1XW5A

Human glutathione s-transferase m2-2 (e.c.2.5.1.18)complexed with glutathione, monoclinic crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 2
publication title Structural Perturbation of the Active Site of Human Glutathione-S-Transferase M2-2 Upon Ligand Binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1xw5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xw5A01
1GUMA 1N2AA 2PWJA 3HCZA 3O6TA 1A0FA 3LG6A 4KSMA 3L78A 4KSOA 3RPPA 2WRTA 2LRCA 1PMTA 3LXTA 1TOFA 2IMIA 4V1Ap 1SL1B 1Z7RA 5ECKB 2OBIA 2LSTA 5EPFA 2V32A 3K8NA 2H74A 3GMFA 2AB6A 3QFBC 4MMMA 3TKPA 2H73A 4KNDA 5IQYA 5J9CA 2C3NA 1QUWA 3IDVA 3LWAA 3Q19A 4N0VA 4TOPA 2O87A 4NV2A 1M0UA 22GSA 2CAIA 2HT9A 1LU4A 1PQNA 1XWKA 1EOGA 5DJLA 4K0GA 1BYEA 3UBKA 3ERWA 4FH8A 3Q6OA 1U87A 5EL8A 1BAYA 2G0FA 4XIHA 3IC4A 13GSA 4NHZA 3TRXA 4OD7A 1HD2A 2CA8A 1TXXA 5DQSA 3SBCA 1HNBA 1MD3A 3HD5A 2LQQA 5J3RA 1V57A 4WETA 1O8XA 2K18A 1IYIA 4F2IA 1USBA 3Q18A 2ALBA 2FCHA 1WP0A 2LNSA 2C80A 2R3XA 2WFCA 2C0FA 5JCUA 3QR6A 3TJBA 1TRVA 1NM3A 1FO5A 1SKWB 3CBUA 5CP1A 3M3MA 4GSTA 2HRFA 5KN2A 4ZXGA 1TU8A 1V9WA 5F8BA 3H93A 1UC7A 4K8MA 1N8JA 4FQUA 4CW9A 4EE0A 2M72A 1THXA 5CNWA 4MH3A 3ZFLA 3FW2A 3BOAA 1BX9A 4I2UA 3TKRA 3GSTA 1ZOFA 3ZZXA 2TRCP 1GNEA 1OVNA 2C3TA 3EVIA 4E8EA 4ECIA 2XBQA 3MSZA 1Z3EA 3TDGA 3ZTLA 1R5AA 4XTSA 5CRWA 3F4RA 1SL0B 3VPQA 1XXUA 4KA0A 2QKEA 2MMNA 3TUEA 4DSSB 5E4WA 4MF5A 4LL4B 1OKDA 4BL7B 4LA1A 1U3IA 3ED3A 5GZZB 5ECHB 1PD21 3J7Yb 4DSRA 1MDJA 3KTLA 5GSSA 1A0RP 2FY6A 1XWBA 1B4PA 3IOSA 2HE3A 4D73A 2VL2A 5AIVA 1AQXA 1MEKA 2MMOA 2DJ1A 4F03A 4EL1A 16GSA 3EE2A 2R5GA 2XPEA 1R26A 2WJUA 1H4OA 1EGRA 2H0IA 1VRSD 4PQHA 1NSWA 4Q5RA 3CRUA 4TRXA 2HZFA 4WR5A 5ELGA 1ERVA 5G31A 3GX8A 1SKRB 4HQZA 2TRXA 4HZ4A 4KDXA 4YAVA 4NV5A 2YCDA 3FKFA 1WPIA 3R2QA 5DAKB 1KNGA 2DJ3A 3R3EA 4XS1A 3ZITA 1WWJA 2WDUA 3H1NA 3C8EA 4IJIA 2CX4A 4OCFA 3EWLA 4OWYA 2VM1A 4MZWA 5IO2A 1FVJA 3KH7A 1U3AA 3F4TA 2K8SA 1GTUA 1Q4JA 3HY2A 2P0GA 5A4VA 5AISA 4XS6A 1GLPA 4TXOB 2CVBA 1FVKA 2C8UA 4PQIA 2JSZA 2H6XA 4NWYA 3KP8A 5CRGA 1F2EA 3TOUA 3VPTA 3QOUA 4AJ7A 3EMXA 5ECNB 2VUPA 1XWGA 2I3YA 1HNCA 1Z6NA 1Z5YE 3DRNA 3F9UA 4YQVA 2YJ7A 2X99A 4IQAA 2XPDA 1K0MA 2HFDA 1BEDA 3LGCA 1S3AA 3UMAA 2MBSA 2A4VA 4HI7A 1FHEA 4MF7A 3QCPA 3BCKA 5ECIB 3KJYA 2O8VB 3KH9A 5CO3A 3ZMLA 4K2DA 2OA7A 4X0XA 2YWIA 5FT3A 2FLSA 1TKDB 1BG5A 2O89A 1V2AA 4ML1A 1EZKA 1XFLA 2L4CA 3TJFA 2X8GA 1R7HA 3UOMA 2CZ3A 1QK8A 3QDNA 3FK8A 5EY6A 4PX1A 1TRUA 5CRDA 5ENUA 2AYTA 3RDWA 2H70A 3GKXA 3F6DA 1OE7A 3F3QA 3EURA 4H86A 2KLXA 4LMVA 2V1MA 5HFKA 3DGQA 3A2WA 2QGVA 1Y25A 3FR3A 2FWFA 3HDCA 1GTAA 2H01A 2HRNA 3UBLA 2ON7A 2OKAA 7GSSA 3VWXA 1GRXA 4IN0A 3HVVA 1M9AA 4JBBA 1J0FA 1EP8A 2K8VA 1GSYA 2NTOA 1A2JA 1XOAA 2GQMA 2LJRA 2H8LA 1K3YA 2C4JA 1F3BA 3HZ4A 1F6MC 3GTUB 1VGLA 5COHA 2FA8A 2L6CA 3KEBA 2F8AA 1QFNA 2Z9SA 3LEFA 3QMXA 1O8WA 2DJKA 3N9JA 2E7PA 2CX3A 4BPYA 2FWHA 3APSA 2JZRA 3WT1A 3A5WA 3IV4A 5A5KA 2B5YA 2GSTA 2E2MA 4FO5A 2NDOA 2YP6A 1TRSA 2O85A 2GT6A 1G7EA 3LYPA 1OC9B 5A4WA 3GUSA 5BMUA 3EINA 3ZRDA 2KOKA 2A2SA 2GQKA 4USSA 2VLVA 4NAXA 4RQXA 2WB9A 5IPGA 2WS2A 3ERFA 4GXZA 1A24A 3I6AA 3DXBA 2MMZA 2VAFA 1M2AA 2FD3A 1PX6A 3D0ZA 3QAGA 4GQCA 2FA4A 1TTZA 3W8SA 1R5PA 1GNWA 1THOA 3KTBA 2H6ZA 4KCEA 4X1UA 5G1LA 4IKHA 2XC2A 3F3RA 3M9JA 1DE1A 1AC1A 1AQVA 1FW1A 1WMJA 5D93A 3W8JA 3P2AA 4JE1A 4OFNA 4HS1A 2VOCA 2FHEA 5JCWA 3CTGA 4RUVA 6GSVA 2LNTA 3DWVA 2V6KA 9GSSA 4KAEA 2VD1A 3C7MA 5B7CA 5IMCA 4FYUA 1QMVA 3C1SA 2GZPA 3BBYA 5J4UA 1O7UA 3VFIA 1GULA 3EU4A 1EEMA 2VL2C 1X5DA 4JEDA 5H5SA 2H30A 4I6XA 1UA5A 4WXTA 4K7IA 2HI7A 3H79A 1G6YA 4K7NA 3PH9A 1T3BA 1ML6A 4Q5NA 4MJCA 3TKSC 1GTBA 5F07A 4JU5A 2OE0A 3UJ1A 2H1GA 4HZ2A 3CTFA 2REMA 4L5LA 2B7JA 2C0GA 3TJJA 3CRTA 2OADA 4KGIA 1VF4A 4EUYA 2IMDA 2JZSA 5GAND 1O85A 5D73A 4WR4A 1Z7PA 5LD0A 5IOWA 4ID0A 1ZZYA 1EEJA 3S9FA 2B5XA 4XRDA 2B1KA 4K9ZA 4HEA2 4JZQA 1DSBA 3L0HA 1VF1A 4RI6A 4MA9A 2V2GA 4EC0A 4BVYA 1UN2A 2LJAA 3TGZA 3FYGA 3HYPA 6GSSA 3EYTA 3O76A 1XVWA 2L6DA 3W6GA 5GAPD 4OO4A 3ZIVA 2HZEA 1A8LA 3TKSE 1AIUA 3KGKA 4EVMA 1FG4A 3TRQA 6GSUA 1GSUA 1Z9HA 4G9HA 3APOA 4XS4A 19GSA 1XIYA 2HRKA 3APQA 3U5RE 4BA7A 5L71A 3F4SA 1PL1A 2HRAA 3I69A 2LUSA 4EO3A 5D9VA 4ZIJA 1AQWA 4ZL8A 5ECMB 5IMFA 3Q74A 4FYCA 3RPNA 4RI7A 1E2YA 1A2MA 4KUNA 3LXZA 3ZVJD 1XZOA 3ISOA 3G7YA 4L0WA 4GQFA 3UAPA 3TCOA 1M2DA 2C0EA 4KX4A 2GS3A 3KIJA 4ISDA 3GKKA 5HFIA 5DALA 5B6MA 1B48A 1GSQA 4MDCA 2NPBA 2HXKA 4AF2A 2EC4A 1B8XA 3FZ9A 1K3OA 3GHAA 3L9SA 2YANA 1ERUA 4AGSA 1WJKA 2LS5A 2P5QA 2D2ZA 5IMDA 5ID2A 3G7IA 2H75A 1GUKA 2GLRA 5DJMA 2I81A 5HR1A 2DJJA 5KEJA 5IO0A 3ZREA 2ON5A 3E0UA 2JACA 4MH2A 2IPAA 5INYA 4BVXA 1EV9A 4PGTA 1A8YA 2HQTA 2YPMA 4MZCA 4GF0A 1K0OA 1RK4A 2WCIA 2VLUA 3C73A 2PBJA 5D9TA 4HJ2A 2YV9A 1XWAA 2X8HA 4ACSA 2AV4A 3N5OA 1Y6EA 4BWSA 3F6FA 3TKSA 2VLTA 1T00A 3FHKA 1XWCA 2CQ9A 1G7OA 4TR3A 3RHBA 2I4AA 4TR1A 5D8IA 4POLA 2PGTA 2WZ9A 5DDLA 4O92A 1CQGA 3JCML 4PQ1A 4OO5A 1TK8B 2OE3A 4IS0A 4MJEA 4K0NA 2RIIA 1ZMAA 3D21A 5KN3A 2TIRA 3GYKA 1SJIA 1ERWA 5G1KA 3L9VA 2PU9C 6GSWA 5JWQB 5ECRB 1G0TA 6GSXA 1JFUA 5F05A 4MJBA 1A23A 2L57A 3IA1A 4TR4A 4GSSA 1FB6A 4I5QA 4LMWA 3CSJA 4OFMA 4ECCA 3UIWA 2YWOA 2N5FA 1SK2A 5A4UA 2EIQA 4ULXA 2F9SA 4GCIA 1FB0A 2GSRA 4NHWA 3IE3A 4PURA 4K7OA 4MP4A 3LFLA 5JWRB 14GSA 5IMAA 3VWVA 1PSQA 1IYHA 2XBIA 5G5EA 2YWMA 1H75A 1X9WB 4ECBA 2G2QA 3VLNA 4O5RA 2H0GA 3FR6A 2K6VA 2B5EA 2LRNA 5HQPA 1G6WA 4POMA 1EV4A 2VCZA 4DEJA 2OJLA 2HSMA 4QL7A 1XW6A 1TW9A 1PN9A 3PPUA 1XCCA 2F51A 3FZ5A 3IXRA 3RHCA 4EKZA 3ZVJA 4PNGA 5G30A 4J2FA 4D73B 3GURA 2GSQA 3G9BA 2HNLA 3US3A 5DQYA 1AXDA 1V98A 3D22A 4OMVA 4ILFA 4IBPA 4E8HA 1I5GA 1BQ7A 1TK0B 3GKMA 4X43A 2RLIA 4N30A 1KEBA 1K3LA 1EOHA 1TDIA 4TW5A 4PUFC 5KN1A 3M9KA 3AY8A 2L5LA 3CSHA 1K0AA 2IN3A 2J9HA 2HYXA 4YAPA 3ZLPA 5B6NA 2IFQA 3FZ4A 2JADA 1K0DA 2LTKA 1GUHA 3IBHA 3E3EA 4LLRA 12GSA 3C71A 2DSAA 2CT6A 2VCWA 4V2LA 1SJ6A 3MWHA 1S3DA 1TP9A 2F8FA 4BWQA 4N11A 5LCZA 5CRHA 4OFTA 3H8QA 1ERTA 2AAWA 3KMOA 3M0FA 3UEMA 1X5CA 2GT5A 4GRFA 4WBJA 1T8EB 5H5RA 3ZFBA 4HOJA 1XBSA 1XVQA 4PXOA 2ZUPA 2DJ0A 2R4VA 4WBRD 4KB3A 3IRAA 1ZL9A 4MPFA 2AJQB 5IMZA 5G2ZA 6GSYA 3NZNA 1C72A 3BCIA 2CV4A 1X9MB 2V6OA 1T4ZA 1SYXA 4L8EA 3GKNA 1YDKA 2EIRA 1HNAA 1GL8A 4ZL7A 2DIZA 4PTSA 3HHVA 4EF0A 1PKZA 2LRTA 2A2RA 3HJOA 3IR4A 1AW9A 2UZ8A 3GL3A 4MK3A 2VL3A 3MAKA 1ABAA 5J5NA 3IHQA 1F9MA 2FWEA 3LORA 1A2LA 4ZB6A 1WOUA 2FGXA 2MZCA 4L5OA 5IMVA 2KHPA 3GN3A 2MYGA 2JL4A 4ZBAA 2YJHA 5HR0A 2M46A 4G10A 5GSTA 3KM6A 2H1DA 4NXIA 4MABA 1O6JA 1W89A 1EWXA 2RM6A 2PPTA 1EP7A 1URMA 4ZB8A 4MF6A 3EMPA 1V40A 1E6BA 1S3CA 2DLXA 3TJGA 1PRXA 3SWLA 2B7KA 5F06A 2GQLA 2VD0A 1MDKA 1ST9A 1YEXA 3M1GA 3GL5A 4K6XA 1JZRA 2IIYA 4ML6A 4J56E 3NIVA 2PUKC 4ZBDA 3HVSA 1KTEA 4I97A 4ZL9A 1GSFA 4KF9A 5ECLB 1OE8A 1U88A 3I9V2 4GSNA 2WGRA 1RQMA 3NOFA 4KH7A 1SENA 4CDOA 3KP9A 2VCXA 5EVOA 2P5RA 1T1VA 2V41A 4YH2A 4WEYA 3BD2A 4O32A 2FUG2 1OYJA 1K0BA 3RAZA 2RUEA 4HUAA 2OBKA 3HA9A 1PA3A 2GVPA 2L4QA 3F63A 1ACVA 10GSA 3WYWA 4HJMA 4Z7XA 4DSSA 1SL2B 3DVWA 2BMXA 2B1LA 1NHOA 1V58A 1XW5A 1JLWA 1GSEA 4IELA 1U6TA 5ECOB 2AHEA 4HU7A 4BL7A 3MNGA 2VIMA 1J08A 1X5EA 1DE2A 3WGXA 2N5BA 1SKSB 1TRWA 4HQSA 3EU3A 3TOTA 1F3AA 3GSSA 3L9UA 3TB2A 3IC8A 2HSYA 3D5JA 4I2TA 4IP6A 2PMTA 2JZTA 4IQ1A 2DC5A 3LSZA 2E2GA 3IK9A 3KZQA 4PUAA 3GV1A 5B8AA 1JHBA 3QAWA 1SD8A 3P7XA 3HJPA 4ZB9A 2DJ2A 2HSNB 1OKTA 4LL1B 4V2NA 3A3TA 1NW2A 4P3YB 1M99A 4YQMA 4WF4A 3VURA 3QAVA 4G0KA 5DAKA 2PVQA 2DIYA 1J9BA 5AGYA 17GSA 4G0LA 1DBYA 3D4TA 3GNJA 1JZDA 2OE1A 2KP2A 1ZYEA 4KW6A 2KP1A 2DBCA 4MPGA 1GSSA 3TRPA 1GTIA 1WE0A 2DMLA 2O7KA 4IVFA 1ON4A 3IK7A 5DCGA 2CZ2A 1SU9A 3WD6A 5H5QA 4TXOA 3J7Yk 2HSHA 5ECPB 4KCAA 2CVDA 4AJ6A 1Q98A 2DMMA 4MCUA 2GTUA 2E0QA 3UVHA 3HZ8A 4L0UA 1TJDA 1TK5B 3G7JA 2VL9A 5J41A 4ZBBA 4DSQA 1YF0A 3FY7A 1SD9A 2VM2A 20GSA 5C00A 4IW9A 1MDIA 5B8BA 1VF3A 1K0NA 4RQRA 1GLQA 3HXSA 2IWTA 2R37A 1PL2A 4QL9A 4GTUA 2H6YA 1QQ2A 3L4NA 4POBA 2YN1A 3UL3A 2H66A 3CSIA 2IMFA 3GX0A 3FEUA 2MMAA 1ILOA 1YQ1A 2BJXA 1JZWA 1UVZA 3WGDA 5CYYA 1PX7A 4BVYB 2FNOA 1JLVA 1I9DA 5AIXA 3GIXA 4FYBA 3GA4A 1BJXA 3LQ7A 1GSDA 4V2MA 2HZEB 5FHIA 4POKA 4YQUA 2IJYA 2H19A 3GH9A 2RUFA 5G5FA 2PERA 5HR3A 3BJ5A 5D96A 4XHMA 3ME8A 4XS4B 4WF5A 2HRKB 3P90A 3P8WA 1R4WA 2HLSA 3FR9A 1GH2A 4FIWA 4NMUA 3PGTA 4HU9A 3KMNA 1RW1A 2GSSA 5LNKe 3F8UA 4AJ8A 1W4VA 3IAS2 2RM5A 2M80A 1B9YC 1HYUA 5ECQB 2PVOC 2VCTA 4XRAA 1DUGA 3CXGA 1LBKA 2YZHA 1XOBA 3CYNA 2KUCA 3KD0A 5HR2A 3U6VA 4G19A 4JR4A 1YJ6A 1OC3A 3FZAA 1GP1A 1SK1A 5FWGA 3OR5A 1SK0A 5DCHA 1O81A 3GTUA 2R2JA 4GWRA 3IAM2 4IJ3A 2JSYA 1MTCA 1YEPA 4K1FA 5DALB 5KN0A 2OACA 3ZYWA 2NVLA 4TN8A 1Z6MA 2GZZA 3H4KA 5JCGA 4MLYA 4NPBA 2N5AA 4Q5QA 5IM9A 2K9FA 5F0GA 1TU7A 2B6MA 2LKUA 1T7PB 2YNXA 5IOXA 2ES7A 5ID2B 5DBQA 3VI5A 2YOIA 2GZYA 3LJRA 2L5OA 2LQOA 1M2BA 3VWWA 1OAZA 5ABRA 5J9BA 2AUVA 1TI1A 3FRCA 1PGTA 1YY7A 3CMIA 4KDUA 3ZIJA 4IGJA 2GGTA 3E9JB 4TVEA 3PR8A 1LJRA 3A2XA 2NBSA 4BVXB 5D9WA 5CAXA 5IPHA 1XW9A 2YV7A 2X64A 2PN8A 4V1Ag 4G0IA 1OC9A 2X8CA 2WULA 3ZMKA 3QPMA 4O7HA 1TI3A 1SJZA 1YKAA 3VWUA 1ZCPA 1XPVA 1AUCA 2R6KA 1JZOA 4F9ZA 3VI7A 1EGOA 4HDEA 3GH6A 1WIKA 2LJKA 2VO4A 3UARA 4PNFA 4MZBA 2C1YA 3RBTA 1GWCA 8GSSA 1F37A 3DEXA 4TR1B 5AN1A 4JRRA 5IIZA 3ERGA 1CQHA 2F3MA 3VK9A 3QFAC 4XCSA 2JU5A 3IPZA 2H76A 4EDZA 3DD3A 2I1UA 2H71A 2IL3A 4DVCA 2H1BA 1MD4A 2MBTA 1FOVA 1OC8A 3V1WA 2IMEA 3DVXA 1ZYQB 5JWOB 1HQOA 4OCEA 5D9XA 5HFGA 1FAAA 1O73A 1B4QA 3TKQA 3DMLA 1QGVA 1NHYA 1VF2A 3DKSA 1PKWA 1YKCA 4CHSA 1X0RA 3EC3A 2VCVA 3F0IA 1K0CA 3M8NA 1AAZA 4N10A 2C3QA 2ZCTA 5DVBA 4Q5FA 4EDYA 4MJAA 3D4MA 3QD9A 2FWGA 5C04A 11GSA 3KXOA 1YF1A 2P31A 1SYRA 2QSIA 1ZGNA 4IHUA 4JR6A 1YZXA 2YWNA 4WKWA 18GSA 3D6IA 2LV3A 3A2VA 2GDRA 2C0DA 4ZILA 2HSMB 2BTOT 2VCQA 1WRYA 2QC7A 4I8BA 2H72A 4KDYA 2J23A 4F82A 3O3TA 4F0BA 3GRXA 3C1RA 4QQ7A 3HVXA 4TR0A 5CREA 4GLTA 2H1AA 6GSTA 3UVTA 2YZUA 3GFKA 4TKYA 3LYKA 2CAQA 3PINA 2L59A 2B3SA 1KBNA 2CVKA 2LEGA 3I43A 1T4YA 3KCMA 3WT2A 4J57E 3MDKA 4F0CA 2IMKA 2I9HA 3HJMA 2IFQB 3ZL5A 3WGEA 5ECSA 3DYRA 1B9XC 3ME7A 3DIEA 1M9BA 1M7TA 3TJKA 2XHFA 1QXHA 4KE3A 2ZNMA 5ELAA 2H0HA 1X9SB 4IP1A 4EXJA 4G2EA 4TXVA 5E59A 4ECJA 4N0ZA 3HKRA 2EIOA
