1YJ6A

Crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase Mu 1
publication title Human Glutathione S-Transferase M1A-1A Catalyzes Formation of Gsh-Metal Complexes
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yj6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yj6A01
3F9UA 1URMA 3E0UA 2REMA 2TRXA 5IPGA 4PNFA 2IMKA 2LV3A 5HFIA 2VLTA 1A2JA 1TW9A 2EC4A 1SKWB 1M7TA 5ELGA 2PPTA 2I9HA 2H75A 1GLPA 3GSSA 4JR6A 1SJ6A 4WBJA 1G6WA 2R5GA 4JZQA 2K6VA 1TDIA 4EF0A 4RUVA 5AIVA 1K0CA 2LRNA 1F6MC 3HJOA 4YQVA 1GSEA 3WGDA 4V1Ap 2VCZA 5FT3A 5IMCA 1MTCA 4KSOA 3IOSA 2E7PA 1U3IA 2DSAA 1AUCA 3FKFA 2GDRA 4MABA 2ZNMA 3A3TA 2H0IA 3HY2A 4TR3A 5ID2B 1YKCA 6GSSA 3VWWA 4MJAA 4NXIA 2OBKA 4IQ1A 1X5DA 4MDCA 1OVNA 3UVHA 1YZXA 6GSVA 4EDZA 4FYUA 2DMLA 5EVOA 2H66A 4YAVA 1KNGA 2B5EA 11GSA 3GV1A 5IMVA 3IE3A 1T00A 2VL2A 1R7HA 4ZXGA 2DC5A 2CZ3A 3KIJA 2V1MA 1YY7A 1M2BA 5E59A 4V2NA 2IPAA 1T4YA 5F8BA 1ZYEA 5KEJA 2WCIA 4AJ7A 5HQPA 3GL5A 5JCGA 3TRXA 3EMXA 2E2MA 3VI7A 3PH9A 5AISA 3CSJA 3W8SA 4I97A 6GSTA 1EEJA 3O6TA 3CMIA 2IN3A 4TR1B 3KP8A 3O3TA 2H1DA 4NV5A 2CA8A 2H0HA 3VFIA 2DMMA 2CVDA 3GSTA 1ZZYA 4ZBDA 2G0FA 4ECJA 4K0GA 1JLVA 3GX0A 5DQSA 5B6NA 3DVWA 1KEBA 4PQHA 2HLSA 4BPYA 3TOTA 2N5AA 3NOFA 3ZIJA 3FEUA 2CZ2A 5EPFA 1SKRB 1BJXA 2LJKA 2CQ9A 3ME7A 3F6FA 1NHOA 4KA0A 2AJQB 2DJJA 4OCFA 5IPHA 4WR4A 1OC3A 4GQCA 5HFGA 4PURA 4XS4B 2O8VB 3ZYWA 3CTFA 2E2GA 2H0GA 5IMFA 3GH9A 3GTUB 1XBSA 5HR0A 2K8VA 1ZCPA 1MD4A 3F4RA 2HSMA 3DVXA 2OADA 3HJMA 2AV4A 3ED3A 2EIRA 2EIOA 2C80A 2GSQA 2B1KA 1W4VA 2KP1A 4G9HA 4IJ3A 2H6XA 2A2RA 4KGIA 1MEKA 2LEGA 5IMZA 3RHCA 2FNOA 3PINA 2XBIA 1GULA 1HNBA 1T1VA 4FIWA 3UIWA 2NVLA 1TKDB 2I81A 1GSSA 1TU8A 5J5NA 1EWXA 4G0LA 2XHFA 3FK8A 2A4VA 2K9FA 1WP0A 14GSA 5CO3A 4QL9A 3J7Yb 1SL2B 3QFAC 4KUNA 4GSSA 4F0BA 4MLYA 4ZB8A 3QCPA 5ID2A 4MZCA 4NAXA 4IN0A 3UL3A 4YQMA 3HVSA 5INYA 5H5RA 5A5KA 5F0GA 4V2MA 4MF6A 4XTSA 2IFQA 2Z9SA 1GUHA 5BMUA 3G7IA 1V57A 2LRCA 3NZNA 1HQOA 4OMVA 1JHBA 4BVYB 4IP6A 4PNGA 3KMNA 4FYBA 4LA1A 1QFNA 4I2TA 5G5FA 6GSYA 4I8BA 4MJCA 4IHUA 5A4VA 5ECRB 4GTUA 2OE1A 2TRCP 2DLXA 5G2ZA 1GL8A 1WWJA 2ZUPA 1EOGA 2B6MA 3ZLPA 2LQQA 3TOUA 2R4VA 3WT1A 1XIYA 1T7PB 1KTEA 3UOMA 5IIZA 2JU5A 3HCZA 3NIVA 3EWLA 3D4MA 3W8JA 1NM3A 1S3AA 4JBBA 4E8HA 2KHPA 1SD9A 2JSYA 1J0FA 3WD6A 1LBKA 6GSWA 2L5OA 2O85A 2YJHA 5DAKB 7GSSA 1HD2A 5ECSA 2VCVA 1GP1A 2RLIA 5GSSA 4KDYA 4I5QA 1O85A 4KE3A 4CDOA 1F3AA 1BAYA 2GT6A 3APQA 3LSZA 4Q5FA 2RM6A 5G1LA 3A5WA 2H6YA 4N11A 2GGTA 2IL3A 1GNWA 3HVXA 3TCOA 1ON4A 1JZRA 1TXXA 1TRVA 3ZVJA 3CSIA 2KOKA 2VUPA 1ERUA 2L6DA 5J41A 1LU4A 3TDGA 5JWQB 2KP2A 1XPVA 2FWEA 2YV7A 3MAKA 2DJ0A 1B9YC 1ZGNA 1MDIA 1I5GA 3FZ5A 2DJ1A 3ISOA 3QMXA 1PL1A 1O73A 3E9JB 5GAND 1MD3A 3HZ4A 3U5RE 4MZWA 4Q5RA 4KCEA 3D22A 1V58A 2WFCA 4RQXA 3BCKA 1GSQA 2B7JA 1AQWA 5G30A 2YOIA 3DWVA 3VPQA 3UBLA 3QOUA 1X0RA 1PQNA 4JU5A 3FY7A 1ML6A 4POBA 1XWBA 2TIRA 4I6XA 1M2AA 5ECMB 4PQIA 3I43A 4NHWA 5AN1A 4JR4A 1PL2A 5IOWA 2FA8A 3GNJA 2R3XA 1XXUA 3GMFA 2K18A 4G19A 1Y25A 3QAGA 3CSHA 2H72A 1BYEA 1GLQA 2RM5A 1CQGA 5DVBA 2YJ7A 1UVZA 2CX3A 3DD3A 1UN2A 3D21A 2X8GA 2F51A 3EMPA 1USBA 2LUSA 4LMWA 4HUAA 2OE3A 1XZOA 2GZYA 4KW6A 2P0GA 4GRFA 4LLRA 3UJ1A 3LORA 1A24A 2GQKA 1FVKA 2DJKA 4LMVA 5LNKe 2MMNA 1XVWA 4K9ZA 1GUMA 4QQ7A 3D4TA 4FYCA 3M0FA 4NWYA 2PMTA 3F8UA 2V32A 2M80A 2B1LA 2LS5A 4LL1B 2JL4A 1QQ2A 1XWGA 4J2FA 2N5BA 3RHBA 4YH2A 2YCDA 2X99A 1VF4A 2PERA 2QSIA 3DXBA 3F3QA 3LG6A 2P5RA 5COHA 2HSYA 1BQ7A 3LJRA 1SL0B 1XVQA 1NW2A 4TXOB 4MZBA 3MDKA 5F05A 3DYRA 5B8AA 2JADA 1F2EA 3ERGA 1A8YA 2M72A 3CTGA 4MH3A 2WRTA 4J57E 1AQXA 2ON7A 2QC7A 2YP6A 2IJYA 4KDXA 4CHSA 2GVPA 1K0OA 4TOPA 4MMMA 1XWCA 2GSTA 1JZDA 2RIIA 5CRDA 2VM1A 4AGSA 13GSA 2IIYA 3KXOA 3GN3A 1A23A 4K2DA 2FCHA 2LQOA 2HSHA 3GFKA 1ZMAA 2F9SA 1AIUA 2B5YA 4OO5A 4HJ2A 5B8BA 3L9UA 3C1RA 3L78A 2VD0A 4MCUA 3SWLA 1SD8A 1K0AA 3IC4A 4TW5A 5IQYA 4BVXB 1U6TA 3IDVA 4XRDA 1PGTA 3H8QA 3QR6A 4PUAA 4X1UA 1O6JA 2BTOT 1UC7A 3P7XA 2CAQA 2BJXA 3HHVA 3TGZA 1O8WA 3F3RA 3RDWA 4IP1A 5CYYA 2YPMA 4RQRA 3TJGA 1TI3A 3FZAA 5ECIB 4YAPA 1THOA 3KMOA 4H86A 5AGYA 3UARA 4HI7A 3DMLA 1Z7RA 4IW9A 2LKUA 1FB6A 1TP9A 1AW9A 3IBHA 1TK5B 3PR8A 1GWCA 3VK9A 16GSA 3ERWA 2GLRA 1O81A 3MSZA 3M8NA 4ECIA 1B4QA 4MPFA 1SK0A 4V1Ag 3IHQA 1ILOA 4K6XA 5JCWA 5J4UA 4ZL8A 3DKSA 4ZBBA 3HZ8A 3L9VA 5C04A 1FVJA 3APSA 5JWOB 2C3NA 5G1KA 1ZYQB 4D73A 2MMZA 4F03A 3GA4A 1QGVA 1FO5A 1FG4A 4PGTA 1H4OA 4F2IA 3KH9A 1T8EB 1TRSA 4LL4B 4FH8A 3QAVA 2HE3A 3TKSC 5D8IA 1SJZA 2GQLA 1V9WA 1OC9A 4AJ8A 1T4ZA 1SK2A 4GCIA 4KX4A 1TTZA 3TKQA 3ZVJD 5EY6A 5ENUA 2HSNB 17GSA 4TRXA 2A2SA 4ULXA 3BOAA 5GAPD 3H79A 2DJ2A 4USSA 5IO2A 2PVQA 5DALA 1XW6A 8GSSA 1G7OA 2I1UA 2R2JA 1TRUA 4F0CA 2MMOA 3LEFA 1Y6EA 2WJUA 2H73A 2MBSA 1OKTA 2GQMA 5KN3A 2FWGA 2DIYA 1A0RP 2HRKB 1A8LA 3G7YA 4BWSA 1CQHA 3L9SA 3MNGA 4FO5A 3EINA 5D96A 4FQUA 5J3RA 3N9JA 3GKKA 3EU3A 4IS0A 3RPNA 4HOJA 3L0HA 2C3QA 5H5QA 2I3YA 3F4SA 3IPZA 4OFTA 2MMAA 3IA1A 3GKMA 4JE1A 1AAZA 3TUEA 2DIZA 1EV9A 4IKHA 4RI6A 1EOHA 2H01A 5E4WA 1Z6NA 5KN0A 4BVXA 4KF9A 2AAWA 4NV2A 1SENA 3F0IA 2GS3A 3EYTA 2LSTA 1G0TA 4XCSA 2K8SA 2O87A 3FR6A 4KB3A 2H70A 2F8AA 2OE0A 3I9V2 3CRTA 3R3EA 4G10A 4KAEA 2L6CA 5KN2A 4XS1A 4OD7A 2VAFA 1PRXA 2V6OA 5IM9A 3O76A 2AUVA 3ZIVA 5DCHA 3IRAA 1PX7A 1VRSD 4ZL7A 2IMDA 4MJEA 5A4UA 4AJ6A 3HKRA 3I6AA 1JZOA 1M9AA 3UAPA 4TR1A 2L4QA 1DUGA 1K3LA 2P31A 3BJ5A 4HQZA 1FOVA 2C4JA 1EGOA 4ISDA 4ECBA 2HRAA 4POMA 1K0BA 1OC8A 3BD2A 4KCAA 3BCIA 2C0GA 2X64A 4GWRA 2C8UA 1TOFA 1G6YA 3BBYA 5F06A 5AIXA 1F3BA 2ZCTA 3FZ4A 2H6ZA 4NPBA 1N2AA 1GH2A 2FA4A 6GSXA 3S9FA 10GSA 2NTOA 4I2UA 4L8EA 2VLUA 3KM6A 3UEMA 2WS2A 1N8JA 2HZEB 4J56E 2GZZA 3VLNA 2LJRA 1JFUA 3VWUA 2R6KA 3H1NA 3APOA 3RAZA 1IYHA 4XS4A 5D9XA 2OBIA 2X8HA 4DSRA 1X5EA 2D2ZA 2IWTA 4NMUA 2PU9C 4ZB6A 2AHEA 1O8XA 2F3MA 4DSSB 3GTUA 1V2AA 5ECHB 1AXDA 2LNSA 3TB2A 3F6DA 2H1AA 3R2QA 1GSFA 3DGQA 4NHZA 1VGLA 5LD0A 4GSNA 4POLA 2PBJA 4EXJA 5CP1A 3C73A 4WBRD 4MP4A 3C1SA 2C0DA 1Z3EA 3UMAA 2JSZA 1XW5A 1A0FA 2JZTA 2DBCA 1SJIA 5FHIA 4OFNA 2B7KA 4Q5NA 2FHEA 4K8MA 2FLSA 1X9MB 3F4TA 3LYKA 3ZREA 2B5XA 1ZOFA 4ML6A 4G2EA 3KTLA 3V1WA 2WB9A 1SU9A 2VM2A 3DIEA 1C72A 1M0UA 4MA9A 4GXZA 1ERVA 2MBTA 5IMDA 4N30A 3IAM2 2B3SA 3LYPA 4V2LA 1PSQA 3TKSA 1GTAA 5HFKA 4ZIJA 4ACSA 2OJLA 3IC8A 1TI1A 1Z9HA 2O89A 1U88A 1GSYA 2H1BA 2XPEA 3VWVA 1R4WA 1YQ1A 5C00A 5CAXA 4EC0A 4GF0A 5FWGA 4HU9A 2E0QA 1K3OA 3ZFBA 3QDNA 2HFDA 1AC1A 3WT2A 1DBYA 1WPIA 4BVYA 5D93A 1NHYA 5GSTA 3IK7A 2WULA 3ZITA 4HDEA 5DDLA 1DE1A 2WZ9A 3RBTA 4KNDA 2V41A 1TJDA 1K0NA 2YWNA 4PXOA 1V98A 2DJ3A 3AY8A 4HU7A 1OKDA 3ME8A 1TU7A 3LGCA 2H8LA 22GSA 5KN1A 2GZPA 1HYUA 1K3YA 2VLVA 2CAIA 1DSBA 1EV4A 3KP9A 1K0DA 3EC3A 4P3YB 2VCWA 1TK8B 2JZRA 5D9WA 2GT5A 1PN9A 2LTKA 5DAKA 1XWAA 2NDOA 5CRHA 1BG5A 2HZFA 1SL1B 3KH7A 4RI7A 2HZEA 2V6KA 2ON5A 5B7CA 3Q19A 5J9BA 1ERTA 1F37A 4PX1A 1BEDA 4ZBAA 3GKNA 4ZB9A 3GH6A 1T3BA 4IBPA 4DSQA 3Q18A 3I69A 4DSSA 5LCZA 1B8XA 3GRXA 3W6GA 2HSMB 4KH7A 3VI5A 3UBKA 3J7Yk 5JWRB 3EURA 2MZCA 1S3CA 4CW9A 2L59A 3UVTA 5CNWA 2OA7A 4PQ1A 2GSSA 4MJBA 4TKYA 3LXZA 1XOAA 1YDKA 3QAWA 5F07A 4O5RA 1EP8A 1VF3A 4EE0A 4ID0A 2HQTA 1BX9A 3FW2A 2RUFA 1YJ6A 2RUEA 1SYRA 4Z7XA 1FW1A 1MDKA 4MH2A 1F9MA 1WJKA 3HD5A 1UA5A 5HR3A 2H76A 1KBNA 4OO4A 3PGTA 2HRFA 3P8WA 3LQ7A 3A2WA 1YEXA 1GNEA 1ZL9A 4XHMA 3GX8A 3GIXA 2YNXA 2PWJA 4TR0A 1PA3A 1RW1A 1J9BA 2J9HA 1YEPA 5DJLA 1EP7A 3LFLA 1TK0B 1XW9A 4WKWA 5J9CA 1XOBA 2ES7A 1Q4JA 2IFQB 4EL1A 3FZ9A 5G31A 5L71A 4ZL9A 3CBUA 4MF7A 4BL7B 3RPPA 2YV9A 4X0XA 5DQYA 4TN8A 3D5JA 3TRQA 3ZTLA 2FWHA 3C8EA 1QK8A 2IMEA 1M99A 3TJFA 4PTSA 1FAAA 1PKWA 4IQAA 3OR5A 4K1FA 4KSMA 4ILFA 4YQUA 1W89A 4OCEA 4ML1A 3ZZXA 3MWHA 2GTUA 3KGKA 3PPUA 1YF1A 1ACVA 1WOUA 4IGJA 2YZHA 3EVIA 2M46A 3LXTA 2C1YA 3FRCA 4HJMA 2FD3A 3DRNA 5A4WA 2X8CA 3D0ZA 6GSUA 1B48A 3HA9A 1Z7PA 18GSA 5IMAA 2VD1A 2FWFA 2IMIA 4DVCA 4K7OA 4K7NA 4HS1A 4HZ4A 1GTUA 1RQMA 4HZ2A 4TXOA 1OAZA 1K0MA 1X9WB 1I9DA 1WE0A 1WMJA 1R26A 2WGRA 3ZMKA 1SK1A 4IELA 4G0IA 5ECOB 1B4PA 5ELAA 1LJRA 4IJIA 1PMTA 2FGXA 1EGRA 4GQFA 4O92A 2HI7A 3C7MA 3IR4A 1XCCA 4JEDA 1M2DA 4DEJA 2P5QA 1VF2A 3CXGA 4F82A 1O7UA 4QL7A 1G7EA 2EIQA 1R5PA 5DBQA 3IK9A 2XBQA 5IO0A 2J23A 4XRAA 3VPTA 19GSA 4N10A 3M1GA 1TRWA 3ZRDA 1JLWA 4OFMA 3QD9A 2VOCA 3LWAA 2KLXA 3CRUA 1JZWA 2NBSA 1PD21 4IVFA 3L4NA 3TKSE 4OWYA 4F9ZA 4L5OA 2C0FA 5HR2A 2XPDA 2H30A 4WXTA 1Z5YE 2PGTA 1DE2A 3WGEA 4L5LA 2YANA 1RK4A 3QPMA 9GSSA 4XS6A 4N0ZA 2FY6A 1GTBA 2G2QA 3FYGA 1PKZA 5ECLB 2R37A 3IXRA 2HNLA 3FHKA 5H5SA 3H4KA 2ALBA 3P90A 1QMVA 20GSA 3WYWA 3HYPA 4WEYA 4HQSA 4HEA2 4BL7A 1X5CA 2OACA 2VO4A 3HDCA 2WDUA 2CV4A 2HYXA 3KTBA 4WETA 1X9SB 2JZSA 1R5AA 3SBCA 2UZ8A 2OKAA 2YZUA 2QKEA 3ZL5A 2L5LA 3JCML 5D9TA 4ECCA 5JCUA 2C0EA 3E3EA 3FR9A 3G9BA 1OE8A 1IYIA 1AQVA 2PUKC 1SYXA 4EVMA 2VCTA 3WGXA 2L4CA 3KZQA 1MDJA 2YWIA 3H93A 1GSUA 1B9XC 1E2YA 3N5OA 4PUFC 1A2LA 2IMFA 3GYKA 3D6IA 5IOXA 1YKAA 2KUCA 5D73A 2HXKA 1YF0A 1XFLA 4AF2A 4EKZA 4O7HA 2VL2C 3GKXA 2MYGA 1Q98A 2QGVA 2CVBA 4XIHA 4ZILA 3DEXA 2LJAA 5D9VA 3Q74A 1ST9A 3VURA 2PVOC 1M9BA 1GSDA 4WF4A 4K7IA 5CREA 4E8EA 3QFBC 3EE2A 2HT9A 4GLTA 1QUWA 3A2VA 5DCGA 1XWKA 3A2XA 3ZFLA 2HRKA 4BWQA 2YN1A 3KEBA 3HVVA 2BMXA 2H71A 2LRTA 4TXVA 2LNTA 3TKPA 2H74A 3KJYA 2AB6A 3ERFA 1GRXA 3VWXA 3TJKA 3TKRA 1H75A 4EUYA 2CX4A 1QXHA 1ABAA 5HR1A 3TJBA 2VCQA 2AYTA 5CRWA 5DJMA 1EZKA 1OE7A 4GSTA 3HXSA 4EO3A 4TR4A 2YWMA 3M3MA 2GSRA 4MF5A 5GZZB 2XC2A 4K0NA 2CVKA 3GHAA 3ZMLA 4JRRA 3K8NA 3Q6OA 3GURA 2I4AA 2VIMA 4POKA 3IV4A 5B6MA 1THXA 2VCXA 2F8FA 5ECKB 3G7JA 2VL9A 1V40A 5CRGA 4TVEA 2N5FA 2HRNA 1HNAA 1EEMA 3KCMA 3IAS2 2H1GA 2FUG2 4KDUA 3GUSA 1S3DA 3U6VA 1U87A 1HNCA 2JACA 3CYNA 1OYJA 4BA7A 5EL8A 4L0UA 1Z6MA 1A2MA 3P2AA 2PN8A 2L57A 1SKSB 3FR3A 2V2GA 3TRPA 1FB0A 1ERWA 3TJJA 1GUKA 5ABRA 5G5EA 4MK3A 3GL3A 4D73B 3M9JA 1PX6A 3M9KA 2CT6A 2NPBA 3C71A 2O7KA 1E6BA 3KD0A 1FHEA 2C3TA 4X43A 4Q5QA 1OC9B 4MPGA 1VF1A 4L0WA 4WF5A 3US3A 2VL3A 4N0VA 3EU4A 4EDYA 1NSWA 2H19A 3HJPA 3F63A 1U3AA 1WRYA 5ECNB 5ECPB 12GSA 2YWOA 1GTIA 1J08A 1WIKA 4WR5A 4O32A 4G0KA 5DALB 5ECQB
