4E8HA

Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
214
Chain Sequence
b'HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural of Bombyx mori glutathione transferase BmGSTD1 complex with GTT
rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 80
structure length 214
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8hA01
3LQ7A 1A2JA 2VCTA 5CREA 4HS1A 1Q98A 1TK8B 6GSSA 2QKEA 4EXJA 1M7TA 2NVLA 5IQYA 3FZ5A 4DVCA 1ZOFA 2PMTA 1K3OA 2O7KA 4K9ZA 1ZMAA 1OKTA 3LFLA 5CP1A 1AQWA 2VOCA 3IOSA 2C0DA 1QK8A 4TXVA 3J7Yb 4GXZA 4N11A 4X43A 5ECKB 1F9MA 3A3TA 5CRWA 1HYUA 1XFLA 4KF9A 3H79A 1YF0A 1YF1A 3RDWA 22GSA 1K0CA 1XWAA 4IQ1A 5F8BA 1WPIA 5J9CA 2HT9A 4F0CA 1EWXA 1PL1A 1AAZA 4ML1A 1TKDB 1XW6A 3IV4A 6GSUA 1J0FA 5D9WA 2V32A 1SD8A 2MMAA 2C3QA 2J9HA 3P90A 11GSA 1QUWA 3W8JA 2LNTA 3G7YA 3HVSA 1GRXA 1R4WA 4K0NA 1W89A 3VPTA 1KTEA 5LNKe 3UAPA 2JSZA 5E59A 3Q6OA 1UC7A 4F9ZA 6GSTA 3EU4A 4EVMA 5J4UA 3DWVA 5G1KA 4MCUA 1ERUA 3F4TA 1XWGA 4EDZA 2FA8A 1K0OA 3TKSC 1T1VA 4KCAA 5DALA 1MDJA 4NV5A 3GURA 4FQUA 1O6JA 3LORA 1AXDA 2CA8A 4PQHA 2WFCA 5GSTA 3FZ4A 4MA9A 4JBBA 4CDOA 2GSRA 4TOPA 3GX8A 1SK1A 4X0XA 3ZVJA 2JACA 4JR6A 5DALB 1GL8A 1PKWA 4MJBA 4POKA 2IMDA 3QAVA 2WRTA 2NPBA 3IK7A 3KP8A 4KW6A 4TW5A 2QSIA 3FHKA 1O7UA 1OC3A 5CRHA 3UARA 2DMLA 3VURA 4HOJA 4BWSA 4ZIJA 2VCQA 4BWQA 4ZILA 2DIZA 2PPTA 4XHMA 2YNXA 2CZ2A 2TRCP 1B9YC 4OMVA 3WYWA 2GZZA 4EO3A 4HUAA 2CAIA 2O8VB 1T3BA 5DBQA 1ABAA 2IL3A 1M2AA 1NHYA 3LWAA 2FUG2 4FYBA 2JZTA 1Z3EA 3N5OA 4RI6A 2VLTA 4RQXA 2GQKA 4MPFA 4TN8A 1SYRA 3DD3A 12GSA 3D22A 2V6OA 2AAWA 4KB3A 1CQGA 2C0FA 1Z6MA 18GSA 1XWKA 1GUKA 5JWOB 2K18A 1GSQA 5EY6A 5KN2A 4KCEA 5D73A 1V9WA 3TJGA 3LXTA 3MWHA 3F6FA 1MTCA 2RLIA 2IFQA 3WD6A 1O8WA 2L59A 3F6DA 4GSSA 2C1YA 2C80A 3E3EA 4K6XA 4POLA 3GSTA 1USBA 2GGTA 3E0UA 4GSNA 2XPDA 1K3LA 4PX1A 3EINA 3VWVA 5CAXA 5AISA 4BL7A 4G0KA 2ALBA 1Z7PA 2YV9A 1MD3A 5G31A 2H72A 2IFQB 4OCEA 3C1RA 2H75A 4TXOA 3W6GA 2PUKC 1UVZA 2H30A 3WT2A 3FEUA 4N0ZA 2H66A 1JHBA 3ZLPA 3KTLA 3UBLA 4BL7B 5EPFA 2GVPA 3TRXA 1FG4A 3KH9A 4H86A 3Q18A 1O8XA 4FIWA 1FO5A 3QR6A 2N5FA 2HLSA 3KD0A 1N8JA 1FOVA 1ZZYA 4GQCA 1SL1B 2YWNA 3HXSA 3HJMA 1YY7A 3RHBA 3IRAA 2FGXA 2RUEA 4AJ6A 4OWYA 1W4VA 4G2EA 2LRNA 3U5RE 1DE1A 2H19A 2FLSA 5F07A 2PGTA 3GSSA 17GSA 2BJXA 2KUCA 4LMVA 2VCVA 4PUAA 5D8IA 1TP9A 1PSQA 3C7MA 4KAEA 3SWLA 4WXTA 1THOA 2VLVA 3BJ5A 4MLYA 2L57A 3FZAA 3PGTA 2VIMA 3I9V2 5DAKB 1VRSD 5A4WA 2JSYA 4HZ2A 1A2MA 1OE8A 4YH2A 6GSYA 4MJEA 1A24A 1J9BA 3HKRA 4IP1A 1S3DA 1T4ZA 2G0FA 3KMNA 4WEYA 2I81A 2IN3A 2ON5A 4TRXA 3GL3A 4XS6A 3TKQA 3WGXA 2P5RA 2X64A 4BPYA 4K7OA 4FYUA 4OD7A 2FA4A 3HCZA 4HI7A 1NSWA 2VL3A 3QD9A 3UIWA 1BAYA 4X1UA 3GKMA 3IAS2 1A8LA 1DUGA 4KX4A 5ECOB 3GA4A 3ZYWA 2WB9A 3ZVJD 3M3MA 2D2ZA 1I9DA 3VK9A 3APOA 2M80A 4RUVA 2K8SA 2CZ3A 5ABRA 2LKUA 2IPAA 5DJLA 2OACA 1VF3A 4XIHA 1TI3A 1MDKA 3IHQA 3LYKA 1WJKA 4NPBA 2CVBA 1GTIA 2TIRA 5IO2A 2DJKA 3BD2A 4V2MA 2OBKA 2WS2A 1XWBA 2XPEA 3CBUA 1F3AA 4BVXB 3KZQA 2WULA 2MBSA 3ERGA 4IJIA 3UMAA 4GTUA 1WOUA 5DJMA 3ZFBA 3ZREA 4QQ7A 2H74A 3GUSA 3EYTA 1PA3A 1SD9A 4I2TA 1XBSA 1Q4JA 3D4TA 1AC1A 4ZB6A 1B8XA 5ECLB 4OFMA 2DJ2A 1QGVA 1GSYA 1SENA 3EMPA 4ULXA 4NHZA 3TOUA 3RBTA 3U6VA 5DCGA 3F0IA 2GTUA 3N9JA 2M46A 4JE1A 5ECHB 2GLRA 4NV2A 3MAKA 5J41A 2B6MA 1GLQA 4KSOA 4WR4A 1H75A 2HSNB 3IA1A 4K1FA 1GP1A 1V2AA 3H8QA 3GL5A 3H1NA 1K0DA 1Z6NA 1G7OA 3VI5A 5AIXA 4YQVA 2DMMA 1AUCA 2B1KA 4DEJA 2OE0A 3I69A 3TKPA 3IR4A 5KN3A 1FVJA 2LUSA 3D6IA 1OYJA 4CW9A 2VL2A 4J56E 2ON7A 2H1DA 1TRUA 3IE3A 1AQXA 1OAZA 1URMA 1XWCA 2GT6A 1GSDA 3I6AA 2PU9C 3UJ1A 3FKFA 1U87A 4POMA 2KLXA 2YV7A 1RW1A 1GSSA 1LBKA 2C8UA 1A0RP 5DQSA 1VF4A 2R37A 3M0FA 4PQ1A 1M2DA 3CXGA 1R5AA 3GNJA 1XCCA 3UL3A 5A4UA 3UVTA 1G0TA 4TR4A 5C00A 3QCPA 2CT6A 2XHFA 2WDUA 1WWJA 2E2MA 5AGYA 1O81A 1JZRA 4JR4A 2GT5A 4KUNA 2HSYA 4G10A 1JLVA 5ELAA 2L4QA 1DSBA 1XPVA 4QL7A 1A23A 3APQA 1HNCA 3CRTA 1THXA 1SKRB 20GSA 4EKZA 1TRVA 3TJFA 3CMIA 2HNLA 5GAPD 5INYA 5IPGA 1U3AA 1A0FA 2V1MA 1G7EA 2PVQA 1G6WA 19GSA 2YN1A 4AJ8A 3VFIA 3FYGA 2YPMA 1TU7A 2V41A 4HQSA 2AUVA 4ISDA 5CRGA 2LJRA 1ERTA 3FZ9A 2YJ7A 1MD4A 1X5CA 1M9AA 3UVHA 3HZ8A 3APSA 3ISOA 4K8MA 3FRCA 3TJBA 2HRAA 4F0BA 3ME8A 1F6MC 3FR3A 1K3YA 2RUFA 3TJKA 1DE2A 1EZKA 3DVXA 2FWGA 2PWJA 1K0BA 3GYKA 5HR2A 1TK0B 1FB6A 2N5AA 3IBHA 5ECMB 4GCIA 1JFUA 2C3TA 4IQAA 3TOTA 1TU8A 3CSHA 6GSWA 4PNGA 1EEMA 4LL1B 1Z9HA 1HNBA 4NWYA 5CRDA 2I4AA 5J3RA 2K6VA 2R2JA 3IDVA 4ACSA 2H1AA 16GSA 1K0MA 2FD3A 2PVOC 3GH9A 4Q5NA 4YQMA 2OBIA 4PURA 3EMXA 5ENUA 3FK8A 2R3XA 2F3MA 4K7NA 2IMKA 4GSTA 5D9XA 5GAND 2VCZA 2B7KA 3LEFA 2VUPA 3TDGA 4N0VA 2OJLA 1R7HA 3ZFLA 4MDCA 3D21A 3HA9A 2HXKA 3TCOA 4TR1A 3RPPA 1X9SB 4MABA 1R26A 1SK2A 2O85A 3QDNA 5ELGA 4LA1A 1OE7A 2FNOA 3BBYA 2IWTA 3ZIJA 14GSA 1GSFA 1GSUA 4MK3A 2GQMA 5IPHA 4TR1B 1TDIA 1XVQA 1N2AA 4HQZA 3PPUA 5ID2A 1BX9A 1X5DA 3GIXA 5IOWA 1TK5B 5G5FA 4DSRA 3TRPA 1RQMA 3WGDA 1K0AA 4E8HA 1IYHA 2H0IA 2E2GA 1T00A 3TKSA 3FR6A 3GKKA 3S9FA 4O7HA 2B7JA 1GTAA 1PL2A 2VD0A 2JZRA 5ID2B 2P5QA 4O32A 4L8EA 2DJ0A 4MZCA 4WF4A 3A2XA 1PKZA 2RM5A 2DLXA 3CTFA 2C3NA 3HJOA 1MDIA 2AV4A 3ZIVA 3O3TA 1I5GA 4HJ2A 1Y6EA 2L4CA 1HQOA 5IMVA 3HJPA 1TRWA 5COHA 1WRYA 4TR3A 2LRTA 3ZTLA 3IAM2 1GH2A 1OC8A 2YCDA 2JU5A 3HDCA 3GRXA 4FYCA 4IW9A 5KN0A 4V2LA 1U3IA 2VLUA 1VGLA 2R6KA 4O92A 3UOMA 2C0GA 4ECIA 2CV4A 2LQOA 2YZUA 4J57E 3IK9A 3L0HA 5HFKA 4KSMA 1V40A 3KTBA 2AJQB 1XW5A 1WMJA 2KP1A 5HR3A 3AY8A 4V1Ag 4OCFA 7GSSA 1LJRA 3DVWA 4GRFA 3K8NA 1TJDA 5H5RA 1ML6A 4ML6A 5B6MA 4JU5A 2J23A 3EURA 1SJIA 4XRAA 5DAKA 1TTZA 4PNFA 2DJ1A 3DEXA 1XOAA 4ZB9A 2GSTA 2GS3A 4KA0A 1PRXA 1U88A 1HNAA 3HVVA 5IMAA 4D73A 1ILOA 2NTOA 3GKNA 3EE2A 2REMA 2KP2A 5HR1A 1WE0A 2P0GA 2FHEA 4IJ3A 2DJJA 1J08A 2VO4A 4WKWA 1QQ2A 3CYNA 3IC8A 3KJYA 3RPNA 1ERVA 4ZL7A 2OADA 2NDOA 4NMUA 4EL1A 1EV4A 2UZ8A 4D73B 3PR8A 3TJJA 4I97A 5JCUA 2WGRA 1K0NA 1OKDA 5AIVA 5GSSA 2G2QA 5IMZA 1F37A 2H70A 3PINA 2AHEA 2QC7A 4MP4A 5CO3A 2ES7A 2H6XA 1XIYA 1BQ7A 3P8WA 4MJAA 4PUFC 1M9BA 1GWCA 1ZYEA 2HSMA 2CX3A 5D93A 1G6YA 2LJKA 4WBRD 5G5EA 1GNEA 2XBQA 3I43A 1X9MB 2HZEA 4Q5FA 4BVXA 5BMUA 4L5OA 4ZBBA 2H76A 2Z9SA 1YDKA 4G19A 2LNSA 1ZGNA 2IIYA 2HSMB 5IIZA 2N5BA 4IBPA 4XCSA 1YKAA 4I8BA 4L0WA 2HZEB 3GV1A 2X8CA 3KGKA 3KIJA 3TKRA 1PD21 3VWWA 4WBJA 2V2GA 2DC5A 5B6NA 4EUYA 4HU7A 5J5NA 1WIKA 5ECQB 5DCHA 3D4MA 1SJ6A 1EV9A 9GSSA 1EGRA 2R4VA 4MZBA 3EU3A 5HFIA 3Q74A 2ZUPA 3KCMA 2H73A 5ECSA 3A2VA 5L71A 6GSXA 1B48A 4IGJA 1KBNA 1DBYA 5ECIB 3TGZA 1BYEA 2OA7A 1NW2A 5KEJA 2HZFA 5HR0A 1F2EA 5H5QA 4V2NA 2E0QA 1X9WB 3F3QA 2YZHA 3RHCA 1Z5YE 2B5YA 3DXBA 4L5LA 1UA5A 2H8LA 5IM9A 1AIUA 2GQLA 4BVYB 3G9BA 2V6KA 4EF0A 3F63A 2LJAA 1BJXA 1YEPA 3EC3A 1ZYQB 3F3RA 1NHOA 3NIVA 3US3A 4HZ4A 5A5KA 2H0HA 4ZL9A 2GDRA 4K7IA 3V1WA 1R5PA 4LLRA 3DKSA 3QAWA 2AYTA 2L6CA 4F03A 2HRNA 4TVEA 2EIOA 1V58A 1TXXA 5D96A 2JZSA 1TOFA 1O85A 1V57A 3CSIA 4JRRA 2L5OA 2YWMA 2CAQA 3H93A 1YJ6A 3M9JA 2RM6A 3BCKA 6GSVA 3GFKA 5CNWA 4I5QA 4GQFA 2MMOA 3H4KA 2H6YA 2HQTA 1AQVA 1F3BA 4EE0A 1GULA 1OC9A 3MNGA 2PN8A 3BOAA 2H0GA 1B4PA 2FWFA 3TUEA 3R3EA 4ECJA 3QMXA 4AGSA 1TW9A 2EIQA 3KEBA 1XXUA 5ECRB 4KH7A 4ZXGA 2F51A 3VWXA 4LMWA 1OC9B 1EGOA 5IO0A 3ZZXA 3NZNA 4I2UA 4RQRA 4F82A 1JLWA 2X8HA 2IMFA 2DIYA 1JZWA 2F9SA 4ZBDA 5AN1A 4FO5A 3L9UA 3CTGA 5A4VA 2VM2A 1GLPA 2VAFA 1SU9A 4EC0A 1C72A 1S3AA 1E2YA 2DSAA 4K0GA 1X5EA 2B5XA 4JZQA 4DSSA 4GWRA 3A5WA 4MPGA 1X0RA 1EOGA 2JL4A 2C0EA 3D5JA 2VM1A 4ID0A 2LS5A 3M1GA 10GSA 4I6XA 4Q5RA 3FW2A 3ZMLA 2HRFA 3GHAA 5FHIA 1T7PB 4MZWA 2IMEA 2BMXA 3HY2A 4OFNA 4MMMA 1T8EB 2HFDA 2H6ZA 4PXOA 1VF2A 1M2BA 5IMFA 4DSSB 1FW1A 5F0GA 1TI1A 5JWQB 3NOFA 1GSEA 5DDLA 4Q5QA 1QMVA 3ERWA 4XTSA 4USSA 5F05A 1FHEA 1YEXA 5B7CA 1XZOA 1M99A 2CVDA 4J2FA 2MBTA 2AB6A 1SYXA 4HEA2 2R5GA 1Y25A 4DSQA 5H5SA 2WZ9A 2OE1A 4RI7A 1ZCPA 5JWRB 3VLNA 2K9FA 3IXRA 5F06A 1OVNA 2H71A 2NBSA 1BEDA 4F2IA 4N30A 5CYYA 5E4WA 3CRUA 1PMTA 4JEDA 2I9HA 3UBKA 3FR9A 2E7PA 3TRQA 4ECBA 4KE3A 4YAPA 3ZL5A 2MZCA 5JCGA 1SK0A 1U6TA 3QOUA 1EOHA 4MF6A 3ME7A 2MMNA 3IPZA 2OE3A 5ECNB 3P7XA 2GSSA 3HYPA 4IS0A 2LQQA 1GTUA 3F4SA 5G2ZA 3O76A 4MF7A 3GKXA 4QL9A 3KM6A 2DBCA 2IMIA 3Q19A 4ZBAA 4KDXA 4NAXA 5KN1A 3DMLA 5HFGA 2CVKA 1WP0A 4V1Ap 4P3YB 2A2RA 5IMCA 2O87A 4WETA 5FT3A 3P2AA 2RIIA 5D9VA 1ACVA 2EC4A 1ST9A 8GSSA 3BCIA 2L6DA 5FWGA 2GZYA 5EVOA 1FB0A 4O5RA 3KH7A 2XBIA 1A2LA 2HE3A 1YKCA 2CX4A 3FY7A 1KNGA 4OO4A 4IN0A 1YZXA 4ZL8A 5IMDA 4HDEA 3KXOA 3ERFA 2HRKA 1M0UA 4GLTA 1S3CA 2HI7A 1VF1A 4NXIA 2LRCA 5GZZB 2X8GA 3D0ZA 2YP6A 2GSQA 3GN3A 2DJ3A 4POBA 4YQUA 2A4VA 2FWEA 3ZMKA 3J7Yk 5ECPB 5C04A 2HRKB 2JADA 3A2WA 5EL8A 2VL9A 3QFAC 3KP9A 4ILFA 3L9SA 1GNWA 3QFBC 2YWIA 1PX7A 4TKYA 2F8FA 13GSA 1FVKA 3CSJA 2I1UA 4KDUA 3TB2A 3EWLA 2H1GA 2PBJA 1JZOA 2FWHA 1CQHA 3HVXA 1SKSB 2IJYA 3HD5A 2LTKA 4BA7A 4GF0A 1B9XC 1UN2A 1AW9A 1PGTA 4TXOB 4IKHA 2B1LA 4MJCA 3VPQA 4E8EA 4PTSA 3QAGA 1HD2A 3C1SA 3LJRA 2FY6A 2XC2A 2YWOA 2ZCTA 1XW9A 5LCZA 3VWUA 2F8AA 1PQNA 3LG6A 1EP7A 4K2DA 3LXZA 2B5EA 3ZRDA 4OO5A 4AJ7A 2LV3A 1MEKA 3L78A 3L9VA 3G7IA 4KNDA 2TRXA 4KGIA 4MF5A 5LD0A 1A8YA 3F8UA 2MMZA 1GUHA 4CHSA 2A2SA 3IC4A 4IVFA 4N10A 2HSHA 3DYRA 3R2QA 2H1BA 4FH8A 4ECCA 3GTUA 3GMFA 3ZITA 3WGEA 5J9BA 4HJMA 3W8SA 5G1LA 5DVBA 2C4JA 3WT1A 3DGQA 1SKWB 2L5LA 2VL2C 1TRSA 5JCWA 5D9TA 2VCWA 1PN9A 1O73A 1ZL9A 3C8EA 4MH3A 4TR0A 5G30A 3GTUB 1SL0B 3UEMA 3VI7A 4IHUA 1RK4A 2KHPA 3C71A 5IOXA 1NM3A 3MSZA 4XRDA 3MDKA 4YAVA 4PGTA 3M9KA 4G0IA 4OFTA 4AF2A 5B8AA 1XOBA 2HYXA 5HQPA 2K8VA 4PQIA 2BTOT 2WCIA 1SL2B 1JZDA 1SJZA 2WJUA 3ED3A 4XS1A 3G7JA 2H01A 2FCHA 2P31A 4Z7XA 4LL4B 1V98A 1BG5A 3JCML 3GX0A 3QPMA 1B4QA 2EIRA 3O6TA 1QFNA 2MYGA 2LEGA 1KEBA 1GTBA 3TKSE 2QGVA 2VCXA 4IELA 2KOKA 4NHWA 3DRNA 3DIEA 3L4NA 4G9HA 4BVYA 1LU4A 1QXHA 3HHVA 3LGCA 4MH2A 1GUMA 4KDYA 1EP8A 3RAZA 1H4OA 1FAAA 3C73A 3F4RA 4L0UA 1PX6A 4WF5A 2M72A 2VD1A 1E6BA 2I3YA 1YQ1A 1Z7RA 2X99A 4IP6A 2ZNMA 4ZB8A 2OKAA 3OR5A 2LSTA 2B3SA 4XS4A 4WR5A 3E9JB 3LSZA 3F9UA 1IYIA 3HZ4A 5B8BA 3M8NA 3EVIA 4EDYA 3GH6A 3LYPA 1EEJA 4G0LA 1ERWA 1XVWA 2YANA 3SBCA 2GZPA 5DQYA 4HU9A 2CQ9A 2PERA 2YJHA 3KMOA 1T4YA 4XS4B 1ON4A 2O89A 2YOIA 3PH9A
