4HI7A

Crystal structure of glutathione transferase homolog from drosophilia mojavensis, target efi-501819, with bound glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
220
structure length
220
Chain Sequence
b'KPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLEDGDANIADSHAIMAYLVSKYGKDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIADFSLISSISSLVAFVPVDAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GI20122
publication title Crystal structure of glutathione transferase homolog from drosophilia mojavensis, TARGET EFI-501819, with bound glutathione
rcsb
source organism Drosophila mojavensis
molecule tags Unknown function
total genus 81
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4hi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hi7A01
4FIWA 4N0VA 3DXBA 1SD9A 2P31A 5J9BA 2V6KA 1RW1A 2I4AA 4OCEA 1MEKA 3HZ8A 1SL2B 2LQOA 2YANA 4D73A 1KTEA 3GH9A 1S3DA 3UOMA 2OBIA 5HR1A 3EU3A 1U3AA 1OC8A 1M2DA 3IK7A 4I8BA 1ML6A 1F3AA 1XZOA 3TJGA 2DJ2A 1JZDA 1AQVA 3GA4A 2JSZA 2IMIA 4J57E 1T3BA 2O89A 4GSTA 2N5BA 3IBHA 3TB2A 3BBYA 1OYJA 4MH3A 3TRXA 1USBA 1OE7A 5CRWA 3VFIA 4IVFA 2HE3A 2LTKA 1PSQA 6GSYA 3FR9A 5C00A 3N5OA 3TCOA 2B1LA 1K3OA 3CBUA 1GNWA 1ABAA 1M9BA 2LRTA 1G7OA 5AIXA 2LRNA 1TK0B 2VM1A 5GAND 1VF2A 4HU9A 3FHKA 5ECQB 2LNSA 2FWGA 2HSNB 4G2EA 2D2ZA 2PWJA 3K8NA 2OE0A 3KM6A 1FHEA 1M99A 1HNCA 3C71A 3LXTA 2RM6A 2J9HA 1R4WA 3BOAA 4ECJA 3LYKA 4PURA 2OKAA 1F37A 2VL2A 3F6FA 4NV5A 3GRXA 4TR1B 2HSHA 2I81A 3H1NA 1OE8A 3D21A 2LRCA 2MMNA 1JFUA 3HCZA 1E2YA 3L0HA 1PMTA 2A4VA 3ZVJA 5CRGA 4LL4B 1TTZA 4G0IA 3UBLA 4J56E 1YKCA 3I6AA 4JBBA 4KDUA 2NBSA 3GHAA 3IDVA 1MDKA 5IMVA 1Z3EA 1AIUA 5IMFA 2L6CA 1DUGA 4YQVA 5DVBA 4ZBAA 1AUCA 5IMDA 3LG6A 2XBQA 4JR6A 3QOUA 4ZBBA 1JHBA 2DJ0A 4WR4A 2KP1A 4DVCA 5IO0A 3ZIVA 2CVDA 3KMNA 3HJMA 1I5GA 2IMEA 4XS1A 2MMOA 2QKEA 3G9BA 2VOCA 3GSTA 4ZBDA 2RM5A 2H75A 5J41A 4WEYA 2DC5A 1R7HA 4FO5A 1PA3A 3D4TA 1FO5A 3UIWA 3DD3A 4TKYA 4WXTA 5IM9A 4PNGA 2FY6A 3ZMKA 3GKNA 3GX0A 4ID0A 3GUSA 3FZ9A 3QPMA 2RUFA 3TJFA 3OR5A 3PGTA 4CDOA 4O5RA 1T1VA 1PKWA 5FWGA 3VPQA 1T4ZA 2B3SA 4K7OA 4L0UA 5J9CA 1Y25A 1FOVA 2IN3A 5G2ZA 1TRVA 4WBRD 4AJ6A 1ZMAA 5ECSA 1ERWA 2GZZA 2AHEA 2OJLA 3FYGA 2JL4A 6GSTA 1O6JA 2KHPA 1GRXA 1GLQA 5ECIB 1EV9A 3CSHA 7GSSA 2EIOA 3HA9A 2LV3A 1FW1A 3H8QA 3ZFLA 3HKRA 3VLNA 4MZCA 2WZ9A 2C4JA 22GSA 1AXDA 1BEDA 3MNGA 5JCWA 3WT1A 5A4UA 4FYBA 2K8VA 2Z9SA 2JZSA 1YDKA 1F9MA 3CXGA 3GNJA 5LNKe 5G31A 2X8HA 4OO4A 1ZOFA 4YQMA 1XBSA 3WD6A 4X0XA 4I2UA 5G30A 2OE3A 4YH2A 2QSIA 1QXHA 4TVEA 2H30A 4DSQA 4LLRA 1GUHA 3U5RE 4RUVA 3MWHA 4HU7A 3KMOA 1DE1A 5J4UA 1GSDA 4V2MA 5DAKB 1GP1A 4K6XA 3TKSE 1GWCA 2WJUA 1YEXA 5HQPA 1ST9A 2OA7A 18GSA 1WOUA 4MJCA 5A4WA 3L9VA 1B8XA 4GXZA 3VI5A 3IXRA 2V32A 2DJ3A 4KE3A 3TKQA 1MD3A 1PN9A 1XWCA 2F51A 3R2QA 1G7EA 1XVWA 14GSA 1GLPA 2H19A 3VWXA 3IAM2 3ZITA 2LS5A 2GZPA 1X9WB 5GSTA 1SKWB 5IPGA 5ECHB 4ZL8A 4AGSA 2GSRA 2LNTA 4WBJA 3HDCA 3PPUA 2H73A 1LU4A 4MJBA 2PU9C 4KW6A 4KCAA 4OFNA 3ZYWA 5DJMA 1XW5A 2I1UA 2HSYA 2VL9A 4HOJA 3TJKA 3HVXA 2WULA 2J23A 5H5SA 3GKXA 2HZEB 3LFLA 2X8GA 1F6MC 1A23A 3DKSA 5ECOB 3VWWA 4K0GA 4NXIA 5B8AA 4KNDA 3TRQA 1IYIA 3VK9A 3G7JA 1HYUA 1B9XC 5JWRB 1SK0A 2FA4A 3RPNA 1TK5B 1M7TA 3ZTLA 1X9SB 5CYYA 4BPYA 2GSQA 3J7Yb 5KN1A 1U87A 5EL8A 2LUSA 1A8LA 2V41A 1TU7A 3QAWA 3CYNA 4NPBA 3C73A 2H66A 1BQ7A 3NIVA 2MBTA 1OKDA 3IPZA 5E4WA 1XOBA 2GZYA 4K7IA 1F3BA 4I97A 5KEJA 2C0FA 1K3YA 5ENUA 4MABA 3HHVA 1Z6MA 5DALB 5C04A 1GSQA 5IQYA 2VCXA 4L8EA 2G0FA 1NW2A 3CSIA 1QFNA 1R26A 4IHUA 5JWQB 1VGLA 5HFIA 4XCSA 4GQFA 5A5KA 3GN3A 4TR1A 4GF0A 3CTGA 3ZFBA 1NSWA 1WIKA 3WT2A 3IC8A 1A0RP 3U6VA 3ERGA 2N5AA 1ERVA 1Z5YE 3W6GA 2VD0A 3HVVA 5DBQA 4JE1A 3IV4A 1U3IA 3ERFA 2B1KA 4Q5FA 4HS1A 3LWAA 1WE0A 1A0FA 2BJXA 1TU8A 5D96A 1YJ6A 2MYGA 2YJHA 3V1WA 4HEA2 4KSOA 4V2LA 2WS2A 5L71A 2HYXA 3GMFA 3HJPA 5B6MA 3WGDA 5GAPD 6GSXA 2VCQA 2K18A 8GSSA 1TOFA 3FR6A 4WKWA 5INYA 3ISOA 3TUEA 2ES7A 3F4TA 2KUCA 1K0OA 1M9AA 1TI1A 4HJ2A 3NOFA 4TXVA 3F9UA 4KCEA 4MPGA 1UA5A 4NHZA 1EZKA 4CHSA 3GTUA 3QFBC 3A2WA 3BCIA 1QK8A 5CRHA 2XC2A 1M0UA 1NHOA 2GQMA 5AISA 2ZCTA 1GSUA 4Z7XA 1JZWA 3I9V2 1PGTA 3TOUA 5CAXA 4PQ1A 1RK4A 1Z7PA 4F03A 5B6NA 1XPVA 1BJXA 2E7PA 2FNOA 3UVHA 5F0GA 1XFLA 4PX1A 2WFCA 4EXJA 1B4QA 3A2VA 1XWAA 2VCTA 3IHQA 1FB6A 3TRPA 2FA8A 3G7IA 4WF4A 2C3QA 3EE2A 4IJ3A 4KAEA 4XTSA 5GZZB 2B5YA 3D5JA 4EL1A 2RUEA 4BVYB 4I2TA 4E8HA 3W8SA 2FUG2 2DIZA 4HJMA 3QAVA 2PVQA 1GTIA 3RBTA 4PUFC 2WB9A 5DCHA 4GSNA 1T00A 5B8BA 2HSMA 5ECKB 1VF1A 1J0FA 5IMAA 2DMMA 2H01A 3RPPA 3KTLA 3LGCA 4YAPA 1NM3A 2XHFA 3GIXA 2CX3A 2YWMA 2CA8A 3UMAA 3D6IA 4ZXGA 2F9SA 2CVKA 2H6YA 2YOIA 3ZRDA 3IRAA 1VF3A 4ECBA 2L4CA 3BCKA 2ALBA 5ABRA 2XBIA 1GUKA 2H76A 1XWGA 1ZZYA 3A2XA 2F8FA 1J9BA 3ZZXA 