chains in the Genus database with same CATH superfamily
3F9UA 1URMA 4FXYP 3E0UA 2REMA 2TRXA 5IPGA 4PNFA 2IMKA 2LV3A 5HFIA 2VLTA 1A2JA 3EPTA 5A34A 1TW9A 2EC4A 1SKWB 1M7TA 5ELGA 2PPTA 1PN0A 2I9HA 2H75A 1GLPA 3GSSA 4JR6A 1SJ6A 4WBJA 1G6WA 2R5GA 4JZQA 2K6VA 1TDIA 4EF0A 4RUVA 5AIVA 1K0CA 2LRNA 1F6MC 3HJOA 4YQVA 1GSEA 3WGDA 4V1Ap 2VCZA 5FT3A 5IMCA 1MTCA 4KSOA 3IOSA 2E7PA 1U3IA 2DSAA 1AUCA 3FKFA 2GDRA 4MABA 2ZNMA 3A3TA 3RGBC 2O5VA 2H0IA 3HY2A 4TR3A 5ID2B 1YKCA 6GSSA 3VWWA 4MJAA 4NXIA 2OBKA 4IQ1A 1X5DA 4MDCA 1OVNA 3UVHA 1YZXA 6GSVA 4EDZA 4FYUA 2DMLA 5EVOA 2H66A 4YAVA 1KNGA 2B5EA 11GSA 3GV1A 5IMVA 3IE3A 1T00A 2VL2A 1R7HA 4ZXGA 2DC5A 2CZ3A 2O36A 3KIJA 2V1MA 1YY7A 1M2BA 5E59A 4V2NA 2IPAA 1T4YA 5F8BA 1ZYEA 5KEJA 2WCIA 4AJ7A 5HQPA 3GL5A 5JCGA 3TRXA 3EMXA 2E2MA 3VI7A 3PH9A 5AISA 3CSJA 3W8SA 4I97A 6GSTA 1EEJA 3O6TA 3CMIA 2IN3A 4TR1B 3KP8A 3O3TA 2H1DA 4NV5A 2CA8A 2H0HA 3VFIA 2DMMA 2CVDA 3GSTA 1ZZYA 2R0PA 4ZBDA 2G0FA 4ECJA 4K0GA 1JLVA 4QMKA 3GX0A 5DQSA 5B6NA 1YVLA 3DVWA 1KEBA 4PQHA 2HLSA 4BPYA 3TOTA 2N5AA 2WZSA 3NOFA 3ZIJA 3FEUA 5BRTA 2CZ2A 5EPFA 1SKRB 1BJXA 2LJKA 2CQ9A 3ME7A 3F6FA 1NHOA 4KA0A 2AJQB 2DJJA 4OCFA 5IPHA 4WR4A 1OC3A 4GQCA 4O5UA 5HFGA 4PURA 4XS4B 2O8VB 3ZYWA 3CTFA 2E2GA 2H0GA 5IMFA 3GH9A 3GTUB 1XBSA 5HR0A 2K8VA 1ZCPA 1MD4A 3F4RA 2HSMA 3DVXA 2OADA 3HJMA 2AV4A 3ED3A 2EIRA 2EIOA 2C80A 2GSQA 5J47A 2B1KA 1W4VA 2KP1A 4G9HA 4IJ3A 2H6XA 2A2RA 4KGIA 2R0CA 1MEKA 2LEGA 5IMZA 3RHCA 2FNOA 3PINA 2XBIA 1GULA 1HNBA 1T1VA 4FIWA 3UIWA 2NVLA 1TKDB 2I81A 1GSSA 1TU8A 5J5NA 1EWXA 4G0LA 2XHFA 3FK8A 2A4VA 2K9FA 1WP0A 14GSA 5CO3A 4QL9A 3J7Yb 1SL2B 3QFAC 4KUNA 4GSSA 4F0BA 4MLYA 4ZB8A 3QCPA 5ID2A 4MZCA 4NAXA 4IN0A 3UL3A 4YQMA 3HVSA 5INYA 5H5RA 5A5KA 5F0GA 4V2MA 4MF6A 4XTSA 2IFQA 2Z9SA 1GUHA 5BMUA 3G7IA 1V57A 2LRCA 3NZNA 1HQOA 4OMVA 1JHBA 4BVYB 4IP6A 4PNGA 3KMNA 4FYBA 4LA1A 1QFNA 4I2TA 5G5FA 6GSYA 4I8BA 4MJCA 4IHUA 5A4VA 5ECRB 4GTUA 2OE1A 2WW2A 2TRCP 2DLXA 5G2ZA 1GL8A 1WWJA 2ZUPA 1EOGA 2B6MA 3ZLPA 2LQQA 3TOUA 2R4VA 3WT1A 1XIYA 1T7PB 1KTEA 3UOMA 5IIZA 2JU5A 3HCZA 3NIVA 3EWLA 3D4MA 3W8JA 1NM3A 2WW3A 1S3AA 4JBBA 4E8HA 2KHPA 1SD9A 2JSYA 1J0FA 3WD6A 1LBKA 6GSWA 2L5OA 2O85A 2YJHA 5DAKB 7GSSA 1HD2A 5ECSA 2VCVA 1GP1A 2RLIA 5GSSA 4Z2UA 4KDYA 4N3ZA 4I5QA 1O85A 4YKFA 4KE3A 4CDOA 1F3AA 1BAYA 2GT6A 3APQA 3LSZA 4Q5FA 2RM6A 5G1LA 3A5WA 2H6YA 4N11A 2GGTA 2IL3A 1GNWA 3HVXA 3TCOA 1ON4A 1JZRA 1TXXA 1TRVA 3ZVJA 3CSIA 4ZB7A 2KOKA 2VUPA 1ERUA 2L6DA 5J41A 1LU4A 3TDGA 5JWQB 2KP2A 1XPVA 2FWEA 2YV7A 3MAKA 2EFDA 2DJ0A 1B9YC 1ZGNA 1MDIA 5A5HB 1I5GA 3FZ5A 2DJ1A 5A1NB 3ISOA 3QMXA 1PL1A 1O73A 3E9JB 5GAND 1MD3A 3HZ4A 3U5RE 4MZWA 4Q5RA 4KCEA 3D22A 1V58A 2WFCA 4RQXA 3BCKA 1GSQA 2B7JA 1AQWA 5G30A 2YOIA 3DWVA 3VPQA 3UBLA 3QOUA 1X0RA 2DKHA 1PQNA 4JU5A 3FY7A 1ML6A 4POBA 1XWBA 4MNNA 5J4VA 2TIRA 4I6XA 1M2AA 5ECMB 4PQIA 3I43A 4NHWA 5AN1A 2EFCA 4JR4A 1PL2A 5IOWA 2FA8A 3GNJA 2R3XA 1XXUA 3GMFA 2K18A 1FOHA 4G19A 1Y25A 3QAGA 3CSHA 2H1LA 2H72A 2EFEA 1BYEA 1GLQA 2RM5A 1CQGA 5DVBA 3CHXC 2YJ7A 1UVZA 2CX3A 3DD3A 1UN2A 3D21A 2X8GA 2F51A 3EMPA 1USBA 2LUSA 4LMWA 4HUAA 2OE3A 1XZOA 2GZYA 4KW6A 2P0GA 4GRFA 4X4JA 4LLRA 3UJ1A 3LORA 1A24A 2GQKA 1FVKA 2DJKA 4LMVA 5LNKe 2MMNA 1XVWA 4QQ7A 1GUMA 3D4TA 4K9ZA 4FYCA 3M0FA 4AKIA 4NWYA 5KOXA 2PMTA 3F8UA 2V32A 2M80A 2B1LA 2LS5A 4LL1B 2JL4A 1QQ2A 1XWGA 4J2FA 2N5BA 3RHBA 4YH2A 2YCDA 2X99A 1VF4A 2PERA 2QSIA 3DXBA 4EIPA 3F3QA 1XG8A 2WVZA 3LG6A 2P5RA 5COHA 2HSYA 1BQ7A 3LJRA 1SL0B 1XVQA 1NW2A 4TXOB 4MZBA 3MDKA 5F05A 3DYRA 5B8AA 2JADA 1F2EA 3ERGA 1A8YA 2M72A 3CTGA 4MH3A 2WRTA 4J57E 1AQXA 2ON7A 2QC7A 2YP6A 2IJYA 4KDXA 4CHSA 2GVPA 1K0OA 4TOPA 4MMMA 1XWCA 2GSTA 1JZDA 2RIIA 5CRDA 2VM1A 4AGSA 13GSA 3TU3B 3FMWA 2IIYA 3KXOA 3GN3A 1S3RA 1A23A 4K2DA 2FCHA 2LQOA 2HSHA 3GFKA 1ZMAA 2F9SA 1AIUA 2B5YA 4OO5A 4HJ2A 5B8BA 3L9UA 3C1RA 3L78A 2VD0A 4MCUA 3SWLA 1SD8A 1K0AA 3IC4A 4TW5A 5IQYA 4BVXB 1U6TA 3IDVA 4XRDA 1PGTA 3H8QA 3QR6A 4PUAA 4X1UA 1O6JA 2BTOT 1UC7A 3P7XA 2CAQA 2BJXA 3HHVA 3TGZA 1O8WA 3F3RA 3RDWA 4IP1A 5CYYA 2YPMA 4RQRA 3TJGA 1TI3A 3FZAA 5ECIB 4YAPA 1THOA 3KMOA 4H86A 5AGYA 3UARA 4HI7A 3DMLA 1Z7RA 4IW9A 2LKUA 1FB6A 1TP9A 1AW9A 4G01A 3IBHA 1TK5B 3PR8A 1GWCA 1N25A 3VK9A 16GSA 3ERWA 2GLRA 1O81A 5J4YA 3MSZA 3M8NA 4ECIA 1B4QA 4MPFA 1SK0A 4V1Ag 3IHQA 1ILOA 4K6XA 5JCWA 5J4UA 4ZL8A 3DKSA 4ZBBA 3HZ8A 3L9VA 5C04A 1FVJA 3APSA 5JWOB 3CQFA 2C3NA 5G1KA 1ZYQB 4D73A 2MMZA 4O5QA 4F03A 3GA4A 1QGVA 1FO5A 1FG4A 4PGTA 1H4OA 4F2IA 3KH9A 1T8EB 1TRSA 4LL4B 4FH8A 3QAVA 2HE3A 3TKSC 5D8IA 1I1IP 1SJZA 2GQLA 1V9WA 1OC9A 2O3EA 4AJ8A 4W66A 1T4ZA 1SK2A 4GCIA 4KX4A 1TTZA 3TKQA 3ZVJD 5EY6A 5ENUA 2HSNB 3LW9A 17GSA 4TRXA 2A2SA 4ULXA 3BOAA 5GAPD 3H79A 2DJ2A 4USSA 4AI6A 5IO2A 2PVQA 5DALA 1XW6A 8GSSA 1G7OA 2I1UA 2R2JA 1TRUA 4F0CA 2MMOA 3LEFA 1Y6EA 2R0GA 2WJUA 2H73A 2MBSA 1OKTA 2GQMA 1SVOA 5KN3A 2FWGA 2WW1A 2DIYA 1A0RP 2HRKB 1A8LA 3G7YA 4BWSA 1CQHA 3L9SA 3MNGA 4FO5A 3EINA 5D96A 4FQUA 5J3RA 3N9JA 3GKKA 3EU3A 4IS0A 3RPNA 4HOJA 3L0HA 2C3QA 5H5QA 2I3YA 3F4SA 3IPZA 4OFTA 1BF5A 2MMAA 4PHZC 3IA1A 3GKMA 4JE1A 1AAZA 4Z2TA 3TUEA 2DIZA 1EV9A 4IKHA 4RI6A 1EOHA 2H01A 5E4WA 1Z6NA 5KN0A 4A5PA 4BVXA 4KF9A 2AAWA 4NV2A 1SENA 3F0IA 2GS3A 3EYTA 2LSTA 1G0TA 4XCSA 2K8SA 2O87A 3FR6A 2QA2A 2H70A 4KB3A 2F8AA 2OE0A 3I9V2 3CRTA 3R3EA 4G10A 4KAEA 2L6CA 5KN2A 4XS1A 4OD7A 2VAFA 1PRXA 1ZYNA 2V6OA 5IM9A 3O76A 2AUVA 3ZIVA 5DCHA 3IRAA 1PX7A 2WVXB 1VRSD 4ZL7A 2IMDA 4MJEA 5A4UA 4AJ6A 4GDFA 3HKRA 1SVMA 3I6AA 1JZOA 1M9AA 3UAPA 4TR1A 2L4QA 1DUGA 1K3LA 2P31A 3BJ5A 4HQZA 1FOVA 2C4JA 1EGOA 4ISDA 4ECBA 2HRAA 4POMA 1K0BA 1OC8A 3BD2A 4KCAA 3BCIA 2C0GA 2X64A 4GWRA 2C8UA 1TOFA 1G6YA 3BBYA 5F06A 5AIXA 1BG1A 1F3BA 2ZCTA 3FZ4A 2H6ZA 4NPBA 1N2AA 1GH2A 2FA4A 6GSXA 3S9FA 10GSA 2NTOA 4I2UA 4L8EA 2VLUA 3KM6A 2DKIA 3UEMA 2WS2A 1N8JA 2HZEB 4J56E 2GZZA 3VLNA 2LJRA 1JFUA 3VWUA 2R6KA 3H1NA 3APOA 3RAZA 1IYHA 4XS4A 5D9XA 2OBIA 2X8HA 4DSRA 1X5EA 2D2ZA 2IWTA 4NMUA 2PU9C 4ZB6A 2AHEA 1O8XA 2F3MA 4DSSB 3GTUA 1V2AA 2A4HA 5ECHB 1AXDA 2LNSA 3TB2A 3F6DA 2H1AA 3R2QA 1GSFA 3DGQA 4NHZA 5A34B 1VGLA 5LD0A 4GSNA 4POLA 2PBJA 4EXJA 5CP1A 3C73A 4WBRD 4MP4A 3C1SA 2C0DA 1Z3EA 3UMAA 2JSZA 1XW5A 1A0FA 2JZTA 2DBCA 1SJIA 5FHIA 4OFNA 2B7KA 4Q5NA 2FHEA 4K8MA 2FLSA 1X9MB 3F4TA 3LYKA 3ZREA 2B5XA 1ZOFA 4ML6A 4G2EA 3KTLA 3V1WA 2VM2A 2WB9A 1SU9A 3DIEA 1PFOA 1C72A 1M0UA 1M3IA 4MA9A 4GXZA 1ERVA 2MBTA 5IMDA 4N30A 3IAM2 2B3SA 4AKHA 3LYPA 4V2LA 1PSQA 3TKSA 1GTAA 5HFKA 4ZIJA 4ACSA 2OJLA 3IC8A 1TI1A 1Z9HA 2O89A 1U88A 1GSYA 2H1BA 2XPEA 3VWVA 1R4WA 1YQ1A 5C00A 5CAXA 4EC0A 4GF0A 5FWGA 4HU9A 2E0QA 1K3OA 3ZFBA 3QDNA 2HFDA 1AC1A 3WT2A 1DBYA 1WPIA 4BVYA 5D93A 1NHYA 5GSTA 3IK7A 2WULA 3ZITA 4HDEA 5DDLA 1DE1A 3MYDA 2WZ9A 3RBTA 4KNDA 2V41A 1TJDA 4YKGA 1K0NA 2YWNA 4PXOA 1V98A 4ICYA 2DJ3A 3AY8A 4HU7A 1OKDA 3ME8A 3MIXA 1TU7A 3LGCA 2H8LA 22GSA 5KN1A 2GZPA 1HYUA 1K3YA 2VLVA 2CAIA 1DSBA 1EV4A 3KP9A 1K0DA 3EC3A 4P3YB 2VCWA 1TK8B 2JZRA 5D9WA 2GT5A 1PN9A 2LTKA 5DAKA 1XWAA 2NDOA 5CRHA 1BG5A 2HZFA 1SL1B 3KH7A 4RI7A 2HZEA 2V6KA 1SVLA 2ON5A 5B7CA 3Q19A 5J9BA 1ERTA 1F37A 4PX1A 1BEDA 4ZBAA 3GKNA 4ZB9A 3GH6A 1T3BA 4IBPA 4DSQA 3Q18A 3I69A 4DSSA 5LCZA 1B8XA 3GRXA 3W6GA 2HSMB 4KH7A 3VI5A 3UBKA 3J7Yk 5JWRB 3EURA 2MZCA 1S3CA 4CW9A 2L59A 3UVTA 5CNWA 2OA7A 4PQ1A 2GSSA 4MJBA 4TKYA 3LXZA 1XOAA 4PI2C 1YDKA 3QAWA 5F07A 5A5HA 1EP8A 4O5RA 1VF3A 4EE0A 5A1NA 4ID0A 2HQTA 1BX9A 3FW2A 2RUFA 1YJ6A 2RUEA 1SYRA 4Z7XA 1FW1A 1MDKA 4MH2A 1F9MA 1WJKA 3HD5A 2VKZG 2QA1A 1UA5A 5HR3A 2H76A 1KBNA 4OO4A 3PGTA 2HRFA 3P8WA 3LQ7A 3A2WA 1YEXA 1GNEA 1ZL9A 3HMJG 4XHMA 3GX8A 3GIXA 2YNXA 2PWJA 4TR0A 1PA3A 1RW1A 1J9BA 2J9HA 1YEPA 5DJLA 1EP7A 3LFLA 1TK0B 1XW9A 4WKWA 5J9CA 1XOBA 2ES7A 1Q4JA 2IFQB 4EL1A 3FZ9A 5BMUB 5G31A 5L71A 4ZL9A 3CBUA 4MF7A 4BL7B 3RPPA 2YV9A 4X0XA 5DQYA 4TN8A 3D5JA 3TRQA 3ZTLA 2FWHA 3C8EA 1QK8A 2IMEA 1M99A 3TJFA 4PTSA 1FAAA 1PKWA 4IQAA 3OR5A 4K1FA 4KSMA 4ILFA 4YQUA 1W89A 4OCEA 4ML1A 3ZZXA 3MWHA 2GTUA 3KGKA 3PPUA 1YF1A 4K5SA 1ACVA 1WOUA 4IGJA 2YZHA 3EVIA 2M46A 3LXTA 2C1YA 3FRCA 4HJMA 2FD3A 3HVNA 3DRNA 5A4WA 2X8CA 3D0ZA 6GSUA 1B48A 3HA9A 1Z7PA 18GSA 5IMAA 2VD1A 2FWFA 2IMIA 1YEWC 4DVCA 4CY6A 4K7OA 4K7NA 4HS1A 4HZ4A 1GTUA 1RQMA 4HZ2A 4TXOA 1OAZA 1K0MA 1X9WB 1I9DA 1WE0A 1WMJA 1R26A 2WGRA 3ZMKA 1SK1A 4IELA 4G0IA 5ECOB 1B4PA 5ELAA 1LJRA 4IJIA 1PMTA 2FGXA 1EGRA 1M3JA 4GQFA 4O92A 2HI7A 2OT3A 3C7MA 3IR4A 1XCCA 4JEDA 1M2DA 4DEJA 2P5QA 1VF2A 3CXGA 1Y1UA 4F82A 1O7UA 4QL7A 1G7EA 4E68A 2EIQA 1R5PA 5DBQA 3IK9A 2X4AA 2XBQA 5IO0A 2J23A 4XRAA 3VPTA 19GSA 4N10A 3M1GA 1TRWA 3ZRDA 1JLWA 4OFMA 3QD9A 2VOCA 3LWAA 2KLXA 3CRUA 1JZWA 2NBSA 1PD21 4IVFA 3L4NA 3TKSE 4OWYA 4F9ZA 4L5OA 2C0FA 5HR2A 2XPDA 2H30A 4WXTA 1Z5YE 2PGTA 1DE2A 3WGEA 4L5LA 2YANA 4HSCX 4CY8A 1RK4A 3QPMA 9GSSA 4XS6A 4N0ZA 2FY6A 1GTBA 2G2QA 3FYGA 1PKZA 5ECLB 2R37A 3IXRA 2HNLA 3FHKA 5H5SA 3H4KA 2ALBA 3P90A 1QMVA 20GSA 3WYWA 4EIQA 3HYPA 4WEYA 4HQSA 4HEA2 4BL7A 1X5CA 1ZYPA 4Z2RA 2OACA 2VO4A 3HDCA 2WDUA 2CV4A 2HYXA 3KTBA 4WETA 1X9SB 4AKGA 2JZSA 1R5AA 3SBCA 2UZ8A 2OKAA 2YZUA 2QKEA 3ZL5A 2L5LA 3JCML 5D9TA 4ECCA 5JCUA 2C0EA 3E3EA 3FR9A 3G9BA 1OE8A 1IYIA 1AQVA 2PUKC 1SYXA 4EVMA 2VCTA 3WGXA 2L4CA 2WW0A 3KZQA 1MDJA 2UV8G 3CWGA 2YWIA 3H93A 1GSUA 1B9XC 1E2YA 3N5OA 2A2PA 4PUFC 1A2LA 2IMFA 2HSNA 3D6IA 3GYKA 5IOXA 1YKAA 2KUCA 5D73A 3RFRC 2HXKA 1YF0A 1XFLA 4AF2A 2X49A 4EKZA 4O7HA 2VL2C 3GKXA 2MYGA 1Q98A 2QGVA 4PI0C 2CVBA 4XIHA 4ZILA 3DEXA 2LJAA 5D9VA 3Q74A 1ST9A 3VURA 2PVOC 1M9BA 1GSDA 4WF4A 4K7IA 5CREA 4E8EA 3QFBC 3EE2A 2HT9A 4GLTA 1QUWA 3A2VA 5DCGA 1XWKA 3A2XA 3ZFLA 2HRKA 4BWQA 2YN1A 3KEBA 3HVVA 2BMXA 2H71A 2LRTA 4TXVA 2LNTA 3TKPA 2H74A 3KJYA 2AB6A 1S4BP 3ERFA 1GRXA 3VWXA 3TJKA 3TKRA 1H75A 4EUYA 2CX4A 1QXHA 1ABAA 5HR1A 3TJBA 2VCQA 2AYTA 5CRWA 5DJMA 1EZKA 1OE7A 4K5RA 4GSTA 3HXSA 4EO3A 4TR4A 2YWMA 3M3MA 2GSRA 4MF5A 5GZZB 2XC2A 2WVYA 4K0NA 2CVKA 3GHAA 3ZMLA 4JRRA 3K8NA 3Q6OA 2EFHA 3GURA 2I4AA 2VIMA 4POKA 3IV4A 5B6MA 1THXA 2VCXA 2F8FA 5ECKB 3G7JA 2VL9A 1V40A 5CRGA 4TVEA 2N5FA 2HRNA 1HNAA 1EEMA 3KCMA 3IAS2 2H1GA 2FUG2 2WVXA 4KDUA 3GUSA 4K2XA 1S3DA 3U6VA 1U87A 1HNCA 2JACA 3CYNA 1OYJA 4BA7A 5EL8A 4L0UA 1Z6MA 1A2MA 3P2AA 3A5IA 2PN8A 2L57A 1SKSB 3FR3A 2V2GA 3TRPA 1FB0A 1ERWA 3TJJA 1GUKA 4BIKA 5ABRA 5G5EA 4MK3A 3GL3A 4D73B 3M9JA 1PX6A 3M9KA 5KOWA 2CT6A 2NPBA 3C71A 4AKXB 2O7KA 1E6BA 5J40A 3KD0A 1FHEA 2C3TA 4X43A 4Q5QA 1OC9B 3IHGA 4MPGA 1VF1A 4L0WA 4WF5A 3US3A 2VL3A 4N0VA 3EU4A 4EDYA 1NSWA 2H19A 3HJPA 3F63A 1U3AA 1WRYA 5ECNB 5ECPB 1TXUA 12GSA 2YWOA 1GTIA 1J08A 1WIKA 4WR5A 4O32A 4G0KA 5DALB 5ECQB
