4E8HA

Structural of bombyx mori glutathione transferase bmgstd1 complex with gtt
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
214
Chain Sequence
HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Structural of Bombyx mori glutathione transferase BmGSTD1 complex with GTT
rcsb
source organism Bombyx mori
total genus 80
structure length 214
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8hA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8hA01
2MZCA 1TK0B 1SYXA 3FHKA 1WJKA 1JZWA 4K1FA 5IO2A 1TJDA 2VL2C 1U87A 2XHFA 4MF5A 2P5QA 4KCEA 2PBJA 1B48A 4V2LA 4OWYA 2LRNA 2YANA 3GSTA 2RUFA 4V1Ap 5ID2A 1A8LA 4ML1A 1DUGA 1Z6NA 2E2GA 3FW2A 2N5AA 1SK2A 3LYPA 1YDKA 1S3CA 3KCMA 1ERWA 2DIZA 3IPZA 3KMOA 3TKRA 2LJKA 5GSTA 4BA7A 1YF0A 2VCTA 4MJEA 4XRAA 3KEBA 3ZTLA 1AQWA 2GS3A 1M9BA 5HQPA 3L9SA 1GNWA 1QGVA 2JADA 3GH6A 3RPPA 2FGXA 2YCDA 19GSA 2C0DA 3F4TA 5ECIB 2H71A 1AUCA 2V2GA 4O5RA 2FCHA 4YAPA 2H1DA 1F37A 4TR0A 1QFNA 4GSNA 6GSSA 2FD3A 2IFQB 4X1UA 2X8HA 1SKRB 3A2XA 1ERUA 2HQTA 2PWJA 3GN3A 1QUWA 4FYCA 3TGZA 1SK0A 5DVBA 1EEMA 3R2QA 1WRYA 2K6VA 2VM1A 1PL2A 5J4UA 2EIOA 2HZFA 2DJ1A 1ERVA 2E7PA 4XIHA 3S9FA 2HRNA 3FR3A 1K3LA 2HRKB 4MDCA 5IPHA 4TR3A 1W4VA 1EGOA 1XIYA 4MCUA 2VOCA 4KH7A 4XTSA 4OD7A 3APSA 3ZREA 5G2ZA 5DJLA 3ZRDA 1X5DA 1R5PA 4OCEA 2IMDA 1M0UA 2ALBA 4KSOA 3G9BA 3WD6A 4KUNA 3TOUA 1GTAA 2HSMA 1TU8A 2DSAA 3HA9A 1QK8A 2H0HA 3PH9A 4POMA 4GSSA 3AY8A 2RUEA 4NHWA 2I3YA 4AGSA 3U6VA 4POLA 2DIYA 2ZUPA 3TJFA 5D9VA 1GSQA 4F9ZA 2FNOA 2GSRA 3GX0A 1TI1A 1O85A 4I97A 2VD1A 4ZXGA 4F82A 1O7UA 3FYGA 3ME8A 3BOAA 4I8BA 2L57A 4WR4A 2MMNA 1R26A 5DCGA 5D9XA 4GTUA 1H75A 3C1SA 1IYIA 1SKSB 2E2MA 1BJXA 4BVXB 2E0QA 2H8LA 3QR6A 2IWTA 3TB2A 3RPNA 4Q5FA 4HZ4A 3BD2A 3FZAA 3ZZXA 2GZPA 2CZ3A 3QAGA 2VCVA 2V41A 1OC9A 3I43A 1GRXA 4E8EA 1OAZA 5HR0A 3KXOA 3A3TA 5ELAA 3CRTA 5ECKB 2L4CA 2H0IA 1XWBA 4MZCA 5AISA 2WGRA 3J7Yb 3IHQA 3ZITA 3UIWA 1AXDA 2N5FA 1T4ZA 3JCML 3RHCA 4RI6A 1FO5A 1K0OA 1VGLA 4N10A 1EV9A 3F6DA 3QAVA 2L6DA 3C73A 5IMAA 4MH2A 1WE0A 3Q74A 4ZL8A 5IPGA 1Q98A 3E9JB 4OFMA 5COHA 2X8GA 2XBIA 1JLWA 3D4TA 2N5BA 4DSSA 1UA5A 3IR4A 1SYRA 3GURA 12GSA 2KP2A 4MA9A 1Z7RA 4ID0A 1NHOA 3M9JA 4KDUA 4AJ8A 1K3YA 5HR1A 2MBTA 1GUMA 1J08A 4TXOA 2ZNMA 4QL9A 1ZGNA 2Z9SA 1OKDA 3LGCA 2V6KA 1PSQA 5INYA 5D9TA 4ECCA 5D96A 1AC1A 2HSMB 4YAVA 3TKPA 5J9CA 2VD0A 2OACA 6GSTA 5AIVA 3FZ5A 1LBKA 5J41A 3F63A 2V32A 3O76A 4MZBA 3EU4A 3OR5A 3IDVA 2C3NA 5EY6A 4FYUA 1GUHA 2L5LA 4GQCA 4MMMA 3WGXA 1OKTA 2DLXA 4L8EA 4MABA 3ISOA 1X9WB 1T7PB 4DEJA 2F8AA 1BQ7A 4HJMA 3L78A 3E3EA 4GLTA 4Q5QA 5HFKA 2P0GA 4IJIA 4WF4A 4BPYA 2CT6A 2I1UA 4HU7A 3N5OA 2BMXA 5CO3A 2HT9A 2AHEA 3CRUA 2HSNB 2RLIA 5L71A 2H70A 2OKAA 2GT6A 2PVOC 3ED3A 4F0BA 4KCAA 4MP4A 1KNGA 2PPTA 2LS5A 1BG5A 5CRGA 1XW5A 3LEFA 3M0FA 1B4QA 2YV7A 1E6BA 3VI7A 4MPFA 4GXZA 5J3RA 2HZEB 3QFAC 4EO3A 3WGEA 3KM6A 3FK8A 4EDYA 3TDGA 1X9MB 3MSZA 2OE0A 3VPTA 1T00A 1IYHA 4K7IA 3U5RE 2YN1A 3LWAA 3RAZA 1ZL9A 2GVPA 4GSTA 1PA3A 2GQMA 1EWXA 5A4UA 2B1LA 4EDZA 2YWIA 2OE3A 4AF2A 1SJZA 1C72A 3TRQA 4PQIA 4F0CA 3Q19A 5DDLA 1PGTA 4KW6A 1CQHA 1A23A 1SK1A 3V1WA 4K0NA 3GFKA 2VL9A 4TR1B 2IPAA 5ECSA 2C8UA 1G6YA 4X43A 4TXOB 3IK9A 1QXHA 2VCXA 1FB0A 5JCGA 2CVDA 3KP9A 2CX4A 3I6AA 4TN8A 2HSYA 4ZB6A 2AJQB 5EL8A 5BMUA 4HEA2 4MZWA 2H75A 1OC8A 4XS4A 3D4MA 3VWWA 1TK5B 1Z9HA 1NM3A 4ZILA 5EVOA 2GQLA 5DCHA 1Z7PA 4JE1A 4PQHA 3FR6A 5ENUA 1THXA 1HQOA 2OJLA 3HZ4A 3TRXA 1XWGA 3TKSA 2VCQA 3IXRA 3TJBA 3US3A 4IP1A 4DVCA 3IC4A 3F0IA 3WT2A 4L0UA 2FUG2 1YJ6A 3HJMA 1JZOA 4FO5A 1K0AA 1EOGA 1TI3A 3H1NA 4HI7A 4TOPA 4NHZA 4D73A 2G2QA 2V1MA 3C7MA 2LQOA 3KD0A 4YQUA 4IELA 4BL7B 2QKEA 2OADA 3CTFA 3C1RA 4ZB8A 4DSRA 2GTUA 1RK4A 3TKQA 1K0MA 4JR6A 1EP8A 3W6GA 1GTUA 2C0EA 2FA8A 1GSSA 1OE8A 1X0RA 1ZYQB 1I5GA 4WEYA 4FQUA 1G6WA 3K8NA 5IMZA 4Q5NA 1N8JA 11GSA 2VAFA 3KZQA 1SL0B 4XHMA 3CXGA 2FHEA 4KSMA 4KB3A 3G7IA 4LL1B 5CAXA 1YEXA 2HFDA 4OO5A 5DAKB 2PGTA 3ZFLA 2PVQA 4WXTA 1M2AA 6GSVA 4POKA 2BJXA 1YY7A 4WF5A 2BTOT 4E8HA 1A8YA 2O8VB 2L5OA 4POBA 5A4VA 2YV9A 4EL1A 4PNGA 3CSHA 2IMKA 1XXUA 3PR8A 1XZOA 4CW9A 4OFTA 5LD0A 3DYRA 2J9HA 1LJRA 3ZIVA 3GL5A 4HS1A 1RW1A 2VLTA 4O32A 5F0GA 4XRDA 3FZ4A 1K0BA 4KAEA 2JZTA 1TW9A 3I69A 3TJKA 2H1BA 2FLSA 4HU9A 3APQA 2YNXA 2ES7A 3IC8A 3D0ZA 1K0NA 3VI5A 5IMDA 4O92A 4L5LA 2DJKA 5LCZA 5D8IA 1PX6A 4OO4A 1UN2A 3GRXA 4KGIA 5A4WA 3O6TA 5AIXA 5ELGA 1V2AA 3IOSA 1F3BA 4GF0A 1GLPA 1GL8A 4LMWA 1Y25A 4TR4A 2D2ZA 3QDNA 2DMLA 2GZYA 2AV4A 5B8BA 4KE3A 2LJRA 1UVZA 4MJBA 3LYKA 1M9AA 3KP8A 3TJJA 1HNBA 2WS2A 1B9YC 4BVYA 2HRFA 1FVJA 2YJHA 2NPBA 4ZBAA 1Q4JA 3HYPA 1I9DA 1M7TA 1EOHA 3CSIA 5DALA 2GQKA 3MDKA 1HD2A 1TRSA 1J0FA 2H6XA 4OFNA 1A0RP 3H8QA 3ZVJD 1Z5YE 1ACVA 1XWAA 3HY2A 3P2AA 5JWRB 2CX3A 4V2NA 4YQMA 3SWLA 2HSHA 5IOWA 4K7NA 3IAM2 1ERTA 1YEPA 2O89A 5ID2B 2AAWA 1AQXA 5HR2A 2WCIA 5D9WA 4ECBA 3L9UA 2OE1A 3C71A 3ERWA 2H6YA 4RQRA 3HD5A 1EEJA 5H5QA 4IHUA 2LSTA 1GSUA 1Y6EA 3EE2A 1ML6A 1AIUA 3QAWA 3DMLA 2MMAA 1TKDB 3IAS2 1WOUA 1ZOFA 5H5SA 4O7HA 4OMVA 5FHIA 5F06A 1NSWA 4ACSA 2RIIA 1R7HA 2WB9A 1MTCA 3KMNA 5IM9A 3TKSE 4RUVA 1OVNA 3ZMLA 4H86A 16GSA 3EWLA 3EU3A 5GZZB 4EUYA 3ERFA 3P8WA 1X5EA 4EVMA 4MF6A 3HDCA 3BBYA 3QPMA 3R3EA 4ZIJA 4QQ7A 3GKKA 3VFIA 4USSA 1PD21 1YQ1A 5GAPD 2NDOA 2CAIA 3N9JA 3UVHA 4IN0A 1SJIA 4EXJA 2F51A 2DJ2A 2VL2A 4HQSA 6GSWA 1PQNA 1BX9A 1V9WA 2VO4A 2VLVA 1PL1A 4IJ3A 5ABRA 4NXIA 3UVTA 1F2EA 4WR5A 5ECLB 2C3TA 1B4PA 5GSSA 3HZ8A 2YJ7A 2X8CA 1T1VA 2A2SA 4PUAA 3ZLPA 5G31A 1VRSD 3BJ5A 2KOKA 2EIRA 5G5FA 3F6FA 1BAYA 1M2DA 1V98A 2JZRA 2IIYA 3EMPA 3F4RA 1HNAA 3ME7A 2CVBA 4N0ZA 1EZKA 2DJJA 3WGDA 1G0TA 4TVEA 4G19A 2L6CA 2XBQA 5HFIA 3PPUA 4NV5A 1KEBA 1X9SB 4BVYB 3HJPA 3GV1A 4GQFA 1TU7A 1GTBA 1YZXA 3GX8A 4NWYA 3Q18A 9GSSA 3CMIA 3WYWA 4G0IA 5IMCA 3QFBC 3UAPA 2PUKC 3FZ9A 4OCFA 1VF3A 1S3AA 4DSQA 4HUAA 20GSA 1SU9A 3QOUA 2MYGA 2IJYA 1TRUA 1U3AA 4ILFA 2NTOA 2VCWA 1SD8A 1JFUA 4JZQA 1XOAA 3L4NA 4KF9A 2I4AA 2PN8A 1Z6MA 3EYTA 2KP1A 1GLQA 4LA1A 1GSDA 5B6MA 2JACA 1HYUA 2GGTA 1OC9B 4NV2A 4FIWA 4MF7A 3L0HA 4L0WA 2H73A 3CYNA 4G10A 1DBYA 1ON4A 1RQMA 4G0LA 2IL3A 2B7KA 4XS6A 1AW9A 2I9HA 2AB6A 2A2RA 1T8EB 2PERA 2B7JA 4MH3A 2C0FA 3UOMA 1G7OA 4IBPA 4FYBA 3IBHA 4IVFA 1QMVA 5DQYA 3GKXA 1U6TA 3P7XA 4IGJA 2DMMA 4JBBA 4F03A 5IMFA 1OC3A 2MBSA 4DSSB 2L4QA 3DKSA 3FY7A 5IO0A 1XFLA 2YWOA 2ON5A 4G2EA 4HZ2A 4PGTA 1O8WA 1TTZA 3F3QA 2H30A 4K0GA 4XCSA 1YKCA 3GHAA 3DWVA 4MPGA 5H5RA 2AYTA 3FR9A 2CAQA 5C04A 3NIVA 1ZCPA 5DBQA 2FA4A 2K9FA 1Z3EA 2H01A 3QCPA 4TW5A 1GH2A 5D73A 1EV4A 1GSFA 1ZYEA 1WWJA 4ZL7A 5HR3A 1J9BA 4Z7XA 3UBKA 2H74A 3IRAA 2F3MA 5ECOB 2C4JA 3KTBA 1VF4A 14GSA 3E0UA 4BWQA 2IFQA 3ZVJA 3CTGA 10GSA 4J57E 2YOIA 1XCCA 5ECQB 1H4OA 1A2LA 2QC7A 3UARA 3DVWA 5G5EA 3P90A 2GSTA 1A2MA 3F4SA 3W8SA 6GSXA 1XVQA 2REMA 3H93A 2X64A 5JWOB 3M9KA 4GWRA 3I9V2 2HRKA 1V57A 4AJ7A 1X5CA 4MJAA 3DD3A 4IP6A 4V2MA 2FWHA 2FWGA 2VIMA 4ML6A 5CRDA 2XPDA 4N11A 8GSSA 2R6KA 4LMVA 2UZ8A 3DIEA 1TRWA 4NAXA 4PNFA 3LG6A 3MNGA 4X0XA 1THOA 5F05A 1PKWA 5IIZA 3UJ1A 1SJ6A 1SD9A 3HJOA 4MLYA 4IQAA 2O87A 1XWKA 1XOBA 2PMTA 3DXBA 1O73A 1K0DA 3GKMA 4FH8A 5J9BA 3A5WA 2IMIA 4BWSA 3LSZA 4TKYA 2CQ9A 1F9MA 2MMOA 3GSSA 5B7CA 2JU5A 2GSQA 3GKNA 4J56E 2NBSA 1E2YA 1PRXA 2B6MA 2LEGA 2AUVA 1FAAA 1KBNA 1B8XA 2QSIA 1MDKA 2B3SA 4K6XA 5G30A 3RDWA 2CZ2A 7GSSA 3G7YA 5LNKe 3VPQA 4BVXA 2FWEA 1V58A 2HLSA 5JWQB 1GUKA 2V6OA 2H19A 13GSA 2F8FA 3TOTA 3F9UA 3WT1A 1K3OA 2CV4A 1ABAA 2WULA 2JSZA 4RI7A 5KN1A 1U88A 4TXVA 3PGTA 2RM5A 1URMA 4K8MA 3D21A 5DJMA 4XS4B 2IMFA 1PX7A 3KH9A 1AAZA 2OBIA 1ST9A 5F8BA 2XPEA 4XS1A 2FY6A 2O7KA 1ZZYA 4GRFA 3DGQA 2XC2A 5E4WA 1ZMAA 1MD3A 1DE2A 4KDYA 2EIQA 2YPMA 17GSA 4JU5A 4EF0A 2CVKA 3Q6OA 1PN9A 3IA1A 1EGRA 4PURA 2WFCA 1DE1A 3VWUA 3J7Yk 3F3RA 4D73B 6GSYA 2LJAA 4G0KA 5IOXA 4ECIA 2LQQA 2L59A 4NPBA 3BCKA 1QQ2A 2LNTA 5IMVA 1USBA 1T3BA 3C8EA 2H1AA 2LTKA 4HQZA 5ECNB 5FWGA 3VURA 4ZL9A 1XW6A 4ZBDA 2HNLA 4WBJA 3LFLA 2PU9C 2IN3A 1JHBA 1GP1A 4L5OA 2JZSA 1VF2A 2H6ZA 6GSUA 1FHEA 2EC4A 3HHVA 1TK8B 5CRWA 3VK9A 2GLRA 4KNDA 1N2AA 4K2DA 5ECPB 3ZYWA 3IE3A 1DSBA 4PTSA 3L9VA 3RHBA 4LL4B 1WPIA 1S3DA 3HVVA 3G7JA 4RQXA 1MD4A 2R2JA 3KGKA 2HE3A 1SENA 2IMEA 3ZL5A 4I5QA 4AJ6A 2MMZA 1TRVA 2M72A 3MWHA 1BYEA 2LRTA 2X99A 3KTLA 2C80A 3LQ7A 2ON7A 1NHYA 2TIRA 3CSJA 4CDOA 2K18A 5B8AA 3FKFA 3HVXA 2R5GA 1NW2A 1W89A 5A5KA 5JCUA 2TRXA 4KX4A 3LXZA 1GTIA 4IQ1A 2HZEA 2HRAA 5C00A 2GDRA 4PX1A 4IW9A 4N0VA 1A24A 3MAKA 3GMFA 3TKSC 5FT3A 2J23A 1T4YA 1LU4A 2HXKA 4G9HA 1FW1A 1A2JA 5G1KA 1SL2B 2R37A 2GSSA 1ILOA 3TRPA 1R5AA 2H72A 1OYJA 2YWNA 4WETA 3TUEA 2LV3A 3W8JA 1UC7A 2RM6A 3A2WA 2R3XA 4I2TA 2GZZA 5HFGA 2VM2A 3DRNA 3UEMA 3VWXA 2LKUA 1MDIA 3GNJA 5CRHA 2GT5A 3D6IA 3LXTA 1OE7A 2OA7A 1GNEA 1XW9A 5J5NA 2WJUA 1K0CA 4YH2A 4ZB9A 2OBKA 4TR1A 3BCIA 4GCIA 2LRCA 3EINA 1EP7A 4I2UA 3EVIA 3DVXA 2QGVA 5ECMB 1WMJA 5CREA 2C3QA 5E59A 1XVWA 1PMTA 3ZIJA 3ZMKA 4PQ1A 5DALB 2A4VA 5CP1A 3LORA 4KA0A 5F07A 2VCZA 2KLXA 2ZCTA 3LJRA 2P31A 3EURA 3HVSA 2K8VA 4YQVA 3GTUA 1SL1B 1GULA 1R4WA 5AN1A 5GAND 2C1YA 3PINA 3TCOA 2DBCA 3IV4A 4LLRA 2KUCA 2DJ3A 5CNWA 1KTEA 3NOFA 3GUSA 1WIKA 5G1LA 2WZ9A 2P5RA 1FOVA 5EPFA 4NMUA 1XPVA 4IKHA 2H76A 22GSA 2YZHA 3F8UA 3UBLA 5ECHB 1FVKA 1U3IA 3CBUA 3D5JA 2K8SA 1TDIA 4ECJA 4BL7A 3RBTA 1XBSA 1PKZA 5ECRB 3IK7A 3O3TA 3KIJA 3H79A 3FEUA 3ERGA 1YKAA 3KJYA 1BEDA 2TRCP 3M1GA 2I81A 2LUSA 3APOA 3EC3A 1FB6A 4MJCA 2WDUA 3UL3A 2M80A 2YWMA 4ZBBA 5KEJA 3GL3A 5D93A 5KN3A 4Q5RA 1FG4A 3M8NA 5IQYA 5DAKA 1M2BA 1F3AA 1AQVA 2KHPA 18GSA 2YZUA 1YF1A 4F2IA 4WKWA 2FWFA 3HXSA 4QL7A 1O8XA 4PUFC 2B5YA 4P3YB 4EC0A 2M46A 2VUPA 3GYKA 4K7OA 1JZRA 1TOFA 1TXXA 2DJ0A 3D22A 4ISDA 2JL4A 1HNCA 1F6MC 2C0GA 3HCZA 3A2VA 3KH7A 3QMXA 2NVLA 4V1Ag 3GA4A 4KDXA 2HI7A 4WBRD 4JRRA 5AGYA 4ULXA 2DC5A 1MEKA 3ZFBA 2H0GA 2B5XA 2H1GA 1SKWB 1GSEA 4PXOA 2G0FA 4EE0A 3TJGA 1MDJA 1XWCA 3HKRA 4HJ2A 3EMXA 3M3MA 3GTUB 3VWVA 2VLUA 3UMAA 2JSYA 3NZNA 1TP9A 1V40A 4HDEA 3H4KA 1O6JA 1G7EA 5B6NA 5CYYA 2H66A 4IS0A 3GH9A 3DEXA 3SBCA 4TRXA 4HOJA 2B5EA 4CHSA 1GSYA 1GWCA 5KN2A 1A0FA 1JLVA 5DQSA 4N30A 1O81A 2O85A 4K9ZA 2YP6A 2WRTA 1VF1A 2F9SA 3GIXA 1WP0A 3QD9A 5KN0A 1M99A 4JEDA 1B9XC 2R4VA 1CQGA 3VLNA 2LNSA 2VL3A 2HYXA 4J2FA 1JZDA 4EKZA 2B1KA 4I6XA 3FRCA 4MK3A 5JCWA 2CA8A 4JR4A