chains in the Genus database with same CATH superfamily
3LQ7A 1A2JA 2VCTA 5CREA 4HS1A 1Q98A 1TK8B 6GSSA 2QKEA 4EXJA 1M7TA 2NVLA 5IQYA 3FZ5A 4DVCA 1S3RA 1ZOFA 2PMTA 1K3OA 2O7KA 4K9ZA 1ZMAA 1OKTA 3LFLA 5CP1A 1AQWA 2VOCA 3IOSA 2C0DA 5J4VA 1QK8A 4TXVA 3J7Yb 4GXZA 4N11A 4X43A 5ECKB 1F9MA 3A3TA 5CRWA 1HYUA 1XFLA 4KF9A 3H79A 1YF0A 1YF1A 4Z2RA 3RDWA 22GSA 1K0CA 1XWAA 4IQ1A 5F8BA 1WPIA 5J9CA 2HT9A 4F0CA 1EWXA 1PL1A 1AAZA 4ML1A 1TKDB 2WW2A 1XW6A 3IV4A 6GSUA 1J0FA 5D9WA 2V32A 2O36A 1SD8A 2MMAA 2C3QA 2J9HA 3P90A 11GSA 1QUWA 3W8JA 2LNTA 3G7YA 3HVSA 1GRXA 1R4WA 4K0NA 1W89A 3VPTA 1KTEA 5LNKe 3UAPA 2JSZA 5E59A 3Q6OA 1UC7A 4F9ZA 6GSTA 3EU4A 2X4AA 4EVMA 5J4UA 3DWVA 5G1KA 4MCUA 1ERUA 3F4TA 1XWGA 4EDZA 2FA8A 1K0OA 4Z2UA 3RGBC 3TKSC 1T1VA 4KCAA 5DALA 1MDJA 4NV5A 3GURA 4FQUA 1O6JA 3LORA 1AXDA 2CA8A 4PQHA 2WFCA 5GSTA 3FZ4A 4MA9A 4JBBA 4CDOA 2GSRA 4TOPA 3GX8A 1SK1A 4X0XA 3ZVJA 2JACA 4JR6A 4EIQA 5DALB 1GL8A 1PKWA 3A5IA 4MJBA 4POKA 2IMDA 3QAVA 2WRTA 2NPBA 3IK7A 3KP8A 4KW6A 4TW5A 2QSIA 3FHKA 1O7UA 1OC3A 5CRHA 5A34A 3UARA 3EPTA 2DMLA 3VURA 4HOJA 4BWSA 4ZIJA 2VCQA 4BWQA 4ZILA 2DIZA 2PPTA 4XHMA 2YNXA 2CZ2A 2TRCP 1B9YC 4OMVA 3WYWA 2GZZA 4EO3A 4HUAA 5A34B 2CAIA 2O8VB 1T3BA 5DBQA 1N25A 1ABAA 2IL3A 1M2AA 1NHYA 4AKGA 3LWAA 2FUG2 4FYBA 2JZTA 1Z3EA 3N5OA 4RI6A 2VLTA 4RQXA 2GQKA 4MPFA 4TN8A 1SYRA 3DD3A 12GSA 3D22A 2V6OA 2AAWA 4KB3A 4AKHA 1CQGA 2C0FA 1Z6MA 18GSA 1XWKA 1GUKA 5JWOB 2K18A 1GSQA 5EY6A 5KN2A 4KCEA 5D73A 1V9WA 3TJGA 3LXTA 5J40A 3MWHA 3F6FA 1MTCA 2RLIA 2IFQA 3WD6A 1O8WA 2L59A 3F6DA 4GSSA 2C1YA 2C80A 3E3EA 4K6XA 4POLA 2O3EA 3GSTA 1USBA 2GGTA 3E0UA 4GSNA 2XPDA 1K3LA 4PX1A 3EINA 3VWVA 5CAXA 5AISA 4ZB7A 3MYDA 4BL7A 4G0KA 2ALBA 1Z7PA 2YV9A 1MD3A 5G31A 2H72A 2IFQB 4OCEA 3C1RA 2H75A 1ZYNA 4TXOA 3W6GA 2PUKC 1UVZA 2H30A 3WT2A 3FEUA 4N0ZA 2H66A 1JHBA 2WW0A 3ZLPA 3KTLA 3UBLA 4BL7B 5EPFA 2GVPA 3TRXA 1FG4A 3KH9A 4H86A 3Q18A 1O8XA 4FIWA 1FO5A 3QR6A 2N5FA 2HLSA 3KD0A 1N8JA 1FOVA 1ZZYA 4GQCA 1SL1B 2YWNA 3HXSA 3HJMA 1YY7A 3RHBA 3IRAA 2FGXA 2RUEA 4AJ6A 4OWYA 1W4VA 4G2EA 2LRNA 3U5RE 1DE1A 2H19A 2FLSA 5F07A 2PGTA 3GSSA 17GSA 1PN0A 2BJXA 2KUCA 2OT3A 4LMVA 2VCVA 4PUAA 5D8IA 1TP9A 1PSQA 3C7MA 4KAEA 3SWLA 4WXTA 1THOA 2VLVA 3BJ5A 4MLYA 2L57A 3FZAA 3PGTA 2VIMA 3I9V2 5DAKB 1VRSD 5A4WA 2JSYA 4HZ2A 1A2MA 1OE8A 4YH2A 6GSYA 4MJEA 1TXUA 1A24A 1J9BA 3HKRA 4IP1A 1S3DA 1T4ZA 2G0FA 3KMNA 4WEYA 2I81A 2IN3A 5KOXA 2ON5A 4TRXA 3GL3A 4XS6A 3TKQA 3WGXA 2P5RA 2X64A 4BPYA 4K7OA 4FYUA 4OD7A 2FA4A 3HCZA 4HI7A 1NSWA 2VL3A 3QD9A 4MNNA 3UIWA 1BAYA 4X1UA 3GKMA 3IAS2 1A8LA 1DUGA 4KX4A 4PI2C 5ECOB 3GA4A 3ZYWA 2WB9A 3ZVJD 3M3MA 2D2ZA 1I9DA 3VK9A 3IHGA 3APOA 2M80A 4RUVA 2K8SA 2CZ3A 5ABRA 2LKUA 2IPAA 5DJLA 2OACA 1VF3A 4XIHA 1TI3A 1MDKA 3IHQA 3LYKA 1WJKA 1XG8A 4NPBA 2CVBA 1GTIA 2TIRA 5IO2A 2DJKA 3BD2A 4V2MA 2OBKA 2WS2A 1XWBA 2XPEA 3CBUA 1F3AA 4BVXB 3KZQA 2WULA 2R0GA 2DKHA 2MBSA 3ERGA 4IJIA 3UMAA 4GTUA 1WOUA 5DJMA 2EFHA 3ZFBA 3ZREA 2H74A 4QQ7A 3GUSA 3EYTA 1PA3A 1SD9A 5KOWA 4I2TA 1XBSA 1Q4JA 2HSNA 3D4TA 1Y1UA 1AC1A 4ZB6A 1B8XA 5ECLB 4OFMA 2DJ2A 1QGVA 1GSYA 1SENA 3EMPA 4ULXA 4NHZA 3TOUA 3RBTA 3U6VA 5DCGA 3F0IA 2GTUA 4EIPA 3N9JA 2M46A 4JE1A 5ECHB 4AKIA 2GLRA 4NV2A 3MAKA 5J41A 2B6MA 3CWGA 1GLQA 4KSOA 4WR4A 1H75A 2HSNB 3IA1A 4K1FA 1GP1A 1V2AA 3H8QA 3GL5A 3H1NA 4N3ZA 1K0DA 2WVXA 1Z6NA 1G7OA 3VI5A 5AIXA 4YQVA 2DMMA 1AUCA 2B1KA 4DEJA 2OE0A 3I69A 3TKPA 3IR4A 5KN3A 1FVJA 2LUSA 3D6IA 1OYJA 4CW9A 2VL2A 4J56E 2ON7A 2H1DA 1TRUA 3IE3A 1AQXA 1OAZA 1URMA 1XWCA 2GT6A 1GSDA 3I6AA 2PU9C 3UJ1A 2WVXB 3FKFA 1U87A 4POMA 2KLXA 2YV7A 1RW1A 1GSSA 1LBKA 2C8UA 1A0RP 5DQSA 1VF4A 2R37A 3M0FA 4PQ1A 1M2DA 3CXGA 1R5AA 3GNJA 1XCCA 3UL3A 5A4UA 3UVTA 1G0TA 1SVMA 4TR4A 5C00A 3QCPA 4A5PA 2CT6A 2XHFA 2WDUA 1WWJA 2E2MA 5AGYA 1O81A 1JZRA 4JR4A 2GT5A 4KUNA 2HSYA 4G10A 1JLVA 5ELAA 2L4QA 1DSBA 1XPVA 4QL7A 1A23A 3APQA 1HNCA 3CRTA 1THXA 1SVOA 1SKRB 20GSA 4EKZA 1TRVA 3TJFA 3CMIA 2HNLA 5GAPD 5INYA 5IPGA 1U3AA 1A0FA 2V1MA 1G7EA 2PVQA 1G6WA 19GSA 2YN1A 4AJ8A 3HMJG 3VFIA 3FYGA 2YPMA 1TU7A 2V41A 4HQSA 2AUVA 4ISDA 5CRGA 2LJRA 1ERTA 3FZ9A 2YJ7A 1MD4A 1X5CA 2R0PA 1M9AA 3UVHA 3HZ8A 3APSA 4PHZC 3ISOA 4K8MA 3FRCA 3TJBA 2HRAA 4F0BA 3ME8A 1F6MC 3FR3A 1K3YA 2RUFA 3TJKA 1DE2A 1EZKA 3DVXA 2FWGA 2PWJA 3GYKA 1K0BA 2QA2A 5HR2A 4Z2TA 1TK0B 1FB6A 3FMWA 5J4YA 2N5AA 3IBHA 5ECMB 4GCIA 1JFUA 2A2PA 2C3TA 4IQAA 3TOTA 1TU8A 1S4BP 3CSHA 6GSWA 4PNGA 2R0CA 1EEMA 4LL1B 1Z9HA 1HNBA 4NWYA 5CRDA 2I4AA 5J3RA 2K6VA 2R2JA 3IDVA 4ACSA 2H1AA 3CQFA 16GSA 1K0MA 2FD3A 2VKZG 2PVOC 3GH9A 4Q5NA 4YQMA 2OBIA 4PURA 3EMXA 5ENUA 3FK8A 2R3XA 2A4HA 2F3MA 4K7NA 2IMKA 4GSTA 5D9XA 5GAND 2VCZA 2B7KA 3LEFA 2VUPA 3TDGA 4N0VA 2OJLA 1R7HA 3ZFLA 4MDCA 3D21A 3HA9A 2HXKA 3TCOA 4TR1A 3RPPA 1X9SB 4MABA 1R26A 1SK2A 2O85A 3QDNA 5ELGA 4LA1A 1OE7A 4YKFA 2FNOA 1YVLA 3BBYA 2IWTA 3ZIJA 14GSA 1GSFA 1GSUA 4MK3A 2GQMA 5IPHA 4TR1B 1TDIA 1XVQA 1N2AA 4HQZA 3PPUA 5ID2A 1BX9A 1X5DA 3GIXA 5IOWA 1TK5B 5G5FA 4DSRA 3TRPA 4ICYA 1RQMA 3WGDA 1K0AA 4E8HA 1IYHA 2H0IA 2E2GA 1T00A 3TKSA 3FR6A 3GKKA 3S9FA 4O7HA 2B7JA 1GTAA 1PL2A 2VD0A 2JZRA 5ID2B 2P5QA 4O32A 4L8EA 2DJ0A 4MZCA 4WF4A 3A2XA 4O5QA 3MIXA 1PKZA 2RM5A 2DLXA 3CTFA 2C3NA 3HJOA 1MDIA 2AV4A 3ZIVA 2EFEA 3O3TA 1I5GA 4HJ2A 1Y6EA 2L4CA 1HQOA 5IMVA 3HJPA 1TRWA 5COHA 1WRYA 4TR3A 2LRTA 3ZTLA 3IAM2 4K2XA 1GH2A 1OC8A 2YCDA 2JU5A 3HDCA 3GRXA 4FYCA 4IW9A 5KN0A 4V2LA 1U3IA 2VLUA 1VGLA 2R6KA 4O92A 3UOMA 2C0GA 4ECIA 2CV4A 2LQOA 2YZUA 4J57E 3IK9A 3L0HA 5HFKA 4KSMA 1V40A 1YEWC 3KTBA 2AJQB 1XW5A 1WMJA 2KP1A 5HR3A 3AY8A 4V1Ag 4OCFA 7GSSA 1LJRA 3DVWA 2WZSA 4GRFA 2WW1A 3K8NA 1TJDA 5H5RA 1ML6A 4ML6A 5B6MA 4JU5A 2J23A 3EURA 1SJIA 4XRAA 4CY8A 5DAKA 1TTZA 4PNFA 2DJ1A 3DEXA 1SVLA 1XOAA 4ZB9A 2GSTA 2GS3A 4KA0A 1PRXA 1U88A 1HNAA 2O5VA 3HVVA 5IMAA 4D73A 1ILOA 2NTOA 3GKNA 3EE2A 2REMA 2KP2A 5HR1A 1WE0A 2P0GA 2FHEA 4IJ3A 2DJJA 1J08A 2VO4A 4WKWA 1QQ2A 3CYNA 4HSCX 3IC8A 3KJYA 3RPNA 1ERVA 4ZL7A 2OADA 4E68A 2NDOA 4NMUA 4EL1A 1EV4A 2UZ8A 4D73B 3PR8A 3TJJA 4I97A 5JCUA 2WGRA 1K0NA 1OKDA 5AIVA 5GSSA 2G2QA 5IMZA 1F37A 2H70A 3PINA 2AHEA 2QC7A 4MP4A 5CO3A 2ES7A 2H6XA 1XIYA 1BQ7A 3P8WA 4MJAA 4PUFC 1M9BA 1GWCA 1ZYEA 2HSMA 2CX3A 4CY6A 5D93A 1G6YA 2LJKA 4WBRD 5G5EA 1GNEA 2XBQA 3I43A 1X9MB 2HZEA 4Q5FA 4BVXA 5BMUA 4L5OA 4ZBBA 2H76A 2Z9SA 1YDKA 4G19A 2LNSA 1ZGNA 2IIYA 2HSMB 5IIZA 2N5BA 4IBPA 4XCSA 1YKAA 4I8BA 4L0WA 2HZEB 3GV1A 2X8CA 5BMUB 3KGKA 3KIJA 3TKRA 4QMKA 1PD21 3VWWA 4WBJA 2V2GA 2DC5A 5B6NA 4EUYA 4HU7A 5J5NA 1WIKA 5ECQB 5DCHA 3D4MA 1SJ6A 1EV9A 9GSSA 1EGRA 2R4VA 3RFRC 4MZBA 3EU3A 5HFIA 3Q74A 2ZUPA 3KCMA 2H73A 5ECSA 3A2VA 5L71A 6GSXA 1B48A 4IGJA 1KBNA 1DBYA 5ECIB 3TGZA 2UV8G 1BYEA 2OA7A 1NW2A 5KEJA 2HZFA 5HR0A 1F2EA 5H5QA 4V2NA 2E0QA 1X9WB 3F3QA 2YZHA 3RHCA 1Z5YE 2B5YA 3DXBA 4L5LA 1UA5A 2H8LA 5IM9A 1AIUA 2GQLA 4BVYB 3G9BA 2V6KA 4EF0A 3F63A 2LJAA 1BJXA 1YEPA 3EC3A 1ZYQB 3F3RA 1NHOA 3NIVA 3US3A 4HZ4A 5A5KA 2H0HA 4ZL9A 2GDRA 4K7IA 4K5RA 3V1WA 1R5PA 4LLRA 3DKSA 3QAWA 2AYTA 2L6CA 4F03A 2HRNA 4TVEA 2EIOA 1V58A 1TXXA 5D96A 2JZSA 1TOFA 1O85A 1V57A 3CSIA 4JRRA 2L5OA 2YWMA 2CAQA 3H93A 1YJ6A 3M9JA 2RM6A 3BCKA 6GSVA 3GFKA 5CNWA 4I5QA 2MMOA 4GQFA 3H4KA 2H6YA 2HQTA 1AQVA 1F3BA 1PFOA 4EE0A 1GULA 1OC9A 1BG1A 3MNGA 2PN8A 3BOAA 2H0GA 1B4PA 2FWFA 3TUEA 3R3EA 1FOHA 4ECJA 3QMXA 4AGSA 1TW9A 2EIQA 3KEBA 1XXUA 5ECRB 4AI6A 4KH7A 4ZXGA 2F51A 3VWXA 4LMWA 1OC9B 1EGOA 5IO0A 3ZZXA 3NZNA 4I2UA 4RQRA 4F82A 1JLWA 2X8HA 2IMFA 2DIYA 1JZWA 2F9SA 3LW9A 4X4JA 4ZBDA 5AN1A 4FO5A 3L9UA 3CTGA 5A4VA 2VM2A 2EFDA 1GLPA 2VAFA 1SU9A 4EC0A 1C72A 1S3AA 1E2YA 2DSAA 4K0GA 1X5EA 2B5XA 4JZQA 4DSSA 4GWRA 3A5WA 4MPGA 1X0RA 1EOGA 2JL4A 2C0EA 3D5JA 2VM1A 4ID0A 2LS5A 3M1GA 10GSA 4I6XA 4Q5RA 3FW2A 3ZMLA 2HRFA 3GHAA 5FHIA 1T7PB 4MZWA 2IMEA 2BMXA 3HY2A 4OFNA 4MMMA 1T8EB 2HFDA 2H6ZA 4PXOA 1VF2A 1M2BA 4W66A 5IMFA 4DSSB 1FW1A 5F0GA 1TI1A 5JWQB 3NOFA 1GSEA 5DDLA 4Q5QA 1QMVA 3ERWA 4XTSA 4USSA 5F05A 1FHEA 1YEXA 2DKIA 5B7CA 1XZOA 1M99A 2CVDA 4J2FA 2MBTA 2AB6A 4AKXB 1SYXA 4HEA2 2R5GA 1Y25A 4DSQA 5H5SA 2WZ9A 2OE1A 2WW3A 4RI7A 1ZCPA 5JWRB 3VLNA 2K9FA 4PI0C 3IXRA 5F06A 1OVNA 2H71A 2NBSA 1BEDA 4F2IA 4N30A 5CYYA 5E4WA 3CRUA 1PMTA 4JEDA 2I9HA 3UBKA 3FR9A 2E7PA 3TRQA 4ECBA 4KE3A 4YAPA 3ZL5A 2MZCA 5JCGA 1SK0A 1U6TA 5J47A 1EOHA 3QOUA 4MF6A 3ME7A 2MMNA 3IPZA 2OE3A 5ECNB 3P7XA 2GSSA 3HYPA 4IS0A 2LQQA 1GTUA 3F4SA 5G2ZA 3O76A 4MF7A 3GKXA 4QL9A 3KM6A 2DBCA 2IMIA 3Q19A 4ZBAA 4KDXA 4NAXA 1M3IA 5KN1A 3DMLA 5HFGA 2CVKA 1WP0A 4V1Ap 4P3YB 2A2RA 5IMCA 2O87A 4WETA 5FT3A 3P2AA 2RIIA 5D9VA 1ACVA 4YKGA 2EC4A 1ST9A 8GSSA 3BCIA 2L6DA 5FWGA 2GZYA 5EVOA 1FB0A 4O5RA 3KH7A 4FXYP 2XBIA 1A2LA 2HE3A 4O5UA 1YKCA 2CX4A 3FY7A 1KNGA 4OO4A 4IN0A 1YZXA 4ZL8A 5IMDA 4HDEA 3KXOA 3ERFA 2HRKA 1M0UA 4GLTA 1S3CA 2HI7A 2H1LA 1VF1A 4NXIA 2LRCA 5GZZB 2X8GA 3D0ZA 2YP6A 2GSQA 3GN3A 2DJ3A 3CHXC 4POBA 4YQUA 2A4VA 2FWEA 3ZMKA 3J7Yk 5ECPB 5C04A 2HRKB 2JADA 3A2WA 5EL8A 2VL9A 3QFAC 3KP9A 4ILFA 3L9SA 1GNWA 3QFBC 2YWIA 1PX7A 4TKYA 2F8FA 13GSA 1FVKA 3CSJA 2I1UA 4KDUA 3TB2A 3EWLA 2H1GA 2PBJA 1JZOA 2FWHA 1CQHA 3HVXA 1SKSB 2IJYA 3HD5A 3HVNA 2LTKA 4BA7A 4GF0A 1B9XC 1UN2A 1AW9A 1PGTA 4TXOB 4IKHA 2B1LA 4MJCA 3VPQA 4E8EA 4PTSA 3QAGA 1HD2A 3C1SA 3LJRA 2FY6A 2XC2A 2YWOA 2ZCTA 5A5HA 1XW9A 5LCZA 3VWUA 2F8AA 1PQNA 5A1NA 3LG6A 1EP7A 4K2DA 3LXZA 2B5EA 3ZRDA 4OO5A 4AJ7A 2LV3A 1MEKA 3L78A 3L9VA 3G7IA 4KNDA 2TRXA 4KGIA 4MF5A 5LD0A 1A8YA 5BRTA 5A5HB 3F8UA 2MMZA 1GUHA 4CHSA 2A2SA 5A1NB 3IC4A 4IVFA 4N10A 2HSHA 3DYRA 3R2QA 2H1BA 4FH8A 4ECCA 3TU3B 3GTUA 3GMFA 3ZITA 3WGEA 5J9BA 4HJMA 3W8SA 5G1LA 5DVBA 2C4JA 3WT1A 3DGQA 1M3JA 1SKWB 2L5LA 2VL2C 1TRSA 5JCWA 5D9TA 2VCWA 1PN9A 1O73A 1ZL9A 3C8EA 4MH3A 4TR0A 5G30A 3GTUB 1SL0B 3UEMA 3VI7A 2X49A 4IHUA 1RK4A 2KHPA 3C71A 4GDFA 5IOXA 1NM3A 3MSZA 4XRDA 3MDKA 4YAVA 4PGTA 3M9KA 4G0IA 4OFTA 4AF2A 5B8AA 1XOBA 2HYXA 5HQPA 2K8VA 4PQIA 2BTOT 2WCIA 1SL2B 1JZDA 1SJZA 2WJUA 3ED3A 4XS1A 3G7JA 2H01A 2FCHA 2P31A 4Z7XA 4LL4B 1V98A 2EFCA 1BG5A 3JCML 3GX0A 4K5SA 3QPMA 1B4QA 1BF5A 2EIRA 3O6TA 1QFNA 2MYGA 2LEGA 1KEBA 1GTBA 3TKSE 2QA1A 2QGVA 2VCXA 4IELA 2KOKA 4NHWA 3DRNA 3DIEA 3L4NA 4G9HA 4BVYA 2WVYA 1LU4A 1QXHA 3HHVA 3LGCA 4MH2A 1GUMA 4KDYA 1EP8A 3RAZA 1H4OA 1FAAA 1I1IP 3C73A 3F4RA 4L0UA 1PX6A 4WF5A 2M72A 2VD1A 1E6BA 2I3YA 1YQ1A 1Z7RA 2X99A 4IP6A 2ZNMA 4ZB8A 2OKAA 3OR5A 2LSTA 2B3SA 2WVZA 4XS4A 4WR5A 3E9JB 3LSZA 3F9UA 1IYIA 3HZ4A 5B8BA 3M8NA 3EVIA 4EDYA 3GH6A 3LYPA 1EEJA 4G0LA 1ERWA 1XVWA 2YANA 3SBCA 1ZYPA 2GZPA 5DQYA 4HU9A 2CQ9A 4BIKA 2PERA 2YJHA 3KMOA 1T4YA 4XS4B 4G01A 1ON4A 2O89A 2YOIA 3PH9A
