1YJ6A

Crystal structure of human glutathione s-transferase m1a-1a complexed with glutathionyl-zinc-trihydroxide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
217
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase Mu 1
publication title Human Glutathione S-Transferase M1A-1A Catalyzes Formation of Gsh-Metal Complexes
rcsb
source organism Homo sapiens
total genus 77
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yj6A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yj6A01
2H6XA 1PA3A 2DJ0A 4P3YB 2ON5A 4XS1A 4K8MA 3GH9A 4OO5A 1TK8B 1GRXA 5HR2A 4PNGA 1HNCA 2RLIA 4CW9A 4DVCA 3GKXA 5FHIA 4I5QA 3IR4A 4WBJA 1XVQA 3GA4A 6GSXA 3BCKA 1GSYA 5HFGA 3KTLA 3D5JA 5KEJA 3KZQA 4V1Ag 1GNEA 3IXRA 13GSA 1YY7A 2OE3A 1QQ2A 2DJ3A 3Q74A 4E8EA 4CDOA 2X8CA 2YANA 1X9MB 3VLNA 2CQ9A 2TIRA 1B9YC 3HVVA 3ZREA 3J7Yb 4XHMA 4OFNA 5ECSA 4G0KA 2J23A 1XBSA 3P90A 2N5FA 3DD3A 5ECQB 4MK3A 1F3AA 4JR4A 1O7UA 5EL8A 4MJEA 6GSTA 4PX1A 5B8AA 4ZL9A 5ECMB 1SK1A 1NSWA 3TKSA 2VAFA 3DYRA 4XIHA 2CVKA 1M9BA 4WBRD 1N2AA 2LEGA 5IQYA 2KP2A 4X43A 4QL9A 3TJJA 5D9VA 2LKUA 5HR3A 1ERWA 3CRUA 3F6FA 2B5EA 2FA4A 4H86A 3UMAA 4L0UA 2QGVA 1K0CA 4NV2A 4MP4A 1WRYA 1Z3EA 3L4NA 5ECHB 2X99A 4EL1A 3F4RA 5JWRB 5J41A 4HDEA 2HSNB 1PKWA 3EC3A 1DUGA 4ILFA 1DSBA 1EOHA 2VLVA 1OKDA 3FR6A 1YQ1A 1K0OA 3F3QA 1MTCA 2QSIA 1ZYEA 1LJRA 2IFQA 5IMFA 1WMJA 2OE1A 3EVIA 3MNGA 5CRWA 4GSTA 1MDKA 2HQTA 4POKA 2MBSA 1JLWA 4IQAA 2NBSA 3ZVJD 5FWGA 2JADA 1Z6MA 3ZFLA 4LL4B 4LMVA 5ECRB 3DEXA 3GUSA 2O8VB 4Q5QA 5DDLA 2C3NA 3KD0A 3UVTA 3KH9A 3QMXA 3HY2A 1A8YA 2H1DA 4WR4A 1XCCA 3APSA 3EINA 3ME8A 1SK0A 2FWGA 3H4KA 1X9SB 5CO3A 1TTZA 1Z9HA 1WWJA 2V6OA 1ZGNA 2O89A 2CVDA 2H75A 1FW1A 2YJ7A 5KN3A 2JL4A 3F63A 1K0MA 4HQZA 1R5PA 3GX0A 4IJIA 1V40A 2EC4A 2PUKC 4JRRA 2ALBA 2H71A 2VCTA 2E7PA 3N5OA 2XHFA 1A2JA 4WXTA 1B4QA 4HZ2A 1PKZA 2ZNMA 2O7KA 2L57A 3ZYWA 4Q5FA 4L8EA 3LORA 2H6ZA 1DE1A 5JWQB 4MH3A 5B8BA 2Z9SA 1UVZA 4EF0A 1VF2A 4BPYA 2YWMA 4ID0A 2PVOC 3QPMA 2YV7A 4IKHA 4PUAA 2AUVA 4GQCA 2R6KA 5EPFA 2L5LA 4KUNA 1NM3A 2IMKA 2H0GA 5H5RA 2IIYA 2VM2A 1MEKA 2I81A 5ELGA 2TRXA 3RPNA 1PX6A 2VL3A 1HNBA 4LMWA 3UAPA 4KDUA 1R5AA 1QK8A 6GSSA 4ZBDA 5HQPA 4KX4A 1T7PB 2F3MA 3EMXA 4I2TA 3LG6A 2B7JA 3HVSA 4HU7A 4I8BA 2G2QA 5C00A 2R2JA 2VLUA 16GSA 3HKRA 4TR3A 3ISOA 1EV4A 3FW2A 4N10A 2H19A 3CXGA 2B5XA 3A2VA 2VOCA 3D0ZA 1GNWA 3W8JA 5EY6A 1FG4A 5ECKB 5DQYA 3TDGA 4WF4A 2GDRA 4KE3A 3IRAA 1V98A 4KA0A 3GKNA 4NMUA 3D22A 4G10A 3CSHA 3CTGA 2OKAA 1YEPA 1MD4A 2WGRA 1V57A 1TI1A 4IVFA 2R3XA 2VCXA 12GSA 5DJLA 4K1FA 4HJMA 2GSRA 4F9ZA 1OYJA 1QFNA 3D6IA 5IOXA 4L0WA 2L6CA 4NPBA 3IA1A 3P7XA 2PBJA 1GSDA 1OKTA 1B48A 1VF3A 4JR6A 5IO0A 5A5KA 4V2MA 4BVYB 3F8UA 5ID2A 2HZEB 1I9DA 2HZFA 2IJYA 3GRXA 2VCVA 2IL3A 3TJGA 3UL3A 2FWHA 5COHA 4GWRA 5DBQA 2C3QA 4EKZA 1VF1A 5G31A 3ZLPA 4HI7A 1ACVA 4K7NA 4ZIJA 2IMFA 3FHKA 2RM5A 2C3TA 2VL2C 1XW9A 2XPDA 5G2ZA 2RUEA 1U88A 2GLRA 2JACA 2O85A 4K0GA 1ZMAA 4KSMA 1OC9A 2P0GA 2FWFA 1WJKA 4X0XA 4AGSA 4TN8A 1THOA 1QGVA 3VWVA 3HA9A 2LV3A 2YOIA 1YF0A 1QUWA 4ZBBA 5CRGA 3RHBA 3GH6A 3O6TA 1EZKA 1M9AA 4OCFA 1E6BA 2YZHA 4J57E 3CSIA 5IMDA 5INYA 2V6KA 2VD0A 1K3LA 3V1WA 3F9UA 3IDVA 2WZ9A 4ZB9A 5IOWA 2RIIA 3ZITA 1OE8A 4K9ZA 3TKRA 2LUSA 4EUYA 4DSQA 3O3TA 2LSTA 2DC5A 3CBUA 6GSUA 4K2DA 3M1GA 2YPMA 1ZZYA 2GT5A 4DEJA 3S9FA 22GSA 3E3EA 3KM6A 4YQVA 5ECOB 2J9HA 3EU3A 2M72A 4KSOA 3EMPA 4RUVA 1GTUA 1MDJA 2WFCA 2UZ8A 3SWLA 3QAWA 1Q98A 2B7KA 4N0VA 4BL7B 2WCIA 2LRNA 4HOJA 3L9UA 3BCIA 3TJFA 1BAYA 4NAXA 1KEBA 3A3TA 1FVJA 3KP9A 1QXHA 1T4YA 3D4MA 3VWUA 1IYIA 1M0UA 3TUEA 1PL1A 2BMXA 3QOUA 2H70A 1ON4A 4MLYA 1CQGA 3ZRDA 4POMA 3C1RA 3LEFA 3IV4A 3BBYA 1T8EB 2MMOA 2JZRA 5GZZB 2HFDA 5CREA 1UC7A 1GSFA 1NHOA 3ZIJA 2M80A 2A2SA 5KN0A 5CNWA 1H75A 4HQSA 2KOKA 3CMIA 2V2GA 2HT9A 2H66A 2GQMA 1HNAA 3IE3A 5J3RA 2VUPA 4N30A 2F9SA 3QDNA 1TK5B 1O81A 1TP9A 2XBQA 2REMA 1K0NA 3PGTA 4EDZA 4TXOB 5IMVA 3TKSC 4MZBA 5ECIB 2WULA 3UBLA 1THXA 3L0HA 3QR6A 3H93A 1PGTA 2AYTA 2HSMA 4KH7A 4PQ1A 3RBTA 2HSMB 2C4JA 5D9XA 1XXUA 3BJ5A 3ZFBA 4YQMA 1W4VA 4GF0A 3VFIA 1MDIA 1FO5A 5D8IA 1UA5A 1XOBA 3GSSA 2RUFA 3L78A 2L4CA 4JE1A 4G0IA 4E8HA 2GVPA 3CSJA 2GTUA 1J0FA 5LCZA 3A5WA 2KUCA 1RQMA 3I43A 3IPZA 2H6YA 2VCWA 5GSTA 2E2MA 2WS2A 2ES7A 3H79A 4XCSA 1TJDA 1E2YA 5B6MA 2GSSA 1X0RA 2WB9A 1J08A 4WR5A 2I3YA 3BD2A 5F05A 5KN2A 1GH2A 2BTOT 4POBA 2C0DA 4POLA 2CZ3A 1AQWA 2B3SA 5LNKe 3Q6OA 2DJ1A 4TVEA 2N5AA 1USBA 5A4VA 5G1KA 5JCUA 1A0RP 5A4WA 2CX4A 5BMUA 1UN2A 1H4OA 4RI6A 4K7IA 11GSA 2WRTA 3F4TA 1NHYA 2KHPA 1ERVA 2MMAA 2X64A 1O8XA 5JWOB 2LJKA 4TRXA 3C7MA 4J2FA 3Q18A 4G0LA 1EV9A 2MMZA 1EGOA 1VF4A 3FY7A 5IPGA 3I69A 2P31A 1GUMA 4KDYA 1U87A 1XWAA 5J9CA 3ZVJA 3PH9A 1U3AA 3IOSA 6GSWA 3ZTLA 2MMNA 1AAZA 2JSYA 1XZOA 2AAWA 1Z6NA 1F37A 4GSNA 1AIUA 5F0GA 3QCPA 5D9TA 1B4PA 3P8WA 3EWLA 2C8UA 1WPIA 5DCGA 4LLRA 2WJUA 2X8HA 3LXZA 2DBCA 3HZ4A 1V9WA 4XS6A 3ZMLA 3VI5A 3P2AA 3R2QA 2JSZA 3Q19A 3ERFA 2YZUA 3VK9A 1KNGA 3J7Yk 1S3DA 2DMMA 1G6YA 3TKSE 2NTOA 3ED3A 1QMVA 4JBBA 3MAKA 3PINA 2QKEA 4ECBA 2VL9A 3IC4A 2F8FA 4IBPA 2FNOA 3GTUB 1RK4A 1F9MA 3GV1A 1AW9A 2HSHA 5G1LA 2H1BA 4KDXA 2X8GA 4TOPA 2K6VA 3C71A 3WGEA 3WT2A 3GKMA 2OACA 1FOVA 4ECJA 3MWHA 2H01A 3G7JA 5DQSA 3KP8A 2LNSA 4PQIA 1J9BA 1G7OA 4FYCA 4IJ3A 1KTEA 3TGZA 2FD3A 5H5SA 3FEUA 1YDKA 2YCDA 3DRNA 3HHVA 3QAGA 4IELA 3E0UA 1XW6A 9GSSA 2F51A 4XRDA 4TR0A 1XVWA 4V2LA 5G5EA 2GSTA 2DLXA 1ST9A 4MCUA 4YAPA 2IMDA 2H1GA 2IPAA 4EVMA 2JZSA 5CRHA 3TB2A 4AF2A 1GTBA 4YQUA 5JCWA 1ZCPA 2RM6A 5E4WA 1N8JA 5F06A 2YNXA 3CYNA 4IHUA 1T1VA 4DSSB 2L6DA 1XIYA 4AJ7A 4G19A 4HU9A 4O92A 1HYUA 4IS0A 4J56E 3IK7A 2PVQA 2LTKA 3KIJA 5G5FA 4MA9A 3EU4A 3R3EA 4MDCA 4NHZA 2AV4A 3UARA 3NIVA 4KB3A 1M99A 3FZ5A 1ABAA 3HDCA 4FIWA 3FK8A 2FHEA 5J4UA 4WETA 1SU9A 1PL2A 1M2DA 1SK2A 2GT6A 6GSYA 5C04A 5F8BA 4AJ8A 1JZDA 1GUKA 2G0FA 4Z7XA 4BVYA 4KNDA 1TW9A 2HZEA 1O6JA 1SD8A 1GWCA 1YEXA 3GNJA 5AIVA 3RHCA 3TKQA 4USSA 1GL8A 3D21A 3FRCA 4MF5A 1SYRA 4IQ1A 3LXTA 1JFUA 3VI7A 2H73A 1M2AA 2DJ2A 4OFMA 3CTFA 2CX3A 2MYGA 2GZYA 2OBKA 1A2MA 4N0ZA 1X5CA 5ECNB 4FYBA 2YV9A 2B1LA 4HS1A 2DJJA 2EIOA 3TRQA 1ZOFA 1K0DA 2HRKA 4NHWA 4YH2A 5DALB 3KXOA 2HRKB 4JEDA 4GRFA 5AGYA 1G0TA 2HSYA 1OC8A 3NOFA 1LBKA 2YWIA 3LYKA 5ENUA 3WT1A 4V1Ap 3VURA 5A4UA 2H74A 2YN1A 4D73B 2PN8A 1T00A 1M7TA 1CQHA 1Z5YE 2R4VA 2H76A 2FY6A 2GQKA 1SJZA 5IMZA 3UOMA 1FB0A 2NDOA 3HYPA 1AC1A 3NZNA 2N5BA 3HJOA 2H1AA 3HCZA 1A2LA 3US3A 4BWQA 1JLVA 2IN3A 2OADA 2C0EA 5D93A 3WGXA 2HRNA 4EC0A 3G7IA 1FVKA 4BL7A 4BVXB 2FCHA 4PXOA 2HRAA 2K8VA 2OJLA 3TCOA 4HZ4A 2C80A 2V1MA 3RPPA 1A0FA 3ZMKA 2LJAA 3APOA 4I2UA 1R7HA 2EIRA 1EP8A 1WOUA 1GTAA 2VIMA 1EEMA 4NV5A 3M8NA 3D4TA 3DWVA 2ON7A 5GSSA 1EGRA 3KEBA 3HZ8A 1TI3A 4F2IA 2B1KA 1EEJA 1WIKA 1XPVA 3WGDA 2MBTA 1DE2A 4JU5A 2CVBA 3G7YA 1OVNA 4I6XA 4YAVA 4MJBA 4MJAA 3QD9A 4ZBAA 1F3BA 1GUHA 2PGTA 4K7OA 3GL3A 3M0FA 4ZB6A 3I6AA 3IBHA 4ACSA 1F6MC 1SENA 5D9WA 2H30A 2HNLA 18GSA 8GSSA 1XWBA 4OD7A 2HI7A 3HVXA 2H0HA 2R37A 1Y25A 1K0BA 4FYUA 20GSA 3UBKA 2HLSA 3F6DA 4TXOA 1TRWA 1MD3A 1AQVA 1U3IA 4MABA 5D96A 1R4WA 3LQ7A 1Z7PA 4DSRA 1Y6EA 3MSZA 5LD0A 4FH8A 4WEYA 3ERWA 2K8SA 4G2EA 2L5OA 3UIWA 3W8SA 2BJXA 3VPTA 4GCIA 1GSUA 1ZYQB 3LFLA 1BYEA 2L59A 4ECCA 2LQOA 2FLSA 4IN0A 3TJBA 5B7CA 4OCEA 1SKRB 4GSSA 2EIQA 3F4SA 2IMEA 1SJIA 1TU8A 3DKSA 3ZZXA 3HXSA 3GN3A 5AIXA 1BEDA 5GAPD 2HE3A 1JZWA 2E0QA 3DVWA 1HQOA 4GXZA 2YJHA 5G30A 4TW5A 5CAXA 3IC8A 4ZL8A 2C0GA 4KCEA 1AXDA 1TK0B 4IP1A 2A4VA 1IYHA 3U6VA 1SJ6A 2FGXA 2DMLA 3FZ4A 2P5QA 3E9JB 4PUFC 4WF5A 3KGKA 1YF1A 3PR8A 3GYKA 3QFAC 1TKDB 1GTIA 2E2GA 1OC3A 1JZOA 3UVHA 4JZQA 3L9VA 5CYYA 1A8LA 2LRTA 2HRFA 4V2NA 3GL5A 5IM9A 4XS4A 4TR4A 3F0IA 2HXKA 2B5YA 1ERTA 4MMMA 4XS4B 1BQ7A 4XRAA 3ZL5A 4F82A 3GIXA 1ML6A 1GLQA 3ZIVA 1BJXA 1ILOA 1PSQA 2PWJA 2ZCTA 4CHSA 2H72A 4O7HA 5KN1A 1TDIA 3GSTA 3JCML 2NVLA 1PMTA 3G9BA 4RI7A 4TXVA 1X5DA 1AUCA 3LSZA 3MDKA 2K9FA 14GSA 1JZRA 3KH7A 2DSAA 1GSSA 5J5NA 3TKPA 1RW1A 3A2WA 1V2AA 4ML1A 1YKAA 2H8LA 3LWAA 2IFQB 3C1SA 3GKKA 1SD9A 2B6MA 1EOGA 1GP1A 2DIYA 3FR9A 5JCGA 4EE0A 4L5LA 5H5QA 4O5RA 1YKCA 1TXXA 2IMIA 3FYGA 3GHAA 1G7EA 1K3YA 1PQNA 5FT3A 2V32A 3W6GA 5IO2A 3LYPA 3LJRA 4I97A 1OAZA 2D2ZA 3DVXA 2NPBA 1U6TA 2I9HA 2VO4A 5CRDA 5DJMA 4ZXGA 2OE0A 2XBIA 1GULA 1XW5A 1W89A 2C1YA 2LRCA 2PMTA 2VLTA 4MH2A 3U5RE 3VWXA 4IGJA 4EXJA 6GSVA 3H1NA 4PTSA 3GTUA 3K8NA 1XWCA 2YWNA 3SBCA 4EDYA 3UEMA 4IW9A 2MZCA 4PQHA 4KCAA 3EYTA 4LA1A 3FR3A 4EO3A 2IWTA 3DIEA 3TRPA 3UJ1A 5EVOA 1I5GA 1X5EA 4MPGA 4QL7A 1AQXA 2FWEA 5ABRA 1SL0B 4QQ7A 3M9JA 2CAQA 4ISDA 19GSA 1LU4A 2AJQB 1EWXA 3HJMA 5DAKA 5DAKB 3BOAA 4TR1A 3TJKA 1KBNA 1JHBA 4TR1B 4KAEA 4IP6A 2PERA 4DSSA 1XFLA 1O73A 1XWGA 3APQA 2VCQA 4XTSA 5CP1A 5ELAA 1PN9A 4TKYA 4FO5A 4K0NA 5GAND 2A2RA 5HR1A 4ECIA 4N11A 3WD6A 2I1UA 4O32A 2H0IA 3FKFA 4K6XA 3C8EA 4FQUA 4AJ6A 1B8XA 3VWWA 1S3CA 1SKWB 3M3MA 1TU7A 1VGLA 5IIZA 10GSA 4GTUA 1V58A 3IAS2 5ECLB 3TOUA 2GS3A 4RQXA 2AHEA 4OWYA 1G6WA 4MZCA 3KCMA 3KTBA 2AB6A 17GSA 4BA7A 2GQLA 1GSEA 3L9SA 5DCHA 2DIZA 4WKWA 1YJ6A 3HJPA 4MF7A 4MF6A 3A2XA 2CT6A 3ERGA 3CRTA 4Q5NA 4F0CA 2GGTA 2V41A 4RQRA 4Q5RA 2TRCP 3DMLA 4G9HA 5AISA 5J9BA 3TRXA 1BX9A 1C72A 2VCZA 3QFBC 3KMNA 1F2EA 2CZ2A 1B9XC 4NWYA 1S3AA 2WDUA 2VM1A 3IK9A 5ID2B 5DALA 5HFIA 5ECPB 5F07A 2LQQA 1Q4JA 2JU5A 4OO4A 5HFKA 2ZUPA 2CA8A 2OA7A 2KLXA 3WYWA 3GFKA 4BWSA 1TRUA 2GZPA 1PRXA 2FUG2 4L5OA 3RDWA 1X9WB 1O85A 2K18A 4D73A 5IMAA 3VPQA 4MZWA 2P5RA 1OE7A 4GQFA 4NXIA 2QC7A 4ZILA 1FAAA 1ZL9A 4ML6A 1FHEA 2KP1A 2F8AA 4MPFA 3IHQA 1Z7RA 2GZZA 5HR0A 2LJRA 1OC9B 4KF9A 1R26A 1EP7A 2OBIA 4PURA 3EE2A 2PU9C 1DBYA 2HYXA 1T4ZA 5IMCA 1BG5A 2CAIA 2O87A 4F0BA 5L71A 1SL2B 4ZL7A 2XC2A 3RAZA 2CV4A 5B6NA 3HD5A 4GLTA 3FZ9A 2YP6A 4BVXA 1TRVA 1WE0A 3C73A 1TOFA 2C0FA 3QAVA 1WP0A 5D73A 4LL1B 4ULXA 2GSQA 1PD21 2JZTA 2I4AA 5AN1A 2LNTA 2VL2A 4HJ2A 3I9V2 3O76A 4HUAA 5DVBA 1PX7A 1YZXA 3DXBA 1SL1B 3TOTA 1NW2A 2DJKA 2VD1A 4KGIA 3IAM2 2FA8A 3H8QA 1XOAA 1GLPA 3KMOA 1T3BA 4OMVA 3OR5A 2M46A 1A24A 1O8WA 1M2BA 3GURA 4PNFA 3FZAA 2XPEA 3ME7A 4F03A 5E59A 3LGCA 1SKSB 1GSQA 4KW6A 2PPTA 3DGQA 1XWKA 3AY8A 1SYXA 4X1UA 3M9KA 2R5GA 3PPUA 4MJCA 1HD2A 1VRSD 4PGTA 1K0AA 2LS5A 4HEA2 1FB6A 1K3OA 2L4QA 5IPHA 3KJYA 3EURA 1A23A 3N9JA 1TRSA 4ZB8A 3GMFA 3F3RA 2YWOA 1URMA 1ERUA 3GX8A 4OFTA 7GSSA
