4E8HA

Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
214
Chain Sequence
HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural of Bombyx mori glutathione transferase BmGSTD1 complex with GTT
rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 80
structure length 214
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8hA01
1F3AA 3J7Yb 2AHEA 2H71A 1M2DA 4KH7A 4XS4B 2H0IA 1AQVA 2WJUA 1FHEA 2MMNA 2P5RA 1QK8A 4DSSA 2L6DA 1K0MA 3L9SA 2PUKC 2H72A 4XS6A 3UVHA 2N5AA 1MDJA 1GSQA 2BMXA 3KZQA 1YEPA 4WR5A 1C72A 5C00A 1VRSD 1O7UA 2FA8A 1A8LA 6GSSA 3WGDA 1AAZA 4NWYA 4NHZA 4OFTA 1SK2A 4KAEA 11GSA 2PU9C 4X43A 3WGEA 4BVYA 3EVIA 3ZIJA 4MK3A 3GKKA 2FNOA 5B8BA 4TW5A 4POLA 1GSUA 1URMA 2V6KA 1YKCA 3TJKA 2IMIA 2VD0A 1B8XA 3HKRA 1PKWA 4JRRA 4J2FA 4FQUA 4IP6A 2R6KA 1HNAA 1XWAA 5IO2A 2ZNMA 3GN3A 3UMAA 3J7Yk 2C0FA 2DBCA 4PQHA 1F3BA 1Z7RA 1BJXA 2O89A 1T4YA 4L8EA 3LORA 4PNFA 1XW9A 5GAND 3ZTLA 4HUAA 5A4UA 1S3CA 1X0RA 1SJZA 1ON4A 1PSQA 4F2IA 4MJEA 5H5QA 5D9XA 3DKSA 2AJQB 3H1NA 1GUKA 1E2YA 2HSNB 2BTOT 18GSA 14GSA 4PGTA 4MJCA 1FB6A 3Q18A 1T00A 4JBBA 2YN1A 1R26A 3I43A 4WXTA 4X0XA 3GFKA 4EE0A 3ZLPA 4F82A 2XBQA 1QGVA 2CAQA 3Q6OA 3BOAA 1AC1A 1SKRB 5H5RA 3TJGA 4Q5NA 3DVWA 1W89A 2KP1A 3F6DA 1YF1A 2YNXA 3VWUA 4JR4A 4OFNA 4BVXA 2LQOA 4TXOA 1XIYA 3CXGA 3LXTA 2VAFA 1JLVA 2GTUA 2GQKA 4PTSA 3HCZA 1O6JA 4G10A 4WBRD 2GT6A 4KA0A 4I5QA 2HSMB 4JU5A 1PL2A 4GLTA 3ERGA 2NDOA 1X9WB 1XOAA 4XS4A 4WF5A 3GMFA 3C7MA 1G0TA 2XPDA 2PPTA 3IDVA 4HS1A 4CHSA 3DGQA 3GTUA 3ISOA 4YAPA 3UAPA 1HD2A 1X9SB 1X5EA 3U5RE 2EIRA 2H1DA 2ES7A 2FUG2 1AUCA 2J23A 1BQ7A 1K0OA 3FR9A 2FY6A 1DSBA 4KGIA 3HJMA 1B4PA 1K3OA 3CTGA 2HT9A 4NV2A 4GSSA 2OE1A 4K7IA 1MTCA 4N0VA 4GQFA 3MNGA 3FZAA 2VCTA 2PN8A 2HNLA 3D0ZA 4Q5RA 3APOA 2QGVA 1S3AA 1SJ6A 5J4UA 3UARA 3CBUA 1RW1A 2VCWA 1YEXA 1TRSA 1XWGA 4ZB8A 2H0HA 3L4NA 4K1FA 2GZYA 1HYUA 1USBA 3LYPA 2QKEA 4DSRA 2B1LA 2GSRA 3ME7A 3GL3A 1Q4JA 5B7CA 1MD4A 3F3QA 2P5QA 1N2AA 5DVBA 5B6MA 5IOWA 2A2SA 4G19A 5IM9A 2GZPA 1XWBA 3D22A 1FB0A 5KN2A 1K0DA 2GS3A 2RIIA 3WD6A 3D4TA 4BWQA 1NHYA 2CVKA 1ZCPA 4L0WA 3QAGA 2HXKA 2G0FA 5J3RA 2C4JA 3QDNA 2YV9A 4KSOA 2LNSA 1TK0B 2NTOA 3IPZA 3GURA 4IQ1A 1QUWA 1SK0A 4HEA2 1U6TA 1JZOA 2DJ0A 2YPMA 1EP8A 1JLWA 5J41A 17GSA 4I6XA 1MDIA 3DYRA 2I81A 3DRNA 2HSHA 3M9KA 1EEMA 1PX6A 2TIRA 1ZZYA 4V2LA 3IXRA 1J0FA 2HRKA 2IMFA 3QFAC 2UZ8A 1U88A 3HZ8A 1GTIA 2BJXA 2HSMA 5E4WA 2WDUA 1JHBA 5L71A 4E8EA 3D5JA 1K0BA 1ML6A 4XTSA 1A2LA 3KEBA 1HNCA 5AN1A 4MLYA 4HU9A 1KEBA 4DEJA 2PVOC 1Z6NA 2X8GA 1HNBA 1Q98A 2HI7A 3KM6A 3WT1A 4IQAA 2GVPA 1NW2A 4ML1A 4IELA 4ILFA 5IMVA 1R4WA 2P0GA 1ERUA 5LNKe 2V32A 1GUHA 2IFQB 3NOFA 2OBKA 2NBSA 1TOFA 2PWJA 2OACA 1QQ2A 4DSSB 4GSNA 4ECJA 2H6YA 2VCZA 2MBSA 5COHA 2OE3A 3KIJA 5ECQB 5IOXA 1M9AA 5FT3A 1GP1A 2IPAA 4HI7A 2HRNA 3ZVJA 2K9FA 2DIYA 2MBTA 1MEKA 1OKTA 4PQ1A 1TK8B 3FHKA 3HDCA 1EGOA 3TKSA 2B7KA 2KHPA 4BVYB 5ECHB 2GT5A 3M1GA 2DIZA 4YQUA 3ZFLA 2YWMA 3ZMLA 1K0AA 3QOUA 4N10A 3VWWA 5JCGA 1KBNA 1LBKA 1PL1A 1V40A 4OFMA 3UIWA 1B9XC 5G30A 2KUCA 2YJHA 1ACVA 5D9WA 2FD3A 4F0CA 2H70A 3KD0A 3EMPA 1Z3EA 3F6FA 4KNDA 4OMVA 4IN0A 3RPPA 2YCDA 4KSMA 5CRGA 3KH9A 3PINA 5B8AA 5D8IA 1A2JA 2B1KA 2LTKA 3CSIA 4ZB9A 1BX9A 3DD3A 2MYGA 3HXSA 1EOHA 1T8EB 3M9JA 2O7KA 2H66A 4FYUA 1PA3A 1Z5YE 2DMMA 2XPEA 3C1RA 4I8BA 3IE3A 3WYWA 5JCWA 2R37A 3LGCA 1ZYQB 1V9WA 2QSIA 3G7YA 5GAPD 3IK7A 1N8JA 2YZUA 3GA4A 1U87A 4HJ2A 2DLXA 2Z9SA 3M8NA 3PGTA 6GSVA 1I5GA 2LSTA 4RI6A 2JACA 5J5NA 3CRUA 2FLSA 3GNJA 4HJMA 3HA9A 3V1WA 4PUAA 20GSA 3U6VA 3IC4A 1QFNA 1F2EA 2LEGA 3H79A 4I2UA 2REMA 4POBA 3ED3A 4JZQA 3TRXA 1SKWB 2E2GA 5INYA 3F63A 2H6XA 2M46A 4USSA 4TR4A 5F07A 2VM2A 2V6OA 2VIMA 1M9BA 3IHQA 3QR6A 2VCQA 2YOIA 6GSTA 1I9DA 2OADA 3C73A 4LLRA 5HFKA 3F3RA 1R5PA 2IFQA 4KUNA 3GTUB 1XZOA 4MMMA 2H74A 3DVXA 4TN8A 3FK8A 2HZFA 1G7OA 3APSA 2P31A 3R3EA 3N5OA 5J9BA 4ZL9A 1X5DA 1YDKA 2B7JA 1A24A 5ECRB 1O73A 2LKUA 1TJDA 2J9HA 3F4SA 4BA7A 2WGRA 2CV4A 4HDEA 4G0KA 2K8VA 3IA1A 4XS1A 3FW2A 4K7NA 1TKDB 4G0LA 4AGSA 5CRHA 5A4VA 3F9UA 4XCSA 2RM6A 4MZBA 2CZ2A 1A8YA 2M80A 3TUEA 3FY7A 3RBTA 2DJKA 4F9ZA 2HYXA 1AQWA 3GHAA 1SKSB 2I1UA 2AUVA 1GRXA 1XVWA 2JSZA 1SL0B 1AQXA 5DCHA 5ABRA 1AXDA 1F9MA 2PMTA 3TOUA 4JR6A 1PD21 3CTFA 3TCOA 3RHCA 3PPUA 1A0RP 1XW6A 4LA1A 5F8BA 3GSSA 2VL2C 1X5CA 2B5EA 5KEJA 1QMVA 3QMXA 3FEUA 1K3LA 1DE2A 4XRDA 3IR4A 1UN2A 2VD1A 2NPBA 1M2AA 2C3NA 4K2DA 2I3YA 3FYGA 3GKMA 3HVSA 3TDGA 4AJ8A 1ZMAA 3HYPA 1YJ6A 4ZIJA 1J9BA 2H1AA 1THOA 4EO3A 3FZ4A 4KB3A 1GSDA 19GSA 4GSTA 4D73B 5JWRB 2HSYA 1OAZA 1S3DA 1G6WA 2I4AA 4IS0A 5J9CA 1ZL9A 3KJYA 2IIYA 4MJAA 2DJJA 1TTZA 1GWCA 2PVQA 2X8HA 2HRKB 4MPGA 4L5LA 4ACSA 3PR8A 3DXBA 1PKZA 2C1YA 4V2NA 4YQMA 2TRCP 4V1Ag 12GSA 2GLRA 5BMUA 2JZSA 1CQGA 3KH7A 3UBKA 2L6CA 3IAS2 5HR2A 4XHMA 2X8CA 3MWHA 1ZYEA 2ON7A 1R7HA 3VWVA 1WIKA 1A23A 6GSXA 1WPIA 5DCGA 2LRCA 2F8AA 2ZCTA 2X64A 3R2QA 3KMNA 1GSFA 3QAWA 1UVZA 1WE0A 3IBHA 1XVQA 1ERWA 4RUVA 1B9YC 2IWTA 2CX3A 2RUFA 1SJIA 5IMZA 4ID0A 4EF0A 2LJRA 3EWLA 3E0UA 3GYKA 3NZNA 3KP9A 2I9HA 2N5FA 3FKFA 5D9TA 3N9JA 4NAXA 5CNWA 1FG4A 5B6NA 3LJRA 4EL1A 3I69A 3MSZA 4FO5A 2YZHA 1H75A 3ZVJD 1GSEA 2LV3A 2K8SA 2V1MA 2E7PA 3Q74A 4NV5A 4O7HA 2L5LA 1PX7A 3MAKA 4CW9A 1XCCA 3HJOA 1V2AA 2WFCA 4ZB6A 5ECLB 5G31A 4Q5QA 2R4VA 1GTBA 3A2WA 3ZREA 5G1KA 1XFLA 2L57A 2HE3A 3APQA 2FA4A 3NIVA 4QQ7A 5ID2A 4ZBDA 3A2VA 3ME8A 1TDIA 5CREA 4KDYA 1GTUA 2R5GA 3HHVA 1GNWA 4TR0A 4KE3A 4EXJA 5G5FA 4Z7XA 4WEYA 1BAYA 1WMJA 2CA8A 3QPMA 1M2BA 3ERWA 1LU4A 1SL1B 2H19A 5IPHA 5EY6A 4MZWA 2K6VA 1O8WA 3GUSA 2YANA 2WB9A 1YF0A 4OWYA 5AGYA 2ALBA 4HOJA 4X1UA 2QC7A 1VF2A 7GSSA 4K6XA 4D73A 2JSYA 3G7IA 1UC7A 1GSYA 5CAXA 2VL3A 1V98A 1BEDA 4MDCA 4QL7A 2IJYA 5AISA 3PH9A 2L5OA 4POKA 1DUGA 1VF4A 2H1BA 3RAZA 3UOMA 4BL7B 1TW9A 1ZGNA 2RLIA 4L5OA 3I9V2 2VLTA 1TI1A 5HR1A 1ABAA 3LEFA 4ZXGA 4ZBAA 3SWLA 5DQYA 1FVKA 5A4WA 1OYJA 3EC3A 3F0IA 1GULA 4G0IA 2OJLA 3TJBA 3GX8A 1F37A 1DE1A 5HQPA 3TKRA 4PURA 4P3YB 3VWXA 5HR3A 3CSJA 3SBCA 3WT2A 4OD7A 1JFUA 1V57A 2H0GA 1LJRA 5CP1A 5DAKA 1XWCA 1IYHA 4YH2A 3GL5A 2FWHA 4FYBA 4TXVA 3C1SA 4NHWA 1WJKA 1YY7A 2WULA 3S9FA 1MDKA 2CAIA 4GF0A 5IPGA 1V58A 1OC8A 4YAVA 1XBSA 4PNGA 1Y6EA 2EIQA 3RDWA 1H4OA 3GH9A 4MA9A 5AIXA 2R3XA 4EVMA 2VCVA 4MCUA 2M72A 3EURA 2KLXA 1BYEA 4G9HA 4XRAA 1EEJA 5D93A 3LG6A 4TRXA 4MF7A 4MP4A 3BCIA 3ZIVA 4K8MA 3H93A 4ULXA 4PXOA 4WKWA 3MDKA 1VGLA 3K8NA 5GSSA 1K3YA 2IMDA 2VLVA 3HVVA 1T1VA 5IIZA 1WP0A 3G9BA 1SYXA 1WOUA 3EMXA 2AYTA 1FO5A 3EE2A 2H8LA 3UBLA 1F6MC 4KCAA 4F03A 3FZ5A 3F4RA 2LJKA 2H76A 3CRTA 2DJ2A 1K0NA 3VFIA 3LFLA 1XWKA 4KDXA 3H4KA 5ELAA 2FGXA 1TI3A 3FZ9A 3GX0A 4ZBBA 3L9VA 2HRAA 3VK9A 4TR3A 2YWOA 4GXZA 2C0GA 4BL7A 4EKZA 1FAAA 2GZZA 1GNEA 3IV4A 2WRTA 3CYNA 3L78A 5DDLA 2MMAA 3GH6A 4J57E 1XXUA 2HFDA 3EYTA 2XHFA 3KTLA 1ERVA 2H1GA 2G2QA 5G1LA 4OCFA 4Q5FA 1OC3A 4MABA 5IMCA 2JZTA 4IHUA 5H5SA 4RQRA 1YZXA 5C04A 3OR5A 2XC2A 3RPNA 1OVNA 3ZITA 1X9MB 1HQOA 1A2MA 2C0DA 2L59A 5KN3A 3KCMA 4NXIA 2RM5A 3UEMA 2A2RA 5ECSA 5A5KA 2DMLA 1RQMA 3QD9A 2WS2A 4O5RA 2MZCA 4IJIA 1OE8A 4PX1A 2LRNA 1Z6MA 2HLSA 2HZEB 1THXA 2DJ3A 3I6AA 4MF6A 4LMVA 2H73A 2B5XA 1AW9A 5IO0A 2XBIA 3QFBC 4AJ7A 4ECBA 4QL9A 3L0HA 1PQNA 1WRYA 3BBYA 4FH8A 1JZRA 2AV4A 3QAVA 5IMAA 2GSQA 2IMKA 1QXHA 1SU9A 3M0FA 3TGZA 3LSZA 5CRWA 4WETA 5F06A 4MPFA 4O92A 5HFGA 1Z7PA 2IN3A 4MF5A 4WR4A 4KCEA 4V1Ap 2YV7A 4EC0A 1NHOA 2WZ9A 5ID2B 1FOVA 1DBYA 1VF1A 1OC9B 4HZ4A 4NMUA 3EU3A 2LQQA 3VI5A 4F0BA 5CYYA 2F9SA 4GQCA 3W8SA 3P7XA 4NPBA 3P8WA 1SENA 2VUPA 4LL1B 2O8VB 2OBIA 5ECIB 2B5YA 3QCPA 3BCKA 2F51A 3FRCA 1Y25A 3E9JB 3ZFBA 3ZYWA 4FIWA 2H6ZA 4PUFC 1W4VA 3ZMKA 2H30A 3UVTA 1EV4A 1OKDA 5DJLA 4ZILA 3TKPA 2VOCA 4TVEA 5EPFA 5G2ZA 5D96A 4ISDA 3KMOA 4DSQA 3AY8A 5G5EA 2V41A 1TP9A 3DWVA 1AIUA 5D73A 1IYIA 3IC8A 3P90A 2JU5A 4N0ZA 1TK5B 4N30A 3TJFA 1GL8A 2PGTA 4ECCA 1EOGA 1T3BA 4FYCA 5DALB 3IRAA 4RQXA 3DIEA 2VL9A 3HZ4A 1PRXA 3FR6A 2YJ7A 5AIVA 2MMZA 5ECNB 1RK4A 1T4ZA 3VI7A 4XIHA 3TKQA 1WWJA 1MD3A 3GRXA 4GCIA 2ZUPA 3GKNA 2GSTA 1JZWA 2HZEA 4HQSA 4IW9A 3IOSA 5DBQA 1YKAA 2ON5A 2YP6A 4O32A 3LWAA 3H8QA 1XW5A 2EIOA 2AAWA 2IMEA 4OO5A 3HY2A 4ECIA 5KN1A 4TR1B 4JEDA 4PQIA 5DAKB 2KOKA 6GSWA 2GQMA 5FWGA 1KNGA 4HU7A 2GSSA 3D4MA 2O87A 1T7PB 3ZRDA 2VL2A 1XPVA 2VO4A 1U3AA 1GSSA 3F8UA 4MH3A 5LCZA 4GRFA 5EVOA 5CO3A 2PBJA 1OE7A 3US3A 3WGXA 5ENUA 5ECMB 2N5BA 1J08A 1GH2A 2DJ1A 4IJ3A 2E2MA 3FR3A 3Q19A 5IMFA 1EZKA 1OC9A 3RHBA 2IL3A 4K0NA 4MH2A 1EV9A 3A3TA 1GLPA 2V2GA 2C3TA 2MMOA 2AB6A 3KP8A 1PN9A 4I2TA 1G6YA 5FHIA 1M99A 1TRUA 3IK9A 1K0CA 1PGTA 4N11A 2K18A 3A2XA 1XOBA 1GTAA 2B3SA 5DQSA 4LMWA 3TKSC 1EGRA 2H01A 4AF2A 1B4QA 4DVCA 2GDRA 2PERA 2FWFA 1O85A 2JZRA 4K7OA 5KN0A 3VPQA 4OCEA 1UA5A 5ECOB 2VM1A 4AJ6A 4RI7A 4K0GA 4I97A 5F05A 4BPYA 1TXXA 5DALA 5GZZB 2LRTA 4MZCA 3HVXA 3LQ7A 1U3IA 3L9UA 3DEXA 3A5WA 1BG5A 5CRDA 3LYKA 3O6TA 1TU8A 3C8EA 2LUSA 2FHEA 4HQZA 4IKHA 2F3MA 2GQLA 2NVLA 1B48A 4JE1A 2FWEA 4E8HA 1EP7A 3TKSE 2LS5A 2CQ9A 13GSA 2CZ3A 3KTBA 2HQTA 3M3MA 3ERFA 2H75A 3TOTA 1GLQA 5D9VA 4TR1A 3IAM2 1NSWA 3GKXA 1KTEA 1PMTA 1CQHA 2LNTA 2TRXA 2C8UA 2CX4A 1FW1A 2JADA 3ZZXA 2LJAA 16GSA 3EU4A 2OA7A 1YQ1A 3VLNA 2VLUA 1JZDA 4IVFA 3D21A 3CSHA 5HR0A 1M7TA 3TJJA 4G2EA 3BD2A 3UJ1A 1EWXA 4EDZA 4K9ZA 1ST9A 22GSA 4EUYA 2WCIA 2C80A 3G7JA 2L4QA 1SL2B 2E0QA 3BJ5A 2DC5A 4IBPA 1ERTA 4H86A 3DMLA 6GSYA 1NM3A 5IQYA 1Z9HA 4KW6A 4TKYA 3HJPA 2FWGA 2JL4A 5ECPB 4GTUA 3O3TA 5ELGA 3VURA 3GIXA 5E59A 2C0EA 9GSSA 4YQVA 5IMDA 3ZL5A 2DSAA 1SYRA 4ZL8A 3TRQA 1SD9A 3JCML 2F8FA 3LXZA 1O8XA 2GGTA 5JWQB 4BWSA 4LL4B 1M0UA 4HZ2A 3GV1A 1R5AA 2C3QA 2VCXA 4KF9A 10GSA 4CDOA 3P2AA 6GSUA 1SK1A 1VF3A 2OE0A 4OO4A 4L0UA 4IGJA 3KXOA 1O81A 2R2JA 2FCHA 5HFIA 2O85A 2L4CA 2OKAA 5JWOB 2RUEA 2X99A 1ILOA 3E3EA 2CT6A 4WF4A 1SD8A 2EC4A 2A4VA 3HD5A 5F0GA 2YWIA 4J56E 4MJBA 1TRWA 2B6MA 1G7EA 1FVJA 2D2ZA 1E6BA 3TB2A 3O76A 1ZOFA 1A0FA 4TOPA 3GSTA 1GUMA 3W6GA 4KX4A 4V2MA 4GWRA 5LD0A 3C71A 3D6IA 2CVDA 4POMA 1TRVA 4ZL7A 1TU7A 3EINA 5JCUA 5DJMA 5ECKB 4ML6A 4EDYA 5EL8A 3KGKA 4IP1A 3F4TA 2HRFA 4BVXB 4TXOB 3W8JA 3TRPA 3CMIA 5GSTA 8GSSA 3VPTA 2KP2A 2CVBA 4WBJA 2YWNA 3UL3A 4KDUA
