1XW5A

Human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase Mu 2
publication title Structural Perturbation of the Active Site of Human Glutathione-S-Transferase M2-2 Upon Ligand Binding
rcsb
source organism Homo sapiens
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xw5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw5A01
3A2WA 4IN0A 3BD2A 5IO2A 1GUHA 4GCIA 8GSSA 1OC3A 1XWCA 5G1KA 1HNBA 1SK1A 4ZIJA 2DIYA 2LNTA 4XTSA 1SL0B 4ML6A 2ON5A 5GAND 2LUSA 4ZBDA 11GSA 1K0CA 3IC4A 3KMOA 1OC8A 1A23A 3FR6A 3CTFA 1ABAA 4YQMA 4IQAA 5IOXA 1TDIA 2HRNA 1ZL9A 3TJGA 1PGTA 2KOKA 1BG5A 4TR0A 1GTAA 2L6CA 3MAKA 5G31A 1F2EA 5F0GA 3FEUA 4K9ZA 4HJMA 3Q18A 4JRRA 4NAXA 2IPAA 4NV2A 1TW9A 1CQHA 5JCUA 2TRXA 3CXGA 1K3YA 3L9SA 2WS2A 2V6OA 3S9FA 1GLPA 2Z9SA 3VWUA 2I81A 3FHKA 5JWRB 2L4CA 1URMA 2XPEA 4MF7A 2LV3A 4JE1A 3ZVJD 1MD3A 5ENUA 2WFCA 5IMVA 2E7PA 1Y6EA 3FY7A 2KP2A 2J9HA 1F3BA 4IELA 1A2LA 2LJKA 1O6JA 2B5EA 1GTBA 3CBUA 1KTEA 2CVDA 2LTKA 4L0WA 1X9SB 3EWLA 2DJJA 4PQ1A 4BVYB 3NZNA 4F9ZA 3HJMA 4Q5FA 1WPIA 4LLRA 4GLTA 1JFUA 3FW2A 3L4NA 4WR5A 4ISDA 3QAWA 4Q5RA 1BAYA 3ZMKA 4ZILA 4O5RA 1PQNA 2LS5A 4KDXA 4FH8A 4DSSB 4G0KA 4GSNA 3KH7A 2FWEA 1GL8A 4WEYA 4YQVA 2VUPA 4OFTA 5ECKB 1R26A 2PMTA 2UZ8A 2X64A 10GSA 1BYEA 4V2NA 3ISOA 2H70A 4BWSA 4F82A 5BMUA 3IAS2 2VLUA 2EIOA 3M0FA 1ZYEA 1TP9A 2HSMB 1O8XA 1T4YA 7GSSA 3E0UA 5AISA 4XS6A 2VAFA 3C1SA 2PU9C 1G6WA 14GSA 3M9JA 3QCPA 1GH2A 2B3SA 4E8EA 2R3XA 4L8EA 3CMIA 5IPGA 1TRUA 2VCZA 1T00A 2DMMA 5IMFA 1EV4A 2V41A 4XS4A 3F63A 3C7MA 1YEPA 2VL9A 5IMCA 2LJRA 4OD7A 1B4PA 4PURA 5DJMA 5J41A 3EURA 2N5AA 2V1MA 4Q5QA 4IQ1A 5G2ZA 1SENA 1GNEA 3J7Yk 2GGTA 4WBRD 2CQ9A 3D0ZA 2I9HA 3HA9A 3DVXA 1J0FA 3FZAA 1WRYA 1ZOFA 2DIZA 2PVOC 2XC2A 4KW6A 4CW9A 1ZCPA 3RPNA 2FWHA 2GQMA 1NM3A 2D2ZA 2LQOA 2JSZA 4JU5A 2EIQA 2HYXA 3HY2A 4GTUA 1DUGA 1ZYQB 3GX0A 5A5KA 1IYHA 4BL7B 5AIXA 1PRXA 2DMLA 3FK8A 1QMVA 2E2GA 4G0IA 3APOA 2FGXA 3WGDA 4POBA 5B6NA 2CV4A 1GUKA 2JZSA 3KTLA 1VF2A 5FHIA 1PSQA 1XOBA 5C00A 2OE3A 1T8EB 4ECIA 4I5QA 1EP8A 4LL1B 1U87A 3HCZA 1XVQA 1AIUA 3GV1A 5HR2A 2IL3A 4K0GA 1DSBA 1TKDB 4GSTA 1T7PB 4NHWA 4KA0A 3TJFA 2L4QA 2VL2C 4IP6A 3F4TA 2CT6A 1F37A 1YZXA 1VF3A 1SK2A 5CP1A 3GFKA 4X1UA 3GKKA 1Z6NA 5CAXA 1PN9A 1M9AA 2CA8A 3KEBA 1DBYA 3HDCA 1JZWA 3APQA 4J57E 2DBCA 2MBSA 4KGIA 1XWGA 1K0OA 2HSYA 4JZQA 1FO5A 2VD1A 2H75A 5CO3A 4KSOA 4WF4A 1K0MA 1YQ1A 5ELGA 3M9KA 2H73A 4I97A 1OC9B 3C73A 1USBA 1VF4A 5E59A 4AGSA 2MZCA 5KEJA 5F06A 1O81A 1H4OA 1UC7A 1GSUA 4L5OA 2GTUA 3H1NA 3UBLA 2LEGA 2C0FA 3TJBA 3TDGA 3IBHA 1WE0A 5IQYA 1TK5B 2R6KA 4D73A 5JCWA 1JZRA 1BX9A 3L0HA 2YJ7A 2VL3A 2WZ9A 4X0XA 1M2DA 2ON7A 4ZL7A 5DJLA 2IFQB 3TKSC 4KE3A 4N0ZA 1PL1A 2YZUA 4PX1A 2C0EA 3HKRA 1FB6A 1G0TA 3VWXA 1TK8B 3QAGA 1K0NA 4ZB6A 3IA1A 4EKZA 2C3NA 3UOMA 1VRSD 3NIVA 4MZWA 2H1DA 2YCDA 2ZUPA 5G5FA 3WD6A 5B8AA 19GSA 2PN8A 3ZIJA 2VD0A 4YAVA 3DRNA 1XBSA 3RAZA 3GTUA 1TK0B 2V6KA 3QMXA 4V1Ap 3GKMA 3R3EA 1S3AA 3IXRA 3RBTA 2JL4A 1A8YA 3LGCA 4FYCA 4KCAA 2B7JA 3KCMA 5FWGA 1O73A 3IOSA 3ZRDA 5A4WA 2P5RA 3DIEA 4BA7A 3U6VA 4KB3A 5DALB 1Z9HA 2YJHA 4EUYA 2DC5A 2HFDA 4ID0A 3HVXA 2C0GA 5IIZA 2L57A 3LYPA 5LD0A 3QDNA 4KCEA 3IC8A 2H1GA 3ZLPA 1TU8A 4MZCA 2B1KA 3G7IA 1YJ6A 4OWYA 1M0UA 3ERGA 3Q74A 3PH9A 4EVMA 5ELAA 2F51A 2REMA 1V40A 4J2FA 4F0BA 1DE1A 4AJ6A 3CRTA 1VGLA 3I6AA 3IAM2 2K9FA 5HR3A 17GSA 4ZXGA 3AY8A 2JSYA 3QPMA 1W89A 5ID2B 3IV4A 1K0AA 3GL5A 2IJYA 2L6DA 1GWCA 4YQUA 2YP6A 5IO0A 5JCGA 6GSUA 4G0LA 3CRUA 3UARA 4RUVA 3MNGA 2X8GA 1EGRA 5KN0A 2RM5A 2H66A 4G10A 2C80A 1A0RP 3ZFLA 3QOUA 1AQVA 2YWOA 2M80A 1LJRA 6GSSA 1PD21 3KZQA 2H72A 2IMKA 3FZ9A 1O85A 3F0IA 3N5OA 2HXKA 1ERVA 2EIRA 2MMAA 4H86A 3ZYWA 1JHBA 3VFIA 4MPFA 3G7JA 1HNAA 3MWHA 1SK0A 2PERA 4F2IA 1RQMA 2VO4A 2XHFA 4K7OA 2HT9A 3VPTA 4BWQA 4O32A 1S3DA 1GTIA 4EO3A 4HQZA 3HXSA 3A5WA 1FW1A 4CDOA 3VLNA 4NPBA 1QUWA 2YWNA 1OE7A 1YEXA 4TR1B 5ECQB 5J9BA 2B7KA 4FO5A 2PPTA 2A2SA 3Q19A 5HQPA 3DD3A 1QFNA 2OBIA 4Z7XA 1LBKA 5JWQB 3DVWA 2H19A 3D22A 2CZ2A 1TRSA 3QAVA 3TRQA 1H75A 4XCSA 4TRXA 3LFLA 3KTBA 2NPBA 4NV5A 4ZBBA 2RUEA 1YKCA 2X99A 2GSRA 4P3YB 3ERWA 1LU4A 2IMDA 2J23A 4V2MA 1B8XA 3TB2A 1EWXA 1TI3A 5GSTA 3GIXA 5H5RA 2HRKA 1EGOA 3EVIA 1O7UA 1MDIA 2H76A 5CRHA 1V9WA 2DJKA 2XBQA 1X9WB 3KJYA 2C0DA 2OA7A 2IMIA 2CZ3A 2F8FA 1BQ7A 2X8HA 4KAEA 1SL1B 1N8JA 1MEKA 3US3A 3D5JA 5E4WA 2PVQA 5IMDA 4HOJA 1YY7A 3F4SA 1SL2B 3HD5A 2YZHA 2NBSA 4BVXB 3IHQA 3MSZA 5IMZA 1AAZA 2VM1A 5ECSA 2KHPA 4OFNA 1G7EA 4POLA 3JCML 4GQFA 2AHEA 2C3TA 1ON4A 2FA4A 5G5EA 4NMUA 3W6GA 2GSSA 3UVTA 3WGXA 2QSIA 3L9VA 2WGRA 4LL4B 2LJAA 5J5NA 2AUVA 4XS1A 4KDUA 1EZKA 1GRXA 4TXOB 5KN1A 3GYKA 5LNKe 1B9YC 3N9JA 1XZOA 2P31A 3SBCA 4LMVA 1WIKA 2O8VB 4IVFA 2AV4A 3J7Yb 3O3TA 1ERTA 2BJXA 2CVKA 3ED3A 1M2AA 3F9UA 2B5XA 2JACA 4N0VA 4KNDA 2IFQA 2QC7A 1T3BA 2PGTA 1O8WA 5IMAA 1EEJA 1XWAA 4IGJA 4HU9A 4AF2A 3IR4A 5F07A 1ZZYA 3ERFA 5INYA 3PPUA 2HI7A 2DJ0A 2YV7A 2LKUA 4O7HA 3ME8A 1YF1A 4WXTA 3WT1A 1X5CA 5ECMB 1ERWA 4NXIA 5CREA 3K8NA 5HR0A 3W8JA 1NHYA 2YANA 4KSMA 4IHUA 1HD2A 3FRCA 3I69A 1NSWA 2HE3A 3KP8A 1UN2A 1Z7PA 3FKFA 4EC0A 4HZ2A 4NHZA 4GWRA 5HFIA 3KP9A 4HJ2A 5GSSA 2C1YA 3IK9A 2L5OA 1X0RA 4ACSA 5EL8A 3GURA 2F3MA 2FWGA 4OCEA 1TJDA 1TRWA 4FIWA 1TOFA 3L78A 1OKDA 3WYWA 16GSA 1Z3EA 4DSQA 1F3AA 2O87A 3O76A 4ULXA 2RM6A 3F3QA 2R5GA 4JEDA 2VCXA 1FG4A 1TRVA 3TJJA 4GXZA 4ML1A 1I5GA 3CSJA 1VF1A 4FYBA 4ZB9A 3C1RA 5DAKA 3VWVA 1GNWA 4K6XA 2VCQA 3FR9A 1SD8A 1ACVA 3P2AA 3ZFBA 4GF0A 2FNOA 4PUFC 1DE2A 4F0CA 2TIRA 3DKSA 5IM9A 5KN2A 5D9WA 3LORA 1GLQA 2CX3A 3KD0A 2FY6A 5ID2A 3BCKA 2I1UA 1SYXA 4GQCA 2HRFA 2DSAA 1FVKA 4I8BA 4PUAA 1E2YA 4KH7A 2GS3A 5D96A 1GP1A 1MDJA 1SJ6A 3Q6OA 4V2LA 5AGYA 1SKRB 1WOUA 3VI7A 3EU3A 3IK7A 1SD9A 4GSSA 4JBBA 2HZFA 2QGVA 3ZREA 4NWYA 1G7OA 2E2MA 2LRNA 2MMOA 3HYPA 1GULA 4K2DA 1K3OA 3GHAA 3WGEA 1Y25A 2GQKA 3KGKA 2R2JA 3ZZXA 4EDZA 5C04A 3DWVA 2O89A 4POKA 4IS0A 3A2VA 2IN3A 2DJ1A 3ZMLA 2HZEB 2N5FA 1R4WA 2FHEA 2YOIA 4X43A 4TR1A 2YPMA 3LWAA 2FLSA 4IBPA 2ALBA 2H6YA 1WMJA 4HU7A 3KM6A 5KN3A 4CHSA 1Q4JA 2FWFA 1FB0A 4HS1A 5LCZA 3NOFA 4XS4B 4OFMA 3QFBC 4K1FA 3F4RA 5F05A 3TOUA 5AIVA 3CSIA 5ECIB 1NW2A 5AN1A 1AUCA 5J3RA 1NHOA 3UJ1A 2M72A 1EOGA 3LQ7A 4QL9A 3PINA 1SJZA 3D4MA 3HZ8A 1SKWB 4JR6A 4TVEA 6GSXA 1WJKA 4AJ8A 2BMXA 1SYRA 3BCIA 1QQ2A 2PUKC 2X8CA 2IWTA 4PQIA 2MMZA 1ZGNA 1HQOA 5ECHB 1G6YA 5G1LA 3GH9A 1RK4A 2YWIA 1WP0A 4BVYA 5DBQA 2QKEA 2V2GA 3GSTA 2R4VA 1OE8A 4PTSA 1IYIA 3UBKA 4MK3A 3UEMA 4DSRA 3C71A 3GMFA 3A2XA 1QXHA 4EL1A 3ME7A 5GZZB 4IJIA 1N2AA 3HVSA 2YN1A 4QQ7A 4TR3A 2AYTA 3PR8A 4DSSA 4MPGA 2H71A 4WF5A 1PX6A 4MJBA 5HFGA 3U5RE 5J9CA 22GSA 5EPFA 3DXBA 1I9DA 2HNLA 5IOWA 2C3QA 3QFAC 4XRAA 2KP1A 4I6XA 1YF0A 3TCOA 5JWOB 4ZL8A 5COHA 1PA3A 1Z6MA 1XXUA 3LXTA 2ES7A 1TU7A 4PQHA 4OCFA 5CYYA 2LNSA 4MF6A 2C4JA 2HSMA 6GSYA 2YWMA 3GUSA 1J9BA 2DJ3A 1X9MB 4RQXA 4EXJA 3OR5A 5HFKA 5ECNB 3P7XA 4MH2A 3G9BA 4I2TA 5IPHA 1V98A 1KBNA 3H93A 5CRDA 1MDKA 3UVHA 4MP4A 2OE0A 3G7YA 1BEDA 2PBJA 1OVNA 2LSTA 3EINA 4HUAA 3RDWA 4WR4A 1B4QA 1TXXA 5D73A 4MF5A 3KIJA 2LRCA 4MJAA 4MMMA 1V58A 1AQWA 4KDYA 4WKWA 3H79A 1K3LA 3H8QA 3TJKA 4D73B 5CNWA 1JLVA 2O85A 3EMPA 4KF9A 4EE0A 4HI7A 1HYUA 1PX7A 2CAIA 4BL7A 1B9XC 1XIYA 2GZYA 2KLXA 3F6DA 2DJ2A 3R2QA 3TKRA 5D9VA 1OYJA 1M7TA 2RIIA 1KNGA 2M46A 3HHVA 1U88A 1Z5YE 2OADA 1TTZA 1M2BA 2G2QA 1GSQA 1QK8A 1ERUA 5FT3A 2K6VA 2GSTA 1W4VA 2VL2A 2LRTA 3IDVA 5D9XA 1ST9A 4HEA2 1CQGA 3KH9A 2B6MA 2XPDA 3IPZA 1ILOA 1AQXA 4PGTA 2WULA 2AB6A 5HR1A 2H1AA 1UA5A 3GTUB 3UAPA 6GSVA 3A3TA 1WWJA 3LJRA 1QGVA 4O92A 1AC1A 3EC3A 3APSA 4MJEA 1GSSA 4BPYA 5DQSA 2N5BA 3LYKA 1GUMA 1BJXA 2JZRA 4HQSA 5ECLB 2H6XA 3VWWA 2B5YA 1ZMAA 2GT6A 1R5PA 2H01A 3KXOA 2B1LA 1V57A 2H0IA 4IW9A 1B48A 1XPVA 1EP7A 1F6MC 3MDKA 3P90A 2OBKA 4I2UA 4MCUA 3WT2A 3EYTA 2TRCP 4OO4A 1OC9A 1THXA 3BOAA 2H1BA 9GSSA 2V32A 2P5QA 2DLXA 3C8EA 1J08A 2P0GA 2IMEA 2ZCTA 3TKSA 1PKZA 2GSQA 3I9V2 1PKWA 4TXVA 4TR4A 1T4ZA 2OKAA 1A2JA 4QL7A 1A24A 2HZEA 4JR4A 1SJIA 5DCGA 5ECRB 3LXZA 5DCHA 2CX4A 3KMNA 3FR3A 2WCIA 3PGTA 1TI1A 2MYGA 1XWKA 4MH3A 1GSEA 3O6TA 5CRWA 1GSDA 3TUEA 5A4UA 4TKYA 5ABRA 4LA1A 1Z7RA 1XCCA 4MLYA 3GL3A 1KEBA 3E9JB 4K0NA 4F03A 1M99A 4PNGA 1X5DA 3CYNA 2WB9A 3M3MA 3UL3A 4OO5A 1MD4A 4FQUA 1T1VA 4RI7A 4ILFA 1RW1A 2JZTA 4G9HA 4YH2A 1THOA 1GSFA 2FD3A 5ECOB 2E0QA 1OAZA 2NTOA 2JU5A 3H4KA 4N30A 3TRPA 2GDRA 3IRAA 5DQYA 5G30A 2WRTA 1FOVA 1JLWA 3D21A 2HLSA 5DALA 4IJ3A 4ZBAA 3F8UA 4XIHA 4K7IA 2VM2A 2A4VA 2HSNB 2AJQB 5ECPB 4E8HA 1JZDA 1F9MA 1PL2A 3TOTA 1OKTA 1SKSB 2RLIA 3GNJA 4KUNA 5D9TA 1K0DA 3F3RA 5B8BA 2R37A 4WETA 2ZNMA 4KX4A 1XOAA 12GSA 2H8LA 1E6BA 2H6ZA 5H5SA 1C72A 4J56E 3FYGA 1S3CA 3F6FA 2BTOT 2HRKB 2AAWA 1EOHA 3VPQA 2GQLA 1U6TA 4ECCA 2H0HA 4AJ7A 1FHEA 2NVLA 3ZITA 5A4VA 3D6IA 1EV9A 2C8UA 2VIMA 4GRFA 5H5QA 3GH6A 1Q98A 1FAAA 3IE3A 3EMXA 2GT5A 3UIWA 2IIYA 3TKPA 1U3AA 3DMLA 4DVCA 4N10A 4EDYA 3RHCA 3RPPA 2GVPA 4USSA 1XFLA 3VK9A 4IP1A 2G0FA 2MBTA 4MZBA 4LMWA 4TN8A 1AXDA 1X5EA 3UMAA 3I43A 3GA4A 5B6MA 2K8VA 3ZIVA 1AW9A 2F9SA 18GSA 2L5LA 3GRXA 5J4UA 4L5LA 3TKSE 3ZL5A 4XHMA 4TW5A 4N11A 3M1GA 4ECJA 1XW6A 5B7CA 2VLTA 1HNCA 2OACA 1M9BA 1MTCA 2NDOA 3EE2A 2OE1A 3HZ4A 2HRAA 3W8SA 2CVBA 4TOPA 4MA9A 4G2EA 4ZB8A 3FZ5A 2IMFA 1XW5A 1XW9A 1GSYA 1JZOA 1A2MA 2H74A 2A2RA 4G19A 1R5AA 2VCTA 2RUFA 5DVBA 3DYRA 3DEXA 1V2AA 3GX8A 2WDUA 3GKNA 3LEFA 2YNXA 4YAPA 1R7HA 2GLRA 4OMVA 1UVZA 5EY6A 5L71A 1YDKA 4XRDA 2I4AA 4HDEA 2LQQA 2GZPA 3P8WA 2L59A 2WJUA 2H0GA 5CRGA 13GSA 6GSWA 4POMA 5D93A 3BJ5A 4MABA 3LSZA 2VLVA 4Q5NA 3QR6A 3FZ4A 2EC4A 3SWLA 5F8BA 4L0UA 3ZVJA 2FUG2 4K7NA 3VI5A 2H30A 3TKQA 4PXOA 1ML6A 2HQTA 4FYUA 4HZ4A 3BBYA 2PWJA 3E3EA 2K8SA 2VOCA 3HJOA 1FVJA 3GKXA 3HVVA 1YKAA 2OJLA 4PNFA 3RHBA 2K18A 2HSHA 4RI6A 1K0BA 4ECBA 3L9UA 1XWBA 3M8NA 1U3IA 5D8IA 4MDCA 2FA8A 2KUCA 3V1WA 3CSHA 2I3YA 3ZTLA 2MMNA 2JADA 4ZL9A 1PMTA 1XVWA 5DDLA 3VURA 3GSSA 4V1Ag 4BVXA 1A0FA 1EEMA 6GSTA 3HJPA 3LG6A 3CTGA 4DEJA 3QD9A 3TRXA 4MJCA 3DGQA 4IKHA 3TGZA 2O7KA 5DAKB 2XBIA 4WBJA 20GSA 5GAPD 1GTUA 5EVOA 2GZZA 1A8LA 2YV9A 2VCVA 1SU9A 2F8AA 3D4TA 2FCHA 3GN3A 4K8MA 2VCWA 4TXOA 4RQRA 4EF0A 3EU4A 2CAQA