chains in the Genus database with same CATH topology
3LQ7A 1A2JA 2VCTA 5CREA 4HS1A 1Q98A 1TK8B 6GSSA 2QKEA 4EXJA 1M7TA 2NVLA 5IQYA 3FZ5A 4DVCA 1ZOFA 2PMTA 1K3OA 2O7KA 4K9ZA 1ZMAA 1OKTA 3LFLA 5CP1A 1AQWA 2VOCA 3IOSA 2C0DA 5J4VA 1QK8A 4TXVA 3J7Yb 4GXZA 4N11A 4X43A 5ECKB 1F9MA 3A3TA 5CRWA 1HYUA 1XFLA 4KF9A 3H79A 1YF0A 1YF1A 4Z2RA 3RDWA 22GSA 1K0CA 1XWAA 4IQ1A 5F8BA 1WPIA 5J9CA 2HT9A 4F0CA 1EWXA 1PL1A 1AAZA 4ML1A 1TKDB 1XW6A 3IV4A 6GSUA 1J0FA 5D9WA 2V32A 1SD8A 2MMAA 2C3QA 2J9HA 3P90A 11GSA 1QUWA 3W8JA 2LNTA 3G7YA 3HVSA 1GRXA 1R4WA 4K0NA 1W89A 3VPTA 1KTEA 5LNKe 3UAPA 2JSZA 5E59A 3Q6OA 1UC7A 4F9ZA 6GSTA 3EU4A 2X4AA 4EVMA 5J4UA 3DWVA 5G1KA 4MCUA 1ERUA 3F4TA 1XWGA 4EDZA 2FA8A 1K0OA 4Z2UA 3TKSC 1T1VA 4KCAA 5DALA 1MDJA 4NV5A 3GURA 4FQUA 1O6JA 3LORA 1AXDA 2CA8A 4PQHA 2WFCA 5GSTA 3FZ4A 4MA9A 4JBBA 4CDOA 2GSRA 4TOPA 3GX8A 1SK1A 4X0XA 3ZVJA 2JACA 4JR6A 4EIQA 5DALB 1GL8A 1PKWA 3A5IA 4MJBA 4POKA 2IMDA 3QAVA 2WRTA 2NPBA 3IK7A 3KP8A 4KW6A 4TW5A 2QSIA 3FHKA 1O7UA 1OC3A 5CRHA 5A34A 3UARA 3EPTA 2DMLA 3VURA 4HOJA 4BWSA 4ZIJA 2VCQA 4BWQA 4ZILA 2DIZA 2PPTA 4XHMA 2YNXA 2CZ2A 2TRCP 1B9YC 4OMVA 3WYWA 2GZZA 4EO3A 4HUAA 5A34B 2CAIA 2O8VB 1T3BA 5DBQA 1N25A 1ABAA 2IL3A 1M2AA 1NHYA 4AKGA 3LWAA 2FUG2 4FYBA 2JZTA 1Z3EA 3N5OA 4RI6A 2VLTA 4RQXA 2GQKA 4MPFA 4TN8A 1SYRA 3DD3A 12GSA 3D22A 2V6OA 2AAWA 4KB3A 4AKHA 1CQGA 2C0FA 1Z6MA 18GSA 1XWKA 1GUKA 5JWOB 2K18A 1GSQA 5EY6A 5KN2A 4KCEA 5D73A 1V9WA 3TJGA 3LXTA 5J40A 3MWHA 3F6FA 1MTCA 2RLIA 2IFQA 3WD6A 1O8WA 2L59A 3F6DA 4GSSA 2C1YA 2C80A 3E3EA 4K6XA 4POLA 3GSTA 1USBA 2GGTA 3E0UA 4GSNA 2XPDA 1K3LA 4PX1A 3EINA 3VWVA 5CAXA 5AISA 4ZB7A 3MYDA 4BL7A 4G0KA 2ALBA 1Z7PA 2YV9A 1MD3A 5G31A 2H72A 2IFQB 4OCEA 3C1RA 2H75A 1ZYNA 4TXOA 3W6GA 2PUKC 1UVZA 2H30A 3WT2A 3FEUA 4N0ZA 2H66A 1JHBA 3ZLPA 3KTLA 3UBLA 4BL7B 5EPFA 2GVPA 3TRXA 1FG4A 3KH9A 4H86A 3Q18A 1O8XA 4FIWA 1FO5A 3QR6A 2N5FA 2HLSA 3KD0A 1N8JA 1FOVA 1ZZYA 4GQCA 1SL1B 2YWNA 3HXSA 3HJMA 1YY7A 3RHBA 3IRAA 2FGXA 2RUEA 4AJ6A 4OWYA 1W4VA 4G2EA 2LRNA 3U5RE 1DE1A 2H19A 2FLSA 5F07A 2PGTA 3GSSA 17GSA 1PN0A 2BJXA 2KUCA 2OT3A 4LMVA 2VCVA 4PUAA 5D8IA 1TP9A 1PSQA 3C7MA 4KAEA 3SWLA 4WXTA 1THOA 2VLVA 3BJ5A 4MLYA 2L57A 3FZAA 3PGTA 2VIMA 3I9V2 5DAKB 1VRSD 5A4WA 2JSYA 4HZ2A 1A2MA 1OE8A 4YH2A 6GSYA 4MJEA 1TXUA 1A24A 1J9BA 3HKRA 4IP1A 1S3DA 1T4ZA 2G0FA 3KMNA 4WEYA 2I81A 2IN3A 5KOXA 2ON5A 4TRXA 3GL3A 4XS6A 3TKQA 3WGXA 2P5RA 2X64A 4BPYA 4K7OA 4FYUA 4OD7A 2FA4A 3HCZA 4HI7A 1NSWA 2VL3A 3QD9A 4MNNA 3UIWA 1BAYA 4X1UA 3GKMA 3IAS2 1A8LA 1DUGA 4KX4A 5ECOB 3GA4A 3ZYWA 2WB9A 3ZVJD 3M3MA 2D2ZA 1I9DA 3VK9A 3IHGA 3APOA 2M80A 4RUVA 2K8SA 2CZ3A 5ABRA 2LKUA 2IPAA 5DJLA 2OACA 1VF3A 4XIHA 1TI3A 1MDKA 3IHQA 3LYKA 1WJKA 4NPBA 2CVBA 1GTIA 2TIRA 5IO2A 2DJKA 3BD2A 4V2MA 2OBKA 2WS2A 1XWBA 2XPEA 3CBUA 1F3AA 4BVXB 3KZQA 2WULA 2R0GA 2DKHA 2MBSA 3ERGA 4IJIA 3UMAA 4GTUA 1WOUA 5DJMA 2EFHA 3ZFBA 3ZREA 4QQ7A 2H74A 3GUSA 3EYTA 1PA3A 1SD9A 5KOWA 4I2TA 1XBSA 1Q4JA 2HSNA 3D4TA 1Y1UA 1AC1A 4ZB6A 1B8XA 5ECLB 4OFMA 2DJ2A 1QGVA 1GSYA 1SENA 3EMPA 4ULXA 4NHZA 3TOUA 3RBTA 3U6VA 5DCGA 3F0IA 2GTUA 4EIPA 3N9JA 2M46A 4JE1A 5ECHB 4AKIA 2GLRA 4NV2A 3MAKA 5J41A 2B6MA 3CWGA 1GLQA 4KSOA 4WR4A 1H75A 2HSNB 3IA1A 4K1FA 1GP1A 1V2AA 3H8QA 3GL5A 3H1NA 4N3ZA 1K0DA 1Z6NA 1G7OA 3VI5A 5AIXA 4YQVA 2DMMA 1AUCA 2B1KA 4DEJA 2OE0A 3I69A 3TKPA 3IR4A 5KN3A 1FVJA 2LUSA 3D6IA 1OYJA 4CW9A 2VL2A 4J56E 2ON7A 2H1DA 1TRUA 3IE3A 1AQXA 1OAZA 1URMA 1XWCA 2GT6A 1GSDA 3I6AA 2PU9C 3UJ1A 3FKFA 1U87A 4POMA 2KLXA 2YV7A 1RW1A 1GSSA 1LBKA 2C8UA 1A0RP 5DQSA 1VF4A 2R37A 3M0FA 4PQ1A 1M2DA 3CXGA 1R5AA 3GNJA 1XCCA 3UL3A 5A4UA 3UVTA 1G0TA 1SVMA 4TR4A 5C00A 3QCPA 4A5PA 2CT6A 2XHFA 2WDUA 1WWJA 2E2MA 5AGYA 1O81A 1JZRA 4JR4A 2GT5A 4KUNA 2HSYA 4G10A 1JLVA 5ELAA 2L4QA 1DSBA 1XPVA 4QL7A 1A23A 3APQA 1HNCA 3CRTA 1THXA 1SVOA 1SKRB 20GSA 4EKZA 1TRVA 3TJFA 3CMIA 2HNLA 5GAPD 5INYA 5IPGA 1U3AA 1A0FA 2V1MA 1G7EA 2PVQA 1G6WA 19GSA 2YN1A 4AJ8A 3HMJG 3VFIA 3FYGA 2YPMA 1TU7A 2V41A 4HQSA 2AUVA 4ISDA 5CRGA 2LJRA 1ERTA 3FZ9A 2YJ7A 1MD4A 1X5CA 2R0PA 1M9AA 3UVHA 3HZ8A 3APSA 3ISOA 4K8MA 3FRCA 3TJBA 2HRAA 4F0BA 3ME8A 1F6MC 3FR3A 1K3YA 2RUFA 3TJKA 1DE2A 1EZKA 3DVXA 2FWGA 2PWJA 3GYKA 1K0BA 2QA2A 5HR2A 4Z2TA 1TK0B 1FB6A 3FMWA 5J4YA 2N5AA 3IBHA 5ECMB 4GCIA 1JFUA 2A2PA 2C3TA 4IQAA 3TOTA 1TU8A 3CSHA 6GSWA 4PNGA 2R0CA 1EEMA 4LL1B 1Z9HA 1HNBA 4NWYA 5CRDA 2I4AA 5J3RA 2K6VA 2R2JA 3IDVA 4ACSA 2H1AA 16GSA 1K0MA 2FD3A 2VKZG 2PVOC 3GH9A 4Q5NA 4YQMA 2OBIA 4PURA 3EMXA 5ENUA 3FK8A 2R3XA 2A4HA 2F3MA 4K7NA 2IMKA 4GSTA 5D9XA 5GAND 2VCZA 2B7KA 3LEFA 2VUPA 3TDGA 4N0VA 2OJLA 1R7HA 3ZFLA 4MDCA 3D21A 3HA9A 2HXKA 3TCOA 4TR1A 3RPPA 1X9SB 4MABA 1R26A 1SK2A 2O85A 3QDNA 5ELGA 4LA1A 1OE7A 4YKFA 2FNOA 1YVLA 3BBYA 2IWTA 3ZIJA 14GSA 1GSFA 1GSUA 4MK3A 2GQMA 5IPHA 4TR1B 1TDIA 1XVQA 1N2AA 4HQZA 3PPUA 5ID2A 1BX9A 1X5DA 3GIXA 5IOWA 1TK5B 5G5FA 4DSRA 3TRPA 4ICYA 1RQMA 3WGDA 1K0AA 4E8HA 1IYHA 2H0IA 2E2GA 1T00A 3TKSA 3FR6A 3GKKA 3S9FA 4O7HA 2B7JA 1GTAA 1PL2A 2VD0A 2JZRA 5ID2B 2P5QA 4O32A 4L8EA 2DJ0A 4MZCA 4WF4A 3A2XA 4O5QA 3MIXA 1PKZA 2RM5A 2DLXA 3CTFA 2C3NA 3HJOA 1MDIA 2AV4A 3ZIVA 2EFEA 3O3TA 1I5GA 4HJ2A 1Y6EA 2L4CA 1HQOA 5IMVA 3HJPA 1TRWA 5COHA 1WRYA 4TR3A 2LRTA 3ZTLA 3IAM2 4K2XA 1GH2A 1OC8A 2YCDA 2JU5A 3HDCA 3GRXA 4FYCA 4IW9A 5KN0A 4V2LA 1U3IA 2VLUA 1VGLA 2R6KA 4O92A 3UOMA 2C0GA 4ECIA 2CV4A 2LQOA 2YZUA 4J57E 3IK9A 3L0HA 5HFKA 4KSMA 1V40A 3KTBA 2AJQB 1XW5A 1WMJA 2KP1A 5HR3A 3AY8A 4V1Ag 4OCFA 7GSSA 1LJRA 3DVWA 4GRFA 3K8NA 1TJDA 5H5RA 1ML6A 4ML6A 5B6MA 4JU5A 2J23A 3EURA 1SJIA 4XRAA 4CY8A 5DAKA 1TTZA 4PNFA 2DJ1A 3DEXA 1SVLA 1XOAA 4ZB9A 2GSTA 2GS3A 4KA0A 1PRXA 1U88A 1HNAA 2O5VA 3HVVA 5IMAA 4D73A 1ILOA 2NTOA 3GKNA 3EE2A 2REMA 2KP2A 5HR1A 1WE0A 2P0GA 2FHEA 4IJ3A 2DJJA 1J08A 2VO4A 4WKWA 1QQ2A 3CYNA 3IC8A 3KJYA 3RPNA 1ERVA 4ZL7A 2OADA 4E68A 2NDOA 4NMUA 4EL1A 1EV4A 2UZ8A 4D73B 3PR8A 3TJJA 4I97A 5JCUA 2WGRA 1K0NA 1OKDA 5AIVA 5GSSA 2G2QA 5IMZA 1F37A 2H70A 3PINA 2AHEA 2QC7A 4MP4A 5CO3A 2ES7A 2H6XA 1XIYA 1BQ7A 3P8WA 4MJAA 4PUFC 1M9BA 1GWCA 1ZYEA 2HSMA 2CX3A 4CY6A 5D93A 1G6YA 2LJKA 4WBRD 5G5EA 1GNEA 2XBQA 3I43A 1X9MB 2HZEA 4Q5FA 4BVXA 5BMUA 4L5OA 4ZBBA 2H76A 2Z9SA 1YDKA 4G19A 2LNSA 1ZGNA 2IIYA 2HSMB 5IIZA 2N5BA 4IBPA 4XCSA 1YKAA 4I8BA 4L0WA 2HZEB 3GV1A 2X8CA 5BMUB 3KGKA 3KIJA 3TKRA 4QMKA 1PD21 3VWWA 4WBJA 2V2GA 2DC5A 5B6NA 4EUYA 4HU7A 5J5NA 1WIKA 5ECQB 5DCHA 3D4MA 1SJ6A 1EV9A 9GSSA 1EGRA 2R4VA 4MZBA 3EU3A 5HFIA 3Q74A 2ZUPA 3KCMA 2H73A 5ECSA 3A2VA 5L71A 6GSXA 1B48A 4IGJA 1KBNA 1DBYA 5ECIB 3TGZA 2UV8G 1BYEA 2OA7A 1NW2A 5KEJA 2HZFA 5HR0A 1F2EA 5H5QA 4V2NA 2E0QA 1X9WB 3F3QA 2YZHA 3RHCA 1Z5YE 2B5YA 3DXBA 4L5LA 1UA5A 2H8LA 5IM9A 1AIUA 2GQLA 4BVYB 3G9BA 2V6KA 4EF0A 3F63A 2LJAA 1BJXA 1YEPA 3EC3A 1ZYQB 3F3RA 1NHOA 3NIVA 3US3A 4HZ4A 5A5KA 2H0HA 4ZL9A 2GDRA 4K7IA 4K5RA 3V1WA 1R5PA 4LLRA 3DKSA 3QAWA 2AYTA 2L6CA 4F03A 2HRNA 4TVEA 2EIOA 1V58A 1TXXA 5D96A 2JZSA 1TOFA 1O85A 1V57A 3CSIA 4JRRA 2L5OA 2YWMA 2CAQA 3H93A 1YJ6A 3M9JA 2RM6A 3BCKA 6GSVA 3GFKA 5CNWA 4I5QA 2MMOA 4GQFA 3H4KA 2H6YA 2HQTA 1AQVA 1F3BA 4EE0A 1GULA 1OC9A 1BG1A 3MNGA 2PN8A 3BOAA 2H0GA 1B4PA 2FWFA 3TUEA 3R3EA 1FOHA 4ECJA 3QMXA 4AGSA 1TW9A 2EIQA 3KEBA 1XXUA 5ECRB 4AI6A 4KH7A 4ZXGA 2F51A 3VWXA 4LMWA 1OC9B 1EGOA 5IO0A 3ZZXA 3NZNA 4I2UA 4RQRA 4F82A 1JLWA 2X8HA 2IMFA 2DIYA 1JZWA 2F9SA 3LW9A 4X4JA 4ZBDA 5AN1A 4FO5A 3L9UA 3CTGA 5A4VA 2VM2A 2EFDA 1GLPA 2VAFA 1SU9A 4EC0A 1C72A 1S3AA 1E2YA 2DSAA 4K0GA 1X5EA 2B5XA 4JZQA 4DSSA 4GWRA 3A5WA 4MPGA 1X0RA 1EOGA 2JL4A 2C0EA 3D5JA 2VM1A 4ID0A 2LS5A 3M1GA 10GSA 4I6XA 4Q5RA 3FW2A 3ZMLA 2HRFA 3GHAA 5FHIA 1T7PB 4MZWA 2IMEA 2BMXA 3HY2A 4OFNA 4MMMA 1T8EB 2HFDA 2H6ZA 4PXOA 1VF2A 1M2BA 4W66A 5IMFA 4DSSB 1FW1A 5F0GA 1TI1A 5JWQB 3NOFA 1GSEA 5DDLA 4Q5QA 1QMVA 3ERWA 4XTSA 4USSA 5F05A 1FHEA 1YEXA 2DKIA 5B7CA 1XZOA 1M99A 2CVDA 4J2FA 2MBTA 2AB6A 4AKXB 1SYXA 4HEA2 2R5GA 1Y25A 4DSQA 5H5SA 2WZ9A 2OE1A 4RI7A 1ZCPA 5JWRB 3VLNA 2K9FA 3IXRA 5F06A 1OVNA 2H71A 2NBSA 1BEDA 4F2IA 4N30A 5CYYA 5E4WA 3CRUA 1PMTA 4JEDA 2I9HA 3UBKA 3FR9A 2E7PA 3TRQA 4ECBA 4KE3A 4YAPA 3ZL5A 2MZCA 5JCGA 1SK0A 1U6TA 5J47A 1EOHA 3QOUA 4MF6A 3ME7A 2MMNA 3IPZA 2OE3A 5ECNB 3P7XA 2GSSA 3HYPA 4IS0A 2LQQA 1GTUA 3F4SA 5G2ZA 3O76A 