chains in the Genus database with same CATH superfamily
1GUMA 1N2AA 2PWJA 3HCZA 3O6TA 1A0FA 3LG6A 4KSMA 3L78A 4KSOA 3RPPA 2WRTA 2LRCA 1PMTA 3LXTA 1TOFA 2IMIA 4V1Ap 1SL1B 1Z7RA 5ECKB 2OBIA 2LSTA 5EPFA 2V32A 3K8NA 2H74A 3GMFA 2AB6A 2O3EA 3QFBC 4MMMA 3TKPA 2H73A 4KNDA 5IQYA 5J9CA 2C3NA 1QUWA 3IDVA 3LWAA 3Q19A 4N0VA 4GDFA 4TOPA 2O87A 4NV2A 1M0UA 22GSA 2CAIA 2HT9A 1LU4A 1PQNA 1XWKA 1EOGA 5DJLA 4K0GA 1BYEA 3UBKA 3ERWA 4FH8A 3Q6OA 1U87A 5EL8A 1BAYA 2G0FA 4XIHA 3IC4A 13GSA 4NHZA 3TRXA 4OD7A 1HD2A 2CA8A 1TXXA 5DQSA 3SBCA 1HNBA 1MD3A 3HD5A 2LQQA 5J3RA 1V57A 4WETA 1M3JA 1O8XA 2K18A 1IYIA 4F2IA 1USBA 5A1NB 3Q18A 2ALBA 2FCHA 1WP0A 2LNSA 2C80A 2R3XA 2WFCA 2C0FA 5JCUA 3QR6A 3TJBA 1TRVA 1NM3A 1FO5A 1SKWB 3CBUA 5CP1A 3M3MA 4GSTA 2HRFA 1ZYNA 5KN2A 4ZXGA 1TU8A 5A5HB 1V9WA 5F8BA 3H93A 1UC7A 4K8MA 1N8JA 4FQUA 4CW9A 4EE0A 2M72A 2H1LA 1THXA 5CNWA 4MH3A 2WW1A 3ZFLA 3FW2A 3BOAA 1BX9A 4I2UA 3TKRA 3GSTA 1ZOFA 3ZZXA 2TRCP 1GNEA 1OVNA 4ZB7A 2C3TA 3EVIA 4E8EA 4ECIA 2XBQA 3MSZA 1I1IP 1Z3EA 3TDGA 3ZTLA 1R5AA 4XTSA 5CRWA 3F4RA 1SL0B 3VPQA 1XXUA 4KA0A 2QKEA 2MMNA 3TUEA 4DSSB 5E4WA 4MF5A 4LL4B 1OKDA 4BL7B 4LA1A 1PFOA 1U3IA 3ED3A 5GZZB 5ECHB 1PD21 3J7Yb 4DSRA 1MDJA 3KTLA 5GSSA 1A0RP 2FY6A 1XWBA 1B4PA 3IOSA 2HE3A 4D73A 4AKIA 3RGBC 2VL2A 2WZSA 5AIVA 1AQXA 1MEKA 2MMOA 2DJ1A 4F03A 4EL1A 16GSA 3EE2A 2R5GA 2XPEA 1R26A 2WJUA 1H4OA 1EGRA 2H0IA 4W66A 1VRSD 4PQHA 1NSWA 4Q5RA 3CRUA 4TRXA 2HZFA 4WR5A 5ELGA 1ERVA 5G31A 3HMJG 3GX8A 1SKRB 2A2PA 4HQZA 2TRXA 4HZ4A 4KDXA 4YAVA 4NV5A 2YCDA 3FKFA 1WPIA 3R2QA 5DAKB 1KNGA 2DJ3A 3R3EA 4XS1A 3ZITA 1WWJA 2WDUA 3H1NA 3C8EA 4IJIA 2CX4A 4OCFA 3EWLA 4OWYA 2VM1A 4MZWA 5IO2A 1FVJA 3KH7A 1U3AA 3F4TA 2K8SA 1GTUA 1Q4JA 3HY2A 2P0GA 5A4VA 5AISA 4XS6A 1GLPA 4TXOB 2CVBA 1FVKA 2C8UA 4BIKA 4PQIA 2JSZA 2H6XA 4NWYA 2O36A 1SVLA 3KP8A 5CRGA 1F2EA 3TOUA 3VPTA 3QOUA 4AJ7A 3EMXA 5ECNB 2VUPA 1XWGA 4HSCX 2I3YA 1HNCA 1Z6NA 1Z5YE 3DRNA 4EIQA 3F9UA 4YQVA 2YJ7A 2X99A 4IQAA 2XPDA 1K0MA 2HFDA 1BEDA 3LGCA 1S3AA 3UMAA 2MBSA 3RFRC 2A4VA 4HI7A 1FHEA 4MF7A 3QCPA 3BCKA 5ECIB 1Y1UA 3KJYA 2O8VB 3KH9A 5CO3A 3ZMLA 4K2DA 2OA7A 2WVXA 3HVNA 4X0XA 3A5IA 2YWIA 5FT3A 2FLSA 1TKDB 1BG5A 2O89A 1V2AA 4ML1A 1EZKA 1XFLA 2L4CA 3TJFA 2X8GA 1R7HA 1YVLA 3UOMA 2CZ3A 1QK8A 3QDNA 3FK8A 5EY6A 4PX1A 1TRUA 5CRDA 5ENUA 2AYTA 3FMWA 3RDWA 2H70A 3GKXA 3F6DA 1OE7A 3F3QA 3EURA 4H86A 2KLXA 4LMVA 2V1MA 5HFKA 4G01A 3DGQA 3A2WA 2QGVA 1Y25A 3FR3A 2FWFA 3HDCA 1GTAA 2H01A 2HRNA 3UBLA 2ON7A 2OKAA 7GSSA 3VWXA 4YKGA 1GRXA 4IN0A 3HVVA 1M9AA 4JBBA 1J0FA 1EP8A 2K8VA 1GSYA 2NTOA 1A2JA 2DKHA 1XOAA 2GQMA 2LJRA 2H8LA 1K3YA 2C4JA 1F3BA 3HZ4A 1F6MC 3GTUB 1VGLA 5COHA 2FA8A 2L6CA 3KEBA 2F8AA 1QFNA 2Z9SA 3LEFA 3QMXA 1O8WA 2DJKA 3N9JA 2E7PA 2CX3A 4BPYA 2FWHA 3APSA 2JZRA 3WT1A 3A5WA 3IV4A 5A5KA 2B5YA 2GSTA 2E2MA 4FO5A 2NDOA 2YP6A 1TRSA 2O85A 2GT6A 1G7EA 3LYPA 1OC9B 5A4WA 3GUSA 5BMUA 3EINA 3ZRDA 2KOKA 2A2SA 2GQKA 4USSA 2VLVA 4NAXA 4RQXA 2WB9A 5IPGA 2WS2A 3ERFA 4GXZA 1A24A 2HSNA 3I6AA 3DXBA 4O5QA 2MMZA 2VAFA 1M2AA 2FD3A 1PX6A 3D0ZA 3QAGA 4GQCA 2FA4A 1M3IA 1TTZA 3W8SA 1R5PA 1GNWA 2WVZA 1THOA 3KTBA 2H6ZA 4KCEA 4X1UA 5G1LA 4IKHA 2XC2A 3F3RA 3M9JA 1DE1A 1ZYPA 1AC1A 1AQVA 1FW1A 1WMJA 5D93A 3W8JA 3P2AA 4JE1A 4OFNA 4HS1A 2VOCA 2FHEA 5JCWA 3CTGA 4RUVA 6GSVA 2LNTA 3DWVA 2V6KA 9GSSA 4KAEA 2VD1A 3C7MA 5B7CA 5IMCA 4FYUA 1QMVA 3C1SA 2GZPA 3BBYA 5J4UA 1O7UA 3VFIA 1GULA 3EU4A 1EEMA 2VL2C 1S4BP 1X5DA 4JEDA 5H5SA 2H30A 4I6XA 1UA5A 4WXTA 4K7IA 2HI7A 3H79A 1G6YA 4K7NA 3PH9A 1T3BA 1ML6A 4Q5NA 4MJCA 3TKSC 1GTBA 5F07A 4JU5A 2OE0A 3UJ1A 2H1GA 4HZ2A 3CTFA 2DKIA 2REMA 4L5LA 2B7JA 2C0GA 3TJJA 3CRTA 2OADA 4KGIA 1VF4A 4EUYA 2IMDA 3MIXA 2JZSA 5GAND 1O85A 5D73A 4ICYA 4WR4A 1Z7PA 5LD0A 5IOWA 4ID0A 1ZZYA 1EEJA 3S9FA 2B5XA 4XRDA 2B1KA 4K9ZA 4HEA2 4JZQA 1DSBA 3L0HA 1VF1A 3CQFA 4RI6A 4MA9A 2V2GA 4EC0A 4BVYA 1UN2A 2LJAA 3TGZA 3FYGA 2WW0A 3HYPA 6GSSA 3EYTA 3O76A 3CHXC 1XVWA 2L6DA 3W6GA 5GAPD 4OO4A 3ZIVA 2HZEA 1A8LA 3TKSE 1AIUA 3KGKA 4EVMA 1FG4A 3TRQA 1N25A 6GSUA 1GSUA 1Z9HA 4G9HA 3APOA 4XS4A 1YEWC 19GSA 1XIYA 2HRKA 3APQA 3U5RE 1SVOA 4BA7A 5L71A 3F4SA 1PL1A 2HRAA 3I69A 2LUSA 4EO3A 4QMKA 5D9VA 4ZIJA 1AQWA 4ZL8A 5ECMB 5IMFA 3Q74A 4FYCA 3RPNA 4RI7A 3MYDA 1E2YA 1A2MA 4KUNA 3LXZA 3ZVJD 1XZOA 3ISOA 3G7YA 4L0WA 4GQFA 3UAPA 3TCOA 1M2DA 2C0EA 4KX4A 2GS3A 3KIJA 4ISDA 3GKKA 5HFIA 5DALA 5B6MA 1B48A 1GSQA 4MDCA 2NPBA 2HXKA 4AF2A 2EC4A 1BF5A 1B8XA 3FZ9A 1K3OA 3GHAA 2YANA 3L9SA 4E68A 1ERUA 4AGSA 1WJKA 2LS5A 2P5QA 2D2ZA 5IMDA 5ID2A 3G7IA 2H75A 1GUKA 2GLRA 5DJMA 2I81A 5HR1A 2EFHA 2DJJA 5KEJA 5IO0A 3ZREA 2ON5A 3E0UA 2JACA 4MH2A 2IPAA 5INYA 4BVXA 1EV9A 4PGTA 1A8YA 2HQTA 2YPMA 4MZCA 4GF0A 2WVYA 1K0OA 1RK4A 2WCIA 2A4HA 2VLUA 3C73A 1TXUA 2PBJA 5D9TA 4HJ2A 2YV9A 1XWAA 2X8HA 4ACSA 2AV4A 2EFEA 3N5OA 1Y6EA 4BWSA 3F6FA 3TKSA 2VLTA 1T00A 3CWGA 3FHKA 1XWCA 2CQ9A 1G7OA 4TR3A 3RHBA 2I4AA 4TR1A 5D8IA 4POLA 2PGTA 2WZ9A 5J40A 5DDLA 4O92A 1CQGA 3JCML 4PQ1A 4OO5A 1TK8B 2OE3A 4IS0A 4MJEA 4K0NA 2RIIA 1ZMAA 3D21A 5KN3A 2TIRA 3GYKA 1SJIA 1ERWA 5G1KA 3L9VA 2PU9C 6GSWA 5JWQB 5ECRB 1G0TA 6GSXA 1JFUA 5F05A 4MJBA 1A23A 2L57A 3IA1A 4TR4A 4GSSA 1FB6A 4I5QA 4LMWA 3CSJA 4OFMA 4ECCA 3UIWA 2YWOA 2N5FA 1SK2A 5A4UA 2EIQA 4ULXA 2F9SA 4GCIA 1FB0A 2GSRA 4NHWA 3IE3A 4PURA 4K7OA 4MP4A 3LFLA 5JWRB 14GSA 5IMAA 3VWVA 1PSQA 1IYHA 2XBIA 5G5EA 2YWMA 1H75A 1X9WB 4ECBA 2G2QA 3VLNA 4O5RA 2H0GA 3FR6A 2K6VA 2B5EA 2LRNA 4Z2TA 5HQPA 1G6WA 1PN0A 4PI2C 4POMA 1EV4A 2VCZA 4DEJA 2OJLA 2HSMA 4QL7A 1XW6A 1TW9A 1PN9A 3PPUA 1XCCA 2F51A 3FZ5A 3IXRA 3RHCA 4EKZA 3ZVJA 4PNGA 5G30A 5BRTA 4J2FA 4D73B 3GURA 2GSQA 3G9BA 2HNLA 3US3A 4A5PA 5DQYA 1AXDA 1V98A 3D22A 4EIPA 4OMVA 4ILFA 4IBPA 4E8HA 1I5GA 1BQ7A 1TK0B 3GKMA 4X43A 2RLIA 4N30A 1KEBA 1K3LA 1EOHA 1TDIA 4TW5A 4PUFC 5KN1A 3M9KA 3AY8A 2L5LA 3CSHA 1K0AA 4PHZC 2IN3A 2J9HA 2QA1A 2HYXA 4YAPA 3ZLPA 5B6NA 2IFQA 3FZ4A 2JADA 5A34A 1K0DA 2LTKA 1GUHA 3IBHA 3E3EA 4LLRA 12GSA 3C71A 2DSAA 2CT6A 1FOHA 2VCWA 4V2LA 1SJ6A 3MWHA 1S3DA 1TP9A 2F8FA 4BWQA 4N11A 5LCZA 5CRHA 4OFTA 3H8QA 1ERTA 2AAWA 3KMOA 3M0FA 3UEMA 1X5CA 2GT5A 4GRFA 5J4YA 4WBJA 1T8EB 5H5RA 3ZFBA 4HOJA 1XBSA 1XVQA 4PXOA 2ZUPA 2DJ0A 2R4VA 4WBRD 4KB3A 3IRAA 1ZL9A 4MPFA 2AJQB 5IMZA 5G2ZA 6GSYA 3NZNA 1C72A 3BCIA 2CV4A 1X9MB 2V6OA 5J47A 1SYXA 1T4ZA 4L8EA 3GKNA 1YDKA 2EIRA 1HNAA 4K5SA 1GL8A 4ZL7A 2DIZA 4PTSA 3HHVA 4EF0A 1PKZA 2LRTA 2A2RA 4AKXB 3HJOA 3IR4A 1AW9A 2UZ8A 3GL3A 4MK3A 2VL3A 3MAKA 1ABAA 5J5NA 3IHQA 1F9MA 2FWEA 3LORA 1A2LA 4ZB6A 1WOUA 2FGXA 2MZCA 4L5OA 4Z2RA 5IMVA 2KHPA 3GN3A 2MYGA 2JL4A 4ZBAA 2YJHA 5HR0A 2M46A 2WVXB 2UV8G 4G10A 5GSTA 3KM6A 2H1DA 2X4AA 4NXIA 4MABA 1O6JA 1W89A 1EWXA 2EFCA 2RM6A 2PPTA 1EP7A 1URMA 4ZB8A 4MF6A 3EMPA 1V40A 1E6BA 1S3CA 2DLXA 5A1NA 3TJGA 2R0PA 1PRXA 3SWLA 2B7KA 5F06A 1BG1A 2GQLA 2VD0A 4N3ZA 1MDKA 1ST9A 2WW3A 1YEXA 3M1GA 3GL5A 4K6XA 1JZRA 2IIYA 4ML6A 4J56E 3NIVA 2PUKC 4ZBDA 3HVSA 1KTEA 4I97A 4ZL9A 5A5HA 1GSFA 4KF9A 5ECLB 1OE8A 1U88A 3I9V2 4GSNA 2WGRA 1RQMA 3NOFA 4KH7A 1SENA 4CDOA 4CY8A 3KP9A 2VCXA 5EVOA 2O5VA 2P5RA 1T1VA 2V41A 4YH2A 4WEYA 3BD2A 4O32A 2FUG2 1OYJA 1K0BA 3RAZA 2RUEA 4HUAA 2OBKA 3HA9A 1PA3A 2GVPA 2L4QA 3LW9A 3F63A 1ACVA 10GSA 3WYWA 4HJMA 4Z7XA 4DSSA 1SL2B 3DVWA 2BMXA 2B1LA 1NHOA 1V58A 1XW5A 1JLWA 1GSEA 4IELA 1U6TA 5ECOB 2AHEA 4HU7A 4BL7A 3MNGA 2VIMA 1J08A 1X5EA 1DE2A 3WGXA 2N5BA 1SKSB 1TRWA 4X4JA 4HQSA 3EU3A 3TOTA 1F3AA 3GSSA 3L9UA 3TB2A 3IC8A 2HSYA 3D5JA 4I2TA 4IP6A 2PMTA 5BMUB 2JZTA 4IQ1A 2DC5A 3LSZA 2E2GA 3IK9A 3KZQA 4PUAA 3GV1A 5B8AA 1JHBA 3QAWA 1SD8A 3P7XA 3HJPA 4ZB9A 2DJ2A 2HSNB 1OKTA 4LL1B 4V2NA 3A3TA 1NW2A 4P3YB 1M99A 4YQMA 4WF4A 3VURA 3QAVA 4G0KA 5DAKA 2PVQA 2DIYA 1J9BA 4K2XA 5AGYA 17GSA 4G0LA 1DBYA 3D4TA 3GNJA 1JZDA 2OE1A 2KP2A 1ZYEA 4KW6A 2KP1A 2DBCA 4MPGA 1GSSA 3TRPA 1GTIA 1WE0A 2DMLA 2O7KA 4IVFA 1ON4A 3IK7A 5DCGA 4CY6A 2CZ2A 1SU9A 4AKGA 3WD6A 5H5QA 4TXOA 3J7Yk 2HSHA 5ECPB 4KCAA 2CVDA 4AJ6A 1Q98A 2DMMA 4MCUA 2GTUA 2E0QA 3UVHA 3HZ8A 4L0UA 1TJDA 1TK5B 3G7JA 2VL9A 5J41A 4ZBBA 4DSQA 1YF0A 3FY7A 1SD9A 2VM2A 20GSA 5C00A 4IW9A 1MDIA 5B8BA 1VF3A 1K0NA 4RQRA 4MNNA 1GLQA 3HXSA 2IWTA 2R37A 1PL2A 2X49A 4QL9A 4AI6A 4GTUA 2H6YA 1QQ2A 3L4NA 4POBA 2YN1A 3UL3A 2H66A 3CSIA 2IMFA 3GX0A 3FEUA 2MMAA 1ILOA 4O5UA 1YQ1A 2BJXA 1JZWA 4K5RA 1UVZA 3WGDA 5CYYA 1PX7A 4BVYB 2FNOA 1JLVA 1I9DA 5AIXA 3GIXA 4FYBA 3GA4A 1BJXA 3LQ7A 1GSDA 4V2MA 2HZEB 5FHIA 4POKA 4YQUA 2IJYA 2H19A 3GH9A 2RUFA 5G5FA 2PERA 5HR3A 3BJ5A 5D96A 4XHMA 3ME8A 4XS4B 4WF5A 2HRKB 3P90A 3P8WA 1R4WA 2HLSA 3FR9A 1GH2A 4FIWA 4NMUA 3PGTA 4HU9A 3KMNA 1RW1A 2GSSA 5LNKe 3F8UA 4AJ8A 1W4VA 3IAS2 2RM5A 4Z2UA 2M80A 1B9YC 1HYUA 5ECQB 2PVOC 2VCTA 4XRAA 1DUGA 3CXGA 1LBKA 2YZHA 1XOBA 3CYNA 2KUCA 3KD0A 5HR2A 3U6VA 4G19A 4JR4A 1YJ6A 1OC3A 3FZAA 1GP1A 1SK1A 5FWGA 3OR5A 1SK0A 5DCHA 1O81A 3GTUA 2R2JA 4GWRA 3IAM2 4IJ3A 2JSYA 1MTCA 1YEPA 4K1FA 5DALB 5KN0A 2OACA 3ZYWA 2NVLA 4TN8A 1Z6MA 2GZZA 3H4KA 5JCGA 4MLYA 4NPBA 2N5AA 4Q5QA 5IM9A 2K9FA 5F0GA 1TU7A 2B6MA 2LKUA 2EFDA 1T7PB 2YNXA 5IOXA 2ES7A 5ID2B 5DBQA 3VI5A 2YOIA 2GZYA 3LJRA 2L5OA 2LQOA 1M2BA 3VWWA 1OAZA 5ABRA 5J9BA 2AUVA 1TI1A 3FRCA 1PGTA 1YY7A 3CMIA 4KDUA 3ZIJA 4IGJA 2GGTA 3E9JB 4TVEA 3PR8A 1LJRA 3A2XA 2NBSA 4YKFA 4BVXB 5D9WA 5CAXA 5IPHA 1XW9A 2YV7A 2X64A 2PN8A 4V1Ag 4G0IA 1OC9A 2X8CA 2WULA 3ZMKA 3QPMA 4O7HA 1TI3A 1SJZA 1YKAA 3VWUA 1ZCPA 1XPVA 1AUCA 2R6KA 1JZOA 4F9ZA 3VI7A 2R0CA 1EGOA 4HDEA 3GH6A 1WIKA 2LJKA 2VO4A 2OT3A 3UARA 4PNFA 4MZBA 2C1YA 3RBTA 1GWCA 8GSSA 1F37A 3DEXA 4TR1B 5AN1A 4JRRA 2R0GA 5IIZA 2VKZG 3ERGA 1CQHA 2F3MA 3VK9A 3QFAC 4XCSA 5KOWA 2JU5A 3IPZA 2H76A 2WW2A 4EDZA 3DD3A 2I1UA 2H71A 2IL3A 4DVCA 2H1BA 1MD4A 2MBTA 1FOVA 1OC8A 3V1WA 2IMEA 3DVXA 1XG8A 1ZYQB 5JWOB 1HQOA 4OCEA 5D9XA 5HFGA 1FAAA 1O73A 1B4QA 3TKQA 3DMLA 1QGVA 1NHYA 1VF2A 1SVMA 3DKSA 1PKWA 1YKCA 4CHSA 1X0RA 3EC3A 2VCVA 3F0IA 1K0CA 3M8NA 1AAZA 4N10A 2C3QA 2ZCTA 5DVBA 4Q5FA 4EDYA 4MJAA 3D4MA 2FWGA 3TU3B 3QD9A 5C04A 11GSA 3KXOA 1YF1A 2P31A 1SYRA 2QSIA 1ZGNA 4IHUA 4FXYP 4JR6A 1YZXA 2YWNA 4WKWA 4AKHA 18GSA 3D6IA 2LV3A 3A2VA 2GDRA 2C0DA 4ZILA 2HSMB 4PI0C 2BTOT 2VCQA 1WRYA 2QC7A 4I8BA 2H72A 4KDYA 2J23A 4F82A 3O3TA 4F0BA 3IHGA 3GRXA 3C1RA 4QQ7A 3HVXA 4TR0A 5CREA 4GLTA 2H1AA 6GSTA 3UVTA 2YZUA 3GFKA 4TKYA 3LYKA 2CAQA 3PINA 2L59A 2B3SA 1KBNA 2CVKA 2LEGA 3I43A 1T4YA 3KCMA 3WT2A 4J57E 3MDKA 4F0CA 2IMKA 2I9HA 3HJMA 2IFQB 3ZL5A 5A34B 5J4VA 3WGEA 5KOXA 5ECSA 3DYRA 1B9XC 3ME7A 3DIEA 1M9BA 1M7TA 3TJKA 2QA2A 2XHFA 1QXHA 4KE3A 2ZNMA 5ELAA 2H0HA 1X9SB 4IP1A 4EXJA 4G2EA 4TXVA 5E59A 4ECJA 4N0ZA 3HKRA 3EPTA 2EIOA 1S3RA