chains in the Genus database with same CATH superfamily
2H6XA 1PA3A 2DJ0A 4P3YB 2ON5A 4XS1A 4K8MA 3GH9A 4OO5A 1TK8B 1GRXA 5HR2A 4PNGA 1HNCA 4YKGA 2RLIA 4CW9A 4A5PA 4DVCA 3GKXA 5FHIA 4I5QA 3IR4A 4WBJA 1XVQA 3GA4A 6GSXA 3BCKA 1GSYA 5BRTA 5HFGA 3KTLA 3D5JA 5KEJA 3KZQA 4V1Ag 1GNEA 3IXRA 13GSA 1YY7A 2OE3A 1QQ2A 3FMWA 2DJ3A 3Q74A 4E8EA 4CDOA 2X8CA 2YANA 1X9MB 3VLNA 2CQ9A 2TIRA 1B9YC 3HVVA 4K5SA 3ZREA 3J7Yb 4XHMA 4OFNA 5ECSA 4G0KA 2J23A 1XBSA 3P90A 2N5FA 3DD3A 5ECQB 4MK3A 1F3AA 4JR4A 1O7UA 5EL8A 4MJEA 6GSTA 4PX1A 5B8AA 1YEWC 4ZL9A 5ECMB 1SK1A 1NSWA 3TKSA 2VAFA 3DYRA 4XIHA 2CVKA 1M9BA 4WBRD 1N2AA 2LEGA 5IQYA 2KP2A 4X43A 4QL9A 3TJJA 5D9VA 2LKUA 5HR3A 1ERWA 3CRUA 3F6FA 2B5EA 2FA4A 4H86A 3UMAA 4L0UA 2QGVA 1K0CA 4NV2A 4Z2UA 4MP4A 1WRYA 1Z3EA 3L4NA 5ECHB 2X99A 4EL1A 3F4RA 5JWRB 5J41A 4HDEA 2HSNB 1PKWA 3EC3A 1DUGA 4ILFA 1DSBA 1EOHA 2VLVA 1OKDA 3FR6A 1YQ1A 1K0OA 3F3QA 1MTCA 2QSIA 1ZYEA 1LJRA 2IFQA 5IMFA 1WMJA 2OE1A 3EVIA 3MNGA 5CRWA 4GSTA 1MDKA 2HQTA 4POKA 2MBSA 1JLWA 4IQAA 2NBSA 3ZVJD 5FWGA 2JADA 1Z6MA 3ZFLA 4LL4B 5KOWA 4LMVA 5ECRB 3DEXA 3GUSA 2O8VB 4Q5QA 5DDLA 2C3NA 3KD0A 3UVTA 3KH9A 3QMXA 3HY2A 1A8YA 2H1DA 4WR4A 1XCCA 3APSA 3EINA 3ME8A 4EIPA 4AKXB 1SK0A 2FWGA 3H4KA 1X9SB 5CO3A 1TTZA 1Z9HA 1WWJA 2V6OA 1ZGNA 1Y1UA 2O89A 2CVDA 2H75A 1FW1A 2YJ7A 5KN3A 2JL4A 3F63A 1K0MA 4HQZA 1R5PA 3GX0A 4IJIA 1V40A 2EC4A 2PUKC 4JRRA 2ALBA 2H71A 2VCTA 2E7PA 3N5OA 2XHFA 1A2JA 4WXTA 4CY6A 1B4QA 4HZ2A 1PKZA 5A5HA 2ZNMA 2O7KA 2L57A 3ZYWA 4Q5FA 4L8EA 4QMKA 3LORA 5A5HB 2H6ZA 1DE1A 5JWQB 4MH3A 5B8BA 2Z9SA 1UVZA 4EF0A 1VF2A 4BPYA 2YWMA 4ID0A 4X4JA 2PVOC 3QPMA 2YV7A 4IKHA 4PUAA 2AUVA 4GQCA 2R6KA 5EPFA 2L5LA 4KUNA 1NM3A 2IMKA 2H0GA 5H5RA 2EFCA 2IIYA 2VM2A 1MEKA 2I81A 5ELGA 2TRXA 3RPNA 1PX6A 2VL3A 1HNBA 4LMWA 3UAPA 4KDUA 1R5AA 1QK8A 6GSSA 4ZBDA 5HQPA 4KX4A 1T7PB 2F3MA 3EMXA 4I2TA 3LG6A 2B7JA 3HVSA 2R0GA 4HU7A 4I8BA 2G2QA 5C00A 2R2JA 2VLUA 16GSA 3HKRA 4TR3A 3ISOA 1EV4A 3FW2A 4N10A 2H19A 3CXGA 2B5XA 3A2VA 2VOCA 3D0ZA 1GNWA 3W8JA 5EY6A 1SVMA 1FG4A 4BIKA 5ECKB 5DQYA 3TDGA 4WF4A 2WVYA 2GDRA 4KE3A 3IRAA 1V98A 4KA0A 3GKNA 4NMUA 3D22A 4G10A 3CSHA 3CTGA 2OKAA 1YEPA 1MD4A 2WGRA 1V57A 1TI1A 4IVFA 2R3XA 2VCXA 12GSA 5DJLA 4K1FA 4HJMA 2GSRA 4F9ZA 1OYJA 1QFNA 3D6IA 5IOXA 4L0WA 1YVLA 2L6CA 4NPBA 3IA1A 3P7XA 2PBJA 1GSDA 1OKTA 1B48A 1VF3A 4JR6A 5IO0A 5A5KA 4V2MA 4BVYB 3F8UA 5ID2A 2HZEB 1I9DA 2HZFA 2WW1A 2IJYA 3GRXA 4HSCX 2VCVA 2IL3A 3TJGA 3UL3A 2FWHA 5COHA 4GWRA 5DBQA 2C3QA 4EKZA 1VF1A 5G31A 3ZLPA 4HI7A 1ACVA 4K7NA 4ZIJA 2IMFA 3FHKA 5A34B 2RM5A 2C3TA 2VL2C 1XW9A 2XPDA 5G2ZA 4FXYP 2RUEA 1U88A 2GLRA 2JACA 2O85A 4K0GA 1ZMAA 4KSMA 1OC9A 2P0GA 2FWFA 1WJKA 4X0XA 4AGSA 4TN8A 1THOA 1QGVA 3VWVA 4PI0C 3HA9A 2LV3A 2YOIA 1YF0A 1QUWA 4ZBBA 5CRGA 3RHBA 3GH6A 3O6TA 1EZKA 1M9AA 4OCFA 1E6BA 2YZHA 4J57E 3CSIA 5IMDA 5INYA 2V6KA 2VD0A 1K3LA 3V1WA 3F9UA 3IDVA 2WZ9A 4ZB9A 5IOWA 2RIIA 3ZITA 3TU3B 1OE8A 4K9ZA 3TKRA 2LUSA 4EUYA 4DSQA 3O3TA 2LSTA 2DC5A 3CBUA 6GSUA 4K2DA 3M1GA 2YPMA 1ZZYA 2GT5A 4DEJA 3S9FA 22GSA 3E3EA 3KM6A 4YQVA 5ECOB 2J9HA 3EU3A 2M72A 4KSOA 3EMPA 4RUVA 1GTUA 1MDJA 2WFCA 2UZ8A 3SWLA 3QAWA 1Q98A 2B7KA 4N0VA 4BL7B 2WCIA 2LRNA 4HOJA 3L9UA 3BCIA 3TJFA 1BAYA 4NAXA 1KEBA 3A3TA 1FVJA 3KP9A 1QXHA 1T4YA 3D4MA 3VWUA 1IYIA 3MYDA 1M0UA 3CWGA 3TUEA 1PL1A 2BMXA 3QOUA 2H70A 1ON4A 4MLYA 1CQGA 3ZRDA 4POMA 3C1RA 3LEFA 3IV4A 3BBYA 1T8EB 2MMOA 2JZRA 5GZZB 3CQFA 2EFEA 2HFDA 5CREA 1UC7A 1GSFA 1NHOA 3ZIJA 2M80A 2A2SA 5KN0A 5CNWA 1H75A 4HQSA 2KOKA 3CMIA 2V2GA 2HT9A 2H66A 2GQMA 1HNAA 3IE3A 5J3RA 2VUPA 4N30A 2F9SA 3QDNA 4ICYA 1TK5B 1O81A 1TP9A 2XBQA 2REMA 1K0NA 3PGTA 4EDZA 4TXOB 5IMVA 3TKSC 4MZBA 5ECIB 2WULA 3UBLA 1THXA 5J47A 3L0HA 3QR6A 3H93A 1PGTA 2AYTA 2HSMA 4KH7A 4PQ1A 5J4VA 3RBTA 2HSMB 2C4JA 5D9XA 1XXUA 2QA1A 3ZFBA 3BJ5A 4YQMA 1W4VA 4GF0A 3VFIA 1MDIA 1FO5A 5D8IA 1UA5A 1XOBA 3GSSA 2RUFA 3L78A 2L4CA 4JE1A 4G0IA 4E8HA 2GVPA 3CSJA 2GTUA 1J0FA 5LCZA 3A5WA 2KUCA 1RQMA 2X49A 3I43A 3IPZA 2H6YA 2VCWA 5GSTA 2E2MA 2WS2A 2ES7A 3H79A 4XCSA 1TJDA 1E2YA 2DKHA 2X4AA 5B6MA 2GSSA 1X0RA 2WB9A 1J08A 4WR5A 2I3YA 3BD2A 5F05A 5KN2A 1GH2A 2BTOT 3RFRC 4POBA 2C0DA 4POLA 2CZ3A 1AQWA 2B3SA 5LNKe 3Q6OA 2DJ1A 4TVEA 2N5AA 1USBA 4PI2C 5A4VA 5G1KA 2HSNA 5JCUA 1A0RP 5A4WA 2CX4A 5BMUA 1UN2A 4AKHA 1H4OA 4RI6A 5BMUB 4K7IA 11GSA 2WRTA 3F4TA 1NHYA 2KHPA 1ERVA 2MMAA 2X64A 1BG1A 1O8XA 5JWOB 2LJKA 4TRXA 3C7MA 4J2FA 2WVXA 3Q18A 4CY8A 4G0LA 1EV9A 2MMZA 1EGOA 1VF4A 3FY7A 5IPGA 2WVXB 3I69A 2P31A 1GUMA 4KDYA 1U87A 1XWAA 5J9CA 3ZVJA 3PH9A 1U3AA 3IOSA 6GSWA 3ZTLA 1ZYNA 2MMNA 1AAZA 2JSYA 3LW9A 1XZOA 2AAWA 1Z6NA 1F37A 4GSNA 1AIUA 5F0GA 3QCPA 5D9TA 1B4PA 3P8WA 3EWLA 2C8UA 1WPIA 5DCGA 4LLRA 2WJUA 2X8HA 3LXZA 2DBCA 3HZ4A 1V9WA 4XS6A 3ZMLA 3VI5A 3P2AA 3R2QA 2JSZA 3Q19A 3ERFA 2YZUA 3VK9A 1KNGA 3J7Yk 5A1NA 1S3DA 2DMMA 2WZSA 1G6YA 3TKSE 5A1NB 2NTOA 3ED3A 1QMVA 4JBBA 3MAKA 3PINA 2QKEA 4ECBA 2VL9A 3IC4A 2F8FA 4IBPA 5J4YA 2FNOA 3GTUB 2UV8G 1RK4A 1F9MA 3GV1A 1AW9A 2HSHA 5G1LA 2H1BA 4KDXA 2X8GA 4TOPA 2K6VA 3C71A 3WGEA 3WT2A 3GKMA 4EIQA 2OACA 1FOVA 4ECJA 4G01A 3MWHA 2H01A 3G7JA 5DQSA 3KP8A 2LNSA 4PQIA 4K2XA 1J9BA 1G7OA 4FYCA 4IJ3A 1KTEA 1BF5A 3TGZA 2FD3A 5H5SA 2WW0A 5KOXA 3FEUA 1YDKA 2YCDA 3DRNA 3HHVA 3QAGA 4IELA 3E0UA 1XW6A 9GSSA 2F51A 4XRDA 4TR0A 1XVWA 4V2LA 5G5EA 2GSTA 2DLXA 1ST9A 4MCUA 4YAPA 2IMDA 2H1GA 2IPAA 4EVMA 2JZSA 5CRHA 3TB2A 4AF2A 1GTBA 4YQUA 5JCWA 1ZCPA 2RM6A 5E4WA 1N8JA 5F06A 2YNXA 3CYNA 4IHUA 1T1VA 4DSSB 3MIXA 2L6DA 1XIYA 1M3IA 4AJ7A 4G19A 4ZB7A 4HU9A 4O92A 1HYUA 4IS0A 4J56E 3IK7A 2PVQA 2LTKA 3KIJA 5G5FA 4MA9A 3EU4A 2WW2A 3R3EA 4MDCA 4NHZA 2AV4A 3UARA 3NIVA 4KB3A 1M99A 3FZ5A 1ABAA 3HDCA 4FIWA 3FK8A 1XG8A 2FHEA 5J4UA 4WETA 1SU9A 1PL2A 1M2DA 1SK2A 2GT6A 6GSYA 5C04A 5F8BA 4AJ8A 1JZDA 1GUKA 2G0FA 4Z7XA 4BVYA 4KNDA 1TW9A 2HZEA 1O6JA 1SD8A 1GWCA 1YEXA 3GNJA 5AIVA 3RHCA 3TKQA 4USSA 1GL8A 4E68A 3D21A 3FRCA 4MF5A 1SYRA 2A4HA 4IQ1A 3LXTA 1JFUA 3VI7A 2H73A 1M2AA 2DJ2A 4OFMA 3CTFA 2CX3A 2MYGA 2GZYA 2OBKA 5A34A 1A2MA 4N0ZA 1X5CA 5ECNB 4FYBA 2YV9A 2B1LA 4HS1A 2DJJA 2EIOA 2O3EA 3TRQA 1ZOFA 1K0DA 2HRKA 4NHWA 4YH2A 5DALB 3KXOA 2HRKB 4JEDA 4GRFA 5AGYA 1G0TA 2HSYA 1OC8A 3NOFA 1LBKA 2YWIA 3LYKA 5ENUA 3WT1A 4V1Ap 3VURA 5A4UA 2H74A 2YN1A 4D73B 2PN8A 1T00A 1M3JA 1M7TA 1CQHA 1PN0A 1Z5YE 2R4VA 2H76A 2FY6A 2GQKA 1SJZA 5IMZA 3UOMA 1FB0A 2NDOA 3HYPA 1AC1A 3NZNA 2N5BA 3HJOA 2H1AA 3HCZA 3A5IA 1A2LA 3US3A 4BWQA 1JLVA 2IN3A 2OADA 2C0EA 5D93A 3WGXA 2HRNA 4EC0A 3G7IA 1FVKA 4BL7A 4BVXB 2FCHA 3EPTA 4PXOA 2HRAA 2K8VA 2OJLA 3TCOA 4HZ4A 2C80A 3RGBC 2V1MA 3RPPA 1A0FA 3ZMKA 2LJAA 3APOA 4I2UA 4Z2TA 1R7HA 2EIRA 1EP8A 1WOUA 1GTAA 2VIMA 1EEMA 4NV5A 3M8NA 3D4TA 3DWVA 2ON7A 5GSSA 1EGRA 3KEBA 3HZ8A 1TI3A 4F2IA 2B1KA 1EEJA 1WIKA 1XPVA 3WGDA 2MBTA 1DE2A 4JU5A 2CVBA 3G7YA 1OVNA 4I6XA 4YAVA 4MJBA 4MJAA 3QD9A 4ZBAA 1F3BA 1GUHA 2PGTA 4K7OA 3GL3A 3M0FA 4AKGA 4ZB6A 3I6AA 3IBHA 4K5RA 4ACSA 1F6MC 1SENA 5D9WA 2H30A 2HNLA 18GSA 8GSSA 1XWBA 4OD7A 2HI7A 3HVXA 2H0HA 2R37A 1Y25A 1K0BA 4FYUA 20GSA 3UBKA 2HLSA 3F6DA 4TXOA 1TRWA 1MD3A 1AQVA 1U3IA 4MABA 4O5QA 1R4WA 5D96A 3LQ7A 1Z7PA 4DSRA 1Y6EA 3MSZA 5LD0A 4FH8A 4WEYA 3ERWA 2K8SA 4W66A 4G2EA 2L5OA 3UIWA 3W8SA 3CHXC 2BJXA 1PFOA 3VPTA 4GCIA 1GSUA 1ZYQB 3LFLA 3HMJG 1BYEA 2L59A 4ECCA 2LQOA 2FLSA 4IN0A 3TJBA 5B7CA 4N3ZA 4OCEA 1SKRB 4GSSA 2EIQA 3F4SA 2IMEA 1SJIA 1TU8A 3DKSA 3ZZXA 3HXSA 3GN3A 5AIXA 1BEDA 5GAPD 2HE3A 1JZWA 2E0QA 2O5VA 3DVWA 1HQOA 4GXZA 2YJHA 5G30A 4TW5A 5CAXA 3IC8A 4ZL8A 2C0GA 4KCEA 1AXDA 1TK0B 4IP1A 2A4VA 1IYHA 2QA2A 3U6VA 1SVOA 1SJ6A 2FGXA 2DMLA 3FZ4A 2P5QA 3E9JB 4PUFC 4WF5A 3KGKA 1ZYPA 1YF1A 3PR8A 3GYKA 3QFAC 1TKDB 1TXUA 1GTIA 2E2GA 1OC3A 1JZOA 3UVHA 4JZQA 3L9VA 5CYYA 1A8LA 2LRTA 2HRFA 4V2NA 3GL5A 5IM9A 4XS4A 2VKZG 4TR4A 3F0IA 2HXKA 2B5YA 1ERTA 4MMMA 4XS4B 1BQ7A 4XRAA 3ZL5A 4F82A 3GIXA 1ML6A 1GLQA 3ZIVA 1BJXA 1ILOA 1PSQA 2PWJA 4PHZC 2ZCTA 4CHSA 2H72A 4O7HA 5KN1A 1TDIA 3GSTA 3JCML 1S4BP 2NVLA 1PMTA 3G9BA 4RI7A 4TXVA 1X5DA 2R0PA 1AUCA 3LSZA 3MDKA 2K9FA 14GSA 3IHGA 1JZRA 3KH7A 2DSAA 1GSSA 5J5NA 3TKPA 1RW1A 3A2WA 1V2AA 4ML1A 1YKAA 2H8LA 3LWAA 2IFQB 3C1SA 3GKKA 1SD9A 2B6MA 1EOGA 1GP1A 2DIYA 3FR9A 5JCGA 4EE0A 4L5LA 5H5QA 4O5RA 1YKCA 1TXXA 2IMIA 3FYGA 3GHAA 1G7EA 2DKIA 1K3YA 1PQNA 5FT3A 2V32A 3W6GA 5IO2A 3LYPA 3LJRA 4I97A 1OAZA 2D2ZA 3DVXA 2NPBA 1U6TA 2I9HA 2VO4A 5CRDA 5DJMA 2A2PA 4ZXGA 2OE0A 2XBIA 1GULA 1XW5A 1W89A 2C1YA 2LRCA 2PMTA 2VLTA 4MH2A 3U5RE 3VWXA 4IGJA 4EXJA 6GSVA 3H1NA 4PTSA 3GTUA 3K8NA 1XWCA 2YWNA 3SBCA 2O36A 4EDYA 3UEMA 4IW9A 2MZCA 4PQHA 4KCAA 3EYTA 4LA1A 3FR3A 4EO3A 2IWTA 3DIEA 3TRPA 3UJ1A 5EVOA 1I5GA 1X5EA 4MPGA 4QL7A 1AQXA 2FWEA 5ABRA 1SL0B 4QQ7A 3M9JA 2CAQA 4ISDA 19GSA 1LU4A 2AJQB 1EWXA 3HJMA 5DAKA 5DAKB 3BOAA 4TR1A 3TJKA 1KBNA 1JHBA 4TR1B 4KAEA 4IP6A 2PERA 4DSSA 1XFLA 1O73A 1XWGA 3APQA 2VCQA 4XTSA 5CP1A 5ELAA 1PN9A 4TKYA 4FO5A 4K0NA 5GAND 2A2RA 5HR1A 4ECIA 4N11A 3WD6A 2I1UA 4O32A 2H0IA 3FKFA 4K6XA 3C8EA 4FQUA 4AJ6A 2EFHA 1B8XA 3VWWA 1S3CA 1SKWB 3M3MA 1TU7A 1VGLA 5IIZA 10GSA 4GTUA 