4MF7A 3GKXA 4QL9A 3KM6A 2DBCA 2IMIA 3Q19A 4ZBAA 4KDXA 4NAXA 5KN1A 3DMLA 5HFGA 2CVKA 1WP0A 4V1Ap 4P3YB 2A2RA 5IMCA 2O87A 4WETA 5FT3A 3P2AA 2RIIA 5D9VA 1ACVA 4YKGA 2EC4A 1ST9A 8GSSA 3BCIA 2L6DA 5FWGA 2GZYA 5EVOA 1FB0A 4O5RA 3KH7A 2XBIA 1A2LA 2HE3A 4O5UA 1YKCA 2CX4A 3FY7A 1KNGA 4OO4A 4IN0A 1YZXA 4ZL8A 5IMDA 4HDEA 3KXOA 3ERFA 2HRKA 1M0UA 4GLTA 1S3CA 2HI7A 2H1LA 1VF1A 4NXIA 2LRCA 5GZZB 2X8GA 3D0ZA 2YP6A 2GSQA 3GN3A 2DJ3A 4POBA 4YQUA 2A4VA 2FWEA 3ZMKA 3J7Yk 5ECPB 5C04A 2HRKB 2JADA 3A2WA 5EL8A 2VL9A 3QFAC 3KP9A 4ILFA 3L9SA 1GNWA 3QFBC 2YWIA 1PX7A 4TKYA 2F8FA 13GSA 1FVKA 3CSJA 2I1UA 4KDUA 3TB2A 3EWLA 2H1GA 2PBJA 1JZOA 2FWHA 1CQHA 3HVXA 1SKSB 2IJYA 3HD5A 2LTKA 4BA7A 4GF0A 1B9XC 1UN2A 1AW9A 1PGTA 4TXOB 4IKHA 2B1LA 4MJCA 3VPQA 4E8EA 4PTSA 3QAGA 1HD2A 3C1SA 3LJRA 2FY6A 2XC2A 2YWOA 2ZCTA 5A5HA 1XW9A 5LCZA 3VWUA 2F8AA 1PQNA 5A1NA 3LG6A 1EP7A 4K2DA 3LXZA 2B5EA 3ZRDA 4OO5A 4AJ7A 2LV3A 1MEKA 3L78A 3L9VA 3G7IA 4KNDA 2TRXA 4KGIA 4MF5A 5LD0A 1A8YA 5BRTA 5A5HB 3F8UA 2MMZA 1GUHA 4CHSA 2A2SA 5A1NB 3IC4A 4IVFA 4N10A 2HSHA 3DYRA 3R2QA 2H1BA 4FH8A 4ECCA 3TU3B 3GTUA 3GMFA 3ZITA 3WGEA 5J9BA 4HJMA 3W8SA 5G1LA 5DVBA 2C4JA 3WT1A 3DGQA 1SKWB 2L5LA 2VL2C 1TRSA 5JCWA 5D9TA 2VCWA 1PN9A 1O73A 1ZL9A 3C8EA 4MH3A 4TR0A 5G30A 3GTUB 1SL0B 3UEMA 3VI7A 2X49A 4IHUA 1RK4A 2KHPA 3C71A 4GDFA 5IOXA 1NM3A 3MSZA 4XRDA 3MDKA 4YAVA 4PGTA 3M9KA 4G0IA 4OFTA 4AF2A 5B8AA 1XOBA 2HYXA 5HQPA 2K8VA 4PQIA 2BTOT 2WCIA 1SL2B 1JZDA 1SJZA 2WJUA 3ED3A 4XS1A 3G7JA 2H01A 2FCHA 2P31A 4Z7XA 4LL4B 1V98A 2EFCA 1BG5A 3JCML 3GX0A 4K5SA 3QPMA 1B4QA 1BF5A 2EIRA 3O6TA 1QFNA 2MYGA 2LEGA 1KEBA 1GTBA 3TKSE 2QA1A 2QGVA 2VCXA 4IELA 2KOKA 4NHWA 3DRNA 3DIEA 3L4NA 4G9HA 4BVYA 1LU4A 1QXHA 3HHVA 3LGCA 4MH2A 1GUMA 4KDYA 1EP8A 3RAZA 1H4OA 1FAAA 3C73A 3F4RA 4L0UA 1PX6A 4WF5A 2M72A 2VD1A 1E6BA 2I3YA 1YQ1A 1Z7RA 2X99A 4IP6A 2ZNMA 4ZB8A 2OKAA 3OR5A 2LSTA 2B3SA 4XS4A 4WR5A 3E9JB 3LSZA 3F9UA 1IYIA 3HZ4A 5B8BA 3M8NA 3EVIA 4EDYA 3GH6A 3LYPA 1EEJA 4G0LA 1ERWA 1XVWA 2YANA 3SBCA 1ZYPA 2GZPA 5DQYA 4HU9A 2CQ9A 2PERA 2YJHA 3KMOA 1T4YA 4XS4B 4G01A 1ON4A 2O89A 2YOIA 3PH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ7 A;  1A2J A;  2VCT A;  5CRE A;  4HS1 A;  1Q98 A;  1TK8 B;  6GSS A;  2QKE A;  4EXJ A;  1M7T A;  2NVL A;  5IQY A;  3FZ5 A;  4DVC A;  1ZOF A;  2PMT A;  1K3O A;  2O7K A;  4K9Z A;  1ZMA A;  1OKT A;  3LFL A;  5CP1 A;  1AQW A;  2VOC A;  3IOS A;  2C0D A;  1QK8 A;  4TXV A;  3J7Y b;  4GXZ A;  4N11 A;  4X43 A;  5ECK B;  1F9M A;  3A3T A;  5CRW A;  1HYU A;  1XFL A;  4KF9 A;  3H79 A;  1YF0 A;  1YF1 A;  3RDW A;  22GS A;  1K0C A;  1XWA A;  4IQ1 A;  5F8B A;  1WPI A;  5J9C A;  2HT9 A;  4F0C A;  1EWX A;  1PL1 A;  1AAZ A;  4ML1 A;  1TKD B;  1XW6 A;  3IV4 A;  6GSU A;  1J0F A;  5D9W A;  2V32 A;  1SD8 A;  2MMA A;  2C3Q A;  2J9H A;  3P90 A;  11GS A;  1QUW A;  3W8J A;  2LNT A;  3G7Y A;  3HVS A;  1GRX A;  1R4W A;  4K0N A;  1W89 A;  3VPT A;  1KTE A;  5LNK e;  3UAP A;  2JSZ A;  5E59 A;  3Q6O A;  1UC7 A;  4F9Z A;  6GST A;  3EU4 A;  4EVM A;  5J4U A;  3DWV A;  5G1K A;  4MCU A;  1ERU A;  3F4T A;  1XWG A;  4EDZ A;  2FA8 A;  1K0O A;  3TKS C;  1T1V A;  4KCA A;  5DAL A;  1MDJ A;  4NV5 A;  3GUR A;  4FQU A;  1O6J A;  3LOR A;  1AXD A;  2CA8 A;  4PQH A;  2WFC A;  5GST A;  3FZ4 A;  4MA9 A;  4JBB A;  4CDO A;  2GSR A;  4TOP A;  3GX8 A;  1SK1 A;  4X0X A;  3ZVJ A;  2JAC A;  4JR6 A;  5DAL B;  1GL8 A;  1PKW A;  4MJB A;  4POK A;  2IMD A;  3QAV A;  2WRT A;  2NPB A;  3IK7 A;  3KP8 A;  4KW6 A;  4TW5 A;  2QSI A;  3FHK A;  1O7U A;  1OC3 A;  5CRH A;  3UAR A;  2DML A;  3VUR A;  4HOJ A;  4BWS A;  4ZIJ A;  2VCQ A;  4BWQ A;  4ZIL A;  2DIZ A;  2PPT A;  4XHM A;  2YNX A;  2CZ2 A;  2TRC P;  1B9Y C;  4OMV A;  3WYW A;  2GZZ A;  4EO3 A;  4HUA A;  2CAI A;  2O8V B;  1T3B A;  5DBQ A;  1ABA A;  2IL3 A;  1M2A A;  1NHY A;  3LWA A;  2FUG 2;  4FYB A;  2JZT A;  1Z3E A;  3N5O A;  4RI6 A;  2VLT A;  4RQX A;  2GQK A;  4MPF A;  4TN8 A;  1SYR A;  3DD3 A;  12GS A;  3D22 A;  2V6O A;  2AAW A;  4KB3 A;  1CQG A;  2C0F A;  1Z6M A;  18GS A;  1XWK A;  1GUK A;  5JWO B;  2K18 A;  1GSQ A;  5EY6 A;  5KN2 A;  4KCE A;  5D73 A;  1V9W A;  3TJG A;  3LXT A;  3MWH A;  3F6F A;  1MTC A;  2RLI A;  2IFQ A;  3WD6 A;  1O8W A;  2L59 A;  3F6D A;  4GSS A;  2C1Y A;  2C80 A;  3E3E A;  4K6X A;  4POL A;  3GST A;  1USB A;  2GGT A;  3E0U A;  4GSN A;  2XPD A;  1K3L A;  4PX1 A;  3EIN A;  3VWV A;  5CAX A;  5AIS A;  4BL7 A;  4G0K A;  2ALB A;  1Z7P A;  2YV9 A;  1MD3 A;  5G31 A;  2H72 A;  2IFQ B;  4OCE A;  3C1R A;  2H75 A;  4TXO A;  3W6G A;  2PUK C;  1UVZ A;  2H30 A;  3WT2 A;  3FEU A;  4N0Z A;  2H66 A;  1JHB A;  3ZLP A;  3KTL A;  3UBL A;  4BL7 B;  5EPF A;  2GVP A;  3TRX A;  1FG4 A;  3KH9 A;  4H86 A;  3Q18 A;  1O8X A;  4FIW A;  1FO5 A;  3QR6 A;  2N5F A;  2HLS A;  3KD0 A;  1N8J A;  1FOV A;  1ZZY A;  4GQC A;  1SL1 B;  2YWN A;  3HXS A;  3HJM A;  1YY7 A;  3RHB A;  3IRA A;  2FGX A;  2RUE A;  4AJ6 A;  4OWY A;  1W4V A;  4G2E A;  2LRN A;  3U5R E;  1DE1 A;  2H19 A;  2FLS A;  5F07 A;  2PGT A;  3GSS A;  17GS A;  2BJX A;  2KUC A;  4LMV A;  2VCV A;  4PUA A;  5D8I A;  1TP9 A;  1PSQ A;  3C7M A;  4KAE A;  3SWL A;  4WXT A;  1THO A;  2VLV A;  3BJ5 A;  4MLY A;  2L57 A;  3FZA A;  3PGT A;  2VIM A;  3I9V 2;  5DAK B;  1VRS D;  5A4W A;  2JSY A;  4HZ2 A;  1A2M A;  1OE8 A;  4YH2 A;  6GSY A;  4MJE A;  1A24 A;  1J9B A;  3HKR A;  4IP1 A;  1S3D A;  1T4Z A;  2G0F A;  3KMN A;  4WEY A;  2I81 A;  2IN3 A;  2ON5 A;  4TRX A;  3GL3 A;  4XS6 A;  3TKQ A;  3WGX A;  2P5R A;  2X64 A;  4BPY A;  4K7O A;  4FYU A;  4OD7 A;  2FA4 A;  3HCZ A;  4HI7 A;  1NSW A;  2VL3 A;  3QD9 A;  3UIW A;  1BAY A;  4X1U A;  3GKM A;  3IAS 2;  1A8L A;  1DUG A;  4KX4 A;  5ECO B;  3GA4 A;  3ZYW A;  2WB9 A;  3ZVJ D;  3M3M A;  2D2Z A;  1I9D A;  3VK9 A;  3APO A;  2M80 A;  4RUV A;  2K8S A;  2CZ3 A;  5ABR A;  2LKU A;  2IPA A;  5DJL A;  2OAC A;  1VF3 A;  4XIH A;  1TI3 A;  1MDK A;  3IHQ A;  3LYK A;  1WJK A;  4NPB A;  2CVB A;  1GTI A;  2TIR A;  5IO2 A;  2DJK A;  3BD2 A;  4V2M A;  2OBK A;  2WS2 A;  1XWB A;  2XPE A;  3CBU A;  1F3A A;  4BVX B;  3KZQ A;  2WUL A;  2MBS A;  3ERG A;  4IJI A;  3UMA A;  4GTU A;  1WOU A;  5DJM A;  3ZFB A;  3ZRE A;  4QQ7 A;  2H74 A;  3GUS A;  3EYT A;  1PA3 A;  1SD9 A;  4I2T A;  1XBS A;  1Q4J A;  3D4T A;  1AC1 A;  4ZB6 A;  1B8X A;  5ECL B;  4OFM A;  2DJ2 A;  1QGV A;  1GSY A;  1SEN A;  3EMP A;  4ULX A;  4NHZ A;  3TOU A;  3RBT A;  3U6V A;  5DCG A;  3F0I A;  2GTU A;  3N9J A;  2M46 A;  4JE1 A;  5ECH B;  2GLR A;  4NV2 A;  3MAK A;  5J41 A;  2B6M A;  1GLQ A;  4KSO A;  4WR4 A;  1H75 A;  2HSN B;  3IA1 A;  4K1F A;  1GP1 A;  1V2A A;  3H8Q A;  3GL5 A;  3H1N A;  1K0D A;  1Z6N A;  1G7O A;  3VI5 A;  5AIX A;  4YQV A;  2DMM A;  1AUC A;  2B1K A;  4DEJ A;  2OE0 A;  3I69 A;  3TKP A;  3IR4 A;  5KN3 A;  1FVJ A;  2LUS A;  3D6I A;  1OYJ A;  4CW9 A;  2VL2 A;  4J56 E;  2ON7 A;  2H1D A;  1TRU A;  3IE3 A;  1AQX A;  1OAZ A;  1URM A;  1XWC A;  2GT6 A;  1GSD A;  3I6A A;  2PU9 C;  3UJ1 A;  3FKF A;  1U87 A;  4POM A;  2KLX A;  2YV7 A;  1RW1 A;  1GSS A;  1LBK A;  2C8U A;  1A0R P;  5DQS A;  1VF4 A;  2R37 A;  3M0F A;  4PQ1 A;  1M2D A;  3CXG A;  1R5A A;  3GNJ A;  1XCC A;  3UL3 A;  5A4U A;  3UVT A;  1G0T A;  4TR4 A;  5C00 A;  3QCP A;  2CT6 A;  2XHF A;  2WDU A;  1WWJ A;  2E2M A;  5AGY A;  1O81 A;  1JZR A;  4JR4 A;  2GT5 A;  4KUN A;  2HSY A;  4G10 A;  1JLV A;  5ELA A;  2L4Q A;  1DSB A;  1XPV A;  4QL7 A;  1A23 A;  3APQ A;  1HNC A;  3CRT A;  1THX A;  1SKR B;  20GS A;  4EKZ A;  1TRV A;  3TJF A;  3CMI A;  2HNL A;  5GAP D;  5INY A;  5IPG A;  1U3A A;  1A0F A;  2V1M A;  1G7E A;  2PVQ A;  1G6W A;  19GS A;  2YN1 A;  4AJ8 A;  3VFI A;  3FYG A;  2YPM A;  1TU7 A;  2V41 A;  4HQS A;  2AUV A;  4ISD A;  5CRG A;  2LJR A;  1ERT A;  3FZ9 A;  2YJ7 A;  1MD4 A;  1X5C A;  1M9A A;  3UVH A;  3HZ8 A;  3APS A;  3ISO A;  4K8M A;  3FRC A;  3TJB A;  2HRA A;  4F0B A;  3ME8 A;  1F6M C;  3FR3 A;  1K3Y A;  2RUF A;  3TJK A;  1DE2 A;  1EZK A;  3DVX A;  2FWG A;  2PWJ A;  1K0B A;  3GYK A;  5HR2 A;  1TK0 B;  1FB6 A;  2N5A A;  3IBH A;  5ECM B;  4GCI A;  1JFU A;  2C3T A;  4IQA A;  3TOT A;  1TU8 A;  3CSH A;  6GSW A;  4PNG A;  1EEM A;  4LL1 B;  1Z9H A;  1HNB A;  4NWY A;  5CRD A;  2I4A A;  5J3R A;  2K6V A;  2R2J A;  3IDV A;  4ACS A;  2H1A A;  16GS A;  1K0M A;  2FD3 A;  2PVO C;  3GH9 A;  4Q5N A;  4YQM A;  2OBI A;  4PUR A;  3EMX A;  5ENU A;  3FK8 A;  2R3X A;  2F3M A;  4K7N A;  2IMK A;  4GST A;  5D9X A;  5GAN D;  2VCZ A;  2B7K A;  3LEF A;  2VUP A;  3TDG A;  4N0V A;  2OJL A;  1R7H A;  3ZFL A;  4MDC A;  3D21 A;  3HA9 A;  2HXK A;  3TCO A;  4TR1 A;  3RPP A;  1X9S B;  4MAB A;  1R26 A;  1SK2 A;  2O85 A;  3QDN A;  5ELG A;  4LA1 A;  1OE7 A;  2FNO A;  3BBY A;  2IWT A;  3ZIJ A;  14GS A;  1GSF A;  1GSU A;  4MK3 A;  2GQM A;  5IPH A;  4TR1 B;  1TDI A;  1XVQ A;  1N2A A;  4HQZ A;  3PPU A;  5ID2 A;  1BX9 A;  1X5D A;  3GIX A;  5IOW A;  1TK5 B;  5G5F A;  4DSR A;  3TRP A;  1RQM A;  3WGD A;  1K0A A;  4E8H A;  1IYH A;  2H0I A;  2E2G A;  1T00 A;  3TKS A;  3FR6 A;  3GKK A;  3S9F A;  4O7H A;  2B7J A;  1GTA A;  1PL2 A;  2VD0 A;  2JZR A;  5ID2 B;  2P5Q A;  4O32 A;  4L8E A;  2DJ0 A;  4MZC A;  4WF4 A;  3A2X A;  1PKZ A;  2RM5 A;  2DLX A;  3CTF A;  2C3N A;  3HJO A;  1MDI A;  2AV4 A;  3ZIV A;  3O3T A;  1I5G A;  4HJ2 A;  1Y6E A;  2L4C A;  1HQO A;  5IMV A;  3HJP A;  1TRW A;  5COH A;  1WRY A;  4TR3 A;  2LRT A;  3ZTL A;  3IAM 2;  1GH2 A;  1OC8 A;  2YCD A;  2JU5 A;  3HDC A;  3GRX A;  4FYC A;  4IW9 A;  5KN0 A;  4V2L A;  1U3I A;  2VLU A;  1VGL A;  2R6K A;  4O92 A;  3UOM A;  2C0G A;  4ECI