chains in the Genus database with same CATH superfamily
2MZCA 1TK0B 1SYXA 3FHKA 1WJKA 1JZWA 4K1FA 5IO2A 1TJDA 2VL2C 1U87A 2XHFA 2EFHA 4MF5A 2P5QA 4KCEA 2PBJA 1B48A 4V2LA 4OWYA 2LRNA 2YANA 3GSTA 2RUFA 4V1Ap 5ID2A 1A8LA 4ML1A 1DUGA 1Z6NA 2E2GA 3FW2A 2N5AA 1SK2A 5A34B 3LYPA 1YDKA 2WVXB 1S3CA 3KCMA 1ERWA 2EFCA 2DIZA 3IPZA 3KMOA 3TKRA 2LJKA 5GSTA 4BA7A 1YF0A 2VCTA 4MJEA 4XRAA 3KEBA 3ZTLA 1AQWA 2GS3A 1M9BA 5HQPA 3L9SA 1GNWA 1QGVA 2JADA 4W66A 3GH6A 3RPPA 2FGXA 2YCDA 19GSA 2C0DA 3F4TA 5ECIB 2H71A 1AUCA 2V2GA 4O5RA 2FCHA 4YAPA 2H1DA 1F37A 4TR0A 1QFNA 5A1NB 4GSNA 5KOWA 6GSSA 2FD3A 2IFQB 4X1UA 2X8HA 1SKRB 3A2XA 1ERUA 2HQTA 2PWJA 3GN3A 1QUWA 4FYCA 3TGZA 1SK0A 5DVBA 1EEMA 4PHZC 3R2QA 1WRYA 2K6VA 2VM1A 1PL2A 5J4UA 2EIOA 2HZFA 4K2XA 2DJ1A 1ERVA 2E7PA 4XIHA 3S9FA 1S4BP 2HRNA 5A5HA 3FR3A 1K3LA 2HRKB 4MDCA 5IPHA 4TR3A 1W4VA 1EGOA 1XIYA 4MCUA 2VOCA 4KH7A 4XTSA 4OD7A 3APSA 3ZREA 5G2ZA 5DJLA 3ZRDA 1X5DA 1R5PA 4OCEA 2IMDA 1M0UA 2ALBA 4KSOA 3G9BA 3WD6A 4KUNA 3TOUA 1GTAA 2HSMA 1TU8A 2DSAA 3HA9A 1QK8A 4EIPA 2H0HA 3PH9A 4POMA 4GSSA 3AY8A 2RUEA 4NHWA 2I3YA 4AGSA 3U6VA 4POLA 2DIYA 2ZUPA 3TJFA 5D9VA 1YEWC 1GSQA 2O3EA 4F9ZA 2FNOA 2GSRA 3GX0A 1TI1A 1O85A 4I97A 2VD1A 4ZXGA 4F82A 1O7UA 3FYGA 3ME8A 3BOAA 4I8BA 2L57A 4WR4A 2MMNA 1R26A 5DCGA 5D9XA 4GTUA 1H75A 3C1SA 1IYIA 1SKSB 5J40A 2OT3A 2E2MA 2HSNA 1BJXA 1SVOA 3CQFA 4BVXB 2E0QA 2H8LA 3QR6A 2IWTA 3TB2A 3RPNA 4Q5FA 4HZ4A 3BD2A 3FZAA 3ZZXA 2GZPA 2CZ3A 3QAGA 2VCVA 2V41A 1OC9A 3I43A 1GRXA 4E8EA 1OAZA 5HR0A 3KXOA 3A3TA 5ELAA 3CRTA 5ECKB 2L4CA 2H0IA 1XWBA 4MZCA 5AISA 2WGRA 3J7Yb 3IHQA 3ZITA 3UIWA 1AXDA 2N5FA 1BG1A 1T4ZA 1ZYNA 3JCML 3RHCA 4RI6A 1FO5A 4Z2RA 1K0OA 1VGLA 4N10A 1EV9A 3F6DA 3QAVA 2L6DA 3C73A 5IMAA 4MH2A 1WE0A 3Q74A 4ZL8A 5IPGA 1Q98A 2X49A 3E9JB 4OFMA 5COHA 2X8GA 2XBIA 1JLWA 3D4TA 2N5BA 4DSSA 1UA5A 3IR4A 1SYRA 3GURA 12GSA 2KP2A 4MA9A 5A5HB 1Z7RA 4ID0A 1NHOA 3M9JA 4KDUA 4AJ8A 1K3YA 5HR1A 2MBTA 1GUMA 1J08A 4TXOA 2ZNMA 4QL9A 1ZGNA 2Z9SA 1OKDA 3LGCA 2V6KA 1PSQA 1BF5A 3A5IA 5INYA 5D9TA 4ECCA 5D96A 1AC1A 2HSMB 4YAVA 3TKPA 5J9CA 2VD0A 4GDFA 2OACA 6GSTA 5AIVA 3FZ5A 1LBKA 5J41A 3F63A 2V32A 3O76A 4MZBA 3EU4A 3OR5A 3IDVA 2C3NA 5EY6A 4FYUA 4PI0C 1GUHA 2L5LA 4GQCA 4MMMA 3WGXA 1OKTA 2DLXA 4L8EA 4MABA 3ISOA 1X9WB 1T7PB 4DEJA 2UV8G 2F8AA 4K5SA 4E68A 1BQ7A 4HJMA 3L78A 3E3EA 4GLTA 4Q5QA 5HFKA 2P0GA 4IJIA 4WF4A 4BPYA 2CT6A 2I1UA 4HU7A 3N5OA 2BMXA 5CO3A 2HT9A 2AHEA 3CRUA 2HSNB 2RLIA 5L71A 2H70A 2OKAA 2GT6A 2PVOC 3ED3A 4F0BA 4KCAA 4MP4A 1KNGA 2PPTA 1N25A 1BG5A 2LS5A 5CRGA 1XW5A 3LEFA 3M0FA 3FMWA 1B4QA 2YV7A 1E6BA 3VI7A 4MPFA 4GXZA 5J3RA 2HZEB 3QFAC 4EO3A 3WGEA 3KM6A 3FK8A 4A5PA 4EDYA 3TDGA 1X9MB 3MSZA 2OE0A 3VPTA 4MNNA 1T00A 1IYHA 4K7IA 3U5RE 2YN1A 5J4YA 3LWAA 3RAZA 1ZL9A 2GVPA 4GSTA 1PA3A 2GQMA 1EWXA 5A4UA 2B1LA 4Z2TA 4EDZA 2YWIA 2OE3A 4AF2A 1SJZA 1C72A 3TRQA 4PQIA 4F0CA 3Q19A 5DDLA 1PGTA 4KW6A 1CQHA 1A23A 1SK1A 3V1WA 4K0NA 3GFKA 2VL9A 4TR1B 2IPAA 5ECSA 2C8UA 1G6YA 4X43A 4TXOB 3IK9A 1QXHA 2VCXA 1FB0A 5JCGA 2CVDA 3KP9A 2CX4A 3I6AA 4TN8A 2HSYA 1XG8A 4ZB6A 3LW9A 2AJQB 5EL8A 5BMUA 4HEA2 4MZWA 2H75A 1OC8A 4XS4A 3D4MA 3VWWA 1TK5B 1Z9HA 1NM3A 4ZILA 5EVOA 2O5VA 2GQLA 2R0CA 5DCHA 1Z7PA 4JE1A 4PQHA 3FR6A 5ENUA 1THXA 1HQOA 2OJLA 3HZ4A 3TRXA 1XWGA 3TKSA 2VCQA 3IXRA 3TJBA 4EIQA 3US3A 4IP1A 4DVCA 3IC4A 3F0IA 3WT2A 4L0UA 2FUG2 1YJ6A 3HJMA 1JZOA 4FO5A 1K0AA 1EOGA 1TI3A 3H1NA 4HI7A 4TOPA 4NHZA 4D73A 2G2QA 2QA1A 2V1MA 3C7MA 2LQOA 3KD0A 4YQUA 4IELA 2DKIA 4BL7B 2QKEA 2OADA 3CTFA 3C1RA 4ZB8A 4DSRA 2GTUA 1RK4A 3TKQA 1K0MA 4JR6A 1EP8A 3W6GA 1GTUA 2C0EA 2FA8A 1GSSA 1OE8A 1X0RA 1ZYQB 1I5GA 4WEYA 4FQUA 1G6WA 3K8NA 5IMZA 4Q5NA 1N8JA 2WZSA 11GSA 2VAFA 3KZQA 1SL0B 4XHMA 3CXGA 2FHEA 4KSMA 4KB3A 5J47A 3G7IA 4LL1B 5CAXA 1YEXA 2HFDA 4OO5A 2VKZG 5DAKB 2PGTA 3ZFLA 2PVQA 4WXTA 1M2AA 6GSVA 4POKA 2BJXA 1YY7A 4WF5A 2BTOT 4E8HA 1A8YA 2O8VB 2L5OA 4POBA 5A4VA 2YV9A 4EL1A 4PNGA 3CSHA 2IMKA 1XXUA 3PR8A 1XZOA 4CW9A 4OFTA 5LD0A 3DYRA 2J9HA 1LJRA 3ZIVA 3GL5A 4HS1A 1RW1A 2VLTA 4O32A 5F0GA 4XRDA 3FZ4A 1K0BA 4KAEA 2JZTA 1TW9A 3I69A 3TJKA 2H1BA 2FLSA 4HU9A 3APQA 2YNXA 2ES7A 3CHXC 3IC8A 3D0ZA 1K0NA 4O5QA 3VI5A 5IMDA 4O92A 4L5LA 2DJKA 5LCZA 5D8IA 1PX6A 4OO4A 1UN2A 3GRXA 4KGIA 5A4WA 3O6TA 2WVYA 5AIXA 5ELGA 1V2AA 4ZB7A 3IOSA 1F3BA 4GF0A 1GLPA 1GL8A 4LMWA 1Y25A 4TR4A 2D2ZA 3QDNA 2DMLA 2GZYA 2AV4A 5B8BA 4KE3A 2LJRA 1UVZA 4MJBA 3LYKA 1M9AA 3KP8A 4BIKA 3TJJA 4CY8A 1HNBA 2WS2A 1B9YC 4BVYA 2HRFA 1FVJA 2YJHA 4AKXB 2NPBA 4ZBAA 1Q4JA 3HYPA 1I9DA 1M7TA 1EOHA 3CSIA 5DALA 2GQKA 3MDKA 1HD2A 1TRSA 1J0FA 2H6XA 4OFNA 1A0RP 3H8QA 3ZVJD 4FXYP 1Z5YE 1ACVA 1XWAA 3HY2A 3P2AA 5JWRB 2CX3A 4V2NA 4YQMA 3SWLA 2HSHA 5IOWA 4K7NA 3IAM2 1ERTA 1YEPA 2O89A 5ID2B 4ICYA 2AAWA 1AQXA 5HR2A 2WCIA 5D9WA 4ECBA 3L9UA 2OE1A 3RGBC 3C71A 3ERWA 2H6YA 4RQRA 3HD5A 1EEJA 5H5QA 4IHUA 2LSTA 1GSUA 1Y6EA 3EE2A 2DKHA 1ML6A 1AIUA 3QAWA 3DMLA 2MMAA 1TKDB 3IAS2 1WOUA 1ZOFA 5H5SA 4O7HA 4OMVA 5FHIA 5F06A 1NSWA 4ACSA 2RIIA 1R7HA 2WB9A 1MTCA 3KMNA 5IM9A 3TKSE 4RUVA 1OVNA 3ZMLA 3HMJG 4H86A 16GSA 3EWLA 3EU3A 5GZZB 4EUYA 3ERFA 1PN0A 3P8WA 1X5EA 4EVMA 4MF6A 3HDCA 3BBYA 3QPMA 3R3EA 4ZIJA 4QQ7A 3GKKA 2H1LA 3VFIA 4USSA 1PD21 1YQ1A 5GAPD 2NDOA 2CAIA 3N9JA 3UVHA 4IN0A 1SJIA 4EXJA 2F51A 2DJ2A 2VL2A 4HQSA 6GSWA 1PQNA 1BX9A 1V9WA 2VO4A 2VLVA 1PL1A 4IJ3A 5ABRA 4NXIA 3UVTA 1F2EA 4WR5A 5ECLB 2C3TA 1B4PA 5GSSA 3HZ8A 2YJ7A 2X8CA 2WW1A 1T1VA 2A2SA 4PUAA 3ZLPA 5G31A 1VRSD 3BJ5A 2KOKA 2EIRA 5G5FA 3F6FA 1BAYA 1M2DA 1V98A 2JZRA 2IIYA 3EMPA 3F4RA 1HNAA 3ME7A 2CVBA 4N0ZA 1EZKA 2DJJA 3WGDA 1G0TA 4TVEA 4G19A 2L6CA 2XBQA 5HFIA 3PPUA 2EFEA 4NV5A 1KEBA 1X9SB 4BVYB 3HJPA 3GV1A 4GQFA 1TU7A 1GTBA 1YZXA 3GX8A 4NWYA 3Q18A 9GSSA 3CMIA 3WYWA 4G0IA 5IMCA 3QFBC 3UAPA 3TU3B 2PUKC 3FZ9A 4OCFA 1VF3A 1S3AA 4DSQA 4HUAA 20GSA 1SU9A 3QOUA 2MYGA 2IJYA 1TRUA 3MIXA 1U3AA 4ILFA 1YVLA 2NTOA 2VCWA 5J4VA 1SD8A 1SVLA 1JFUA 4JZQA 1XOAA 3L4NA 4KF9A 3EPTA 2I4AA 2PN8A 1Z6MA 3EYTA 2KP1A 1GLQA 4LA1A 1GSDA 5B6MA 2JACA 1HYUA 2GGTA 1OC9B 4NV2A 4FIWA 4MF7A 3L0HA 4L0WA 2H73A 3CYNA 2WW0A 4G10A 1DBYA 1ON4A 1RQMA 4G0LA 2IL3A 2B7KA 4XS6A 1AW9A 2I9HA 2AB6A 2A2RA 1T8EB 3HVNA 2PERA 2B7JA 4MH3A 2C0FA 4PI2C 2O36A 3UOMA 1G7OA 4IBPA 4FYBA 3IBHA 4IVFA 1QMVA 5DQYA 3GKXA 1U6TA 3P7XA 4IGJA 2DMMA 4K5RA 4JBBA 4F03A 5IMFA 1OC3A 2MBSA 4DSSB 2L4QA 3DKSA 3FY7A 5IO0A 1XFLA 4AKHA 2YWOA 2ON5A 4G2EA 4HZ2A 4PGTA 5A34A 1O8WA 1TTZA 2WVXA 3F3QA 2H30A 4K0GA 4XCSA 1YKCA 3GHAA 3DWVA 4MPGA 5H5RA 2AYTA 3FR9A 2CAQA 5C04A 3NIVA 1ZCPA 5DBQA 2FA4A 2K9FA 1Z3EA 2H01A 3QCPA 4TW5A 1GH2A 5D73A 1EV4A 1GSFA 1ZYEA 1WWJA 4ZL7A 5HR3A 1J9BA 4Z7XA 3UBKA 2H74A 3IRAA 2F3MA 5ECOB 2C4JA 3KTBA 1VF4A 5A1NA 14GSA 3E0UA 4BWQA 2IFQA 1ZYPA 3ZVJA 3CTGA 10GSA 4J57E 2YOIA 1PFOA 1XCCA 5ECQB 1H4OA 1A2LA 2QC7A 3UARA 3DVWA 5G5EA 3P90A 2A4HA 3F4SA 2GSTA 1A2MA 2A2PA 3W8SA 6GSXA 1XVQA 2REMA 3H93A 2X64A 5JWOB 3M9KA 4GWRA 3I9V2 1S3RA 2HRKA 1V57A 4AJ7A 1X5CA 2QA2A 4MJAA 3DD3A 4IP6A 4V2MA 2FWHA 2FWGA 2VIMA 4ML6A 5CRDA 2XPDA 4N11A 8GSSA 2R6KA 4LMVA 2UZ8A 3DIEA 4Z2UA 1TRWA 4NAXA 3CWGA 4PNFA 3LG6A 3MNGA 4X0XA 1THOA 5F05A 1PKWA 5IIZA 3UJ1A 1SJ6A 1SD9A 3HJOA 4MLYA 4IQAA 5KOXA 4AI6A 2O87A 1XWKA 1XOBA 2PMTA 3DXBA 1O73A 1K0DA 3GKMA 4FH8A 5J9BA 3A5WA 2IMIA 4BWSA 3LSZA 4TKYA 2CQ9A 1F9MA 2MMOA 3GSSA 5B7CA 2JU5A 2GSQA 3GKNA 4J56E 2NBSA 1E2YA 1PRXA 2B6MA 2LEGA 2AUVA 1FAAA 1KBNA 1FOHA 1B8XA 2QSIA 4YKGA 1MDKA 2B3SA 4K6XA 5G30A 3RDWA 2CZ2A 4YKFA 7GSSA 3G7YA 5LNKe 3VPQA 4BVXA 2FWEA 4O5UA 1V58A 2HLSA 5JWQB 1GUKA 2V6OA 2H19A 13GSA 2F8FA 3TOTA 3F9UA 3WT1A 1K3OA 2CV4A 1ABAA 2WULA 2JSZA 4RI7A 5KN1A 1U88A 4TXVA 3PGTA 2RM5A 5BMUB 1URMA 4K8MA 3D21A 5DJMA 4XS4B 2IMFA 1PX7A 3KH9A 1AAZA 2OBIA 1ST9A 5F8BA 2XPEA 4XS1A 2FY6A 2O7KA 1ZZYA 4GRFA 3DGQA 2XC2A 5E4WA 1ZMAA 1MD3A 1DE2A 4KDYA 2EIQA 2YPMA 17GSA 4JU5A 4EF0A 2CVKA 3Q6OA 1PN9A 3IA1A 4AKGA 1EGRA 4PURA 2WFCA 1DE1A 3VWUA 3J7Yk 3F3RA 4D73B 6GSYA 2LJAA 4G0KA 4AKIA 5IOXA 4ECIA 2LQQA 2L59A 4NPBA 3BCKA 1QQ2A 2LNTA 5IMVA 1USBA 1T3BA 3C8EA 2H1AA 2LTKA 4HQZA 5ECNB 5FWGA 3VURA 4ZL9A 1XW6A 4ZBDA 2HNLA 4WBJA 3LFLA 1SVMA 2PU9C 2IN3A 1JHBA 1GP1A 2WW2A 1I1IP 4L5OA 2JZSA 1VF2A 2H6ZA 6GSUA 1FHEA 2R0GA 2EC4A 3HHVA 1TK8B 5CRWA 3VK9A 2GLRA 4KNDA 1N2AA 4K2DA 5ECPB 3ZYWA 3IE3A 1DSBA 4PTSA 2X4AA 3L9VA 3RHBA 4LL4B 1WPIA 1S3DA 3HVVA 3G7JA 4RQXA 1MD4A 1TXUA 2R2JA 3KGKA 2HE3A 1SENA 2R0PA 2IMEA 3ZL5A 4I5QA 4AJ6A 2MMZA 1TRVA 2M72A 3MWHA 1BYEA 2LRTA 2X99A 3KTLA 2C80A 3LQ7A 2ON7A 1NHYA 2TIRA 3CSJA 4CDOA 2K18A 1M3JA 5B8AA 3FKFA 3HVXA 2R5GA 1NW2A 1W89A 5A5KA 5JCUA 2TRXA 4KX4A 3LXZA 1GTIA 4IQ1A 2HZEA 2HRAA 5C00A 2GDRA 4PX1A 4IW9A 4N0VA 1A24A 3MAKA 3GMFA 3TKSC 5FT3A 2J23A 1T4YA 1LU4A 2HXKA 4G9HA 1FW1A 1A2JA 5G1KA 1SL2B 2R37A 2GSSA 1ILOA 3TRPA 1R5AA 2H72A 1OYJA 2YWNA 4WETA 3TUEA 2LV3A 4HSCX 2WW3A 3W8JA 1UC7A 2RM6A 3A2WA 2R3XA 4X4JA 4I2TA 2GZZA 5HFGA 2VM2A 4CY6A 3DRNA 3UEMA 3VWXA 2LKUA 1MDIA 3GNJA 5CRHA 2GT5A 3D6IA 3LXTA 1OE7A 2OA7A 1GNEA 1XW9A 5J5NA 2WJUA 1K0CA 4YH2A 4ZB9A 2OBKA 3MYDA 4TR1A 3BCIA 4GCIA 2LRCA 3EINA 1EP7A 4I2UA 3EVIA 