4ML1A 2UZ8A 4G10A 4EC0A 2TRXA 3GH6A 1X9MB 1ZGNA 4GCIA 1MD4A 4ILFA 5DAKA 4XS6A 3ZVJD 2KP2A 2C80A 4OFTA 4K9ZA 4AF2A 4V1Ap 1YY7A 4KX4A 5F8BA 4ACSA 4AJ8A 2VM2A 3W8JA 2HRAA 1GUMA 4POLA 5JWOB 1AAZA 5KN3A 1TRUA 3CMIA 10GSA 2NPBA 2JZTA 3KP9A 4K8MA 2FD3A 2DJ1A 4ZIJA 3D22A 3G7YA 3GKMA 5D9TA 2TIRA 4F82A 4EE0A 3KIJA 2IL3A 4HZ2A 2LJKA 3EC3A 1UVZA 3DYRA 2VLUA 1RQMA 3JCML 2A2RA 1SKRB 4MZWA 1K0CA 5F07A 5ECRB 1URMA 2O85A 4EO3A 3KH7A 1W4VA 4LMVA 2IMFA 3QCPA 1TKDB 2AJQB 2VIMA 3TKSC 1I9DA 3KEBA 1SK2A 2H72A 2GVPA 3ZLPA 2AUVA 4KF9A 4JEDA 4GSSA 3MSZA 3HZ4A 2CT6A 3C7MA 3HYPA 3Q6OA 1EGRA 4I5QA 4EVMA 4IS0A 5E59A 3C1RA 4G0KA 3M9KA 2HZEA 2M72A 3FRCA 4LL1B 4K2DA 4N10A 1XWKA 3EMXA 1PL2A 2O87A 4K1FA 2HXKA 3CRTA 1UC7A 4BA7A 4MH2A 5D73A 4QL7A 1JZOA 1V9WA 3DWVA 4GRFA 2HNLA 2JZRA 4BL7A 5FHIA 4Q5RA 4JU5A 1CQHA 1SENA 4ULXA 3S9FA 1O85A 2YPMA 5HFGA 4KH7A 1WJKA 3TKRA 2H74A 1XWBA 1N2AA 4RQRA 1G6WA 3QAGA 1HD2A 3I43A 2B5XA 1JLVA 1G6YA 2A2SA 2G2QA 5BMUA 1EP8A 4RQXA 4CW9A 2R4VA 3P2AA 3LEFA 1SK1A 2CVBA 3LJRA 4EF0A 1UN2A 4LMWA 5DALA 3RDWA 4XS4B 1TRSA 3UL3A 3F4RA 4NHWA 3WGXA 3FR3A 1OVNA 3TKPA 5D9WA 4O7HA 1WRYA 1CQGA 5H5QA 1ON4A 3PR8A 16GSA 2B5EA 5EVOA 1SYXA 4ML6A 4V2NA 1DBYA 2I3YA 2VL2C 2L5OA 5IO2A 3VURA 5G1LA 1KNGA 4K7NA 3VWVA 4USSA 2GTUA 2C1YA 2IJYA 1XIYA 3M9JA 1AC1A 4LA1A 1XW6A 11GSA 4FYUA 1OC3A 3GV1A 2F3MA 2L6DA 3J7Yk 3F6DA 2REMA 2YWNA 2H70A 1SJIA 3A3TA 2HQTA 2IWTA 1PD21 4KDXA 2YWOA 2JADA 4DSSA 3ZIJA 3IA1A 2DLXA 4WETA 1GSFA 2CAQA 2VLVA 4G19A 1TP9A 1WWJA 1FAAA 3L9UA 3CSJA 3CTFA 4PXOA 3L78A 3VWUA 4Q5NA 1J08A 3E0UA 4OD7A 4KB3A 4PUAA 2KLXA 2MBSA 2HI7A 2ZUPA 1MTCA 1K0DA 2HFDA 3DEXA 3KCMA 3TJBA 3F4SA 3FZ5A 1OKTA 4KUNA 2GSTA 2DBCA 5J5NA 1OC9B 4MPFA 3EURA 2QC7A 1KBNA 2FWEA 4ZL9A 2PMTA 5HFKA 5B7CA 1EOGA 4N11A 2B6MA 1EOHA 2GT6A 3QR6A 3GFKA 3AY8A 2C3NA 4I6XA 4POBA 3UEMA 5IIZA 1O73A 5G1KA 3TDGA 4O32A 1V58A 3O76A 2VCZA 1O81A 3HD5A 4TR4A 4MJAA 4TRXA 1VF4A 4MK3A 5H5RA 2HRNA 4MA9A 3QD9A 2MZCA 3FK8A 5D9VA 3APOA 1PQNA 5D8IA 2DIYA 1S3CA 2R2JA 1MDIA 2CZ3A 1YQ1A 3Q19A 1X5CA 2E2MA 2YCDA 3F0IA 4BVYA 3KTBA 4QQ7A 1BX9A 4BVXB 3FZAA 3QDNA 1XW9A 2OACA 5ELGA 2VO4A 1S3AA 1ACVA 4MMMA 1FB0A 4Q5QA 1YEPA 2ON5A 3ZL5A 1WMJA 3P7XA 2PBJA 3NZNA 5IMZA 2WGRA 5IPHA 4OMVA 3GKKA 1O8XA 2X64A 4JZQA 1R5AA 4ZB8A 3DIEA 3KZQA 4JRRA 2LQQA 2PN8A 4PTSA 1PKZA 2P0GA 3VPTA 2L4QA 4TXOB 5F05A 3HXSA 2YZUA 2VAFA 5FT3A 1U6TA 3UBKA 4L5OA 3BD2A 4DSRA 4G0LA 5IOXA 3ZMLA 3IOSA 5AGYA 3KJYA 2R37A 4L0WA 1Z7RA 4IN0A 1BAYA 2HT9A 2B7JA 2B7KA 5DJLA 4EUYA 4H86A 1SL0B 3EINA 1TJDA 4HDEA 2RIIA 4ZB9A 2H6ZA 4ECIA 2GLRA 5KN2A 3TOTA 1SJZA 3IE3A 2JSYA 5AN1A 3ME7A 1T4YA 2ZNMA 4MF6A 1HQOA 3LQ7A 1X5DA 1B48A 2L57A 4V1Ag 4OFMA 2H0IA 2KOKA 12GSA 2HRKB 3O6TA 2CV4A 2TRCP 5ID2B 1NHYA 2FHEA 4FH8A 4GWRA 1KEBA 2AB6A 2VCVA 1ERTA 4F9ZA 4AJ7A 2VD1A 2GSSA 3LORA 5IMCA 2DJJA 1JLWA 4MF7A 1XXUA 1YF0A 2N5FA 2K9FA 4NAXA 2H1AA 4HQSA 5COHA 4IP6A 1GULA 1X5EA 2FWHA 1DSBA 2FGXA 5GSSA 4EKZA 3KD0A 3APQA 2FLSA 5JCUA 2CX4A 2F8AA 3M3MA 2H71A 4HQZA 1U88A 4XIHA 5CREA 2EIQA 1V2AA 3GL5A 5J3RA 3EWLA 3E3EA 3C1SA 5LD0A 3F3RA 4MCUA 3O3TA 1WPIA 4XHMA 4RI7A 1THXA 2P5QA 2JACA 1DE2A 5F06A 3H79A 1K3LA 3EU4A 1V40A 2DMLA 1XCCA 1H75A 2GDRA 1EEJA 2NVLA 4KSMA 5HR3A 1GTAA 1TXXA 4XS4A 1EP7A 1E6BA 2V1MA 2LEGA 2BMXA 4POKA 2IFQB 1A2JA 4FYCA 5DQSA 2GQLA 9GSSA 2HRFA 1TDIA 6GSWA 2P5RA 3UVTA 1M2AA 3VI7A 2R3XA 2VUPA 4MJEA 4L5LA 4KA0A 3MAKA 1SU9A 3IR4A 5DCGA 4XRDA 3KH9A 1R5PA 6GSSA 3BJ5A 3EMPA 1GH2A 3LSZA 2QGVA 1WP0A 4N0ZA 1GTUA 2OE1A 4IJIA 4PQIA 1X0RA 3M0FA 3H93A 4KDYA 1SYRA 4JR4A 1IYHA 3GX8A 4D73B 1A24A 2O7KA 4P3YB 2L59A 5CNWA 1TW9A 4OO5A 3SBCA 4EDZA 2C0EA 2NTOA 1AW9A 3LXZA 3GTUB 2PUKC 1LJRA 3IC4A 3C8EA 1K0AA 4G9HA 2JU5A 19GSA 2CAIA 4ECCA 2K8SA 4IW9A 3KGKA 4WR5A 3MDKA 1OC9A 2H0GA 2IPAA 2CQ9A 1SD8A 2XPDA 1QGVA 3ZREA 4FQUA 1W89A 3IAS2 2AYTA 1VRSD 1YZXA 4TN8A 4K0NA 3ED3A 4MDCA 3KXOA 2V6OA 5KN0A 1PX7A 4TW5A 5ECNB 2H1GA 1A8YA 4IBPA 5ECMB 4ZL7A 3E9JB 2X8CA 2GT5A 2ON7A 3DRNA 20GSA 2PGTA 5AIVA 4ISDA 3SWLA 4EDYA 5A4VA 1Q98A 4NV2A 2XPEA 2HSMB 2OBKA 6GSUA 4KGIA 3DGQA 4N30A 3PH9A 4GLTA 1N8JA 1HNAA 4RI6A 3R3EA 4QL9A 2MMAA 2H0HA 4MLYA 1M2BA 1Y6EA 2MMZA 3RHCA 4BVXA 2YV9A 3RHBA 4BWSA 3M8NA 3APSA 4TOPA 2IIYA 3UARA 3PINA 3KP8A 3L9SA 1TI3A 5IOWA 4YAVA 2WDUA 6GSVA 4HI7A 2AV4A 2HZFA 4PNFA 5EY6A 4HUAA 4X1UA 4F2IA 1GSYA 2BTOT 2GS3A 4MP4A 5ECLB 2IMDA 1YF1A 4IGJA 13GSA 2YJ7A 4PQHA 2YWIA 1B4PA 4POMA 3WYWA 5HR2A 2EC4A 3FY7A 4J2FA 2H6XA 2L5LA 1ILOA 2I9HA 2AAWA 4IP1A 1EGOA 2H1DA 3N9JA 1V98A 1V57A 1PX6A 1SJ6A 4TXOA 2FWFA 4O92A 2E2GA 1FVKA 4BWQA 3WGEA 2IMKA 2PERA 2M80A 4F0BA 1THOA 2VCWA 3DVWA 1T8EB 2C3TA 3F63A 1G0TA 2VLTA 1EWXA 4X43A 1AQXA 3FZ4A 1K0BA 2O8VB 4HZ4A 4MF5A 1FVJA 1QMVA 1F2EA 5CP1A 1ZL9A 3Q74A 5EPFA 4WF5A 3Q18A 5CO3A 2K6VA 1HNBA 