A;  2CV4 A;  2LQO A;  2YZU A;  4J57 E;  3IK9 A;  3L0H A;  5HFK A;  4KSM A;  1V40 A;  3KTB A;  2AJQ B;  1XW5 A;  1WMJ A;  2KP1 A;  5HR3 A;  3AY8 A;  4V1A g;  4OCF A;  7GSS A;  1LJR A;  3DVW A;  4GRF A;  3K8N A;  1TJD A;  5H5R A;  1ML6 A;  4ML6 A;  5B6M A;  4JU5 A;  2J23 A;  3EUR A;  1SJI A;  4XRA A;  5DAK A;  1TTZ A;  4PNF A;  2DJ1 A;  3DEX A;  1XOA A;  4ZB9 A;  2GST A;  2GS3 A;  4KA0 A;  1PRX A;  1U88 A;  1HNA A;  3HVV A;  5IMA A;  4D73 A;  1ILO A;  2NTO A;  3GKN A;  3EE2 A;  2REM A;  2KP2 A;  5HR1 A;  1WE0 A;  2P0G A;  2FHE A;  4IJ3 A;  2DJJ A;  1J08 A;  2VO4 A;  4WKW A;  1QQ2 A;  3CYN A;  3IC8 A;  3KJY A;  3RPN A;  1ERV A;  4ZL7 A;  2OAD A;  2NDO A;  4NMU A;  4EL1 A;  1EV4 A;  2UZ8 A;  4D73 B;  3PR8 A;  3TJJ A;  4I97 A;  5JCU A;  2WGR A;  1K0N A;  1OKD A;  5AIV A;  5GSS A;  2G2Q A;  5IMZ A;  1F37 A;  2H70 A;  3PIN A;  2AHE A;  2QC7 A;  4MP4 A;  5CO3 A;  2ES7 A;  2H6X A;  1XIY A;  1BQ7 A;  3P8W A;  4MJA A;  4PUF C;  1M9B A;  1GWC A;  1ZYE A;  2HSM A;  2CX3 A;  5D93 A;  1G6Y A;  2LJK A;  4WBR D;  5G5E A;  1GNE A;  2XBQ A;  3I43 A;  1X9M B;  2HZE A;  4Q5F A;  4BVX A;  5BMU A;  4L5O A;  4ZBB A;  2H76 A;  2Z9S A;  1YDK A;  4G19 A;  2LNS A;  1ZGN A;  2IIY A;  2HSM B;  5IIZ A;  2N5B A;  4IBP A;  4XCS A;  1YKA A;  4I8B A;  4L0W A;  2HZE B;  3GV1 A;  2X8C A;  3KGK A;  3KIJ A;  3TKR A;  1PD2 1;  3VWW A;  4WBJ A;  2V2G A;  2DC5 A;  5B6N A;  4EUY A;  4HU7 A;  5J5N A;  1WIK A;  5ECQ B;  5DCH A;  3D4M A;  1SJ6 A;  1EV9 A;  9GSS A;  1EGR A;  2R4V A;  4MZB A;  3EU3 A;  5HFI A;  3Q74 A;  2ZUP A;  3KCM A;  2H73 A;  5ECS A;  3A2V A;  5L71 A;  6GSX A;  1B48 A;  4IGJ A;  1KBN A;  1DBY A;  5ECI B;  3TGZ A;  1BYE A;  2OA7 A;  1NW2 A;  5KEJ A;  2HZF A;  5HR0 A;  1F2E A;  5H5Q A;  4V2N A;  2E0Q A;  1X9W B;  3F3Q A;  2YZH A;  3RHC A;  1Z5Y E;  2B5Y A;  3DXB A;  4L5L A;  1UA5 A;  2H8L A;  5IM9 A;  1AIU A;  2GQL A;  4BVY B;  3G9B A;  2V6K A;  4EF0 A;  3F63 A;  2LJA A;  1BJX A;  1YEP A;  3EC3 A;  1ZYQ B;  3F3R A;  1NHO A;  3NIV A;  3US3 A;  4HZ4 A;  5A5K A;  2H0H A;  4ZL9 A;  2GDR A;  4K7I A;  3V1W A;  1R5P A;  4LLR A;  3DKS A;  3QAW A;  2AYT A;  2L6C A;  4F03 A;  2HRN A;  4TVE A;  2EIO A;  1V58 A;  1TXX A;  5D96 A;  2JZS A;  1TOF A;  1O85 A;  1V57 A;  3CSI A;  4JRR A;  2L5O A;  2YWM A;  2CAQ A;  3H93 A;  1YJ6 A;  3M9J A;  2RM6 A;  3BCK A;  6GSV A;  3GFK A;  5CNW A;  4I5Q A;  4GQF A;  2MMO A;  3H4K A;  2H6Y A;  2HQT A;  1AQV A;  1F3B A;  4EE0 A;  1GUL A;  1OC9 A;  3MNG A;  2PN8 A;  3BOA A;  2H0G A;  1B4P A;  2FWF A;  3TUE A;  3R3E A;  4ECJ A;  3QMX A;  4AGS A;  1TW9 A;  2EIQ A;  3KEB A;  1XXU A;  5ECR B;  4KH7 A;  4ZXG A;  2F51 A;  3VWX A;  4LMW A;  1OC9 B;  1EGO A;  5IO0 A;  3ZZX A;  3NZN A;  4I2U A;  4RQR A;  4F82 A;  1JLW A;  2X8H A;  2IMF A;  2DIY A;  1JZW A;  2F9S A;  4ZBD A;  5AN1 A;  4FO5 A;  3L9U A;  3CTG A;  5A4V A;  2VM2 A;  1GLP A;  2VAF A;  1SU9 A;  4EC0 A;  1C72 A;  1S3A A;  1E2Y A;  2DSA A;  4K0G A;  1X5E A;  2B5X A;  4JZQ A;  4DSS A;  4GWR A;  3A5W A;  4MPG A;  1X0R A;  1EOG A;  2JL4 A;  2C0E A;  3D5J A;  2VM1 A;  4ID0 A;  2LS5 A;  3M1G A;  10GS A;  4I6X A;  4Q5R A;  3FW2 A;  3ZML A;  2HRF A;  3GHA A;  5FHI A;  1T7P B;  4MZW A;  2IME A;  2BMX A;  3HY2 A;  4OFN A;  4MMM A;  1T8E B;  2HFD A;  2H6Z A;  4PXO A;  1VF2 A;  1M2B A;  5IMF A;  4DSS B;  1FW1 A;  5F0G A;  1TI1 A;  5JWQ B;  3NOF A;  1GSE A;  5DDL A;  4Q5Q A;  1QMV A;  3ERW A;  4XTS A;  4USS A;  5F05 A;  1FHE A;  1YEX A;  5B7C A;  1XZO A;  1M99 A;  2CVD A;  4J2F A;  2MBT A;  2AB6 A;  1SYX A;  4HEA 2;  2R5G A;  1Y25 A;  4DSQ A;  5H5S A;  2WZ9 A;  2OE1 A;  4RI7 A;  1ZCP A;  5JWR B;  3VLN A;  2K9F A;  3IXR A;  5F06 A;  1OVN A;  2H71 A;  2NBS A;  1BED A;  4F2I A;  4N30 A;  5CYY A;  5E4W A;  3CRU A;  1PMT A;  4JED A;  2I9H A;  3UBK A;  3FR9 A;  2E7P A;  3TRQ A;  4ECB A;  4KE3 A;  4YAP A;  3ZL5 A;  2MZC A;  5JCG A;  1SK0 A;  1U6T A;  3QOU A;  1EOH A;  4MF6 A;  3ME7 A;  2MMN A;  3IPZ A;  2OE3 A;  5ECN B;  3P7X A;  2GSS A;  3HYP A;  4IS0 A;  2LQQ A;  1GTU A;  3F4S A;  5G2Z A;  3O76 A;  4MF7 A;  3GKX A;  4QL9 A;  3KM6 A;  2DBC A;  2IMI A;  3Q19 A;  4ZBA A;  4KDX A;  4NAX A;  5KN1 A;  3DML A;  5HFG A;  2CVK A;  1WP0 A;  4V1A p;  4P3Y B;  2A2R A;  5IMC A;  2O87 A;  4WET A;  5FT3 A;  3P2A A;  2RII A;  5D9V A;  1ACV A;  2EC4 A;  1ST9 A;  8GSS A;  3BCI A;  2L6D A;  5FWG A;  2GZY A;  5EVO A;  1FB0 A;  4O5R A;  3KH7 A;  2XBI A;  1A2L A;  2HE3 A;  1YKC A;  2CX4 A;  3FY7 A;  1KNG A;  4OO4 A;  4IN0 A;  1YZX A;  4ZL8 A;  5IMD A;  4HDE A;  3KXO A;  3ERF A;  2HRK A;  1M0U A;  4GLT A;  1S3C A;  2HI7 A;  1VF1 A;  4NXI A;  2LRC A;  5GZZ B;  2X8G A;  3D0Z A;  2YP6 A;  2GSQ A;  3GN3 A;  2DJ3 A;  4POB A;  4YQU A;  2A4V A;  2FWE A;  3ZMK A;  3J7Y k;  5ECP B;  5C04 A;  2HRK B;  2JAD A;  3A2W A;  5EL8 A;  2VL9 A;  3QFA C;  3KP9 A;  4ILF A;  3L9S A;  1GNW A;  3QFB C;  2YWI A;  1PX7 A;  4TKY A;  2F8F A;  13GS A;  1FVK A;  3CSJ A;  2I1U A;  4KDU A;  3TB2 A;  3EWL A;  2H1G A;  2PBJ A;  1JZO A;  2FWH A;  1CQH A;  3HVX A;  1SKS B;  2IJY A;  3HD5 A;  2LTK A;  4BA7 A;  4GF0 A;  1B9X C;  1UN2 A;  1AW9 A;  1PGT A;  4TXO B;  4IKH A;  2B1L A;  4MJC A;  3VPQ A;  4E8E A;  4PTS A;  3QAG A;  1HD2 A;  3C1S A;  3LJR A;  2FY6 A;  2XC2 A;  2YWO A;  2ZCT A;  1XW9 A;  5LCZ A;  3VWU A;  2F8A A;  1PQN A;  3LG6 A;  1EP7 A;  4K2D A;  3LXZ A;  2B5E A;  3ZRD A;  4OO5 A;  4AJ7 A;  2LV3 A;  1MEK A;  3L78 A;  3L9V A;  3G7I A;  4KND A;  2TRX A;  4KGI A;  4MF5 A;  5LD0 A;  1A8Y A;  3F8U A;  2MMZ A;  1GUH A;  4CHS A;  2A2S A;  3IC4 A;  4IVF A;  4N10 A;  2HSH A;  3DYR A;  3R2Q A;  2H1B A;  4FH8 A;  4ECC A;  3GTU A;  3GMF A;  3ZIT A;  3WGE A;  5J9B A;  4HJM A;  3W8S A;  5G1L A;  5DVB A;  2C4J A;  3WT1 A;  3DGQ A;  1SKW B;  2L5L A;  2VL2 C;  1TRS A;  5JCW A;  5D9T A;  2VCW A;  1PN9 A;  1O73 A;  1ZL9 A;  3C8E A;  4MH3 A;  4TR0 A;  5G30 A;  3GTU B;  1SL0 B;  3UEM A;  3VI7 A;  4IHU A;  1RK4 A;  2KHP A;  3C71 A;  5IOX A;  1NM3 A;  3MSZ A;  4XRD A;  3MDK A;  4YAV A;  4PGT A;  3M9K A;  4G0I A;  4OFT A;  4AF2 A;  5B8A A;  1XOB A;  2HYX A;  5HQP A;  2K8V A;  4PQI A;  2BTO T;  2WCI A;  1SL2 B;  1JZD A;  1SJZ A;  2WJU A;  3ED3 A;  4XS1 A;  3G7J A;  2H01 A;  2FCH A;  2P31 A;  4Z7X A;  4LL4 B;  1V98 A;  1BG5 A;  3JCM L;  3GX0 A;  3QPM A;  1B4Q A;  2EIR A;  3O6T A;  1QFN A;  2MYG A;  2LEG A;  1KEB A;  1GTB A;  3TKS E;  2QGV A;  2VCX A;  4IEL A;  2KOK A;  4NHW A;  3DRN A;  3DIE A;  3L4N A;  4G9H A;  4BVY A;  1LU4 A;  1QXH A;  3HHV A;  3LGC A;  4MH2 A;  1GUM A;  4KDY A;  1EP8 A;  3RAZ A;  1H4O A;  1FAA A;  3C73 A;  3F4R A;  4L0U A;  1PX6 A;  4WF5 A;  2M72 A;  2VD1 A;  1E6B A;  2I3Y A;  1YQ1 A;  1Z7R A;  2X99 A;  4IP6 A;  2ZNM A;  4ZB8 A;  2OKA A;  3OR5 A;  2LST A;  2B3S A;  4XS4 A;  4WR5 A;  3E9J B;  3LSZ A;  3F9U A;  1IYI A;  3HZ4 A;  5B8B A;  3M8N A;  3EVI A;  4EDY A;  3GH6 A;  3LYP A;  1EEJ A;  4G0L A;  1ERW A;  1XVW A;  2YAN A;  3SBC A;  2GZP A;  5DQY A;  4HU9 A;  2CQ9 A;  2PER A;  2YJH A;  3KMO A;  1T4Y A;  4XS4 B;  1ON4 A;  2O89 A;  2YOI A;  3PH9 A; 
#chains in the Genus database with same CATH topology
 3LQ7 A;  1A2J A;  2VCT A;  5CRE A;  4HS1 A;  1Q98 A;  1TK8 B;  6GSS A;  2QKE A;  4EXJ A;  1M7T A;  2NVL A;  5IQY A;  3FZ5 A;  4DVC A;  1S3R A;  1ZOF A;  2PMT A;  1K3O A;  2O7K A;  4K9Z A;  1ZMA A;  1OKT A;  3LFL A;  5CP1 A;  1AQW A;  2VOC A;  3IOS A;  2C0D A;  5J4V A;  1QK8 A;  4TXV A;  3J7Y b;  4GXZ A;  4N11 A;  4X43 A;  5ECK B;  1F9M A;  3A3T A;  5CRW A;  1HYU A;  1XFL A;  4KF9 A;  3H79 A;  1YF0 A;  1YF1 A;  4Z2R A;  3RDW A;  22GS A;  1K0C A;  1XWA A;  4IQ1 A;  5F8B A;  1WPI A;  5J9C A;  2HT9 A;  4F0C A;  1EWX A;  1PL1 A;  1AAZ A;  4ML1 A;  1TKD B;  2WW2 A;  1XW6 A;  3IV4 A;  6GSU A;  1J0F A;  5D9W A;  2V32 A;  2O36 A;  1SD8 A;  2MMA A;  2C3Q A;  2J9H A;  3P90 A;  11GS A;  1QUW A;  3W8J A;  2LNT A;  3G7Y A;  3HVS A;  1GRX A;  1R4W A;  4K0N A;  1W89 A;  3VPT A;  1KTE A;  5LNK e;  3UAP A;  2JSZ A;  5E59 A;  3Q6O A;  1UC7 A;  4F9Z A;  6GST A;  3EU4 A;  2X4A A;  4EVM A;  5J4U A;  3DWV A;  5G1K A;  4MCU A;  1ERU A;  3F4T A;  1XWG A;  4EDZ A;  2FA8 A;  1K0O A;  4Z2U A;  3RGB C;  3TKS C;  1T1V A;  4KCA A;  5DAL A;  1MDJ A;  4NV5 A;  3GUR A;  4FQU A;  1O6J A;  3LOR A;  1AXD A;  2CA8 A;  4PQH A;  2WFC A;  5GST A;  3FZ4 A;  4MA9 A;  4JBB A;  4CDO A;  2GSR A;  4TOP A;  3GX8 A;  1SK1 A;  4X0X A;  3ZVJ A;  2JAC A;  4JR6 A;  4EIQ A;  5DAL B;  1GL8 A;  1PKW A;  3A5I A;  4MJB A;  4POK A;  2IMD A;  3QAV A;  2WRT A;  2NPB A;  3IK7 A;  3KP8 A;  4KW6 A;  4TW5 A;  2QSI A;  3FHK A;  1O7U A;  1OC3 A;  5CRH A;  5A34 A;  3UAR A;  3EPT A;  2DML A;  3VUR A;  4HOJ A;  4BWS A;  4ZIJ A;  2VCQ A;  4BWQ A;  4ZIL A;  2DIZ A;  2PPT A;  4XHM A;  2YNX A;  2CZ2 A;  2TRC P;  1B9Y C;  4OMV A;  3WYW A;  2GZZ A;  4EO3 A;  4HUA A;  5A34 B;  2CAI A;  2O8V B;  1T3B A;  5DBQ A;  1N25 A;  1ABA A;  2IL3 A;  1M2A A;  1NHY A;  4AKG A;  3LWA A;  2FUG 2;  4FYB A;  2JZT A;  1Z3E A;  3N5O A;  4RI6 A;  2VLT A;  4RQX A;  2GQK A;  4MPF A;  4TN8 A;  1SYR A;  3DD3 A;  12GS A;  3D22 A;  2V6O A;  2AAW A;  4KB3 A;  4AKH A;  1CQG A;  2C0F A;  1Z6M A;  18GS A;  1XWK A;  1GUK A;  5JWO B;  2K18 A;  1GSQ A;  5EY6 A;  5KN2 A;  4KCE A;  5D73 A;  1V9W A;  3TJG A;  3LXT A;  5J40 A;  3MWH A;  3F6F A;  1MTC A;  2RLI A;  2IFQ A;  3WD6 A;  1O8W A;  2L59 A;  3F6D A;  4GSS A;  2C1Y A;  2C80 A;  3E3E A;  4K6X A;  4POL A;  2O3E A;  3GST A;  1USB A;  2GGT A;  3E0U A;  4GSN A;  2XPD A;  1K3L A;  4PX1 A;  3EIN