3DVXA 2QGVA 5ECMB 1WMJA 5CREA 2C3QA 5E59A 1XVWA 1PMTA 3ZIJA 3ZMKA 4PQ1A 5DALB 2A4VA 5CP1A 3LORA 4KA0A 5F07A 2VCZA 2KLXA 2ZCTA 3LJRA 2P31A 3EURA 3HVSA 2K8VA 4YQVA 3GTUA 1SL1B 1GULA 1R4WA 3IHGA 5AN1A 5GAND 2C1YA 3PINA 2EFDA 3TCOA 2DBCA 3IV4A 4LLRA 2KUCA 2DJ3A 5CNWA 1KTEA 3NOFA 3GUSA 1WIKA 5G1LA 2WZ9A 2P5RA 1FOVA 5EPFA 4NMUA 4G01A 1XPVA 4IKHA 2H76A 22GSA 2YZHA 3F8UA 3UBLA 5ECHB 1FVKA 1U3IA 3CBUA 3D5JA 2K8SA 1TDIA 4ECJA 4BL7A 3RBTA 1XBSA 1PKZA 5ECRB 3IK7A 3O3TA 3KIJA 3H79A 3FEUA 3ERGA 1YKAA 3KJYA 1BEDA 2TRCP 3M1GA 2I81A 2LUSA 3APOA 3EC3A 1FB6A 4MJCA 2WDUA 3UL3A 2M80A 2YWMA 4ZBBA 5KEJA 3GL3A 5D93A 5KN3A 4Q5RA 1FG4A 3M8NA 5IQYA 5DAKA 1M2BA 1F3AA 1AQVA 2KHPA 1M3IA 18GSA 2YZUA 1YF1A 4F2IA 4WKWA 2FWFA 3HXSA 4QL7A 1O8XA 4PUFC 2B5YA 4P3YB 4EC0A 2M46A 2VUPA 3GYKA 4K7OA 1JZRA 1TOFA 1TXXA 2DJ0A 3D22A 4ISDA 2JL4A 1HNCA 1F6MC 2C0GA 3HCZA 3A2VA 3KH7A 3QMXA 2NVLA 4V1Ag 2WVZA 4KDXA 3GA4A 2HI7A 4WBRD 4JRRA 5AGYA 4ULXA 2DC5A 1MEKA 3ZFBA 1Y1UA 2H0GA 4QMKA 2B5XA 2H1GA 1SKWB 1GSEA 4PXOA 2G0FA 4EE0A 3TJGA 1MDJA 1XWCA 3HKRA 4HJ2A 3EMXA 3M3MA 3GTUB 3VWVA 2VLUA 3UMAA 2JSYA 3NZNA 1TP9A 1V40A 4HDEA 3H4KA 1O6JA 1G7EA 5B6NA 5CYYA 2H66A 4IS0A 3GH9A 3DEXA 3SBCA 4TRXA 4HOJA 2B5EA 4CHSA 1GSYA 1GWCA 5KN2A 5BRTA 1A0FA 1JLVA 5DQSA 4N30A 1O81A 2O85A 4K9ZA 2YP6A 2WRTA 1VF1A 2F9SA 3GIXA 1WP0A 3QD9A 5KN0A 1M99A 4JEDA 4N3ZA 3RFRC 1B9XC 2R4VA 1CQGA 3VLNA 2LNSA 2VL3A 2HYXA 4J2FA 1JZDA 4EKZA 2B1KA 4I6XA 3FRCA 4MK3A 5JCWA 2CA8A 4JR4A
chains in the Genus database with same CATH topology
2MZCA 1TK0B 1SYXA 3FHKA 1WJKA 1JZWA 4K1FA 5IO2A 1TJDA 2VL2C 1U87A 2XHFA 2EFHA 4MF5A 2P5QA 4KCEA 2PBJA 1B48A 4V2LA 4OWYA 2LRNA 2YANA 3GSTA 2RUFA 4V1Ap 5ID2A 1A8LA 4ML1A 1DUGA 1Z6NA 2E2GA 3FW2A 2N5AA 1SK2A 5A34B 3LYPA 1YDKA 1S3CA 3KCMA 1ERWA 2EFCA 2DIZA 3IPZA 3KMOA 3TKRA 2LJKA 5GSTA 4BA7A 1YF0A 2VCTA 4MJEA 4XRAA 3KEBA 3ZTLA 1AQWA 2GS3A 1M9BA 5HQPA 3L9SA 1GNWA 1QGVA 2JADA 4W66A 3GH6A 3RPPA 2FGXA 2YCDA 19GSA 2C0DA 3F4TA 5ECIB 2H71A 1AUCA 2V2GA 4O5RA 2FCHA 4YAPA 2H1DA 1F37A 4TR0A 1QFNA 5A1NB 4GSNA 5KOWA 6GSSA 2FD3A 2IFQB 4X1UA 2X8HA 1SKRB 3A2XA 1ERUA 2HQTA 2PWJA 3GN3A 1QUWA 4FYCA 3TGZA 1SK0A 5DVBA 1EEMA 3R2QA 1WRYA 2K6VA 2VM1A 1PL2A 5J4UA 2EIOA 2HZFA 4K2XA 2DJ1A 1ERVA 2E7PA 4XIHA 3S9FA 2HRNA 5A5HA 3FR3A 1K3LA 2HRKB 4MDCA 5IPHA 4TR3A 1W4VA 1EGOA 1XIYA 4MCUA 2VOCA 4KH7A 4XTSA 4OD7A 3APSA 3ZREA 5G2ZA 5DJLA 3ZRDA 1X5DA 1R5PA 4OCEA 2IMDA 1M0UA 2ALBA 4KSOA 3G9BA 3WD6A 4KUNA 3TOUA 1GTAA 2HSMA 1TU8A 2DSAA 3HA9A 1QK8A 4EIPA 2H0HA 3PH9A 4POMA 4GSSA 3AY8A 2RUEA 4NHWA 2I3YA 4AGSA 3U6VA 4POLA 2DIYA 2ZUPA 3TJFA 5D9VA 1GSQA 4F9ZA 2FNOA 2GSRA 3GX0A 1TI1A 1O85A 4I97A 2VD1A 4ZXGA 4F82A 1O7UA 3FYGA 3ME8A 3BOAA 4I8BA 2L57A 4WR4A 2MMNA 1R26A 5DCGA 5D9XA 4GTUA 1H75A 3C1SA 1IYIA 1SKSB 5J40A 2OT3A 2E2MA 2HSNA 1BJXA 1SVOA 4BVXB 2E0QA 2H8LA 3QR6A 2IWTA 3TB2A 3RPNA 4Q5FA 4HZ4A 3BD2A 3FZAA 3ZZXA 2GZPA 2CZ3A 3QAGA 2VCVA 2V41A 1OC9A 3I43A 1GRXA 4E8EA 1OAZA 5HR0A 3KXOA 3A3TA 5ELAA 3CRTA 5ECKB 2L4CA 2H0IA 1XWBA 4MZCA 5AISA 2WGRA 3J7Yb 3IHQA 3ZITA 3UIWA 1AXDA 2N5FA 1BG1A 1T4ZA 1ZYNA 3JCML 3RHCA 4RI6A 1FO5A 4Z2RA 1K0OA 1VGLA 4N10A 1EV9A 3F6DA 3QAVA 2L6DA 3C73A 5IMAA 4MH2A 1WE0A 3Q74A 4ZL8A 5IPGA 1Q98A 2X49A 3E9JB 4OFMA 5COHA 2X8GA 2XBIA 1JLWA 3D4TA 2N5BA 4DSSA 1UA5A 3IR4A 1SYRA 3GURA 12GSA 2KP2A 4MA9A 5A5HB 1Z7RA 4ID0A 1NHOA 3M9JA 4KDUA 4AJ8A 1K3YA 5HR1A 2MBTA 1GUMA 1J08A 4TXOA 2ZNMA 4QL9A 1ZGNA 2Z9SA 1OKDA 3LGCA 2V6KA 1PSQA 1BF5A 3A5IA 5INYA 5D9TA 4ECCA 5D96A 1AC1A 2HSMB 4YAVA 3TKPA 5J9CA 2VD0A 4GDFA 2OACA 6GSTA 5AIVA 3FZ5A 1LBKA 5J41A 3F63A 2V32A 3O76A 4MZBA 3EU4A 3OR5A 3IDVA 2C3NA 5EY6A 4FYUA 1GUHA 2L5LA 4GQCA 4MMMA 3WGXA 1OKTA 2DLXA 4L8EA 4MABA 3ISOA 1X9WB 1T7PB 4DEJA 2UV8G 2F8AA 4K5SA 4E68A 1BQ7A 4HJMA 3L78A 3E3EA 4GLTA 4Q5QA 5HFKA 2P0GA 4IJIA 4WF4A 4BPYA 2CT6A 2I1UA 4HU7A 3N5OA 2BMXA 5CO3A 2HT9A 2AHEA 3CRUA 2HSNB 2RLIA 5L71A 2H70A 2OKAA 2GT6A 2PVOC 3ED3A 4F0BA 4KCAA 4MP4A 1KNGA 2PPTA 1N25A 1BG5A 2LS5A 5CRGA 1XW5A 3LEFA 3M0FA 3FMWA 1B4QA 2YV7A 1E6BA 3VI7A 4MPFA 4GXZA 5J3RA 2HZEB 3QFAC 4EO3A 3WGEA 3KM6A 3FK8A 4A5PA 4EDYA 3TDGA 1X9MB 3MSZA 2OE0A 3VPTA 4MNNA 1T00A 1IYHA 4K7IA 3U5RE 2YN1A 5J4YA 3LWAA 3RAZA 1ZL9A 2GVPA 4GSTA 1PA3A 2GQMA 1EWXA 5A4UA 2B1LA 4Z2TA 4EDZA 2YWIA 2OE3A 4AF2A 1SJZA 1C72A 3TRQA 4PQIA 4F0CA 3Q19A 5DDLA 1PGTA 4KW6A 1CQHA 1A23A 1SK1A 3V1WA 4K0NA 3GFKA 2VL9A 4TR1B 2IPAA 5ECSA 2C8UA 1G6YA 4X43A 4TXOB 3IK9A 1QXHA 2VCXA 1FB0A 5JCGA 2CVDA 3KP9A 2CX4A 3I6AA 4TN8A 2HSYA 4ZB6A 3LW9A 2AJQB 5EL8A 5BMUA 4HEA2 4MZWA 2H75A 1OC8A 4XS4A 3D4MA 3VWWA 1TK5B 1Z9HA 1NM3A 4ZILA 5EVOA 2O5VA 2GQLA 2R0CA 5DCHA 1Z7PA 4JE1A 4PQHA 3FR6A 5ENUA 1THXA 1HQOA 2OJLA 3HZ4A 3TRXA 1XWGA 3TKSA 2VCQA 3IXRA 3TJBA 4EIQA 3US3A 4IP1A 4DVCA 3IC4A 3F0IA 3WT2A 4L0UA 2FUG2 1YJ6A 3HJMA 1JZOA 4FO5A 1K0AA 1EOGA 1TI3A 3H1NA 4HI7A 4TOPA 4NHZA 4D73A 2G2QA 2QA1A 2V1MA 3C7MA 2LQOA 3KD0A 4YQUA 4IELA 2DKIA 4BL7B 2QKEA 2OADA 3CTFA 3C1RA 4ZB8A 4DSRA 2GTUA 1RK4A 3TKQA 1K0MA 4JR6A 1EP8A 3W6GA 1GTUA 2C0EA 2FA8A 1GSSA 1OE8A 1X0RA 1ZYQB 1I5GA 4WEYA 4FQUA 1G6WA 3K8NA 5IMZA 4Q5NA 1N8JA 11GSA 2VAFA 3KZQA 1SL0B 4XHMA 3CXGA 2FHEA 4KSMA 4KB3A 5J47A 3G7IA 4LL1B 5CAXA 1YEXA 2HFDA 4OO5A 2VKZG 5DAKB 2PGTA 3ZFLA 2PVQA 4WXTA 1M2AA 6GSVA 4POKA 2BJXA 1YY7A 4WF5A 2BTOT 4E8HA 1A8YA 2O8VB 2L5OA 4POBA 5A4VA 2YV9A 4EL1A 4PNGA 3CSHA 2IMKA 1XXUA 3PR8A 1XZOA 4CW9A 4OFTA 5LD0A 3DYRA 2J9HA 1LJRA 3ZIVA 3GL5A 4HS1A 1RW1A 2VLTA 4O32A 5F0GA 4XRDA 3FZ4A 1K0BA 4KAEA 2JZTA 1TW9A 3I69A 3TJKA 2H1BA 2FLSA 4HU9A 3APQA 2YNXA 2ES7A 3IC8A 3D0ZA 1K0NA 4O5QA 3VI5A 5IMDA 4O92A 4L5LA 2DJKA 5LCZA 5D8IA 1PX6A 4OO4A 1UN2A 3GRXA 4KGIA 5A4WA 3O6TA 5AIXA 5ELGA 1V2AA 4ZB7A 3IOSA 1F3BA 4GF0A 1GLPA 1GL8A 4LMWA 1Y25A 4TR4A 2D2ZA 3QDNA 2DMLA 2GZYA 2AV4A 5B8BA 4KE3A 2LJRA 1UVZA 4MJBA 3LYKA 1M9AA 3KP8A 3TJJA 4CY8A 1HNBA 2WS2A 1B9YC 4BVYA 2HRFA 1FVJA 2YJHA 4AKXB 2NPBA 4ZBAA 1Q4JA 3HYPA 1I9DA 1M7TA 1EOHA 3CSIA 5DALA 2GQKA 3MDKA 1HD2A 1TRSA 1J0FA 2H6XA 4OFNA 1A0RP 3H8QA 3ZVJD 1Z5YE 1ACVA 1XWAA 3HY2A 3P2AA 5JWRB 2CX3A 4V2NA 4YQMA 3SWLA 2HSHA 5IOWA 4K7NA 3IAM2 1ERTA 1YEPA 2O89A 5ID2B 4ICYA 2AAWA 1AQXA 5HR2A 2WCIA 5D9WA 4ECBA 3L9UA 2OE1A 3C71A 3ERWA 2H6YA 4RQRA 3HD5A 1EEJA 5H5QA 4IHUA 2LSTA 1GSUA 1Y6EA 3EE2A 2DKHA 1ML6A 1AIUA 3QAWA 3DMLA 2MMAA 1TKDB 3IAS2 1WOUA 1ZOFA 5H5SA 4O7HA 4OMVA 5FHIA 5F06A 1NSWA 4ACSA 2RIIA 1R7HA 2WB9A 1MTCA 3KMNA 5IM9A 3TKSE 4RUVA 1OVNA 3ZMLA 3HMJG 4H86A 16GSA 3EWLA 3EU3A 5GZZB 4EUYA 3ERFA 1PN0A 3P8WA 1X5EA 4EVMA 4MF6A 3HDCA 3BBYA 3QPMA 3R3EA 4ZIJA 4QQ7A 3GKKA 2H1LA 3VFIA 4USSA 1PD21 1YQ1A 5GAPD 2NDOA 2CAIA 3N9JA 3UVHA 4IN0A 1SJIA 4EXJA 2F51A 2DJ2A 2VL2A 4HQSA 6GSWA 1PQNA 1BX9A 1V9WA 2VO4A 2VLVA 1PL1A 4IJ3A 5ABRA 4NXIA 3UVTA 1F2EA 4WR5A 5ECLB 2C3TA 1B4PA 5GSSA 3HZ8A 2YJ7A 2X8CA 1T1VA 2A2SA 4PUAA 3ZLPA 5G31A 1VRSD 3BJ5A 2KOKA 2EIRA 5G5FA 3F6FA 1BAYA 1M2DA 1V98A 2JZRA 2IIYA 3EMPA 3F4RA 1HNAA 3ME7A 2CVBA 4N0ZA 1EZKA 2DJJA 3WGDA 1G0TA 4TVEA 4G19A 2L6CA 2XBQA 5HFIA 3PPUA 2EFEA 4NV5A 1KEBA 1X9SB 4BVYB 3HJPA 3GV1A 4GQFA 1TU7A 1GTBA 1YZXA 3GX8A 4NWYA 3Q18A 9GSSA 3CMIA 3WYWA 4G0IA 5IMCA 3QFBC 3UAPA 3TU3B 2PUKC 3FZ9A 4OCFA 1VF3A 1S3AA 4DSQA 4HUAA 20GSA 1SU9A 3QOUA 2MYGA 2IJYA 1TRUA 3MIXA 1U3AA 4ILFA 1YVLA 2NTOA 2VCWA 5J4VA 1SD8A 1SVLA 1JFUA 4JZQA 1XOAA 3L4NA 4KF9A 3EPTA 2I4AA 2PN8A 1Z6MA 3EYTA 2KP1A 1GLQA 4LA1A 1GSDA 5B6MA 2JACA 1HYUA 2GGTA 1OC9B 4NV2A 4FIWA 4MF7A 3L0HA 4L0WA 2H73A 3CYNA 4G10A 1DBYA 1ON4A 1RQMA 4G0LA 2IL3A 2B7KA 4XS6A 1AW9A 2I9HA 2AB6A 2A2RA 1T8EB 2PERA 2B7JA 4MH3A 2C0FA 3UOMA 1G7OA 4IBPA 4FYBA 3IBHA 4IVFA 1QMVA 5DQYA 3GKXA 1U6TA 3P7XA 4IGJA 2DMMA 4K5RA 4JBBA 4F03A 5IMFA 1OC3A 2MBSA 4DSSB 2L4QA 3DKSA 3FY7A 5IO0A 1XFLA 4AKHA 2YWOA 2ON5A 4G2EA 4HZ2A 4PGTA 5A34A 1O8WA 1TTZA 3F3QA 2H30A 4K0GA 4XCSA 1YKCA 3GHAA 3DWVA 4MPGA 5H5RA 2AYTA 3FR9A 2CAQA 5C04A 3NIVA 1ZCPA 5DBQA 2FA4A 2K9FA 1Z3EA 2H01A 3QCPA 4TW5A 1GH2A 5D73A 1EV4A 1GSFA 1ZYEA 1WWJA 4ZL7A 5HR3A 1J9BA 4Z7XA 3UBKA 2H74A 3IRAA 2F3MA 5ECOB 2C4JA 3KTBA 1VF4A 5A1NA 14GSA 3E0UA 4BWQA 2IFQA 1ZYPA 3ZVJA 3CTGA 10GSA 4J57E 2YOIA 1XCCA 5ECQB 1H4OA 1A2LA 2QC7A 3UARA 3DVWA 5G5EA 3P90A 2A4HA 3F4SA 2GSTA 1A2MA 2A2PA 3W8SA 6GSXA 1XVQA 2REMA 3H93A 2X64A 5JWOB 3M9KA 4GWRA 3I9V2 2HRKA 1V57A 4AJ7A 1X5CA 2QA2A 4MJAA 3DD3A 4IP6A 4V2MA 2FWHA 2FWGA 2VIMA 4ML6A 5CRDA 2XPDA 4N11A 8GSSA 2R6KA 4LMVA 2UZ8A 3DIEA 4Z2UA 1TRWA 4NAXA 3CWGA 4PNFA 3LG6A 3MNGA 4X0XA 1THOA 5F05A 1PKWA 5IIZA 3UJ1A 1SJ6A 1SD9A 3HJOA 4MLYA 4IQAA 5KOXA 4AI6A 2O87A 1XWKA 1XOBA 2PMTA 3DXBA 1O73A 1K0DA 3GKMA 4FH8A 5J9BA 3A5WA 2IMIA 4BWSA 3LSZA 4TKYA 2CQ9A 1F9MA 2MMOA 3GSSA 5B7CA 2JU5A 2GSQA 3GKNA 4J56E 2NBSA 1E2YA 1PRXA 2B6MA 2LEGA 2AUVA 1FAAA 1KBNA 1FOHA 1B8XA 2QSIA 4YKGA 1MDKA 2B3SA 4K6XA 5G30A 3RDWA 2CZ2A 4YKFA 7GSSA 3G7YA 5LNKe 3VPQA 4BVXA 2FWEA 4O5UA 1V58A 2HLSA 5JWQB 1GUKA 2V6OA 2H19A 13GSA 2F8FA 3TOTA 3F9UA 3WT1A 1K3OA 2CV4A 1ABAA 2WULA 2JSZA 4RI7A 5KN1A 1U88A 4TXVA 3PGTA 2RM5A 5BMUB 1URMA 4K8MA 3D21A 5DJMA 4XS4B 2IMFA 1PX7A 3KH9A 1AAZA 2OBIA 1ST9A 5F8BA 2XPEA 4XS1A 2FY6A 2O7KA 1ZZYA 4GRFA 3DGQA 2XC2A 5E4WA 1ZMAA 1MD3A 1DE2A 4KDYA 2EIQA 2YPMA 17GSA 4JU5A 4EF0A 2CVKA 3Q6OA 1PN9A 3IA1A 4AKGA 1EGRA 4PURA 2WFCA 1DE1A 3VWUA 3J7Yk 3F3RA 4D73B 6GSYA 2LJAA 4G0KA 4AKIA 5IOXA 4ECIA 2LQQA 2L59A 4NPBA 3BCKA 1QQ2A 2LNTA 5IMVA 1USBA 1T3BA 3C8EA 2H1AA 2LTKA 4HQZA 5ECNB 5FWGA 3VURA 4ZL9A 1XW6A 4ZBDA 2HNLA 4WBJA 3LFLA 1SVMA 2PU9C 2IN3A 1JHBA 1GP1A 4L5OA 2JZSA 1VF2A 2H6ZA 6GSUA 1FHEA 2R0GA 2EC4A 3HHVA 1TK8B 5CRWA 3VK9A 2GLRA 4KNDA 1N2AA 4K2DA 5ECPB 3ZYWA 3IE3A 1DSBA 4PTSA 2X4AA 3L9VA 3RHBA 4LL4B 1WPIA 1S3DA 