chains in the Genus database with same CATH topology
1GUMA 1N2AA 2PWJA 3HCZA 3O6TA 1A0FA 3LG6A 4KSMA 3L78A 4KSOA 3RPPA 2WRTA 2LRCA 1PMTA 3LXTA 1TOFA 2IMIA 4V1Ap 1SL1B 1Z7RA 5ECKB 2OBIA 2LSTA 5EPFA 2V32A 3K8NA 2H74A 3GMFA 2AB6A 3QFBC 4MMMA 3TKPA 2H73A 4KNDA 5IQYA 5J9CA 2C3NA 1QUWA 3IDVA 3LWAA 3Q19A 4N0VA 4GDFA 4TOPA 2O87A 4NV2A 1M0UA 22GSA 2CAIA 2HT9A 1LU4A 1PQNA 1XWKA 1EOGA 5DJLA 4K0GA 1BYEA 3UBKA 3ERWA 4FH8A 3Q6OA 1U87A 5EL8A 1BAYA 2G0FA 4XIHA 3IC4A 13GSA 4NHZA 3TRXA 4OD7A 1HD2A 2CA8A 1TXXA 5DQSA 3SBCA 1HNBA 1MD3A 3HD5A 2LQQA 5J3RA 1V57A 4WETA 1O8XA 2K18A 1IYIA 4F2IA 1USBA 5A1NB 3Q18A 2ALBA 2FCHA 1WP0A 2LNSA 2C80A 2R3XA 2WFCA 2C0FA 5JCUA 3QR6A 3TJBA 1TRVA 1NM3A 1FO5A 1SKWB 3CBUA 5CP1A 3M3MA 4GSTA 2HRFA 1ZYNA 5KN2A 4ZXGA 1TU8A 5A5HB 1V9WA 5F8BA 3H93A 1UC7A 4K8MA 1N8JA 4FQUA 4CW9A 4EE0A 2M72A 2H1LA 1THXA 5CNWA 4MH3A 3ZFLA 3FW2A 3BOAA 1BX9A 4I2UA 3TKRA 3GSTA 1ZOFA 3ZZXA 2TRCP 1GNEA 1OVNA 4ZB7A 2C3TA 3EVIA 4E8EA 4ECIA 3MSZA 2XBQA 1Z3EA 3TDGA 3ZTLA 1R5AA 4XTSA 5CRWA 3F4RA 1SL0B 3VPQA 1XXUA 4KA0A 2QKEA 2MMNA 3TUEA 4DSSB 5E4WA 4MF5A 4LL4B 1OKDA 4BL7B 4LA1A 1U3IA 3ED3A 5GZZB 5ECHB 1PD21 3J7Yb 4DSRA 1MDJA 3KTLA 5GSSA 1A0RP 2FY6A 1XWBA 1B4PA 3IOSA 2HE3A 4D73A 4AKIA 2VL2A 5AIVA 1AQXA 1MEKA 2MMOA 2DJ1A 4F03A 4EL1A 16GSA 3EE2A 2R5GA 2XPEA 1R26A 2WJUA 1H4OA 1EGRA 2H0IA 4W66A 1VRSD 4PQHA 1NSWA 4Q5RA 3CRUA 4TRXA 2HZFA 4WR5A 5ELGA 1ERVA 5G31A 3HMJG 3GX8A 1SKRB 2A2PA 4HQZA 2TRXA 4HZ4A 4KDXA 4YAVA 4NV5A 2YCDA 3FKFA 1WPIA 3R2QA 5DAKB 1KNGA 2DJ3A 3R3EA 4XS1A 3ZITA 1WWJA 2WDUA 3H1NA 3C8EA 4IJIA 2CX4A 4OCFA 3EWLA 4OWYA 2VM1A 4MZWA 5IO2A 1FVJA 3KH7A 1U3AA 3F4TA 2K8SA 1GTUA 1Q4JA 3HY2A 2P0GA 5A4VA 5AISA 4XS6A 1GLPA 4TXOB 2CVBA 1FVKA 2C8UA 4PQIA 2JSZA 2H6XA 4NWYA 1SVLA 3KP8A 5CRGA 1F2EA 3TOUA 3VPTA 3QOUA 4AJ7A 3EMXA 5ECNB 2VUPA 1XWGA 2I3YA 1HNCA 1Z6NA 1Z5YE 3DRNA 4EIQA 3F9UA 4YQVA 2YJ7A 2X99A 4IQAA 2XPDA 1K0MA 2HFDA 1BEDA 3LGCA 1S3AA 3UMAA 2MBSA 2A4VA 4HI7A 1FHEA 4MF7A 3QCPA 3BCKA 5ECIB 1Y1UA 3KJYA 2O8VB 3KH9A 5CO3A 3ZMLA 4K2DA 2OA7A 4X0XA 3A5IA 2YWIA 5FT3A 2FLSA 1TKDB 1BG5A 2O89A 1V2AA 4ML1A 1EZKA 1XFLA 2L4CA 3TJFA 2X8GA 1R7HA 1YVLA 3UOMA 2CZ3A 1QK8A 3QDNA 3FK8A 5EY6A 4PX1A 1TRUA 5CRDA 5ENUA 2AYTA 3FMWA 3RDWA 2H70A 3GKXA 3F6DA 1OE7A 3F3QA 3EURA 4H86A 2KLXA 4LMVA 2V1MA 5HFKA 4G01A 3DGQA 3A2WA 2QGVA 1Y25A 3FR3A 2FWFA 3HDCA 1GTAA 2H01A 2HRNA 3UBLA 2ON7A 2OKAA 7GSSA 3VWXA 4YKGA 1GRXA 4IN0A 3HVVA 1M9AA 4JBBA 1J0FA 1EP8A 2K8VA 1GSYA 2NTOA 1A2JA 2DKHA 1XOAA 2GQMA 2LJRA 2H8LA 1K3YA 2C4JA 1F3BA 3HZ4A 1F6MC 3GTUB 1VGLA 5COHA 2FA8A 2L6CA 3KEBA 2F8AA 1QFNA 2Z9SA 3LEFA 3QMXA 1O8WA 2DJKA 3N9JA 2E7PA 2CX3A 4BPYA 2FWHA 3APSA 2JZRA 3WT1A 3A5WA 3IV4A 5A5KA 2B5YA 2GSTA 2E2MA 4FO5A 2NDOA 2YP6A 1TRSA 2O85A 2GT6A 1G7EA 3LYPA 1OC9B 5A4WA 3GUSA 5BMUA 3EINA 3ZRDA 2KOKA 2A2SA 2GQKA 4USSA 2VLVA 4NAXA 4RQXA 2WB9A 5IPGA 2WS2A 3ERFA 4GXZA 1A24A 2HSNA 3I6AA 3DXBA 4O5QA 2MMZA 2VAFA 1M2AA 2FD3A 1PX6A 3D0ZA 3QAGA 4GQCA 2FA4A 1TTZA 3W8SA 1R5PA 1GNWA 1THOA 3KTBA 2H6ZA 4KCEA 4X1UA 5G1LA 4IKHA 2XC2A 3F3RA 3M9JA 1DE1A 1ZYPA 1AC1A 1AQVA 1FW1A 1WMJA 5D93A 3W8JA 3P2AA 4JE1A 4OFNA 4HS1A 2VOCA 2FHEA 5JCWA 3CTGA 4RUVA 6GSVA 2LNTA 3DWVA 2V6KA 9GSSA 4KAEA 2VD1A 3C7MA 5B7CA 5IMCA 4FYUA 1QMVA 3C1SA 2GZPA 3BBYA 5J4UA 1O7UA 3VFIA 1GULA 3EU4A 1EEMA 2VL2C 1X5DA 4JEDA 5H5SA 2H30A 4I6XA 1UA5A 4WXTA 4K7IA 2HI7A 3H79A 1G6YA 4K7NA 3PH9A 1T3BA 1ML6A 4Q5NA 4MJCA 3TKSC 1GTBA 5F07A 4JU5A 2OE0A 3UJ1A 2H1GA 4HZ2A 3CTFA 2DKIA 2REMA 4L5LA 2B7JA 2C0GA 3TJJA 3CRTA 2OADA 4KGIA 1VF4A 4EUYA 2IMDA 3MIXA 2JZSA 5GAND 1O85A 5D73A 4ICYA 4WR4A 1Z7PA 5LD0A 5IOWA 4ID0A 1ZZYA 1EEJA 3S9FA 2B5XA 4XRDA 2B1KA 4K9ZA 4HEA2 4JZQA 1DSBA 3L0HA 1VF1A 4RI6A 4MA9A 2V2GA 4EC0A 4BVYA 1UN2A 2LJAA 3TGZA 3FYGA 3HYPA 6GSSA 3EYTA 3O76A 1XVWA 2L6DA 3W6GA 5GAPD 4OO4A 3ZIVA 2HZEA 1A8LA 3TKSE 1AIUA 3KGKA 4EVMA 1FG4A 3TRQA 1N25A 6GSUA 1GSUA 1Z9HA 4G9HA 3APOA 4XS4A 19GSA 1XIYA 2HRKA 3APQA 3U5RE 1SVOA 4BA7A 5L71A 3F4SA 1PL1A 2HRAA 3I69A 2LUSA 4EO3A 4QMKA 5D9VA 4ZIJA 1AQWA 4ZL8A 5ECMB 5IMFA 3Q74A 4FYCA 3RPNA 4RI7A 3MYDA 1E2YA 1A2MA 4KUNA 3LXZA 3ZVJD 1XZOA 3ISOA 3G7YA 4L0WA 4GQFA 3UAPA 3TCOA 1M2DA 2C0EA 4KX4A 2GS3A 3KIJA 4ISDA 3GKKA 5HFIA 5DALA 5B6MA 1B48A 1GSQA 4MDCA 2NPBA 2HXKA 4AF2A 2EC4A 1BF5A 1B8XA 3FZ9A 1K3OA 3GHAA 3L9SA 2YANA 4E68A 1ERUA 4AGSA 1WJKA 2LS5A 2P5QA 2D2ZA 5IMDA 5ID2A 3G7IA 2H75A 1GUKA 2GLRA 5DJMA 2I81A 5HR1A 2EFHA 2DJJA 5KEJA 5IO0A 3ZREA 2ON5A 3E0UA 2JACA 4MH2A 2IPAA 5INYA 4BVXA 1EV9A 4PGTA 1A8YA 2HQTA 2YPMA 4MZCA 4GF0A 1K0OA 1RK4A 2WCIA 2A4HA 2VLUA 3C73A 1TXUA 2PBJA 5D9TA 4HJ2A 2YV9A 1XWAA 2X8HA 4ACSA 2AV4A 2EFEA 3N5OA 1Y6EA 4BWSA 3F6FA 3TKSA 2VLTA 1T00A 3CWGA 3FHKA 1XWCA 2CQ9A 1G7OA 4TR3A 3RHBA 2I4AA 4TR1A 5D8IA 4POLA 2PGTA 2WZ9A 5J40A 5DDLA 4O92A 1CQGA 3JCML 4PQ1A 4OO5A 1TK8B 2OE3A 4IS0A 4MJEA 4K0NA 2RIIA 1ZMAA 3D21A 5KN3A 2TIRA 3GYKA 1SJIA 1ERWA 5G1KA 3L9VA 2PU9C 6GSWA 5JWQB 5ECRB 1G0TA 6GSXA 1JFUA 5F05A 4MJBA 1A23A 2L57A 3IA1A 4TR4A 4GSSA 1FB6A 4I5QA 4LMWA 3CSJA 4OFMA 4ECCA 3UIWA 2YWOA 2N5FA 1SK2A 5A4UA 2EIQA 4ULXA 2F9SA 4GCIA 1FB0A 2GSRA 4NHWA 3IE3A 4PURA 4K7OA 4MP4A 3LFLA 5JWRB 14GSA 5IMAA 3VWVA 1PSQA 1IYHA 2XBIA 5G5EA 2YWMA 1H75A 1X9WB 4ECBA 2G2QA 3VLNA 4O5RA 2H0GA 3FR6A 2K6VA 2B5EA 2LRNA 4Z2TA 5HQPA 1G6WA 1PN0A 4POMA 1EV4A 2VCZA 4DEJA 2OJLA 2HSMA 4QL7A 1XW6A 1TW9A 1PN9A 3PPUA 1XCCA 2F51A 3FZ5A 3IXRA 3RHCA 4EKZA 3ZVJA 4PNGA 5G30A 5BRTA 4J2FA 4D73B 3GURA 2GSQA 3G9BA 2HNLA 3US3A 4A5PA 5DQYA 1AXDA 1V98A 3D22A 4EIPA 4OMVA 4ILFA 4IBPA 4E8HA 1I5GA 1BQ7A 1TK0B 3GKMA 4X43A 2RLIA 4N30A 1KEBA 1K3LA 1EOHA 1TDIA 4TW5A 4PUFC 5KN1A 3M9KA 3AY8A 2L5LA 3CSHA 1K0AA 2IN3A 2J9HA 2QA1A 2HYXA 4YAPA 3ZLPA 5B6NA 2IFQA 3FZ4A 2JADA 5A34A 1K0DA 2LTKA 1GUHA 3IBHA 3E3EA 4LLRA 12GSA 3C71A 2DSAA 2CT6A 1FOHA 2VCWA 4V2LA 1SJ6A 3MWHA 1S3DA 1TP9A 2F8FA 4BWQA 4N11A 5LCZA 5CRHA 4OFTA 3H8QA 1ERTA 2AAWA 3KMOA 3M0FA 3UEMA 1X5CA 2GT5A 4GRFA 5J4YA 4WBJA 1T8EB 5H5RA 3ZFBA 4HOJA 1XBSA 1XVQA 4PXOA 2ZUPA 2DJ0A 2R4VA 4WBRD 4KB3A 3IRAA 1ZL9A 4MPFA 2AJQB 5IMZA 5G2ZA 6GSYA 3NZNA 1C72A 3BCIA 2CV4A 1X9MB 2V6OA 5J47A 1SYXA 1T4ZA 4L8EA 3GKNA 1YDKA 2EIRA 1HNAA 4K5SA 1GL8A 4ZL7A 2DIZA 4PTSA 3HHVA 4EF0A 1PKZA 2LRTA 2A2RA 4AKXB 3HJOA 3IR4A 1AW9A 2UZ8A 3GL3A 4MK3A 2VL3A 3MAKA 1ABAA 5J5NA 3IHQA 1F9MA 2FWEA 3LORA 1A2LA 4ZB6A 1WOUA 2FGXA 2MZCA 4L5OA 4Z2RA 5IMVA 2KHPA 3GN3A 2MYGA 2JL4A 4ZBAA 2YJHA 5HR0A 2M46A 2UV8G 4G10A 5GSTA 3KM6A 2H1DA 2X4AA 4NXIA 4MABA 1O6JA 1W89A 1EWXA 2EFCA 2RM6A 2PPTA 1EP7A 1URMA 4ZB8A 4MF6A 3EMPA 1V40A 1E6BA 1S3CA 2DLXA 5A1NA 3TJGA 2R0PA 1PRXA 3SWLA 2B7KA 5F06A 1BG1A 2GQLA 2VD0A 4N3ZA 1MDKA 1ST9A 1YEXA 3M1GA 3GL5A 4K6XA 1JZRA 2IIYA 4ML6A 4J56E 3NIVA 2PUKC 4ZBDA 3HVSA 1KTEA 4I97A 4ZL9A 5A5HA 1GSFA 4KF9A 5ECLB 1OE8A 1U88A 3I9V2 4GSNA 2WGRA 1RQMA 3NOFA 4KH7A 1SENA 4CDOA 4CY8A 3KP9A 2VCXA 5EVOA 2O5VA 2P5RA 1T1VA 2V41A 4YH2A 4WEYA 3BD2A 4O32A 2FUG2 1OYJA 1K0BA 3RAZA 2RUEA 4HUAA 2OBKA 3HA9A 1PA3A 2GVPA 2L4QA 3LW9A 3F63A 1ACVA 10GSA 3WYWA 4HJMA 4Z7XA 4DSSA 1SL2B 3DVWA 2BMXA 2B1LA 1NHOA 1V58A 1XW5A 1JLWA 1GSEA 4IELA 1U6TA 5ECOB 2AHEA 4HU7A 4BL7A 3MNGA 2VIMA 1J08A 1X5EA 1DE2A 3WGXA 2N5BA 1SKSB 1TRWA 4X4JA 4HQSA 3EU3A 3TOTA 1F3AA 3GSSA 3L9UA 3TB2A 3IC8A 2HSYA 3D5JA 4I2TA 4IP6A 2PMTA 5BMUB 2JZTA 4IQ1A 2DC5A 3LSZA 2E2GA 3IK9A 3KZQA 4PUAA 3GV1A 5B8AA 1JHBA 3QAWA 1SD8A 3P7XA 3HJPA 4ZB9A 2DJ2A 2HSNB 1OKTA 4LL1B 4V2NA 3A3TA 1NW2A 4P3YB 1M99A 4YQMA 4WF4A 3VURA 3QAVA 4G0KA 5DAKA 2PVQA 2DIYA 1J9BA 4K2XA 5AGYA 17GSA 4G0LA 1DBYA 3D4TA 3GNJA 1JZDA 2OE1A 2KP2A 1ZYEA 4KW6A 2KP1A 2DBCA 4MPGA 1GSSA 3TRPA 1GTIA 1WE0A 2DMLA 2O7KA 4IVFA 1ON4A 3IK7A 5DCGA 4CY6A 2CZ2A 1SU9A 4AKGA 3WD6A 5H5QA 4TXOA 3J7Yk 2HSHA 5ECPB 4KCAA 2CVDA 4AJ6A 1Q98A 2DMMA 4MCUA 2GTUA 2E0QA 3UVHA 3HZ8A 4L0UA 1TJDA 1TK5B 3G7JA 2VL9A 5J41A 4ZBBA 4DSQA 1YF0A 3FY7A 1SD9A 2VM2A 20GSA 5C00A 4IW9A 1MDIA 5B8BA 1VF3A 1K0NA 4RQRA 4MNNA 1GLQA 3HXSA 2IWTA 2R37A 1PL2A 2X49A 4QL9A 4AI6A 4GTUA 2H6YA 1QQ2A 3L4NA 4POBA 2YN1A 3UL3A 2H66A 3CSIA 2IMFA 3GX0A 3FEUA 2MMAA 1ILOA 4O5UA 1YQ1A 2BJXA 1JZWA 4K5RA 1UVZA 3WGDA 5CYYA 1PX7A 4BVYB 2FNOA 1JLVA 1I9DA 5AIXA 3GIXA 4FYBA 3GA4A 1BJXA 3LQ7A 1GSDA 4V2MA 