1XVQA 1ZYEA 4IQAA 1FG4A 3P90A 4IELA 1K0MA 3TJJA 3FKFA 1JZRA 1AQWA 4XRAA 2YZHA 5HR0A 3D4MA 5ELAA 3H4KA 3M1GA 1LBKA 1SKSB 2HRKA 2H1BA 3GL3A 5ID2A 1BYEA 1PL1A 5LCZA 4IQ1A 1SL1B 3UJ1A 3UAPA 2H8LA 1BG5A 1Z9HA 1K0NA 1TRWA 2LJRA 2C8UA 1C72A 3HJOA 5DDLA 4E8EA 4MZBA 3F8UA 2DSAA 3ME8A 2YN1A 4BL7B 3D0ZA 2GGTA 2LJAA 1ERUA 2YP6A 3US3A 2C0DA 3QMXA 1TK8B 1EV4A 3F3QA 4DEJA 1YKAA 1EEMA 3FEUA 1A2MA 2PVOC 3GSSA 1GL8A 1B9YC 5G5EA 3DVXA 4TR0A 2X99A 2LKUA 2PPTA 3EVIA 2CZ2A 1MDJA 1GNEA 5G5FA 2OADA 3ERWA 2HLSA 3GYKA 2LSTA 1ZYQB 1Z6NA 4ZILA 4NWYA 2C0GA 1OAZA 3QFAC 4GTUA 4YQUA 1QQ2A 4F0CA 1Q4JA 1A2LA 4ZB6A 3FW2A 3P8WA 4IKHA 2R5GA 2WRTA 3HVSA 3TGZA 3LYPA 3L4NA 4PGTA 2M46A 1O7UA 4OWYA 3GURA 2YNXA 1O8WA 1XOAA 2EIRA 1H4OA 3HY2A 1QUWA 3I69A 2IFQA 3EYTA 5DQYA 2E0QA 1PRXA 4TR3A 5JCGA 2FCHA 4GQCA 3CRUA 3RAZA 5D9XA 5D93A 3DMLA 2VL3A 2V2GA 2R6KA 2DJKA 3A5WA 2NDOA 1GTBA 2GQKA 3TKSA 1GSEA 4DSSB 5ECPB 1GSSA 2RLIA 5CRDA 2YV7A 3IK9A 17GSA 4NMUA 2WCIA 1T7PB 1ZCPA 4OCFA
chains in the Genus database with same CATH superfamily
4FIWA 4N0VA 3DXBA 1SD9A 2P31A 5J9BA 2V6KA 1RW1A 2I4AA 4OCEA 1MEKA 3HZ8A 1SL2B 2H1LA 2LQOA 2YANA 4D73A 1KTEA 3GH9A 1S3DA 3UOMA 2OBIA 5HR1A 3EU3A 1U3AA 1OC8A 1M2DA 3IK7A 4I8BA 1ML6A 1F3AA 1XZOA 3TJGA 2DJ2A 1JZDA 1AQVA 2VKZG 3GA4A 2JSZA 2IMIA 4J57E 1T3BA 2O89A 4GSTA 2N5BA 3IBHA 3TB2A 3BBYA 1OYJA 4MH3A 3TRXA 1USBA 1OE7A 5CRWA 3VFIA 4IVFA 2HE3A 2LTKA 1PSQA 6GSYA 3FR9A 1Y1UA 4QMKA 5C00A 3N5OA 3TCOA 2B1LA 2UV8G 1K3OA 3CBUA 1GNWA 1ABAA 1M9BA 2LRTA 1G7OA 5AIXA 2LRNA 1TK0B 2VM1A 5GAND 1VF2A 4HU9A 1FOHA 4HSCX 3FHKA 5ECQB 1S3RA 2LNSA 2FWGA 2HSNB 4G2EA 2D2ZA 2PWJA 3K8NA 1ZYPA 2OE0A 3KM6A 1FHEA 1PFOA 1M99A 1HNCA 3C71A 3LXTA 2RM6A 2J9HA 1R4WA 3BOAA 4ECJA 3LYKA 4PURA 2OKAA 1F37A 2VL2A 3F6FA 4NV5A 3GRXA 4TR1B 2HSHA 2I81A 3H1NA 1OE8A 3D21A 2LRCA 2MMNA 1JFUA 3HCZA 1E2YA 3L0HA 1PMTA 2A4VA 3ZVJA 5CRGA 4LL4B 1TTZA 4G0IA 3UBLA 4J56E 1YKCA 3I6AA 4JBBA 4KDUA 2NBSA 3GHAA 3IDVA 1MDKA 5IMVA 1Z3EA 1AIUA 5IMFA 2L6CA 1DUGA 4YQVA 5DVBA 5A5HB 4ZBAA 1AUCA 5IMDA 3LG6A 2XBQA 4JR6A 3QOUA 4ZBBA 1JHBA 2DJ0A 4WR4A 2KP1A 4YKGA 4DVCA 5IO0A 3ZIVA 2CVDA 3KMNA 3HJMA 1I5GA 2IMEA 4XS1A 2WW2A 2MMOA 4BIKA 2QKEA 3G9BA 2VOCA 3GSTA 4ZBDA 2RM5A 2H75A 5J41A 4WEYA 2DC5A 1R7HA 4FO5A 1PA3A 3D4TA 1FO5A 3UIWA 3DD3A 4TKYA 4WXTA 5IM9A 4PNGA 2FY6A 4YKFA 3ZMKA 3GKNA 3IHGA 3GX0A 4ID0A 3GUSA 3FZ9A 3QPMA 2RUFA 3TJFA 3OR5A 3CHXC 3PGTA 4CDOA 4O5RA 1T1VA 1PKWA 5FWGA 3VPQA 1T4ZA 4FXYP 2B3SA 5BRTA 4K7OA 4L0UA 5J9CA 1Y25A 1FOVA 2IN3A 5G2ZA 1TRVA 4WBRD 4AJ6A 1ZMAA 5ECSA 1ERWA 2GZZA 2AHEA 4AKGA 2OJLA 3FYGA 2JL4A 6GSTA 1O6JA 3CWGA 2KHPA 1GRXA 1GLQA 5ECIB 1EV9A 3CSHA 7GSSA 2EIOA 3HA9A 2LV3A 1FW1A 3H8QA 3ZFLA 3HKRA 3VLNA 4MZCA 2WZ9A 2C4JA 2WVZA 22GSA 1AXDA 1BEDA 3MNGA 5JCWA 3WT1A 5A4UA 4FYBA 2K8VA 2Z9SA 2JZSA 1YDKA 1F9MA 3CXGA 3GNJA 5LNKe 5G31A 2X8HA 4OO4A 1ZOFA 4YQMA 1XBSA 3WD6A 4X0XA 4I2UA 5G30A 2OE3A 4YH2A 2QSIA 1QXHA 4TVEA 2H30A 4DSQA 4CY6A 4LLRA 1GUHA 3U5RE 4RUVA 3MWHA 4HU7A 3KMOA 4MNNA 1DE1A 5J4UA 1GSDA 4V2MA 5DAKB 1GP1A 4K6XA 3TKSE 2DKHA 1GWCA 2WJUA 1YEXA 5HQPA 1ST9A 2OA7A 18GSA 1WOUA 4MJCA 5A4WA 3L9VA 1B8XA 4GXZA 3VI5A 3IXRA 4PHZC 2V32A 2DJ3A 4KE3A 3TKQA 1MD3A 1PN9A 1XWCA 2F51A 3R2QA 1G7EA 1XVWA 14GSA 1GLPA 5KOWA 2H19A 3VWXA 3IAM2 3ZITA 4CY8A 2LS5A 2GZPA 1X9WB 4G01A 5GSTA 1SKWB 5IPGA 5ECHB 4ZL8A 4AGSA 2GSRA 2LNTA 4WBJA 3HDCA 3PPUA 2H73A 1LU4A 4MJBA 2PU9C 4KW6A 4ICYA 4KCAA 4OFNA 3ZYWA 5DJMA 1XW5A 2I1UA 2HSYA 2VL9A 4HOJA 3TJKA 3HVXA 2WULA 2J23A 5H5SA 3GKXA 2HZEB 3LFLA 2X8GA 1F6MC 1A23A 3DKSA 2O5VA 4AI6A 5ECOB 3VWWA 5J47A 4K0GA 4NXIA 5B8AA 4KNDA 3TRQA 1IYIA 3VK9A 3G7JA 1HYUA 1B9XC 5JWRB 1SK0A 2FA4A 3RPNA 1TK5B 1M7TA 3ZTLA 1X9SB 5CYYA 4BPYA 2R0CA 2GSQA 3J7Yb 5KN1A 1U87A 5EL8A 2LUSA 1SVOA 1A8LA 2V41A 1TU7A 3QAWA 3CYNA 4NPBA 3C73A 2H66A 1BQ7A 3NIVA 2MBTA 1OKDA 3IPZA 5E4WA 1XOBA 2GZYA 4K7IA 1F3BA 4I97A 5KEJA 2C0FA 1K3YA 5ENUA 4MABA 3HHVA 5J4YA 1Z6MA 5DALB 5C04A 1GSQA 2HSNA 5IQYA 2VCXA 4L8EA 2G0FA 1NW2A 3CSIA 1ZYNA 1QFNA 1R26A 4IHUA 5JWQB 1VGLA 5HFIA 4XCSA 4GQFA 5A5KA 3GN3A 4TR1A 4GF0A 3CTGA 3ZFBA 1NSWA 1WIKA 3WT2A 3IC8A 3HVNA 1A0RP 3U6VA 3ERGA 2N5AA 1ERVA 1Z5YE 3W6GA 2VD0A 3HVVA 5DBQA 4JE1A 3IV4A 1U3IA 3ERFA 2B1KA 4Q5FA 1S4BP 4HS1A 3LWAA 3RFRC 1WE0A 1A0FA 2BJXA 1TU8A 5D96A 1YJ6A 2MYGA 5A5HA 2YJHA 3V1WA 4HEA2 4KSOA 4V2LA 2WS2A 5L71A 2HYXA 3GMFA 3HJPA 5B6MA 3WGDA 5GAPD 5J40A 6GSXA 2VCQA 2K18A 2WVYA 4E68A 8GSSA 1TOFA 3FR6A 4WKWA 5INYA 3ISOA 3TUEA 2ES7A 3F4TA 2KUCA 1K0OA 1M9AA 1TI1A 3CQFA 4HJ2A 4GDFA 3NOFA 4TXVA 3F9UA 4KCEA 1SVLA 4MPGA 1UA5A 4NHZA 1EZKA 4CHSA 3GTUA 3QFBC 3A2WA 3BCIA 1QK8A 5CRHA 2XC2A 1M0UA 1NHOA 2GQMA 5AISA 2ZCTA 1GSUA 4Z7XA 1JZWA 3I9V2 1PGTA 3TOUA 5CAXA 4PQ1A 1RK4A 1Z7PA 4AKIA 4F03A 5B6NA 1XPVA 1BJXA 2E7PA 