chains in the Genus database with same CATH topology
3F9UA 1URMA 3E0UA 2REMA 2TRXA 5IPGA 4PNFA 2IMKA 2LV3A 5HFIA 2VLTA 1A2JA 3EPTA 5A34A 1TW9A 2EC4A 1SKWB 1M7TA 5ELGA 2PPTA 1PN0A 2I9HA 2H75A 1GLPA 3GSSA 4JR6A 1SJ6A 4WBJA 1G6WA 2R5GA 4JZQA 2K6VA 1TDIA 4EF0A 4RUVA 5AIVA 1K0CA 2LRNA 1F6MC 3HJOA 4YQVA 1GSEA 3WGDA 4V1Ap 2VCZA 5FT3A 5IMCA 1MTCA 4KSOA 3IOSA 2E7PA 1U3IA 2DSAA 1AUCA 3FKFA 2GDRA 4MABA 2ZNMA 3A3TA 2O5VA 2H0IA 3HY2A 4TR3A 5ID2B 1YKCA 6GSSA 3VWWA 4MJAA 4NXIA 2OBKA 4IQ1A 1X5DA 4MDCA 1OVNA 3UVHA 1YZXA 6GSVA 4EDZA 4FYUA 2DMLA 5EVOA 2H66A 4YAVA 1KNGA 2B5EA 11GSA 3GV1A 5IMVA 3IE3A 1T00A 2VL2A 1R7HA 4ZXGA 2DC5A 2CZ3A 3KIJA 2V1MA 1YY7A 1M2BA 5E59A 4V2NA 2IPAA 1T4YA 5F8BA 1ZYEA 5KEJA 2WCIA 4AJ7A 5HQPA 3GL5A 5JCGA 3TRXA 3EMXA 2E2MA 3VI7A 3PH9A 5AISA 3CSJA 3W8SA 4I97A 6GSTA 1EEJA 3O6TA 3CMIA 2IN3A 4TR1B 3KP8A 3O3TA 2H1DA 4NV5A 2CA8A 2H0HA 3VFIA 2DMMA 2CVDA 3GSTA 1ZZYA 2R0PA 4ZBDA 2G0FA 4ECJA 4K0GA 1JLVA 4QMKA 3GX0A 5DQSA 5B6NA 1YVLA 3DVWA 1KEBA 4PQHA 2HLSA 4BPYA 3TOTA 2N5AA 3NOFA 3ZIJA 3FEUA 5BRTA 2CZ2A 5EPFA 1SKRB 1BJXA 2LJKA 2CQ9A 3ME7A 3F6FA 1NHOA 4KA0A 2AJQB 2DJJA 4OCFA 5IPHA 4WR4A 1OC3A 4GQCA 4O5UA 5HFGA 4PURA 4XS4B 2O8VB 3ZYWA 3CTFA 2E2GA 2H0GA 5IMFA 3GH9A 3GTUB 1XBSA 5HR0A 2K8VA 1ZCPA 1MD4A 3F4RA 2HSMA 3DVXA 2OADA 3HJMA 2AV4A 3ED3A 2EIRA 2EIOA 2C80A 2GSQA 5J47A 2B1KA 1W4VA 2KP1A 4G9HA 4IJ3A 2H6XA 2A2RA 4KGIA 2R0CA 1MEKA 2LEGA 5IMZA 3RHCA 2FNOA 3PINA 2XBIA 1GULA 1HNBA 1T1VA 4FIWA 3UIWA 2NVLA 1TKDB 2I81A 1GSSA 1TU8A 5J5NA 1EWXA 4G0LA 2XHFA 3FK8A 2A4VA 2K9FA 1WP0A 14GSA 5CO3A 4QL9A 3J7Yb 1SL2B 3QFAC 4KUNA 4GSSA 4F0BA 4MLYA 4ZB8A 3QCPA 5ID2A 4MZCA 4NAXA 4IN0A 3UL3A 4YQMA 3HVSA 5INYA 5H5RA 5A5KA 5F0GA 4V2MA 4MF6A 4XTSA 2IFQA 2Z9SA 1GUHA 5BMUA 3G7IA 1V57A 2LRCA 3NZNA 1HQOA 4OMVA 1JHBA 4BVYB 4IP6A 4PNGA 3KMNA 4FYBA 4LA1A 1QFNA 4I2TA 5G5FA 6GSYA 4I8BA 4MJCA 4IHUA 5A4VA 5ECRB 4GTUA 2OE1A 2TRCP 2DLXA 5G2ZA 1GL8A 1WWJA 2ZUPA 1EOGA 2B6MA 3ZLPA 2LQQA 3TOUA 2R4VA 3WT1A 1XIYA 1T7PB 1KTEA 3UOMA 5IIZA 2JU5A 3HCZA 3NIVA 3EWLA 3D4MA 3W8JA 1NM3A 1S3AA 4JBBA 4E8HA 2KHPA 1SD9A 2JSYA 1J0FA 3WD6A 1LBKA 6GSWA 2L5OA 2O85A 2YJHA 5DAKB 7GSSA 1HD2A 5ECSA 2VCVA 1GP1A 2RLIA 5GSSA 4Z2UA 4KDYA 4N3ZA 4I5QA 1O85A 4YKFA 4KE3A 4CDOA 1F3AA 1BAYA 2GT6A 3APQA 3LSZA 4Q5FA 2RM6A 5G1LA 3A5WA 2H6YA 4N11A 2GGTA 2IL3A 1GNWA 3HVXA 3TCOA 1ON4A 1JZRA 1TXXA 1TRVA 3ZVJA 3CSIA 4ZB7A 2KOKA 2VUPA 1ERUA 2L6DA 5J41A 1LU4A 3TDGA 5JWQB 2KP2A 1XPVA 2FWEA 2YV7A 3MAKA 2EFDA 2DJ0A 1B9YC 1ZGNA 1MDIA 5A5HB 1I5GA 3FZ5A 2DJ1A 5A1NB 3ISOA 3QMXA 1PL1A 1O73A 3E9JB 5GAND 1MD3A 3HZ4A 3U5RE 4MZWA 4Q5RA 4KCEA 3D22A 1V58A 2WFCA 4RQXA 3BCKA 1GSQA 2B7JA 1AQWA 5G30A 2YOIA 3DWVA 3VPQA 3UBLA 3QOUA 1X0RA 2DKHA 1PQNA 4JU5A 3FY7A 1ML6A 4POBA 1XWBA 4MNNA 5J4VA 2TIRA 4I6XA 1M2AA 5ECMB 4PQIA 3I43A 4NHWA 5AN1A 2EFCA 4JR4A 1PL2A 5IOWA 2FA8A 3GNJA 2R3XA 1XXUA 3GMFA 2K18A 1FOHA 4G19A 1Y25A 3QAGA 3CSHA 2H1LA 2H72A 2EFEA 1BYEA 1GLQA 2RM5A 1CQGA 5DVBA 2YJ7A 1UVZA 2CX3A 3DD3A 1UN2A 3D21A 2X8GA 2F51A 3EMPA 1USBA 2LUSA 4LMWA 4HUAA 2OE3A 1XZOA 2GZYA 4KW6A 2P0GA 4GRFA 4X4JA 4LLRA 3UJ1A 3LORA 1A24A 2GQKA 1FVKA 2DJKA 4LMVA 5LNKe 2MMNA 1XVWA 4QQ7A 1GUMA 3D4TA 4K9ZA 4FYCA 3M0FA 4AKIA 4NWYA 5KOXA 2PMTA 3F8UA 2V32A 2M80A 2B1LA 2LS5A 4LL1B 2JL4A 1QQ2A 1XWGA 4J2FA 2N5BA 3RHBA 4YH2A 2YCDA 2X99A 1VF4A 2PERA 2QSIA 3DXBA 4EIPA 3F3QA 3LG6A 2P5RA 5COHA 2HSYA 1BQ7A 3LJRA 1SL0B 1XVQA 1NW2A 4TXOB 4MZBA 3MDKA 5F05A 3DYRA 5B8AA 2JADA 1F2EA 3ERGA 1A8YA 2M72A 3CTGA 4MH3A 2WRTA 4J57E 1AQXA 2ON7A 2QC7A 2YP6A 2IJYA 4KDXA 4CHSA 2GVPA 1K0OA 4TOPA 4MMMA 1XWCA 2GSTA 1JZDA 2RIIA 5CRDA 2VM1A 4AGSA 13GSA 3TU3B 3FMWA 2IIYA 3KXOA 3GN3A 1A23A 4K2DA 2FCHA 2LQOA 2HSHA 3GFKA 1ZMAA 2F9SA 1AIUA 2B5YA 4OO5A 4HJ2A 5B8BA 3L9UA 3C1RA 3L78A 2VD0A 4MCUA 3SWLA 1SD8A 1K0AA 3IC4A 4TW5A 5IQYA 4BVXB 1U6TA 3IDVA 4XRDA 1PGTA 3H8QA 3QR6A 4PUAA 4X1UA 1O6JA 2BTOT 1UC7A 3P7XA 2CAQA 2BJXA 3HHVA 3TGZA 1O8WA 3F3RA 3RDWA 4IP1A 5CYYA 2YPMA 4RQRA 3TJGA 1TI3A 3FZAA 5ECIB 4YAPA 1THOA 3KMOA 4H86A 5AGYA 3UARA 4HI7A 3DMLA 1Z7RA 4IW9A 2LKUA 1FB6A 1TP9A 1AW9A 4G01A 3IBHA 1TK5B 3PR8A 1GWCA 1N25A 3VK9A 16GSA 3ERWA 2GLRA 1O81A 5J4YA 3MSZA 3M8NA 4ECIA 1B4QA 4MPFA 1SK0A 4V1Ag 3IHQA 1ILOA 4K6XA 5JCWA 5J4UA 4ZL8A 3DKSA 4ZBBA 3HZ8A 3L9VA 5C04A 1FVJA 3APSA 5JWOB 2C3NA 5G1KA 1ZYQB 4D73A 2MMZA 4O5QA 4F03A 3GA4A 1QGVA 1FO5A 1FG4A 4PGTA 1H4OA 4F2IA 3KH9A 1T8EB 1TRSA 4LL4B 4FH8A 3QAVA 2HE3A 3TKSC 5D8IA 1SJZA 2GQLA 1V9WA 1OC9A 4AJ8A 4W66A 1T4ZA 1SK2A 4GCIA 4KX4A 1TTZA 3TKQA 3ZVJD 5EY6A 5ENUA 2HSNB 3LW9A 17GSA 4TRXA 2A2SA 4ULXA 3BOAA 5GAPD 3H79A 2DJ2A 4USSA 4AI6A 5IO2A 2PVQA 5DALA 1XW6A 8GSSA 1G7OA 2I1UA 2R2JA 1TRUA 4F0CA 2MMOA 3LEFA 1Y6EA 2R0GA 2WJUA 2H73A 2MBSA 1OKTA 2GQMA 1SVOA 5KN3A 2FWGA 2DIYA 1A0RP 2HRKB 1A8LA 3G7YA 4BWSA 1CQHA 3L9SA 3MNGA 4FO5A 3EINA 5D96A 4FQUA 5J3RA 3N9JA 3GKKA 3EU3A 4IS0A 3RPNA 4HOJA 3L0HA 2C3QA 5H5QA 2I3YA 3F4SA 3IPZA 4OFTA 1BF5A 2MMAA 3IA1A 3GKMA 4JE1A 1AAZA 4Z2TA 3TUEA 2DIZA 1EV9A 4IKHA 4RI6A 1EOHA 2H01A 5E4WA 1Z6NA 5KN0A 4A5PA 4BVXA 4KF9A 2AAWA 4NV2A 1SENA 3F0IA 2GS3A 3EYTA 2LSTA 1G0TA 4XCSA 2K8SA 2O87A 3FR6A 2QA2A 2H70A 4KB3A 2F8AA 2OE0A 3I9V2 3CRTA 3R3EA 4G10A 4KAEA 2L6CA 5KN2A 4XS1A 4OD7A 2VAFA 1PRXA 1ZYNA 2V6OA 5IM9A 3O76A 2AUVA 3ZIVA 5DCHA 3IRAA 1PX7A 1VRSD 4ZL7A 2IMDA 4MJEA 5A4UA 4AJ6A 4GDFA 3HKRA 1SVMA 3I6AA 1JZOA 1M9AA 3UAPA 4TR1A 2L4QA 1DUGA 1K3LA 2P31A 3BJ5A 4HQZA 1FOVA 2C4JA 1EGOA 4ISDA 4ECBA 2HRAA 4POMA 1K0BA 1OC8A 3BD2A 4KCAA 3BCIA 2C0GA 2X64A 4GWRA 2C8UA 1TOFA 1G6YA 3BBYA 5F06A 5AIXA 1BG1A 1F3BA 2ZCTA 3FZ4A 2H6ZA 4NPBA 1N2AA 1GH2A 2FA4A 6GSXA 3S9FA 10GSA 2NTOA 4I2UA 4L8EA 2VLUA 3KM6A 2DKIA 3UEMA 2WS2A 1N8JA 2HZEB 4J56E 2GZZA 3VLNA 2LJRA 1JFUA 3VWUA 2R6KA 3H1NA 3APOA 3RAZA 1IYHA 4XS4A 5D9XA 2OBIA 2X8HA 4DSRA 1X5EA 2D2ZA 2IWTA 4NMUA 2PU9C 4ZB6A 2AHEA 1O8XA 2F3MA 4DSSB 3GTUA 1V2AA 2A4HA 5ECHB 1AXDA 2LNSA 3TB2A 3F6DA 2H1AA 3R2QA 1GSFA 3DGQA 4NHZA 5A34B 1VGLA 5LD0A 4GSNA 4POLA 2PBJA 4EXJA 5CP1A 3C73A 4WBRD 4MP4A 3C1SA 2C0DA 1Z3EA 3UMAA 2JSZA 1XW5A 1A0FA 2JZTA 2DBCA 1SJIA 5FHIA 4OFNA 2B7KA 4Q5NA 2FHEA 4K8MA 2FLSA 1X9MB 3F4TA 3LYKA 3ZREA 2B5XA 1ZOFA 4ML6A 4G2EA 3KTLA 3V1WA 2WB9A 1SU9A 2VM2A 3DIEA 1C72A 1M0UA 4MA9A 4GXZA 1ERVA 2MBTA 5IMDA 4N30A 3IAM2 2B3SA 4AKHA 3LYPA 4V2LA 1PSQA 3TKSA 1GTAA 5HFKA 4ZIJA 4ACSA 2OJLA 3IC8A 1TI1A 1Z9HA 2O89A 1U88A 1GSYA 2H1BA 2XPEA 3VWVA 1R4WA 1YQ1A 5C00A 5CAXA 4EC0A 4GF0A 5FWGA 4HU9A 2E0QA 1K3OA 3ZFBA 3QDNA 2HFDA 1AC1A 3WT2A 1DBYA 1WPIA 4BVYA 5D93A 1NHYA 5GSTA 3IK7A 2WULA 3ZITA 4HDEA 5DDLA 1DE1A 3MYDA 2WZ9A 3RBTA 4KNDA 2V41A 1TJDA 4YKGA 1K0NA 2YWNA 4PXOA 1V98A 4ICYA 2DJ3A 3AY8A 4HU7A 1OKDA 3ME8A 3MIXA 1TU7A 3LGCA 2H8LA 22GSA 5KN1A 2GZPA 1HYUA 1K3YA 2VLVA 2CAIA 1DSBA 1EV4A 3KP9A 1K0DA 3EC3A 4P3YB 2VCWA 1TK8B 2JZRA 5D9WA 2GT5A 1PN9A 2LTKA 5DAKA 1XWAA 2NDOA 5CRHA 1BG5A 2HZFA 1SL1B 3KH7A 4RI7A 2HZEA 2V6KA 1SVLA 2ON5A 5B7CA 3Q19A 5J9BA 1ERTA 1F37A 4PX1A 1BEDA 4ZBAA 3GKNA 4ZB9A 3GH6A 1T3BA 4IBPA 4DSQA 3Q18A 3I69A 4DSSA 5LCZA 1B8XA 3GRXA 3W6GA 2HSMB 4KH7A 3VI5A 3UBKA 3J7Yk 5JWRB 3EURA 2MZCA 1S3CA 4CW9A 2L59A 3UVTA 5CNWA 2OA7A 4PQ1A 2GSSA 4MJBA 4TKYA 3LXZA 1XOAA 1YDKA 3QAWA 5F07A 5A5HA 1EP8A 4O5RA 1VF3A 4EE0A 5A1NA 4ID0A 2HQTA 1BX9A 3FW2A 2RUFA 1YJ6A 2RUEA 1SYRA 4Z7XA 1FW1A 1MDKA 4MH2A 1F9MA 1WJKA 3HD5A 2VKZG 2QA1A 1UA5A 5HR3A 2H76A 1KBNA 4OO4A 3PGTA 2HRFA 3P8WA 3LQ7A 3A2WA 1YEXA 1GNEA 1ZL9A 3HMJG 4XHMA 3GX8A 3GIXA 2YNXA 2PWJA 4TR0A 1PA3A 1RW1A 1J9BA 2J9HA 1YEPA 5DJLA 1EP7A 3LFLA 1TK0B 1XW9A 4WKWA 5J9CA 1XOBA 2ES7A 1Q4JA 2IFQB 4EL1A 3FZ9A 5BMUB 5G31A 5L71A 4ZL9A 3CBUA 4MF7A 4BL7B 3RPPA 2YV9A 4X0XA 5DQYA 4TN8A 3D5JA 3TRQA 3ZTLA 2FWHA 3C8EA 1QK8A 2IMEA 1M99A 3TJFA 4PTSA 1FAAA 1PKWA 4IQAA 3OR5A 4K1FA 4KSMA 4ILFA 4YQUA 1W89A 4OCEA 4ML1A 3ZZXA 3MWHA 2GTUA 3KGKA 3PPUA 1YF1A 4K5SA 1ACVA 1WOUA 4IGJA 2YZHA 3EVIA 2M46A 3LXTA 2C1YA 3FRCA 4HJMA 2FD3A 3DRNA 5A4WA 2X8CA 3D0ZA 6GSUA 1B48A 3HA9A 1Z7PA 18GSA 5IMAA 2VD1A 2FWFA 2IMIA 4DVCA 4CY6A 4K7OA 4K7NA 4HS1A 4HZ4A 1GTUA 1RQMA 4HZ2A 4TXOA 1OAZA 1K0MA 1X9WB 1I9DA 1WE0A 1WMJA 1R26A 2WGRA 3ZMKA 1SK1A 4IELA 4G0IA 5ECOB 1B4PA 5ELAA 1LJRA 4IJIA 1PMTA 2FGXA 1EGRA 4GQFA 4O92A 2HI7A 2OT3A 3C7MA 3IR4A 1XCCA 4JEDA 1M2DA 4DEJA 2P5QA 1VF2A 