2HZEB 5FHIA 4POKA 4YQUA 2IJYA 2H19A 3GH9A 2RUFA 5G5FA 2PERA 5HR3A 3BJ5A 5D96A 4XHMA 3ME8A 4XS4B 4WF5A 2HRKB 3P90A 3P8WA 1R4WA 2HLSA 3FR9A 1GH2A 4FIWA 4NMUA 3PGTA 4HU9A 3KMNA 1RW1A 2GSSA 5LNKe 3F8UA 4AJ8A 1W4VA 3IAS2 2RM5A 4Z2UA 2M80A 1B9YC 1HYUA 5ECQB 2PVOC 2VCTA 4XRAA 1DUGA 3CXGA 1LBKA 2YZHA 1XOBA 3CYNA 2KUCA 3KD0A 5HR2A 3U6VA 4G19A 4JR4A 1YJ6A 1OC3A 3FZAA 1GP1A 1SK1A 5FWGA 3OR5A 1SK0A 5DCHA 1O81A 3GTUA 2R2JA 4GWRA 3IAM2 4IJ3A 2JSYA 1MTCA 1YEPA 4K1FA 5DALB 5KN0A 2OACA 3ZYWA 2NVLA 4TN8A 1Z6MA 2GZZA 3H4KA 5JCGA 4MLYA 4NPBA 2N5AA 4Q5QA 5IM9A 2K9FA 5F0GA 1TU7A 2B6MA 2LKUA 2EFDA 1T7PB 2YNXA 5IOXA 2ES7A 5ID2B 5DBQA 3VI5A 2YOIA 2GZYA 3LJRA 2L5OA 2LQOA 1M2BA 3VWWA 1OAZA 5ABRA 5J9BA 2AUVA 1TI1A 3FRCA 1PGTA 1YY7A 3CMIA 4KDUA 3ZIJA 4IGJA 2GGTA 3E9JB 4TVEA 3PR8A 1LJRA 3A2XA 2NBSA 4YKFA 4BVXB 5D9WA 5CAXA 5IPHA 1XW9A 2YV7A 2X64A 2PN8A 4V1Ag 4G0IA 1OC9A 2X8CA 2WULA 3ZMKA 3QPMA 4O7HA 1TI3A 1SJZA 1YKAA 3VWUA 1ZCPA 1XPVA 1AUCA 2R6KA 1JZOA 4F9ZA 3VI7A 2R0CA 1EGOA 4HDEA 3GH6A 1WIKA 2LJKA 2VO4A 2OT3A 3UARA 4PNFA 4MZBA 2C1YA 3RBTA 1GWCA 8GSSA 1F37A 3DEXA 4TR1B 5AN1A 4JRRA 2R0GA 5IIZA 2VKZG 3ERGA 1CQHA 2F3MA 3VK9A 3QFAC 4XCSA 5KOWA 2JU5A 3IPZA 2H76A 4EDZA 3DD3A 2I1UA 2H71A 2IL3A 4DVCA 2H1BA 1MD4A 2MBTA 1FOVA 1OC8A 3V1WA 2IMEA 3DVXA 1ZYQB 5JWOB 1HQOA 4OCEA 5D9XA 5HFGA 1FAAA 1O73A 1B4QA 3TKQA 3DMLA 1QGVA 1NHYA 1VF2A 1SVMA 3DKSA 1PKWA 1YKCA 4CHSA 1X0RA 3EC3A 2VCVA 3F0IA 1K0CA 3M8NA 1AAZA 4N10A 2C3QA 2ZCTA 5DVBA 4Q5FA 4EDYA 4MJAA 3D4MA 2FWGA 3TU3B 3QD9A 5C04A 11GSA 3KXOA 1YF1A 2P31A 1SYRA 2QSIA 1ZGNA 4IHUA 4JR6A 1YZXA 2YWNA 4WKWA 4AKHA 18GSA 3D6IA 2LV3A 3A2VA 2GDRA 2C0DA 4ZILA 2HSMB 2BTOT 2VCQA 1WRYA 2QC7A 4I8BA 2H72A 4KDYA 2J23A 4F82A 3O3TA 4F0BA 3IHGA 3GRXA 3C1RA 4QQ7A 3HVXA 4TR0A 5CREA 4GLTA 2H1AA 6GSTA 3UVTA 2YZUA 3GFKA 4TKYA 3LYKA 2CAQA 3PINA 2L59A 2B3SA 1KBNA 2CVKA 2LEGA 3I43A 1T4YA 3KCMA 3WT2A 4J57E 3MDKA 4F0CA 2IMKA 2I9HA 3HJMA 2IFQB 3ZL5A 5A34B 5J4VA 3WGEA 5KOXA 5ECSA 3DYRA 1B9XC 3ME7A 3DIEA 1M9BA 1M7TA 3TJKA 2QA2A 2XHFA 1QXHA 4KE3A 2ZNMA 5ELAA 2H0HA 1X9SB 4IP1A 4EXJA 4G2EA 4TXVA 5E59A 4ECJA 4N0ZA 3HKRA 3EPTA 2EIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUM A;  1N2A A;  2PWJ A;  3HCZ A;  3O6T A;  1A0F A;  3LG6 A;  4KSM A;  3L78 A;  4KSO A;  3RPP A;  2WRT A;  2LRC A;  1PMT A;  3LXT A;  1TOF A;  2IMI A;  4V1A p;  1SL1 B;  1Z7R A;  5ECK B;  2OBI A;  2LST A;  5EPF A;  2V32 A;  3K8N A;  2H74 A;  3GMF A;  2AB6 A;  3QFB C;  4MMM A;  3TKP A;  2H73 A;  4KND A;  5IQY A;  5J9C A;  2C3N A;  1QUW A;  3IDV A;  3LWA A;  3Q19 A;  4N0V A;  4TOP A;  2O87 A;  4NV2 A;  1M0U A;  22GS A;  2CAI A;  2HT9 A;  1LU4 A;  1PQN A;  1XWK A;  1EOG A;  5DJL A;  4K0G A;  1BYE A;  3UBK A;  3ERW A;  4FH8 A;  3Q6O A;  1U87 A;  5EL8 A;  1BAY A;  2G0F A;  4XIH A;  3IC4 A;  13GS A;  4NHZ A;  3TRX A;  4OD7 A;  1HD2 A;  2CA8 A;  1TXX A;  5DQS A;  3SBC A;  1HNB A;  1MD3 A;  3HD5 A;  2LQQ A;  5J3R A;  1V57 A;  4WET A;  1O8X A;  2K18 A;  1IYI A;  4F2I A;  1USB A;  3Q18 A;  2ALB A;  2FCH A;  1WP0 A;  2LNS A;  2C80 A;  2R3X A;  2WFC A;  2C0F A;  5JCU A;  3QR6 A;  3TJB A;  1TRV A;  1NM3 A;  1FO5 A;  1SKW B;  3CBU A;  5CP1 A;  3M3M A;  4GST A;  2HRF A;  5KN2 A;  4ZXG A;  1TU8 A;  1V9W A;  5F8B A;  3H93 A;  1UC7 A;  4K8M A;  1N8J A;  4FQU A;  4CW9 A;  4EE0 A;  2M72 A;  1THX A;  5CNW A;  4MH3 A;  3ZFL A;  3FW2 A;  3BOA A;  1BX9 A;  4I2U A;  3TKR A;  3GST A;  1ZOF A;  3ZZX A;  2TRC P;  1GNE A;  1OVN A;  2C3T A;  3EVI A;  4E8E A;  4ECI A;  2XBQ A;  3MSZ A;  1Z3E A;  3TDG A;  3ZTL A;  1R5A A;  4XTS A;  5CRW A;  3F4R A;  1SL0 B;  3VPQ A;  1XXU A;  4KA0 A;  2QKE A;  2MMN A;  3TUE A;  4DSS B;  5E4W A;  4MF5 A;  4LL4 B;  1OKD A;  4BL7 B;  4LA1 A;  1U3I A;  3ED3 A;  5GZZ B;  5ECH B;  1PD2 1;  3J7Y b;  4DSR A;  1MDJ A;  3KTL A;  5GSS A;  1A0R P;  2FY6 A;  1XWB A;  1B4P A;  3IOS A;  2HE3 A;  4D73 A;  2VL2 A;  5AIV A;  1AQX A;  1MEK A;  2MMO A;  2DJ1 A;  4F03 A;  4EL1 A;  16GS A;  3EE2 A;  2R5G A;  2XPE A;  1R26 A;  2WJU A;  1H4O A;  1EGR A;  2H0I A;  1VRS D;  4PQH A;  1NSW A;  4Q5R A;  3CRU A;  4TRX A;  2HZF A;  4WR5 A;  5ELG A;  1ERV A;  5G31 A;  3GX8 A;  1SKR B;  4HQZ A;  2TRX A;  4HZ4 A;  4KDX A;  4YAV A;  4NV5 A;  2YCD A;  3FKF A;  1WPI A;  3R2Q A;  5DAK B;  1KNG A;  2DJ3 A;  3R3E A;  4XS1 A;  3ZIT A;  1WWJ A;  2WDU A;  3H1N A;  3C8E A;  4IJI A;  2CX4 A;  4OCF A;  3EWL A;  4OWY A;  2VM1 A;  4MZW A;  5IO2 A;  1FVJ A;  3KH7 A;  1U3A A;  3F4T A;  2K8S A;  1GTU A;  1Q4J A;  3HY2 A;  2P0G A;  5A4V A;  5AIS A;  4XS6 A;  1GLP A;  4TXO B;  2CVB A;  1FVK A;  2C8U A;  4PQI A;  2JSZ A;  2H6X A;  4NWY A;  3KP8 A;  5CRG A;  1F2E A;  3TOU A;  3VPT A;  3QOU A;  4AJ7 A;  3EMX A;  5ECN B;  2VUP A;  1XWG A;  2I3Y A;  1HNC A;  1Z6N A;  1Z5Y E;  3DRN A;  3F9U A;  4YQV A;  2YJ7 A;  2X99 A;  4IQA A;  2XPD A;  1K0M A;  2HFD A;  1BED A;  3LGC A;  1S3A A;  3UMA A;  2MBS A;  2A4V A;  4HI7 A;  1FHE A;  4MF7 A;  3QCP A;  3BCK A;  5ECI B;  3KJY A;  2O8V B;  3KH9 A;  5CO3 A;  3ZML A;  4K2D A;  2OA7 A;  4X0X A;  2YWI A;  5FT3 A;  2FLS A;  1TKD B;  1BG5 A;  2O89 A;  1V2A A;  4ML1 A;  1EZK A;  1XFL A;  2L4C A;  3TJF A;  2X8G A;  1R7H A;  3UOM A;  2CZ3 A;  1QK8 A;  3QDN A;  3FK8 A;  5EY6 A;  4PX1 A;  1TRU A;  5CRD A;  5ENU A;  2AYT A;  3RDW A;  2H70 A;  3GKX A;  3F6D A;  1OE7 A;  3F3Q A;  3EUR A;  4H86 A;  2KLX A;  4LMV A;  2V1M A;  5HFK A;  3DGQ A;  3A2W A;  2QGV A;  1Y25 A;  3FR3 A;  2FWF A;  3HDC A;  1GTA A;  2H01 A;  2HRN A;  3UBL A;  2ON7 A;  2OKA A;  7GSS A;  3VWX A;  1GRX A;  4IN0 A;  3HVV A;  1M9A A;  4JBB A;  1J0F A;  1EP8 A;  2K8V A;  1GSY A;  2NTO A;  1A2J A;  1XOA A;  2GQM A;  2LJR A;  2H8L A;  1K3Y A;  2C4J A;  1F3B A;  3HZ4 A;  1F6M C;  3GTU B;  1VGL A;  5COH A;  2FA8 A;  2L6C A;  3KEB A;  2F8A A;  1QFN A;  2Z9S A;  3LEF A;  3QMX A;  1O8W A;  2DJK A;  3N9J A;  2E7P A;  2CX3 A;  4BPY A;  2FWH A;  3APS A;  2JZR A;  3WT1 A;  3A5W A;  3IV4 A;  5A5K A;  2B5Y A;  2GST A;  2E2M A;  4FO5 A;  2NDO A;  2YP6 A;  1TRS A;  2O85 A;  2GT6 A;  1G7E A;  3LYP A;  1OC9 B;  5A4W A;  3GUS A;  5BMU A;  3EIN A;  3ZRD A;  2KOK A;  2A2S A;  2GQK A;  4USS A;  2VLV A;  4NAX A;  4RQX A;  2WB9 A;  5IPG A;  2WS2 A;  3ERF A;  4GXZ A;  1A24 A;  3I6A A;  3DXB A;  2MMZ A;  2VAF A;  1M2A A;  2FD3 A;  1PX6 A;  3D0Z A;  3QAG A;  4GQC A;  2FA4 A;  1TTZ A;  3W8S A;  1R5P A;  1GNW A;  1THO A;  3KTB A;  2H6Z A;  4KCE A;  4X1U A;  5G1L A;  4IKH A;  2XC2 A;  3F3R A;  3M9J A;  1DE1 A;  1AC1 A;  1AQV A;  1FW1 A;  1WMJ A;  5D93 A;  3W8J A;  3P2A A;  4JE1 A;  4OFN A;  4HS1 A;  2VOC A;  2FHE A;  5JCW A;  3CTG A;  4RUV A;  6GSV A;  2LNT A;  3DWV A;  2V6K A;  9GSS A;  4KAE A;  2VD1 A;  3C7M A;  5B7C A;  5IMC A;  4FYU A;  1QMV A;  3C1S A;  2GZP A;  3BBY A;  5J4U A;  1O7U A;  3VFI A;  1GUL A;  3EU4 A;  1EEM A;  2VL2 C;  1X5D A;  4JED A;  5H5S A;  2H30 A;  4I6X A;  1UA5 A;  4WXT A;  4K7I A;  2HI7 A;  3H79 A;  1G6Y A;  4K7N A;  3PH9 A;  1T3B A;  1ML6 A;  4Q5N A;  4MJC A;  3TKS C;  1GTB A;  5F07 A;  4JU5 A;  2OE0 A;  3UJ1 A;  2H1G A;  4HZ2 A;  3CTF A;  2REM A;  4L5L A;  2B7J A;  2C0G A;  3TJJ A;  3CRT A;  2OAD A;  4KGI A;  1VF4 A;  4EUY A;  2IMD A;  2JZS A;  5GAN D;  1O85 A;  5D73 A;  4WR4 A;  1Z7P A;  5LD0 A;  5IOW A;  4ID0 A;  1ZZY A;  1EEJ A;  3S9F A;  2B5X A;  4XRD A;  2B1K A;  4K9Z A;  4HEA 2;  4JZQ A;  1DSB A;  3L0H A;  1VF1 A;  4RI6 A;  4MA9 A;  2V2G A;  4EC0 A;  4BVY A;  1UN2 A;  2LJA A;  3TGZ A;  3FYG A;  3HYP A;  6GSS A;  3EYT A;  3O76 A;  1XVW A;  2L6D A;  3W6G A;  5GAP D;  4OO4 A;  3ZIV A;  2HZE A;  1A8L A;  3TKS E;  1AIU A;  3KGK A;  4EVM A;  1FG4 A;  3TRQ A;  6GSU A;  1GSU A;  1Z9H A;  4G9H A;  3APO A;  4XS4 A;  19GS A;  1XIY A;  2HRK A;  3APQ A;  3U5R E;  4BA7 A;  5L71 A;  3F4S A;  1PL1 A;  2HRA A;  3I69 A;  2LUS A;  4EO3 A;  5D9V A;  4ZIJ A;  1AQW A;  4ZL8 A;  5ECM B;  5IMF A;  3Q74 A;  4FYC A;  3RPN A;  4RI7 A;  1E2Y A;  1A2M A;  4KUN A;  3LXZ A;  3ZVJ D;  1XZO A;  3ISO A;  3G7Y A;  4L0W A;  4GQF A;  3UAP A;  3TCO A;  1M2D A;  2C0E A;  4KX4 A;  2GS3 A;  3KIJ A;  4ISD A;  3GKK A;  5HFI A;  5DAL A;  5B6M A;  1B48 A;  1GSQ A;  4MDC A;  2NPB A;  2HXK A;  4AF2 A;  2EC4 A;  1B8X A;  3FZ9 A;  1K3O A;  3GHA A;  3L9S A;  2YAN A;  1ERU A;  4AGS A;  1WJK A;  2LS5 A;  2P5Q A;  2D2Z A;  5IMD A;  5ID2 A;  3G7I A;  2H75 A;  1GUK A;  2GLR A;  5DJM A;  2I81 A;  5HR1 A;  2DJJ A;  5KEJ A;  5IO0 A;  3ZRE A;  2ON5 A;  3E0U A;  2JAC A;  4MH2 A;  2IPA A;  5INY A;  4BVX A;  1EV9 A;  4PGT A;  1A8Y A;  2HQT A;  2YPM A;  4MZC A;  4GF0 A;  1K0O A;  1RK4 A;  2WCI A;  2VLU A;  3C73 A;  2PBJ A;  5D9T A;  4HJ2 A;  2YV9 A;  1XWA A;  2X8H A;  4ACS A;  2AV4 A;  3N5O A;  1Y6E A;  4BWS A;  3F6F A;  3TKS A;  2VLT A;  1T00 A;  3FHK A;  1XWC A;  2CQ9 A;  1G7O A;  4TR3 A;  3RHB A;  2I4A A;  4TR1 A;  5D8I A;  4POL A;  2PGT A;  2WZ9 A;  5DDL A;  4O92 A;  1CQG A;  3JCM L;  4PQ1 A;  4OO5 A;  1TK8 B;  2OE3 A;  4IS0 A;  4MJE A;  4K0N A;  2RII A;  1ZMA A;  3D21 A;  5KN3 A;  2TIR A;  3GYK A;  1SJI A;  1ERW A;  5G1K A;  3L9V A;  2PU9 C;  6GSW A;  5JWQ B;  5ECR B;  1G0T A;  6GSX A;  1JFU A;  5F05 A;  4MJB A;  1A23 A;  2L57 A;  3IA1 A;  4TR4 A;  4GSS A;  1FB6 A;  4I5Q A;  4LMW A;  3CSJ A;  4OFM A;  4ECC A;  3UIW A;  2YWO A;  2N5F A;  1SK2 A;  5A4U A;  2EIQ A;  4ULX A;  2F9S A;  4GCI A;  1FB0 A;  2GSR A;  4NHW A;  3IE3 A;  4PUR A;  4K7O A;  4MP4 A;  3LFL A;  5JWR B;  14GS A;  5IMA A;  3VWV A;  1PSQ A;  1IYH A;  2XBI A;  5G5E A;  2YWM A;  1H75 A;  1X9W B;  4ECB A;  2G2Q A;  3VLN A;  