chains in the Genus database with same CATH superfamily
1YEWC 1F3AA 3J7Yb 2AHEA 2H71A 1M2DA 4KH7A 4XS4B 2H0IA 1AQVA 2WJUA 1FHEA 3HMJG 2MMNA 2P5RA 1QK8A 4DSSA 2L6DA 1K0MA 3L9SA 2QA1A 2PUKC 2H72A 4XS6A 3UVHA 2N5AA 1MDJA 1GSQA 2BMXA 3KZQA 1YEPA 4WR5A 1C72A 5C00A 1VRSD 1O7UA 2FA8A 4A5PA 1A8LA 6GSSA 3WGDA 1AAZA 4NWYA 4NHZA 4OFTA 1SK2A 4KAEA 11GSA 2PU9C 4X43A 3WGEA 4BVYA 3EVIA 3ZIJA 4MK3A 3GKKA 2FNOA 5B8BA 4TW5A 4POLA 1GSUA 1URMA 2V6KA 4AKGA 1YKCA 3TJKA 2IMIA 2VD0A 1B8XA 3HKRA 1PKWA 4JRRA 4J2FA 4FQUA 4IP6A 2R6KA 4ICYA 1HNAA 1XWAA 5IO2A 2ZNMA 3GN3A 3UMAA 3J7Yk 2C0FA 2DBCA 4PQHA 1F3BA 1Z7RA 1BJXA 2O89A 1T4YA 4L8EA 4K5SA 3LORA 4PNFA 1XW9A 5GAND 3ZTLA 4HUAA 5A4UA 1S3CA 1X0RA 1SJZA 1ON4A 1PSQA 3FMWA 4F2IA 4MJEA 5H5QA 5D9XA 3DKSA 2AJQB 3H1NA 1GUKA 1E2YA 4AI6A 2HSNB 2BTOT 18GSA 14GSA 4PGTA 4MJCA 1FB6A 2EFCA 3Q18A 1T00A 4JBBA 2YN1A 1R26A 3I43A 4WXTA 4X0XA 3GFKA 4EE0A 3EPTA 3ZLPA 4F82A 2XBQA 1QGVA 2CAQA 3Q6OA 3BOAA 1AC1A 1SKRB 5H5RA 3TJGA 4Q5NA 2R0CA 3DVWA 5KOXA 1W89A 2KP1A 3F6DA 1YF1A 2YNXA 3VWUA 4JR4A 4OFNA 4EIQA 4BVXA 2LQOA 4TXOA 1XIYA 3CXGA 3LXTA 2VAFA 1JLVA 2GTUA 2GQKA 4PTSA 3HCZA 1O6JA 4G10A 4WBRD 2GT6A 4KA0A 4I5QA 2HSMB 4JU5A 1PL2A 4AKHA 4GLTA 3ERGA 2NDOA 1X9WB 1XOAA 4XS4A 5A34A 5J4YA 4WF5A 3GMFA 3C7MA 1G0TA 2XPDA 2PPTA 3IDVA 4HS1A 4CHSA 3DGQA 3GTUA 4Z2TA 3ISOA 4YAPA 3UAPA 1HD2A 1X9SB 1X5EA 3U5RE 2EIRA 2H1DA 2R0PA 2ES7A 2FUG2 1BF5A 1AUCA 2J23A 2WW3A 1BQ7A 1K0OA 3FR9A 4QMKA 2FY6A 1YVLA 1DSBA 4KGIA 3HJMA 1B4PA 1K3OA 3CTGA 2HT9A 4NV2A 4GSSA 2OE1A 4K7IA 1MTCA 4GDFA 2WW1A 4N0VA 2O36A 4GQFA 3MNGA 3FZAA 2VCTA 2PN8A 2HNLA 3D0ZA 4Q5RA 3APOA 2QGVA 1S3AA 1SJ6A 5J4UA 3UARA 3CBUA 1RW1A 2VCWA 1YEXA 1TRSA 1XWGA 4ZB8A 2H0HA 3L4NA 4K2XA 4K1FA 2GZYA 1HYUA 1USBA 3LYPA 4AKXB 2QKEA 4G01A 1S4BP 4DSRA 2B1LA 2GSRA 1ZYNA 3ME7A 3GL3A 1Q4JA 5B7CA 1MD4A 3F3QA 2P5QA 1N2AA 5DVBA 5B6MA 5IOWA 2A2SA 4G19A 5IM9A 2GZPA 1XWBA 2HSNA 3D22A 1FB0A 5KN2A 1K0DA 2GS3A 2RIIA 3WD6A 3D4TA 4BWQA 1NHYA 2CVKA 1ZCPA 4L0WA 3QAGA 2HXKA 2G0FA 5J3RA 2C4JA 3QDNA 2YV9A 4KSOA 2LNSA 1TK0B 4PHZC 2NTOA 3IPZA 3GURA 4IQ1A 1QUWA 1SK0A 4HEA2 1U6TA 1JZOA 2DJ0A 2R0GA 2YPMA 1EP8A 1JLWA 5J41A 17GSA 4I6XA 1MDIA 3DYRA 2I81A 3DRNA 2HSHA 3M9KA 1EEMA 1PX6A 2TIRA 1ZZYA 4V2LA 3IXRA 1J0FA 2HRKA 2IMFA 3QFAC 2UZ8A 1U88A 3HZ8A 1GTIA 2BJXA 3CQFA 2HSMA 4E68A 5E4WA 2WDUA 1JHBA 5L71A 4E8EA 3D5JA 1K0BA 1ML6A 4XTSA 2WW0A 1A2LA 3KEBA 3LW9A 1HNCA 5AN1A 4MLYA 4HU9A 1KEBA 4DEJA 2PVOC 1Z6NA 2X8GA 1HNBA 1Q98A 2HI7A 3KM6A 3WT1A 4IQAA 2GVPA 1NW2A 4ML1A 4IELA 4ILFA 5IMVA 1I1IP 2WZSA 1R4WA 2P0GA 5A1NB 1ERUA 5LNKe 2V32A 1GUHA 2IFQB 3NOFA 2OBKA 2NBSA 1TOFA 2PWJA 2OACA 1QQ2A 4DSSB 4GSNA 4ECJA 2H6YA 2VCZA 2MBSA 5COHA 2OE3A 3KIJA 5ECQB 5IOXA 1M9AA 5FT3A 1GP1A 2IPAA 4HI7A 2HRNA 3ZVJA 2K9FA 2DIYA 2MBTA 1MEKA 1OKTA 4PQ1A 1TK8B 3FHKA 3HDCA 1EGOA 3TKSA 2B7KA 2KHPA 4BVYB 5ECHB 2GT5A 3M1GA 1SVOA 2DIZA 4YQUA 3ZFLA 2YWMA 3ZMLA 1K0AA 3QOUA 4N10A 4BIKA 2H1LA 3VWWA 5JCGA 1KBNA 1LBKA 1PL1A 1V40A 4OFMA 4MNNA 3UIWA 1B9XC 5G30A 2KUCA 2YJHA 1ACVA 5D9WA 2FD3A 4F0CA 2H70A 3KD0A 3EMPA 1Z3EA 3F6FA 4KNDA 4OMVA 4IN0A 3RPPA 1BG1A 2YCDA 5J40A 4KSMA 5CRGA 3KH9A 3CWGA 3PINA 5B8AA 5D8IA 1A2JA 2B1KA 2LTKA 3CSIA 4ZB9A 1BX9A 3DD3A 2MYGA 3HXSA 1EOHA 1T8EB 3M9JA 2O7KA 2H66A 4FYUA 1PA3A 1Z5YE 2DMMA 2XPEA 3C1RA 4I8BA 3IE3A 3WYWA 5JCWA 2R37A 3LGCA 1ZYQB 1V9WA 2QSIA 3G7YA 5GAPD 3IK7A 1N8JA 4Z2RA 2YZUA 3GA4A 1U87A 4HJ2A 1M3JA 2DLXA 2Z9SA 3M8NA 3PGTA 6GSVA 1I5GA 2LSTA 4RI6A 1SVMA 2JACA 2A4HA 5J5NA 3CRUA 2FLSA 3GNJA 4HJMA 3HA9A 3V1WA 4PUAA 20GSA 3U6VA 3IC4A 1QFNA 1F2EA 2LEGA 3H79A 4I2UA 2REMA 4POBA 3ED3A 4JZQA 3TRXA 1SKWB 2E2GA 5INYA 3F63A 2H6XA 2M46A 4USSA 4TR4A 5F07A 2VM2A 2V6OA 2VIMA 1M9BA 5BMUB 3IHQA 3QR6A 2VCQA 2YOIA 5A34B 6GSTA 5A1NA 1I9DA 2OADA 3C73A 4LLRA 5HFKA 3F3RA 1R5PA 2IFQA 3MYDA 4KUNA 3GTUB 1XZOA 4MMMA 2H74A 3DVXA 4TN8A 3FK8A 2HZFA 1G7OA 3APSA 2P31A 3R3EA 3N5OA 5J9BA 4ZL9A 1X5DA 1YDKA 2B7JA 1A24A 5ECRB 1O73A 2LKUA 1TJDA 2J9HA 3F4SA 4BA7A 2WGRA 2O5VA 2CV4A 4HDEA 4G0KA 2K8VA 3IA1A 4XS1A 3FW2A 4K7NA 1TKDB 4G0LA 4AGSA 5CRHA 5A4VA 3F9UA 4XCSA 2RM6A 4MZBA 2CZ2A 1A8YA 2M80A 3TUEA 3FY7A 3RBTA 2DJKA 4F9ZA 2HYXA 1AQWA 3GHAA 1SKSB 2I1UA 5A5HB 2AUVA 1GRXA 5J47A 1XVWA 2JSZA 1SL0B 1AQXA 5DCHA 5ABRA 1AXDA 1F9MA 2PMTA 3TOUA 4JR6A 1PD21 3CTFA 3TCOA 3RHCA 3PPUA 1A0RP 1XW6A 4LA1A 5F8BA 3GSSA 2VL2C 1X5CA 2B5EA 5KEJA 1QMVA 3QMXA 3FEUA 1K3LA 1DE2A 4XRDA 3IR4A 1UN2A 2VD1A 2NPBA 1M2AA 2C3NA 4K2DA 2I3YA 3FYGA 3GKMA 3HVSA 3TDGA 4AJ8A 1ZMAA 3HYPA 1YJ6A 4ZIJA 1J9BA 2H1AA 1THOA 4EO3A 3FZ4A 4KB3A 1GSDA 19GSA 4GSTA 4D73B 5JWRB 2HSYA 1OAZA 1S3DA 1G6WA 2I4AA 4IS0A 5J9CA 1ZL9A 3KJYA 2IIYA 4MJAA 2DJJA 1TTZA 1GWCA 2PVQA 2X8HA 2HRKB 1Y1UA 4MPGA 4L5LA 4ACSA 3PR8A 3DXBA 2WVZA 1PKZA 2C1YA 4V2NA 4YQMA 2TRCP 4V1Ag 12GSA 2GLRA 5BMUA 2JZSA 1CQGA 3KH7A 3UBKA 2L6CA 3IAS2 5HR2A 4Z2UA 4XHMA 2X8CA 3MWHA 1ZYEA 2ON7A 1R7HA 4X4JA 3VWVA 1WIKA 1A23A 6GSXA 1WPIA 4EIPA 5DCGA 2LRCA 2F8AA 2ZCTA 2X64A 3R2QA 3KMNA 1GSFA 3QAWA 1UVZA 1WE0A 3IBHA 1XVQA 1ERWA 4RUVA 1B9YC 2IWTA 2CX3A 2RUFA 1SJIA 3RFRC 5IMZA 4ID0A 4EF0A 2EFHA 2LJRA 3EWLA 3E0UA 3GYKA 3NZNA 3KP9A 2I9HA 2N5FA 3CHXC 3FKFA 5D9TA 4HSCX 3N9JA 4NAXA 5CNWA 1FG4A 5B6NA 3LJRA 4EL1A 3I69A 3MSZA 4FO5A 2YZHA 1H75A 3ZVJD 1GSEA 4O5UA 2LV3A 2K8SA 2V1MA 2E7PA 3Q74A 4NV5A 4O7HA 5A5HA 2L5LA 1PX7A 3MAKA 4CW9A 1XCCA 3HJOA 1V2AA 2WFCA 4ZB6A 5ECLB 5G31A 4Q5QA 2R4VA 1GTBA 3A2WA 3ZREA 5G1KA 1XFLA 2L57A 2HE3A 3APQA 2FA4A 3NIVA 4QQ7A 5ID2A 4ZBDA 3A2VA 3ME8A 1TDIA 5CREA 4KDYA 1GTUA 2R5GA 3HHVA 1GNWA 4TR0A 4KE3A 4EXJA 1S3RA 5G5FA 4Z7XA 4WEYA 1BAYA 1WMJA 2CA8A 3QPMA 1M2BA 3ERWA 1LU4A 1SL1B 2H19A 5IPHA 5EY6A 4MZWA 2K6VA 1O8WA 3GUSA 2YANA 2WB9A 1YF0A 4OWYA 5AGYA 2ALBA 4HOJA 4X1UA 2QC7A 1VF2A 7GSSA 4K6XA 4D73A 2JSYA 3G7IA 1UC7A 1GSYA 5CAXA 2VL3A 4YKGA 1V98A 1BEDA 4MDCA 4QL7A 2IJYA 5AISA 3PH9A 2L5OA 4POKA 1DUGA 1VF4A 2H1BA 3RAZA 3UOMA 4BL7B 1TW9A 1ZGNA 2RLIA 4ZB7A 4L5OA 3I9V2 2VLTA 1TI1A 5HR1A 1ABAA 3LEFA 4ZXGA 4ZBAA 3SWLA 5DQYA 1FVKA 5A4WA 1OYJA 3EC3A 3F0IA 1GULA 4G0IA 2OJLA 3TJBA 3GX8A 1F37A 1DE1A 5HQPA 4PI2C 3TKRA 4PURA 4P3YB 3VWXA 5HR3A 3CSJA 3SBCA 3WT2A 4OD7A 1JFUA 1V57A 2H0GA 1LJRA 1SVLA 5CP1A 2OT3A 5DAKA 1XWCA 1IYHA 4YH2A 3GL5A 2FWHA 4FYBA 4TXVA 4PI0C 3C1SA 4NHWA 1WJKA 1YY7A 2WULA 3A5IA 3S9FA 1MDKA 2CAIA 4GF0A 5IPGA 1V58A 1OC8A 4YAVA 1XBSA 4PNGA 1Y6EA 2EIQA 3RDWA 1H4OA 3GH9A 4MA9A 5AIXA 2R3XA 4EVMA 2VCVA 4MCUA 2M72A 3EURA 2KLXA 4FXYP 1BYEA 4G9HA 4XRAA 1EEJA 3MIXA 5D93A 3LG6A 4TRXA 4MF7A 4MP4A 4CY8A 3BCIA 3ZIVA 4K8MA 3H93A 4ULXA 4PXOA 4WKWA 3MDKA 1VGLA 3K8NA 2WVYA 1K3YA 3RGBC 5GSSA 2IMDA 2VLVA 3HVVA 1T1VA 5IIZA 1WP0A 3G9BA 1SYXA 1WOUA 3EMXA 2AYTA 1FO5A 3EE2A 2H8LA 3UBLA 1F6MC 4KCAA 3FZ5A 4F03A 3F4RA 2LJKA 2H76A 3CRTA 2DJ2A 1K0NA 3VFIA 3LFLA 1XWKA 4KDXA 3H4KA 5ELAA 2FGXA 1TI3A 3FZ9A 3GX0A 4ZBBA 3L9VA 2HRAA 3VK9A 4TR3A 2YWOA 4GXZA 2C0GA 4BL7A 4EKZA 1FAAA 2GZZA 1GNEA 3IV4A 2WRTA 3CYNA 3L78A 5DDLA 2MMAA 3GH6A 4J57E 1XXUA 2HFDA 3EYTA 2XHFA 3KTLA 1ERVA 2H1GA 1TXUA 2G2QA 5G1LA 4OCFA 4Q5FA 1OC3A 4MABA 5IMCA 2UV8G 1PN0A 2JZTA 4IHUA 5H5SA 2EFEA 1YZXA 4RQRA 5C04A 3OR5A 2XC2A 3RPNA 1OVNA 3ZITA 1X9MB 1HQOA 1A2MA 2C0DA 2L59A 5KN3A 3KCMA 4NXIA 2RM5A 3UEMA 2A2RA 5ECSA 5A5KA 2DMLA 1RQMA 3QD9A 2WS2A 4O5RA 2MZCA 4IJIA 1OE8A 4PX1A 2LRNA 1Z6MA 2HLSA 2HZEB 1THXA 2DJ3A 3I6AA 4MF6A 4LMVA 2H73A 2B5XA 1XG8A 1AW9A 5IO0A 2XBIA 3QFBC 4AJ7A 4ECBA 4QL9A 3L0HA 1PQNA 1WRYA 3BBYA 4FH8A 1JZRA 2AV4A 3QAVA 5IMAA 2GSQA 2IMKA 1QXHA 1SU9A 1FOHA 3M0FA 3TU3B 2X49A 3TGZA 3LSZA 5CRWA 4WETA 5F06A 4MPFA 1ZYPA 4O92A 5HFGA 1Z7PA 2IN3A 1PFOA 4MF5A 4WR4A 4KCEA 4V1Ap 2YV7A 4EC0A 1NHOA 2WZ9A 5ID2B 1FOVA 1DBYA 1VF1A 5BRTA 1OC9B 4HZ4A 4NMUA 3EU3A 2LQQA 3VI5A 4F0BA 5CYYA 2F9SA 4GQCA 3W8SA 3P7XA 4NPBA 3P8WA 1SENA 2VUPA 4LL1B 2O8VB 2OBIA 5ECIB 2B5YA 3QCPA 3BCKA 2F51A 3HVNA 3FRCA 1Y25A 3E9JB 3ZFBA 3ZYWA 4FIWA 2H6ZA 4PUFC 1W4VA 3ZMKA 2H30A 3UVTA 1EV4A 1OKDA 5DJLA 2WVXB 4ZILA 3TKPA 2VOCA 4TVEA 5EPFA 5G2ZA 5D96A 4ISDA 3KMOA 4DSQA 3AY8A 5G5EA 2V41A 1TP9A 3DWVA 1AIUA 5D73A 1IYIA 3IC8A 3P90A 2JU5A 4N0ZA 1TK5B 4N30A 3TJFA 1GL8A 2PGTA 4ECCA 1EOGA 1T3BA 4FYCA 5DALB 3IRAA 4RQXA 3DIEA 2VL9A 3HZ4A 1PRXA 3FR6A 2YJ7A 5AIVA 2MMZA 5ECNB 1RK4A 1T4ZA 3VI7A 4XIHA 3TKQA 1WWJA 1MD3A 3GRXA 4GCIA 2O3EA 2ZUPA 3GKNA 2GSTA 1JZWA 2HZEA 4HQSA 4IW9A 3IOSA 5DBQA 1YKAA 4O5QA 2ON5A 2YP6A 4O32A 3LWAA 3H8QA 1XW5A 2EIOA 2AAWA 2IMEA 4OO5A 3HY2A 4N3ZA 4ECIA 5KN1A 4TR1B 4JEDA 4PQIA 5DAKB 2KOKA 6GSWA 2GQMA 5FWGA 1KNGA 4HU7A 2GSSA 3D4MA 2O87A 1T7PB 3ZRDA 2VL2A 1XPVA 2VO4A 1U3AA 1GSSA 3F8UA 4MH3A 5LCZA 4GRFA 5EVOA 5CO3A 2PBJA 1OE7A 3US3A 3WGXA 5ENUA 4W66A 5ECMB 2N5BA 1J08A 1GH2A 2DJ1A 4IJ3A 2E2MA 3FR3A 3Q19A 5IMFA 1EZKA 1OC9A 3RHBA 2IL3A 4K0NA 4MH2A 1EV9A 3A3TA 1GLPA 2V2GA 2C3TA 2MMOA 2AB6A 3KP8A 1PN9A 4I2TA 2DKHA 1G6YA 5KOWA 5FHIA 1M99A 1TRUA 3IK9A 2DKIA 1K0CA 1PGTA 4N11A 2K18A 3A2XA 1XOBA 1GTAA 2B3SA 5DQSA 4LMWA 3TKSC 1EGRA 2H01A 4AF2A 1B4QA 4DVCA 2GDRA 2PERA 2FWFA 1O85A 2JZRA 4K7OA 2EFDA 2WVXA 5KN0A 3VPQA 4OCEA 1UA5A 5ECOB 2VM1A 4AJ6A 4RI7A 4K0GA 4I97A 5F05A 2A2PA 4BPYA 1TXXA 5DALA 5GZZB 2LRTA 4MZCA 3HVXA 4AKIA 3LQ7A 1U3IA 3L9UA 3DEXA 3A5WA 1BG5A 5CRDA 3LYKA 3O6TA 1TU8A 3C8EA 2LUSA 2FHEA 4HQZA 4IKHA 2F3MA 2GQLA 2NVLA 1B48A 4YKFA 4JE1A 2FWEA 4E8HA 1EP7A 3TKSE 2LS5A 2CQ9A 13GSA 2CZ3A 3KTBA 2HQTA 3M3MA 3ERFA 2H75A 3TOTA 1GLQA 5D9VA 4TR1A 3IAM2 1NSWA 3GKXA 1KTEA 1PMTA 1CQHA 2LNTA 2TRXA 2VKZG 2C8UA 2CX4A 1FW1A 2JADA 3ZZXA 2LJAA 16GSA 3EU4A 2OA7A 1YQ1A 3VLNA 2VLUA 1JZDA 4IVFA 3D21A 2WW2A 3CSHA 5HR0A 1M7TA 3TJJA 4G2EA 3BD2A 3UJ1A 1EWXA 4EDZA 4K9ZA 1ST9A 22GSA 4EUYA 2WCIA 2C80A 3G7JA 2L4QA 1SL2B 2E0QA 3BJ5A 2DC5A 4IBPA 1ERTA 4H86A 3DMLA 6GSYA 1NM3A 5IQYA 1Z9HA 4KW6A 4TKYA 3HJPA 2FWGA 2JL4A 5ECPB 4GTUA 3O3TA 5ELGA 3VURA 3GIXA 1M3IA 2C0EA 5E59A 9GSSA 4YQVA 5IMDA 3ZL5A 2DSAA 1SYRA 4ZL8A 3TRQA 1SD9A 3JCML 2F8FA 3LXZA 1O8XA 2GGTA 2X4AA 5JWQB 4BWSA 4LL4B 1M0UA 4CY6A 4HZ2A 3GV1A 1R5AA 2C3QA 2VCXA 4KF9A 10GSA 4CDOA 3P2AA 6GSUA 1SK1A 1VF3A 2OE0A 4OO4A 4L0UA 4IGJA 3KXOA 1O81A 2R2JA 2FCHA 5HFIA 2O85A 2L4CA 2OKAA 5JWOB 2QA2A 2RUEA 2X99A 1ILOA 3E3EA 2CT6A 4WF4A 1SD8A 2EC4A 2A4VA 3HD5A 5F0GA 2YWIA 4J56E 4MJBA 1TRWA 2B6MA 1G7EA 1FVJA 2D2ZA 1E6BA 3TB2A 3O76A 1ZOFA 1A0FA 4TOPA 3GSTA 1GUMA 3W6GA 4KX4A 4V2MA 4GWRA 5LD0A 3C71A 3D6IA 2CVDA 4POMA 1TRVA 3IHGA 4ZL7A 1TU7A 3EINA 5JCUA 5DJMA 5ECKB 4ML6A 4K5RA 4EDYA 5EL8A 3KGKA 4IP1A 3F4TA 5J4VA 2HRFA 4BVXB 4TXOB 3W8JA 3TRPA 3CMIA 5GSTA 8GSSA 3VPTA 2KP2A 2CVBA 4WBJA 2YWNA 3UL3A 1N25A 4KDUA
