1XW5A

Human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 2
publication title Structural Perturbation of the Active Site of Human Glutathione-S-Transferase M2-2 Upon Ligand Binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xw5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw5A01
4ECCA 2R2JA 4IQAA 3FY7A 4MZWA 3KH9A 2VL2C 2AV4A 1SKWB 4Q5QA 3CRTA 3A2XA 1YEXA 4AJ7A 4L5OA 2MMAA 1F3BA 2R3XA 4NWYA 1XZOA 2FD3A 5J9BA 3F9UA 2VD0A 3TKQA 2N5AA 5IOWA 2VCTA 5A4UA 2CX3A 1DSBA 3GHAA 5CYYA 1VF1A 2QC7A 4K0NA 2H0HA 1K0OA 4XRDA 2IMFA 4IVFA 4TR0A 2V41A 1TK8B 5CRDA 3KP8A 4F2IA 1SU9A 3UIWA 4KSMA 2IN3A 1JZDA 2JZRA 2MBSA 5D8IA 4GF0A 1ML6A 2PMTA 1DE1A 3TB2A 3MDKA 3E9JB 4TR1B 1AQXA 4KGIA 3L9VA 4NPBA 1NHOA 2HZEB 4EF0A 3TUEA 1PSQA 1PRXA 2FY6A 2DJ3A 1OKTA 2O8VB 2ZNMA 3WGEA 1PMTA 4I2UA 5D73A 3CXGA 4CHSA 3GYKA 4MF6A 4QQ7A 3C73A 4HS1A 2HSHA 4OMVA 2H1DA 5KN2A 4K6XA 3ZFBA 2L57A 2OBKA 1Q4JA 2LUSA 1VF2A 3VPTA 1SYRA 4PQIA 2YANA 1B4PA 3J7Yb 2JZSA 1XOBA 1NHYA 1ZYQB 1LBKA 4FIWA 2WGRA 1LJRA 3N5OA 1JZOA 3QMXA 3GIXA 5JCUA 3GN3A 4HU9A 4ZB8A 3W6GA 1OYJA 3IXRA 4GXZA 2TIRA 5DDLA 1YF0A 4ILFA 2AAWA 1WWJA 4MJCA 2H6XA 1EZKA 5E4WA 1X5CA 3GRXA 3VURA 3EURA 4HJ2A 3TOTA 1EEJA 2KLXA 3TJKA 4ECIA 4WKWA 2CA8A 3FHKA 1ZL9A 2A2RA 1F9MA 2VAFA 4NAXA 3QFAC 3EU3A 3TKRA 3NOFA 1K3LA 2F3MA 3F3QA 4XS4B 3US3A 3KP9A 1BQ7A 2IWTA 3L0HA 2DJKA 1ERTA 4MZCA 5HR1A 1MEKA 4ML6A 4PGTA 5CREA 4GWRA 3HVVA 2HQTA 3ME8A 2H72A 2CVDA 1TRUA 5AN1A 4POKA 2OACA 3H1NA 2LTKA 3QFBC 3TGZA 5JCGA 3TKPA 2YV7A 5CRWA 4RI7A 1A24A 1EGRA 1FW1A 3GX0A 3KM6A 3G7YA 4OFTA 3KGKA 3FR3A 3FZ4A 2FCHA 2H75A 2YP6A 1ABAA 3EMPA 3HJOA 5G31A 1GSDA 4ID0A 2F9SA 2DJ1A 2WS2A 1XOAA 2J9HA 3H79A 2DSAA 3F63A 4RQRA 3TKSA 3APQA 3M8NA 5IMVA 2PPTA 1MDJA 5CP1A 2LJKA 2B5XA 5ECRB 3F8UA 4EDZA 1SK0A 2HSMA 2IJYA 4D73A 5J5NA 2HYXA 1Z9HA 5EPFA 5HFIA 2XBIA 3DKSA 5DVBA 2DBCA 2DLXA 5LCZA 4O32A 1T8EB 3IK9A 3DXBA 5J9CA 4LL4B 1WOUA 3GX8A 3QPMA 3RBTA 1G6YA 4KF9A 1A2JA 3HXSA 1GLPA 4KX4A 2O7KA 2VLTA 4PUAA 2WB9A 1GULA 4AJ8A 4LA1A 1URMA 1WMJA 3KTLA 5ECPB 2WFCA 4POBA 2LSTA 3Q74A 2AB6A 1XW9A 5GSSA 1U3IA 1LU4A 3LQ7A 5GSTA 1FB0A 5IO0A 1EV9A 3BD2A 4H86A 2CZ3A 2L6CA 3M9KA 3DGQA 2V6KA 2B5EA 3EVIA 3PINA 2HRFA 2VLVA 3TJGA 3HKRA 4HOJA 3TRQA 1HNCA 2IPAA 1EWXA 2K18A 2VUPA 4TXOA 2GVPA 4PNGA 2RM6A 5D9VA 4KDUA 1B48A 2OE0A 2O89A 2FA4A 4O92A 4JRRA 2F51A 2JSYA 4ML1A 3ZVJD 3WD6A 3IA1A 1VRSD 3M9JA 3LXTA 2GLRA 3IC8A 3TJBA 4NHWA 5DQYA 1USBA 5G1LA 3DYRA 3WGDA 3KD0A 3UL3A 1PL2A 1PX7A 2JACA 5JWRB 3HJPA 3I69A 2P0GA 2R6KA 3KJYA 4DSSA 2C0EA 1SYXA 1A8LA 3GH9A 2HNLA 3DVXA 3BOAA 3QCPA 4LL1B 2HSMB 4D73B 1N8JA 6GSSA 3ERGA 4OFNA 1N2AA 2B6MA 4MJEA 3DMLA 1C72A 4IP6A 1M9AA 2LRNA 2X8HA 4KH7A 4F0CA 3QR6A 1WRYA 3TDGA 2CVKA 2HRAA 2DMLA 2B5YA 1AW9A 3FRCA 1SL0B 2VM2A 1THXA 3FR6A 1J08A 1ON4A 3C8EA 2DJ0A 1GUKA 4TW5A 5AGYA 5ECNB 3IBHA 3C1SA 1K0AA 3GURA 3UOMA 2REMA 3UJ1A 1GSQA 2H76A 1O8WA 2PUKC 2LJRA 1GSFA 3GV1A 1A2MA 1U6TA 1YEPA 2H71A 2VL3A 2GQLA 3VI5A 4EE0A 1SJ6A 3UBLA 1GTBA 1JZWA 17GSA 2GZPA 1GLQA 1A23A 4AJ6A 3GTUA 5C04A 3NIVA 1ZZYA 2AYTA 1O81A 3LG6A 1ERWA 4RUVA 2HSNB 4RQXA 3MAKA 1BEDA 2DIYA 3IE3A 4KA0A 2K6VA 2J23A 1KTEA 2EIQA 4TXOB 1ST9A 5HQPA 4HZ2A 4IGJA 2XPEA 5CNWA 4V1Ap 1M2BA 1JLWA 5GAND 3CSJA 2G0FA 2YCDA 2A4VA 3F6FA 4K0GA 4ZL9A 5ECLB 4F9ZA 2H1AA 4ZBBA 5CRGA 1YJ6A 1G7EA 3RPPA 1A0RP 2FUG2 1R5AA 5DAKA 3HA9A 1HYUA 1B9XC 4ECBA 3IPZA 3PH9A 4DSSB 1JHBA 1B9YC 2I3YA 2VLUA 4I97A 1OC9B 4L0WA 5IMCA 1KNGA 3EE2A 3H4KA 1EP7A 1Z7RA 1V40A 4MABA 1ILOA 2JU5A 4OCEA 3DRNA 3SBCA 2IIYA 2YNXA 2AJQB 1M0UA 2QGVA 4HEA2 1UVZA 3O3TA 4FO5A 2YWIA 1S3CA 4JU5A 4G19A 1NM3A 6GSTA 3IK7A 3UEMA 1H75A 4MA9A 2VO4A 4WETA 3HJMA 2GT6A 4J57E 2P31A 4CW9A 1I9DA 2BMXA 2WULA 3ZLPA 1TI3A 2RUEA 2B1LA 4FYUA 3VWXA 2DMMA 4QL7A 1T3BA 1TOFA 2L4QA 4IJIA 2H6YA 2PBJA 3IOSA 4MJBA 3IAM2 2WDUA 3A2WA 1U88A 3M0FA 4N10A 3FK8A 3KTBA 4P3YB 2O87A 2HFDA 3ERFA 5D9TA 1H4OA 5AIXA 5DAKB 4EUYA 2H0IA 2KP1A 5DJLA 3G9BA 4YAPA 4USSA 1K0NA 5ECSA 3DVWA 5H5SA 4TRXA 3FEUA 4MPGA 3P90A 1QK8A 4MLYA 4POLA 1Y25A 2IMEA 3I43A 1QQ2A 4XTSA 5KEJA 3GL3A 2X8GA 1TK0B 4G9HA 1FVJA 1K3OA 2DJJA 1ZYEA 1TP9A 20GSA 1GH2A 1W89A 3ERWA 2LNSA 4JR4A 3LYKA 1AIUA 5ECHB 1Z6NA 2LRTA 1O6JA 3Q19A 4K7NA 4IS0A 3QAGA 4ULXA 3E3EA 2CAQA 19GSA 5B7CA 2C3QA 1G7OA 3GL5A 2RIIA 3QAVA 2FLSA 5D9XA 1BYEA 3LORA 3RAZA 4XS1A 4KAEA 4NHZA 3L4NA 4G0KA 5DQSA 4MK3A 3AY8A 4IJ3A 2I1UA 3DWVA 1AQWA 3APSA 5L71A 3EWLA 3FZ5A 1JLVA 3CBUA 1F3AA 3D5JA 5GAPD 4J2FA 2GS3A 1RQMA 2C0FA 2FA8A 3BJ5A 4HQZA 1V57A 3R2QA 4HZ4A 2FWEA 4BPYA 2P5QA 1X5EA 1SL1B 3ZYWA 2FHEA 4YQVA 1RK4A 4FH8A 4Q5NA 3IV4A 1OE7A 3PGTA 3GFKA 3WGXA 4GSTA 1FO5A 4WBJA 4G2EA 2B7KA 1SJZA 5IQYA 1GSUA 4IQ1A 4OO4A 3F3RA 1FHEA 2VIMA 3M3MA 2HXKA 4OWYA 4JZQA 2GQMA 4I6XA 4N11A 3MNGA 3KCMA 1BJXA 3BBYA 2YWMA 4WXTA 2JADA 1GL8A 4BL7A 4V2MA 2HT9A 4IKHA 1TRVA 1NSWA 4F82A 5CO3A 3K8NA 4MH2A 2MMNA 4KDYA 4K7IA 3CSIA 2PVOC 1OE8A 5ECQB 1PL1A 4ISDA 1I5GA 1YF1A 1XWGA 2PVQA 1V2AA 3D6IA 4MCUA 3GMFA 4HUAA 3HCZA 1SK1A 4PX1A 3GUSA 5ID2A 1M2AA 2R4VA 1A2LA 3G7IA 4G0LA 1QMVA 1YKAA 2GSQA 1FB6A 2ON7A 1U3AA 3GKKA 1SKSB 3ZZXA 4TKYA 3ZL5A 4WF4A 2JSZA 5ENUA 2IL3A 3HYPA 5G1KA 5HR3A 3DD3A 3LSZA 4RI6A 3N9JA 3ED3A 3UVHA 5DALA 1GSYA 2E2GA 3CRUA 1VGLA 7GSSA 1GWCA 5F8BA 4KCEA 4YQUA 5DCGA 2HRNA 2DIZA 5IPGA 5FHIA 2XBQA 4EC0A 4TR3A 4PURA 3H93A 1WJKA 5B6NA 1T4ZA 1GTAA 3LFLA 4MF7A 3IR4A 1YY7A 4BL7B 3D4MA 2LEGA 2VOCA 2NBSA 3KZQA 3FYGA 3SWLA 2GSTA 3R3EA 1XXUA 1T7PB 4NMUA 1UC7A 4GCIA 2LV3A 5HR2A 2GZZA 2M80A 3JCML 2MMOA 4KUNA 2H1GA 3V1WA 2OE1A 3C1RA 1DE2A 2VD1A 3RPNA 2HLSA 4PUFC 1IYHA 1AC1A 3CTGA 5EY6A 3C7MA 5ID2B 3A5WA 1AUCA 3EC3A 1BX9A 1OAZA 5ELGA 5JWOB 5J41A 1VF4A 2V1MA 2CVBA 3C71A 3HY2A 6GSVA 1Z6MA 2RUFA 4GSNA 2TRCP 1FOVA 4KW6A 1BAYA 1TKDB 4V2LA 5G5EA 2C8UA 5DALB 3QD9A 4KDXA 2RM5A 4ZB6A 1XWAA 4LMWA 4EL1A 1CQGA 3KXOA 5EVOA 1TRWA 4G0IA 2XPDA 3KH7A 2GGTA 1YDKA 3D0ZA 2VL9A 1PKZA 4IHUA 1QGVA 3WYWA 5A5KA 9GSSA 4YAVA 2QSIA 1SKRB 3EYTA 1K3YA 2WJUA 5KN0A 2Z9SA 3TRPA 3VPQA 5C00A 3VLNA 1SL2B 2V6OA 3EU4A 5IMDA 4N30A 4FYCA 2YZHA 1XWBA 4K1FA 2YZUA 1O8XA 5IOXA 1TU8A 3L9SA 4FQUA 2B1KA 3RHBA 1TXXA 1ERVA 5JWQB 1JFUA 4QL9A 1ZCPA 2C80A 4ECJA 1A0FA 4WF5A 6GSYA 2L4CA 1HNAA 2FWGA 3P2AA 2IFQA 4FYBA 5D9WA 3EMXA 4AF2A 2CV4A 2I9HA 5IMAA 4HU7A 2H01A 3UAPA 4XHMA 5INYA 1M2DA 3HZ4A 1X0RA 4L5LA 1DBYA 1GSSA 3O6TA 3IC4A 2N5BA 2MYGA 3U5RE 3FKFA 4TOPA 1MDKA 1ZGNA 3MSZA 10GSA 1M7TA 1X5DA 5IPHA 1TU7A 1TJDA 5LD0A 3RHCA 13GSA 1XW6A 3KEBA 2VCXA 3VI7A 2YV9A 1G6WA 3IAS2 4EVMA 5F06A 4TR1A 4E8HA 4OO5A 2EIRA 1KEBA 4MH3A 2H74A 4GQFA 2WRTA 3D4TA 1Y6EA 4DSQA 1GRXA 3HHVA 3ZIVA 5IMZA 4Z7XA 3VK9A 3CYNA 4TXVA 1EEMA 1SD9A 2L6DA 4X43A 2MZCA 3CTFA 1VF3A 2N5FA 2ON5A 1QXHA 3GTUB 3LGCA 1Z5YE 1RW1A 4ZL8A 1X9SB 2K8VA 2R5GA 4O5RA 2A2SA 1QFNA 4V1Ag 3QAWA 5D93A 4HDEA 4PQ1A 5KN3A 2GZYA 1S3AA 1TTZA 3I9V2 4EKZA 5GZZB 2NTOA 1YQ1A 2R37A 2IFQB 5A4VA 2GSSA 5EL8A 3ME7A 1B8XA 3OR5A 5JCWA 2NDOA 2OKAA 3HVXA 1F2EA 1ZMAA 8GSSA 1OC3A 2WCIA 3W8JA 2AHEA 1SD8A 4GQCA 3IDVA 4NV5A 2H0GA 4V2NA 1CQHA 3UBKA 4IN0A 1XWCA 3TJFA 2V32A 2HSYA 1TW9A 4MDCA 1J9BA 2E0QA 2IMKA 3F4RA 2I4AA 2PGTA 2KUCA 3M1GA 2GT5A 1FVKA 5CAXA 2PU9C 6GSWA 1S3DA 4JE1A 4XS4A 4J56E 2OBIA 2HI7A 2FWFA 2TRXA 3H8QA 4ZL7A 3GKMA 3ZMKA 2CZ2A 2C4JA 4K2DA 4IBPA 2LJAA 3GSTA 2HRKA 4K7OA 5COHA 5H5RA 4F0BA 2PN8A 2H1BA 5F07A 2H19A 2CT6A 1B4QA 12GSA 3TJJA 3ZIJA 4LLRA 2YWNA 2RLIA 1F37A 2M46A 4TR4A 2GQKA 2LKUA 1PX6A 1R5PA 1XVWA 2VL2A 2B7JA 1OKDA 3U6VA 1F6MC 2VCVA 2L59A 4DVCA 4ZIJA 5E59A 3LEFA 5G2ZA 2KHPA 1A8YA 5FT3A 1PN9A 4KSOA 1XCCA 3TRXA 2OADA 1V9WA 3GKNA 4NXIA 1GUHA 2I81A 2WZ9A 5KN1A 3F0IA 1R26A 4WR4A 3O76A 3UARA 2HZFA 4I8BA 2VCWA 3ZTLA 2QKEA 2E7PA 16GSA 2L5OA 3TKSC 1G0TA 2IMDA 1UN2A 5B8AA 1THOA 2V2GA 2LS5A 1M9BA 1IYIA 4PNFA 3P7XA 4XIHA 1K0CA 3G7JA 3RDWA 3EINA 4IELA 1FG4A 1GUMA 3KMNA 2AUVA 4GRFA 3FZAA 3ZREA 2YOIA 2HRKB 5IO2A 4WEYA 4BVXA 4AGSA 5IM9A 1T4YA 5HFGA 1EOGA 1GTIA 2X64A 3VWUA 1PA3A 4EXJA 3L78A 4MF5A 1OC8A 2VM1A 2OJLA 4PTSA 4BWQA 1XVQA 1TDIA 2YN1A 4WR5A 1YZXA 5DBQA 1MTCA 5IIZA 1ACVA 2EIOA 4MPFA 2BJXA 1HQOA 2YJ7A 3DEXA 4JEDA 5DJMA 3VWVA 2JL4A 5J3RA 2OE3A 3W8SA 4MMMA 4X0XA 3LJRA 1MD3A 2L5LA 4K9ZA 1WIKA 3HZ8A 2LQOA 5BMUA 4Q5FA 1Q98A 3ZMLA 2K9FA 4L0UA 1M99A 4BWSA 2C0DA 2YJHA 2GTUA 1ERUA 3S9FA 4O7HA 2CQ9A 1U87A 1AQVA 3CSHA 1HNBA 1GNEA 4MJAA 2XHFA 2VCQA 3Q18A 5HR0A 2YWOA 4OD7A 4GSSA 3FR9A 3HVSA 3IRAA 5H5QA 4XRAA 4ZXGA 4GTUA 4EDYA 3TKSE 1DUGA 2DC5A 1WE0A 1QUWA 5G30A 2F8AA 1YKCA 3ISOA 1HD2A 2ZCTA 4E8EA 3GA4A 4F03A 4I2TA 1JZRA 2OA7A 2ES7A 3FZ9A 2LRCA 2C0GA 1T1VA 1PGTA 4HQSA 4HI7A 1ZOFA 5LNKe 1V98A 4N0VA 3HD5A 1X9WB 3QDNA 4ZBAA 3GH6A 2FWHA 4KE3A 3UVTA 1WP0A 4WBRD 4BVXB 3D22A 1SJIA 1R7HA 2P5RA 3TOUA 2FGXA 2H66A 4CDOA 2DJ2A 2O85A 4N0ZA 4YH2A 4KCAA 5ABRA 3A3TA 4LMVA 2KOKA 2MMZA 4DEJA 1V58A 2CAIA 2M72A 2ZUPA 3BCKA 3E0UA 2JZTA 2ALBA 2NPBA 1AXDA 3DIEA 3A2VA 4ZB9A 3F6DA 11GSA 3D21A 3J7Yk 3WT2A 1XIYA 2VCZA 2C3NA 1GNWA 3VFIA 1TK5B 1GSEA 2CX4A 5HFKA 1BG5A 3ZITA 4NV2A 14GSA 1T00A 2PWJA 2YPMA 4K8MA 3L9UA 3PR8A 4GLTA 3FW2A 3QOUA 2XC2A 1XW5A 4ZILA 2NVLA 5D96A 2G2QA 1E2YA 5G5FA 1R4WA 1TI1A 3ZFLA 1PKWA 1OC9A 6GSXA 2EC4A 2H30A 1EP8A 2GDRA 1X9MB 2UZ8A 3GSSA 3KMOA 2H73A 22GSA 3HDCA 3LXZA 5AISA 4BVYA 2BTOT 1O7UA 1K0MA 4L8EA 3F4SA 4MZBA 1WPIA 2X8CA 1PQNA 3KIJA 4ACSA 3BCIA 1Z3EA 4DSRA 5A4WA 3IHQA 2LNTA 5F05A 3WT1A 5IMFA 2K8SA 4X1UA 4KB3A 5AIVA 4IP1A 4MP4A 5ECOB 1PD21 4Q5RA 2C3TA 5DCHA 3CMIA 4POMA 2H70A 4IW9A 3MWHA 4JR6A 3TCOA 2MBTA 4ZBDA 2IMIA 4OFMA 1MD4A 1XPVA 4EO3A 4PXOA 1TRSA 3P8WA 1J0FA 1Z7PA 1MDIA 4KNDA 1O85A 2HE3A 2KP2A 2F8FA 4I5QA 1UA5A 3Q6OA 1W4VA 2GSRA 3UMAA 4TVEA 2FNOA 2D2ZA 4PQHA 5ECMB 5FWGA 18GSA 3I6AA 5F0GA 5J4UA 1AAZA 3ZVJA 1FAAA 4BA7A 4HJMA 2HZEA 4OCFA 5B8BA 4XS6A 2E2MA 3GKXA 3NZNA 3APOA 1NW2A 2C1YA 4JBBA 5ELAA 5B6MA 2PERA 1K0BA 2LQQA 2X99A 4BVYB 5ECKB 1OVNA 2H8LA 3VWWA 1KBNA 1GP1A 6GSUA 1SK2A 2B3SA 4YQMA 1XWKA 3GNJA 1K0DA 3PPUA 5CRHA 1EOHA 1EGOA 5ECIB 1XFLA 4G10A 1EV4A 3LYPA 3LWAA 4XCSA 1SENA 3F4TA 1XBSA 1GTUA 3ZRDA 4TN8A 1O73A 2H6ZA 1E6BA