4O5R A;  2H0G A;  3FR6 A;  2K6V A;  2B5E A;  2LRN A;  5HQP A;  1G6W A;  4POM A;  1EV4 A;  2VCZ A;  4DEJ A;  2OJL A;  2HSM A;  4QL7 A;  1XW6 A;  1TW9 A;  1PN9 A;  3PPU A;  1XCC A;  2F51 A;  3FZ5 A;  3IXR A;  3RHC A;  4EKZ A;  3ZVJ A;  4PNG A;  5G30 A;  4J2F A;  4D73 B;  3GUR A;  2GSQ A;  3G9B A;  2HNL A;  3US3 A;  5DQY A;  1AXD A;  1V98 A;  3D22 A;  4OMV A;  4ILF A;  4IBP A;  4E8H A;  1I5G A;  1BQ7 A;  1TK0 B;  3GKM A;  4X43 A;  2RLI A;  4N30 A;  1KEB A;  1K3L A;  1EOH A;  1TDI A;  4TW5 A;  4PUF C;  5KN1 A;  3M9K A;  3AY8 A;  2L5L A;  3CSH A;  1K0A A;  2IN3 A;  2J9H A;  2HYX A;  4YAP A;  3ZLP A;  5B6N A;  2IFQ A;  3FZ4 A;  2JAD A;  1K0D A;  2LTK A;  1GUH A;  3IBH A;  3E3E A;  4LLR A;  12GS A;  3C71 A;  2DSA A;  2CT6 A;  2VCW A;  4V2L A;  1SJ6 A;  3MWH A;  1S3D A;  1TP9 A;  2F8F A;  4BWQ A;  4N11 A;  5LCZ A;  5CRH A;  4OFT A;  3H8Q A;  1ERT A;  2AAW A;  3KMO A;  3M0F A;  3UEM A;  1X5C A;  2GT5 A;  4GRF A;  4WBJ A;  1T8E B;  5H5R A;  3ZFB A;  4HOJ A;  1XBS A;  1XVQ A;  4PXO A;  2ZUP A;  2DJ0 A;  2R4V A;  4WBR D;  4KB3 A;  3IRA A;  1ZL9 A;  4MPF A;  2AJQ B;  5IMZ A;  5G2Z A;  6GSY A;  3NZN A;  1C72 A;  3BCI A;  2CV4 A;  1X9M B;  2V6O A;  1T4Z A;  1SYX A;  4L8E A;  3GKN A;  1YDK A;  2EIR A;  1HNA A;  1GL8 A;  4ZL7 A;  2DIZ A;  4PTS A;  3HHV A;  4EF0 A;  1PKZ A;  2LRT A;  2A2R A;  3HJO A;  3IR4 A;  1AW9 A;  2UZ8 A;  3GL3 A;  4MK3 A;  2VL3 A;  3MAK A;  1ABA A;  5J5N A;  3IHQ A;  1F9M A;  2FWE A;  3LOR A;  1A2L A;  4ZB6 A;  1WOU A;  2FGX A;  2MZC A;  4L5O A;  5IMV A;  2KHP A;  3GN3 A;  2MYG A;  2JL4 A;  4ZBA A;  2YJH A;  5HR0 A;  2M46 A;  4G10 A;  5GST A;  3KM6 A;  2H1D A;  4NXI A;  4MAB A;  1O6J A;  1W89 A;  1EWX A;  2RM6 A;  2PPT A;  1EP7 A;  1URM A;  4ZB8 A;  4MF6 A;  3EMP A;  1V40 A;  1E6B A;  1S3C A;  2DLX A;  3TJG A;  1PRX A;  3SWL A;  2B7K A;  5F06 A;  2GQL A;  2VD0 A;  1MDK A;  1ST9 A;  1YEX A;  3M1G A;  3GL5 A;  4K6X A;  1JZR A;  2IIY A;  4ML6 A;  4J56 E;  3NIV A;  2PUK C;  4ZBD A;  3HVS A;  1KTE A;  4I97 A;  4ZL9 A;  1GSF A;  4KF9 A;  5ECL B;  1OE8 A;  1U88 A;  3I9V 2;  4GSN A;  2WGR A;  1RQM A;  3NOF A;  4KH7 A;  1SEN A;  4CDO A;  3KP9 A;  2VCX A;  5EVO A;  2P5R A;  1T1V A;  2V41 A;  4YH2 A;  4WEY A;  3BD2 A;  4O32 A;  2FUG 2;  1OYJ A;  1K0B A;  3RAZ A;  2RUE A;  4HUA A;  2OBK A;  3HA9 A;  1PA3 A;  2GVP A;  2L4Q A;  3F63 A;  1ACV A;  10GS A;  3WYW A;  4HJM A;  4Z7X A;  4DSS A;  1SL2 B;  3DVW A;  2BMX A;  2B1L A;  1NHO A;  1V58 A;  1XW5 A;  1JLW A;  1GSE A;  4IEL A;  1U6T A;  5ECO B;  2AHE A;  4HU7 A;  4BL7 A;  3MNG A;  2VIM A;  1J08 A;  1X5E A;  1DE2 A;  3WGX A;  2N5B A;  1SKS B;  1TRW A;  4HQS A;  3EU3 A;  3TOT A;  1F3A A;  3GSS A;  3L9U A;  3TB2 A;  3IC8 A;  2HSY A;  3D5J A;  4I2T A;  4IP6 A;  2PMT A;  2JZT A;  4IQ1 A;  2DC5 A;  3LSZ A;  2E2G A;  3IK9 A;  3KZQ A;  4PUA A;  3GV1 A;  5B8A A;  1JHB A;  3QAW A;  1SD8 A;  3P7X A;  3HJP A;  4ZB9 A;  2DJ2 A;  2HSN B;  1OKT A;  4LL1 B;  4V2N A;  3A3T A;  1NW2 A;  4P3Y B;  1M99 A;  4YQM A;  4WF4 A;  3VUR A;  3QAV A;  4G0K A;  5DAK A;  2PVQ A;  2DIY A;  1J9B A;  5AGY A;  17GS A;  4G0L A;  1DBY A;  3D4T A;  3GNJ A;  1JZD A;  2OE1 A;  2KP2 A;  1ZYE A;  4KW6 A;  2KP1 A;  2DBC A;  4MPG A;  1GSS A;  3TRP A;  1GTI A;  1WE0 A;  2DML A;  2O7K A;  4IVF A;  1ON4 A;  3IK7 A;  5DCG A;  2CZ2 A;  1SU9 A;  3WD6 A;  5H5Q A;  4TXO A;  3J7Y k;  2HSH A;  5ECP B;  4KCA A;  2CVD A;  4AJ6 A;  1Q98 A;  2DMM A;  4MCU A;  2GTU A;  2E0Q A;  3UVH A;  3HZ8 A;  4L0U A;  1TJD A;  1TK5 B;  3G7J A;  2VL9 A;  5J41 A;  4ZBB A;  4DSQ A;  1YF0 A;  3FY7 A;  1SD9 A;  2VM2 A;  20GS A;  5C00 A;  4IW9 A;  1MDI A;  5B8B A;  1VF3 A;  1K0N A;  4RQR A;  1GLQ A;  3HXS A;  2IWT A;  2R37 A;  1PL2 A;  4QL9 A;  4GTU A;  2H6Y A;  1QQ2 A;  3L4N A;  4POB A;  2YN1 A;  3UL3 A;  2H66 A;  3CSI A;  2IMF A;  3GX0 A;  3FEU A;  2MMA A;  1ILO A;  1YQ1 A;  2BJX A;  1JZW A;  1UVZ A;  3WGD A;  5CYY A;  1PX7 A;  4BVY B;  2FNO A;  1JLV A;  1I9D A;  5AIX A;  3GIX A;  4FYB A;  3GA4 A;  1BJX A;  3LQ7 A;  1GSD A;  4V2M A;  2HZE B;  5FHI A;  4POK A;  4YQU A;  2IJY A;  2H19 A;  3GH9 A;  2RUF A;  5G5F A;  2PER A;  5HR3 A;  3BJ5 A;  5D96 A;  4XHM A;  3ME8 A;  4XS4 B;  4WF5 A;  2HRK B;  3P90 A;  3P8W A;  1R4W A;  2HLS A;  3FR9 A;  1GH2 A;  4FIW A;  4NMU A;  3PGT A;  4HU9 A;  3KMN A;  1RW1 A;  2GSS A;  5LNK e;  3F8U A;  4AJ8 A;  1W4V A;  3IAS 2;  2RM5 A;  2M80 A;  1B9Y C;  1HYU A;  5ECQ B;  2PVO C;  2VCT A;  4XRA A;  1DUG A;  3CXG A;  1LBK A;  2YZH A;  1XOB A;  3CYN A;  2KUC A;  3KD0 A;  5HR2 A;  3U6V A;  4G19 A;  4JR4 A;  1YJ6 A;  1OC3 A;  3FZA A;  1GP1 A;  1SK1 A;  5FWG A;  3OR5 A;  1SK0 A;  5DCH A;  1O81 A;  3GTU A;  2R2J A;  4GWR A;  3IAM 2;  4IJ3 A;  2JSY A;  1MTC A;  1YEP A;  4K1F A;  5DAL B;  5KN0 A;  2OAC A;  3ZYW A;  2NVL A;  4TN8 A;  1Z6M A;  2GZZ A;  3H4K A;  5JCG A;  4MLY A;  4NPB A;  2N5A A;  4Q5Q A;  5IM9 A;  2K9F A;  5F0G A;  1TU7 A;  2B6M A;  2LKU A;  1T7P B;  2YNX A;  5IOX A;  2ES7 A;  5ID2 B;  5DBQ A;  3VI5 A;  2YOI A;  2GZY A;  3LJR A;  2L5O A;  2LQO A;  1M2B A;  3VWW A;  1OAZ A;  5ABR A;  5J9B A;  2AUV A;  1TI1 A;  3FRC A;  1PGT A;  1YY7 A;  3CMI A;  4KDU A;  3ZIJ A;  4IGJ A;  2GGT A;  3E9J B;  4TVE A;  3PR8 A;  1LJR A;  3A2X A;  2NBS A;  4BVX B;  5D9W A;  5CAX A;  5IPH A;  1XW9 A;  2YV7 A;  2X64 A;  2PN8 A;  4V1A g;  4G0I A;  1OC9 A;  2X8C A;  2WUL A;  3ZMK A;  3QPM A;  4O7H A;  1TI3 A;  1SJZ A;  1YKA A;  3VWU A;  1ZCP A;  1XPV A;  1AUC A;  2R6K A;  1JZO A;  4F9Z A;  3VI7 A;  1EGO A;  4HDE A;  3GH6 A;  1WIK A;  2LJK A;  2VO4 A;  3UAR A;  4PNF A;  4MZB A;  2C1Y A;  3RBT A;  1GWC A;  8GSS A;  1F37 A;  3DEX A;  4TR1 B;  5AN1 A;  4JRR A;  5IIZ A;  3ERG A;  1CQH A;  2F3M A;  3VK9 A;  3QFA C;  4XCS A;  2JU5 A;  3IPZ A;  2H76 A;  4EDZ A;  3DD3 A;  2I1U A;  2H71 A;  2IL3 A;  4DVC A;  2H1B A;  1MD4 A;  2MBT A;  1FOV A;  1OC8 A;  3V1W A;  2IME A;  3DVX A;  1ZYQ B;  5JWO B;  1HQO A;  4OCE A;  5D9X A;  5HFG A;  1FAA A;  1O73 A;  1B4Q A;  3TKQ A;  3DML A;  1QGV A;  1NHY A;  1VF2 A;  3DKS A;  1PKW A;  1YKC A;  4CHS A;  1X0R A;  3EC3 A;  2VCV A;  3F0I A;  1K0C A;  3M8N A;  1AAZ A;  4N10 A;  2C3Q A;  2ZCT A;  5DVB A;  4Q5F A;  4EDY A;  4MJA A;  3D4M A;  3QD9 A;  2FWG A;  5C04 A;  11GS A;  3KXO A;  1YF1 A;  2P31 A;  1SYR A;  2QSI A;  1ZGN A;  4IHU A;  4JR6 A;  1YZX A;  2YWN A;  4WKW A;  18GS A;  3D6I A;  2LV3 A;  3A2V A;  2GDR A;  2C0D A;  4ZIL A;  2HSM B;  2BTO T;  2VCQ A;  1WRY A;  2QC7 A;  4I8B A;  2H72 A;  4KDY A;  2J23 A;  4F82 A;  3O3T A;  4F0B A;  3GRX A;  3C1R A;  4QQ7 A;  3HVX A;  4TR0 A;  5CRE A;  4GLT A;  2H1A A;  6GST A;  3UVT A;  2YZU A;  3GFK A;  4TKY A;  3LYK A;  2CAQ A;  3PIN A;  2L59 A;  2B3S A;  1KBN A;  2CVK A;  2LEG A;  3I43 A;  1T4Y A;  3KCM A;  3WT2 A;  4J57 E;  3MDK A;  4F0C A;  2IMK A;  2I9H A;  3HJM A;  2IFQ B;  3ZL5 A;  3WGE A;  5ECS A;  3DYR A;  1B9X C;  3ME7 A;  3DIE A;  1M9B A;  1M7T A;  3TJK A;  2XHF A;  1QXH A;  4KE3 A;  2ZNM A;  5ELA A;  2H0H A;  1X9S B;  4IP1 A;  4EXJ A;  4G2E A;  4TXV A;  5E59 A;  4ECJ A;  4N0Z A;  3HKR A;  2EIO A; 
#chains in the Genus database with same CATH topology
 1GUM A;  1N2A A;  2PWJ A;  3HCZ A;  3O6T A;  1A0F A;  3LG6 A;  4KSM A;  3L78 A;  4KSO A;  3RPP A;  2WRT A;  2LRC A;  1PMT A;  3LXT A;  1TOF A;  2IMI A;  4V1A p;  1SL1 B;  1Z7R A;  5ECK B;  2OBI A;  2LST A;  5EPF A;  2V32 A;  3K8N A;  2H74 A;  3GMF A;  2AB6 A;  2O3E A;  3QFB C;  4MMM A;  3TKP A;  2H73 A;  4KND A;  5IQY A;  5J9C A;  2C3N A;  1QUW A;  3IDV A;  3LWA A;  3Q19 A;  4N0V A;  4GDF A;  4TOP A;  2O87 A;  4NV2 A;  1M0U A;  22GS A;  2CAI A;  2HT9 A;  1LU4 A;  1PQN A;  1XWK A;  1EOG A;  5DJL A;  4K0G A;  1BYE A;  3UBK A;  3ERW A;  4FH8 A;  3Q6O A;  1U87 A;  5EL8 A;  1BAY A;  2G0F A;  4XIH A;  3IC4 A;  13GS A;  4NHZ A;  3TRX A;  4OD7 A;  1HD2 A;  2CA8 A;  1TXX A;  5DQS A;  3SBC A;  1HNB A;  1MD3 A;  3HD5 A;  2LQQ A;  5J3R A;  1V57 A;  4WET A;  1M3J A;  1O8X A;  2K18 A;  1IYI A;  4F2I A;  1USB A;  5A1N B;  3Q18 A;  2ALB A;  2FCH A;  1WP0 A;  2LNS A;  2C80 A;  2R3X A;  2WFC A;  2C0F A;  5JCU A;  3QR6 A;  3TJB A;  1TRV A;  1NM3 A;  1FO5 A;  1SKW B;  3CBU A;  5CP1 A;  3M3M A;  4GST A;  2HRF A;  1ZYN A;  5KN2 A;  4ZXG A;  1TU8 A;  5A5H B;  1V9W A;  5F8B A;  3H93 A;  1UC7 A;  4K8M A;  1N8J A;  4FQU A;  4CW9 A;  4EE0 A;  2M72 A;  2H1L A;  1THX A;  5CNW A;  4MH3 A;  2WW1 A;  3ZFL A;  3FW2 A;  3BOA A;  1BX9 A;  4I2U A;  3TKR A;  3GST A;  1ZOF A;  3ZZX A;  2TRC P;  1GNE A;  1OVN A;  4ZB7 A;  2C3T A;  3EVI A;  4E8E A;  4ECI A;  2XBQ A;  3MSZ A;  1I1I P;  1Z3E A;  3TDG A;  3ZTL A;  1R5A A;  4XTS A;  5CRW A;  3F4R A;  1SL0 B;  3VPQ A;  1XXU A;  4KA0 A;  2QKE A;  2MMN A;  3TUE A;  4DSS B;  5E4W A;  4MF5 A;  4LL4 B;  1OKD A;  4BL7 B;  4LA1 A;  1PFO A;  1U3I A;  3ED3 A;  5GZZ B;  5ECH B;  1PD2 1;  3J7Y b;  4DSR A;  1MDJ A;  3KTL A;  5GSS A;  1A0R P;  2FY6 A;  1XWB A;  1B4P A;  3IOS A;  2HE3 A;  4D73 A;  4AKI A;  3RGB C;  2VL2 A;  2WZS A;  5AIV A;  1AQX A;  1MEK A;  2MMO A;  2DJ1 A;  4F03 A;  4EL1 A;  16GS A;  3EE2 A;  2R5G A;  2XPE A;  1R26 A;  2WJU A;  1H4O A;  1EGR A;  2H0I A;  4W66 A;  1VRS D;  4PQH A;  1NSW A;  4Q5R A;  3CRU A;  4TRX A;  2HZF A;  4WR5 A;  5ELG A;  1ERV A;  5G31 A;  3HMJ G;  3GX8 A;  1SKR B;  2A2P A;  4HQZ A;  2TRX A;  4HZ4 A;  4KDX A;  4YAV A;  4NV5 A;  2YCD A;  3FKF A;  1WPI A;  3R2Q A;  5DAK B;  1KNG A;  2DJ3 A;  3R3E A;  4XS1 A;  3ZIT A;  1WWJ A;  2WDU A;  3H1N A;  3C8E A;  4IJI A;  2CX4 A;  4OCF A;  3EWL A;  