2FNOA 3UVHA 5F0GA 1XFLA 4PX1A 2WFCA 4EXJA 1B4QA 3A2VA 1XWAA 2VCTA 3IHQA 1FB6A 3TRPA 2FA8A 3G7IA 4WF4A 2C3QA 3EE2A 4IJ3A 2X49A 4KAEA 4XTSA 5GZZB 2B5YA 3D5JA 4EL1A 2RUEA 4BVYB 4I2TA 4E8HA 3W8SA 2FUG2 2DIZA 4HJMA 3QAVA 2PVQA 1GTIA 3RBTA 4PUFC 2WB9A 5DCHA 4GSNA 1T00A 5B8BA 2HSMA 5ECKB 1VF1A 1J0FA 5IMAA 2DMMA 2H01A 3RPPA 5A1NB 3KTLA 3LGCA 4YAPA 2WW0A 1NM3A 2XHFA 3GIXA 2CX3A 2YWMA 2CA8A 3UMAA 3D6IA 4ZXGA 2F9SA 2CVKA 2H6YA 2YOIA 1N25A 3IRAA 3ZRDA 1VF3A 4ECBA 2L4CA 3BCKA 2ALBA 5ABRA 2XBIA 1GUKA 2H76A 1XWGA 1ZZYA 3A2XA 2F8FA 1J9BA 3ZZXA 4ML1A 2UZ8A 4G10A 4EC0A 2TRXA 3GH6A 1X9MB 1ZGNA 4GCIA 2WVXA 1MD4A 4ILFA 5DAKA 4XS6A 3ZVJD 2KP2A 2C80A 4OFTA 3MIXA 4K9ZA 4AF2A 4V1Ap 1YY7A 4KX4A 5F8BA 4ACSA 4AJ8A 3RGBC 2VM2A 3W8JA 2HRAA 1GUMA 4POLA 5JWOB 1AAZA 5KN3A 1TRUA 3CMIA 10GSA 2NPBA 2JZTA 3KP9A 4K8MA 2FD3A 2DJ1A 4ZIJA 3D22A 3G7YA 3GKMA 5D9TA 2TIRA 4F82A 4EE0A 3KIJA 2IL3A 4HZ2A 2LJKA 3EC3A 1UVZA 3DYRA 2VLUA 1RQMA 3JCML 2A2RA 1SKRB 4MZWA 1K0CA 5F07A 5ECRB 1URMA 2O85A 4EO3A 3KH7A 1W4VA 4LMVA 2IMFA 3QCPA 1TKDB 2AJQB 2VIMA 3TKSC 1I9DA 3KEBA 1SK2A 2H72A 2GVPA 3ZLPA 2AUVA 4KF9A 2O36A 4JEDA 4GSSA 3MSZA 3HZ4A 2WW1A 2CT6A 3C7MA 3HYPA 3Q6OA 1EGRA 4I5QA 4EVMA 4IS0A 1BG1A 5E59A 3C1RA 4G0KA 3M9KA 2HZEA 2M72A 3FRCA 4LL1B 4K2DA 4N3ZA 1XWKA 4N10A 3EMXA 1PL2A 2O87A 4K1FA 2HXKA 2A2PA 3CRTA 1UC7A 3A5IA 4BA7A 4MH2A 2OT3A 5D73A 4QL7A 1JZOA 1V9WA 3DWVA 4GRFA 2HNLA 2JZRA 4BL7A 5FHIA 4Q5RA 4JU5A 1CQHA 1SENA 4ULXA 3S9FA 1O85A 2YPMA 5HFGA 4KH7A 1WJKA 3TKRA 2H74A 1XWBA 2O3EA 1N2AA 4RQRA 1G6WA 3QAGA 1HD2A 3I43A 2B5XA 1JLVA 1G6YA 2A2SA 2G2QA 5BMUA 1EP8A 4RQXA 4CW9A 2R4VA 3P2AA 3LEFA 1SK1A 2CVBA 3LJRA 4EF0A 1UN2A 4LMWA 5DALA 3RDWA 4XS4B 1TRSA 3UL3A 3F4RA 4NHWA 3WGXA 3FR3A 1OVNA 4X4JA 3TKPA 5D9WA 4O7HA 1WRYA 1CQGA 5H5QA 1ON4A 3PR8A 16GSA 2B5EA 5EVOA 1SYXA 4ML6A 4PI2C 4V2NA 1DBYA 2I3YA 2VL2C 2L5OA 5IO2A 3VURA 5G1LA 1KNGA 4K7NA 3VWVA 4USSA 2GTUA 2C1YA 2IJYA 1XIYA 3M9JA 1AC1A 4LA1A 1XW6A 11GSA 4FYUA 1OC3A 3GV1A 1M3JA 2F3MA 2L6DA 3J7Yk 3F6DA 2REMA 2YWNA 2H70A 1SJIA 3A3TA 2HQTA 2IWTA 1PD21 4KDXA 2YWOA 2JADA 4DSSA 3ZIJA 3IA1A 2DLXA 4WETA 1GSFA 2CAQA 2VLVA 4G19A 4PI0C 1TP9A 1WWJA 1FAAA 3L9UA 3CSJA 3CTFA 4PXOA 3L78A 3VWUA 4Q5NA 1J08A 3E0UA 4OD7A 4KB3A 4PUAA 2KLXA 2MBSA 2HI7A 4Z2RA 2ZUPA 1MTCA 1K0DA 2HFDA 3DEXA 3KCMA 3TJBA 3F4SA 3FZ5A 1OKTA 4KUNA 2GSTA 2DBCA 5J5NA 1OC9B 4MPFA 1BF5A 3EURA 2QC7A 1KBNA 2FWEA 4ZL9A 2PMTA 5HFKA 5B7CA 1EOGA 4N11A 2B6MA 1EOHA 2GT6A 3QR6A 3GFKA 3AY8A 2C3NA 4I6XA 4POBA 3UEMA 5IIZA 1O73A 5G1KA 3TDGA 4O32A 1V58A 3O76A 2VCZA 1O81A 3HD5A 4TR4A 4MJAA 4TRXA 1VF4A 4MK3A 5H5RA 2HRNA 4MA9A 3QD9A 2MZCA 3FK8A 5D9VA 3APOA 1PQNA 5D8IA 4AKXB 2DIYA 1S3CA 2R2JA 1MDIA 2CZ3A 4EIPA 5KOXA 1YQ1A 3Q19A 1X5CA 2E2MA 2YCDA 3F0IA 4BVYA 3KTBA 4QQ7A 1BX9A 1YVLA 4BVXB 3FZAA 3QDNA 1XW9A 2OACA 5A1NA 5ELGA 2VO4A 1S3AA 1ACVA 2WW3A 4ZB7A 4MMMA 1FB0A 4Q5QA 1YEPA 2ON5A 3ZL5A 1WMJA 3P7XA 3EPTA 2PBJA 3NZNA 5IMZA 2WGRA 5IPHA 4OMVA 3GKKA 1O8XA 2X64A 4JZQA 1R5AA 4ZB8A 3DIEA 3KZQA 4JRRA 1I1IP 2LQQA 2PN8A 4PTSA 1PKZA 2P0GA 3VPTA 2L4QA 4TXOB 5F05A 3HXSA 2YZUA 2VAFA 5FT3A 1U6TA 3UBKA 4L5OA 3BD2A 4DSRA 4G0LA 5IOXA 3ZMLA 3IOSA 5AGYA 3KJYA 2R37A 4L0WA 1Z7RA 4IN0A 1BAYA 2HT9A 2B7JA 2B7KA 5DJLA 4EUYA 4H86A 1SL0B 3EINA 1TJDA 4HDEA 2RIIA 4ZB9A 2H6ZA 4ECIA 2GLRA 5KN2A 3TOTA 1SJZA 3IE3A 2EFHA 2JSYA 5AN1A 3ME7A 1T4YA 2ZNMA 4MF6A 1HQOA 3LQ7A 1X5DA 1B48A 2L57A 4V1Ag 4OFMA 2H0IA 4Z2UA 2KOKA 12GSA 2HRKB 3O6TA 2CV4A 2TRCP 5ID2B 1NHYA 2FHEA 4FH8A 4GWRA 1KEBA 2AB6A 2VCVA 1ERTA 4F9ZA 4AJ7A 4A5PA 2VD1A 2GSSA 3LORA 5IMCA 2DJJA 1JLWA 4MF7A 1XXUA 1YF0A 2N5FA 2K9FA 4NAXA 2H1AA 4HQSA 5COHA 4IP6A 1GULA 1X5EA 2FWHA 1DSBA 2FGXA 4AKHA 5GSSA 4EKZA 3KD0A 3APQA 2FLSA 5JCUA 2CX4A 2F8AA 3M3MA 2H71A 4K2XA 4HQZA 4W66A 1U88A 4XIHA 5CREA 2EIQA 1V2AA 3GL5A 5J3RA 3EWLA 3E3EA 3C1SA 5LD0A 3F3RA 4MCUA 3O3TA 5A34B 1WPIA 4XHMA 4RI7A 1THXA 2P5QA 2JACA 1DE2A 5F06A 3H79A 1K3LA 3EU4A 1SVMA 1V40A 2DMLA 1XCCA 2EFDA 2GDRA 1EEJA 1H75A 2NVLA 4KSMA 5HR3A 1GTAA 1TXXA 4XS4A 1EP7A 1E6BA 2V1MA 2LEGA 2BMXA 4POKA 2IFQB 1A2JA 4FYCA 5DQSA 2GQLA 9GSSA 2HRFA 1TDIA 6GSWA 2P5RA 3UVTA 1M2AA 3VI7A 2R3XA 2VUPA 4MJEA 4L5LA 4KA0A 3MAKA 1SU9A 3IR4A 5DCGA 4XRDA 3MYDA 3KH9A 1R5PA 6GSSA 3BJ5A 3EMPA 1GH2A 3LSZA 2QGVA 1WP0A 4N0ZA 1GTUA 2R0PA 2OE1A 4IJIA 4PQIA 1X0RA 3M0FA 3H93A 4KDYA 1SYRA 4JR4A 1IYHA 3GX8A 4D73B 1A24A 2O7KA 4P3YB 2L59A 5CNWA 1TW9A 4OO5A 3SBCA 4EDZA 2C0EA 2NTOA 1AW9A 3LXZA 3GTUB 2PUKC 1LJRA 3IC4A 3C8EA 1K0AA 4G9HA 2JU5A 19GSA 2CAIA 4ECCA 2K8SA 4IW9A 3KGKA 4WR5A 3MDKA 1OC9A 2H0GA 2IPAA 2CQ9A 1SD8A 2XPDA 1QGVA 3ZREA 4FQUA 1W89A 3IAS2 2R0GA 2AYTA 1VRSD 1YZXA 4TN8A 4K0NA 3ED3A 4MDCA 3KXOA 2V6OA 5KN0A 1PX7A 4TW5A 5ECNB 2H1GA 4EIQA 1A8YA 4IBPA 5ECMB 4ZL7A 3E9JB 2X4AA 