chains in the Genus database with same CATH topology
1F3AA 3J7Yb 2AHEA 2H71A 1M2DA 4KH7A 4XS4B 2H0IA 1AQVA 2WJUA 1FHEA 3HMJG 2MMNA 2P5RA 1QK8A 4DSSA 2L6DA 1K0MA 3L9SA 2QA1A 2PUKC 2H72A 4XS6A 3UVHA 2N5AA 1MDJA 1GSQA 2BMXA 3KZQA 1YEPA 4WR5A 1C72A 5C00A 1VRSD 1O7UA 2FA8A 4A5PA 1A8LA 6GSSA 3WGDA 1AAZA 4NWYA 4NHZA 4OFTA 1SK2A 4KAEA 11GSA 2PU9C 4X43A 3WGEA 4BVYA 3EVIA 3ZIJA 4MK3A 3GKKA 2FNOA 5B8BA 4TW5A 4POLA 1GSUA 1URMA 2V6KA 4AKGA 1YKCA 3TJKA 2IMIA 2VD0A 1B8XA 3HKRA 1PKWA 4JRRA 4J2FA 4FQUA 4IP6A 2R6KA 4ICYA 1HNAA 1XWAA 5IO2A 2ZNMA 3GN3A 3UMAA 3J7Yk 2C0FA 2DBCA 4PQHA 1F3BA 1Z7RA 1BJXA 2O89A 1T4YA 4L8EA 4K5SA 3LORA 4PNFA 1XW9A 5GAND 3ZTLA 4HUAA 5A4UA 1S3CA 1X0RA 1SJZA 1ON4A 1PSQA 3FMWA 4F2IA 4MJEA 5H5QA 5D9XA 3DKSA 2AJQB 3H1NA 1GUKA 1E2YA 4AI6A 2HSNB 2BTOT 18GSA 14GSA 4PGTA 4MJCA 1FB6A 2EFCA 3Q18A 1T00A 4JBBA 2YN1A 1R26A 3I43A 4WXTA 4X0XA 3GFKA 4EE0A 3EPTA 3ZLPA 4F82A 2XBQA 1QGVA 2CAQA 3Q6OA 3BOAA 1AC1A 1SKRB 5H5RA 3TJGA 4Q5NA 2R0CA 3DVWA 5KOXA 1W89A 2KP1A 3F6DA 1YF1A 2YNXA 3VWUA 4JR4A 4OFNA 4EIQA 4BVXA 2LQOA 4TXOA 1XIYA 3CXGA 3LXTA 2VAFA 1JLVA 2GTUA 2GQKA 4PTSA 3HCZA 1O6JA 4G10A 4WBRD 2GT6A 4KA0A 4I5QA 2HSMB 4JU5A 1PL2A 4AKHA 4GLTA 3ERGA 2NDOA 1X9WB 1XOAA 4XS4A 5A34A 5J4YA 4WF5A 3GMFA 3C7MA 1G0TA 2XPDA 2PPTA 3IDVA 4HS1A 4CHSA 3DGQA 3GTUA 4Z2TA 3ISOA 4YAPA 3UAPA 1HD2A 1X9SB 1X5EA 3U5RE 2EIRA 2H1DA 2R0PA 2ES7A 2FUG2 1BF5A 1AUCA 2J23A 1BQ7A 1K0OA 3FR9A 4QMKA 2FY6A 1YVLA 1DSBA 4KGIA 3HJMA 1B4PA 1K3OA 3CTGA 2HT9A 4NV2A 4GSSA 2OE1A 4K7IA 1MTCA 4GDFA 4N0VA 4GQFA 3MNGA 3FZAA 2VCTA 2PN8A 2HNLA 3D0ZA 4Q5RA 3APOA 2QGVA 1S3AA 1SJ6A 5J4UA 3UARA 3CBUA 1RW1A 2VCWA 1YEXA 1TRSA 1XWGA 4ZB8A 2H0HA 3L4NA 4K2XA 4K1FA 2GZYA 1HYUA 1USBA 3LYPA 4AKXB 2QKEA 4G01A 4DSRA 2B1LA 2GSRA 1ZYNA 3ME7A 3GL3A 1Q4JA 5B7CA 1MD4A 3F3QA 2P5QA 1N2AA 5DVBA 5B6MA 5IOWA 2A2SA 4G19A 5IM9A 2GZPA 1XWBA 2HSNA 3D22A 1FB0A 5KN2A 1K0DA 2GS3A 2RIIA 3WD6A 3D4TA 4BWQA 1NHYA 2CVKA 1ZCPA 4L0WA 3QAGA 2HXKA 2G0FA 5J3RA 2C4JA 3QDNA 2YV9A 4KSOA 2LNSA 1TK0B 2NTOA 3IPZA 3GURA 4IQ1A 1QUWA 1SK0A 4HEA2 1U6TA 1JZOA 2DJ0A 2R0GA 2YPMA 1EP8A 1JLWA 5J41A 17GSA 4I6XA 1MDIA 3DYRA 2I81A 3DRNA 2HSHA 3M9KA 1EEMA 1PX6A 2TIRA 1ZZYA 4V2LA 3IXRA 1J0FA 2HRKA 2IMFA 3QFAC 2UZ8A 1U88A 3HZ8A 1GTIA 2BJXA 2HSMA 4E68A 5E4WA 2WDUA 1JHBA 5L71A 4E8EA 3D5JA 1K0BA 1ML6A 4XTSA 1A2LA 3KEBA 3LW9A 1HNCA 5AN1A 4MLYA 4HU9A 1KEBA 4DEJA 2PVOC 1Z6NA 2X8GA 1HNBA 1Q98A 2HI7A 3KM6A 3WT1A 4IQAA 2GVPA 1NW2A 4ML1A 4IELA 4ILFA 5IMVA 1R4WA 2P0GA 5A1NB 1ERUA 5LNKe 2V32A 1GUHA 2IFQB 3NOFA 2OBKA 2NBSA 1TOFA 2PWJA 2OACA 1QQ2A 4DSSB 4GSNA 4ECJA 2H6YA 2VCZA 2MBSA 5COHA 2OE3A 3KIJA 5ECQB 5IOXA 1M9AA 5FT3A 1GP1A 2IPAA 4HI7A 2HRNA 3ZVJA 2K9FA 2DIYA 2MBTA 1MEKA 1OKTA 4PQ1A 1TK8B 3FHKA 3HDCA 1EGOA 3TKSA 2B7KA 2KHPA 4BVYB 5ECHB 2GT5A 3M1GA 1SVOA 2DIZA 4YQUA 3ZFLA 2YWMA 3ZMLA 1K0AA 3QOUA 4N10A 2H1LA 3VWWA 5JCGA 1KBNA 1LBKA 1PL1A 1V40A 4OFMA 4MNNA 3UIWA 1B9XC 5G30A 2KUCA 2YJHA 1ACVA 5D9WA 2FD3A 4F0CA 2H70A 3KD0A 3EMPA 1Z3EA 3F6FA 4KNDA 4OMVA 4IN0A 3RPPA 1BG1A 2YCDA 5J40A 4KSMA 5CRGA 3KH9A 3CWGA 3PINA 5B8AA 5D8IA 1A2JA 2B1KA 2LTKA 3CSIA 4ZB9A 1BX9A 3DD3A 2MYGA 3HXSA 1EOHA 1T8EB 3M9JA 2O7KA 2H66A 4FYUA 1PA3A 1Z5YE 2DMMA 2XPEA 3C1RA 4I8BA 3IE3A 3WYWA 5JCWA 2R37A 3LGCA 1ZYQB 1V9WA 2QSIA 3G7YA 5GAPD 3IK7A 1N8JA 4Z2RA 2YZUA 3GA4A 1U87A 4HJ2A 2DLXA 2Z9SA 3M8NA 3PGTA 6GSVA 1I5GA 2LSTA 4RI6A 1SVMA 2JACA 2A4HA 5J5NA 3CRUA 2FLSA 3GNJA 4HJMA 3HA9A 3V1WA 4PUAA 20GSA 3U6VA 3IC4A 1QFNA 1F2EA 2LEGA 3H79A 4I2UA 2REMA 4POBA 3ED3A 4JZQA 3TRXA 1SKWB 2E2GA 5INYA 3F63A 2H6XA 2M46A 4USSA 4TR4A 5F07A 2VM2A 2V6OA 2VIMA 1M9BA 5BMUB 3IHQA 3QR6A 2VCQA 2YOIA 5A34B 6GSTA 5A1NA 1I9DA 2OADA 3C73A 4LLRA 5HFKA 3F3RA 1R5PA 2IFQA 3MYDA 4KUNA 3GTUB 1XZOA 4MMMA 2H74A 3DVXA 4TN8A 3FK8A 2HZFA 1G7OA 3APSA 2P31A 3R3EA 3N5OA 5J9BA 4ZL9A 1X5DA 1YDKA 2B7JA 1A24A 5ECRB 1O73A 2LKUA 1TJDA 2J9HA 3F4SA 4BA7A 2WGRA 2O5VA 2CV4A 4HDEA 4G0KA 2K8VA 3IA1A 4XS1A 3FW2A 4K7NA 1TKDB 4G0LA 4AGSA 5CRHA 5A4VA 3F9UA 4XCSA 2RM6A 4MZBA 2CZ2A 1A8YA 2M80A 3TUEA 3FY7A 3RBTA 2DJKA 4F9ZA 2HYXA 1AQWA 3GHAA 1SKSB 2I1UA 5A5HB 2AUVA 1GRXA 5J47A 1XVWA 2JSZA 1SL0B 1AQXA 5DCHA 5ABRA 1AXDA 1F9MA 2PMTA 3TOUA 4JR6A 1PD21 3CTFA 3TCOA 3RHCA 3PPUA 1A0RP 1XW6A 4LA1A 5F8BA 3GSSA 2VL2C 1X5CA 2B5EA 5KEJA 1QMVA 3QMXA 3FEUA 1K3LA 1DE2A 4XRDA 3IR4A 1UN2A 2VD1A 2NPBA 1M2AA 2C3NA 4K2DA 2I3YA 3FYGA 3GKMA 3HVSA 3TDGA 4AJ8A 1ZMAA 3HYPA 1YJ6A 4ZIJA 1J9BA 2H1AA 1THOA 4EO3A 3FZ4A 4KB3A 1GSDA 19GSA 4GSTA 4D73B 5JWRB 2HSYA 1OAZA 1S3DA 1G6WA 2I4AA 4IS0A 5J9CA 1ZL9A 3KJYA 2IIYA 4MJAA 2DJJA 1TTZA 1GWCA 2PVQA 2X8HA 2HRKB 1Y1UA 4MPGA 4L5LA 4ACSA 3PR8A 3DXBA 1PKZA 2C1YA 4V2NA 4YQMA 2TRCP 4V1Ag 12GSA 2GLRA 5BMUA 2JZSA 1CQGA 3KH7A 3UBKA 2L6CA 3IAS2 5HR2A 4Z2UA 4XHMA 2X8CA 3MWHA 1ZYEA 2ON7A 1R7HA 4X4JA 3VWVA 1WIKA 1A23A 6GSXA 1WPIA 4EIPA 5DCGA 2LRCA 2F8AA 2ZCTA 2X64A 3R2QA 3KMNA 1GSFA 3QAWA 1UVZA 1WE0A 3IBHA 1XVQA 1ERWA 4RUVA 1B9YC 2IWTA 2CX3A 2RUFA 1SJIA 5IMZA 4ID0A 4EF0A 2EFHA 2LJRA 3EWLA 3E0UA 3GYKA 3NZNA 3KP9A 2I9HA 2N5FA 3FKFA 5D9TA 3N9JA 4NAXA 5CNWA 1FG4A 5B6NA 3LJRA 4EL1A 3I69A 3MSZA 4FO5A 2YZHA 1H75A 3ZVJD 1GSEA 4O5UA 2LV3A 2K8SA 2V1MA 2E7PA 3Q74A 4NV5A 4O7HA 5A5HA 2L5LA 1PX7A 3MAKA 4CW9A 1XCCA 3HJOA 1V2AA 2WFCA 4ZB6A 5ECLB 5G31A 4Q5QA 2R4VA 1GTBA 3A2WA 3ZREA 5G1KA 1XFLA 2L57A 2HE3A 3APQA 2FA4A 3NIVA 4QQ7A 5ID2A 4ZBDA 3A2VA 3ME8A 1TDIA 5CREA 4KDYA 1GTUA 2R5GA 3HHVA 1GNWA 4TR0A 4KE3A 4EXJA 5G5FA 4Z7XA 4WEYA 1BAYA 1WMJA 2CA8A 3QPMA 1M2BA 3ERWA 1LU4A 1SL1B 2H19A 5IPHA 5EY6A 4MZWA 2K6VA 1O8WA 3GUSA 2YANA 2WB9A 1YF0A 4OWYA 5AGYA 2ALBA 4HOJA 4X1UA 2QC7A 1VF2A 7GSSA 4K6XA 4D73A 2JSYA 3G7IA 1UC7A 1GSYA 5CAXA 2VL3A 4YKGA 1V98A 1BEDA 4MDCA 4QL7A 2IJYA 5AISA 3PH9A 2L5OA 4POKA 1DUGA 1VF4A 2H1BA 3RAZA 3UOMA 4BL7B 1TW9A 1ZGNA 2RLIA 4ZB7A 4L5OA 3I9V2 2VLTA 1TI1A 5HR1A 1ABAA 3LEFA 4ZXGA 4ZBAA 3SWLA 5DQYA 1FVKA 5A4WA 1OYJA 3EC3A 3F0IA 1GULA 4G0IA 2OJLA 3TJBA 3GX8A 1F37A 1DE1A 5HQPA 3TKRA 4PURA 4P3YB 3VWXA 5HR3A 3CSJA 3SBCA 3WT2A 4OD7A 1JFUA 1V57A 2H0GA 1LJRA 1SVLA 5CP1A 2OT3A 5DAKA 1XWCA 1IYHA 4YH2A 3GL5A 2FWHA 4FYBA 4TXVA 3C1SA 4NHWA 1WJKA 1YY7A 2WULA 3A5IA 3S9FA 1MDKA 2CAIA 4GF0A 5IPGA 1V58A 1OC8A 4YAVA 1XBSA 4PNGA 1Y6EA 2EIQA 3RDWA 1H4OA 3GH9A 4MA9A 5AIXA 2R3XA 4EVMA 2VCVA 4MCUA 2M72A 3EURA 2KLXA 1BYEA 4G9HA 4XRAA 1EEJA 3MIXA 5D93A 3LG6A 4TRXA 4MF7A 4MP4A 4CY8A 3BCIA 3ZIVA 4K8MA 3H93A 4ULXA 4PXOA 4WKWA 3MDKA 1VGLA 3K8NA 5GSSA 1K3YA 2IMDA 2VLVA 3HVVA 1T1VA 5IIZA 1WP0A 3G9BA 1SYXA 1WOUA 3EMXA 2AYTA 1FO5A 3EE2A 2H8LA 3UBLA 1F6MC 4KCAA 3FZ5A 4F03A 3F4RA 2LJKA 2H76A 3CRTA 2DJ2A 1K0NA 3VFIA 3LFLA 1XWKA 4KDXA 3H4KA 5ELAA 2FGXA 1TI3A 3FZ9A 3GX0A 4ZBBA 3L9VA 2HRAA 3VK9A 4TR3A 2YWOA 4GXZA 2C0GA 4BL7A 4EKZA 1FAAA 2GZZA 1GNEA 3IV4A 2WRTA 3CYNA 3L78A 5DDLA 2MMAA 3GH6A 4J57E 1XXUA 2HFDA 3EYTA 2XHFA 3KTLA 1ERVA 2H1GA 1TXUA 2G2QA 5G1LA 4OCFA 4Q5FA 1OC3A 4MABA 5IMCA 2UV8G 1PN0A 2JZTA 4IHUA 5H5SA 2EFEA 1YZXA 4RQRA 5C04A 3OR5A 2XC2A 3RPNA 1OVNA 3ZITA 1X9MB 1HQOA 1A2MA 2C0DA 2L59A 5KN3A 3KCMA 4NXIA 2RM5A 3UEMA 2A2RA 5ECSA 5A5KA 2DMLA 1RQMA 3QD9A 2WS2A 4O5RA 2MZCA 4IJIA 1OE8A 4PX1A 2LRNA 1Z6MA 2HLSA 2HZEB 1THXA 2DJ3A 3I6AA 4MF6A 4LMVA 2H73A 2B5XA 1AW9A 5IO0A 2XBIA 3QFBC 4AJ7A 4ECBA 4QL9A 3L0HA 1PQNA 1WRYA 3BBYA 4FH8A 1JZRA 2AV4A 3QAVA 5IMAA 2GSQA 2IMKA 1QXHA 1SU9A 1FOHA 3M0FA 3TU3B 2X49A 3TGZA 3LSZA 5CRWA 4WETA 5F06A 4MPFA 1ZYPA 4O92A 5HFGA 1Z7PA 2IN3A 4MF5A 4WR4A 4KCEA 4V1Ap 2YV7A 4EC0A 1NHOA 2WZ9A 5ID2B 1FOVA 1DBYA 1VF1A 5BRTA 1OC9B 4HZ4A 4NMUA 3EU3A 2LQQA 3VI5A 4F0BA 5CYYA 2F9SA 4GQCA 3W8SA 3P7XA 4NPBA 3P8WA 1SENA 2VUPA 4LL1B 2O8VB 2OBIA 5ECIB 2B5YA 3QCPA 3BCKA 2F51A 3FRCA 1Y25A 3E9JB 3ZFBA 3ZYWA 4FIWA 2H6ZA 4PUFC 1W4VA 3ZMKA 2H30A 3UVTA 1EV4A 1OKDA 5DJLA 4ZILA 3TKPA 2VOCA 4TVEA 5EPFA 5G2ZA 5D96A 4ISDA 3KMOA 4DSQA 3AY8A 5G5EA 2V41A 1TP9A 3DWVA 1AIUA 5D73A 1IYIA 3IC8A 3P90A 2JU5A 4N0ZA 1TK5B 4N30A 3TJFA 1GL8A 2PGTA 4ECCA 1EOGA 1T3BA 4FYCA 5DALB 3IRAA 4RQXA 3DIEA 2VL9A 3HZ4A 1PRXA 3FR6A 2YJ7A 5AIVA 2MMZA 5ECNB 1RK4A 1T4ZA 3VI7A 4XIHA 3TKQA 1WWJA 1MD3A 3GRXA 4GCIA 2ZUPA 3GKNA 2GSTA 1JZWA 2HZEA 4HQSA 4IW9A 3IOSA 5DBQA 1YKAA 4O5QA 2ON5A 2YP6A 4O32A 3LWAA 3H8QA 1XW5A 2EIOA 