3HVVA 3G7JA 4RQXA 1MD4A 1TXUA 2R2JA 3KGKA 2HE3A 1SENA 2R0PA 2IMEA 3ZL5A 4I5QA 4AJ6A 2MMZA 1TRVA 2M72A 3MWHA 1BYEA 2LRTA 2X99A 3KTLA 2C80A 3LQ7A 2ON7A 1NHYA 2TIRA 3CSJA 4CDOA 2K18A 5B8AA 3FKFA 3HVXA 2R5GA 1NW2A 1W89A 5A5KA 5JCUA 2TRXA 4KX4A 3LXZA 1GTIA 4IQ1A 2HZEA 2HRAA 5C00A 2GDRA 4PX1A 4IW9A 4N0VA 1A24A 3MAKA 3GMFA 3TKSC 5FT3A 2J23A 1T4YA 1LU4A 2HXKA 4G9HA 1FW1A 1A2JA 5G1KA 1SL2B 2R37A 2GSSA 1ILOA 3TRPA 1R5AA 2H72A 1OYJA 2YWNA 4WETA 3TUEA 2LV3A 3W8JA 1UC7A 2RM6A 3A2WA 2R3XA 4X4JA 4I2TA 2GZZA 5HFGA 2VM2A 4CY6A 3DRNA 3UEMA 3VWXA 2LKUA 1MDIA 3GNJA 5CRHA 2GT5A 3D6IA 3LXTA 1OE7A 2OA7A 1GNEA 1XW9A 5J5NA 2WJUA 1K0CA 4YH2A 4ZB9A 2OBKA 3MYDA 4TR1A 3BCIA 4GCIA 2LRCA 3EINA 1EP7A 4I2UA 3EVIA 3DVXA 2QGVA 5ECMB 1WMJA 5CREA 2C3QA 5E59A 1XVWA 1PMTA 3ZIJA 3ZMKA 4PQ1A 5DALB 2A4VA 5CP1A 3LORA 4KA0A 5F07A 2VCZA 2KLXA 2ZCTA 3LJRA 2P31A 3EURA 3HVSA 2K8VA 4YQVA 3GTUA 1SL1B 1GULA 1R4WA 3IHGA 5AN1A 5GAND 2C1YA 3PINA 2EFDA 3TCOA 2DBCA 3IV4A 4LLRA 2KUCA 2DJ3A 5CNWA 1KTEA 3NOFA 3GUSA 1WIKA 5G1LA 2WZ9A 2P5RA 1FOVA 5EPFA 4NMUA 4G01A 1XPVA 4IKHA 2H76A 22GSA 2YZHA 3F8UA 3UBLA 5ECHB 1FVKA 1U3IA 3CBUA 3D5JA 2K8SA 1TDIA 4ECJA 4BL7A 3RBTA 1XBSA 1PKZA 5ECRB 3IK7A 3O3TA 3KIJA 3H79A 3FEUA 3ERGA 1YKAA 3KJYA 1BEDA 2TRCP 3M1GA 2I81A 2LUSA 3APOA 3EC3A 1FB6A 4MJCA 2WDUA 3UL3A 2M80A 2YWMA 4ZBBA 5KEJA 3GL3A 5D93A 5KN3A 4Q5RA 1FG4A 3M8NA 5IQYA 5DAKA 1M2BA 1F3AA 1AQVA 2KHPA 18GSA 2YZUA 1YF1A 4F2IA 4WKWA 2FWFA 3HXSA 4QL7A 1O8XA 4PUFC 2B5YA 4P3YB 4EC0A 2M46A 2VUPA 3GYKA 4K7OA 1JZRA 1TOFA 1TXXA 2DJ0A 3D22A 4ISDA 2JL4A 1HNCA 1F6MC 2C0GA 3HCZA 3A2VA 3KH7A 3QMXA 2NVLA 4V1Ag 3GA4A 4KDXA 2HI7A 4WBRD 4JRRA 5AGYA 4ULXA 2DC5A 1MEKA 3ZFBA 1Y1UA 2H0GA 4QMKA 2B5XA 2H1GA 1SKWB 1GSEA 4PXOA 2G0FA 4EE0A 3TJGA 1MDJA 1XWCA 3HKRA 4HJ2A 3EMXA 3M3MA 3GTUB 3VWVA 2VLUA 3UMAA 2JSYA 3NZNA 1TP9A 1V40A 4HDEA 3H4KA 1O6JA 1G7EA 5B6NA 5CYYA 2H66A 4IS0A 3GH9A 3DEXA 3SBCA 4TRXA 4HOJA 2B5EA 4CHSA 1GSYA 1GWCA 5KN2A 5BRTA 1A0FA 1JLVA 5DQSA 4N30A 1O81A 2O85A 4K9ZA 2YP6A 2WRTA 1VF1A 2F9SA 3GIXA 1WP0A 3QD9A 5KN0A 1M99A 4JEDA 4N3ZA 1B9XC 2R4VA 1CQGA 3VLNA 2LNSA 2VL3A 2HYXA 4J2FA 1JZDA 4EKZA 2B1KA 4I6XA 3FRCA 4MK3A 5JCWA 2CA8A 4JR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MZC A;  1TK0 B;  1SYX A;  3FHK A;  1WJK A;  1JZW A;  4K1F A;  5IO2 A;  1TJD A;  2VL2 C;  1U87 A;  2XHF A;  4MF5 A;  2P5Q A;  4KCE A;  2PBJ A;  1B48 A;  4V2L A;  4OWY A;  2LRN A;  2YAN A;  3GST A;  2RUF A;  4V1A p;  5ID2 A;  1A8L A;  4ML1 A;  1DUG A;  1Z6N A;  2E2G A;  3FW2 A;  2N5A A;  1SK2 A;  3LYP A;  1YDK A;  1S3C A;  3KCM A;  1ERW A;  2DIZ A;  3IPZ A;  3KMO A;  3TKR A;  2LJK A;  5GST A;  4BA7 A;  1YF0 A;  2VCT A;  4MJE A;  4XRA A;  3KEB A;  3ZTL A;  1AQW A;  2GS3 A;  1M9B A;  5HQP A;  3L9S A;  1GNW A;  1QGV A;  2JAD A;  3GH6 A;  3RPP A;  2FGX A;  2YCD A;  19GS A;  2C0D A;  3F4T A;  5ECI B;  2H71 A;  1AUC A;  2V2G A;  4O5R A;  2FCH A;  4YAP A;  2H1D A;  1F37 A;  4TR0 A;  1QFN A;  4GSN A;  6GSS A;  2FD3 A;  2IFQ B;  4X1U A;  2X8H A;  1SKR B;  3A2X A;  1ERU A;  2HQT A;  2PWJ A;  3GN3 A;  1QUW A;  4FYC A;  3TGZ A;  1SK0 A;  5DVB A;  1EEM A;  3R2Q A;  1WRY A;  2K6V A;  2VM1 A;  1PL2 A;  5J4U A;  2EIO A;  2HZF A;  2DJ1 A;  1ERV A;  2E7P A;  4XIH A;  3S9F A;  2HRN A;  3FR3 A;  1K3L A;  2HRK B;  4MDC A;  5IPH A;  4TR3 A;  1W4V A;  1EGO A;  1XIY A;  4MCU A;  2VOC A;  4KH7 A;  4XTS A;  4OD7 A;  3APS A;  3ZRE A;  5G2Z A;  5DJL A;  3ZRD A;  1X5D A;  1R5P A;  4OCE A;  2IMD A;  1M0U A;  2ALB A;  4KSO A;  3G9B A;  3WD6 A;  4KUN A;  3TOU A;  1GTA A;  2HSM A;  1TU8 A;  2DSA A;  3HA9 A;  1QK8 A;  2H0H A;  3PH9 A;  4POM A;  4GSS A;  3AY8 A;  2RUE A;  4NHW A;  2I3Y A;  4AGS A;  3U6V A;  4POL A;  2DIY A;  2ZUP A;  3TJF A;  5D9V A;  1GSQ A;  4F9Z A;  2FNO A;  2GSR A;  3GX0 A;  1TI1 A;  1O85 A;  4I97 A;  2VD1 A;  4ZXG A;  4F82 A;  1O7U A;  3FYG A;  3ME8 A;  3BOA A;  4I8B A;  2L57 A;  4WR4 A;  2MMN A;  1R26 A;  5DCG A;  5D9X A;  4GTU A;  1H75 A;  3C1S A;  1IYI A;  1SKS B;  2E2M A;  1BJX A;  4BVX B;  2E0Q A;  2H8L A;  3QR6 A;  2IWT A;  3TB2 A;  3RPN A;  4Q5F A;  4HZ4 A;  3BD2 A;  3FZA A;  3ZZX A;  2GZP A;  2CZ3 A;  3QAG A;  2VCV A;  2V41 A;  1OC9 A;  3I43 A;  1GRX A;  4E8E A;  1OAZ A;  5HR0 A;  3KXO A;  3A3T A;  5ELA A;  3CRT A;  5ECK B;  2L4C A;  2H0I A;  1XWB A;  4MZC A;  5AIS A;  2WGR A;  3J7Y b;  3IHQ A;  3ZIT A;  3UIW A;  1AXD A;  2N5F A;  1T4Z A;  3JCM L;  3RHC A;  4RI6 A;  1FO5 A;  1K0O A;  1VGL A;  4N10 A;  1EV9 A;  3F6D A;  3QAV A;  2L6D A;  3C73 A;  5IMA A;  4MH2 A;  1WE0 A;  3Q74 A;  4ZL8 A;  5IPG A;  1Q98 A;  3E9J B;  4OFM A;  5COH A;  2X8G A;  2XBI A;  1JLW A;  3D4T A;  2N5B A;  4DSS A;  1UA5 A;  3IR4 A;  1SYR A;  3GUR A;  12GS A;  2KP2 A;  4MA9 A;  1Z7R A;  4ID0 A;  1NHO A;  3M9J A;  4KDU A;  4AJ8 A;  1K3Y A;  5HR1 A;  2MBT A;  1GUM A;  1J08 A;  4TXO A;  2ZNM A;  4QL9 A;  1ZGN A;  2Z9S A;  1OKD A;  3LGC A;  2V6K A;  1PSQ A;  5INY A;  5D9T A;  4ECC A;  5D96 A;  1AC1 A;  2HSM B;  4YAV A;  3TKP A;  5J9C A;  2VD0 A;  2OAC A;  6GST A;  5AIV A;  3FZ5 A;  1LBK A;  5J41 A;  3F63 A;  2V32 A;  3O76 A;  4MZB A;  3EU4 A;  3OR5 A;  3IDV A;  2C3N A;  5EY6 A;  4FYU A;  1GUH A;  2L5L A;  4GQC A;  4MMM A;  3WGX A;  1OKT A;  2DLX A;  4L8E A;  4MAB A;  3ISO A;  1X9W B;  1T7P B;  4DEJ A;  2F8A A;  1BQ7 A;  4HJM A;  3L78 A;  3E3E A;  4GLT A;  4Q5Q A;  5HFK A;  2P0G A;  4IJI A;  4WF4 A;  4BPY A;  2CT6 A;  2I1U A;  4HU7 A;  3N5O A;  2BMX A;  5CO3 A;  2HT9 A;  2AHE A;  3CRU A;  2HSN B;  2RLI A;  5L71 A;  2H70 A;  2OKA A;  2GT6 A;  2PVO C;  3ED3 A;  4F0B A;  4KCA A;  4MP4 A;  1KNG A;  2PPT A;  2LS5 A;  1BG5 A;  5CRG A;  1XW5 A;  3LEF A;  3M0F A;  1B4Q A;  2YV7 A;  1E6B A;  3VI7 A;  4MPF A;  4GXZ A;  5J3R A;  2HZE B;  3QFA C;  4EO3 A;  3WGE A;  3KM6 A;  3FK8 A;  4EDY A;  3TDG A;  1X9M B;  3MSZ A;  2OE0 A;  3VPT A;  1T00 A;  1IYH A;  4K7I A;  3U5R E;  2YN1 A;  3LWA A;  3RAZ A;  1ZL9 A;  2GVP A;  4GST A;  1PA3 A;  2GQM A;  1EWX A;  5A4U A;  2B1L A;  4EDZ A;  2YWI A;  2OE3 A;  4AF2 A;  1SJZ A;  1C72 A;  3TRQ A;  4PQI A;  4F0C A;  3Q19 A;  5DDL A;  1PGT A;  4KW6 A;  1CQH A;  1A23 A;  1SK1 A;  3V1W A;  4K0N A;  3GFK A;  2VL9 A;  4TR1 B;  2IPA A;  5ECS A;  2C8U A;  1G6Y A;  4X43 A;  4TXO B;  3IK9 A;  1QXH A;  2VCX A;  1FB0 A;  5JCG A;  2CVD A;  3KP9 A;  2CX4 A;  3I6A A;  4TN8 A;  2HSY A;  4ZB6 A;  2AJQ B;  5EL8 A;  5BMU A;  4HEA 2;  4MZW A;  2H75 A;  1OC8 A;  4XS4 A;  3D4M A;  3VWW A;  1TK5 B;  1Z9H A;  1NM3 A;  4ZIL A;  5EVO A;  2GQL A;  5DCH A;  1Z7P A;  4JE1 A;  4PQH A;  3FR6 A;  5ENU A;  1THX A;  1HQO A;  2OJL A;  3HZ4 A;  3TRX A;  1XWG A;  3TKS A;  2VCQ A;  3IXR A;  3TJB A;  3US3 A;  4IP1 A;  4DVC A;  3IC4 A;  3F0I A;  3WT2 A;  4L0U A;  2FUG 2;  1YJ6 A;  3HJM A;  1JZO A;  4FO5 A;  1K0A A;  1EOG A;  1TI3 A;  3H1N A;  4HI7 A;  4TOP A;  4NHZ A;  4D73 A;  2G2Q A;  2V1M A;  3C7M A;  2LQO A;  3KD0 A;  4YQU A;  4IEL A;  4BL7 B;  2QKE A;  2OAD A;  3CTF A;  3C1R A;  4ZB8 A;  4DSR A;  2GTU A;  1RK4 A;  3TKQ A;  1K0M A;  4JR6 A;  1EP8 A;  3W6G A;  1GTU A;  2C0E A;  2FA8 A;  1GSS A;  1OE8 A;  1X0R A;  1ZYQ B;  1I5G A;  4WEY A;  4FQU A;  1G6W A;  3K8N A;  5IMZ A;  4Q5N A;  1N8J A;  11GS A;  2VAF A;  3KZQ A;  1SL0 B;  4XHM A;  3CXG A;  2FHE A;  4KSM A;  4KB3 A;  3G7I A;  4LL1 B;  5CAX A;  1YEX A;  2HFD A;  4OO5 A;  5DAK B;  2PGT A;  3ZFL A;  2PVQ A;  4WXT A;  1M2A A;  6GSV A;  4POK A;  2BJX A;  1YY7 A;  4WF5 A;  2BTO T;  4E8H A;  1A8Y A;  2O8V B;  2L5O A;  4POB A;  5A4V A;  2YV9 A;  4EL1 A;  4PNG A;  3CSH A;  2IMK A;  1XXU A;  3PR8 A;  1XZO A;  4CW9 A;  4OFT A;  5LD0 A;  3DYR A;  2J9H A;  1LJR A;  3ZIV A;  3GL5 A;  4HS1 A;  1RW1 A;  2VLT A;  4O32 A;  5F0G A;  4XRD A;  3FZ4 A;  1K0B A;  4KAE A;  2JZT A;  1TW9 A;  3I69 A;  3TJK A;  2H1B A;  2FLS A;  4HU9 A;  3APQ A;  2YNX A;  2ES7 A;  3IC8 A;  3D0Z A;  1K0N A;  3VI5 A;  5IMD A;  4O92 A;  4L5L A;  2DJK A;  5LCZ A;  5D8I A;  1PX6 A;  4OO4 A;  1UN2 A;  3GRX A;  4KGI A;  5A4W A;  3O6T A;  5AIX A;  5ELG A;  1V2A A;  3IOS A;  1F3B A;  4GF0 A;  1GLP A;  1GL8 A;  4LMW A;  1Y25 A;  4TR4 A;  2D2Z A;  3QDN A;  2DML A;  2GZY A;  2AV4 A;  5B8B A;  4KE3 A;  2LJR A;  1UVZ A;  4MJB A;  3LYK A;  1M9A A;  3KP8 A;  3TJJ A;  1HNB A;  2WS2 A;  1B9Y C;  4BVY A;  2HRF A;  1FVJ A;  2YJH A;  2NPB A;  4ZBA A;  1Q4J A;  3HYP A;  1I9D A;  1M7T A;  1EOH A;  3CSI A;  5DAL A;  2GQK A;  3MDK A;  1HD2 A;  1TRS A;  1J0F A;  2H6X A;  4OFN A;  1A0R P;  3H8Q A;  3ZVJ D;  1Z5Y E;  1ACV A;  1XWA A;  3HY2 A;  3P2A A;  5JWR B;  2CX3 A;  4V2N A;  4YQM A;  3SWL A;  2HSH A;  5IOW A;  4K7N A;  3IAM 2;  1ERT A;  1YEP A;  2O89 A;  5ID2 B;  2AAW A;  1AQX A;  5HR2 A;  2WCI A;  5D9W A;  4ECB A;  3L9U A;  2OE1 A;  3C71 A;  3ERW A;  2H6Y A;  4RQR A;  3HD5 A;  1EEJ A;  5H5Q A;  4IHU A;  2LST A;  1GSU A;  1Y6E A;  3EE2 A;  1ML6 A;  1AIU A;  3QAW A;  3DML A;  2MMA A;  1TKD B;  3IAS 2;  1WOU A;  1ZOF A;  5H5S A;  4O7H A;  4OMV A;  5FHI A;  5F06 A;  1NSW A;  4ACS A;  2RII A;  1R7H A;  2WB9 A;  1MTC A;  3KMN A;  5IM9 A;  3TKS E;  4RUV A;  1OVN A;  3ZML A;  4H86 A;  16GS A;  3EWL A;  3EU3 A;  5GZZ B;  4EUY A;  3ERF A;  3P8W A;  1X5E A;  4EVM A;  4MF6 A;  3HDC A;  3BBY A;  3QPM A;  3R3E A;  4ZIJ A;  4QQ7 A;  3GKK A;  3VFI A;  4USS A;  1PD2 1;  1YQ1 A;  5GAP D;  2NDO A;  2CAI A;  3N9J A;  3UVH A;  4IN0 A;  1SJI A;  4EXJ A;  2F51 A;  2DJ2 A;  2VL2 A;  4HQS A;  6GSW A;  1PQN A;  1BX9 A;  1V9W A;  2VO4 A;  2VLV A;  1PL1 A;  4IJ3 A;  5ABR A;  4NXI A;  3UVT A;  1F2E A;  4WR5 A;  5ECL B;  2C3T