chains in the Genus database with same CATH superfamily
4ECCA 2R2JA 4IQAA 3FY7A 4MZWA 3KH9A 2VL2C 2AV4A 2R0CA 1SKWB 4Q5QA 3CRTA 3A2XA 1YEXA 4AJ7A 4L5OA 2MMAA 1F3BA 2R3XA 4NWYA 1XZOA 2FD3A 5J9BA 3F9UA 2VD0A 3TKQA 2N5AA 5IOWA 2VCTA 5A4UA 2CX3A 1DSBA 3GHAA 5CYYA 1VF1A 2QC7A 4K0NA 2H0HA 1K0OA 4XRDA 2IMFA 4IVFA 4TR0A 2V41A 1TK8B 5CRDA 3KP8A 4F2IA 1SU9A 3UIWA 4KSMA 2IN3A 1JZDA 2JZRA 2MBSA 5D8IA 4GF0A 1ML6A 2PMTA 1DE1A 3TB2A 3MDKA 3E9JB 4TR1B 1AQXA 4KGIA 3L9VA 4NPBA 1NHOA 2HZEB 4EF0A 2QA2A 3TUEA 1PSQA 1PRXA 2FY6A 2DJ3A 1OKTA 2O8VB 2ZNMA 5KOWA 3WGEA 1PMTA 4I2UA 5D73A 3CXGA 4CHSA 3GYKA 4MF6A 4QQ7A 3C73A 4HS1A 2HSHA 4OMVA 2H1DA 5KN2A 4K6XA 3ZFBA 2L57A 2OBKA 1Q4JA 2LUSA 1VF2A 3VPTA 1SYRA 4PQIA 2YANA 1B4PA 3J7Yb 5A5HB 2JZSA 1XOBA 1NHYA 1ZYQB 1LBKA 4FIWA 2WGRA 1ZYNA 1LJRA 3N5OA 1JZOA 3QMXA 3GIXA 5JCUA 3GN3A 4HU9A 4ZB8A 4AKIA 3W6GA 1OYJA 3MYDA 3A5IA 3IXRA 4ZB7A 4GXZA 2TIRA 5DDLA 1YF0A 4ILFA 2AAWA 1WWJA 4MJCA 2H6XA 1EZKA 5E4WA 1X5CA 3GRXA 3VURA 3EURA 4HJ2A 3TOTA 1EEJA 2KLXA 3TJKA 4ECIA 4WKWA 2CA8A 3FHKA 1ZL9A 2A2RA 1F9MA 2VAFA 4NAXA 5J40A 3QFAC 3EU3A 3TKRA 3NOFA 1K3LA 2F3MA 3F3QA 4XS4B 3US3A 3KP9A 1BQ7A 2IWTA 3L0HA 2DJKA 1ERTA 4MZCA 5HR1A 1MEKA 4ML6A 4PGTA 5CREA 4GWRA 3HVVA 2HQTA 3ME8A 2H72A 2CVDA 1TRUA 5AN1A 4POKA 2OACA 3H1NA 2LTKA 3QFBC 3TGZA 5JCGA 1PFOA 3TKPA 2YV7A 5CRWA 4RI7A 1A24A 1EGRA 3GX0A 1FW1A 3KM6A 3G7YA 4OFTA 3KGKA 1ZYPA 3FR3A 3FZ4A 2FCHA 2H75A 2YP6A 1ABAA 3EMPA 3HJOA 5G31A 1GSDA 4ID0A 2F9SA 2WW3A 2DJ1A 4AKXB 2WS2A 1XOAA 2J9HA 3H79A 2DSAA 3F63A 4RQRA 2O36A 3TKSA 3APQA 3M8NA 2EFDA 5IMVA 2PPTA 1MDJA 5CP1A 2LJKA 2B5XA 4W66A 5ECRB 3F8UA 4EDZA 1SK0A 1SVMA 2HSMA 2IJYA 4D73A 5J5NA 4BIKA 2HYXA 1Z9HA 5EPFA 5HFIA 2XBIA 3DKSA 5DVBA 2DBCA 2DLXA 5LCZA 4O32A 1T8EB 4ICYA 3IK9A 3DXBA 5J9CA 4LL4B 1WOUA 3GX8A 3QPMA 3RBTA 1G6YA 4KF9A 1A2JA 3HXSA 1GLPA 4KX4A 2O7KA 2VLTA 4PUAA 2WB9A 1GULA 4AJ8A 4LA1A 4E68A 1URMA 1WMJA 2X49A 3KTLA 5ECPB 2WFCA 4POBA 2LSTA 3Q74A 2AB6A 1XW9A 2WW1A 5GSSA 1U3IA 1LU4A 3LQ7A 5GSTA 1FB0A 5IO0A 1EV9A 3BD2A 4H86A 2CZ3A 2L6CA 3M9KA 3DGQA 2V6KA 2B5EA 3EVIA 3PINA 2HRFA 4AI6A 2VLVA 3TJGA 3HKRA 4HOJA 3TRQA 1HNCA 2IPAA 1EWXA 2K18A 2VUPA 4TXOA 2GVPA 4PNGA 2RM6A 5D9VA 4KDUA 1B48A 2OE0A 2O89A 2FA4A 4O92A 4JRRA 2F51A 2JSYA 4ML1A 3ZVJD 3WD6A 3IA1A 1VRSD 3M9JA 3LXTA 2GLRA 3IC8A 3TJBA 4NHWA 5DQYA 1USBA 5G1LA 3DYRA 3WGDA 3KD0A 3UL3A 1PL2A 4O5QA 1PX7A 2JACA 5JWRB 3HJPA 3I69A 2P0GA 2R6KA 3KJYA 4DSSA 2C0EA 1SYXA 1A8LA 3GH9A 2HNLA 3DVXA 3BOAA 3QCPA 4LL1B 2HSMB 4D73B 1N8JA 6GSSA 3ERGA 4OFNA 1N2AA 2B6MA 4MJEA 3DMLA 1C72A 4IP6A 1M9AA 2LRNA 2X8HA 4KH7A 4F0CA 3QR6A 1WRYA 3TDGA 2CVKA 2HRAA 2DMLA 2B5YA 1AW9A 3FRCA 1SL0B 2VM2A 1THXA 3FR6A 1J08A 1ON4A 3C8EA 2DJ0A 1GUKA 4TW5A 5AGYA 5ECNB 3IBHA 3C1SA 1K0AA 3GURA 3UOMA 2REMA 3UJ1A 1GSQA 2H76A 1O8WA 2PUKC 3GV1A 2LJRA 1GSFA 1A2MA 1U6TA 1YEPA 2H71A 2VL3A 2GQLA 3VI5A 4EE0A 1SJ6A 3UBLA 1GTBA 1JZWA 17GSA 2GZPA 2WZSA 1GLQA 1A23A 4AJ6A 3GTUA 5C04A 1N25A 3NIVA 1ZZYA 4EIPA 2AYTA 1O81A 3LG6A 1ERWA 4RUVA 2HSNB 4RQXA 3MAKA 1BEDA 2DIYA 3IE3A 4KA0A 5J47A 2K6VA 1XG8A 2J23A 1KTEA 2EIQA 4TXOB 1ST9A 5HQPA 4HZ2A 4IGJA 2XPEA 5CNWA 4V1Ap 1M2BA 1JLWA 5GAND 3CSJA 2G0FA 2YCDA 2A4VA 3F6FA 4K0GA 4ZL9A 5ECLB 4YKGA 4F9ZA 2H1AA 4ZBBA 5CRGA 1YJ6A 1G7EA 3RPPA 1A0RP 2FUG2 1R5AA 5DAKA 3HA9A 1HYUA 1B9XC 4N3ZA 4ECBA 3IPZA 3PH9A 4DSSB 1JHBA 2WVYA 1B9YC 2I3YA 2VLUA 4I97A 1OC9B 4L0WA 5IMCA 1KNGA 3EE2A 3H4KA 1EP7A 1Z7RA 1V40A 4MABA 1ILOA 4Z2UA 2JU5A 4OCEA 4Z2RA 3DRNA 3SBCA 2IIYA 2YNXA 2AJQB 1M0UA 2QGVA 4HEA2 1UVZA 3O3TA 4FO5A 2YWIA 1S3CA 4JU5A 4G19A 1NM3A 6GSTA 3IK7A 3UEMA 1H75A 4MA9A 2VO4A 4WETA 3HJMA 2GT6A 1S4BP 4AKHA 4J57E 2P31A 4CW9A 1I9DA 2BMXA 2WULA 3ZLPA 1TI3A 2RUEA 2B1LA 4FYUA 3VWXA 2DMMA 4QL7A 1T3BA 1TOFA 2L4QA 4IJIA 2H6YA 2PBJA 3IOSA 4MJBA 3IAM2 2WDUA 3A2WA 1U88A 3M0FA 1M3JA 4N10A 3FK8A 3KTBA 2EFHA 4P3YB 2O87A 2HFDA 3ERFA 5D9TA 1H4OA 5AIXA 5DAKB 4EUYA 2H0IA 2KP1A 5DJLA 3G9BA 4YAPA 4USSA 1K0NA 5ECSA 5A1NA 3DVWA 5H5SA 4TRXA 3FEUA 4MPGA 3P90A 1QK8A 4MLYA 4POLA 1Y25A 2IMEA 3I43A 1QQ2A 4XTSA 5KEJA 3GL3A 2X8GA 1TK0B 4G9HA 1FVJA 1K3OA 2DJJA 1SVOA 1ZYEA 1TP9A 20GSA 1GH2A 1W89A 3ERWA 2LNSA 4JR4A 3LYKA 1AIUA 5ECHB 1Z6NA 2LRTA 1O6JA 3Q19A 4K7NA 4IS0A 3QAGA 4ULXA 3E3EA 2CAQA 19GSA 5B7CA 2C3QA 1G7OA 3GL5A 2RIIA 3QAVA 2FLSA 5D9XA 1BYEA 3LORA 3RAZA 4XS1A 4KAEA 4NHZA 3L4NA 4K5SA 4G0KA 5DQSA 4MK3A 3AY8A 2I1UA 4IJ3A 3DWVA 1AQWA 3APSA 5L71A 3EWLA 3FZ5A 1JLVA 3CBUA 1F3AA 3D5JA 5GAPD 4J2FA 2GS3A 1RQMA 3TU3B 2C0FA 2FA8A 4CY8A 3BJ5A 4HQZA 2O3EA 1V57A 3R2QA 4HZ4A 2FWEA 4BPYA 2P5QA 1X5EA 1SL1B 3ZYWA 2FHEA 4YQVA 1RK4A 4FH8A 4Q5NA 3IV4A 1OE7A 3PGTA 3GFKA 3WGXA 4GSTA 5J4VA 1FO5A 4WBJA 4G2EA 2B7KA 1SJZA 5IQYA 2DKHA 1GSUA 4IQ1A 4OO4A 3F3RA 5A1NB 1FHEA 2VIMA 4GDFA 3M3MA 2HXKA 4OWYA 4JZQA 2GQMA 4I6XA 4N11A 3MNGA 3KCMA 1BJXA 3BBYA 2YWMA 4WXTA 2JADA 3HVNA 1GL8A 4BL7A 4V2MA 2HT9A 4IKHA 1TRVA 1NSWA 4F82A 5CO3A 3RGBC 3K8NA 4MH2A 2MMNA 4KDYA 4K7IA 1Y1UA 3CSIA 2PVOC 1OE8A 5ECQB 1PL1A 4CY6A 4ISDA 2QA1A 1I5GA 1YF1A 1XWGA 2PVQA 1V2AA 3D6IA 4MCUA 3GMFA 4HUAA 3HCZA 1SK1A 4PX1A 3GUSA 5ID2A 1M2AA 5BRTA 2R4VA 1A2LA 3G7IA 4G0LA 1QMVA 1YKAA 2GSQA 1FB6A 2X4AA 2WW0A 3IHGA 2ON7A 1U3AA 3GKKA 1SKSB 3ZZXA 4TKYA 3ZL5A 4WF4A 2JSZA 5ENUA 2IL3A 3HYPA 5G1KA 5HR3A 4K2XA 3DD3A 3LSZA 4RI6A 3N9JA 1BF5A 3ED3A 3UVHA 5DALA 1GSYA 2E2GA 3CRUA 1VGLA 7GSSA 1GWCA 5F8BA 4EIQA 4KCEA 2R0PA 4YQUA 5DCGA 2HRNA 2DIZA 5IPGA 5FHIA 2XBQA 4EC0A 4TR3A 4PURA 3H93A 1WJKA 5B6NA 1T4ZA 1GTAA 3LFLA 4MF7A 3IR4A 1YY7A 4BL7B 3D4MA 2LEGA 2VOCA 2NBSA 3KZQA 3FYGA 3SWLA 2GSTA 3R3EA 1XXUA 1T7PB 4NMUA 1UC7A 4GCIA 2LV3A 5HR2A 2GZZA 2M80A 3JCML 2MMOA 4KUNA 2H1GA 3V1WA 2OE1A 3C1RA 1DE2A 2VD1A 3RPNA 2HLSA 4PUFC 1IYHA 1AC1A 3CTGA 5EY6A 3C7MA 5ID2B 3A5WA 1AUCA 3EC3A 1BX9A 1OAZA 5ELGA 5JWOB 5J41A 4K5RA 1VF4A 4PHZC 2V1MA 5J4YA 2CVBA 3C71A 3HY2A 6GSVA 1Z6MA 2RUFA 4GSNA 2TRCP 1FOVA 4KW6A 1BAYA 1TKDB 4V2LA 5G5EA 2C8UA 5DALB 3QD9A 4KDXA 2RM5A 3LW9A 4ZB6A 1XWAA 2H1LA 4LMWA 4EL1A 1CQGA 3KXOA 5EVOA 1TRWA 4G0IA 2XPDA 3KH7A 2GGTA 1YDKA 3D0ZA 4X4JA 2VL9A 1PKZA 4IHUA 1QGVA 3WYWA 5A5KA 9GSSA 4YAVA 2QSIA 1YVLA 1SKRB 3EPTA 3EYTA 1K3YA 2WJUA 5KN0A 2Z9SA 5A34A 3TRPA 3VPQA 5C00A 3VLNA 1SL2B 2V6OA 3EU4A 5IMDA 4N30A 2UV8G 4FYCA 2YZHA 1XWBA 4K1FA 2YZUA 1O8XA 5IOXA 1TU8A 3L9SA 4FQUA 2B1KA 2OT3A 3RHBA 1TXXA 1ERVA 5JWQB 1JFUA 4QL9A 1ZCPA 2C80A 4ECJA 1A0FA 4WF5A 6GSYA 2L4CA 1HNAA 2FWGA 3P2AA 2IFQA 4FYBA 1BG1A 5D9WA 1M3IA 3EMXA 4AF2A 2CV4A 2I9HA 5IMAA 4HU7A 2H01A 3UAPA 4XHMA 5INYA 1M2DA 3HZ4A 1X0RA 4L5LA 1DBYA 1GSSA 3O6TA 3IC4A 2N5BA 2MYGA 3U5RE 3FKFA 4TOPA 1MDKA 1ZGNA 3MSZA 10GSA 1M7TA 1X5DA 5IPHA 1TU7A 1TJDA 5LD0A 3RHCA 2VKZG 13GSA 1XW6A 3KEBA 2VCXA 3MIXA 3VI7A 2YV9A 1G6WA 3IAS2 4EVMA 5F06A 3HMJG 4TR1A 4E8HA 4OO5A 2EIRA 1KEBA 4MH3A 2H74A 4GQFA 2WRTA 3D4TA 1Y6EA 4DSQA 1GRXA 3HHVA 3ZIVA 5IMZA 4Z7XA 3VK9A 3CYNA 4TXVA 1EEMA 3RFRC 1SD9A 2L6DA 4X43A 2MZCA 3CTFA 1VF3A 2N5FA 2ON5A 4A5PA 1QXHA 3GTUB 3LGCA 1Z5YE 1RW1A 4ZL8A 1X9SB 2K8VA 2R5GA 4O5RA 2A2SA 1QFNA 4V1Ag 3QAWA 5D93A 4HDEA 4PQ1A 5KN3A 2GZYA 1S3AA 1TTZA 3I9V2 4EKZA 5GZZB 2NTOA 3CQFA 3CHXC 1YQ1A 2R37A 2IFQB 5A4VA 2GSSA 5EL8A 3ME7A 1B8XA 3OR5A 5JCWA 2NDOA 2OKAA 3HVXA 1F2EA 1ZMAA 8GSSA 1OC3A 2WCIA 3W8JA 2AHEA 1SD8A 4GQCA 3IDVA 4NV5A 2H0GA 4V2NA 1CQHA 3UBKA 4IN0A 1XWCA 3TJFA 2V32A 2HSYA 1TW9A 4MDCA 1J9BA 2E0QA 2IMKA 3F4RA 2A4HA 2PGTA 2I4AA 2KUCA 3M1GA 2GT5A 1FVKA 4HSCX 5CAXA 2PU9C 6GSWA 1S3DA 4JE1A 4XS4A 4J56E 2OBIA 2HI7A 2FWFA 2TRXA 3H8QA 4ZL7A 3GKMA 3ZMKA 2CZ2A 2C4JA 4O5UA 4K2DA 4IBPA 2LJAA 3GSTA 2HRKA 4K7OA 5COHA 5H5RA 4F0BA 2PN8A 2H1BA 5F07A 2H19A 2CT6A 1B4QA 12GSA 3TJJA 3ZIJA 4LLRA 2YWNA 2RLIA 1F37A 2M46A 4TR4A 2GQKA 2LKUA 1PX6A 1R5PA 1XVWA 2VL2A 2B7JA 1OKDA 3U6VA 1F6MC 2VCVA 5KOXA 2L59A 4DVCA 4ZIJA 5E59A 3LEFA 4QMKA 5G2ZA 2KHPA 1A8YA 5FT3A 1PN9A 4KSOA 1XCCA 4FXYP 3TRXA 2OADA 1V9WA 3GKNA 2EFCA 4NXIA 1GUHA 2I81A 2WZ9A 5KN1A 3F0IA 1R26A 4WR4A 3O76A 3UARA 2HZFA 4I8BA 2VCWA 3ZTLA 2QKEA 2E7PA 16GSA 2L5OA 3TKSC 1G0TA 2IMDA 1UN2A 5B8AA 1THOA 2V2GA 2LS5A 1M9BA 1IYIA 4PNFA 3P7XA 2WVXA 1I1IP 4XIHA 1K0CA 3G7JA 3RDWA 3EINA 4IELA 1FG4A 1GUMA 3KMNA 2AUVA 4GRFA 3FZAA 3ZREA 2YOIA 2HRKB 5IO2A 4WEYA 4BVXA 4AGSA 5IM9A 1T4YA 5HFGA 1EOGA 1GTIA 2X64A 3VWUA 1PA3A 4EXJA 3L78A 4MF5A 1OC8A 1SVLA 2VM1A 2OJLA 4PTSA 4BWQA 1XVQA 1TDIA 2YN1A 4WR5A 1YZXA 5DBQA 1MTCA 5IIZA 1ACVA 2EIOA 4MPFA 2BJXA 1HQOA 2YJ7A 3DEXA 4JEDA 5DJMA 3VWVA 2JL4A 5J3RA 2OE3A 3W8SA 4MMMA 4X0XA 3LJRA 4PI2C 1MD3A 4Z2TA 2L5LA 4K9ZA 1WIKA 3HZ8A 2LQOA 5BMUA 4Q5FA 1Q98A 3ZMLA 2K9FA 4L0UA 1M99A 4BWSA 2C0DA 2YJHA 2GTUA 1ERUA 3S9FA 4O7HA 2CQ9A 1U87A 1AQVA 3CSHA 1HNBA 1GNEA 4MJAA 2XHFA 2VCQA 3Q18A 5HR0A 2YWOA 4OD7A 4GSSA 3FR9A 3HVSA 3IRAA 5H5QA 4XRAA 4ZXGA 4GTUA 4EDYA 3TKSE 1DUGA 2DC5A 1WE0A 1QUWA 5G30A 2WVXB 2F8AA 1YKCA 3ISOA 1HD2A 2ZCTA 4E8EA 3GA4A 4F03A 4I2TA 1JZRA 2OA7A 2ES7A 3FZ9A 2LRCA 2C0GA 1T1VA 1PGTA 4HQSA 4HI7A 1ZOFA 5LNKe 1V98A 4N0VA 3HD5A 2R0GA 1X9WB 3QDNA 4ZBAA 3GH6A 2FWHA 4KE3A 1YEWC 3UVTA 1WP0A 4WBRD 4BVXB 3D22A 1SJIA 2EFEA 1R7HA 2P5RA 3TOUA 2FGXA 2H66A 4CDOA 2DJ2A 2O85A 4N0ZA 4YH2A 4KCAA 5ABRA 3A3TA 4LMVA 2KOKA 2MMZA 4DEJA 1V58A 2CAIA 2M72A 2ZUPA 2HSNA 2WVZA 3BCKA 3E0UA 2JZTA 4MNNA 2WW2A 2ALBA 2NPBA 1AXDA 4AKGA 3DIEA 3A2VA 4ZB9A 3F6DA 11GSA 3D21A 3J7Yk 3WT2A 1XIYA 2VCZA 2C3NA 1GNWA 3VFIA 1TK5B 1GSEA 1PN0A 5BMUB 2CX4A 5HFKA 1BG5A 3ZITA 4NV2A 14GSA 1T00A 2PWJA 1FOHA 2YPMA 4K8MA 3L9UA 3PR8A 4GLTA 3FW2A 3QOUA 2XC2A 1XW5A 4ZILA 2NVLA 5D96A 2G2QA 1E2YA 5G5FA 1R4WA 1TI1A 3ZFLA 1PKWA 1OC9A 6GSXA 2EC4A 2H30A 1EP8A 2GDRA 1X9MB 2UZ8A 3GSSA 3KMOA 2H73A 22GSA 3HDCA 3LXZA 5AISA 4BVYA 2BTOT 1O7UA 1K0MA 4L8EA 3F4SA 4MZBA 1WPIA 2X8CA 1PQNA 3KIJA 4YKFA 4ACSA 3BCIA 1Z3EA 4DSRA 5A4WA 3IHQA 2LNTA 5F05A 3WT1A 5IMFA 2K8SA 4X1UA 4KB3A 5AIVA 4IP1A 4MP4A 5ECOB 1PD21 4Q5RA 2A2PA 2C3TA 5DCHA 3CMIA 4POMA 2H70A 4IW9A 3MWHA 4JR6A 3TCOA 2MBTA 4ZBDA 2IMIA 4OFMA 1MD4A 1XPVA 4EO3A 4PXOA 1TRSA 3P8WA 1J0FA 1Z7PA 1MDIA 4KNDA 1O85A 2HE3A 2KP2A 2F8FA 4I5QA 1UA5A 3Q6OA 1W4VA 2GSRA 3UMAA 4TVEA 2FNOA 4G01A 2D2ZA 4PQHA 5ECMB 5FWGA 18GSA 3I6AA 5F0GA 5J4UA 3CWGA 2O5VA 1AAZA 3ZVJA 1FAAA 2DKIA 4BA7A 4HJMA 2HZEA 4OCFA 5B8BA 4XS6A 2E2MA 3GKXA 3NZNA 3APOA 1NW2A 2C1YA 4JBBA 5ELAA 5B6MA 2PERA 1K0BA 2LQQA 2X99A 4BVYB 5A34B 5ECKB 1OVNA 3FMWA 2H8LA 3VWWA 1KBNA 1GP1A 6GSUA 1SK2A 2B3SA 4YQMA 1XWKA 3GNJA 1K0DA 3PPUA 5CRHA 1EOHA 1EGOA 1TXUA 5ECIB 1XFLA 4G10A 1EV4A 3LYPA 3LWAA 4XCSA 1SENA 4PI0C 1S3RA 3F4TA 1XBSA 1GTUA 3ZRDA 5A5HA 4TN8A 1O73A 2H6ZA 1E6BA