3CXGA 1Y1UA 4F82A 1O7UA 4QL7A 1G7EA 4E68A 2EIQA 1R5PA 5DBQA 3IK9A 2X4AA 2XBQA 5IO0A 2J23A 4XRAA 3VPTA 19GSA 4N10A 3M1GA 1TRWA 3ZRDA 1JLWA 4OFMA 3QD9A 2VOCA 3LWAA 2KLXA 3CRUA 1JZWA 2NBSA 1PD21 4IVFA 3L4NA 3TKSE 4OWYA 4F9ZA 4L5OA 2C0FA 5HR2A 2XPDA 2H30A 4WXTA 1Z5YE 2PGTA 1DE2A 3WGEA 4L5LA 2YANA 4CY8A 1RK4A 3QPMA 9GSSA 4XS6A 4N0ZA 2FY6A 1GTBA 2G2QA 3FYGA 1PKZA 5ECLB 2R37A 3IXRA 2HNLA 3FHKA 5H5SA 3H4KA 2ALBA 3P90A 1QMVA 20GSA 3WYWA 4EIQA 3HYPA 4WEYA 4HQSA 4HEA2 4BL7A 1X5CA 1ZYPA 4Z2RA 2OACA 2VO4A 3HDCA 2WDUA 2CV4A 2HYXA 3KTBA 4WETA 1X9SB 4AKGA 2JZSA 1R5AA 3SBCA 2UZ8A 2OKAA 2YZUA 2QKEA 3ZL5A 2L5LA 3JCML 5D9TA 4ECCA 5JCUA 2C0EA 3E3EA 3FR9A 3G9BA 1OE8A 1IYIA 1AQVA 2PUKC 1SYXA 4EVMA 2VCTA 3WGXA 2L4CA 3KZQA 1MDJA 2UV8G 3CWGA 2YWIA 3H93A 1GSUA 1B9XC 1E2YA 3N5OA 2A2PA 4PUFC 1A2LA 2IMFA 2HSNA 3D6IA 3GYKA 5IOXA 1YKAA 2KUCA 5D73A 2HXKA 1YF0A 1XFLA 4AF2A 2X49A 4EKZA 4O7HA 2VL2C 3GKXA 2MYGA 1Q98A 2QGVA 2CVBA 4XIHA 4ZILA 3DEXA 2LJAA 5D9VA 3Q74A 1ST9A 3VURA 2PVOC 1M9BA 1GSDA 4WF4A 4K7IA 5CREA 4E8EA 3QFBC 3EE2A 2HT9A 4GLTA 1QUWA 3A2VA 5DCGA 1XWKA 3A2XA 3ZFLA 2HRKA 4BWQA 2YN1A 3KEBA 3HVVA 2BMXA 2H71A 2LRTA 4TXVA 2LNTA 3TKPA 2H74A 3KJYA 2AB6A 3ERFA 1GRXA 3VWXA 3TJKA 3TKRA 1H75A 4EUYA 2CX4A 1QXHA 1ABAA 5HR1A 3TJBA 2VCQA 2AYTA 5CRWA 5DJMA 1EZKA 1OE7A 4K5RA 4GSTA 3HXSA 4EO3A 4TR4A 2YWMA 3M3MA 2GSRA 4MF5A 5GZZB 2XC2A 4K0NA 2CVKA 3GHAA 3ZMLA 4JRRA 3K8NA 3Q6OA 2EFHA 3GURA 2I4AA 2VIMA 4POKA 3IV4A 5B6MA 1THXA 2VCXA 2F8FA 5ECKB 3G7JA 2VL9A 1V40A 5CRGA 4TVEA 2N5FA 2HRNA 1HNAA 1EEMA 3KCMA 3IAS2 2H1GA 2FUG2 4KDUA 3GUSA 4K2XA 1S3DA 3U6VA 1U87A 1HNCA 2JACA 3CYNA 1OYJA 4BA7A 5EL8A 4L0UA 1Z6MA 1A2MA 3P2AA 3A5IA 2PN8A 2L57A 1SKSB 3FR3A 2V2GA 3TRPA 1FB0A 1ERWA 3TJJA 1GUKA 5ABRA 5G5EA 4MK3A 3GL3A 4D73B 3M9JA 1PX6A 3M9KA 5KOWA 2CT6A 2NPBA 3C71A 4AKXB 2O7KA 1E6BA 5J40A 3KD0A 1FHEA 2C3TA 4X43A 4Q5QA 1OC9B 3IHGA 4MPGA 1VF1A 4L0WA 4WF5A 3US3A 2VL3A 4N0VA 3EU4A 4EDYA 1NSWA 2H19A 3HJPA 3F63A 1U3AA 1WRYA 5ECNB 5ECPB 1TXUA 12GSA 2YWOA 1GTIA 1J08A 1WIKA 4WR5A 4O32A 4G0KA 5DALB 5ECQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9U A;  1URM A;  3E0U A;  2REM A;  2TRX A;  5IPG A;  4PNF A;  2IMK A;  2LV3 A;  5HFI A;  2VLT A;  1A2J A;  1TW9 A;  2EC4 A;  1SKW B;  1M7T A;  5ELG A;  2PPT A;  2I9H A;  2H75 A;  1GLP A;  3GSS A;  4JR6 A;  1SJ6 A;  4WBJ A;  1G6W A;  2R5G A;  4JZQ A;  2K6V A;  1TDI A;  4EF0 A;  4RUV A;  5AIV A;  1K0C A;  2LRN A;  1F6M C;  3HJO A;  4YQV A;  1GSE A;  3WGD A;  4V1A p;  2VCZ A;  5FT3 A;  5IMC A;  1MTC A;  4KSO A;  3IOS A;  2E7P A;  1U3I A;  2DSA A;  1AUC A;  3FKF A;  2GDR A;  4MAB A;  2ZNM A;  3A3T A;  2H0I A;  3HY2 A;  4TR3 A;  5ID2 B;  1YKC A;  6GSS A;  3VWW A;  4MJA A;  4NXI A;  2OBK A;  4IQ1 A;  1X5D A;  4MDC A;  1OVN A;  3UVH A;  1YZX A;  6GSV A;  4EDZ A;  4FYU A;  2DML A;  5EVO A;  2H66 A;  4YAV A;  1KNG A;  2B5E A;  11GS A;  3GV1 A;  5IMV A;  3IE3 A;  1T00 A;  2VL2 A;  1R7H A;  4ZXG A;  2DC5 A;  2CZ3 A;  3KIJ A;  2V1M A;  1YY7 A;  1M2B A;  5E59 A;  4V2N A;  2IPA A;  1T4Y A;  5F8B A;  1ZYE A;  5KEJ A;  2WCI A;  4AJ7 A;  5HQP A;  3GL5 A;  5JCG A;  3TRX A;  3EMX A;  2E2M A;  3VI7 A;  3PH9 A;  5AIS A;  3CSJ A;  3W8S A;  4I97 A;  6GST A;  1EEJ A;  3O6T A;  3CMI A;  2IN3 A;  4TR1 B;  3KP8 A;  3O3T A;  2H1D A;  4NV5 A;  2CA8 A;  2H0H A;  3VFI A;  2DMM A;  2CVD A;  3GST A;  1ZZY A;  4ZBD A;  2G0F A;  4ECJ A;  4K0G A;  1JLV A;  3GX0 A;  5DQS A;  5B6N A;  3DVW A;  1KEB A;  4PQH A;  2HLS A;  4BPY A;  3TOT A;  2N5A A;  3NOF A;  3ZIJ A;  3FEU A;  2CZ2 A;  5EPF A;  1SKR B;  1BJX A;  2LJK A;  2CQ9 A;  3ME7 A;  3F6F A;  1NHO A;  4KA0 A;  2AJQ B;  2DJJ A;  4OCF A;  5IPH A;  4WR4 A;  1OC3 A;  4GQC A;  5HFG A;  4PUR A;  4XS4 B;  2O8V B;  3ZYW A;  3CTF A;  2E2G A;  2H0G A;  5IMF A;  3GH9 A;  3GTU B;  1XBS A;  5HR0 A;  2K8V A;  1ZCP A;  1MD4 A;  3F4R A;  2HSM A;  3DVX A;  2OAD A;  3HJM A;  2AV4 A;  3ED3 A;  2EIR A;  2EIO A;  2C80 A;  2GSQ A;  2B1K A;  1W4V A;  2KP1 A;  4G9H A;  4IJ3 A;  2H6X A;  2A2R A;  4KGI A;  1MEK A;  2LEG A;  5IMZ A;  3RHC A;  2FNO A;  3PIN A;  2XBI A;  1GUL A;  1HNB A;  1T1V A;  4FIW A;  3UIW A;  2NVL A;  1TKD B;  2I81 A;  1GSS A;  1TU8 A;  5J5N A;  1EWX A;  4G0L A;  2XHF A;  3FK8 A;  2A4V A;  2K9F A;  1WP0 A;  14GS A;  5CO3 A;  4QL9 A;  3J7Y b;  1SL2 B;  3QFA C;  4KUN A;  4GSS A;  4F0B A;  4MLY A;  4ZB8 A;  3QCP A;  5ID2 A;  4MZC A;  4NAX A;  4IN0 A;  3UL3 A;  4YQM A;  3HVS A;  5INY A;  5H5R A;  5A5K A;  5F0G A;  4V2M A;  4MF6 A;  4XTS A;  2IFQ A;  2Z9S A;  1GUH A;  5BMU A;  3G7I A;  1V57 A;  2LRC A;  3NZN A;  1HQO A;  4OMV A;  1JHB A;  4BVY B;  4IP6 A;  4PNG A;  3KMN A;  4FYB A;  4LA1 A;  1QFN A;  4I2T A;  5G5F A;  6GSY A;  4I8B A;  4MJC A;  4IHU A;  5A4V A;  5ECR B;  4GTU A;  2OE1 A;  2TRC P;  2DLX A;  5G2Z A;  1GL8 A;  1WWJ A;  2ZUP A;  1EOG A;  2B6M A;  3ZLP A;  2LQQ A;  3TOU A;  2R4V A;  3WT1 A;  1XIY A;  1T7P B;  1KTE A;  3UOM A;  5IIZ A;  2JU5 A;  3HCZ A;  3NIV A;  3EWL A;  3D4M A;  3W8J A;  1NM3 A;  1S3A A;  4JBB A;  4E8H A;  2KHP A;  1SD9 A;  2JSY A;  1J0F A;  3WD6 A;  1LBK A;  6GSW A;  2L5O A;  2O85 A;  2YJH A;  5DAK B;  7GSS A;  1HD2 A;  5ECS A;  2VCV A;  1GP1 A;  2RLI A;  5GSS A;  4KDY A;  4I5Q A;  1O85 A;  4KE3 A;  4CDO A;  1F3A A;  1BAY A;  2GT6 A;  3APQ A;  3LSZ A;  4Q5F A;  2RM6 A;  5G1L A;  3A5W A;  2H6Y A;  4N11 A;  2GGT A;  2IL3 A;  1GNW A;  3HVX A;  3TCO A;  1ON4 A;  1JZR A;  1TXX A;  1TRV A;  3ZVJ A;  3CSI A;  2KOK A;  2VUP A;  1ERU A;  2L6D A;  5J41 A;  1LU4 A;  3TDG A;  5JWQ B;  2KP2 A;  1XPV A;  2FWE A;  2YV7 A;  3MAK A;  2DJ0 A;  1B9Y C;  1ZGN A;  1MDI A;  1I5G A;  3FZ5 A;  2DJ1 A;  3ISO A;  3QMX A;  1PL1 A;  1O73 A;  3E9J B;  5GAN D;  1MD3 A;  3HZ4 A;  3U5R E;  4MZW A;  4Q5R A;  4KCE A;  3D22 A;  1V58 A;  2WFC A;  4RQX A;  3BCK A;  1GSQ A;  2B7J A;  1AQW A;  5G30 A;  2YOI A;  3DWV A;  3VPQ A;  3UBL A;  3QOU A;  1X0R A;  1PQN A;  4JU5 A;  3FY7 A;  1ML6 A;  4POB A;  1XWB A;  2TIR A;  4I6X A;  1M2A A;  5ECM B;  4PQI A;  3I43 A;  4NHW A;  5AN1 A;  4JR4 A;  1PL2 A;  5IOW A;  2FA8 A;  3GNJ A;  2R3X A;  1XXU A;  3GMF A;  2K18 A;  4G19 A;  1Y25 A;  3QAG A;  3CSH A;  2H72 A;  1BYE A;  1GLQ A;  2RM5 A;  1CQG A;  5DVB A;  2YJ7 A;  1UVZ A;  2CX3 A;  3DD3 A;  1UN2 A;  3D21 A;  2X8G A;  2F51 A;  3EMP A;  1USB A;  2LUS A;  4LMW A;  4HUA A;  2OE3 A;  1XZO A;  2GZY A;  4KW6 A;  2P0G A;  4GRF A;  4LLR A;  3UJ1 A;  3LOR A;  1A24 A;  2GQK A;  1FVK A;  2DJK A;  4LMV A;  5LNK e;  2MMN A;  1XVW A;  4K9Z A;  1GUM A;  4QQ7 A;  3D4T A;  4FYC A;  3M0F A;  4NWY A;  2PMT A;  3F8U A;  2V32 A;  2M80 A;  2B1L A;  2LS5 A;  4LL1 B;  2JL4 A;  1QQ2 A;  1XWG A;  4J2F A;  2N5B A;  3RHB A;  4YH2 A;  2YCD A;  2X99 A;  1VF4 A;  2PER A;  2QSI A;  3DXB A;  3F3Q A;  3LG6 A;  2P5R A;  5COH A;  2HSY A;  1BQ7 A;  3LJR A;  1SL0 B;  1XVQ A;  1NW2 A;  4TXO B;  4MZB A;  3MDK A;  5F05 A;  3DYR A;  5B8A A;  2JAD A;  1F2E A;  3ERG A;  1A8Y A;  2M72 A;  3CTG A;  4MH3 A;  2WRT A;  4J57 E;  1AQX A;  2ON7 A;  2QC7 A;  2YP6 A;  2IJY A;  4KDX A;  4CHS A;  2GVP A;  1K0O A;  4TOP A;  4MMM A;  1XWC A;  2GST A;  1JZD A;  2RII A;  5CRD A;  2VM1 A;  4AGS A;  13GS A;  2IIY A;  3KXO A;  3GN3 A;  1A23 A;  4K2D A;  2FCH A;  2LQO A;  2HSH A;  3GFK A;  1ZMA A;  2F9S A;  1AIU A;  2B5Y A;  4OO5 A;  4HJ2 A;  5B8B A;  3L9U A;  3C1R A;  3L78 A;  2VD0 A;  4MCU A;  3SWL A;  1SD8 A;  1K0A A;  3IC4 A;  4TW5 A;  5IQY A;  4BVX B;  1U6T A;  3IDV A;  4XRD A;  1PGT A;  3H8Q A;  3QR6 A;  4PUA A;  4X1U A;  1O6J A;  2BTO T;  1UC7 A;  3P7X A;  2CAQ A;  2BJX A;  3HHV A;  3TGZ A;  1O8W A;  3F3R A;  3RDW A;  4IP1 A;  5CYY A;  2YPM A;  4RQR A;  3TJG A;  1TI3 A;  3FZA A;  5ECI B;  4YAP A;  1THO A;  3KMO A;  4H86 A;  5AGY A;  3UAR A;  4HI7 A;  3DML A;  1Z7R A;  4IW9 A;  2LKU A;  1FB6 A;  1TP9 A;  1AW9 A;  3IBH A;  1TK5 B;  3PR8 A;  1GWC A;  3VK9 A;  16GS A;  3ERW A;  2GLR A;  1O81 A;  3MSZ A;  3M8N A;  4ECI A;  1B4Q A;  4MPF A;  1SK0 A;  4V1A g;  3IHQ A;  1ILO A;  4K6X A;  5JCW A;  5J4U A;  4ZL8 A;  3DKS A;  4ZBB A;  3HZ8 A;  3L9V A;  5C04 A;  1FVJ A;  3APS A;  5JWO B;  2C3N A;  5G1K A;  1ZYQ B;  4D73 A;  2MMZ A;  4F03 A;  3GA4 A;  1QGV A;  1FO5 A;  1FG4 A;  4PGT A;  1H4O A;  4F2I A;  3KH9 A;  1T8E B;  1TRS A;  4LL4 B;  4FH8 A;  3QAV A;  2HE3 A;  3TKS C;  5D8I A;  1SJZ A;  2GQL A;  1V9W A;  1OC9 A;  4AJ8 A;  1T4Z A;  1SK2 A;  4GCI A;  4KX4 A;  1TTZ A;  3TKQ A;  3ZVJ D;  5EY6 A;  5ENU A;  2HSN B;  17GS A;  4TRX A;  2A2S A;  4ULX A;  3BOA A;  5GAP D;  3H79 A;  2DJ2 A;  4USS A;  5IO2 A;  2PVQ A;  5DAL A;  1XW6 A;  8GSS A;  1G7O A;  2I1U A;  2R2J A;  1TRU A;  4F0C A;  2MMO A;  3LEF A;  1Y6E A;  2WJU A;  2H73 A;  2MBS A;  1OKT A;  2GQM A;  5KN3 A;  2FWG A;  2DIY A;  1A0R P;  2HRK B;  1A8L A;  3G7Y A;  4BWS A;  1CQH A;  3L9S A;  3MNG A;  4FO5 A;  3EIN A;  5D96 A;  4FQU A;  5J3R A;  3N9J A;  3GKK A;  3EU3 A;  4IS0 A;  3RPN A;  4HOJ A;  3L0H A;  2C3Q A;  5H5Q A;  2I3Y A;  3F4S A;  3IPZ A;  4OFT A;  2MMA A;  3IA1 A;  3GKM A;  4JE1 A;  1AAZ A;  3TUE A;  2DIZ A;  1EV9 A;  4IKH A;  4RI6 A;  1EOH A;  2H01 A;  5E4W A;  1Z6N A;  5KN0 A;  4BVX A;  4KF9 A;  2AAW A;  4NV2 A;  1SEN A;  3F0I A;  2GS3 A;  3EYT A;  2LST A;  1G0T A;  4XCS A;  2K8S A;  2O87 A;  3FR6 A;  4KB3 A;  2H70 A;  2F8A A;  2OE0 A;  3I9V 2;  3CRT A;  3R3E A;  4G10 A;  4KAE A;  2L6C A;  5KN2 A;  4XS1 A;  4OD7 A;  2VAF A;  1PRX A;  2V6O A;  5IM9 A;  3O76 A;  2AUV A;  3ZIV A;  5DCH A;  3IRA A;  1PX7 A;  1VRS D;  4ZL7 A;  2IMD A;  4MJE