1V58A 2WVZA 3IAS2 5J40A 5ECLB 3TOUA 2GS3A 4RQXA 2AHEA 4OWYA 1G6WA 1FOHA 4MZCA 3KCMA 3KTBA 2AB6A 17GSA 4BA7A 2GQLA 1GSEA 3L9SA 5DCHA 2DIZA 4WKWA 1YJ6A 2WW3A 3HJPA 4MF7A 4MF6A 3A2XA 2CT6A 3ERGA 3CRTA 4Q5NA 4F0CA 2GGTA 2V41A 4RQRA 4Q5RA 2TRCP 3DMLA 4G9HA 5AISA 5J9BA 3TRXA 1BX9A 1C72A 2VCZA 3QFBC 3KMNA 1F2EA 2CZ2A 1B9XC 4NWYA 1S3AA 2WDUA 2VM1A 3IK9A 5ID2B 5DALA 5HFIA 5ECPB 5F07A 2LQQA 1Q4JA 2JU5A 4OO4A 5HFKA 2ZUPA 2CA8A 2OA7A 2KLXA 3WYWA 3GFKA 1N25A 4BWSA 1TRUA 2GZPA 4YKFA 1SVLA 1PRXA 2FUG2 4L5OA 3RDWA 1X9WB 1O85A 4O5UA 2K18A 4D73A 5IMAA 2EFDA 3VPQA 4MZWA 2P5RA 1OE7A 4GQFA 4NXIA 1I1IP 2QC7A 4ZILA 1FAAA 1ZL9A 4ML6A 1FHEA 2KP1A 2F8AA 4MPFA 3IHQA 1Z7RA 2GZZA 5HR0A 2LJRA 1OC9B 4KF9A 1R26A 1EP7A 2OBIA 2R0CA 1S3RA 4PURA 3EE2A 2PU9C 1DBYA 2HYXA 1T4ZA 5IMCA 4MNNA 1BG5A 2CAIA 2O87A 4F0BA 5L71A 1SL2B 4ZL7A 2XC2A 3RAZA 2CV4A 5B6NA 3HD5A 4GLTA 3FZ9A 2YP6A 4BVXA 1TRVA 1WE0A 3C73A 1TOFA 2C0FA 3QAVA 1WP0A 5D73A 4LL1B 4ULXA 2GSQA 1PD21 2JZTA 2I4AA 5AN1A 2LNTA 2VL2A 4HJ2A 3I9V2 3O76A 4HUAA 5DVBA 1YZXA 1PX7A 3DXBA 1SL1B 3TOTA 1NW2A 2DJKA 2VD1A 4KGIA 3IAM2 2FA8A 4AKIA 4GDFA 3H8QA 1XOAA 1GLPA 3KMOA 1T3BA 4OMVA 3OR5A 2M46A 1A24A 4AI6A 1O8WA 1M2BA 3GURA 4PNFA 3FZAA 2XPEA 3ME7A 4F03A 5E59A 3LGCA 2OT3A 2H1LA 1SKSB 1GSQA 4KW6A 2PPTA 3DGQA 1XWKA 3AY8A 1SYXA 4X1UA 3M9KA 4Z2RA 2R5GA 3PPUA 4MJCA 1HD2A 1VRSD 4PGTA 1K0AA 2LS5A 4HEA2 1FB6A 1K3OA 3HVNA 2L4QA 5IPHA 3KJYA 3EURA 1A23A 3N9JA 1TRSA 4ZB8A 3GMFA 3F3RA 2YWOA 1URMA 1ERUA 3GX8A 4OFTA 7GSSA
chains in the Genus database with same CATH topology
2H6XA 1PA3A 2DJ0A 4P3YB 2ON5A 4XS1A 4K8MA 3GH9A 4OO5A 1TK8B 1GRXA 5HR2A 4PNGA 1HNCA 4YKGA 2RLIA 4CW9A 4A5PA 4DVCA 3GKXA 5FHIA 4I5QA 3IR4A 4WBJA 1XVQA 3GA4A 6GSXA 3BCKA 1GSYA 5BRTA 5HFGA 3KTLA 3D5JA 5KEJA 3KZQA 4V1Ag 1GNEA 3IXRA 13GSA 1YY7A 2OE3A 1QQ2A 3FMWA 2DJ3A 3Q74A 4E8EA 4CDOA 2X8CA 2YANA 1X9MB 3VLNA 2CQ9A 2TIRA 1B9YC 3HVVA 4K5SA 3ZREA 3J7Yb 4XHMA 4OFNA 5ECSA 4G0KA 2J23A 1XBSA 3P90A 2N5FA 3DD3A 5ECQB 4MK3A 1F3AA 4JR4A 1O7UA 5EL8A 4MJEA 6GSTA 4PX1A 5B8AA 4ZL9A 5ECMB 1SK1A 1NSWA 3TKSA 2VAFA 3DYRA 4XIHA 2CVKA 1M9BA 4WBRD 1N2AA 2LEGA 5IQYA 2KP2A 4X43A 4QL9A 3TJJA 5D9VA 2LKUA 5HR3A 1ERWA 3CRUA 3F6FA 2B5EA 2FA4A 4H86A 3UMAA 4L0UA 2QGVA 1K0CA 4NV2A 4Z2UA 4MP4A 1WRYA 1Z3EA 3L4NA 5ECHB 2X99A 4EL1A 3F4RA 5JWRB 5J41A 4HDEA 2HSNB 1PKWA 3EC3A 1DUGA 4ILFA 1DSBA 1EOHA 2VLVA 1OKDA 3FR6A 1YQ1A 1K0OA 3F3QA 1MTCA 2QSIA 1ZYEA 1LJRA 2IFQA 5IMFA 1WMJA 2OE1A 3EVIA 3MNGA 5CRWA 4GSTA 1MDKA 2HQTA 4POKA 2MBSA 1JLWA 4IQAA 2NBSA 3ZVJD 5FWGA 2JADA 1Z6MA 3ZFLA 4LL4B 5KOWA 4LMVA 5ECRB 3DEXA 3GUSA 2O8VB 4Q5QA 5DDLA 2C3NA 3KD0A 3UVTA 3KH9A 3QMXA 3HY2A 1A8YA 2H1DA 4WR4A 1XCCA 3APSA 3EINA 3ME8A 4EIPA 4AKXB 1SK0A 2FWGA 3H4KA 1X9SB 5CO3A 1TTZA 1Z9HA 1WWJA 2V6OA 1ZGNA 1Y1UA 2O89A 2CVDA 2H75A 1FW1A 2YJ7A 5KN3A 2JL4A 3F63A 1K0MA 4HQZA 1R5PA 3GX0A 4IJIA 1V40A 2EC4A 2PUKC 4JRRA 2ALBA 2H71A 2VCTA 2E7PA 3N5OA 2XHFA 1A2JA 4WXTA 4CY6A 1B4QA 4HZ2A 1PKZA 5A5HA 2ZNMA 2O7KA 2L57A 3ZYWA 4Q5FA 4L8EA 4QMKA 3LORA 5A5HB 2H6ZA 1DE1A 5JWQB 4MH3A 5B8BA 2Z9SA 1UVZA 4EF0A 1VF2A 4BPYA 2YWMA 4ID0A 4X4JA 2PVOC 3QPMA 2YV7A 4IKHA 4PUAA 2AUVA 4GQCA 2R6KA 5EPFA 2L5LA 4KUNA 1NM3A 2IMKA 2H0GA 5H5RA 2EFCA 2IIYA 2VM2A 1MEKA 2I81A 5ELGA 2TRXA 3RPNA 1PX6A 2VL3A 1HNBA 4LMWA 3UAPA 4KDUA 1R5AA 1QK8A 6GSSA 4ZBDA 5HQPA 4KX4A 1T7PB 2F3MA 3EMXA 4I2TA 3LG6A 2B7JA 3HVSA 2R0GA 4HU7A 4I8BA 2G2QA 5C00A 2R2JA 2VLUA 16GSA 3HKRA 4TR3A 3ISOA 1EV4A 3FW2A 4N10A 2H19A 3CXGA 2B5XA 3A2VA 2VOCA 3D0ZA 1GNWA 3W8JA 5EY6A 1SVMA 1FG4A 5ECKB 5DQYA 3TDGA 4WF4A 2GDRA 4KE3A 3IRAA 1V98A 4KA0A 3GKNA 4NMUA 3D22A 4G10A 3CSHA 3CTGA 2OKAA 1YEPA 1MD4A 2WGRA 1V57A 1TI1A 4IVFA 2R3XA 2VCXA 12GSA 5DJLA 4K1FA 4HJMA 2GSRA 4F9ZA 1OYJA 1QFNA 3D6IA 5IOXA 4L0WA 1YVLA 2L6CA 4NPBA 3IA1A 3P7XA 2PBJA 1GSDA 1OKTA 1B48A 1VF3A 4JR6A 5IO0A 5A5KA 4V2MA 4BVYB 3F8UA 5ID2A 2HZEB 1I9DA 2HZFA 2IJYA 3GRXA 2VCVA 2IL3A 3TJGA 3UL3A 2FWHA 5COHA 4GWRA 5DBQA 2C3QA 4EKZA 1VF1A 5G31A 3ZLPA 4HI7A 1ACVA 4K7NA 4ZIJA 2IMFA 3FHKA 5A34B 2RM5A 2C3TA 2VL2C 1XW9A 2XPDA 5G2ZA 2RUEA 1U88A 2GLRA 2JACA 2O85A 4K0GA 1ZMAA 4KSMA 1OC9A 2P0GA 2FWFA 1WJKA 4X0XA 4AGSA 4TN8A 1THOA 1QGVA 3VWVA 3HA9A 2LV3A 2YOIA 1YF0A 1QUWA 4ZBBA 5CRGA 3RHBA 3GH6A 3O6TA 1EZKA 1M9AA 4OCFA 1E6BA 2YZHA 4J57E 3CSIA 5IMDA 5INYA 2V6KA 2VD0A 1K3LA 3V1WA 3F9UA 3IDVA 2WZ9A 4ZB9A 5IOWA 2RIIA 3ZITA 3TU3B 1OE8A 4K9ZA 3TKRA 2LUSA 4EUYA 4DSQA 3O3TA 2LSTA 2DC5A 3CBUA 6GSUA 4K2DA 3M1GA 2YPMA 1ZZYA 2GT5A 4DEJA 3S9FA 22GSA 3E3EA 3KM6A 4YQVA 5ECOB 2J9HA 3EU3A 2M72A 4KSOA 3EMPA 4RUVA 1GTUA 1MDJA 2WFCA 2UZ8A 3SWLA 3QAWA 1Q98A 2B7KA 4N0VA 4BL7B 2WCIA 2LRNA 4HOJA 3L9UA 3BCIA 3TJFA 1BAYA 4NAXA 1KEBA 3A3TA 1FVJA 3KP9A 1QXHA 1T4YA 3D4MA 3VWUA 1IYIA 3MYDA 1M0UA 3CWGA 3TUEA 1PL1A 2BMXA 3QOUA 2H70A 1ON4A 4MLYA 1CQGA 3ZRDA 4POMA 3C1RA 3LEFA 3IV4A 3BBYA 1T8EB 2MMOA 2JZRA 5GZZB 2EFEA 2HFDA 5CREA 1UC7A 1GSFA 1NHOA 3ZIJA 2M80A 2A2SA 5KN0A 5CNWA 1H75A 4HQSA 2KOKA 3CMIA 2V2GA 2HT9A 2H66A 2GQMA 1HNAA 3IE3A 5J3RA 2VUPA 4N30A 2F9SA 3QDNA 4ICYA 1TK5B 1O81A 1TP9A 2XBQA 2REMA 1K0NA 3PGTA 4EDZA 4TXOB 5IMVA 3TKSC 4MZBA 5ECIB 2WULA 3UBLA 1THXA 5J47A 3L0HA 3QR6A 3H93A 1PGTA 2AYTA 2HSMA 4KH7A 4PQ1A 5J4VA 3RBTA 2HSMB 2C4JA 5D9XA 1XXUA 2QA1A 3ZFBA 3BJ5A 4YQMA 1W4VA 4GF0A 3VFIA 1MDIA 1FO5A 5D8IA 1UA5A 1XOBA 3GSSA 2RUFA 3L78A 2L4CA 4JE1A 4G0IA 4E8HA 2GVPA 3CSJA 2GTUA 1J0FA 5LCZA 3A5WA 2KUCA 1RQMA 2X49A 3I43A 3IPZA 2H6YA 2VCWA 5GSTA 2E2MA 2WS2A 2ES7A 3H79A 4XCSA 1TJDA 1E2YA 2DKHA 2X4AA 5B6MA 2GSSA 1X0RA 2WB9A 1J08A 4WR5A 2I3YA 3BD2A 5F05A 5KN2A 1GH2A 2BTOT 4POBA 2C0DA 4POLA 2CZ3A 1AQWA 2B3SA 5LNKe 3Q6OA 2DJ1A 4TVEA 2N5AA 1USBA 5A4VA 5G1KA 2HSNA 5JCUA 1A0RP 5A4WA 2CX4A 5BMUA 1UN2A 4AKHA 1H4OA 4RI6A 5BMUB 4K7IA 11GSA 2WRTA 3F4TA 1NHYA 2KHPA 1ERVA 2MMAA 2X64A 1BG1A 1O8XA 5JWOB 2LJKA 4TRXA 3C7MA 4J2FA 3Q18A 4CY8A 4G0LA 1EV9A 2MMZA 1EGOA 1VF4A 3FY7A 5IPGA 3I69A 2P31A 1GUMA 4KDYA 1U87A 1XWAA 5J9CA 3ZVJA 3PH9A 1U3AA 3IOSA 6GSWA 3ZTLA 1ZYNA 2MMNA 1AAZA 2JSYA 3LW9A 1XZOA 2AAWA 1Z6NA 1F37A 4GSNA 1AIUA 5F0GA 3QCPA 5D9TA 1B4PA 3P8WA 3EWLA 2C8UA 1WPIA 5DCGA 4LLRA 2WJUA 2X8HA 3LXZA 2DBCA 3HZ4A 1V9WA 4XS6A 3ZMLA 3VI5A 3P2AA 3R2QA 2JSZA 3Q19A 3ERFA 2YZUA 3VK9A 1KNGA 3J7Yk 5A1NA 1S3DA 2DMMA 1G6YA 3TKSE 5A1NB 2NTOA 3ED3A 1QMVA 4JBBA 3MAKA 3PINA 2QKEA 4ECBA 2VL9A 3IC4A 2F8FA 4IBPA 5J4YA 2FNOA 3GTUB 2UV8G 1RK4A 1F9MA 3GV1A 1AW9A 2HSHA 5G1LA 2H1BA 4KDXA 2X8GA 4TOPA 2K6VA 3C71A 3WGEA 3WT2A 3GKMA 4EIQA 2OACA 1FOVA 4ECJA 4G01A 3MWHA 2H01A 3G7JA 5DQSA 3KP8A 2LNSA 4PQIA 4K2XA 1J9BA 1G7OA 4FYCA 4IJ3A 1KTEA 1BF5A 3TGZA 2FD3A 5H5SA 5KOXA 3FEUA 1YDKA 2YCDA 3DRNA 3HHVA 3QAGA 4IELA 3E0UA 1XW6A 9GSSA 2F51A 4XRDA 4TR0A 1XVWA 4V2LA 5G5EA 2GSTA 2DLXA 1ST9A 4MCUA 4YAPA 2IMDA 2H1GA 2IPAA 4EVMA 2JZSA 5CRHA 3TB2A 4AF2A 1GTBA 4YQUA 5JCWA 1ZCPA 2RM6A 5E4WA 1N8JA 5F06A 2YNXA 3CYNA 4IHUA 1T1VA 4DSSB 3MIXA 2L6DA 1XIYA 4AJ7A 4G19A 4ZB7A 4HU9A 4O92A 1HYUA 4IS0A 4J56E 3IK7A 2PVQA 2LTKA 3KIJA 5G5FA 4MA9A 3EU4A 3R3EA 4MDCA 4NHZA 2AV4A 3UARA 3NIVA 4KB3A 1M99A 3FZ5A 1ABAA 3HDCA 4FIWA 3FK8A 2FHEA 5J4UA 4WETA 1SU9A 1PL2A 1M2DA 1SK2A 2GT6A 6GSYA 5C04A 5F8BA 4AJ8A 1JZDA 1GUKA 2G0FA 4Z7XA 4BVYA 4KNDA 1TW9A 2HZEA 1O6JA 1SD8A 1GWCA 1YEXA 3GNJA 5AIVA 3RHCA 3TKQA 4USSA 1GL8A 4E68A 3D21A 3FRCA 4MF5A 1SYRA 2A4HA 4IQ1A 3LXTA 1JFUA 3VI7A 2H73A 1M2AA 2DJ2A 4OFMA 3CTFA 2CX3A 2MYGA 2GZYA 2OBKA 5A34A 1A2MA 4N0ZA 1X5CA 5ECNB 4FYBA 2YV9A 2B1LA 4HS1A 2DJJA 2EIOA 3TRQA 1ZOFA 1K0DA 2HRKA 4NHWA 4YH2A 5DALB 3KXOA 2HRKB 4JEDA 4GRFA 5AGYA 1G0TA 2HSYA 1OC8A 3NOFA 1LBKA 2YWIA 3LYKA 5ENUA 3WT1A 4V1Ap 3VURA 5A4UA 2H74A 2YN1A 4D73B 2PN8A 1T00A 1M7TA 1CQHA 1PN0A 1Z5YE 2R4VA 2H76A 2FY6A 2GQKA 1SJZA 5IMZA 3UOMA 1FB0A 2NDOA 3HYPA 1AC1A 3NZNA 2N5BA 3HJOA 2H1AA 3HCZA 3A5IA 1A2LA 3US3A 4BWQA 1JLVA 2IN3A 2OADA 2C0EA 5D93A 3WGXA 2HRNA 4EC0A 3G7IA 1FVKA 4BL7A 4BVXB 2FCHA 3EPTA 4PXOA 2HRAA 2K8VA 2OJLA 3TCOA 4HZ4A 2C80A 2V1MA 3RPPA 1A0FA 3ZMKA 2LJAA 3APOA 4I2UA 4Z2TA 1R7HA 2EIRA 1EP8A 1WOUA 1GTAA 2VIMA 1EEMA 4NV5A 3M8NA 3D4TA 3DWVA 2ON7A 5GSSA 1EGRA 3KEBA 3HZ8A 1TI3A 4F2IA 2B1KA 1EEJA 1WIKA 1XPVA 3WGDA 2MBTA 1DE2A 4JU5A 2CVBA 3G7YA 1OVNA 4I6XA 4YAVA 4MJBA 4MJAA 3QD9A 4ZBAA 1F3BA 1GUHA 2PGTA 4K7OA 3GL3A 3M0FA 4AKGA 4ZB6A 3I6AA 3IBHA 4K5RA 4ACSA 1F6MC 1SENA 5D9WA 2H30A 2HNLA 18GSA 8GSSA 1XWBA 4OD7A 2HI7A 3HVXA 2H0HA 2R37A 1Y25A 1K0BA 4FYUA 20GSA 3UBKA 2HLSA 3F6DA 4TXOA 1TRWA 1MD3A 1AQVA 1U3IA 4MABA 4O5QA 1R4WA 5D96A 3LQ7A 1Z7PA 4DSRA 1Y6EA 3MSZA 5LD0A 4FH8A 4WEYA 3ERWA 2K8SA 4W66A 4G2EA 2L5OA 3UIWA 3W8SA 2BJXA 3VPTA 4GCIA 1GSUA 1ZYQB 3LFLA 3HMJG 1BYEA 2L59A 4ECCA 2LQOA 2FLSA 4IN0A 3TJBA 5B7CA 4N3ZA 4OCEA 1SKRB 4GSSA 2EIQA 3F4SA 2IMEA 1SJIA 1TU8A 3DKSA 3ZZXA 3HXSA 3GN3A 5AIXA 1BEDA 5GAPD 2HE3A 1JZWA 2E0QA 2O5VA 3DVWA 1HQOA 4GXZA 2YJHA 5G30A 4TW5A 5CAXA 3IC8A 4ZL8A 2C0GA 4KCEA 1AXDA 1TK0B 4IP1A 2A4VA 1IYHA 2QA2A 3U6VA 1SVOA 1SJ6A 2FGXA 2DMLA 3FZ4A 2P5QA 3E9JB 4PUFC 4WF5A 3KGKA 1ZYPA 1YF1A 3PR8A 3GYKA 3QFAC 1TKDB 1TXUA 1GTIA 2E2GA 1OC3A 1JZOA 3UVHA 4JZQA 3L9VA 5CYYA 1A8LA 2LRTA 2HRFA 4V2NA 3GL5A 5IM9A 4XS4A 2VKZG 4TR4A 3F0IA 2HXKA 2B5YA 1ERTA 4MMMA 4XS4B 1BQ7A 4XRAA 3ZL5A 4F82A 3GIXA 1ML6A 1GLQA 3ZIVA 1BJXA 1ILOA 1PSQA 2PWJA 2ZCTA 4CHSA 2H72A 4O7HA 5KN1A 1TDIA 3GSTA 3JCML 2NVLA 1PMTA 3G9BA 4RI7A 4TXVA 1X5DA 2R0PA 1AUCA 3LSZA 3MDKA 2K9FA 14GSA 3IHGA 1JZRA 3KH7A 2DSAA 1GSSA 5J5NA 3TKPA 1RW1A 3A2WA 1V2AA 4ML1A 1YKAA 2H8LA 3LWAA 2IFQB 3C1SA 3GKKA 1SD9A 2B6MA 1EOGA 1GP1A 2DIYA 3FR9A 5JCGA 4EE0A 4L5LA 5H5QA 4O5RA 1YKCA 1TXXA 2IMIA 3FYGA 3GHAA 1G7EA 2DKIA 1K3YA 1PQNA 5FT3A 2V32A 3W6GA 5IO2A 3LYPA 