4OWY A;  2VM1 A;  4MZW A;  5IO2 A;  1FVJ A;  3KH7 A;  1U3A A;  3F4T A;  2K8S A;  1GTU A;  1Q4J A;  3HY2 A;  2P0G A;  5A4V A;  5AIS A;  4XS6 A;  1GLP A;  4TXO B;  2CVB A;  1FVK A;  2C8U A;  4BIK A;  4PQI A;  2JSZ A;  2H6X A;  4NWY A;  2O36 A;  1SVL A;  3KP8 A;  5CRG A;  1F2E A;  3TOU A;  3VPT A;  3QOU A;  4AJ7 A;  3EMX A;  5ECN B;  2VUP A;  1XWG A;  4HSC X;  2I3Y A;  1HNC A;  1Z6N A;  1Z5Y E;  3DRN A;  4EIQ A;  3F9U A;  4YQV A;  2YJ7 A;  2X99 A;  4IQA A;  2XPD A;  1K0M A;  2HFD A;  1BED A;  3LGC A;  1S3A A;  3UMA A;  2MBS A;  3RFR C;  2A4V A;  4HI7 A;  1FHE A;  4MF7 A;  3QCP A;  3BCK A;  5ECI B;  1Y1U A;  3KJY A;  2O8V B;  3KH9 A;  5CO3 A;  3ZML A;  4K2D A;  2OA7 A;  2WVX A;  3HVN A;  4X0X A;  3A5I A;  2YWI A;  5FT3 A;  2FLS A;  1TKD B;  1BG5 A;  2O89 A;  1V2A A;  4ML1 A;  1EZK A;  1XFL A;  2L4C A;  3TJF A;  2X8G A;  1R7H A;  1YVL A;  3UOM A;  2CZ3 A;  1QK8 A;  3QDN A;  3FK8 A;  5EY6 A;  4PX1 A;  1TRU A;  5CRD A;  5ENU A;  2AYT A;  3FMW A;  3RDW A;  2H70 A;  3GKX A;  3F6D A;  1OE7 A;  3F3Q A;  3EUR A;  4H86 A;  2KLX A;  4LMV A;  2V1M A;  5HFK A;  4G01 A;  3DGQ A;  3A2W A;  2QGV A;  1Y25 A;  3FR3 A;  2FWF A;  3HDC A;  1GTA A;  2H01 A;  2HRN A;  3UBL A;  2ON7 A;  2OKA A;  7GSS A;  3VWX A;  4YKG A;  1GRX A;  4IN0 A;  3HVV A;  1M9A A;  4JBB A;  1J0F A;  1EP8 A;  2K8V A;  1GSY A;  2NTO A;  1A2J A;  2DKH A;  1XOA A;  2GQM A;  2LJR A;  2H8L A;  1K3Y A;  2C4J A;  1F3B A;  3HZ4 A;  1F6M C;  3GTU B;  1VGL A;  5COH A;  2FA8 A;  2L6C A;  3KEB A;  2F8A A;  1QFN A;  2Z9S A;  3LEF A;  3QMX A;  1O8W A;  2DJK A;  3N9J A;  2E7P A;  2CX3 A;  4BPY A;  2FWH A;  3APS A;  2JZR A;  3WT1 A;  3A5W A;  3IV4 A;  5A5K A;  2B5Y A;  2GST A;  2E2M A;  4FO5 A;  2NDO A;  2YP6 A;  1TRS A;  2O85 A;  2GT6 A;  1G7E A;  3LYP A;  1OC9 B;  5A4W A;  3GUS A;  5BMU A;  3EIN A;  3ZRD A;  2KOK A;  2A2S A;  2GQK A;  4USS A;  2VLV A;  4NAX A;  4RQX A;  2WB9 A;  5IPG A;  2WS2 A;  3ERF A;  4GXZ A;  1A24 A;  2HSN A;  3I6A A;  3DXB A;  4O5Q A;  2MMZ A;  2VAF A;  1M2A A;  2FD3 A;  1PX6 A;  3D0Z A;  3QAG A;  4GQC A;  2FA4 A;  1M3I A;  1TTZ A;  3W8S A;  1R5P A;  1GNW A;  2WVZ A;  1THO A;  3KTB A;  2H6Z A;  4KCE A;  4X1U A;  5G1L A;  4IKH A;  2XC2 A;  3F3R A;  3M9J A;  1DE1 A;  1ZYP A;  1AC1 A;  1AQV A;  1FW1 A;  1WMJ A;  5D93 A;  3W8J A;  3P2A A;  4JE1 A;  4OFN A;  4HS1 A;  2VOC A;  2FHE A;  5JCW A;  3CTG A;  4RUV A;  6GSV A;  2LNT A;  3DWV A;  2V6K A;  9GSS A;  4KAE A;  2VD1 A;  3C7M A;  5B7C A;  5IMC A;  4FYU A;  1QMV A;  3C1S A;  2GZP A;  3BBY A;  5J4U A;  1O7U A;  3VFI A;  1GUL A;  3EU4 A;  1EEM A;  2VL2 C;  1S4B P;  1X5D A;  4JED A;  5H5S A;  2H30 A;  4I6X A;  1UA5 A;  4WXT A;  4K7I A;  2HI7 A;  3H79 A;  1G6Y A;  4K7N A;  3PH9 A;  1T3B A;  1ML6 A;  4Q5N A;  4MJC A;  3TKS C;  1GTB A;  5F07 A;  4JU5 A;  2OE0 A;  3UJ1 A;  2H1G A;  4HZ2 A;  3CTF A;  2DKI A;  2REM A;  4L5L A;  2B7J A;  2C0G A;  3TJJ A;  3CRT A;  2OAD A;  4KGI A;  1VF4 A;  4EUY A;  2IMD A;  3MIX A;  2JZS A;  5GAN D;  1O85 A;  5D73 A;  4ICY A;  4WR4 A;  1Z7P A;  5LD0 A;  5IOW A;  4ID0 A;  1ZZY A;  1EEJ A;  3S9F A;  2B5X A;  4XRD A;  2B1K A;  4K9Z A;  4HEA 2;  4JZQ A;  1DSB A;  3L0H A;  1VF1 A;  3CQF A;  4RI6 A;  4MA9 A;  2V2G A;  4EC0 A;  4BVY A;  1UN2 A;  2LJA A;  3TGZ A;  3FYG A;  2WW0 A;  3HYP A;  6GSS A;  3EYT A;  3O76 A;  3CHX C;  1XVW A;  2L6D A;  3W6G A;  5GAP D;  4OO4 A;  3ZIV A;  2HZE A;  1A8L A;  3TKS E;  1AIU A;  3KGK A;  4EVM A;  1FG4 A;  3TRQ A;  1N25 A;  6GSU A;  1GSU A;  1Z9H A;  4G9H A;  3APO A;  4XS4 A;  1YEW C;  19GS A;  1XIY A;  2HRK A;  3APQ A;  3U5R E;  1SVO A;  4BA7 A;  5L71 A;  3F4S A;  1PL1 A;  2HRA A;  3I69 A;  2LUS A;  4EO3 A;  4QMK A;  5D9V A;  4ZIJ A;  1AQW A;  4ZL8 A;  5ECM B;  5IMF A;  3Q74 A;  4FYC A;  3RPN A;  4RI7 A;  3MYD A;  1E2Y A;  1A2M A;  4KUN A;  3LXZ A;  3ZVJ D;  1XZO A;  3ISO A;  3G7Y A;  4L0W A;  4GQF A;  3UAP A;  3TCO A;  1M2D A;  2C0E A;  4KX4 A;  2GS3 A;  3KIJ A;  4ISD A;  3GKK A;  5HFI A;  5DAL A;  5B6M A;  1B48 A;  1GSQ A;  4MDC A;  2NPB A;  2HXK A;  4AF2 A;  2EC4 A;  1BF5 A;  1B8X A;  3FZ9 A;  1K3O A;  3GHA A;  2YAN A;  3L9S A;  4E68 A;  1ERU A;  4AGS A;  1WJK A;  2LS5 A;  2P5Q A;  2D2Z A;  5IMD A;  5ID2 A;  3G7I A;  2H75 A;  1GUK A;  2GLR A;  5DJM A;  2I81 A;  5HR1 A;  2EFH A;  2DJJ A;  5KEJ A;  5IO0 A;  3ZRE A;  2ON5 A;  3E0U A;  2JAC A;  4MH2 A;  2IPA A;  5INY A;  4BVX A;  1EV9 A;  4PGT A;  1A8Y A;  2HQT A;  2YPM A;  4MZC A;  4GF0 A;  2WVY A;  1K0O A;  1RK4 A;  2WCI A;  2A4H A;  2VLU A;  3C73 A;  1TXU A;  2PBJ A;  5D9T A;  4HJ2 A;  2YV9 A;  1XWA A;  2X8H A;  4ACS A;  2AV4 A;  2EFE A;  3N5O A;  1Y6E A;  4BWS A;  3F6F A;  3TKS A;  2VLT A;  1T00 A;  3CWG A;  3FHK A;  1XWC A;  2CQ9 A;  1G7O A;  4TR3 A;  3RHB A;  2I4A A;  4TR1 A;  5D8I A;  4POL A;  2PGT A;  2WZ9 A;  5J40 A;  5DDL A;  4O92 A;  1CQG A;  3JCM L;  4PQ1 A;  4OO5 A;  1TK8 B;  2OE3 A;  4IS0 A;  4MJE A;  4K0N A;  2RII A;  1ZMA A;  3D21 A;  5KN3 A;  2TIR A;  3GYK A;  1SJI A;  1ERW A;  5G1K A;  3L9V A;  2PU9 C;  6GSW A;  5JWQ B;  5ECR B;  1G0T A;  6GSX A;  1JFU A;  5F05 A;  4MJB A;  1A23 A;  2L57 A;  3IA1 A;  4TR4 A;  4GSS A;  1FB6 A;  4I5Q A;  4LMW A;  3CSJ A;  4OFM A;  4ECC A;  3UIW A;  2YWO A;  2N5F A;  1SK2 A;  5A4U A;  2EIQ A;  4ULX A;  2F9S A;  4GCI A;  1FB0 A;  2GSR A;  4NHW A;  3IE3 A;  4PUR A;  4K7O A;  4MP4 A;  3LFL A;  5JWR B;  14GS A;  5IMA A;  3VWV A;  1PSQ A;  1IYH A;  2XBI A;  5G5E A;  2YWM A;  1H75 A;  1X9W B;  4ECB A;  2G2Q A;  3VLN A;  4O5R A;  2H0G A;  3FR6 A;  2K6V A;  2B5E A;  2LRN A;  4Z2T A;  5HQP A;  1G6W A;  1PN0 A;  4PI2 C;  4POM A;  1EV4 A;  2VCZ A;  4DEJ A;  2OJL A;  2HSM A;  4QL7 A;  1XW6 A;  1TW9 A;  1PN9 A;  3PPU A;  1XCC A;  2F51 A;  3FZ5 A;  3IXR A;  3RHC A;  4EKZ A;  3ZVJ A;  4PNG A;  5G30 A;  5BRT A;  4J2F A;  4D73 B;  3GUR A;  2GSQ A;  3G9B A;  2HNL A;  3US3 A;  4A5P A;  5DQY A;  1AXD A;  1V98 A;  3D22 A;  4EIP A;  4OMV A;  4ILF A;  4IBP A;  4E8H A;  1I5G A;  1BQ7 A;  1TK0 B;  3GKM A;  4X43 A;  2RLI A;  4N30 A;  1KEB A;  1K3L A;  1EOH A;  1TDI A;  4TW5 A;  4PUF C;  5KN1 A;  3M9K A;  3AY8 A;  2L5L A;  3CSH A;  1K0A A;  4PHZ C;  2IN3 A;  2J9H A;  2QA1 A;  2HYX A;  4YAP A;  3ZLP A;  5B6N A;  2IFQ A;  3FZ4 A;  2JAD A;  5A34 A;  1K0D A;  2LTK A;  1GUH A;  3IBH A;  3E3E A;  4LLR A;  12GS A;  3C71 A;  2DSA A;  2CT6 A;  1FOH A;  2VCW A;  4V2L A;  1SJ6 A;  3MWH A;  1S3D A;  1TP9 A;  2F8F A;  4BWQ A;  4N11 A;  5LCZ A;  5CRH A;  4OFT A;  3H8Q A;  1ERT A;  2AAW A;  3KMO A;  3M0F A;  3UEM A;  1X5C A;  2GT5 A;  4GRF A;  5J4Y A;  4WBJ A;  1T8E B;  5H5R A;  3ZFB A;  4HOJ A;  1XBS A;  1XVQ A;  4PXO A;  2ZUP A;  2DJ0 A;  2R4V A;  4WBR D;  4KB3 A;  3IRA A;  1ZL9 A;  4MPF A;  2AJQ B;  5IMZ A;  5G2Z A;  6GSY A;  3NZN A;  1C72 A;  3BCI A;  2CV4 A;  1X9M B;  2V6O A;  5J47 A;  1SYX A;  1T4Z A;  4L8E A;  3GKN A;  1YDK A;  2EIR A;  1HNA A;  4K5S A;  1GL8 A;  4ZL7 A;  2DIZ A;  4PTS A;  3HHV A;  4EF0 A;  1PKZ A;  2LRT A;  2A2R A;  4AKX B;  3HJO A;  3IR4 A;  1AW9 A;  2UZ8 A;  3GL3 A;  4MK3 A;  2VL3 A;  3MAK A;  1ABA A;  5J5N A;  3IHQ A;  1F9M A;  2FWE A;  3LOR A;  1A2L A;  4ZB6 A;  1WOU A;  2FGX A;  2MZC A;  4L5O A;  4Z2R A;  5IMV A;  2KHP A;  3GN3 A;  2MYG A;  2JL4 A;  4ZBA A;  2YJH A;  5HR0 A;  2M46 A;  2WVX B;  2UV8 G;  4G10 A;  5GST A;  3KM6 A;  2H1D A;  2X4A A;  4NXI A;  4MAB A;  1O6J A;  1W89 A;  1EWX A;  2EFC A;  2RM6 A;  2PPT A;  1EP7 A;  1URM A;  4ZB8 A;  4MF6 A;  3EMP A;  1V40 A;  1E6B A;  1S3C A;  2DLX A;  5A1N A;  3TJG A;  2R0P A;  1PRX A;  3SWL A;  2B7K A;  5F06 A;  1BG1 A;  2GQL A;  2VD0 A;  4N3Z A;  1MDK A;  1ST9 A;  2WW3 A;  1YEX A;  3M1G A;  3GL5 A;  4K6X A;  1JZR A;  2IIY A;  4ML6 A;  4J56 E;  3NIV A;  2PUK C;  4ZBD A;  3HVS A;  1KTE A;  4I97 A;  4ZL9 A;  5A5H A;  1GSF A;  4KF9 A;  5ECL B;  1OE8 A;  1U88 A;  3I9V 2;  4GSN A;  2WGR A;  1RQM A;  3NOF A;  4KH7 A;  1SEN A;  4CDO A;  4CY8 A;  3KP9 A;  2VCX A;  5EVO A;  2O5V A;  2P5R A;  1T1V A;  2V41 A;  4YH2 A;  4WEY A;  3BD2 A;  4O32 A;  2FUG 2;  1OYJ A;  1K0B A;  3RAZ A;  2RUE A;  4HUA A;  2OBK A;  3HA9 A;  1PA3 A;  2GVP A;  2L4Q A;  3LW9 A;  3F63 A;  1ACV A;  10GS A;  3WYW A;  4HJM A;  4Z7X A;  4DSS A;  1SL2 B;  3DVW A;  2BMX A;  2B1L A;  1NHO A;  1V58 A;  1XW5 A;  1JLW A;  1GSE A;  4IEL A;  1U6T A;  5ECO B;  2AHE A;  4HU7 A;  4BL7 A;  3MNG A;  2VIM A;  1J08 A;  1X5E A;  1DE2 A;  3WGX A;  2N5B A;  1SKS B;  1TRW A;  4X4J A;  4HQS A;  3EU3 A;  3TOT A;  1F3A A;  3GSS A;  3L9U A;  3TB2 A;  3IC8 A;  2HSY A;  3D5J A;  4I2T A;  4IP6 A;  2PMT A;  5BMU B;  2JZT A;  4IQ1 A;  2DC5 A;  3LSZ A;  2E2G A;  3IK9 A;  3KZQ A;  4PUA A;  3GV1 A;  5B8A A;  1JHB A;  3QAW A;  1SD8 A;  3P7X A;  3HJP A;  4ZB9 A;  2DJ2 A;  2HSN B;  1OKT A;  4LL1 B;  4V2N A;  3A3T A;  1NW2 A;  4P3Y B;  1M99 A;  4YQM A;  4WF4 A;  3VUR A;  3QAV A;  4G0K A;  5DAK A;  2PVQ A;  2DIY A;  1J9B A;  4K2X A;  5AGY A;  17GS A;  4G0L A;  1DBY A;  3D4T A;  3GNJ A;  1JZD A;  2OE1 A;  2KP2 A;  1ZYE A;  4KW6 A;  2KP1 A;  2DBC A;  4MPG A;  1GSS A;  3TRP A;  1GTI A;  1WE0 A;  2DML A;  2O7K A;  4IVF A;  1ON4 A;  3IK7 A;  5DCG A;  4CY6 A;  2CZ2 A;  1SU9 A;  4AKG A;  3WD6 A;  5H5Q A;  4TXO A;  3J7Y k;  2HSH A;  5ECP B;  4KCA A;  2CVD A;  4AJ6 A;  1Q98 A;  2DMM A;  4MCU A;  2GTU A;  2E0Q A;  3UVH A;  3HZ8 A;  4L0U A;  1TJD A;  1TK5 B;  3G7J A;  2VL9 A;  5J41 A;  4ZBB A;  4DSQ A;  1YF0 A;  3FY7 A;  1SD9 A;  2VM2 A;  20GS A;  5C00 A;  4IW9 A;  1MDI A;  5B8B A;  1VF3 A;  1K0N A;  4RQR