2GSQA

Glutathione s-transferase from squid digestive gland complexed with s-(3-iodobenzyl)glutathione
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
202
structure length
202
Chain Sequence
PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Location of a potential transport binding site in a sigma class glutathione transferase by x-ray crystallography.
pubmed doi rcsb
source organism Ommastrephes sloani
molecule tags Transferase
total genus 72
structure length 202
sequence length 202
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1995-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2gsqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gsqA01
5DDLA 4LLRA 1AXDA 3MAKA 2EIOA 2JZTA 1SK0A 1JZWA 1FB6A 5HR2A 2BMXA 1NSWA 1GSDA 1THOA 2AB6A 2FWFA 5C04A 1T3BA 3U6VA 2IPAA 3LXZA 2GVPA 2WJUA 4MJAA 1O73A 1V98A 2GDRA 2OKAA 2H1AA 4XS1A 3TJBA 4ECCA 2EC4A 4O32A 1JZOA 1SL0B 3DGQA 1X9MB 3FR6A 4ZBDA 2C0FA 4FH8A 4MCUA 4IN0A 2F9SA 3KCMA 1NW2A 1TXXA 3A2XA 2LKUA 5ABRA 3J7Yk 1EGOA 2MMZA 1UA5A 1X5EA 5D9XA 1ZCPA 4POLA 2B1KA 4EDYA 1KNGA 1X0RA 2LRCA 2BJXA 4E8HA 4IHUA 3TKSE 2YWOA 2CX4A 4JBBA 3ZIVA 2V2GA 4BWSA 7GSSA 3WGXA 2F8FA 4HU9A 1M2AA 5HR0A 3QAVA 5G31A 3Q6OA 3N5OA 3H79A 3UARA 1A0RP 2FA4A 2HYXA 3D6IA 4ECBA 4G19A 2OA7A 4HDEA 3RHBA 1K0BA 4G2EA 3UIWA 4G0LA 4LMWA 2NDOA 1EOGA 1OAZA 3FZ4A 1QFNA 2UZ8A 4EF0A 1H75A 2FWHA 2XC2A 4ECIA 2O89A 4CHSA 4LMVA 4NHWA 4KB3A 2FLSA 2HI7A 3MDKA 3IC4A 1TK0B 3GHAA 3KMOA 5B8AA 2MYGA 2XPDA 1ZYQB 1ZMAA 1U3IA 4NHZA 2NPBA 2HSYA 2PERA 3LG6A 4JR4A 1YF1A 1YKCA 5CO3A 1TOFA 2P5QA 1R5AA 4Q5FA 5ID2A 2LSTA 3ISOA 1RW1A 3KH7A 5J41A 4KSOA 2DMLA 3GSTA 4DSSA 3EINA 5H5RA 1Z6MA 5L71A 1VF4A 1PKZA 2YWNA 4JE1A 3NIVA 2ZCTA 2HSHA 5IM9A 2VL3A 2C8UA 3PR8A 4EE0A 4ID0A 4MK3A 1A8YA 2WULA 5B6MA 2HE3A 4DSSB 2HNLA 4NAXA 1BQ7A 4ZIJA 4MJCA 4OCEA 2H73A 5IMDA 2LNTA 2H70A 1WRYA 5AIVA 1V58A 3L4NA 1M9AA 3V1WA 4MJBA 5CRGA 1X9SB 4TR4A 2MBSA 2K6VA 2OADA 1QXHA 2JACA 4PUAA 1QUWA 1PD21 5FHIA 6GSSA 3FZAA 3LORA 3F6FA 3W8JA 1TTZA 3DVWA 1GRXA 4BVXB 4KAEA 3VWUA 6GSWA 3L0HA 1PMTA 4WXTA 3ERGA 4XTSA 3NZNA 3EYTA 5JCUA 2DJJA 4WEYA 4MP4A 5HR1A 3HXSA 1A24A 3ZMKA 4N0ZA 1YF0A 4K6XA 2C0GA 2H74A 2NVLA 3UBLA 1EEJA 5HFGA 1SK2A 1K0DA 5FWGA 4YAPA 2N5BA 1I5GA 4TKYA 4IP1A 1O6JA 1F3BA 3UMAA 3DEXA 4FO5A 2VCVA 1PX7A 5AIXA 1F9MA 1MDIA 1SJ6A 1E2YA 1SYRA 3RPPA 2WS2A 2LRNA 2DJ2A 1LBKA 2PVQA 1FOVA 4H86A 3C71A 5CREA 4F03A 1V40A 2JSYA 1LJRA 1A2LA 5ECHB 5DAKA 2MZCA 1ACVA 1WMJA 3F4TA 2VD0A 2VLTA 4J57E 3KGKA 2FUG2 2VLVA 2TIRA 3UAPA 2N5AA 1T00A 5DQYA 2JZSA 1GUMA 3M9JA 1SJZA 3I43A 3HZ4A 2QKEA 4IQ1A 3ZRDA 1NHYA 1PQNA 3D21A 4IELA 2C80A 5DAKB 2LNSA 4Q5NA 1Y25A 2CV4A 4P3YB 4KCAA 5IPGA 4K7IA 2AUVA 5J3RA 4OWYA 3GKNA 4CW9A 2HSMB 4G0KA 1Q4JA 4MDCA 1HNBA 4TR0A 1O8XA 5IMVA 2B6MA 1O81A 5F07A 2EIQA 4TXVA 1FG4A 4GRFA 4FYUA 1J08A 3PPUA 2H76A 2IIYA 5DJLA 2P31A 2GTUA 1SD9A 3TJGA 5JWOB 2YANA 16GSA 1EP7A 4V1Ag 1PL2A 2YP6A 1XW9A 5HQPA 2GSSA 3ED3A 3J7Yb 1T8EB 3F0IA 3O76A 4GWRA 4F2IA 3GKXA 3ME8A 4MABA 4Z7XA 3HVSA 3ZFBA 1DE1A 2BTOT 3QMXA 2X8HA 4PXOA 5B7CA 5D93A 2HZEB 2H72A 5GAPD 4L5OA 2LJAA 2HRKA 1USBA 3GV1A 6GSVA 2JL4A 4KDYA 2L6CA 3I6AA 3KTLA 5LNKe 3EU3A 1OC9A 3DRNA 5IO2A 2AYTA 3GURA 2WDUA 2OBKA 1TI3A 2WFCA 2I9HA 1GTUA 3HA9A 1V57A 2H30A 1KEBA 2YZUA 3L9SA 1R5PA 4J2FA 2MMNA 2HRKB 2RIIA 2G0FA 2R6KA 4I8BA 1G0TA 1IYIA 3KP9A 3CTFA 5D96A 1TU8A 4KE3A 4WF4A 3HZ8A 1OC9B 2X8CA 3F4SA 4DVCA 3UBKA 4ZL8A 3IAM2 4GQCA 5EL8A 1B8XA 1G6YA 2CVDA 2XBQA 2H6ZA 1XOBA 2VCWA 4OFTA 4WR4A 4KNDA 1M99A 2VLUA 2IMFA 3FYGA 4ISDA 5CYYA 4L0WA 3RHCA 5IMCA 3CSJA 1HQOA 6GSUA 3HJOA 3IBHA 3LFLA 1TK5B 1Z6NA 4ZL9A 3GX0A 3M3MA 5ECMB 2FGXA 4TOPA 2GQMA 1FO5A 5DCGA 3HJMA 2VL2C 4HJMA 3EC3A 2REMA 1SYXA 1AQWA 3TRXA 1EEMA 1OVNA 5HR3A 5IMAA 2B7JA 3IRAA 2GZZA 3K8NA 1K0NA 3OR5A 2PPTA 5LD0A 2N5FA 4XCSA 5DALA 3D5JA 2VCXA 4I2TA 3APOA 3D0ZA 2H6XA 2WB9A 1OC3A 2PN8A 3LGCA 1TK8B 1N8JA 1AQVA 2H6YA 4KCEA 2K8VA 5EPFA 4LL4B 5IO0A 1VRSD 3TJJA 5FT3A 1XWBA 3TKSC 1Q98A 1RQMA 3FZ5A 5D8IA 1ST9A 4HZ4A 2FWGA 4I6XA 4JEDA 3TUEA 1SENA 1QK8A 3KJYA 1M7TA 3DXBA 1PSQA 5LCZA 3H1NA 4OCFA 1BEDA 2KP2A 4PQ1A 2VD1A 4V2MA 5CRDA 3W6GA 5IMZA 3HVVA 2I81A 6GSYA 4IGJA 4K1FA 2R37A 4ML6A 1RK4A 5E4WA 1T7PB 4OFNA 2A2RA 1LU4A 2QC7A 2IN3A 5C00A 2A2SA 3LWAA 2C1YA 3GKKA 3E9JB 5ECPB 1UN2A 1SL2B 2L59A 5ECSA 2L5LA 5JWRB 4IS0A 5IMFA 1THXA 4TR1A 5J9BA 2M72A 4AJ7A 2GT6A 4MZWA 2GLRA 1FB0A 4MLYA 2O87A 10GSA 4DSQA 2L4CA 1SU9A 3HD5A 2CAQA 5G1KA 2GQLA 5H5QA 4MJEA 1CQHA 2AAWA 1EWXA 1R26A 4PNGA 1YQ1A 3W8SA 17GSA 1PGTA 3L9VA 3BCIA 1TP9A 4K0GA 3EU4A 4MF6A 5CP1A 1EV4A 4HU7A 1EP8A 3L9UA 4YH2A 1GTIA 5DCHA 5ECRB 5B8BA 5ELAA 4G10A 4I97A 4EDZA 3VWWA 2ON7A 5D9VA 5H5SA 3G7IA 1QQ2A 1AUCA 2RM6A 1S3DA 1TDIA 4OFMA 2MMAA 4G0IA 1YY7A 3TOUA 1U87A 5ECOB 4QQ7A 3HKRA 3DD3A 1MD3A 2O85A 2IJYA 1ERWA 5AN1A 5IOXA 2YNXA 5ID2B 2PWJA 1F6MC 3ZLPA 2L57A 12GSA 1XW6A 3BJ5A 5ECIB 2LJKA 4TW5A 1VF1A 5DQSA 1F37A 3ERWA 3ZITA 5ECKB 1ON4A 4PURA 2H8LA 5EY6A 3EVIA 1YKAA 1N2AA 1G7EA 2X99A 5COHA 2F51A 3CTGA 2R5GA 2YN1A 3IPZA 3VURA 2GSQA 4YQVA 3VWVA 3VWXA 6GSXA 1DUGA 5ECQB 2V32A 2LJRA 1K0MA 4KH7A 4OO4A 4TXOA 5INYA 1SK1A 5G1LA 3E3EA 3IK7A 3EWLA 4KSMA 4F0CA 2J9HA 3GL5A 2YPMA 5CNWA 3EMPA 3FK8A 3TDGA 3IAS2 1XBSA 2X64A 1UC7A 5B6NA 3VI7A 5IOWA 2Z9SA 1FW1A 4D73A 6GSTA 2NBSA 4WBJA 1WWJA 4F9ZA 3R3EA 2MBTA 3WT1A 5ECLB 4K7NA 2ZUPA 4BVYA 4TXOB 3LSZA 2L6DA 4XS6A 4AJ8A 3TKRA 3TRQA 4MPGA 4DEJA 3PGTA 4MZBA 5CRWA 14GSA 2ON5A 4YQMA 2YZHA 4O5RA 3F9UA 2GQKA 2FA8A 1MTCA 3GH9A 5D9WA 1A2JA 20GSA 3WT2A 4XS4A 4GF0A 3GRXA 2KP1A 3WYWA 4XRDA 1GSEA 4G9HA 2YV9A 2IL3A 1GSUA 1T4YA 3GH6A 1FAAA 5KEJA 5F06A 3MWHA 2V41A 3ZL5A 2VCTA 3G7JA 2O8VB 3M0FA 2H19A 4FYBA 3TCOA 3IC8A 2HLSA 4GTUA 1W89A 5CAXA 5J9CA 3FY7A 4ZL7A 1VF2A 4V1Ap 2LQOA 4ECJA 1ML6A 4V2NA 2VL2A 2FCHA 2H1DA 3GMFA 4BPYA 3GN3A 2YJHA 3DVXA 3HJPA 2KUCA 4QL7A 2DBCA 1X5DA 4TN8A 1M9BA 5IPHA 3IDVA 2CAIA 1FHEA 1OE8A 4FYCA 4HS1A 3ZTLA 3S9FA 5D73A 3P8WA 3FR9A 1J0FA 3SBCA 2B5XA 5F0GA 2C3QA 4Q5QA 1MDJA 3ZZXA 3VLNA 3GFKA 2CX3A 3US3A 2DC5A 4USSA 4AF2A 2R4VA 4FQUA 2XHFA 1B4PA 3LQ7A 2QSIA 1GLQA 4FIWA 4MF5A 4EC0A 4X0XA 2HRNA 3LXTA 4I5QA 2OJLA 4BL7A 5DBQA 3ZVJD 1OKDA 4EUYA 2P5RA 3UL3A 1WIKA 1TRVA 3SWLA 1E6BA 2VIMA 1EOHA 2OE0A 5G5FA 1IYHA 4WKWA 3A2WA 1BX9A 3F6DA 4RQRA 1SKWB 3VI5A 4BL7B 1TI1A 3H4KA 4MPFA 1EGRA 4V2LA 3QAGA 5A4WA 4RI6A 3HY2A 5JWQB 1A0FA 2C0EA 5G30A 3GNJA 3ZIJA 3UVHA 1TW9A 2CVBA 3NOFA 2LRTA 4KGIA 1YEXA 5J4UA 2V6OA 2VAFA 2GGTA 1GUKA 9GSSA 3C8EA 4MH2A 4XRAA 2GSTA 2I3YA 3C7MA 2CVKA 3GUSA 4MF7A 2VO4A 4PGTA 1Z7PA 3P2AA 4GCIA 4X1UA 5IQYA 3G9BA 2A4VA 1A23A 1GNWA 2LTKA 3GSSA 3TJKA 3KIJA 4HQZA 2DJ3A 2E7PA 2GZPA 3CSHA 2ES7A 1B9XC 3CMIA 4BWQA 4GQFA 5ECNB 2O7KA 3CRTA 3M8NA 1TRUA 3E0UA 4L0UA 2QGVA 1XWCA 2M46A 3ME7A 1PX6A 2CA8A 2E2MA 4KA0A 2H75A 3AY8A 3ZFLA 1XFLA 4EKZA 4XIHA 1WOUA 2OE3A 4PX1A 2YV7A 3KP8A 1NM3A 4CDOA 1WP0A 3ZMLA 1B9YC 2E2GA 2H1BA 3PH9A 3ERFA 2L4QA 4N11A 1DE2A 4MA9A 4WR5A 1TJDA 3DYRA 5DVBA 3A2VA 1ABAA 4L5LA 3LYPA 1YZXA 4ZBBA 4HJ2A 1AW9A 1Z3EA 2PVOC 5GSSA 2MMOA 2DSAA 4IJ3A 1M0UA 3C1RA 1VF3A 1R7HA 1ILOA 5HFIA 2WZ9A 3I69A 2HT9A 3CRUA 3HDCA 4X43A 3TOTA 1ERUA 2LV3A 4K2DA 1XZOA 1BJXA 1V2AA 5DALB 4KF9A 2HSNB 1U3AA 2L5OA 1X5CA 5KN0A 2KLXA 3UJ1A 5ELGA 2FNOA 1C72A 1JZDA 4K7OA 3LYKA 1PRXA 3QCPA 3EMXA 2PUKC 3QD9A 3KD0A 3CXGA 2IMEA 4JR6A 3IR4A 2XBIA 4O92A 1GSFA 2IMKA 3WGEA 2JZRA 2G2QA 3QOUA 2GZYA 3BOAA 1UVZA 4LL1B 2AV4A 3GX8A 3KTBA 1TKDB 4PNFA 1AAZA 3IV4A 2EIRA 3DKSA 4EXJA 3GA4A 4NXIA 2CQ9A 2I4AA 4OD7A 2V1MA 3UEMA 3M1GA 5F05A 2K8SA 2NTOA 4ZILA 1X9WB 4J56E 3GL3A 1V9WA 3QPMA 2CZ2A 4GSNA 1OKTA 1XW5A 2VM1A 3LJRA 3VFIA 3BD2A 1XWGA 3GKMA 3F4RA 4ZXGA 1FVKA 5G2ZA 3O6TA 2VCQA 3VPTA 4XHMA 3WGDA 4OO5A 3DMLA 2V6KA 4IQAA 1F3AA 1AIUA 2AHEA 3FHKA 3N9JA 4HQSA 1F2EA 3P7XA 4TR1B 1JLWA 1YEPA 1BYEA 2R3XA 2DJ0A 3ZVJA 3RAZA 2GT5A 2WRTA 3QDNA 4IBPA 2RUEA 4EVMA 3UOMA 4E8EA 4GSTA 4RQXA 2B3SA 2C3NA 4Q5RA 1GULA 3DIEA 3TKQA 4NMUA 1A8LA 3GIXA 1SKRB 1JFUA 3APSA 2WGRA 2LS5A 2DIYA 4WETA 1B4QA 3C73A 1GLPA 3LEFA 4JU5A 2C3TA 4KDXA 4HEA2 2KHPA 3HHVA 2XPEA 2YWIA 2DMMA 2IWTA 2VCZA 4QL9A 4NPBA 1HNCA 4KUNA 4ACSA 4GLTA 2K18A 3M9KA 1KBNA 2B1LA 1MD4A 3CBUA 4HOJA 4GSSA 3D4MA 2M80A 1PA3A 2PGTA 2B5EA 3VPQA 4KX4A 1T1VA 3MNGA 2JU5A 2VUPA 5DJMA 2K9FA 1ERVA 2TRXA 5KN1A 4BVXA 4RUVA 3RPNA 1ZL9A 2FY6A 4LA1A 2FHEA 3IA1A 1K3OA 5AGYA 2YJ7A 3MSZA 3RDWA 5GAND 1OYJA 2B7KA 1XXUA 1DBYA 3ZYWA 3VK9A 1K0OA 3D4TA 4PQHA 4N10A 3GTUA 2CZ3A 3TGZA 1GTAA 1GTBA 4K0NA 1K3YA 1AC1A 5IIZA 5KN2A 2FWEA 5GSTA 1JZRA 2JSZA 5D9TA 4MMMA 4AGSA 1XPVA 4HUAA 2DIZA 1W4VA 2IMDA 3TRPA 1HD2A 3GTUB 2R2JA 4DSRA 3IE3A 2H71A 2WCIA 2FD3A 1OE7A 4D73B 3D22A 2HRFA 4BA7A 4NV2A 1Z7RA 4BVYB 3TB2A 2TRCP 3TJFA 3KMNA 2D2ZA 5F8BA 4ZB8A 19GSA 1QMVA 1DSBA 2YWMA 1TRWA 1PL1A 2ALBA 1O8WA 3QR6A 11GSA 3HVXA 22GSA 4POKA 3KXOA 1ZYEA 2F3MA 3P90A 5E59A 2LEGA 5BMUA 1EV9A 1JHBA 2YOIA 2PMTA 4N0VA 3FW2A 1H4OA 3EE2A 1K3LA 2RUFA 1R4WA 3BCKA 2OBIA 2LQQA 4YQUA 2C0DA 4NWYA 3I9V2 3A5WA 2C4JA 1JLVA 3KZQA 4XS4B 2X8GA 2PBJA 3U5RE 3IK9A 3R2QA 5G5EA 3G7YA 4PUFC 3IHQA 4MZCA 1K0CA 3KEBA 2IMIA 2F8AA 2H0IA 2HFDA 4JRRA 2HSMA 1XIYA 1SL1B 1GUHA 1ZZYA 2CT6A 1WJKA 3O3TA 5A4VA 1I9DA 3TKSA 4K9ZA 1S3CA 2H0GA 4IJIA 2H66A 4TRXA 1M2BA 2AJQB 2DJKA 3F3QA 1TU7A 3IOSA 3PINA 4KDUA 5J5NA 2VM2A 1CQGA 3F63A 3ZREA 3DWVA 4AJ6A 4PQIA 4ULXA 4WF5A 2HXKA 3HYPA 2RM5A 4EO3A 3Q74A 18GSA 1O85A 1GP1A 1XVQA 1YDKA 1U6TA 1VGLA 3Q19A 2B5YA 3UVTA 1GSYA 1G7OA 3QAWA 1J9BA 3H93A 4ZB6A 2OACA 1URMA 2E0QA 3CSIA 1GWCA 3APQA 3GYKA 4NV5A 1ERTA 4HZ2A 2HZEA 4K8MA 4POBA 3HCZA 8GSSA 4YAVA 1T4ZA 1A2MA 5ENUA 1YJ6A 3FR3A 1SD8A 3QFBC 3QFAC 2H1GA 1ZGNA 1OC8A 1KTEA 3FKFA 1GH2A 1FVJA 2VL9A 4N30A 1XWAA 2P0GA 4KW6A 1AQXA 4OMVA 1B48A 3Q18A 5CRHA 2VOCA 3C1SA 1Z5YE 1WPIA 1ZOFA 3JCML 4ZBAA 2KOKA 2LUSA 5AISA 4RI7A 1Y6EA 3F3RA 2RLIA 2ZNMA 2YCDA 1TRSA 2HRAA 1M2DA 3IXRA 4IVFA 1XVWA 1GL8A 13GSA 1NHOA 1S3AA 3RBTA 4TVEA 1MEKA 4ILFA 1BAYA 1GSSA 2GSRA 1XCCA 4ZB9A 4POMA 5A4UA 1HYUA 1GNEA 1QGVA 1GSQA 5JCWA 4PTSA 1PN9A 3H8QA 4IP6A 1XOAA 3KH9A 1SKSB 3FEUA 3KM6A 5EVOA 2IFQA 2H0HA 3EURA 2I1UA 4F0BA 4O7HA 1WE0A 5A5KA 4WBRD 2DJ1A 4ML1A 3A3TA 1BG5A 2H01A 2PU9C 2J23A 1G6WA 5KN3A 2JADA 3BBYA 2OE1A 2HQTA 4IKHA 5JCGA 1MDKA 5GZZB 4MH3A 3F8UA 2HZFA 2IFQB 1HNAA 4L8EA 4EL1A 2DLXA 3TKPA 4I2UA 1SJIA 4IW9A 1K0AA 1XWKA 4TR3A 3FRCA 3CYNA 1PKWA 4HI7A 1U88A 3WD6A 1EZKA 5HFKA 1Z9HA 1O7UA 4JZQA 3L78A 4GXZA 2GS3A 3FZ9A 4F82A