chains in the Genus database with same CATH topology
4ECCA 2R2JA 4IQAA 3FY7A 4MZWA 3KH9A 2VL2C 2AV4A 2R0CA 1SKWB 4Q5QA 3CRTA 3A2XA 1YEXA 4AJ7A 4L5OA 2MMAA 1F3BA 2R3XA 4NWYA 1XZOA 2FD3A 5J9BA 3F9UA 2VD0A 3TKQA 2N5AA 5IOWA 2VCTA 5A4UA 2CX3A 1DSBA 3GHAA 5CYYA 1VF1A 2QC7A 4K0NA 2H0HA 1K0OA 4XRDA 2IMFA 4IVFA 4TR0A 2V41A 1TK8B 5CRDA 3KP8A 4F2IA 1SU9A 3UIWA 4KSMA 2IN3A 1JZDA 2JZRA 2MBSA 5D8IA 4GF0A 1ML6A 2PMTA 1DE1A 3TB2A 3MDKA 3E9JB 4TR1B 1AQXA 4KGIA 3L9VA 4NPBA 1NHOA 2HZEB 4EF0A 2QA2A 3TUEA 1PSQA 1PRXA 2FY6A 2DJ3A 1OKTA 2O8VB 2ZNMA 5KOWA 3WGEA 1PMTA 4I2UA 5D73A 3CXGA 4CHSA 3GYKA 4MF6A 4QQ7A 3C73A 4HS1A 2HSHA 4OMVA 2H1DA 5KN2A 4K6XA 3ZFBA 2L57A 2OBKA 1Q4JA 2LUSA 1VF2A 3VPTA 1SYRA 4PQIA 2YANA 1B4PA 3J7Yb 5A5HB 2JZSA 1XOBA 1NHYA 1ZYQB 1LBKA 4FIWA 2WGRA 1ZYNA 1LJRA 3N5OA 1JZOA 3QMXA 3GIXA 5JCUA 3GN3A 4HU9A 4ZB8A 4AKIA 3W6GA 1OYJA 3MYDA 3A5IA 3IXRA 4ZB7A 4GXZA 2TIRA 5DDLA 1YF0A 4ILFA 2AAWA 1WWJA 4MJCA 2H6XA 1EZKA 5E4WA 1X5CA 3GRXA 3VURA 3EURA 4HJ2A 3TOTA 1EEJA 2KLXA 3TJKA 4ECIA 4WKWA 2CA8A 3FHKA 1ZL9A 2A2RA 1F9MA 2VAFA 4NAXA 5J40A 3QFAC 3EU3A 3TKRA 3NOFA 1K3LA 2F3MA 3F3QA 4XS4B 3US3A 3KP9A 1BQ7A 2IWTA 3L0HA 2DJKA 1ERTA 4MZCA 5HR1A 1MEKA 4ML6A 4PGTA 5CREA 4GWRA 3HVVA 2HQTA 3ME8A 2H72A 2CVDA 1TRUA 5AN1A 4POKA 2OACA 3H1NA 2LTKA 3QFBC 3TGZA 5JCGA 3TKPA 2YV7A 5CRWA 4RI7A 1A24A 1EGRA 1FW1A 3GX0A 3KM6A 3G7YA 4OFTA 3KGKA 1ZYPA 3FR3A 3FZ4A 2FCHA 2H75A 2YP6A 1ABAA 3EMPA 3HJOA 5G31A 1GSDA 4ID0A 2F9SA 2DJ1A 4AKXB 2WS2A 1XOAA 2J9HA 3H79A 2DSAA 3F63A 4RQRA 3TKSA 3APQA 3M8NA 2EFDA 5IMVA 2PPTA 1MDJA 5CP1A 2LJKA 2B5XA 4W66A 5ECRB 3F8UA 4EDZA 1SK0A 1SVMA 2HSMA 2IJYA 4D73A 5J5NA 2HYXA 1Z9HA 5EPFA 5HFIA 2XBIA 3DKSA 5DVBA 2DBCA 2DLXA 5LCZA 4O32A 1T8EB 4ICYA 3IK9A 3DXBA 5J9CA 4LL4B 1WOUA 3GX8A 3QPMA 3RBTA 1G6YA 4KF9A 1A2JA 3HXSA 1GLPA 4KX4A 2O7KA 2VLTA 4PUAA 2WB9A 1GULA 4AJ8A 4LA1A 4E68A 1URMA 1WMJA 2X49A 3KTLA 5ECPB 2WFCA 4POBA 2LSTA 3Q74A 2AB6A 1XW9A 5GSSA 1U3IA 1LU4A 3LQ7A 5GSTA 1FB0A 5IO0A 1EV9A 3BD2A 4H86A 2CZ3A 2L6CA 3M9KA 3DGQA 2V6KA 2B5EA 3EVIA 3PINA 2HRFA 4AI6A 2VLVA 3TJGA 3HKRA 4HOJA 3TRQA 1HNCA 2IPAA 1EWXA 2K18A 2VUPA 4TXOA 2GVPA 4PNGA 2RM6A 5D9VA 4KDUA 1B48A 2OE0A 2O89A 2FA4A 4O92A 4JRRA 2F51A 2JSYA 4ML1A 3ZVJD 3WD6A 3IA1A 1VRSD 3M9JA 3LXTA 2GLRA 3IC8A 3TJBA 4NHWA 5DQYA 1USBA 5G1LA 3DYRA 3WGDA 3KD0A 3UL3A 1PL2A 4O5QA 1PX7A 2JACA 5JWRB 3HJPA 3I69A 2P0GA 2R6KA 3KJYA 4DSSA 2C0EA 1SYXA 1A8LA 3GH9A 2HNLA 3DVXA 3BOAA 3QCPA 4LL1B 2HSMB 4D73B 1N8JA 6GSSA 3ERGA 4OFNA 1N2AA 2B6MA 4MJEA 3DMLA 1C72A 4IP6A 1M9AA 2LRNA 2X8HA 4KH7A 4F0CA 3QR6A 1WRYA 3TDGA 2CVKA 2HRAA 2DMLA 2B5YA 1AW9A 3FRCA 1SL0B 2VM2A 1THXA 3FR6A 1J08A 1ON4A 3C8EA 2DJ0A 1GUKA 4TW5A 5AGYA 5ECNB 3IBHA 3C1SA 1K0AA 3GURA 3UOMA 2REMA 3UJ1A 1GSQA 2H76A 1O8WA 2PUKC 3GV1A 2LJRA 1GSFA 1A2MA 1U6TA 1YEPA 2H71A 2VL3A 2GQLA 3VI5A 4EE0A 1SJ6A 3UBLA 1GTBA 1JZWA 17GSA 2GZPA 1GLQA 1A23A 4AJ6A 3GTUA 5C04A 1N25A 3NIVA 1ZZYA 4EIPA 2AYTA 1O81A 3LG6A 1ERWA 4RUVA 2HSNB 4RQXA 3MAKA 1BEDA 2DIYA 3IE3A 4KA0A 5J47A 2K6VA 2J23A 1KTEA 2EIQA 4TXOB 1ST9A 5HQPA 4HZ2A 4IGJA 2XPEA 5CNWA 4V1Ap 1M2BA 1JLWA 5GAND 3CSJA 2G0FA 2YCDA 2A4VA 3F6FA 4K0GA 4ZL9A 5ECLB 4YKGA 4F9ZA 2H1AA 4ZBBA 5CRGA 1YJ6A 1G7EA 3RPPA 1A0RP 2FUG2 1R5AA 5DAKA 3HA9A 1HYUA 1B9XC 4N3ZA 4ECBA 3IPZA 3PH9A 4DSSB 1JHBA 1B9YC 2I3YA 2VLUA 4I97A 1OC9B 4L0WA 5IMCA 1KNGA 3EE2A 3H4KA 1EP7A 1Z7RA 1V40A 4MABA 1ILOA 4Z2UA 2JU5A 4OCEA 4Z2RA 3DRNA 3SBCA 2IIYA 2YNXA 2AJQB 1M0UA 2QGVA 4HEA2 1UVZA 3O3TA 4FO5A 2YWIA 1S3CA 4JU5A 4G19A 1NM3A 6GSTA 3IK7A 3UEMA 1H75A 4MA9A 2VO4A 4WETA 3HJMA 2GT6A 4AKHA 4J57E 2P31A 4CW9A 1I9DA 2BMXA 2WULA 3ZLPA 1TI3A 2RUEA 2B1LA 4FYUA 3VWXA 2DMMA 4QL7A 1T3BA 1TOFA 2L4QA 4IJIA 2H6YA 2PBJA 3IOSA 4MJBA 3IAM2 2WDUA 3A2WA 1U88A 3M0FA 4N10A 3FK8A 3KTBA 2EFHA 4P3YB 2O87A 2HFDA 3ERFA 5D9TA 1H4OA 5AIXA 5DAKB 4EUYA 2H0IA 2KP1A 5DJLA 3G9BA 4YAPA 4USSA 1K0NA 5ECSA 5A1NA 3DVWA 5H5SA 4TRXA 3FEUA 4MPGA 3P90A 1QK8A 4MLYA 4POLA 1Y25A 2IMEA 3I43A 1QQ2A 4XTSA 5KEJA 3GL3A 2X8GA 1TK0B 4G9HA 1FVJA 1K3OA 2DJJA 1SVOA 1ZYEA 1TP9A 20GSA 1GH2A 1W89A 3ERWA 2LNSA 4JR4A 3LYKA 1AIUA 5ECHB 1Z6NA 2LRTA 1O6JA 3Q19A 4K7NA 4IS0A 3QAGA 4ULXA 3E3EA 2CAQA 19GSA 5B7CA 2C3QA 1G7OA 3GL5A 2RIIA 3QAVA 2FLSA 5D9XA 1BYEA 3LORA 3RAZA 4XS1A 4KAEA 4NHZA 3L4NA 4K5SA 4G0KA 5DQSA 4MK3A 3AY8A 2I1UA 4IJ3A 3DWVA 1AQWA 3APSA 5L71A 3EWLA 3FZ5A 1JLVA 3CBUA 1F3AA 3D5JA 5GAPD 4J2FA 2GS3A 1RQMA 3TU3B 2C0FA 2FA8A 4CY8A 3BJ5A 4HQZA 1V57A 3R2QA 4HZ4A 2FWEA 4BPYA 2P5QA 1X5EA 1SL1B 3ZYWA 2FHEA 4YQVA 1RK4A 4FH8A 4Q5NA 3IV4A 1OE7A 3PGTA 3GFKA 3WGXA 4GSTA 5J4VA 1FO5A 4WBJA 4G2EA 2B7KA 1SJZA 5IQYA 2DKHA 1GSUA 4IQ1A 4OO4A 3F3RA 5A1NB 1FHEA 2VIMA 4GDFA 3M3MA 2HXKA 4OWYA 4JZQA 2GQMA 4I6XA 4N11A 3MNGA 3KCMA 1BJXA 3BBYA 2YWMA 4WXTA 2JADA 1GL8A 4BL7A 4V2MA 2HT9A 4IKHA 1TRVA 1NSWA 4F82A 5CO3A 3K8NA 4MH2A 2MMNA 4KDYA 4K7IA 1Y1UA 3CSIA 2PVOC 1OE8A 5ECQB 1PL1A 4CY6A 4ISDA 2QA1A 1I5GA 1YF1A 1XWGA 2PVQA 1V2AA 3D6IA 4MCUA 3GMFA 4HUAA 3HCZA 1SK1A 4PX1A 3GUSA 5ID2A 1M2AA 5BRTA 2R4VA 1A2LA 3G7IA 4G0LA 1QMVA 1YKAA 2GSQA 1FB6A 2X4AA 3IHGA 2ON7A 1U3AA 3GKKA 1SKSB 3ZZXA 4TKYA 3ZL5A 4WF4A 2JSZA 5ENUA 2IL3A 3HYPA 5G1KA 5HR3A 4K2XA 3DD3A 3LSZA 4RI6A 3N9JA 1BF5A 3ED3A 3UVHA 5DALA 1GSYA 2E2GA 3CRUA 1VGLA 7GSSA 1GWCA 5F8BA 4EIQA 4KCEA 2R0PA 4YQUA 5DCGA 2HRNA 2DIZA 5IPGA 5FHIA 2XBQA 4EC0A 4TR3A 4PURA 3H93A 1WJKA 5B6NA 1T4ZA 1GTAA 3LFLA 4MF7A 3IR4A 1YY7A 4BL7B 3D4MA 2LEGA 2VOCA 2NBSA 3KZQA 3FYGA 3SWLA 2GSTA 3R3EA 1XXUA 1T7PB 4NMUA 1UC7A 4GCIA 2LV3A 5HR2A 2GZZA 2M80A 3JCML 2MMOA 4KUNA 2H1GA 3V1WA 2OE1A 3C1RA 1DE2A 2VD1A 3RPNA 2HLSA 4PUFC 1IYHA 1AC1A 3CTGA 5EY6A 3C7MA 5ID2B 3A5WA 1AUCA 3EC3A 1BX9A 1OAZA 5ELGA 5JWOB 5J41A 4K5RA 1VF4A 2V1MA 5J4YA 2CVBA 3C71A 3HY2A 6GSVA 1Z6MA 2RUFA 4GSNA 2TRCP 1FOVA 4KW6A 1BAYA 1TKDB 4V2LA 5G5EA 2C8UA 5DALB 3QD9A 4KDXA 2RM5A 3LW9A 4ZB6A 1XWAA 2H1LA 4LMWA 4EL1A 1CQGA 3KXOA 5EVOA 1TRWA 4G0IA 2XPDA 3KH7A 2GGTA 1YDKA 3D0ZA 4X4JA 2VL9A 1PKZA 4IHUA 1QGVA 3WYWA 5A5KA 9GSSA 4YAVA 2QSIA 1YVLA 1SKRB 3EPTA 3EYTA 1K3YA 2WJUA 5KN0A 2Z9SA 5A34A 3TRPA 3VPQA 5C00A 3VLNA 1SL2B 2V6OA 3EU4A 5IMDA 4N30A 2UV8G 4FYCA 2YZHA 1XWBA 4K1FA 2YZUA 1O8XA 5IOXA 1TU8A 3L9SA 4FQUA 2B1KA 2OT3A 3RHBA 1TXXA 1ERVA 5JWQB 1JFUA 4QL9A 1ZCPA 2C80A 4ECJA 1A0FA 4WF5A 6GSYA 2L4CA 1HNAA 2FWGA 3P2AA 2IFQA 4FYBA 1BG1A 5D9WA 3EMXA 4AF2A 2CV4A 2I9HA 5IMAA 4HU7A 2H01A 3UAPA 4XHMA 5INYA 1M2DA 3HZ4A 1X0RA 4L5LA 1DBYA 1GSSA 3O6TA 3IC4A 2N5BA 2MYGA 3U5RE 3FKFA 4TOPA 1MDKA 1ZGNA 3MSZA 10GSA 1M7TA 1X5DA 5IPHA 1TU7A 1TJDA 5LD0A 3RHCA 2VKZG 13GSA 1XW6A 3KEBA 2VCXA 3MIXA 3VI7A 2YV9A 1G6WA 3IAS2 4EVMA 5F06A 3HMJG 4TR1A 4E8HA 4OO5A 2EIRA 1KEBA 4MH3A 2H74A 4GQFA 2WRTA 3D4TA 1Y6EA 4DSQA 1GRXA 3HHVA 3ZIVA 5IMZA 4Z7XA 3VK9A 3CYNA 4TXVA 1EEMA 1SD9A 2L6DA 4X43A 2MZCA 3CTFA 1VF3A 2N5FA 2ON5A 4A5PA 1QXHA 3GTUB 3LGCA 1Z5YE 1RW1A 4ZL8A 1X9SB 2K8VA 2R5GA 4O5RA 2A2SA 1QFNA 4V1Ag 3QAWA 5D93A 4HDEA 4PQ1A 5KN3A 2GZYA 1S3AA 1TTZA 3I9V2 4EKZA 5GZZB 2NTOA 1YQ1A 2R37A 2IFQB 5A4VA 2GSSA 5EL8A 3ME7A 1B8XA 3OR5A 5JCWA 2NDOA 2OKAA 3HVXA 1F2EA 1ZMAA 8GSSA 1OC3A 2WCIA 3W8JA 2AHEA 1SD8A 4GQCA 3IDVA 4NV5A 2H0GA 4V2NA 1CQHA 3UBKA 4IN0A 1XWCA 3TJFA 2V32A 2HSYA 1TW9A 4MDCA 1J9BA 2E0QA 2IMKA 3F4RA 2A4HA 2PGTA 2I4AA 2KUCA 3M1GA 2GT5A 1FVKA 5CAXA 2PU9C 6GSWA 1S3DA 4JE1A 4XS4A 4J56E 2OBIA 2HI7A 2FWFA 2TRXA 3H8QA 4ZL7A 3GKMA 3ZMKA 2CZ2A 2C4JA 4O5UA 4K2DA 4IBPA 2LJAA 3GSTA 2HRKA 4K7OA 5COHA 5H5RA 4F0BA 2PN8A 2H1BA 5F07A 2H19A 2CT6A 1B4QA 12GSA 3TJJA 3ZIJA 4LLRA 2YWNA 2RLIA 1F37A 2M46A 4TR4A 2GQKA 2LKUA 1PX6A 1R5PA 1XVWA 2VL2A 2B7JA 1OKDA 3U6VA 1F6MC 2VCVA 5KOXA 2L59A 4DVCA 4ZIJA 5E59A 3LEFA 4QMKA 5G2ZA 2KHPA 1A8YA 5FT3A 1PN9A 4KSOA 1XCCA 3TRXA 2OADA 1V9WA 3GKNA 2EFCA 4NXIA 1GUHA 2I81A 2WZ9A 5KN1A 3F0IA 1R26A 4WR4A 3O76A 3UARA 2HZFA 4I8BA 2VCWA 3ZTLA 2QKEA 2E7PA 16GSA 2L5OA 3TKSC 1G0TA 2IMDA 1UN2A 5B8AA 1THOA 2V2GA 2LS5A 1M9BA 1IYIA 4PNFA 3P7XA 4XIHA 1K0CA 3G7JA 3RDWA 3EINA 4IELA 1FG4A 1GUMA 3KMNA 2AUVA 4GRFA 3FZAA 3ZREA 2YOIA 2HRKB 5IO2A 4WEYA 4BVXA 4AGSA 5IM9A 1T4YA 5HFGA 1EOGA 1GTIA 2X64A 3VWUA 1PA3A 4EXJA 3L78A 4MF5A 1OC8A 1SVLA 2VM1A 2OJLA 4PTSA 4BWQA 1XVQA 1TDIA 2YN1A 4WR5A 1YZXA 5DBQA 1MTCA 5IIZA 1ACVA 2EIOA 4MPFA 2BJXA 1HQOA 2YJ7A 3DEXA 4JEDA 5DJMA 3VWVA 2JL4A 5J3RA 2OE3A 3W8SA 4MMMA 4X0XA 3LJRA 1MD3A 4Z2TA 2L5LA 4K9ZA 1WIKA 3HZ8A 2LQOA 5BMUA 4Q5FA 1Q98A 3ZMLA 2K9FA 4L0UA 1M99A 4BWSA 2C0DA 2YJHA 2GTUA 1ERUA 3S9FA 4O7HA 2CQ9A 1U87A 1AQVA 3CSHA 1HNBA 1GNEA 4MJAA 2XHFA 2VCQA 3Q18A 5HR0A 2YWOA 4OD7A 4GSSA 3FR9A 3HVSA 3IRAA 5H5QA 4XRAA 4ZXGA 4GTUA 4EDYA 3TKSE 1DUGA 2DC5A 1WE0A 1QUWA 5G30A 2F8AA 1YKCA 3ISOA 1HD2A 2ZCTA 4E8EA 3GA4A 4F03A 4I2TA 1JZRA 2OA7A 2ES7A 3FZ9A 2LRCA 2C0GA 1T1VA 1PGTA 4HQSA 4HI7A 1ZOFA 5LNKe 1V98A 4N0VA 3HD5A 2R0GA 1X9WB 3QDNA 4ZBAA 3GH6A 2FWHA 4KE3A 3UVTA 1WP0A 4WBRD 4BVXB 3D22A 1SJIA 2EFEA 1R7HA 2P5RA 3TOUA 2FGXA 2H66A 4CDOA 2DJ2A 2O85A 4N0ZA 4YH2A 4KCAA 5ABRA 3A3TA 4LMVA 2KOKA 2MMZA 4DEJA 1V58A 2CAIA 2M72A 2ZUPA 2HSNA 3BCKA 3E0UA 2JZTA 4MNNA 2ALBA 2NPBA 1AXDA 4AKGA 3DIEA 3A2VA 4ZB9A 3F6DA 11GSA 3D21A 3J7Yk 3WT2A 1XIYA 2VCZA 2C3NA 1GNWA 3VFIA 1TK5B 1GSEA 1PN0A 5BMUB 2CX4A 5HFKA 1BG5A 3ZITA 4NV2A 14GSA 1T00A 2PWJA 1FOHA 2YPMA 4K8MA 3L9UA 3PR8A 4GLTA 3FW2A 3QOUA 2XC2A 1XW5A 4ZILA 2NVLA 5D96A 2G2QA 1E2YA 5G5FA 1R4WA 1TI1A 3ZFLA 1PKWA 1OC9A 6GSXA 2EC4A 2H30A 1EP8A 2GDRA 1X9MB 2UZ8A 3GSSA 3KMOA 2H73A 22GSA 3HDCA 3LXZA 5AISA 4BVYA 2BTOT 1O7UA 1K0MA 4L8EA 3F4SA 4MZBA 1WPIA 2X8CA 1PQNA 3KIJA 4YKFA 4ACSA 3BCIA 1Z3EA 4DSRA 5A4WA 3IHQA 2LNTA 5F05A 3WT1A 5IMFA 2K8SA 4X1UA 4KB3A 5AIVA 4IP1A 4MP4A 5ECOB 1PD21 4Q5RA 2A2PA 2C3TA 5DCHA 3CMIA 4POMA 2H70A 4IW9A 3MWHA 4JR6A 3TCOA 2MBTA 4ZBDA 2IMIA 4OFMA 1MD4A 1XPVA 4EO3A 4PXOA 1TRSA 3P8WA 1J0FA 1Z7PA 1MDIA 4KNDA 1O85A 2HE3A 2KP2A 2F8FA 4I5QA 1UA5A 3Q6OA 1W4VA 2GSRA 3UMAA 4TVEA 2FNOA 4G01A 2D2ZA 4PQHA 5ECMB 5FWGA 18GSA 3I6AA 5F0GA 5J4UA 3CWGA 2O5VA 1AAZA 3ZVJA 1FAAA 2DKIA 4BA7A 4HJMA 2HZEA 4OCFA 5B8BA 4XS6A 2E2MA 3GKXA 3NZNA 3APOA 1NW2A 2C1YA 4JBBA 5ELAA 5B6MA 2PERA 1K0BA 2LQQA 2X99A 4BVYB 5A34B 5ECKB 1OVNA 3FMWA 2H8LA 3VWWA 1KBNA 1GP1A 6GSUA 1SK2A 2B3SA 4YQMA 1XWKA 3GNJA 1K0DA 3PPUA 5CRHA 1EOHA 1EGOA 1TXUA 5ECIB 1XFLA 4G10A 1EV4A 3LYPA 3LWAA 4XCSA 1SENA 3F4TA 1XBSA 1GTUA 3ZRDA 5A5HA 4TN8A 1O73A 2H6ZA 1E6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECC A;  2R2J A;  4IQA A;  3FY7 A;  4MZW A;  3KH9 A;  2VL2 C;  2AV4 A;  1SKW B;  4Q5Q A;  3CRT A;  3A2X A;  1YEX A;  4AJ7 A;  4L5O A;  2MMA A;  1F3B A;  2R3X A;  4NWY A;  1XZO A;  2FD3 A;  5J9B A;  3F9U A;  2VD0 A;  3TKQ A;  2N5A A;  5IOW A;  2VCT A;  5A4U A;  2CX3 A;  1DSB A;  3GHA A;  5CYY A;  1VF1 A;  2QC7 A;  4K0N A;  2H0H A;  1K0O A;  4XRD A;  2IMF A;  4IVF A;  4TR0 A;  2V41 A;  1TK8 B;  5CRD A;  3KP8 A;  4F2I A;  1SU9 A;  3UIW A;  4KSM A;  2IN3 A;  1JZD A;  2JZR A;  2MBS A;  5D8I A;  4GF0 A;  1ML6 A;  2PMT A;  1DE1 A;  3TB2 A;  3MDK A;  3E9J B;  4TR1 B;  1AQX A;  4KGI A;  3L9V A;  4NPB A;  1NHO A;  2HZE B;  4EF0 A;  3TUE A;  1PSQ A;  1PRX A;  2FY6 A;  2DJ3 A;  1OKT A;  2O8V B;  2ZNM A;  3WGE A;  1PMT A;  4I2U A;  5D73 A;  3CXG A;  4CHS A;  3GYK A;  4MF6 A;  4QQ7 A;  3C73 A;  4HS1 A;  2HSH A;  4OMV A;  2H1D A;  5KN2 A;  4K6X A;  3ZFB A;  2L57 A;  2OBK A;  1Q4J A;  2LUS A;  1VF2 A;  3VPT A;  1SYR A;  4PQI A;  2YAN A;  1B4P A;  3J7Y b;  2JZS A;  1XOB A;  1NHY A;  1ZYQ B;  1LBK A;  4FIW A;  2WGR A;  1LJR A;  3N5O A;  1JZO A;  3QMX A;  3GIX A;  5JCU A;  3GN3 A;  4HU9 A;  4ZB8 A;  3W6G A;  1OYJ A;  3IXR A;  4GXZ A;  2TIR A;  5DDL A;  1YF0 A;  4ILF A;  2AAW A;  1WWJ A;  4MJC A;  2H6X A;  1EZK A;  5E4W A;  1X5C A;  3GRX A;  3VUR A;  3EUR A;  4HJ2 A;  3TOT A;  1EEJ A;  2KLX A;  3TJK A;  4ECI A;  4WKW A;  2CA8 A;  3FHK A;  1ZL9 A;  2A2R A;  1F9M A;  2VAF A;  4NAX A;  3QFA C;  3EU3 A;  3TKR A;  3NOF A;  1K3L A;  2F3M A;  3F3Q A;  4XS4 B;  3US3 A;  3KP9 A;  1BQ7 A;  2IWT A;  3L0H A;  2DJK A;  1ERT A;  4MZC A;  5HR1 A;  1MEK A;  4ML6 A;  4PGT A;  5CRE A;  4GWR A;  3HVV A;  2HQT A;  3ME8 A;  2H72 A;  2CVD A;  1TRU A;  5AN1 A;  4POK A;  2OAC A;  3H1N A;  2LTK A;  3QFB C;  3TGZ A;  5JCG A;  3TKP A;  2YV7 A;  5CRW A;  4RI7 A;  1A24 A;  1EGR A;  1FW1 A;  3GX0 A;  3KM6 A;  3G7Y A;  4OFT A;  3KGK A;  3FR3 A;  3FZ4 A;  2FCH A;  2H75 A;  2YP6 A;  1ABA A;  3EMP A;  3HJO A;  5G31 A;  1GSD A;  4ID0 A;  2F9S A;  2DJ1 A;  2WS2 A;  1XOA A;  2J9H A;  3H79 A;  2DSA A;  3F63 A;  4RQR A;  3TKS A;  3APQ A;  3M8N A;  5IMV A;  2PPT A;  1MDJ A;  5CP1 A;  2LJK A;  2B5X A;  5ECR B;  3F8U A;  4EDZ A;  1SK0 A;  2HSM A;  2IJY A;  4D73 A;  5J5N A;  2HYX A;  1Z9H A;  5EPF A;  5HFI A;  2XBI A;  3DKS A;  5DVB A;  2DBC A;  2DLX A;  5LCZ A;  4O32 A;  1T8E B;  3IK9 A;  3DXB A;  5J9C A;  4LL4 B;  1WOU A;  3GX8 A;  3QPM A;  3RBT A;  1G6Y A;  4KF9 A;  1A2J A;  3HXS A;  1GLP A;  4KX4 A;  2O7K A;  2VLT A;  4PUA A;  2WB9 A;  1GUL A;  4AJ8 A;  4LA1 A;  1URM A;  1WMJ A;  3KTL A;  5ECP B;  2WFC A;  4POB A;  2LST A;  3Q74 A;  2AB6 A;  1XW9 A;  5GSS A;  1U3I A;  1LU4 A;  3LQ7 A;  5GST A;  1FB0 A;  5IO0 A;  1EV9 A;  3BD2 A;  4H86 A;  2CZ3 A;  2L6C A;  3M9K A;  3DGQ A;  2V6K A;  2B5E A;  3EVI A;  3PIN A;  2HRF A;  2VLV A;  3TJG A;  3HKR A;  4HOJ A;  3TRQ A;  1HNC A;  2IPA A;  1EWX A;  2K18 A;  2VUP A;  4TXO A;  2GVP A;  4PNG A;  2RM6 A;  5D9V A;  4KDU A;  1B48 A;  2OE0 A;  2O89 A;  2FA4 A;  4O92 A;  4JRR A;  2F51 A;  2JSY A;  4ML1 A;  3ZVJ D;  3WD6 A;  3IA1 A;  1VRS D;  3M9J A;  3LXT A;  2GLR A;  3IC8 A;  3TJB A;  4NHW A;  5DQY A;  1USB A;  5G1L A;  3DYR A;  3WGD A;  3KD0 A;  3UL3 A;  1PL2 A;  1PX7 A;  2JAC A;  5JWR B;  3HJP A;  3I69 A;  2P0G A;  2R6K A;  3KJY A;  4DSS A;  2C0E A;  1SYX A;  1A8L A;  3GH9 A;  2HNL A;  3DVX A;  3BOA A;  3QCP A;  4LL1 B;  2HSM B;  4D73 B;  1N8J A;  6GSS A;  3ERG A;  4OFN A;  1N2A A;  2B6M A;  4MJE A;  3DML A;  1C72 A;  4IP6 A;  1M9A A;  2LRN A;  2X8H A;  4KH7 A;  4F0C A;  3QR6 A;  1WRY A;  3TDG A;  2CVK A;  2HRA A;  2DML A;  2B5Y A;  1AW9 A;  3FRC A;  1SL0 B;  2VM2 A;  1THX A;  3FR6 A;  1J08 A;  1ON4 A;  3C8E A;  2DJ0 A;  1GUK A;  4TW5 A;  5AGY A;  5ECN B;  3IBH A;  3C1S A;  1K0A A;  3GUR A;  3UOM A;  2REM A;  3UJ1 A;  1GSQ A;  2H76 A;  1O8W A;  2PUK C;  2LJR A;  1GSF A;  3GV1 A;  1A2M A;  1U6T A;  1YEP A;  2H71 A;  2VL3 A;  2GQL A;  3VI5 A;  4EE0 A;  1SJ6 A;  3UBL A;  1GTB A;  1JZW A;  17GS A;  2GZP A;  1GLQ A;  1A23 A;  4AJ6 A;  3GTU A;  5C04 A;  3NIV A;  1ZZY A;  2AYT A;  1O81 A;  3LG6 A;  1ERW A;  4RUV A;  2HSN B;  4RQX A;  3MAK A;  1BED A;  2DIY A;  3IE3 A;  4KA0 A;  2K6V A;  2J23 A;  1KTE A;  2EIQ A;  4TXO B;  1ST9 A;  5HQP A;  4HZ2 A;  4IGJ A;  2XPE A;  5CNW A;  4V1A p;  1M2B A;  1JLW A;  5GAN D;  3CSJ A;  2G0F A;  2YCD A;  2A4V A;  3F6F A;  4K0G A;  4ZL9 A;  5ECL B;  4F9Z A;  2H1A A;  4ZBB A;  5CRG A;  1YJ6 A;  1G7E A;  3RPP A;  1A0R P;  2FUG 2;  1R5A A;  5DAK A;  3HA9 A;  1HYU A;  1B9X C;  4ECB A;  3IPZ A;  3PH9 A;  4DSS B;  1JHB A;  1B9Y C;  2I3Y A;  2VLU A;  4I97 A;  1OC9 B;  4L0W A;  5IMC A;  1KNG A;  3EE2 A;  3H4K A;  1EP7 A;  1Z7R A;  1V40 A;  4MAB A;  1ILO A;  2JU5 A;  4OCE A;  3DRN A;  3SBC A;  2IIY A;  2YNX A;  2AJQ B;  1M0U A;  2QGV A;  4HEA 2;  1UVZ A;  3O3T A;  4FO5 A;  2YWI A;  1S3C A;  4JU5 A;  4G19 A;  1NM3 A;  6GST A;  3IK7 A;  3UEM A;  1H75 A;  4MA9 A;  2VO4 A;  4WET A;  3HJM A;  2GT6 A;  4J57 E;  2P31 A;  4CW9 A;  1I9D A;  2BMX A;  2WUL A;  3ZLP A;  1TI3 A;  2RUE A;  2B1L A;  4FYU A;  3VWX A;  2DMM A;  4QL7 A;  1T3B A;  1TOF A;  2L4Q A;  4IJI A;  2H6Y A;  2PBJ A;  3IOS A;  4MJB A;  3IAM 2;  2WDU A;  3A2W A;  1U88 A;  3M0F A;  4N10 A;  3FK8 A;  3KTB A;  4P3Y B;  2O87 A;  2HFD A;  3ERF A;  5D9T A;  1H4O A;  5AIX A;  5DAK B;  4EUY A;  2H0I A;  2KP1 A;  5DJL A;  3G9B A;  4YAP A;  4USS A;  1K0N A;  5ECS A;  3DVW A;  5H5S A;  4TRX A;  3FEU A;  4MPG A;  3P90 A;  1QK8 A;  4MLY A;  4POL A;  1Y25 A;  2IME A;  3I43 A;  1QQ2 A;  4XTS A;  5KEJ A;  3GL3 A;  2X8G A;  1TK0 B;  4G9H A;  1FVJ A;  1K3O A;  2DJJ A;  1ZYE A;  1TP9 A;  20GS A;  1GH2 A;  1W89 A;  3ERW A;  2LNS A;  4JR4 A;  3LYK A;  1AIU A;  5ECH B;  1Z6N A;  2LRT A;  1O6J A;  3Q19 A;  4K7N A;  4IS0 A;  3QAG A;  4ULX A;  3E3E A;  2CAQ A;  19GS A;  5B7C A;  2C3Q A;  1G7O A;  3GL5 A;  2RII A;  3QAV A;  2FLS A;  5D9X A;  1BYE A;  3LOR A;  3RAZ A;  4XS1 A;  4KAE A;  4NHZ A;  3L4N A;  4G0K A;  5DQS A;  4MK3 A;  3AY8 A;  4IJ3 A;  2I1U A;  3DWV A;  1AQW A;  3APS A;  5L71 A;  3EWL A;  3FZ5 A;  1JLV A;  3CBU A;  1F3A A;  3D5J A;  5GAP D;  4J2F A;  2GS3 A;  1RQM A;  2C0F A;  2FA8 A;  3BJ5 A;  4HQZ A;  1V57 A;  3R2Q A;  4HZ4 A;  2FWE A;  4BPY A;  2P5Q A;  1X5E A;  1SL1 B;  3ZYW A;  2FHE A;  4YQV A;  1RK4 A;  4FH8 A;  4Q5N A;  3IV4 A;  1OE7 A;  3PGT A;  3GFK A;  3WGX A;  4GST A;  1FO5 A;  4WBJ A;  4G2E A;  2B7K A;  1SJZ A;  5IQY A;  1GSU A;  4IQ1 A;  4OO4 A;  3F3R A;  1FHE A;  2VIM A;  3M3M A;  2HXK A;  4OWY A;  4JZQ A;  2GQM A;  4I6X A;  4N11 A;  3MNG A;  3KCM A;  1BJX A;  3BBY A;  2YWM A;  4WXT A;  2JAD A;  1GL8 A;  4BL7 A;  4V2M A;  2HT9 A;  4IKH A;  1TRV A;  1NSW A;  4F82 A;  5CO3 A;  3K8N A;  4MH2 A;  2MMN A;  4KDY A;  4K7I A;  3CSI A;  2PVO C;  1OE8 A;  5ECQ B;  1PL1 A;  4ISD A;  1I5G A;  1YF1 A;  1XWG A;  2PVQ A;  1V2A A;  3D6I A;  4MCU A;  3GMF A;  4HUA A;  3HCZ A;  1SK1 A;  4PX1 A;  3GUS A;  5ID2 A;  1M2A A;  2R4V A;  1A2L A;  3G7I A;  4G0L A;  1QMV A;  1YKA A;  2GSQ A;  1FB6 A;  2ON7 A;  1U3A A;  3GKK A;  1SKS B;  3ZZX A;  4TKY A;  3ZL5 A;  4WF4 A;  2JSZ A;  5ENU A;  2IL3 A;  3HYP A;  5G1K A;  5HR3 A;  3DD3 A;  3LSZ A;  4RI6 A;  3N9J A;  3ED3 A;  3UVH A;  5DAL A;  1GSY A;  2E2G A;  3CRU A;  1VGL A;  7GSS A;  1GWC A;  5F8B A;  4KCE A;  4YQU A;  5DCG A;  2HRN A;  2DIZ A;  