A;  3VWV A;  5CAX A;  5AIS A;  4ZB7 A;  3MYD A;  4BL7 A;  4G0K A;  2ALB A;  1Z7P A;  2YV9 A;  1MD3 A;  5G31 A;  2H72 A;  2IFQ B;  4OCE A;  3C1R A;  2H75 A;  1ZYN A;  4TXO A;  3W6G A;  2PUK C;  1UVZ A;  2H30 A;  3WT2 A;  3FEU A;  4N0Z A;  2H66 A;  1JHB A;  2WW0 A;  3ZLP A;  3KTL A;  3UBL A;  4BL7 B;  5EPF A;  2GVP A;  3TRX A;  1FG4 A;  3KH9 A;  4H86 A;  3Q18 A;  1O8X A;  4FIW A;  1FO5 A;  3QR6 A;  2N5F A;  2HLS A;  3KD0 A;  1N8J A;  1FOV A;  1ZZY A;  4GQC A;  1SL1 B;  2YWN A;  3HXS A;  3HJM A;  1YY7 A;  3RHB A;  3IRA A;  2FGX A;  2RUE A;  4AJ6 A;  4OWY A;  1W4V A;  4G2E A;  2LRN A;  3U5R E;  1DE1 A;  2H19 A;  2FLS A;  5F07 A;  2PGT A;  3GSS A;  17GS A;  1PN0 A;  2BJX A;  2KUC A;  2OT3 A;  4LMV A;  2VCV A;  4PUA A;  5D8I A;  1TP9 A;  1PSQ A;  3C7M A;  4KAE A;  3SWL A;  4WXT A;  1THO A;  2VLV A;  3BJ5 A;  4MLY A;  2L57 A;  3FZA A;  3PGT A;  2VIM A;  3I9V 2;  5DAK B;  1VRS D;  5A4W A;  2JSY A;  4HZ2 A;  1A2M A;  1OE8 A;  4YH2 A;  6GSY A;  4MJE A;  1TXU A;  1A24 A;  1J9B A;  3HKR A;  4IP1 A;  1S3D A;  1T4Z A;  2G0F A;  3KMN A;  4WEY A;  2I81 A;  2IN3 A;  5KOX A;  2ON5 A;  4TRX A;  3GL3 A;  4XS6 A;  3TKQ A;  3WGX A;  2P5R A;  2X64 A;  4BPY A;  4K7O A;  4FYU A;  4OD7 A;  2FA4 A;  3HCZ A;  4HI7 A;  1NSW A;  2VL3 A;  3QD9 A;  4MNN A;  3UIW A;  1BAY A;  4X1U A;  3GKM A;  3IAS 2;  1A8L A;  1DUG A;  4KX4 A;  4PI2 C;  5ECO B;  3GA4 A;  3ZYW A;  2WB9 A;  3ZVJ D;  3M3M A;  2D2Z A;  1I9D A;  3VK9 A;  3IHG A;  3APO A;  2M80 A;  4RUV A;  2K8S A;  2CZ3 A;  5ABR A;  2LKU A;  2IPA A;  5DJL A;  2OAC A;  1VF3 A;  4XIH A;  1TI3 A;  1MDK A;  3IHQ A;  3LYK A;  1WJK A;  1XG8 A;  4NPB A;  2CVB A;  1GTI A;  2TIR A;  5IO2 A;  2DJK A;  3BD2 A;  4V2M A;  2OBK A;  2WS2 A;  1XWB A;  2XPE A;  3CBU A;  1F3A A;  4BVX B;  3KZQ A;  2WUL A;  2R0G A;  2DKH A;  2MBS A;  3ERG A;  4IJI A;  3UMA A;  4GTU A;  1WOU A;  5DJM A;  2EFH A;  3ZFB A;  3ZRE A;  2H74 A;  4QQ7 A;  3GUS A;  3EYT A;  1PA3 A;  1SD9 A;  5KOW A;  4I2T A;  1XBS A;  1Q4J A;  2HSN A;  3D4T A;  1Y1U A;  1AC1 A;  4ZB6 A;  1B8X A;  5ECL B;  4OFM A;  2DJ2 A;  1QGV A;  1GSY A;  1SEN A;  3EMP A;  4ULX A;  4NHZ A;  3TOU A;  3RBT A;  3U6V A;  5DCG A;  3F0I A;  2GTU A;  4EIP A;  3N9J A;  2M46 A;  4JE1 A;  5ECH B;  4AKI A;  2GLR A;  4NV2 A;  3MAK A;  5J41 A;  2B6M A;  3CWG A;  1GLQ A;  4KSO A;  4WR4 A;  1H75 A;  2HSN B;  3IA1 A;  4K1F A;  1GP1 A;  1V2A A;  3H8Q A;  3GL5 A;  3H1N A;  4N3Z A;  1K0D A;  2WVX A;  1Z6N A;  1G7O A;  3VI5 A;  5AIX A;  4YQV A;  2DMM A;  1AUC A;  2B1K A;  4DEJ A;  2OE0 A;  3I69 A;  3TKP A;  3IR4 A;  5KN3 A;  1FVJ A;  2LUS A;  3D6I A;  1OYJ A;  4CW9 A;  2VL2 A;  4J56 E;  2ON7 A;  2H1D A;  1TRU A;  3IE3 A;  1AQX A;  1OAZ A;  1URM A;  1XWC A;  2GT6 A;  1GSD A;  3I6A A;  2PU9 C;  3UJ1 A;  2WVX B;  3FKF A;  1U87 A;  4POM A;  2KLX A;  2YV7 A;  1RW1 A;  1GSS A;  1LBK A;  2C8U A;  1A0R P;  5DQS A;  1VF4 A;  2R37 A;  3M0F A;  4PQ1 A;  1M2D A;  3CXG A;  1R5A A;  3GNJ A;  1XCC A;  3UL3 A;  5A4U A;  3UVT A;  1G0T A;  1SVM A;  4TR4 A;  5C00 A;  3QCP A;  4A5P A;  2CT6 A;  2XHF A;  2WDU A;  1WWJ A;  2E2M A;  5AGY A;  1O81 A;  1JZR A;  4JR4 A;  2GT5 A;  4KUN A;  2HSY A;  4G10 A;  1JLV A;  5ELA A;  2L4Q A;  1DSB A;  1XPV A;  4QL7 A;  1A23 A;  3APQ A;  1HNC A;  3CRT A;  1THX A;  1SVO A;  1SKR B;  20GS A;  4EKZ A;  1TRV A;  3TJF A;  3CMI A;  2HNL A;  5GAP D;  5INY A;  5IPG A;  1U3A A;  1A0F A;  2V1M A;  1G7E A;  2PVQ A;  1G6W A;  19GS A;  2YN1 A;  4AJ8 A;  3HMJ G;  3VFI A;  3FYG A;  2YPM A;  1TU7 A;  2V41 A;  4HQS A;  2AUV A;  4ISD A;  5CRG A;  2LJR A;  1ERT A;  3FZ9 A;  2YJ7 A;  1MD4 A;  1X5C A;  2R0P A;  1M9A A;  3UVH A;  3HZ8 A;  3APS A;  4PHZ C;  3ISO A;  4K8M A;  3FRC A;  3TJB A;  2HRA A;  4F0B A;  3ME8 A;  1F6M C;  3FR3 A;  1K3Y A;  2RUF A;  3TJK A;  1DE2 A;  1EZK A;  3DVX A;  2FWG A;  2PWJ A;  3GYK A;  1K0B A;  2QA2 A;  5HR2 A;  4Z2T A;  1TK0 B;  1FB6 A;  3FMW A;  5J4Y A;  2N5A A;  3IBH A;  5ECM B;  4GCI A;  1JFU A;  2A2P A;  2C3T A;  4IQA A;  3TOT A;  1TU8 A;  1S4B P;  3CSH A;  6GSW A;  4PNG A;  2R0C A;  1EEM A;  4LL1 B;  1Z9H A;  1HNB A;  4NWY A;  5CRD A;  2I4A A;  5J3R A;  2K6V A;  2R2J A;  3IDV A;  4ACS A;  2H1A A;  3CQF A;  16GS A;  1K0M A;  2FD3 A;  2VKZ G;  2PVO C;  3GH9 A;  4Q5N A;  4YQM A;  2OBI A;  4PUR A;  3EMX A;  5ENU A;  3FK8 A;  2R3X A;  2A4H A;  2F3M A;  4K7N A;  2IMK A;  4GST A;  5D9X A;  5GAN D;  2VCZ A;  2B7K A;  3LEF A;  2VUP A;  3TDG A;  4N0V A;  2OJL A;  1R7H A;  3ZFL A;  4MDC A;  3D21 A;  3HA9 A;  2HXK A;  3TCO A;  4TR1 A;  3RPP A;  1X9S B;  4MAB A;  1R26 A;  1SK2 A;  2O85 A;  3QDN A;  5ELG A;  4LA1 A;  1OE7 A;  4YKF A;  2FNO A;  1YVL A;  3BBY A;  2IWT A;  3ZIJ A;  14GS A;  1GSF A;  1GSU A;  4MK3 A;  2GQM A;  5IPH A;  4TR1 B;  1TDI A;  1XVQ A;  1N2A A;  4HQZ A;  3PPU A;  5ID2 A;  1BX9 A;  1X5D A;  3GIX A;  5IOW A;  1TK5 B;  5G5F A;  4DSR A;  3TRP A;  4ICY A;  1RQM A;  3WGD A;  1K0A A;  4E8H A;  1IYH A;  2H0I A;  2E2G A;  1T00 A;  3TKS A;  3FR6 A;  3GKK A;  3S9F A;  4O7H A;  2B7J A;  1GTA A;  1PL2 A;  2VD0 A;  2JZR A;  5ID2 B;  2P5Q A;  4O32 A;  4L8E A;  2DJ0 A;  4MZC A;  4WF4 A;  3A2X A;  4O5Q A;  3MIX A;  1PKZ A;  2RM5 A;  2DLX A;  3CTF A;  2C3N A;  3HJO A;  1MDI A;  2AV4 A;  3ZIV A;  2EFE A;  3O3T A;  1I5G A;  4HJ2 A;  1Y6E A;  2L4C A;  1HQO A;  5IMV A;  3HJP A;  1TRW A;  5COH A;  1WRY A;  4TR3 A;  2LRT A;  3ZTL A;  3IAM 2;  4K2X A;  1GH2 A;  1OC8 A;  2YCD A;  2JU5 A;  3HDC A;  3GRX A;  4FYC A;  4IW9 A;  5KN0 A;  4V2L A;  1U3I A;  2VLU A;  1VGL A;  2R6K A;  4O92 A;  3UOM A;  2C0G A;  4ECI A;  2CV4 A;  2LQO A;  2YZU A;  4J57 E;  3IK9 A;  3L0H A;  5HFK A;  4KSM A;  1V40 A;  1YEW C;  3KTB A;  2AJQ B;  1XW5 A;  1WMJ A;  2KP1 A;  5HR3 A;  3AY8 A;  4V1A g;  4OCF A;  7GSS A;  1LJR A;  3DVW A;  2WZS A;  4GRF A;  2WW1 A;  3K8N A;  1TJD A;  5H5R A;  1ML6 A;  4ML6 A;  5B6M A;  4JU5 A;  2J23 A;  3EUR A;  1SJI A;  4XRA A;  4CY8 A;  5DAK A;  1TTZ A;  4PNF A;  2DJ1 A;  3DEX A;  1SVL A;  1XOA A;  4ZB9 A;  2GST A;  2GS3 A;  4KA0 A;  1PRX A;  1U88 A;  1HNA A;  2O5V A;  3HVV A;  5IMA A;  4D73 A;  1ILO A;  2NTO A;  3GKN A;  3EE2 A;  2REM A;  2KP2 A;  5HR1 A;  1WE0 A;  2P0G A;  2FHE A;  4IJ3 A;  2DJJ A;  1J08 A;  2VO4 A;  4WKW A;  1QQ2 A;  3CYN A;  4HSC X;  3IC8 A;  3KJY A;  3RPN A;  1ERV A;  4ZL7 A;  2OAD A;  4E68 A;  2NDO A;  4NMU A;  4EL1 A;  1EV4 A;  2UZ8 A;  4D73 B;  3PR8 A;  3TJJ A;  4I97 A;  5JCU A;  2WGR A;  1K0N A;  1OKD A;  5AIV A;  5GSS A;  2G2Q A;  5IMZ A;  1F37 A;  2H70 A;  3PIN A;  2AHE A;  2QC7 A;  4MP4 A;  5CO3 A;  2ES7 A;  2H6X A;  1XIY A;  1BQ7 A;  3P8W A;  4MJA A;  4PUF C;  1M9B A;  1GWC A;  1ZYE A;  2HSM A;  2CX3 A;  4CY6 A;  5D93 A;  1G6Y A;  2LJK A;  4WBR D;  5G5E A;  1GNE A;  2XBQ A;  3I43 A;  1X9M B;  2HZE A;  4Q5F A;  4BVX A;  5BMU A;  4L5O A;  4ZBB A;  2H76 A;  2Z9S A;  1YDK A;  4G19 A;  2LNS A;  1ZGN A;  2IIY A;  2HSM B;  5IIZ A;  2N5B A;  4IBP A;  4XCS A;  1YKA A;  4I8B A;  4L0W A;  2HZE B;  3GV1 A;  2X8C A;  5BMU B;  3KGK A;  3KIJ A;  3TKR A;  4QMK A;  1PD2 1;  3VWW A;  4WBJ A;  2V2G A;  2DC5 A;  5B6N A;  4EUY A;  4HU7 A;  5J5N A;  1WIK A;  5ECQ B;  5DCH A;  3D4M A;  1SJ6 A;  1EV9 A;  9GSS A;  1EGR A;  2R4V A;  3RFR C;  4MZB A;  3EU3 A;  5HFI A;  3Q74 A;  2ZUP A;  3KCM A;  2H73 A;  5ECS A;  3A2V A;  5L71 A;  6GSX A;  1B48 A;  4IGJ A;  1KBN A;  1DBY A;  5ECI B;  3TGZ A;  2UV8 G;  1BYE A;  2OA7 A;  1NW2 A;  5KEJ A;  2HZF A;  5HR0 A;  1F2E A;  5H5Q A;  4V2N A;  2E0Q A;  1X9W B;  3F3Q A;  2YZH A;  3RHC A;  1Z5Y E;  2B5Y A;  3DXB A;  4L5L A;  1UA5 A;  2H8L A;  5IM9 A;  1AIU A;  2GQL A;  4BVY B;  3G9B A;  2V6K A;  4EF0 A;  3F63 A;  2LJA A;  1BJX A;  1YEP A;  3EC3 A;  1ZYQ B;  3F3R A;  1NHO A;  3NIV A;  3US3 A;  4HZ4 A;  5A5K A;  2H0H A;  4ZL9 A;  2GDR A;  4K7I A;  4K5R A;  3V1W A;  1R5P A;  4LLR A;  3DKS A;  3QAW A;  2AYT A;  2L6C A;  4F03 A;  2HRN A;  4TVE A;  2EIO A;  1V58 A;  1TXX A;  5D96 A;  2JZS A;  1TOF A;  1O85 A;  1V57 A;  3CSI A;  4JRR A;  2L5O A;  2YWM A;  2CAQ A;  3H93 A;  1YJ6 A;  3M9J A;  2RM6 A;  3BCK A;  6GSV A;  3GFK A;  5CNW A;  4I5Q A;  2MMO A;  4GQF A;  3H4K A;  2H6Y A;  2HQT A;  1AQV A;  1F3B A;  1PFO A;  4EE0 A;  1GUL A;  1OC9 A;  1BG1 A;  3MNG A;  2PN8 A;  3BOA A;  2H0G A;  1B4P A;  2FWF A;  3TUE A;  3R3E A;  1FOH A;  4ECJ A;  3QMX A;  4AGS A;  1TW9 A;  2EIQ A;  3KEB A;  1XXU A;  5ECR B;  4AI6 A;  4KH7 A;  4ZXG A;  2F51 A;  3VWX A;  4LMW A;  1OC9 B;  1EGO A;  5IO0 A;  3ZZX A;  3NZN A;  4I2U A;  4RQR A;  4F82 A;  1JLW A;  2X8H A;  2IMF A;  2DIY A;  1JZW A;  2F9S A;  3LW9 A;  4X4J A;  4ZBD A;  5AN1 A;  4FO5 A;  3L9U A;  3CTG A;  5A4V A;  2VM2 A;  2EFD A;  1GLP A;  2VAF A;  1SU9 A;  4EC0 A;  1C72 A;  1S3A A;  1E2Y A;  2DSA A;  4K0G A;  1X5E A;  2B5X A;  4JZQ A;  4DSS A;  4GWR A;  3A5W A;  4MPG A;  1X0R A;  1EOG A;  2JL4 A;  2C0E A;  3D5J A;  2VM1 A;  4ID0 A;  2LS5 A;  3M1G A;  10GS A;  4I6X A;  4Q5R A;  3FW2 A;  3ZML A;  2HRF A;  3GHA A;  5FHI A;  1T7P B;  4MZW A;  2IME A;  2BMX A;  3HY2 A;  4OFN A;  4MMM A;  1T8E B;  2HFD A;  2H6Z A;  4PXO A;  1VF2 A;  1M2B A;  4W66 A;  5IMF A;  4DSS B;  1FW1 A;  5F0G A;  1TI1 A;  5JWQ B;  3NOF A;  1GSE A;  5DDL A;  4Q5Q A;  1QMV A;  3ERW A;  4XTS A;  4USS A;  5F05 A;  1FHE A;  1YEX A;  2DKI A;  5B7C A;  1XZO A;  1M99 A;  2CVD A;  4J2F A;  2MBT A;  2AB6 A;  4AKX B;  1SYX A;  4HEA 2;  2R5G A;  1Y25 A;  4DSQ A;  5H5S A;  2WZ9 A;  2OE1 A;  2WW3 A;  4RI7 A;  1ZCP A;  5JWR B;  3VLN A;  2K9F A;  4PI0 C;  