chains in the Genus database with same CATH superfamily
3A2WA 4IN0A 3BD2A 5IO2A 1GUHA 4GCIA 8GSSA 1OC3A 1XWCA 5G1KA 1HNBA 1SK1A 4ZIJA 2DIYA 2LNTA 4XTSA 1SL0B 4ML6A 2ON5A 5GAND 2LUSA 4ZBDA 11GSA 1K0CA 3IC4A 3KMOA 1OC8A 1A23A 3FR6A 3CTFA 1ABAA 4YQMA 4IQAA 5IOXA 1TDIA 2HRNA 1ZL9A 3TJGA 1PGTA 2KOKA 1BG5A 4TR0A 1GTAA 2L6CA 3MAKA 5G31A 1F2EA 5F0GA 3FEUA 4HSCX 4K9ZA 4HJMA 3Q18A 4JRRA 4NAXA 2IPAA 4NV2A 1TW9A 1CQHA 5JCUA 2TRXA 3CXGA 4AKXB 1K3YA 3L9SA 2WS2A 2V6OA 3S9FA 1GLPA 2Z9SA 3VWUA 2I81A 4AKIA 3FHKA 5JWRB 2L4CA 1URMA 2XPEA 4MF7A 2LV3A 4JE1A 4K2XA 3ZVJD 1MD3A 5ENUA 2WFCA 5IMVA 2E7PA 1Y6EA 3FY7A 2KP2A 2J9HA 1F3BA 4IELA 2O36A 1A2LA 2LJKA 5A34A 1O6JA 2B5EA 1GTBA 3CBUA 1KTEA 2CVDA 2LTKA 4L0WA 2DKHA 1X9SB 3EWLA 4Z2UA 2DJJA 4PQ1A 4BVYB 1ZYPA 3NZNA 4F9ZA 4YKFA 3HJMA 4Q5FA 1WPIA 4LLRA 4GLTA 1JFUA 3FW2A 3L4NA 4WR5A 4ISDA 3QAWA 4Q5RA 1BAYA 3ZMKA 4ZILA 4O5RA 1PQNA 2VKZG 2LS5A 3RGBC 2X49A 4KDXA 4Z2TA 4FH8A 4DSSB 5A1NB 4G0KA 4GSNA 3KH7A 2FWEA 1GL8A 4WEYA 4YQVA 2VUPA 4OFTA 5ECKB 1R26A 2PMTA 2UZ8A 2X64A 10GSA 1BYEA 4V2NA 2WVZA 3LW9A 4G01A 3ISOA 2H70A 4BWSA 4F82A 5BMUA 3IAS2 2VLUA 2EIOA 3M0FA 1ZYEA 1TP9A 2HSMB 1O8XA 4N3ZA 1T4YA 7GSSA 3E0UA 5AISA 4XS6A 2VAFA 3C1SA 2PU9C 2O3EA 1G6WA 14GSA 3M9JA 3QCPA 1GH2A 2B3SA 4E8EA 2R3XA 4L8EA 3CMIA 5IPGA 1TRUA 2VCZA 1T00A 2DMMA 5IMFA 1EV4A 2V41A 2R0CA 4XS4A 3F63A 3C7MA 1YEPA 2VL9A 5IMCA 2LJRA 4OD7A 1B4PA 4PURA 5DJMA 5J41A 3EURA 2N5AA 2V1MA 4Q5QA 4IQ1A 5G2ZA 1SENA 4YKGA 1GNEA 3J7Yk 2GGTA 4WBRD 2CQ9A 3D0ZA 2I9HA 3HA9A 3DVXA 1J0FA 3FZAA 1WRYA 1ZOFA 2DIZA 2PVOC 2A4HA 2XC2A 4KW6A 4CW9A 1ZCPA 3RPNA 2FWHA 2GQMA 1NM3A 2D2ZA 4PI0C 2LQOA 2JSZA 4JU5A 4CY8A 2EIQA 2HYXA 3HY2A 4GTUA 1DUGA 1ZYQB 3GX0A 5A5KA 1IYHA 4BL7B 5AIXA 1PRXA 2DMLA 3FK8A 1QMVA 2E2GA 4G0IA 3APOA 2FGXA 3WGDA 4POBA 5B6NA 2CV4A 1GUKA 2JZSA 3KTLA 1VF2A 5FHIA 1PSQA 1XOBA 5C00A 2OE3A 1T8EB 4ECIA 4I5QA 1EP8A 4LL1B 1U87A 3HCZA 4AKHA 1XVQA 1AIUA 3GV1A 5HR2A 2IL3A 4K0GA 1DSBA 1TKDB 4GSTA 1T7PB 4NHWA 4KA0A 3TJFA 2L4QA 2VL2C 4IP6A 3F4TA 2CT6A 3IHGA 1F37A 1YZXA 1VF3A 1SK2A 5CP1A 3GFKA 4X1UA 3GKKA 1Z6NA 5CAXA 1PN9A 1M9AA 2CA8A 3KEBA 1DBYA 4A5PA 3HDCA 1JZWA 3APQA 4J57E 2DBCA 2MBSA 4KGIA 1XWGA 1K0OA 2HSYA 4JZQA 2A2PA 1FO5A 2VD1A 2H75A 5CO3A 4KSOA 4WF4A 1K0MA 1YQ1A 5KOXA 5ELGA 3M9KA 2H73A 4I97A 1OC9B 3C73A 1USBA 1VF4A 5E59A 4AGSA 2MZCA 5KEJA 5F06A 1O81A 1H4OA 1UC7A 2QA2A 1GSUA 4L5OA 4K5SA 2GTUA 3HMJG 3H1NA 3UBLA 2LEGA 2C0FA 3TJBA 3TDGA 3IBHA 1WE0A 5IQYA 1PFOA 1TK5B 2R6KA 4D73A 5JCWA 1JZRA 1BX9A 3L0HA 2YJ7A 2VL3A 2WZ9A 4X0XA 1M2DA 2ON7A 4ZL7A 4O5QA 5DJLA 1SVLA 2IFQB 3TKSC 4KE3A 4N0ZA 1PL1A 2YZUA 4PX1A 1M3IA 3HKRA 1FB6A 2C0EA 1G0TA 3VWXA 1TK8B 2WW3A 3QAGA 1K0NA 4ZB6A 3IA1A 4EKZA 2C3NA 3UOMA 1VRSD 3NIVA 4MZWA 3CHXC 2H1DA 2YCDA 2ZUPA 5G5FA 3WD6A 5B8AA 19GSA 2PN8A 3ZIJA 2VD0A 4YAVA 3DRNA 1XBSA 3RAZA 3GTUA 4O5UA 1TK0B 2V6KA 3QMXA 4V1Ap 2EFHA 3GKMA 3R3EA 1S3AA 3IXRA 3RBTA 2JL4A 2WW0A 1A8YA 3LGCA 4FYCA 4KCAA 2B7JA 3KCMA 5FWGA 1O73A 3IOSA 3ZRDA 5A4WA 2P5RA 3DIEA 4BA7A 3U6VA 4KB3A 5DALB 1Z9HA 2YJHA 4EUYA 2DC5A 2HFDA 4ID0A 3HVXA 2C0GA 5IIZA 2L57A 3LYPA 5LD0A 3QDNA 4KCEA 3IC8A 2H1GA 3ZLPA 1TU8A 4MZCA 2B1KA 3G7IA 1YJ6A 4OWYA 1M0UA 3ERGA 3Q74A 3PH9A 4EVMA 5ELAA 2F51A 2REMA 1V40A 4J2FA 4F0BA 1DE1A 4AJ6A 3CRTA 1VGLA 3I6AA 3IAM2 2K9FA 5HR3A 17GSA 4ZXGA 3AY8A 2JSYA 3QPMA 1W89A 5ID2B 3IV4A 1K0AA 3GL5A 2IJYA 2L6DA 1GWCA 4YQUA 2YP6A 5IO0A 5JCGA 6GSUA 4G0LA 3CRUA 3UARA 4RUVA 3MNGA 2X8GA 1EGRA 5KN0A 2RM5A 2H66A 4G10A 2C80A 1A0RP 3ZFLA 3QOUA 1AQVA 2YWOA 2M80A 1LJRA 6GSSA 1PD21 3KZQA 2H72A 2IMKA 3FZ9A 1O85A 3F0IA 3N5OA 2HXKA 1ERVA 2EIRA 2MMAA 4H86A 3ZYWA 1JHBA 3VFIA 4MPFA 5A5HA 3G7JA 1HNAA 3MWHA 1SK0A 2PERA 4F2IA 1RQMA 2VO4A 2XHFA 4K7OA 2HT9A 3VPTA 4BWQA 4O32A 1S3DA 1GTIA 4EO3A 4HQZA 3HXSA 3A5WA 1FW1A 4CDOA 3VLNA 4NPBA 1QUWA 2YWNA 1OE7A 1YEXA 4TR1B 5ECQB 5J9BA 2B7KA 4FO5A 2PPTA 2A2SA 4ICYA 3Q19A 5HQPA 3DD3A 1QFNA 2OBIA 4Z7XA 1LBKA 5JWQB 3DVWA 2H19A 3D22A 4K5RA 2CZ2A 1TRSA 2HSNA 3QAVA 3TRQA 1H75A 4XCSA 4TRXA 3LFLA 3KTBA 2NPBA 4NV5A 4ZBBA 2RUEA 1YKCA 2X99A 2GSRA 4P3YB 3ERWA 1LU4A 2IMDA 2J23A 4V2MA 1B8XA 3TB2A 1EWXA 1TI3A 5GSTA 3GIXA 5H5RA 2HRKA 1EGOA 5KOWA 3EVIA 1O7UA 1MDIA 2H76A 5CRHA 1V9WA 2DJKA 2XBQA 1X9WB 3KJYA 2C0DA 2OA7A 2IMIA 2CZ3A 2X4AA 2F8FA 1BQ7A 2X8HA 4KAEA 1SL1B 1N8JA 1MEKA 3US3A 3D5JA 5E4WA 2PVQA 5IMDA 4HOJA 1YY7A 3F4SA 1SL2B 3HD5A 4W66A 2YZHA 2NBSA 4BVXB 3IHQA 3MSZA 5IMZA 1AAZA 2VM1A 4Z2RA 5ECSA 2KHPA 4OFNA 1G7EA 4POLA 3JCML 2AHEA 4GQFA 2C3TA 1ON4A 2FA4A 5G5EA 4NMUA 3W6GA 2GSSA 3UVTA 3WGXA 2QSIA 3L9VA 2WGRA 4LL4B 2LJAA 5J5NA 2AUVA 4XS1A 4KDUA 1EZKA 1GRXA 2O5VA 4TXOB 5KN1A 3GYKA 5LNKe 1B9YC 3N9JA 1XZOA 2P31A 3SBCA 4LMVA 1WIKA 2O8VB 4IVFA 2AV4A 3J7Yb 3O3TA 1ERTA 2BJXA 2CVKA 3ED3A 1M2AA 3F9UA 2B5XA 2JACA 4N0VA 4KNDA 2IFQA 5J4VA 2QC7A 1T3BA 2PGTA 1O8WA 5IMAA 1EEJA 1XWAA 4IGJA 2WW2A 1I1IP 4HU9A 4AF2A 3IR4A 5F07A 1ZZYA 3ERFA 5INYA 3PPUA 2HI7A 2DJ0A 2EFCA 2YV7A 2LKUA 4O7HA 3ME8A 1YF1A 4WXTA 4FXYP 3WT1A 1X5CA 5ECMB 1ERWA 4NXIA 5CREA 3K8NA 5HR0A 3A5IA 3W8JA 1NHYA 2YANA 4KSMA 4IHUA 1HD2A 3FRCA 3I69A 1NSWA 2HE3A 3KP8A 1UN2A 1Z7PA 3FKFA 4EC0A 4HZ2A 4NHZA 4GWRA 5HFIA 3KP9A 4HJ2A 5GSSA 2C1YA 3IK9A 2L5OA 1X0RA 4ACSA 5EL8A 3GURA 2F3MA 2FWGA 4OCEA 1TJDA 1TRWA 4FIWA 1TOFA 3L78A 1OKDA 3WYWA 16GSA 1Z3EA 4DSQA 1F3AA 2WVXB 3O76A 2O87A 4ULXA 2RM6A 3F3QA 2R5GA 4JEDA 2VCXA 1FG4A 1TRVA 3TJJA 4GXZA 4ML1A 1I5GA 3CSJA 1VF1A 4FYBA 3RFRC 4ZB9A 3C1RA 5DAKA 5A34B 3VWVA 1GNWA 4K6XA 2VCQA 3FR9A 1SD8A 1ACVA 3P2AA 1Y1UA 3ZFBA 4GF0A 2FNOA 4PUFC 1DE2A 4F0CA 2TIRA 3DKSA 5IM9A 5KN2A 5D9WA 3LORA 1GLQA 2CX3A 3KD0A 2FY6A 5ID2A 3BCKA 2I1UA 1SYXA 4GQCA 2HRFA 2DSAA 1FVKA 4I8BA 4PUAA 1E2YA 2DKIA 4KH7A 2GS3A 5D96A 1GP1A 1MDJA 1SJ6A 3Q6OA 4V2LA 5AGYA 1SKRB 1WOUA 3VI7A 2H1LA 3EU3A 3IK7A 1SD9A 4GSSA 4JBBA 2HZFA 2QGVA 3ZREA 4NWYA 1G7OA 2E2MA 2LRNA 2MMOA 3HYPA 1GULA 4K2DA 1K3OA 3GHAA 3WGEA 3MIXA 1Y25A 2GQKA 3KGKA 1YEWC 2R2JA 3ZZXA 5BMUB 4EDZA 5C04A 3DWVA 2O89A 4POKA 4IS0A 3A2VA 2IN3A 2DJ1A 3ZMLA 2HZEB 2N5FA 1R4WA 3EPTA 2FHEA 2YOIA 4X43A 4TR1A 2YPMA 3LWAA 2FLSA 5J40A 4IBPA 2ALBA 2H6YA 1WMJA 4HU7A 3KM6A 5KN3A 4CHSA 1Q4JA 2FWFA 1FB0A 4HS1A 5LCZA 3NOFA 4XS4B 4OFMA 3QFBC 4K1FA 3F4RA 5F05A 3TOUA 5AIVA 3CSIA 5ECIB 1SVOA 1NW2A 1ZYNA 5AN1A 1AUCA 5J3RA 1NHOA 3UJ1A 2M72A 1EOGA 3TU3B 3LQ7A 4QL9A 3PINA 1SJZA 3D4MA 1FOHA 3HZ8A 1SKWB 4JR6A 4TVEA 6GSXA 4EIPA 1WJKA 4AJ8A 2WW1A 2BMXA 1SYRA 3BCIA 1QQ2A 2PUKC 2X8CA 2IWTA 4PQIA 2MMZA 1ZGNA 1HQOA 5ECHB 1G6YA 5G1LA 3GH9A 1RK4A 2YWIA 1WP0A 4BVYA 5DBQA 2QKEA 4PHZC 2V2GA 3GSTA 2R4VA 1OE8A 4PTSA 1IYIA 3UBKA 4MK3A 3UEMA 4DSRA 3C71A 3GMFA 3A2XA 1QXHA 4EL1A 3ME7A 5GZZB 4IJIA 1N2AA 3HVSA 2YN1A 4QQ7A 4TR3A 2AYTA 3PR8A 4DSSA 5A1NA 4MPGA 2H71A 4WF5A 1PX6A 4MJBA 5HFGA 3U5RE 5J9CA 22GSA 5EPFA 3DXBA 1I9DA 2HNLA 5IOWA 2C3QA 3QFAC 4XRAA 2KP1A 4I6XA 1YF0A 3TCOA 5JWOB 4ZL8A 5COHA 1PA3A 1Z6MA 1XXUA 3LXTA 4BIKA 2ES7A 1PN0A 1TU7A 4GDFA 4PQHA 4OCFA 5CYYA 2LNSA 4MF6A 2C4JA 2HSMA 6GSYA 2YWMA 3GUSA 1J9BA 2DJ3A 1X9MB 4RQXA 4EXJA 3OR5A 4CY6A 5HFKA 5ECNB 3P7XA 4MH2A 3G9BA 4I2TA 5IPHA 1YVLA 1V98A 1KBNA 4ZB7A 3H93A 5CRDA 1MDKA 3UVHA 4MP4A 2OE0A 3G7YA 1BEDA 2PBJA 1OVNA 2LSTA 3EINA 4HUAA 3RDWA 4WR4A 3CQFA 1B4QA 1TXXA 5D73A 4MF5A 3KIJA 2LRCA 4MJAA 4MMMA 1V58A 1AQWA 4MNNA 4KDYA 4WKWA 3H79A 1K3LA 3H8QA 3TJKA 4D73B 5CNWA 1JLVA 2O85A 3EMPA 4KF9A 4EE0A 4HI7A 1HYUA 1PX7A 2CAIA 4BL7A 1B9XC 1XIYA 2GZYA 2KLXA 3F6DA 2DJ2A 3R2QA 3TKRA 5D9VA 1OYJA 1M7TA 2RIIA 1KNGA 2M46A 3HHVA 1U88A 1Z5YE 2OADA 1TTZA 1M2BA 2G2QA 1GSQA 1QK8A 1ERUA 5FT3A 2K6VA 2GSTA 1W4VA 2VL2A 2LRTA 3IDVA 5D9XA 1ST9A 4HEA2 1CQGA 3KH9A 2B6MA 2XPDA 3IPZA 1ILOA 1AQXA 2WVXA 4PGTA 2WULA 2AB6A 5HR1A 2H1AA 1UA5A 3GTUB 3UAPA 6GSVA 3A3TA 1WWJA 3LJRA 1QGVA 4O92A 1AC1A 3EC3A 3APSA 4MJEA 1GSSA 1S3RA 4BPYA 5DQSA 2N5BA 3LYKA 1GUMA 1BJXA 2JZRA 4HQSA 5ECLB 2H6XA 3VWWA 2B5YA 1ZMAA 2GT6A 3HVNA 1R5PA 2H01A 3KXOA 2B1LA 1V57A 2H0IA 4IW9A 1B48A 1XPVA 1EP7A 1F6MC 3MDKA 3P90A 2OBKA 4I2UA 4MCUA 3WT2A 3EYTA 2TRCP 4OO4A 1OC9A 1THXA 3BOAA 2H1BA 9GSSA 2V32A 2P5QA 2EFEA 2DLXA 5BRTA 3C8EA 1J08A 2P0GA 2IMEA 2ZCTA 3TKSA 1PKZA 2GSQA 3I9V2 1PKWA 4TXVA 4TR4A 2R0PA 1T4ZA 2OKAA 4X4JA 1A2JA 3CWGA 4QL7A 1XG8A 2HZEA 1A24A 4JR4A 1SJIA 5DCGA 5ECRB 3LXZA 5DCHA 2CX4A 3KMNA 3FR3A 2WCIA 3PGTA 1TI1A 2MYGA 1XWKA 4MH3A 1GSEA 3O6TA 5CRWA 1GSDA 3TUEA 5A4UA 4TKYA 5ABRA 2OT3A 4LA1A 5A5HB 1Z7RA 1XCCA 4MLYA 3GL3A 1KEBA 1S4BP 3E9JB 4K0NA 4F03A 1M99A 4PNGA 1X5DA 3CYNA 2WB9A 3M3MA 3UL3A 4OO5A 1MD4A 4FQUA 1T1VA 4RI7A 4ILFA 1RW1A 2JZTA 4E68A 4G9HA 3MYDA 4YH2A 1THOA 1GSFA 2FD3A 5ECOB 2E0QA 1OAZA 2NTOA 2JU5A 3H4KA 4N30A 3TRPA 2GDRA 3IRAA 5DQYA 5G30A 4PI2C 2WRTA 1FOVA 2UV8G 1JLWA 3D21A 2HLSA 5DALA 4IJ3A 4ZBAA 3F8UA 4XIHA 4K7IA 2VM2A 2A4VA 2HSNB 2AJQB 5ECPB 4E8HA 1JZDA 1F9MA 1PL2A 3TOTA 1OKTA 2WZSA 1SKSB 2RLIA 3GNJA 4KUNA 5D9TA 1K0DA 3F3RA 5J47A 5B8BA 4QMKA 2R37A 4WETA 2ZNMA 4KX4A 1XOAA 3FMWA 12GSA 2H8LA 1E6BA 2H6ZA 5H5SA 1C72A 4J56E 3FYGA 1S3CA 3F6FA 2BTOT 2HRKB 2AAWA 1EOHA 3VPQA 2GQLA 1U6TA 4ECCA 2H0HA 4AJ7A 1FHEA 2NVLA 3ZITA 5A4VA 3D6IA 1EV9A 2C8UA 2VIMA 2WVYA 4GRFA 5H5QA 3GH6A 1Q98A 1FAAA 3IE3A 3EMXA 2GT5A 3UIWA 2IIYA 3TKPA 1U3AA 3DMLA 4DVCA 4N10A 1N25A 4EDYA 3RHCA 1BG1A 3RPPA 2GVPA 4USSA 1XFLA 3VK9A 4IP1A 2G0FA 2MBTA 4MZBA 4LMWA 4TN8A 1AXDA 1X5EA 3UMAA 3I43A 3GA4A 4EIQA 5B6MA 2K8VA 3ZIVA 1AW9A 2F9SA 18GSA 1SVMA 2L5LA 3GRXA 5J4UA 4L5LA 3TKSE 3ZL5A 4XHMA 4TW5A 4N11A 3M1GA 4ECJA 1XW6A 5B7CA 2VLTA 1HNCA 2OACA 1M9BA 1MTCA 2NDOA 3EE2A 2OE1A 3HZ4A 2HRAA 3W8SA 2CVBA 4TOPA 2R0GA 4MA9A 4G2EA 4ZB8A 3FZ5A 2IMFA 1XW5A 1XW9A 1GSYA 1JZOA 1A2MA 2H74A 2A2RA 4G19A 1R5AA 2VCTA 1BF5A 2RUFA 5DVBA 3DYRA 3DEXA 1V2AA 3GX8A 2WDUA 3GKNA 3LEFA 2YNXA 4YAPA 1R7HA 2GLRA 4OMVA 1UVZA 5EY6A 5L71A 1YDKA 5J4YA 4XRDA 2I4AA 4HDEA 2LQQA 2GZPA 3P8WA 2L59A 2EFDA 2WJUA 2H0GA 5CRGA 13GSA 6GSWA 4POMA 5D93A 3BJ5A 4MABA 3LSZA 2VLVA 4Q5NA 3QR6A 3FZ4A 2EC4A 3SWLA 5F8BA 4L0UA 3ZVJA 2FUG2 4K7NA 3VI5A 2QA1A 2H30A 1TXUA 3TKQA 4PXOA 1ML6A 2HQTA 4FYUA 4HZ4A 3BBYA 2PWJA 3E3EA 2K8SA 2VOCA 3HJOA 1FVJA 3GKXA 3HVVA 1YKAA 2OJLA 4PNFA 3RHBA 2K18A 2HSHA 4RI6A 1K0BA 4ECBA 3L9UA 1XWBA 4AI6A 3M8NA 1U3IA 5D8IA 4MDCA 2FA8A 2KUCA 3V1WA 3CSHA 2I3YA 3ZTLA 2MMNA 2JADA 4ZL9A 1PMTA 1XVWA 5DDLA 3VURA 3GSSA 4V1Ag 4BVXA 1A0FA 1EEMA 6GSTA 3HJPA 3LG6A 1M3JA 3CTGA 4DEJA 3QD9A 3TRXA 4MJCA 3DGQA 4IKHA 3TGZA 2O7KA 5DAKB 2XBIA 4WBJA 20GSA 5GAPD 1GTUA 5EVOA 2GZZA 1A8LA 2YV9A 2VCVA 1SU9A 2F8AA 3D4TA 2FCHA 3GN3A 4K8MA 2VCWA 4AKGA 4TXOA 4RQRA 4EF0A 3EU4A 2CAQA