5IPG A;  5FHI A;  2XBQ A;  4EC0 A;  4TR3 A;  4PUR A;  3H93 A;  1WJK A;  5B6N A;  1T4Z A;  1GTA A;  3LFL A;  4MF7 A;  3IR4 A;  1YY7 A;  4BL7 B;  3D4M A;  2LEG A;  2VOC A;  2NBS A;  3KZQ A;  3FYG A;  3SWL A;  2GST A;  3R3E A;  1XXU A;  1T7P B;  4NMU A;  1UC7 A;  4GCI A;  2LV3 A;  5HR2 A;  2GZZ A;  2M80 A;  3JCM L;  2MMO A;  4KUN A;  2H1G A;  3V1W A;  2OE1 A;  3C1R A;  1DE2 A;  2VD1 A;  3RPN A;  2HLS A;  4PUF C;  1IYH A;  1AC1 A;  3CTG A;  5EY6 A;  3C7M A;  5ID2 B;  3A5W A;  1AUC A;  3EC3 A;  1BX9 A;  1OAZ A;  5ELG A;  5JWO B;  5J41 A;  1VF4 A;  2V1M A;  2CVB A;  3C71 A;  3HY2 A;  6GSV A;  1Z6M A;  2RUF A;  4GSN A;  2TRC P;  1FOV A;  4KW6 A;  1BAY A;  1TKD B;  4V2L A;  5G5E A;  2C8U A;  5DAL B;  3QD9 A;  4KDX A;  2RM5 A;  4ZB6 A;  1XWA A;  4LMW A;  4EL1 A;  1CQG A;  3KXO A;  5EVO A;  1TRW A;  4G0I A;  2XPD A;  3KH7 A;  2GGT A;  1YDK A;  3D0Z A;  2VL9 A;  1PKZ A;  4IHU A;  1QGV A;  3WYW A;  5A5K A;  9GSS A;  4YAV A;  2QSI A;  1SKR B;  3EYT A;  1K3Y A;  2WJU A;  5KN0 A;  2Z9S A;  3TRP A;  3VPQ A;  5C00 A;  3VLN A;  1SL2 B;  2V6O A;  3EU4 A;  5IMD A;  4N30 A;  4FYC A;  2YZH A;  1XWB A;  4K1F A;  2YZU A;  1O8X A;  5IOX A;  1TU8 A;  3L9S A;  4FQU A;  2B1K A;  3RHB A;  1TXX A;  1ERV A;  5JWQ B;  1JFU A;  4QL9 A;  1ZCP A;  2C80 A;  4ECJ A;  1A0F A;  4WF5 A;  6GSY A;  2L4C A;  1HNA A;  2FWG A;  3P2A A;  2IFQ A;  4FYB A;  5D9W A;  3EMX A;  4AF2 A;  2CV4 A;  2I9H A;  5IMA A;  4HU7 A;  2H01 A;  3UAP A;  4XHM A;  5INY A;  1M2D A;  3HZ4 A;  1X0R A;  4L5L A;  1DBY A;  1GSS A;  3O6T A;  3IC4 A;  2N5B A;  2MYG A;  3U5R E;  3FKF A;  4TOP A;  1MDK A;  1ZGN A;  3MSZ A;  10GS A;  1M7T A;  1X5D A;  5IPH A;  1TU7 A;  1TJD A;  5LD0 A;  3RHC A;  13GS A;  1XW6 A;  3KEB A;  2VCX A;  3VI7 A;  2YV9 A;  1G6W A;  3IAS 2;  4EVM A;  5F06 A;  4TR1 A;  4E8H A;  4OO5 A;  2EIR A;  1KEB A;  4MH3 A;  2H74 A;  4GQF A;  2WRT A;  3D4T A;  1Y6E A;  4DSQ A;  1GRX A;  3HHV A;  3ZIV A;  5IMZ A;  4Z7X A;  3VK9 A;  3CYN A;  4TXV A;  1EEM A;  1SD9 A;  2L6D A;  4X43 A;  2MZC A;  3CTF A;  1VF3 A;  2N5F A;  2ON5 A;  1QXH A;  3GTU B;  3LGC A;  1Z5Y E;  1RW1 A;  4ZL8 A;  1X9S B;  2K8V A;  2R5G A;  4O5R A;  2A2S A;  1QFN A;  4V1A g;  3QAW A;  5D93 A;  4HDE A;  4PQ1 A;  5KN3 A;  2GZY A;  1S3A A;  1TTZ A;  3I9V 2;  4EKZ A;  5GZZ B;  2NTO A;  1YQ1 A;  2R37 A;  2IFQ B;  5A4V A;  2GSS A;  5EL8 A;  3ME7 A;  1B8X A;  3OR5 A;  5JCW A;  2NDO A;  2OKA A;  3HVX A;  1F2E A;  1ZMA A;  8GSS A;  1OC3 A;  2WCI A;  3W8J A;  2AHE A;  1SD8 A;  4GQC A;  3IDV A;  4NV5 A;  2H0G A;  4V2N A;  1CQH A;  3UBK A;  4IN0 A;  1XWC A;  3TJF A;  2V32 A;  2HSY A;  1TW9 A;  4MDC A;  1J9B A;  2E0Q A;  2IMK A;  3F4R A;  2I4A A;  2PGT A;  2KUC A;  3M1G A;  2GT5 A;  1FVK A;  5CAX A;  2PU9 C;  6GSW A;  1S3D A;  4JE1 A;  4XS4 A;  4J56 E;  2OBI A;  2HI7 A;  2FWF A;  2TRX A;  3H8Q A;  4ZL7 A;  3GKM A;  3ZMK A;  2CZ2 A;  2C4J A;  4K2D A;  4IBP A;  2LJA A;  3GST A;  2HRK A;  4K7O A;  5COH A;  5H5R A;  4F0B A;  2PN8 A;  2H1B A;  5F07 A;  2H19 A;  2CT6 A;  1B4Q A;  12GS A;  3TJJ A;  3ZIJ A;  4LLR A;  2YWN A;  2RLI A;  1F37 A;  2M46 A;  4TR4 A;  2GQK A;  2LKU A;  1PX6 A;  1R5P A;  1XVW A;  2VL2 A;  2B7J A;  1OKD A;  3U6V A;  1F6M C;  2VCV A;  2L59 A;  4DVC A;  4ZIJ A;  5E59 A;  3LEF A;  5G2Z A;  2KHP A;  1A8Y A;  5FT3 A;  1PN9 A;  4KSO A;  1XCC A;  3TRX A;  2OAD A;  1V9W A;  3GKN A;  4NXI A;  1GUH A;  2I81 A;  2WZ9 A;  5KN1 A;  3F0I A;  1R26 A;  4WR4 A;  3O76 A;  3UAR A;  2HZF A;  4I8B A;  2VCW A;  3ZTL A;  2QKE A;  2E7P A;  16GS A;  2L5O A;  3TKS C;  1G0T A;  2IMD A;  1UN2 A;  5B8A A;  1THO A;  2V2G A;  2LS5 A;  1M9B A;  1IYI A;  4PNF A;  3P7X A;  4XIH A;  1K0C A;  3G7J A;  3RDW A;  3EIN A;  4IEL A;  1FG4 A;  1GUM A;  3KMN A;  2AUV A;  4GRF A;  3FZA A;  3ZRE A;  2YOI A;  2HRK B;  5IO2 A;  4WEY A;  4BVX A;  4AGS A;  5IM9 A;  1T4Y A;  5HFG A;  1EOG A;  1GTI A;  2X64 A;  3VWU A;  1PA3 A;  4EXJ A;  3L78 A;  4MF5 A;  1OC8 A;  2VM1 A;  2OJL A;  4PTS A;  4BWQ A;  1XVQ A;  1TDI A;  2YN1 A;  4WR5 A;  1YZX A;  5DBQ A;  1MTC A;  5IIZ A;  1ACV A;  2EIO A;  4MPF A;  2BJX A;  1HQO A;  2YJ7 A;  3DEX A;  4JED A;  5DJM A;  3VWV A;  2JL4 A;  5J3R A;  2OE3 A;  3W8S A;  4MMM A;  4X0X A;  3LJR A;  1MD3 A;  2L5L A;  4K9Z A;  1WIK A;  3HZ8 A;  2LQO A;  5BMU A;  4Q5F A;  1Q98 A;  3ZML A;  2K9F A;  4L0U A;  1M99 A;  4BWS A;  2C0D A;  2YJH A;  2GTU A;  1ERU A;  3S9F A;  4O7H A;  2CQ9 A;  1U87 A;  1AQV A;  3CSH A;  1HNB A;  1GNE A;  4MJA A;  2XHF A;  2VCQ A;  3Q18 A;  5HR0 A;  2YWO A;  4OD7 A;  4GSS A;  3FR9 A;  3HVS A;  3IRA A;  5H5Q A;  4XRA A;  4ZXG A;  4GTU A;  4EDY A;  3TKS E;  1DUG A;  2DC5 A;  1WE0 A;  1QUW A;  5G30 A;  2F8A A;  1YKC A;  3ISO A;  1HD2 A;  2ZCT A;  4E8E A;  3GA4 A;  4F03 A;  4I2T A;  1JZR A;  2OA7 A;  2ES7 A;  3FZ9 A;  2LRC A;  2C0G A;  1T1V A;  1PGT A;  4HQS A;  4HI7 A;  1ZOF A;  5LNK e;  1V98 A;  4N0V A;  3HD5 A;  1X9W B;  3QDN A;  4ZBA A;  3GH6 A;  2FWH A;  4KE3 A;  3UVT A;  1WP0 A;  4WBR D;  4BVX B;  3D22 A;  1SJI A;  1R7H A;  2P5R A;  3TOU A;  2FGX A;  2H66 A;  4CDO A;  2DJ2 A;  2O85 A;  4N0Z A;  4YH2 A;  4KCA A;  5ABR A;  3A3T A;  4LMV A;  2KOK A;  2MMZ A;  4DEJ A;  1V58 A;  2CAI A;  2M72 A;  2ZUP A;  3BCK A;  3E0U A;  2JZT A;  2ALB A;  2NPB A;  1AXD A;  3DIE A;  3A2V A;  4ZB9 A;  3F6D A;  11GS A;  3D21 A;  3J7Y k;  3WT2 A;  1XIY A;  2VCZ A;  2C3N A;  1GNW A;  3VFI A;  1TK5 B;  1GSE A;  2CX4 A;  5HFK A;  1BG5 A;  3ZIT A;  4NV2 A;  14GS A;  1T00 A;  2PWJ A;  2YPM A;  4K8M A;  3L9U A;  3PR8 A;  4GLT A;  3FW2 A;  3QOU A;  2XC2 A;  1XW5 A;  4ZIL A;  2NVL A;  5D96 A;  2G2Q A;  1E2Y A;  5G5F A;  1R4W A;  1TI1 A;  3ZFL A;  1PKW A;  1OC9 A;  6GSX A;  2EC4 A;  2H30 A;  1EP8 A;  2GDR A;  1X9M B;  2UZ8 A;  3GSS A;  3KMO A;  2H73 A;  22GS A;  3HDC A;  3LXZ A;  5AIS A;  4BVY A;  2BTO T;  1O7U A;  1K0M A;  4L8E A;  3F4S A;  4MZB A;  1WPI A;  2X8C A;  1PQN A;  3KIJ A;  4ACS A;  3BCI A;  1Z3E A;  4DSR A;  5A4W A;  3IHQ A;  2LNT A;  5F05 A;  3WT1 A;  5IMF A;  2K8S A;  4X1U A;  4KB3 A;  5AIV A;  4IP1 A;  4MP4 A;  5ECO B;  1PD2 1;  4Q5R A;  2C3T A;  5DCH A;  3CMI A;  4POM A;  2H70 A;  4IW9 A;  3MWH A;  4JR6 A;  3TCO A;  2MBT A;  4ZBD A;  2IMI A;  4OFM A;  1MD4 A;  1XPV A;  4EO3 A;  4PXO A;  1TRS A;  3P8W A;  1J0F A;  1Z7P A;  1MDI A;  4KND A;  1O85 A;  2HE3 A;  2KP2 A;  2F8F A;  4I5Q A;  1UA5 A;  3Q6O A;  1W4V A;  2GSR A;  3UMA A;  4TVE A;  2FNO A;  2D2Z A;  4PQH A;  5ECM B;  5FWG A;  18GS A;  3I6A A;  5F0G A;  5J4U A;  1AAZ A;  3ZVJ A;  1FAA A;  4BA7 A;  4HJM A;  2HZE A;  4OCF A;  5B8B A;  4XS6 A;  2E2M A;  3GKX A;  3NZN A;  3APO A;  1NW2 A;  2C1Y A;  4JBB A;  5ELA A;  5B6M A;  2PER A;  1K0B A;  2LQQ A;  2X99 A;  4BVY B;  5ECK B;  1OVN A;  2H8L A;  3VWW A;  1KBN A;  1GP1 A;  6GSU A;  1SK2 A;  2B3S A;  4YQM A;  1XWK A;  3GNJ A;  1K0D A;  3PPU A;  5CRH A;  1EOH A;  1EGO A;  5ECI B;  1XFL A;  4G10 A;  1EV4 A;  3LYP A;  3LWA A;  4XCS A;  1SEN A;  3F4T A;  1XBS A;  1GTU A;  3ZRD A;  4TN8 A;  1O73 A;  2H6Z A;  1E6B A; 
#chains in the Genus database with same CATH topology
 4ECC A;  2R2J A;  4IQA A;  3FY7 A;  4MZW A;  3KH9 A;  2VL2 C;  2AV4 A;  2R0C A;  1SKW B;  4Q5Q A;  3CRT A;  3A2X A;  1YEX A;  4AJ7 A;  4L5O A;  2MMA A;  1F3B A;  2R3X A;  4NWY A;  1XZO A;  2FD3 A;  5J9B A;  3F9U A;  2VD0 A;  3TKQ A;  2N5A A;  5IOW A;  2VCT A;  5A4U A;  2CX3 A;  1DSB A;  3GHA A;  5CYY A;  1VF1 A;  2QC7 A;  4K0N A;  2H0H A;  1K0O A;  4XRD A;  2IMF A;  4IVF A;  4TR0 A;  2V41 A;  1TK8 B;  5CRD A;  3KP8 A;  4F2I A;  1SU9 A;  3UIW A;  4KSM A;  2IN3 A;  1JZD A;  2JZR A;  2MBS A;  5D8I A;  4GF0 A;  1ML6 A;  2PMT A;  1DE1 A;  3TB2 A;  3MDK A;  3E9J B;  4TR1 B;  1AQX A;  4KGI A;  3L9V A;  4NPB A;  1NHO A;  2HZE B;  4EF0 A;  2QA2 A;  3TUE A;  1PSQ A;  1PRX A;  2FY6 A;  2DJ3 A;  1OKT A;  2O8V B;  2ZNM A;  5KOW A;  3WGE A;  1PMT A;  4I2U A;  5D73 A;  3CXG A;  4CHS A;  3GYK A;  4MF6 A;  4QQ7 A;  3C73 A;  4HS1 A;  2HSH A;  4OMV A;  2H1D A;  5KN2 A;  4K6X A;  3ZFB A;  2L57 A;  2OBK A;  1Q4J A;  2LUS A;  1VF2 A;  3VPT A;  1SYR A;  4PQI A;  2YAN A;  1B4P A;  3J7Y b;  5A5H B;  2JZS A;  1XOB A;  1NHY A;  1ZYQ B;  1LBK A;  4FIW A;  2WGR A;  1ZYN A;  1LJR A;  3N5O A;  1JZO A;  3QMX A;  3GIX A;  5JCU A;  3GN3 A;  4HU9 A;  4ZB8 A;  4AKI A;  3W6G A;  1OYJ A;  3MYD A;  3A5I A;  3IXR A;  4ZB7 A;  4GXZ A;  2TIR A;  5DDL A;  1YF0 A;  4ILF A;  2AAW A;  1WWJ A;  4MJC A;  2H6X A;  1EZK A;  5E4W A;  1X5C A;  3GRX A;  3VUR A;  3EUR A;  4HJ2 A;  3TOT A;  1EEJ A;  2KLX A;  3TJK A;  4ECI A;  4WKW A;  2CA8 A;  3FHK A;  1ZL9 A;  2A2R A;  1F9M A;  2VAF A;  4NAX A;  5J40 A;  3QFA C;  3EU3 A;  3TKR A;  3NOF A;  1K3L A;  2F3M A;  3F3Q A;  4XS4 B;  3US3 A;  3KP9 A;  1BQ7 A;  2IWT A;  3L0H A;  2DJK A;  1ERT A;  4MZC A;  5HR1 A;  1MEK A;  4ML6 A;  4PGT A;  5CRE A;  4GWR A;  3HVV A;  2HQT A;  3ME8 A;  2H72 A;  2CVD A;  1TRU A;  5AN1 A;  4POK A;  2OAC A;  3H1N A;  2LTK A;  3QFB C;  3TGZ A;  5JCG A;  1PFO A;  3TKP A;  2YV7 A;  5CRW A;  4RI7 A;  1A24 A;  1EGR A;  3GX0 A;  1FW1 A;  3KM6 A;  3G7Y A;  4OFT A;  3KGK A;  1ZYP A;  3FR3 A;  3FZ4 A;  2FCH A;  2H75 A;  2YP6 A;  1ABA A;  3EMP A;  3HJO A;  5G31 A;  1GSD A;  4ID0 A;  2F9S A;  2WW3 A;  2DJ1 A;  4AKX B;  2WS2 A;  1XOA A;  2J9H A;  3H79 A;  2DSA A;  3F63 A;  4RQR A;  2O36 A;  3TKS A;  3APQ A;  3M8N A;  2EFD A;  5IMV A;  2PPT A;  1MDJ A;  5CP1 A;  2LJK A;  2B5X A;  4W66 A;  5ECR B;  3F8U A;  4EDZ A;  1SK0 A;  1SVM A;  2HSM A;  2IJY