3IXR A;  5F06 A;  1OVN A;  2H71 A;  2NBS A;  1BED A;  4F2I A;  4N30 A;  5CYY A;  5E4W A;  3CRU A;  1PMT A;  4JED A;  2I9H A;  3UBK A;  3FR9 A;  2E7P A;  3TRQ A;  4ECB A;  4KE3 A;  4YAP A;  3ZL5 A;  2MZC A;  5JCG A;  1SK0 A;  1U6T A;  5J47 A;  1EOH A;  3QOU A;  4MF6 A;  3ME7 A;  2MMN A;  3IPZ A;  2OE3 A;  5ECN B;  3P7X A;  2GSS A;  3HYP A;  4IS0 A;  2LQQ A;  1GTU A;  3F4S A;  5G2Z A;  3O76 A;  4MF7 A;  3GKX A;  4QL9 A;  3KM6 A;  2DBC A;  2IMI A;  3Q19 A;  4ZBA A;  4KDX A;  4NAX A;  1M3I A;  5KN1 A;  3DML A;  5HFG A;  2CVK A;  1WP0 A;  4V1A p;  4P3Y B;  2A2R A;  5IMC A;  2O87 A;  4WET A;  5FT3 A;  3P2A A;  2RII A;  5D9V A;  1ACV A;  4YKG A;  2EC4 A;  1ST9 A;  8GSS A;  3BCI A;  2L6D A;  5FWG A;  2GZY A;  5EVO A;  1FB0 A;  4O5R A;  3KH7 A;  4FXY P;  2XBI A;  1A2L A;  2HE3 A;  4O5U A;  1YKC A;  2CX4 A;  3FY7 A;  1KNG A;  4OO4 A;  4IN0 A;  1YZX A;  4ZL8 A;  5IMD A;  4HDE A;  3KXO A;  3ERF A;  2HRK A;  1M0U A;  4GLT A;  1S3C A;  2HI7 A;  2H1L A;  1VF1 A;  4NXI A;  2LRC A;  5GZZ B;  2X8G A;  3D0Z A;  2YP6 A;  2GSQ A;  3GN3 A;  2DJ3 A;  3CHX C;  4POB A;  4YQU A;  2A4V A;  2FWE A;  3ZMK A;  3J7Y k;  5ECP B;  5C04 A;  2HRK B;  2JAD A;  3A2W A;  5EL8 A;  2VL9 A;  3QFA C;  3KP9 A;  4ILF A;  3L9S A;  1GNW A;  3QFB C;  2YWI A;  1PX7 A;  4TKY A;  2F8F A;  13GS A;  1FVK A;  3CSJ A;  2I1U A;  4KDU A;  3TB2 A;  3EWL A;  2H1G A;  2PBJ A;  1JZO A;  2FWH A;  1CQH A;  3HVX A;  1SKS B;  2IJY A;  3HD5 A;  3HVN A;  2LTK A;  4BA7 A;  4GF0 A;  1B9X C;  1UN2 A;  1AW9 A;  1PGT A;  4TXO B;  4IKH A;  2B1L A;  4MJC A;  3VPQ A;  4E8E A;  4PTS A;  3QAG A;  1HD2 A;  3C1S A;  3LJR A;  2FY6 A;  2XC2 A;  2YWO A;  2ZCT A;  5A5H A;  1XW9 A;  5LCZ A;  3VWU A;  2F8A A;  1PQN A;  5A1N A;  3LG6 A;  1EP7 A;  4K2D A;  3LXZ A;  2B5E A;  3ZRD A;  4OO5 A;  4AJ7 A;  2LV3 A;  1MEK A;  3L78 A;  3L9V A;  3G7I A;  4KND A;  2TRX A;  4KGI A;  4MF5 A;  5LD0 A;  1A8Y A;  5BRT A;  5A5H B;  3F8U A;  2MMZ A;  1GUH A;  4CHS A;  2A2S A;  5A1N B;  3IC4 A;  4IVF A;  4N10 A;  2HSH A;  3DYR A;  3R2Q A;  2H1B A;  4FH8 A;  4ECC A;  3TU3 B;  3GTU A;  3GMF A;  3ZIT A;  3WGE A;  5J9B A;  4HJM A;  3W8S A;  5G1L A;  5DVB A;  2C4J A;  3WT1 A;  3DGQ A;  1M3J A;  1SKW B;  2L5L A;  2VL2 C;  1TRS A;  5JCW A;  5D9T A;  2VCW A;  1PN9 A;  1O73 A;  1ZL9 A;  3C8E A;  4MH3 A;  4TR0 A;  5G30 A;  3GTU B;  1SL0 B;  3UEM A;  3VI7 A;  2X49 A;  4IHU A;  1RK4 A;  2KHP A;  3C71 A;  4GDF A;  5IOX A;  1NM3 A;  3MSZ A;  4XRD A;  3MDK A;  4YAV A;  4PGT A;  3M9K A;  4G0I A;  4OFT A;  4AF2 A;  5B8A A;  1XOB A;  2HYX A;  5HQP A;  2K8V A;  4PQI A;  2BTO T;  2WCI A;  1SL2 B;  1JZD A;  1SJZ A;  2WJU A;  3ED3 A;  4XS1 A;  3G7J A;  2H01 A;  2FCH A;  2P31 A;  4Z7X A;  4LL4 B;  1V98 A;  2EFC A;  1BG5 A;  3JCM L;  3GX0 A;  4K5S A;  3QPM A;  1B4Q A;  1BF5 A;  2EIR A;  3O6T A;  1QFN A;  2MYG A;  2LEG A;  1KEB A;  1GTB A;  3TKS E;  2QA1 A;  2QGV A;  2VCX A;  4IEL A;  2KOK A;  4NHW A;  3DRN A;  3DIE A;  3L4N A;  4G9H A;  4BVY A;  2WVY A;  1LU4 A;  1QXH A;  3HHV A;  3LGC A;  4MH2 A;  1GUM A;  4KDY A;  1EP8 A;  3RAZ A;  1H4O A;  1FAA A;  1I1I P;  3C73 A;  3F4R A;  4L0U A;  1PX6 A;  4WF5 A;  2M72 A;  2VD1 A;  1E6B A;  2I3Y A;  1YQ1 A;  1Z7R A;  2X99 A;  4IP6 A;  2ZNM A;  4ZB8 A;  2OKA A;  3OR5 A;  2LST A;  2B3S A;  2WVZ A;  4XS4 A;  4WR5 A;  3E9J B;  3LSZ A;  3F9U A;  1IYI A;  3HZ4 A;  5B8B A;  3M8N A;  3EVI A;  4EDY A;  3GH6 A;  3LYP A;  1EEJ A;  4G0L A;  1ERW A;  1XVW A;  2YAN A;  3SBC A;  1ZYP A;  2GZP A;  5DQY A;  4HU9 A;  2CQ9 A;  4BIK A;  2PER A;  2YJH A;  3KMO A;  1T4Y A;  4XS4 B;  4G01 A;  1ON4 A;  2O89 A;  2YOI A;  3PH9 A; 
#chains in the Genus database with same CATH homology
 3LQ7 A;  1A2J A;  2VCT A;  5CRE A;  4HS1 A;  1Q98 A;  1TK8 B;  6GSS A;  2QKE A;  4EXJ A;  1M7T A;  2NVL A;  5IQY A;  3FZ5 A;  4DVC A;  1ZOF A;  2PMT A;  1K3O A;  2O7K A;  4K9Z A;  1ZMA A;  1OKT A;  3LFL A;  5CP1 A;  1AQW A;  2VOC A;  3IOS A;  2C0D A;  5J4V A;  1QK8 A;  4TXV A;  3J7Y b;  4GXZ A;  4N11 A;  4X43 A;  5ECK B;  1F9M A;  3A3T A;  5CRW A;  1HYU A;  1XFL A;  4KF9 A;  3H79 A;  1YF0 A;  1YF1 A;  4Z2R A;  3RDW A;  22GS A;  1K0C A;  1XWA A;  4IQ1 A;  5F8B A;  1WPI A;  5J9C A;  2HT9 A;  4F0C A;  1EWX A;  1PL1 A;  1AAZ A;  4ML1 A;  1TKD B;  1XW6 A;  3IV4 A;  6GSU A;  1J0F A;  5D9W A;  2V32 A;  1SD8 A;  2MMA A;  2C3Q A;  2J9H A;  3P90 A;  11GS A;  1QUW A;  3W8J A;  2LNT A;  3G7Y A;  3HVS A;  1GRX A;  1R4W A;  4K0N A;  1W89 A;  3VPT A;  1KTE A;  5LNK e;  3UAP A;  2JSZ A;  5E59 A;  3Q6O A;  1UC7 A;  4F9Z A;  6GST A;  3EU4 A;  2X4A A;  4EVM A;  5J4U A;  3DWV A;  5G1K A;  4MCU A;  1ERU A;  3F4T A;  1XWG A;  4EDZ A;  2FA8 A;  1K0O A;  4Z2U A;  3TKS C;  1T1V A;  4KCA A;  5DAL A;  1MDJ A;  4NV5 A;  3GUR A;  4FQU A;  1O6J A;  3LOR A;  1AXD A;  2CA8 A;  4PQH A;  2WFC A;  5GST A;  3FZ4 A;  4MA9 A;  4JBB A;  4CDO A;  2GSR A;  4TOP A;  3GX8 A;  1SK1 A;  4X0X A;  3ZVJ A;  2JAC A;  4JR6 A;  4EIQ A;  5DAL B;  1GL8 A;  1PKW A;  3A5I A;  4MJB A;  4POK A;  2IMD A;  3QAV A;  2WRT A;  2NPB A;  3IK7 A;  3KP8 A;  4KW6 A;  4TW5 A;  2QSI A;  3FHK A;  1O7U A;  1OC3 A;  5CRH A;  5A34 A;  3UAR A;  3EPT A;  2DML A;  3VUR A;  4HOJ A;  4BWS A;  4ZIJ A;  2VCQ A;  4BWQ A;  4ZIL A;  2DIZ A;  2PPT A;  4XHM A;  2YNX A;  2CZ2 A;  2TRC P;  1B9Y C;  4OMV A;  3WYW A;  2GZZ A;  4EO3 A;  4HUA A;  5A34 B;  2CAI A;  2O8V B;  1T3B A;  5DBQ A;  1N25 A;  1ABA A;  2IL3 A;  1M2A A;  1NHY A;  4AKG A;  3LWA A;  2FUG 2;  4FYB A;  2JZT A;  1Z3E A;  3N5O A;  4RI6 A;  2VLT A;  4RQX A;  2GQK A;  4MPF A;  4TN8 A;  1SYR A;  3DD3 A;  12GS A;  3D22 A;  2V6O A;  2AAW A;  4KB3 A;  4AKH A;  1CQG A;  2C0F A;  1Z6M A;  18GS A;  1XWK A;  1GUK A;  5JWO B;  2K18 A;  1GSQ A;  5EY6 A;  5KN2 A;  4KCE A;  5D73 A;  1V9W A;  3TJG A;  3LXT A;  5J40 A;  3MWH A;  3F6F A;  1MTC A;  2RLI A;  2IFQ A;  3WD6 A;  1O8W A;  2L59 A;  3F6D A;  4GSS A;  2C1Y A;  2C80 A;  3E3E A;  4K6X A;  4POL A;  3GST A;  1USB A;  2GGT A;  3E0U A;  4GSN A;  2XPD A;  1K3L A;  4PX1 A;  3EIN A;  3VWV A;  5CAX A;  5AIS A;  4ZB7 A;  3MYD A;  4BL7 A;  4G0K A;  2ALB A;  1Z7P A;  2YV9 A;  1MD3 A;  5G31 A;  2H72 A;  2IFQ B;  4OCE A;  3C1R A;  2H75 A;  1ZYN A;  4TXO A;  3W6G A;  2PUK C;  1UVZ A;  2H30 A;  3WT2 A;  3FEU A;  4N0Z A;  2H66 A;  1JHB A;  3ZLP A;  3KTL A;  3UBL A;  4BL7 B;  5EPF A;  2GVP A;  3TRX A;  1FG4 A;  3KH9 A;  4H86 A;  3Q18 A;  1O8X A;  4FIW A;  1FO5 A;  3QR6 A;  2N5F A;  2HLS A;  3KD0 A;  1N8J A;  1FOV A;  1ZZY A;  4GQC A;  1SL1 B;  2YWN A;  3HXS A;  3HJM A;  1YY7 A;  3RHB A;  3IRA A;  2FGX A;  2RUE A;  4AJ6 A;  4OWY A;  1W4V A;  4G2E A;  2LRN A;  3U5R E;  1DE1 A;  2H19 A;  2FLS A;  5F07 A;  2PGT A;  3GSS A;  17GS A;  1PN0 A;  2BJX A;  2KUC A;  2OT3 A;  4LMV A;  2VCV A;  4PUA A;  5D8I A;  1TP9 A;  1PSQ A;  3C7M A;  4KAE A;  3SWL A;  4WXT A;  1THO A;  2VLV A;  3BJ5 A;  4MLY A;  2L57 A;  3FZA A;  3PGT A;  2VIM A;  3I9V 2;  5DAK B;  1VRS D;  5A4W A;  2JSY A;  4HZ2 A;  1A2M A;  1OE8 A;  4YH2 A;  6GSY A;  4MJE A;  1TXU A;  1A24 A;  1J9B A;  3HKR A;  4IP1 A;  1S3D A;  1T4Z A;  2G0F A;  3KMN A;  4WEY A;  2I81 A;  2IN3 A;  5KOX A;  2ON5 A;  4TRX A;  3GL3 A;  4XS6 A;  3TKQ A;  3WGX A;  2P5R A;  2X64 A;  4BPY A;  4K7O A;  4FYU A;  4OD7 A;  2FA4 A;  3HCZ A;  4HI7 A;  1NSW A;  2VL3 A;  3QD9 A;  4MNN A;  3UIW A;  1BAY A;  4X1U A;  3GKM A;  3IAS 2;  1A8L A;  1DUG A;  4KX4 A;  5ECO B;  3GA4 A;  3ZYW A;  2WB9 A;  3ZVJ D;  3M3M A;  2D2Z A;  1I9D A;  3VK9 A;  3IHG A;  3APO A;  2M80 A;  4RUV A;  2K8S A;  2CZ3 A;  5ABR A;  2LKU A;  2IPA A;  5DJL A;  2OAC A;  1VF3 A;  4XIH A;  1TI3 A;  1MDK A;  3IHQ A;  3LYK A;  1WJK A;  4NPB A;  2CVB A;  1GTI A;  2TIR A;  5IO2 A;  2DJK A;  3BD2 A;  4V2M A;  2OBK A;  2WS2 A;  1XWB A;  2XPE A;  3CBU A;  1F3A A;  4BVX B;  3KZQ A;  2WUL A;  2R0G A;  2DKH A;  2MBS A;  3ERG A;  4IJI A;  3UMA A;  4GTU A;  1WOU A;  5DJM A;  2EFH A;  3ZFB A;  3ZRE A;  4QQ7 A;  2H74 A;  3GUS A;  3EYT A;  1PA3 A;  1SD9 A;  5KOW A;  4I2T A;  1XBS A;  1Q4J A;  2HSN A;  3D4T A;  1Y1U A;  1AC1 A;  4ZB6 A;  1B8X A;  5ECL B;  4OFM A;  2DJ2 A;  1QGV A;  1GSY A;  1SEN A;  3EMP A;  4ULX A;  4NHZ A;  3TOU A;  3RBT A;  3U6V A;  5DCG A;  3F0I A;  2GTU A;  4EIP A;  3N9J A;  2M46 A;  4JE1 A;  5ECH B;  4AKI A;  2GLR A;  4NV2 A;  3MAK A;  5J41 A;  2B6M A;  3CWG A;  1GLQ A;  4KSO A;  4WR4 A;  1H75 A;  2HSN B;  3IA1 A;  4K1F A;  1GP1 A;  1V2A A;  3H8Q A;  3GL5 A;  3H1N A;  4N3Z A;  1K0D A;  1Z6N A;  1G7O A;  3VI5 A;  5AIX A;  4YQV A;  2DMM A;  1AUC A;  2B1K A;  4DEJ A;  2OE0 A;  3I69 A;  3TKP A;  3IR4 A;  5KN3 A;  1FVJ A;  2LUS A;  3D6I A;  1OYJ A;  4CW9 A;  2VL2 A;  4J56 E;  2ON7 A;  2H1D A;  1TRU A;  3IE3 A;  1AQX A;  1OAZ A;  1URM A;  1XWC A;  2GT6 A;  1GSD A;  3I6A A;  2PU9 C;  3UJ1 A;  3FKF A;  1U87 A;  4POM A;  2KLX A;  2YV7 A;  1RW1 A;  1GSS A;  1LBK A;  2C8U A;  1A0R P;  5DQS A;  1VF4 A;  2R37 A;  3M0F A;  4PQ1 A;  1M2D A;  3CXG A;  1R5A A;  3GNJ A;  1XCC A;  3UL3 A;  5A4U A;  3UVT A;  1G0T A;  1SVM A;  4TR4 A;  5C00 A;  3QCP A;  4A5P A;  2CT6 A;  2XHF A;  2WDU A;  1WWJ A;  2E2M A;  5AGY A;  1O81 A;  1JZR A;  4JR4 A;  2GT5 A;  4KUN A;  2HSY A;  4G10 A;  1JLV A;  5ELA A;  2L4Q A;  1DSB A;  1XPV A;  4QL7 A;  1A23 A;  3APQ A;  1HNC A;  3CRT A;  1THX A;  1SVO A;  1SKR B;  20GS A;  4EKZ A;  1TRV A;  3TJF A;  3CMI A;  2HNL A;  5GAP D;  5INY A;  5IPG A;  1U3A A;  1A0F A;  2V1M A;  1G7E A;  2PVQ A;  1G6W A;  19GS A;  2YN1 A;  4AJ8 A;  3HMJ G;  3VFI A;  