A;  5A4U A;  4AJ6 A;  3HKR A;  3I6A A;  1JZO A;  1M9A A;  3UAP A;  4TR1 A;  2L4Q A;  1DUG A;  1K3L A;  2P31 A;  3BJ5 A;  4HQZ A;  1FOV A;  2C4J A;  1EGO A;  4ISD A;  4ECB A;  2HRA A;  4POM A;  1K0B A;  1OC8 A;  3BD2 A;  4KCA A;  3BCI A;  2C0G A;  2X64 A;  4GWR A;  2C8U A;  1TOF A;  1G6Y A;  3BBY A;  5F06 A;  5AIX A;  1F3B A;  2ZCT A;  3FZ4 A;  2H6Z A;  4NPB A;  1N2A A;  1GH2 A;  2FA4 A;  6GSX A;  3S9F A;  10GS A;  2NTO A;  4I2U A;  4L8E A;  2VLU A;  3KM6 A;  3UEM A;  2WS2 A;  1N8J A;  2HZE B;  4J56 E;  2GZZ A;  3VLN A;  2LJR A;  1JFU A;  3VWU A;  2R6K A;  3H1N A;  3APO A;  3RAZ A;  1IYH A;  4XS4 A;  5D9X A;  2OBI A;  2X8H A;  4DSR A;  1X5E A;  2D2Z A;  2IWT A;  4NMU A;  2PU9 C;  4ZB6 A;  2AHE A;  1O8X A;  2F3M A;  4DSS B;  3GTU A;  1V2A A;  5ECH B;  1AXD A;  2LNS A;  3TB2 A;  3F6D A;  2H1A A;  3R2Q A;  1GSF A;  3DGQ A;  4NHZ A;  1VGL A;  5LD0 A;  4GSN A;  4POL A;  2PBJ A;  4EXJ A;  5CP1 A;  3C73 A;  4WBR D;  4MP4 A;  3C1S A;  2C0D A;  1Z3E A;  3UMA A;  2JSZ A;  1XW5 A;  1A0F A;  2JZT A;  2DBC A;  1SJI A;  5FHI A;  4OFN A;  2B7K A;  4Q5N A;  2FHE A;  4K8M A;  2FLS A;  1X9M B;  3F4T A;  3LYK A;  3ZRE A;  2B5X A;  1ZOF A;  4ML6 A;  4G2E A;  3KTL A;  3V1W A;  2WB9 A;  1SU9 A;  2VM2 A;  3DIE A;  1C72 A;  1M0U A;  4MA9 A;  4GXZ A;  1ERV A;  2MBT A;  5IMD A;  4N30 A;  3IAM 2;  2B3S A;  3LYP A;  4V2L A;  1PSQ A;  3TKS A;  1GTA A;  5HFK A;  4ZIJ A;  4ACS A;  2OJL A;  3IC8 A;  1TI1 A;  1Z9H A;  2O89 A;  1U88 A;  1GSY A;  2H1B A;  2XPE A;  3VWV A;  1R4W A;  1YQ1 A;  5C00 A;  5CAX A;  4EC0 A;  4GF0 A;  5FWG A;  4HU9 A;  2E0Q A;  1K3O A;  3ZFB A;  3QDN A;  2HFD A;  1AC1 A;  3WT2 A;  1DBY A;  1WPI A;  4BVY A;  5D93 A;  1NHY A;  5GST A;  3IK7 A;  2WUL A;  3ZIT A;  4HDE A;  5DDL A;  1DE1 A;  2WZ9 A;  3RBT A;  4KND A;  2V41 A;  1TJD A;  1K0N A;  2YWN A;  4PXO A;  1V98 A;  2DJ3 A;  3AY8 A;  4HU7 A;  1OKD A;  3ME8 A;  1TU7 A;  3LGC A;  2H8L A;  22GS A;  5KN1 A;  2GZP A;  1HYU A;  1K3Y A;  2VLV A;  2CAI A;  1DSB A;  1EV4 A;  3KP9 A;  1K0D A;  3EC3 A;  4P3Y B;  2VCW A;  1TK8 B;  2JZR A;  5D9W A;  2GT5 A;  1PN9 A;  2LTK A;  5DAK A;  1XWA A;  2NDO A;  5CRH A;  1BG5 A;  2HZF A;  1SL1 B;  3KH7 A;  4RI7 A;  2HZE A;  2V6K A;  2ON5 A;  5B7C A;  3Q19 A;  5J9B A;  1ERT A;  1F37 A;  4PX1 A;  1BED A;  4ZBA A;  3GKN A;  4ZB9 A;  3GH6 A;  1T3B A;  4IBP A;  4DSQ A;  3Q18 A;  3I69 A;  4DSS A;  5LCZ A;  1B8X A;  3GRX A;  3W6G A;  2HSM B;  4KH7 A;  3VI5 A;  3UBK A;  3J7Y k;  5JWR B;  3EUR A;  2MZC A;  1S3C A;  4CW9 A;  2L59 A;  3UVT A;  5CNW A;  2OA7 A;  4PQ1 A;  2GSS A;  4MJB A;  4TKY A;  3LXZ A;  1XOA A;  1YDK A;  3QAW A;  5F07 A;  4O5R A;  1EP8 A;  1VF3 A;  4EE0 A;  4ID0 A;  2HQT A;  1BX9 A;  3FW2 A;  2RUF A;  1YJ6 A;  2RUE A;  1SYR A;  4Z7X A;  1FW1 A;  1MDK A;  4MH2 A;  1F9M A;  1WJK A;  3HD5 A;  1UA5 A;  5HR3 A;  2H76 A;  1KBN A;  4OO4 A;  3PGT A;  2HRF A;  3P8W A;  3LQ7 A;  3A2W A;  1YEX A;  1GNE A;  1ZL9 A;  4XHM A;  3GX8 A;  3GIX A;  2YNX A;  2PWJ A;  4TR0 A;  1PA3 A;  1RW1 A;  1J9B A;  2J9H A;  1YEP A;  5DJL A;  1EP7 A;  3LFL A;  1TK0 B;  1XW9 A;  4WKW A;  5J9C A;  1XOB A;  2ES7 A;  1Q4J A;  2IFQ B;  4EL1 A;  3FZ9 A;  5G31 A;  5L71 A;  4ZL9 A;  3CBU A;  4MF7 A;  4BL7 B;  3RPP A;  2YV9 A;  4X0X A;  5DQY A;  4TN8 A;  3D5J A;  3TRQ A;  3ZTL A;  2FWH A;  3C8E A;  1QK8 A;  2IME A;  1M99 A;  3TJF A;  4PTS A;  1FAA A;  1PKW A;  4IQA A;  3OR5 A;  4K1F A;  4KSM A;  4ILF A;  4YQU A;  1W89 A;  4OCE A;  4ML1 A;  3ZZX A;  3MWH A;  2GTU A;  3KGK A;  3PPU A;  1YF1 A;  1ACV A;  1WOU A;  4IGJ A;  2YZH A;  3EVI A;  2M46 A;  3LXT A;  2C1Y A;  3FRC A;  4HJM A;  2FD3 A;  3DRN A;  5A4W A;  2X8C A;  3D0Z A;  6GSU A;  1B48 A;  3HA9 A;  1Z7P A;  18GS A;  5IMA A;  2VD1 A;  2FWF A;  2IMI A;  4DVC A;  4K7O A;  4K7N A;  4HS1 A;  4HZ4 A;  1GTU A;  1RQM A;  4HZ2 A;  4TXO A;  1OAZ A;  1K0M A;  1X9W B;  1I9D A;  1WE0 A;  1WMJ A;  1R26 A;  2WGR A;  3ZMK A;  1SK1 A;  4IEL A;  4G0I A;  5ECO B;  1B4P A;  5ELA A;  1LJR A;  4IJI A;  1PMT A;  2FGX A;  1EGR A;  4GQF A;  4O92 A;  2HI7 A;  3C7M A;  3IR4 A;  1XCC A;  4JED A;  1M2D A;  4DEJ A;  2P5Q A;  1VF2 A;  3CXG A;  4F82 A;  1O7U A;  4QL7 A;  1G7E A;  2EIQ A;  1R5P A;  5DBQ A;  3IK9 A;  2XBQ A;  5IO0 A;  2J23 A;  4XRA A;  3VPT A;  19GS A;  4N10 A;  3M1G A;  1TRW A;  3ZRD A;  1JLW A;  4OFM A;  3QD9 A;  2VOC A;  3LWA A;  2KLX A;  3CRU A;  1JZW A;  2NBS A;  1PD2 1;  4IVF A;  3L4N A;  3TKS E;  4OWY A;  4F9Z A;  4L5O A;  2C0F A;  5HR2 A;  2XPD A;  2H30 A;  4WXT A;  1Z5Y E;  2PGT A;  1DE2 A;  3WGE A;  4L5L A;  2YAN A;  1RK4 A;  3QPM A;  9GSS A;  4XS6 A;  4N0Z A;  2FY6 A;  1GTB A;  2G2Q A;  3FYG A;  1PKZ A;  5ECL B;  2R37 A;  3IXR A;  2HNL A;  3FHK A;  5H5S A;  3H4K A;  2ALB A;  3P90 A;  1QMV A;  20GS A;  3WYW A;  3HYP A;  4WEY A;  4HQS A;  4HEA 2;  4BL7 A;  1X5C A;  2OAC A;  2VO4 A;  3HDC A;  2WDU A;  2CV4 A;  2HYX A;  3KTB A;  4WET A;  1X9S B;  2JZS A;  1R5A A;  3SBC A;  2UZ8 A;  2OKA A;  2YZU A;  2QKE A;  3ZL5 A;  2L5L A;  3JCM L;  5D9T A;  4ECC A;  5JCU A;  2C0E A;  3E3E A;  3FR9 A;  3G9B A;  1OE8 A;  1IYI A;  1AQV A;  2PUK C;  1SYX A;  4EVM A;  2VCT A;  3WGX A;  2L4C A;  3KZQ A;  1MDJ A;  2YWI A;  3H93 A;  1GSU A;  1B9X C;  1E2Y A;  3N5O A;  4PUF C;  1A2L A;  2IMF A;  3GYK A;  3D6I A;  5IOX A;  1YKA A;  2KUC A;  5D73 A;  2HXK A;  1YF0 A;  1XFL A;  4AF2 A;  4EKZ A;  4O7H A;  2VL2 C;  3GKX A;  2MYG A;  1Q98 A;  2QGV A;  2CVB A;  4XIH A;  4ZIL A;  3DEX A;  2LJA A;  5D9V A;  3Q74 A;  1ST9 A;  3VUR A;  2PVO C;  1M9B A;  1GSD A;  4WF4 A;  4K7I A;  5CRE A;  4E8E A;  3QFB C;  3EE2 A;  2HT9 A;  4GLT A;  1QUW A;  3A2V A;  5DCG A;  1XWK A;  3A2X A;  3ZFL A;  2HRK A;  4BWQ A;  2YN1 A;  3KEB A;  3HVV A;  2BMX A;  2H71 A;  2LRT A;  4TXV A;  2LNT A;  3TKP A;  2H74 A;  3KJY A;  2AB6 A;  3ERF A;  1GRX A;  3VWX A;  3TJK A;  3TKR A;  1H75 A;  4EUY A;  2CX4 A;  1QXH A;  1ABA A;  5HR1 A;  3TJB A;  2VCQ A;  2AYT A;  5CRW A;  5DJM A;  1EZK A;  1OE7 A;  4GST A;  3HXS A;  4EO3 A;  4TR4 A;  2YWM A;  3M3M A;  2GSR A;  4MF5 A;  5GZZ B;  2XC2 A;  4K0N A;  2CVK A;  3GHA A;  3ZML A;  4JRR A;  3K8N A;  3Q6O A;  3GUR A;  2I4A A;  2VIM A;  4POK A;  3IV4 A;  5B6M A;  1THX A;  2VCX A;  2F8F A;  5ECK B;  3G7J A;  2VL9 A;  1V40 A;  5CRG A;  4TVE A;  2N5F A;  2HRN A;  1HNA A;  1EEM A;  3KCM A;  3IAS 2;  2H1G A;  2FUG 2;  4KDU A;  3GUS A;  1S3D A;  3U6V A;  1U87 A;  1HNC A;  2JAC A;  3CYN A;  1OYJ A;  4BA7 A;  5EL8 A;  4L0U A;  1Z6M A;  1A2M A;  3P2A A;  2PN8 A;  2L57 A;  1SKS B;  3FR3 A;  2V2G A;  3TRP A;  1FB0 A;  1ERW A;  3TJJ A;  1GUK A;  5ABR A;  5G5E A;  4MK3 A;  3GL3 A;  4D73 B;  3M9J A;  1PX6 A;  3M9K A;  2CT6 A;  2NPB A;  3C71 A;  2O7K A;  1E6B A;  3KD0 A;  1FHE A;  2C3T A;  4X43 A;  4Q5Q A;  1OC9 B;  4MPG A;  1VF1 A;  4L0W A;  4WF5 A;  3US3 A;  2VL3 A;  4N0V A;  3EU4 A;  4EDY A;  1NSW A;  2H19 A;  3HJP A;  3F63 A;  1U3A A;  1WRY A;  5ECN B;  5ECP B;  12GS A;  2YWO A;  1GTI A;  1J08 A;  1WIK A;  4WR5 A;  4O32 A;  4G0K A;  5DAL B;  5ECQ B; 
#chains in the Genus database with same CATH topology
 3F9U A;  1URM A;  4FXY P;  3E0U A;  2REM A;  2TRX A;  5IPG A;  4PNF A;  2IMK A;  2LV3 A;  5HFI A;  2VLT A;  1A2J A;  3EPT A;  5A34 A;  1TW9 A;  2EC4 A;  1SKW B;  1M7T A;  5ELG A;  2PPT A;  1PN0 A;  2I9H A;  2H75 A;  1GLP A;  3GSS A;  4JR6 A;  1SJ6 A;  4WBJ A;  1G6W A;  2R5G A;  4JZQ A;  2K6V A;  1TDI A;  4EF0 A;  4RUV A;  5AIV A;  1K0C A;  2LRN A;  1F6M C;  3HJO A;  4YQV A;  1GSE A;  3WGD A;  4V1A p;  2VCZ A;  5FT3 A;  5IMC A;  1MTC A;  4KSO A;  3IOS A;  2E7P A;  1U3I A;  2DSA A;  1AUC A;  3FKF A;  2GDR A;  4MAB A;  2ZNM A;  3A3T A;  3RGB C;  2O5V A;  2H0I A;  3HY2 A;  4TR3 A;  5ID2 B;  1YKC A;  6GSS A;  3VWW A;  4MJA A;  4NXI A;  2OBK A;  4IQ1 A;  1X5D A;  4MDC A;  1OVN A;  3UVH A;  1YZX A;  6GSV A;  4EDZ A;  4FYU A;  2DML A;  5EVO A;  2H66 A;  4YAV A;  1KNG A;  2B5E A;  11GS A;  3GV1 A;  5IMV A;  3IE3 A;  1T00 A;  2VL2 A;  1R7H A;  4ZXG A;  2DC5 A;  2CZ3 A;  2O36 A;  3KIJ A;  2V1M A;  1YY7 A;  1M2B A;  5E59 A;  4V2N A;  2IPA A;  1T4Y A;  5F8B A;  1ZYE A;  5KEJ A;  2WCI A;  4AJ7 A;  5HQP A;  3GL5 A;  5JCG A;  3TRX A;  3EMX A;  2E2M A;  3VI7 A;  3PH9 A;  5AIS A;  3CSJ A;  3W8S A;  4I97 A;  6GST A;  1EEJ A;  3O6T A;  3CMI A;  2IN3 A;  4TR1 B;  3KP8 A;  3O3T A;  2H1D A;  4NV5 A;  2CA8 A;  2H0H A;  3VFI A;  2DMM A;  2CVD A;  3GST A;  1ZZY A;  2R0P A;  4ZBD A;  2G0F A;  4ECJ A;  4K0G A;  1JLV A;  4QMK A;  3GX0 A;  5DQS A;  5B6N A;  1YVL A;  3DVW A;  1KEB A;  4PQH A;  2HLS A;  4BPY A;  3TOT A;  2N5A A;  2WZS A;  3NOF A;  3ZIJ A;  3FEU A;  5BRT A;  2CZ2 A;  5EPF A;  1SKR B;  1BJX A;  2LJK A;  2CQ9 A;  3ME7 A;  3F6F A;  1NHO A;  4KA0 A;  2AJQ B;  2DJJ A;  4OCF A;  5IPH A;  4WR4 A;  1OC3 A;  4GQC A;  4O5U A;  5HFG A;  4PUR A;  4XS4 B;  2O8V B;  3ZYW A;  3CTF A;  2E2G A;  2H0G A;  5IMF A;  3GH9 A;  3GTU B;  1XBS A;  5HR0 A;  2K8V A;  1ZCP A;  1MD4 A;  3F4R A;  2HSM A;  3DVX A;  2OAD A;  3HJM A;  2AV4 A;  3ED3 A;  2EIR A;  2EIO A;  2C80 A;  2GSQ A;  5J47 A;  2B1K A;  1W4V A;  2KP1 A;  4G9H A;  4IJ3 A;  2H6X A;  2A2R A;  4KGI A;  2R0C A;  1MEK A;  2LEG A;  5IMZ A;  3RHC A;  2FNO A;  3PIN A;  2XBI A;  1GUL A;  1HNB A;  1T1V A;  4FIW A;  3UIW A;  2NVL A;  1TKD B;  2I81 A;  1GSS A;  1TU8 A;  5J5N A;  1EWX A;  4G0L A;  2XHF A;  3FK8 A;  2A4V A;  2K9F A;  1WP0 A;  14GS A;  5CO3 A;  4QL9 A;  3J7Y b;  1SL2 B;  3QFA C;  4KUN A;  4GSS A;  4F0B A;  4MLY A;  4ZB8 A;  3QCP A;  