A;  4D73 A;  5J5N A;  4BIK A;  2HYX A;  1Z9H A;  5EPF A;  5HFI A;  2XBI A;  3DKS A;  5DVB A;  2DBC A;  2DLX A;  5LCZ A;  4O32 A;  1T8E B;  4ICY A;  3IK9 A;  3DXB A;  5J9C A;  4LL4 B;  1WOU A;  3GX8 A;  3QPM A;  3RBT A;  1G6Y A;  4KF9 A;  1A2J A;  3HXS A;  1GLP A;  4KX4 A;  2O7K A;  2VLT A;  4PUA A;  2WB9 A;  1GUL A;  4AJ8 A;  4LA1 A;  4E68 A;  1URM A;  1WMJ A;  2X49 A;  3KTL A;  5ECP B;  2WFC A;  4POB A;  2LST A;  3Q74 A;  2AB6 A;  1XW9 A;  2WW1 A;  5GSS A;  1U3I A;  1LU4 A;  3LQ7 A;  5GST A;  1FB0 A;  5IO0 A;  1EV9 A;  3BD2 A;  4H86 A;  2CZ3 A;  2L6C A;  3M9K A;  3DGQ A;  2V6K A;  2B5E A;  3EVI A;  3PIN A;  2HRF A;  4AI6 A;  2VLV A;  3TJG A;  3HKR A;  4HOJ A;  3TRQ A;  1HNC A;  2IPA A;  1EWX A;  2K18 A;  2VUP A;  4TXO A;  2GVP A;  4PNG A;  2RM6 A;  5D9V A;  4KDU A;  1B48 A;  2OE0 A;  2O89 A;  2FA4 A;  4O92 A;  4JRR A;  2F51 A;  2JSY A;  4ML1 A;  3ZVJ D;  3WD6 A;  3IA1 A;  1VRS D;  3M9J A;  3LXT A;  2GLR A;  3IC8 A;  3TJB A;  4NHW A;  5DQY A;  1USB A;  5G1L A;  3DYR A;  3WGD A;  3KD0 A;  3UL3 A;  1PL2 A;  4O5Q A;  1PX7 A;  2JAC A;  5JWR B;  3HJP A;  3I69 A;  2P0G A;  2R6K A;  3KJY A;  4DSS A;  2C0E A;  1SYX A;  1A8L A;  3GH9 A;  2HNL A;  3DVX A;  3BOA A;  3QCP A;  4LL1 B;  2HSM B;  4D73 B;  1N8J A;  6GSS A;  3ERG A;  4OFN A;  1N2A A;  2B6M A;  4MJE A;  3DML A;  1C72 A;  4IP6 A;  1M9A A;  2LRN A;  2X8H A;  4KH7 A;  4F0C A;  3QR6 A;  1WRY A;  3TDG A;  2CVK A;  2HRA A;  2DML A;  2B5Y A;  1AW9 A;  3FRC A;  1SL0 B;  2VM2 A;  1THX A;  3FR6 A;  1J08 A;  1ON4 A;  3C8E A;  2DJ0 A;  1GUK A;  4TW5 A;  5AGY A;  5ECN B;  3IBH A;  3C1S A;  1K0A A;  3GUR A;  3UOM A;  2REM A;  3UJ1 A;  1GSQ A;  2H76 A;  1O8W A;  2PUK C;  3GV1 A;  2LJR A;  1GSF A;  1A2M A;  1U6T A;  1YEP A;  2H71 A;  2VL3 A;  2GQL A;  3VI5 A;  4EE0 A;  1SJ6 A;  3UBL A;  1GTB A;  1JZW A;  17GS A;  2GZP A;  2WZS A;  1GLQ A;  1A23 A;  4AJ6 A;  3GTU A;  5C04 A;  1N25 A;  3NIV A;  1ZZY A;  4EIP A;  2AYT A;  1O81 A;  3LG6 A;  1ERW A;  4RUV A;  2HSN B;  4RQX A;  3MAK A;  1BED A;  2DIY A;  3IE3 A;  4KA0 A;  5J47 A;  2K6V A;  1XG8 A;  2J23 A;  1KTE A;  2EIQ A;  4TXO B;  1ST9 A;  5HQP A;  4HZ2 A;  4IGJ A;  2XPE A;  5CNW A;  4V1A p;  1M2B A;  1JLW A;  5GAN D;  3CSJ A;  2G0F A;  2YCD A;  2A4V A;  3F6F A;  4K0G A;  4ZL9 A;  5ECL B;  4YKG A;  4F9Z A;  2H1A A;  4ZBB A;  5CRG A;  1YJ6 A;  1G7E A;  3RPP A;  1A0R P;  2FUG 2;  1R5A A;  5DAK A;  3HA9 A;  1HYU A;  1B9X C;  4N3Z A;  4ECB A;  3IPZ A;  3PH9 A;  4DSS B;  1JHB A;  2WVY A;  1B9Y C;  2I3Y A;  2VLU A;  4I97 A;  1OC9 B;  4L0W A;  5IMC A;  1KNG A;  3EE2 A;  3H4K A;  1EP7 A;  1Z7R A;  1V40 A;  4MAB A;  1ILO A;  4Z2U A;  2JU5 A;  4OCE A;  4Z2R A;  3DRN A;  3SBC A;  2IIY A;  2YNX A;  2AJQ B;  1M0U A;  2QGV A;  4HEA 2;  1UVZ A;  3O3T A;  4FO5 A;  2YWI A;  1S3C A;  4JU5 A;  4G19 A;  1NM3 A;  6GST A;  3IK7 A;  3UEM A;  1H75 A;  4MA9 A;  2VO4 A;  4WET A;  3HJM A;  2GT6 A;  1S4B P;  4AKH A;  4J57 E;  2P31 A;  4CW9 A;  1I9D A;  2BMX A;  2WUL A;  3ZLP A;  1TI3 A;  2RUE A;  2B1L A;  4FYU A;  3VWX A;  2DMM A;  4QL7 A;  1T3B A;  1TOF A;  2L4Q A;  4IJI A;  2H6Y A;  2PBJ A;  3IOS A;  4MJB A;  3IAM 2;  2WDU A;  3A2W A;  1U88 A;  3M0F A;  1M3J A;  4N10 A;  3FK8 A;  3KTB A;  2EFH A;  4P3Y B;  2O87 A;  2HFD A;  3ERF A;  5D9T A;  1H4O A;  5AIX A;  5DAK B;  4EUY A;  2H0I A;  2KP1 A;  5DJL A;  3G9B A;  4YAP A;  4USS A;  1K0N A;  5ECS A;  5A1N A;  3DVW A;  5H5S A;  4TRX A;  3FEU A;  4MPG A;  3P90 A;  1QK8 A;  4MLY A;  4POL A;  1Y25 A;  2IME A;  3I43 A;  1QQ2 A;  4XTS A;  5KEJ A;  3GL3 A;  2X8G A;  1TK0 B;  4G9H A;  1FVJ A;  1K3O A;  2DJJ A;  1SVO A;  1ZYE A;  1TP9 A;  20GS A;  1GH2 A;  1W89 A;  3ERW A;  2LNS A;  4JR4 A;  3LYK A;  1AIU A;  5ECH B;  1Z6N A;  2LRT A;  1O6J A;  3Q19 A;  4K7N A;  4IS0 A;  3QAG A;  4ULX A;  3E3E A;  2CAQ A;  19GS A;  5B7C A;  2C3Q A;  1G7O A;  3GL5 A;  2RII A;  3QAV A;  2FLS A;  5D9X A;  1BYE A;  3LOR A;  3RAZ A;  4XS1 A;  4KAE A;  4NHZ A;  3L4N A;  4K5S A;  4G0K A;  5DQS A;  4MK3 A;  3AY8 A;  2I1U A;  4IJ3 A;  3DWV A;  1AQW A;  3APS A;  5L71 A;  3EWL A;  3FZ5 A;  1JLV A;  3CBU A;  1F3A A;  3D5J A;  5GAP D;  4J2F A;  2GS3 A;  1RQM A;  3TU3 B;  2C0F A;  2FA8 A;  4CY8 A;  3BJ5 A;  4HQZ A;  2O3E A;  1V57 A;  3R2Q A;  4HZ4 A;  2FWE A;  4BPY A;  2P5Q A;  1X5E A;  1SL1 B;  3ZYW A;  2FHE A;  4YQV A;  1RK4 A;  4FH8 A;  4Q5N A;  3IV4 A;  1OE7 A;  3PGT A;  3GFK A;  3WGX A;  4GST A;  5J4V A;  1FO5 A;  4WBJ A;  4G2E A;  2B7K A;  1SJZ A;  5IQY A;  2DKH A;  1GSU A;  4IQ1 A;  4OO4 A;  3F3R A;  5A1N B;  1FHE A;  2VIM A;  4GDF A;  3M3M A;  2HXK A;  4OWY A;  4JZQ A;  2GQM A;  4I6X A;  4N11 A;  3MNG A;  3KCM A;  1BJX A;  3BBY A;  2YWM A;  4WXT A;  2JAD A;  3HVN A;  1GL8 A;  4BL7 A;  4V2M A;  2HT9 A;  4IKH A;  1TRV A;  1NSW A;  4F82 A;  5CO3 A;  3RGB C;  3K8N A;  4MH2 A;  2MMN A;  4KDY A;  4K7I A;  1Y1U A;  3CSI A;  2PVO C;  1OE8 A;  5ECQ B;  1PL1 A;  4CY6 A;  4ISD A;  2QA1 A;  1I5G A;  1YF1 A;  1XWG A;  2PVQ A;  1V2A A;  3D6I A;  4MCU A;  3GMF A;  4HUA A;  3HCZ A;  1SK1 A;  4PX1 A;  3GUS A;  5ID2 A;  1M2A A;  5BRT A;  2R4V A;  1A2L A;  3G7I A;  4G0L A;  1QMV A;  1YKA A;  2GSQ A;  1FB6 A;  2X4A A;  2WW0 A;  3IHG A;  2ON7 A;  1U3A A;  3GKK A;  1SKS B;  3ZZX A;  4TKY A;  3ZL5 A;  4WF4 A;  2JSZ A;  5ENU A;  2IL3 A;  3HYP A;  5G1K A;  5HR3 A;  4K2X A;  3DD3 A;  3LSZ A;  4RI6 A;  3N9J A;  1BF5 A;  3ED3 A;  3UVH A;  5DAL A;  1GSY A;  2E2G A;  3CRU A;  1VGL A;  7GSS A;  1GWC A;  5F8B A;  4EIQ A;  4KCE A;  2R0P A;  4YQU A;  5DCG A;  2HRN A;  2DIZ A;  5IPG A;  5FHI A;  2XBQ A;  4EC0 A;  4TR3 A;  4PUR A;  3H93 A;  1WJK A;  5B6N A;  1T4Z A;  1GTA A;  3LFL A;  4MF7 A;  3IR4 A;  1YY7 A;  4BL7 B;  3D4M A;  2LEG A;  2VOC A;  2NBS A;  3KZQ A;  3FYG A;  3SWL A;  2GST A;  3R3E A;  1XXU A;  1T7P B;  4NMU A;  1UC7 A;  4GCI A;  2LV3 A;  5HR2 A;  2GZZ A;  2M80 A;  3JCM L;  2MMO A;  4KUN A;  2H1G A;  3V1W A;  2OE1 A;  3C1R A;  1DE2 A;  2VD1 A;  3RPN A;  2HLS A;  4PUF C;  1IYH A;  1AC1 A;  3CTG A;  5EY6 A;  3C7M A;  5ID2 B;  3A5W A;  1AUC A;  3EC3 A;  1BX9 A;  1OAZ A;  5ELG A;  5JWO B;  5J41 A;  4K5R A;  1VF4 A;  4PHZ C;  2V1M A;  5J4Y A;  2CVB A;  3C71 A;  3HY2 A;  6GSV A;  1Z6M A;  2RUF A;  4GSN A;  2TRC P;  1FOV A;  4KW6 A;  1BAY A;  1TKD B;  4V2L A;  5G5E A;  2C8U A;  5DAL B;  3QD9 A;  4KDX A;  2RM5 A;  3LW9 A;  4ZB6 A;  1XWA A;  2H1L A;  4LMW A;  4EL1 A;  1CQG A;  3KXO A;  5EVO A;  1TRW A;  4G0I A;  2XPD A;  3KH7 A;  2GGT A;  1YDK A;  3D0Z A;  4X4J A;  2VL9 A;  1PKZ A;  4IHU A;  1QGV A;  3WYW A;  5A5K A;  9GSS A;  4YAV A;  2QSI A;  1YVL A;  1SKR B;  3EPT A;  3EYT A;  1K3Y A;  2WJU A;  5KN0 A;  2Z9S A;  5A34 A;  3TRP A;  3VPQ A;  5C00 A;  3VLN A;  1SL2 B;  2V6O A;  3EU4 A;  5IMD A;  4N30 A;  2UV8 G;  4FYC A;  2YZH A;  1XWB A;  4K1F A;  2YZU A;  1O8X A;  5IOX A;  1TU8 A;  3L9S A;  4FQU A;  2B1K A;  2OT3 A;  3RHB A;  1TXX A;  1ERV A;  5JWQ B;  1JFU A;  4QL9 A;  1ZCP A;  2C80 A;  4ECJ A;  1A0F A;  4WF5 A;  6GSY A;  2L4C A;  1HNA A;  2FWG A;  3P2A A;  2IFQ A;  4FYB A;  1BG1 A;  5D9W A;  1M3I A;  3EMX A;  4AF2 A;  2CV4 A;  2I9H A;  5IMA A;  4HU7 A;  2H01 A;  3UAP A;  4XHM A;  5INY A;  1M2D A;  3HZ4 A;  1X0R A;  4L5L A;  1DBY A;  1GSS A;  3O6T A;  3IC4 A;  2N5B A;  2MYG A;  3U5R E;  3FKF A;  4TOP A;  1MDK A;  1ZGN A;  3MSZ A;  10GS A;  1M7T A;  1X5D A;  5IPH A;  1TU7 A;  1TJD A;  5LD0 A;  3RHC A;  2VKZ G;  13GS A;  1XW6 A;  3KEB A;  2VCX A;  3MIX A;  3VI7 A;  2YV9 A;  1G6W A;  3IAS 2;  4EVM A;  5F06 A;  3HMJ G;  4TR1 A;  4E8H A;  4OO5 A;  2EIR A;  1KEB A;  4MH3 A;  2H74 A;  4GQF A;  2WRT A;  3D4T A;  1Y6E A;  4DSQ A;  1GRX A;  3HHV A;  3ZIV A;  5IMZ A;  4Z7X A;  3VK9 A;  3CYN A;  4TXV A;  1EEM A;  3RFR C;  1SD9 A;  2L6D A;  4X43 A;  2MZC A;  3CTF A;  1VF3 A;  2N5F A;  2ON5 A;  4A5P A;  1QXH A;  3GTU B;  3LGC A;  1Z5Y E;  1RW1 A;  4ZL8 A;  1X9S B;  2K8V A;  2R5G A;  4O5R A;  2A2S A;  1QFN A;  4V1A g;  3QAW A;  5D93 A;  4HDE A;  4PQ1 A;  5KN3 A;  2GZY A;  1S3A A;  1TTZ A;  3I9V 2;  4EKZ A;  5GZZ B;  2NTO A;  3CQF A;  3CHX C;  1YQ1 A;  2R37 A;  2IFQ B;  5A4V A;  2GSS A;  5EL8 A;  3ME7 A;  1B8X A;  3OR5 A;  5JCW A;  2NDO A;  2OKA A;  3HVX A;  1F2E A;  1ZMA A;  8GSS A;  1OC3 A;  2WCI A;  3W8J A;  2AHE A;  1SD8 A;  4GQC A;  3IDV A;  4NV5 A;  2H0G A;  4V2N A;  1CQH A;  3UBK A;  4IN0 A;  1XWC A;  3TJF A;  2V32 A;  2HSY A;  1TW9 A;  4MDC A;  1J9B A;  2E0Q A;  2IMK A;  3F4R A;  2A4H A;  2PGT A;  2I4A A;  2KUC A;  3M1G A;  2GT5 A;  1FVK A;  4HSC X;  5CAX A;  2PU9 C;  6GSW A;  1S3D A;  4JE1 A;  4XS4 A;  4J56 E;  2OBI A;  2HI7 A;  2FWF A;  2TRX A;  3H8Q A;  4ZL7 A;  3GKM A;  3ZMK A;  2CZ2 A;  2C4J A;  4O5U A;  4K2D A;  4IBP A;  2LJA A;  3GST A;  2HRK A;  4K7O A;  5COH A;  5H5R A;  4F0B A;  2PN8 A;  2H1B A;  5F07 A;  2H19 A;  2CT6 A;  1B4Q A;  12GS A;  3TJJ A;  3ZIJ A;  4LLR A;  2YWN A;  2RLI A;  1F37 A;  2M46 A;  4TR4 A;  2GQK A;  2LKU A;  1PX6 A;  1R5P A;  1XVW A;  2VL2 A;  2B7J A;  1OKD A;  3U6V A;  1F6M C;  2VCV A;  5KOX A;  2L59 A;  4DVC A;  4ZIJ A;  5E59 A;  3LEF A;  4QMK A;  5G2Z A;  2KHP A;  1A8Y A;  5FT3 A;  1PN9 A;  4KSO A;  1XCC A;  4FXY P;  3TRX A;  2OAD A;  1V9W A;  3GKN A;  2EFC A;  4NXI A;  1GUH A;  2I81 A;  2WZ9 A;  5KN1 A;  3F0I A;  1R26 A;  4WR4 A;  3O76 A;  3UAR A;  2HZF A;  4I8B A;  2VCW A;  3ZTL A;  2QKE A;  2E7P A;  16GS A;  2L5O A;  3TKS C;  1G0T A;  2IMD A;  1UN2 A;  5B8A A;  1THO A;  2V2G A;  2LS5 A;  1M9B A;  1IYI A;  4PNF A;  3P7X A;  