chains in the Genus database with same CATH topology
3A2WA 4IN0A 3BD2A 5IO2A 1GUHA 4GCIA 8GSSA 1OC3A 1XWCA 5G1KA 1HNBA 1SK1A 4ZIJA 2DIYA 2LNTA 4XTSA 1SL0B 4ML6A 2ON5A 5GAND 2LUSA 4ZBDA 11GSA 1K0CA 3IC4A 3KMOA 1OC8A 1A23A 3FR6A 3CTFA 1ABAA 4YQMA 4IQAA 5IOXA 1TDIA 2HRNA 1ZL9A 3TJGA 1PGTA 2KOKA 1BG5A 4TR0A 1GTAA 2L6CA 3MAKA 5G31A 1F2EA 5F0GA 3FEUA 4K9ZA 4HJMA 3Q18A 4JRRA 4NAXA 2IPAA 4NV2A 1TW9A 1CQHA 5JCUA 2TRXA 3CXGA 4AKXB 1K3YA 3L9SA 2WS2A 2V6OA 3S9FA 1GLPA 2Z9SA 3VWUA 2I81A 4AKIA 3FHKA 5JWRB 2L4CA 1URMA 2XPEA 4MF7A 2LV3A 4JE1A 4K2XA 3ZVJD 1MD3A 5ENUA 2WFCA 5IMVA 2E7PA 1Y6EA 3FY7A 2KP2A 2J9HA 1F3BA 4IELA 1A2LA 2LJKA 5A34A 1O6JA 2B5EA 1GTBA 3CBUA 1KTEA 2CVDA 2LTKA 4L0WA 2DKHA 1X9SB 3EWLA 4Z2UA 2DJJA 4PQ1A 4BVYB 1ZYPA 3NZNA 4F9ZA 4YKFA 3HJMA 4Q5FA 1WPIA 4LLRA 4GLTA 1JFUA 3FW2A 3L4NA 4WR5A 4ISDA 3QAWA 4Q5RA 1BAYA 3ZMKA 4ZILA 4O5RA 1PQNA 2VKZG 2LS5A 2X49A 4KDXA 4Z2TA 4FH8A 4DSSB 5A1NB 4G0KA 4GSNA 3KH7A 2FWEA 1GL8A 4WEYA 4YQVA 2VUPA 4OFTA 5ECKB 1R26A 2PMTA 2UZ8A 2X64A 10GSA 1BYEA 4V2NA 3LW9A 4G01A 3ISOA 2H70A 4BWSA 4F82A 5BMUA 3IAS2 2VLUA 2EIOA 3M0FA 1ZYEA 1TP9A 2HSMB 1O8XA 4N3ZA 1T4YA 7GSSA 3E0UA 5AISA 4XS6A 2VAFA 3C1SA 2PU9C 1G6WA 14GSA 3M9JA 3QCPA 1GH2A 2B3SA 4E8EA 2R3XA 4L8EA 3CMIA 5IPGA 1TRUA 2VCZA 1T00A 2DMMA 5IMFA 1EV4A 2V41A 2R0CA 4XS4A 3F63A 3C7MA 1YEPA 2VL9A 5IMCA 2LJRA 4OD7A 1B4PA 4PURA 5DJMA 5J41A 3EURA 2N5AA 2V1MA 4Q5QA 4IQ1A 5G2ZA 1SENA 4YKGA 1GNEA 3J7Yk 2GGTA 4WBRD 2CQ9A 3D0ZA 2I9HA 3HA9A 3DVXA 1J0FA 3FZAA 1WRYA 1ZOFA 2DIZA 2PVOC 2A4HA 2XC2A 4KW6A 4CW9A 1ZCPA 3RPNA 2FWHA 2GQMA 1NM3A 2D2ZA 2LQOA 2JSZA 4JU5A 4CY8A 2EIQA 2HYXA 3HY2A 4GTUA 1DUGA 1ZYQB 3GX0A 5A5KA 1IYHA 4BL7B 5AIXA 1PRXA 2DMLA 3FK8A 1QMVA 2E2GA 4G0IA 3APOA 2FGXA 3WGDA 4POBA 5B6NA 2CV4A 1GUKA 2JZSA 3KTLA 1VF2A 5FHIA 1PSQA 1XOBA 5C00A 2OE3A 1T8EB 4ECIA 4I5QA 1EP8A 4LL1B 1U87A 3HCZA 4AKHA 1XVQA 1AIUA 3GV1A 5HR2A 2IL3A 4K0GA 1DSBA 1TKDB 4GSTA 1T7PB 4NHWA 4KA0A 3TJFA 2L4QA 2VL2C 4IP6A 3F4TA 2CT6A 3IHGA 1F37A 1YZXA 1VF3A 1SK2A 5CP1A 3GFKA 4X1UA 3GKKA 1Z6NA 5CAXA 1PN9A 1M9AA 2CA8A 3KEBA 1DBYA 4A5PA 3HDCA 1JZWA 3APQA 4J57E 2DBCA 2MBSA 4KGIA 1XWGA 1K0OA 2HSYA 4JZQA 2A2PA 1FO5A 2VD1A 2H75A 5CO3A 4KSOA 4WF4A 1K0MA 1YQ1A 5KOXA 5ELGA 3M9KA 2H73A 4I97A 1OC9B 3C73A 1USBA 1VF4A 5E59A 4AGSA 2MZCA 5KEJA 5F06A 1O81A 1H4OA 1UC7A 2QA2A 1GSUA 4L5OA 4K5SA 2GTUA 3HMJG 3H1NA 3UBLA 2LEGA 2C0FA 3TJBA 3TDGA 3IBHA 1WE0A 5IQYA 1TK5B 2R6KA 4D73A 5JCWA 1JZRA 1BX9A 3L0HA 2YJ7A 2VL3A 2WZ9A 4X0XA 1M2DA 2ON7A 4ZL7A 4O5QA 5DJLA 1SVLA 2IFQB 3TKSC 4KE3A 4N0ZA 1PL1A 2YZUA 4PX1A 2C0EA 3HKRA 1FB6A 1G0TA 3VWXA 1TK8B 3QAGA 1K0NA 4ZB6A 3IA1A 4EKZA 2C3NA 3UOMA 1VRSD 3NIVA 4MZWA 2H1DA 2YCDA 2ZUPA 5G5FA 3WD6A 5B8AA 19GSA 2PN8A 3ZIJA 2VD0A 4YAVA 3DRNA 1XBSA 3RAZA 3GTUA 4O5UA 1TK0B 2V6KA 3QMXA 4V1Ap 2EFHA 3GKMA 3R3EA 1S3AA 3IXRA 3RBTA 2JL4A 1A8YA 3LGCA 4FYCA 4KCAA 2B7JA 3KCMA 5FWGA 1O73A 3IOSA 3ZRDA 5A4WA 2P5RA 3DIEA 4BA7A 3U6VA 4KB3A 5DALB 1Z9HA 2YJHA 4EUYA 2DC5A 2HFDA 4ID0A 3HVXA 2C0GA 5IIZA 2L57A 3LYPA 5LD0A 3QDNA 4KCEA 3IC8A 2H1GA 3ZLPA 1TU8A 4MZCA 2B1KA 3G7IA 1YJ6A 4OWYA 1M0UA 3ERGA 3Q74A 3PH9A 4EVMA 5ELAA 2F51A 2REMA 1V40A 4J2FA 4F0BA 1DE1A 4AJ6A 3CRTA 1VGLA 3I6AA 3IAM2 2K9FA 5HR3A 17GSA 4ZXGA 3AY8A 2JSYA 3QPMA 1W89A 5ID2B 3IV4A 1K0AA 3GL5A 2IJYA 2L6DA 1GWCA 4YQUA 2YP6A 5IO0A 5JCGA 6GSUA 4G0LA 3CRUA 3UARA 4RUVA 3MNGA 2X8GA 1EGRA 5KN0A 2RM5A 2H66A 4G10A 2C80A 1A0RP 3ZFLA 3QOUA 1AQVA 2YWOA 2M80A 1LJRA 6GSSA 1PD21 3KZQA 2H72A 2IMKA 3FZ9A 1O85A 3F0IA 3N5OA 2HXKA 1ERVA 2EIRA 2MMAA 4H86A 3ZYWA 1JHBA 3VFIA 4MPFA 5A5HA 3G7JA 1HNAA 3MWHA 1SK0A 2PERA 4F2IA 1RQMA 2VO4A 2XHFA 4K7OA 2HT9A 3VPTA 4BWQA 4O32A 1S3DA 1GTIA 4EO3A 4HQZA 3HXSA 3A5WA 1FW1A 4CDOA 3VLNA 4NPBA 1QUWA 2YWNA 1OE7A 1YEXA 4TR1B 5ECQB 5J9BA 2B7KA 4FO5A 2PPTA 2A2SA 4ICYA 3Q19A 5HQPA 3DD3A 1QFNA 2OBIA 4Z7XA 1LBKA 5JWQB 3DVWA 2H19A 3D22A 4K5RA 2CZ2A 1TRSA 2HSNA 3QAVA 3TRQA 1H75A 4XCSA 4TRXA 3LFLA 3KTBA 2NPBA 4NV5A 4ZBBA 2RUEA 1YKCA 2X99A 2GSRA 4P3YB 3ERWA 1LU4A 2IMDA 2J23A 4V2MA 1B8XA 3TB2A 1EWXA 1TI3A 5GSTA 3GIXA 5H5RA 2HRKA 1EGOA 5KOWA 3EVIA 1O7UA 1MDIA 2H76A 5CRHA 1V9WA 2DJKA 2XBQA 1X9WB 3KJYA 2C0DA 2OA7A 2IMIA 2CZ3A 2X4AA 2F8FA 1BQ7A 2X8HA 4KAEA 1SL1B 1N8JA 1MEKA 3US3A 3D5JA 5E4WA 2PVQA 5IMDA 4HOJA 1YY7A 3F4SA 1SL2B 3HD5A 4W66A 2YZHA 2NBSA 4BVXB 3IHQA 3MSZA 5IMZA 1AAZA 2VM1A 4Z2RA 5ECSA 2KHPA 4OFNA 1G7EA 4POLA 3JCML 2AHEA 4GQFA 2C3TA 1ON4A 2FA4A 5G5EA 4NMUA 3W6GA 2GSSA 3UVTA 3WGXA 2QSIA 3L9VA 2WGRA 4LL4B 2LJAA 5J5NA 2AUVA 4XS1A 4KDUA 1EZKA 1GRXA 2O5VA 4TXOB 5KN1A 3GYKA 5LNKe 1B9YC 3N9JA 1XZOA 2P31A 3SBCA 4LMVA 1WIKA 2O8VB 4IVFA 2AV4A 3J7Yb 3O3TA 1ERTA 2BJXA 2CVKA 3ED3A 1M2AA 3F9UA 2B5XA 2JACA 4N0VA 4KNDA 2IFQA 5J4VA 2QC7A 1T3BA 2PGTA 1O8WA 5IMAA 1EEJA 1XWAA 4IGJA 4HU9A 4AF2A 3IR4A 5F07A 1ZZYA 3ERFA 5INYA 3PPUA 2HI7A 2DJ0A 2EFCA 2YV7A 2LKUA 4O7HA 3ME8A 1YF1A 4WXTA 3WT1A 1X5CA 5ECMB 1ERWA 4NXIA 5CREA 3K8NA 5HR0A 3A5IA 3W8JA 1NHYA 2YANA 4KSMA 4IHUA 1HD2A 3FRCA 3I69A 1NSWA 2HE3A 3KP8A 1UN2A 1Z7PA 3FKFA 4EC0A 4HZ2A 4NHZA 4GWRA 5HFIA 3KP9A 4HJ2A 5GSSA 2C1YA 3IK9A 2L5OA 1X0RA 4ACSA 5EL8A 3GURA 2F3MA 2FWGA 4OCEA 1TJDA 1TRWA 4FIWA 1TOFA 3L78A 1OKDA 3WYWA 16GSA 1Z3EA 4DSQA 1F3AA 2O87A 3O76A 4ULXA 2RM6A 3F3QA 2R5GA 4JEDA 2VCXA 1FG4A 1TRVA 3TJJA 4GXZA 4ML1A 1I5GA 3CSJA 1VF1A 4FYBA 4ZB9A 3C1RA 5DAKA 5A34B 3VWVA 1GNWA 4K6XA 2VCQA 3FR9A 1SD8A 1ACVA 3P2AA 1Y1UA 3ZFBA 4GF0A 2FNOA 4PUFC 1DE2A 4F0CA 2TIRA 3DKSA 5IM9A 5KN2A 5D9WA 3LORA 1GLQA 2CX3A 3KD0A 2FY6A 5ID2A 3BCKA 2I1UA 1SYXA 4GQCA 2HRFA 2DSAA 1FVKA 4I8BA 4PUAA 1E2YA 2DKIA 4KH7A 2GS3A 5D96A 1GP1A 1MDJA 1SJ6A 3Q6OA 4V2LA 5AGYA 1SKRB 1WOUA 3VI7A 2H1LA 3EU3A 3IK7A 1SD9A 4GSSA 4JBBA 2HZFA 2QGVA 3ZREA 4NWYA 1G7OA 2E2MA 2LRNA 2MMOA 3HYPA 1GULA 4K2DA 1K3OA 3GHAA 3WGEA 3MIXA 1Y25A 2GQKA 3KGKA 2R2JA 3ZZXA 5BMUB 4EDZA 5C04A 3DWVA 2O89A 4POKA 4IS0A 3A2VA 2IN3A 2DJ1A 3ZMLA 2HZEB 2N5FA 1R4WA 3EPTA 2FHEA 2YOIA 4X43A 4TR1A 2YPMA 3LWAA 2FLSA 5J40A 4IBPA 2ALBA 2H6YA 1WMJA 4HU7A 3KM6A 5KN3A 4CHSA 1Q4JA 2FWFA 1FB0A 4HS1A 5LCZA 3NOFA 4XS4B 4OFMA 3QFBC 4K1FA 3F4RA 5F05A 3TOUA 5AIVA 3CSIA 5ECIB 1SVOA 1NW2A 1ZYNA 5AN1A 1AUCA 5J3RA 1NHOA 3UJ1A 2M72A 1EOGA 3TU3B 3LQ7A 4QL9A 3PINA 1SJZA 3D4MA 1FOHA 3HZ8A 1SKWB 4JR6A 4TVEA 6GSXA 4EIPA 1WJKA 4AJ8A 2BMXA 1SYRA 3BCIA 1QQ2A 2PUKC 2X8CA 2IWTA 4PQIA 2MMZA 1ZGNA 1HQOA 5ECHB 1G6YA 5G1LA 3GH9A 1RK4A 2YWIA 1WP0A 4BVYA 5DBQA 2QKEA 2V2GA 3GSTA 2R4VA 1OE8A 4PTSA 1IYIA 3UBKA 4MK3A 3UEMA 4DSRA 3C71A 3GMFA 3A2XA 1QXHA 4EL1A 3ME7A 5GZZB 4IJIA 1N2AA 3HVSA 2YN1A 4QQ7A 4TR3A 2AYTA 3PR8A 4DSSA 5A1NA 4MPGA 2H71A 4WF5A 1PX6A 4MJBA 5HFGA 3U5RE 5J9CA 22GSA 5EPFA 3DXBA 1I9DA 2HNLA 5IOWA 2C3QA 3QFAC 4XRAA 2KP1A 4I6XA 1YF0A 3TCOA 5JWOB 4ZL8A 5COHA 1PA3A 1Z6MA 1XXUA 3LXTA 2ES7A 1PN0A 1TU7A 4GDFA 4PQHA 4OCFA 5CYYA 2LNSA 4MF6A 2C4JA 2HSMA 6GSYA 2YWMA 3GUSA 1J9BA 2DJ3A 1X9MB 4RQXA 4EXJA 3OR5A 4CY6A 5HFKA 5ECNB 3P7XA 4MH2A 3G9BA 4I2TA 5IPHA 1YVLA 1V98A 1KBNA 4ZB7A 3H93A 5CRDA 1MDKA 3UVHA 4MP4A 2OE0A 3G7YA 1BEDA 2PBJA 1OVNA 2LSTA 3EINA 4HUAA 3RDWA 4WR4A 1B4QA 1TXXA 5D73A 4MF5A 3KIJA 2LRCA 4MJAA 4MMMA 1V58A 1AQWA 4MNNA 4KDYA 4WKWA 3H79A 1K3LA 3H8QA 3TJKA 4D73B 5CNWA 1JLVA 2O85A 3EMPA 4KF9A 4EE0A 4HI7A 1HYUA 1PX7A 2CAIA 4BL7A 1B9XC 1XIYA 2GZYA 2KLXA 3F6DA 2DJ2A 3R2QA 3TKRA 5D9VA 1OYJA 1M7TA 2RIIA 1KNGA 2M46A 3HHVA 1U88A 1Z5YE 2OADA 1TTZA 1M2BA 2G2QA 1GSQA 1QK8A 1ERUA 5FT3A 2K6VA 2GSTA 1W4VA 2VL2A 2LRTA 3IDVA 5D9XA 1ST9A 4HEA2 1CQGA 3KH9A 2B6MA 2XPDA 3IPZA 1ILOA 1AQXA 4PGTA 2WULA 2AB6A 5HR1A 2H1AA 1UA5A 3GTUB 3UAPA 6GSVA 3A3TA 1WWJA 3LJRA 1QGVA 4O92A 1AC1A 3EC3A 3APSA 4MJEA 1GSSA 4BPYA 5DQSA 2N5BA 3LYKA 1GUMA 1BJXA 2JZRA 4HQSA 5ECLB 2H6XA 3VWWA 2B5YA 1ZMAA 2GT6A 1R5PA 2H01A 3KXOA 2B1LA 1V57A 2H0IA 4IW9A 1B48A 1XPVA 1EP7A 1F6MC 3MDKA 3P90A 2OBKA 4I2UA 4MCUA 3WT2A 3EYTA 2TRCP 4OO4A 1OC9A 1THXA 3BOAA 2H1BA 9GSSA 2V32A 2P5QA 2EFEA 2DLXA 5BRTA 3C8EA 1J08A 2P0GA 2IMEA 2ZCTA 3TKSA 1PKZA 2GSQA 3I9V2 1PKWA 4TXVA 4TR4A 2R0PA 1T4ZA 2OKAA 4X4JA 1A2JA 3CWGA 4QL7A 1A24A 2HZEA 4JR4A 1SJIA 5DCGA 5ECRB 3LXZA 5DCHA 2CX4A 3KMNA 3FR3A 2WCIA 3PGTA 1TI1A 2MYGA 1XWKA 4MH3A 1GSEA 3O6TA 5CRWA 1GSDA 3TUEA 5A4UA 4TKYA 5ABRA 2OT3A 