3FYG A;  2YPM A;  1TU7 A;  2V41 A;  4HQS A;  2AUV A;  4ISD A;  5CRG A;  2LJR A;  1ERT A;  3FZ9 A;  2YJ7 A;  1MD4 A;  1X5C A;  2R0P A;  1M9A A;  3UVH A;  3HZ8 A;  3APS A;  3ISO A;  4K8M A;  3FRC A;  3TJB A;  2HRA A;  4F0B A;  3ME8 A;  1F6M C;  3FR3 A;  1K3Y A;  2RUF A;  3TJK A;  1DE2 A;  1EZK A;  3DVX A;  2FWG A;  2PWJ A;  3GYK A;  1K0B A;  2QA2 A;  5HR2 A;  4Z2T A;  1TK0 B;  1FB6 A;  3FMW A;  5J4Y A;  2N5A A;  3IBH A;  5ECM B;  4GCI A;  1JFU A;  2A2P A;  2C3T A;  4IQA A;  3TOT A;  1TU8 A;  3CSH A;  6GSW A;  4PNG A;  2R0C A;  1EEM A;  4LL1 B;  1Z9H A;  1HNB A;  4NWY A;  5CRD A;  2I4A A;  5J3R A;  2K6V A;  2R2J A;  3IDV A;  4ACS A;  2H1A A;  16GS A;  1K0M A;  2FD3 A;  2VKZ G;  2PVO C;  3GH9 A;  4Q5N A;  4YQM A;  2OBI A;  4PUR A;  3EMX A;  5ENU A;  3FK8 A;  2R3X A;  2A4H A;  2F3M A;  4K7N A;  2IMK A;  4GST A;  5D9X A;  5GAN D;  2VCZ A;  2B7K A;  3LEF A;  2VUP A;  3TDG A;  4N0V A;  2OJL A;  1R7H A;  3ZFL A;  4MDC A;  3D21 A;  3HA9 A;  2HXK A;  3TCO A;  4TR1 A;  3RPP A;  1X9S B;  4MAB A;  1R26 A;  1SK2 A;  2O85 A;  3QDN A;  5ELG A;  4LA1 A;  1OE7 A;  4YKF A;  2FNO A;  1YVL A;  3BBY A;  2IWT A;  3ZIJ A;  14GS A;  1GSF A;  1GSU A;  4MK3 A;  2GQM A;  5IPH A;  4TR1 B;  1TDI A;  1XVQ A;  1N2A A;  4HQZ A;  3PPU A;  5ID2 A;  1BX9 A;  1X5D A;  3GIX A;  5IOW A;  1TK5 B;  5G5F A;  4DSR A;  3TRP A;  4ICY A;  1RQM A;  3WGD A;  1K0A A;  4E8H A;  1IYH A;  2H0I A;  2E2G A;  1T00 A;  3TKS A;  3FR6 A;  3GKK A;  3S9F A;  4O7H A;  2B7J A;  1GTA A;  1PL2 A;  2VD0 A;  2JZR A;  5ID2 B;  2P5Q A;  4O32 A;  4L8E A;  2DJ0 A;  4MZC A;  4WF4 A;  3A2X A;  4O5Q A;  3MIX A;  1PKZ A;  2RM5 A;  2DLX A;  3CTF A;  2C3N A;  3HJO A;  1MDI A;  2AV4 A;  3ZIV A;  2EFE A;  3O3T A;  1I5G A;  4HJ2 A;  1Y6E A;  2L4C A;  1HQO A;  5IMV A;  3HJP A;  1TRW A;  5COH A;  1WRY A;  4TR3 A;  2LRT A;  3ZTL A;  3IAM 2;  4K2X A;  1GH2 A;  1OC8 A;  2YCD A;  2JU5 A;  3HDC A;  3GRX A;  4FYC A;  4IW9 A;  5KN0 A;  4V2L A;  1U3I A;  2VLU A;  1VGL A;  2R6K A;  4O92 A;  3UOM A;  2C0G A;  4ECI A;  2CV4 A;  2LQO A;  2YZU A;  4J57 E;  3IK9 A;  3L0H A;  5HFK A;  4KSM A;  1V40 A;  3KTB A;  2AJQ B;  1XW5 A;  1WMJ A;  2KP1 A;  5HR3 A;  3AY8 A;  4V1A g;  4OCF A;  7GSS A;  1LJR A;  3DVW A;  4GRF A;  3K8N A;  1TJD A;  5H5R A;  1ML6 A;  4ML6 A;  5B6M A;  4JU5 A;  2J23 A;  3EUR A;  1SJI A;  4XRA A;  4CY8 A;  5DAK A;  1TTZ A;  4PNF A;  2DJ1 A;  3DEX A;  1SVL A;  1XOA A;  4ZB9 A;  2GST A;  2GS3 A;  4KA0 A;  1PRX A;  1U88 A;  1HNA A;  2O5V A;  3HVV A;  5IMA A;  4D73 A;  1ILO A;  2NTO A;  3GKN A;  3EE2 A;  2REM A;  2KP2 A;  5HR1 A;  1WE0 A;  2P0G A;  2FHE A;  4IJ3 A;  2DJJ A;  1J08 A;  2VO4 A;  4WKW A;  1QQ2 A;  3CYN A;  3IC8 A;  3KJY A;  3RPN A;  1ERV A;  4ZL7 A;  2OAD A;  4E68 A;  2NDO A;  4NMU A;  4EL1 A;  1EV4 A;  2UZ8 A;  4D73 B;  3PR8 A;  3TJJ A;  4I97 A;  5JCU A;  2WGR A;  1K0N A;  1OKD A;  5AIV A;  5GSS A;  2G2Q A;  5IMZ A;  1F37 A;  2H70 A;  3PIN A;  2AHE A;  2QC7 A;  4MP4 A;  5CO3 A;  2ES7 A;  2H6X A;  1XIY A;  1BQ7 A;  3P8W A;  4MJA A;  4PUF C;  1M9B A;  1GWC A;  1ZYE A;  2HSM A;  2CX3 A;  4CY6 A;  5D93 A;  1G6Y A;  2LJK A;  4WBR D;  5G5E A;  1GNE A;  2XBQ A;  3I43 A;  1X9M B;  2HZE A;  4Q5F A;  4BVX A;  5BMU A;  4L5O A;  4ZBB A;  2H76 A;  2Z9S A;  1YDK A;  4G19 A;  2LNS A;  1ZGN A;  2IIY A;  2HSM B;  5IIZ A;  2N5B A;  4IBP A;  4XCS A;  1YKA A;  4I8B A;  4L0W A;  2HZE B;  3GV1 A;  2X8C A;  5BMU B;  3KGK A;  3KIJ A;  3TKR A;  4QMK A;  1PD2 1;  3VWW A;  4WBJ A;  2V2G A;  2DC5 A;  5B6N A;  4EUY A;  4HU7 A;  5J5N A;  1WIK A;  5ECQ B;  5DCH A;  3D4M A;  1SJ6 A;  1EV9 A;  9GSS A;  1EGR A;  2R4V A;  4MZB A;  3EU3 A;  5HFI A;  3Q74 A;  2ZUP A;  3KCM A;  2H73 A;  5ECS A;  3A2V A;  5L71 A;  6GSX A;  1B48 A;  4IGJ A;  1KBN A;  1DBY A;  5ECI B;  3TGZ A;  2UV8 G;  1BYE A;  2OA7 A;  1NW2 A;  5KEJ A;  2HZF A;  5HR0 A;  1F2E A;  5H5Q A;  4V2N A;  2E0Q A;  1X9W B;  3F3Q A;  2YZH A;  3RHC A;  1Z5Y E;  2B5Y A;  3DXB A;  4L5L A;  1UA5 A;  2H8L A;  5IM9 A;  1AIU A;  2GQL A;  4BVY B;  3G9B A;  2V6K A;  4EF0 A;  3F63 A;  2LJA A;  1BJX A;  1YEP A;  3EC3 A;  1ZYQ B;  3F3R A;  1NHO A;  3NIV A;  3US3 A;  4HZ4 A;  5A5K A;  2H0H A;  4ZL9 A;  2GDR A;  4K7I A;  4K5R A;  3V1W A;  1R5P A;  4LLR A;  3DKS A;  3QAW A;  2AYT A;  2L6C A;  4F03 A;  2HRN A;  4TVE A;  2EIO A;  1V58 A;  1TXX A;  5D96 A;  2JZS A;  1TOF A;  1O85 A;  1V57 A;  3CSI A;  4JRR A;  2L5O A;  2YWM A;  2CAQ A;  3H93 A;  1YJ6 A;  3M9J A;  2RM6 A;  3BCK A;  6GSV A;  3GFK A;  5CNW A;  4I5Q A;  2MMO A;  4GQF A;  3H4K A;  2H6Y A;  2HQT A;  1AQV A;  1F3B A;  4EE0 A;  1GUL A;  1OC9 A;  1BG1 A;  3MNG A;  2PN8 A;  3BOA A;  2H0G A;  1B4P A;  2FWF A;  3TUE A;  3R3E A;  1FOH A;  4ECJ A;  3QMX A;  4AGS A;  1TW9 A;  2EIQ A;  3KEB A;  1XXU A;  5ECR B;  4AI6 A;  4KH7 A;  4ZXG A;  2F51 A;  3VWX A;  4LMW A;  1OC9 B;  1EGO A;  5IO0 A;  3ZZX A;  3NZN A;  4I2U A;  4RQR A;  4F82 A;  1JLW A;  2X8H A;  2IMF A;  2DIY A;  1JZW A;  2F9S A;  3LW9 A;  4X4J A;  4ZBD A;  5AN1 A;  4FO5 A;  3L9U A;  3CTG A;  5A4V A;  2VM2 A;  2EFD A;  1GLP A;  2VAF A;  1SU9 A;  4EC0 A;  1C72 A;  1S3A A;  1E2Y A;  2DSA A;  4K0G A;  1X5E A;  2B5X A;  4JZQ A;  4DSS A;  4GWR A;  3A5W A;  4MPG A;  1X0R A;  1EOG A;  2JL4 A;  2C0E A;  3D5J A;  2VM1 A;  4ID0 A;  2LS5 A;  3M1G A;  10GS A;  4I6X A;  4Q5R A;  3FW2 A;  3ZML A;  2HRF A;  3GHA A;  5FHI A;  1T7P B;  4MZW A;  2IME A;  2BMX A;  3HY2 A;  4OFN A;  4MMM A;  1T8E B;  2HFD A;  2H6Z A;  4PXO A;  1VF2 A;  1M2B A;  4W66 A;  5IMF A;  4DSS B;  1FW1 A;  5F0G A;  1TI1 A;  5JWQ B;  3NOF A;  1GSE A;  5DDL A;  4Q5Q A;  1QMV A;  3ERW A;  4XTS A;  4USS A;  5F05 A;  1FHE A;  1YEX A;  2DKI A;  5B7C A;  1XZO A;  1M99 A;  2CVD A;  4J2F A;  2MBT A;  2AB6 A;  4AKX B;  1SYX A;  4HEA 2;  2R5G A;  1Y25 A;  4DSQ A;  5H5S A;  2WZ9 A;  2OE1 A;  4RI7 A;  1ZCP A;  5JWR B;  3VLN A;  2K9F A;  3IXR A;  5F06 A;  1OVN A;  2H71 A;  2NBS A;  1BED A;  4F2I A;  4N30 A;  5CYY A;  5E4W A;  3CRU A;  1PMT A;  4JED A;  2I9H A;  3UBK A;  3FR9 A;  2E7P A;  3TRQ A;  4ECB A;  4KE3 A;  4YAP A;  3ZL5 A;  2MZC A;  5JCG A;  1SK0 A;  1U6T A;  5J47 A;  1EOH A;  3QOU A;  4MF6 A;  3ME7 A;  2MMN A;  3IPZ A;  2OE3 A;  5ECN B;  3P7X A;  2GSS A;  3HYP A;  4IS0 A;  2LQQ A;  1GTU A;  3F4S A;  5G2Z A;  3O76 A;  4MF7 A;  3GKX A;  4QL9 A;  3KM6 A;  2DBC A;  2IMI A;  3Q19 A;  4ZBA A;  4KDX A;  4NAX A;  5KN1 A;  3DML A;  5HFG A;  2CVK A;  1WP0 A;  4V1A p;  4P3Y B;  2A2R A;  5IMC A;  2O87 A;  4WET A;  5FT3 A;  3P2A A;  2RII A;  5D9V A;  1ACV A;  4YKG A;  2EC4 A;  1ST9 A;  8GSS A;  3BCI A;  2L6D A;  5FWG A;  2GZY A;  5EVO A;  1FB0 A;  4O5R A;  3KH7 A;  2XBI A;  1A2L A;  2HE3 A;  4O5U A;  1YKC A;  2CX4 A;  3FY7 A;  1KNG A;  4OO4 A;  4IN0 A;  1YZX A;  4ZL8 A;  5IMD A;  4HDE A;  3KXO A;  3ERF A;  2HRK A;  1M0U A;  4GLT A;  1S3C A;  2HI7 A;  2H1L A;  1VF1 A;  4NXI A;  2LRC A;  5GZZ B;  2X8G A;  3D0Z A;  2YP6 A;  2GSQ A;  3GN3 A;  2DJ3 A;  4POB A;  4YQU A;  2A4V A;  2FWE A;  3ZMK A;  3J7Y k;  5ECP B;  5C04 A;  2HRK B;  2JAD A;  3A2W A;  5EL8 A;  2VL9 A;  3QFA C;  3KP9 A;  4ILF A;  3L9S A;  1GNW A;  3QFB C;  2YWI A;  1PX7 A;  4TKY A;  2F8F A;  13GS A;  1FVK A;  3CSJ A;  2I1U A;  4KDU A;  3TB2 A;  3EWL A;  2H1G A;  2PBJ A;  1JZO A;  2FWH A;  1CQH A;  3HVX A;  1SKS B;  2IJY A;  3HD5 A;  2LTK A;  4BA7 A;  4GF0 A;  1B9X C;  1UN2 A;  1AW9 A;  1PGT A;  4TXO B;  4IKH A;  2B1L A;  4MJC A;  3VPQ A;  4E8E A;  4PTS A;  3QAG A;  1HD2 A;  3C1S A;  3LJR A;  2FY6 A;  2XC2 A;  2YWO A;  2ZCT A;  5A5H A;  1XW9 A;  5LCZ A;  3VWU A;  2F8A A;  1PQN A;  5A1N A;  3LG6 A;  1EP7 A;  4K2D A;  3LXZ A;  2B5E A;  3ZRD A;  4OO5 A;  4AJ7 A;  2LV3 A;  1MEK A;  3L78 A;  3L9V A;  3G7I A;  4KND A;  2TRX A;  4KGI A;  4MF5 A;  5LD0 A;  1A8Y A;  5BRT A;  5A5H B;  3F8U A;  2MMZ A;  1GUH A;  4CHS A;  2A2S A;  5A1N B;  3IC4 A;  4IVF A;  4N10 A;  2HSH A;  3DYR A;  3R2Q A;  2H1B A;  4FH8 A;  4ECC A;  3TU3 B;  3GTU A;  3GMF A;  3ZIT A;  3WGE A;  5J9B A;  4HJM A;  3W8S A;  5G1L A;  5DVB A;  2C4J A;  3WT1 A;  3DGQ A;  1SKW B;  2L5L A;  2VL2 C;  1TRS A;  5JCW A;  5D9T A;  2VCW A;  1PN9 A;  1O73 A;  1ZL9 A;  3C8E A;  4MH3 A;  4TR0 A;  5G30 A;  3GTU B;  1SL0 B;  3UEM A;  3VI7 A;  2X49 A;  4IHU A;  1RK4 A;  2KHP A;  3C71 A;  4GDF A;  5IOX A;  1NM3 A;  3MSZ A;  4XRD A;  3MDK A;  4YAV A;  4PGT A;  3M9K A;  4G0I A;  4OFT A;  4AF2 A;  5B8A A;  1XOB A;  2HYX A;  5HQP A;  2K8V A;  4PQI A;  2BTO T;  2WCI A;  1SL2 B;  1JZD A;  1SJZ A;  2WJU A;  3ED3 A;  4XS1 A;  3G7J A;  2H01 A;  2FCH A;  2P31 A;  4Z7X A;  4LL4 B;  1V98 A;  2EFC A;  1BG5 A;  3JCM L;  3GX0 A;  4K5S A;  3QPM A;  1B4Q A;  1BF5 A;  2EIR A;  3O6T A;  1QFN A;  2MYG A;  2LEG A;  1KEB A;  1GTB A;  3TKS E;  2QA1 A;  2QGV A;  2VCX A;  4IEL A;  2KOK A;  4NHW A;  3DRN A;  3DIE A;  3L4N A;  4G9H A;  4BVY A;  1LU4 A;  1QXH A;  3HHV A;  3LGC A;  4MH2 A;  1GUM A;  4KDY A;  1EP8 A;  3RAZ A;  1H4O A;  1FAA A;  3C73 A;  3F4R A;  4L0U A;  1PX6 A;  4WF5 A;  2M72 A;  2VD1 A;  1E6B A;  2I3Y A;  1YQ1 A;  1Z7R A;  2X99 A;  4IP6 A;  2ZNM A;  4ZB8 A;  2OKA A;  3OR5 A;  2LST A;  2B3S A;  4XS4 A;  4WR5 A;  3E9J B;  3LSZ A;  3F9U A;  1IYI A;  3HZ4 A;  5B8B A;  3M8N A;  3EVI A;  4EDY A;  3GH6 A;  3LYP A;  1EEJ A;  4G0L A;  1ERW A;  1XVW A;  2YAN A;  3SBC A;  1ZYP A;  2GZP A;  5DQY A;  4HU9 A;  2CQ9 A;  2PER A;  2YJH A;  3KMO A;  1T4Y A;  4XS4 B;  4G01 A;  1ON4 A;  2O89 A;  2YOI A;  3PH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...