2X8CA 2GT5A 2ON7A 3DRNA 20GSA 2PGTA 5AIVA 1TXUA 4ISDA 3SWLA 4EDYA 5A4VA 1Q98A 4NV2A 2XPEA 2HSMB 2OBKA 6GSUA 4KGIA 3DGQA 4N30A 3PH9A 4GLTA 1N8JA 2EFCA 1HNAA 4RI6A 1XG8A 3R3EA 4QL9A 2MMAA 2H0HA 4MLYA 1M2BA 1Y6EA 2MMZA 3RHCA 4BVXA 2YV9A 3RHBA 4BWSA 3M8NA 3APSA 4TOPA 2IIYA 3UARA 3PINA 3KP8A 3L9SA 1TI3A 3LW9A 5IOWA 4YAVA 2WDUA 2WZSA 6GSVA 4HI7A 2WVXB 2AV4A 3HMJG 2HZFA 4PNFA 4K5SA 5EY6A 4HUAA 4X1UA 4F2IA 1GSYA 2BTOT 2GS3A 4MP4A 5ECLB 2IMDA 1YF1A 4IGJA 13GSA 2YJ7A 4PQHA 2YWIA 1B4PA 2QA1A 4POMA 3WYWA 5HR2A 2EC4A 3FY7A 4J2FA 2H6XA 2L5LA 1ILOA 4O5UA 2I9HA 2AAWA 4IP1A 1EGOA 2H1DA 3N9JA 1V98A 1V57A 1PX6A 1SJ6A 4TXOA 2FWFA 4O92A 2E2GA 1FVKA 4BWQA 3WGEA 2IMKA 2PERA 2M80A 4F0BA 1THOA 2A4HA 2VCWA 3FMWA 3DVWA 1T8EB 2C3TA 3F63A 1G0TA 2VLTA 1EWXA 4X43A 1AQXA 3FZ4A 1K0BA 2O8VB 4HZ4A 2QA2A 4MF5A 1FVJA 1QMVA 1F2EA 5CP1A 1ZL9A 3Q74A 5EPFA 4WF5A 3Q18A 5CO3A 2K6VA 1HNBA 1XVQA 1ZYEA 4IQAA 1FG4A 3P90A 4IELA 1K0MA 3TJJA 3FKFA 1JZRA 1AQWA 5J4VA 4XRAA 2YZHA 5HR0A 3D4MA 4K5RA 5ELAA 3H4KA 3M1GA 1LBKA 1SKSB 2HRKA 2H1BA 3GL3A 5ID2A 1BYEA 1PL1A 5LCZA 4IQ1A 1SL1B 3UJ1A 3UAPA 2H8LA 1BG5A 1M3IA 1Z9HA 1K0NA 1TRWA 2LJRA 2C8UA 1C72A 3HJOA 5DDLA 4E8EA 4MZBA 3F8UA 2DSAA 3ME8A 2YN1A 4BL7B 3D0ZA 2GGTA 2LJAA 1ERUA 2YP6A 4Z2TA 3US3A 2C0DA 3QMXA 1TK8B 1EV4A 3F3QA 4DEJA 1YKAA 1EEMA 2DKIA 3FEUA 5BMUB 4O5QA 1A2MA 2PVOC 3GSSA 1GL8A 1B9YC 5G5EA 3DVXA 4TR0A 3TU3B 2X99A 2LKUA 2PPTA 3EVIA 2CZ2A 1MDJA 1GNEA 5G5FA 2OADA 3ERWA 2HLSA 5A34A 3GYKA 2LSTA 1ZYQB 1Z6NA 4ZILA 4NWYA 2C0GA 1OAZA 3QFAC 4GTUA 4YQUA 1QQ2A 4F0CA 1Q4JA 1A2LA 4ZB6A 3FW2A 3P8WA 4IKHA 2R5GA 2WRTA 3HVSA 3TGZA 3LYPA 3L4NA 4PGTA 2M46A 1O7UA 4OWYA 3GURA 2YNXA 1O8WA 1XOAA 2EIRA 1H4OA 3HY2A 1QUWA 3I69A 2IFQA 3EYTA 2EFEA 5DQYA 2E0QA 1PRXA 4TR3A 5JCGA 2FCHA 4GQCA 3CRUA 3RAZA 5D9XA 5D93A 3DMLA 2VL3A 2V2GA 2R6KA 2DJKA 3A5WA 2NDOA 1GTBA 1YEWC 2GQKA 3TKSA 1GSEA 4DSSB 5ECPB 1GSSA 2RLIA 5CRDA 2YV7A 3IK9A 17GSA 4NMUA 2WCIA 1T7PB 1ZCPA 4OCFA 1PN0A
chains in the Genus database with same CATH topology
4FIWA 4N0VA 3DXBA 1SD9A 2P31A 5J9BA 2V6KA 1RW1A 2I4AA 4OCEA 1MEKA 3HZ8A 1SL2B 2H1LA 2LQOA 2YANA 4D73A 1KTEA 3GH9A 1S3DA 3UOMA 2OBIA 5HR1A 3EU3A 1U3AA 1OC8A 1M2DA 3IK7A 4I8BA 1ML6A 1F3AA 1XZOA 3TJGA 2DJ2A 1JZDA 1AQVA 2VKZG 3GA4A 2JSZA 2IMIA 4J57E 1T3BA 2O89A 4GSTA 2N5BA 3IBHA 3TB2A 3BBYA 1OYJA 4MH3A 3TRXA 1USBA 1OE7A 5CRWA 3VFIA 4IVFA 2HE3A 2LTKA 1PSQA 6GSYA 3FR9A 1Y1UA 4QMKA 5C00A 3N5OA 3TCOA 2B1LA 2UV8G 1K3OA 3CBUA 1GNWA 1ABAA 1M9BA 2LRTA 1G7OA 5AIXA 2LRNA 1TK0B 2VM1A 5GAND 1VF2A 4HU9A 1FOHA 3FHKA 5ECQB 2LNSA 2FWGA 2HSNB 4G2EA 2D2ZA 2PWJA 3K8NA 1ZYPA 2OE0A 3KM6A 1FHEA 1M99A 1HNCA 3C71A 3LXTA 2RM6A 2J9HA 1R4WA 3BOAA 4ECJA 3LYKA 4PURA 2OKAA 1F37A 2VL2A 3F6FA 4NV5A 3GRXA 4TR1B 2HSHA 2I81A 3H1NA 1OE8A 3D21A 2LRCA 2MMNA 1JFUA 3HCZA 1E2YA 3L0HA 1PMTA 2A4VA 3ZVJA 5CRGA 4LL4B 1TTZA 4G0IA 3UBLA 4J56E 1YKCA 3I6AA 4JBBA 4KDUA 2NBSA 3GHAA 3IDVA 1MDKA 5IMVA 1Z3EA 1AIUA 5IMFA 2L6CA 1DUGA 4YQVA 5DVBA 5A5HB 4ZBAA 1AUCA 5IMDA 3LG6A 2XBQA 4JR6A 3QOUA 4ZBBA 1JHBA 2DJ0A 4WR4A 2KP1A 4YKGA 4DVCA 5IO0A 3ZIVA 2CVDA 3KMNA 3HJMA 1I5GA 2IMEA 4XS1A 2MMOA 2QKEA 3G9BA 2VOCA 3GSTA 4ZBDA 2RM5A 2H75A 5J41A 4WEYA 2DC5A 1R7HA 4FO5A 1PA3A 3D4TA 1FO5A 3UIWA 3DD3A 4TKYA 4WXTA 5IM9A 4PNGA 2FY6A 4YKFA 3ZMKA 3GKNA 3IHGA 3GX0A 4ID0A 3GUSA 3FZ9A 3QPMA 2RUFA 3TJFA 3OR5A 3PGTA 4CDOA 4O5RA 1T1VA 1PKWA 5FWGA 3VPQA 1T4ZA 2B3SA 5BRTA 4K7OA 4L0UA 5J9CA 1Y25A 1FOVA 2IN3A 5G2ZA 1TRVA 4WBRD 4AJ6A 1ZMAA 5ECSA 1ERWA 2GZZA 2AHEA 4AKGA 2OJLA 3FYGA 2JL4A 6GSTA 1O6JA 3CWGA 2KHPA 1GRXA 1GLQA 5ECIB 1EV9A 3CSHA 7GSSA 2EIOA 3HA9A 2LV3A 1FW1A 3H8QA 3ZFLA 3HKRA 3VLNA 4MZCA 2WZ9A 2C4JA 22GSA 1AXDA 1BEDA 3MNGA 5JCWA 3WT1A 5A4UA 4FYBA 2K8VA 2Z9SA 2JZSA 1YDKA 1F9MA 3CXGA 3GNJA 5LNKe 5G31A 2X8HA 4OO4A 1ZOFA 4YQMA 1XBSA 3WD6A 4X0XA 4I2UA 5G30A 2OE3A 4YH2A 2QSIA 1QXHA 4TVEA 2H30A 4DSQA 4CY6A 4LLRA 1GUHA 3U5RE 4RUVA 3MWHA 4HU7A 3KMOA 4MNNA 1DE1A 5J4UA 1GSDA 4V2MA 5DAKB 1GP1A 4K6XA 3TKSE 2DKHA 1GWCA 2WJUA 1YEXA 5HQPA 1ST9A 2OA7A 18GSA 1WOUA 4MJCA 5A4WA 3L9VA 1B8XA 4GXZA 3VI5A 3IXRA 2V32A 2DJ3A 4KE3A 3TKQA 1MD3A 1PN9A 1XWCA 2F51A 3R2QA 1G7EA 1XVWA 14GSA 1GLPA 5KOWA 2H19A 3VWXA 3IAM2 3ZITA 4CY8A 2LS5A 2GZPA 1X9WB 4G01A 5GSTA 1SKWB 5IPGA 5ECHB 4ZL8A 4AGSA 2GSRA 2LNTA 4WBJA 3HDCA 3PPUA 2H73A 1LU4A 4MJBA 2PU9C 4KW6A 4ICYA 4KCAA 4OFNA 3ZYWA 5DJMA 1XW5A 2I1UA 2HSYA 2VL9A 4HOJA 3TJKA 3HVXA 2WULA 2J23A 5H5SA 3GKXA 2HZEB 3LFLA 2X8GA 1F6MC 1A23A 3DKSA 2O5VA 4AI6A 5ECOB 3VWWA 5J47A 4K0GA 4NXIA 5B8AA 4KNDA 3TRQA 1IYIA 3VK9A 3G7JA 1HYUA 1B9XC 5JWRB 1SK0A 2FA4A 3RPNA 1TK5B 1M7TA 3ZTLA 1X9SB 5CYYA 4BPYA 2R0CA 2GSQA 3J7Yb 5KN1A 1U87A 5EL8A 2LUSA 1SVOA 1A8LA 2V41A 1TU7A 3QAWA 3CYNA 4NPBA 3C73A 2H66A 1BQ7A 3NIVA 2MBTA 1OKDA 