chains in the Genus database with same CATH superfamily
5DDLA 4LLRA 1AXDA 3MAKA 2EIOA 2JZTA 1SK0A 1JZWA 1FB6A 5HR2A 2BMXA 1NSWA 1GSDA 1THOA 2AB6A 2FWFA 5C04A 1T3BA 3U6VA 2IPAA 3LXZA 2GVPA 2WJUA 4MJAA 1O73A 1V98A 2GDRA 2OKAA 2H1AA 4XS1A 3TJBA 4ECCA 2EC4A 4O32A 1JZOA 1SL0B 3DGQA 1X9MB 2R0CA 3FR6A 4ZBDA 2C0FA 4FH8A 1M3JA 4MCUA 4IN0A 2F9SA 3KCMA 1NW2A 1TXXA 3A2XA 2LKUA 5ABRA 3J7Yk 1EGOA 2MMZA 1UA5A 1X5EA 5D9XA 1ZCPA 4POLA 2B1KA 4EDYA 1KNGA 1X0RA 2LRCA 2BJXA 4E8HA 1TXUA 4IHUA 2X4AA 3TKSE 2YWOA 4N3ZA 2CX4A 4JBBA 2WZSA 1PN0A 3ZIVA 2V2GA 4BWSA 7GSSA 3WGXA 2F8FA 4HU9A 1M2AA 5HR0A 3QAVA 5G31A 4GDFA 3Q6OA 3N5OA 1PFOA 3H79A 3UARA 1A0RP 2FA4A 2HYXA 3D6IA 4ECBA 4G19A 2OA7A 4HDEA 3RHBA 1K0BA 4G2EA 3UIWA 4G0LA 4G01A 4LMWA 1EOGA 2NDOA 1OAZA 3FZ4A 1QFNA 2UZ8A 4EF0A 1H75A 2FWHA 2XC2A 4ECIA 2O89A 4CHSA 4LMVA 4NHWA 4KB3A 2FLSA 2HI7A 3MDKA 3IC4A 1TK0B 3GHAA 3KMOA 5B8AA 2MYGA 2XPDA 1ZYQB 3RGBC 1ZMAA 1U3IA 4NHZA 2NPBA 2HSYA 2PERA 3LG6A 4JR4A 1YF1A 1YKCA 5CO3A 1TOFA 2P5QA 1R5AA 4Q5FA 2WVYA 5ID2A 2LSTA 4PHZC 3ISOA 1RW1A 3KH7A 5J41A 4KSOA 2DMLA 3GSTA 4DSSA 3EINA 5H5RA 1Z6MA 5L71A 1VF4A 1PKZA 2YWNA 4JE1A 3NIVA 2ZCTA 2HSHA 5IM9A 2VL3A 2C8UA 3PR8A 4EE0A 4ID0A 4MK3A 1A8YA 2WULA 5B6MA 2HE3A 4DSSB 2HNLA 4NAXA 1BQ7A 4ZIJA 4MJCA 4OCEA 2H73A 3CQFA 5IMDA 2LNTA 2H70A 1WRYA 5AIVA 1V58A 3L4NA 1M9AA 3V1WA 4MJBA 2DKIA 5CRGA 1X9SB 4TR4A 2MBSA 2K6VA 2OADA 1QXHA 2JACA 4PUAA 1QUWA 1PD21 5FHIA 6GSSA 3FZAA 2WW0A 3LORA 3F6FA 3W8JA 1TTZA 3DVWA 1GRXA 4BVXB 4KAEA 3VWUA 6GSWA 3L0HA 1PMTA 4WXTA 3ERGA 4XTSA 3NZNA 3EYTA 5JCUA 2DJJA 2WVZA 4WEYA 4MP4A 5J40A 5HR1A 3HXSA 1A24A 3ZMKA 4N0ZA 1YF0A 4K6XA 2C0GA 2H74A 2NVLA 3UBLA 1EEJA 5HFGA 1SK2A 1K0DA 5FWGA 4YAPA 2N5BA 1I5GA 4TKYA 4IP1A 1O6JA 1F3BA 2X49A 3UMAA 3DEXA 4FO5A 2VCVA 1PX7A 5AIXA 1F9MA 1MDIA 1SJ6A 5A1NA 1E2YA 1SYRA 3RPPA 2WS2A 2LRNA 2R0GA 2DJ2A 1LBKA 2PVQA 1FOVA 4H86A 3C71A 5CREA 4F03A 1V40A 2JSYA 1LJRA 1A2LA 5ECHB 5DAKA 2MZCA 2UV8G 1ACVA 1WMJA 3F4TA 4HSCX 2VD0A 2VLTA 4J57E 3KGKA 2FUG2 5A1NB 2VLVA 2TIRA 3UAPA 2N5AA 1T00A 4YKFA 5DQYA 2JZSA 1GUMA 3M9JA 1SJZA 3I43A 3HZ4A 2QKEA 4IQ1A 3ZRDA 1NHYA 1PQNA 3D21A 4Z2UA 4IELA 2C80A 5DAKB 2LNSA 4Q5NA 1Y25A 2CV4A 4P3YB 4KCAA 5IPGA 4K7IA 2AUVA 5J3RA 4OWYA 3GKNA 1N25A 4CW9A 2HSMB 4G0KA 1Q4JA 4MDCA 1HNBA 4TR0A 1O8XA 5IMVA 2B6MA 1O81A 5F07A 2EIQA 4TXVA 1FG4A 4K5RA 4GRFA 1ZYNA 4FYUA 1J08A 3PPUA 2H76A 2IIYA 5DJLA 2P31A 2GTUA 1SD9A 3TJGA 5JWOB 2YANA 16GSA 1EP7A 4V1Ag 1PL2A 1BF5A 2YP6A 1XW9A 5HQPA 2GSSA 3ED3A 3J7Yb 1T8EB 3F0IA 3O76A 4GWRA 4F2IA 3GKXA 3ME8A 4MABA 4Z7XA 3HVSA 3ZFBA 1DE1A 2BTOT 2DKHA 3QMXA 2X8HA 4PXOA 2H1LA 5B7CA 5D93A 2HZEB 2H72A 5GAPD 4L5OA 2LJAA 2HRKA 1USBA 3GV1A 6GSVA 2JL4A 4KDYA 2L6CA 3I6AA 3KTLA 5LNKe 3EU3A 1OC9A 3DRNA 5IO2A 2AYTA 3GURA 2WDUA 2OBKA 1TI3A 2WFCA 2I9HA 1GTUA 3HA9A 1V57A 2H30A 1KEBA 2YZUA 3L9SA 1R5PA 4J2FA 2MMNA 2HRKB 2RIIA 2G0FA 2R6KA 4I8BA 1G0TA 4FXYP 1IYIA 2WVXB 3KP9A 3CTFA 2A2PA 5D96A 1TU8A 4KE3A 4WF4A 3HZ8A 1OC9B 2X8CA 3F4SA 4DVCA 3UBKA 4ZL8A 3IAM2 4GQCA 5EL8A 1B8XA 1G6YA 2CVDA 2XBQA 2H6ZA 1XOBA 2VCWA 4AKGA 4OFTA 4WR4A 4KNDA 1M99A 2VLUA 2IMFA 3FYGA 4ISDA 5CYYA 4L0WA 3RHCA 5IMCA 3CSJA 1HQOA 6GSUA 3HJOA 2O5VA 3IBHA 3LFLA 1TK5B 1Z6NA 4ZL9A 3GX0A 3M3MA 5ECMB 3LW9A 2FGXA 4TOPA 2GQMA 1FO5A 5DCGA 3HJMA 2VL2C 1I1IP 4HJMA 3EC3A 2REMA 1SYXA 1AQWA 3TRXA 1EEMA 1OVNA 5HR3A 5IMAA 3RFRC 2B7JA 3IRAA 2GZZA 3K8NA 1K0NA 3OR5A 2PPTA 5LD0A 2N5FA 4XCSA 5DALA 3D5JA 2VCXA 4I2TA 3APOA 3D0ZA 2H6XA 2WB9A 1OC3A 2PN8A 3LGCA 1TK8B 1N8JA 1AQVA 2H6YA 4KCEA 2K8VA 5EPFA 4LL4B 5IO0A 4A5PA 1VRSD 3TJJA 5FT3A 1XWBA 3TKSC 4W66A 1Q98A 1RQMA 3FZ5A 5D8IA 1ST9A 4HZ4A 2FWGA 4I6XA 4JEDA 3TUEA 1SENA 1QK8A 3KJYA 1M7TA 3DXBA 1PSQA 5LCZA 3H1NA 4E68A 4OCFA 1BEDA 2KP2A 4O5UA 4PQ1A 2VD1A 4V2MA 5CRDA 3W6GA 5IMZA 3HVVA 2I81A 6GSYA 4IGJA 4K1FA 2R37A 4ML6A 1RK4A 5E4WA 1T7PB 4OFNA 2WW2A 2A2RA 1LU4A 2QC7A 2IN3A 5C00A 2A2SA 3LWAA 2EFHA 4CY6A 2C1YA 3GKKA 3E9JB 5ECPB 1UN2A 1SL2B 2L59A 5ECSA 2L5LA 5JWRB 4IS0A 5IMFA 1THXA 4TR1A 5J9BA 2M72A 4AJ7A 2GT6A 4MZWA 2GLRA 1FB0A 4MLYA 2O87A 10GSA 4DSQA 2L4CA 1SU9A 3HD5A 2CAQA 5G1KA 2GQLA 5H5QA 4MJEA 1CQHA 2AAWA 1EWXA 1R26A 4PNGA 1YQ1A 3W8SA 17GSA 1PGTA 3L9VA 3BCIA 1TP9A 4K0GA 3EU4A 4MF6A 5CP1A 1EV4A 2WW3A 4HU7A 1EP8A 3L9UA 4YH2A 1GTIA 5DCHA 5ECRB 5B8BA 5ELAA 4G10A 4I97A 4EDZA 3VWWA 2ON7A 4AI6A 5D9VA 5H5SA 3G7IA 1QQ2A 1AUCA 2RM6A 1S3DA 1TDIA 4OFMA 2MMAA 4G0IA 1YY7A 3TOUA 1U87A 5ECOB 4QQ7A 3HKRA 3DD3A 1MD3A 2O85A 2IJYA 4BIKA 1ERWA 5AN1A 5IOXA 2YNXA 5ID2B 2PWJA 1F6MC 3ZLPA 2L57A 12GSA 1XW6A 3BJ5A 5ECIB 2LJKA 4TW5A 4EIQA 1VF1A 5DQSA 1F37A 3ERWA 3ZITA 5ECKB 1ON4A 4PURA 2H8LA 5EY6A 3EVIA 1YKAA 1N2AA 1G7EA 2X99A 5COHA 2F51A 3CTGA 2R5GA 2YN1A 3IPZA 3VURA 2GSQA 4YQVA 3VWVA 3VWXA 6GSXA 1DUGA 5ECQB 2V32A 2LJRA 1K0MA 4KH7A 4OO4A 4TXOA 5INYA 1SK1A 5G1LA 3E3EA 3IK7A 3EWLA 4KSMA 4F0CA 2J9HA 3GL5A 2YPMA 5CNWA 3EMPA 3FK8A 3HVNA 3TDGA 3IAS2 1XBSA 2X64A 1UC7A 5B6NA 3VI7A 5IOWA 2Z9SA 1FW1A 4D73A 6GSTA 2NBSA 4WBJA 1WWJA 4F9ZA 3R3EA 2MBTA 3WT1A 5ECLB 4K7NA 2ZUPA 4BVYA 4TXOB 3LSZA 4ZB7A 2L6DA 4ICYA 4XS6A 4AJ8A 3TKRA 3TRQA 1SVOA 4MPGA 4DEJA 3PGTA 4MZBA 5CRWA 14GSA 4MNNA 2ON5A 4YQMA 2YZHA 4O5RA 3F9UA 2GQKA 2FA8A 1MTCA 3GH9A 5D9WA 1A2JA 20GSA 3WT2A 4XS4A 4GF0A 3GRXA 2KP1A 3WYWA 4XRDA 1GSEA 4G9HA 2YV9A 2IL3A 1GSUA 5BRTA 1T4YA 3GH6A 1FAAA 5KEJA 5F06A 3MWHA 2V41A 3ZL5A 2VCTA 3G7JA 2O8VB 3M0FA 2H19A 4FYBA 3TCOA 3IC8A 2HLSA 4GTUA 1W89A 5CAXA 5J9CA 3CWGA 3FY7A 4ZL7A 1VF2A 4V1Ap 2LQOA 4ECJA 4Z2TA 1ML6A 4V2NA 2VL2A 2FCHA 2H1DA 3GMFA 4BPYA 3GN3A 2YJHA 3DVXA 3HJPA 2KUCA 4QL7A 2DBCA 1X5DA 4TN8A 1M9BA 5IPHA 3IDVA 2CAIA 1FHEA 1OE8A 4FYCA 4HS1A 3ZTLA 3S9FA 5D73A 4AKXB 3P8WA 3FR9A 4AKHA 1J0FA 3SBCA 2B5XA 5F0GA 2C3QA 4Q5QA 1MDJA 3ZZXA 3VLNA 3GFKA 2EFCA 2CX3A 3US3A 2DC5A 4USSA 2VKZG 4AF2A 2R4VA 4FQUA 2XHFA 1ZYPA 3LQ7A 1B4PA 2QSIA 1GLQA 4FIWA 4MF5A 4EC0A 4X0XA 2HRNA 3LXTA 4I5QA 1BG1A 2OJLA 4BL7A 5DBQA 3ZVJD 1OKDA 4EUYA 2P5RA 3UL3A 1WIKA 1S3RA 1TRVA 3SWLA 1E6BA 2VIMA 1EOHA 5A34A 2OE0A 5G5FA 1IYHA 4WKWA 3A2WA 1BX9A 3F6DA 4RQRA 1FOHA 1SKWB 3VI5A 4BL7B 1TI1A 3H4KA 4MPFA 1EGRA 4V2LA 3QAGA 2QA2A 5A4WA 4RI6A 3HY2A 5JWQB 1A0FA 3MYDA 2C0EA 5G30A 3GNJA 3ZIJA 3UVHA 1TW9A 2CVBA 3NOFA 2LRTA 4KGIA 1YEXA 5J4UA 2V6OA 1Y1UA 2VAFA 2GGTA 1GUKA 9GSSA 3C8EA 4MH2A 4XRAA 2GSTA 2I3YA 3C7MA 3IHGA 2CVKA 3GUSA 4MF7A 2VO4A 4PGTA 1Z7PA 3P2AA 4GCIA 4X1UA 5IQYA 3G9BA 2A4VA 1A23A 1GNWA 2LTKA 3GSSA 2WW1A 4K5SA 3TJKA 3KIJA 4HQZA 2DJ3A 4YKGA 2E7PA 2GZPA 3CSHA 2ES7A 1B9XC 3CMIA 4BWQA 4GQFA 5ECNB 2O7KA 3CRTA 3M8NA 1TRUA 3E0UA 4L0UA 2QGVA 1XWCA 2M46A 3ME7A 1PX6A 2CA8A 2E2MA 3EPTA 4KA0A 2H75A 3AY8A 3ZFLA 1XFLA 4EKZA 4XIHA 1WOUA 2OE3A 4PX1A 2YV7A 3KP8A 5A5HA 1NM3A 4CDOA 1WP0A 3ZMLA 1B9YC 2E2GA 2H1BA 3PH9A 3ERFA 2QA1A 2L4QA 4N11A 1DE2A 4MA9A 4WR5A 1TJDA 3DYRA 5DVBA 2HSNA 3A2VA 1ABAA 4L5LA 3LYPA 1YZXA 4ZBBA 4HJ2A 2EFEA 1AW9A 1Z3EA 2PVOC 5GSSA 2MMOA 5A5HB 2DSAA 4IJ3A 1M0UA 3C1RA 1VF3A 1R7HA 1ILOA 5HFIA 2WZ9A 3I69A 2HT9A 3CRUA 3HDCA 4X43A 4PI2C 2R0PA 3TOTA 1ERUA 2LV3A 4K2DA 1XZOA 1BJXA 1V2AA 5DALB 4KF9A 2HSNB 1U3AA 2L5OA 1X5CA 5KN0A 2KLXA 3UJ1A 5ELGA 2FNOA 1C72A 1JZDA 4K7OA 3LYKA 1PRXA 3QCPA 3EMXA 2PUKC 3QD9A 3KD0A 3CXGA 2IMEA 4JR6A 3IR4A 2XBIA 4O92A 1GSFA 2IMKA 3WGEA 2JZRA 2G2QA 3QOUA 2OT3A 2GZYA 3BOAA 1UVZA 4LL1B 2AV4A 3GX8A 3KTBA 1TKDB 4PNFA 1AAZA 3IV4A 2EIRA 3DKSA 4EXJA 3GA4A 4NXIA 2CQ9A 2I4AA 4OD7A 2V1MA 3UEMA 3M1GA 5F05A 2K8SA 2NTOA 4ZILA 4CY8A 1X9WB 3FMWA 4J56E 3GL3A 1V9WA 3QPMA 2CZ2A 4GSNA 1OKTA 1XW5A 2VM1A 3LJRA 3VFIA 3BD2A 1XWGA 3GKMA 3F4RA 4ZXGA 2O3EA 1FVKA 5G2ZA 3O6TA 2VCQA 3VPTA 4K2XA 4XHMA 3WGDA 4OO5A 3DMLA 2V6KA 4IQAA 1F3AA 1AIUA 2AHEA 3FHKA 3N9JA 4HQSA 1F2EA 3P7XA 4TR1B 1JLWA 1YEPA 1BYEA 2R3XA 2DJ0A 3ZVJA 3RAZA 2GT5A 2WRTA 3QDNA 4IBPA 2RUEA 4EVMA 3UOMA 4E8EA 1M3IA 4GSTA 4RQXA 2B3SA 2C3NA 4Q5RA 1GULA 3DIEA 3TKQA 4NMUA 1A8LA 3GIXA 1SKRB 1JFUA 3APSA 2WGRA 2LS5A 2DIYA 4WETA 1B4QA 3C73A 1GLPA 3LEFA 4JU5A 2C3TA 4KDXA 4HEA2 3MIXA 2KHPA 3HHVA 2XPEA 2YWIA 3HMJG 2DMMA 2IWTA 2VCZA 4QL9A 4NPBA 1HNCA 4KUNA 4ACSA 4GLTA 2K18A 3M9KA 1KBNA 2B1LA 1MD4A 3CBUA 4HOJA 4GSSA 3D4MA 2M80A 1PA3A 2PGTA 2B5EA 3VPQA 4KX4A 1T1VA 3MNGA 2JU5A 2VUPA 5DJMA 2K9FA 1ERVA 2TRXA 5KN1A 4BVXA 4O5QA 4RUVA 3RPNA 1ZL9A 1YEWC 2FY6A 4LA1A 2FHEA 3IA1A 1K3OA 5AGYA 2YJ7A 3MSZA 5J4VA 3RDWA 5GAND 1OYJA 2B7KA 1XXUA 1DBYA 3ZYWA 3VK9A 1K0OA 3D4TA 4PQHA 4N10A 3GTUA 2CZ3A 3TGZA 1GTAA 1GTBA 4K0NA 1K3YA 1AC1A 5IIZA 5KN2A 2FWEA 5GSTA 1JZRA 2JSZA 5D9TA 4MMMA 4AGSA 1XPVA 4HUAA 2DIZA 1W4VA 2IMDA 3TRPA 1HD2A 3GTUB 2R2JA 2A4HA 3IE3A 2H71A 2WCIA 2FD3A 4DSRA 1OE7A 4D73B 3D22A 2HRFA 4BA7A 4NV2A 1Z7RA 4BVYB 3TB2A 1XG8A 2TRCP 3TJFA 3KMNA 1SVMA 2D2ZA 5F8BA 4ZB8A 19GSA 1QMVA 1DSBA 2YWMA 1TRWA 1PL1A 2ALBA 1O8WA 3QR6A 11GSA 3HVXA 22GSA 4POKA 3KXOA 1ZYEA 2F3MA 3P90A 5E59A 2LEGA 5BMUA 1EV9A 1JHBA 2YOIA 2PMTA 4N0VA 3FW2A 