2WVX A;  1I1I P;  4XIH A;  1K0C A;  3G7J A;  3RDW A;  3EIN A;  4IEL A;  1FG4 A;  1GUM A;  3KMN A;  2AUV A;  4GRF A;  3FZA A;  3ZRE A;  2YOI A;  2HRK B;  5IO2 A;  4WEY A;  4BVX A;  4AGS A;  5IM9 A;  1T4Y A;  5HFG A;  1EOG A;  1GTI A;  2X64 A;  3VWU A;  1PA3 A;  4EXJ A;  3L78 A;  4MF5 A;  1OC8 A;  1SVL A;  2VM1 A;  2OJL A;  4PTS A;  4BWQ A;  1XVQ A;  1TDI A;  2YN1 A;  4WR5 A;  1YZX A;  5DBQ A;  1MTC A;  5IIZ A;  1ACV A;  2EIO A;  4MPF A;  2BJX A;  1HQO A;  2YJ7 A;  3DEX A;  4JED A;  5DJM A;  3VWV A;  2JL4 A;  5J3R A;  2OE3 A;  3W8S A;  4MMM A;  4X0X A;  3LJR A;  4PI2 C;  1MD3 A;  4Z2T A;  2L5L A;  4K9Z A;  1WIK A;  3HZ8 A;  2LQO A;  5BMU A;  4Q5F A;  1Q98 A;  3ZML A;  2K9F A;  4L0U A;  1M99 A;  4BWS A;  2C0D A;  2YJH A;  2GTU A;  1ERU A;  3S9F A;  4O7H A;  2CQ9 A;  1U87 A;  1AQV A;  3CSH A;  1HNB A;  1GNE A;  4MJA A;  2XHF A;  2VCQ A;  3Q18 A;  5HR0 A;  2YWO A;  4OD7 A;  4GSS A;  3FR9 A;  3HVS A;  3IRA A;  5H5Q A;  4XRA A;  4ZXG A;  4GTU A;  4EDY A;  3TKS E;  1DUG A;  2DC5 A;  1WE0 A;  1QUW A;  5G30 A;  2WVX B;  2F8A A;  1YKC A;  3ISO A;  1HD2 A;  2ZCT A;  4E8E A;  3GA4 A;  4F03 A;  4I2T A;  1JZR A;  2OA7 A;  2ES7 A;  3FZ9 A;  2LRC A;  2C0G A;  1T1V A;  1PGT A;  4HQS A;  4HI7 A;  1ZOF A;  5LNK e;  1V98 A;  4N0V A;  3HD5 A;  2R0G A;  1X9W B;  3QDN A;  4ZBA A;  3GH6 A;  2FWH A;  4KE3 A;  1YEW C;  3UVT A;  1WP0 A;  4WBR D;  4BVX B;  3D22 A;  1SJI A;  2EFE A;  1R7H A;  2P5R A;  3TOU A;  2FGX A;  2H66 A;  4CDO A;  2DJ2 A;  2O85 A;  4N0Z A;  4YH2 A;  4KCA A;  5ABR A;  3A3T A;  4LMV A;  2KOK A;  2MMZ A;  4DEJ A;  1V58 A;  2CAI A;  2M72 A;  2ZUP A;  2HSN A;  2WVZ A;  3BCK A;  3E0U A;  2JZT A;  4MNN A;  2WW2 A;  2ALB A;  2NPB A;  1AXD A;  4AKG A;  3DIE A;  3A2V A;  4ZB9 A;  3F6D A;  11GS A;  3D21 A;  3J7Y k;  3WT2 A;  1XIY A;  2VCZ A;  2C3N A;  1GNW A;  3VFI A;  1TK5 B;  1GSE A;  1PN0 A;  5BMU B;  2CX4 A;  5HFK A;  1BG5 A;  3ZIT A;  4NV2 A;  14GS A;  1T00 A;  2PWJ A;  1FOH A;  2YPM A;  4K8M A;  3L9U A;  3PR8 A;  4GLT A;  3FW2 A;  3QOU A;  2XC2 A;  1XW5 A;  4ZIL A;  2NVL A;  5D96 A;  2G2Q A;  1E2Y A;  5G5F A;  1R4W A;  1TI1 A;  3ZFL A;  1PKW A;  1OC9 A;  6GSX A;  2EC4 A;  2H30 A;  1EP8 A;  2GDR A;  1X9M B;  2UZ8 A;  3GSS A;  3KMO A;  2H73 A;  22GS A;  3HDC A;  3LXZ A;  5AIS A;  4BVY A;  2BTO T;  1O7U A;  1K0M A;  4L8E A;  3F4S A;  4MZB A;  1WPI A;  2X8C A;  1PQN A;  3KIJ A;  4YKF A;  4ACS A;  3BCI A;  1Z3E A;  4DSR A;  5A4W A;  3IHQ A;  2LNT A;  5F05 A;  3WT1 A;  5IMF A;  2K8S A;  4X1U A;  4KB3 A;  5AIV A;  4IP1 A;  4MP4 A;  5ECO B;  1PD2 1;  4Q5R A;  2A2P A;  2C3T A;  5DCH A;  3CMI A;  4POM A;  2H70 A;  4IW9 A;  3MWH A;  4JR6 A;  3TCO A;  2MBT A;  4ZBD A;  2IMI A;  4OFM A;  1MD4 A;  1XPV A;  4EO3 A;  4PXO A;  1TRS A;  3P8W A;  1J0F A;  1Z7P A;  1MDI A;  4KND A;  1O85 A;  2HE3 A;  2KP2 A;  2F8F A;  4I5Q A;  1UA5 A;  3Q6O A;  1W4V A;  2GSR A;  3UMA A;  4TVE A;  2FNO A;  4G01 A;  2D2Z A;  4PQH A;  5ECM B;  5FWG A;  18GS A;  3I6A A;  5F0G A;  5J4U A;  3CWG A;  2O5V A;  1AAZ A;  3ZVJ A;  1FAA A;  2DKI A;  4BA7 A;  4HJM A;  2HZE A;  4OCF A;  5B8B A;  4XS6 A;  2E2M A;  3GKX A;  3NZN A;  3APO A;  1NW2 A;  2C1Y A;  4JBB A;  5ELA A;  5B6M A;  2PER A;  1K0B A;  2LQQ A;  2X99 A;  4BVY B;  5A34 B;  5ECK B;  1OVN A;  3FMW A;  2H8L A;  3VWW A;  1KBN A;  1GP1 A;  6GSU A;  1SK2 A;  2B3S A;  4YQM A;  1XWK A;  3GNJ A;  1K0D A;  3PPU A;  5CRH A;  1EOH A;  1EGO A;  1TXU A;  5ECI B;  1XFL A;  4G10 A;  1EV4 A;  3LYP A;  3LWA A;  4XCS A;  1SEN A;  4PI0 C;  1S3R A;  3F4T A;  1XBS A;  1GTU A;  3ZRD A;  5A5H A;  4TN8 A;  1O73 A;  2H6Z A;  1E6B A; 
#chains in the Genus database with same CATH homology
 4ECC A;  2R2J A;  4IQA A;  3FY7 A;  4MZW A;  3KH9 A;  2VL2 C;  2AV4 A;  2R0C A;  1SKW B;  4Q5Q A;  3CRT A;  3A2X A;  1YEX A;  4AJ7 A;  4L5O A;  2MMA A;  1F3B A;  2R3X A;  4NWY A;  1XZO A;  2FD3 A;  5J9B A;  3F9U A;  2VD0 A;  3TKQ A;  2N5A A;  5IOW A;  2VCT A;  5A4U A;  2CX3 A;  1DSB A;  3GHA A;  5CYY A;  1VF1 A;  2QC7 A;  4K0N A;  2H0H A;  1K0O A;  4XRD A;  2IMF A;  4IVF A;  4TR0 A;  2V41 A;  1TK8 B;  5CRD A;  3KP8 A;  4F2I A;  1SU9 A;  3UIW A;  4KSM A;  2IN3 A;  1JZD A;  2JZR A;  2MBS A;  5D8I A;  4GF0 A;  1ML6 A;  2PMT A;  1DE1 A;  3TB2 A;  3MDK A;  3E9J B;  4TR1 B;  1AQX A;  4KGI A;  3L9V A;  4NPB A;  1NHO A;  2HZE B;  4EF0 A;  2QA2 A;  3TUE A;  1PSQ A;  1PRX A;  2FY6 A;  2DJ3 A;  1OKT A;  2O8V B;  2ZNM A;  5KOW A;  3WGE A;  1PMT A;  4I2U A;  5D73 A;  3CXG A;  4CHS A;  3GYK A;  4MF6 A;  4QQ7 A;  3C73 A;  4HS1 A;  2HSH A;  4OMV A;  2H1D A;  5KN2 A;  4K6X A;  3ZFB A;  2L57 A;  2OBK A;  1Q4J A;  2LUS A;  1VF2 A;  3VPT A;  1SYR A;  4PQI A;  2YAN A;  1B4P A;  3J7Y b;  5A5H B;  2JZS A;  1XOB A;  1NHY A;  1ZYQ B;  1LBK A;  4FIW A;  2WGR A;  1ZYN A;  1LJR A;  3N5O A;  1JZO A;  3QMX A;  3GIX A;  5JCU A;  3GN3 A;  4HU9 A;  4ZB8 A;  4AKI A;  3W6G A;  1OYJ A;  3MYD A;  3A5I A;  3IXR A;  4ZB7 A;  4GXZ A;  2TIR A;  5DDL A;  1YF0 A;  4ILF A;  2AAW A;  1WWJ A;  4MJC A;  2H6X A;  1EZK A;  5E4W A;  1X5C A;  3GRX A;  3VUR A;  3EUR A;  4HJ2 A;  3TOT A;  1EEJ A;  2KLX A;  3TJK A;  4ECI A;  4WKW A;  2CA8 A;  3FHK A;  1ZL9 A;  2A2R A;  1F9M A;  2VAF A;  4NAX A;  5J40 A;  3QFA C;  3EU3 A;  3TKR A;  3NOF A;  1K3L A;  2F3M A;  3F3Q A;  4XS4 B;  3US3 A;  3KP9 A;  1BQ7 A;  2IWT A;  3L0H A;  2DJK A;  1ERT A;  4MZC A;  5HR1 A;  1MEK A;  4ML6 A;  4PGT A;  5CRE A;  4GWR A;  3HVV A;  2HQT A;  3ME8 A;  2H72 A;  2CVD A;  1TRU A;  5AN1 A;  4POK A;  2OAC A;  3H1N A;  2LTK A;  3QFB C;  3TGZ A;  5JCG A;  3TKP A;  2YV7 A;  5CRW A;  4RI7 A;  1A24 A;  1EGR A;  1FW1 A;  3GX0 A;  3KM6 A;  3G7Y A;  4OFT A;  3KGK A;  1ZYP A;  3FR3 A;  3FZ4 A;  2FCH A;  2H75 A;  2YP6 A;  1ABA A;  3EMP A;  3HJO A;  5G31 A;  1GSD A;  4ID0 A;  2F9S A;  2DJ1 A;  4AKX B;  2WS2 A;  1XOA A;  2J9H A;  3H79 A;  2DSA A;  3F63 A;  4RQR A;  3TKS A;  3APQ A;  3M8N A;  2EFD A;  5IMV A;  2PPT A;  1MDJ A;  5CP1 A;  2LJK A;  2B5X A;  4W66 A;  5ECR B;  3F8U A;  4EDZ A;  1SK0 A;  1SVM A;  2HSM A;  2IJY A;  4D73 A;  5J5N A;  2HYX A;  1Z9H A;  5EPF A;  5HFI A;  2XBI A;  3DKS A;  5DVB A;  2DBC A;  2DLX A;  5LCZ A;  4O32 A;  1T8E B;  4ICY A;  3IK9 A;  3DXB A;  5J9C A;  4LL4 B;  1WOU A;  3GX8 A;  3QPM A;  3RBT A;  1G6Y A;  4KF9 A;  1A2J A;  3HXS A;  1GLP A;  4KX4 A;  2O7K A;  2VLT A;  4PUA A;  2WB9 A;  1GUL A;  4AJ8 A;  4LA1 A;  4E68 A;  1URM A;  1WMJ A;  2X49 A;  3KTL A;  5ECP B;  2WFC A;  4POB A;  2LST A;  3Q74 A;  2AB6 A;  1XW9 A;  5GSS A;  1U3I A;  1LU4 A;  3LQ7 A;  5GST A;  1FB0 A;  5IO0 A;  1EV9 A;  3BD2 A;  4H86 A;  2CZ3 A;  2L6C A;  3M9K A;  3DGQ A;  2V6K A;  2B5E A;  3EVI A;  3PIN A;  2HRF A;  4AI6 A;  2VLV A;  3TJG A;  3HKR A;  4HOJ A;  3TRQ A;  1HNC A;  2IPA A;  1EWX A;  2K18 A;  2VUP A;  4TXO A;  2GVP A;  4PNG A;  2RM6 A;  5D9V A;  4KDU A;  1B48 A;  2OE0 A;  2O89 A;  2FA4 A;  4O92 A;  4JRR A;  2F51 A;  2JSY A;  4ML1 A;  3ZVJ D;  3WD6 A;  3IA1 A;  1VRS D;  3M9J A;  3LXT A;  2GLR A;  3IC8 A;  3TJB A;  4NHW A;  5DQY A;  1USB A;  5G1L A;  3DYR A;  3WGD A;  3KD0 A;  3UL3 A;  1PL2 A;  4O5Q A;  1PX7 A;  2JAC A;  5JWR B;  3HJP A;  3I69 A;  2P0G A;  2R6K A;  3KJY A;  4DSS A;  2C0E A;  1SYX A;  1A8L A;  3GH9 A;  2HNL A;  3DVX A;  3BOA A;  3QCP A;  4LL1 B;  2HSM B;  4D73 B;  1N8J A;  6GSS A;  3ERG A;  4OFN A;  1N2A A;  2B6M A;  4MJE A;  3DML A;  1C72 A;  4IP6 A;  1M9A A;  2LRN A;  2X8H A;  4KH7 A;  4F0C A;  3QR6 A;  1WRY A;  3TDG A;  2CVK A;  2HRA A;  2DML A;  2B5Y A;  1AW9 A;  3FRC A;  1SL0 B;  2VM2 A;  1THX A;  3FR6 A;  1J08 A;  1ON4 A;  3C8E A;  2DJ0 A;  1GUK A;  4TW5 A;  5AGY A;  5ECN B;  3IBH A;  3C1S A;  1K0A A;  3GUR A;  3UOM A;  2REM A;  3UJ1 A;  1GSQ A;  2H76 A;  1O8W A;  2PUK C;  3GV1 A;  2LJR A;  1GSF A;  1A2M A;  1U6T A;  1YEP A;  2H71 A;  2VL3 A;  2GQL A;  3VI5 A;  4EE0 A;  1SJ6 A;  3UBL A;  1GTB A;  1JZW A;  17GS A;  2GZP A;  1GLQ A;  1A23 A;  4AJ6 A;  3GTU A;  5C04 A;  1N25 A;  3NIV A;  1ZZY A;  4EIP A;  2AYT A;  1O81 A;  3LG6 A;  1ERW A;  4RUV A;  2HSN B;  4RQX A;  3MAK A;  1BED A;  2DIY A;  3IE3 A;  4KA0 A;  5J47 A;  2K6V A;  2J23 A;  1KTE A;  2EIQ A;  4TXO B;  1ST9 A;  5HQP A;  4HZ2 A;  4IGJ A;  2XPE A;  5CNW A;  4V1A p;  1M2B A;  1JLW A;  5GAN D;  3CSJ A;  2G0F A;  2YCD A;  2A4V A;  3F6F A;  4K0G A;  4ZL9 A;  5ECL B;  4YKG A;  4F9Z A;  2H1A A;  4ZBB A;  5CRG A;  1YJ6 A;  1G7E A;  3RPP A;  1A0R P;  2FUG 2;  1R5A A;  5DAK A;  3HA9 A;  1HYU A;  1B9X C;  4N3Z A;  4ECB A;  3IPZ A;  3PH9 A;  4DSS B;  1JHB A;  1B9Y C;  2I3Y A;  2VLU A;  4I97 A;  1OC9 B;  4L0W A;  5IMC A;  1KNG A;  3EE2 A;  3H4K A;  1EP7 A;  1Z7R A;  1V40 A;  4MAB A;  1ILO A;  4Z2U A;  2JU5 A;  4OCE A;  4Z2R A;  3DRN A;  3SBC A;  2IIY A;  2YNX A;  2AJQ B;  1M0U A;  2QGV A;  4HEA 2;  1UVZ A;  3O3T A;  4FO5 A;  2YWI A;  1S3C A;  4JU5 A;  4G19 A;  1NM3 A;  6GST A;  3IK7 A;  3UEM A;  1H75 A;  4MA9 A;  2VO4 A;  4WET A;  3HJM A;  2GT6 A;  4AKH A;  4J57 E;  2P31 A;  4CW9 A;  1I9D A;  2BMX A;  2WUL A;  3ZLP A;  1TI3 A;  2RUE A;  2B1L A;  4FYU A;  3VWX A;  2DMM A;  4QL7 A;  1T3B A;  1TOF A;  2L4Q A;  4IJI A;  2H6Y A;  2PBJ A;  3IOS A;  4MJB A;  3IAM 2;  2WDU A;  3A2W A;  1U88 A;  3M0F A;  4N10 A;  3FK8 A;  3KTB A;  2EFH A;  4P3Y B;  2O87 A;  2HFD A;  3ERF A;  5D9T A;  1H4O A;  5AIX A;  5DAK B;  4EUY A;  2H0I A;  2KP1 A;  5DJL A;  3G9B A;  4YAP A;  4USS A;  1K0N A;  5ECS A;  5A1N A;  3DVW A;  5H5S A;  4TRX A;  3FEU A;  4MPG A;  3P90 A;  1QK8 A;  4MLY A;  