A;  4MNN A;  1GLQ A;  3HXS A;  2IWT A;  2R37 A;  1PL2 A;  2X49 A;  4QL9 A;  4AI6 A;  4GTU A;  2H6Y A;  1QQ2 A;  3L4N A;  4POB A;  2YN1 A;  3UL3 A;  2H66 A;  3CSI A;  2IMF A;  3GX0 A;  3FEU A;  2MMA A;  1ILO A;  4O5U A;  1YQ1 A;  2BJX A;  1JZW A;  4K5R A;  1UVZ A;  3WGD A;  5CYY A;  1PX7 A;  4BVY B;  2FNO A;  1JLV A;  1I9D A;  5AIX A;  3GIX A;  4FYB A;  3GA4 A;  1BJX A;  3LQ7 A;  1GSD A;  4V2M A;  2HZE B;  5FHI A;  4POK A;  4YQU A;  2IJY A;  2H19 A;  3GH9 A;  2RUF A;  5G5F A;  2PER A;  5HR3 A;  3BJ5 A;  5D96 A;  4XHM A;  3ME8 A;  4XS4 B;  4WF5 A;  2HRK B;  3P90 A;  3P8W A;  1R4W A;  2HLS A;  3FR9 A;  1GH2 A;  4FIW A;  4NMU A;  3PGT A;  4HU9 A;  3KMN A;  1RW1 A;  2GSS A;  5LNK e;  3F8U A;  4AJ8 A;  1W4V A;  3IAS 2;  2RM5 A;  4Z2U A;  2M80 A;  1B9Y C;  1HYU A;  5ECQ B;  2PVO C;  2VCT A;  4XRA A;  1DUG A;  3CXG A;  1LBK A;  2YZH A;  1XOB A;  3CYN A;  2KUC A;  3KD0 A;  5HR2 A;  3U6V A;  4G19 A;  4JR4 A;  1YJ6 A;  1OC3 A;  3FZA A;  1GP1 A;  1SK1 A;  5FWG A;  3OR5 A;  1SK0 A;  5DCH A;  1O81 A;  3GTU A;  2R2J A;  4GWR A;  3IAM 2;  4IJ3 A;  2JSY A;  1MTC A;  1YEP A;  4K1F A;  5DAL B;  5KN0 A;  2OAC A;  3ZYW A;  2NVL A;  4TN8 A;  1Z6M A;  2GZZ A;  3H4K A;  5JCG A;  4MLY A;  4NPB A;  2N5A A;  4Q5Q A;  5IM9 A;  2K9F A;  5F0G A;  1TU7 A;  2B6M A;  2LKU A;  2EFD A;  1T7P B;  2YNX A;  5IOX A;  2ES7 A;  5ID2 B;  5DBQ A;  3VI5 A;  2YOI A;  2GZY A;  3LJR A;  2L5O A;  2LQO A;  1M2B A;  3VWW A;  1OAZ A;  5ABR A;  5J9B A;  2AUV A;  1TI1 A;  3FRC A;  1PGT A;  1YY7 A;  3CMI A;  4KDU A;  3ZIJ A;  4IGJ A;  2GGT A;  3E9J B;  4TVE A;  3PR8 A;  1LJR A;  3A2X A;  2NBS A;  4YKF A;  4BVX B;  5D9W A;  5CAX A;  5IPH A;  1XW9 A;  2YV7 A;  2X64 A;  2PN8 A;  4V1A g;  4G0I A;  1OC9 A;  2X8C A;  2WUL A;  3ZMK A;  3QPM A;  4O7H A;  1TI3 A;  1SJZ A;  1YKA A;  3VWU A;  1ZCP A;  1XPV A;  1AUC A;  2R6K A;  1JZO A;  4F9Z A;  3VI7 A;  2R0C A;  1EGO A;  4HDE A;  3GH6 A;  1WIK A;  2LJK A;  2VO4 A;  2OT3 A;  3UAR A;  4PNF A;  4MZB A;  2C1Y A;  3RBT A;  1GWC A;  8GSS A;  1F37 A;  3DEX A;  4TR1 B;  5AN1 A;  4JRR A;  2R0G A;  5IIZ A;  2VKZ G;  3ERG A;  1CQH A;  2F3M A;  3VK9 A;  3QFA C;  4XCS A;  5KOW A;  2JU5 A;  3IPZ A;  2H76 A;  2WW2 A;  4EDZ A;  3DD3 A;  2I1U A;  2H71 A;  2IL3 A;  4DVC A;  2H1B A;  1MD4 A;  2MBT A;  1FOV A;  1OC8 A;  3V1W A;  2IME A;  3DVX A;  1XG8 A;  1ZYQ B;  5JWO B;  1HQO A;  4OCE A;  5D9X A;  5HFG A;  1FAA A;  1O73 A;  1B4Q A;  3TKQ A;  3DML A;  1QGV A;  1NHY A;  1VF2 A;  1SVM A;  3DKS A;  1PKW A;  1YKC A;  4CHS A;  1X0R A;  3EC3 A;  2VCV A;  3F0I A;  1K0C A;  3M8N A;  1AAZ A;  4N10 A;  2C3Q A;  2ZCT A;  5DVB A;  4Q5F A;  4EDY A;  4MJA A;  3D4M A;  2FWG A;  3TU3 B;  3QD9 A;  5C04 A;  11GS A;  3KXO A;  1YF1 A;  2P31 A;  1SYR A;  2QSI A;  1ZGN A;  4IHU A;  4FXY P;  4JR6 A;  1YZX A;  2YWN A;  4WKW A;  4AKH A;  18GS A;  3D6I A;  2LV3 A;  3A2V A;  2GDR A;  2C0D A;  4ZIL A;  2HSM B;  4PI0 C;  2BTO T;  2VCQ A;  1WRY A;  2QC7 A;  4I8B A;  2H72 A;  4KDY A;  2J23 A;  4F82 A;  3O3T A;  4F0B A;  3IHG A;  3GRX A;  3C1R A;  4QQ7 A;  3HVX A;  4TR0 A;  5CRE A;  4GLT A;  2H1A A;  6GST A;  3UVT A;  2YZU A;  3GFK A;  4TKY A;  3LYK A;  2CAQ A;  3PIN A;  2L59 A;  2B3S A;  1KBN A;  2CVK A;  2LEG A;  3I43 A;  1T4Y A;  3KCM A;  3WT2 A;  4J57 E;  3MDK A;  4F0C A;  2IMK A;  2I9H A;  3HJM A;  2IFQ B;  3ZL5 A;  5A34 B;  5J4V A;  3WGE A;  5KOX A;  5ECS A;  3DYR A;  1B9X C;  3ME7 A;  3DIE A;  1M9B A;  1M7T A;  3TJK A;  2QA2 A;  2XHF A;  1QXH A;  4KE3 A;  2ZNM A;  5ELA A;  2H0H A;  1X9S B;  4IP1 A;  4EXJ A;  4G2E A;  4TXV A;  5E59 A;  4ECJ A;  4N0Z A;  3HKR A;  3EPT A;  2EIO A;  1S3R A; 
#chains in the Genus database with same CATH homology
 1GUM A;  1N2A A;  2PWJ A;  3HCZ A;  3O6T A;  1A0F A;  3LG6 A;  4KSM A;  3L78 A;  4KSO A;  3RPP A;  2WRT A;  2LRC A;  1PMT A;  3LXT A;  1TOF A;  2IMI A;  4V1A p;  1SL1 B;  1Z7R A;  5ECK B;  2OBI A;  2LST A;  5EPF A;  2V32 A;  3K8N A;  2H74 A;  3GMF A;  2AB6 A;  3QFB C;  4MMM A;  3TKP A;  2H73 A;  4KND A;  5IQY A;  5J9C A;  2C3N A;  1QUW A;  3IDV A;  3LWA A;  3Q19 A;  4N0V A;  4GDF A;  4TOP A;  2O87 A;  4NV2 A;  1M0U A;  22GS A;  2CAI A;  2HT9 A;  1LU4 A;  1PQN A;  1XWK A;  1EOG A;  5DJL A;  4K0G A;  1BYE A;  3UBK A;  3ERW A;  4FH8 A;  3Q6O A;  1U87 A;  5EL8 A;  1BAY A;  2G0F A;  4XIH A;  3IC4 A;  13GS A;  4NHZ A;  3TRX A;  4OD7 A;  1HD2 A;  2CA8 A;  1TXX A;  5DQS A;  3SBC A;  1HNB A;  1MD3 A;  3HD5 A;  2LQQ A;  5J3R A;  1V57 A;  4WET A;  1O8X A;  2K18 A;  1IYI A;  4F2I A;  1USB A;  5A1N B;  3Q18 A;  2ALB A;  2FCH A;  1WP0 A;  2LNS A;  2C80 A;  2R3X A;  2WFC A;  2C0F A;  5JCU A;  3QR6 A;  3TJB A;  1TRV A;  1NM3 A;  1FO5 A;  1SKW B;  3CBU A;  5CP1 A;  3M3M A;  4GST A;  2HRF A;  1ZYN A;  5KN2 A;  4ZXG A;  1TU8 A;  5A5H B;  1V9W A;  5F8B A;  3H93 A;  1UC7 A;  4K8M A;  1N8J A;  4FQU A;  4CW9 A;  4EE0 A;  2M72 A;  2H1L A;  1THX A;  5CNW A;  4MH3 A;  3ZFL A;  3FW2 A;  3BOA A;  1BX9 A;  4I2U A;  3TKR A;  3GST A;  1ZOF A;  3ZZX A;  2TRC P;  1GNE A;  1OVN A;  4ZB7 A;  2C3T A;  3EVI A;  4E8E A;  4ECI A;  3MSZ A;  2XBQ A;  1Z3E A;  3TDG A;  3ZTL A;  1R5A A;  4XTS A;  5CRW A;  3F4R A;  1SL0 B;  3VPQ A;  1XXU A;  4KA0 A;  2QKE A;  2MMN A;  3TUE A;  4DSS B;  5E4W A;  4MF5 A;  4LL4 B;  1OKD A;  4BL7 B;  4LA1 A;  1U3I A;  3ED3 A;  5GZZ B;  5ECH B;  1PD2 1;  3J7Y b;  4DSR A;  1MDJ A;  3KTL A;  5GSS A;  1A0R P;  2FY6 A;  1XWB A;  1B4P A;  3IOS A;  2HE3 A;  4D73 A;  4AKI A;  2VL2 A;  5AIV A;  1AQX A;  1MEK A;  2MMO A;  2DJ1 A;  4F03 A;  4EL1 A;  16GS A;  3EE2 A;  2R5G A;  2XPE A;  1R26 A;  2WJU A;  1H4O A;  1EGR A;  2H0I A;  4W66 A;  1VRS D;  4PQH A;  1NSW A;  4Q5R A;  3CRU A;  4TRX A;  2HZF A;  4WR5 A;  5ELG A;  1ERV A;  5G31 A;  3HMJ G;  3GX8 A;  1SKR B;  2A2P A;  4HQZ A;  2TRX A;  4HZ4 A;  4KDX A;  4YAV A;  4NV5 A;  2YCD A;  3FKF A;  1WPI A;  3R2Q A;  5DAK B;  1KNG A;  2DJ3 A;  3R3E A;  4XS1 A;  3ZIT A;  1WWJ A;  2WDU A;  3H1N A;  3C8E A;  4IJI A;  2CX4 A;  4OCF A;  3EWL A;  4OWY A;  2VM1 A;  4MZW A;  5IO2 A;  1FVJ A;  3KH7 A;  1U3A A;  3F4T A;  2K8S A;  1GTU A;  1Q4J A;  3HY2 A;  2P0G A;  5A4V A;  5AIS A;  4XS6 A;  1GLP A;  4TXO B;  2CVB A;  1FVK A;  2C8U A;  4PQI A;  2JSZ A;  2H6X A;  4NWY A;  1SVL A;  3KP8 A;  5CRG A;  1F2E A;  3TOU A;  3VPT A;  3QOU A;  4AJ7 A;  3EMX A;  5ECN B;  2VUP A;  1XWG A;  2I3Y A;  1HNC A;  1Z6N A;  1Z5Y E;  3DRN A;  4EIQ A;  3F9U A;  4YQV A;  2YJ7 A;  2X99 A;  4IQA A;  2XPD A;  1K0M A;  2HFD A;  1BED A;  3LGC A;  1S3A A;  3UMA A;  2MBS A;  2A4V A;  4HI7 A;  1FHE A;  4MF7 A;  3QCP A;  3BCK A;  5ECI B;  1Y1U A;  3KJY A;  2O8V B;  3KH9 A;  5CO3 A;  3ZML A;  4K2D A;  2OA7 A;  4X0X A;  3A5I A;  2YWI A;  5FT3 A;  2FLS A;  1TKD B;  1BG5 A;  2O89 A;  1V2A A;  4ML1 A;  1EZK A;  1XFL A;  2L4C A;  3TJF A;  2X8G A;  1R7H A;  1YVL A;  3UOM A;  2CZ3 A;  1QK8 A;  3QDN A;  3FK8 A;  5EY6 A;  4PX1 A;  1TRU A;  5CRD A;  5ENU A;  2AYT A;  3FMW A;  3RDW A;  2H70 A;  3GKX A;  3F6D A;  1OE7 A;  3F3Q A;  3EUR A;  4H86 A;  2KLX A;  4LMV A;  2V1M A;  5HFK A;  4G01 A;  3DGQ A;  3A2W A;  2QGV A;  1Y25 A;  3FR3 A;  2FWF A;  3HDC A;  1GTA A;  2H01 A;  2HRN A;  3UBL A;  2ON7 A;  2OKA A;  7GSS A;  3VWX A;  4YKG A;  1GRX A;  4IN0 A;  3HVV A;  1M9A A;  4JBB A;  1J0F A;  1EP8 A;  2K8V A;  1GSY A;  2NTO A;  1A2J A;  2DKH A;  1XOA A;  2GQM A;  2LJR A;  2H8L A;  1K3Y A;  2C4J A;  1F3B A;  3HZ4 A;  1F6M C;  3GTU B;  1VGL A;  5COH A;  2FA8 A;  2L6C A;  3KEB A;  2F8A A;  1QFN A;  2Z9S A;  3LEF A;  3QMX A;  1O8W A;  2DJK A;  3N9J A;  2E7P A;  2CX3 A;  4BPY A;  2FWH A;  3APS A;  2JZR A;  3WT1 A;  3A5W A;  3IV4 A;  5A5K A;  2B5Y A;  2GST A;  2E2M A;  4FO5 A;  2NDO A;  2YP6 A;  1TRS A;  2O85 A;  2GT6 A;  1G7E A;  3LYP A;  1OC9 B;  5A4W A;  3GUS A;  5BMU A;  3EIN A;  3ZRD A;  2KOK A;  2A2S A;  2GQK A;  4USS A;  2VLV A;  4NAX A;  4RQX A;  2WB9 A;  5IPG A;  2WS2 A;  3ERF A;  4GXZ A;  1A24 A;  2HSN A;  3I6A A;  3DXB A;  4O5Q A;  2MMZ A;  2VAF A;  1M2A A;  2FD3 A;  1PX6 A;  3D0Z A;  3QAG A;  4GQC A;  2FA4 A;  1TTZ A;  3W8S A;  1R5P A;  1GNW A;  1THO A;  3KTB A;  2H6Z A;  4KCE A;  4X1U A;  5G1L A;  4IKH A;  2XC2 A;  3F3R A;  3M9J A;  1DE1 A;  1ZYP A;  1AC1 A;  1AQV A;  1FW1 A;  1WMJ A;  5D93 A;  3W8J A;  3P2A A;  4JE1 A;  4OFN A;  4HS1 A;  2VOC A;  2FHE A;  5JCW A;  3CTG A;  4RUV A;  6GSV A;  2LNT A;  3DWV A;  2V6K A;  9GSS A;  4KAE A;  2VD1 A;  3C7M A;  5B7C A;  5IMC A;  4FYU A;  1QMV A;  3C1S A;  2GZP A;  3BBY A;  5J4U A;  1O7U A;  3VFI A;  1GUL A;  3EU4 A;  1EEM A;  2VL2 C;  1X5D A;  4JED A;  5H5S A;  2H30 A;  4I6X A;  1UA5 A;  4WXT A;  4K7I A;  2HI7 A;  3H79 A;  1G6Y A;  4K7N A;  3PH9 A;  1T3B A;  1ML6 A;  4Q5N A;  4MJC A;  3TKS C;  1GTB A;  5F07 A;  4JU5 A;  2OE0 A;  3UJ1 A;  2H1G A;  4HZ2 A;  3CTF A;  2DKI A;  2REM A;  4L5L A;  2B7J A;  2C0G A;  3TJJ A;  3CRT A;  2OAD A;  4KGI A;  1VF4 A;  4EUY A;  2IMD A;  3MIX A;  2JZS A;  5GAN D;  1O85 A;  5D73 A;  4ICY A;  4WR4 A;  1Z7P A;  5LD0 A;  5IOW A;  4ID0 A;  1ZZY A;  1EEJ A;  3S9F A;  2B5X A;  4XRD A;  2B1K A;  4K9Z A;  4HEA 2;  4JZQ A;  1DSB A;  3L0H A;  1VF1 A;  4RI6 A;  4MA9 A;  2V2G A;  4EC0 A;  4BVY A;  1UN2 A;  2LJA A;  3TGZ A;  3FYG A;  3HYP A;  6GSS A;  3EYT A;  3O76 A;  1XVW A;  2L6D A;  3W6G A;  5GAP D;  4OO4 A;  3ZIV A;  2HZE A;  1A8L A;  3TKS E;  1AIU A;  3KGK A;  4EVM A;  1FG4 A;  3TRQ A;  1N25 A;  6GSU A;  1GSU A;  1Z9H A;  4G9H A;  3APO A;  4XS4 A;  19GS A;  1XIY A;  2HRK A;  3APQ A;  3U5R E;  1SVO