2AAWA 2IMEA 4OO5A 3HY2A 4N3ZA 4ECIA 5KN1A 4TR1B 4JEDA 4PQIA 5DAKB 2KOKA 6GSWA 2GQMA 5FWGA 1KNGA 4HU7A 2GSSA 3D4MA 2O87A 1T7PB 3ZRDA 2VL2A 1XPVA 2VO4A 1U3AA 1GSSA 3F8UA 4MH3A 5LCZA 4GRFA 5EVOA 5CO3A 2PBJA 1OE7A 3US3A 3WGXA 5ENUA 4W66A 5ECMB 2N5BA 1J08A 1GH2A 2DJ1A 4IJ3A 2E2MA 3FR3A 3Q19A 5IMFA 1EZKA 1OC9A 3RHBA 2IL3A 4K0NA 4MH2A 1EV9A 3A3TA 1GLPA 2V2GA 2C3TA 2MMOA 2AB6A 3KP8A 1PN9A 4I2TA 2DKHA 1G6YA 5KOWA 5FHIA 1M99A 1TRUA 3IK9A 2DKIA 1K0CA 1PGTA 4N11A 2K18A 3A2XA 1XOBA 1GTAA 2B3SA 5DQSA 4LMWA 3TKSC 1EGRA 2H01A 4AF2A 1B4QA 4DVCA 2GDRA 2PERA 2FWFA 1O85A 2JZRA 4K7OA 2EFDA 5KN0A 3VPQA 4OCEA 1UA5A 5ECOB 2VM1A 4AJ6A 4RI7A 4K0GA 4I97A 5F05A 2A2PA 4BPYA 1TXXA 5DALA 5GZZB 2LRTA 4MZCA 3HVXA 4AKIA 3LQ7A 1U3IA 3L9UA 3DEXA 3A5WA 1BG5A 5CRDA 3LYKA 3O6TA 1TU8A 3C8EA 2LUSA 2FHEA 4HQZA 4IKHA 2F3MA 2GQLA 2NVLA 1B48A 4YKFA 4JE1A 2FWEA 4E8HA 1EP7A 3TKSE 2LS5A 2CQ9A 13GSA 2CZ3A 3KTBA 2HQTA 3M3MA 3ERFA 2H75A 3TOTA 1GLQA 5D9VA 4TR1A 3IAM2 1NSWA 3GKXA 1KTEA 1PMTA 1CQHA 2LNTA 2TRXA 2VKZG 2C8UA 2CX4A 1FW1A 2JADA 3ZZXA 2LJAA 16GSA 3EU4A 2OA7A 1YQ1A 3VLNA 2VLUA 1JZDA 4IVFA 3D21A 3CSHA 5HR0A 1M7TA 3TJJA 4G2EA 3BD2A 3UJ1A 1EWXA 4EDZA 4K9ZA 1ST9A 22GSA 4EUYA 2WCIA 2C80A 3G7JA 2L4QA 1SL2B 2E0QA 3BJ5A 2DC5A 4IBPA 1ERTA 4H86A 3DMLA 6GSYA 1NM3A 5IQYA 1Z9HA 4KW6A 4TKYA 3HJPA 2FWGA 2JL4A 5ECPB 4GTUA 3O3TA 5ELGA 3VURA 3GIXA 5E59A 2C0EA 9GSSA 4YQVA 5IMDA 3ZL5A 2DSAA 1SYRA 4ZL8A 3TRQA 1SD9A 3JCML 2F8FA 3LXZA 1O8XA 2GGTA 2X4AA 5JWQB 4BWSA 4LL4B 1M0UA 4CY6A 4HZ2A 3GV1A 1R5AA 2C3QA 2VCXA 4KF9A 10GSA 4CDOA 3P2AA 6GSUA 1SK1A 1VF3A 2OE0A 4OO4A 4L0UA 4IGJA 3KXOA 1O81A 2R2JA 2FCHA 5HFIA 2O85A 2L4CA 2OKAA 5JWOB 2QA2A 2RUEA 2X99A 1ILOA 3E3EA 2CT6A 4WF4A 1SD8A 2EC4A 2A4VA 3HD5A 5F0GA 2YWIA 4J56E 4MJBA 1TRWA 2B6MA 1G7EA 1FVJA 2D2ZA 1E6BA 3TB2A 3O76A 1ZOFA 1A0FA 4TOPA 3GSTA 1GUMA 3W6GA 4KX4A 4V2MA 4GWRA 5LD0A 3C71A 3D6IA 2CVDA 4POMA 1TRVA 3IHGA 4ZL7A 1TU7A 3EINA 5JCUA 5DJMA 5ECKB 4ML6A 4K5RA 4EDYA 5EL8A 3KGKA 4IP1A 3F4TA 5J4VA 2HRFA 4BVXB 4TXOB 3W8JA 3TRPA 3CMIA 5GSTA 8GSSA 3VPTA 2KP2A 2CVBA 4WBJA 2YWNA 3UL3A 1N25A 4KDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F3A A;  3J7Y b;  2AHE A;  2H71 A;  1M2D A;  4KH7 A;  4XS4 B;  2H0I A;  1AQV A;  2WJU A;  1FHE A;  2MMN A;  2P5R A;  1QK8 A;  4DSS A;  2L6D A;  1K0M A;  3L9S A;  2PUK C;  2H72 A;  4XS6 A;  3UVH A;  2N5A A;  1MDJ A;  1GSQ A;  2BMX A;  3KZQ A;  1YEP A;  4WR5 A;  1C72 A;  5C00 A;  1VRS D;  1O7U A;  2FA8 A;  1A8L A;  6GSS A;  3WGD A;  1AAZ A;  4NWY A;  4NHZ A;  4OFT A;  1SK2 A;  4KAE A;  11GS A;  2PU9 C;  4X43 A;  3WGE A;  4BVY A;  3EVI A;  3ZIJ A;  4MK3 A;  3GKK A;  2FNO A;  5B8B A;  4TW5 A;  4POL A;  1GSU A;  1URM A;  2V6K A;  1YKC A;  3TJK A;  2IMI A;  2VD0 A;  1B8X A;  3HKR A;  1PKW A;  4JRR A;  4J2F A;  4FQU A;  4IP6 A;  2R6K A;  1HNA A;  1XWA A;  5IO2 A;  2ZNM A;  3GN3 A;  3UMA A;  3J7Y k;  2C0F A;  2DBC A;  4PQH A;  1F3B A;  1Z7R A;  1BJX A;  2O89 A;  1T4Y A;  4L8E A;  3LOR A;  4PNF A;  1XW9 A;  5GAN D;  3ZTL A;  4HUA A;  5A4U A;  1S3C A;  1X0R A;  1SJZ A;  1ON4 A;  1PSQ A;  4F2I A;  4MJE A;  5H5Q A;  5D9X A;  3DKS A;  2AJQ B;  3H1N A;  1GUK A;  1E2Y A;  2HSN B;  2BTO T;  18GS A;  14GS A;  4PGT A;  4MJC A;  1FB6 A;  3Q18 A;  1T00 A;  4JBB A;  2YN1 A;  1R26 A;  3I43 A;  4WXT A;  4X0X A;  3GFK A;  4EE0 A;  3ZLP A;  4F82 A;  2XBQ A;  1QGV A;  2CAQ A;  3Q6O A;  3BOA A;  1AC1 A;  1SKR B;  5H5R A;  3TJG A;  4Q5N A;  3DVW A;  1W89 A;  2KP1 A;  3F6D A;  1YF1 A;  2YNX A;  3VWU A;  4JR4 A;  4OFN A;  4BVX A;  2LQO A;  4TXO A;  1XIY A;  3CXG A;  3LXT A;  2VAF A;  1JLV A;  2GTU A;  2GQK A;  4PTS A;  3HCZ A;  1O6J A;  4G10 A;  4WBR D;  2GT6 A;  4KA0 A;  4I5Q A;  2HSM B;  4JU5 A;  1PL2 A;  4GLT A;  3ERG A;  2NDO A;  1X9W B;  1XOA A;  4XS4 A;  4WF5 A;  3GMF A;  3C7M A;  1G0T A;  2XPD A;  2PPT A;  3IDV A;  4HS1 A;  4CHS A;  3DGQ A;  3GTU A;  3ISO A;  4YAP A;  3UAP A;  1HD2 A;  1X9S B;  1X5E A;  3U5R E;  2EIR A;  2H1D A;  2ES7 A;  2FUG 2;  1AUC A;  2J23 A;  1BQ7 A;  1K0O A;  3FR9 A;  2FY6 A;  1DSB A;  4KGI A;  3HJM A;  1B4P A;  1K3O A;  3CTG A;  2HT9 A;  4NV2 A;  4GSS A;  2OE1 A;  4K7I A;  1MTC A;  4N0V A;  4GQF A;  3MNG A;  3FZA A;  2VCT A;  2PN8 A;  2HNL A;  3D0Z A;  4Q5R A;  3APO A;  2QGV A;  1S3A A;  1SJ6 A;  5J4U A;  3UAR A;  3CBU A;  1RW1 A;  2VCW A;  1YEX A;  1TRS A;  1XWG A;  4ZB8 A;  2H0H A;  3L4N A;  4K1F A;  2GZY A;  1HYU A;  1USB A;  3LYP A;  2QKE A;  4DSR A;  2B1L A;  2GSR A;  3ME7 A;  3GL3 A;  1Q4J A;  5B7C A;  1MD4 A;  3F3Q A;  2P5Q A;  1N2A A;  5DVB A;  5B6M A;  5IOW A;  2A2S A;  4G19 A;  5IM9 A;  2GZP A;  1XWB A;  3D22 A;  1FB0 A;  5KN2 A;  1K0D A;  2GS3 A;  2RII A;  3WD6 A;  3D4T A;  4BWQ A;  1NHY A;  2CVK A;  1ZCP A;  4L0W A;  3QAG A;  2HXK A;  2G0F A;  5J3R A;  2C4J A;  3QDN A;  2YV9 A;  4KSO A;  2LNS A;  1TK0 B;  2NTO A;  3IPZ A;  3GUR A;  4IQ1 A;  1QUW A;  1SK0 A;  4HEA 2;  1U6T A;  1JZO A;  2DJ0 A;  2YPM A;  1EP8 A;  1JLW A;  5J41 A;  17GS A;  4I6X A;  1MDI A;  3DYR A;  2I81 A;  3DRN A;  2HSH A;  3M9K A;  1EEM A;  1PX6 A;  2TIR A;  1ZZY A;  4V2L A;  3IXR A;  1J0F A;  2HRK A;  2IMF A;  3QFA C;  2UZ8 A;  1U88 A;  3HZ8 A;  1GTI A;  2BJX A;  2HSM A;  5E4W A;  2WDU A;  1JHB A;  5L71 A;  4E8E A;  3D5J A;  1K0B A;  1ML6 A;  4XTS A;  1A2L A;  3KEB A;  1HNC A;  5AN1 A;  4MLY A;  4HU9 A;  1KEB A;  4DEJ A;  2PVO C;  1Z6N A;  2X8G A;  1HNB A;  1Q98 A;  2HI7 A;  3KM6 A;  3WT1 A;  4IQA A;  2GVP A;  1NW2 A;  4ML1 A;  4IEL A;  4ILF A;  5IMV A;  1R4W A;  2P0G A;  1ERU A;  5LNK e;  2V32 A;  1GUH A;  2IFQ B;  3NOF A;  2OBK A;  2NBS A;  1TOF A;  2PWJ A;  2OAC A;  1QQ2 A;  4DSS B;  4GSN A;  4ECJ A;  2H6Y A;  2VCZ A;  2MBS A;  5COH A;  2OE3 A;  3KIJ A;  5ECQ B;  5IOX A;  1M9A A;  5FT3 A;  1GP1 A;  2IPA A;  4HI7 A;  2HRN A;  3ZVJ A;  2K9F A;  2DIY A;  2MBT A;  1MEK A;  1OKT A;  4PQ1 A;  1TK8 B;  3FHK A;  3HDC A;  1EGO A;  3TKS A;  2B7K A;  2KHP A;  4BVY B;  5ECH B;  2GT5 A;  3M1G A;  2DIZ A;  4YQU A;  3ZFL A;  2YWM A;  3ZML A;  1K0A A;  3QOU A;  4N10 A;  3VWW A;  5JCG A;  1KBN A;  1LBK A;  1PL1 A;  1V40 A;  4OFM A;  3UIW A;  1B9X C;  5G30 A;  2KUC A;  2YJH A;  1ACV A;  5D9W A;  2FD3 A;  4F0C A;  2H70 A;  3KD0 A;  3EMP A;  1Z3E A;  3F6F A;  4KND A;  4OMV A;  4IN0 A;  3RPP A;  2YCD A;  4KSM A;  5CRG A;  3KH9 A;  3PIN A;  5B8A A;  5D8I A;  1A2J A;  2B1K A;  2LTK A;  3CSI A;  4ZB9 A;  1BX9 A;  3DD3 A;  2MYG A;  3HXS A;  1EOH A;  1T8E B;  3M9J A;  2O7K A;  2H66 A;  4FYU A;  1PA3 A;  1Z5Y E;  2DMM A;  2XPE A;  3C1R A;  4I8B A;  3IE3 A;  3WYW A;  5JCW A;  2R37 A;  3LGC A;  1ZYQ B;  1V9W A;  2QSI A;  3G7Y A;  5GAP D;  3IK7 A;  1N8J A;  2YZU A;  3GA4 A;  1U87 A;  4HJ2 A;  2DLX A;  2Z9S A;  3M8N A;  3PGT A;  6GSV A;  1I5G A;  2LST A;  4RI6 A;  2JAC A;  5J5N A;  3CRU A;  2FLS A;  3GNJ A;  4HJM A;  3HA9 A;  3V1W A;  4PUA A;  20GS A;  3U6V A;  3IC4 A;  1QFN A;  1F2E A;  2LEG A;  3H79 A;  4I2U A;  2REM A;  4POB A;  3ED3 A;  4JZQ A;  3TRX A;  1SKW B;  2E2G A;  5INY A;  3F63 A;  2H6X A;  2M46 A;  4USS A;  4TR4 A;  5F07 A;  2VM2 A;  2V6O A;  2VIM A;  1M9B A;  3IHQ A;  3QR6 A;  2VCQ A;  2YOI A;  6GST A;  1I9D A;  2OAD A;  3C73 A;  4LLR A;  5HFK A;  3F3R A;  1R5P A;  2IFQ A;  4KUN A;  3GTU B;  1XZO A;  4MMM A;  2H74 A;  3DVX A;  4TN8 A;  3FK8 A;  2HZF A;  1G7O A;  3APS A;  2P31 A;  3R3E A;  3N5O A;  5J9B A;  4ZL9 A;  1X5D A;  1YDK A;  2B7J A;  1A24 A;  5ECR B;  1O73 A;  2LKU A;  1TJD A;  2J9H A;  3F4S A;  4BA7 A;  2WGR A;  2CV4 A;  4HDE A;  4G0K A;  2K8V A;  3IA1 A;  4XS1 A;  3FW2 A;  4K7N A;  1TKD B;  4G0L A;  4AGS A;  5CRH A;  5A4V A;  3F9U A;  4XCS A;  2RM6 A;  4MZB A;  2CZ2 A;  1A8Y A;  2M80 A;  3TUE A;  3FY7 A;  3RBT A;  2DJK A;  4F9Z A;  2HYX A;  1AQW A;  3GHA A;  1SKS B;  2I1U A;  2AUV A;  1GRX A;  1XVW A;  2JSZ A;  1SL0 B;  1AQX A;  5DCH A;  5ABR A;  1AXD A;  1F9M A;  2PMT A;  3TOU A;  4JR6 A;  1PD2 1;  3CTF A;  3TCO A;  3RHC A;  3PPU A;  1A0R P;  1XW6 A;  4LA1 A;  5F8B A;  3GSS A;  2VL2 C;  1X5C A;  2B5E A;  5KEJ A;  1QMV A;  3QMX A;  3FEU A;  1K3L A;  1DE2 A;  4XRD A;  3IR4 A;  1UN2 A;  2VD1 A;  2NPB A;  1M2A A;  2C3N A;  4K2D A;  2I3Y A;  3FYG A;  3GKM A;  3HVS A;  3TDG A;  4AJ8 A;  1ZMA A;  3HYP A;  1YJ6 A;  4ZIJ A;  1J9B A;  2H1A A;  1THO A;  4EO3 A;  3FZ4 A;  4KB3 A;  1GSD A;  19GS A;  4GST A;  4D73 B;  5JWR B;  2HSY A;  1OAZ A;  1S3D A;  1G6W A;  2I4A A;  4IS0 A;  5J9C A;  1ZL9 A;  3KJY A;  2IIY A;  4MJA A;  2DJJ A;  1TTZ A;  1GWC A;  2PVQ A;  2X8H A;  2HRK B;  4MPG A;  4L5L A;  4ACS A;  3PR8 A;  3DXB A;  1PKZ A;  2C1Y A;  4V2N A;  4YQM A;  2TRC P;  4V1A g;  12GS A;  2GLR A;  5BMU A;  2JZS A;  1CQG A;  3KH7 A;  3UBK A;  2L6C A;  3IAS 2;  5HR2 A;  4XHM A;  2X8C A;  3MWH A;  1ZYE A;  2ON7 A;  1R7H A;  3VWV A;  1WIK A;  1A23 A;  6GSX A;  1WPI A;  5DCG A;  2LRC A;  2F8A A;  2ZCT A;  2X64 A;  3R2Q A;  3KMN A;  1GSF A;  3QAW A;  1UVZ A;  1WE0 A;  3IBH A;  1XVQ A;  1ERW A;  4RUV A;  1B9Y C;  2IWT A;  2CX3 A;  2RUF A;  1SJI A;  5IMZ A;  4ID0 A;  4EF0 A;  2LJR A;  3EWL A;  3E0U A;  3GYK A;  3NZN A;  3KP9 A;  2I9H A;  2N5F A;  3FKF A;  5D9T A;  3N9J A;  4NAX A;  5CNW A;  1FG4 A;  5B6N A;  3LJR A;  4EL1 A;  3I69 A;  3MSZ A;  4FO5 A;  2YZH A;  1H75 A;  3ZVJ D;  1GSE A;  2LV3 A;  2K8S A;  2V1M A;  2E7P A;  3Q74 A;  4NV5 A;  4O7H A;  2L5L A;  1PX7 A;  3MAK A;  4CW9 A;  1XCC A;  3HJO A;  1V2A A;  2WFC A;  4ZB6 A;  5ECL B;  5G31 A;  4Q5Q A;  2R4V A;  1GTB A;  3A2W A;  3ZRE A;  5G1K A;  1XFL A;  2L57 A;  2HE3 A;  3APQ A;  2FA4 