A;  1B4P A;  5GSS A;  3HZ8 A;  2YJ7 A;  2X8C A;  1T1V A;  2A2S A;  4PUA A;  3ZLP A;  5G31 A;  1VRS D;  3BJ5 A;  2KOK A;  2EIR A;  5G5F A;  3F6F A;  1BAY A;  1M2D A;  1V98 A;  2JZR A;  2IIY A;  3EMP A;  3F4R A;  1HNA A;  3ME7 A;  2CVB A;  4N0Z A;  1EZK A;  2DJJ A;  3WGD A;  1G0T A;  4TVE A;  4G19 A;  2L6C A;  2XBQ A;  5HFI A;  3PPU A;  4NV5 A;  1KEB A;  1X9S B;  4BVY B;  3HJP A;  3GV1 A;  4GQF A;  1TU7 A;  1GTB A;  1YZX A;  3GX8 A;  4NWY A;  3Q18 A;  9GSS A;  3CMI A;  3WYW A;  4G0I A;  5IMC A;  3QFB C;  3UAP A;  2PUK C;  3FZ9 A;  4OCF A;  1VF3 A;  1S3A A;  4DSQ A;  4HUA A;  20GS A;  1SU9 A;  3QOU A;  2MYG A;  2IJY A;  1TRU A;  1U3A A;  4ILF A;  2NTO A;  2VCW A;  1SD8 A;  1JFU A;  4JZQ A;  1XOA A;  3L4N A;  4KF9 A;  2I4A A;  2PN8 A;  1Z6M A;  3EYT A;  2KP1 A;  1GLQ A;  4LA1 A;  1GSD A;  5B6M A;  2JAC A;  1HYU A;  2GGT A;  1OC9 B;  4NV2 A;  4FIW A;  4MF7 A;  3L0H A;  4L0W A;  2H73 A;  3CYN A;  4G10 A;  1DBY A;  1ON4 A;  1RQM A;  4G0L A;  2IL3 A;  2B7K A;  4XS6 A;  1AW9 A;  2I9H A;  2AB6 A;  2A2R A;  1T8E B;  2PER A;  2B7J A;  4MH3 A;  2C0F A;  3UOM A;  1G7O A;  4IBP A;  4FYB A;  3IBH A;  4IVF A;  1QMV A;  5DQY A;  3GKX A;  1U6T A;  3P7X A;  4IGJ A;  2DMM A;  4JBB A;  4F03 A;  5IMF A;  1OC3 A;  2MBS A;  4DSS B;  2L4Q A;  3DKS A;  3FY7 A;  5IO0 A;  1XFL A;  2YWO A;  2ON5 A;  4G2E A;  4HZ2 A;  4PGT A;  1O8W A;  1TTZ A;  3F3Q A;  2H30 A;  4K0G A;  4XCS A;  1YKC A;  3GHA A;  3DWV A;  4MPG A;  5H5R A;  2AYT A;  3FR9 A;  2CAQ A;  5C04 A;  3NIV A;  1ZCP A;  5DBQ A;  2FA4 A;  2K9F A;  1Z3E A;  2H01 A;  3QCP A;  4TW5 A;  1GH2 A;  5D73 A;  1EV4 A;  1GSF A;  1ZYE A;  1WWJ A;  4ZL7 A;  5HR3 A;  1J9B A;  4Z7X A;  3UBK A;  2H74 A;  3IRA A;  2F3M A;  5ECO B;  2C4J A;  3KTB A;  1VF4 A;  14GS A;  3E0U A;  4BWQ A;  2IFQ A;  3ZVJ A;  3CTG A;  10GS A;  4J57 E;  2YOI A;  1XCC A;  5ECQ B;  1H4O A;  1A2L A;  2QC7 A;  3UAR A;  3DVW A;  5G5E A;  3P90 A;  2GST A;  1A2M A;  3F4S A;  3W8S A;  6GSX A;  1XVQ A;  2REM A;  3H93 A;  2X64 A;  5JWO B;  3M9K A;  4GWR A;  3I9V 2;  2HRK A;  1V57 A;  4AJ7 A;  1X5C A;  4MJA A;  3DD3 A;  4IP6 A;  4V2M A;  2FWH A;  2FWG A;  2VIM A;  4ML6 A;  5CRD A;  2XPD A;  4N11 A;  8GSS A;  2R6K A;  4LMV A;  2UZ8 A;  3DIE A;  1TRW A;  4NAX A;  4PNF A;  3LG6 A;  3MNG A;  4X0X A;  1THO A;  5F05 A;  1PKW A;  5IIZ A;  3UJ1 A;  1SJ6 A;  1SD9 A;  3HJO A;  4MLY A;  4IQA A;  2O87 A;  1XWK A;  1XOB A;  2PMT A;  3DXB A;  1O73 A;  1K0D A;  3GKM A;  4FH8 A;  5J9B A;  3A5W A;  2IMI A;  4BWS A;  3LSZ A;  4TKY A;  2CQ9 A;  1F9M A;  2MMO A;  3GSS A;  5B7C A;  2JU5 A;  2GSQ A;  3GKN A;  4J56 E;  2NBS A;  1E2Y A;  1PRX A;  2B6M A;  2LEG A;  2AUV A;  1FAA A;  1KBN A;  1B8X A;  2QSI A;  1MDK A;  2B3S A;  4K6X A;  5G30 A;  3RDW A;  2CZ2 A;  7GSS A;  3G7Y A;  5LNK e;  3VPQ A;  4BVX A;  2FWE A;  1V58 A;  2HLS A;  5JWQ B;  1GUK A;  2V6O A;  2H19 A;  13GS A;  2F8F A;  3TOT A;  3F9U A;  3WT1 A;  1K3O A;  2CV4 A;  1ABA A;  2WUL A;  2JSZ A;  4RI7 A;  5KN1 A;  1U88 A;  4TXV A;  3PGT A;  2RM5 A;  1URM A;  4K8M A;  3D21 A;  5DJM A;  4XS4 B;  2IMF A;  1PX7 A;  3KH9 A;  1AAZ A;  2OBI A;  1ST9 A;  5F8B A;  2XPE A;  4XS1 A;  2FY6 A;  2O7K A;  1ZZY A;  4GRF A;  3DGQ A;  2XC2 A;  5E4W A;  1ZMA A;  1MD3 A;  1DE2 A;  4KDY A;  2EIQ A;  2YPM A;  17GS A;  4JU5 A;  4EF0 A;  2CVK A;  3Q6O A;  1PN9 A;  3IA1 A;  1EGR A;  4PUR A;  2WFC A;  1DE1 A;  3VWU A;  3J7Y k;  3F3R A;  4D73 B;  6GSY A;  2LJA A;  4G0K A;  5IOX A;  4ECI A;  2LQQ A;  2L59 A;  4NPB A;  3BCK A;  1QQ2 A;  2LNT A;  5IMV A;  1USB A;  1T3B A;  3C8E A;  2H1A A;  2LTK A;  4HQZ A;  5ECN B;  5FWG A;  3VUR A;  4ZL9 A;  1XW6 A;  4ZBD A;  2HNL A;  4WBJ A;  3LFL A;  2PU9 C;  2IN3 A;  1JHB A;  1GP1 A;  4L5O A;  2JZS A;  1VF2 A;  2H6Z A;  6GSU A;  1FHE A;  2EC4 A;  3HHV A;  1TK8 B;  5CRW A;  3VK9 A;  2GLR A;  4KND A;  1N2A A;  4K2D A;  5ECP B;  3ZYW A;  3IE3 A;  1DSB A;  4PTS A;  3L9V A;  3RHB A;  4LL4 B;  1WPI A;  1S3D A;  3HVV A;  3G7J A;  4RQX A;  1MD4 A;  2R2J A;  3KGK A;  2HE3 A;  1SEN A;  2IME A;  3ZL5 A;  4I5Q A;  4AJ6 A;  2MMZ A;  1TRV A;  2M72 A;  3MWH A;  1BYE A;  2LRT A;  2X99 A;  3KTL A;  2C80 A;  3LQ7 A;  2ON7 A;  1NHY A;  2TIR A;  3CSJ A;  4CDO A;  2K18 A;  5B8A A;  3FKF A;  3HVX A;  2R5G A;  1NW2 A;  1W89 A;  5A5K A;  5JCU A;  2TRX A;  4KX4 A;  3LXZ A;  1GTI A;  4IQ1 A;  2HZE A;  2HRA A;  5C00 A;  2GDR A;  4PX1 A;  4IW9 A;  4N0V A;  1A24 A;  3MAK A;  3GMF A;  3TKS C;  5FT3 A;  2J23 A;  1T4Y A;  1LU4 A;  2HXK A;  4G9H A;  1FW1 A;  1A2J A;  5G1K A;  1SL2 B;  2R37 A;  2GSS A;  1ILO A;  3TRP A;  1R5A A;  2H72 A;  1OYJ A;  2YWN A;  4WET A;  3TUE A;  2LV3 A;  3W8J A;  1UC7 A;  2RM6 A;  3A2W A;  2R3X A;  4I2T A;  2GZZ A;  5HFG A;  2VM2 A;  3DRN A;  3UEM A;  3VWX A;  2LKU A;  1MDI A;  3GNJ A;  5CRH A;  2GT5 A;  3D6I A;  3LXT A;  1OE7 A;  2OA7 A;  1GNE A;  1XW9 A;  5J5N A;  2WJU A;  1K0C A;  4YH2 A;  4ZB9 A;  2OBK A;  4TR1 A;  3BCI A;  4GCI A;  2LRC A;  3EIN A;  1EP7 A;  4I2U A;  3EVI A;  3DVX A;  2QGV A;  5ECM B;  1WMJ A;  5CRE A;  2C3Q A;  5E59 A;  1XVW A;  1PMT A;  3ZIJ A;  3ZMK A;  4PQ1 A;  5DAL B;  2A4V A;  5CP1 A;  3LOR A;  4KA0 A;  5F07 A;  2VCZ A;  2KLX A;  2ZCT A;  3LJR A;  2P31 A;  3EUR A;  3HVS A;  2K8V A;  4YQV A;  3GTU A;  1SL1 B;  1GUL A;  1R4W A;  5AN1 A;  5GAN D;  2C1Y A;  3PIN A;  3TCO A;  2DBC A;  3IV4 A;  4LLR A;  2KUC A;  2DJ3 A;  5CNW A;  1KTE A;  3NOF A;  3GUS A;  1WIK A;  5G1L A;  2WZ9 A;  2P5R A;  1FOV A;  5EPF A;  4NMU A;  1XPV A;  4IKH A;  2H76 A;  22GS A;  2YZH A;  3F8U A;  3UBL A;  5ECH B;  1FVK A;  1U3I A;  3CBU A;  3D5J A;  2K8S A;  1TDI A;  4ECJ A;  4BL7 A;  3RBT A;  1XBS A;  1PKZ A;  5ECR B;  3IK7 A;  3O3T A;  3KIJ A;  3H79 A;  3FEU A;  3ERG A;  1YKA A;  3KJY A;  1BED A;  2TRC P;  3M1G A;  2I81 A;  2LUS A;  3APO A;  3EC3 A;  1FB6 A;  4MJC A;  2WDU A;  3UL3 A;  2M80 A;  2YWM A;  4ZBB A;  5KEJ A;  3GL3 A;  5D93 A;  5KN3 A;  4Q5R A;  1FG4 A;  3M8N A;  5IQY A;  5DAK A;  1M2B A;  1F3A A;  1AQV A;  2KHP A;  18GS A;  2YZU A;  1YF1 A;  4F2I A;  4WKW A;  2FWF A;  3HXS A;  4QL7 A;  1O8X A;  4PUF C;  2B5Y A;  4P3Y B;  4EC0 A;  2M46 A;  2VUP A;  3GYK A;  4K7O A;  1JZR A;  1TOF A;  1TXX A;  2DJ0 A;  3D22 A;  4ISD A;  2JL4 A;  1HNC A;  1F6M C;  2C0G A;  3HCZ A;  3A2V A;  3KH7 A;  3QMX A;  2NVL A;  4V1A g;  3GA4 A;  4KDX A;  2HI7 A;  4WBR D;  4JRR A;  5AGY A;  4ULX A;  2DC5 A;  1MEK A;  3ZFB A;  2H0G A;  2B5X A;  2H1G A;  1SKW B;  1GSE A;  4PXO A;  2G0F A;  4EE0 A;  3TJG A;  1MDJ A;  1XWC A;  3HKR A;  4HJ2 A;  3EMX A;  3M3M A;  3GTU B;  3VWV A;  2VLU A;  3UMA A;  2JSY A;  3NZN A;  1TP9 A;  1V40 A;  4HDE A;  3H4K A;  1O6J A;  1G7E A;  5B6N A;  5CYY A;  2H66 A;  4IS0 A;  3GH9 A;  3DEX A;  3SBC A;  4TRX A;  4HOJ A;  2B5E A;  4CHS A;  1GSY A;  1GWC A;  5KN2 A;  1A0F A;  1JLV A;  5DQS A;  4N30 A;  1O81 A;  2O85 A;  4K9Z A;  2YP6 A;  2WRT A;  1VF1 A;  2F9S A;  3GIX A;  1WP0 A;  3QD9 A;  5KN0 A;  1M99 A;  4JED A;  1B9X C;  2R4V A;  1CQG A;  3VLN A;  2LNS A;  2VL3 A;  2HYX A;  4J2F A;  1JZD A;  4EKZ A;  2B1K A;  4I6X A;  3FRC A;  4MK3 A;  5JCW A;  2CA8 A;  4JR4 A; 
#chains in the Genus database with same CATH topology
 2MZC A;  1TK0 B;  1SYX A;  3FHK A;  1WJK A;  1JZW A;  4K1F A;  5IO2 A;  1TJD A;  2VL2 C;  1U87 A;  2XHF A;  2EFH A;  4MF5 A;  2P5Q A;  4KCE A;  2PBJ A;  1B48 A;  4V2L A;  4OWY A;  2LRN A;  2YAN A;  3GST A;  2RUF A;  4V1A p;  5ID2 A;  1A8L A;  4ML1 A;  1DUG A;  1Z6N A;  2E2G A;  3FW2 A;  2N5A A;  1SK2 A;  5A34 B;  3LYP A;  1YDK A;  2WVX B;  1S3C A;  3KCM A;  1ERW A;  2EFC A;  2DIZ A;  3IPZ A;  3KMO A;  3TKR A;  2LJK A;  5GST A;  4BA7 A;  1YF0 A;  2VCT A;  4MJE A;  4XRA A;  3KEB A;  3ZTL A;  1AQW A;  2GS3 A;  1M9B A;  5HQP A;  3L9S A;  1GNW A;  1QGV A;  2JAD A;  4W66 A;  3GH6 A;  3RPP A;  2FGX A;  2YCD A;  19GS A;  2C0D A;  3F4T A;  5ECI B;  2H71 A;  1AUC A;  2V2G A;  4O5R A;  2FCH A;  4YAP A;  2H1D A;  1F37 A;  4TR0 A;  1QFN A;  5A1N B;  4GSN A;  5KOW A;  6GSS A;  2FD3 A;  2IFQ B;  4X1U A;  2X8H A;  1SKR B;  3A2X A;  1ERU A;  2HQT A;  2PWJ A;  3GN3 A;  1QUW A;  4FYC A;  3TGZ A;  1SK0 A;  5DVB A;  1EEM A;  4PHZ C;  3R2Q A;  1WRY A;  2K6V A;  2VM1 A;  1PL2 A;  5J4U A;  2EIO A;  2HZF A;  4K2X A;  2DJ1 A;  1ERV A;  2E7P A;  4XIH A;  3S9F A;  1S4B P;  2HRN A;  5A5H A;  3FR3 A;  1K3L A;  2HRK B;  4MDC A;  5IPH A;  4TR3 A;  1W4V A;  1EGO A;  1XIY A;  4MCU A;  2VOC A;  4KH7 A;  4XTS A;  4OD7 A;  3APS A;  3ZRE A;  5G2Z A;  5DJL A;  3ZRD A;  1X5D A;  1R5P A;  4OCE A;  2IMD A;  1M0U A;  2ALB A;  4KSO A;  3G9B A;  3WD6 A;  4KUN A;  3TOU A;  1GTA A;  2HSM A;  1TU8 A;  2DSA A;  3HA9 A;  1QK8 A;  4EIP A;  2H0H A;  3PH9 A;  4POM A;  4GSS A;  3AY8 A;  2RUE A;  4NHW A;  2I3Y A;  4AGS A;  3U6V A;  4POL A;  2DIY A;  2ZUP A;  3TJF A;  5D9V A;  1YEW C;  1GSQ A;  2O3E A;  4F9Z A;  2FNO A;  2GSR A;  3GX0 A;  1TI1 A;  1O85 A;  4I97 A;  2VD1 A;  4ZXG A;  4F82 A;  1O7U A;  3FYG A;  3ME8 A;  3BOA A;  4I8B A;  2L57 A;  4WR4 A;  2MMN A;  1R26 A;  5DCG A;  5D9X A;  4GTU A;  1H75 A;  3C1S A;  1IYI A;  1SKS B;  5J40 A;  2OT3 A;  2E2M A;  2HSN A;  1BJX A;  1SVO A;  3CQF A;  4BVX B;  2E0Q A;  2H8L A;  3QR6 A;  2IWT A;  3TB2 A;  3RPN A;  4Q5F A;  4HZ4 A;  3BD2 A;  3FZA A;  3ZZX A;  2GZP A;  2CZ3 A;  3QAG A;  2VCV A;  2V41 A;  1OC9 A;  3I43 A;  1GRX A;  4E8E A;  1OAZ A;  5HR0 A;  3KXO A;  3A3T A;  5ELA A;  3CRT A;  5ECK B;  2L4C A;  2H0I A;  1XWB A;  4MZC A;  5AIS A;  2WGR A;  3J7Y b;  3IHQ A;  3ZIT A;  3UIW A;  1AXD A;  2N5F