3LJRA 4I97A 1OAZA 2D2ZA 3DVXA 2NPBA 1U6TA 2I9HA 2VO4A 5CRDA 5DJMA 2A2PA 4ZXGA 2OE0A 2XBIA 1GULA 1XW5A 1W89A 2C1YA 2LRCA 2PMTA 2VLTA 4MH2A 3U5RE 3VWXA 4IGJA 4EXJA 6GSVA 3H1NA 4PTSA 3GTUA 3K8NA 1XWCA 2YWNA 3SBCA 4EDYA 3UEMA 4IW9A 2MZCA 4PQHA 4KCAA 3EYTA 4LA1A 3FR3A 4EO3A 2IWTA 3DIEA 3TRPA 3UJ1A 5EVOA 1I5GA 1X5EA 4MPGA 4QL7A 1AQXA 2FWEA 5ABRA 1SL0B 4QQ7A 3M9JA 2CAQA 4ISDA 19GSA 1LU4A 2AJQB 1EWXA 3HJMA 5DAKA 5DAKB 3BOAA 4TR1A 3TJKA 1KBNA 1JHBA 4TR1B 4KAEA 4IP6A 2PERA 4DSSA 1XFLA 1O73A 1XWGA 3APQA 2VCQA 4XTSA 5CP1A 5ELAA 1PN9A 4TKYA 4FO5A 4K0NA 5GAND 2A2RA 5HR1A 4ECIA 4N11A 3WD6A 2I1UA 4O32A 2H0IA 3FKFA 4K6XA 3C8EA 4FQUA 4AJ6A 2EFHA 1B8XA 3VWWA 1S3CA 1SKWB 3M3MA 1TU7A 1VGLA 5IIZA 10GSA 4GTUA 1V58A 3IAS2 5J40A 5ECLB 3TOUA 2GS3A 4RQXA 2AHEA 4OWYA 1G6WA 1FOHA 4MZCA 3KCMA 3KTBA 2AB6A 17GSA 4BA7A 2GQLA 1GSEA 3L9SA 5DCHA 2DIZA 4WKWA 1YJ6A 3HJPA 4MF7A 4MF6A 3A2XA 2CT6A 3ERGA 3CRTA 4Q5NA 4F0CA 2GGTA 2V41A 4RQRA 4Q5RA 2TRCP 3DMLA 4G9HA 5AISA 5J9BA 3TRXA 1BX9A 1C72A 2VCZA 3QFBC 3KMNA 1F2EA 2CZ2A 1B9XC 4NWYA 1S3AA 2WDUA 2VM1A 3IK9A 5ID2B 5DALA 5HFIA 5ECPB 5F07A 2LQQA 1Q4JA 2JU5A 4OO4A 5HFKA 2ZUPA 2CA8A 2OA7A 2KLXA 3WYWA 3GFKA 1N25A 4BWSA 1TRUA 2GZPA 4YKFA 1SVLA 1PRXA 2FUG2 4L5OA 3RDWA 1X9WB 1O85A 4O5UA 2K18A 4D73A 5IMAA 2EFDA 3VPQA 4MZWA 2P5RA 1OE7A 4GQFA 4NXIA 2QC7A 4ZILA 1FAAA 1ZL9A 4ML6A 1FHEA 2KP1A 2F8AA 4MPFA 3IHQA 1Z7RA 2GZZA 5HR0A 2LJRA 1OC9B 4KF9A 1R26A 1EP7A 2OBIA 2R0CA 4PURA 3EE2A 2PU9C 1DBYA 2HYXA 1T4ZA 5IMCA 4MNNA 1BG5A 2CAIA 2O87A 4F0BA 5L71A 1SL2B 4ZL7A 2XC2A 3RAZA 2CV4A 5B6NA 3HD5A 4GLTA 3FZ9A 2YP6A 4BVXA 1TRVA 1WE0A 3C73A 1TOFA 2C0FA 3QAVA 1WP0A 5D73A 4LL1B 4ULXA 2GSQA 1PD21 2JZTA 2I4AA 5AN1A 2LNTA 2VL2A 4HJ2A 3I9V2 3O76A 4HUAA 5DVBA 1YZXA 1PX7A 3DXBA 1SL1B 3TOTA 1NW2A 2DJKA 2VD1A 4KGIA 3IAM2 2FA8A 4AKIA 4GDFA 3H8QA 1XOAA 1GLPA 3KMOA 1T3BA 4OMVA 3OR5A 2M46A 1A24A 4AI6A 1O8WA 1M2BA 3GURA 4PNFA 3FZAA 2XPEA 3ME7A 4F03A 5E59A 3LGCA 2OT3A 2H1LA 1SKSB 1GSQA 4KW6A 2PPTA 3DGQA 1XWKA 3AY8A 1SYXA 4X1UA 3M9KA 4Z2RA 2R5GA 3PPUA 4MJCA 1HD2A 1VRSD 4PGTA 1K0AA 2LS5A 4HEA2 1FB6A 1K3OA 2L4QA 5IPHA 3KJYA 3EURA 1A23A 3N9JA 1TRSA 4ZB8A 3GMFA 3F3RA 2YWOA 1URMA 1ERUA 3GX8A 4OFTA 7GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6X A;  1PA3 A;  2DJ0 A;  4P3Y B;  2ON5 A;  4XS1 A;  4K8M A;  3GH9 A;  4OO5 A;  1TK8 B;  1GRX A;  5HR2 A;  4PNG A;  1HNC A;  2RLI A;  4CW9 A;  4DVC A;  3GKX A;  5FHI A;  4I5Q A;  3IR4 A;  4WBJ A;  1XVQ A;  3GA4 A;  6GSX A;  3BCK A;  1GSY A;  5HFG A;  3KTL A;  3D5J A;  5KEJ A;  3KZQ A;  4V1A g;  1GNE A;  3IXR A;  13GS A;  1YY7 A;  2OE3 A;  1QQ2 A;  2DJ3 A;  3Q74 A;  4E8E A;  4CDO A;  2X8C A;  2YAN A;  1X9M B;  3VLN A;  2CQ9 A;  2TIR A;  1B9Y C;  3HVV A;  3ZRE A;  3J7Y b;  4XHM A;  4OFN A;  5ECS A;  4G0K A;  2J23 A;  1XBS A;  3P90 A;  2N5F A;  3DD3 A;  5ECQ B;  4MK3 A;  1F3A A;  4JR4 A;  1O7U A;  5EL8 A;  4MJE A;  6GST A;  4PX1 A;  5B8A A;  4ZL9 A;  5ECM B;  1SK1 A;  1NSW A;  3TKS A;  2VAF A;  3DYR A;  4XIH A;  2CVK A;  1M9B A;  4WBR D;  1N2A A;  2LEG A;  5IQY A;  2KP2 A;  4X43 A;  4QL9 A;  3TJJ A;  5D9V A;  2LKU A;  5HR3 A;  1ERW A;  3CRU A;  3F6F A;  2B5E A;  2FA4 A;  4H86 A;  3UMA A;  4L0U A;  2QGV A;  1K0C A;  4NV2 A;  4MP4 A;  1WRY A;  1Z3E A;  3L4N A;  5ECH B;  2X99 A;  4EL1 A;  3F4R A;  5JWR B;  5J41 A;  4HDE A;  2HSN B;  1PKW A;  3EC3 A;  1DUG A;  4ILF A;  1DSB A;  1EOH A;  2VLV A;  1OKD A;  3FR6 A;  1YQ1 A;  1K0O A;  3F3Q A;  1MTC A;  2QSI A;  1ZYE A;  1LJR A;  2IFQ A;  5IMF A;  1WMJ A;  2OE1 A;  3EVI A;  3MNG A;  5CRW A;  4GST A;  1MDK A;  2HQT A;  4POK A;  2MBS A;  1JLW A;  4IQA A;  2NBS A;  3ZVJ D;  5FWG A;  2JAD A;  1Z6M A;  3ZFL A;  4LL4 B;  4LMV A;  5ECR B;  3DEX A;  3GUS A;  2O8V B;  4Q5Q A;  5DDL A;  2C3N A;  3KD0 A;  3UVT A;  3KH9 A;  3QMX A;  3HY2 A;  1A8Y A;  2H1D A;  4WR4 A;  1XCC A;  3APS A;  3EIN A;  3ME8 A;  1SK0 A;  2FWG A;  3H4K A;  1X9S B;  5CO3 A;  1TTZ A;  1Z9H A;  1WWJ A;  2V6O A;  1ZGN A;  2O89 A;  2CVD A;  2H75 A;  1FW1 A;  2YJ7 A;  5KN3 A;  2JL4 A;  3F63 A;  1K0M A;  4HQZ A;  1R5P A;  3GX0 A;  4IJI A;  1V40 A;  2EC4 A;  2PUK C;  4JRR A;  2ALB A;  2H71 A;  2VCT A;  2E7P A;  3N5O A;  2XHF A;  1A2J A;  4WXT A;  1B4Q A;  4HZ2 A;  1PKZ A;  2ZNM A;  2O7K A;  2L57 A;  3ZYW A;  4Q5F A;  4L8E A;  3LOR A;  2H6Z A;  1DE1 A;  5JWQ B;  4MH3 A;  5B8B A;  2Z9S A;  1UVZ A;  4EF0 A;  1VF2 A;  4BPY A;  2YWM A;  4ID0 A;  2PVO C;  3QPM A;  2YV7 A;  4IKH A;  4PUA A;  2AUV A;  4GQC A;  2R6K A;  5EPF A;  2L5L A;  4KUN A;  1NM3 A;  2IMK A;  2H0G A;  5H5R A;  2IIY A;  2VM2 A;  1MEK A;  2I81 A;  5ELG A;  2TRX A;  3RPN A;  1PX6 A;  2VL3 A;  1HNB A;  4LMW A;  3UAP A;  4KDU A;  1R5A A;  1QK8 A;  6GSS A;  4ZBD A;  5HQP A;  4KX4 A;  1T7P B;  2F3M A;  3EMX A;  4I2T A;  3LG6 A;  2B7J A;  3HVS A;  4HU7 A;  4I8B A;  2G2Q A;  5C00 A;  2R2J A;  2VLU A;  16GS A;  3HKR A;  4TR3 A;  3ISO A;  1EV4 A;  3FW2 A;  4N10 A;  2H19 A;  3CXG A;  2B5X A;  3A2V A;  2VOC A;  3D0Z A;  1GNW A;  3W8J A;  5EY6 A;  1FG4 A;  5ECK B;  5DQY A;  3TDG A;  4WF4 A;  2GDR A;  4KE3 A;  3IRA A;  1V98 A;  4KA0 A;  3GKN A;  4NMU A;  3D22 A;  4G10 A;  3CSH A;  3CTG A;  2OKA A;  1YEP A;  1MD4 A;  2WGR A;  1V57 A;  1TI1 A;  4IVF A;  2R3X A;  2VCX A;  12GS A;  5DJL A;  4K1F A;  4HJM A;  2GSR A;  4F9Z A;  1OYJ A;  1QFN A;  3D6I A;  5IOX A;  4L0W A;  2L6C A;  4NPB A;  3IA1 A;  3P7X A;  2PBJ A;  1GSD A;  1OKT A;  1B48 A;  1VF3 A;  4JR6 A;  5IO0 A;  5A5K A;  4V2M A;  4BVY B;  3F8U A;  5ID2 A;  2HZE B;  1I9D A;  2HZF A;  2IJY A;  3GRX A;  2VCV A;  2IL3 A;  3TJG A;  3UL3 A;  2FWH A;  5COH A;  4GWR A;  5DBQ A;  2C3Q A;  4EKZ A;  1VF1 A;  5G31 A;  3ZLP A;  4HI7 A;  1ACV A;  4K7N A;  4ZIJ A;  2IMF A;  3FHK A;  2RM5 A;  2C3T A;  2VL2 C;  1XW9 A;  2XPD A;  5G2Z A;  2RUE A;  1U88 A;  2GLR A;  2JAC A;  2O85 A;  4K0G A;  1ZMA A;  4KSM A;  1OC9 A;  2P0G A;  2FWF A;  1WJK A;  4X0X A;  4AGS A;  4TN8 A;  1THO A;  1QGV A;  3VWV A;  3HA9 A;  2LV3 A;  2YOI A;  1YF0 A;  1QUW A;  4ZBB A;  5CRG A;  3RHB A;  3GH6 A;  3O6T A;  1EZK A;  1M9A A;  4OCF A;  1E6B A;  2YZH A;  4J57 E;  3CSI A;  5IMD A;  5INY A;  2V6K A;  2VD0 A;  1K3L A;  3V1W A;  3F9U A;  3IDV A;  2WZ9 A;  4ZB9 A;  5IOW A;  2RII A;  3ZIT A;  1OE8 A;  4K9Z A;  3TKR A;  2LUS A;  4EUY A;  4DSQ A;  3O3T A;  2LST A;  2DC5 A;  3CBU A;  6GSU A;  4K2D A;  3M1G A;  2YPM A;  1ZZY A;  2GT5 A;  4DEJ A;  3S9F A;  22GS A;  3E3E A;  3KM6 A;  4YQV A;  5ECO B;  2J9H A;  3EU3 A;  2M72 A;  4KSO A;  3EMP A;  4RUV A;  1GTU A;  1MDJ A;  2WFC A;  2UZ8 A;  3SWL A;  3QAW A;  1Q98 A;  2B7K A;  4N0V A;  4BL7 B;  2WCI A;  2LRN A;  4HOJ A;  3L9U A;  3BCI A;  3TJF A;  1BAY A;  4NAX A;  1KEB A;  3A3T A;  1FVJ A;  3KP9 A;  1QXH A;  1T4Y A;  3D4M A;  3VWU A;  1IYI A;  1M0U A;  3TUE A;  1PL1 A;  2BMX A;  3QOU A;  2H70 A;  1ON4 A;  4MLY A;  1CQG A;  3ZRD A;  4POM A;  3C1R A;  3LEF A;  3IV4 A;  3BBY A;  1T8E B;  2MMO A;  2JZR A;  5GZZ B;  2HFD A;  5CRE A;  1UC7 A;  1GSF A;  1NHO A;  3ZIJ A;  2M80 A;  2A2S A;  5KN0 A;  5CNW A;  1H75 A;  4HQS A;  2KOK A;  3CMI A;  2V2G A;  2HT9 A;  2H66 A;  2GQM A;  1HNA A;  3IE3 A;  5J3R A;  2VUP A;  4N30 A;  2F9S A;  3QDN A;  1TK5 B;  1O81 A;  1TP9 A;  2XBQ A;  2REM A;  1K0N A;  3PGT A;  4EDZ A;  4TXO B;  5IMV A;  3TKS C;  4MZB A;  5ECI B;  2WUL A;  3UBL A;  1THX A;  3L0H A;  3QR6 A;  3H93 A;  1PGT A;  2AYT A;  2HSM A;  4KH7 A;  4PQ1 A;  3RBT A;  2HSM B;  2C4J A;  5D9X A;  1XXU A;  3BJ5 A;  3ZFB A;  4YQM A;  1W4V A;  4GF0 A;  3VFI A;  1MDI A;  1FO5 A;  5D8I A;  1UA5 A;  1XOB A;  3GSS A;  2RUF A;  3L78 A;  2L4C A;  4JE1 A;  4G0I A;  4E8H A;  2GVP A;  3CSJ A;  2GTU A;  1J0F A;  5LCZ A;  3A5W A;  2KUC A;  1RQM A;  3I43 A;  3IPZ A;  2H6Y A;  2VCW A;  5GST A;  2E2M A;  2WS2 A;  2ES7 A;  3H79 A;  4XCS A;  1TJD A;  1E2Y A;  5B6M A;  2GSS A;  1X0R A;  2WB9 A;  1J08 A;  4WR5 A;  2I3Y A;  3BD2 A;  5F05 A;  5KN2 A;  1GH2 A;  2BTO T;  4POB A;  2C0D A;  4POL A;  2CZ3 A;  1AQW A;  2B3S A;  5LNK e;  3Q6O A;  2DJ1 A;  4TVE A;  2N5A A;  1USB A;  5A4V A;  5G1K A;  5JCU A;  1A0R P;  5A4W A;  2CX4 A;  5BMU A;  1UN2 A;  1H4O A;  4RI6 A;  4K7I A;  11GS A;  2WRT A;  3F4T A;  1NHY A;  2KHP A;  1ERV A;  2MMA A;  2X64 A;  1O8X A;  5JWO B;  2LJK A;  4TRX A;  3C7M A;  4J2F A;  3Q18 A;  4G0L A;  1EV9 A;  2MMZ A;  1EGO A;  1VF4 A;  3FY7 A;  5IPG A;  3I69 A;  2P31 A;  1GUM A;  4KDY A;  1U87 A;  1XWA A;  5J9C A;  3ZVJ A;  3PH9 A;  1U3A A;  3IOS A;  6GSW A;  3ZTL A;  2MMN A;  1AAZ A;  2JSY A;  1XZO A;  2AAW A;  1Z6N A;  1F37 A;  4GSN A;  1AIU A;  5F0G A;  3QCP A;  5D9T A;  1B4P A;  3P8W A;  3EWL A;  2C8U A;  1WPI A;  5DCG A;  4LLR A;  2WJU A;  2X8H A;  3LXZ A;  2DBC A;  3HZ4 A;  1V9W A;  4XS6 A;  3ZML A;  3VI5 A;  3P2A A;  3R2Q A;  2JSZ A;  3Q19 A;  3ERF A;  2YZU A;  3VK9 A;  1KNG A;  3J7Y k;  1S3D A;  2DMM A;  1G6Y A;  3TKS E;  2NTO A;  3ED3 A;  1QMV A;  4JBB A;  3MAK A;  3PIN A;  2QKE A;  4ECB A;  2VL9 A;  3IC4 A;  2F8F A;  4IBP A;  2FNO A;  3GTU B;  1RK4 A;  1F9M A;  3GV1 A;  1AW9 A;  2HSH A;  5G1L A;  2H1B A;  4KDX A;  2X8G A;  4TOP A;  2K6V A;  3C71 A;  3WGE A;  3WT2 A;  3GKM A;  2OAC A;  1FOV A;  4ECJ A;  3MWH A;  2H01 A;  3G7J A;  5DQS A;  3KP8 A;  2LNS A;  4PQI A;  1J9B A;  1G7O A;  4FYC A;  4IJ3 A;  1KTE A;  3TGZ A;  2FD3 A;  5H5S A;  3FEU A;  1YDK A;  2YCD A;  3DRN A;  3HHV A;  3QAG A;  4IEL A;  3E0U A;  1XW6 A;  9GSS A;  2F51 A;  4XRD A;  4TR0 A;  1XVW A;  4V2L A;  5G5E A;  2GST A;  2DLX A;  1ST9 A;  4MCU A;  4YAP A;  2IMD A;  2H1G A;  2IPA A;  