5ID2 A;  4MZC A;  4NAX A;  4IN0 A;  3UL3 A;  4YQM A;  3HVS A;  5INY A;  5H5R A;  5A5K A;  5F0G A;  4V2M A;  4MF6 A;  4XTS A;  2IFQ A;  2Z9S A;  1GUH A;  5BMU A;  3G7I A;  1V57 A;  2LRC A;  3NZN A;  1HQO A;  4OMV A;  1JHB A;  4BVY B;  4IP6 A;  4PNG A;  3KMN A;  4FYB A;  4LA1 A;  1QFN A;  4I2T A;  5G5F A;  6GSY A;  4I8B A;  4MJC A;  4IHU A;  5A4V A;  5ECR B;  4GTU A;  2OE1 A;  2WW2 A;  2TRC P;  2DLX A;  5G2Z A;  1GL8 A;  1WWJ A;  2ZUP A;  1EOG A;  2B6M A;  3ZLP A;  2LQQ A;  3TOU A;  2R4V A;  3WT1 A;  1XIY A;  1T7P B;  1KTE A;  3UOM A;  5IIZ A;  2JU5 A;  3HCZ A;  3NIV A;  3EWL A;  3D4M A;  3W8J A;  1NM3 A;  2WW3 A;  1S3A A;  4JBB A;  4E8H A;  2KHP A;  1SD9 A;  2JSY A;  1J0F A;  3WD6 A;  1LBK A;  6GSW A;  2L5O A;  2O85 A;  2YJH A;  5DAK B;  7GSS A;  1HD2 A;  5ECS A;  2VCV A;  1GP1 A;  2RLI A;  5GSS A;  4Z2U A;  4KDY A;  4N3Z A;  4I5Q A;  1O85 A;  4YKF A;  4KE3 A;  4CDO A;  1F3A A;  1BAY A;  2GT6 A;  3APQ A;  3LSZ A;  4Q5F A;  2RM6 A;  5G1L A;  3A5W A;  2H6Y A;  4N11 A;  2GGT A;  2IL3 A;  1GNW A;  3HVX A;  3TCO A;  1ON4 A;  1JZR A;  1TXX A;  1TRV A;  3ZVJ A;  3CSI A;  4ZB7 A;  2KOK A;  2VUP A;  1ERU A;  2L6D A;  5J41 A;  1LU4 A;  3TDG A;  5JWQ B;  2KP2 A;  1XPV A;  2FWE A;  2YV7 A;  3MAK A;  2EFD A;  2DJ0 A;  1B9Y C;  1ZGN A;  1MDI A;  5A5H B;  1I5G A;  3FZ5 A;  2DJ1 A;  5A1N B;  3ISO A;  3QMX A;  1PL1 A;  1O73 A;  3E9J B;  5GAN D;  1MD3 A;  3HZ4 A;  3U5R E;  4MZW A;  4Q5R A;  4KCE A;  3D22 A;  1V58 A;  2WFC A;  4RQX A;  3BCK A;  1GSQ A;  2B7J A;  1AQW A;  5G30 A;  2YOI A;  3DWV A;  3VPQ A;  3UBL A;  3QOU A;  1X0R A;  2DKH A;  1PQN A;  4JU5 A;  3FY7 A;  1ML6 A;  4POB A;  1XWB A;  4MNN A;  5J4V A;  2TIR A;  4I6X A;  1M2A A;  5ECM B;  4PQI A;  3I43 A;  4NHW A;  5AN1 A;  2EFC A;  4JR4 A;  1PL2 A;  5IOW A;  2FA8 A;  3GNJ A;  2R3X A;  1XXU A;  3GMF A;  2K18 A;  1FOH A;  4G19 A;  1Y25 A;  3QAG A;  3CSH A;  2H1L A;  2H72 A;  2EFE A;  1BYE A;  1GLQ A;  2RM5 A;  1CQG A;  5DVB A;  3CHX C;  2YJ7 A;  1UVZ A;  2CX3 A;  3DD3 A;  1UN2 A;  3D21 A;  2X8G A;  2F51 A;  3EMP A;  1USB A;  2LUS A;  4LMW A;  4HUA A;  2OE3 A;  1XZO A;  2GZY A;  4KW6 A;  2P0G A;  4GRF A;  4X4J A;  4LLR A;  3UJ1 A;  3LOR A;  1A24 A;  2GQK A;  1FVK A;  2DJK A;  4LMV A;  5LNK e;  2MMN A;  1XVW A;  4QQ7 A;  1GUM A;  3D4T A;  4K9Z A;  4FYC A;  3M0F A;  4AKI A;  4NWY A;  5KOX A;  2PMT A;  3F8U A;  2V32 A;  2M80 A;  2B1L A;  2LS5 A;  4LL1 B;  2JL4 A;  1QQ2 A;  1XWG A;  4J2F A;  2N5B A;  3RHB A;  4YH2 A;  2YCD A;  2X99 A;  1VF4 A;  2PER A;  2QSI A;  3DXB A;  4EIP A;  3F3Q A;  1XG8 A;  2WVZ A;  3LG6 A;  2P5R A;  5COH A;  2HSY A;  1BQ7 A;  3LJR A;  1SL0 B;  1XVQ A;  1NW2 A;  4TXO B;  4MZB A;  3MDK A;  5F05 A;  3DYR A;  5B8A A;  2JAD A;  1F2E A;  3ERG A;  1A8Y A;  2M72 A;  3CTG A;  4MH3 A;  2WRT A;  4J57 E;  1AQX A;  2ON7 A;  2QC7 A;  2YP6 A;  2IJY A;  4KDX A;  4CHS A;  2GVP A;  1K0O A;  4TOP A;  4MMM A;  1XWC A;  2GST A;  1JZD A;  2RII A;  5CRD A;  2VM1 A;  4AGS A;  13GS A;  3TU3 B;  3FMW A;  2IIY A;  3KXO A;  3GN3 A;  1S3R A;  1A23 A;  4K2D A;  2FCH A;  2LQO A;  2HSH A;  3GFK A;  1ZMA A;  2F9S A;  1AIU A;  2B5Y A;  4OO5 A;  4HJ2 A;  5B8B A;  3L9U A;  3C1R A;  3L78 A;  2VD0 A;  4MCU A;  3SWL A;  1SD8 A;  1K0A A;  3IC4 A;  4TW5 A;  5IQY A;  4BVX B;  1U6T A;  3IDV A;  4XRD A;  1PGT A;  3H8Q A;  3QR6 A;  4PUA A;  4X1U A;  1O6J A;  2BTO T;  1UC7 A;  3P7X A;  2CAQ A;  2BJX A;  3HHV A;  3TGZ A;  1O8W A;  3F3R A;  3RDW A;  4IP1 A;  5CYY A;  2YPM A;  4RQR A;  3TJG A;  1TI3 A;  3FZA A;  5ECI B;  4YAP A;  1THO A;  3KMO A;  4H86 A;  5AGY A;  3UAR A;  4HI7 A;  3DML A;  1Z7R A;  4IW9 A;  2LKU A;  1FB6 A;  1TP9 A;  1AW9 A;  4G01 A;  3IBH A;  1TK5 B;  3PR8 A;  1GWC A;  1N25 A;  3VK9 A;  16GS A;  3ERW A;  2GLR A;  1O81 A;  5J4Y A;  3MSZ A;  3M8N A;  4ECI A;  1B4Q A;  4MPF A;  1SK0 A;  4V1A g;  3IHQ A;  1ILO A;  4K6X A;  5JCW A;  5J4U A;  4ZL8 A;  3DKS A;  4ZBB A;  3HZ8 A;  3L9V A;  5C04 A;  1FVJ A;  3APS A;  5JWO B;  3CQF A;  2C3N A;  5G1K A;  1ZYQ B;  4D73 A;  2MMZ A;  4O5Q A;  4F03 A;  3GA4 A;  1QGV A;  1FO5 A;  1FG4 A;  4PGT A;  1H4O A;  4F2I A;  3KH9 A;  1T8E B;  1TRS A;  4LL4 B;  4FH8 A;  3QAV A;  2HE3 A;  3TKS C;  5D8I A;  1I1I P;  1SJZ A;  2GQL A;  1V9W A;  1OC9 A;  2O3E A;  4AJ8 A;  4W66 A;  1T4Z A;  1SK2 A;  4GCI A;  4KX4 A;  1TTZ A;  3TKQ A;  3ZVJ D;  5EY6 A;  5ENU A;  2HSN B;  3LW9 A;  17GS A;  4TRX A;  2A2S A;  4ULX A;  3BOA A;  5GAP D;  3H79 A;  2DJ2 A;  4USS A;  4AI6 A;  5IO2 A;  2PVQ A;  5DAL A;  1XW6 A;  8GSS A;  1G7O A;  2I1U A;  2R2J A;  1TRU A;  4F0C A;  2MMO A;  3LEF A;  1Y6E A;  2R0G A;  2WJU A;  2H73 A;  2MBS A;  1OKT A;  2GQM A;  1SVO A;  5KN3 A;  2FWG A;  2WW1 A;  2DIY A;  1A0R P;  2HRK B;  1A8L A;  3G7Y A;  4BWS A;  1CQH A;  3L9S A;  3MNG A;  4FO5 A;  3EIN A;  5D96 A;  4FQU A;  5J3R A;  3N9J A;  3GKK A;  3EU3 A;  4IS0 A;  3RPN A;  4HOJ A;  3L0H A;  2C3Q A;  5H5Q A;  2I3Y A;  3F4S A;  3IPZ A;  4OFT A;  1BF5 A;  2MMA A;  4PHZ C;  3IA1 A;  3GKM A;  4JE1 A;  1AAZ A;  4Z2T A;  3TUE A;  2DIZ A;  1EV9 A;  4IKH A;  4RI6 A;  1EOH A;  2H01 A;  5E4W A;  1Z6N A;  5KN0 A;  4A5P A;  4BVX A;  4KF9 A;  2AAW A;  4NV2 A;  1SEN A;  3F0I A;  2GS3 A;  3EYT A;  2LST A;  1G0T A;  4XCS A;  2K8S A;  2O87 A;  3FR6 A;  2QA2 A;  2H70 A;  4KB3 A;  2F8A A;  2OE0 A;  3I9V 2;  3CRT A;  3R3E A;  4G10 A;  4KAE A;  2L6C A;  5KN2 A;  4XS1 A;  4OD7 A;  2VAF A;  1PRX A;  1ZYN A;  2V6O A;  5IM9 A;  3O76 A;  2AUV A;  3ZIV A;  5DCH A;  3IRA A;  1PX7 A;  2WVX B;  1VRS D;  4ZL7 A;  2IMD A;  4MJE A;  5A4U A;  4AJ6 A;  4GDF A;  3HKR A;  1SVM A;  3I6A A;  1JZO A;  1M9A A;  3UAP A;  4TR1 A;  2L4Q A;  1DUG A;  1K3L A;  2P31 A;  3BJ5 A;  4HQZ A;  1FOV A;  2C4J A;  1EGO A;  4ISD A;  4ECB A;  2HRA A;  4POM A;  1K0B A;  1OC8 A;  3BD2 A;  4KCA A;  3BCI A;  2C0G A;  2X64 A;  4GWR A;  2C8U A;  1TOF A;  1G6Y A;  3BBY A;  5F06 A;  5AIX A;  1BG1 A;  1F3B A;  2ZCT A;  3FZ4 A;  2H6Z A;  4NPB A;  1N2A A;  1GH2 A;  2FA4 A;  6GSX A;  3S9F A;  10GS A;  2NTO A;  4I2U A;  4L8E A;  2VLU A;  3KM6 A;  2DKI A;  3UEM A;  2WS2 A;  1N8J A;  2HZE B;  4J56 E;  2GZZ A;  3VLN A;  2LJR A;  1JFU A;  3VWU A;  2R6K A;  3H1N A;  3APO A;  3RAZ A;  1IYH A;  4XS4 A;  5D9X A;  2OBI A;  2X8H A;  4DSR A;  1X5E A;  2D2Z A;  2IWT A;  4NMU A;  2PU9 C;  4ZB6 A;  2AHE A;  1O8X A;  2F3M A;  4DSS B;  3GTU A;  1V2A A;  2A4H A;  5ECH B;  1AXD A;  2LNS A;  3TB2 A;  3F6D A;  2H1A A;  3R2Q A;  1GSF A;  3DGQ A;  4NHZ A;  5A34 B;  1VGL A;  5LD0 A;  4GSN A;  4POL A;  2PBJ A;  4EXJ A;  5CP1 A;  3C73 A;  4WBR D;  4MP4 A;  3C1S A;  2C0D A;  1Z3E A;  3UMA A;  2JSZ A;  1XW5 A;  1A0F A;  2JZT A;  2DBC A;  1SJI A;  5FHI A;  4OFN A;  2B7K A;  4Q5N A;  2FHE A;  4K8M A;  2FLS A;  1X9M B;  3F4T A;  3LYK A;  3ZRE A;  2B5X A;  1ZOF A;  4ML6 A;  4G2E A;  3KTL A;  3V1W A;  2VM2 A;  2WB9 A;  1SU9 A;  3DIE A;  1PFO A;  1C72 A;  1M0U A;  1M3I A;  4MA9 A;  4GXZ A;  1ERV A;  2MBT A;  5IMD A;  4N30 A;  3IAM 2;  2B3S A;  4AKH A;  3LYP A;  4V2L A;  1PSQ A;  3TKS A;  1GTA A;  5HFK A;  4ZIJ A;  4ACS A;  2OJL A;  3IC8 A;  1TI1 A;  1Z9H A;  2O89 A;  1U88 A;  1GSY A;  2H1B A;  2XPE A;  3VWV A;  1R4W A;  1YQ1 A;  5C00 A;  5CAX A;  4EC0 A;  4GF0 A;  5FWG A;  4HU9 A;  2E0Q A;  1K3O A;  3ZFB A;  3QDN A;  2HFD A;  1AC1 A;  3WT2 A;  1DBY A;  1WPI A;  4BVY A;  5D93 A;  1NHY A;  5GST A;  3IK7 A;  2WUL A;  3ZIT A;  4HDE A;  5DDL A;  1DE1 A;  3MYD A;  2WZ9 A;  3RBT A;  4KND A;  2V41 A;  1TJD A;  4YKG A;  1K0N A;  2YWN A;  4PXO A;  1V98 A;  4ICY A;  2DJ3 A;  3AY8 A;  4HU7 A;  1OKD A;  3ME8 A;  3MIX A;  1TU7 A;  3LGC A;  2H8L A;  22GS A;  5KN1 A;  2GZP A;  1HYU A;  1K3Y A;  2VLV A;  2CAI A;  1DSB A;  1EV4 A;  3KP9 A;  1K0D A;  3EC3 A;  4P3Y B;  2VCW A;  1TK8 B;  2JZR A;  5D9W A;  2GT5 A;  1PN9 A;  2LTK A;  5DAK A;  1XWA A;  2NDO A;  5CRH A;  1BG5 A;  2HZF A;  1SL1 B;  3KH7 A;  4RI7 A;  2HZE A;  2V6K A;  1SVL A;  2ON5 A;  5B7C A;  3Q19 A;  5J9B A;  1ERT A;  1F37 A;  4PX1 A;  1BED A;  4ZBA A;  3GKN A;  4ZB9 A;  3GH6 A;  1T3B A;  4IBP A;  4DSQ A;  3Q18 A;  3I69 A;  4DSS A;  5LCZ A;  1B8X A;  3GRX A;  3W6G A;  2HSM B;  4KH7 A;  3VI5 A;  3UBK A;  3J7Y k;  5JWR B;  3EUR A;  2MZC A;  1S3C A;  4CW9 A;  2L59 A;  3UVT A;  5CNW A;  2OA7 A;  4PQ1 A;  2GSS A;  4MJB A;  4TKY A;  3LXZ A;  1XOA A;  4PI2 C;  1YDK A;  3QAW A;  5F07 A;  5A5H A;  1EP8 A;  4O5R A;  1VF3 A;  4EE0 A;  5A1N A;  4ID0 A;  2HQT A;  1BX9 A;  3FW2 A;  2RUF A;  1YJ6 A;  2RUE A;  1SYR A;  4Z7X A;  1FW1 A;  1MDK A;  4MH2 A;  1F9M A;  1WJK A;  3HD5 A;  2VKZ G;  2QA1 A;  1UA5 A;  5HR3 A;  2H76 A;  1KBN A;  4OO4 A;  3PGT A;  2HRF A;  3P8W A;  3LQ7 A;  3A2W A;  1YEX A;  1GNE A;  1ZL9 A;  3HMJ G;  4XHM A;  3GX8 A;  3GIX A;  2YNX A;  2PWJ A;  4TR0 A;  1PA3 A;  1RW1 A;  1J9B A;  2J9H A;  1YEP A;  5DJL A;  1EP7 A;  3LFL A;  1TK0 B;  1XW9 A;  4WKW A;  5J9C A;  1XOB A;  2ES7 A;  1Q4J A;  2IFQ B;  4EL1 A;  3FZ9 A;  5BMU B;  5G31 A;  5L71 A;  4ZL9 A;  3CBU A;  4MF7 A;  4BL7 B;  3RPP A;  2YV9 A;  4X0X A;  5DQY A;  4TN8 A;  3D5J A;  3TRQ A;  3ZTL A;  2FWH A;  3C8E A;  1QK8 A;  2IME A;  1M99 A;  3TJF A;  4PTS A;  1FAA A;  1PKW A;  4IQA A;  3OR5 A;  4K1F A;  4KSM A;  4ILF A;  4YQU A;  1W89 A;  4OCE A;  4ML1 A;  3ZZX A;  3MWH A;  2GTU A;  3KGK A;  3PPU A;  1YF1 A;  4K5S A;  1ACV A;  1WOU A;  4IGJ A;  2YZH A;  3EVI A;  2M46 A;  3LXT A;  2C1Y A;  3FRC A;  4HJM A;  2FD3 A;  3HVN A;  3DRN A;  5A4W A;  2X8C A;  3D0Z A;  6GSU A;  1B48 A;  3HA9 A;  1Z7P