A;  1BG1 A;  1T4Z A;  1ZYN A;  3JCM L;  3RHC A;  4RI6 A;  1FO5 A;  4Z2R A;  1K0O A;  1VGL A;  4N10 A;  1EV9 A;  3F6D A;  3QAV A;  2L6D A;  3C73 A;  5IMA A;  4MH2 A;  1WE0 A;  3Q74 A;  4ZL8 A;  5IPG A;  1Q98 A;  2X49 A;  3E9J B;  4OFM A;  5COH A;  2X8G A;  2XBI A;  1JLW A;  3D4T A;  2N5B A;  4DSS A;  1UA5 A;  3IR4 A;  1SYR A;  3GUR A;  12GS A;  2KP2 A;  4MA9 A;  5A5H B;  1Z7R A;  4ID0 A;  1NHO A;  3M9J A;  4KDU A;  4AJ8 A;  1K3Y A;  5HR1 A;  2MBT A;  1GUM A;  1J08 A;  4TXO A;  2ZNM A;  4QL9 A;  1ZGN A;  2Z9S A;  1OKD A;  3LGC A;  2V6K A;  1PSQ A;  1BF5 A;  3A5I A;  5INY A;  5D9T A;  4ECC A;  5D96 A;  1AC1 A;  2HSM B;  4YAV A;  3TKP A;  5J9C A;  2VD0 A;  4GDF A;  2OAC A;  6GST A;  5AIV A;  3FZ5 A;  1LBK A;  5J41 A;  3F63 A;  2V32 A;  3O76 A;  4MZB A;  3EU4 A;  3OR5 A;  3IDV A;  2C3N A;  5EY6 A;  4FYU A;  4PI0 C;  1GUH A;  2L5L A;  4GQC A;  4MMM A;  3WGX A;  1OKT A;  2DLX A;  4L8E A;  4MAB A;  3ISO A;  1X9W B;  1T7P B;  4DEJ A;  2UV8 G;  2F8A A;  4K5S A;  4E68 A;  1BQ7 A;  4HJM A;  3L78 A;  3E3E A;  4GLT A;  4Q5Q A;  5HFK A;  2P0G A;  4IJI A;  4WF4 A;  4BPY A;  2CT6 A;  2I1U A;  4HU7 A;  3N5O A;  2BMX A;  5CO3 A;  2HT9 A;  2AHE A;  3CRU A;  2HSN B;  2RLI A;  5L71 A;  2H70 A;  2OKA A;  2GT6 A;  2PVO C;  3ED3 A;  4F0B A;  4KCA A;  4MP4 A;  1KNG A;  2PPT A;  1N25 A;  1BG5 A;  2LS5 A;  5CRG A;  1XW5 A;  3LEF A;  3M0F A;  3FMW A;  1B4Q A;  2YV7 A;  1E6B A;  3VI7 A;  4MPF A;  4GXZ A;  5J3R A;  2HZE B;  3QFA C;  4EO3 A;  3WGE A;  3KM6 A;  3FK8 A;  4A5P A;  4EDY A;  3TDG A;  1X9M B;  3MSZ A;  2OE0 A;  3VPT A;  4MNN A;  1T00 A;  1IYH A;  4K7I A;  3U5R E;  2YN1 A;  5J4Y A;  3LWA A;  3RAZ A;  1ZL9 A;  2GVP A;  4GST A;  1PA3 A;  2GQM A;  1EWX A;  5A4U A;  2B1L A;  4Z2T A;  4EDZ A;  2YWI A;  2OE3 A;  4AF2 A;  1SJZ A;  1C72 A;  3TRQ A;  4PQI A;  4F0C A;  3Q19 A;  5DDL A;  1PGT A;  4KW6 A;  1CQH A;  1A23 A;  1SK1 A;  3V1W A;  4K0N A;  3GFK A;  2VL9 A;  4TR1 B;  2IPA A;  5ECS A;  2C8U A;  1G6Y A;  4X43 A;  4TXO B;  3IK9 A;  1QXH A;  2VCX A;  1FB0 A;  5JCG A;  2CVD A;  3KP9 A;  2CX4 A;  3I6A A;  4TN8 A;  2HSY A;  1XG8 A;  4ZB6 A;  3LW9 A;  2AJQ B;  5EL8 A;  5BMU A;  4HEA 2;  4MZW A;  2H75 A;  1OC8 A;  4XS4 A;  3D4M A;  3VWW A;  1TK5 B;  1Z9H A;  1NM3 A;  4ZIL A;  5EVO A;  2O5V A;  2GQL A;  2R0C A;  5DCH A;  1Z7P A;  4JE1 A;  4PQH A;  3FR6 A;  5ENU A;  1THX A;  1HQO A;  2OJL A;  3HZ4 A;  3TRX A;  1XWG A;  3TKS A;  2VCQ A;  3IXR A;  3TJB A;  4EIQ A;  3US3 A;  4IP1 A;  4DVC A;  3IC4 A;  3F0I A;  3WT2 A;  4L0U A;  2FUG 2;  1YJ6 A;  3HJM A;  1JZO A;  4FO5 A;  1K0A A;  1EOG A;  1TI3 A;  3H1N A;  4HI7 A;  4TOP A;  4NHZ A;  4D73 A;  2G2Q A;  2QA1 A;  2V1M A;  3C7M A;  2LQO A;  3KD0 A;  4YQU A;  4IEL A;  2DKI A;  4BL7 B;  2QKE A;  2OAD A;  3CTF A;  3C1R A;  4ZB8 A;  4DSR A;  2GTU A;  1RK4 A;  3TKQ A;  1K0M A;  4JR6 A;  1EP8 A;  3W6G A;  1GTU A;  2C0E A;  2FA8 A;  1GSS A;  1OE8 A;  1X0R A;  1ZYQ B;  1I5G A;  4WEY A;  4FQU A;  1G6W A;  3K8N A;  5IMZ A;  4Q5N A;  1N8J A;  2WZS A;  11GS A;  2VAF A;  3KZQ A;  1SL0 B;  4XHM A;  3CXG A;  2FHE A;  4KSM A;  4KB3 A;  5J47 A;  3G7I A;  4LL1 B;  5CAX A;  1YEX A;  2HFD A;  4OO5 A;  2VKZ G;  5DAK B;  2PGT A;  3ZFL A;  2PVQ A;  4WXT A;  1M2A A;  6GSV A;  4POK A;  2BJX A;  1YY7 A;  4WF5 A;  2BTO T;  4E8H A;  1A8Y A;  2O8V B;  2L5O A;  4POB A;  5A4V A;  2YV9 A;  4EL1 A;  4PNG A;  3CSH A;  2IMK A;  1XXU A;  3PR8 A;  1XZO A;  4CW9 A;  4OFT A;  5LD0 A;  3DYR A;  2J9H A;  1LJR A;  3ZIV A;  3GL5 A;  4HS1 A;  1RW1 A;  2VLT A;  4O32 A;  5F0G A;  4XRD A;  3FZ4 A;  1K0B A;  4KAE A;  2JZT A;  1TW9 A;  3I69 A;  3TJK A;  2H1B A;  2FLS A;  4HU9 A;  3APQ A;  2YNX A;  2ES7 A;  3CHX C;  3IC8 A;  3D0Z A;  1K0N A;  4O5Q A;  3VI5 A;  5IMD A;  4O92 A;  4L5L A;  2DJK A;  5LCZ A;  5D8I A;  1PX6 A;  4OO4 A;  1UN2 A;  3GRX A;  4KGI A;  5A4W A;  3O6T A;  2WVY A;  5AIX A;  5ELG A;  1V2A A;  4ZB7 A;  3IOS A;  1F3B A;  4GF0 A;  1GLP A;  1GL8 A;  4LMW A;  1Y25 A;  4TR4 A;  2D2Z A;  3QDN A;  2DML A;  2GZY A;  2AV4 A;  5B8B A;  4KE3 A;  2LJR A;  1UVZ A;  4MJB A;  3LYK A;  1M9A A;  3KP8 A;  4BIK A;  3TJJ A;  4CY8 A;  1HNB A;  2WS2 A;  1B9Y C;  4BVY A;  2HRF A;  1FVJ A;  2YJH A;  4AKX B;  2NPB A;  4ZBA A;  1Q4J A;  3HYP A;  1I9D A;  1M7T A;  1EOH A;  3CSI A;  5DAL A;  2GQK A;  3MDK A;  1HD2 A;  1TRS A;  1J0F A;  2H6X A;  4OFN A;  1A0R P;  3H8Q A;  3ZVJ D;  4FXY P;  1Z5Y E;  1ACV A;  1XWA A;  3HY2 A;  3P2A A;  5JWR B;  2CX3 A;  4V2N A;  4YQM A;  3SWL A;  2HSH A;  5IOW A;  4K7N A;  3IAM 2;  1ERT A;  1YEP A;  2O89 A;  5ID2 B;  4ICY A;  2AAW A;  1AQX A;  5HR2 A;  2WCI A;  5D9W A;  4ECB A;  3L9U A;  2OE1 A;  3RGB C;  3C71 A;  3ERW A;  2H6Y A;  4RQR A;  3HD5 A;  1EEJ A;  5H5Q A;  4IHU A;  2LST A;  1GSU A;  1Y6E A;  3EE2 A;  2DKH A;  1ML6 A;  1AIU A;  3QAW A;  3DML A;  2MMA A;  1TKD B;  3IAS 2;  1WOU A;  1ZOF A;  5H5S A;  4O7H A;  4OMV A;  5FHI A;  5F06 A;  1NSW A;  4ACS A;  2RII A;  1R7H A;  2WB9 A;  1MTC A;  3KMN A;  5IM9 A;  3TKS E;  4RUV A;  1OVN A;  3ZML A;  3HMJ G;  4H86 A;  16GS A;  3EWL A;  3EU3 A;  5GZZ B;  4EUY A;  3ERF A;  1PN0 A;  3P8W A;  1X5E A;  4EVM A;  4MF6 A;  3HDC A;  3BBY A;  3QPM A;  3R3E A;  4ZIJ A;  4QQ7 A;  3GKK A;  2H1L A;  3VFI A;  4USS A;  1PD2 1;  1YQ1 A;  5GAP D;  2NDO A;  2CAI A;  3N9J A;  3UVH A;  4IN0 A;  1SJI A;  4EXJ A;  2F51 A;  2DJ2 A;  2VL2 A;  4HQS A;  6GSW A;  1PQN A;  1BX9 A;  1V9W A;  2VO4 A;  2VLV A;  1PL1 A;  4IJ3 A;  5ABR A;  4NXI A;  3UVT A;  1F2E A;  4WR5 A;  5ECL B;  2C3T A;  1B4P A;  5GSS A;  3HZ8 A;  2YJ7 A;  2X8C A;  2WW1 A;  1T1V A;  2A2S A;  4PUA A;  3ZLP A;  5G31 A;  1VRS D;  3BJ5 A;  2KOK A;  2EIR A;  5G5F A;  3F6F A;  1BAY A;  1M2D A;  1V98 A;  2JZR A;  2IIY A;  3EMP A;  3F4R A;  1HNA A;  3ME7 A;  2CVB A;  4N0Z A;  1EZK A;  2DJJ A;  3WGD A;  1G0T A;  4TVE A;  4G19 A;  2L6C A;  2XBQ A;  5HFI A;  3PPU A;  2EFE A;  4NV5 A;  1KEB A;  1X9S B;  4BVY B;  3HJP A;  3GV1 A;  4GQF A;  1TU7 A;  1GTB A;  1YZX A;  3GX8 A;  4NWY A;  3Q18 A;  9GSS A;  3CMI A;  3WYW A;  4G0I A;  5IMC A;  3QFB C;  3UAP A;  3TU3 B;  2PUK C;  3FZ9 A;  4OCF A;  1VF3 A;  1S3A A;  4DSQ A;  4HUA A;  20GS A;  1SU9 A;  3QOU A;  2MYG A;  2IJY A;  1TRU A;  3MIX A;  1U3A A;  4ILF A;  1YVL A;  2NTO A;  2VCW A;  5J4V A;  1SD8 A;  1SVL A;  1JFU A;  4JZQ A;  1XOA A;  3L4N A;  4KF9 A;  3EPT A;  2I4A A;  2PN8 A;  1Z6M A;  3EYT A;  2KP1 A;  1GLQ A;  4LA1 A;  1GSD A;  5B6M A;  2JAC A;  1HYU A;  2GGT A;  1OC9 B;  4NV2 A;  4FIW A;  4MF7 A;  3L0H A;  4L0W A;  2H73 A;  3CYN A;  2WW0 A;  4G10 A;  1DBY A;  1ON4 A;  1RQM A;  4G0L A;  2IL3 A;  2B7K A;  4XS6 A;  1AW9 A;  2I9H A;  2AB6 A;  2A2R A;  1T8E B;  3HVN A;  2PER A;  2B7J A;  4MH3 A;  2C0F A;  4PI2 C;  2O36 A;  3UOM A;  1G7O A;  4IBP A;  4FYB A;  3IBH A;  4IVF A;  1QMV A;  5DQY A;  3GKX A;  1U6T A;  3P7X A;  4IGJ A;  2DMM A;  4K5R A;  4JBB A;  4F03 A;  5IMF A;  1OC3 A;  2MBS A;  4DSS B;  2L4Q A;  3DKS A;  3FY7 A;  5IO0 A;  1XFL A;  4AKH A;  2YWO A;  2ON5 A;  4G2E A;  4HZ2 A;  4PGT A;  5A34 A;  1O8W A;  1TTZ A;  2WVX A;  3F3Q A;  2H30 A;  4K0G A;  4XCS A;  1YKC A;  3GHA A;  3DWV A;  4MPG A;  5H5R A;  2AYT A;  3FR9 A;  2CAQ A;  5C04 A;  3NIV A;  1ZCP A;  5DBQ A;  2FA4 A;  2K9F A;  1Z3E A;  2H01 A;  3QCP A;  4TW5 A;  1GH2 A;  5D73 A;  1EV4 A;  1GSF A;  1ZYE A;  1WWJ A;  4ZL7 A;  5HR3 A;  1J9B A;  4Z7X A;  3UBK A;  2H74 A;  3IRA A;  2F3M A;  5ECO B;  2C4J A;  3KTB A;  1VF4 A;  5A1N A;  14GS A;  3E0U A;  4BWQ A;  2IFQ A;  1ZYP A;  3ZVJ A;  3CTG A;  10GS A;  4J57 E;  2YOI A;  1PFO A;  1XCC A;  5ECQ B;  1H4O A;  1A2L A;  2QC7 A;  3UAR A;  3DVW A;  5G5E A;  3P90 A;  2A4H A;  3F4S A;  2GST A;  1A2M A;  2A2P A;  3W8S A;  6GSX A;  1XVQ A;  2REM A;  3H93 A;  2X64 A;  5JWO B;  3M9K A;  4GWR A;  3I9V 2;  1S3R A;  2HRK A;  1V57 A;  4AJ7 A;  1X5C A;  2QA2 A;  4MJA A;  3DD3 A;  4IP6 A;  4V2M A;  2FWH A;  2FWG A;  2VIM A;  4ML6 A;  5CRD A;  2XPD A;  4N11 A;  8GSS A;  2R6K A;  4LMV A;  2UZ8 A;  3DIE A;  4Z2U A;  1TRW A;  4NAX A;  3CWG A;  4PNF A;  3LG6 A;  3MNG A;  4X0X A;  1THO A;  5F05 A;  1PKW A;  5IIZ A;  3UJ1 A;  1SJ6 A;  1SD9 A;  3HJO A;  4MLY A;  4IQA A;  5KOX A;  4AI6 A;  2O87 A;  1XWK A;  1XOB A;  2PMT A;  3DXB A;  1O73 A;  1K0D A;  3GKM A;  4FH8 A;  5J9B A;  3A5W A;  2IMI A;  4BWS A;  3LSZ A;  4TKY A;  2CQ9 A;  1F9M A;  2MMO A;  3GSS A;  5B7C A;  2JU5 A;  2GSQ A;  3GKN A;  4J56 E;  2NBS A;  1E2Y A;  1PRX A;  2B6M A;  2LEG A;  2AUV A;  1FAA A;  1KBN A;  1FOH A;  1B8X A;  2QSI A;  4YKG A;  1MDK A;  2B3S A;  4K6X A;  5G30 A;  3RDW A;  2CZ2 A;  4YKF A;  7GSS A;  3G7Y A;  5LNK e;  3VPQ A;  4BVX A;  2FWE A;  4O5U A;  1V58 A;  2HLS A;  5JWQ B;  1GUK A;  2V6O A;  2H19 A;  13GS A;  2F8F A;  3TOT A;  3F9U A;  3WT1 A;  1K3O A;  2CV4 A;  1ABA A;  2WUL A;  2JSZ A;  4RI7 A;  5KN1 A;  1U88 A;  4TXV A;  3PGT A;  2RM5 A;  5BMU B;  1URM A;  4K8M A;  3D21 A;  5DJM A;  4XS4 B;  2IMF A;  1PX7 A;  3KH9 A;  1AAZ A;  2OBI A;  1ST9 A;  5F8B A;  2XPE A;  4XS1 A;  2FY6 A;  2O7K A;  1ZZY A;  4GRF A;  3DGQ A;  2XC2 A;  5E4W A;  1ZMA A;  1MD3 A;  1DE2 A;  4KDY A;  2EIQ A;  2YPM A;  17GS A;  4JU5 A;  4EF0 A;  2CVK A;  3Q6O A;  1PN9 A;  3IA1 A;  4AKG A;  1EGR A;  4PUR A;  2WFC A;  1DE1 A;  3VWU A;  3J7Y k;  3F3R A;  4D73 B;  6GSY A;  2LJA A;  4G0K A;  4AKI A;  5IOX A;  4ECI A;  2LQQ A;  2L59 A;  4NPB A;  3BCK A;  1QQ2 A;  2LNT A;  5IMV A;  1USB A;  1T3B A;  3C8E A;  2H1A A;  2LTK A;  4HQZ A;  5ECN B;  5FWG A;  3VUR A;  4ZL9 A;  1XW6 A;  4ZBD