1H4OA 3EE2A 1K3LA 2RUFA 1R4WA 3BCKA 2OBIA 2LQQA 4YQUA 2C0DA 4NWYA 3I9V2 3A5WA 2C4JA 1JLVA 3KZQA 4XS4B 2X8GA 2PBJA 1S4BP 3U5RE 3IK9A 3R2QA 5G5EA 5BMUB 3G7YA 4PUFC 3IHQA 5KOWA 4MZCA 1K0CA 3KEBA 2IMIA 2F8AA 2H0IA 2HFDA 4JRRA 2HSMA 1XIYA 1SVLA 1SL1B 1GUHA 1ZZYA 2CT6A 1WJKA 3O3TA 5A4VA 1I9DA 3TKSA 4K9ZA 1S3CA 2H0GA 4IJIA 2H66A 4TRXA 1M2BA 2AJQB 2DJKA 3F3QA 1TU7A 3IOSA 3PINA 4KDUA 5J5NA 2VM2A 1CQGA 3F63A 3ZREA 3DWVA 4AJ6A 4PQIA 4ULXA 4WF5A 2HXKA 3HYPA 2RM5A 4EO3A 3Q74A 18GSA 1O85A 1GP1A 1XVQA 1YDKA 1U6TA 1VGLA 3Q19A 2B5YA 3UVTA 1GSYA 1G7OA 3QAWA 1J9BA 3H93A 4ZB6A 2OACA 1URMA 2E0QA 1YVLA 3CSIA 1GWCA 3APQA 3GYKA 4NV5A 1ERTA 4HZ2A 2HZEA 4K8MA 4POBA 3HCZA 8GSSA 4YAVA 1T4ZA 1A2MA 5ENUA 1YJ6A 3FR3A 1SD8A 3QFBC 3QFAC 2H1GA 5A34B 3CHXC 1ZGNA 1OC8A 1KTEA 3FKFA 1GH2A 1FVJA 2VL9A 4N30A 1XWAA 2P0GA 4KW6A 1AQXA 4OMVA 1B48A 3Q18A 5CRHA 2VOCA 3C1SA 1Z5YE 1WPIA 1ZOFA 3JCML 4ZBAA 2KOKA 2LUSA 5AISA 3A5IA 4RI7A 1Y6EA 4X4JA 3F3RA 2RLIA 2ZNMA 2YCDA 1TRSA 4AKIA 2HRAA 1M2DA 2O36A 2WVXA 3IXRA 5KOXA 4IVFA 1XVWA 1GL8A 13GSA 1NHOA 1S3AA 3RBTA 4TVEA 1MEKA 4ILFA 1BAYA 1GSSA 2GSRA 1XCCA 2EFDA 4ZB9A 4POMA 5A4UA 1HYUA 1GNEA 1QGVA 1GSQA 5JCWA 4PTSA 1PN9A 3H8QA 4IP6A 1XOAA 3KH9A 1SKSB 3FEUA 3KM6A 5EVOA 5J4YA 2IFQA 3TU3B 2H0HA 3EURA 2I1UA 4F0BA 5J47A 4O7HA 1WE0A 5A5KA 4WBRD 2DJ1A 4ML1A 3A3TA 1BG5A 2H01A 2PU9C 2J23A 1G6WA 5KN3A 2JADA 3BBYA 2OE1A 2HQTA 4IKHA 5JCGA 4Z2RA 4PI0C 1MDKA 5GZZB 4MH3A 3F8UA 2HZFA 2IFQB 1HNAA 4L8EA 4EL1A 2DLXA 3TKPA 4I2UA 1SJIA 4IW9A 1K0AA 1XWKA 4TR3A 4EIPA 3FRCA 3CYNA 1PKWA 4HI7A 4QMKA 1U88A 3WD6A 1EZKA 5HFKA 1Z9HA 1O7UA 4JZQA 3L78A 4GXZA 2GS3A 3FZ9A 4F82A
chains in the Genus database with same CATH topology
5DDLA 4LLRA 1AXDA 3MAKA 2EIOA 2JZTA 1SK0A 1JZWA 1FB6A 5HR2A 2BMXA 1NSWA 1GSDA 1THOA 2AB6A 2FWFA 5C04A 1T3BA 3U6VA 2IPAA 3LXZA 2GVPA 2WJUA 4MJAA 1O73A 1V98A 2GDRA 2OKAA 2H1AA 4XS1A 3TJBA 4ECCA 2EC4A 4O32A 1JZOA 1SL0B 3DGQA 1X9MB 2R0CA 3FR6A 4ZBDA 2C0FA 4FH8A 4MCUA 4IN0A 2F9SA 3KCMA 1NW2A 1TXXA 3A2XA 2LKUA 5ABRA 3J7Yk 1EGOA 2MMZA 1UA5A 1X5EA 5D9XA 1ZCPA 4POLA 2B1KA 4EDYA 1KNGA 1X0RA 2LRCA 2BJXA 4E8HA 1TXUA 4IHUA 2X4AA 3TKSE 2YWOA 4N3ZA 2CX4A 4JBBA 1PN0A 3ZIVA 2V2GA 4BWSA 7GSSA 3WGXA 2F8FA 4HU9A 1M2AA 5HR0A 3QAVA 5G31A 4GDFA 3Q6OA 3N5OA 3H79A 3UARA 1A0RP 2FA4A 2HYXA 3D6IA 4ECBA 4G19A 2OA7A 4HDEA 3RHBA 1K0BA 4G2EA 3UIWA 4G0LA 4G01A 4LMWA 1EOGA 2NDOA 1OAZA 3FZ4A 1QFNA 2UZ8A 4EF0A 1H75A 2FWHA 2XC2A 4ECIA 2O89A 4CHSA 4LMVA 4NHWA 4KB3A 2FLSA 2HI7A 3MDKA 3IC4A 1TK0B 3GHAA 3KMOA 5B8AA 2MYGA 2XPDA 1ZYQB 1ZMAA 1U3IA 4NHZA 2NPBA 2HSYA 2PERA 3LG6A 4JR4A 1YF1A 1YKCA 5CO3A 1TOFA 2P5QA 1R5AA 4Q5FA 5ID2A 2LSTA 3ISOA 1RW1A 3KH7A 5J41A 4KSOA 2DMLA 3GSTA 4DSSA 3EINA 5H5RA 1Z6MA 5L71A 1VF4A 1PKZA 2YWNA 4JE1A 3NIVA 2ZCTA 2HSHA 5IM9A 2VL3A 2C8UA 3PR8A 4EE0A 4ID0A 4MK3A 1A8YA 2WULA 5B6MA 2HE3A 4DSSB 2HNLA 4NAXA 1BQ7A 4ZIJA 4MJCA 4OCEA 2H73A 5IMDA 2LNTA 2H70A 1WRYA 5AIVA 1V58A 3L4NA 1M9AA 3V1WA 4MJBA 2DKIA 5CRGA 1X9SB 4TR4A 2MBSA 2K6VA 2OADA 1QXHA 2JACA 4PUAA 1QUWA 1PD21 5FHIA 6GSSA 3FZAA 3LORA 3F6FA 3W8JA 1TTZA 3DVWA 1GRXA 4BVXB 4KAEA 3VWUA 6GSWA 3L0HA 1PMTA 4WXTA 3ERGA 4XTSA 3NZNA 3EYTA 5JCUA 2DJJA 4WEYA 4MP4A 5J40A 5HR1A 3HXSA 1A24A 3ZMKA 4N0ZA 1YF0A 4K6XA 2C0GA 2H74A 2NVLA 3UBLA 1EEJA 5HFGA 1SK2A 1K0DA 5FWGA 4YAPA 2N5BA 1I5GA 4TKYA 4IP1A 1O6JA 1F3BA 2X49A 3UMAA 3DEXA 4FO5A 2VCVA 1PX7A 5AIXA 1F9MA 1MDIA 1SJ6A 5A1NA 1E2YA 1SYRA 3RPPA 2WS2A 2LRNA 2R0GA 2DJ2A 1LBKA 2PVQA 1FOVA 4H86A 3C71A 5CREA 4F03A 1V40A 2JSYA 1LJRA 1A2LA 5ECHB 5DAKA 2MZCA 2UV8G 1ACVA 1WMJA 3F4TA 2VD0A 2VLTA 4J57E 3KGKA 2FUG2 5A1NB 2VLVA 2TIRA 3UAPA 2N5AA 1T00A 4YKFA 5DQYA 2JZSA 1GUMA 3M9JA 1SJZA 3I43A 3HZ4A 2QKEA 4IQ1A 3ZRDA 1NHYA 1PQNA 3D21A 4Z2UA 4IELA 2C80A 5DAKB 2LNSA 4Q5NA 1Y25A 2CV4A 4P3YB 4KCAA 5IPGA 4K7IA 2AUVA 5J3RA 4OWYA 3GKNA 1N25A 4CW9A 2HSMB 4G0KA 1Q4JA 4MDCA 1HNBA 4TR0A 1O8XA 5IMVA 2B6MA 1O81A 5F07A 2EIQA 4TXVA 1FG4A 4K5RA 4GRFA 1ZYNA 4FYUA 1J08A 3PPUA 2H76A 2IIYA 5DJLA 2P31A 2GTUA 1SD9A 3TJGA 5JWOB 2YANA 16GSA 1EP7A 4V1Ag 1PL2A 1BF5A 2YP6A 1XW9A 5HQPA 2GSSA 3ED3A 3J7Yb 1T8EB 3F0IA 3O76A 4GWRA 4F2IA 3GKXA 3ME8A 4MABA 4Z7XA 3HVSA 3ZFBA 1DE1A 2BTOT 2DKHA 3QMXA 2X8HA 4PXOA 2H1LA 5B7CA 5D93A 2HZEB 2H72A 5GAPD 4L5OA 2LJAA 2HRKA 1USBA 3GV1A 6GSVA 2JL4A 4KDYA 2L6CA 3I6AA 3KTLA 5LNKe 3EU3A 1OC9A 3DRNA 5IO2A 2AYTA 3GURA 2WDUA 2OBKA 1TI3A 2WFCA 2I9HA 1GTUA 3HA9A 1V57A 2H30A 1KEBA 2YZUA 3L9SA 1R5PA 4J2FA 2MMNA 2HRKB 2RIIA 2G0FA 2R6KA 4I8BA 1G0TA 1IYIA 3KP9A 3CTFA 2A2PA 5D96A 1TU8A 4KE3A 4WF4A 3HZ8A 1OC9B 2X8CA 3F4SA 4DVCA 3UBKA 4ZL8A 3IAM2 4GQCA 5EL8A 1B8XA 1G6YA 2CVDA 2XBQA 2H6ZA 1XOBA 2VCWA 4AKGA 4OFTA 4WR4A 4KNDA 1M99A 2VLUA 2IMFA 3FYGA 4ISDA 5CYYA 4L0WA 3RHCA 5IMCA 3CSJA 1HQOA 6GSUA 3HJOA 2O5VA 3IBHA 3LFLA 1TK5B 1Z6NA 4ZL9A 3GX0A 3M3MA 5ECMB 3LW9A 2FGXA 4TOPA 2GQMA 1FO5A 5DCGA 3HJMA 2VL2C 4HJMA 3EC3A 2REMA 1SYXA 1AQWA 3TRXA 1EEMA 1OVNA 5HR3A 5IMAA 2B7JA 3IRAA 2GZZA 3K8NA 1K0NA 3OR5A 2PPTA 5LD0A 2N5FA 4XCSA 5DALA 3D5JA 2VCXA 4I2TA 3APOA 3D0ZA 2H6XA 2WB9A 1OC3A 2PN8A 3LGCA 1TK8B 1N8JA 1AQVA 2H6YA 4KCEA 2K8VA 5EPFA 4LL4B 5IO0A 4A5PA 1VRSD 3TJJA 5FT3A 1XWBA 3TKSC 4W66A 1Q98A 1RQMA 3FZ5A 5D8IA 1ST9A 4HZ4A 2FWGA 4I6XA 4JEDA 3TUEA 1SENA 1QK8A 3KJYA 1M7TA 3DXBA 1PSQA 5LCZA 3H1NA 4E68A 4OCFA 1BEDA 2KP2A 4O5UA 4PQ1A 2VD1A 4V2MA 5CRDA 3W6GA 5IMZA 3HVVA 2I81A 6GSYA 4IGJA 4K1FA 2R37A 4ML6A 1RK4A 5E4WA 1T7PB 4OFNA 2A2RA 1LU4A 2QC7A 2IN3A 5C00A 2A2SA 3LWAA 2EFHA 4CY6A 2C1YA 3GKKA 3E9JB 5ECPB 1UN2A 1SL2B 2L59A 5ECSA 2L5LA 5JWRB 4IS0A 5IMFA 1THXA 4TR1A 5J9BA 2M72A 4AJ7A 2GT6A 4MZWA 2GLRA 1FB0A 4MLYA 2O87A 10GSA 4DSQA 2L4CA 1SU9A 3HD5A 2CAQA 5G1KA 2GQLA 5H5QA 4MJEA 1CQHA 2AAWA 1EWXA 1R26A 4PNGA 1YQ1A 3W8SA 17GSA 1PGTA 3L9VA 3BCIA 1TP9A 4K0GA 3EU4A 4MF6A 5CP1A 1EV4A 4HU7A 1EP8A 3L9UA 4YH2A 1GTIA 5DCHA 5ECRB 5B8BA 5ELAA 4G10A 4I97A 4EDZA 3VWWA 2ON7A 4AI6A 5D9VA 5H5SA 3G7IA 1QQ2A 1AUCA 2RM6A 1S3DA 1TDIA 4OFMA 2MMAA 4G0IA 1YY7A 3TOUA 1U87A 5ECOB 4QQ7A 3HKRA 3DD3A 1MD3A 2O85A 2IJYA 1ERWA 5AN1A 5IOXA 2YNXA 5ID2B 2PWJA 1F6MC 3ZLPA 2L57A 12GSA 1XW6A 3BJ5A 5ECIB 2LJKA 4TW5A 4EIQA 1VF1A 5DQSA 1F37A 3ERWA 3ZITA 5ECKB 1ON4A 4PURA 2H8LA 5EY6A 3EVIA 1YKAA 1N2AA 1G7EA 2X99A 5COHA 2F51A 3CTGA 2R5GA 2YN1A 3IPZA 3VURA 2GSQA 4YQVA 3VWVA 3VWXA 6GSXA 1DUGA 5ECQB 2V32A 2LJRA 1K0MA 4KH7A 4OO4A 4TXOA 5INYA 1SK1A 5G1LA 3E3EA 3IK7A 3EWLA 4KSMA 4F0CA 2J9HA 3GL5A 2YPMA 5CNWA 3EMPA 3FK8A 3TDGA 3IAS2 1XBSA 2X64A 1UC7A 5B6NA 3VI7A 5IOWA 2Z9SA 1FW1A 4D73A 6GSTA 2NBSA 4WBJA 1WWJA 4F9ZA 3R3EA 2MBTA 3WT1A 5ECLB 4K7NA 2ZUPA 4BVYA 4TXOB 3LSZA 4ZB7A 2L6DA 4ICYA 4XS6A 4AJ8A 3TKRA 3TRQA 1SVOA 4MPGA 4DEJA 3PGTA 4MZBA 5CRWA 14GSA 4MNNA 2ON5A 4YQMA 2YZHA 4O5RA 3F9UA 2GQKA 2FA8A 1MTCA 3GH9A 5D9WA 1A2JA 20GSA 3WT2A 4XS4A 4GF0A 3GRXA 2KP1A 3WYWA 4XRDA 1GSEA 4G9HA 2YV9A 2IL3A 1GSUA 5BRTA 1T4YA 3GH6A 1FAAA 5KEJA 5F06A 3MWHA 2V41A 3ZL5A 2VCTA 3G7JA 2O8VB 3M0FA 2H19A 4FYBA 3TCOA 3IC8A 2HLSA 4GTUA 1W89A 5CAXA 5J9CA 3CWGA 3FY7A 4ZL7A 1VF2A 4V1Ap 2LQOA 4ECJA 4Z2TA 1ML6A 4V2NA 2VL2A 2FCHA 2H1DA 3GMFA 4BPYA 3GN3A 2YJHA 3DVXA 3HJPA 2KUCA 4QL7A 2DBCA 1X5DA 4TN8A 1M9BA 5IPHA 3IDVA 2CAIA 1FHEA 1OE8A 4FYCA 4HS1A 3ZTLA 3S9FA 5D73A 4AKXB 3P8WA 3FR9A 4AKHA 1J0FA 3SBCA 2B5XA 5F0GA 2C3QA 4Q5QA 1MDJA 3ZZXA 3VLNA 3GFKA 2EFCA 2CX3A 3US3A 2DC5A 4USSA 2VKZG 4AF2A 2R4VA 4FQUA 2XHFA 1ZYPA 1B4PA 3LQ7A 2QSIA 1GLQA 4FIWA 4MF5A 4EC0A 4X0XA 2HRNA 3LXTA 4I5QA 1BG1A 2OJLA 4BL7A 5DBQA 3ZVJD 1OKDA 4EUYA 2P5RA 3UL3A 1WIKA 1TRVA 3SWLA 1E6BA 2VIMA 1EOHA 5A34A 2OE0A 5G5FA 1IYHA 4WKWA 3A2WA 1BX9A 3F6DA 4RQRA 1FOHA 1SKWB 3VI5A 4BL7B 1TI1A 3H4KA 4MPFA 1EGRA 4V2LA 3QAGA 2QA2A 5A4WA 4RI6A 3HY2A 5JWQB 1A0FA 3MYDA 2C0EA 5G30A 3GNJA 3ZIJA 3UVHA 1TW9A 2CVBA 3NOFA 2LRTA 4KGIA 1YEXA 5J4UA 2V6OA 1Y1UA 2VAFA 2GGTA 1GUKA 9GSSA 3C8EA 4MH2A 4XRAA 2GSTA 2I3YA 3C7MA 3IHGA 2CVKA 3GUSA 4MF7A 2VO4A 4PGTA 1Z7PA 3P2AA 4GCIA 4X1UA 5IQYA 3G9BA 2A4VA 1A23A 1GNWA 2LTKA 3GSSA 4K5SA 3TJKA 3KIJA 4HQZA 2DJ3A 4YKGA 2E7PA 2GZPA 3CSHA 2ES7A 1B9XC 3CMIA 4BWQA 4GQFA 5ECNB 2O7KA 3CRTA 3M8NA 1TRUA 3E0UA 4L0UA 2QGVA 1XWCA 2M46A 3ME7A 1PX6A 2CA8A 2E2MA 3EPTA 4KA0A 2H75A 3AY8A 3ZFLA 1XFLA 4EKZA 4XIHA 1WOUA 2OE3A 4PX1A 2YV7A 3KP8A 5A5HA 1NM3A 4CDOA 1WP0A 3ZMLA 1B9YC 2E2GA 2H1BA 3PH9A 3ERFA 2QA1A 2L4QA 4N11A 1DE2A 4MA9A 4WR5A 1TJDA 3DYRA 5DVBA 2HSNA 3A2VA 1ABAA 4L5LA 3LYPA 1YZXA 4ZBBA 4HJ2A 2EFEA 1AW9A 1Z3EA 2PVOC 5GSSA 2MMOA 5A5HB 2DSAA 4IJ3A 1M0UA 3C1RA 1VF3A 1R7HA 1ILOA 5HFIA 2WZ9A 3I69A 2HT9A 3CRUA 3HDCA 4X43A 2R0PA 3TOTA 1ERUA 2LV3A 4K2DA 1XZOA 1BJXA 1V2AA 5DALB 4KF9A 2HSNB 1U3AA 2L5OA 1X5CA 5KN0A 2KLXA 3UJ1A 5ELGA 2FNOA 1C72A 1JZDA 4K7OA 3LYKA 1PRXA 3QCPA 3EMXA 2PUKC 3QD9A 3KD0A 3CXGA 2IMEA 4JR6A 3IR4A 2XBIA 4O92A 1GSFA 2IMKA 3WGEA 2JZRA 2G2QA 3QOUA 2OT3A 2GZYA 3BOAA 1UVZA 4LL1B 2AV4A 3GX8A 3KTBA 1TKDB 4PNFA 1AAZA 3IV4A 2EIRA 3DKSA 4EXJA 3GA4A 4NXIA 2CQ9A 2I4AA 4OD7A 2V1MA 3UEMA 3M1GA 5F05A 2K8SA 2NTOA 4ZILA 4CY8A 1X9WB 3FMWA 4J56E 3GL3A 1V9WA 3QPMA 2CZ2A 4GSNA 1OKTA 1XW5A 2VM1A 3LJRA 3VFIA 3BD2A 1XWGA 3GKMA 3F4RA 4ZXGA 1FVKA 5G2ZA 3O6TA 2VCQA 3VPTA 4K2XA 4XHMA 3WGDA 4OO5A 3DMLA 2V6KA 4IQAA 1F3AA 1AIUA 2AHEA 3FHKA 3N9JA 4HQSA 1F2EA 3P7XA 4TR1B 1JLWA 1YEPA 1BYEA 2R3XA 2DJ0A 3ZVJA 3RAZA 2GT5A 2WRTA 3QDNA 4IBPA 2RUEA 4EVMA 3UOMA 4E8EA 4GSTA 4RQXA 2B3SA 2C3NA 4Q5RA 1GULA 3DIEA 3TKQA 4NMUA 1A8LA 3GIXA 1SKRB 1JFUA 3APSA 2WGRA 2LS5A 2DIYA 4WETA 1B4QA 3C73A 1GLPA 3LEFA 4JU5A 2C3TA 4KDXA 4HEA2 3MIXA 2KHPA 3HHVA 2XPEA 2YWIA 3HMJG 2DMMA 2IWTA 2VCZA 4QL9A 4NPBA 1HNCA 4KUNA 4ACSA 4GLTA 2K18A 3M9KA 1KBNA 2B1LA 1MD4A 3CBUA 4HOJA 4GSSA 3D4MA 2M80A 1PA3A 2PGTA 