4EVM A;  2JZS A;  5CRH A;  3TB2 A;  4AF2 A;  1GTB A;  4YQU A;  5JCW A;  1ZCP A;  2RM6 A;  5E4W A;  1N8J A;  5F06 A;  2YNX A;  3CYN A;  4IHU A;  1T1V A;  4DSS B;  2L6D A;  1XIY A;  4AJ7 A;  4G19 A;  4HU9 A;  4O92 A;  1HYU A;  4IS0 A;  4J56 E;  3IK7 A;  2PVQ A;  2LTK A;  3KIJ A;  5G5F A;  4MA9 A;  3EU4 A;  3R3E A;  4MDC A;  4NHZ A;  2AV4 A;  3UAR A;  3NIV A;  4KB3 A;  1M99 A;  3FZ5 A;  1ABA A;  3HDC A;  4FIW A;  3FK8 A;  2FHE A;  5J4U A;  4WET A;  1SU9 A;  1PL2 A;  1M2D A;  1SK2 A;  2GT6 A;  6GSY A;  5C04 A;  5F8B A;  4AJ8 A;  1JZD A;  1GUK A;  2G0F A;  4Z7X A;  4BVY A;  4KND A;  1TW9 A;  2HZE A;  1O6J A;  1SD8 A;  1GWC A;  1YEX A;  3GNJ A;  5AIV A;  3RHC A;  3TKQ A;  4USS A;  1GL8 A;  3D21 A;  3FRC A;  4MF5 A;  1SYR A;  4IQ1 A;  3LXT A;  1JFU A;  3VI7 A;  2H73 A;  1M2A A;  2DJ2 A;  4OFM A;  3CTF A;  2CX3 A;  2MYG A;  2GZY A;  2OBK A;  1A2M A;  4N0Z A;  1X5C A;  5ECN B;  4FYB A;  2YV9 A;  2B1L A;  4HS1 A;  2DJJ A;  2EIO A;  3TRQ A;  1ZOF A;  1K0D A;  2HRK A;  4NHW A;  4YH2 A;  5DAL B;  3KXO A;  2HRK B;  4JED A;  4GRF A;  5AGY A;  1G0T A;  2HSY A;  1OC8 A;  3NOF A;  1LBK A;  2YWI A;  3LYK A;  5ENU A;  3WT1 A;  4V1A p;  3VUR A;  5A4U A;  2H74 A;  2YN1 A;  4D73 B;  2PN8 A;  1T00 A;  1M7T A;  1CQH A;  1Z5Y E;  2R4V A;  2H76 A;  2FY6 A;  2GQK A;  1SJZ A;  5IMZ A;  3UOM A;  1FB0 A;  2NDO A;  3HYP A;  1AC1 A;  3NZN A;  2N5B A;  3HJO A;  2H1A A;  3HCZ A;  1A2L A;  3US3 A;  4BWQ A;  1JLV A;  2IN3 A;  2OAD A;  2C0E A;  5D93 A;  3WGX A;  2HRN A;  4EC0 A;  3G7I A;  1FVK A;  4BL7 A;  4BVX B;  2FCH A;  4PXO A;  2HRA A;  2K8V A;  2OJL A;  3TCO A;  4HZ4 A;  2C80 A;  2V1M A;  3RPP A;  1A0F A;  3ZMK A;  2LJA A;  3APO A;  4I2U A;  1R7H A;  2EIR A;  1EP8 A;  1WOU A;  1GTA A;  2VIM A;  1EEM A;  4NV5 A;  3M8N A;  3D4T A;  3DWV A;  2ON7 A;  5GSS A;  1EGR A;  3KEB A;  3HZ8 A;  1TI3 A;  4F2I A;  2B1K A;  1EEJ A;  1WIK A;  1XPV A;  3WGD A;  2MBT A;  1DE2 A;  4JU5 A;  2CVB A;  3G7Y A;  1OVN A;  4I6X A;  4YAV A;  4MJB A;  4MJA A;  3QD9 A;  4ZBA A;  1F3B A;  1GUH A;  2PGT A;  4K7O A;  3GL3 A;  3M0F A;  4ZB6 A;  3I6A A;  3IBH A;  4ACS A;  1F6M C;  1SEN A;  5D9W A;  2H30 A;  2HNL A;  18GS A;  8GSS A;  1XWB A;  4OD7 A;  2HI7 A;  3HVX A;  2H0H A;  2R37 A;  1Y25 A;  1K0B A;  4FYU A;  20GS A;  3UBK A;  2HLS A;  3F6D A;  4TXO A;  1TRW A;  1MD3 A;  1AQV A;  1U3I A;  4MAB A;  5D96 A;  1R4W A;  3LQ7 A;  1Z7P A;  4DSR A;  1Y6E A;  3MSZ A;  5LD0 A;  4FH8 A;  4WEY A;  3ERW A;  2K8S A;  4G2E A;  2L5O A;  3UIW A;  3W8S A;  2BJX A;  3VPT A;  4GCI A;  1GSU A;  1ZYQ B;  3LFL A;  1BYE A;  2L59 A;  4ECC A;  2LQO A;  2FLS A;  4IN0 A;  3TJB A;  5B7C A;  4OCE A;  1SKR B;  4GSS A;  2EIQ A;  3F4S A;  2IME A;  1SJI A;  1TU8 A;  3DKS A;  3ZZX A;  3HXS A;  3GN3 A;  5AIX A;  1BED A;  5GAP D;  2HE3 A;  1JZW A;  2E0Q A;  3DVW A;  1HQO A;  4GXZ A;  2YJH A;  5G30 A;  4TW5 A;  5CAX A;  3IC8 A;  4ZL8 A;  2C0G A;  4KCE A;  1AXD A;  1TK0 B;  4IP1 A;  2A4V A;  1IYH A;  3U6V A;  1SJ6 A;  2FGX A;  2DML A;  3FZ4 A;  2P5Q A;  3E9J B;  4PUF C;  4WF5 A;  3KGK A;  1YF1 A;  3PR8 A;  3GYK A;  3QFA C;  1TKD B;  1GTI A;  2E2G A;  1OC3 A;  1JZO A;  3UVH A;  4JZQ A;  3L9V A;  5CYY A;  1A8L A;  2LRT A;  2HRF A;  4V2N A;  3GL5 A;  5IM9 A;  4XS4 A;  4TR4 A;  3F0I A;  2HXK A;  2B5Y A;  1ERT A;  4MMM A;  4XS4 B;  1BQ7 A;  4XRA A;  3ZL5 A;  4F82 A;  3GIX A;  1ML6 A;  1GLQ A;  3ZIV A;  1BJX A;  1ILO A;  1PSQ A;  2PWJ A;  2ZCT A;  4CHS A;  2H72 A;  4O7H A;  5KN1 A;  1TDI A;  3GST A;  3JCM L;  2NVL A;  1PMT A;  3G9B A;  4RI7 A;  4TXV A;  1X5D A;  1AUC A;  3LSZ A;  3MDK A;  2K9F A;  14GS A;  1JZR A;  3KH7 A;  2DSA A;  1GSS A;  5J5N A;  3TKP A;  1RW1 A;  3A2W A;  1V2A A;  4ML1 A;  1YKA A;  2H8L A;  3LWA A;  2IFQ B;  3C1S A;  3GKK A;  1SD9 A;  2B6M A;  1EOG A;  1GP1 A;  2DIY A;  3FR9 A;  5JCG A;  4EE0 A;  4L5L A;  5H5Q A;  4O5R A;  1YKC A;  1TXX A;  2IMI A;  3FYG A;  3GHA A;  1G7E A;  1K3Y A;  1PQN A;  5FT3 A;  2V32 A;  3W6G A;  5IO2 A;  3LYP A;  3LJR A;  4I97 A;  1OAZ A;  2D2Z A;  3DVX A;  2NPB A;  1U6T A;  2I9H A;  2VO4 A;  5CRD A;  5DJM A;  4ZXG A;  2OE0 A;  2XBI A;  1GUL A;  1XW5 A;  1W89 A;  2C1Y A;  2LRC A;  2PMT A;  2VLT A;  4MH2 A;  3U5R E;  3VWX A;  4IGJ A;  4EXJ A;  6GSV A;  3H1N A;  4PTS A;  3GTU A;  3K8N A;  1XWC A;  2YWN A;  3SBC A;  4EDY A;  3UEM A;  4IW9 A;  2MZC A;  4PQH A;  4KCA A;  3EYT A;  4LA1 A;  3FR3 A;  4EO3 A;  2IWT A;  3DIE A;  3TRP A;  3UJ1 A;  5EVO A;  1I5G A;  1X5E A;  4MPG A;  4QL7 A;  1AQX A;  2FWE A;  5ABR A;  1SL0 B;  4QQ7 A;  3M9J A;  2CAQ A;  4ISD A;  19GS A;  1LU4 A;  2AJQ B;  1EWX A;  3HJM A;  5DAK A;  5DAK B;  3BOA A;  4TR1 A;  3TJK A;  1KBN A;  1JHB A;  4TR1 B;  4KAE A;  4IP6 A;  2PER A;  4DSS A;  1XFL A;  1O73 A;  1XWG A;  3APQ A;  2VCQ A;  4XTS A;  5CP1 A;  5ELA A;  1PN9 A;  4TKY A;  4FO5 A;  4K0N A;  5GAN D;  2A2R A;  5HR1 A;  4ECI A;  4N11 A;  3WD6 A;  2I1U A;  4O32 A;  2H0I A;  3FKF A;  4K6X A;  3C8E A;  4FQU A;  4AJ6 A;  1B8X A;  3VWW A;  1S3C A;  1SKW B;  3M3M A;  1TU7 A;  1VGL A;  5IIZ A;  10GS A;  4GTU A;  1V58 A;  3IAS 2;  5ECL B;  3TOU A;  2GS3 A;  4RQX A;  2AHE A;  4OWY A;  1G6W A;  4MZC A;  3KCM A;  3KTB A;  2AB6 A;  17GS A;  4BA7 A;  2GQL A;  1GSE A;  3L9S A;  5DCH A;  2DIZ A;  4WKW A;  1YJ6 A;  3HJP A;  4MF7 A;  4MF6 A;  3A2X A;  2CT6 A;  3ERG A;  3CRT A;  4Q5N A;  4F0C A;  2GGT A;  2V41 A;  4RQR A;  4Q5R A;  2TRC P;  3DML A;  4G9H A;  5AIS A;  5J9B A;  3TRX A;  1BX9 A;  1C72 A;  2VCZ A;  3QFB C;  3KMN A;  1F2E A;  2CZ2 A;  1B9X C;  4NWY A;  1S3A A;  2WDU A;  2VM1 A;  3IK9 A;  5ID2 B;  5DAL A;  5HFI A;  5ECP B;  5F07 A;  2LQQ A;  1Q4J A;  2JU5 A;  4OO4 A;  5HFK A;  2ZUP A;  2CA8 A;  2OA7 A;  2KLX A;  3WYW A;  3GFK A;  4BWS A;  1TRU A;  2GZP A;  1PRX A;  2FUG 2;  4L5O A;  3RDW A;  1X9W B;  1O85 A;  2K18 A;  4D73 A;  5IMA A;  3VPQ A;  4MZW A;  2P5R A;  1OE7 A;  4GQF A;  4NXI A;  2QC7 A;  4ZIL A;  1FAA A;  1ZL9 A;  4ML6 A;  1FHE A;  2KP1 A;  2F8A A;  4MPF A;  3IHQ A;  1Z7R A;  2GZZ A;  5HR0 A;  2LJR A;  1OC9 B;  4KF9 A;  1R26 A;  1EP7 A;  2OBI A;  4PUR A;  3EE2 A;  2PU9 C;  1DBY A;  2HYX A;  1T4Z A;  5IMC A;  1BG5 A;  2CAI A;  2O87 A;  4F0B A;  5L71 A;  1SL2 B;  4ZL7 A;  2XC2 A;  3RAZ A;  2CV4 A;  5B6N A;  3HD5 A;  4GLT A;  3FZ9 A;  2YP6 A;  4BVX A;  1TRV A;  1WE0 A;  3C73 A;  1TOF A;  2C0F A;  3QAV A;  1WP0 A;  5D73 A;  4LL1 B;  4ULX A;  2GSQ A;  1PD2 1;  2JZT A;  2I4A A;  5AN1 A;  2LNT A;  2VL2 A;  4HJ2 A;  3I9V 2;  3O76 A;  4HUA A;  5DVB A;  1PX7 A;  1YZX A;  3DXB A;  1SL1 B;  3TOT A;  1NW2 A;  2DJK A;  2VD1 A;  4KGI A;  3IAM 2;  2FA8 A;  3H8Q A;  1XOA A;  1GLP A;  3KMO A;  1T3B A;  4OMV A;  3OR5 A;  2M46 A;  1A24 A;  1O8W A;  1M2B A;  3GUR A;  4PNF A;  3FZA A;  2XPE A;  3ME7 A;  4F03 A;  5E59 A;  3LGC A;  1SKS B;  1GSQ A;  4KW6 A;  2PPT A;  3DGQ A;  1XWK A;  3AY8 A;  1SYX A;  4X1U A;  3M9K A;  2R5G A;  3PPU A;  4MJC A;  1HD2 A;  1VRS D;  4PGT A;  1K0A A;  2LS5 A;  4HEA 2;  1FB6 A;  1K3O A;  2L4Q A;  5IPH A;  3KJY A;  3EUR A;  1A23 A;  3N9J A;  1TRS A;  4ZB8 A;  3GMF A;  3F3R A;  2YWO A;  1URM A;  1ERU A;  3GX8 A;  4OFT A;  7GSS A; 
#chains in the Genus database with same CATH topology
 2H6X A;  1PA3 A;  2DJ0 A;  4P3Y B;  2ON5 A;  4XS1 A;  4K8M A;  3GH9 A;  4OO5 A;  1TK8 B;  1GRX A;  5HR2 A;  4PNG A;  1HNC A;  4YKG A;  2RLI A;  4CW9 A;  4A5P A;  4DVC A;  3GKX A;  5FHI A;  4I5Q A;  3IR4 A;  4WBJ A;  1XVQ A;  3GA4 A;  6GSX A;  3BCK A;  1GSY A;  5BRT A;  5HFG A;  3KTL A;  3D5J A;  5KEJ A;  3KZQ A;  4V1A g;  1GNE A;  3IXR A;  13GS A;  1YY7 A;  2OE3 A;  1QQ2 A;  3FMW A;  2DJ3 A;  3Q74 A;  4E8E A;  4CDO A;  2X8C A;  2YAN A;  1X9M B;  3VLN A;  2CQ9 A;  2TIR A;  1B9Y C;  3HVV A;  4K5S A;  3ZRE A;  3J7Y b;  4XHM A;  4OFN A;  5ECS A;  4G0K A;  2J23 A;  1XBS A;  3P90 A;  2N5F A;  3DD3 A;  5ECQ B;  4MK3 A;  1F3A A;  4JR4 A;  1O7U A;  5EL8 A;  4MJE A;  6GST A;  4PX1 A;  5B8A A;  1YEW C;  4ZL9 A;  5ECM B;  1SK1 A;  1NSW A;  3TKS A;  2VAF A;  3DYR A;  4XIH A;  2CVK A;  1M9B A;  4WBR D;  1N2A A;  2LEG A;  5IQY A;  2KP2 A;  4X43 A;  4QL9 A;  3TJJ A;  5D9V A;  2LKU A;  5HR3 A;  1ERW A;  3CRU A;  3F6F A;  2B5E A;  2FA4 A;  4H86 A;  3UMA A;  4L0U A;  2QGV A;  1K0C A;  4NV2 A;  4Z2U A;  4MP4 A;  1WRY A;  1Z3E A;  3L4N A;  5ECH B;  2X99 A;  4EL1 A;  3F4R A;  5JWR B;  5J41 A;  4HDE A;  2HSN B;  1PKW A;  3EC3 A;  1DUG A;  4ILF A;  1DSB A;  1EOH A;  2VLV A;  1OKD A;  3FR6 A;  1YQ1 A;  1K0O A;  3F3Q A;  1MTC A;  2QSI A;  1ZYE A;  1LJR A;  2IFQ A;  5IMF A;  1WMJ A;  2OE1 A;  3EVI A;  3MNG A;  5CRW A;  4GST A;  1MDK A;  2HQT A;  4POK A;  2MBS A;  1JLW A;  4IQA A;  2NBS A;  3ZVJ D;  5FWG A;  2JAD A;  1Z6M A;  3ZFL A;  4LL4 B;  5KOW A;  4LMV A;  5ECR B;  3DEX A;  3GUS A;  2O8V B;  4Q5Q A;  5DDL A;  2C3N A;  3KD0 A;  3UVT A;  3KH9 A;  3QMX A;  3HY2 A;  1A8Y A;  2H1D A;  4WR4 A;  1XCC A;  3APS A;  3EIN A;  3ME8 A;  4EIP A;  4AKX B;  1SK0 A;  2FWG A;  3H4K A;  1X9S B;  5CO3 A;  1TTZ A;  1Z9H A;  1WWJ A;  2V6O A;  1ZGN A;  1Y1U A;  2O89 A;  2CVD A;  2H75 A;  1FW1 A;  2YJ7 A;  5KN3 A;  2JL4 A;  3F63 A;  1K0M A;  4HQZ A;  1R5P A;  3GX0 A;  4IJI A;  1V40 A;  2EC4 A;  2PUK C;  4JRR A;  2ALB A;  2H71 A;  2VCT A;  2E7P A;  3N5O A;  2XHF A;  1A2J A;  4WXT A;  4CY6 A;  1B4Q A;  4HZ2 A;  1PKZ A;  5A5H A;  2ZNM A;  2O7K A;  2L57 A;  3ZYW A;  4Q5F A;  4L8E A;  4QMK A;  3LOR A;  5A5H B;  2H6Z A;  1DE1 A;  5JWQ B;  4MH3 A;  5B8B A;  2Z9S A;  1UVZ A;  4EF0 A;  1VF2 A;  4BPY A;  2YWM A;  4ID0 A;  4X4J A;  