3IPZA 5E4WA 1XOBA 2GZYA 4K7IA 1F3BA 4I97A 5KEJA 2C0FA 1K3YA 5ENUA 4MABA 3HHVA 5J4YA 1Z6MA 5DALB 5C04A 1GSQA 2HSNA 5IQYA 2VCXA 4L8EA 2G0FA 1NW2A 3CSIA 1ZYNA 1QFNA 1R26A 4IHUA 5JWQB 1VGLA 5HFIA 4XCSA 4GQFA 5A5KA 3GN3A 4TR1A 4GF0A 3CTGA 3ZFBA 1NSWA 1WIKA 3WT2A 3IC8A 1A0RP 3U6VA 3ERGA 2N5AA 1ERVA 1Z5YE 3W6GA 2VD0A 3HVVA 5DBQA 4JE1A 3IV4A 1U3IA 3ERFA 2B1KA 4Q5FA 4HS1A 3LWAA 1WE0A 1A0FA 2BJXA 1TU8A 5D96A 1YJ6A 2MYGA 5A5HA 2YJHA 3V1WA 4HEA2 4KSOA 4V2LA 2WS2A 5L71A 2HYXA 3GMFA 3HJPA 5B6MA 3WGDA 5GAPD 5J40A 6GSXA 2VCQA 2K18A 4E68A 8GSSA 1TOFA 3FR6A 4WKWA 5INYA 3ISOA 3TUEA 2ES7A 3F4TA 2KUCA 1K0OA 1M9AA 1TI1A 4HJ2A 4GDFA 3NOFA 4TXVA 3F9UA 4KCEA 1SVLA 4MPGA 1UA5A 4NHZA 1EZKA 4CHSA 3GTUA 3QFBC 3A2WA 3BCIA 1QK8A 5CRHA 2XC2A 1M0UA 1NHOA 2GQMA 5AISA 2ZCTA 1GSUA 4Z7XA 1JZWA 3I9V2 1PGTA 3TOUA 5CAXA 4PQ1A 1RK4A 1Z7PA 4AKIA 4F03A 5B6NA 1XPVA 1BJXA 2E7PA 2FNOA 3UVHA 5F0GA 1XFLA 4PX1A 2WFCA 4EXJA 1B4QA 3A2VA 1XWAA 2VCTA 3IHQA 1FB6A 3TRPA 2FA8A 3G7IA 4WF4A 2C3QA 3EE2A 4IJ3A 2X49A 4KAEA 4XTSA 5GZZB 2B5YA 3D5JA 4EL1A 2RUEA 4BVYB 4I2TA 4E8HA 3W8SA 2FUG2 2DIZA 4HJMA 3QAVA 2PVQA 1GTIA 3RBTA 4PUFC 2WB9A 5DCHA 4GSNA 1T00A 5B8BA 2HSMA 5ECKB 1VF1A 1J0FA 5IMAA 2DMMA 2H01A 3RPPA 5A1NB 3KTLA 3LGCA 4YAPA 1NM3A 2XHFA 3GIXA 2CX3A 2YWMA 2CA8A 3UMAA 3D6IA 4ZXGA 2F9SA 2CVKA 2H6YA 2YOIA 1N25A 3IRAA 3ZRDA 1VF3A 4ECBA 2L4CA 3BCKA 2ALBA 5ABRA 2XBIA 1GUKA 2H76A 1XWGA 1ZZYA 3A2XA 2F8FA 1J9BA 3ZZXA 4ML1A 2UZ8A 4G10A 4EC0A 2TRXA 3GH6A 1X9MB 1ZGNA 4GCIA 1MD4A 4ILFA 5DAKA 4XS6A 3ZVJD 2KP2A 2C80A 4OFTA 3MIXA 4K9ZA 4AF2A 4V1Ap 1YY7A 4KX4A 5F8BA 4ACSA 4AJ8A 2VM2A 3W8JA 2HRAA 1GUMA 4POLA 5JWOB 1AAZA 5KN3A 1TRUA 3CMIA 10GSA 2NPBA 2JZTA 3KP9A 4K8MA 2FD3A 2DJ1A 4ZIJA 3D22A 3G7YA 3GKMA 5D9TA 2TIRA 4F82A 4EE0A 3KIJA 2IL3A 4HZ2A 2LJKA 3EC3A 1UVZA 3DYRA 2VLUA 1RQMA 3JCML 2A2RA 1SKRB 4MZWA 1K0CA 5F07A 5ECRB 1URMA 2O85A 4EO3A 3KH7A 1W4VA 4LMVA 2IMFA 3QCPA 1TKDB 2AJQB 2VIMA 3TKSC 1I9DA 3KEBA 1SK2A 2H72A 2GVPA 3ZLPA 2AUVA 4KF9A 4JEDA 4GSSA 3MSZA 3HZ4A 2CT6A 3C7MA 3HYPA 3Q6OA 1EGRA 4I5QA 4EVMA 4IS0A 1BG1A 5E59A 3C1RA 4G0KA 3M9KA 2HZEA 2M72A 3FRCA 4LL1B 4K2DA 4N3ZA 1XWKA 4N10A 3EMXA 1PL2A 2O87A 4K1FA 2HXKA 2A2PA 3CRTA 1UC7A 3A5IA 4BA7A 4MH2A 2OT3A 5D73A 4QL7A 1JZOA 1V9WA 3DWVA 4GRFA 2HNLA 2JZRA 4BL7A 5FHIA 4Q5RA 4JU5A 1CQHA 1SENA 4ULXA 3S9FA 1O85A 2YPMA 5HFGA 4KH7A 1WJKA 3TKRA 2H74A 1XWBA 1N2AA 4RQRA 1G6WA 3QAGA 1HD2A 3I43A 2B5XA 1JLVA 1G6YA 2A2SA 2G2QA 5BMUA 1EP8A 4RQXA 4CW9A 2R4VA 3P2AA 3LEFA 1SK1A 2CVBA 3LJRA 4EF0A 1UN2A 4LMWA 5DALA 3RDWA 4XS4B 1TRSA 3UL3A 3F4RA 4NHWA 3WGXA 3FR3A 1OVNA 4X4JA 3TKPA 5D9WA 4O7HA 1WRYA 1CQGA 5H5QA 1ON4A 3PR8A 16GSA 2B5EA 5EVOA 1SYXA 4ML6A 4V2NA 1DBYA 2I3YA 2VL2C 2L5OA 5IO2A 3VURA 5G1LA 1KNGA 4K7NA 3VWVA 4USSA 2GTUA 2C1YA 2IJYA 1XIYA 3M9JA 1AC1A 4LA1A 1XW6A 11GSA 4FYUA 1OC3A 3GV1A 2F3MA 2L6DA 3J7Yk 3F6DA 2REMA 2YWNA 2H70A 1SJIA 3A3TA 2HQTA 2IWTA 1PD21 4KDXA 2YWOA 2JADA 4DSSA 3ZIJA 3IA1A 2DLXA 4WETA 1GSFA 2CAQA 2VLVA 4G19A 1TP9A 1WWJA 1FAAA 3L9UA 3CSJA 3CTFA 4PXOA 3L78A 3VWUA 4Q5NA 1J08A 3E0UA 4OD7A 4KB3A 4PUAA 2KLXA 2MBSA 2HI7A 4Z2RA 2ZUPA 1MTCA 1K0DA 2HFDA 3DEXA 3KCMA 3TJBA 3F4SA 3FZ5A 1OKTA 4KUNA 2GSTA 2DBCA 5J5NA 1OC9B 4MPFA 1BF5A 3EURA 2QC7A 1KBNA 2FWEA 4ZL9A 2PMTA 5HFKA 5B7CA 1EOGA 4N11A 2B6MA 1EOHA 2GT6A 3QR6A 3GFKA 3AY8A 2C3NA 4I6XA 4POBA 3UEMA 5IIZA 1O73A 5G1KA 3TDGA 4O32A 1V58A 3O76A 2VCZA 1O81A 3HD5A 4TR4A 4MJAA 4TRXA 1VF4A 4MK3A 5H5RA 2HRNA 4MA9A 3QD9A 2MZCA 3FK8A 5D9VA 3APOA 1PQNA 5D8IA 4AKXB 2DIYA 1S3CA 2R2JA 1MDIA 2CZ3A 4EIPA 5KOXA 1YQ1A 3Q19A 1X5CA 2E2MA 2YCDA 3F0IA 4BVYA 3KTBA 4QQ7A 1BX9A 1YVLA 4BVXB 3FZAA 3QDNA 1XW9A 2OACA 5A1NA 5ELGA 2VO4A 1S3AA 1ACVA 4ZB7A 4MMMA 1FB0A 4Q5QA 1YEPA 2ON5A 3ZL5A 1WMJA 3P7XA 3EPTA 2PBJA 3NZNA 5IMZA 2WGRA 5IPHA 4OMVA 3GKKA 1O8XA 2X64A 4JZQA 1R5AA 4ZB8A 3DIEA 3KZQA 4JRRA 2LQQA 2PN8A 4PTSA 1PKZA 2P0GA 3VPTA 2L4QA 4TXOB 5F05A 3HXSA 2YZUA 2VAFA 5FT3A 1U6TA 3UBKA 4L5OA 3BD2A 4DSRA 4G0LA 5IOXA 3ZMLA 3IOSA 5AGYA 3KJYA 2R37A 4L0WA 1Z7RA 4IN0A 1BAYA 2HT9A 2B7JA 2B7KA 5DJLA 4EUYA 4H86A 1SL0B 3EINA 1TJDA 4HDEA 2RIIA 4ZB9A 2H6ZA 4ECIA 2GLRA 5KN2A 3TOTA 1SJZA 3IE3A 2EFHA 2JSYA 5AN1A 3ME7A 1T4YA 2ZNMA 4MF6A 1HQOA 3LQ7A 1X5DA 1B48A 2L57A 4V1Ag 4OFMA 2H0IA 4Z2UA 2KOKA 12GSA 2HRKB 3O6TA 2CV4A 2TRCP 5ID2B 1NHYA 2FHEA 4FH8A 4GWRA 1KEBA 2AB6A 2VCVA 1ERTA 4F9ZA 4AJ7A 4A5PA 2VD1A 2GSSA 3LORA 5IMCA 2DJJA 1JLWA 4MF7A 1XXUA 1YF0A 2N5FA 2K9FA 4NAXA 2H1AA 4HQSA 5COHA 4IP6A 1GULA 1X5EA 2FWHA 1DSBA 2FGXA 4AKHA 5GSSA 4EKZA 3KD0A 3APQA 2FLSA 5JCUA 2CX4A 2F8AA 3M3MA 2H71A 4K2XA 4HQZA 4W66A 1U88A 4XIHA 5CREA 2EIQA 1V2AA 3GL5A 5J3RA 3EWLA 3E3EA 3C1SA 5LD0A 3F3RA 4MCUA 3O3TA 5A34B 1WPIA 4XHMA 4RI7A 1THXA 2P5QA 2JACA 1DE2A 5F06A 3H79A 1K3LA 3EU4A 