2B5EA 3VPQA 4KX4A 1T1VA 3MNGA 2JU5A 2VUPA 5DJMA 2K9FA 1ERVA 2TRXA 5KN1A 4BVXA 4O5QA 4RUVA 3RPNA 1ZL9A 2FY6A 4LA1A 2FHEA 3IA1A 1K3OA 5AGYA 2YJ7A 3MSZA 5J4VA 3RDWA 5GAND 1OYJA 2B7KA 1XXUA 1DBYA 3ZYWA 3VK9A 1K0OA 3D4TA 4PQHA 4N10A 3GTUA 2CZ3A 3TGZA 1GTAA 1GTBA 4K0NA 1K3YA 1AC1A 5IIZA 5KN2A 2FWEA 5GSTA 1JZRA 2JSZA 5D9TA 4MMMA 4AGSA 1XPVA 4HUAA 2DIZA 1W4VA 2IMDA 3TRPA 1HD2A 3GTUB 2R2JA 2A4HA 3IE3A 2H71A 2WCIA 2FD3A 4DSRA 1OE7A 4D73B 3D22A 2HRFA 4BA7A 4NV2A 1Z7RA 4BVYB 3TB2A 2TRCP 3TJFA 3KMNA 1SVMA 2D2ZA 5F8BA 4ZB8A 19GSA 1QMVA 1DSBA 2YWMA 1TRWA 1PL1A 2ALBA 1O8WA 3QR6A 11GSA 3HVXA 22GSA 4POKA 3KXOA 1ZYEA 2F3MA 3P90A 5E59A 2LEGA 5BMUA 1EV9A 1JHBA 2YOIA 2PMTA 4N0VA 3FW2A 1H4OA 3EE2A 1K3LA 2RUFA 1R4WA 3BCKA 2OBIA 2LQQA 4YQUA 2C0DA 4NWYA 3I9V2 3A5WA 2C4JA 1JLVA 3KZQA 4XS4B 2X8GA 2PBJA 3U5RE 3IK9A 3R2QA 5G5EA 5BMUB 3G7YA 4PUFC 3IHQA 5KOWA 4MZCA 1K0CA 3KEBA 2IMIA 2F8AA 2H0IA 2HFDA 4JRRA 2HSMA 1XIYA 1SVLA 1SL1B 1GUHA 1ZZYA 2CT6A 1WJKA 3O3TA 5A4VA 1I9DA 3TKSA 4K9ZA 1S3CA 2H0GA 4IJIA 2H66A 4TRXA 1M2BA 2AJQB 2DJKA 3F3QA 1TU7A 3IOSA 3PINA 4KDUA 5J5NA 2VM2A 1CQGA 3F63A 3ZREA 3DWVA 4AJ6A 4PQIA 4ULXA 4WF5A 2HXKA 3HYPA 2RM5A 4EO3A 3Q74A 18GSA 1O85A 1GP1A 1XVQA 1YDKA 1U6TA 1VGLA 3Q19A 2B5YA 3UVTA 1GSYA 1G7OA 3QAWA 1J9BA 3H93A 4ZB6A 2OACA 1URMA 2E0QA 1YVLA 3CSIA 1GWCA 3APQA 3GYKA 4NV5A 1ERTA 4HZ2A 2HZEA 4K8MA 4POBA 3HCZA 8GSSA 4YAVA 1T4ZA 1A2MA 5ENUA 1YJ6A 3FR3A 1SD8A 3QFBC 3QFAC 2H1GA 5A34B 1ZGNA 1OC8A 1KTEA 3FKFA 1GH2A 1FVJA 2VL9A 4N30A 1XWAA 2P0GA 4KW6A 1AQXA 4OMVA 1B48A 3Q18A 5CRHA 2VOCA 3C1SA 1Z5YE 1WPIA 1ZOFA 3JCML 4ZBAA 2KOKA 2LUSA 5AISA 3A5IA 4RI7A 1Y6EA 4X4JA 3F3RA 2RLIA 2ZNMA 2YCDA 1TRSA 4AKIA 2HRAA 1M2DA 3IXRA 5KOXA 4IVFA 1XVWA 1GL8A 13GSA 1NHOA 1S3AA 3RBTA 4TVEA 1MEKA 4ILFA 1BAYA 1GSSA 2GSRA 1XCCA 2EFDA 4ZB9A 4POMA 5A4UA 1HYUA 1GNEA 1QGVA 1GSQA 5JCWA 4PTSA 1PN9A 3H8QA 4IP6A 1XOAA 3KH9A 1SKSB 3FEUA 3KM6A 5EVOA 5J4YA 2IFQA 3TU3B 2H0HA 3EURA 2I1UA 4F0BA 5J47A 4O7HA 1WE0A 5A5KA 4WBRD 2DJ1A 4ML1A 3A3TA 1BG5A 2H01A 2PU9C 2J23A 1G6WA 5KN3A 2JADA 3BBYA 2OE1A 2HQTA 4IKHA 5JCGA 4Z2RA 1MDKA 5GZZB 4MH3A 3F8UA 2HZFA 2IFQB 1HNAA 4L8EA 4EL1A 2DLXA 3TKPA 4I2UA 1SJIA 4IW9A 1K0AA 1XWKA 4TR3A 4EIPA 3FRCA 3CYNA 1PKWA 4HI7A 4QMKA 1U88A 3WD6A 1EZKA 5HFKA 1Z9HA 1O7UA 4JZQA 3L78A 4GXZA 2GS3A 3FZ9A 4F82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DDL A;  4LLR A;  1AXD A;  3MAK A;  2EIO A;  2JZT A;  1SK0 A;  1JZW A;  1FB6 A;  5HR2 A;  2BMX A;  1NSW A;  1GSD A;  1THO A;  2AB6 A;  2FWF A;  5C04 A;  1T3B A;  3U6V A;  2IPA A;  3LXZ A;  2GVP A;  2WJU A;  4MJA A;  1O73 A;  1V98 A;  2GDR A;  2OKA A;  2H1A A;  4XS1 A;  3TJB A;  4ECC A;  2EC4 A;  4O32 A;  1JZO A;  1SL0 B;  3DGQ A;  1X9M B;  3FR6 A;  4ZBD A;  2C0F A;  4FH8 A;  4MCU A;  4IN0 A;  2F9S A;  3KCM A;  1NW2 A;  1TXX A;  3A2X A;  2LKU A;  5ABR A;  3J7Y k;  1EGO A;  2MMZ A;  1UA5 A;  1X5E A;  5D9X A;  1ZCP A;  4POL A;  2B1K A;  4EDY A;  1KNG A;  1X0R A;  2LRC A;  2BJX A;  4E8H A;  4IHU A;  3TKS E;  2YWO A;  2CX4 A;  4JBB A;  3ZIV A;  2V2G A;  4BWS A;  7GSS A;  3WGX A;  2F8F A;  4HU9 A;  1M2A A;  5HR0 A;  3QAV A;  5G31 A;  3Q6O A;  3N5O A;  3H79 A;  3UAR A;  1A0R P;  2FA4 A;  2HYX A;  3D6I A;  4ECB A;  4G19 A;  2OA7 A;  4HDE A;  3RHB A;  1K0B A;  4G2E A;  3UIW A;  4G0L A;  4LMW A;  2NDO A;  1EOG A;  1OAZ A;  3FZ4 A;  1QFN A;  2UZ8 A;  4EF0 A;  1H75 A;  2FWH A;  2XC2 A;  4ECI A;  2O89 A;  4CHS A;  4LMV A;  4NHW A;  4KB3 A;  2FLS A;  2HI7 A;  3MDK A;  3IC4 A;  1TK0 B;  3GHA A;  3KMO A;  5B8A A;  2MYG A;  2XPD A;  1ZYQ B;  1ZMA A;  1U3I A;  4NHZ A;  2NPB A;  2HSY A;  2PER A;  3LG6 A;  4JR4 A;  1YF1 A;  1YKC A;  5CO3 A;  1TOF A;  2P5Q A;  1R5A A;  4Q5F A;  5ID2 A;  2LST A;  3ISO A;  1RW1 A;  3KH7 A;  5J41 A;  4KSO A;  2DML A;  3GST A;  4DSS A;  3EIN A;  5H5R A;  1Z6M A;  5L71 A;  1VF4 A;  1PKZ A;  2YWN A;  4JE1 A;  3NIV A;  2ZCT A;  2HSH A;  5IM9 A;  2VL3 A;  2C8U A;  3PR8 A;  4EE0 A;  4ID0 A;  4MK3 A;  1A8Y A;  2WUL A;  5B6M A;  2HE3 A;  4DSS B;  2HNL A;  4NAX A;  1BQ7 A;  4ZIJ A;  4MJC A;  4OCE A;  2H73 A;  5IMD A;  2LNT A;  2H70 A;  1WRY A;  5AIV A;  1V58 A;  3L4N A;  1M9A A;  3V1W A;  4MJB A;  5CRG A;  1X9S B;  4TR4 A;  2MBS A;  2K6V A;  2OAD A;  1QXH A;  2JAC A;  4PUA A;  1QUW A;  1PD2 1;  5FHI A;  6GSS A;  3FZA A;  3LOR A;  3F6F A;  3W8J A;  1TTZ A;  3DVW A;  1GRX A;  4BVX B;  4KAE A;  3VWU A;  6GSW A;  3L0H A;  1PMT A;  4WXT A;  3ERG A;  4XTS A;  3NZN A;  3EYT A;  5JCU A;  2DJJ A;  4WEY A;  4MP4 A;  5HR1 A;  3HXS A;  1A24 A;  3ZMK A;  4N0Z A;  1YF0 A;  4K6X A;  2C0G A;  2H74 A;  2NVL A;  3UBL A;  1EEJ A;  5HFG A;  1SK2 A;  1K0D A;  5FWG A;  4YAP A;  2N5B A;  1I5G A;  4TKY A;  4IP1 A;  1O6J A;  1F3B A;  3UMA A;  3DEX A;  4FO5 A;  2VCV A;  1PX7 A;  5AIX A;  1F9M A;  1MDI A;  1SJ6 A;  1E2Y A;  1SYR A;  3RPP A;  2WS2 A;  2LRN A;  2DJ2 A;  1LBK A;  2PVQ A;  1FOV A;  4H86 A;  3C71 A;  5CRE A;  4F03 A;  1V40 A;  2JSY A;  1LJR A;  1A2L A;  5ECH B;  5DAK A;  2MZC A;  1ACV A;  1WMJ A;  3F4T A;  2VD0 A;  2VLT A;  4J57 E;  3KGK A;  2FUG 2;  2VLV A;  2TIR A;  3UAP A;  2N5A A;  1T00 A;  5DQY A;  2JZS A;  1GUM A;  3M9J A;  1SJZ A;  3I43 A;  3HZ4 A;  2QKE A;  4IQ1 A;  3ZRD A;  1NHY A;  1PQN A;  3D21 A;  4IEL A;  2C80 A;  5DAK B;  2LNS A;  4Q5N A;  1Y25 A;  2CV4 A;  4P3Y B;  4KCA A;  5IPG A;  4K7I A;  2AUV A;  5J3R A;  4OWY A;  3GKN A;  4CW9 A;  2HSM B;  4G0K A;  1Q4J A;  4MDC A;  1HNB A;  4TR0 A;  1O8X A;  5IMV A;  2B6M A;  1O81 A;  5F07 A;  2EIQ A;  4TXV A;  1FG4 A;  4GRF A;  4FYU A;  1J08 A;  3PPU A;  2H76 A;  2IIY A;  5DJL A;  2P31 A;  2GTU A;  1SD9 A;  3TJG A;  5JWO B;  2YAN A;  16GS A;  1EP7 A;  4V1A g;  1PL2 A;  2YP6 A;  1XW9 A;  5HQP A;  2GSS A;  3ED3 A;  3J7Y b;  1T8E B;  3F0I A;  3O76 A;  4GWR A;  4F2I A;  3GKX A;  3ME8 A;  4MAB A;  4Z7X A;  3HVS A;  3ZFB A;  1DE1 A;  2BTO T;  3QMX A;  2X8H A;  4PXO A;  5B7C A;  5D93 A;  2HZE B;  2H72 A;  5GAP D;  4L5O A;  2LJA A;  2HRK A;  1USB A;  3GV1 A;  6GSV A;  2JL4 A;  4KDY A;  2L6C A;  3I6A A;  3KTL A;  5LNK e;  3EU3 A;  1OC9 A;  3DRN A;  5IO2 A;  2AYT A;  3GUR A;  2WDU A;  2OBK A;  1TI3 A;  2WFC A;  2I9H A;  1GTU A;  3HA9 A;  1V57 A;  2H30 A;  1KEB A;  2YZU A;  3L9S A;  1R5P A;  4J2F A;  2MMN A;  2HRK B;  2RII A;  2G0F A;  2R6K A;  4I8B A;  1G0T A;  1IYI A;  3KP9 A;  3CTF A;  5D96 A;  1TU8 A;  4KE3 A;  4WF4 A;  3HZ8 A;  1OC9 B;  2X8C A;  3F4S A;  4DVC A;  3UBK A;  4ZL8 A;  3IAM 2;  4GQC A;  5EL8 A;  1B8X A;  1G6Y A;  2CVD A;  2XBQ A;  2H6Z A;  1XOB A;  2VCW A;  4OFT A;  4WR4 A;  4KND A;  1M99 A;  2VLU A;  2IMF A;  3FYG A;  4ISD A;  5CYY A;  4L0W A;  3RHC A;  5IMC A;  3CSJ A;  1HQO A;  6GSU A;  3HJO A;  3IBH A;  3LFL A;  1TK5 B;  1Z6N A;  4ZL9 A;  3GX0 A;  3M3M A;  5ECM B;  2FGX A;  4TOP A;  2GQM A;  1FO5 A;  5DCG A;  3HJM A;  2VL2 C;  4HJM A;  3EC3 A;  2REM A;  1SYX A;  1AQW A;  3TRX A;  1EEM A;  1OVN A;  5HR3 A;  5IMA A;  2B7J A;  3IRA A;  2GZZ A;  3K8N A;  1K0N A;  3OR5 A;  2PPT A;  5LD0 A;  2N5F A;  4XCS A;  5DAL A;  3D5J A;  2VCX A;  4I2T A;  3APO A;  3D0Z A;  2H6X A;  2WB9 A;  1OC3 A;  2PN8 A;  3LGC A;  1TK8 B;  1N8J A;  1AQV A;  2H6Y A;  4KCE A;  2K8V A;  5EPF A;  4LL4 B;  5IO0 A;  1VRS D;  3TJJ A;  5FT3 A;  1XWB A;  3TKS C;  1Q98 A;  1RQM A;  3FZ5 A;  5D8I A;  1ST9 A;  4HZ4 A;  2FWG A;  4I6X A;  4JED A;  3TUE A;  1SEN A;  1QK8 A;  3KJY A;  1M7T A;  3DXB A;  1PSQ A;  5LCZ A;  3H1N A;  4OCF A;  1BED A;  2KP2 A;  4PQ1 A;  2VD1 A;  4V2M A;  5CRD A;  3W6G A;  5IMZ A;  3HVV A;  2I81 A;  6GSY A;  4IGJ A;  4K1F A;  2R37 A;  4ML6 A;  1RK4 A;  5E4W A;  1T7P B;  4OFN A;  2A2R A;  1LU4 A;  2QC7 A;  2IN3 A;  5C00 A;  2A2S A;  3LWA A;  2C1Y A;  3GKK A;  3E9J B;  5ECP B;  1UN2 A;  1SL2 B;  2L59 A;  5ECS A;  2L5L A;  5JWR B;  4IS0 A;  5IMF A;  1THX A;  4TR1 A;  5J9B A;  2M72 A;  4AJ7 A;  2GT6 A;  4MZW A;  2GLR A;  1FB0 A;  4MLY A;  2O87 A;  10GS A;  4DSQ A;  2L4C A;  1SU9 A;  3HD5 A;  2CAQ A;  5G1K A;  2GQL A;  5H5Q A;  4MJE A;  1CQH A;  2AAW A;  1EWX A;  1R26 A;  4PNG A;  1YQ1 A;  3W8S A;  17GS A;  1PGT A;  3L9V A;  3BCI A;  1TP9 A;  4K0G A;  3EU4 A;  4MF6 A;  5CP1 A;  1EV4 A;  4HU7 A;  1EP8 A;  3L9U A;  4YH2 A;  1GTI A;  5DCH A;  5ECR B;  5B8B A;  5ELA A;  4G10 A;  4I97 A;  4EDZ A;  3VWW A;  2ON7 A;  5D9V A;  5H5S A;  3G7I A;  1QQ2 A;  1AUC A;  2RM6 A;  1S3D A;  1TDI A;  4OFM A;  2MMA A;  4G0I A;  1YY7 A;  3TOU A;  1U87 A;  5ECO B;  4QQ7 A;  3HKR A;  3DD3 A;  1MD3 A;  2O85 A;  2IJY A;  1ERW A;  5AN1 A;  5IOX A;  2YNX A;  5ID2 B;  2PWJ A;  1F6M C;  3ZLP A;  2L57 A;  12GS A;  1XW6 A;  3BJ5 A;  5ECI B;  2LJK A;  4TW5 A;  1VF1 A;  5DQS A;  1F37 A;  3ERW A;  3ZIT A;  5ECK B;  1ON4 A;  4PUR A;  2H8L A;  5EY6 A;  3EVI A;  1YKA A;  1N2A A;  1G7E A;  2X99 A;  5COH A;  2F51 A;  3CTG A;  2R5G A;  2YN1 A;  3IPZ A;  3VUR A;  2GSQ A;  4YQV A;  3VWV A;  3VWX A;  6GSX A;  1DUG A;  5ECQ B;  2V32 A;  2LJR A;  1K0M A;  4KH7 A;  4OO4 A;  4TXO A;  5INY A;  1SK1 A;  5G1L A;  3E3E A;  3IK7 A;  3EWL A;  4KSM A;  4F0C A;  2J9H A;  3GL5 A;  2YPM A;  5CNW A;  3EMP A;  3FK8 A;  3TDG A;  3IAS 2;  1XBS A;  2X64 A;  1UC7 A;  5B6N A;  3VI7 A;  5IOW A;  2Z9S A;  1FW1 A;  4D73 A;  6GST A;  2NBS A;  4WBJ A;  1WWJ A;  4F9Z A;  3R3E A;  2MBT A;  3WT1 A;  5ECL B;  4K7N A;  2ZUP A;  4BVY A;  4TXO B;  3LSZ A;  2L6D A;  4XS6 A;  4AJ8 A;  3TKR A;  3TRQ A;  4MPG A;  4DEJ A;  3PGT A;  4MZB A;  5CRW A;  14GS A;  2ON5 A;  4YQM A;  2YZH A;  4O5R A;  3F9U A;  2GQK A;  2FA8 A;  1MTC A;  3GH9 A;  5D9W A;  1A2J A;  20GS A;  3WT2 A;  4XS4 A;  