A;  18GS A;  5IMA A;  2VD1 A;  2FWF A;  2IMI A;  1YEW C;  4DVC A;  4CY6 A;  4K7O A;  4K7N A;  4HS1 A;  4HZ4 A;  1GTU A;  1RQM A;  4HZ2 A;  4TXO A;  1OAZ A;  1K0M A;  1X9W B;  1I9D A;  1WE0 A;  1WMJ A;  1R26 A;  2WGR A;  3ZMK A;  1SK1 A;  4IEL A;  4G0I A;  5ECO B;  1B4P A;  5ELA A;  1LJR A;  4IJI A;  1PMT A;  2FGX A;  1EGR A;  1M3J A;  4GQF A;  4O92 A;  2HI7 A;  2OT3 A;  3C7M A;  3IR4 A;  1XCC A;  4JED A;  1M2D A;  4DEJ A;  2P5Q A;  1VF2 A;  3CXG A;  1Y1U A;  4F82 A;  1O7U A;  4QL7 A;  1G7E A;  4E68 A;  2EIQ A;  1R5P A;  5DBQ A;  3IK9 A;  2X4A A;  2XBQ A;  5IO0 A;  2J23 A;  4XRA A;  3VPT A;  19GS A;  4N10 A;  3M1G A;  1TRW A;  3ZRD A;  1JLW A;  4OFM A;  3QD9 A;  2VOC A;  3LWA A;  2KLX A;  3CRU A;  1JZW A;  2NBS A;  1PD2 1;  4IVF A;  3L4N A;  3TKS E;  4OWY A;  4F9Z A;  4L5O A;  2C0F A;  5HR2 A;  2XPD A;  2H30 A;  4WXT A;  1Z5Y E;  2PGT A;  1DE2 A;  3WGE A;  4L5L A;  2YAN A;  4HSC X;  4CY8 A;  1RK4 A;  3QPM A;  9GSS A;  4XS6 A;  4N0Z A;  2FY6 A;  1GTB A;  2G2Q A;  3FYG A;  1PKZ A;  5ECL B;  2R37 A;  3IXR A;  2HNL A;  3FHK A;  5H5S A;  3H4K A;  2ALB A;  3P90 A;  1QMV A;  20GS A;  3WYW A;  4EIQ A;  3HYP A;  4WEY A;  4HQS A;  4HEA 2;  4BL7 A;  1X5C A;  1ZYP A;  4Z2R A;  2OAC A;  2VO4 A;  3HDC A;  2WDU A;  2CV4 A;  2HYX A;  3KTB A;  4WET A;  1X9S B;  4AKG A;  2JZS A;  1R5A A;  3SBC A;  2UZ8 A;  2OKA A;  2YZU A;  2QKE A;  3ZL5 A;  2L5L A;  3JCM L;  5D9T A;  4ECC A;  5JCU A;  2C0E A;  3E3E A;  3FR9 A;  3G9B A;  1OE8 A;  1IYI A;  1AQV A;  2PUK C;  1SYX A;  4EVM A;  2VCT A;  3WGX A;  2L4C A;  2WW0 A;  3KZQ A;  1MDJ A;  2UV8 G;  3CWG A;  2YWI A;  3H93 A;  1GSU A;  1B9X C;  1E2Y A;  3N5O A;  2A2P A;  4PUF C;  1A2L A;  2IMF A;  2HSN A;  3D6I A;  3GYK A;  5IOX A;  1YKA A;  2KUC A;  5D73 A;  3RFR C;  2HXK A;  1YF0 A;  1XFL A;  4AF2 A;  2X49 A;  4EKZ A;  4O7H A;  2VL2 C;  3GKX A;  2MYG A;  1Q98 A;  2QGV A;  4PI0 C;  2CVB A;  4XIH A;  4ZIL A;  3DEX A;  2LJA A;  5D9V A;  3Q74 A;  1ST9 A;  3VUR A;  2PVO C;  1M9B A;  1GSD A;  4WF4 A;  4K7I A;  5CRE A;  4E8E A;  3QFB C;  3EE2 A;  2HT9 A;  4GLT A;  1QUW A;  3A2V A;  5DCG A;  1XWK A;  3A2X A;  3ZFL A;  2HRK A;  4BWQ A;  2YN1 A;  3KEB A;  3HVV A;  2BMX A;  2H71 A;  2LRT A;  4TXV A;  2LNT A;  3TKP A;  2H74 A;  3KJY A;  2AB6 A;  1S4B P;  3ERF A;  1GRX A;  3VWX A;  3TJK A;  3TKR A;  1H75 A;  4EUY A;  2CX4 A;  1QXH A;  1ABA A;  5HR1 A;  3TJB A;  2VCQ A;  2AYT A;  5CRW A;  5DJM A;  1EZK A;  1OE7 A;  4K5R A;  4GST A;  3HXS A;  4EO3 A;  4TR4 A;  2YWM A;  3M3M A;  2GSR A;  4MF5 A;  5GZZ B;  2XC2 A;  2WVY A;  4K0N A;  2CVK A;  3GHA A;  3ZML A;  4JRR A;  3K8N A;  3Q6O A;  2EFH A;  3GUR A;  2I4A A;  2VIM A;  4POK A;  3IV4 A;  5B6M A;  1THX A;  2VCX A;  2F8F A;  5ECK B;  3G7J A;  2VL9 A;  1V40 A;  5CRG A;  4TVE A;  2N5F A;  2HRN A;  1HNA A;  1EEM A;  3KCM A;  3IAS 2;  2H1G A;  2FUG 2;  2WVX A;  4KDU A;  3GUS A;  4K2X A;  1S3D A;  3U6V A;  1U87 A;  1HNC A;  2JAC A;  3CYN A;  1OYJ A;  4BA7 A;  5EL8 A;  4L0U A;  1Z6M A;  1A2M A;  3P2A A;  3A5I A;  2PN8 A;  2L57 A;  1SKS B;  3FR3 A;  2V2G A;  3TRP A;  1FB0 A;  1ERW A;  3TJJ A;  1GUK A;  4BIK A;  5ABR A;  5G5E A;  4MK3 A;  3GL3 A;  4D73 B;  3M9J A;  1PX6 A;  3M9K A;  5KOW A;  2CT6 A;  2NPB A;  3C71 A;  4AKX B;  2O7K A;  1E6B A;  5J40 A;  3KD0 A;  1FHE A;  2C3T A;  4X43 A;  4Q5Q A;  1OC9 B;  3IHG A;  4MPG A;  1VF1 A;  4L0W A;  4WF5 A;  3US3 A;  2VL3 A;  4N0V A;  3EU4 A;  4EDY A;  1NSW A;  2H19 A;  3HJP A;  3F63 A;  1U3A A;  1WRY A;  5ECN B;  5ECP B;  1TXU A;  12GS A;  2YWO A;  1GTI A;  1J08 A;  1WIK A;  4WR5 A;  4O32 A;  4G0K A;  5DAL B;  5ECQ B; 
#chains in the Genus database with same CATH homology
 3F9U A;  1URM A;  3E0U A;  2REM A;  2TRX A;  5IPG A;  4PNF A;  2IMK A;  2LV3 A;  5HFI A;  2VLT A;  1A2J A;  3EPT A;  5A34 A;  1TW9 A;  2EC4 A;  1SKW B;  1M7T A;  5ELG A;  2PPT A;  1PN0 A;  2I9H A;  2H75 A;  1GLP A;  3GSS A;  4JR6 A;  1SJ6 A;  4WBJ A;  1G6W A;  2R5G A;  4JZQ A;  2K6V A;  1TDI A;  4EF0 A;  4RUV A;  5AIV A;  1K0C A;  2LRN A;  1F6M C;  3HJO A;  4YQV A;  1GSE A;  3WGD A;  4V1A p;  2VCZ A;  5FT3 A;  5IMC A;  1MTC A;  4KSO A;  3IOS A;  2E7P A;  1U3I A;  2DSA A;  1AUC A;  3FKF A;  2GDR A;  4MAB A;  2ZNM A;  3A3T A;  2O5V A;  2H0I A;  3HY2 A;  4TR3 A;  5ID2 B;  1YKC A;  6GSS A;  3VWW A;  4MJA A;  4NXI A;  2OBK A;  4IQ1 A;  1X5D A;  4MDC A;  1OVN A;  3UVH A;  1YZX A;  6GSV A;  4EDZ A;  4FYU A;  2DML A;  5EVO A;  2H66 A;  4YAV A;  1KNG A;  2B5E A;  11GS A;  3GV1 A;  5IMV A;  3IE3 A;  1T00 A;  2VL2 A;  1R7H A;  4ZXG A;  2DC5 A;  2CZ3 A;  3KIJ A;  2V1M A;  1YY7 A;  1M2B A;  5E59 A;  4V2N A;  2IPA A;  1T4Y A;  5F8B A;  1ZYE A;  5KEJ A;  2WCI A;  4AJ7 A;  5HQP A;  3GL5 A;  5JCG A;  3TRX A;  3EMX A;  2E2M A;  3VI7 A;  3PH9 A;  5AIS A;  3CSJ A;  3W8S A;  4I97 A;  6GST A;  1EEJ A;  3O6T A;  3CMI A;  2IN3 A;  4TR1 B;  3KP8 A;  3O3T A;  2H1D A;  4NV5 A;  2CA8 A;  2H0H A;  3VFI A;  2DMM A;  2CVD A;  3GST A;  1ZZY A;  2R0P A;  4ZBD A;  2G0F A;  4ECJ A;  4K0G A;  1JLV A;  4QMK A;  3GX0 A;  5DQS A;  5B6N A;  1YVL A;  3DVW A;  1KEB A;  4PQH A;  2HLS A;  4BPY A;  3TOT A;  2N5A A;  3NOF A;  3ZIJ A;  3FEU A;  5BRT A;  2CZ2 A;  5EPF A;  1SKR B;  1BJX A;  2LJK A;  2CQ9 A;  3ME7 A;  3F6F A;  1NHO A;  4KA0 A;  2AJQ B;  2DJJ A;  4OCF A;  5IPH A;  4WR4 A;  1OC3 A;  4GQC A;  4O5U A;  5HFG A;  4PUR A;  4XS4 B;  2O8V B;  3ZYW A;  3CTF A;  2E2G A;  2H0G A;  5IMF A;  3GH9 A;  3GTU B;  1XBS A;  5HR0 A;  2K8V A;  1ZCP A;  1MD4 A;  3F4R A;  2HSM A;  3DVX A;  2OAD A;  3HJM A;  2AV4 A;  3ED3 A;  2EIR A;  2EIO A;  2C80 A;  2GSQ A;  5J47 A;  2B1K A;  1W4V A;  2KP1 A;  4G9H A;  4IJ3 A;  2H6X A;  2A2R A;  4KGI A;  2R0C A;  1MEK A;  2LEG A;  5IMZ A;  3RHC A;  2FNO A;  3PIN A;  2XBI A;  1GUL A;  1HNB A;  1T1V A;  4FIW A;  3UIW A;  2NVL A;  1TKD B;  2I81 A;  1GSS A;  1TU8 A;  5J5N A;  1EWX A;  4G0L A;  2XHF A;  3FK8 A;  2A4V A;  2K9F A;  1WP0 A;  14GS A;  5CO3 A;  4QL9 A;  3J7Y b;  1SL2 B;  3QFA C;  4KUN A;  4GSS A;  4F0B A;  4MLY A;  4ZB8 A;  3QCP A;  5ID2 A;  4MZC A;  4NAX A;  4IN0 A;  3UL3 A;  4YQM A;  3HVS A;  5INY A;  5H5R A;  5A5K A;  5F0G A;  4V2M A;  4MF6 A;  4XTS A;  2IFQ A;  2Z9S A;  1GUH A;  5BMU A;  3G7I A;  1V57 A;  2LRC A;  3NZN A;  1HQO A;  4OMV A;  1JHB A;  4BVY B;  4IP6 A;  4PNG A;  3KMN A;  4FYB A;  4LA1 A;  1QFN A;  4I2T A;  5G5F A;  6GSY A;  4I8B A;  4MJC A;  4IHU A;  5A4V A;  5ECR B;  4GTU A;  2OE1 A;  2TRC P;  2DLX A;  5G2Z A;  1GL8 A;  1WWJ A;  2ZUP A;  1EOG A;  2B6M A;  3ZLP A;  2LQQ A;  3TOU A;  2R4V A;  3WT1 A;  1XIY A;  1T7P B;  1KTE A;  3UOM A;  5IIZ A;  2JU5 A;  3HCZ A;  3NIV A;  3EWL A;  3D4M A;  3W8J A;  1NM3 A;  1S3A A;  4JBB A;  4E8H A;  2KHP A;  1SD9 A;  2JSY A;  1J0F A;  3WD6 A;  1LBK A;  6GSW A;  2L5O A;  2O85 A;  2YJH A;  5DAK B;  7GSS A;  1HD2 A;  5ECS A;  2VCV A;  1GP1 A;  2RLI A;  5GSS A;  4Z2U A;  4KDY A;  4N3Z A;  4I5Q A;  1O85 A;  4YKF A;  4KE3 A;  4CDO A;  1F3A A;  1BAY A;  2GT6 A;  3APQ A;  3LSZ A;  4Q5F A;  2RM6 A;  5G1L A;  3A5W A;  2H6Y A;  4N11 A;  2GGT A;  2IL3 A;  1GNW A;  3HVX A;  3TCO A;  1ON4 A;  1JZR A;  1TXX A;  1TRV A;  3ZVJ A;  3CSI A;  4ZB7 A;  2KOK A;  2VUP A;  1ERU A;  2L6D A;  5J41 A;  1LU4 A;  3TDG A;  5JWQ B;  2KP2 A;  1XPV A;  2FWE A;  2YV7 A;  3MAK A;  2EFD A;  2DJ0 A;  1B9Y C;  1ZGN A;  1MDI A;  5A5H B;  1I5G A;  3FZ5 A;  2DJ1 A;  5A1N B;  3ISO A;  3QMX A;  1PL1 A;  1O73 A;  3E9J B;  5GAN D;  1MD3 A;  3HZ4 A;  3U5R E;  4MZW A;  4Q5R A;  4KCE A;  3D22 A;  1V58 A;  2WFC A;  4RQX A;  3BCK A;  1GSQ A;  2B7J A;  1AQW A;  5G30 A;  2YOI A;  3DWV A;  3VPQ A;  3UBL A;  3QOU A;  1X0R A;  2DKH A;  1PQN A;  4JU5 A;  3FY7 A;  1ML6 A;  4POB A;  1XWB A;  4MNN A;  5J4V A;  2TIR A;  4I6X A;  1M2A A;  5ECM B;  4PQI A;  3I43 A;  4NHW A;  5AN1 A;  2EFC A;  4JR4 A;  1PL2 A;  5IOW A;  2FA8 A;  3GNJ A;  2R3X A;  1XXU A;  3GMF A;  2K18 A;  1FOH A;  4G19 A;  1Y25 A;  3QAG A;  3CSH A;  2H1L A;  2H72 A;  2EFE A;  1BYE A;  1GLQ A;  2RM5 A;  1CQG A;  5DVB A;  2YJ7 A;  1UVZ A;  2CX3 A;  3DD3 A;  1UN2 A;  3D21 A;  2X8G A;  2F51 A;  3EMP A;  1USB A;  2LUS A;  4LMW A;  4HUA A;  2OE3 A;  1XZO A;  2GZY A;  4KW6 A;  2P0G A;  4GRF A;  4X4J A;  4LLR A;  3UJ1 A;  3LOR A;  1A24 A;  2GQK A;  1FVK A;  2DJK A;  4LMV A;  5LNK e;  2MMN A;  1XVW A;  4QQ7 A;  1GUM A;  3D4T A;  4K9Z A;  4FYC A;  3M0F A;  4AKI A;  4NWY A;  5KOX A;  2PMT A;  3F8U A;  2V32 A;  2M80 A;  2B1L A;  2LS5 A;  4LL1 B;  2JL4 A;  1QQ2 A;  1XWG A;  4J2F A;  2N5B A;  3RHB A;  4YH2 A;  2YCD A;  2X99 A;  1VF4 A;  2PER A;  2QSI A;  3DXB A;  4EIP A;  3F3Q A;  3LG6 A;  2P5R A;  5COH A;  2HSY A;  1BQ7 A;  3LJR A;  1SL0 B;  1XVQ A;  1NW2 A;  4TXO B;  4MZB A;  3MDK A;  5F05 A;  3DYR A;  5B8A A;  2JAD A;  1F2E A;  3ERG A;  1A8Y A;  2M72 A;  3CTG A;  4MH3 A;  2WRT A;  4J57 E;  1AQX A;  2ON7 A;  2QC7 A;  2YP6 A;  2IJY A;  4KDX A;  4CHS A;  2GVP A;  1K0O A;  4TOP A;  4MMM A;  1XWC A;  2GST A;  1JZD A;  2RII A;  5CRD A;  2VM1 A;  4AGS A;  13GS A;  3TU3 B;  3FMW A;  2IIY A;  3KXO A;  3GN3 A;  1A23 A;  4K2D A;  2FCH A;  2LQO A;  2HSH A;  3GFK A;  1ZMA A;  2F9S A;  1AIU A;  2B5Y A;  4OO5 A;  4HJ2 A;  5B8B A;  3L9U A;  3C1R A;  3L78 A;  2VD0 A;  4MCU A;  3SWL A;  1SD8 A;  1K0A A;  3IC4 A;  4TW5 A;  5IQY A;  4BVX B;  1U6T A;  3IDV A;  4XRD A;  1PGT A;  3H8Q A;  3QR6 A;  4PUA A;  4X1U A;  1O6J A;  2BTO T;  1UC7 A;  3P7X A;  2CAQ A;  2BJX A;  3HHV A;  3TGZ A;  1O8W A;  3F3R A;  3RDW A;  4IP1 A;  5CYY A;  