A;  3NIV A;  4QQ7 A;  5ID2 A;  4ZBD A;  3A2V A;  3ME8 A;  1TDI A;  5CRE A;  4KDY A;  1GTU A;  2R5G A;  3HHV A;  1GNW A;  4TR0 A;  4KE3 A;  4EXJ A;  5G5F A;  4Z7X A;  4WEY A;  1BAY A;  1WMJ A;  2CA8 A;  3QPM A;  1M2B A;  3ERW A;  1LU4 A;  1SL1 B;  2H19 A;  5IPH A;  5EY6 A;  4MZW A;  2K6V A;  1O8W A;  3GUS A;  2YAN A;  2WB9 A;  1YF0 A;  4OWY A;  5AGY A;  2ALB A;  4HOJ A;  4X1U A;  2QC7 A;  1VF2 A;  7GSS A;  4K6X A;  4D73 A;  2JSY A;  3G7I A;  1UC7 A;  1GSY A;  5CAX A;  2VL3 A;  1V98 A;  1BED A;  4MDC A;  4QL7 A;  2IJY A;  5AIS A;  3PH9 A;  2L5O A;  4POK A;  1DUG A;  1VF4 A;  2H1B A;  3RAZ A;  3UOM A;  4BL7 B;  1TW9 A;  1ZGN A;  2RLI A;  4L5O A;  3I9V 2;  2VLT A;  1TI1 A;  5HR1 A;  1ABA A;  3LEF A;  4ZXG A;  4ZBA A;  3SWL A;  5DQY A;  1FVK A;  5A4W A;  1OYJ A;  3EC3 A;  3F0I A;  1GUL A;  4G0I A;  2OJL A;  3TJB A;  3GX8 A;  1F37 A;  1DE1 A;  5HQP A;  3TKR A;  4PUR A;  4P3Y B;  3VWX A;  5HR3 A;  3CSJ A;  3SBC A;  3WT2 A;  4OD7 A;  1JFU A;  1V57 A;  2H0G A;  1LJR A;  5CP1 A;  5DAK A;  1XWC A;  1IYH A;  4YH2 A;  3GL5 A;  2FWH A;  4FYB A;  4TXV A;  3C1S A;  4NHW A;  1WJK A;  1YY7 A;  2WUL A;  3S9F A;  1MDK A;  2CAI A;  4GF0 A;  5IPG A;  1V58 A;  1OC8 A;  4YAV A;  1XBS A;  4PNG A;  1Y6E A;  2EIQ A;  3RDW A;  1H4O A;  3GH9 A;  4MA9 A;  5AIX A;  2R3X A;  4EVM A;  2VCV A;  4MCU A;  2M72 A;  3EUR A;  2KLX A;  1BYE A;  4G9H A;  4XRA A;  1EEJ A;  5D93 A;  3LG6 A;  4TRX A;  4MF7 A;  4MP4 A;  3BCI A;  3ZIV A;  4K8M A;  3H93 A;  4ULX A;  4PXO A;  4WKW A;  3MDK A;  1VGL A;  3K8N A;  5GSS A;  1K3Y A;  2IMD A;  2VLV A;  3HVV A;  1T1V A;  5IIZ A;  1WP0 A;  3G9B A;  1SYX A;  1WOU A;  3EMX A;  2AYT A;  1FO5 A;  3EE2 A;  2H8L A;  3UBL A;  1F6M C;  4KCA A;  4F03 A;  3FZ5 A;  3F4R A;  2LJK A;  2H76 A;  3CRT A;  2DJ2 A;  1K0N A;  3VFI A;  3LFL A;  1XWK A;  4KDX A;  3H4K A;  5ELA A;  2FGX A;  1TI3 A;  3FZ9 A;  3GX0 A;  4ZBB A;  3L9V A;  2HRA A;  3VK9 A;  4TR3 A;  2YWO A;  4GXZ A;  2C0G A;  4BL7 A;  4EKZ A;  1FAA A;  2GZZ A;  1GNE A;  3IV4 A;  2WRT A;  3CYN A;  3L78 A;  5DDL A;  2MMA A;  3GH6 A;  4J57 E;  1XXU A;  2HFD A;  3EYT A;  2XHF A;  3KTL A;  1ERV A;  2H1G A;  2G2Q A;  5G1L A;  4OCF A;  4Q5F A;  1OC3 A;  4MAB A;  5IMC A;  2JZT A;  4IHU A;  5H5S A;  4RQR A;  1YZX A;  5C04 A;  3OR5 A;  2XC2 A;  3RPN A;  1OVN A;  3ZIT A;  1X9M B;  1HQO A;  1A2M A;  2C0D A;  2L59 A;  5KN3 A;  3KCM A;  4NXI A;  2RM5 A;  3UEM A;  2A2R A;  5ECS A;  5A5K A;  2DML A;  1RQM A;  3QD9 A;  2WS2 A;  4O5R A;  2MZC A;  4IJI A;  1OE8 A;  4PX1 A;  2LRN A;  1Z6M A;  2HLS A;  2HZE B;  1THX A;  2DJ3 A;  3I6A A;  4MF6 A;  4LMV A;  2H73 A;  2B5X A;  1AW9 A;  5IO0 A;  2XBI A;  3QFB C;  4AJ7 A;  4ECB A;  4QL9 A;  3L0H A;  1PQN A;  1WRY A;  3BBY A;  4FH8 A;  1JZR A;  2AV4 A;  3QAV A;  5IMA A;  2GSQ A;  2IMK A;  1QXH A;  1SU9 A;  3M0F A;  3TGZ A;  3LSZ A;  5CRW A;  4WET A;  5F06 A;  4MPF A;  4O92 A;  5HFG A;  1Z7P A;  2IN3 A;  4MF5 A;  4WR4 A;  4KCE A;  4V1A p;  2YV7 A;  4EC0 A;  1NHO A;  2WZ9 A;  5ID2 B;  1FOV A;  1DBY A;  1VF1 A;  1OC9 B;  4HZ4 A;  4NMU A;  3EU3 A;  2LQQ A;  3VI5 A;  4F0B A;  5CYY A;  2F9S A;  4GQC A;  3W8S A;  3P7X A;  4NPB A;  3P8W A;  1SEN A;  2VUP A;  4LL1 B;  2O8V B;  2OBI A;  5ECI B;  2B5Y A;  3QCP A;  3BCK A;  2F51 A;  3FRC A;  1Y25 A;  3E9J B;  3ZFB A;  3ZYW A;  4FIW A;  2H6Z A;  4PUF C;  1W4V A;  3ZMK A;  2H30 A;  3UVT A;  1EV4 A;  1OKD A;  5DJL A;  4ZIL A;  3TKP A;  2VOC A;  4TVE A;  5EPF A;  5G2Z A;  5D96 A;  4ISD A;  3KMO A;  4DSQ A;  3AY8 A;  5G5E A;  2V41 A;  1TP9 A;  3DWV A;  1AIU A;  5D73 A;  1IYI A;  3IC8 A;  3P90 A;  2JU5 A;  4N0Z A;  1TK5 B;  4N30 A;  3TJF A;  1GL8 A;  2PGT A;  4ECC A;  1EOG A;  1T3B A;  4FYC A;  5DAL B;  3IRA A;  4RQX A;  3DIE A;  2VL9 A;  3HZ4 A;  1PRX A;  3FR6 A;  2YJ7 A;  5AIV A;  2MMZ A;  5ECN B;  1RK4 A;  1T4Z A;  3VI7 A;  4XIH A;  3TKQ A;  1WWJ A;  1MD3 A;  3GRX A;  4GCI A;  2ZUP A;  3GKN A;  2GST A;  1JZW A;  2HZE A;  4HQS A;  4IW9 A;  3IOS A;  5DBQ A;  1YKA A;  2ON5 A;  2YP6 A;  4O32 A;  3LWA A;  3H8Q A;  1XW5 A;  2EIO A;  2AAW A;  2IME A;  4OO5 A;  3HY2 A;  4ECI A;  5KN1 A;  4TR1 B;  4JED A;  4PQI A;  5DAK B;  2KOK A;  6GSW A;  2GQM A;  5FWG A;  1KNG A;  4HU7 A;  2GSS A;  3D4M A;  2O87 A;  1T7P B;  3ZRD A;  2VL2 A;  1XPV A;  2VO4 A;  1U3A A;  1GSS A;  3F8U A;  4MH3 A;  5LCZ A;  4GRF A;  5EVO A;  5CO3 A;  2PBJ A;  1OE7 A;  3US3 A;  3WGX A;  5ENU A;  5ECM B;  2N5B A;  1J08 A;  1GH2 A;  2DJ1 A;  4IJ3 A;  2E2M A;  3FR3 A;  3Q19 A;  5IMF A;  1EZK A;  1OC9 A;  3RHB A;  2IL3 A;  4K0N A;  4MH2 A;  1EV9 A;  3A3T A;  1GLP A;  2V2G A;  2C3T A;  2MMO A;  2AB6 A;  3KP8 A;  1PN9 A;  4I2T A;  1G6Y A;  5FHI A;  1M99 A;  1TRU A;  3IK9 A;  1K0C A;  1PGT A;  4N11 A;  2K18 A;  3A2X A;  1XOB A;  1GTA A;  2B3S A;  5DQS A;  4LMW A;  3TKS C;  1EGR A;  2H01 A;  4AF2 A;  1B4Q A;  4DVC A;  2GDR A;  2PER A;  2FWF A;  1O85 A;  2JZR A;  4K7O A;  5KN0 A;  3VPQ A;  4OCE A;  1UA5 A;  5ECO B;  2VM1 A;  4AJ6 A;  4RI7 A;  4K0G A;  4I97 A;  5F05 A;  4BPY A;  1TXX A;  5DAL A;  5GZZ B;  2LRT A;  4MZC A;  3HVX A;  3LQ7 A;  1U3I A;  3L9U A;  3DEX A;  3A5W A;  1BG5 A;  5CRD A;  3LYK A;  3O6T A;  1TU8 A;  3C8E A;  2LUS A;  2FHE A;  4HQZ A;  4IKH A;  2F3M A;  2GQL A;  2NVL A;  1B48 A;  4JE1 A;  2FWE A;  4E8H A;  1EP7 A;  3TKS E;  2LS5 A;  2CQ9 A;  13GS A;  2CZ3 A;  3KTB A;  2HQT A;  3M3M A;  3ERF A;  2H75 A;  3TOT A;  1GLQ A;  5D9V A;  4TR1 A;  3IAM 2;  1NSW A;  3GKX A;  1KTE A;  1PMT A;  1CQH A;  2LNT A;  2TRX A;  2C8U A;  2CX4 A;  1FW1 A;  2JAD A;  3ZZX A;  2LJA A;  16GS A;  3EU4 A;  2OA7 A;  1YQ1 A;  3VLN A;  2VLU A;  1JZD A;  4IVF A;  3D21 A;  3CSH A;  5HR0 A;  1M7T A;  3TJJ A;  4G2E A;  3BD2 A;  3UJ1 A;  1EWX A;  4EDZ A;  4K9Z A;  1ST9 A;  22GS A;  4EUY A;  2WCI A;  2C80 A;  3G7J A;  2L4Q A;  1SL2 B;  2E0Q A;  3BJ5 A;  2DC5 A;  4IBP A;  1ERT A;  4H86 A;  3DML A;  6GSY A;  1NM3 A;  5IQY A;  1Z9H A;  4KW6 A;  4TKY A;  3HJP A;  2FWG A;  2JL4 A;  5ECP B;  4GTU A;  3O3T A;  5ELG A;  3VUR A;  3GIX A;  5E59 A;  2C0E A;  9GSS A;  4YQV A;  5IMD A;  3ZL5 A;  2DSA A;  1SYR A;  4ZL8 A;  3TRQ A;  1SD9 A;  3JCM L;  2F8F A;  3LXZ A;  1O8X A;  2GGT A;  5JWQ B;  4BWS A;  4LL4 B;  1M0U A;  4HZ2 A;  3GV1 A;  1R5A A;  2C3Q A;  2VCX A;  4KF9 A;  10GS A;  4CDO A;  3P2A A;  6GSU A;  1SK1 A;  1VF3 A;  2OE0 A;  4OO4 A;  4L0U A;  4IGJ A;  3KXO A;  1O81 A;  2R2J A;  2FCH A;  5HFI A;  2O85 A;  2L4C A;  2OKA A;  5JWO B;  2RUE A;  2X99 A;  1ILO A;  3E3E A;  2CT6 A;  4WF4 A;  1SD8 A;  2EC4 A;  2A4V A;  3HD5 A;  5F0G A;  2YWI A;  4J56 E;  4MJB A;  1TRW A;  2B6M A;  1G7E A;  1FVJ A;  2D2Z A;  1E6B A;  3TB2 A;  3O76 A;  1ZOF A;  1A0F A;  4TOP A;  3GST A;  1GUM A;  3W6G A;  4KX4 A;  4V2M A;  4GWR A;  5LD0 A;  3C71 A;  3D6I A;  2CVD A;  4POM A;  1TRV A;  4ZL7 A;  1TU7 A;  3EIN A;  5JCU A;  5DJM A;  5ECK B;  4ML6 A;  4EDY A;  5EL8 A;  3KGK A;  4IP1 A;  3F4T A;  2HRF A;  4BVX B;  4TXO B;  3W8J A;  3TRP A;  3CMI A;  5GST A;  8GSS A;  3VPT A;  2KP2 A;  2CVB A;  4WBJ A;  2YWN A;  3UL3 A;  4KDU A; 
#chains in the Genus database with same CATH topology
 1YEW C;  1F3A A;  3J7Y b;  2AHE A;  2H71 A;  1M2D A;  4KH7 A;  4XS4 B;  2H0I A;  1AQV A;  2WJU A;  1FHE A;  3HMJ G;  2MMN A;  2P5R A;  1QK8 A;  4DSS A;  2L6D A;  1K0M A;  3L9S A;  2QA1 A;  2PUK C;  2H72 A;  4XS6 A;  3UVH A;  2N5A A;  1MDJ A;  1GSQ A;  2BMX A;  3KZQ A;  1YEP A;  4WR5 A;  1C72 A;  5C00 A;  1VRS D;  1O7U A;  2FA8 A;  4A5P A;  1A8L A;  6GSS A;  3WGD A;  1AAZ A;  4NWY A;  4NHZ A;  4OFT A;  1SK2 A;  4KAE A;  11GS A;  2PU9 C;  4X43 A;  3WGE A;  4BVY A;  3EVI A;  3ZIJ A;  4MK3 A;  3GKK A;  2FNO A;  5B8B A;  4TW5 A;  4POL A;  1GSU A;  1URM A;  2V6K A;  4AKG A;  1YKC A;  3TJK A;  2IMI A;  2VD0 A;  1B8X A;  3HKR A;  1PKW A;  4JRR A;  4J2F A;  4FQU A;  4IP6 A;  2R6K A;  4ICY A;  1HNA A;  1XWA A;  5IO2 A;  2ZNM A;  3GN3 A;  3UMA A;  3J7Y k;  2C0F A;  2DBC A;  4PQH A;  1F3B A;  1Z7R A;  1BJX A;  2O89 A;  1T4Y A;  4L8E A;  4K5S A;  3LOR A;  4PNF A;  1XW9 A;  5GAN D;  3ZTL A;  4HUA A;  5A4U A;  1S3C A;  1X0R A;  1SJZ A;  1ON4 A;  1PSQ A;  3FMW A;  4F2I A;  4MJE A;  5H5Q A;  5D9X A;  3DKS A;  2AJQ B;  3H1N A;  1GUK A;  1E2Y A;  4AI6 A;  2HSN B;  2BTO T;  18GS A;  14GS A;  4PGT A;  4MJC A;  1FB6 A;  2EFC A;  3Q18 A;  1T00 A;  4JBB A;  2YN1 A;  1R26 A;  3I43 A;  4WXT A;  4X0X A;  3GFK A;  4EE0 A;  3EPT A;  3ZLP A;  4F82 A;  2XBQ A;  1QGV A;  2CAQ A;  3Q6O A;  3BOA A;  1AC1 A;  1SKR B;  5H5R A;  3TJG A;  4Q5N A;  2R0C A;  3DVW A;  5KOX A;  1W89 A;  2KP1 A;  3F6D A;  1YF1 A;  2YNX A;  3VWU A;  4JR4 A;  4OFN A;  4EIQ A;  4BVX A;  2LQO A;  4TXO A;  1XIY A;  3CXG A;  3LXT A;  2VAF A;  1JLV A;  2GTU A;  2GQK A;  4PTS A;  3HCZ A;  1O6J A;  4G10 A;  4WBR D;  2GT6 A;  4KA0 A;  4I5Q A;  2HSM B;  4JU5 A;  1PL2 A;  4AKH A;  4GLT A;  3ERG A;  2NDO A;  1X9W B;  1XOA A;  4XS4 A;  5A34 A;  5J4Y A;  4WF5 A;  3GMF A;  3C7M A;  1G0T A;  2XPD A;  2PPT A;  3IDV A;  4HS1 A;  4CHS A;  3DGQ A;  3GTU A;  4Z2T A;  3ISO A;  4YAP A;  3UAP A;  1HD2 A;  1X9S B;  1X5E A;  3U5R E;  2EIR A;  2H1D A;  2R0P A;  2ES7 A;  2FUG 2;  1BF5 A;  1AUC A;  2J23 A;  2WW3 A;  1BQ7 A;  1K0O A;  3FR9 A;  4QMK A;  2FY6 A;  1YVL A;  1DSB A;  4KGI A;  3HJM A;  1B4P A;  1K3O A;  3CTG A;  2HT9 A;  4NV2 A;  4GSS A;  2OE1 A;  4K7I A;  1MTC A;  4GDF A;  2WW1 A;  4N0V A;  2O36 A;  4GQF A;  3MNG A;  3FZA A;  2VCT A;  2PN8 A;  2HNL A;  3D0Z A;  4Q5R A;  3APO A;  2QGV A;  1S3A A;  1SJ6 A;  5J4U