4GF0 A;  3GRX A;  2KP1 A;  3WYW A;  4XRD A;  1GSE A;  4G9H A;  2YV9 A;  2IL3 A;  1GSU A;  1T4Y A;  3GH6 A;  1FAA A;  5KEJ A;  5F06 A;  3MWH A;  2V41 A;  3ZL5 A;  2VCT A;  3G7J A;  2O8V B;  3M0F A;  2H19 A;  4FYB A;  3TCO A;  3IC8 A;  2HLS A;  4GTU A;  1W89 A;  5CAX A;  5J9C A;  3FY7 A;  4ZL7 A;  1VF2 A;  4V1A p;  2LQO A;  4ECJ A;  1ML6 A;  4V2N A;  2VL2 A;  2FCH A;  2H1D A;  3GMF A;  4BPY A;  3GN3 A;  2YJH A;  3DVX A;  3HJP A;  2KUC A;  4QL7 A;  2DBC A;  1X5D A;  4TN8 A;  1M9B A;  5IPH A;  3IDV A;  2CAI A;  1FHE A;  1OE8 A;  4FYC A;  4HS1 A;  3ZTL A;  3S9F A;  5D73 A;  3P8W A;  3FR9 A;  1J0F A;  3SBC A;  2B5X A;  5F0G A;  2C3Q A;  4Q5Q A;  1MDJ A;  3ZZX A;  3VLN A;  3GFK A;  2CX3 A;  3US3 A;  2DC5 A;  4USS A;  4AF2 A;  2R4V A;  4FQU A;  2XHF A;  1B4P A;  3LQ7 A;  2QSI A;  1GLQ A;  4FIW A;  4MF5 A;  4EC0 A;  4X0X A;  2HRN A;  3LXT A;  4I5Q A;  2OJL A;  4BL7 A;  5DBQ A;  3ZVJ D;  1OKD A;  4EUY A;  2P5R A;  3UL3 A;  1WIK A;  1TRV A;  3SWL A;  1E6B A;  2VIM A;  1EOH A;  2OE0 A;  5G5F A;  1IYH A;  4WKW A;  3A2W A;  1BX9 A;  3F6D A;  4RQR A;  1SKW B;  3VI5 A;  4BL7 B;  1TI1 A;  3H4K A;  4MPF A;  1EGR A;  4V2L A;  3QAG A;  5A4W A;  4RI6 A;  3HY2 A;  5JWQ B;  1A0F A;  2C0E A;  5G30 A;  3GNJ A;  3ZIJ A;  3UVH A;  1TW9 A;  2CVB A;  3NOF A;  2LRT A;  4KGI A;  1YEX A;  5J4U A;  2V6O A;  2VAF A;  2GGT A;  1GUK A;  9GSS A;  3C8E A;  4MH2 A;  4XRA A;  2GST A;  2I3Y A;  3C7M A;  2CVK A;  3GUS A;  4MF7 A;  2VO4 A;  4PGT A;  1Z7P A;  3P2A A;  4GCI A;  4X1U A;  5IQY A;  3G9B A;  2A4V A;  1A23 A;  1GNW A;  2LTK A;  3GSS A;  3TJK A;  3KIJ A;  4HQZ A;  2DJ3 A;  2E7P A;  2GZP A;  3CSH A;  2ES7 A;  1B9X C;  3CMI A;  4BWQ A;  4GQF A;  5ECN B;  2O7K A;  3CRT A;  3M8N A;  1TRU A;  3E0U A;  4L0U A;  2QGV A;  1XWC A;  2M46 A;  3ME7 A;  1PX6 A;  2CA8 A;  2E2M A;  4KA0 A;  2H75 A;  3AY8 A;  3ZFL A;  1XFL A;  4EKZ A;  4XIH A;  1WOU A;  2OE3 A;  4PX1 A;  2YV7 A;  3KP8 A;  1NM3 A;  4CDO A;  1WP0 A;  3ZML A;  1B9Y C;  2E2G A;  2H1B A;  3PH9 A;  3ERF A;  2L4Q A;  4N11 A;  1DE2 A;  4MA9 A;  4WR5 A;  1TJD A;  3DYR A;  5DVB A;  3A2V A;  1ABA A;  4L5L A;  3LYP A;  1YZX A;  4ZBB A;  4HJ2 A;  1AW9 A;  1Z3E A;  2PVO C;  5GSS A;  2MMO A;  2DSA A;  4IJ3 A;  1M0U A;  3C1R A;  1VF3 A;  1R7H A;  1ILO A;  5HFI A;  2WZ9 A;  3I69 A;  2HT9 A;  3CRU A;  3HDC A;  4X43 A;  3TOT A;  1ERU A;  2LV3 A;  4K2D A;  1XZO A;  1BJX A;  1V2A A;  5DAL B;  4KF9 A;  2HSN B;  1U3A A;  2L5O A;  1X5C A;  5KN0 A;  2KLX A;  3UJ1 A;  5ELG A;  2FNO A;  1C72 A;  1JZD A;  4K7O A;  3LYK A;  1PRX A;  3QCP A;  3EMX A;  2PUK C;  3QD9 A;  3KD0 A;  3CXG A;  2IME A;  4JR6 A;  3IR4 A;  2XBI A;  4O92 A;  1GSF A;  2IMK A;  3WGE A;  2JZR A;  2G2Q A;  3QOU A;  2GZY A;  3BOA A;  1UVZ A;  4LL1 B;  2AV4 A;  3GX8 A;  3KTB A;  1TKD B;  4PNF A;  1AAZ A;  3IV4 A;  2EIR A;  3DKS A;  4EXJ A;  3GA4 A;  4NXI A;  2CQ9 A;  2I4A A;  4OD7 A;  2V1M A;  3UEM A;  3M1G A;  5F05 A;  2K8S A;  2NTO A;  4ZIL A;  1X9W B;  4J56 E;  3GL3 A;  1V9W A;  3QPM A;  2CZ2 A;  4GSN A;  1OKT A;  1XW5 A;  2VM1 A;  3LJR A;  3VFI A;  3BD2 A;  1XWG A;  3GKM A;  3F4R A;  4ZXG A;  1FVK A;  5G2Z A;  3O6T A;  2VCQ A;  3VPT A;  4XHM A;  3WGD A;  4OO5 A;  3DML A;  2V6K A;  4IQA A;  1F3A A;  1AIU A;  2AHE A;  3FHK A;  3N9J A;  4HQS A;  1F2E A;  3P7X A;  4TR1 B;  1JLW A;  1YEP A;  1BYE A;  2R3X A;  2DJ0 A;  3ZVJ A;  3RAZ A;  2GT5 A;  2WRT A;  3QDN A;  4IBP A;  2RUE A;  4EVM A;  3UOM A;  4E8E A;  4GST A;  4RQX A;  2B3S A;  2C3N A;  4Q5R A;  1GUL A;  3DIE A;  3TKQ A;  4NMU A;  1A8L A;  3GIX A;  1SKR B;  1JFU A;  3APS A;  2WGR A;  2LS5 A;  2DIY A;  4WET A;  1B4Q A;  3C73 A;  1GLP A;  3LEF A;  4JU5 A;  2C3T A;  4KDX A;  4HEA 2;  2KHP A;  3HHV A;  2XPE A;  2YWI A;  2DMM A;  2IWT A;  2VCZ A;  4QL9 A;  4NPB A;  1HNC A;  4KUN A;  4ACS A;  4GLT A;  2K18 A;  3M9K A;  1KBN A;  2B1L A;  1MD4 A;  3CBU A;  4HOJ A;  4GSS A;  3D4M A;  2M80 A;  1PA3 A;  2PGT A;  2B5E A;  3VPQ A;  4KX4 A;  1T1V A;  3MNG A;  2JU5 A;  2VUP A;  5DJM A;  2K9F A;  1ERV A;  2TRX A;  5KN1 A;  4BVX A;  4RUV A;  3RPN A;  1ZL9 A;  2FY6 A;  4LA1 A;  2FHE A;  3IA1 A;  1K3O A;  5AGY A;  2YJ7 A;  3MSZ A;  3RDW A;  5GAN D;  1OYJ A;  2B7K A;  1XXU A;  1DBY A;  3ZYW A;  3VK9 A;  1K0O A;  3D4T A;  4PQH A;  4N10 A;  3GTU A;  2CZ3 A;  3TGZ A;  1GTA A;  1GTB A;  4K0N A;  1K3Y A;  1AC1 A;  5IIZ A;  5KN2 A;  2FWE A;  5GST A;  1JZR A;  2JSZ A;  5D9T A;  4MMM A;  4AGS A;  1XPV A;  4HUA A;  2DIZ A;  1W4V A;  2IMD A;  3TRP A;  1HD2 A;  3GTU B;  2R2J A;  4DSR A;  3IE3 A;  2H71 A;  2WCI A;  2FD3 A;  1OE7 A;  4D73 B;  3D22 A;  2HRF A;  4BA7 A;  4NV2 A;  1Z7R A;  4BVY B;  3TB2 A;  2TRC P;  3TJF A;  3KMN A;  2D2Z A;  5F8B A;  4ZB8 A;  19GS A;  1QMV A;  1DSB A;  2YWM A;  1TRW A;  1PL1 A;  2ALB A;  1O8W A;  3QR6 A;  11GS A;  3HVX A;  22GS A;  4POK A;  3KXO A;  1ZYE A;  2F3M A;  3P90 A;  5E59 A;  2LEG A;  5BMU A;  1EV9 A;  1JHB A;  2YOI A;  2PMT A;  4N0V A;  3FW2 A;  1H4O A;  3EE2 A;  1K3L A;  2RUF A;  1R4W A;  3BCK A;  2OBI A;  2LQQ A;  4YQU A;  2C0D A;  4NWY A;  3I9V 2;  3A5W A;  2C4J A;  1JLV A;  3KZQ A;  4XS4 B;  2X8G A;  2PBJ A;  3U5R E;  3IK9 A;  3R2Q A;  5G5E A;  3G7Y A;  4PUF C;  3IHQ A;  4MZC A;  1K0C A;  3KEB A;  2IMI A;  2F8A A;  2H0I A;  2HFD A;  4JRR A;  2HSM A;  1XIY A;  1SL1 B;  1GUH A;  1ZZY A;  2CT6 A;  1WJK A;  3O3T A;  5A4V A;  1I9D A;  3TKS A;  4K9Z A;  1S3C A;  2H0G A;  4IJI A;  2H66 A;  4TRX A;  1M2B A;  2AJQ B;  2DJK A;  3F3Q A;  1TU7 A;  3IOS A;  3PIN A;  4KDU A;  5J5N A;  2VM2 A;  1CQG A;  3F63 A;  3ZRE A;  3DWV A;  4AJ6 A;  4PQI A;  4ULX A;  4WF5 A;  2HXK A;  3HYP A;  2RM5 A;  4EO3 A;  3Q74 A;  18GS A;  1O85 A;  1GP1 A;  1XVQ A;  1YDK A;  1U6T A;  1VGL A;  3Q19 A;  2B5Y A;  3UVT A;  1GSY A;  1G7O A;  3QAW A;  1J9B A;  3H93 A;  4ZB6 A;  2OAC A;  1URM A;  2E0Q A;  3CSI A;  1GWC A;  3APQ A;  3GYK A;  4NV5 A;  1ERT A;  4HZ2 A;  2HZE A;  4K8M A;  4POB A;  3HCZ A;  8GSS A;  4YAV A;  1T4Z A;  1A2M A;  5ENU A;  1YJ6 A;  3FR3 A;  1SD8 A;  3QFB C;  3QFA C;  2H1G A;  1ZGN A;  1OC8 A;  1KTE A;  3FKF A;  1GH2 A;  1FVJ A;  2VL9 A;  4N30 A;  1XWA A;  2P0G A;  4KW6 A;  1AQX A;  4OMV A;  1B48 A;  3Q18 A;  5CRH A;  2VOC A;  3C1S A;  1Z5Y E;  1WPI A;  1ZOF A;  3JCM L;  4ZBA A;  2KOK A;  2LUS A;  5AIS A;  4RI7 A;  1Y6E A;  3F3R A;  2RLI A;  2ZNM A;  2YCD A;  1TRS A;  2HRA A;  1M2D A;  3IXR A;  4IVF A;  1XVW A;  1GL8 A;  13GS A;  1NHO A;  1S3A A;  3RBT A;  4TVE A;  1MEK A;  4ILF A;  1BAY A;  1GSS A;  2GSR A;  1XCC A;  4ZB9 A;  4POM A;  5A4U A;  1HYU A;  1GNE A;  1QGV A;  1GSQ A;  5JCW A;  4PTS A;  1PN9 A;  3H8Q A;  4IP6 A;  1XOA A;  3KH9 A;  1SKS B;  3FEU A;  3KM6 A;  5EVO A;  2IFQ A;  2H0H A;  3EUR A;  2I1U A;  4F0B A;  4O7H A;  1WE0 A;  5A5K A;  4WBR D;  2DJ1 A;  4ML1 A;  3A3T A;  1BG5 A;  2H01 A;  2PU9 C;  2J23 A;  1G6W A;  5KN3 A;  2JAD A;  3BBY A;  2OE1 A;  2HQT A;  4IKH A;  5JCG A;  1MDK A;  5GZZ B;  4MH3 A;  3F8U A;  2HZF A;  2IFQ B;  1HNA A;  4L8E A;  4EL1 A;  2DLX A;  3TKP A;  4I2U A;  1SJI A;  4IW9 A;  1K0A A;  1XWK A;  4TR3 A;  3FRC A;  3CYN A;  1PKW A;  4HI7 A;  1U88 A;  3WD6 A;  1EZK A;  5HFK A;  1Z9H A;  1O7U A;  4JZQ A;  3L78 A;  4GXZ A;  2GS3 A;  3FZ9 A;  4F82 A; 
#chains in the Genus database with same CATH topology
 5DDL A;  4LLR A;  1AXD A;  3MAK A;  2EIO A;  2JZT A;  1SK0 A;  1JZW A;  1FB6 A;  5HR2 A;  2BMX A;  1NSW A;  1GSD A;  1THO A;  2AB6 A;  2FWF A;  5C04 A;  1T3B A;  3U6V A;  2IPA A;  3LXZ A;  2GVP A;  2WJU A;  4MJA A;  1O73 A;  1V98 A;  2GDR A;  2OKA A;  2H1A A;  4XS1 A;  3TJB A;  4ECC A;  2EC4 A;  4O32 A;  1JZO A;  1SL0 B;  3DGQ A;  1X9M B;  2R0C A;  3FR6 A;  4ZBD A;  2C0F A;  4FH8 A;  1M3J A;  4MCU A;  4IN0 A;  2F9S A;  3KCM A;  1NW2 A;  1TXX A;  3A2X A;  2LKU A;  5ABR A;  3J7Y k;  1EGO A;  2MMZ A;  1UA5 A;  1X5E A;  5D9X A;  1ZCP A;  4POL A;  2B1K A;  4EDY A;  1KNG A;  1X0R A;  2LRC A;  2BJX A;  4E8H A;  1TXU A;  4IHU A;  2X4A A;  3TKS E;  2YWO A;  4N3Z A;  2CX4 A;  4JBB A;  2WZS A;  1PN0 A;  3ZIV A;  2V2G A;  4BWS A;  7GSS A;  3WGX A;  2F8F A;  4HU9 A;  1M2A A;  5HR0 A;  3QAV A;  5G31 A;  4GDF A;  3Q6O A;  3N5O A;  1PFO A;  3H79 A;  3UAR A;  1A0R P;  2FA4 A;  2HYX A;  3D6I A;  4ECB A;  4G19 A;  2OA7 A;  4HDE A;  3RHB A;  1K0B A;  4G2E A;  3UIW A;  4G0L A;  4G01 A;  4LMW A;  1EOG A;  2NDO A;  1OAZ A;  3FZ4 A;  1QFN A;  2UZ8 A;  4EF0 A;  1H75 A;  2FWH A;  2XC2 A;  4ECI A;  2O89 A;  4CHS A;  4LMV A;  4NHW A;  4KB3 A;  2FLS A;  2HI7 A;  3MDK A;  3IC4 A;  1TK0 B;  3GHA A;  3KMO A;  5B8A A;  2MYG A;  2XPD A;  1ZYQ B;  3RGB C;  1ZMA A;  1U3I A;  4NHZ A;  2NPB A;  2HSY A;  2PER A;  3LG6 A;  4JR4 A;  1YF1 A;  1YKC A;  5CO3 A;  1TOF A;  2P5Q A;  1R5A A;  4Q5F A;  2WVY A;  5ID2 A;  2LST A;  4PHZ C;  3ISO A;  1RW1 A;  3KH7 A;  5J41 A;  4KSO A;  2DML A;  3GST A;  4DSS A;  3EIN A;  5H5R A;  1Z6M A;  5L71 A;  1VF4 A;  1PKZ A;  2YWN A;  4JE1 A;  3NIV A;  2ZCT A;  2HSH A;  5IM9 A;  2VL3 A;  2C8U A;  3PR8 A;  4EE0 A;  4ID0 A;  4MK3 A;  1A8Y A;  2WUL A;  5B6M A;  2HE3 A;  4DSS B;  2HNL A;  4NAX A;  1BQ7 A;  4ZIJ A;  4MJC A;  4OCE A;  2H73 A;  3CQF A;  5IMD A;  2LNT A;  2H70 A;  1WRY A;  5AIV A;  1V58 A;  3L4N A;  1M9A A;  3V1W A;  4MJB A;  2DKI A;  5CRG A;  1X9S B;  4TR4 A;  2MBS A;  2K6V A;  2OAD A;  1QXH A;  2JAC A;  4PUA A;  1QUW A;  1PD2 1;  5FHI A;  6GSS A;  3FZA A;  2WW0 A;  3LOR A;  3F6F A;  3W8J A;  1TTZ A;  3DVW A;  1GRX A;  4BVX B;  4KAE A;  3VWU A;  6GSW A;  3L0H A;  1PMT A;  4WXT A;  3ERG A;  4XTS A;  3NZN A;  3EYT A;  