4LA1A 5A5HB 1Z7RA 1XCCA 4MLYA 3GL3A 1KEBA 3E9JB 4K0NA 4F03A 1M99A 4PNGA 1X5DA 3CYNA 2WB9A 3M3MA 3UL3A 4OO5A 1MD4A 4FQUA 1T1VA 4RI7A 4ILFA 1RW1A 2JZTA 4E68A 4G9HA 3MYDA 4YH2A 1THOA 1GSFA 2FD3A 5ECOB 2E0QA 1OAZA 2NTOA 2JU5A 3H4KA 4N30A 3TRPA 2GDRA 3IRAA 5DQYA 5G30A 2WRTA 1FOVA 2UV8G 1JLWA 3D21A 2HLSA 5DALA 4IJ3A 4ZBAA 3F8UA 4XIHA 4K7IA 2VM2A 2A4VA 2HSNB 2AJQB 5ECPB 4E8HA 1JZDA 1F9MA 1PL2A 3TOTA 1OKTA 1SKSB 2RLIA 3GNJA 4KUNA 5D9TA 1K0DA 3F3RA 5J47A 5B8BA 4QMKA 2R37A 4WETA 2ZNMA 4KX4A 1XOAA 3FMWA 12GSA 2H8LA 1E6BA 2H6ZA 5H5SA 1C72A 4J56E 3FYGA 1S3CA 3F6FA 2BTOT 2HRKB 2AAWA 1EOHA 3VPQA 2GQLA 1U6TA 4ECCA 2H0HA 4AJ7A 1FHEA 2NVLA 3ZITA 5A4VA 3D6IA 1EV9A 2C8UA 2VIMA 4GRFA 5H5QA 3GH6A 1Q98A 1FAAA 3IE3A 3EMXA 2GT5A 3UIWA 2IIYA 3TKPA 1U3AA 3DMLA 4DVCA 4N10A 1N25A 4EDYA 3RHCA 1BG1A 3RPPA 2GVPA 4USSA 1XFLA 3VK9A 4IP1A 2G0FA 2MBTA 4MZBA 4LMWA 4TN8A 1AXDA 1X5EA 3UMAA 3I43A 3GA4A 4EIQA 5B6MA 2K8VA 3ZIVA 1AW9A 2F9SA 18GSA 1SVMA 2L5LA 3GRXA 5J4UA 4L5LA 3TKSE 3ZL5A 4XHMA 4TW5A 4N11A 3M1GA 4ECJA 1XW6A 5B7CA 2VLTA 1HNCA 2OACA 1M9BA 1MTCA 2NDOA 3EE2A 2OE1A 3HZ4A 2HRAA 3W8SA 2CVBA 4TOPA 2R0GA 4MA9A 4G2EA 4ZB8A 3FZ5A 2IMFA 1XW5A 1XW9A 1GSYA 1JZOA 1A2MA 2H74A 2A2RA 4G19A 1R5AA 2VCTA 1BF5A 2RUFA 5DVBA 3DYRA 3DEXA 1V2AA 3GX8A 2WDUA 3GKNA 3LEFA 2YNXA 4YAPA 1R7HA 2GLRA 4OMVA 1UVZA 5EY6A 5L71A 1YDKA 5J4YA 4XRDA 2I4AA 4HDEA 2LQQA 2GZPA 3P8WA 2L59A 2EFDA 2WJUA 2H0GA 5CRGA 13GSA 6GSWA 4POMA 5D93A 3BJ5A 4MABA 3LSZA 2VLVA 4Q5NA 3QR6A 3FZ4A 2EC4A 3SWLA 5F8BA 4L0UA 3ZVJA 2FUG2 4K7NA 3VI5A 2QA1A 2H30A 1TXUA 3TKQA 4PXOA 1ML6A 2HQTA 4FYUA 4HZ4A 3BBYA 2PWJA 3E3EA 2K8SA 2VOCA 3HJOA 1FVJA 3GKXA 3HVVA 1YKAA 2OJLA 4PNFA 3RHBA 2K18A 2HSHA 4RI6A 1K0BA 4ECBA 3L9UA 1XWBA 4AI6A 3M8NA 1U3IA 5D8IA 4MDCA 2FA8A 2KUCA 3V1WA 3CSHA 2I3YA 3ZTLA 2MMNA 2JADA 4ZL9A 1PMTA 1XVWA 5DDLA 3VURA 3GSSA 4V1Ag 4BVXA 1A0FA 1EEMA 6GSTA 3HJPA 3LG6A 3CTGA 4DEJA 3QD9A 3TRXA 4MJCA 3DGQA 4IKHA 3TGZA 2O7KA 5DAKB 2XBIA 4WBJA 20GSA 5GAPD 1GTUA 5EVOA 2GZZA 1A8LA 2YV9A 2VCVA 1SU9A 2F8AA 3D4TA 2FCHA 3GN3A 4K8MA 2VCWA 4AKGA 4TXOA 4RQRA 4EF0A 3EU4A 2CAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A2W A;  4IN0 A;  3BD2 A;  5IO2 A;  1GUH A;  4GCI A;  8GSS A;  1OC3 A;  1XWC A;  5G1K A;  1HNB A;  1SK1 A;  4ZIJ A;  2DIY A;  2LNT A;  4XTS A;  1SL0 B;  4ML6 A;  2ON5 A;  5GAN D;  2LUS A;  4ZBD A;  11GS A;  1K0C A;  3IC4 A;  3KMO A;  1OC8 A;  1A23 A;  3FR6 A;  3CTF A;  1ABA A;  4YQM A;  4IQA A;  5IOX A;  1TDI A;  2HRN A;  1ZL9 A;  3TJG A;  1PGT A;  2KOK A;  1BG5 A;  4TR0 A;  1GTA A;  2L6C A;  3MAK A;  5G31 A;  1F2E A;  5F0G A;  3FEU A;  4K9Z A;  4HJM A;  3Q18 A;  4JRR A;  4NAX A;  2IPA A;  4NV2 A;  1TW9 A;  1CQH A;  5JCU A;  2TRX A;  3CXG A;  1K3Y A;  3L9S A;  2WS2 A;  2V6O A;  3S9F A;  1GLP A;  2Z9S A;  3VWU A;  2I81 A;  3FHK A;  5JWR B;  2L4C A;  1URM A;  2XPE A;  4MF7 A;  2LV3 A;  4JE1 A;  3ZVJ D;  1MD3 A;  5ENU A;  2WFC A;  5IMV A;  2E7P A;  1Y6E A;  3FY7 A;  2KP2 A;  2J9H A;  1F3B A;  4IEL A;  1A2L A;  2LJK A;  1O6J A;  2B5E A;  1GTB A;  3CBU A;  1KTE A;  2CVD A;  2LTK A;  4L0W A;  1X9S B;  3EWL A;  2DJJ A;  4PQ1 A;  4BVY B;  3NZN A;  4F9Z A;  3HJM A;  4Q5F A;  1WPI A;  4LLR A;  4GLT A;  1JFU A;  3FW2 A;  3L4N A;  4WR5 A;  4ISD A;  3QAW A;  4Q5R A;  1BAY A;  3ZMK A;  4ZIL A;  4O5R A;  1PQN A;  2LS5 A;  4KDX A;  4FH8 A;  4DSS B;  4G0K A;  4GSN A;  3KH7 A;  2FWE A;  1GL8 A;  4WEY A;  4YQV A;  2VUP A;  4OFT A;  5ECK B;  1R26 A;  2PMT A;  2UZ8 A;  2X64 A;  10GS A;  1BYE A;  4V2N A;  3ISO A;  2H70 A;  4BWS A;  4F82 A;  5BMU A;  3IAS 2;  2VLU A;  2EIO A;  3M0F A;  1ZYE A;  1TP9 A;  2HSM B;  1O8X A;  1T4Y A;  7GSS A;  3E0U A;  5AIS A;  4XS6 A;  2VAF A;  3C1S A;  2PU9 C;  1G6W A;  14GS A;  3M9J A;  3QCP A;  1GH2 A;  2B3S A;  4E8E A;  2R3X A;  4L8E A;  3CMI A;  5IPG A;  1TRU A;  2VCZ A;  1T00 A;  2DMM A;  5IMF A;  1EV4 A;  2V41 A;  4XS4 A;  3F63 A;  3C7M A;  1YEP A;  2VL9 A;  5IMC A;  2LJR A;  4OD7 A;  1B4P A;  4PUR A;  5DJM A;  5J41 A;  3EUR A;  2N5A A;  2V1M A;  4Q5Q A;  4IQ1 A;  5G2Z A;  1SEN A;  1GNE A;  3J7Y k;  2GGT A;  4WBR D;  2CQ9 A;  3D0Z A;  2I9H A;  3HA9 A;  3DVX A;  1J0F A;  3FZA A;  1WRY A;  1ZOF A;  2DIZ A;  2PVO C;  2XC2 A;  4KW6 A;  4CW9 A;  1ZCP A;  3RPN A;  2FWH A;  2GQM A;  1NM3 A;  2D2Z A;  2LQO A;  2JSZ A;  4JU5 A;  2EIQ A;  2HYX A;  3HY2 A;  4GTU A;  1DUG A;  1ZYQ B;  3GX0 A;  5A5K A;  1IYH A;  4BL7 B;  5AIX A;  1PRX A;  2DML A;  3FK8 A;  1QMV A;  2E2G A;  4G0I A;  3APO A;  2FGX A;  3WGD A;  4POB A;  5B6N A;  2CV4 A;  1GUK A;  2JZS A;  3KTL A;  1VF2 A;  5FHI A;  1PSQ A;  1XOB A;  5C00 A;  2OE3 A;  1T8E B;  4ECI A;  4I5Q A;  1EP8 A;  4LL1 B;  1U87 A;  3HCZ A;  1XVQ A;  1AIU A;  3GV1 A;  5HR2 A;  2IL3 A;  4K0G A;  1DSB A;  1TKD B;  4GST A;  1T7P B;  4NHW A;  4KA0 A;  3TJF A;  2L4Q A;  2VL2 C;  4IP6 A;  3F4T A;  2CT6 A;  1F37 A;  1YZX A;  1VF3 A;  1SK2 A;  5CP1 A;  3GFK A;  4X1U A;  3GKK A;  1Z6N A;  5CAX A;  1PN9 A;  1M9A A;  2CA8 A;  3KEB A;  1DBY A;  3HDC A;  1JZW A;  3APQ A;  4J57 E;  2DBC A;  2MBS A;  4KGI A;  1XWG A;  1K0O A;  2HSY A;  4JZQ A;  1FO5 A;  2VD1 A;  2H75 A;  5CO3 A;  4KSO A;  4WF4 A;  1K0M A;  1YQ1 A;  5ELG A;  3M9K A;  2H73 A;  4I97 A;  1OC9 B;  3C73 A;  1USB A;  1VF4 A;  5E59 A;  4AGS A;  2MZC A;  5KEJ A;  5F06 A;  1O81 A;  1H4O A;  1UC7 A;  1GSU A;  4L5O A;  2GTU A;  3H1N A;  3UBL A;  2LEG A;  2C0F A;  3TJB A;  3TDG A;  3IBH A;  1WE0 A;  5IQY A;  1TK5 B;  2R6K A;  4D73 A;  5JCW A;  1JZR A;  1BX9 A;  3L0H A;  2YJ7 A;  2VL3 A;  2WZ9 A;  4X0X A;  1M2D A;  2ON7 A;  4ZL7 A;  5DJL A;  2IFQ B;  3TKS C;  4KE3 A;  4N0Z A;  1PL1 A;  2YZU A;  4PX1 A;  2C0E A;  3HKR A;  1FB6 A;  1G0T A;  3VWX A;  1TK8 B;  3QAG A;  1K0N A;  4ZB6 A;  3IA1 A;  4EKZ A;  2C3N A;  3UOM A;  1VRS D;  3NIV A;  4MZW A;  2H1D A;  2YCD A;  2ZUP A;  5G5F A;  3WD6 A;  5B8A A;  19GS A;  2PN8 A;  3ZIJ A;  2VD0 A;  4YAV A;  3DRN A;  1XBS A;  3RAZ A;  3GTU A;  1TK0 B;  2V6K A;  3QMX A;  4V1A p;  3GKM A;  3R3E A;  1S3A A;  3IXR A;  3RBT A;  2JL4 A;  1A8Y A;  3LGC A;  4FYC A;  4KCA A;  2B7J A;  3KCM A;  5FWG A;  1O73 A;  3IOS A;  3ZRD A;  5A4W A;  2P5R A;  3DIE A;  4BA7 A;  3U6V A;  4KB3 A;  5DAL B;  1Z9H A;  2YJH A;  4EUY A;  2DC5 A;  2HFD A;  4ID0 A;  3HVX A;  2C0G A;  5IIZ A;  2L57 A;  3LYP A;  5LD0 A;  3QDN A;  4KCE A;  3IC8 A;  2H1G A;  3ZLP A;  1TU8 A;  4MZC A;  2B1K A;  3G7I A;  1YJ6 A;  4OWY A;  1M0U A;  3ERG A;  3Q74 A;  3PH9 A;  4EVM A;  5ELA A;  2F51 A;  2REM A;  1V40 A;  4J2F A;  4F0B A;  1DE1 A;  4AJ6 A;  3CRT A;  1VGL A;  3I6A A;  3IAM 2;  2K9F A;  5HR3 A;  17GS A;  4ZXG A;  3AY8 A;  2JSY A;  3QPM A;  1W89 A;  5ID2 B;  3IV4 A;  1K0A A;  3GL5 A;  2IJY A;  2L6D A;  1GWC A;  4YQU A;  2YP6 A;  5IO0 A;  5JCG A;  6GSU A;  4G0L A;  3CRU A;  3UAR A;  4RUV A;  3MNG A;  2X8G A;  1EGR A;  5KN0 A;  2RM5 A;  2H66 A;  4G10 A;  2C80 A;  1A0R P;  3ZFL A;  3QOU A;  1AQV A;  2YWO A;  2M80 A;  1LJR A;  6GSS A;  1PD2 1;  3KZQ A;  2H72 A;  2IMK A;  3FZ9 A;  1O85 A;  3F0I A;  3N5O A;  2HXK A;  1ERV A;  2EIR A;  2MMA A;  4H86 A;  3ZYW A;  1JHB A;  3VFI A;  4MPF A;  3G7J A;  1HNA A;  3MWH A;  1SK0 A;  2PER A;  4F2I A;  1RQM A;  2VO4 A;  2XHF A;  4K7O A;  2HT9 A;  3VPT A;  4BWQ A;  4O32 A;  1S3D A;  1GTI A;  4EO3 A;  4HQZ A;  3HXS A;  3A5W A;  1FW1 A;  4CDO A;  3VLN A;  4NPB A;  1QUW A;  2YWN A;  1OE7 A;  1YEX A;  4TR1 B;  5ECQ B;  5J9B A;  2B7K A;  4FO5 A;  2PPT A;  2A2S A;  3Q19 A;  5HQP A;  3DD3 A;  1QFN A;  2OBI A;  4Z7X A;  1LBK A;  5JWQ B;  3DVW A;  2H19 A;  3D22 A;  2CZ2 A;  1TRS A;  3QAV A;  3TRQ A;  1H75 A;  4XCS A;  4TRX A;  3LFL A;  3KTB A;  2NPB A;  4NV5 A;  4ZBB A;  2RUE A;  1YKC A;  2X99 A;  2GSR A;  4P3Y B;  3ERW A;  1LU4 A;  2IMD A;  2J23 A;  4V2M A;  1B8X A;  3TB2 A;  1EWX A;  1TI3 A;  5GST A;  3GIX A;  5H5R A;  2HRK A;  1EGO A;  3EVI A;  1O7U A;  1MDI A;  2H76 A;  5CRH A;  1V9W A;  2DJK A;  2XBQ A;  1X9W B;  3KJY A;  2C0D A;  2OA7 A;  2IMI A;  2CZ3 A;  2F8F A;  1BQ7 A;  2X8H A;  4KAE A;  1SL1 B;  1N8J A;  1MEK A;  3US3 A;  3D5J A;  5E4W A;  2PVQ A;  5IMD A;  4HOJ A;  1YY7 A;  3F4S A;  1SL2 B;  3HD5 A;  2YZH A;  2NBS A;  4BVX B;  3IHQ A;  3MSZ A;  5IMZ A;  1AAZ A;  2VM1 A;  5ECS A;  2KHP A;  4OFN A;  1G7E A;  4POL A;  3JCM L;  4GQF A;  2AHE A;  2C3T A;  1ON4 A;  2FA4 A;  5G5E A;  4NMU A;  3W6G A;  2GSS A;  3UVT A;  3WGX A;  2QSI A;  3L9V A;  2WGR A;  4LL4 B;  2LJA A;  5J5N A;  2AUV A;  4XS1 A;  4KDU A;  1EZK A;  1GRX A;  4TXO B;  5KN1 A;  3GYK A;  5LNK e;  1B9Y C;  3N9J A;  1XZO A;  2P31 A;  3SBC A;  4LMV A;  1WIK A;  2O8V B;  4IVF A;  2AV4 A;  3J7Y b;  3O3T A;  1ERT A;  2BJX A;  2CVK A;  3ED3 A;  1M2A A;  3F9U A;  2B5X A;  2JAC A;  4N0V A;  4KND A;  2IFQ A;  2QC7 A;  1T3B A;  2PGT A;  1O8W A;  5IMA A;  1EEJ A;  1XWA A;  4IGJ A;  4HU9 A;  4AF2 A;  3IR4 A;  5F07 A;  1ZZY A;  3ERF A;  5INY A;  3PPU A;  2HI7 A;  2DJ0 A;  2YV7 A;  2LKU A;  4O7H A;  3ME8 A;  1YF1 A;  4WXT A;  3WT1 A;  1X5C A;  5ECM B;  1ERW A;  4NXI A;  5CRE A;  3K8N A;  5HR0 A;  3W8J A;  1NHY A;  2YAN A;  4KSM A;  4IHU A;  1HD2 A;  3FRC A;  3I69 A;  1NSW A;  2HE3 A;  3KP8 A;  1UN2 A;  1Z7P A;  3FKF A;  4EC0 A;  4HZ2 A;  4NHZ A;  4GWR A;  5HFI A;  3KP9 A;  4HJ2 A;  5GSS A;  2C1Y A;  3IK9 A;  2L5O A;  1X0R A;  4ACS A;  5EL8 A;  3GUR A;  2F3M A;  2FWG A;  4OCE A;  1TJD A;  1TRW A;  4FIW A;  1TOF A;  3L78 A;  1OKD A;  3WYW A;  16GS A;  1Z3E A;  4DSQ A;  1F3A A;  2O87 A;  3O76 A;  4ULX A;  2RM6 A;  3F3Q A;  2R5G A;  4JED A;  2VCX A;  1FG4 