2PVO C;  3QPM A;  2YV7 A;  4IKH A;  4PUA A;  2AUV A;  4GQC A;  2R6K A;  5EPF A;  2L5L A;  4KUN A;  1NM3 A;  2IMK A;  2H0G A;  5H5R A;  2EFC A;  2IIY A;  2VM2 A;  1MEK A;  2I81 A;  5ELG A;  2TRX A;  3RPN A;  1PX6 A;  2VL3 A;  1HNB A;  4LMW A;  3UAP A;  4KDU A;  1R5A A;  1QK8 A;  6GSS A;  4ZBD A;  5HQP A;  4KX4 A;  1T7P B;  2F3M A;  3EMX A;  4I2T A;  3LG6 A;  2B7J A;  3HVS A;  2R0G A;  4HU7 A;  4I8B A;  2G2Q A;  5C00 A;  2R2J A;  2VLU A;  16GS A;  3HKR A;  4TR3 A;  3ISO A;  1EV4 A;  3FW2 A;  4N10 A;  2H19 A;  3CXG A;  2B5X A;  3A2V A;  2VOC A;  3D0Z A;  1GNW A;  3W8J A;  5EY6 A;  1SVM A;  1FG4 A;  4BIK A;  5ECK B;  5DQY A;  3TDG A;  4WF4 A;  2WVY A;  2GDR A;  4KE3 A;  3IRA A;  1V98 A;  4KA0 A;  3GKN A;  4NMU A;  3D22 A;  4G10 A;  3CSH A;  3CTG A;  2OKA A;  1YEP A;  1MD4 A;  2WGR A;  1V57 A;  1TI1 A;  4IVF A;  2R3X A;  2VCX A;  12GS A;  5DJL A;  4K1F A;  4HJM A;  2GSR A;  4F9Z A;  1OYJ A;  1QFN A;  3D6I A;  5IOX A;  4L0W A;  1YVL A;  2L6C A;  4NPB A;  3IA1 A;  3P7X A;  2PBJ A;  1GSD A;  1OKT A;  1B48 A;  1VF3 A;  4JR6 A;  5IO0 A;  5A5K A;  4V2M A;  4BVY B;  3F8U A;  5ID2 A;  2HZE B;  1I9D A;  2HZF A;  2WW1 A;  2IJY A;  3GRX A;  4HSC X;  2VCV A;  2IL3 A;  3TJG A;  3UL3 A;  2FWH A;  5COH A;  4GWR A;  5DBQ A;  2C3Q A;  4EKZ A;  1VF1 A;  5G31 A;  3ZLP A;  4HI7 A;  1ACV A;  4K7N A;  4ZIJ A;  2IMF A;  3FHK A;  5A34 B;  2RM5 A;  2C3T A;  2VL2 C;  1XW9 A;  2XPD A;  5G2Z A;  4FXY P;  2RUE A;  1U88 A;  2GLR A;  2JAC A;  2O85 A;  4K0G A;  1ZMA A;  4KSM A;  1OC9 A;  2P0G A;  2FWF A;  1WJK A;  4X0X A;  4AGS A;  4TN8 A;  1THO A;  1QGV A;  3VWV A;  4PI0 C;  3HA9 A;  2LV3 A;  2YOI A;  1YF0 A;  1QUW A;  4ZBB A;  5CRG A;  3RHB A;  3GH6 A;  3O6T A;  1EZK A;  1M9A A;  4OCF A;  1E6B A;  2YZH A;  4J57 E;  3CSI A;  5IMD A;  5INY A;  2V6K A;  2VD0 A;  1K3L A;  3V1W A;  3F9U A;  3IDV A;  2WZ9 A;  4ZB9 A;  5IOW A;  2RII A;  3ZIT A;  3TU3 B;  1OE8 A;  4K9Z A;  3TKR A;  2LUS A;  4EUY A;  4DSQ A;  3O3T A;  2LST A;  2DC5 A;  3CBU A;  6GSU A;  4K2D A;  3M1G A;  2YPM A;  1ZZY A;  2GT5 A;  4DEJ A;  3S9F A;  22GS A;  3E3E A;  3KM6 A;  4YQV A;  5ECO B;  2J9H A;  3EU3 A;  2M72 A;  4KSO A;  3EMP A;  4RUV A;  1GTU A;  1MDJ A;  2WFC A;  2UZ8 A;  3SWL A;  3QAW A;  1Q98 A;  2B7K A;  4N0V A;  4BL7 B;  2WCI A;  2LRN A;  4HOJ A;  3L9U A;  3BCI A;  3TJF A;  1BAY A;  4NAX A;  1KEB A;  3A3T A;  1FVJ A;  3KP9 A;  1QXH A;  1T4Y A;  3D4M A;  3VWU A;  1IYI A;  3MYD A;  1M0U A;  3CWG A;  3TUE A;  1PL1 A;  2BMX A;  3QOU A;  2H70 A;  1ON4 A;  4MLY A;  1CQG A;  3ZRD A;  4POM A;  3C1R A;  3LEF A;  3IV4 A;  3BBY A;  1T8E B;  2MMO A;  2JZR A;  5GZZ B;  3CQF A;  2EFE A;  2HFD A;  5CRE A;  1UC7 A;  1GSF A;  1NHO A;  3ZIJ A;  2M80 A;  2A2S A;  5KN0 A;  5CNW A;  1H75 A;  4HQS A;  2KOK A;  3CMI A;  2V2G A;  2HT9 A;  2H66 A;  2GQM A;  1HNA A;  3IE3 A;  5J3R A;  2VUP A;  4N30 A;  2F9S A;  3QDN A;  4ICY A;  1TK5 B;  1O81 A;  1TP9 A;  2XBQ A;  2REM A;  1K0N A;  3PGT A;  4EDZ A;  4TXO B;  5IMV A;  3TKS C;  4MZB A;  5ECI B;  2WUL A;  3UBL A;  1THX A;  5J47 A;  3L0H A;  3QR6 A;  3H93 A;  1PGT A;  2AYT A;  2HSM A;  4KH7 A;  4PQ1 A;  5J4V A;  3RBT A;  2HSM B;  2C4J A;  5D9X A;  1XXU A;  2QA1 A;  3ZFB A;  3BJ5 A;  4YQM A;  1W4V A;  4GF0 A;  3VFI A;  1MDI A;  1FO5 A;  5D8I A;  1UA5 A;  1XOB A;  3GSS A;  2RUF A;  3L78 A;  2L4C A;  4JE1 A;  4G0I A;  4E8H A;  2GVP A;  3CSJ A;  2GTU A;  1J0F A;  5LCZ A;  3A5W A;  2KUC A;  1RQM A;  2X49 A;  3I43 A;  3IPZ A;  2H6Y A;  2VCW A;  5GST A;  2E2M A;  2WS2 A;  2ES7 A;  3H79 A;  4XCS A;  1TJD A;  1E2Y A;  2DKH A;  2X4A A;  5B6M A;  2GSS A;  1X0R A;  2WB9 A;  1J08 A;  4WR5 A;  2I3Y A;  3BD2 A;  5F05 A;  5KN2 A;  1GH2 A;  2BTO T;  3RFR C;  4POB A;  2C0D A;  4POL A;  2CZ3 A;  1AQW A;  2B3S A;  5LNK e;  3Q6O A;  2DJ1 A;  4TVE A;  2N5A A;  1USB A;  4PI2 C;  5A4V A;  5G1K A;  2HSN A;  5JCU A;  1A0R P;  5A4W A;  2CX4 A;  5BMU A;  1UN2 A;  4AKH A;  1H4O A;  4RI6 A;  5BMU B;  4K7I A;  11GS A;  2WRT A;  3F4T A;  1NHY A;  2KHP A;  1ERV A;  2MMA A;  2X64 A;  1BG1 A;  1O8X A;  5JWO B;  2LJK A;  4TRX A;  3C7M A;  4J2F A;  2WVX A;  3Q18 A;  4CY8 A;  4G0L A;  1EV9 A;  2MMZ A;  1EGO A;  1VF4 A;  3FY7 A;  5IPG A;  2WVX B;  3I69 A;  2P31 A;  1GUM A;  4KDY A;  1U87 A;  1XWA A;  5J9C A;  3ZVJ A;  3PH9 A;  1U3A A;  3IOS A;  6GSW A;  3ZTL A;  1ZYN A;  2MMN A;  1AAZ A;  2JSY A;  3LW9 A;  1XZO A;  2AAW A;  1Z6N A;  1F37 A;  4GSN A;  1AIU A;  5F0G A;  3QCP A;  5D9T A;  1B4P A;  3P8W A;  3EWL A;  2C8U A;  1WPI A;  5DCG A;  4LLR A;  2WJU A;  2X8H A;  3LXZ A;  2DBC A;  3HZ4 A;  1V9W A;  4XS6 A;  3ZML A;  3VI5 A;  3P2A A;  3R2Q A;  2JSZ A;  3Q19 A;  3ERF A;  2YZU A;  3VK9 A;  1KNG A;  3J7Y k;  5A1N A;  1S3D A;  2DMM A;  2WZS A;  1G6Y A;  3TKS E;  5A1N B;  2NTO A;  3ED3 A;  1QMV A;  4JBB A;  3MAK A;  3PIN A;  2QKE A;  4ECB A;  2VL9 A;  3IC4 A;  2F8F A;  4IBP A;  5J4Y A;  2FNO A;  3GTU B;  2UV8 G;  1RK4 A;  1F9M A;  3GV1 A;  1AW9 A;  2HSH A;  5G1L A;  2H1B A;  4KDX A;  2X8G A;  4TOP A;  2K6V A;  3C71 A;  3WGE A;  3WT2 A;  3GKM A;  4EIQ A;  2OAC A;  1FOV A;  4ECJ A;  4G01 A;  3MWH A;  2H01 A;  3G7J A;  5DQS A;  3KP8 A;  2LNS A;  4PQI A;  4K2X A;  1J9B A;  1G7O A;  4FYC A;  4IJ3 A;  1KTE A;  1BF5 A;  3TGZ A;  2FD3 A;  5H5S A;  2WW0 A;  5KOX A;  3FEU A;  1YDK A;  2YCD A;  3DRN A;  3HHV A;  3QAG A;  4IEL A;  3E0U A;  1XW6 A;  9GSS A;  2F51 A;  4XRD A;  4TR0 A;  1XVW A;  4V2L A;  5G5E A;  2GST A;  2DLX A;  1ST9 A;  4MCU A;  4YAP A;  2IMD A;  2H1G A;  2IPA A;  4EVM A;  2JZS A;  5CRH A;  3TB2 A;  4AF2 A;  1GTB A;  4YQU A;  5JCW A;  1ZCP A;  2RM6 A;  5E4W A;  1N8J A;  5F06 A;  2YNX A;  3CYN A;  4IHU A;  1T1V A;  4DSS B;  3MIX A;  2L6D A;  1XIY A;  1M3I A;  4AJ7 A;  4G19 A;  4ZB7 A;  4HU9 A;  4O92 A;  1HYU A;  4IS0 A;  4J56 E;  3IK7 A;  2PVQ A;  2LTK A;  3KIJ A;  5G5F A;  4MA9 A;  3EU4 A;  2WW2 A;  3R3E A;  4MDC A;  4NHZ A;  2AV4 A;  3UAR A;  3NIV A;  4KB3 A;  1M99 A;  3FZ5 A;  1ABA A;  3HDC A;  4FIW A;  3FK8 A;  1XG8 A;  2FHE A;  5J4U A;  4WET A;  1SU9 A;  1PL2 A;  1M2D A;  1SK2 A;  2GT6 A;  6GSY A;  5C04 A;  5F8B A;  4AJ8 A;  1JZD A;  1GUK A;  2G0F A;  4Z7X A;  4BVY A;  4KND A;  1TW9 A;  2HZE A;  1O6J A;  1SD8 A;  1GWC A;  1YEX A;  3GNJ A;  5AIV A;  3RHC A;  3TKQ A;  4USS A;  1GL8 A;  4E68 A;  3D21 A;  3FRC A;  4MF5 A;  1SYR A;  2A4H A;  4IQ1 A;  3LXT A;  1JFU A;  3VI7 A;  2H73 A;  1M2A A;  2DJ2 A;  4OFM A;  3CTF A;  2CX3 A;  2MYG A;  2GZY A;  2OBK A;  5A34 A;  1A2M A;  4N0Z A;  1X5C A;  5ECN B;  4FYB A;  2YV9 A;  2B1L A;  4HS1 A;  2DJJ A;  2EIO A;  2O3E A;  3TRQ A;  1ZOF A;  1K0D A;  2HRK A;  4NHW A;  4YH2 A;  5DAL B;  3KXO A;  2HRK B;  4JED A;  4GRF A;  5AGY A;  1G0T A;  2HSY A;  1OC8 A;  3NOF A;  1LBK A;  2YWI A;  3LYK A;  5ENU A;  3WT1 A;  4V1A p;  3VUR A;  5A4U A;  2H74 A;  2YN1 A;  4D73 B;  2PN8 A;  1T00 A;  1M3J A;  1M7T A;  1CQH A;  1PN0 A;  1Z5Y E;  2R4V A;  2H76 A;  2FY6 A;  2GQK A;  1SJZ A;  5IMZ A;  3UOM A;  1FB0 A;  2NDO A;  3HYP A;  1AC1 A;  3NZN A;  2N5B A;  3HJO A;  2H1A A;  3HCZ A;  3A5I A;  1A2L A;  3US3 A;  4BWQ A;  1JLV A;  2IN3 A;  2OAD A;  2C0E A;  5D93 A;  3WGX A;  2HRN A;  4EC0 A;  3G7I A;  1FVK A;  4BL7 A;  4BVX B;  2FCH A;  3EPT A;  4PXO A;  2HRA A;  2K8V A;  2OJL A;  3TCO A;  4HZ4 A;  2C80 A;  3RGB C;  2V1M A;  3RPP A;  1A0F A;  3ZMK A;  2LJA A;  3APO A;  4I2U A;  4Z2T A;  1R7H A;  2EIR A;  1EP8 A;  1WOU A;  1GTA A;  2VIM A;  1EEM A;  4NV5 A;  3M8N A;  3D4T A;  3DWV A;  2ON7 A;  5GSS A;  1EGR A;  3KEB A;  3HZ8 A;  1TI3 A;  4F2I A;  2B1K A;  1EEJ A;  1WIK A;  1XPV A;  3WGD A;  2MBT A;  1DE2 A;  4JU5 A;  2CVB A;  3G7Y A;  1OVN A;  4I6X A;  4YAV A;  4MJB A;  4MJA A;  3QD9 A;  4ZBA A;  1F3B A;  1GUH A;  2PGT A;  4K7O A;  3GL3 A;  3M0F A;  4AKG A;  4ZB6 A;  3I6A A;  3IBH A;  4K5R A;  4ACS A;  1F6M C;  1SEN A;  5D9W A;  2H30 A;  2HNL A;  18GS A;  8GSS A;  1XWB A;  4OD7 A;  2HI7 A;  3HVX A;  2H0H A;  2R37 A;  1Y25 A;  1K0B A;  4FYU A;  20GS A;  3UBK A;  2HLS A;  3F6D A;  4TXO A;  1TRW A;  1MD3 A;  1AQV A;  1U3I A;  4MAB A;  4O5Q A;  1R4W A;  5D96 A;  3LQ7 A;  1Z7P A;  4DSR A;  1Y6E A;  3MSZ A;  5LD0 A;  4FH8 A;  4WEY A;  3ERW A;  2K8S A;  4W66 A;  4G2E A;  2L5O A;  3UIW A;  3W8S A;  3CHX C;  2BJX A;  1PFO A;  3VPT A;  4GCI A;  1GSU A;  1ZYQ B;  3LFL A;  3HMJ G;  1BYE A;  2L59 A;  4ECC A;  2LQO A;  2FLS A;  4IN0 A;  3TJB A;  5B7C A;  4N3Z A;  4OCE A;  1SKR B;  4GSS A;  2EIQ A;  3F4S A;  2IME A;  1SJI A;  1TU8 A;  3DKS A;  3ZZX A;  3HXS A;  3GN3 A;  5AIX A;  1BED A;  5GAP D;  2HE3 A;  1JZW A;  2E0Q A;  2O5V A;  3DVW A;  1HQO A;  4GXZ A;  2YJH A;  5G30 A;  4TW5 A;  5CAX A;  3IC8 A;  4ZL8 A;  2C0G A;  4KCE A;  1AXD A;  1TK0 B;  4IP1 A;  2A4V A;  1IYH A;  2QA2 A;  3U6V A;  1SVO A;  1SJ6 A;  2FGX A;  2DML A;  3FZ4 A;  2P5Q A;  3E9J B;  4PUF C;  4WF5 A;  3KGK A;  1ZYP A;  1YF1 A;  3PR8 A;  3GYK A;  3QFA C;  1TKD B;  1TXU A;  1GTI A;  2E2G A;  1OC3 A;  1JZO A;  3UVH A;  4JZQ A;  3L9V A;  5CYY A;  1A8L A;  2LRT A;  2HRF A;  4V2N A;  3GL5 A;  5IM9 A;  4XS4 A;  2VKZ G;  4TR4 A;  3F0I A;  2HXK A;  2B5Y A;  1ERT A;  4MMM A;  4XS4 B;  1BQ7 A;  4XRA A;  3ZL5 A;  4F82 A;  3GIX A;  1ML6 A;  1GLQ A;  3ZIV A;  1BJX A;  1ILO A;  1PSQ A;  2PWJ A;  4PHZ C;  2ZCT A;  4CHS A;  2H72 A;  4O7H A;  5KN1 A;  1TDI A;  3GST A;  3JCM L;  1S4B P;  2NVL A;  1PMT A;  3G9B A;  4RI7 A;  4TXV A;  1X5D A;  2R0P A;  1AUC A;  3LSZ A;  3MDK A;  2K9F A;  14GS A;  3IHG A;  1JZR A;  3KH7 A;  2DSA A;  1GSS A;  5J5N A;  3TKP