5JCU A;  2DJJ A;  2WVZ A;  4WEY A;  4MP4 A;  5J40 A;  5HR1 A;  3HXS A;  1A24 A;  3ZMK A;  4N0Z A;  1YF0 A;  4K6X A;  2C0G A;  2H74 A;  2NVL A;  3UBL A;  1EEJ A;  5HFG A;  1SK2 A;  1K0D A;  5FWG A;  4YAP A;  2N5B A;  1I5G A;  4TKY A;  4IP1 A;  1O6J A;  1F3B A;  2X49 A;  3UMA A;  3DEX A;  4FO5 A;  2VCV A;  1PX7 A;  5AIX A;  1F9M A;  1MDI A;  1SJ6 A;  5A1N A;  1E2Y A;  1SYR A;  3RPP A;  2WS2 A;  2LRN A;  2R0G A;  2DJ2 A;  1LBK A;  2PVQ A;  1FOV A;  4H86 A;  3C71 A;  5CRE A;  4F03 A;  1V40 A;  2JSY A;  1LJR A;  1A2L A;  5ECH B;  5DAK A;  2MZC A;  2UV8 G;  1ACV A;  1WMJ A;  3F4T A;  4HSC X;  2VD0 A;  2VLT A;  4J57 E;  3KGK A;  2FUG 2;  5A1N B;  2VLV A;  2TIR A;  3UAP A;  2N5A A;  1T00 A;  4YKF A;  5DQY A;  2JZS A;  1GUM A;  3M9J A;  1SJZ A;  3I43 A;  3HZ4 A;  2QKE A;  4IQ1 A;  3ZRD A;  1NHY A;  1PQN A;  3D21 A;  4Z2U A;  4IEL A;  2C80 A;  5DAK B;  2LNS A;  4Q5N A;  1Y25 A;  2CV4 A;  4P3Y B;  4KCA A;  5IPG A;  4K7I A;  2AUV A;  5J3R A;  4OWY A;  3GKN A;  1N25 A;  4CW9 A;  2HSM B;  4G0K A;  1Q4J A;  4MDC A;  1HNB A;  4TR0 A;  1O8X A;  5IMV A;  2B6M A;  1O81 A;  5F07 A;  2EIQ A;  4TXV A;  1FG4 A;  4K5R A;  4GRF A;  1ZYN A;  4FYU A;  1J08 A;  3PPU A;  2H76 A;  2IIY A;  5DJL A;  2P31 A;  2GTU A;  1SD9 A;  3TJG A;  5JWO B;  2YAN A;  16GS A;  1EP7 A;  4V1A g;  1PL2 A;  1BF5 A;  2YP6 A;  1XW9 A;  5HQP A;  2GSS A;  3ED3 A;  3J7Y b;  1T8E B;  3F0I A;  3O76 A;  4GWR A;  4F2I A;  3GKX A;  3ME8 A;  4MAB A;  4Z7X A;  3HVS A;  3ZFB A;  1DE1 A;  2BTO T;  2DKH A;  3QMX A;  2X8H A;  4PXO A;  2H1L A;  5B7C A;  5D93 A;  2HZE B;  2H72 A;  5GAP D;  4L5O A;  2LJA A;  2HRK A;  1USB A;  3GV1 A;  6GSV A;  2JL4 A;  4KDY A;  2L6C A;  3I6A A;  3KTL A;  5LNK e;  3EU3 A;  1OC9 A;  3DRN A;  5IO2 A;  2AYT A;  3GUR A;  2WDU A;  2OBK A;  1TI3 A;  2WFC A;  2I9H A;  1GTU A;  3HA9 A;  1V57 A;  2H30 A;  1KEB A;  2YZU A;  3L9S A;  1R5P A;  4J2F A;  2MMN A;  2HRK B;  2RII A;  2G0F A;  2R6K A;  4I8B A;  1G0T A;  4FXY P;  1IYI A;  2WVX B;  3KP9 A;  3CTF A;  2A2P A;  5D96 A;  1TU8 A;  4KE3 A;  4WF4 A;  3HZ8 A;  1OC9 B;  2X8C A;  3F4S A;  4DVC A;  3UBK A;  4ZL8 A;  3IAM 2;  4GQC A;  5EL8 A;  1B8X A;  1G6Y A;  2CVD A;  2XBQ A;  2H6Z A;  1XOB A;  2VCW A;  4AKG A;  4OFT A;  4WR4 A;  4KND A;  1M99 A;  2VLU A;  2IMF A;  3FYG A;  4ISD A;  5CYY A;  4L0W A;  3RHC A;  5IMC A;  3CSJ A;  1HQO A;  6GSU A;  3HJO A;  2O5V A;  3IBH A;  3LFL A;  1TK5 B;  1Z6N A;  4ZL9 A;  3GX0 A;  3M3M A;  5ECM B;  3LW9 A;  2FGX A;  4TOP A;  2GQM A;  1FO5 A;  5DCG A;  3HJM A;  2VL2 C;  1I1I P;  4HJM A;  3EC3 A;  2REM A;  1SYX A;  1AQW A;  3TRX A;  1EEM A;  1OVN A;  5HR3 A;  5IMA A;  3RFR C;  2B7J A;  3IRA A;  2GZZ A;  3K8N A;  1K0N A;  3OR5 A;  2PPT A;  5LD0 A;  2N5F A;  4XCS A;  5DAL A;  3D5J A;  2VCX A;  4I2T A;  3APO A;  3D0Z A;  2H6X A;  2WB9 A;  1OC3 A;  2PN8 A;  3LGC A;  1TK8 B;  1N8J A;  1AQV A;  2H6Y A;  4KCE A;  2K8V A;  5EPF A;  4LL4 B;  5IO0 A;  4A5P A;  1VRS D;  3TJJ A;  5FT3 A;  1XWB A;  3TKS C;  4W66 A;  1Q98 A;  1RQM A;  3FZ5 A;  5D8I A;  1ST9 A;  4HZ4 A;  2FWG A;  4I6X A;  4JED A;  3TUE A;  1SEN A;  1QK8 A;  3KJY A;  1M7T A;  3DXB A;  1PSQ A;  5LCZ A;  3H1N A;  4E68 A;  4OCF A;  1BED A;  2KP2 A;  4O5U A;  4PQ1 A;  2VD1 A;  4V2M A;  5CRD A;  3W6G A;  5IMZ A;  3HVV A;  2I81 A;  6GSY A;  4IGJ A;  4K1F A;  2R37 A;  4ML6 A;  1RK4 A;  5E4W A;  1T7P B;  4OFN A;  2WW2 A;  2A2R A;  1LU4 A;  2QC7 A;  2IN3 A;  5C00 A;  2A2S A;  3LWA A;  2EFH A;  4CY6 A;  2C1Y A;  3GKK A;  3E9J B;  5ECP B;  1UN2 A;  1SL2 B;  2L59 A;  5ECS A;  2L5L A;  5JWR B;  4IS0 A;  5IMF A;  1THX A;  4TR1 A;  5J9B A;  2M72 A;  4AJ7 A;  2GT6 A;  4MZW A;  2GLR A;  1FB0 A;  4MLY A;  2O87 A;  10GS A;  4DSQ A;  2L4C A;  1SU9 A;  3HD5 A;  2CAQ A;  5G1K A;  2GQL A;  5H5Q A;  4MJE A;  1CQH A;  2AAW A;  1EWX A;  1R26 A;  4PNG A;  1YQ1 A;  3W8S A;  17GS A;  1PGT A;  3L9V A;  3BCI A;  1TP9 A;  4K0G A;  3EU4 A;  4MF6 A;  5CP1 A;  1EV4 A;  2WW3 A;  4HU7 A;  1EP8 A;  3L9U A;  4YH2 A;  1GTI A;  5DCH A;  5ECR B;  5B8B A;  5ELA A;  4G10 A;  4I97 A;  4EDZ A;  3VWW A;  2ON7 A;  4AI6 A;  5D9V A;  5H5S A;  3G7I A;  1QQ2 A;  1AUC A;  2RM6 A;  1S3D A;  1TDI A;  4OFM A;  2MMA A;  4G0I A;  1YY7 A;  3TOU A;  1U87 A;  5ECO B;  4QQ7 A;  3HKR A;  3DD3 A;  1MD3 A;  2O85 A;  2IJY A;  4BIK A;  1ERW A;  5AN1 A;  5IOX A;  2YNX A;  5ID2 B;  2PWJ A;  1F6M C;  3ZLP A;  2L57 A;  12GS A;  1XW6 A;  3BJ5 A;  5ECI B;  2LJK A;  4TW5 A;  4EIQ A;  1VF1 A;  5DQS A;  1F37 A;  3ERW A;  3ZIT A;  5ECK B;  1ON4 A;  4PUR A;  2H8L A;  5EY6 A;  3EVI A;  1YKA A;  1N2A A;  1G7E A;  2X99 A;  5COH A;  2F51 A;  3CTG A;  2R5G A;  2YN1 A;  3IPZ A;  3VUR A;  2GSQ A;  4YQV A;  3VWV A;  3VWX A;  6GSX A;  1DUG A;  5ECQ B;  2V32 A;  2LJR A;  1K0M A;  4KH7 A;  4OO4 A;  4TXO A;  5INY A;  1SK1 A;  5G1L A;  3E3E A;  3IK7 A;  3EWL A;  4KSM A;  4F0C A;  2J9H A;  3GL5 A;  2YPM A;  5CNW A;  3EMP A;  3FK8 A;  3HVN A;  3TDG A;  3IAS 2;  1XBS A;  2X64 A;  1UC7 A;  5B6N A;  3VI7 A;  5IOW A;  2Z9S A;  1FW1 A;  4D73 A;  6GST A;  2NBS A;  4WBJ A;  1WWJ A;  4F9Z A;  3R3E A;  2MBT A;  3WT1 A;  5ECL B;  4K7N A;  2ZUP A;  4BVY A;  4TXO B;  3LSZ A;  4ZB7 A;  2L6D A;  4ICY A;  4XS6 A;  4AJ8 A;  3TKR A;  3TRQ A;  1SVO A;  4MPG A;  4DEJ A;  3PGT A;  4MZB A;  5CRW A;  14GS A;  4MNN A;  2ON5 A;  4YQM A;  2YZH A;  4O5R A;  3F9U A;  2GQK A;  2FA8 A;  1MTC A;  3GH9 A;  5D9W A;  1A2J A;  20GS A;  3WT2 A;  4XS4 A;  4GF0 A;  3GRX A;  2KP1 A;  3WYW A;  4XRD A;  1GSE A;  4G9H A;  2YV9 A;  2IL3 A;  1GSU A;  5BRT A;  1T4Y A;  3GH6 A;  1FAA A;  5KEJ A;  5F06 A;  3MWH A;  2V41 A;  3ZL5 A;  2VCT A;  3G7J A;  2O8V B;  3M0F A;  2H19 A;  4FYB A;  3TCO A;  3IC8 A;  2HLS A;  4GTU A;  1W89 A;  5CAX A;  5J9C A;  3CWG A;  3FY7 A;  4ZL7 A;  1VF2 A;  4V1A p;  2LQO A;  4ECJ A;  4Z2T A;  1ML6 A;  4V2N A;  2VL2 A;  2FCH A;  2H1D A;  3GMF A;  4BPY A;  3GN3 A;  2YJH A;  3DVX A;  3HJP A;  2KUC A;  4QL7 A;  2DBC A;  1X5D A;  4TN8 A;  1M9B A;  5IPH A;  3IDV A;  2CAI A;  1FHE A;  1OE8 A;  4FYC A;  4HS1 A;  3ZTL A;  3S9F A;  5D73 A;  4AKX B;  3P8W A;  3FR9 A;  4AKH A;  1J0F A;  3SBC A;  2B5X A;  5F0G A;  2C3Q A;  4Q5Q A;  1MDJ A;  3ZZX A;  3VLN A;  3GFK A;  2EFC A;  2CX3 A;  3US3 A;  2DC5 A;  4USS A;  2VKZ G;  4AF2 A;  2R4V A;  4FQU A;  2XHF A;  1ZYP A;  3LQ7 A;  1B4P A;  2QSI A;  1GLQ A;  4FIW A;  4MF5 A;  4EC0 A;  4X0X A;  2HRN A;  3LXT A;  4I5Q A;  1BG1 A;  2OJL A;  4BL7 A;  5DBQ A;  3ZVJ D;  1OKD A;  4EUY A;  2P5R A;  3UL3 A;  1WIK A;  1S3R A;  1TRV A;  3SWL A;  1E6B A;  2VIM A;  1EOH A;  5A34 A;  2OE0 A;  5G5F A;  1IYH A;  4WKW A;  3A2W A;  1BX9 A;  3F6D A;  4RQR A;  1FOH A;  1SKW B;  3VI5 A;  4BL7 B;  1TI1 A;  3H4K A;  4MPF A;  1EGR A;  4V2L A;  3QAG A;  2QA2 A;  5A4W A;  4RI6 A;  3HY2 A;  5JWQ B;  1A0F A;  3MYD A;  2C0E A;  5G30 A;  3GNJ A;  3ZIJ A;  3UVH A;  1TW9 A;  2CVB A;  3NOF A;  2LRT A;  4KGI A;  1YEX A;  5J4U A;  2V6O A;  1Y1U A;  2VAF A;  2GGT A;  1GUK A;  9GSS A;  3C8E A;  4MH2 A;  4XRA A;  2GST A;  2I3Y A;  3C7M A;  3IHG A;  2CVK A;  3GUS A;  4MF7 A;  2VO4 A;  4PGT A;  1Z7P A;  3P2A A;  4GCI A;  4X1U A;  5IQY A;  3G9B A;  2A4V A;  1A23 A;  1GNW A;  2LTK A;  3GSS A;  2WW1 A;  4K5S A;  3TJK A;  3KIJ A;  4HQZ A;  2DJ3 A;  4YKG A;  2E7P A;  2GZP A;  3CSH A;  2ES7 A;  1B9X C;  3CMI A;  4BWQ A;  4GQF A;  5ECN B;  2O7K A;  3CRT A;  3M8N A;  1TRU A;  3E0U A;  4L0U A;  2QGV A;  1XWC A;  2M46 A;  3ME7 A;  1PX6 A;  2CA8 A;  2E2M A;  3EPT A;  4KA0 A;  2H75 A;  3AY8 A;  3ZFL A;  1XFL A;  4EKZ A;  4XIH A;  1WOU A;  2OE3 A;  4PX1 A;  2YV7 A;  3KP8 A;  5A5H A;  1NM3 A;  4CDO A;  1WP0 A;  3ZML A;  1B9Y C;  2E2G A;  2H1B A;  3PH9 A;  3ERF A;  2QA1 A;  2L4Q A;  4N11 A;  1DE2 A;  4MA9 A;  4WR5 A;  1TJD A;  3DYR A;  5DVB A;  2HSN A;  3A2V A;  1ABA A;  4L5L A;  3LYP A;  1YZX A;  4ZBB A;  4HJ2 A;  2EFE A;  1AW9 A;  1Z3E A;  2PVO C;  5GSS A;  2MMO A;  5A5H B;  2DSA A;  4IJ3 A;  1M0U A;  3C1R A;  1VF3 A;  1R7H A;  1ILO A;  5HFI A;  2WZ9 A;  3I69 A;  2HT9 A;  3CRU A;  3HDC A;  4X43 A;  4PI2 C;  2R0P A;  3TOT A;  1ERU A;  2LV3 A;  4K2D A;  1XZO A;  1BJX A;  1V2A A;  5DAL B;  4KF9 A;  2HSN B;  1U3A A;  2L5O A;  1X5C A;  5KN0 A;  2KLX A;  3UJ1 A;  5ELG A;  2FNO A;  1C72 A;  1JZD A;  4K7O A;  3LYK A;  1PRX A;  3QCP A;  3EMX A;  2PUK C;  3QD9 A;  3KD0 A;  3CXG A;  2IME A;  4JR6 A;  3IR4 A;  2XBI A;  4O92 A;  1GSF A;  2IMK A;  3WGE A;  2JZR A;  2G2Q A;  3QOU A;  2OT3 A;  2GZY A;  3BOA A;  1UVZ A;  4LL1 B;  2AV4 A;  3GX8 A;  3KTB A;  1TKD B;  4PNF A;  1AAZ A;  3IV4 A;  2EIR A;  3DKS A;  4EXJ A;  3GA4 A;  4NXI A;  2CQ9 A;  2I4A A;  4OD7 A;  2V1M A;  3UEM A;  3M1G A;  5F05 A;  2K8S A;  2NTO A;  4ZIL A;  4CY8 A;  1X9W B;  3FMW A;  4J56 E;  3GL3 A;  1V9W A;  3QPM A;  2CZ2 A;  4GSN A;  1OKT A;  1XW5 A;  2VM1 A;  3LJR A;  3VFI A;  3BD2 A;  1XWG A;  3GKM A;  3F4R A;  4ZXG A;  2O3E A;  1FVK A;  5G2Z A;  3O6T A;  2VCQ A;  3VPT A;  4K2X A;  4XHM A;  3WGD A;  4OO5 A;  3DML A;  2V6K A;  4IQA A;  1F3A A;  1AIU A;  2AHE A;  3FHK A;  3N9J A;  4HQS A;  1F2E A;  3P7X A;  4TR1 B;  1JLW A;  1YEP A;  1BYE A;  2R3X A;  2DJ0 A;  3ZVJ A;  3RAZ A;  2GT5 A;  2WRT A;  3QDN A;  4IBP A;  2RUE A;  4EVM A;  3UOM A;  4E8E A;  1M3I A;  4GST A;  4RQX A;  2B3S A;  2C3N A;  4Q5R A;  1GUL A;  3DIE A;  3TKQ A;  4NMU A;  1A8L A;  3GIX A;  1SKR B;  1JFU A;  3APS A;  2WGR A;  2LS5 A;  2DIY A;  4WET A;  1B4Q A;  3C73 A;  1GLP A;  3LEF A;  4JU5 A;  2C3T A;  4KDX A;  4HEA 2;  3MIX A;  2KHP A;  3HHV A;  2XPE A;  2YWI A;  3HMJ G;  