A;  1TRV A;  3TJJ A;  4GXZ A;  4ML1 A;  1I5G A;  3CSJ A;  1VF1 A;  4FYB A;  4ZB9 A;  3C1R A;  5DAK A;  3VWV A;  1GNW A;  4K6X A;  2VCQ A;  3FR9 A;  1SD8 A;  1ACV A;  3P2A A;  3ZFB A;  4GF0 A;  2FNO A;  4PUF C;  1DE2 A;  4F0C A;  2TIR A;  3DKS A;  5IM9 A;  5KN2 A;  5D9W A;  3LOR A;  1GLQ A;  2CX3 A;  3KD0 A;  2FY6 A;  5ID2 A;  3BCK A;  2I1U A;  1SYX A;  4GQC A;  2HRF A;  2DSA A;  1FVK A;  4I8B A;  4PUA A;  1E2Y A;  4KH7 A;  2GS3 A;  5D96 A;  1GP1 A;  1MDJ A;  1SJ6 A;  3Q6O A;  4V2L A;  5AGY A;  1SKR B;  1WOU A;  3VI7 A;  3EU3 A;  3IK7 A;  1SD9 A;  4GSS A;  4JBB A;  2HZF A;  2QGV A;  3ZRE A;  4NWY A;  1G7O A;  2E2M A;  2LRN A;  2MMO A;  3HYP A;  1GUL A;  4K2D A;  1K3O A;  3GHA A;  3WGE A;  1Y25 A;  2GQK A;  3KGK A;  2R2J A;  3ZZX A;  4EDZ A;  5C04 A;  3DWV A;  2O89 A;  4POK A;  4IS0 A;  3A2V A;  2IN3 A;  2DJ1 A;  3ZML A;  2HZE B;  2N5F A;  1R4W A;  2FHE A;  2YOI A;  4X43 A;  4TR1 A;  2YPM A;  3LWA A;  2FLS A;  4IBP A;  2ALB A;  2H6Y A;  1WMJ A;  4HU7 A;  3KM6 A;  5KN3 A;  4CHS A;  1Q4J A;  2FWF A;  1FB0 A;  4HS1 A;  5LCZ A;  3NOF A;  4XS4 B;  4OFM A;  3QFB C;  4K1F A;  3F4R A;  5F05 A;  3TOU A;  5AIV A;  3CSI A;  5ECI B;  1NW2 A;  5AN1 A;  1AUC A;  5J3R A;  1NHO A;  3UJ1 A;  2M72 A;  1EOG A;  3LQ7 A;  4QL9 A;  3PIN A;  1SJZ A;  3D4M A;  3HZ8 A;  1SKW B;  4JR6 A;  4TVE A;  6GSX A;  1WJK A;  4AJ8 A;  2BMX A;  1SYR A;  3BCI A;  1QQ2 A;  2PUK C;  2X8C A;  2IWT A;  4PQI A;  2MMZ A;  1ZGN A;  1HQO A;  5ECH B;  1G6Y A;  5G1L A;  3GH9 A;  1RK4 A;  2YWI A;  1WP0 A;  4BVY A;  5DBQ A;  2QKE A;  2V2G A;  3GST A;  2R4V A;  1OE8 A;  4PTS A;  1IYI A;  3UBK A;  4MK3 A;  3UEM A;  4DSR A;  3C71 A;  3GMF A;  3A2X A;  1QXH A;  4EL1 A;  3ME7 A;  5GZZ B;  4IJI A;  1N2A A;  3HVS A;  2YN1 A;  4QQ7 A;  4TR3 A;  2AYT A;  3PR8 A;  4DSS A;  4MPG A;  2H71 A;  4WF5 A;  1PX6 A;  4MJB A;  5HFG A;  3U5R E;  5J9C A;  22GS A;  5EPF A;  3DXB A;  1I9D A;  2HNL A;  5IOW A;  2C3Q A;  3QFA C;  4XRA A;  2KP1 A;  4I6X A;  1YF0 A;  3TCO A;  5JWO B;  4ZL8 A;  5COH A;  1PA3 A;  1Z6M A;  1XXU A;  3LXT A;  2ES7 A;  1TU7 A;  4PQH A;  4OCF A;  5CYY A;  2LNS A;  4MF6 A;  2C4J A;  2HSM A;  6GSY A;  2YWM A;  3GUS A;  1J9B A;  2DJ3 A;  1X9M B;  4RQX A;  4EXJ A;  3OR5 A;  5HFK A;  5ECN B;  3P7X A;  4MH2 A;  3G9B A;  4I2T A;  5IPH A;  1V98 A;  1KBN A;  3H93 A;  5CRD A;  1MDK A;  3UVH A;  4MP4 A;  2OE0 A;  3G7Y A;  1BED A;  2PBJ A;  1OVN A;  2LST A;  3EIN A;  4HUA A;  3RDW A;  4WR4 A;  1B4Q A;  1TXX A;  5D73 A;  4MF5 A;  3KIJ A;  2LRC A;  4MJA A;  4MMM A;  1V58 A;  1AQW A;  4KDY A;  4WKW A;  3H79 A;  1K3L A;  3H8Q A;  3TJK A;  4D73 B;  5CNW A;  1JLV A;  2O85 A;  3EMP A;  4KF9 A;  4EE0 A;  4HI7 A;  1HYU A;  1PX7 A;  2CAI A;  4BL7 A;  1B9X C;  1XIY A;  2GZY A;  2KLX A;  3F6D A;  2DJ2 A;  3R2Q A;  3TKR A;  5D9V A;  1OYJ A;  1M7T A;  2RII A;  1KNG A;  2M46 A;  3HHV A;  1U88 A;  1Z5Y E;  2OAD A;  1TTZ A;  1M2B A;  2G2Q A;  1GSQ A;  1QK8 A;  1ERU A;  5FT3 A;  2K6V A;  2GST A;  1W4V A;  2VL2 A;  2LRT A;  3IDV A;  5D9X A;  1ST9 A;  4HEA 2;  1CQG A;  3KH9 A;  2B6M A;  2XPD A;  3IPZ A;  1ILO A;  1AQX A;  4PGT A;  2WUL A;  2AB6 A;  5HR1 A;  2H1A A;  1UA5 A;  3GTU B;  3UAP A;  6GSV A;  3A3T A;  1WWJ A;  3LJR A;  1QGV A;  4O92 A;  1AC1 A;  3EC3 A;  3APS A;  4MJE A;  1GSS A;  4BPY A;  5DQS A;  2N5B A;  3LYK A;  1GUM A;  1BJX A;  2JZR A;  4HQS A;  5ECL B;  2H6X A;  3VWW A;  2B5Y A;  1ZMA A;  2GT6 A;  1R5P A;  2H01 A;  3KXO A;  2B1L A;  1V57 A;  2H0I A;  4IW9 A;  1B48 A;  1XPV A;  1EP7 A;  1F6M C;  3MDK A;  3P90 A;  2OBK A;  4I2U A;  4MCU A;  3WT2 A;  3EYT A;  2TRC P;  4OO4 A;  1OC9 A;  1THX A;  3BOA A;  2H1B A;  9GSS A;  2V32 A;  2P5Q A;  2DLX A;  3C8E A;  1J08 A;  2P0G A;  2IME A;  2ZCT A;  3TKS A;  1PKZ A;  2GSQ A;  3I9V 2;  1PKW A;  4TXV A;  4TR4 A;  1T4Z A;  2OKA A;  1A2J A;  4QL7 A;  1A24 A;  2HZE A;  4JR4 A;  1SJI A;  5DCG A;  5ECR B;  3LXZ A;  5DCH A;  2CX4 A;  3KMN A;  3FR3 A;  2WCI A;  3PGT A;  1TI1 A;  2MYG A;  1XWK A;  4MH3 A;  1GSE A;  3O6T A;  5CRW A;  1GSD A;  3TUE A;  5A4U A;  4TKY A;  5ABR A;  4LA1 A;  1Z7R A;  1XCC A;  4MLY A;  3GL3 A;  1KEB A;  3E9J B;  4K0N A;  4F03 A;  1M99 A;  4PNG A;  1X5D A;  3CYN A;  2WB9 A;  3M3M A;  3UL3 A;  4OO5 A;  1MD4 A;  4FQU A;  1T1V A;  4RI7 A;  4ILF A;  1RW1 A;  2JZT A;  4G9H A;  4YH2 A;  1THO A;  1GSF A;  2FD3 A;  5ECO B;  2E0Q A;  1OAZ A;  2NTO A;  2JU5 A;  3H4K A;  4N30 A;  3TRP A;  2GDR A;  3IRA A;  5DQY A;  5G30 A;  2WRT A;  1FOV A;  1JLW A;  3D21 A;  2HLS A;  5DAL A;  4IJ3 A;  4ZBA A;  3F8U A;  4XIH A;  4K7I A;  2VM2 A;  2A4V A;  2HSN B;  2AJQ B;  5ECP B;  4E8H A;  1JZD A;  1F9M A;  1PL2 A;  3TOT A;  1OKT A;  1SKS B;  2RLI A;  3GNJ A;  4KUN A;  5D9T A;  1K0D A;  3F3R A;  5B8B A;  2R37 A;  4WET A;  2ZNM A;  4KX4 A;  1XOA A;  12GS A;  2H8L A;  1E6B A;  2H6Z A;  5H5S A;  1C72 A;  4J56 E;  3FYG A;  1S3C A;  3F6F A;  2BTO T;  2HRK B;  2AAW A;  1EOH A;  3VPQ A;  2GQL A;  1U6T A;  4ECC A;  2H0H A;  4AJ7 A;  1FHE A;  2NVL A;  3ZIT A;  5A4V A;  3D6I A;  1EV9 A;  2C8U A;  2VIM A;  4GRF A;  5H5Q A;  3GH6 A;  1Q98 A;  1FAA A;  3IE3 A;  3EMX A;  2GT5 A;  3UIW A;  2IIY A;  3TKP A;  1U3A A;  3DML A;  4DVC A;  4N10 A;  4EDY A;  3RHC A;  3RPP A;  2GVP A;  4USS A;  1XFL A;  3VK9 A;  4IP1 A;  2G0F A;  2MBT A;  4MZB A;  4LMW A;  4TN8 A;  1AXD A;  1X5E A;  3UMA A;  3I43 A;  3GA4 A;  5B6M A;  2K8V A;  3ZIV A;  1AW9 A;  2F9S A;  18GS A;  2L5L A;  3GRX A;  5J4U A;  4L5L A;  3TKS E;  3ZL5 A;  4XHM A;  4TW5 A;  4N11 A;  3M1G A;  4ECJ A;  1XW6 A;  5B7C A;  2VLT A;  1HNC A;  2OAC A;  1M9B A;  1MTC A;  2NDO A;  3EE2 A;  2OE1 A;  3HZ4 A;  2HRA A;  3W8S A;  2CVB A;  4TOP A;  4MA9 A;  4G2E A;  4ZB8 A;  3FZ5 A;  2IMF A;  1XW5 A;  1XW9 A;  1GSY A;  1JZO A;  1A2M A;  2H74 A;  2A2R A;  4G19 A;  1R5A A;  2VCT A;  2RUF A;  5DVB A;  3DYR A;  3DEX A;  1V2A A;  3GX8 A;  2WDU A;  3GKN A;  3LEF A;  2YNX A;  4YAP A;  1R7H A;  2GLR A;  4OMV A;  1UVZ A;  5EY6 A;  5L71 A;  1YDK A;  4XRD A;  2I4A A;  4HDE A;  2LQQ A;  2GZP A;  3P8W A;  2L59 A;  2WJU A;  2H0G A;  5CRG A;  13GS A;  6GSW A;  4POM A;  5D93 A;  3BJ5 A;  4MAB A;  3LSZ A;  2VLV A;  4Q5N A;  3QR6 A;  3FZ4 A;  2EC4 A;  3SWL A;  5F8B A;  4L0U A;  3ZVJ A;  2FUG 2;  4K7N A;  3VI5 A;  2H30 A;  3TKQ A;  4PXO A;  1ML6 A;  2HQT A;  4FYU A;  4HZ4 A;  3BBY A;  2PWJ A;  3E3E A;  2K8S A;  2VOC A;  3HJO A;  1FVJ A;  3GKX A;  3HVV A;  1YKA A;  2OJL A;  4PNF A;  3RHB A;  2K18 A;  2HSH A;  4RI6 A;  1K0B A;  4ECB A;  3L9U A;  1XWB A;  3M8N A;  1U3I A;  5D8I A;  4MDC A;  2FA8 A;  2KUC A;  3V1W A;  3CSH A;  2I3Y A;  3ZTL A;  2MMN A;  2JAD A;  4ZL9 A;  1PMT A;  1XVW A;  5DDL A;  3VUR A;  3GSS A;  4V1A g;  4BVX A;  1A0F A;  1EEM A;  6GST A;  3HJP A;  3LG6 A;  3CTG A;  4DEJ A;  3QD9 A;  3TRX A;  4MJC A;  3DGQ A;  4IKH A;  3TGZ A;  2O7K A;  5DAK B;  2XBI A;  4WBJ A;  20GS A;  5GAP D;  1GTU A;  5EVO A;  2GZZ A;  1A8L A;  2YV9 A;  2VCV A;  1SU9 A;  2F8A A;  3D4T A;  2FCH A;  3GN3 A;  4K8M A;  2VCW A;  4TXO A;  4RQR A;  4EF0 A;  3EU4 A;  2CAQ A; 
#chains in the Genus database with same CATH topology
 3A2W A;  4IN0 A;  3BD2 A;  5IO2 A;  1GUH A;  4GCI A;  8GSS A;  1OC3 A;  1XWC A;  5G1K A;  1HNB A;  1SK1 A;  4ZIJ A;  2DIY A;  2LNT A;  4XTS A;  1SL0 B;  4ML6 A;  2ON5 A;  5GAN D;  2LUS A;  4ZBD A;  11GS A;  1K0C A;  3IC4 A;  3KMO A;  1OC8 A;  1A23 A;  3FR6 A;  3CTF A;  1ABA A;  4YQM A;  4IQA A;  5IOX A;  1TDI A;  2HRN A;  1ZL9 A;  3TJG A;  1PGT A;  2KOK A;  1BG5 A;  4TR0 A;  1GTA A;  2L6C A;  3MAK A;  5G31 A;  1F2E A;  5F0G A;  3FEU A;  4HSC X;  4K9Z A;  4HJM A;  3Q18 A;  4JRR A;  4NAX A;  2IPA A;  4NV2 A;  1TW9 A;  1CQH A;  5JCU A;  2TRX A;  3CXG A;  4AKX B;  1K3Y A;  3L9S A;  2WS2 A;  2V6O A;  3S9F A;  1GLP A;  2Z9S A;  3VWU A;  2I81 A;  4AKI A;  3FHK A;  5JWR B;  2L4C A;  1URM A;  2XPE A;  4MF7 A;  2LV3 A;  4JE1 A;  4K2X A;  3ZVJ D;  1MD3 A;  5ENU A;  2WFC A;  5IMV A;  2E7P A;  1Y6E A;  3FY7 A;  2KP2 A;  2J9H A;  1F3B A;  4IEL A;  2O36 A;  1A2L A;  2LJK A;  5A34 A;  1O6J A;  2B5E A;  1GTB A;  3CBU A;  1KTE A;  2CVD A;  2LTK A;  4L0W A;  2DKH A;  1X9S B;  3EWL A;  4Z2U A;  2DJJ A;  4PQ1 A;  4BVY B;  1ZYP A;  3NZN A;  4F9Z A;  4YKF A;  3HJM A;  4Q5F A;  1WPI A;  4LLR A;  4GLT A;  1JFU A;  3FW2 A;  3L4N A;  4WR5 A;  4ISD A;  3QAW A;  4Q5R A;  1BAY A;  3ZMK A;  4ZIL A;  4O5R A;  1PQN A;  2VKZ G;  2LS5 A;  3RGB C;  2X49 A;  4KDX A;  4Z2T A;  4FH8 A;  4DSS B;  5A1N B;  4G0K A;  4GSN A;  3KH7 A;  2FWE A;  1GL8 A;  4WEY A;  4YQV A;  2VUP A;  4OFT A;  5ECK B;  1R26 A;  2PMT A;  2UZ8 A;  2X64 A;  10GS A;  1BYE A;  4V2N A;  2WVZ A;  3LW9 A;  4G01 A;  3ISO A;  2H70 A;  4BWS A;  4F82 A;  5BMU A;  3IAS 2;  2VLU A;  2EIO A;  3M0F A;  1ZYE A;  1TP9 A;  2HSM B;  1O8X A;  4N3Z A;  1T4Y A;  7GSS A;  3E0U A;  5AIS A;  4XS6 A;  2VAF A;  3C1S A;  2PU9 C;  2O3E A;  1G6W A;  14GS A;  3M9J A;  3QCP A;  1GH2 A;  2B3S A;  4E8E A;  2R3X A;  4L8E A;  3CMI A;  5IPG A;  1TRU A;  2VCZ A;  1T00 A;  2DMM A;  5IMF A;  1EV4 A;  2V41 A;  2R0C A;  4XS4 A;  3F63 A;  3C7M A;  1YEP A;  2VL9 A;  5IMC A;  2LJR A;  4OD7 A;  1B4P A;  4PUR A;  5DJM A;  5J41 A;  3EUR A;  2N5A A;  2V1M A;  4Q5Q A;  4IQ1 A;  5G2Z A;  1SEN A;  4YKG A;  1GNE A;  3J7Y k;  2GGT A;  4WBR D;  2CQ9 A;  3D0Z A;  2I9H A;  3HA9 A;  3DVX A;  1J0F A;  3FZA A;  1WRY A;  1ZOF A;  2DIZ A;  2PVO C;  2A4H A;  2XC2 A;  4KW6 A;  4CW9 A;  1ZCP A;  3RPN A;  2FWH A;  2GQM A;  1NM3 A;  2D2Z A;  4PI0 C;  2LQO A;  2JSZ A;  4JU5 A;  4CY8 A;  2EIQ A;  2HYX A;  3HY2 A;  4GTU A;  1DUG A;  1ZYQ B;  3GX0 A;  5A5K A;  1IYH A;  4BL7 B;  5AIX A;  1PRX A;  2DML A;  3FK8 A;  1QMV A;  2E2G A;  4G0I A;  3APO A;  2FGX A;  3WGD A;  4POB A;  5B6N A;  2CV4 A;  1GUK A;  2JZS A;  3KTL A;  1VF2 A;  5FHI A;  1PSQ A;  1XOB A;  5C00 A;  2OE3 A;  1T8E B;  4ECI A;  4I5Q A;  1EP8 A;  4LL1 B;  1U87 A;  3HCZ A;  4AKH A;  1XVQ A;  1AIU A;  3GV1 A;  5HR2 A;  2IL3 A;  4K0G A;  1DSB A;  1TKD B;  4GST A;  1T7P B;  4NHW A;  4KA0 A;  3TJF A;  2L4Q A;  2VL2 C;  4IP6 A;  3F4T A;  2CT6 A;  3IHG A;  1F37 A;  1YZX A;  1VF3 A;  1SK2 A;  5CP1 A;  3GFK A;  4X1U A;  3GKK A;  1Z6N A;  5CAX A;  1PN9 A;  1M9A A;  2CA8 A;  3KEB A;  1DBY A;  4A5P A;  3HDC A;  1JZW A;  3APQ A;  4J57 E;  2DBC A;  2MBS A;  4KGI A;  1XWG A;  1K0O A;  2HSY A;  4JZQ A;  2A2P A;  1FO5 A;  2VD1 A;  2H75 A;  5CO3 A;  4KSO A;  4WF4 A;  1K0M A;  1YQ1 A;  5KOX A;  5ELG A;  3M9K A;  2H73 A;  4I97 A;  1OC9 B;  3C73 A;  1USB A;  1VF4 A;  5E59 A;  4AGS A;  2MZC A;  5KEJ A;  5F06 A;  1O81 A;  1H4O A;  1UC7 A;  2QA2 A;  1GSU A;  4L5O A;  4K5S A;  2GTU A;  3HMJ G;  3H1N A;  3UBL A;  2LEG A;  2C0F A;  3TJB A;  3TDG A;  3IBH A;  1WE0 A;  5IQY A;  1PFO A;  1TK5 B;  2R6K A;  4D73 A;  5JCW A;  1JZR A;  1BX9 A;  3L0H A;  2YJ7 A;  2VL3 A;  2WZ9 A;  4X0X A;  1M2D A;  2ON7 A;  4ZL7 A;  4O5Q A;  5DJL A;  1SVL A;  2IFQ B;  3TKS C;  4KE3 A;  4N0Z A;  1PL1 A;  2YZU A;  4PX1 A;  1M3I A;  3HKR A;  1FB6 A;  2C0E A;  1G0T A;  3VWX A;  1TK8 B;  2WW3 A;  3QAG A;  1K0N A;  4ZB6 A;  3IA1 A;  4EKZ A;  2C3N A;  3UOM A;  1VRS D;  3NIV A;  4MZW A;  3CHX C;  2H1D A;  2YCD A;  2ZUP A;  5G5F A;  3WD6 A;  5B8A A;  19GS A;  2PN8 A;  3ZIJ A;  2VD0 A;  4YAV A;  3DRN A;  1XBS A;  3RAZ A;  3GTU A;  4O5U A;  1TK0 B;  2V6K A;  3QMX A;  4V1A p;  2EFH A;  3GKM A;  3R3E A;  1S3A A;  3IXR A;  3RBT A;  2JL4 A;  2WW0 A;  1A8Y A;  3LGC A;  4FYC A;  4KCA A;  2B7J A;  3KCM A;  5FWG A;  1O73 A;  3IOS A;  3ZRD A;  5A4W A;  2P5R A;  3DIE A;  4BA7 A;  3U6V A;  4KB3 A;  5DAL B;  1Z9H A;  2YJH A;  4EUY A;  2DC5 A;  2HFD A;  4ID0 A;  3HVX A;  2C0G A;  5IIZ A;  2L57 A;  3LYP A;  5LD0 A;  3QDN A;  4KCE A;  3IC8 A;  2H1G A;  3ZLP A;  1TU8 A;  4MZC A;  2B1K A;  3G7I A;  1YJ6 A;  4OWY A;  1M0U A;  3ERG A;  3Q74 A;  3PH9 A;  4EVM A;  5ELA A;  2F51 A;  2REM A;  1V40 A;  4J2F A;  4F0B A;  1DE1 A;  4AJ6 A;  3CRT A;  1VGL A;  3I6A A;  3IAM 2;  2K9F A;  5HR3 A;  17GS A;  4ZXG A;  3AY8 A;  2JSY A;  3QPM A;  1W89 A;  5ID2 B;  3IV4 A;  1K0A A;  3GL5 A;  2IJY A;  2L6D A;  1GWC A;  4YQU A;  2YP6 A;  5IO0 A;  5JCG A;  6GSU A;  4G0L A;  3CRU A;  3UAR A;  4RUV A;  3MNG A;  2X8G A;  1EGR A;  5KN0 A;  2RM5 A;  2H66 A;  4G10 A;  2C80 A;  1A0R P;  3ZFL A;  3QOU A;  1AQV A;  2YWO A;  2M80 A;  1LJR A;  6GSS A;  1PD2 1;  3KZQ A;  2H72 A;  2IMK A;  3FZ9 A;  1O85 A;  3F0I A;  3N5O A;  2HXK A;  1ERV A;  2EIR A;  2MMA A;  4H86 A;  3ZYW A;  1JHB A;  3VFI A;  4MPF A;  5A5H A;  3G7J A;  1HNA A;  3MWH A;  1SK0 A;  2PER A;  4F2I A;  1RQM A;  2VO4 A;  2XHF A;  4K7O A;  2HT9 A;  3VPT A;  4BWQ A;  4O32 A;  1S3D A;  1GTI A;  4EO3 A;  4HQZ A;  3HXS A;  3A5W A;  1FW1 A;  4CDO A;  3VLN A;  4NPB A;  1QUW A;  2YWN A;  1OE7 A;  1YEX A;  4TR1 B;  5ECQ B;  5J9B A;  2B7K A;  4FO5 A;  2PPT A;  2A2S A;  4ICY A;  3Q19 A;  5HQP A;  3DD3 A;  1QFN A;  2OBI A;  4Z7X A;  1LBK A;  5JWQ B;  3DVW A;  2H19 A;  3D22 A;  4K5R A;  2CZ2 A;  1TRS A;  2HSN A;  3QAV A;  3TRQ A;  1H75 A;  4XCS A;  4TRX A;  3LFL A;  3KTB A;  2NPB A;  4NV5 A;  4ZBB A;  2RUE A;  1YKC A;  2X99 A;  2GSR A;  4P3Y B;  3ERW A;  1LU4 A;  2IMD A;  2J23 A;  4V2M A;  1B8X A;  3TB2 A;  1EWX A;  1TI3 A;  5GST A;  3GIX A;  5H5R A;  2HRK A;  1EGO A;  5KOW A;  3EVI A;  1O7U A;  1MDI A;  2H76 A;  5CRH A;  1V9W A;  2DJK A;  2XBQ A;  1X9W B;  3KJY A;  2C0D A;  2OA7 A;  2IMI A;  2CZ3 A;  2X4A A;  2F8F A;  1BQ7 A;  2X8H A;  4KAE A;  1SL1 B;  1N8J A;  1MEK A;  3US3 A;  3D5J A;  5E4W A;  2PVQ A;  5IMD A;  4HOJ A;  1YY7 A;  3F4S A;  1SL2 B;  3HD5 A;  4W66 A;  2YZH A;  2NBS A;  4BVX B;  3IHQ A;  3MSZ A;  5IMZ A;  1AAZ A;  2VM1 A;  4Z2R A;  5ECS A;  2KHP A;  4OFN A;  1G7E A;  4POL A;  3JCM L;  2AHE A;  4GQF A;  2C3T A;  1ON4 A;  2FA4 A;  5G5E A;  4NMU A;  3W6G A;  2GSS A;  3UVT A;  3WGX A;  2QSI A;  3L9V A;  2WGR A;  4LL4 B;  2LJA A;  5J5N A;  2AUV A;  4XS1 A;  4KDU A;  1EZK A;  1GRX A;  2O5V A;  4TXO B;  5KN1 A;  3GYK A;  5LNK e;  1B9Y C;  3N9J A;  1XZO A;  2P31 A;  3SBC A;  4LMV A;  1WIK A;  2O8V B;  4IVF A;  2AV4 A;  3J7Y b;  3O3T A;  1ERT A;  2BJX A;  2CVK A;  3ED3 A;  1M2A A;  3F9U A;  2B5X A;  2JAC A;  4N0V A;  4KND A;  2IFQ A;  5J4V A;  2QC7 A;  1T3B A;  2PGT A;  1O8W A;  5IMA A;  1EEJ A;  1XWA A;  4IGJ A;  2WW2 A;  1I1I P;  4HU9 A;  4AF2 A;  3IR4 A;  5F07 A;  1ZZY A;  3ERF A;  5INY A;  3PPU A;  2HI7 A;  2DJ0 A;  2EFC A;  2YV7 A;  2LKU A;  4O7H A;  3ME8 A;  1YF1 A;  4WXT A;  4FXY P;  3WT1 A;  1X5C A;  5ECM B;  1ERW A;  4NXI A;  5CRE A;  3K8N A;  5HR0 A;  3A5I A;  3W8J A;  1NHY A;  2YAN A;  4KSM A;  4IHU A;  1HD2 A;  3FRC A;  3I69 A;  1NSW A;  2HE3 A;  3KP8 A;  1UN2 A;  1Z7P A;  3FKF A;  4EC0 A;  4HZ2 A;  4NHZ A;  4GWR A;  5HFI A;  3KP9 A;  4HJ2 A;  5GSS A;  2C1Y A;  3IK9 A;  2L5O A;  1X0R A;  4ACS A;  5EL8 A;  3GUR A;  2F3M A;  2FWG A;  4OCE A;  1TJD A;  1TRW A;  4FIW A;  1TOF A;  3L78 A;  1OKD A;  3WYW A;  16GS A;  1Z3E A;  4DSQ A;  1F3A A;  2WVX B;  3O76 A;  2O87 A;  4ULX A;  2RM6 A;  3F3Q A;  2R5G A;  4JED A;  2VCX A;  1FG4 A;  1TRV A;  3TJJ A;  4GXZ A;  4ML1 A;  1I5G A;  3CSJ A;  1VF1 A;  4FYB A;  3RFR C;  4ZB9 A;  3C1R A;  5DAK A;  5A34 B;  3VWV A;  1GNW A;  4K6X A;  2VCQ A;  3FR9 A;  1SD8 A;  1ACV A;  3P2A A;  1Y1U A;  3ZFB A;  4GF0 A;  2FNO A;  4PUF C;  1DE2 A;  4F0C A;  2TIR A;  3DKS A;  5IM9 A;  5KN2 A;  5D9W A;  3LOR A;  1GLQ A;  2CX3 A;  3KD0 A;  2FY6 A;  5ID2 A;  3BCK A;  2I1U A;  1SYX A;  4GQC A;  2HRF A;  2DSA A;  1FVK A;  4I8B A;  4PUA A;  1E2Y A;  2DKI A;  4KH7 A;  2GS3 A;  5D96 A;  1GP1 A;  1MDJ A;  1SJ6 A;  3Q6O A;  4V2L A;  5AGY A;  1SKR B;  1WOU A;  3VI7 A;  2H1L A;  3EU3 A;  3IK7 A;  1SD9 A;  4GSS A;  4JBB A;  2HZF A;  2QGV A;  3ZRE A;  4NWY A;  1G7O A;  2E2M A;  2LRN A;  2MMO A;  3HYP A;  1GUL A;  4K2D A;  1K3O A;  3GHA A;  3WGE A;  3MIX A;  1Y25 A;  2GQK A;  3KGK A;  1YEW C;  2R2J A;  3ZZX A;  5BMU B;  4EDZ A;  5C04 A;  3DWV A;  2O89 A;  4POK A;  4IS0 A;  3A2V A;  2IN3 A;  2DJ1 A;  3ZML A;  2HZE B;  2N5F A;  1R4W A;  3EPT A;  2FHE A;  2YOI A;  4X43 A;  4TR1 A;  2YPM A;  3LWA A;  2FLS A;  5J40 A;  4IBP A;  2ALB A;  2H6Y A;  1WMJ A;  4HU7 A;  3KM6 A;  5KN3 A;  4CHS A;  1Q4J A;  2FWF A;  1FB0 A;  4HS1 A;  5LCZ A;  3NOF A;  4XS4 B;  4OFM A;  3QFB C;  4K1F A;  3F4R A;  5F05 A;  3TOU A;  5AIV A;  3CSI A;  5ECI B;  1SVO A;  1NW2 A;  1ZYN A;  5AN1 A;  1AUC A;  5J3R A;  1NHO A;  3UJ1 A;  2M72 A;  1EOG A;  3TU3 B;  3LQ7 A;  4QL9 A;  3PIN A;  1SJZ A;  3D4M A;  1FOH A;  3HZ8 A;  1SKW B;  4JR6 A;  4TVE A;  6GSX A;  4EIP A;  1WJK A;  4AJ8 A;  2WW1 A;  2BMX A;  1SYR A;  3BCI A;  1QQ2 A;  2PUK C;  2X8C A;  2IWT A;  4PQI A;  2MMZ A;  1ZGN A;  1HQO A;  5ECH B;  1G6Y A;  5G1L A;  3GH9 A;  1RK4 A;  2YWI A;  1WP0 A;  4BVY A;  5DBQ A;  2QKE A;  4PHZ C;  2V2G A;  3GST A;  2R4V A;  1OE8 A;  4PTS A;  1IYI A;  3UBK A;  4MK3 A;  3UEM A;  4DSR A;  3C71 A;  3GMF A;  3A2X A;  1QXH A;  4EL1 A;  3ME7 A;  5GZZ B;  4IJI A;  1N2A A;  3HVS A;  2YN1 A;  4QQ7 A;  4TR3 A;  2AYT A;  3PR8 A;  4DSS A;  5A1N A;  4MPG A;  2H71 A;  4WF5 A;  1PX6 A;  4MJB A;  5HFG A;  3U5R E;  5J9C A;  22GS A;  5EPF A;  3DXB A;  1I9D A;  2HNL A;  5IOW A;  2C3Q A;  3QFA C;  4XRA A;  2KP1 A;  4I6X A;  1YF0 A;  3TCO A;  5JWO B;  4ZL8 A;  5COH A;  1PA3 A;  1Z6M A;  1XXU A;  3LXT A;  4BIK A;  2ES7 A;  1PN0 A;  1TU7 A;  4GDF A;  4PQH A;  4OCF A;  5CYY A;  2LNS A;  4MF6 A;  2C4J A;  2HSM A;  6GSY A;  2YWM A;  3GUS A;  1J9B A;  2DJ3 A;  1X9M B;  4RQX A;  4EXJ A;  3OR5 A;  4CY6 A;  5HFK A;  5ECN B;  3P7X A;  4MH2 A;  3G9B A;  4I2T A;  5IPH A;  1YVL A;  1V98 A;  1KBN A;  4ZB7 A;  3H93 A;  5CRD A;  1MDK A;  3UVH A;  4MP4 A;  2OE0 A;  3G7Y A;  1BED A;  2PBJ A;  1OVN A;  2LST A;  3EIN A;  4HUA A;  3RDW A;  4WR4 A;  3CQF A;  1B4Q A;  1TXX A;  5D73 A;  4MF5 A;  3KIJ A;  2LRC A;  4MJA A;  4MMM A;  1V58 A;  1AQW A;  4MNN A;  4KDY A;  4WKW A;  3H79 A;  1K3L A;  3H8Q A;  3TJK A;  4D73 B;  5CNW A;  1JLV A;  2O85 A;  3EMP A;  4KF9 A;  4EE0 A;  4HI7 A;  1HYU A;  1PX7 A;  2CAI A;  4BL7 A;  1B9X C;  1XIY A;  2GZY A;  2KLX A;  3F6D A;  2DJ2 A;  3R2Q A;  3TKR A;  5D9V A;  1OYJ A;  1M7T A;  2RII A;  1KNG A;  2M46 A;  3HHV A;  1U88 A;  1Z5Y E;  2OAD A;  1TTZ A;  1M2B A;  2G2Q A;  1GSQ A;  1QK8 A;  1ERU A;  5FT3 A;  2K6V A;  2GST A;  1W4V A;  2VL2 A;  2LRT A;  3IDV A;  5D9X A;  1ST9 A;  4HEA 2;  1CQG A;  3KH9 A;  2B6M A;  2XPD A;  3IPZ A;  1ILO A;  1AQX A;  2WVX A;  4PGT A;  2WUL A;  2AB6 A;  5HR1 A;  2H1A A;  1UA5 A;  3GTU B;  3UAP A;  6GSV A;  3A3T A;  1WWJ A;  3LJR A;  1QGV A;  4O92 A;  1AC1 A;  3EC3 A;  3APS A;  4MJE A;  1GSS A;  1S3R A;  4BPY A;  5DQS A;  2N5B A;  3LYK A;  1GUM A;  1BJX A;  2JZR A;  4HQS A;  5ECL B;  2H6X A;  3VWW A;  2B5Y A;  1ZMA A;  2GT6 A;  3HVN A;  1R5P A;  2H01 A;  3KXO A;  2B1L A;  1V57 A;  2H0I A;  4IW9 A;  1B48 A;  1XPV A;  1EP7 A;  1F6M C;  3MDK A;  3P90 A;  2OBK A;  4I2U A;  4MCU A;  3WT2 A;  3EYT A;  2TRC P;  4OO4 A;  1OC9 A;  1THX A;  3BOA A;  2H1B A;  9GSS A;  2V32 A;  2P5Q A;  2EFE A;  