A;  1RW1 A;  3A2W A;  1V2A A;  4ML1 A;  1YKA A;  2H8L A;  3LWA A;  2IFQ B;  3C1S A;  3GKK A;  1SD9 A;  2B6M A;  1EOG A;  1GP1 A;  2DIY A;  3FR9 A;  5JCG A;  4EE0 A;  4L5L A;  5H5Q A;  4O5R A;  1YKC A;  1TXX A;  2IMI A;  3FYG A;  3GHA A;  1G7E A;  2DKI A;  1K3Y A;  1PQN A;  5FT3 A;  2V32 A;  3W6G A;  5IO2 A;  3LYP A;  3LJR A;  4I97 A;  1OAZ A;  2D2Z A;  3DVX A;  2NPB A;  1U6T A;  2I9H A;  2VO4 A;  5CRD A;  5DJM A;  2A2P A;  4ZXG A;  2OE0 A;  2XBI A;  1GUL A;  1XW5 A;  1W89 A;  2C1Y A;  2LRC A;  2PMT A;  2VLT A;  4MH2 A;  3U5R E;  3VWX A;  4IGJ A;  4EXJ A;  6GSV A;  3H1N A;  4PTS A;  3GTU A;  3K8N A;  1XWC A;  2YWN A;  3SBC A;  2O36 A;  4EDY A;  3UEM A;  4IW9 A;  2MZC A;  4PQH A;  4KCA A;  3EYT A;  4LA1 A;  3FR3 A;  4EO3 A;  2IWT A;  3DIE A;  3TRP A;  3UJ1 A;  5EVO A;  1I5G A;  1X5E A;  4MPG A;  4QL7 A;  1AQX A;  2FWE A;  5ABR A;  1SL0 B;  4QQ7 A;  3M9J A;  2CAQ A;  4ISD A;  19GS A;  1LU4 A;  2AJQ B;  1EWX A;  3HJM A;  5DAK A;  5DAK B;  3BOA A;  4TR1 A;  3TJK A;  1KBN A;  1JHB A;  4TR1 B;  4KAE A;  4IP6 A;  2PER A;  4DSS A;  1XFL A;  1O73 A;  1XWG A;  3APQ A;  2VCQ A;  4XTS A;  5CP1 A;  5ELA A;  1PN9 A;  4TKY A;  4FO5 A;  4K0N A;  5GAN D;  2A2R A;  5HR1 A;  4ECI A;  4N11 A;  3WD6 A;  2I1U A;  4O32 A;  2H0I A;  3FKF A;  4K6X A;  3C8E A;  4FQU A;  4AJ6 A;  2EFH A;  1B8X A;  3VWW A;  1S3C A;  1SKW B;  3M3M A;  1TU7 A;  1VGL A;  5IIZ A;  10GS A;  4GTU A;  1V58 A;  2WVZ A;  3IAS 2;  5J40 A;  5ECL B;  3TOU A;  2GS3 A;  4RQX A;  2AHE A;  4OWY A;  1G6W A;  1FOH A;  4MZC A;  3KCM A;  3KTB A;  2AB6 A;  17GS A;  4BA7 A;  2GQL A;  1GSE A;  3L9S A;  5DCH A;  2DIZ A;  4WKW A;  1YJ6 A;  2WW3 A;  3HJP A;  4MF7 A;  4MF6 A;  3A2X A;  2CT6 A;  3ERG A;  3CRT A;  4Q5N A;  4F0C A;  2GGT A;  2V41 A;  4RQR A;  4Q5R A;  2TRC P;  3DML A;  4G9H A;  5AIS A;  5J9B A;  3TRX A;  1BX9 A;  1C72 A;  2VCZ A;  3QFB C;  3KMN A;  1F2E A;  2CZ2 A;  1B9X C;  4NWY A;  1S3A A;  2WDU A;  2VM1 A;  3IK9 A;  5ID2 B;  5DAL A;  5HFI A;  5ECP B;  5F07 A;  2LQQ A;  1Q4J A;  2JU5 A;  4OO4 A;  5HFK A;  2ZUP A;  2CA8 A;  2OA7 A;  2KLX A;  3WYW A;  3GFK A;  1N25 A;  4BWS A;  1TRU A;  2GZP A;  4YKF A;  1SVL A;  1PRX A;  2FUG 2;  4L5O A;  3RDW A;  1X9W B;  1O85 A;  4O5U A;  2K18 A;  4D73 A;  5IMA A;  2EFD A;  3VPQ A;  4MZW A;  2P5R A;  1OE7 A;  4GQF A;  4NXI A;  1I1I P;  2QC7 A;  4ZIL A;  1FAA A;  1ZL9 A;  4ML6 A;  1FHE A;  2KP1 A;  2F8A A;  4MPF A;  3IHQ A;  1Z7R A;  2GZZ A;  5HR0 A;  2LJR A;  1OC9 B;  4KF9 A;  1R26 A;  1EP7 A;  2OBI A;  2R0C A;  1S3R A;  4PUR A;  3EE2 A;  2PU9 C;  1DBY A;  2HYX A;  1T4Z A;  5IMC A;  4MNN A;  1BG5 A;  2CAI A;  2O87 A;  4F0B A;  5L71 A;  1SL2 B;  4ZL7 A;  2XC2 A;  3RAZ A;  2CV4 A;  5B6N A;  3HD5 A;  4GLT A;  3FZ9 A;  2YP6 A;  4BVX A;  1TRV A;  1WE0 A;  3C73 A;  1TOF A;  2C0F A;  3QAV A;  1WP0 A;  5D73 A;  4LL1 B;  4ULX A;  2GSQ A;  1PD2 1;  2JZT A;  2I4A A;  5AN1 A;  2LNT A;  2VL2 A;  4HJ2 A;  3I9V 2;  3O76 A;  4HUA A;  5DVB A;  1YZX A;  1PX7 A;  3DXB A;  1SL1 B;  3TOT A;  1NW2 A;  2DJK A;  2VD1 A;  4KGI A;  3IAM 2;  2FA8 A;  4AKI A;  4GDF A;  3H8Q A;  1XOA A;  1GLP A;  3KMO A;  1T3B A;  4OMV A;  3OR5 A;  2M46 A;  1A24 A;  4AI6 A;  1O8W A;  1M2B A;  3GUR A;  4PNF A;  3FZA A;  2XPE A;  3ME7 A;  4F03 A;  5E59 A;  3LGC A;  2OT3 A;  2H1L A;  1SKS B;  1GSQ A;  4KW6 A;  2PPT A;  3DGQ A;  1XWK A;  3AY8 A;  1SYX A;  4X1U A;  3M9K A;  4Z2R A;  2R5G A;  3PPU A;  4MJC A;  1HD2 A;  1VRS D;  4PGT A;  1K0A A;  2LS5 A;  4HEA 2;  1FB6 A;  1K3O A;  3HVN A;  2L4Q A;  5IPH A;  3KJY A;  3EUR A;  1A23 A;  3N9J A;  1TRS A;  4ZB8 A;  3GMF A;  3F3R A;  2YWO A;  1URM A;  1ERU A;  3GX8 A;  4OFT A;  7GSS A; 
#chains in the Genus database with same CATH homology
 2H6X A;  1PA3 A;  2DJ0 A;  4P3Y B;  2ON5 A;  4XS1 A;  4K8M A;  3GH9 A;  4OO5 A;  1TK8 B;  1GRX A;  5HR2 A;  4PNG A;  1HNC A;  4YKG A;  2RLI A;  4CW9 A;  4A5P A;  4DVC A;  3GKX A;  5FHI A;  4I5Q A;  3IR4 A;  4WBJ A;  1XVQ A;  3GA4 A;  6GSX A;  3BCK A;  1GSY A;  5BRT A;  5HFG A;  3KTL A;  3D5J A;  5KEJ A;  3KZQ A;  4V1A g;  1GNE A;  3IXR A;  13GS A;  1YY7 A;  2OE3 A;  1QQ2 A;  3FMW A;  2DJ3 A;  3Q74 A;  4E8E A;  4CDO A;  2X8C A;  2YAN A;  1X9M B;  3VLN A;  2CQ9 A;  2TIR A;  1B9Y C;  3HVV A;  4K5S A;  3ZRE A;  3J7Y b;  4XHM A;  4OFN A;  5ECS A;  4G0K A;  2J23 A;  1XBS A;  3P90 A;  2N5F A;  3DD3 A;  5ECQ B;  4MK3 A;  1F3A A;  4JR4 A;  1O7U A;  5EL8 A;  4MJE A;  6GST A;  4PX1 A;  5B8A A;  4ZL9 A;  5ECM B;  1SK1 A;  1NSW A;  3TKS A;  2VAF A;  3DYR A;  4XIH A;  2CVK A;  1M9B A;  4WBR D;  1N2A A;  2LEG A;  5IQY A;  2KP2 A;  4X43 A;  4QL9 A;  3TJJ A;  5D9V A;  2LKU A;  5HR3 A;  1ERW A;  3CRU A;  3F6F A;  2B5E A;  2FA4 A;  4H86 A;  3UMA A;  4L0U A;  2QGV A;  1K0C A;  4NV2 A;  4Z2U A;  4MP4 A;  1WRY A;  1Z3E A;  3L4N A;  5ECH B;  2X99 A;  4EL1 A;  3F4R A;  5JWR B;  5J41 A;  4HDE A;  2HSN B;  1PKW A;  3EC3 A;  1DUG A;  4ILF A;  1DSB A;  1EOH A;  2VLV A;  1OKD A;  3FR6 A;  1YQ1 A;  1K0O A;  3F3Q A;  1MTC A;  2QSI A;  1ZYE A;  1LJR A;  2IFQ A;  5IMF A;  1WMJ A;  2OE1 A;  3EVI A;  3MNG A;  5CRW A;  4GST A;  1MDK A;  2HQT A;  4POK A;  2MBS A;  1JLW A;  4IQA A;  2NBS A;  3ZVJ D;  5FWG A;  2JAD A;  1Z6M A;  3ZFL A;  4LL4 B;  5KOW A;  4LMV A;  5ECR B;  3DEX A;  3GUS A;  2O8V B;  4Q5Q A;  5DDL A;  2C3N A;  3KD0 A;  3UVT A;  3KH9 A;  3QMX A;  3HY2 A;  1A8Y A;  2H1D A;  4WR4 A;  1XCC A;  3APS A;  3EIN A;  3ME8 A;  4EIP A;  4AKX B;  1SK0 A;  2FWG A;  3H4K A;  1X9S B;  5CO3 A;  1TTZ A;  1Z9H A;  1WWJ A;  2V6O A;  1ZGN A;  1Y1U A;  2O89 A;  2CVD A;  2H75 A;  1FW1 A;  2YJ7 A;  5KN3 A;  2JL4 A;  3F63 A;  1K0M A;  4HQZ A;  1R5P A;  3GX0 A;  4IJI A;  1V40 A;  2EC4 A;  2PUK C;  4JRR A;  2ALB A;  2H71 A;  2VCT A;  2E7P A;  3N5O A;  2XHF A;  1A2J A;  4WXT A;  4CY6 A;  1B4Q A;  4HZ2 A;  1PKZ A;  5A5H A;  2ZNM A;  2O7K A;  2L57 A;  3ZYW A;  4Q5F A;  4L8E A;  4QMK A;  3LOR A;  5A5H B;  2H6Z A;  1DE1 A;  5JWQ B;  4MH3 A;  5B8B A;  2Z9S A;  1UVZ A;  4EF0 A;  1VF2 A;  4BPY A;  2YWM A;  4ID0 A;  4X4J A;  2PVO C;  3QPM A;  2YV7 A;  4IKH A;  4PUA A;  2AUV A;  4GQC A;  2R6K A;  5EPF A;  2L5L A;  4KUN A;  1NM3 A;  2IMK A;  2H0G A;  5H5R A;  2EFC A;  2IIY A;  2VM2 A;  1MEK A;  2I81 A;  5ELG A;  2TRX A;  3RPN A;  1PX6 A;  2VL3 A;  1HNB A;  4LMW A;  3UAP A;  4KDU A;  1R5A A;  1QK8 A;  6GSS A;  4ZBD A;  5HQP A;  4KX4 A;  1T7P B;  2F3M A;  3EMX A;  4I2T A;  3LG6 A;  2B7J A;  3HVS A;  2R0G A;  4HU7 A;  4I8B A;  2G2Q A;  5C00 A;  2R2J A;  2VLU A;  16GS A;  3HKR A;  4TR3 A;  3ISO A;  1EV4 A;  3FW2 A;  4N10 A;  2H19 A;  3CXG A;  2B5X A;  3A2V A;  2VOC A;  3D0Z A;  1GNW A;  3W8J A;  5EY6 A;  1SVM A;  1FG4 A;  5ECK B;  5DQY A;  3TDG A;  4WF4 A;  2GDR A;  4KE3 A;  3IRA A;  1V98 A;  4KA0 A;  3GKN A;  4NMU A;  3D22 A;  4G10 A;  3CSH A;  3CTG A;  2OKA A;  1YEP A;  1MD4 A;  2WGR A;  1V57 A;  1TI1 A;  4IVF A;  2R3X A;  2VCX A;  12GS A;  5DJL A;  4K1F A;  4HJM A;  2GSR A;  4F9Z A;  1OYJ A;  1QFN A;  3D6I A;  5IOX A;  4L0W A;  1YVL A;  2L6C A;  4NPB A;  3IA1 A;  3P7X A;  2PBJ A;  1GSD A;  1OKT A;  1B48 A;  1VF3 A;  4JR6 A;  5IO0 A;  5A5K A;  4V2M A;  4BVY B;  3F8U A;  5ID2 A;  2HZE B;  1I9D A;  2HZF A;  2IJY A;  3GRX A;  2VCV A;  2IL3 A;  3TJG A;  3UL3 A;  2FWH A;  5COH A;  4GWR A;  5DBQ A;  2C3Q A;  4EKZ A;  1VF1 A;  5G31 A;  3ZLP A;  4HI7 A;  1ACV A;  4K7N A;  4ZIJ A;  2IMF A;  3FHK A;  5A34 B;  2RM5 A;  2C3T A;  2VL2 C;  1XW9 A;  2XPD A;  5G2Z A;  2RUE A;  1U88 A;  2GLR A;  2JAC A;  2O85 A;  4K0G A;  1ZMA A;  4KSM A;  1OC9 A;  2P0G A;  2FWF A;  1WJK A;  4X0X A;  4AGS A;  4TN8 A;  1THO A;  1QGV A;  3VWV A;  3HA9 A;  2LV3 A;  2YOI A;  1YF0 A;  1QUW A;  4ZBB A;  5CRG A;  3RHB A;  3GH6 A;  3O6T A;  1EZK A;  1M9A A;  4OCF A;  1E6B A;  2YZH A;  4J57 E;  3CSI A;  5IMD A;  5INY A;  2V6K A;  2VD0 A;  1K3L A;  3V1W A;  3F9U A;  3IDV A;  2WZ9 A;  4ZB9 A;  5IOW A;  2RII A;  3ZIT A;  3TU3 B;  1OE8 A;  4K9Z A;  3TKR A;  2LUS A;  4EUY A;  4DSQ A;  3O3T A;  2LST A;  2DC5 A;  3CBU A;  6GSU A;  4K2D A;  3M1G A;  2YPM A;  1ZZY A;  2GT5 A;  4DEJ A;  3S9F A;  22GS A;  3E3E A;  3KM6 A;  4YQV A;  5ECO B;  2J9H A;  3EU3 A;  2M72 A;  4KSO A;  3EMP A;  4RUV A;  1GTU A;  1MDJ A;  2WFC A;  2UZ8 A;  3SWL A;  3QAW A;  1Q98 A;  2B7K A;  4N0V A;  4BL7 B;  2WCI A;  2LRN A;  4HOJ A;  3L9U A;  3BCI A;  3TJF A;  1BAY A;  4NAX A;  1KEB A;  3A3T A;  1FVJ A;  3KP9 A;  1QXH A;  1T4Y A;  3D4M A;  3VWU A;  1IYI A;  3MYD A;  1M0U A;  3CWG A;  3TUE A;  1PL1 A;  2BMX A;  3QOU A;  2H70 A;  1ON4 A;  4MLY A;  1CQG A;  3ZRD A;  4POM A;  3C1R A;  3LEF A;  3IV4 A;  3BBY A;  1T8E B;  2MMO A;  2JZR A;  5GZZ B;  2EFE A;  2HFD A;  5CRE A;  1UC7 A;  1GSF A;  1NHO A;  3ZIJ A;  2M80 A;  2A2S A;  5KN0 A;  5CNW A;  1H75 A;  4HQS A;  2KOK A;  3CMI A;  2V2G A;  2HT9 A;  2H66 A;  2GQM A;  1HNA A;  3IE3 A;  5J3R A;  2VUP A;  4N30 A;  2F9S A;  3QDN A;  4ICY A;  1TK5 B;  1O81 A;  1TP9 A;  2XBQ A;  2REM A;  1K0N A;  3PGT A;  4EDZ A;  4TXO B;  5IMV A;  3TKS C;  4MZB A;  5ECI B;  2WUL A;  3UBL A;  1THX A;  5J47 A;  3L0H A;  3QR6 A;  3H93 A;  1PGT A;  2AYT A;  2HSM A;  4KH7 A;  4PQ1 A;  5J4V A;  3RBT A;  2HSM B;  2C4J A;  5D9X A;  1XXU A;  2QA1 A;  3ZFB A;  3BJ5 A;  4YQM A;  1W4V A;  4GF0 A;  3VFI A;  1MDI A;  1FO5 A;  5D8I A;  1UA5 A;  1XOB A;  3GSS A;  2RUF A;  3L78 A;  2L4C A;  4JE1 A;  4G0I A;  4E8H A;  2GVP A;  3CSJ A;  2GTU A;  1J0F A;  5LCZ A;  3A5W A;  2KUC A;  1RQM A;  2X49 A;  3I43 A;  3IPZ A;  2H6Y A;  2VCW A;  5GST A;  2E2M A;  