2DMM A;  2IWT A;  2VCZ A;  4QL9 A;  4NPB A;  1HNC A;  4KUN A;  4ACS A;  4GLT A;  2K18 A;  3M9K A;  1KBN A;  2B1L A;  1MD4 A;  3CBU A;  4HOJ A;  4GSS A;  3D4M A;  2M80 A;  1PA3 A;  2PGT A;  2B5E A;  3VPQ A;  4KX4 A;  1T1V A;  3MNG A;  2JU5 A;  2VUP A;  5DJM A;  2K9F A;  1ERV A;  2TRX A;  5KN1 A;  4BVX A;  4O5Q A;  4RUV A;  3RPN A;  1ZL9 A;  1YEW C;  2FY6 A;  4LA1 A;  2FHE A;  3IA1 A;  1K3O A;  5AGY A;  2YJ7 A;  3MSZ A;  5J4V A;  3RDW A;  5GAN D;  1OYJ A;  2B7K A;  1XXU A;  1DBY A;  3ZYW A;  3VK9 A;  1K0O A;  3D4T A;  4PQH A;  4N10 A;  3GTU A;  2CZ3 A;  3TGZ A;  1GTA A;  1GTB A;  4K0N A;  1K3Y A;  1AC1 A;  5IIZ A;  5KN2 A;  2FWE A;  5GST A;  1JZR A;  2JSZ A;  5D9T A;  4MMM A;  4AGS A;  1XPV A;  4HUA A;  2DIZ A;  1W4V A;  2IMD A;  3TRP A;  1HD2 A;  3GTU B;  2R2J A;  2A4H A;  3IE3 A;  2H71 A;  2WCI A;  2FD3 A;  4DSR A;  1OE7 A;  4D73 B;  3D22 A;  2HRF A;  4BA7 A;  4NV2 A;  1Z7R A;  4BVY B;  3TB2 A;  1XG8 A;  2TRC P;  3TJF A;  3KMN A;  1SVM A;  2D2Z A;  5F8B A;  4ZB8 A;  19GS A;  1QMV A;  1DSB A;  2YWM A;  1TRW A;  1PL1 A;  2ALB A;  1O8W A;  3QR6 A;  11GS A;  3HVX A;  22GS A;  4POK A;  3KXO A;  1ZYE A;  2F3M A;  3P90 A;  5E59 A;  2LEG A;  5BMU A;  1EV9 A;  1JHB A;  2YOI A;  2PMT A;  4N0V A;  3FW2 A;  1H4O A;  3EE2 A;  1K3L A;  2RUF A;  1R4W A;  3BCK A;  2OBI A;  2LQQ A;  4YQU A;  2C0D A;  4NWY A;  3I9V 2;  3A5W A;  2C4J A;  1JLV A;  3KZQ A;  4XS4 B;  2X8G A;  2PBJ A;  1S4B P;  3U5R E;  3IK9 A;  3R2Q A;  5G5E A;  5BMU B;  3G7Y A;  4PUF C;  3IHQ A;  5KOW A;  4MZC A;  1K0C A;  3KEB A;  2IMI A;  2F8A A;  2H0I A;  2HFD A;  4JRR A;  2HSM A;  1XIY A;  1SVL A;  1SL1 B;  1GUH A;  1ZZY A;  2CT6 A;  1WJK A;  3O3T A;  5A4V A;  1I9D A;  3TKS A;  4K9Z A;  1S3C A;  2H0G A;  4IJI A;  2H66 A;  4TRX A;  1M2B A;  2AJQ B;  2DJK A;  3F3Q A;  1TU7 A;  3IOS A;  3PIN A;  4KDU A;  5J5N A;  2VM2 A;  1CQG A;  3F63 A;  3ZRE A;  3DWV A;  4AJ6 A;  4PQI A;  4ULX A;  4WF5 A;  2HXK A;  3HYP A;  2RM5 A;  4EO3 A;  3Q74 A;  18GS A;  1O85 A;  1GP1 A;  1XVQ A;  1YDK A;  1U6T A;  1VGL A;  3Q19 A;  2B5Y A;  3UVT A;  1GSY A;  1G7O A;  3QAW A;  1J9B A;  3H93 A;  4ZB6 A;  2OAC A;  1URM A;  2E0Q A;  1YVL A;  3CSI A;  1GWC A;  3APQ A;  3GYK A;  4NV5 A;  1ERT A;  4HZ2 A;  2HZE A;  4K8M A;  4POB A;  3HCZ A;  8GSS A;  4YAV A;  1T4Z A;  1A2M A;  5ENU A;  1YJ6 A;  3FR3 A;  1SD8 A;  3QFB C;  3QFA C;  2H1G A;  5A34 B;  3CHX C;  1ZGN A;  1OC8 A;  1KTE A;  3FKF A;  1GH2 A;  1FVJ A;  2VL9 A;  4N30 A;  1XWA A;  2P0G A;  4KW6 A;  1AQX A;  4OMV A;  1B48 A;  3Q18 A;  5CRH A;  2VOC A;  3C1S A;  1Z5Y E;  1WPI A;  1ZOF A;  3JCM L;  4ZBA A;  2KOK A;  2LUS A;  5AIS A;  3A5I A;  4RI7 A;  1Y6E A;  4X4J A;  3F3R A;  2RLI A;  2ZNM A;  2YCD A;  1TRS A;  4AKI A;  2HRA A;  1M2D A;  2O36 A;  2WVX A;  3IXR A;  5KOX A;  4IVF A;  1XVW A;  1GL8 A;  13GS A;  1NHO A;  1S3A A;  3RBT A;  4TVE A;  1MEK A;  4ILF A;  1BAY A;  1GSS A;  2GSR A;  1XCC A;  2EFD A;  4ZB9 A;  4POM A;  5A4U A;  1HYU A;  1GNE A;  1QGV A;  1GSQ A;  5JCW A;  4PTS A;  1PN9 A;  3H8Q A;  4IP6 A;  1XOA A;  3KH9 A;  1SKS B;  3FEU A;  3KM6 A;  5EVO A;  5J4Y A;  2IFQ A;  3TU3 B;  2H0H A;  3EUR A;  2I1U A;  4F0B A;  5J47 A;  4O7H A;  1WE0 A;  5A5K A;  4WBR D;  2DJ1 A;  4ML1 A;  3A3T A;  1BG5 A;  2H01 A;  2PU9 C;  2J23 A;  1G6W A;  5KN3 A;  2JAD A;  3BBY A;  2OE1 A;  2HQT A;  4IKH A;  5JCG A;  4Z2R A;  4PI0 C;  1MDK A;  5GZZ B;  4MH3 A;  3F8U A;  2HZF A;  2IFQ B;  1HNA A;  4L8E A;  4EL1 A;  2DLX A;  3TKP A;  4I2U A;  1SJI A;  4IW9 A;  1K0A A;  1XWK A;  4TR3 A;  4EIP A;  3FRC A;  3CYN A;  1PKW A;  4HI7 A;  4QMK A;  1U88 A;  3WD6 A;  1EZK A;  5HFK A;  1Z9H A;  1O7U A;  4JZQ A;  3L78 A;  4GXZ A;  2GS3 A;  3FZ9 A;  4F82 A; 
#chains in the Genus database with same CATH homology
 5DDL A;  4LLR A;  1AXD A;  3MAK A;  2EIO A;  2JZT A;  1SK0 A;  1JZW A;  1FB6 A;  5HR2 A;  2BMX A;  1NSW A;  1GSD A;  1THO A;  2AB6 A;  2FWF A;  5C04 A;  1T3B A;  3U6V A;  2IPA A;  3LXZ A;  2GVP A;  2WJU A;  4MJA A;  1O73 A;  1V98 A;  2GDR A;  2OKA A;  2H1A A;  4XS1 A;  3TJB A;  4ECC A;  2EC4 A;  4O32 A;  1JZO A;  1SL0 B;  3DGQ A;  1X9M B;  2R0C A;  3FR6 A;  4ZBD A;  2C0F A;  4FH8 A;  4MCU A;  4IN0 A;  2F9S A;  3KCM A;  1NW2 A;  1TXX A;  3A2X A;  2LKU A;  5ABR A;  3J7Y k;  1EGO A;  2MMZ A;  1UA5 A;  1X5E A;  5D9X A;  1ZCP A;  4POL A;  2B1K A;  4EDY A;  1KNG A;  1X0R A;  2LRC A;  2BJX A;  4E8H A;  1TXU A;  4IHU A;  2X4A A;  3TKS E;  2YWO A;  4N3Z A;  2CX4 A;  4JBB A;  1PN0 A;  3ZIV A;  2V2G A;  4BWS A;  7GSS A;  3WGX A;  2F8F A;  4HU9 A;  1M2A A;  5HR0 A;  3QAV A;  5G31 A;  4GDF A;  3Q6O A;  3N5O A;  3H79 A;  3UAR A;  1A0R P;  2FA4 A;  2HYX A;  3D6I A;  4ECB A;  4G19 A;  2OA7 A;  4HDE A;  3RHB A;  1K0B A;  4G2E A;  3UIW A;  4G0L A;  4G01 A;  4LMW A;  1EOG A;  2NDO A;  1OAZ A;  3FZ4 A;  1QFN A;  2UZ8 A;  4EF0 A;  1H75 A;  2FWH A;  2XC2 A;  4ECI A;  2O89 A;  4CHS A;  4LMV A;  4NHW A;  4KB3 A;  2FLS A;  2HI7 A;  3MDK A;  3IC4 A;  1TK0 B;  3GHA A;  3KMO A;  5B8A A;  2MYG A;  2XPD A;  1ZYQ B;  1ZMA A;  1U3I A;  4NHZ A;  2NPB A;  2HSY A;  2PER A;  3LG6 A;  4JR4 A;  1YF1 A;  1YKC A;  5CO3 A;  1TOF A;  2P5Q A;  1R5A A;  4Q5F A;  5ID2 A;  2LST A;  3ISO A;  1RW1 A;  3KH7 A;  5J41 A;  4KSO A;  2DML A;  3GST A;  4DSS A;  3EIN A;  5H5R A;  1Z6M A;  5L71 A;  1VF4 A;  1PKZ A;  2YWN A;  4JE1 A;  3NIV A;  2ZCT A;  2HSH A;  5IM9 A;  2VL3 A;  2C8U A;  3PR8 A;  4EE0 A;  4ID0 A;  4MK3 A;  1A8Y A;  2WUL A;  5B6M A;  2HE3 A;  4DSS B;  2HNL A;  4NAX A;  1BQ7 A;  4ZIJ A;  4MJC A;  4OCE A;  2H73 A;  5IMD A;  2LNT A;  2H70 A;  1WRY A;  5AIV A;  1V58 A;  3L4N A;  1M9A A;  3V1W A;  4MJB A;  2DKI A;  5CRG A;  1X9S B;  4TR4 A;  2MBS A;  2K6V A;  2OAD A;  1QXH A;  2JAC A;  4PUA A;  1QUW A;  1PD2 1;  5FHI A;  6GSS A;  3FZA A;  3LOR A;  3F6F A;  3W8J A;  1TTZ A;  3DVW A;  1GRX A;  4BVX B;  4KAE A;  3VWU A;  6GSW A;  3L0H A;  1PMT A;  4WXT A;  3ERG A;  4XTS A;  3NZN A;  3EYT A;  5JCU A;  2DJJ A;  4WEY A;  4MP4 A;  5J40 A;  5HR1 A;  3HXS A;  1A24 A;  3ZMK A;  4N0Z A;  1YF0 A;  4K6X A;  2C0G A;  2H74 A;  2NVL A;  3UBL A;  1EEJ A;  5HFG A;  1SK2 A;  1K0D A;  5FWG A;  4YAP A;  2N5B A;  1I5G A;  4TKY A;  4IP1 A;  1O6J A;  1F3B A;  2X49 A;  3UMA A;  3DEX A;  4FO5 A;  2VCV A;  1PX7 A;  5AIX A;  1F9M A;  1MDI A;  1SJ6 A;  5A1N A;  1E2Y A;  1SYR A;  3RPP A;  2WS2 A;  2LRN A;  2R0G A;  2DJ2 A;  1LBK A;  2PVQ A;  1FOV A;  4H86 A;  3C71 A;  5CRE A;  4F03 A;  1V40 A;  2JSY A;  1LJR A;  1A2L A;  5ECH B;  5DAK A;  2MZC A;  2UV8 G;  1ACV A;  1WMJ A;  3F4T A;  2VD0 A;  2VLT A;  4J57 E;  3KGK A;  2FUG 2;  5A1N B;  2VLV A;  2TIR A;  3UAP A;  2N5A A;  1T00 A;  4YKF A;  5DQY A;  2JZS A;  1GUM A;  3M9J A;  1SJZ A;  3I43 A;  3HZ4 A;  2QKE A;  4IQ1 A;  3ZRD A;  1NHY A;  1PQN A;  3D21 A;  4Z2U A;  4IEL A;  2C80 A;  5DAK B;  2LNS A;  4Q5N A;  1Y25 A;  2CV4 A;  4P3Y B;  4KCA A;  5IPG A;  4K7I A;  2AUV A;  5J3R A;  4OWY A;  3GKN A;  1N25 A;  4CW9 A;  2HSM B;  4G0K A;  1Q4J A;  4MDC A;  1HNB A;  4TR0 A;  1O8X A;  5IMV A;  2B6M A;  1O81 A;  5F07 A;  2EIQ A;  4TXV A;  1FG4 A;  4K5R A;  4GRF A;  1ZYN A;  4FYU A;  1J08 A;  3PPU A;  2H76 A;  2IIY A;  5DJL A;  2P31 A;  2GTU A;  1SD9 A;  3TJG A;  5JWO B;  2YAN A;  16GS A;  1EP7 A;  4V1A g;  1PL2 A;  1BF5 A;  2YP6 A;  1XW9 A;  5HQP A;  2GSS A;  3ED3 A;  3J7Y b;  1T8E B;  3F0I A;  3O76 A;  4GWR A;  4F2I A;  3GKX A;  3ME8 A;  4MAB A;  4Z7X A;  3HVS A;  3ZFB A;  1DE1 A;  2BTO T;  2DKH A;  3QMX A;  2X8H A;  4PXO A;  2H1L A;  5B7C A;  5D93 A;  2HZE B;  2H72 A;  5GAP D;  4L5O A;  2LJA A;  2HRK A;  1USB A;  3GV1 A;  6GSV A;  2JL4 A;  4KDY A;  2L6C A;  3I6A A;  3KTL A;  5LNK e;  3EU3 A;  1OC9 A;  3DRN A;  5IO2 A;  2AYT A;  3GUR A;  2WDU A;  2OBK A;  1TI3 A;  2WFC A;  2I9H A;  1GTU A;  3HA9 A;  1V57 A;  2H30 A;  1KEB A;  2YZU A;  3L9S A;  1R5P A;  4J2F A;  2MMN A;  2HRK B;  2RII A;  2G0F A;  2R6K A;  4I8B A;  1G0T A;  1IYI A;  3KP9 A;  3CTF A;  2A2P A;  5D96 A;  1TU8 A;  4KE3 A;  4WF4 A;  3HZ8 A;  1OC9 B;  2X8C A;  3F4S A;  4DVC A;  3UBK A;  4ZL8 A;  3IAM 2;  4GQC A;  5EL8 A;  1B8X A;  1G6Y A;  2CVD A;  2XBQ A;  2H6Z A;  1XOB A;  2VCW A;  4AKG A;  4OFT A;  4WR4 A;  4KND A;  1M99 A;  2VLU A;  2IMF A;  3FYG A;  4ISD A;  5CYY A;  4L0W A;  3RHC A;  5IMC A;  3CSJ A;  1HQO A;  6GSU A;  3HJO A;  2O5V A;  3IBH A;  3LFL A;  1TK5 B;  1Z6N A;  4ZL9 A;  3GX0 A;  3M3M A;  5ECM B;  3LW9 A;  2FGX A;  4TOP A;  2GQM A;  1FO5 A;  5DCG A;  3HJM A;  2VL2 C;  4HJM A;  3EC3 A;  2REM A;  1SYX A;  1AQW A;  3TRX A;  1EEM A;  1OVN A;  5HR3 A;  5IMA A;  2B7J A;  3IRA A;  2GZZ A;  3K8N A;  1K0N A;  3OR5 A;  2PPT A;  5LD0 A;  2N5F A;  4XCS A;  5DAL A;  3D5J A;  2VCX A;  4I2T A;  3APO A;  3D0Z A;  2H6X A;  2WB9 A;  1OC3 A;  2PN8 A;  3LGC A;  1TK8 B;  1N8J A;  1AQV A;  2H6Y A;  4KCE A;  2K8V A;  5EPF A;  4LL4 B;  5IO0 A;  4A5P A;  1VRS D;  3TJJ A;  5FT3 A;  1XWB A;  3TKS C;  4W66 A;  1Q98 A;  1RQM A;  3FZ5 A;  5D8I A;  1ST9 A;  4HZ4 A;  2FWG A;  4I6X A;  4JED A;  3TUE A;  1SEN A;  1QK8 A;  3KJY A;  1M7T A;  3DXB A;  1PSQ A;  5LCZ A;  3H1N A;  4E68 A;  4OCF A;  1BED A;  2KP2 A;  4O5U A;  4PQ1 A;  2VD1 A;  4V2M A;  5CRD A;  3W6G A;  5IMZ A;  3HVV A;  2I81 A;  6GSY A;  4IGJ A;  4K1F A;  2R37 A;  4ML6 A;  1RK4 A;  5E4W A;  1T7P B;  4OFN A;  2A2R A;  1LU4 A;  2QC7 A;  2IN3 A;  5C00 A;  2A2S A;  3LWA A;  2EFH A;  4CY6 A;  2C1Y A;  3GKK A;  3E9J B;  5ECP B;  1UN2 A;  1SL2 B;  2L59 A;  5ECS A;  2L5L A;  5JWR B;  4IS0 A;  5IMF A;  1THX A;  4TR1 A;  5J9B A;  2M72 