2YPM A;  4RQR A;  3TJG A;  1TI3 A;  3FZA A;  5ECI B;  4YAP A;  1THO A;  3KMO A;  4H86 A;  5AGY A;  3UAR A;  4HI7 A;  3DML A;  1Z7R A;  4IW9 A;  2LKU A;  1FB6 A;  1TP9 A;  1AW9 A;  4G01 A;  3IBH A;  1TK5 B;  3PR8 A;  1GWC A;  1N25 A;  3VK9 A;  16GS A;  3ERW A;  2GLR A;  1O81 A;  5J4Y A;  3MSZ A;  3M8N A;  4ECI A;  1B4Q A;  4MPF A;  1SK0 A;  4V1A g;  3IHQ A;  1ILO A;  4K6X A;  5JCW A;  5J4U A;  4ZL8 A;  3DKS A;  4ZBB A;  3HZ8 A;  3L9V A;  5C04 A;  1FVJ A;  3APS A;  5JWO B;  2C3N A;  5G1K A;  1ZYQ B;  4D73 A;  2MMZ A;  4O5Q A;  4F03 A;  3GA4 A;  1QGV A;  1FO5 A;  1FG4 A;  4PGT A;  1H4O A;  4F2I A;  3KH9 A;  1T8E B;  1TRS A;  4LL4 B;  4FH8 A;  3QAV A;  2HE3 A;  3TKS C;  5D8I A;  1SJZ A;  2GQL A;  1V9W A;  1OC9 A;  4AJ8 A;  4W66 A;  1T4Z A;  1SK2 A;  4GCI A;  4KX4 A;  1TTZ A;  3TKQ A;  3ZVJ D;  5EY6 A;  5ENU A;  2HSN B;  3LW9 A;  17GS A;  4TRX A;  2A2S A;  4ULX A;  3BOA A;  5GAP D;  3H79 A;  2DJ2 A;  4USS A;  4AI6 A;  5IO2 A;  2PVQ A;  5DAL A;  1XW6 A;  8GSS A;  1G7O A;  2I1U A;  2R2J A;  1TRU A;  4F0C A;  2MMO A;  3LEF A;  1Y6E A;  2R0G A;  2WJU A;  2H73 A;  2MBS A;  1OKT A;  2GQM A;  1SVO A;  5KN3 A;  2FWG A;  2DIY A;  1A0R P;  2HRK B;  1A8L A;  3G7Y A;  4BWS A;  1CQH A;  3L9S A;  3MNG A;  4FO5 A;  3EIN A;  5D96 A;  4FQU A;  5J3R A;  3N9J A;  3GKK A;  3EU3 A;  4IS0 A;  3RPN A;  4HOJ A;  3L0H A;  2C3Q A;  5H5Q A;  2I3Y A;  3F4S A;  3IPZ A;  4OFT A;  1BF5 A;  2MMA A;  3IA1 A;  3GKM A;  4JE1 A;  1AAZ A;  4Z2T A;  3TUE A;  2DIZ A;  1EV9 A;  4IKH A;  4RI6 A;  1EOH A;  2H01 A;  5E4W A;  1Z6N A;  5KN0 A;  4A5P A;  4BVX A;  4KF9 A;  2AAW A;  4NV2 A;  1SEN A;  3F0I A;  2GS3 A;  3EYT A;  2LST A;  1G0T A;  4XCS A;  2K8S A;  2O87 A;  3FR6 A;  2QA2 A;  2H70 A;  4KB3 A;  2F8A A;  2OE0 A;  3I9V 2;  3CRT A;  3R3E A;  4G10 A;  4KAE A;  2L6C A;  5KN2 A;  4XS1 A;  4OD7 A;  2VAF A;  1PRX A;  1ZYN A;  2V6O A;  5IM9 A;  3O76 A;  2AUV A;  3ZIV A;  5DCH A;  3IRA A;  1PX7 A;  1VRS D;  4ZL7 A;  2IMD A;  4MJE A;  5A4U A;  4AJ6 A;  4GDF A;  3HKR A;  1SVM A;  3I6A A;  1JZO A;  1M9A A;  3UAP A;  4TR1 A;  2L4Q A;  1DUG A;  1K3L A;  2P31 A;  3BJ5 A;  4HQZ A;  1FOV A;  2C4J A;  1EGO A;  4ISD A;  4ECB A;  2HRA A;  4POM A;  1K0B A;  1OC8 A;  3BD2 A;  4KCA A;  3BCI A;  2C0G A;  2X64 A;  4GWR A;  2C8U A;  1TOF A;  1G6Y A;  3BBY A;  5F06 A;  5AIX A;  1BG1 A;  1F3B A;  2ZCT A;  3FZ4 A;  2H6Z A;  4NPB A;  1N2A A;  1GH2 A;  2FA4 A;  6GSX A;  3S9F A;  10GS A;  2NTO A;  4I2U A;  4L8E A;  2VLU A;  3KM6 A;  2DKI A;  3UEM A;  2WS2 A;  1N8J A;  2HZE B;  4J56 E;  2GZZ A;  3VLN A;  2LJR A;  1JFU A;  3VWU A;  2R6K A;  3H1N A;  3APO A;  3RAZ A;  1IYH A;  4XS4 A;  5D9X A;  2OBI A;  2X8H A;  4DSR A;  1X5E A;  2D2Z A;  2IWT A;  4NMU A;  2PU9 C;  4ZB6 A;  2AHE A;  1O8X A;  2F3M A;  4DSS B;  3GTU A;  1V2A A;  2A4H A;  5ECH B;  1AXD A;  2LNS A;  3TB2 A;  3F6D A;  2H1A A;  3R2Q A;  1GSF A;  3DGQ A;  4NHZ A;  5A34 B;  1VGL A;  5LD0 A;  4GSN A;  4POL A;  2PBJ A;  4EXJ A;  5CP1 A;  3C73 A;  4WBR D;  4MP4 A;  3C1S A;  2C0D A;  1Z3E A;  3UMA A;  2JSZ A;  1XW5 A;  1A0F A;  2JZT A;  2DBC A;  1SJI A;  5FHI A;  4OFN A;  2B7K A;  4Q5N A;  2FHE A;  4K8M A;  2FLS A;  1X9M B;  3F4T A;  3LYK A;  3ZRE A;  2B5X A;  1ZOF A;  4ML6 A;  4G2E A;  3KTL A;  3V1W A;  2WB9 A;  1SU9 A;  2VM2 A;  3DIE A;  1C72 A;  1M0U A;  4MA9 A;  4GXZ A;  1ERV A;  2MBT A;  5IMD A;  4N30 A;  3IAM 2;  2B3S A;  4AKH A;  3LYP A;  4V2L A;  1PSQ A;  3TKS A;  1GTA A;  5HFK A;  4ZIJ A;  4ACS A;  2OJL A;  3IC8 A;  1TI1 A;  1Z9H A;  2O89 A;  1U88 A;  1GSY A;  2H1B A;  2XPE A;  3VWV A;  1R4W A;  1YQ1 A;  5C00 A;  5CAX A;  4EC0 A;  4GF0 A;  5FWG A;  4HU9 A;  2E0Q A;  1K3O A;  3ZFB A;  3QDN A;  2HFD A;  1AC1 A;  3WT2 A;  1DBY A;  1WPI A;  4BVY A;  5D93 A;  1NHY A;  5GST A;  3IK7 A;  2WUL A;  3ZIT A;  4HDE A;  5DDL A;  1DE1 A;  3MYD A;  2WZ9 A;  3RBT A;  4KND A;  2V41 A;  1TJD A;  4YKG A;  1K0N A;  2YWN A;  4PXO A;  1V98 A;  4ICY A;  2DJ3 A;  3AY8 A;  4HU7 A;  1OKD A;  3ME8 A;  3MIX A;  1TU7 A;  3LGC A;  2H8L A;  22GS A;  5KN1 A;  2GZP A;  1HYU A;  1K3Y A;  2VLV A;  2CAI A;  1DSB A;  1EV4 A;  3KP9 A;  1K0D A;  3EC3 A;  4P3Y B;  2VCW A;  1TK8 B;  2JZR A;  5D9W A;  2GT5 A;  1PN9 A;  2LTK A;  5DAK A;  1XWA A;  2NDO A;  5CRH A;  1BG5 A;  2HZF A;  1SL1 B;  3KH7 A;  4RI7 A;  2HZE A;  2V6K A;  1SVL A;  2ON5 A;  5B7C A;  3Q19 A;  5J9B A;  1ERT A;  1F37 A;  4PX1 A;  1BED A;  4ZBA A;  3GKN A;  4ZB9 A;  3GH6 A;  1T3B A;  4IBP A;  4DSQ A;  3Q18 A;  3I69 A;  4DSS A;  5LCZ A;  1B8X A;  3GRX A;  3W6G A;  2HSM B;  4KH7 A;  3VI5 A;  3UBK A;  3J7Y k;  5JWR B;  3EUR A;  2MZC A;  1S3C A;  4CW9 A;  2L59 A;  3UVT A;  5CNW A;  2OA7 A;  4PQ1 A;  2GSS A;  4MJB A;  4TKY A;  3LXZ A;  1XOA A;  1YDK A;  3QAW A;  5F07 A;  5A5H A;  1EP8 A;  4O5R A;  1VF3 A;  4EE0 A;  5A1N A;  4ID0 A;  2HQT A;  1BX9 A;  3FW2 A;  2RUF A;  1YJ6 A;  2RUE A;  1SYR A;  4Z7X A;  1FW1 A;  1MDK A;  4MH2 A;  1F9M A;  1WJK A;  3HD5 A;  2VKZ G;  2QA1 A;  1UA5 A;  5HR3 A;  2H76 A;  1KBN A;  4OO4 A;  3PGT A;  2HRF A;  3P8W A;  3LQ7 A;  3A2W A;  1YEX A;  1GNE A;  1ZL9 A;  3HMJ G;  4XHM A;  3GX8 A;  3GIX A;  2YNX A;  2PWJ A;  4TR0 A;  1PA3 A;  1RW1 A;  1J9B A;  2J9H A;  1YEP A;  5DJL A;  1EP7 A;  3LFL A;  1TK0 B;  1XW9 A;  4WKW A;  5J9C A;  1XOB A;  2ES7 A;  1Q4J A;  2IFQ B;  4EL1 A;  3FZ9 A;  5BMU B;  5G31 A;  5L71 A;  4ZL9 A;  3CBU A;  4MF7 A;  4BL7 B;  3RPP A;  2YV9 A;  4X0X A;  5DQY A;  4TN8 A;  3D5J A;  3TRQ A;  3ZTL A;  2FWH A;  3C8E A;  1QK8 A;  2IME A;  1M99 A;  3TJF A;  4PTS A;  1FAA A;  1PKW A;  4IQA A;  3OR5 A;  4K1F A;  4KSM A;  4ILF A;  4YQU A;  1W89 A;  4OCE A;  4ML1 A;  3ZZX A;  3MWH A;  2GTU A;  3KGK A;  3PPU A;  1YF1 A;  4K5S A;  1ACV A;  1WOU A;  4IGJ A;  2YZH A;  3EVI A;  2M46 A;  3LXT A;  2C1Y A;  3FRC A;  4HJM A;  2FD3 A;  3DRN A;  5A4W A;  2X8C A;  3D0Z A;  6GSU A;  1B48 A;  3HA9 A;  1Z7P A;  18GS A;  5IMA A;  2VD1 A;  2FWF A;  2IMI A;  4DVC A;  4CY6 A;  4K7O A;  4K7N A;  4HS1 A;  4HZ4 A;  1GTU A;  1RQM A;  4HZ2 A;  4TXO A;  1OAZ A;  1K0M A;  1X9W B;  1I9D A;  1WE0 A;  1WMJ A;  1R26 A;  2WGR A;  3ZMK A;  1SK1 A;  4IEL A;  4G0I A;  5ECO B;  1B4P A;  5ELA A;  1LJR A;  4IJI A;  1PMT A;  2FGX A;  1EGR A;  4GQF A;  4O92 A;  2HI7 A;  2OT3 A;  3C7M A;  3IR4 A;  1XCC A;  4JED A;  1M2D A;  4DEJ A;  2P5Q A;  1VF2 A;  3CXG A;  1Y1U A;  4F82 A;  1O7U A;  4QL7 A;  1G7E A;  4E68 A;  2EIQ A;  1R5P A;  5DBQ A;  3IK9 A;  2X4A A;  2XBQ A;  5IO0 A;  2J23 A;  4XRA A;  3VPT A;  19GS A;  4N10 A;  3M1G A;  1TRW A;  3ZRD A;  1JLW A;  4OFM A;  3QD9 A;  2VOC A;  3LWA A;  2KLX A;  3CRU A;  1JZW A;  2NBS A;  1PD2 1;  4IVF A;  3L4N A;  3TKS E;  4OWY A;  4F9Z A;  4L5O A;  2C0F A;  5HR2 A;  2XPD A;  2H30 A;  4WXT A;  1Z5Y E;  2PGT A;  1DE2 A;  3WGE A;  4L5L A;  2YAN A;  4CY8 A;  1RK4 A;  3QPM A;  9GSS A;  4XS6 A;  4N0Z A;  2FY6 A;  1GTB A;  2G2Q A;  3FYG A;  1PKZ A;  5ECL B;  2R37 A;  3IXR A;  2HNL A;  3FHK A;  5H5S A;  3H4K A;  2ALB A;  3P90 A;  1QMV A;  20GS A;  3WYW A;  4EIQ A;  3HYP A;  4WEY A;  4HQS A;  4HEA 2;  4BL7 A;  1X5C A;  1ZYP A;  4Z2R A;  2OAC A;  2VO4 A;  3HDC A;  2WDU A;  2CV4 A;  2HYX A;  3KTB A;  4WET A;  1X9S B;  4AKG A;  2JZS A;  1R5A A;  3SBC A;  2UZ8 A;  2OKA A;  2YZU A;  2QKE A;  3ZL5 A;  2L5L A;  3JCM L;  5D9T A;  4ECC A;  5JCU A;  2C0E A;  3E3E A;  3FR9 A;  3G9B A;  1OE8 A;  1IYI A;  1AQV A;  2PUK C;  1SYX A;  4EVM A;  2VCT A;  3WGX A;  2L4C A;  3KZQ A;  1MDJ A;  2UV8 G;  3CWG A;  2YWI A;  3H93 A;  1GSU A;  1B9X C;  1E2Y A;  3N5O A;  2A2P A;  4PUF C;  1A2L A;  2IMF A;  2HSN A;  3D6I A;  3GYK A;  5IOX A;  1YKA A;  2KUC A;  5D73 A;  2HXK A;  1YF0 A;  1XFL A;  4AF2 A;  2X49 A;  4EKZ A;  4O7H A;  2VL2 C;  3GKX A;  2MYG A;  1Q98 A;  2QGV A;  2CVB A;  4XIH A;  4ZIL A;  3DEX A;  2LJA A;  5D9V A;  3Q74 A;  1ST9 A;  3VUR A;  2PVO C;  1M9B A;  1GSD A;  4WF4 A;  4K7I A;  5CRE A;  4E8E A;  3QFB C;  3EE2 A;  2HT9 A;  4GLT A;  1QUW A;  3A2V A;  5DCG A;  1XWK A;  3A2X A;  3ZFL A;  2HRK A;  4BWQ A;  2YN1 A;  3KEB A;  3HVV A;  2BMX A;  2H71 A;  2LRT A;  4TXV A;  2LNT A;  3TKP A;  2H74 A;  3KJY A;  2AB6 A;  3ERF A;  1GRX A;  3VWX A;  3TJK A;  3TKR A;  1H75 A;  4EUY A;  2CX4 A;  1QXH A;  1ABA A;  5HR1 A;  3TJB A;  2VCQ A;  2AYT A;  5CRW A;  5DJM A;  1EZK A;  1OE7 A;  4K5R A;  4GST A;  3HXS A;  4EO3 A;  4TR4 A;  2YWM A;  3M3M A;  2GSR A;  4MF5 A;  5GZZ B;  2XC2 A;  4K0N A;  2CVK A;  3GHA A;  3ZML A;  4JRR A;  3K8N A;  3Q6O A;  2EFH A;  3GUR A;  2I4A A;  2VIM A;  4POK A;  3IV4 A;  5B6M A;  1THX A;  2VCX A;  2F8F A;  5ECK B;  3G7J A;  2VL9 A;  1V40 A;  5CRG A;  4TVE A;  2N5F A;  2HRN A;  1HNA A;  1EEM A;  3KCM A;  3IAS 2;  2H1G A;  2FUG 2;  4KDU A;  3GUS A;  4K2X A;  1S3D A;  3U6V A;  1U87 A;  1HNC A;  2JAC A;  3CYN A;  1OYJ A;  4BA7 A;  5EL8 A;  4L0U A;  1Z6M A;  1A2M A;  3P2A A;  3A5I A;  2PN8 A;  2L57 A;  1SKS B;  3FR3 A;  2V2G A;  3TRP A;  1FB0 A;  1ERW A;  3TJJ A;  1GUK A;  5ABR A;  5G5E A;  4MK3 A;  3GL3 A;  4D73 B;  3M9J A;  1PX6 A;  3M9K A;  5KOW A;  2CT6 A;  2NPB A;  3C71 A;  4AKX B;  2O7K A;  1E6B A;  5J40 A;  3KD0 A;  1FHE A;  2C3T A;  4X43 A;  4Q5Q A;  1OC9 B;  3IHG A;  4MPG A;  1VF1 A;  4L0W A;  4WF5 A;  3US3 A;  2VL3 A;  4N0V A;  3EU4 A;  4EDY A;  1NSW A;  2H19 A;  3HJP A;  3F63 A;  1U3A A;  1WRY A;  5ECN B;  5ECP B;  1TXU A;  12GS A;  2YWO A;  1GTI A;  1J08 A;  1WIK A;  4WR5 A;  4O32 A;  4G0K A;  5DAL B;  5ECQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...