1SVMA 1V40A 2DMLA 1XCCA 2EFDA 2GDRA 1EEJA 1H75A 2NVLA 4KSMA 5HR3A 1GTAA 1TXXA 4XS4A 1EP7A 1E6BA 2V1MA 2LEGA 2BMXA 4POKA 2IFQB 1A2JA 4FYCA 5DQSA 2GQLA 9GSSA 2HRFA 1TDIA 6GSWA 2P5RA 3UVTA 1M2AA 3VI7A 2R3XA 2VUPA 4MJEA 4L5LA 4KA0A 3MAKA 1SU9A 3IR4A 5DCGA 4XRDA 3MYDA 3KH9A 1R5PA 6GSSA 3BJ5A 3EMPA 1GH2A 3LSZA 2QGVA 1WP0A 4N0ZA 1GTUA 2R0PA 2OE1A 4IJIA 4PQIA 1X0RA 3M0FA 3H93A 4KDYA 1SYRA 4JR4A 1IYHA 3GX8A 4D73B 1A24A 2O7KA 4P3YB 2L59A 5CNWA 1TW9A 4OO5A 3SBCA 4EDZA 2C0EA 2NTOA 1AW9A 3LXZA 3GTUB 2PUKC 1LJRA 3IC4A 3C8EA 1K0AA 4G9HA 2JU5A 19GSA 2CAIA 4ECCA 2K8SA 4IW9A 3KGKA 4WR5A 3MDKA 1OC9A 2H0GA 2IPAA 2CQ9A 1SD8A 2XPDA 1QGVA 3ZREA 4FQUA 1W89A 3IAS2 2R0GA 2AYTA 1VRSD 1YZXA 4TN8A 4K0NA 3ED3A 4MDCA 3KXOA 2V6OA 5KN0A 1PX7A 4TW5A 5ECNB 2H1GA 4EIQA 1A8YA 4IBPA 5ECMB 4ZL7A 3E9JB 2X4AA 2X8CA 2GT5A 2ON7A 3DRNA 20GSA 2PGTA 5AIVA 1TXUA 4ISDA 3SWLA 4EDYA 5A4VA 1Q98A 4NV2A 2XPEA 2HSMB 2OBKA 6GSUA 4KGIA 3DGQA 4N30A 3PH9A 4GLTA 1N8JA 2EFCA 1HNAA 4RI6A 3R3EA 4QL9A 2MMAA 2H0HA 4MLYA 1M2BA 1Y6EA 2MMZA 3RHCA 4BVXA 2YV9A 3RHBA 4BWSA 3M8NA 3APSA 4TOPA 2IIYA 3UARA 3PINA 3KP8A 3L9SA 1TI3A 3LW9A 5IOWA 4YAVA 2WDUA 6GSVA 4HI7A 2AV4A 3HMJG 2HZFA 4PNFA 4K5SA 5EY6A 4HUAA 4X1UA 4F2IA 1GSYA 2BTOT 2GS3A 4MP4A 5ECLB 2IMDA 1YF1A 4IGJA 13GSA 2YJ7A 4PQHA 2YWIA 1B4PA 2QA1A 4POMA 3WYWA 5HR2A 2EC4A 3FY7A 4J2FA 2H6XA 2L5LA 1ILOA 4O5UA 2I9HA 2AAWA 4IP1A 1EGOA 2H1DA 3N9JA 1V98A 1V57A 1PX6A 1SJ6A 4TXOA 2FWFA 4O92A 2E2GA 1FVKA 4BWQA 3WGEA 2IMKA 2PERA 2M80A 4F0BA 1THOA 2A4HA 2VCWA 3FMWA 3DVWA 1T8EB 2C3TA 3F63A 1G0TA 2VLTA 1EWXA 4X43A 1AQXA 3FZ4A 1K0BA 2O8VB 4HZ4A 2QA2A 4MF5A 1FVJA 1QMVA 1F2EA 5CP1A 1ZL9A 3Q74A 5EPFA 4WF5A 3Q18A 5CO3A 2K6VA 1HNBA 1XVQA 1ZYEA 4IQAA 1FG4A 3P90A 4IELA 1K0MA 3TJJA 3FKFA 1JZRA 1AQWA 5J4VA 4XRAA 2YZHA 5HR0A 3D4MA 4K5RA 5ELAA 3H4KA 3M1GA 1LBKA 1SKSB 2HRKA 2H1BA 3GL3A 5ID2A 1BYEA 1PL1A 5LCZA 4IQ1A 1SL1B 3UJ1A 3UAPA 2H8LA 1BG5A 1Z9HA 1K0NA 1TRWA 2LJRA 2C8UA 1C72A 3HJOA 5DDLA 4E8EA 4MZBA 3F8UA 2DSAA 3ME8A 2YN1A 4BL7B 3D0ZA 2GGTA 2LJAA 1ERUA 2YP6A 4Z2TA 3US3A 2C0DA 3QMXA 1TK8B 1EV4A 3F3QA 4DEJA 1YKAA 1EEMA 2DKIA 3FEUA 5BMUB 4O5QA 1A2MA 2PVOC 3GSSA 1GL8A 1B9YC 5G5EA 3DVXA 4TR0A 3TU3B 2X99A 2LKUA 2PPTA 3EVIA 2CZ2A 1MDJA 1GNEA 5G5FA 2OADA 3ERWA 2HLSA 5A34A 3GYKA 2LSTA 1ZYQB 1Z6NA 4ZILA 4NWYA 2C0GA 1OAZA 3QFAC 4GTUA 4YQUA 1QQ2A 4F0CA 1Q4JA 1A2LA 4ZB6A 3FW2A 3P8WA 4IKHA 2R5GA 2WRTA 3HVSA 3TGZA 3LYPA 3L4NA 4PGTA 2M46A 1O7UA 4OWYA 3GURA 2YNXA 1O8WA 1XOAA 2EIRA 1H4OA 3HY2A 1QUWA 3I69A 2IFQA 3EYTA 2EFEA 5DQYA 2E0QA 1PRXA 4TR3A 5JCGA 2FCHA 4GQCA 3CRUA 3RAZA 5D9XA 5D93A 3DMLA 2VL3A 2V2GA 2R6KA 2DJKA 3A5WA 2NDOA 1GTBA 2GQKA 3TKSA 1GSEA 4DSSB 5ECPB 1GSSA 2RLIA 5CRDA 2YV7A 3IK9A 17GSA 4NMUA 2WCIA 1T7PB 1ZCPA 4OCFA 1PN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIW A;  4N0V A;  3DXB A;  1SD9 A;  2P31 A;  5J9B A;  2V6K A;  1RW1 A;  2I4A A;  4OCE A;  1MEK A;  3HZ8 A;  1SL2 B;  2LQO A;  2YAN A;  4D73 A;  1KTE A;  3GH9 A;  1S3D A;  3UOM A;  2OBI A;  5HR1 A;  3EU3 A;  1U3A A;  1OC8 A;  1M2D A;  3IK7 A;  4I8B A;  1ML6 A;  1F3A A;  1XZO A;  3TJG A;  2DJ2 A;  1JZD A;  1AQV A;  3GA4 A;  2JSZ A;  2IMI A;  4J57 E;  1T3B A;  2O89 A;  4GST A;  2N5B A;  3IBH A;  3TB2 A;  3BBY A;  1OYJ A;  4MH3 A;  3TRX A;  1USB A;  1OE7 A;  5CRW A;  3VFI A;  4IVF A;  2HE3 A;  2LTK A;  1PSQ A;  6GSY A;  3FR9 A;  5C00 A;  3N5O A;  3TCO A;  2B1L A;  1K3O A;  3CBU A;  1GNW A;  1ABA A;  1M9B A;  2LRT A;  1G7O A;  5AIX A;  2LRN A;  1TK0 B;  2VM1 A;  5GAN D;  1VF2 A;  4HU9 A;  3FHK A;  5ECQ B;  2LNS A;  2FWG A;  2HSN B;  4G2E A;  2D2Z A;  2PWJ A;  3K8N A;  2OE0 A;  3KM6 A;  1FHE A;  1M99 A;  1HNC A;  3C71 A;  3LXT A;  2RM6 A;  2J9H A;  1R4W A;  3BOA A;  4ECJ A;  3LYK A;  4PUR A;  2OKA A;  1F37 A;  2VL2 A;  3F6F A;  4NV5 A;  3GRX A;  4TR1 B;  2HSH A;  2I81 A;  3H1N A;  1OE8 A;  3D21 A;  2LRC A;  2MMN A;  1JFU A;  3HCZ A;  1E2Y A;  3L0H A;  1PMT A;  2A4V A;  3ZVJ A;  5CRG A;  4LL4 B;  1TTZ A;  4G0I A;  3UBL A;  4J56 E;  1YKC A;  3I6A A;  4JBB A;  4KDU A;  2NBS A;  3GHA A;  3IDV A;  1MDK A;  5IMV A;  1Z3E A;  1AIU A;  5IMF A;  2L6C A;  1DUG A;  4YQV A;  5DVB A;  4ZBA A;  1AUC A;  5IMD A;  3LG6 A;  2XBQ A;  4JR6 A;  3QOU A;  4ZBB A;  1JHB A;  2DJ0 A;  4WR4 A;  2KP1 A;  4DVC A;  5IO0 A;  3ZIV A;  2CVD A;  3KMN A;  3HJM A;  1I5G A;  2IME A;  4XS1 A;  2MMO A;  2QKE A;  3G9B A;  2VOC A;  3GST A;  4ZBD A;  2RM5 A;  2H75 A;  5J41 A;  4WEY A;  2DC5 A;  1R7H A;  4FO5 A;  1PA3 A;  3D4T A;  1FO5 A;  3UIW A;  3DD3 A;  4TKY A;  4WXT A;  5IM9 A;  4PNG A;  2FY6 A;  3ZMK A;  3GKN A;  3GX0 A;  4ID0 A;  3GUS A;  3FZ9 A;  3QPM A;  2RUF A;  3TJF A;  3OR5 A;  3PGT A;  4CDO A;  4O5R A;  1T1V A;  1PKW A;  5FWG A;  3VPQ A;  1T4Z