A;  4AJ7 A;  2GT6 A;  4MZW A;  2GLR A;  1FB0 A;  4MLY A;  2O87 A;  10GS A;  4DSQ A;  2L4C A;  1SU9 A;  3HD5 A;  2CAQ A;  5G1K A;  2GQL A;  5H5Q A;  4MJE A;  1CQH A;  2AAW A;  1EWX A;  1R26 A;  4PNG A;  1YQ1 A;  3W8S A;  17GS A;  1PGT A;  3L9V A;  3BCI A;  1TP9 A;  4K0G A;  3EU4 A;  4MF6 A;  5CP1 A;  1EV4 A;  4HU7 A;  1EP8 A;  3L9U A;  4YH2 A;  1GTI A;  5DCH A;  5ECR B;  5B8B A;  5ELA A;  4G10 A;  4I97 A;  4EDZ A;  3VWW A;  2ON7 A;  4AI6 A;  5D9V A;  5H5S A;  3G7I A;  1QQ2 A;  1AUC A;  2RM6 A;  1S3D A;  1TDI A;  4OFM A;  2MMA A;  4G0I A;  1YY7 A;  3TOU A;  1U87 A;  5ECO B;  4QQ7 A;  3HKR A;  3DD3 A;  1MD3 A;  2O85 A;  2IJY A;  1ERW A;  5AN1 A;  5IOX A;  2YNX A;  5ID2 B;  2PWJ A;  1F6M C;  3ZLP A;  2L57 A;  12GS A;  1XW6 A;  3BJ5 A;  5ECI B;  2LJK A;  4TW5 A;  4EIQ A;  1VF1 A;  5DQS A;  1F37 A;  3ERW A;  3ZIT A;  5ECK B;  1ON4 A;  4PUR A;  2H8L A;  5EY6 A;  3EVI A;  1YKA A;  1N2A A;  1G7E A;  2X99 A;  5COH A;  2F51 A;  3CTG A;  2R5G A;  2YN1 A;  3IPZ A;  3VUR A;  2GSQ A;  4YQV A;  3VWV A;  3VWX A;  6GSX A;  1DUG A;  5ECQ B;  2V32 A;  2LJR A;  1K0M A;  4KH7 A;  4OO4 A;  4TXO A;  5INY A;  1SK1 A;  5G1L A;  3E3E A;  3IK7 A;  3EWL A;  4KSM A;  4F0C A;  2J9H A;  3GL5 A;  2YPM A;  5CNW A;  3EMP A;  3FK8 A;  3TDG A;  3IAS 2;  1XBS A;  2X64 A;  1UC7 A;  5B6N A;  3VI7 A;  5IOW A;  2Z9S A;  1FW1 A;  4D73 A;  6GST A;  2NBS A;  4WBJ A;  1WWJ A;  4F9Z A;  3R3E A;  2MBT A;  3WT1 A;  5ECL B;  4K7N A;  2ZUP A;  4BVY A;  4TXO B;  3LSZ A;  4ZB7 A;  2L6D A;  4ICY A;  4XS6 A;  4AJ8 A;  3TKR A;  3TRQ A;  1SVO A;  4MPG A;  4DEJ A;  3PGT A;  4MZB A;  5CRW A;  14GS A;  4MNN A;  2ON5 A;  4YQM A;  2YZH A;  4O5R A;  3F9U A;  2GQK A;  2FA8 A;  1MTC A;  3GH9 A;  5D9W A;  1A2J A;  20GS A;  3WT2 A;  4XS4 A;  4GF0 A;  3GRX A;  2KP1 A;  3WYW A;  4XRD A;  1GSE A;  4G9H A;  2YV9 A;  2IL3 A;  1GSU A;  5BRT A;  1T4Y A;  3GH6 A;  1FAA A;  5KEJ A;  5F06 A;  3MWH A;  2V41 A;  3ZL5 A;  2VCT A;  3G7J A;  2O8V B;  3M0F A;  2H19 A;  4FYB A;  3TCO A;  3IC8 A;  2HLS A;  4GTU A;  1W89 A;  5CAX A;  5J9C A;  3CWG A;  3FY7 A;  4ZL7 A;  1VF2 A;  4V1A p;  2LQO A;  4ECJ A;  4Z2T A;  1ML6 A;  4V2N A;  2VL2 A;  2FCH A;  2H1D A;  3GMF A;  4BPY A;  3GN3 A;  2YJH A;  3DVX A;  3HJP A;  2KUC A;  4QL7 A;  2DBC A;  1X5D A;  4TN8 A;  1M9B A;  5IPH A;  3IDV A;  2CAI A;  1FHE A;  1OE8 A;  4FYC A;  4HS1 A;  3ZTL A;  3S9F A;  5D73 A;  4AKX B;  3P8W A;  3FR9 A;  4AKH A;  1J0F A;  3SBC A;  2B5X A;  5F0G A;  2C3Q A;  4Q5Q A;  1MDJ A;  3ZZX A;  3VLN A;  3GFK A;  2EFC A;  2CX3 A;  3US3 A;  2DC5 A;  4USS A;  2VKZ G;  4AF2 A;  2R4V A;  4FQU A;  2XHF A;  1ZYP A;  1B4P A;  3LQ7 A;  2QSI A;  1GLQ A;  4FIW A;  4MF5 A;  4EC0 A;  4X0X A;  2HRN A;  3LXT A;  4I5Q A;  1BG1 A;  2OJL A;  4BL7 A;  5DBQ A;  3ZVJ D;  1OKD A;  4EUY A;  2P5R A;  3UL3 A;  1WIK A;  1TRV A;  3SWL A;  1E6B A;  2VIM A;  1EOH A;  5A34 A;  2OE0 A;  5G5F A;  1IYH A;  4WKW A;  3A2W A;  1BX9 A;  3F6D A;  4RQR A;  1FOH A;  1SKW B;  3VI5 A;  4BL7 B;  1TI1 A;  3H4K A;  4MPF A;  1EGR A;  4V2L A;  3QAG A;  2QA2 A;  5A4W A;  4RI6 A;  3HY2 A;  5JWQ B;  1A0F A;  3MYD A;  2C0E A;  5G30 A;  3GNJ A;  3ZIJ A;  3UVH A;  1TW9 A;  2CVB A;  3NOF A;  2LRT A;  4KGI A;  1YEX A;  5J4U A;  2V6O A;  1Y1U A;  2VAF A;  2GGT A;  1GUK A;  9GSS A;  3C8E A;  4MH2 A;  4XRA A;  2GST A;  2I3Y A;  3C7M A;  3IHG A;  2CVK A;  3GUS A;  4MF7 A;  2VO4 A;  4PGT A;  1Z7P A;  3P2A A;  4GCI A;  4X1U A;  5IQY A;  3G9B A;  2A4V A;  1A23 A;  1GNW A;  2LTK A;  3GSS A;  4K5S A;  3TJK A;  3KIJ A;  4HQZ A;  2DJ3 A;  4YKG A;  2E7P A;  2GZP A;  3CSH A;  2ES7 A;  1B9X C;  3CMI A;  4BWQ A;  4GQF A;  5ECN B;  2O7K A;  3CRT A;  3M8N A;  1TRU A;  3E0U A;  4L0U A;  2QGV A;  1XWC A;  2M46 A;  3ME7 A;  1PX6 A;  2CA8 A;  2E2M A;  3EPT A;  4KA0 A;  2H75 A;  3AY8 A;  3ZFL A;  1XFL A;  4EKZ A;  4XIH A;  1WOU A;  2OE3 A;  4PX1 A;  2YV7 A;  3KP8 A;  5A5H A;  1NM3 A;  4CDO A;  1WP0 A;  3ZML A;  1B9Y C;  2E2G A;  2H1B A;  3PH9 A;  3ERF A;  2QA1 A;  2L4Q A;  4N11 A;  1DE2 A;  4MA9 A;  4WR5 A;  1TJD A;  3DYR A;  5DVB A;  2HSN A;  3A2V A;  1ABA A;  4L5L A;  3LYP A;  1YZX A;  4ZBB A;  4HJ2 A;  2EFE A;  1AW9 A;  1Z3E A;  2PVO C;  5GSS A;  2MMO A;  5A5H B;  2DSA A;  4IJ3 A;  1M0U A;  3C1R A;  1VF3 A;  1R7H A;  1ILO A;  5HFI A;  2WZ9 A;  3I69 A;  2HT9 A;  3CRU A;  3HDC A;  4X43 A;  2R0P A;  3TOT A;  1ERU A;  2LV3 A;  4K2D A;  1XZO A;  1BJX A;  1V2A A;  5DAL B;  4KF9 A;  2HSN B;  1U3A A;  2L5O A;  1X5C A;  5KN0 A;  2KLX A;  3UJ1 A;  5ELG A;  2FNO A;  1C72 A;  1JZD A;  4K7O A;  3LYK A;  1PRX A;  3QCP A;  3EMX A;  2PUK C;  3QD9 A;  3KD0 A;  3CXG A;  2IME A;  4JR6 A;  3IR4 A;  2XBI A;  4O92 A;  1GSF A;  2IMK A;  3WGE A;  2JZR A;  2G2Q A;  3QOU A;  2OT3 A;  2GZY A;  3BOA A;  1UVZ A;  4LL1 B;  2AV4 A;  3GX8 A;  3KTB A;  1TKD B;  4PNF A;  1AAZ A;  3IV4 A;  2EIR A;  3DKS A;  4EXJ A;  3GA4 A;  4NXI A;  2CQ9 A;  2I4A A;  4OD7 A;  2V1M A;  3UEM A;  3M1G A;  5F05 A;  2K8S A;  2NTO A;  4ZIL A;  4CY8 A;  1X9W B;  3FMW A;  4J56 E;  3GL3 A;  1V9W A;  3QPM A;  2CZ2 A;  4GSN A;  1OKT A;  1XW5 A;  2VM1 A;  3LJR A;  3VFI A;  3BD2 A;  1XWG A;  3GKM A;  3F4R A;  4ZXG A;  1FVK A;  5G2Z A;  3O6T A;  2VCQ A;  3VPT A;  4K2X A;  4XHM A;  3WGD A;  4OO5 A;  3DML A;  2V6K A;  4IQA A;  1F3A A;  1AIU A;  2AHE A;  3FHK A;  3N9J A;  4HQS A;  1F2E A;  3P7X A;  4TR1 B;  1JLW A;  1YEP A;  1BYE A;  2R3X A;  2DJ0 A;  3ZVJ A;  3RAZ A;  2GT5 A;  2WRT A;  3QDN A;  4IBP A;  2RUE A;  4EVM A;  3UOM A;  4E8E A;  4GST A;  4RQX A;  2B3S A;  2C3N A;  4Q5R A;  1GUL A;  3DIE A;  3TKQ A;  4NMU A;  1A8L A;  3GIX A;  1SKR B;  1JFU A;  3APS A;  2WGR A;  2LS5 A;  2DIY A;  4WET A;  1B4Q A;  3C73 A;  1GLP A;  3LEF A;  4JU5 A;  2C3T A;  4KDX A;  4HEA 2;  3MIX A;  2KHP A;  3HHV A;  2XPE A;  2YWI A;  3HMJ G;  2DMM A;  2IWT A;  2VCZ A;  4QL9 A;  4NPB A;  1HNC A;  4KUN A;  4ACS A;  4GLT A;  2K18 A;  3M9K A;  1KBN A;  2B1L A;  1MD4 A;  3CBU A;  4HOJ A;  4GSS A;  3D4M A;  2M80 A;  1PA3 A;  2PGT A;  2B5E A;  3VPQ A;  4KX4 A;  1T1V A;  3MNG A;  2JU5 A;  2VUP A;  5DJM A;  2K9F A;  1ERV A;  2TRX A;  5KN1 A;  4BVX A;  4O5Q A;  4RUV A;  3RPN A;  1ZL9 A;  2FY6 A;  4LA1 A;  2FHE A;  3IA1 A;  1K3O A;  5AGY A;  2YJ7 A;  3MSZ A;  5J4V A;  3RDW A;  5GAN D;  1OYJ A;  2B7K A;  1XXU A;  1DBY A;  3ZYW A;  3VK9 A;  1K0O A;  3D4T A;  4PQH A;  4N10 A;  3GTU A;  2CZ3 A;  3TGZ A;  1GTA A;  1GTB A;  4K0N A;  1K3Y A;  1AC1 A;  5IIZ A;  5KN2 A;  2FWE A;  5GST A;  1JZR A;  2JSZ A;  5D9T A;  4MMM A;  4AGS A;  1XPV A;  4HUA A;  2DIZ A;  1W4V A;  2IMD A;  3TRP A;  1HD2 A;  3GTU B;  2R2J A;  2A4H A;  3IE3 A;  2H71 A;  2WCI A;  2FD3 A;  4DSR A;  1OE7 A;  4D73 B;  3D22 A;  2HRF A;  4BA7 A;  4NV2 A;  1Z7R A;  4BVY B;  3TB2 A;  2TRC P;  3TJF A;  3KMN A;  1SVM A;  2D2Z A;  5F8B A;  4ZB8 A;  19GS A;  1QMV A;  1DSB A;  2YWM A;  1TRW A;  1PL1 A;  2ALB A;  1O8W A;  3QR6 A;  11GS A;  3HVX A;  22GS A;  4POK A;  3KXO A;  1ZYE A;  2F3M A;  3P90 A;  5E59 A;  2LEG A;  5BMU A;  1EV9 A;  1JHB A;  2YOI A;  2PMT A;  4N0V A;  3FW2 A;  1H4O A;  3EE2 A;  1K3L A;  2RUF A;  1R4W A;  3BCK A;  2OBI A;  2LQQ A;  4YQU A;  2C0D A;  4NWY A;  3I9V 2;  3A5W A;  2C4J A;  1JLV A;  3KZQ A;  4XS4 B;  2X8G A;  2PBJ A;  3U5R E;  3IK9 A;  3R2Q A;  5G5E A;  5BMU B;  3G7Y A;  4PUF C;  3IHQ A;  5KOW A;  4MZC A;  1K0C A;  3KEB A;  2IMI A;  2F8A A;  2H0I A;  2HFD A;  4JRR A;  2HSM A;  1XIY A;  1SVL A;  1SL1 B;  1GUH A;  1ZZY A;  2CT6 A;  1WJK A;  3O3T A;  5A4V A;  1I9D A;  3TKS A;  4K9Z A;  1S3C A;  2H0G A;  4IJI A;  2H66 A;  4TRX A;  1M2B A;  2AJQ B;  2DJK A;  3F3Q A;  1TU7 A;  3IOS A;  3PIN A;  4KDU A;  5J5N A;  2VM2 A;  1CQG A;  3F63 A;  3ZRE A;  3DWV A;  4AJ6 A;  4PQI A;  4ULX A;  4WF5 A;  2HXK A;  3HYP A;  2RM5 A;  4EO3 A;  3Q74 A;  18GS A;  1O85 A;  1GP1 A;  1XVQ A;  1YDK A;  1U6T A;  1VGL A;  3Q19 A;  2B5Y A;  3UVT A;  1GSY A;  1G7O A;  3QAW A;  1J9B A;  3H93 A;  4ZB6 A;  2OAC A;  1URM A;  2E0Q A;  1YVL A;  3CSI A;  1GWC A;  3APQ A;  3GYK A;  4NV5 A;  1ERT A;  4HZ2 A;  2HZE A;  4K8M A;  4POB A;  3HCZ A;  8GSS A;  4YAV A;  1T4Z A;  1A2M A;  5ENU A;  1YJ6 A;  3FR3 A;  1SD8 A;  3QFB C;  3QFA C;  2H1G A;  5A34 B;  1ZGN A;  1OC8 A;  1KTE A;  3FKF A;  1GH2 A;  1FVJ A;  2VL9 A;  4N30 A;  1XWA A;  2P0G A;  4KW6 A;  1AQX A;  4OMV A;  1B48 A;  3Q18 A;  5CRH A;  2VOC A;  3C1S A;  1Z5Y E;  1WPI A;  1ZOF A;  3JCM L;  4ZBA A;  2KOK A;  2LUS A;  5AIS A;  3A5I A;  4RI7 A;  1Y6E A;  4X4J A;  3F3R A;  2RLI A;  2ZNM A;  2YCD A;  1TRS A;  4AKI A;  2HRA A;  1M2D A;  3IXR A;  5KOX A;  4IVF A;  1XVW A;  1GL8 A;  13GS A;  1NHO A;  1S3A A;  3RBT A;  4TVE A;  1MEK A;  4ILF A;  1BAY A;  1GSS A;  2GSR A;  1XCC A;  2EFD A;  4ZB9 A;  4POM A;  5A4U A;  1HYU A;  1GNE A;  1QGV A;  1GSQ A;  5JCW A;  4PTS A;  1PN9 A;  3H8Q A;  4IP6 A;  1XOA A;  3KH9 A;  1SKS B;  3FEU A;  3KM6 A;  5EVO A;  5J4Y A;  2IFQ A;  3TU3 B;  2H0H A;  3EUR A;  2I1U A;  4F0B A;  5J47 A;  4O7H A;  1WE0 A;  5A5K A;  4WBR D;  2DJ1 A;  4ML1 A;  3A3T A;  1BG5 A;  2H01 A;  2PU9 C;  2J23 A;  1G6W A;  5KN3 A;  2JAD A;  3BBY A;  2OE1 A;  2HQT A;  4IKH A;  5JCG A;  4Z2R A;  1MDK A;  5GZZ B;  4MH3 A;  3F8U A;  2HZF A;  2IFQ B;  1HNA A;  4L8E A;  4EL1 A;  2DLX A;  3TKP A;  4I2U A;  1SJI A;  4IW9 A;  1K0A A;  1XWK A;  4TR3 A;  4EIP A;  3FRC A;  3CYN A;  1PKW A;  4HI7 A;  4QMK A;  1U88 A;  3WD6 A;  1EZK A;  5HFK A;  1Z9H A;  1O7U A;  4JZQ A;  3L78 A;  4GXZ A;  2GS3 A;  3FZ9 A;  4F82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...