2DLX A;  5BRT A;  3C8E A;  1J08 A;  2P0G A;  2IME A;  2ZCT A;  3TKS A;  1PKZ A;  2GSQ A;  3I9V 2;  1PKW A;  4TXV A;  4TR4 A;  2R0P A;  1T4Z A;  2OKA A;  4X4J A;  1A2J A;  3CWG A;  4QL7 A;  1XG8 A;  2HZE A;  1A24 A;  4JR4 A;  1SJI A;  5DCG A;  5ECR B;  3LXZ A;  5DCH A;  2CX4 A;  3KMN A;  3FR3 A;  2WCI A;  3PGT A;  1TI1 A;  2MYG A;  1XWK A;  4MH3 A;  1GSE A;  3O6T A;  5CRW A;  1GSD A;  3TUE A;  5A4U A;  4TKY A;  5ABR A;  2OT3 A;  4LA1 A;  5A5H B;  1Z7R A;  1XCC A;  4MLY A;  3GL3 A;  1KEB A;  1S4B P;  3E9J B;  4K0N A;  4F03 A;  1M99 A;  4PNG A;  1X5D A;  3CYN A;  2WB9 A;  3M3M A;  3UL3 A;  4OO5 A;  1MD4 A;  4FQU A;  1T1V A;  4RI7 A;  4ILF A;  1RW1 A;  2JZT A;  4E68 A;  4G9H A;  3MYD A;  4YH2 A;  1THO A;  1GSF A;  2FD3 A;  5ECO B;  2E0Q A;  1OAZ A;  2NTO A;  2JU5 A;  3H4K A;  4N30 A;  3TRP A;  2GDR A;  3IRA A;  5DQY A;  5G30 A;  4PI2 C;  2WRT A;  1FOV A;  2UV8 G;  1JLW A;  3D21 A;  2HLS A;  5DAL A;  4IJ3 A;  4ZBA A;  3F8U A;  4XIH A;  4K7I A;  2VM2 A;  2A4V A;  2HSN B;  2AJQ B;  5ECP B;  4E8H A;  1JZD A;  1F9M A;  1PL2 A;  3TOT A;  1OKT A;  2WZS A;  1SKS B;  2RLI A;  3GNJ A;  4KUN A;  5D9T A;  1K0D A;  3F3R A;  5J47 A;  5B8B A;  4QMK A;  2R37 A;  4WET A;  2ZNM A;  4KX4 A;  1XOA A;  3FMW A;  12GS A;  2H8L A;  1E6B A;  2H6Z A;  5H5S A;  1C72 A;  4J56 E;  3FYG A;  1S3C A;  3F6F A;  2BTO T;  2HRK B;  2AAW A;  1EOH A;  3VPQ A;  2GQL A;  1U6T A;  4ECC A;  2H0H A;  4AJ7 A;  1FHE A;  2NVL A;  3ZIT A;  5A4V A;  3D6I A;  1EV9 A;  2C8U A;  2VIM A;  2WVY A;  4GRF A;  5H5Q A;  3GH6 A;  1Q98 A;  1FAA A;  3IE3 A;  3EMX A;  2GT5 A;  3UIW A;  2IIY A;  3TKP A;  1U3A A;  3DML A;  4DVC A;  4N10 A;  1N25 A;  4EDY A;  3RHC A;  1BG1 A;  3RPP A;  2GVP A;  4USS A;  1XFL A;  3VK9 A;  4IP1 A;  2G0F A;  2MBT A;  4MZB A;  4LMW A;  4TN8 A;  1AXD A;  1X5E A;  3UMA A;  3I43 A;  3GA4 A;  4EIQ A;  5B6M A;  2K8V A;  3ZIV A;  1AW9 A;  2F9S A;  18GS A;  1SVM A;  2L5L A;  3GRX A;  5J4U A;  4L5L A;  3TKS E;  3ZL5 A;  4XHM A;  4TW5 A;  4N11 A;  3M1G A;  4ECJ A;  1XW6 A;  5B7C A;  2VLT A;  1HNC A;  2OAC A;  1M9B A;  1MTC A;  2NDO A;  3EE2 A;  2OE1 A;  3HZ4 A;  2HRA A;  3W8S A;  2CVB A;  4TOP A;  2R0G A;  4MA9 A;  4G2E A;  4ZB8 A;  3FZ5 A;  2IMF A;  1XW5 A;  1XW9 A;  1GSY A;  1JZO A;  1A2M A;  2H74 A;  2A2R A;  4G19 A;  1R5A A;  2VCT A;  1BF5 A;  2RUF A;  5DVB A;  3DYR A;  3DEX A;  1V2A A;  3GX8 A;  2WDU A;  3GKN A;  3LEF A;  2YNX A;  4YAP A;  1R7H A;  2GLR A;  4OMV A;  1UVZ A;  5EY6 A;  5L71 A;  1YDK A;  5J4Y A;  4XRD A;  2I4A A;  4HDE A;  2LQQ A;  2GZP A;  3P8W A;  2L59 A;  2EFD A;  2WJU A;  2H0G A;  5CRG A;  13GS A;  6GSW A;  4POM A;  5D93 A;  3BJ5 A;  4MAB A;  3LSZ A;  2VLV A;  4Q5N A;  3QR6 A;  3FZ4 A;  2EC4 A;  3SWL A;  5F8B A;  4L0U A;  3ZVJ A;  2FUG 2;  4K7N A;  3VI5 A;  2QA1 A;  2H30 A;  1TXU A;  3TKQ A;  4PXO A;  1ML6 A;  2HQT A;  4FYU A;  4HZ4 A;  3BBY A;  2PWJ A;  3E3E A;  2K8S A;  2VOC A;  3HJO A;  1FVJ A;  3GKX A;  3HVV A;  1YKA A;  2OJL A;  4PNF A;  3RHB A;  2K18 A;  2HSH A;  4RI6 A;  1K0B A;  4ECB A;  3L9U A;  1XWB A;  4AI6 A;  3M8N A;  1U3I A;  5D8I A;  4MDC A;  2FA8 A;  2KUC A;  3V1W A;  3CSH A;  2I3Y A;  3ZTL A;  2MMN A;  2JAD A;  4ZL9 A;  1PMT A;  1XVW A;  5DDL A;  3VUR A;  3GSS A;  4V1A g;  4BVX A;  1A0F A;  1EEM A;  6GST A;  3HJP A;  3LG6 A;  1M3J A;  3CTG A;  4DEJ A;  3QD9 A;  3TRX A;  4MJC A;  3DGQ A;  4IKH A;  3TGZ A;  2O7K A;  5DAK B;  2XBI A;  4WBJ A;  20GS A;  5GAP D;  1GTU A;  5EVO A;  2GZZ A;  1A8L A;  2YV9 A;  2VCV A;  1SU9 A;  2F8A A;  3D4T A;  2FCH A;  3GN3 A;  4K8M A;  2VCW A;  4AKG A;  4TXO A;  4RQR A;  4EF0 A;  3EU4 A;  2CAQ A; 
#chains in the Genus database with same CATH homology
 3A2W A;  4IN0 A;  3BD2 A;  5IO2 A;  1GUH A;  4GCI A;  8GSS A;  1OC3 A;  1XWC A;  5G1K A;  1HNB A;  1SK1 A;  4ZIJ A;  2DIY A;  2LNT A;  4XTS A;  1SL0 B;  4ML6 A;  2ON5 A;  5GAN D;  2LUS A;  4ZBD A;  11GS A;  1K0C A;  3IC4 A;  3KMO A;  1OC8 A;  1A23 A;  3FR6 A;  3CTF A;  1ABA A;  4YQM A;  4IQA A;  5IOX A;  1TDI A;  2HRN A;  1ZL9 A;  3TJG A;  1PGT A;  2KOK A;  1BG5 A;  4TR0 A;  1GTA A;  2L6C A;  3MAK A;  5G31 A;  1F2E A;  5F0G A;  3FEU A;  4K9Z A;  4HJM A;  3Q18 A;  4JRR A;  4NAX A;  2IPA A;  4NV2 A;  1TW9 A;  1CQH A;  5JCU A;  2TRX A;  3CXG A;  4AKX B;  1K3Y A;  3L9S A;  2WS2 A;  2V6O A;  3S9F A;  1GLP A;  2Z9S A;  3VWU A;  2I81 A;  4AKI A;  3FHK A;  5JWR B;  2L4C A;  1URM A;  2XPE A;  4MF7 A;  2LV3 A;  4JE1 A;  4K2X A;  3ZVJ D;  1MD3 A;  5ENU A;  2WFC A;  5IMV A;  2E7P A;  1Y6E A;  3FY7 A;  2KP2 A;  2J9H A;  1F3B A;  4IEL A;  1A2L A;  2LJK A;  5A34 A;  1O6J A;  2B5E A;  1GTB A;  3CBU A;  1KTE A;  2CVD A;  2LTK A;  4L0W A;  2DKH A;  1X9S B;  3EWL A;  4Z2U A;  2DJJ A;  4PQ1 A;  4BVY B;  1ZYP A;  3NZN A;  4F9Z A;  4YKF A;  3HJM A;  4Q5F A;  1WPI A;  4LLR A;  4GLT A;  1JFU A;  3FW2 A;  3L4N A;  4WR5 A;  4ISD A;  3QAW A;  4Q5R A;  1BAY A;  3ZMK A;  4ZIL A;  4O5R A;  1PQN A;  2VKZ G;  2LS5 A;  2X49 A;  4KDX A;  4Z2T A;  4FH8 A;  4DSS B;  5A1N B;  4G0K A;  4GSN A;  3KH7 A;  2FWE A;  1GL8 A;  4WEY A;  4YQV A;  2VUP A;  4OFT A;  5ECK B;  1R26 A;  2PMT A;  2UZ8 A;  2X64 A;  10GS A;  1BYE A;  4V2N A;  3LW9 A;  4G01 A;  3ISO A;  2H70 A;  4BWS A;  4F82 A;  5BMU A;  3IAS 2;  2VLU A;  2EIO A;  3M0F A;  1ZYE A;  1TP9 A;  2HSM B;  1O8X A;  4N3Z A;  1T4Y A;  7GSS A;  3E0U A;  5AIS A;  4XS6 A;  2VAF A;  3C1S A;  2PU9 C;  1G6W A;  14GS A;  3M9J A;  3QCP A;  1GH2 A;  2B3S A;  4E8E A;  2R3X A;  4L8E A;  3CMI A;  5IPG A;  1TRU A;  2VCZ A;  1T00 A;  2DMM A;  5IMF A;  1EV4 A;  2V41 A;  2R0C A;  4XS4 A;  3F63 A;  3C7M A;  1YEP A;  2VL9 A;  5IMC A;  2LJR A;  4OD7 A;  1B4P A;  4PUR A;  5DJM A;  5J41 A;  3EUR A;  2N5A A;  2V1M A;  4Q5Q A;  4IQ1 A;  5G2Z A;  1SEN A;  4YKG A;  1GNE A;  3J7Y k;  2GGT A;  4WBR D;  2CQ9 A;  3D0Z A;  2I9H A;  3HA9 A;  3DVX A;  1J0F A;  3FZA A;  1WRY A;  1ZOF A;  2DIZ A;  2PVO C;  2A4H A;  2XC2 A;  4KW6 A;  4CW9 A;  1ZCP A;  3RPN A;  2FWH A;  2GQM A;  1NM3 A;  2D2Z A;  2LQO A;  2JSZ A;  4JU5 A;  4CY8 A;  2EIQ A;  2HYX A;  3HY2 A;  4GTU A;  1DUG A;  1ZYQ B;  3GX0 A;  5A5K A;  1IYH A;  4BL7 B;  5AIX A;  1PRX A;  2DML A;  3FK8 A;  1QMV A;  2E2G A;  4G0I A;  3APO A;  2FGX A;  3WGD A;  4POB A;  5B6N A;  2CV4 A;  1GUK A;  2JZS A;  3KTL A;  1VF2 A;  5FHI A;  1PSQ A;  1XOB A;  5C00 A;  2OE3 A;  1T8E B;  4ECI A;  4I5Q A;  1EP8 A;  4LL1 B;  1U87 A;  3HCZ A;  4AKH A;  1XVQ A;  1AIU A;  3GV1 A;  5HR2 A;  2IL3 A;  4K0G A;  1DSB A;  1TKD B;  4GST A;  1T7P B;  4NHW A;  4KA0 A;  3TJF A;  2L4Q A;  2VL2 C;  4IP6 A;  3F4T A;  2CT6 A;  3IHG A;  1F37 A;  1YZX A;  1VF3 A;  1SK2 A;  5CP1 A;  3GFK A;  4X1U A;  3GKK A;  1Z6N A;  5CAX A;  1PN9 A;  1M9A A;  2CA8 A;  3KEB A;  1DBY A;  4A5P A;  3HDC A;  1JZW A;  3APQ A;  4J57 E;  2DBC A;  2MBS A;  4KGI A;  1XWG A;  1K0O A;  2HSY A;  4JZQ A;  2A2P A;  1FO5 A;  2VD1 A;  2H75 A;  5CO3 A;  4KSO A;  4WF4 A;  1K0M A;  1YQ1 A;  5KOX A;  5ELG A;  3M9K A;  2H73 A;  4I97 A;  1OC9 B;  3C73 A;  1USB A;  1VF4 A;  5E59 A;  4AGS A;  2MZC A;  5KEJ A;  5F06 A;  1O81 A;  1H4O A;  1UC7 A;  2QA2 A;  1GSU A;  4L5O A;  4K5S A;  2GTU A;  3HMJ G;  3H1N A;  3UBL A;  2LEG A;  2C0F A;  3TJB A;  3TDG A;  3IBH A;  1WE0 A;  5IQY A;  1TK5 B;  2R6K A;  4D73 A;  5JCW A;  1JZR A;  1BX9 A;  3L0H A;  2YJ7 A;  2VL3 A;  2WZ9 A;  4X0X A;  1M2D A;  2ON7 A;  4ZL7 A;  4O5Q A;  5DJL A;  1SVL A;  2IFQ B;  3TKS C;  4KE3 A;  4N0Z A;  1PL1 A;  2YZU A;  4PX1 A;  2C0E A;  3HKR A;  1FB6 A;  1G0T A;  3VWX A;  1TK8 B;  3QAG A;  1K0N A;  4ZB6 A;  3IA1 A;  4EKZ A;  2C3N A;  3UOM A;  1VRS D;  3NIV A;  4MZW A;  2H1D A;  2YCD A;  2ZUP A;  5G5F A;  3WD6 A;  5B8A A;  19GS A;  2PN8 A;  3ZIJ A;  2VD0 A;  4YAV A;  3DRN A;  1XBS A;  3RAZ A;  3GTU A;  4O5U A;  1TK0 B;  2V6K A;  3QMX A;  4V1A p;  2EFH A;  3GKM A;  3R3E A;  1S3A A;  3IXR A;  3RBT A;  2JL4 A;  1A8Y A;  3LGC A;  4FYC A;  4KCA A;  2B7J A;  3KCM A;  5FWG A;  1O73 A;  3IOS A;  3ZRD A;  5A4W A;  2P5R A;  3DIE A;  4BA7 A;  3U6V A;  4KB3 A;  5DAL B;  1Z9H A;  2YJH A;  4EUY A;  2DC5 A;  2HFD A;  4ID0 A;  3HVX A;  2C0G A;  5IIZ A;  2L57 A;  3LYP A;  5LD0 A;  3QDN A;  4KCE A;  3IC8 A;  2H1G A;  3ZLP A;  1TU8 A;  4MZC A;  2B1K A;  3G7I A;  1YJ6 A;  4OWY A;  1M0U A;  3ERG A;  3Q74 A;  3PH9 A;  4EVM A;  5ELA A;  2F51 A;  2REM A;  1V40 A;  4J2F A;  4F0B A;  1DE1 A;  4AJ6 A;  3CRT A;  1VGL A;  3I6A A;  3IAM 2;  2K9F A;  5HR3 A;  17GS A;  4ZXG A;  3AY8 A;  2JSY A;  3QPM A;  1W89 A;  5ID2 B;  3IV4 A;  1K0A A;  3GL5 A;  2IJY A;  2L6D A;  1GWC A;  4YQU A;  2YP6 A;  5IO0 A;  5JCG A;  6GSU A;  4G0L A;  3CRU A;  3UAR A;  4RUV A;  3MNG A;  2X8G A;  1EGR A;  5KN0 A;  2RM5 A;  2H66 A;  4G10 A;  2C80 A;  1A0R P;  3ZFL A;  3QOU A;  1AQV A;  2YWO A;  2M80 A;  1LJR A;  6GSS A;  1PD2 1;  3KZQ A;  2H72 A;  2IMK A;  3FZ9 A;  1O85 A;  3F0I A;  3N5O A;  2HXK A;  1ERV A;  2EIR A;  2MMA A;  4H86 A;  3ZYW A;  1JHB A;  3VFI A;  4MPF A;  5A5H A;  3G7J A;  1HNA A;  3MWH A;  1SK0 A;  2PER A;  4F2I A;  1RQM A;  2VO4 A;  2XHF A;  4K7O A;  2HT9 A;  3VPT A;  4BWQ A;  4O32 A;  1S3D A;  1GTI A;  4EO3 A;  4HQZ A;  3HXS A;  3A5W A;  1FW1 A;  4CDO A;  3VLN A;  4NPB A;  1QUW A;  2YWN A;  1OE7 A;  1YEX A;  4TR1 B;  5ECQ B;  5J9B A;  2B7K A;  4FO5 A;  2PPT A;  2A2S A;  4ICY A;  3Q19 A;  5HQP A;  3DD3 A;  1QFN A;  2OBI A;  4Z7X A;  1LBK A;  5JWQ B;  3DVW A;  2H19 A;  3D22 A;  4K5R A;  2CZ2 A;  1TRS A;  2HSN A;  3QAV A;  3TRQ A;  1H75 A;  4XCS A;  4TRX A;  3LFL A;  