A;  3UAR A;  3CBU A;  1RW1 A;  2VCW A;  1YEX A;  1TRS A;  1XWG A;  4ZB8 A;  2H0H A;  3L4N A;  4K2X A;  4K1F A;  2GZY A;  1HYU A;  1USB A;  3LYP A;  4AKX B;  2QKE A;  4G01 A;  1S4B P;  4DSR A;  2B1L A;  2GSR A;  1ZYN A;  3ME7 A;  3GL3 A;  1Q4J A;  5B7C A;  1MD4 A;  3F3Q A;  2P5Q A;  1N2A A;  5DVB A;  5B6M A;  5IOW A;  2A2S A;  4G19 A;  5IM9 A;  2GZP A;  1XWB A;  2HSN A;  3D22 A;  1FB0 A;  5KN2 A;  1K0D A;  2GS3 A;  2RII A;  3WD6 A;  3D4T A;  4BWQ A;  1NHY A;  2CVK A;  1ZCP A;  4L0W A;  3QAG A;  2HXK A;  2G0F A;  5J3R A;  2C4J A;  3QDN A;  2YV9 A;  4KSO A;  2LNS A;  1TK0 B;  4PHZ C;  2NTO A;  3IPZ A;  3GUR A;  4IQ1 A;  1QUW A;  1SK0 A;  4HEA 2;  1U6T A;  1JZO A;  2DJ0 A;  2R0G A;  2YPM A;  1EP8 A;  1JLW A;  5J41 A;  17GS A;  4I6X A;  1MDI A;  3DYR A;  2I81 A;  3DRN A;  2HSH A;  3M9K A;  1EEM A;  1PX6 A;  2TIR A;  1ZZY A;  4V2L A;  3IXR A;  1J0F A;  2HRK A;  2IMF A;  3QFA C;  2UZ8 A;  1U88 A;  3HZ8 A;  1GTI A;  2BJX A;  3CQF A;  2HSM A;  4E68 A;  5E4W A;  2WDU A;  1JHB A;  5L71 A;  4E8E A;  3D5J A;  1K0B A;  1ML6 A;  4XTS A;  2WW0 A;  1A2L A;  3KEB A;  3LW9 A;  1HNC A;  5AN1 A;  4MLY A;  4HU9 A;  1KEB A;  4DEJ A;  2PVO C;  1Z6N A;  2X8G A;  1HNB A;  1Q98 A;  2HI7 A;  3KM6 A;  3WT1 A;  4IQA A;  2GVP A;  1NW2 A;  4ML1 A;  4IEL A;  4ILF A;  5IMV A;  1I1I P;  2WZS A;  1R4W A;  2P0G A;  5A1N B;  1ERU A;  5LNK e;  2V32 A;  1GUH A;  2IFQ B;  3NOF A;  2OBK A;  2NBS A;  1TOF A;  2PWJ A;  2OAC A;  1QQ2 A;  4DSS B;  4GSN A;  4ECJ A;  2H6Y A;  2VCZ A;  2MBS A;  5COH A;  2OE3 A;  3KIJ A;  5ECQ B;  5IOX A;  1M9A A;  5FT3 A;  1GP1 A;  2IPA A;  4HI7 A;  2HRN A;  3ZVJ A;  2K9F A;  2DIY A;  2MBT A;  1MEK A;  1OKT A;  4PQ1 A;  1TK8 B;  3FHK A;  3HDC A;  1EGO A;  3TKS A;  2B7K A;  2KHP A;  4BVY B;  5ECH B;  2GT5 A;  3M1G A;  1SVO A;  2DIZ A;  4YQU A;  3ZFL A;  2YWM A;  3ZML A;  1K0A A;  3QOU A;  4N10 A;  4BIK A;  2H1L A;  3VWW A;  5JCG A;  1KBN A;  1LBK A;  1PL1 A;  1V40 A;  4OFM A;  4MNN A;  3UIW A;  1B9X C;  5G30 A;  2KUC A;  2YJH A;  1ACV A;  5D9W A;  2FD3 A;  4F0C A;  2H70 A;  3KD0 A;  3EMP A;  1Z3E A;  3F6F A;  4KND A;  4OMV A;  4IN0 A;  3RPP A;  1BG1 A;  2YCD A;  5J40 A;  4KSM A;  5CRG A;  3KH9 A;  3CWG A;  3PIN A;  5B8A A;  5D8I A;  1A2J A;  2B1K A;  2LTK A;  3CSI A;  4ZB9 A;  1BX9 A;  3DD3 A;  2MYG A;  3HXS A;  1EOH A;  1T8E B;  3M9J A;  2O7K A;  2H66 A;  4FYU A;  1PA3 A;  1Z5Y E;  2DMM A;  2XPE A;  3C1R A;  4I8B A;  3IE3 A;  3WYW A;  5JCW A;  2R37 A;  3LGC A;  1ZYQ B;  1V9W A;  2QSI A;  3G7Y A;  5GAP D;  3IK7 A;  1N8J A;  4Z2R A;  2YZU A;  3GA4 A;  1U87 A;  4HJ2 A;  1M3J A;  2DLX A;  2Z9S A;  3M8N A;  3PGT A;  6GSV A;  1I5G A;  2LST A;  4RI6 A;  1SVM A;  2JAC A;  2A4H A;  5J5N A;  3CRU A;  2FLS A;  3GNJ A;  4HJM A;  3HA9 A;  3V1W A;  4PUA A;  20GS A;  3U6V A;  3IC4 A;  1QFN A;  1F2E A;  2LEG A;  3H79 A;  4I2U A;  2REM A;  4POB A;  3ED3 A;  4JZQ A;  3TRX A;  1SKW B;  2E2G A;  5INY A;  3F63 A;  2H6X A;  2M46 A;  4USS A;  4TR4 A;  5F07 A;  2VM2 A;  2V6O A;  2VIM A;  1M9B A;  5BMU B;  3IHQ A;  3QR6 A;  2VCQ A;  2YOI A;  5A34 B;  6GST A;  5A1N A;  1I9D A;  2OAD A;  3C73 A;  4LLR A;  5HFK A;  3F3R A;  1R5P A;  2IFQ A;  3MYD A;  4KUN A;  3GTU B;  1XZO A;  4MMM A;  2H74 A;  3DVX A;  4TN8 A;  3FK8 A;  2HZF A;  1G7O A;  3APS A;  2P31 A;  3R3E A;  3N5O A;  5J9B A;  4ZL9 A;  1X5D A;  1YDK A;  2B7J A;  1A24 A;  5ECR B;  1O73 A;  2LKU A;  1TJD A;  2J9H A;  3F4S A;  4BA7 A;  2WGR A;  2O5V A;  2CV4 A;  4HDE A;  4G0K A;  2K8V A;  3IA1 A;  4XS1 A;  3FW2 A;  4K7N A;  1TKD B;  4G0L A;  4AGS A;  5CRH A;  5A4V A;  3F9U A;  4XCS A;  2RM6 A;  4MZB A;  2CZ2 A;  1A8Y A;  2M80 A;  3TUE A;  3FY7 A;  3RBT A;  2DJK A;  4F9Z A;  2HYX A;  1AQW A;  3GHA A;  1SKS B;  2I1U A;  5A5H B;  2AUV A;  1GRX A;  5J47 A;  1XVW A;  2JSZ A;  1SL0 B;  1AQX A;  5DCH A;  5ABR A;  1AXD A;  1F9M A;  2PMT A;  3TOU A;  4JR6 A;  1PD2 1;  3CTF A;  3TCO A;  3RHC A;  3PPU A;  1A0R P;  1XW6 A;  4LA1 A;  5F8B A;  3GSS A;  2VL2 C;  1X5C A;  2B5E A;  5KEJ A;  1QMV A;  3QMX A;  3FEU A;  1K3L A;  1DE2 A;  4XRD A;  3IR4 A;  1UN2 A;  2VD1 A;  2NPB A;  1M2A A;  2C3N A;  4K2D A;  2I3Y A;  3FYG A;  3GKM A;  3HVS A;  3TDG A;  4AJ8 A;  1ZMA A;  3HYP A;  1YJ6 A;  4ZIJ A;  1J9B A;  2H1A A;  1THO A;  4EO3 A;  3FZ4 A;  4KB3 A;  1GSD A;  19GS A;  4GST A;  4D73 B;  5JWR B;  2HSY A;  1OAZ A;  1S3D A;  1G6W A;  2I4A A;  4IS0 A;  5J9C A;  1ZL9 A;  3KJY A;  2IIY A;  4MJA A;  2DJJ A;  1TTZ A;  1GWC A;  2PVQ A;  2X8H A;  2HRK B;  1Y1U A;  4MPG A;  4L5L A;  4ACS A;  3PR8 A;  3DXB A;  2WVZ A;  1PKZ A;  2C1Y A;  4V2N A;  4YQM A;  2TRC P;  4V1A g;  12GS A;  2GLR A;  5BMU A;  2JZS A;  1CQG A;  3KH7 A;  3UBK A;  2L6C A;  3IAS 2;  5HR2 A;  4Z2U A;  4XHM A;  2X8C A;  3MWH A;  1ZYE A;  2ON7 A;  1R7H A;  4X4J A;  3VWV A;  1WIK A;  1A23 A;  6GSX A;  1WPI A;  4EIP A;  5DCG A;  2LRC A;  2F8A A;  2ZCT A;  2X64 A;  3R2Q A;  3KMN A;  1GSF A;  3QAW A;  1UVZ A;  1WE0 A;  3IBH A;  1XVQ A;  1ERW A;  4RUV A;  1B9Y C;  2IWT A;  2CX3 A;  2RUF A;  1SJI A;  3RFR C;  5IMZ A;  4ID0 A;  4EF0 A;  2EFH A;  2LJR A;  3EWL A;  3E0U A;  3GYK A;  3NZN A;  3KP9 A;  2I9H A;  2N5F A;  3CHX C;  3FKF A;  5D9T A;  4HSC X;  3N9J A;  4NAX A;  5CNW A;  1FG4 A;  5B6N A;  3LJR A;  4EL1 A;  3I69 A;  3MSZ A;  4FO5 A;  2YZH A;  1H75 A;  3ZVJ D;  1GSE A;  4O5U A;  2LV3 A;  2K8S A;  2V1M A;  2E7P A;  3Q74 A;  4NV5 A;  4O7H A;  5A5H A;  2L5L A;  1PX7 A;  3MAK A;  4CW9 A;  1XCC A;  3HJO A;  1V2A A;  2WFC A;  4ZB6 A;  5ECL B;  5G31 A;  4Q5Q A;  2R4V A;  1GTB A;  3A2W A;  3ZRE A;  5G1K A;  1XFL A;  2L57 A;  2HE3 A;  3APQ A;  2FA4 A;  3NIV A;  4QQ7 A;  5ID2 A;  4ZBD A;  3A2V A;  3ME8 A;  1TDI A;  5CRE A;  4KDY A;  1GTU A;  2R5G A;  3HHV A;  1GNW A;  4TR0 A;  4KE3 A;  4EXJ A;  1S3R A;  5G5F A;  4Z7X A;  4WEY A;  1BAY A;  1WMJ A;  2CA8 A;  3QPM A;  1M2B A;  3ERW A;  1LU4 A;  1SL1 B;  2H19 A;  5IPH A;  5EY6 A;  4MZW A;  2K6V A;  1O8W A;  3GUS A;  2YAN A;  2WB9 A;  1YF0 A;  4OWY A;  5AGY A;  2ALB A;  4HOJ A;  4X1U A;  2QC7 A;  1VF2 A;  7GSS A;  4K6X A;  4D73 A;  2JSY A;  3G7I A;  1UC7 A;  1GSY A;  5CAX A;  2VL3 A;  4YKG A;  1V98 A;  1BED A;  4MDC A;  4QL7 A;  2IJY A;  5AIS A;  3PH9 A;  2L5O A;  4POK A;  1DUG A;  1VF4 A;  2H1B A;  3RAZ A;  3UOM A;  4BL7 B;  1TW9 A;  1ZGN A;  2RLI A;  4ZB7 A;  4L5O A;  3I9V 2;  2VLT A;  1TI1 A;  5HR1 A;  1ABA A;  3LEF A;  4ZXG A;  4ZBA A;  3SWL A;  5DQY A;  1FVK A;  5A4W A;  1OYJ A;  3EC3 A;  3F0I A;  1GUL A;  4G0I A;  2OJL A;  3TJB A;  3GX8 A;  1F37 A;  1DE1 A;  5HQP A;  4PI2 C;  3TKR A;  4PUR A;  4P3Y B;  3VWX A;  5HR3 A;  3CSJ A;  3SBC A;  3WT2 A;  4OD7 A;  1JFU A;  1V57 A;  2H0G A;  1LJR A;  1SVL A;  5CP1 A;  2OT3 A;  5DAK A;  1XWC A;  1IYH A;  4YH2 A;  3GL5 A;  2FWH A;  4FYB A;  4TXV A;  4PI0 C;  3C1S A;  4NHW A;  1WJK A;  1YY7 A;  2WUL A;  3A5I A;  3S9F A;  1MDK A;  2CAI A;  4GF0 A;  5IPG A;  1V58 A;  1OC8 A;  4YAV A;  1XBS A;  4PNG A;  1Y6E A;  2EIQ A;  3RDW A;  1H4O A;  3GH9 A;  4MA9 A;  5AIX A;  2R3X A;  4EVM A;  2VCV A;  4MCU A;  2M72 A;  3EUR A;  2KLX A;  4FXY P;  1BYE A;  4G9H A;  4XRA A;  1EEJ A;  3MIX A;  5D93 A;  3LG6 A;  4TRX A;  4MF7 A;  4MP4 A;  4CY8 A;  3BCI A;  3ZIV A;  4K8M A;  3H93 A;  4ULX A;  4PXO A;  4WKW A;  3MDK A;  1VGL A;  3K8N A;  2WVY A;  1K3Y A;  3RGB C;  5GSS A;  2IMD A;  2VLV A;  3HVV A;  1T1V A;  5IIZ A;  1WP0 A;  3G9B A;  1SYX A;  1WOU A;  3EMX A;  2AYT A;  1FO5 A;  3EE2 A;  2H8L A;  3UBL A;  1F6M C;  4KCA A;  3FZ5 A;  4F03 A;  3F4R A;  2LJK A;  2H76 A;  3CRT A;  2DJ2 A;  1K0N A;  3VFI A;  3LFL A;  1XWK A;  4KDX A;  3H4K A;  5ELA A;  2FGX A;  1TI3 A;  3FZ9 A;  3GX0 A;  4ZBB A;  3L9V A;  2HRA A;  3VK9 A;  4TR3 A;  2YWO A;  4GXZ A;  2C0G A;  4BL7 A;  4EKZ A;  1FAA A;  2GZZ A;  1GNE A;  3IV4 A;  2WRT A;  3CYN A;  3L78 A;  5DDL A;  2MMA A;  3GH6 A;  4J57 E;  1XXU A;  2HFD A;  3EYT A;  2XHF A;  3KTL A;  1ERV A;  2H1G A;  1TXU A;  2G2Q A;  5G1L A;  4OCF A;  4Q5F A;  1OC3 A;  4MAB A;  5IMC A;  2UV8 G;  1PN0 A;  2JZT A;  4IHU A;  5H5S A;  2EFE A;  1YZX A;  4RQR A;  5C04 A;  3OR5 A;  2XC2 A;  3RPN A;  1OVN A;  3ZIT A;  1X9M B;  1HQO A;  1A2M A;  2C0D A;  2L59 A;  5KN3 A;  3KCM A;  4NXI A;  2RM5 A;  3UEM A;  2A2R A;  5ECS A;  5A5K A;  2DML A;  1RQM A;  3QD9 A;  2WS2 A;  4O5R A;  2MZC A;  4IJI A;  1OE8 A;  4PX1 A;  2LRN A;  1Z6M A;  2HLS A;  2HZE B;  1THX A;  2DJ3 A;  3I6A A;  4MF6 A;  4LMV A;  2H73 A;  2B5X A;  1XG8 A;  1AW9 A;  5IO0 A;  2XBI A;  3QFB C;  4AJ7 A;  4ECB A;  4QL9 A;  3L0H A;  1PQN A;  1WRY A;  3BBY A;  4FH8 A;  1JZR A;  2AV4 A;  3QAV A;  5IMA A;  2GSQ A;  2IMK A;  1QXH A;  1SU9 A;  1FOH A;  3M0F A;  3TU3 B;  2X49 A;  3TGZ A;  3LSZ A;  5CRW A;  4WET A;  5F06 A;  4MPF A;  1ZYP A;  4O92 A;  5HFG A;  1Z7P A;  2IN3 A;  1PFO A;  4MF5 A;  4WR4 A;  4KCE A;  4V1A p;  2YV7 A;  4EC0 A;  1NHO A;  2WZ9 A;  5ID2 B;  1FOV A;  1DBY A;  1VF1 A;  5BRT A;  1OC9 B;  4HZ4 A;  4NMU A;  3EU3 A;  2LQQ A;  3VI5 A;  4F0B A;  5CYY A;  2F9S A;  4GQC A;  3W8S A;  3P7X A;  4NPB A;  3P8W A;  1SEN A;  2VUP A;  4LL1 B;  2O8V B;  2OBI A;  5ECI B;  2B5Y A;  3QCP A;  3BCK A;  2F51 A;  3HVN A;  3FRC A;  1Y25 A;  3E9J B;  3ZFB A;  3ZYW A;  4FIW A;  2H6Z A;  4PUF C;  1W4V A;  3ZMK A;  2H30 A;  3UVT A;  1EV4 A;  1OKD A;  5DJL A;  2WVX B;  4ZIL A;  3TKP A;  2VOC A;  4TVE A;  5EPF A;  5G2Z A;  5D96 A;  4ISD A;  3KMO A;  4DSQ A;  3AY8 A;  5G5E A;  2V41 A;  1TP9 A;  3DWV A;  1AIU A;  5D73 A;  1IYI A;  3IC8 A;  3P90 A;  2JU5 A;  