2WS2 A;  2ES7 A;  3H79 A;  4XCS A;  1TJD A;  1E2Y A;  2DKH A;  2X4A A;  5B6M A;  2GSS A;  1X0R A;  2WB9 A;  1J08 A;  4WR5 A;  2I3Y A;  3BD2 A;  5F05 A;  5KN2 A;  1GH2 A;  2BTO T;  4POB A;  2C0D A;  4POL A;  2CZ3 A;  1AQW A;  2B3S A;  5LNK e;  3Q6O A;  2DJ1 A;  4TVE A;  2N5A A;  1USB A;  5A4V A;  5G1K A;  2HSN A;  5JCU A;  1A0R P;  5A4W A;  2CX4 A;  5BMU A;  1UN2 A;  4AKH A;  1H4O A;  4RI6 A;  5BMU B;  4K7I A;  11GS A;  2WRT A;  3F4T A;  1NHY A;  2KHP A;  1ERV A;  2MMA A;  2X64 A;  1BG1 A;  1O8X A;  5JWO B;  2LJK A;  4TRX A;  3C7M A;  4J2F A;  3Q18 A;  4CY8 A;  4G0L A;  1EV9 A;  2MMZ A;  1EGO A;  1VF4 A;  3FY7 A;  5IPG A;  3I69 A;  2P31 A;  1GUM A;  4KDY A;  1U87 A;  1XWA A;  5J9C A;  3ZVJ A;  3PH9 A;  1U3A A;  3IOS A;  6GSW A;  3ZTL A;  1ZYN A;  2MMN A;  1AAZ A;  2JSY A;  3LW9 A;  1XZO A;  2AAW A;  1Z6N A;  1F37 A;  4GSN A;  1AIU A;  5F0G A;  3QCP A;  5D9T A;  1B4P A;  3P8W A;  3EWL A;  2C8U A;  1WPI A;  5DCG A;  4LLR A;  2WJU A;  2X8H A;  3LXZ A;  2DBC A;  3HZ4 A;  1V9W A;  4XS6 A;  3ZML A;  3VI5 A;  3P2A A;  3R2Q A;  2JSZ A;  3Q19 A;  3ERF A;  2YZU A;  3VK9 A;  1KNG A;  3J7Y k;  5A1N A;  1S3D A;  2DMM A;  1G6Y A;  3TKS E;  5A1N B;  2NTO A;  3ED3 A;  1QMV A;  4JBB A;  3MAK A;  3PIN A;  2QKE A;  4ECB A;  2VL9 A;  3IC4 A;  2F8F A;  4IBP A;  5J4Y A;  2FNO A;  3GTU B;  2UV8 G;  1RK4 A;  1F9M A;  3GV1 A;  1AW9 A;  2HSH A;  5G1L A;  2H1B A;  4KDX A;  2X8G A;  4TOP A;  2K6V A;  3C71 A;  3WGE A;  3WT2 A;  3GKM A;  4EIQ A;  2OAC A;  1FOV A;  4ECJ A;  4G01 A;  3MWH A;  2H01 A;  3G7J A;  5DQS A;  3KP8 A;  2LNS A;  4PQI A;  4K2X A;  1J9B A;  1G7O A;  4FYC A;  4IJ3 A;  1KTE A;  1BF5 A;  3TGZ A;  2FD3 A;  5H5S A;  5KOX A;  3FEU A;  1YDK A;  2YCD A;  3DRN A;  3HHV A;  3QAG A;  4IEL A;  3E0U A;  1XW6 A;  9GSS A;  2F51 A;  4XRD A;  4TR0 A;  1XVW A;  4V2L A;  5G5E A;  2GST A;  2DLX A;  1ST9 A;  4MCU A;  4YAP A;  2IMD A;  2H1G A;  2IPA A;  4EVM A;  2JZS A;  5CRH A;  3TB2 A;  4AF2 A;  1GTB A;  4YQU A;  5JCW A;  1ZCP A;  2RM6 A;  5E4W A;  1N8J A;  5F06 A;  2YNX A;  3CYN A;  4IHU A;  1T1V A;  4DSS B;  3MIX A;  2L6D A;  1XIY A;  4AJ7 A;  4G19 A;  4ZB7 A;  4HU9 A;  4O92 A;  1HYU A;  4IS0 A;  4J56 E;  3IK7 A;  2PVQ A;  2LTK A;  3KIJ A;  5G5F A;  4MA9 A;  3EU4 A;  3R3E A;  4MDC A;  4NHZ A;  2AV4 A;  3UAR A;  3NIV A;  4KB3 A;  1M99 A;  3FZ5 A;  1ABA A;  3HDC A;  4FIW A;  3FK8 A;  2FHE A;  5J4U A;  4WET A;  1SU9 A;  1PL2 A;  1M2D A;  1SK2 A;  2GT6 A;  6GSY A;  5C04 A;  5F8B A;  4AJ8 A;  1JZD A;  1GUK A;  2G0F A;  4Z7X A;  4BVY A;  4KND A;  1TW9 A;  2HZE A;  1O6J A;  1SD8 A;  1GWC A;  1YEX A;  3GNJ A;  5AIV A;  3RHC A;  3TKQ A;  4USS A;  1GL8 A;  4E68 A;  3D21 A;  3FRC A;  4MF5 A;  1SYR A;  2A4H A;  4IQ1 A;  3LXT A;  1JFU A;  3VI7 A;  2H73 A;  1M2A A;  2DJ2 A;  4OFM A;  3CTF A;  2CX3 A;  2MYG A;  2GZY A;  2OBK A;  5A34 A;  1A2M A;  4N0Z A;  1X5C A;  5ECN B;  4FYB A;  2YV9 A;  2B1L A;  4HS1 A;  2DJJ A;  2EIO A;  3TRQ A;  1ZOF A;  1K0D A;  2HRK A;  4NHW A;  4YH2 A;  5DAL B;  3KXO A;  2HRK B;  4JED A;  4GRF A;  5AGY A;  1G0T A;  2HSY A;  1OC8 A;  3NOF A;  1LBK A;  2YWI A;  3LYK A;  5ENU A;  3WT1 A;  4V1A p;  3VUR A;  5A4U A;  2H74 A;  2YN1 A;  4D73 B;  2PN8 A;  1T00 A;  1M7T A;  1CQH A;  1PN0 A;  1Z5Y E;  2R4V A;  2H76 A;  2FY6 A;  2GQK A;  1SJZ A;  5IMZ A;  3UOM A;  1FB0 A;  2NDO A;  3HYP A;  1AC1 A;  3NZN A;  2N5B A;  3HJO A;  2H1A A;  3HCZ A;  3A5I A;  1A2L A;  3US3 A;  4BWQ A;  1JLV A;  2IN3 A;  2OAD A;  2C0E A;  5D93 A;  3WGX A;  2HRN A;  4EC0 A;  3G7I A;  1FVK A;  4BL7 A;  4BVX B;  2FCH A;  3EPT A;  4PXO A;  2HRA A;  2K8V A;  2OJL A;  3TCO A;  4HZ4 A;  2C80 A;  2V1M A;  3RPP A;  1A0F A;  3ZMK A;  2LJA A;  3APO A;  4I2U A;  4Z2T A;  1R7H A;  2EIR A;  1EP8 A;  1WOU A;  1GTA A;  2VIM A;  1EEM A;  4NV5 A;  3M8N A;  3D4T A;  3DWV A;  2ON7 A;  5GSS A;  1EGR A;  3KEB A;  3HZ8 A;  1TI3 A;  4F2I A;  2B1K A;  1EEJ A;  1WIK A;  1XPV A;  3WGD A;  2MBT A;  1DE2 A;  4JU5 A;  2CVB A;  3G7Y A;  1OVN A;  4I6X A;  4YAV A;  4MJB A;  4MJA A;  3QD9 A;  4ZBA A;  1F3B A;  1GUH A;  2PGT A;  4K7O A;  3GL3 A;  3M0F A;  4AKG A;  4ZB6 A;  3I6A A;  3IBH A;  4K5R A;  4ACS A;  1F6M C;  1SEN A;  5D9W A;  2H30 A;  2HNL A;  18GS A;  8GSS A;  1XWB A;  4OD7 A;  2HI7 A;  3HVX A;  2H0H A;  2R37 A;  1Y25 A;  1K0B A;  4FYU A;  20GS A;  3UBK A;  2HLS A;  3F6D A;  4TXO A;  1TRW A;  1MD3 A;  1AQV A;  1U3I A;  4MAB A;  4O5Q A;  1R4W A;  5D96 A;  3LQ7 A;  1Z7P A;  4DSR A;  1Y6E A;  3MSZ A;  5LD0 A;  4FH8 A;  4WEY A;  3ERW A;  2K8S A;  4W66 A;  4G2E A;  2L5O A;  3UIW A;  3W8S A;  2BJX A;  3VPT A;  4GCI A;  1GSU A;  1ZYQ B;  3LFL A;  3HMJ G;  1BYE A;  2L59 A;  4ECC A;  2LQO A;  2FLS A;  4IN0 A;  3TJB A;  5B7C A;  4N3Z A;  4OCE A;  1SKR B;  4GSS A;  2EIQ A;  3F4S A;  2IME A;  1SJI A;  1TU8 A;  3DKS A;  3ZZX A;  3HXS A;  3GN3 A;  5AIX A;  1BED A;  5GAP D;  2HE3 A;  1JZW A;  2E0Q A;  2O5V A;  3DVW A;  1HQO A;  4GXZ A;  2YJH A;  5G30 A;  4TW5 A;  5CAX A;  3IC8 A;  4ZL8 A;  2C0G A;  4KCE A;  1AXD A;  1TK0 B;  4IP1 A;  2A4V A;  1IYH A;  2QA2 A;  3U6V A;  1SVO A;  1SJ6 A;  2FGX A;  2DML A;  3FZ4 A;  2P5Q A;  3E9J B;  4PUF C;  4WF5 A;  3KGK A;  1ZYP A;  1YF1 A;  3PR8 A;  3GYK A;  3QFA C;  1TKD B;  1TXU A;  1GTI A;  2E2G A;  1OC3 A;  1JZO A;  3UVH A;  4JZQ A;  3L9V A;  5CYY A;  1A8L A;  2LRT A;  2HRF A;  4V2N A;  3GL5 A;  5IM9 A;  4XS4 A;  2VKZ G;  4TR4 A;  3F0I A;  2HXK A;  2B5Y A;  1ERT A;  4MMM A;  4XS4 B;  1BQ7 A;  4XRA A;  3ZL5 A;  4F82 A;  3GIX A;  1ML6 A;  1GLQ A;  3ZIV A;  1BJX A;  1ILO A;  1PSQ A;  2PWJ A;  2ZCT A;  4CHS A;  2H72 A;  4O7H A;  5KN1 A;  1TDI A;  3GST A;  3JCM L;  2NVL A;  1PMT A;  3G9B A;  4RI7 A;  4TXV A;  1X5D A;  2R0P A;  1AUC A;  3LSZ A;  3MDK A;  2K9F A;  14GS A;  3IHG A;  1JZR A;  3KH7 A;  2DSA A;  1GSS A;  5J5N A;  3TKP A;  1RW1 A;  3A2W A;  1V2A A;  4ML1 A;  1YKA A;  2H8L A;  3LWA A;  2IFQ B;  3C1S A;  3GKK A;  1SD9 A;  2B6M A;  1EOG A;  1GP1 A;  2DIY A;  3FR9 A;  5JCG A;  4EE0 A;  4L5L A;  5H5Q A;  4O5R A;  1YKC A;  1TXX A;  2IMI A;  3FYG A;  3GHA A;  1G7E A;  2DKI A;  1K3Y A;  1PQN A;  5FT3 A;  2V32 A;  3W6G A;  5IO2 A;  3LYP A;  3LJR A;  4I97 A;  1OAZ A;  2D2Z A;  3DVX A;  2NPB A;  1U6T A;  2I9H A;  2VO4 A;  5CRD A;  5DJM A;  2A2P A;  4ZXG A;  2OE0 A;  2XBI A;  1GUL A;  1XW5 A;  1W89 A;  2C1Y A;  2LRC A;  2PMT A;  2VLT A;  4MH2 A;  3U5R E;  3VWX A;  4IGJ A;  4EXJ A;  6GSV A;  3H1N A;  4PTS A;  3GTU A;  3K8N A;  1XWC A;  2YWN A;  3SBC A;  4EDY A;  3UEM A;  4IW9 A;  2MZC A;  4PQH A;  4KCA A;  3EYT A;  4LA1 A;  3FR3 A;  4EO3 A;  2IWT A;  3DIE A;  3TRP A;  3UJ1 A;  5EVO A;  1I5G A;  1X5E A;  4MPG A;  4QL7 A;  1AQX A;  2FWE A;  5ABR A;  1SL0 B;  4QQ7 A;  3M9J A;  2CAQ A;  4ISD A;  19GS A;  1LU4 A;  2AJQ B;  1EWX A;  3HJM A;  5DAK A;  5DAK B;  3BOA A;  4TR1 A;  3TJK A;  1KBN A;  1JHB A;  4TR1 B;  4KAE A;  4IP6 A;  2PER A;  4DSS A;  1XFL A;  1O73 A;  1XWG A;  3APQ A;  2VCQ A;  4XTS A;  5CP1 A;  5ELA A;  1PN9 A;  4TKY A;  4FO5 A;  4K0N A;  5GAN D;  2A2R A;  5HR1 A;  4ECI A;  4N11 A;  3WD6 A;  2I1U A;  4O32 A;  2H0I A;  3FKF A;  4K6X A;  3C8E A;  4FQU A;  4AJ6 A;  2EFH A;  1B8X A;  3VWW A;  1S3C A;  1SKW B;  3M3M A;  1TU7 A;  1VGL A;  5IIZ A;  10GS A;  4GTU A;  1V58 A;  3IAS 2;  5J40 A;  5ECL B;  3TOU A;  2GS3 A;  4RQX A;  2AHE A;  4OWY A;  1G6W A;  1FOH A;  4MZC A;  3KCM A;  3KTB A;  2AB6 A;  17GS A;  4BA7 A;  2GQL A;  1GSE A;  3L9S A;  5DCH A;  2DIZ A;  4WKW A;  1YJ6 A;  3HJP A;  4MF7 A;  4MF6 A;  3A2X A;  2CT6 A;  3ERG A;  3CRT A;  4Q5N A;  4F0C A;  2GGT A;  2V41 A;  4RQR A;  4Q5R A;  2TRC P;  3DML A;  4G9H A;  5AIS A;  5J9B A;  3TRX A;  1BX9 A;  1C72 A;  2VCZ A;  3QFB C;  3KMN A;  1F2E A;  2CZ2 A;  1B9X C;  4NWY A;  1S3A A;  2WDU A;  2VM1 A;  3IK9 A;  5ID2 B;  5DAL A;  5HFI A;  5ECP B;  5F07 A;  2LQQ A;  1Q4J A;  2JU5 A;  4OO4 A;  5HFK A;  2ZUP A;  2CA8 A;  2OA7 A;  2KLX A;  3WYW A;  3GFK A;  1N25 A;  4BWS A;  1TRU A;  2GZP A;  4YKF A;  1SVL A;  1PRX A;  2FUG 2;  4L5O A;  3RDW A;  1X9W B;  1O85 A;  4O5U A;  2K18 A;  4D73 A;  5IMA A;  2EFD A;  3VPQ A;  4MZW A;  2P5R A;  1OE7 A;  4GQF A;  4NXI A;  2QC7 A;  4ZIL A;  1FAA A;  1ZL9 A;  4ML6 A;  1FHE A;  2KP1 A;  2F8A A;  4MPF A;  3IHQ A;  1Z7R A;  2GZZ A;  5HR0 A;  2LJR A;  1OC9 B;  4KF9 A;  1R26 A;  1EP7 A;  2OBI A;  2R0C A;  4PUR A;  3EE2 A;  2PU9 C;  1DBY A;  2HYX A;  1T4Z A;  5IMC A;  4MNN A;  1BG5 A;  2CAI A;  2O87 A;  4F0B A;  5L71 A;  1SL2 B;  4ZL7 A;  2XC2 A;  3RAZ A;  2CV4 A;  5B6N A;  3HD5 A;  4GLT A;  3FZ9 A;  2YP6 A;  4BVX A;  1TRV A;  1WE0 A;  3C73 A;  1TOF A;  2C0F A;  3QAV A;  1WP0 A;  5D73 A;  4LL1 B;  4ULX A;  2GSQ A;  1PD2 1;  2JZT A;  2I4A A;  5AN1 A;  2LNT A;  2VL2 A;  4HJ2 A;  3I9V 2;  3O76 A;  4HUA A;  5DVB A;  1YZX A;  1PX7 A;  3DXB A;  1SL1 B;  3TOT A;  1NW2 A;  2DJK A;  2VD1 A;  4KGI A;  3IAM 2;  2FA8 A;  4AKI A;  4GDF A;  3H8Q A;  1XOA A;  1GLP A;  3KMO A;  1T3B A;  4OMV A;  3OR5 A;  2M46 A;  1A24 A;  4AI6 A;  1O8W A;  1M2B A;  3GUR A;  4PNF A;  3FZA A;  2XPE A;  3ME7 A;  4F03 A;  5E59 A;  3LGC A;  2OT3 A;  2H1L A;  1SKS B;  1GSQ A;  4KW6 A;  2PPT A;  3DGQ A;  1XWK A;  3AY8 A;  1SYX A;  4X1U A;  3M9K A;  4Z2R A;  2R5G A;  3PPU A;  4MJC A;  1HD2 A;  1VRS D;  4PGT A;  1K0A A;  2LS5 A;  4HEA 2;  1FB6 A;  1K3O A;  2L4Q A;  5IPH A;  3KJY A;  3EUR A;  1A23 A;  3N9J A;  1TRS A;  4ZB8 A;  3GMF A;  3F3R A;  2YWO A;  1URM A;  1ERU A;  3GX8 A;  4OFT A;  7GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...