A;  2HNL A;  4WBJ A;  3LFL A;  1SVM A;  2PU9 C;  2IN3 A;  1JHB A;  1GP1 A;  2WW2 A;  1I1I P;  4L5O A;  2JZS A;  1VF2 A;  2H6Z A;  6GSU A;  1FHE A;  2R0G A;  2EC4 A;  3HHV A;  1TK8 B;  5CRW A;  3VK9 A;  2GLR A;  4KND A;  1N2A A;  4K2D A;  5ECP B;  3ZYW A;  3IE3 A;  1DSB A;  4PTS A;  2X4A A;  3L9V A;  3RHB A;  4LL4 B;  1WPI A;  1S3D A;  3HVV A;  3G7J A;  4RQX A;  1MD4 A;  1TXU A;  2R2J A;  3KGK A;  2HE3 A;  1SEN A;  2R0P A;  2IME A;  3ZL5 A;  4I5Q A;  4AJ6 A;  2MMZ A;  1TRV A;  2M72 A;  3MWH A;  1BYE A;  2LRT A;  2X99 A;  3KTL A;  2C80 A;  3LQ7 A;  2ON7 A;  1NHY A;  2TIR A;  3CSJ A;  4CDO A;  2K18 A;  1M3J A;  5B8A A;  3FKF A;  3HVX A;  2R5G A;  1NW2 A;  1W89 A;  5A5K A;  5JCU A;  2TRX A;  4KX4 A;  3LXZ A;  1GTI A;  4IQ1 A;  2HZE A;  2HRA A;  5C00 A;  2GDR A;  4PX1 A;  4IW9 A;  4N0V A;  1A24 A;  3MAK A;  3GMF A;  3TKS C;  5FT3 A;  2J23 A;  1T4Y A;  1LU4 A;  2HXK A;  4G9H A;  1FW1 A;  1A2J A;  5G1K A;  1SL2 B;  2R37 A;  2GSS A;  1ILO A;  3TRP A;  1R5A A;  2H72 A;  1OYJ A;  2YWN A;  4WET A;  3TUE A;  2LV3 A;  4HSC X;  2WW3 A;  3W8J A;  1UC7 A;  2RM6 A;  3A2W A;  2R3X A;  4X4J A;  4I2T A;  2GZZ A;  5HFG A;  2VM2 A;  4CY6 A;  3DRN A;  3UEM A;  3VWX A;  2LKU A;  1MDI A;  3GNJ A;  5CRH A;  2GT5 A;  3D6I A;  3LXT A;  1OE7 A;  2OA7 A;  1GNE A;  1XW9 A;  5J5N A;  2WJU A;  1K0C A;  4YH2 A;  4ZB9 A;  2OBK A;  3MYD A;  4TR1 A;  3BCI A;  4GCI A;  2LRC A;  3EIN A;  1EP7 A;  4I2U A;  3EVI A;  3DVX A;  2QGV A;  5ECM B;  1WMJ A;  5CRE A;  2C3Q A;  5E59 A;  1XVW A;  1PMT A;  3ZIJ A;  3ZMK A;  4PQ1 A;  5DAL B;  2A4V A;  5CP1 A;  3LOR A;  4KA0 A;  5F07 A;  2VCZ A;  2KLX A;  2ZCT A;  3LJR A;  2P31 A;  3EUR A;  3HVS A;  2K8V A;  4YQV A;  3GTU A;  1SL1 B;  1GUL A;  1R4W A;  3IHG A;  5AN1 A;  5GAN D;  2C1Y A;  3PIN A;  2EFD A;  3TCO A;  2DBC A;  3IV4 A;  4LLR A;  2KUC A;  2DJ3 A;  5CNW A;  1KTE A;  3NOF A;  3GUS A;  1WIK A;  5G1L A;  2WZ9 A;  2P5R A;  1FOV A;  5EPF A;  4NMU A;  4G01 A;  1XPV A;  4IKH A;  2H76 A;  22GS A;  2YZH A;  3F8U A;  3UBL A;  5ECH B;  1FVK A;  1U3I A;  3CBU A;  3D5J A;  2K8S A;  1TDI A;  4ECJ A;  4BL7 A;  3RBT A;  1XBS A;  1PKZ A;  5ECR B;  3IK7 A;  3O3T A;  3KIJ A;  3H79 A;  3FEU A;  3ERG A;  1YKA A;  3KJY A;  1BED A;  2TRC P;  3M1G A;  2I81 A;  2LUS A;  3APO A;  3EC3 A;  1FB6 A;  4MJC A;  2WDU A;  3UL3 A;  2M80 A;  2YWM A;  4ZBB A;  5KEJ A;  3GL3 A;  5D93 A;  5KN3 A;  4Q5R A;  1FG4 A;  3M8N A;  5IQY A;  5DAK A;  1M2B A;  1F3A A;  1AQV A;  2KHP A;  1M3I A;  18GS A;  2YZU A;  1YF1 A;  4F2I A;  4WKW A;  2FWF A;  3HXS A;  4QL7 A;  1O8X A;  4PUF C;  2B5Y A;  4P3Y B;  4EC0 A;  2M46 A;  2VUP A;  3GYK A;  4K7O A;  1JZR A;  1TOF A;  1TXX A;  2DJ0 A;  3D22 A;  4ISD A;  2JL4 A;  1HNC A;  1F6M C;  2C0G A;  3HCZ A;  3A2V A;  3KH7 A;  3QMX A;  2NVL A;  4V1A g;  2WVZ A;  4KDX A;  3GA4 A;  2HI7 A;  4WBR D;  4JRR A;  5AGY A;  4ULX A;  2DC5 A;  1MEK A;  3ZFB A;  1Y1U A;  2H0G A;  4QMK A;  2B5X A;  2H1G A;  1SKW B;  1GSE A;  4PXO A;  2G0F A;  4EE0 A;  3TJG A;  1MDJ A;  1XWC A;  3HKR A;  4HJ2 A;  3EMX A;  3M3M A;  3GTU B;  3VWV A;  2VLU A;  3UMA A;  2JSY A;  3NZN A;  1TP9 A;  1V40 A;  4HDE A;  3H4K A;  1O6J A;  1G7E A;  5B6N A;  5CYY A;  2H66 A;  4IS0 A;  3GH9 A;  3DEX A;  3SBC A;  4TRX A;  4HOJ A;  2B5E A;  4CHS A;  1GSY A;  1GWC A;  5KN2 A;  5BRT A;  1A0F A;  1JLV A;  5DQS A;  4N30 A;  1O81 A;  2O85 A;  4K9Z A;  2YP6 A;  2WRT A;  1VF1 A;  2F9S A;  3GIX A;  1WP0 A;  3QD9 A;  5KN0 A;  1M99 A;  4JED A;  4N3Z A;  3RFR C;  1B9X C;  2R4V A;  1CQG A;  3VLN A;  2LNS A;  2VL3 A;  2HYX A;  4J2F A;  1JZD A;  4EKZ A;  2B1K A;  4I6X A;  3FRC A;  4MK3 A;  5JCW A;  2CA8 A;  4JR4 A; 
#chains in the Genus database with same CATH homology
 2MZC A;  1TK0 B;  1SYX A;  3FHK A;  1WJK A;  1JZW A;  4K1F A;  5IO2 A;  1TJD A;  2VL2 C;  1U87 A;  2XHF A;  2EFH A;  4MF5 A;  2P5Q A;  4KCE A;  2PBJ A;  1B48 A;  4V2L A;  4OWY A;  2LRN A;  2YAN A;  3GST A;  2RUF A;  4V1A p;  5ID2 A;  1A8L A;  4ML1 A;  1DUG A;  1Z6N A;  2E2G A;  3FW2 A;  2N5A A;  1SK2 A;  5A34 B;  3LYP A;  1YDK A;  1S3C A;  3KCM A;  1ERW A;  2EFC A;  2DIZ A;  3IPZ A;  3KMO A;  3TKR A;  2LJK A;  5GST A;  4BA7 A;  1YF0 A;  2VCT A;  4MJE A;  4XRA A;  3KEB A;  3ZTL A;  1AQW A;  2GS3 A;  1M9B A;  5HQP A;  3L9S A;  1GNW A;  1QGV A;  2JAD A;  4W66 A;  3GH6 A;  3RPP A;  2FGX A;  2YCD A;  19GS A;  2C0D A;  3F4T A;  5ECI B;  2H71 A;  1AUC A;  2V2G A;  4O5R A;  2FCH A;  4YAP A;  2H1D A;  1F37 A;  4TR0 A;  1QFN A;  5A1N B;  4GSN A;  5KOW A;  6GSS A;  2FD3 A;  2IFQ B;  4X1U A;  2X8H A;  1SKR B;  3A2X A;  1ERU A;  2HQT A;  2PWJ A;  3GN3 A;  1QUW A;  4FYC A;  3TGZ A;  1SK0 A;  5DVB A;  1EEM A;  3R2Q A;  1WRY A;  2K6V A;  2VM1 A;  1PL2 A;  5J4U A;  2EIO A;  2HZF A;  4K2X A;  2DJ1 A;  1ERV A;  2E7P A;  4XIH A;  3S9F A;  2HRN A;  5A5H A;  3FR3 A;  1K3L A;  2HRK B;  4MDC A;  5IPH A;  4TR3 A;  1W4V A;  1EGO A;  1XIY A;  4MCU A;  2VOC A;  4KH7 A;  4XTS A;  4OD7 A;  3APS A;  3ZRE A;  5G2Z A;  5DJL A;  3ZRD A;  1X5D A;  1R5P A;  4OCE A;  2IMD A;  1M0U A;  2ALB A;  4KSO A;  3G9B A;  3WD6 A;  4KUN A;  3TOU A;  1GTA A;  2HSM A;  1TU8 A;  2DSA A;  3HA9 A;  1QK8 A;  4EIP A;  2H0H A;  3PH9 A;  4POM A;  4GSS A;  3AY8 A;  2RUE A;  4NHW A;  2I3Y A;  4AGS A;  3U6V A;  4POL A;  2DIY A;  2ZUP A;  3TJF A;  5D9V A;  1GSQ A;  4F9Z A;  2FNO A;  2GSR A;  3GX0 A;  1TI1 A;  1O85 A;  4I97 A;  2VD1 A;  4ZXG A;  4F82 A;  1O7U A;  3FYG A;  3ME8 A;  3BOA A;  4I8B A;  2L57 A;  4WR4 A;  2MMN A;  1R26 A;  5DCG A;  5D9X A;  4GTU A;  1H75 A;  3C1S A;  1IYI A;  1SKS B;  5J40 A;  2OT3 A;  2E2M A;  2HSN A;  1BJX A;  1SVO A;  4BVX B;  2E0Q A;  2H8L A;  3QR6 A;  2IWT A;  3TB2 A;  3RPN A;  4Q5F A;  4HZ4 A;  3BD2 A;  3FZA A;  3ZZX A;  2GZP A;  2CZ3 A;  3QAG A;  2VCV A;  2V41 A;  1OC9 A;  3I43 A;  1GRX A;  4E8E A;  1OAZ A;  5HR0 A;  3KXO A;  3A3T A;  5ELA A;  3CRT A;  5ECK B;  2L4C A;  2H0I A;  1XWB A;  4MZC A;  5AIS A;  2WGR A;  3J7Y b;  3IHQ A;  3ZIT A;  3UIW A;  1AXD A;  2N5F A;  1BG1 A;  1T4Z A;  1ZYN A;  3JCM L;  3RHC A;  4RI6 A;  1FO5 A;  4Z2R A;  1K0O A;  1VGL A;  4N10 A;  1EV9 A;  3F6D A;  3QAV A;  2L6D A;  3C73 A;  5IMA A;  4MH2 A;  1WE0 A;  3Q74 A;  4ZL8 A;  5IPG A;  1Q98 A;  2X49 A;  3E9J B;  4OFM A;  5COH A;  2X8G A;  2XBI A;  1JLW A;  3D4T A;  2N5B A;  4DSS A;  1UA5 A;  3IR4 A;  1SYR A;  3GUR A;  12GS A;  2KP2 A;  4MA9 A;  5A5H B;  1Z7R A;  4ID0 A;  1NHO A;  3M9J A;  4KDU A;  4AJ8 A;  1K3Y A;  5HR1 A;  2MBT A;  1GUM A;  1J08 A;  4TXO A;  2ZNM A;  4QL9 A;  1ZGN A;  2Z9S A;  1OKD A;  3LGC A;  2V6K A;  1PSQ A;  1BF5 A;  3A5I A;  5INY A;  5D9T A;  4ECC A;  5D96 A;  1AC1 A;  2HSM B;  4YAV A;  3TKP A;  5J9C A;  2VD0 A;  4GDF A;  2OAC A;  6GST A;  5AIV A;  3FZ5 A;  1LBK A;  5J41 A;  3F63 A;  2V32 A;  3O76 A;  4MZB A;  3EU4 A;  3OR5 A;  3IDV A;  2C3N A;  5EY6 A;  4FYU A;  1GUH A;  2L5L A;  4GQC A;  4MMM A;  3WGX A;  1OKT A;  2DLX A;  4L8E A;  4MAB A;  3ISO A;  1X9W B;  1T7P B;  4DEJ A;  2UV8 G;  2F8A A;  4K5S A;  4E68 A;  1BQ7 A;  4HJM A;  3L78 A;  3E3E A;  4GLT A;  4Q5Q A;  5HFK A;  2P0G A;  4IJI A;  4WF4 A;  4BPY A;  2CT6 A;  2I1U A;  4HU7 A;  3N5O A;  2BMX A;  5CO3 A;  2HT9 A;  2AHE A;  3CRU A;  2HSN B;  2RLI A;  5L71 A;  2H70 A;  2OKA A;  2GT6 A;  2PVO C;  3ED3 A;  4F0B A;  4KCA A;  4MP4 A;  1KNG A;  2PPT A;  1N25 A;  1BG5 A;  2LS5 A;  5CRG A;  1XW5 A;  3LEF A;  3M0F A;  3FMW A;  1B4Q A;  2YV7 A;  1E6B A;  3VI7 A;  4MPF A;  4GXZ A;  5J3R A;  2HZE B;  3QFA C;  4EO3 A;  3WGE A;  3KM6 A;  3FK8 A;  4A5P A;  4EDY A;  3TDG A;  1X9M B;  3MSZ A;  2OE0 A;  3VPT A;  4MNN A;  1T00 A;  1IYH A;  4K7I A;  3U5R E;  2YN1 A;  5J4Y A;  3LWA A;  3RAZ A;  1ZL9 A;  2GVP A;  4GST A;  1PA3 A;  2GQM A;  1EWX A;  5A4U A;  2B1L A;  4Z2T A;  4EDZ A;  2YWI A;  2OE3 A;  4AF2 A;  1SJZ A;  1C72 A;  3TRQ A;  4PQI A;  4F0C A;  3Q19 A;  5DDL A;  1PGT A;  4KW6 A;  1CQH A;  1A23 A;  1SK1 A;  3V1W A;  4K0N A;  3GFK A;  2VL9 A;  4TR1 B;  2IPA A;  5ECS A;  2C8U A;  1G6Y A;  4X43 A;  4TXO B;  3IK9 A;  1QXH A;  2VCX A;  1FB0 A;  5JCG A;  2CVD A;  3KP9 A;  2CX4 A;  3I6A A;  4TN8 A;  2HSY A;  4ZB6 A;  3LW9 A;  2AJQ B;  5EL8 A;  5BMU A;  4HEA 2;  4MZW A;  2H75 A;  1OC8 A;  4XS4 A;  3D4M A;  3VWW A;  1TK5 B;  1Z9H A;  1NM3 A;  4ZIL A;  5EVO A;  2O5V A;  2GQL A;  2R0C A;  5DCH A;  1Z7P A;  4JE1 A;  4PQH A;  3FR6 A;  5ENU A;  1THX A;  1HQO A;  2OJL A;  3HZ4 A;  3TRX A;  1XWG A;  3TKS A;  2VCQ A;  3IXR A;  3TJB A;  4EIQ A;  3US3 A;  4IP1 A;  4DVC A;  3IC4 A;  3F0I A;  3WT2 A;  4L0U A;  2FUG 2;  1YJ6 A;  3HJM A;  1JZO A;  4FO5 A;  1K0A A;  1EOG A;  1TI3 A;  3H1N A;  4HI7 A;  4TOP A;  4NHZ A;  4D73 A;  2G2Q A;  2QA1 A;  2V1M A;  3C7M A;  2LQO A;  3KD0 A;  4YQU A;  4IEL A;  2DKI A;  4BL7 B;  2QKE A;  2OAD A;  3CTF A;  3C1R A;  4ZB8 A;  4DSR A;  2GTU A;  1RK4 A;  3TKQ A;  1K0M A;  4JR6 A;  1EP8 A;  3W6G A;  1GTU A;  2C0E A;  2FA8 A;  1GSS A;  1OE8 A;  1X0R A;  1ZYQ B;  1I5G A;  4WEY A;  4FQU A;  1G6W A;  3K8N A;  5IMZ A;  4Q5N A;  1N8J A;  11GS A;  2VAF A;  3KZQ A;  1SL0 B;  4XHM A;  3CXG A;  2FHE A;  4KSM A;  4KB3 A;  5J47 A;  3G7I A;  4LL1 B;  5CAX A;  1YEX A;  2HFD A;  4OO5 A;  2VKZ G;  5DAK B;  2PGT A;  3ZFL A;  2PVQ A;  4WXT A;  1M2A A;  6GSV A;  4POK A;  2BJX A;  1YY7 A;  4WF5 A;  2BTO T;  4E8H A;  1A8Y A;  2O8V B;  2L5O A;  4POB A;  5A4V A;  2YV9 A;  4EL1 A;  4PNG A;  3CSH A;  2IMK A;  1XXU A;  3PR8 A;  1XZO A;  4CW9 A;  4OFT A;  5LD0 A;  3DYR A;  2J9H A;  1LJR A;  3ZIV A;  3GL5 A;  4HS1 A;  1RW1 