4N0Z A;  1TK5 B;  4N30 A;  3TJF A;  1GL8 A;  2PGT A;  4ECC A;  1EOG A;  1T3B A;  4FYC A;  5DAL B;  3IRA A;  4RQX A;  3DIE A;  2VL9 A;  3HZ4 A;  1PRX A;  3FR6 A;  2YJ7 A;  5AIV A;  2MMZ A;  5ECN B;  1RK4 A;  1T4Z A;  3VI7 A;  4XIH A;  3TKQ A;  1WWJ A;  1MD3 A;  3GRX A;  4GCI A;  2O3E A;  2ZUP A;  3GKN A;  2GST A;  1JZW A;  2HZE A;  4HQS A;  4IW9 A;  3IOS A;  5DBQ A;  1YKA A;  4O5Q A;  2ON5 A;  2YP6 A;  4O32 A;  3LWA A;  3H8Q A;  1XW5 A;  2EIO A;  2AAW A;  2IME A;  4OO5 A;  3HY2 A;  4N3Z A;  4ECI A;  5KN1 A;  4TR1 B;  4JED A;  4PQI A;  5DAK B;  2KOK A;  6GSW A;  2GQM A;  5FWG A;  1KNG A;  4HU7 A;  2GSS A;  3D4M A;  2O87 A;  1T7P B;  3ZRD A;  2VL2 A;  1XPV A;  2VO4 A;  1U3A A;  1GSS A;  3F8U A;  4MH3 A;  5LCZ A;  4GRF A;  5EVO A;  5CO3 A;  2PBJ A;  1OE7 A;  3US3 A;  3WGX A;  5ENU A;  4W66 A;  5ECM B;  2N5B A;  1J08 A;  1GH2 A;  2DJ1 A;  4IJ3 A;  2E2M A;  3FR3 A;  3Q19 A;  5IMF A;  1EZK A;  1OC9 A;  3RHB A;  2IL3 A;  4K0N A;  4MH2 A;  1EV9 A;  3A3T A;  1GLP A;  2V2G A;  2C3T A;  2MMO A;  2AB6 A;  3KP8 A;  1PN9 A;  4I2T A;  2DKH A;  1G6Y A;  5KOW A;  5FHI A;  1M99 A;  1TRU A;  3IK9 A;  2DKI A;  1K0C A;  1PGT A;  4N11 A;  2K18 A;  3A2X A;  1XOB A;  1GTA A;  2B3S A;  5DQS A;  4LMW A;  3TKS C;  1EGR A;  2H01 A;  4AF2 A;  1B4Q A;  4DVC A;  2GDR A;  2PER A;  2FWF A;  1O85 A;  2JZR A;  4K7O A;  2EFD A;  2WVX A;  5KN0 A;  3VPQ A;  4OCE A;  1UA5 A;  5ECO B;  2VM1 A;  4AJ6 A;  4RI7 A;  4K0G A;  4I97 A;  5F05 A;  2A2P A;  4BPY A;  1TXX A;  5DAL A;  5GZZ B;  2LRT A;  4MZC A;  3HVX A;  4AKI A;  3LQ7 A;  1U3I A;  3L9U A;  3DEX A;  3A5W A;  1BG5 A;  5CRD A;  3LYK A;  3O6T A;  1TU8 A;  3C8E A;  2LUS A;  2FHE A;  4HQZ A;  4IKH A;  2F3M A;  2GQL A;  2NVL A;  1B48 A;  4YKF A;  4JE1 A;  2FWE A;  4E8H A;  1EP7 A;  3TKS E;  2LS5 A;  2CQ9 A;  13GS A;  2CZ3 A;  3KTB A;  2HQT A;  3M3M A;  3ERF A;  2H75 A;  3TOT A;  1GLQ A;  5D9V A;  4TR1 A;  3IAM 2;  1NSW A;  3GKX A;  1KTE A;  1PMT A;  1CQH A;  2LNT A;  2TRX A;  2VKZ G;  2C8U A;  2CX4 A;  1FW1 A;  2JAD A;  3ZZX A;  2LJA A;  16GS A;  3EU4 A;  2OA7 A;  1YQ1 A;  3VLN A;  2VLU A;  1JZD A;  4IVF A;  3D21 A;  2WW2 A;  3CSH A;  5HR0 A;  1M7T A;  3TJJ A;  4G2E A;  3BD2 A;  3UJ1 A;  1EWX A;  4EDZ A;  4K9Z A;  1ST9 A;  22GS A;  4EUY A;  2WCI A;  2C80 A;  3G7J A;  2L4Q A;  1SL2 B;  2E0Q A;  3BJ5 A;  2DC5 A;  4IBP A;  1ERT A;  4H86 A;  3DML A;  6GSY A;  1NM3 A;  5IQY A;  1Z9H A;  4KW6 A;  4TKY A;  3HJP A;  2FWG A;  2JL4 A;  5ECP B;  4GTU A;  3O3T A;  5ELG A;  3VUR A;  3GIX A;  1M3I A;  2C0E A;  5E59 A;  9GSS A;  4YQV A;  5IMD A;  3ZL5 A;  2DSA A;  1SYR A;  4ZL8 A;  3TRQ A;  1SD9 A;  3JCM L;  2F8F A;  3LXZ A;  1O8X A;  2GGT A;  2X4A A;  5JWQ B;  4BWS A;  4LL4 B;  1M0U A;  4CY6 A;  4HZ2 A;  3GV1 A;  1R5A A;  2C3Q A;  2VCX A;  4KF9 A;  10GS A;  4CDO A;  3P2A A;  6GSU A;  1SK1 A;  1VF3 A;  2OE0 A;  4OO4 A;  4L0U A;  4IGJ A;  3KXO A;  1O81 A;  2R2J A;  2FCH A;  5HFI A;  2O85 A;  2L4C A;  2OKA A;  5JWO B;  2QA2 A;  2RUE A;  2X99 A;  1ILO A;  3E3E A;  2CT6 A;  4WF4 A;  1SD8 A;  2EC4 A;  2A4V A;  3HD5 A;  5F0G A;  2YWI A;  4J56 E;  4MJB A;  1TRW A;  2B6M A;  1G7E A;  1FVJ A;  2D2Z A;  1E6B A;  3TB2 A;  3O76 A;  1ZOF A;  1A0F A;  4TOP A;  3GST A;  1GUM A;  3W6G A;  4KX4 A;  4V2M A;  4GWR A;  5LD0 A;  3C71 A;  3D6I A;  2CVD A;  4POM A;  1TRV A;  3IHG A;  4ZL7 A;  1TU7 A;  3EIN A;  5JCU A;  5DJM A;  5ECK B;  4ML6 A;  4K5R A;  4EDY A;  5EL8 A;  3KGK A;  4IP1 A;  3F4T A;  5J4V A;  2HRF A;  4BVX B;  4TXO B;  3W8J A;  3TRP A;  3CMI A;  5GST A;  8GSS A;  3VPT A;  2KP2 A;  2CVB A;  4WBJ A;  2YWN A;  3UL3 A;  1N25 A;  4KDU A; 
#chains in the Genus database with same CATH homology
 1F3A A;  3J7Y b;  2AHE A;  2H71 A;  1M2D A;  4KH7 A;  4XS4 B;  2H0I A;  1AQV A;  2WJU A;  1FHE A;  3HMJ G;  2MMN A;  2P5R A;  1QK8 A;  4DSS A;  2L6D A;  1K0M A;  3L9S A;  2QA1 A;  2PUK C;  2H72 A;  4XS6 A;  3UVH A;  2N5A A;  1MDJ A;  1GSQ A;  2BMX A;  3KZQ A;  1YEP A;  4WR5 A;  1C72 A;  5C00 A;  1VRS D;  1O7U A;  2FA8 A;  4A5P A;  1A8L A;  6GSS A;  3WGD A;  1AAZ A;  4NWY A;  4NHZ A;  4OFT A;  1SK2 A;  4KAE A;  11GS A;  2PU9 C;  4X43 A;  3WGE A;  4BVY A;  3EVI A;  3ZIJ A;  4MK3 A;  3GKK A;  2FNO A;  5B8B A;  4TW5 A;  4POL A;  1GSU A;  1URM A;  2V6K A;  4AKG A;  1YKC A;  3TJK A;  2IMI A;  2VD0 A;  1B8X A;  3HKR A;  1PKW A;  4JRR A;  4J2F A;  4FQU A;  4IP6 A;  2R6K A;  4ICY A;  1HNA A;  1XWA A;  5IO2 A;  2ZNM A;  3GN3 A;  3UMA A;  3J7Y k;  2C0F A;  2DBC A;  4PQH A;  1F3B A;  1Z7R A;  1BJX A;  2O89 A;  1T4Y A;  4L8E A;  4K5S A;  3LOR A;  4PNF A;  1XW9 A;  5GAN D;  3ZTL A;  4HUA A;  5A4U A;  1S3C A;  1X0R A;  1SJZ A;  1ON4 A;  1PSQ A;  3FMW A;  4F2I A;  4MJE A;  5H5Q A;  5D9X A;  3DKS A;  2AJQ B;  3H1N A;  1GUK A;  1E2Y A;  4AI6 A;  2HSN B;  2BTO T;  18GS A;  14GS A;  4PGT A;  4MJC A;  1FB6 A;  2EFC A;  3Q18 A;  1T00 A;  4JBB A;  2YN1 A;  1R26 A;  3I43 A;  4WXT A;  4X0X A;  3GFK A;  4EE0 A;  3EPT A;  3ZLP A;  4F82 A;  2XBQ A;  1QGV A;  2CAQ A;  3Q6O A;  3BOA A;  1AC1 A;  1SKR B;  5H5R A;  3TJG A;  4Q5N A;  2R0C A;  3DVW A;  5KOX A;  1W89 A;  2KP1 A;  3F6D A;  1YF1 A;  2YNX A;  3VWU A;  4JR4 A;  4OFN A;  4EIQ A;  4BVX A;  2LQO A;  4TXO A;  1XIY A;  3CXG A;  3LXT A;  2VAF A;  1JLV A;  2GTU A;  2GQK A;  4PTS A;  3HCZ A;  1O6J A;  4G10 A;  4WBR D;  2GT6 A;  4KA0 A;  4I5Q A;  2HSM B;  4JU5 A;  1PL2 A;  4AKH A;  4GLT A;  3ERG A;  2NDO A;  1X9W B;  1XOA A;  4XS4 A;  5A34 A;  5J4Y A;  4WF5 A;  3GMF A;  3C7M A;  1G0T A;  2XPD A;  2PPT A;  3IDV A;  4HS1 A;  4CHS A;  3DGQ A;  3GTU A;  4Z2T A;  3ISO A;  4YAP A;  3UAP A;  1HD2 A;  1X9S B;  1X5E A;  3U5R E;  2EIR A;  2H1D A;  2R0P A;  2ES7 A;  2FUG 2;  1BF5 A;  1AUC A;  2J23 A;  1BQ7 A;  1K0O A;  3FR9 A;  4QMK A;  2FY6 A;  1YVL A;  1DSB A;  4KGI A;  3HJM A;  1B4P A;  1K3O A;  3CTG A;  2HT9 A;  4NV2 A;  4GSS A;  2OE1 A;  4K7I A;  1MTC A;  4GDF A;  4N0V A;  4GQF A;  3MNG A;  3FZA A;  2VCT A;  2PN8 A;  2HNL A;  3D0Z A;  4Q5R A;  3APO A;  2QGV A;  1S3A A;  1SJ6 A;  5J4U A;  3UAR A;  3CBU A;  1RW1 A;  2VCW A;  1YEX A;  1TRS A;  1XWG A;  4ZB8 A;  2H0H A;  3L4N A;  4K2X A;  4K1F A;  2GZY A;  1HYU A;  1USB A;  3LYP A;  4AKX B;  2QKE A;  4G01 A;  4DSR A;  2B1L A;  2GSR A;  1ZYN A;  3ME7 A;  3GL3 A;  1Q4J A;  5B7C A;  1MD4 A;  3F3Q A;  2P5Q A;  1N2A A;  5DVB A;  5B6M A;  5IOW A;  2A2S A;  4G19 A;  5IM9 A;  2GZP A;  1XWB A;  2HSN A;  3D22 A;  1FB0 A;  5KN2 A;  1K0D A;  2GS3 A;  2RII A;  3WD6 A;  3D4T A;  4BWQ A;  1NHY A;  2CVK A;  1ZCP A;  4L0W A;  3QAG A;  2HXK A;  2G0F A;  5J3R A;  2C4J A;  3QDN A;  2YV9 A;  4KSO A;  2LNS A;  1TK0 B;  2NTO A;  3IPZ A;  3GUR A;  4IQ1 A;  1QUW A;  1SK0 A;  4HEA 2;  1U6T A;  1JZO A;  2DJ0 A;  2R0G A;  2YPM A;  1EP8 A;  1JLW A;  5J41 A;  17GS A;  4I6X A;  1MDI A;  3DYR A;  2I81 A;  3DRN A;  2HSH A;  3M9K A;  1EEM A;  1PX6 A;  2TIR A;  1ZZY A;  4V2L A;  3IXR A;  1J0F A;  2HRK A;  2IMF A;  3QFA C;  2UZ8 A;  1U88 A;  3HZ8 A;  1GTI A;  2BJX A;  2HSM A;  4E68 A;  5E4W A;  2WDU A;  1JHB A;  5L71 A;  4E8E A;  3D5J A;  1K0B A;  1ML6 A;  4XTS A;  1A2L A;  3KEB A;  3LW9 A;  1HNC A;  5AN1 A;  4MLY A;  4HU9 A;  1KEB A;  4DEJ A;  2PVO C;  1Z6N A;  2X8G A;  1HNB A;  1Q98 A;  2HI7 A;  3KM6 A;  3WT1 A;  4IQA A;  2GVP A;  1NW2 A;  4ML1 A;  4IEL A;  4ILF A;  5IMV A;  1R4W A;  2P0G A;  5A1N B;  1ERU A;  5LNK e;  2V32 A;  1GUH A;  2IFQ B;  3NOF A;  2OBK A;  2NBS A;  1TOF A;  2PWJ A;  2OAC A;  1QQ2 A;  4DSS B;  4GSN A;  4ECJ A;  2H6Y A;  2VCZ A;  2MBS A;  5COH A;  2OE3 A;  3KIJ A;  5ECQ B;  5IOX A;  1M9A A;  5FT3 A;  1GP1 A;  2IPA A;  4HI7 A;  2HRN A;  3ZVJ A;  2K9F A;  2DIY A;  2MBT A;  1MEK A;  1OKT A;  4PQ1 A;  1TK8 B;  3FHK A;  3HDC A;  1EGO A;  3TKS A;  2B7K A;  2KHP A;  4BVY B;  5ECH B;  2GT5 A;  3M1G A;  1SVO A;  2DIZ A;  4YQU A;  3ZFL A;  2YWM A;  3ZML A;  1K0A A;  3QOU A;  4N10 A;  2H1L A;  3VWW A;  5JCG A;  1KBN A;  1LBK A;  1PL1 A;  1V40 A;  4OFM A;  4MNN A;  3UIW A;  1B9X C;  5G30 A;  2KUC A;  2YJH A;  1ACV A;  5D9W A;  2FD3 A;  4F0C A;  2H70 A;  3KD0 A;  3EMP A;  1Z3E A;  3F6F A;  4KND A;  4OMV A;  4IN0 A;  3RPP A;  1BG1 A;  2YCD A;  5J40 A;  4KSM A;  5CRG A;  3KH9 A;  3CWG A;  3PIN A;  5B8A A;  5D8I A;  1A2J A;  2B1K A;  2LTK A;  3CSI A;  4ZB9 A;  1BX9 A;  3DD3 A;  2MYG A;  3HXS A;  1EOH A;  1T8E B;  3M9J A;  2O7K A;  2H66 A;  4FYU A;  1PA3 A;  1Z5Y E;  2DMM A;  2XPE A;  3C1R A;  4I8B A;  3IE3 A;  3WYW A;  5JCW A;  2R37 A;  3LGC A;  1ZYQ B;  1V9W A;  2QSI A;  3G7Y A;  5GAP D;  3IK7 A;  1N8J A;  4Z2R A;  2YZU A;  3GA4 A;  1U87 A;  4HJ2 A;  2DLX A;  2Z9S A;  3M8N A;  3PGT A;  6GSV A;  1I5G A;  2LST A;  4RI6 A;  1SVM A;  2JAC A;  2A4H A;  5J5N A;  3CRU A;  2FLS A;  3GNJ A;  4HJM A;  3HA9 A;  3V1W A;  4PUA A;  20GS A;  3U6V A;  3IC4 A;  1QFN A;  1F2E A;  2LEG A;  3H79 A;  4I2U A;  2REM A;  4POB A;  3ED3 A;  4JZQ A;  3TRX A;  1SKW B;  2E2G A;  5INY A;  3F63 A;  2H6X A;  2M46 A;  4USS A;  4TR4 A;  5F07 A;  2VM2 A;  2V6O A;  2VIM A;  1M9B A;  5BMU B;  3IHQ A;  3QR6 A;  2VCQ A;  2YOI A;  5A34 B;  6GST A;  5A1N A;  1I9D A;  2OAD A;  3C73 A;  4LLR A;  5HFK A;  3F3R A;  1R5P A;  2IFQ A;  3MYD A;  4KUN A;  3GTU B;  1XZO A;  4MMM A;  2H74 A;  3DVX A;  4TN8 A;  3FK8 A;  2HZF A;  1G7O A;  3APS A;  2P31 A;  3R3E A;  3N5O A;  5J9B A;  4ZL9 A;  1X5D A;  1YDK A;  2B7J A;  1A24 A;  5ECR B;  1O73 A;  2LKU A;  1TJD A;  2J9H A;  3F4S A;  4BA7 A;  2WGR A;  2O5V A;  2CV4 A;  4HDE A;  4G0K A;  2K8V A;  3IA1 A;  