4POL A;  1Y25 A;  2IME A;  3I43 A;  1QQ2 A;  4XTS A;  5KEJ A;  3GL3 A;  2X8G A;  1TK0 B;  4G9H A;  1FVJ A;  1K3O A;  2DJJ A;  1SVO A;  1ZYE A;  1TP9 A;  20GS A;  1GH2 A;  1W89 A;  3ERW A;  2LNS A;  4JR4 A;  3LYK A;  1AIU A;  5ECH B;  1Z6N A;  2LRT A;  1O6J A;  3Q19 A;  4K7N A;  4IS0 A;  3QAG A;  4ULX A;  3E3E A;  2CAQ A;  19GS A;  5B7C A;  2C3Q A;  1G7O A;  3GL5 A;  2RII A;  3QAV A;  2FLS A;  5D9X A;  1BYE A;  3LOR A;  3RAZ A;  4XS1 A;  4KAE A;  4NHZ A;  3L4N A;  4K5S A;  4G0K A;  5DQS A;  4MK3 A;  3AY8 A;  2I1U A;  4IJ3 A;  3DWV A;  1AQW A;  3APS A;  5L71 A;  3EWL A;  3FZ5 A;  1JLV A;  3CBU A;  1F3A A;  3D5J A;  5GAP D;  4J2F A;  2GS3 A;  1RQM A;  3TU3 B;  2C0F A;  2FA8 A;  4CY8 A;  3BJ5 A;  4HQZ A;  1V57 A;  3R2Q A;  4HZ4 A;  2FWE A;  4BPY A;  2P5Q A;  1X5E A;  1SL1 B;  3ZYW A;  2FHE A;  4YQV A;  1RK4 A;  4FH8 A;  4Q5N A;  3IV4 A;  1OE7 A;  3PGT A;  3GFK A;  3WGX A;  4GST A;  5J4V A;  1FO5 A;  4WBJ A;  4G2E A;  2B7K A;  1SJZ A;  5IQY A;  2DKH A;  1GSU A;  4IQ1 A;  4OO4 A;  3F3R A;  5A1N B;  1FHE A;  2VIM A;  4GDF A;  3M3M A;  2HXK A;  4OWY A;  4JZQ A;  2GQM A;  4I6X A;  4N11 A;  3MNG A;  3KCM A;  1BJX A;  3BBY A;  2YWM A;  4WXT A;  2JAD A;  1GL8 A;  4BL7 A;  4V2M A;  2HT9 A;  4IKH A;  1TRV A;  1NSW A;  4F82 A;  5CO3 A;  3K8N A;  4MH2 A;  2MMN A;  4KDY A;  4K7I A;  1Y1U A;  3CSI A;  2PVO C;  1OE8 A;  5ECQ B;  1PL1 A;  4CY6 A;  4ISD A;  2QA1 A;  1I5G A;  1YF1 A;  1XWG A;  2PVQ A;  1V2A A;  3D6I A;  4MCU A;  3GMF A;  4HUA A;  3HCZ A;  1SK1 A;  4PX1 A;  3GUS A;  5ID2 A;  1M2A A;  5BRT A;  2R4V A;  1A2L A;  3G7I A;  4G0L A;  1QMV A;  1YKA A;  2GSQ A;  1FB6 A;  2X4A A;  3IHG A;  2ON7 A;  1U3A A;  3GKK A;  1SKS B;  3ZZX A;  4TKY A;  3ZL5 A;  4WF4 A;  2JSZ A;  5ENU A;  2IL3 A;  3HYP A;  5G1K A;  5HR3 A;  4K2X A;  3DD3 A;  3LSZ A;  4RI6 A;  3N9J A;  1BF5 A;  3ED3 A;  3UVH A;  5DAL A;  1GSY A;  2E2G A;  3CRU A;  1VGL A;  7GSS A;  1GWC A;  5F8B A;  4EIQ A;  4KCE A;  2R0P A;  4YQU A;  5DCG A;  2HRN A;  2DIZ A;  5IPG A;  5FHI A;  2XBQ A;  4EC0 A;  4TR3 A;  4PUR A;  3H93 A;  1WJK A;  5B6N A;  1T4Z A;  1GTA A;  3LFL A;  4MF7 A;  3IR4 A;  1YY7 A;  4BL7 B;  3D4M A;  2LEG A;  2VOC A;  2NBS A;  3KZQ A;  3FYG A;  3SWL A;  2GST A;  3R3E A;  1XXU A;  1T7P B;  4NMU A;  1UC7 A;  4GCI A;  2LV3 A;  5HR2 A;  2GZZ A;  2M80 A;  3JCM L;  2MMO A;  4KUN A;  2H1G A;  3V1W A;  2OE1 A;  3C1R A;  1DE2 A;  2VD1 A;  3RPN A;  2HLS A;  4PUF C;  1IYH A;  1AC1 A;  3CTG A;  5EY6 A;  3C7M A;  5ID2 B;  3A5W A;  1AUC A;  3EC3 A;  1BX9 A;  1OAZ A;  5ELG A;  5JWO B;  5J41 A;  4K5R A;  1VF4 A;  2V1M A;  5J4Y A;  2CVB A;  3C71 A;  3HY2 A;  6GSV A;  1Z6M A;  2RUF A;  4GSN A;  2TRC P;  1FOV A;  4KW6 A;  1BAY A;  1TKD B;  4V2L A;  5G5E A;  2C8U A;  5DAL B;  3QD9 A;  4KDX A;  2RM5 A;  3LW9 A;  4ZB6 A;  1XWA A;  2H1L A;  4LMW A;  4EL1 A;  1CQG A;  3KXO A;  5EVO A;  1TRW A;  4G0I A;  2XPD A;  3KH7 A;  2GGT A;  1YDK A;  3D0Z A;  4X4J A;  2VL9 A;  1PKZ A;  4IHU A;  1QGV A;  3WYW A;  5A5K A;  9GSS A;  4YAV A;  2QSI A;  1YVL A;  1SKR B;  3EPT A;  3EYT A;  1K3Y A;  2WJU A;  5KN0 A;  2Z9S A;  5A34 A;  3TRP A;  3VPQ A;  5C00 A;  3VLN A;  1SL2 B;  2V6O A;  3EU4 A;  5IMD A;  4N30 A;  2UV8 G;  4FYC A;  2YZH A;  1XWB A;  4K1F A;  2YZU A;  1O8X A;  5IOX A;  1TU8 A;  3L9S A;  4FQU A;  2B1K A;  2OT3 A;  3RHB A;  1TXX A;  1ERV A;  5JWQ B;  1JFU A;  4QL9 A;  1ZCP A;  2C80 A;  4ECJ A;  1A0F A;  4WF5 A;  6GSY A;  2L4C A;  1HNA A;  2FWG A;  3P2A A;  2IFQ A;  4FYB A;  1BG1 A;  5D9W A;  3EMX A;  4AF2 A;  2CV4 A;  2I9H A;  5IMA A;  4HU7 A;  2H01 A;  3UAP A;  4XHM A;  5INY A;  1M2D A;  3HZ4 A;  1X0R A;  4L5L A;  1DBY A;  1GSS A;  3O6T A;  3IC4 A;  2N5B A;  2MYG A;  3U5R E;  3FKF A;  4TOP A;  1MDK A;  1ZGN A;  3MSZ A;  10GS A;  1M7T A;  1X5D A;  5IPH A;  1TU7 A;  1TJD A;  5LD0 A;  3RHC A;  2VKZ G;  13GS A;  1XW6 A;  3KEB A;  2VCX A;  3MIX A;  3VI7 A;  2YV9 A;  1G6W A;  3IAS 2;  4EVM A;  5F06 A;  3HMJ G;  4TR1 A;  4E8H A;  4OO5 A;  2EIR A;  1KEB A;  4MH3 A;  2H74 A;  4GQF A;  2WRT A;  3D4T A;  1Y6E A;  4DSQ A;  1GRX A;  3HHV A;  3ZIV A;  5IMZ A;  4Z7X A;  3VK9 A;  3CYN A;  4TXV A;  1EEM A;  1SD9 A;  2L6D A;  4X43 A;  2MZC A;  3CTF A;  1VF3 A;  2N5F A;  2ON5 A;  4A5P A;  1QXH A;  3GTU B;  3LGC A;  1Z5Y E;  1RW1 A;  4ZL8 A;  1X9S B;  2K8V A;  2R5G A;  4O5R A;  2A2S A;  1QFN A;  4V1A g;  3QAW A;  5D93 A;  4HDE A;  4PQ1 A;  5KN3 A;  2GZY A;  1S3A A;  1TTZ A;  3I9V 2;  4EKZ A;  5GZZ B;  2NTO A;  1YQ1 A;  2R37 A;  2IFQ B;  5A4V A;  2GSS A;  5EL8 A;  3ME7 A;  1B8X A;  3OR5 A;  5JCW A;  2NDO A;  2OKA A;  3HVX A;  1F2E A;  1ZMA A;  8GSS A;  1OC3 A;  2WCI A;  3W8J A;  2AHE A;  1SD8 A;  4GQC A;  3IDV A;  4NV5 A;  2H0G A;  4V2N A;  1CQH A;  3UBK A;  4IN0 A;  1XWC A;  3TJF A;  2V32 A;  2HSY A;  1TW9 A;  4MDC A;  1J9B A;  2E0Q A;  2IMK A;  3F4R A;  2A4H A;  2PGT A;  2I4A A;  2KUC A;  3M1G A;  2GT5 A;  1FVK A;  5CAX A;  2PU9 C;  6GSW A;  1S3D A;  4JE1 A;  4XS4 A;  4J56 E;  2OBI A;  2HI7 A;  2FWF A;  2TRX A;  3H8Q A;  4ZL7 A;  3GKM A;  3ZMK A;  2CZ2 A;  2C4J A;  4O5U A;  4K2D A;  4IBP A;  2LJA A;  3GST A;  2HRK A;  4K7O A;  5COH A;  5H5R A;  4F0B A;  2PN8 A;  2H1B A;  5F07 A;  2H19 A;  2CT6 A;  1B4Q A;  12GS A;  3TJJ A;  3ZIJ A;  4LLR A;  2YWN A;  2RLI A;  1F37 A;  2M46 A;  4TR4 A;  2GQK A;  2LKU A;  1PX6 A;  1R5P A;  1XVW A;  2VL2 A;  2B7J A;  1OKD A;  3U6V A;  1F6M C;  2VCV A;  5KOX A;  2L59 A;  4DVC A;  4ZIJ A;  5E59 A;  3LEF A;  4QMK A;  5G2Z A;  2KHP A;  1A8Y A;  5FT3 A;  1PN9 A;  4KSO A;  1XCC A;  3TRX A;  2OAD A;  1V9W A;  3GKN A;  2EFC A;  4NXI A;  1GUH A;  2I81 A;  2WZ9 A;  5KN1 A;  3F0I A;  1R26 A;  4WR4 A;  3O76 A;  3UAR A;  2HZF A;  4I8B A;  2VCW A;  3ZTL A;  2QKE A;  2E7P A;  16GS A;  2L5O A;  3TKS C;  1G0T A;  2IMD A;  1UN2 A;  5B8A A;  1THO A;  2V2G A;  2LS5 A;  1M9B A;  1IYI A;  4PNF A;  3P7X A;  4XIH A;  1K0C A;  3G7J A;  3RDW A;  3EIN A;  4IEL A;  1FG4 A;  1GUM A;  3KMN A;  2AUV A;  4GRF A;  3FZA A;  3ZRE A;  2YOI A;  2HRK B;  5IO2 A;  4WEY A;  4BVX A;  4AGS A;  5IM9 A;  1T4Y A;  5HFG A;  1EOG A;  1GTI A;  2X64 A;  3VWU A;  1PA3 A;  4EXJ A;  3L78 A;  4MF5 A;  1OC8 A;  1SVL A;  2VM1 A;  2OJL A;  4PTS A;  4BWQ A;  1XVQ A;  1TDI A;  2YN1 A;  4WR5 A;  1YZX A;  5DBQ A;  1MTC A;  5IIZ A;  1ACV A;  2EIO A;  4MPF A;  2BJX A;  1HQO A;  2YJ7 A;  3DEX A;  4JED A;  5DJM A;  3VWV A;  2JL4 A;  5J3R A;  2OE3 A;  3W8S A;  4MMM A;  4X0X A;  3LJR A;  1MD3 A;  4Z2T A;  2L5L A;  4K9Z A;  1WIK A;  3HZ8 A;  2LQO A;  5BMU A;  4Q5F A;  1Q98 A;  3ZML A;  2K9F A;  4L0U A;  1M99 A;  4BWS A;  2C0D A;  2YJH A;  2GTU A;  1ERU A;  3S9F A;  4O7H A;  2CQ9 A;  1U87 A;  1AQV A;  3CSH A;  1HNB A;  1GNE A;  4MJA A;  2XHF A;  2VCQ A;  3Q18 A;  5HR0 A;  2YWO A;  4OD7 A;  4GSS A;  3FR9 A;  3HVS A;  3IRA A;  5H5Q A;  4XRA A;  4ZXG A;  4GTU A;  4EDY A;  3TKS E;  1DUG A;  2DC5 A;  1WE0 A;  1QUW A;  5G30 A;  2F8A A;  1YKC A;  3ISO A;  1HD2 A;  2ZCT A;  4E8E A;  3GA4 A;  4F03 A;  4I2T A;  1JZR A;  2OA7 A;  2ES7 A;  3FZ9 A;  2LRC A;  2C0G A;  1T1V A;  1PGT A;  4HQS A;  4HI7 A;  1ZOF A;  5LNK e;  1V98 A;  4N0V A;  3HD5 A;  2R0G A;  1X9W B;  3QDN A;  4ZBA A;  3GH6 A;  2FWH A;  4KE3 A;  3UVT A;  1WP0 A;  4WBR D;  4BVX B;  3D22 A;  1SJI A;  2EFE A;  1R7H A;  2P5R A;  3TOU A;  2FGX A;  2H66 A;  4CDO A;  2DJ2 A;  2O85 A;  4N0Z A;  4YH2 A;  4KCA A;  5ABR A;  3A3T A;  4LMV A;  2KOK A;  2MMZ A;  4DEJ A;  1V58 A;  2CAI A;  2M72 A;  2ZUP A;  2HSN A;  3BCK A;  3E0U A;  2JZT A;  4MNN A;  2ALB A;  2NPB A;  1AXD A;  4AKG A;  3DIE A;  3A2V A;  4ZB9 A;  3F6D A;  11GS A;  3D21 A;  3J7Y k;  3WT2 A;  1XIY A;  2VCZ A;  2C3N A;  1GNW A;  3VFI A;  1TK5 B;  1GSE A;  1PN0 A;  5BMU B;  2CX4 A;  5HFK A;  1BG5 A;  3ZIT A;  4NV2 A;  14GS A;  1T00 A;  2PWJ A;  1FOH A;  2YPM A;  4K8M A;  3L9U A;  3PR8 A;  4GLT A;  3FW2 A;  3QOU A;  2XC2 A;  1XW5 A;  4ZIL A;  2NVL A;  5D96 A;  2G2Q A;  1E2Y A;  5G5F A;  1R4W A;  1TI1 A;  3ZFL A;  1PKW A;  1OC9 A;  6GSX A;  2EC4 A;  2H30 A;  1EP8 A;  2GDR A;  1X9M B;  2UZ8 A;  3GSS A;  3KMO A;  2H73 A;  22GS A;  3HDC A;  3LXZ A;  5AIS A;  4BVY A;  2BTO T;  1O7U A;  1K0M A;  4L8E A;  3F4S A;  4MZB A;  1WPI A;  2X8C A;  1PQN A;  3KIJ A;  4YKF A;  4ACS A;  3BCI A;  1Z3E A;  4DSR A;  5A4W A;  3IHQ A;  2LNT A;  5F05 A;  3WT1 A;  5IMF A;  2K8S A;  4X1U A;  4KB3 A;  5AIV A;  4IP1 A;  4MP4 A;  5ECO B;  1PD2 1;  4Q5R A;  2A2P A;  2C3T A;  5DCH A;  3CMI A;  4POM A;  2H70 A;  4IW9 A;  3MWH A;  4JR6 A;  3TCO A;  2MBT A;  4ZBD A;  2IMI A;  4OFM A;  1MD4 A;  1XPV A;  4EO3 A;  4PXO A;  1TRS A;  3P8W A;  1J0F A;  1Z7P A;  1MDI A;  4KND A;  1O85 A;  2HE3 A;  2KP2 A;  2F8F A;  4I5Q A;  1UA5 A;  3Q6O A;  1W4V A;  2GSR A;  3UMA A;  4TVE A;  2FNO A;  4G01 A;  2D2Z A;  4PQH A;  5ECM B;  5FWG A;  18GS A;  3I6A A;  5F0G A;  5J4U A;  3CWG A;  2O5V A;  1AAZ A;  3ZVJ A;  1FAA A;  2DKI A;  4BA7 A;  4HJM A;  2HZE A;  4OCF A;  5B8B A;  4XS6 A;  2E2M A;  3GKX A;  3NZN A;  3APO A;  1NW2 A;  2C1Y A;  4JBB A;  5ELA A;  5B6M A;  2PER A;  1K0B A;  2LQQ A;  2X99 A;  4BVY B;  5A34 B;  5ECK B;  1OVN A;  3FMW A;  2H8L A;  3VWW A;  1KBN A;  1GP1 A;  6GSU A;  1SK2 A;  2B3S A;  4YQM A;  1XWK A;  3GNJ A;  1K0D A;  3PPU A;  5CRH A;  1EOH A;  1EGO A;  1TXU A;  5ECI B;  1XFL A;  4G10 A;  1EV4 A;  3LYP A;  3LWA A;  4XCS A;  1SEN A;  3F4T A;  1XBS A;  1GTU A;  3ZRD A;  5A5H A;  4TN8 A;  1O73 A;  2H6Z A;  1E6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...