A;  2VLT A;  4O32 A;  5F0G A;  4XRD A;  3FZ4 A;  1K0B A;  4KAE A;  2JZT A;  1TW9 A;  3I69 A;  3TJK A;  2H1B A;  2FLS A;  4HU9 A;  3APQ A;  2YNX A;  2ES7 A;  3IC8 A;  3D0Z A;  1K0N A;  4O5Q A;  3VI5 A;  5IMD A;  4O92 A;  4L5L A;  2DJK A;  5LCZ A;  5D8I A;  1PX6 A;  4OO4 A;  1UN2 A;  3GRX A;  4KGI A;  5A4W A;  3O6T A;  5AIX A;  5ELG A;  1V2A A;  4ZB7 A;  3IOS A;  1F3B A;  4GF0 A;  1GLP A;  1GL8 A;  4LMW A;  1Y25 A;  4TR4 A;  2D2Z A;  3QDN A;  2DML A;  2GZY A;  2AV4 A;  5B8B A;  4KE3 A;  2LJR A;  1UVZ A;  4MJB A;  3LYK A;  1M9A A;  3KP8 A;  3TJJ A;  4CY8 A;  1HNB A;  2WS2 A;  1B9Y C;  4BVY A;  2HRF A;  1FVJ A;  2YJH A;  4AKX B;  2NPB A;  4ZBA A;  1Q4J A;  3HYP A;  1I9D A;  1M7T A;  1EOH A;  3CSI A;  5DAL A;  2GQK A;  3MDK A;  1HD2 A;  1TRS A;  1J0F A;  2H6X A;  4OFN A;  1A0R P;  3H8Q A;  3ZVJ D;  1Z5Y E;  1ACV A;  1XWA A;  3HY2 A;  3P2A A;  5JWR B;  2CX3 A;  4V2N A;  4YQM A;  3SWL A;  2HSH A;  5IOW A;  4K7N A;  3IAM 2;  1ERT A;  1YEP A;  2O89 A;  5ID2 B;  4ICY A;  2AAW A;  1AQX A;  5HR2 A;  2WCI A;  5D9W A;  4ECB A;  3L9U A;  2OE1 A;  3C71 A;  3ERW A;  2H6Y A;  4RQR A;  3HD5 A;  1EEJ A;  5H5Q A;  4IHU A;  2LST A;  1GSU A;  1Y6E A;  3EE2 A;  2DKH A;  1ML6 A;  1AIU A;  3QAW A;  3DML A;  2MMA A;  1TKD B;  3IAS 2;  1WOU A;  1ZOF A;  5H5S A;  4O7H A;  4OMV A;  5FHI A;  5F06 A;  1NSW A;  4ACS A;  2RII A;  1R7H A;  2WB9 A;  1MTC A;  3KMN A;  5IM9 A;  3TKS E;  4RUV A;  1OVN A;  3ZML A;  3HMJ G;  4H86 A;  16GS A;  3EWL A;  3EU3 A;  5GZZ B;  4EUY A;  3ERF A;  1PN0 A;  3P8W A;  1X5E A;  4EVM A;  4MF6 A;  3HDC A;  3BBY A;  3QPM A;  3R3E A;  4ZIJ A;  4QQ7 A;  3GKK A;  2H1L A;  3VFI A;  4USS A;  1PD2 1;  1YQ1 A;  5GAP D;  2NDO A;  2CAI A;  3N9J A;  3UVH A;  4IN0 A;  1SJI A;  4EXJ A;  2F51 A;  2DJ2 A;  2VL2 A;  4HQS A;  6GSW A;  1PQN A;  1BX9 A;  1V9W A;  2VO4 A;  2VLV A;  1PL1 A;  4IJ3 A;  5ABR A;  4NXI A;  3UVT A;  1F2E A;  4WR5 A;  5ECL B;  2C3T A;  1B4P A;  5GSS A;  3HZ8 A;  2YJ7 A;  2X8C A;  1T1V A;  2A2S A;  4PUA A;  3ZLP A;  5G31 A;  1VRS D;  3BJ5 A;  2KOK A;  2EIR A;  5G5F A;  3F6F A;  1BAY A;  1M2D A;  1V98 A;  2JZR A;  2IIY A;  3EMP A;  3F4R A;  1HNA A;  3ME7 A;  2CVB A;  4N0Z A;  1EZK A;  2DJJ A;  3WGD A;  1G0T A;  4TVE A;  4G19 A;  2L6C A;  2XBQ A;  5HFI A;  3PPU A;  2EFE A;  4NV5 A;  1KEB A;  1X9S B;  4BVY B;  3HJP A;  3GV1 A;  4GQF A;  1TU7 A;  1GTB A;  1YZX A;  3GX8 A;  4NWY A;  3Q18 A;  9GSS A;  3CMI A;  3WYW A;  4G0I A;  5IMC A;  3QFB C;  3UAP A;  3TU3 B;  2PUK C;  3FZ9 A;  4OCF A;  1VF3 A;  1S3A A;  4DSQ A;  4HUA A;  20GS A;  1SU9 A;  3QOU A;  2MYG A;  2IJY A;  1TRU A;  3MIX A;  1U3A A;  4ILF A;  1YVL A;  2NTO A;  2VCW A;  5J4V A;  1SD8 A;  1SVL A;  1JFU A;  4JZQ A;  1XOA A;  3L4N A;  4KF9 A;  3EPT A;  2I4A A;  2PN8 A;  1Z6M A;  3EYT A;  2KP1 A;  1GLQ A;  4LA1 A;  1GSD A;  5B6M A;  2JAC A;  1HYU A;  2GGT A;  1OC9 B;  4NV2 A;  4FIW A;  4MF7 A;  3L0H A;  4L0W A;  2H73 A;  3CYN A;  4G10 A;  1DBY A;  1ON4 A;  1RQM A;  4G0L A;  2IL3 A;  2B7K A;  4XS6 A;  1AW9 A;  2I9H A;  2AB6 A;  2A2R A;  1T8E B;  2PER A;  2B7J A;  4MH3 A;  2C0F A;  3UOM A;  1G7O A;  4IBP A;  4FYB A;  3IBH A;  4IVF A;  1QMV A;  5DQY A;  3GKX A;  1U6T A;  3P7X A;  4IGJ A;  2DMM A;  4K5R A;  4JBB A;  4F03 A;  5IMF A;  1OC3 A;  2MBS A;  4DSS B;  2L4Q A;  3DKS A;  3FY7 A;  5IO0 A;  1XFL A;  4AKH A;  2YWO A;  2ON5 A;  4G2E A;  4HZ2 A;  4PGT A;  5A34 A;  1O8W A;  1TTZ A;  3F3Q A;  2H30 A;  4K0G A;  4XCS A;  1YKC A;  3GHA A;  3DWV A;  4MPG A;  5H5R A;  2AYT A;  3FR9 A;  2CAQ A;  5C04 A;  3NIV A;  1ZCP A;  5DBQ A;  2FA4 A;  2K9F A;  1Z3E A;  2H01 A;  3QCP A;  4TW5 A;  1GH2 A;  5D73 A;  1EV4 A;  1GSF A;  1ZYE A;  1WWJ A;  4ZL7 A;  5HR3 A;  1J9B A;  4Z7X A;  3UBK A;  2H74 A;  3IRA A;  2F3M A;  5ECO B;  2C4J A;  3KTB A;  1VF4 A;  5A1N A;  14GS A;  3E0U A;  4BWQ A;  2IFQ A;  1ZYP A;  3ZVJ A;  3CTG A;  10GS A;  4J57 E;  2YOI A;  1XCC A;  5ECQ B;  1H4O A;  1A2L A;  2QC7 A;  3UAR A;  3DVW A;  5G5E A;  3P90 A;  2A4H A;  3F4S A;  2GST A;  1A2M A;  2A2P A;  3W8S A;  6GSX A;  1XVQ A;  2REM A;  3H93 A;  2X64 A;  5JWO B;  3M9K A;  4GWR A;  3I9V 2;  2HRK A;  1V57 A;  4AJ7 A;  1X5C A;  2QA2 A;  4MJA A;  3DD3 A;  4IP6 A;  4V2M A;  2FWH A;  2FWG A;  2VIM A;  4ML6 A;  5CRD A;  2XPD A;  4N11 A;  8GSS A;  2R6K A;  4LMV A;  2UZ8 A;  3DIE A;  4Z2U A;  1TRW A;  4NAX A;  3CWG A;  4PNF A;  3LG6 A;  3MNG A;  4X0X A;  1THO A;  5F05 A;  1PKW A;  5IIZ A;  3UJ1 A;  1SJ6 A;  1SD9 A;  3HJO A;  4MLY A;  4IQA A;  5KOX A;  4AI6 A;  2O87 A;  1XWK A;  1XOB A;  2PMT A;  3DXB A;  1O73 A;  1K0D A;  3GKM A;  4FH8 A;  5J9B A;  3A5W A;  2IMI A;  4BWS A;  3LSZ A;  4TKY A;  2CQ9 A;  1F9M A;  2MMO A;  3GSS A;  5B7C A;  2JU5 A;  2GSQ A;  3GKN A;  4J56 E;  2NBS A;  1E2Y A;  1PRX A;  2B6M A;  2LEG A;  2AUV A;  1FAA A;  1KBN A;  1FOH A;  1B8X A;  2QSI A;  4YKG A;  1MDK A;  2B3S A;  4K6X A;  5G30 A;  3RDW A;  2CZ2 A;  4YKF A;  7GSS A;  3G7Y A;  5LNK e;  3VPQ A;  4BVX A;  2FWE A;  4O5U A;  1V58 A;  2HLS A;  5JWQ B;  1GUK A;  2V6O A;  2H19 A;  13GS A;  2F8F A;  3TOT A;  3F9U A;  3WT1 A;  1K3O A;  2CV4 A;  1ABA A;  2WUL A;  2JSZ A;  4RI7 A;  5KN1 A;  1U88 A;  4TXV A;  3PGT A;  2RM5 A;  5BMU B;  1URM A;  4K8M A;  3D21 A;  5DJM A;  4XS4 B;  2IMF A;  1PX7 A;  3KH9 A;  1AAZ A;  2OBI A;  1ST9 A;  5F8B A;  2XPE A;  4XS1 A;  2FY6 A;  2O7K A;  1ZZY A;  4GRF A;  3DGQ A;  2XC2 A;  5E4W A;  1ZMA A;  1MD3 A;  1DE2 A;  4KDY A;  2EIQ A;  2YPM A;  17GS A;  4JU5 A;  4EF0 A;  2CVK A;  3Q6O A;  1PN9 A;  3IA1 A;  4AKG A;  1EGR A;  4PUR A;  2WFC A;  1DE1 A;  3VWU A;  3J7Y k;  3F3R A;  4D73 B;  6GSY A;  2LJA A;  4G0K A;  4AKI A;  5IOX A;  4ECI A;  2LQQ A;  2L59 A;  4NPB A;  3BCK A;  1QQ2 A;  2LNT A;  5IMV A;  1USB A;  1T3B A;  3C8E A;  2H1A A;  2LTK A;  4HQZ A;  5ECN B;  5FWG A;  3VUR A;  4ZL9 A;  1XW6 A;  4ZBD A;  2HNL A;  4WBJ A;  3LFL A;  1SVM A;  2PU9 C;  2IN3 A;  1JHB A;  1GP1 A;  4L5O A;  2JZS A;  1VF2 A;  2H6Z A;  6GSU A;  1FHE A;  2R0G A;  2EC4 A;  3HHV A;  1TK8 B;  5CRW A;  3VK9 A;  2GLR A;  4KND A;  1N2A A;  4K2D A;  5ECP B;  3ZYW A;  3IE3 A;  1DSB A;  4PTS A;  2X4A A;  3L9V A;  3RHB A;  4LL4 B;  1WPI A;  1S3D A;  3HVV A;  3G7J A;  4RQX A;  1MD4 A;  1TXU A;  2R2J A;  3KGK A;  2HE3 A;  1SEN A;  2R0P A;  2IME A;  3ZL5 A;  4I5Q A;  4AJ6 A;  2MMZ A;  1TRV A;  2M72 A;  3MWH A;  1BYE A;  2LRT A;  2X99 A;  3KTL A;  2C80 A;  3LQ7 A;  2ON7 A;  1NHY A;  2TIR A;  3CSJ A;  4CDO A;  2K18 A;  5B8A A;  3FKF A;  3HVX A;  2R5G A;  1NW2 A;  1W89 A;  5A5K A;  5JCU A;  2TRX A;  4KX4 A;  3LXZ A;  1GTI A;  4IQ1 A;  2HZE A;  2HRA A;  5C00 A;  2GDR A;  4PX1 A;  4IW9 A;  4N0V A;  1A24 A;  3MAK A;  3GMF A;  3TKS C;  5FT3 A;  2J23 A;  1T4Y A;  1LU4 A;  2HXK A;  4G9H A;  1FW1 A;  1A2J A;  5G1K A;  1SL2 B;  2R37 A;  2GSS A;  1ILO A;  3TRP A;  1R5A A;  2H72 A;  1OYJ A;  2YWN A;  4WET A;  3TUE A;  2LV3 A;  3W8J A;  1UC7 A;  2RM6 A;  3A2W A;  2R3X A;  4X4J A;  4I2T A;  2GZZ A;  5HFG A;  2VM2 A;  4CY6 A;  3DRN A;  3UEM A;  3VWX A;  2LKU A;  1MDI A;  3GNJ A;  5CRH A;  2GT5 A;  3D6I A;  3LXT A;  1OE7 A;  2OA7 A;  1GNE A;  1XW9 A;  5J5N A;  2WJU A;  1K0C A;  4YH2 A;  4ZB9 A;  2OBK A;  3MYD A;  4TR1 A;  3BCI A;  4GCI A;  2LRC A;  3EIN A;  1EP7 A;  4I2U A;  3EVI A;  3DVX A;  2QGV A;  5ECM B;  1WMJ A;  5CRE A;  2C3Q A;  5E59 A;  1XVW A;  1PMT A;  3ZIJ A;  3ZMK A;  4PQ1 A;  5DAL B;  2A4V A;  5CP1 A;  3LOR A;  4KA0 A;  5F07 A;  2VCZ A;  2KLX A;  2ZCT A;  3LJR A;  2P31 A;  3EUR A;  3HVS A;  2K8V A;  4YQV A;  3GTU A;  1SL1 B;  1GUL A;  1R4W A;  3IHG A;  5AN1 A;  5GAN D;  2C1Y A;  3PIN A;  2EFD A;  3TCO A;  2DBC A;  3IV4 A;  4LLR A;  2KUC A;  2DJ3 A;  5CNW A;  1KTE A;  3NOF A;  3GUS A;  1WIK A;  5G1L A;  2WZ9 A;  2P5R A;  1FOV A;  5EPF A;  4NMU A;  4G01 A;  1XPV A;  4IKH A;  2H76 A;  22GS A;  2YZH A;  3F8U A;  3UBL A;  5ECH B;  1FVK A;  1U3I A;  3CBU A;  3D5J A;  2K8S A;  1TDI A;  4ECJ A;  4BL7 A;  3RBT A;  1XBS A;  1PKZ A;  5ECR B;  3IK7 A;  3O3T A;  3KIJ A;  3H79 A;  3FEU A;  3ERG A;  1YKA A;  3KJY A;  1BED A;  2TRC P;  3M1G A;  2I81 A;  2LUS A;  3APO A;  3EC3 A;  1FB6 A;  4MJC A;  2WDU A;  3UL3 A;  2M80 A;  2YWM A;  4ZBB A;  5KEJ A;  3GL3 A;  5D93 A;  5KN3 A;  4Q5R A;  1FG4 A;  3M8N A;  5IQY A;  5DAK A;  1M2B A;  1F3A A;  1AQV A;  2KHP A;  18GS A;  2YZU A;  1YF1 A;  4F2I A;  4WKW A;  2FWF A;  3HXS A;  4QL7 A;  1O8X A;  4PUF C;  2B5Y A;  4P3Y B;  4EC0 A;  2M46 A;  2VUP A;  3GYK A;  4K7O A;  1JZR A;  1TOF A;  1TXX A;  2DJ0 A;  3D22 A;  4ISD A;  2JL4 A;  1HNC A;  1F6M C;  2C0G A;  3HCZ A;  3A2V A;  3KH7 A;  3QMX A;  2NVL A;  4V1A g;  3GA4 A;  4KDX A;  2HI7 A;  4WBR D;  4JRR A;  5AGY A;  4ULX A;  2DC5 A;  1MEK A;  3ZFB A;  1Y1U A;  2H0G A;  4QMK A;  2B5X A;  2H1G A;  1SKW B;  1GSE A;  4PXO A;  2G0F A;  4EE0 A;  3TJG A;  1MDJ A;  1XWC A;  3HKR A;  4HJ2 A;  3EMX A;  3M3M A;  3GTU B;  3VWV A;  2VLU A;  3UMA A;  2JSY A;  3NZN A;  1TP9 A;  1V40 A;  4HDE A;  3H4K A;  1O6J A;  1G7E A;  5B6N A;  5CYY A;  2H66 A;  4IS0 A;  3GH9 A;  3DEX A;  3SBC A;  4TRX A;  4HOJ A;  2B5E A;  4CHS A;  1GSY A;  1GWC A;  5KN2 A;  5BRT A;  1A0F A;  1JLV A;  5DQS A;  4N30 A;  1O81 A;  2O85 A;  4K9Z A;  2YP6 A;  2WRT A;  1VF1 A;  2F9S A;  3GIX A;  1WP0 A;  3QD9 A;  5KN0 A;  1M99 A;  4JED A;  4N3Z A;  1B9X C;  2R4V A;  1CQG A;  3VLN A;  2LNS A;  2VL3 A;  2HYX A;  4J2F A;  1JZD A;  4EKZ A;  2B1K A;  4I6X A;  3FRC A;  4MK3 A;  5JCW A;  2CA8 A;  4JR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...