4XS1 A;  3FW2 A;  4K7N A;  1TKD B;  4G0L A;  4AGS A;  5CRH A;  5A4V A;  3F9U A;  4XCS A;  2RM6 A;  4MZB A;  2CZ2 A;  1A8Y A;  2M80 A;  3TUE A;  3FY7 A;  3RBT A;  2DJK A;  4F9Z A;  2HYX A;  1AQW A;  3GHA A;  1SKS B;  2I1U A;  5A5H B;  2AUV A;  1GRX A;  5J47 A;  1XVW A;  2JSZ A;  1SL0 B;  1AQX A;  5DCH A;  5ABR A;  1AXD A;  1F9M A;  2PMT A;  3TOU A;  4JR6 A;  1PD2 1;  3CTF A;  3TCO A;  3RHC A;  3PPU A;  1A0R P;  1XW6 A;  4LA1 A;  5F8B A;  3GSS A;  2VL2 C;  1X5C A;  2B5E A;  5KEJ A;  1QMV A;  3QMX A;  3FEU A;  1K3L A;  1DE2 A;  4XRD A;  3IR4 A;  1UN2 A;  2VD1 A;  2NPB A;  1M2A A;  2C3N A;  4K2D A;  2I3Y A;  3FYG A;  3GKM A;  3HVS A;  3TDG A;  4AJ8 A;  1ZMA A;  3HYP A;  1YJ6 A;  4ZIJ A;  1J9B A;  2H1A A;  1THO A;  4EO3 A;  3FZ4 A;  4KB3 A;  1GSD A;  19GS A;  4GST A;  4D73 B;  5JWR B;  2HSY A;  1OAZ A;  1S3D A;  1G6W A;  2I4A A;  4IS0 A;  5J9C A;  1ZL9 A;  3KJY A;  2IIY A;  4MJA A;  2DJJ A;  1TTZ A;  1GWC A;  2PVQ A;  2X8H A;  2HRK B;  1Y1U A;  4MPG A;  4L5L A;  4ACS A;  3PR8 A;  3DXB A;  1PKZ A;  2C1Y A;  4V2N A;  4YQM A;  2TRC P;  4V1A g;  12GS A;  2GLR A;  5BMU A;  2JZS A;  1CQG A;  3KH7 A;  3UBK A;  2L6C A;  3IAS 2;  5HR2 A;  4Z2U A;  4XHM A;  2X8C A;  3MWH A;  1ZYE A;  2ON7 A;  1R7H A;  4X4J A;  3VWV A;  1WIK A;  1A23 A;  6GSX A;  1WPI A;  4EIP A;  5DCG A;  2LRC A;  2F8A A;  2ZCT A;  2X64 A;  3R2Q A;  3KMN A;  1GSF A;  3QAW A;  1UVZ A;  1WE0 A;  3IBH A;  1XVQ A;  1ERW A;  4RUV A;  1B9Y C;  2IWT A;  2CX3 A;  2RUF A;  1SJI A;  5IMZ A;  4ID0 A;  4EF0 A;  2EFH A;  2LJR A;  3EWL A;  3E0U A;  3GYK A;  3NZN A;  3KP9 A;  2I9H A;  2N5F A;  3FKF A;  5D9T A;  3N9J A;  4NAX A;  5CNW A;  1FG4 A;  5B6N A;  3LJR A;  4EL1 A;  3I69 A;  3MSZ A;  4FO5 A;  2YZH A;  1H75 A;  3ZVJ D;  1GSE A;  4O5U A;  2LV3 A;  2K8S A;  2V1M A;  2E7P A;  3Q74 A;  4NV5 A;  4O7H A;  5A5H A;  2L5L A;  1PX7 A;  3MAK A;  4CW9 A;  1XCC A;  3HJO A;  1V2A A;  2WFC A;  4ZB6 A;  5ECL B;  5G31 A;  4Q5Q A;  2R4V A;  1GTB A;  3A2W A;  3ZRE A;  5G1K A;  1XFL A;  2L57 A;  2HE3 A;  3APQ A;  2FA4 A;  3NIV A;  4QQ7 A;  5ID2 A;  4ZBD A;  3A2V A;  3ME8 A;  1TDI A;  5CRE A;  4KDY A;  1GTU A;  2R5G A;  3HHV A;  1GNW A;  4TR0 A;  4KE3 A;  4EXJ A;  5G5F A;  4Z7X A;  4WEY A;  1BAY A;  1WMJ A;  2CA8 A;  3QPM A;  1M2B A;  3ERW A;  1LU4 A;  1SL1 B;  2H19 A;  5IPH A;  5EY6 A;  4MZW A;  2K6V A;  1O8W A;  3GUS A;  2YAN A;  2WB9 A;  1YF0 A;  4OWY A;  5AGY A;  2ALB A;  4HOJ A;  4X1U A;  2QC7 A;  1VF2 A;  7GSS A;  4K6X A;  4D73 A;  2JSY A;  3G7I A;  1UC7 A;  1GSY A;  5CAX A;  2VL3 A;  4YKG A;  1V98 A;  1BED A;  4MDC A;  4QL7 A;  2IJY A;  5AIS A;  3PH9 A;  2L5O A;  4POK A;  1DUG A;  1VF4 A;  2H1B A;  3RAZ A;  3UOM A;  4BL7 B;  1TW9 A;  1ZGN A;  2RLI A;  4ZB7 A;  4L5O A;  3I9V 2;  2VLT A;  1TI1 A;  5HR1 A;  1ABA A;  3LEF A;  4ZXG A;  4ZBA A;  3SWL A;  5DQY A;  1FVK A;  5A4W A;  1OYJ A;  3EC3 A;  3F0I A;  1GUL A;  4G0I A;  2OJL A;  3TJB A;  3GX8 A;  1F37 A;  1DE1 A;  5HQP A;  3TKR A;  4PUR A;  4P3Y B;  3VWX A;  5HR3 A;  3CSJ A;  3SBC A;  3WT2 A;  4OD7 A;  1JFU A;  1V57 A;  2H0G A;  1LJR A;  1SVL A;  5CP1 A;  2OT3 A;  5DAK A;  1XWC A;  1IYH A;  4YH2 A;  3GL5 A;  2FWH A;  4FYB A;  4TXV A;  3C1S A;  4NHW A;  1WJK A;  1YY7 A;  2WUL A;  3A5I A;  3S9F A;  1MDK A;  2CAI A;  4GF0 A;  5IPG A;  1V58 A;  1OC8 A;  4YAV A;  1XBS A;  4PNG A;  1Y6E A;  2EIQ A;  3RDW A;  1H4O A;  3GH9 A;  4MA9 A;  5AIX A;  2R3X A;  4EVM A;  2VCV A;  4MCU A;  2M72 A;  3EUR A;  2KLX A;  1BYE A;  4G9H A;  4XRA A;  1EEJ A;  3MIX A;  5D93 A;  3LG6 A;  4TRX A;  4MF7 A;  4MP4 A;  4CY8 A;  3BCI A;  3ZIV A;  4K8M A;  3H93 A;  4ULX A;  4PXO A;  4WKW A;  3MDK A;  1VGL A;  3K8N A;  5GSS A;  1K3Y A;  2IMD A;  2VLV A;  3HVV A;  1T1V A;  5IIZ A;  1WP0 A;  3G9B A;  1SYX A;  1WOU A;  3EMX A;  2AYT A;  1FO5 A;  3EE2 A;  2H8L A;  3UBL A;  1F6M C;  4KCA A;  3FZ5 A;  4F03 A;  3F4R A;  2LJK A;  2H76 A;  3CRT A;  2DJ2 A;  1K0N A;  3VFI A;  3LFL A;  1XWK A;  4KDX A;  3H4K A;  5ELA A;  2FGX A;  1TI3 A;  3FZ9 A;  3GX0 A;  4ZBB A;  3L9V A;  2HRA A;  3VK9 A;  4TR3 A;  2YWO A;  4GXZ A;  2C0G A;  4BL7 A;  4EKZ A;  1FAA A;  2GZZ A;  1GNE A;  3IV4 A;  2WRT A;  3CYN A;  3L78 A;  5DDL A;  2MMA A;  3GH6 A;  4J57 E;  1XXU A;  2HFD A;  3EYT A;  2XHF A;  3KTL A;  1ERV A;  2H1G A;  1TXU A;  2G2Q A;  5G1L A;  4OCF A;  4Q5F A;  1OC3 A;  4MAB A;  5IMC A;  2UV8 G;  1PN0 A;  2JZT A;  4IHU A;  5H5S A;  2EFE A;  1YZX A;  4RQR A;  5C04 A;  3OR5 A;  2XC2 A;  3RPN A;  1OVN A;  3ZIT A;  1X9M B;  1HQO A;  1A2M A;  2C0D A;  2L59 A;  5KN3 A;  3KCM A;  4NXI A;  2RM5 A;  3UEM A;  2A2R A;  5ECS A;  5A5K A;  2DML A;  1RQM A;  3QD9 A;  2WS2 A;  4O5R A;  2MZC A;  4IJI A;  1OE8 A;  4PX1 A;  2LRN A;  1Z6M A;  2HLS A;  2HZE B;  1THX A;  2DJ3 A;  3I6A A;  4MF6 A;  4LMV A;  2H73 A;  2B5X A;  1AW9 A;  5IO0 A;  2XBI A;  3QFB C;  4AJ7 A;  4ECB A;  4QL9 A;  3L0H A;  1PQN A;  1WRY A;  3BBY A;  4FH8 A;  1JZR A;  2AV4 A;  3QAV A;  5IMA A;  2GSQ A;  2IMK A;  1QXH A;  1SU9 A;  1FOH A;  3M0F A;  3TU3 B;  2X49 A;  3TGZ A;  3LSZ A;  5CRW A;  4WET A;  5F06 A;  4MPF A;  1ZYP A;  4O92 A;  5HFG A;  1Z7P A;  2IN3 A;  4MF5 A;  4WR4 A;  4KCE A;  4V1A p;  2YV7 A;  4EC0 A;  1NHO A;  2WZ9 A;  5ID2 B;  1FOV A;  1DBY A;  1VF1 A;  5BRT A;  1OC9 B;  4HZ4 A;  4NMU A;  3EU3 A;  2LQQ A;  3VI5 A;  4F0B A;  5CYY A;  2F9S A;  4GQC A;  3W8S A;  3P7X A;  4NPB A;  3P8W A;  1SEN A;  2VUP A;  4LL1 B;  2O8V B;  2OBI A;  5ECI B;  2B5Y A;  3QCP A;  3BCK A;  2F51 A;  3FRC A;  1Y25 A;  3E9J B;  3ZFB A;  3ZYW A;  4FIW A;  2H6Z A;  4PUF C;  1W4V A;  3ZMK A;  2H30 A;  3UVT A;  1EV4 A;  1OKD A;  5DJL A;  4ZIL A;  3TKP A;  2VOC A;  4TVE A;  5EPF A;  5G2Z A;  5D96 A;  4ISD A;  3KMO A;  4DSQ A;  3AY8 A;  5G5E A;  2V41 A;  1TP9 A;  3DWV A;  1AIU A;  5D73 A;  1IYI A;  3IC8 A;  3P90 A;  2JU5 A;  4N0Z A;  1TK5 B;  4N30 A;  3TJF A;  1GL8 A;  2PGT A;  4ECC A;  1EOG A;  1T3B A;  4FYC A;  5DAL B;  3IRA A;  4RQX A;  3DIE A;  2VL9 A;  3HZ4 A;  1PRX A;  3FR6 A;  2YJ7 A;  5AIV A;  2MMZ A;  5ECN B;  1RK4 A;  1T4Z A;  3VI7 A;  4XIH A;  3TKQ A;  1WWJ A;  1MD3 A;  3GRX A;  4GCI A;  2ZUP A;  3GKN A;  2GST A;  1JZW A;  2HZE A;  4HQS A;  4IW9 A;  3IOS A;  5DBQ A;  1YKA A;  4O5Q A;  2ON5 A;  2YP6 A;  4O32 A;  3LWA A;  3H8Q A;  1XW5 A;  2EIO A;  2AAW A;  2IME A;  4OO5 A;  3HY2 A;  4N3Z A;  4ECI A;  5KN1 A;  4TR1 B;  4JED A;  4PQI A;  5DAK B;  2KOK A;  6GSW A;  2GQM A;  5FWG A;  1KNG A;  4HU7 A;  2GSS A;  3D4M A;  2O87 A;  1T7P B;  3ZRD A;  2VL2 A;  1XPV A;  2VO4 A;  1U3A A;  1GSS A;  3F8U A;  4MH3 A;  5LCZ A;  4GRF A;  5EVO A;  5CO3 A;  2PBJ A;  1OE7 A;  3US3 A;  3WGX A;  5ENU A;  4W66 A;  5ECM B;  2N5B A;  1J08 A;  1GH2 A;  2DJ1 A;  4IJ3 A;  2E2M A;  3FR3 A;  3Q19 A;  5IMF A;  1EZK A;  1OC9 A;  3RHB A;  2IL3 A;  4K0N A;  4MH2 A;  1EV9 A;  3A3T A;  1GLP A;  2V2G A;  2C3T A;  2MMO A;  2AB6 A;  3KP8 A;  1PN9 A;  4I2T A;  2DKH A;  1G6Y A;  5KOW A;  5FHI A;  1M99 A;  1TRU A;  3IK9 A;  2DKI A;  1K0C A;  1PGT A;  4N11 A;  2K18 A;  3A2X A;  1XOB A;  1GTA A;  2B3S A;  5DQS A;  4LMW A;  3TKS C;  1EGR A;  2H01 A;  4AF2 A;  1B4Q A;  4DVC A;  2GDR A;  2PER A;  2FWF A;  1O85 A;  2JZR A;  4K7O A;  2EFD A;  5KN0 A;  3VPQ A;  4OCE A;  1UA5 A;  5ECO B;  2VM1 A;  4AJ6 A;  4RI7 A;  4K0G A;  4I97 A;  5F05 A;  2A2P A;  4BPY A;  1TXX A;  5DAL A;  5GZZ B;  2LRT A;  4MZC A;  3HVX A;  4AKI A;  3LQ7 A;  1U3I A;  3L9U A;  3DEX A;  3A5W A;  1BG5 A;  5CRD A;  3LYK A;  3O6T A;  1TU8 A;  3C8E A;  2LUS A;  2FHE A;  4HQZ A;  4IKH A;  2F3M A;  2GQL A;  2NVL A;  1B48 A;  4YKF A;  4JE1 A;  2FWE A;  4E8H A;  1EP7 A;  3TKS E;  2LS5 A;  2CQ9 A;  13GS A;  2CZ3 A;  3KTB A;  2HQT A;  3M3M A;  3ERF A;  2H75 A;  3TOT A;  1GLQ A;  5D9V A;  4TR1 A;  3IAM 2;  1NSW A;  3GKX A;  1KTE A;  1PMT A;  1CQH A;  2LNT A;  2TRX A;  2VKZ G;  2C8U A;  2CX4 A;  1FW1 A;  2JAD A;  3ZZX A;  2LJA A;  16GS A;  3EU4 A;  2OA7 A;  1YQ1 A;  3VLN A;  2VLU A;  1JZD A;  4IVF A;  3D21 A;  3CSH A;  5HR0 A;  1M7T A;  3TJJ A;  4G2E A;  3BD2 A;  3UJ1 A;  1EWX A;  4EDZ A;  4K9Z A;  1ST9 A;  22GS A;  4EUY A;  2WCI A;  2C80 A;  3G7J A;  2L4Q A;  1SL2 B;  2E0Q A;  3BJ5 A;  2DC5 A;  4IBP A;  1ERT A;  4H86 A;  3DML A;  6GSY A;  1NM3 A;  5IQY A;  1Z9H A;  4KW6 A;  4TKY A;  3HJP A;  2FWG A;  2JL4 A;  5ECP B;  4GTU A;  3O3T A;  5ELG A;  3VUR A;  3GIX A;  5E59 A;  2C0E A;  9GSS A;  4YQV A;  5IMD A;  3ZL5 A;  2DSA A;  1SYR A;  4ZL8 A;  3TRQ A;  1SD9 A;  3JCM L;  2F8F A;  3LXZ A;  1O8X A;  2GGT A;  2X4A A;  5JWQ B;  4BWS A;  4LL4 B;  1M0U A;  4CY6 A;  4HZ2 A;  3GV1 A;  1R5A A;  2C3Q A;  2VCX A;  4KF9 A;  10GS A;  4CDO A;  3P2A A;  6GSU A;  1SK1 A;  1VF3 A;  2OE0 A;  4OO4 A;  4L0U A;  4IGJ A;  3KXO A;  1O81 A;  2R2J A;  2FCH A;  5HFI A;  2O85 A;  2L4C A;  2OKA A;  5JWO B;  2QA2 A;  2RUE A;  2X99 A;  1ILO A;  3E3E A;  2CT6 A;  4WF4 A;  1SD8 A;  2EC4 A;  2A4V A;  3HD5 A;  5F0G A;  2YWI A;  4J56 E;  4MJB A;  1TRW A;  2B6M A;  1G7E A;  1FVJ A;  2D2Z A;  1E6B A;  3TB2 A;  3O76 A;  1ZOF A;  1A0F A;  4TOP A;  3GST A;  1GUM A;  3W6G A;  4KX4 A;  4V2M A;  4GWR A;  5LD0 A;  3C71 A;  3D6I A;  2CVD A;  4POM A;  1TRV A;  3IHG A;  4ZL7 A;  1TU7 A;  3EIN A;  5JCU A;  5DJM A;  5ECK B;  4ML6 A;  4K5R A;  4EDY A;  5EL8 A;  3KGK A;  4IP1 A;  3F4T A;  5J4V A;  2HRF A;  4BVX B;  4TXO B;  3W8J A;  3TRP A;  3CMI A;  5GST A;  8GSS A;  3VPT A;  2KP2 A;  2CVB A;  4WBJ A;  2YWN A;  3UL3 A;  1N25 A;  4KDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...