A;  4BA7 A;  5L71 A;  3F4S A;  1PL1 A;  2HRA A;  3I69 A;  2LUS A;  4EO3 A;  4QMK A;  5D9V A;  4ZIJ A;  1AQW A;  4ZL8 A;  5ECM B;  5IMF A;  3Q74 A;  4FYC A;  3RPN A;  4RI7 A;  3MYD A;  1E2Y A;  1A2M A;  4KUN A;  3LXZ A;  3ZVJ D;  1XZO A;  3ISO A;  3G7Y A;  4L0W A;  4GQF A;  3UAP A;  3TCO A;  1M2D A;  2C0E A;  4KX4 A;  2GS3 A;  3KIJ A;  4ISD A;  3GKK A;  5HFI A;  5DAL A;  5B6M A;  1B48 A;  1GSQ A;  4MDC A;  2NPB A;  2HXK A;  4AF2 A;  2EC4 A;  1BF5 A;  1B8X A;  3FZ9 A;  1K3O A;  3GHA A;  3L9S A;  2YAN A;  4E68 A;  1ERU A;  4AGS A;  1WJK A;  2LS5 A;  2P5Q A;  2D2Z A;  5IMD A;  5ID2 A;  3G7I A;  2H75 A;  1GUK A;  2GLR A;  5DJM A;  2I81 A;  5HR1 A;  2EFH A;  2DJJ A;  5KEJ A;  5IO0 A;  3ZRE A;  2ON5 A;  3E0U A;  2JAC A;  4MH2 A;  2IPA A;  5INY A;  4BVX A;  1EV9 A;  4PGT A;  1A8Y A;  2HQT A;  2YPM A;  4MZC A;  4GF0 A;  1K0O A;  1RK4 A;  2WCI A;  2A4H A;  2VLU A;  3C73 A;  1TXU A;  2PBJ A;  5D9T A;  4HJ2 A;  2YV9 A;  1XWA A;  2X8H A;  4ACS A;  2AV4 A;  2EFE A;  3N5O A;  1Y6E A;  4BWS A;  3F6F A;  3TKS A;  2VLT A;  1T00 A;  3CWG A;  3FHK A;  1XWC A;  2CQ9 A;  1G7O A;  4TR3 A;  3RHB A;  2I4A A;  4TR1 A;  5D8I A;  4POL A;  2PGT A;  2WZ9 A;  5J40 A;  5DDL A;  4O92 A;  1CQG A;  3JCM L;  4PQ1 A;  4OO5 A;  1TK8 B;  2OE3 A;  4IS0 A;  4MJE A;  4K0N A;  2RII A;  1ZMA A;  3D21 A;  5KN3 A;  2TIR A;  3GYK A;  1SJI A;  1ERW A;  5G1K A;  3L9V A;  2PU9 C;  6GSW A;  5JWQ B;  5ECR B;  1G0T A;  6GSX A;  1JFU A;  5F05 A;  4MJB A;  1A23 A;  2L57 A;  3IA1 A;  4TR4 A;  4GSS A;  1FB6 A;  4I5Q A;  4LMW A;  3CSJ A;  4OFM A;  4ECC A;  3UIW A;  2YWO A;  2N5F A;  1SK2 A;  5A4U A;  2EIQ A;  4ULX A;  2F9S A;  4GCI A;  1FB0 A;  2GSR A;  4NHW A;  3IE3 A;  4PUR A;  4K7O A;  4MP4 A;  3LFL A;  5JWR B;  14GS A;  5IMA A;  3VWV A;  1PSQ A;  1IYH A;  2XBI A;  5G5E A;  2YWM A;  1H75 A;  1X9W B;  4ECB A;  2G2Q A;  3VLN A;  4O5R A;  2H0G A;  3FR6 A;  2K6V A;  2B5E A;  2LRN A;  4Z2T A;  5HQP A;  1G6W A;  1PN0 A;  4POM A;  1EV4 A;  2VCZ A;  4DEJ A;  2OJL A;  2HSM A;  4QL7 A;  1XW6 A;  1TW9 A;  1PN9 A;  3PPU A;  1XCC A;  2F51 A;  3FZ5 A;  3IXR A;  3RHC A;  4EKZ A;  3ZVJ A;  4PNG A;  5G30 A;  5BRT A;  4J2F A;  4D73 B;  3GUR A;  2GSQ A;  3G9B A;  2HNL A;  3US3 A;  4A5P A;  5DQY A;  1AXD A;  1V98 A;  3D22 A;  4EIP A;  4OMV A;  4ILF A;  4IBP A;  4E8H A;  1I5G A;  1BQ7 A;  1TK0 B;  3GKM A;  4X43 A;  2RLI A;  4N30 A;  1KEB A;  1K3L A;  1EOH A;  1TDI A;  4TW5 A;  4PUF C;  5KN1 A;  3M9K A;  3AY8 A;  2L5L A;  3CSH A;  1K0A A;  2IN3 A;  2J9H A;  2QA1 A;  2HYX A;  4YAP A;  3ZLP A;  5B6N A;  2IFQ A;  3FZ4 A;  2JAD A;  5A34 A;  1K0D A;  2LTK A;  1GUH A;  3IBH A;  3E3E A;  4LLR A;  12GS A;  3C71 A;  2DSA A;  2CT6 A;  1FOH A;  2VCW A;  4V2L A;  1SJ6 A;  3MWH A;  1S3D A;  1TP9 A;  2F8F A;  4BWQ A;  4N11 A;  5LCZ A;  5CRH A;  4OFT A;  3H8Q A;  1ERT A;  2AAW A;  3KMO A;  3M0F A;  3UEM A;  1X5C A;  2GT5 A;  4GRF A;  5J4Y A;  4WBJ A;  1T8E B;  5H5R A;  3ZFB A;  4HOJ A;  1XBS A;  1XVQ A;  4PXO A;  2ZUP A;  2DJ0 A;  2R4V A;  4WBR D;  4KB3 A;  3IRA A;  1ZL9 A;  4MPF A;  2AJQ B;  5IMZ A;  5G2Z A;  6GSY A;  3NZN A;  1C72 A;  3BCI A;  2CV4 A;  1X9M B;  2V6O A;  5J47 A;  1SYX A;  1T4Z A;  4L8E A;  3GKN A;  1YDK A;  2EIR A;  1HNA A;  4K5S A;  1GL8 A;  4ZL7 A;  2DIZ A;  4PTS A;  3HHV A;  4EF0 A;  1PKZ A;  2LRT A;  2A2R A;  4AKX B;  3HJO A;  3IR4 A;  1AW9 A;  2UZ8 A;  3GL3 A;  4MK3 A;  2VL3 A;  3MAK A;  1ABA A;  5J5N A;  3IHQ A;  1F9M A;  2FWE A;  3LOR A;  1A2L A;  4ZB6 A;  1WOU A;  2FGX A;  2MZC A;  4L5O A;  4Z2R A;  5IMV A;  2KHP A;  3GN3 A;  2MYG A;  2JL4 A;  4ZBA A;  2YJH A;  5HR0 A;  2M46 A;  2UV8 G;  4G10 A;  5GST A;  3KM6 A;  2H1D A;  2X4A A;  4NXI A;  4MAB A;  1O6J A;  1W89 A;  1EWX A;  2EFC A;  2RM6 A;  2PPT A;  1EP7 A;  1URM A;  4ZB8 A;  4MF6 A;  3EMP A;  1V40 A;  1E6B A;  1S3C A;  2DLX A;  5A1N A;  3TJG A;  2R0P A;  1PRX A;  3SWL A;  2B7K A;  5F06 A;  1BG1 A;  2GQL A;  2VD0 A;  4N3Z A;  1MDK A;  1ST9 A;  1YEX A;  3M1G A;  3GL5 A;  4K6X A;  1JZR A;  2IIY A;  4ML6 A;  4J56 E;  3NIV A;  2PUK C;  4ZBD A;  3HVS A;  1KTE A;  4I97 A;  4ZL9 A;  5A5H A;  1GSF A;  4KF9 A;  5ECL B;  1OE8 A;  1U88 A;  3I9V 2;  4GSN A;  2WGR A;  1RQM A;  3NOF A;  4KH7 A;  1SEN A;  4CDO A;  4CY8 A;  3KP9 A;  2VCX A;  5EVO A;  2O5V A;  2P5R A;  1T1V A;  2V41 A;  4YH2 A;  4WEY A;  3BD2 A;  4O32 A;  2FUG 2;  1OYJ A;  1K0B A;  3RAZ A;  2RUE A;  4HUA A;  2OBK A;  3HA9 A;  1PA3 A;  2GVP A;  2L4Q A;  3LW9 A;  3F63 A;  1ACV A;  10GS A;  3WYW A;  4HJM A;  4Z7X A;  4DSS A;  1SL2 B;  3DVW A;  2BMX A;  2B1L A;  1NHO A;  1V58 A;  1XW5 A;  1JLW A;  1GSE A;  4IEL A;  1U6T A;  5ECO B;  2AHE A;  4HU7 A;  4BL7 A;  3MNG A;  2VIM A;  1J08 A;  1X5E A;  1DE2 A;  3WGX A;  2N5B A;  1SKS B;  1TRW A;  4X4J A;  4HQS A;  3EU3 A;  3TOT A;  1F3A A;  3GSS A;  3L9U A;  3TB2 A;  3IC8 A;  2HSY A;  3D5J A;  4I2T A;  4IP6 A;  2PMT A;  5BMU B;  2JZT A;  4IQ1 A;  2DC5 A;  3LSZ A;  2E2G A;  3IK9 A;  3KZQ A;  4PUA A;  3GV1 A;  5B8A A;  1JHB A;  3QAW A;  1SD8 A;  3P7X A;  3HJP A;  4ZB9 A;  2DJ2 A;  2HSN B;  1OKT A;  4LL1 B;  4V2N A;  3A3T A;  1NW2 A;  4P3Y B;  1M99 A;  4YQM A;  4WF4 A;  3VUR A;  3QAV A;  4G0K A;  5DAK A;  2PVQ A;  2DIY A;  1J9B A;  4K2X A;  5AGY A;  17GS A;  4G0L A;  1DBY A;  3D4T A;  3GNJ A;  1JZD A;  2OE1 A;  2KP2 A;  1ZYE A;  4KW6 A;  2KP1 A;  2DBC A;  4MPG A;  1GSS A;  3TRP A;  1GTI A;  1WE0 A;  2DML A;  2O7K A;  4IVF A;  1ON4 A;  3IK7 A;  5DCG A;  4CY6 A;  2CZ2 A;  1SU9 A;  4AKG A;  3WD6 A;  5H5Q A;  4TXO A;  3J7Y k;  2HSH A;  5ECP B;  4KCA A;  2CVD A;  4AJ6 A;  1Q98 A;  2DMM A;  4MCU A;  2GTU A;  2E0Q A;  3UVH A;  3HZ8 A;  4L0U A;  1TJD A;  1TK5 B;  3G7J A;  2VL9 A;  5J41 A;  4ZBB A;  4DSQ A;  1YF0 A;  3FY7 A;  1SD9 A;  2VM2 A;  20GS A;  5C00 A;  4IW9 A;  1MDI A;  5B8B A;  1VF3 A;  1K0N A;  4RQR A;  4MNN A;  1GLQ A;  3HXS A;  2IWT A;  2R37 A;  1PL2 A;  2X49 A;  4QL9 A;  4AI6 A;  4GTU A;  2H6Y A;  1QQ2 A;  3L4N A;  4POB A;  2YN1 A;  3UL3 A;  2H66 A;  3CSI A;  2IMF A;  3GX0 A;  3FEU A;  2MMA A;  1ILO A;  4O5U A;  1YQ1 A;  2BJX A;  1JZW A;  4K5R A;  1UVZ A;  3WGD A;  5CYY A;  1PX7 A;  4BVY B;  2FNO A;  1JLV A;  1I9D A;  5AIX A;  3GIX A;  4FYB A;  3GA4 A;  1BJX A;  3LQ7 A;  1GSD A;  4V2M A;  2HZE B;  5FHI A;  4POK A;  4YQU A;  2IJY A;  2H19 A;  3GH9 A;  2RUF A;  5G5F A;  2PER A;  5HR3 A;  3BJ5 A;  5D96 A;  4XHM A;  3ME8 A;  4XS4 B;  4WF5 A;  2HRK B;  3P90 A;  3P8W A;  1R4W A;  2HLS A;  3FR9 A;  1GH2 A;  4FIW A;  4NMU A;  3PGT A;  4HU9 A;  3KMN A;  1RW1 A;  2GSS A;  5LNK e;  3F8U A;  4AJ8 A;  1W4V A;  3IAS 2;  2RM5 A;  4Z2U A;  2M80 A;  1B9Y C;  1HYU A;  5ECQ B;  2PVO C;  2VCT A;  4XRA A;  1DUG A;  3CXG A;  1LBK A;  2YZH A;  1XOB A;  3CYN A;  2KUC A;  3KD0 A;  5HR2 A;  3U6V A;  4G19 A;  4JR4 A;  1YJ6 A;  1OC3 A;  3FZA A;  1GP1 A;  1SK1 A;  5FWG A;  3OR5 A;  1SK0 A;  5DCH A;  1O81 A;  3GTU A;  2R2J A;  4GWR A;  3IAM 2;  4IJ3 A;  2JSY A;  1MTC A;  1YEP A;  4K1F A;  5DAL B;  5KN0 A;  2OAC A;  3ZYW A;  2NVL A;  4TN8 A;  1Z6M A;  2GZZ A;  3H4K A;  5JCG A;  4MLY A;  4NPB A;  2N5A A;  4Q5Q A;  5IM9 A;  2K9F A;  5F0G A;  1TU7 A;  2B6M A;  2LKU A;  2EFD A;  1T7P B;  2YNX A;  5IOX A;  2ES7 A;  5ID2 B;  5DBQ A;  3VI5 A;  2YOI A;  2GZY A;  3LJR A;  2L5O A;  2LQO A;  1M2B A;  3VWW A;  1OAZ A;  5ABR A;  5J9B A;  2AUV A;  1TI1 A;  3FRC A;  1PGT A;  1YY7 A;  3CMI A;  4KDU A;  3ZIJ A;  4IGJ A;  2GGT A;  3E9J B;  4TVE A;  3PR8 A;  1LJR A;  3A2X A;  2NBS A;  4YKF A;  4BVX B;  5D9W A;  5CAX A;  5IPH A;  1XW9 A;  2YV7 A;  2X64 A;  2PN8 A;  4V1A g;  4G0I A;  1OC9 A;  2X8C A;  2WUL A;  3ZMK A;  3QPM A;  4O7H A;  1TI3 A;  1SJZ A;  1YKA A;  3VWU A;  1ZCP A;  1XPV A;  1AUC A;  2R6K A;  1JZO A;  4F9Z A;  3VI7 A;  2R0C A;  1EGO A;  4HDE A;  3GH6 A;  1WIK A;  2LJK A;  2VO4 A;  2OT3 A;  3UAR A;  4PNF A;  4MZB A;  2C1Y A;  3RBT A;  1GWC A;  8GSS A;  1F37 A;  3DEX A;  4TR1 B;  5AN1 A;  4JRR A;  2R0G A;  5IIZ A;  2VKZ G;  3ERG A;  1CQH A;  2F3M A;  3VK9 A;  3QFA C;  4XCS A;  5KOW A;  2JU5 A;  3IPZ A;  2H76 A;  4EDZ A;  3DD3 A;  2I1U A;  2H71 A;  2IL3 A;  4DVC A;  2H1B A;  1MD4 A;  2MBT A;  1FOV A;  1OC8 A;  3V1W A;  2IME A;  3DVX A;  1ZYQ B;  5JWO B;  1HQO A;  4OCE A;  5D9X A;  5HFG A;  1FAA A;  1O73 A;  1B4Q A;  3TKQ A;  3DML A;  1QGV A;  1NHY A;  1VF2 A;  1SVM A;  3DKS A;  1PKW A;  1YKC A;  4CHS A;  1X0R A;  3EC3 A;  2VCV A;  3F0I A;  1K0C A;  3M8N A;  1AAZ A;  4N10 A;  2C3Q A;  2ZCT A;  5DVB A;  4Q5F A;  4EDY A;  4MJA A;  3D4M A;  2FWG A;  3TU3 B;  3QD9 A;  5C04 A;  11GS A;  3KXO A;  1YF1 A;  2P31 A;  1SYR A;  2QSI A;  1ZGN A;  4IHU A;  4JR6 A;  1YZX A;  2YWN A;  4WKW A;  4AKH A;  18GS A;  3D6I A;  2LV3 A;  3A2V A;  2GDR A;  2C0D A;  4ZIL A;  2HSM B;  2BTO T;  2VCQ A;  1WRY A;  2QC7 A;  4I8B A;  2H72 A;  4KDY A;  2J23 A;  4F82 A;  3O3T A;  4F0B A;  3IHG A;  3GRX A;  3C1R A;  4QQ7 A;  3HVX A;  4TR0 A;  5CRE A;  4GLT A;  2H1A A;  6GST A;  3UVT A;  2YZU A;  3GFK A;  4TKY A;  3LYK A;  2CAQ A;  3PIN A;  2L59 A;  2B3S A;  1KBN A;  2CVK A;  2LEG A;  3I43 A;  1T4Y A;  3KCM A;  3WT2 A;  4J57 E;  3MDK A;  4F0C A;  2IMK A;  2I9H A;  3HJM A;  2IFQ B;  3ZL5 A;  5A34 B;  5J4V A;  3WGE A;  5KOX A;  5ECS A;  3DYR A;  1B9X C;  3ME7 A;  3DIE A;  1M9B A;  1M7T A;  3TJK A;  2QA2 A;  2XHF A;  1QXH A;  4KE3 A;  2ZNM A;  5ELA A;  2H0H A;  1X9S B;  4IP1 A;  4EXJ A;  4G2E A;  4TXV A;  5E59 A;  4ECJ A;  4N0Z A;  3HKR A;  3EPT A;  2EIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...