3KTB A;  2NPB A;  4NV5 A;  4ZBB A;  2RUE A;  1YKC A;  2X99 A;  2GSR A;  4P3Y B;  3ERW A;  1LU4 A;  2IMD A;  2J23 A;  4V2M A;  1B8X A;  3TB2 A;  1EWX A;  1TI3 A;  5GST A;  3GIX A;  5H5R A;  2HRK A;  1EGO A;  5KOW A;  3EVI A;  1O7U A;  1MDI A;  2H76 A;  5CRH A;  1V9W A;  2DJK A;  2XBQ A;  1X9W B;  3KJY A;  2C0D A;  2OA7 A;  2IMI A;  2CZ3 A;  2X4A A;  2F8F A;  1BQ7 A;  2X8H A;  4KAE A;  1SL1 B;  1N8J A;  1MEK A;  3US3 A;  3D5J A;  5E4W A;  2PVQ A;  5IMD A;  4HOJ A;  1YY7 A;  3F4S A;  1SL2 B;  3HD5 A;  4W66 A;  2YZH A;  2NBS A;  4BVX B;  3IHQ A;  3MSZ A;  5IMZ A;  1AAZ A;  2VM1 A;  4Z2R A;  5ECS A;  2KHP A;  4OFN A;  1G7E A;  4POL A;  3JCM L;  2AHE A;  4GQF A;  2C3T A;  1ON4 A;  2FA4 A;  5G5E A;  4NMU A;  3W6G A;  2GSS A;  3UVT A;  3WGX A;  2QSI A;  3L9V A;  2WGR A;  4LL4 B;  2LJA A;  5J5N A;  2AUV A;  4XS1 A;  4KDU A;  1EZK A;  1GRX A;  2O5V A;  4TXO B;  5KN1 A;  3GYK A;  5LNK e;  1B9Y C;  3N9J A;  1XZO A;  2P31 A;  3SBC A;  4LMV A;  1WIK A;  2O8V B;  4IVF A;  2AV4 A;  3J7Y b;  3O3T A;  1ERT A;  2BJX A;  2CVK A;  3ED3 A;  1M2A A;  3F9U A;  2B5X A;  2JAC A;  4N0V A;  4KND A;  2IFQ A;  5J4V A;  2QC7 A;  1T3B A;  2PGT A;  1O8W A;  5IMA A;  1EEJ A;  1XWA A;  4IGJ A;  4HU9 A;  4AF2 A;  3IR4 A;  5F07 A;  1ZZY A;  3ERF A;  5INY A;  3PPU A;  2HI7 A;  2DJ0 A;  2EFC A;  2YV7 A;  2LKU A;  4O7H A;  3ME8 A;  1YF1 A;  4WXT A;  3WT1 A;  1X5C A;  5ECM B;  1ERW A;  4NXI A;  5CRE A;  3K8N A;  5HR0 A;  3A5I A;  3W8J A;  1NHY A;  2YAN A;  4KSM A;  4IHU A;  1HD2 A;  3FRC A;  3I69 A;  1NSW A;  2HE3 A;  3KP8 A;  1UN2 A;  1Z7P A;  3FKF A;  4EC0 A;  4HZ2 A;  4NHZ A;  4GWR A;  5HFI A;  3KP9 A;  4HJ2 A;  5GSS A;  2C1Y A;  3IK9 A;  2L5O A;  1X0R A;  4ACS A;  5EL8 A;  3GUR A;  2F3M A;  2FWG A;  4OCE A;  1TJD A;  1TRW A;  4FIW A;  1TOF A;  3L78 A;  1OKD A;  3WYW A;  16GS A;  1Z3E A;  4DSQ A;  1F3A A;  2O87 A;  3O76 A;  4ULX A;  2RM6 A;  3F3Q A;  2R5G A;  4JED A;  2VCX A;  1FG4 A;  1TRV A;  3TJJ A;  4GXZ A;  4ML1 A;  1I5G A;  3CSJ A;  1VF1 A;  4FYB A;  4ZB9 A;  3C1R A;  5DAK A;  5A34 B;  3VWV A;  1GNW A;  4K6X A;  2VCQ A;  3FR9 A;  1SD8 A;  1ACV A;  3P2A A;  1Y1U A;  3ZFB A;  4GF0 A;  2FNO A;  4PUF C;  1DE2 A;  4F0C A;  2TIR A;  3DKS A;  5IM9 A;  5KN2 A;  5D9W A;  3LOR A;  1GLQ A;  2CX3 A;  3KD0 A;  2FY6 A;  5ID2 A;  3BCK A;  2I1U A;  1SYX A;  4GQC A;  2HRF A;  2DSA A;  1FVK A;  4I8B A;  4PUA A;  1E2Y A;  2DKI A;  4KH7 A;  2GS3 A;  5D96 A;  1GP1 A;  1MDJ A;  1SJ6 A;  3Q6O A;  4V2L A;  5AGY A;  1SKR B;  1WOU A;  3VI7 A;  2H1L A;  3EU3 A;  3IK7 A;  1SD9 A;  4GSS A;  4JBB A;  2HZF A;  2QGV A;  3ZRE A;  4NWY A;  1G7O A;  2E2M A;  2LRN A;  2MMO A;  3HYP A;  1GUL A;  4K2D A;  1K3O A;  3GHA A;  3WGE A;  3MIX A;  1Y25 A;  2GQK A;  3KGK A;  2R2J A;  3ZZX A;  5BMU B;  4EDZ A;  5C04 A;  3DWV A;  2O89 A;  4POK A;  4IS0 A;  3A2V A;  2IN3 A;  2DJ1 A;  3ZML A;  2HZE B;  2N5F A;  1R4W A;  3EPT A;  2FHE A;  2YOI A;  4X43 A;  4TR1 A;  2YPM A;  3LWA A;  2FLS A;  5J40 A;  4IBP A;  2ALB A;  2H6Y A;  1WMJ A;  4HU7 A;  3KM6 A;  5KN3 A;  4CHS A;  1Q4J A;  2FWF A;  1FB0 A;  4HS1 A;  5LCZ A;  3NOF A;  4XS4 B;  4OFM A;  3QFB C;  4K1F A;  3F4R A;  5F05 A;  3TOU A;  5AIV A;  3CSI A;  5ECI B;  1SVO A;  1NW2 A;  1ZYN A;  5AN1 A;  1AUC A;  5J3R A;  1NHO A;  3UJ1 A;  2M72 A;  1EOG A;  3TU3 B;  3LQ7 A;  4QL9 A;  3PIN A;  1SJZ A;  3D4M A;  1FOH A;  3HZ8 A;  1SKW B;  4JR6 A;  4TVE A;  6GSX A;  4EIP A;  1WJK A;  4AJ8 A;  2BMX A;  1SYR A;  3BCI A;  1QQ2 A;  2PUK C;  2X8C A;  2IWT A;  4PQI A;  2MMZ A;  1ZGN A;  1HQO A;  5ECH B;  1G6Y A;  5G1L A;  3GH9 A;  1RK4 A;  2YWI A;  1WP0 A;  4BVY A;  5DBQ A;  2QKE A;  2V2G A;  3GST A;  2R4V A;  1OE8 A;  4PTS A;  1IYI A;  3UBK A;  4MK3 A;  3UEM A;  4DSR A;  3C71 A;  3GMF A;  3A2X A;  1QXH A;  4EL1 A;  3ME7 A;  5GZZ B;  4IJI A;  1N2A A;  3HVS A;  2YN1 A;  4QQ7 A;  4TR3 A;  2AYT A;  3PR8 A;  4DSS A;  5A1N A;  4MPG A;  2H71 A;  4WF5 A;  1PX6 A;  4MJB A;  5HFG A;  3U5R E;  5J9C A;  22GS A;  5EPF A;  3DXB A;  1I9D A;  2HNL A;  5IOW A;  2C3Q A;  3QFA C;  4XRA A;  2KP1 A;  4I6X A;  1YF0 A;  3TCO A;  5JWO B;  4ZL8 A;  5COH A;  1PA3 A;  1Z6M A;  1XXU A;  3LXT A;  2ES7 A;  1PN0 A;  1TU7 A;  4GDF A;  4PQH A;  4OCF A;  5CYY A;  2LNS A;  4MF6 A;  2C4J A;  2HSM A;  6GSY A;  2YWM A;  3GUS A;  1J9B A;  2DJ3 A;  1X9M B;  4RQX A;  4EXJ A;  3OR5 A;  4CY6 A;  5HFK A;  5ECN B;  3P7X A;  4MH2 A;  3G9B A;  4I2T A;  5IPH A;  1YVL A;  1V98 A;  1KBN A;  4ZB7 A;  3H93 A;  5CRD A;  1MDK A;  3UVH A;  4MP4 A;  2OE0 A;  3G7Y A;  1BED A;  2PBJ A;  1OVN A;  2LST A;  3EIN A;  4HUA A;  3RDW A;  4WR4 A;  1B4Q A;  1TXX A;  5D73 A;  4MF5 A;  3KIJ A;  2LRC A;  4MJA A;  4MMM A;  1V58 A;  1AQW A;  4MNN A;  4KDY A;  4WKW A;  3H79 A;  1K3L A;  3H8Q A;  3TJK A;  4D73 B;  5CNW A;  1JLV A;  2O85 A;  3EMP A;  4KF9 A;  4EE0 A;  4HI7 A;  1HYU A;  1PX7 A;  2CAI A;  4BL7 A;  1B9X C;  1XIY A;  2GZY A;  2KLX A;  3F6D A;  2DJ2 A;  3R2Q A;  3TKR A;  5D9V A;  1OYJ A;  1M7T A;  2RII A;  1KNG A;  2M46 A;  3HHV A;  1U88 A;  1Z5Y E;  2OAD A;  1TTZ A;  1M2B A;  2G2Q A;  1GSQ A;  1QK8 A;  1ERU A;  5FT3 A;  2K6V A;  2GST A;  1W4V A;  2VL2 A;  2LRT A;  3IDV A;  5D9X A;  1ST9 A;  4HEA 2;  1CQG A;  3KH9 A;  2B6M A;  2XPD A;  3IPZ A;  1ILO A;  1AQX A;  4PGT A;  2WUL A;  2AB6 A;  5HR1 A;  2H1A A;  1UA5 A;  3GTU B;  3UAP A;  6GSV A;  3A3T A;  1WWJ A;  3LJR A;  1QGV A;  4O92 A;  1AC1 A;  3EC3 A;  3APS A;  4MJE A;  1GSS A;  4BPY A;  5DQS A;  2N5B A;  3LYK A;  1GUM A;  1BJX A;  2JZR A;  4HQS A;  5ECL B;  2H6X A;  3VWW A;  2B5Y A;  1ZMA A;  2GT6 A;  1R5P A;  2H01 A;  3KXO A;  2B1L A;  1V57 A;  2H0I A;  4IW9 A;  1B48 A;  1XPV A;  1EP7 A;  1F6M C;  3MDK A;  3P90 A;  2OBK A;  4I2U A;  4MCU A;  3WT2 A;  3EYT A;  2TRC P;  4OO4 A;  1OC9 A;  1THX A;  3BOA A;  2H1B A;  9GSS A;  2V32 A;  2P5Q A;  2EFE A;  2DLX A;  5BRT A;  3C8E A;  1J08 A;  2P0G A;  2IME A;  2ZCT A;  3TKS A;  1PKZ A;  2GSQ A;  3I9V 2;  1PKW A;  4TXV A;  4TR4 A;  2R0P A;  1T4Z A;  2OKA A;  4X4J A;  1A2J A;  3CWG A;  4QL7 A;  1A24 A;  2HZE A;  4JR4 A;  1SJI A;  5DCG A;  5ECR B;  3LXZ A;  5DCH A;  2CX4 A;  3KMN A;  3FR3 A;  2WCI A;  3PGT A;  1TI1 A;  2MYG A;  1XWK A;  4MH3 A;  1GSE A;  3O6T A;  5CRW A;  1GSD A;  3TUE A;  5A4U A;  4TKY A;  5ABR A;  2OT3 A;  4LA1 A;  5A5H B;  1Z7R A;  1XCC A;  4MLY A;  3GL3 A;  1KEB A;  3E9J B;  4K0N A;  4F03 A;  1M99 A;  4PNG A;  1X5D A;  3CYN A;  2WB9 A;  3M3M A;  3UL3 A;  4OO5 A;  1MD4 A;  4FQU A;  1T1V A;  4RI7 A;  4ILF A;  1RW1 A;  2JZT A;  4E68 A;  4G9H A;  3MYD A;  4YH2 A;  1THO A;  1GSF A;  2FD3 A;  5ECO B;  2E0Q A;  1OAZ A;  2NTO A;  2JU5 A;  3H4K A;  4N30 A;  3TRP A;  2GDR A;  3IRA A;  5DQY A;  5G30 A;  2WRT A;  1FOV A;  2UV8 G;  1JLW A;  3D21 A;  2HLS A;  5DAL A;  4IJ3 A;  4ZBA A;  3F8U A;  4XIH A;  4K7I A;  2VM2 A;  2A4V A;  2HSN B;  2AJQ B;  5ECP B;  4E8H A;  1JZD A;  1F9M A;  1PL2 A;  3TOT A;  1OKT A;  1SKS B;  2RLI A;  3GNJ A;  4KUN A;  5D9T A;  1K0D A;  3F3R A;  5J47 A;  5B8B A;  4QMK A;  2R37 A;  4WET A;  2ZNM A;  4KX4 A;  1XOA A;  3FMW A;  12GS A;  2H8L A;  1E6B A;  2H6Z A;  5H5S A;  1C72 A;  4J56 E;  3FYG A;  1S3C A;  3F6F A;  2BTO T;  2HRK B;  2AAW A;  1EOH A;  3VPQ A;  2GQL A;  1U6T A;  4ECC A;  2H0H A;  4AJ7 A;  1FHE A;  2NVL A;  3ZIT A;  5A4V A;  3D6I A;  1EV9 A;  2C8U A;  2VIM A;  4GRF A;  5H5Q A;  3GH6 A;  1Q98 A;  1FAA A;  3IE3 A;  3EMX A;  2GT5 A;  3UIW A;  2IIY A;  3TKP A;  1U3A A;  3DML A;  4DVC A;  4N10 A;  1N25 A;  4EDY A;  3RHC A;  1BG1 A;  3RPP A;  2GVP A;  4USS A;  1XFL A;  3VK9 A;  4IP1 A;  2G0F A;  2MBT A;  4MZB A;  4LMW A;  4TN8 A;  1AXD A;  1X5E A;  3UMA A;  3I43 A;  3GA4 A;  4EIQ A;  5B6M A;  2K8V A;  3ZIV A;  1AW9 A;  2F9S A;  18GS A;  1SVM A;  2L5L A;  3GRX A;  5J4U A;  4L5L A;  3TKS E;  3ZL5 A;  4XHM A;  4TW5 A;  4N11 A;  3M1G A;  4ECJ A;  1XW6 A;  5B7C A;  2VLT A;  1HNC A;  2OAC A;  1M9B A;  1MTC A;  2NDO A;  3EE2 A;  2OE1 A;  3HZ4 A;  2HRA A;  3W8S A;  2CVB A;  4TOP A;  2R0G A;  4MA9 A;  4G2E A;  4ZB8 A;  3FZ5 A;  2IMF A;  1XW5 A;  1XW9 A;  1GSY A;  1JZO A;  1A2M A;  2H74 A;  2A2R A;  4G19 A;  1R5A A;  2VCT A;  1BF5 A;  2RUF A;  5DVB A;  3DYR A;  3DEX A;  1V2A A;  3GX8 A;  2WDU A;  3GKN A;  3LEF A;  2YNX A;  4YAP A;  1R7H A;  2GLR A;  4OMV A;  1UVZ A;  5EY6 A;  5L71 A;  1YDK A;  5J4Y A;  4XRD A;  2I4A A;  4HDE A;  2LQQ A;  2GZP A;  3P8W A;  2L59 A;  2EFD A;  2WJU A;  2H0G A;  5CRG A;  13GS A;  6GSW A;  4POM A;  5D93 A;  3BJ5 A;  4MAB A;  3LSZ A;  2VLV A;  4Q5N A;  3QR6 A;  3FZ4 A;  2EC4 A;  3SWL A;  5F8B A;  4L0U A;  3ZVJ A;  2FUG 2;  4K7N A;  3VI5 A;  2QA1 A;  2H30 A;  1TXU A;  3TKQ A;  4PXO A;  1ML6 A;  2HQT A;  4FYU A;  4HZ4 A;  3BBY A;  2PWJ A;  3E3E A;  2K8S A;  2VOC A;  3HJO A;  1FVJ A;  3GKX A;  3HVV A;  1YKA A;  2OJL A;  4PNF A;  3RHB A;  2K18 A;  2HSH A;  4RI6 A;  1K0B A;  4ECB A;  3L9U A;  1XWB A;  4AI6 A;  3M8N A;  1U3I A;  5D8I A;  4MDC A;  2FA8 A;  2KUC A;  3V1W A;  3CSH A;  2I3Y A;  3ZTL A;  2MMN A;  2JAD A;  4ZL9 A;  1PMT A;  1XVW A;  5DDL A;  3VUR A;  3GSS A;  4V1A g;  4BVX A;  1A0F A;  1EEM A;  6GST A;  3HJP A;  3LG6 A;  3CTG A;  4DEJ A;  3QD9 A;  3TRX A;  4MJC A;  3DGQ A;  4IKH A;  3TGZ A;  2O7K A;  5DAK B;  2XBI A;  4WBJ A;  20GS A;  5GAP D;  1GTU A;  5EVO A;  2GZZ A;  1A8L A;  2YV9 A;  2VCV A;  1SU9 A;  2F8A A;  3D4T A;  2FCH A;  3GN3 A;  4K8M A;  2VCW A;  4AKG A;  4TXO A;  4RQR A;  4EF0 A;  3EU4 A;  2CAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...