A;  2B3S A;  4K7O A;  4L0U A;  5J9C A;  1Y25 A;  1FOV A;  2IN3 A;  5G2Z A;  1TRV A;  4WBR D;  4AJ6 A;  1ZMA A;  5ECS A;  1ERW A;  2GZZ A;  2AHE A;  2OJL A;  3FYG A;  2JL4 A;  6GST A;  1O6J A;  2KHP A;  1GRX A;  1GLQ A;  5ECI B;  1EV9 A;  3CSH A;  7GSS A;  2EIO A;  3HA9 A;  2LV3 A;  1FW1 A;  3H8Q A;  3ZFL A;  3HKR A;  3VLN A;  4MZC A;  2WZ9 A;  2C4J A;  22GS A;  1AXD A;  1BED A;  3MNG A;  5JCW A;  3WT1 A;  5A4U A;  4FYB A;  2K8V A;  2Z9S A;  2JZS A;  1YDK A;  1F9M A;  3CXG A;  3GNJ A;  5LNK e;  5G31 A;  2X8H A;  4OO4 A;  1ZOF A;  4YQM A;  1XBS A;  3WD6 A;  4X0X A;  4I2U A;  5G30 A;  2OE3 A;  4YH2 A;  2QSI A;  1QXH A;  4TVE A;  2H30 A;  4DSQ A;  4LLR A;  1GUH A;  3U5R E;  4RUV A;  3MWH A;  4HU7 A;  3KMO A;  1DE1 A;  5J4U A;  1GSD A;  4V2M A;  5DAK B;  1GP1 A;  4K6X A;  3TKS E;  1GWC A;  2WJU A;  1YEX A;  5HQP A;  1ST9 A;  2OA7 A;  18GS A;  1WOU A;  4MJC A;  5A4W A;  3L9V A;  1B8X A;  4GXZ A;  3VI5 A;  3IXR A;  2V32 A;  2DJ3 A;  4KE3 A;  3TKQ A;  1MD3 A;  1PN9 A;  1XWC A;  2F51 A;  3R2Q A;  1G7E A;  1XVW A;  14GS A;  1GLP A;  2H19 A;  3VWX A;  3IAM 2;  3ZIT A;  2LS5 A;  2GZP A;  1X9W B;  5GST A;  1SKW B;  5IPG A;  5ECH B;  4ZL8 A;  4AGS A;  2GSR A;  2LNT A;  4WBJ A;  3HDC A;  3PPU A;  2H73 A;  1LU4 A;  4MJB A;  2PU9 C;  4KW6 A;  4KCA A;  4OFN A;  3ZYW A;  5DJM A;  1XW5 A;  2I1U A;  2HSY A;  2VL9 A;  4HOJ A;  3TJK A;  3HVX A;  2WUL A;  2J23 A;  5H5S A;  3GKX A;  2HZE B;  3LFL A;  2X8G A;  1F6M C;  1A23 A;  3DKS A;  5ECO B;  3VWW A;  4K0G A;  4NXI A;  5B8A A;  4KND A;  3TRQ A;  1IYI A;  3VK9 A;  3G7J A;  1HYU A;  1B9X C;  5JWR B;  1SK0 A;  2FA4 A;  3RPN A;  1TK5 B;  1M7T A;  3ZTL A;  1X9S B;  5CYY A;  4BPY A;  2GSQ A;  3J7Y b;  5KN1 A;  1U87 A;  5EL8 A;  2LUS A;  1A8L A;  2V41 A;  1TU7 A;  3QAW A;  3CYN A;  4NPB A;  3C73 A;  2H66 A;  1BQ7 A;  3NIV A;  2MBT A;  1OKD A;  3IPZ A;  5E4W A;  1XOB A;  2GZY A;  4K7I A;  1F3B A;  4I97 A;  5KEJ A;  2C0F A;  1K3Y A;  5ENU A;  4MAB A;  3HHV A;  1Z6M A;  5DAL B;  5C04 A;  1GSQ A;  5IQY A;  2VCX A;  4L8E A;  2G0F A;  1NW2 A;  3CSI A;  1QFN A;  1R26 A;  4IHU A;  5JWQ B;  1VGL A;  5HFI A;  4XCS A;  4GQF A;  5A5K A;  3GN3 A;  4TR1 A;  4GF0 A;  3CTG A;  3ZFB A;  1NSW A;  1WIK A;  3WT2 A;  3IC8 A;  1A0R P;  3U6V A;  3ERG A;  2N5A A;  1ERV A;  1Z5Y E;  3W6G A;  2VD0 A;  3HVV A;  5DBQ A;  4JE1 A;  3IV4 A;  1U3I A;  3ERF A;  2B1K A;  4Q5F A;  4HS1 A;  3LWA A;  1WE0 A;  1A0F A;  2BJX A;  1TU8 A;  5D96 A;  1YJ6 A;  2MYG A;  2YJH A;  3V1W A;  4HEA 2;  4KSO A;  4V2L A;  2WS2 A;  5L71 A;  2HYX A;  3GMF A;  3HJP A;  5B6M A;  3WGD A;  5GAP D;  6GSX A;  2VCQ A;  2K18 A;  8GSS A;  1TOF A;  3FR6 A;  4WKW A;  5INY A;  3ISO A;  3TUE A;  2ES7 A;  3F4T A;  2KUC A;  1K0O A;  1M9A A;  1TI1 A;  4HJ2 A;  3NOF A;  4TXV A;  3F9U A;  4KCE A;  4MPG A;  1UA5 A;  4NHZ A;  1EZK A;  4CHS A;  3GTU A;  3QFB C;  3A2W A;  3BCI A;  1QK8 A;  5CRH A;  2XC2 A;  1M0U A;  1NHO A;  2GQM A;  5AIS A;  2ZCT A;  1GSU A;  4Z7X A;  1JZW A;  3I9V 2;  1PGT A;  3TOU A;  5CAX A;  4PQ1 A;  1RK4 A;  1Z7P A;  4F03 A;  5B6N A;  1XPV A;  1BJX A;  2E7P A;  2FNO A;  3UVH A;  5F0G A;  1XFL A;  4PX1 A;  2WFC A;  4EXJ A;  1B4Q A;  3A2V A;  1XWA A;  2VCT A;  3IHQ A;  1FB6 A;  3TRP A;  2FA8 A;  3G7I A;  4WF4 A;  2C3Q A;  3EE2 A;  4IJ3 A;  4KAE A;  4XTS A;  5GZZ B;  2B5Y A;  3D5J A;  4EL1 A;  2RUE A;  4BVY B;  4I2T A;  4E8H A;  3W8S A;  2FUG 2;  2DIZ A;  4HJM A;  3QAV A;  2PVQ A;  1GTI A;  3RBT A;  4PUF C;  2WB9 A;  5DCH A;  4GSN A;  1T00 A;  5B8B A;  2HSM A;  5ECK B;  1VF1 A;  1J0F A;  5IMA A;  2DMM A;  2H01 A;  3RPP A;  3KTL A;  3LGC A;  4YAP A;  1NM3 A;  2XHF A;  3GIX A;  2CX3 A;  2YWM A;  2CA8 A;  3UMA A;  3D6I A;  4ZXG A;  2F9S A;  2CVK A;  2H6Y A;  2YOI A;  3ZRD A;  3IRA A;  1VF3 A;  4ECB A;  2L4C A;  3BCK A;  2ALB A;  5ABR A;  2XBI A;  1GUK A;  2H76 A;  1XWG A;  1ZZY A;  3A2X A;  2F8F A;  1J9B A;  3ZZX A;  4ML1 A;  2UZ8 A;  4G10 A;  4EC0 A;  2TRX A;  3GH6 A;  1X9M B;  1ZGN A;  4GCI A;  1MD4 A;  4ILF A;  5DAK A;  4XS6 A;  3ZVJ D;  2KP2 A;  2C80 A;  4OFT A;  4K9Z A;  4AF2 A;  4V1A p;  1YY7 A;  4KX4 A;  5F8B A;  4ACS A;  4AJ8 A;  2VM2 A;  3W8J A;  2HRA A;  1GUM A;  4POL A;  5JWO B;  1AAZ A;  5KN3 A;  1TRU A;  3CMI A;  10GS A;  2NPB A;  2JZT A;  3KP9 A;  4K8M A;  2FD3 A;  2DJ1 A;  4ZIJ A;  3D22 A;  3G7Y A;  3GKM A;  5D9T A;  2TIR A;  4F82 A;  4EE0 A;  3KIJ A;  2IL3 A;  4HZ2 A;  2LJK A;  3EC3 A;  1UVZ A;  3DYR A;  2VLU A;  1RQM A;  3JCM L;  2A2R A;  1SKR B;  4MZW A;  1K0C A;  5F07 A;  5ECR B;  1URM A;  2O85 A;  4EO3 A;  3KH7 A;  1W4V A;  4LMV A;  2IMF A;  3QCP A;  1TKD B;  2AJQ B;  2VIM A;  3TKS C;  1I9D A;  3KEB A;  1SK2 A;  2H72 A;  2GVP A;  3ZLP A;  2AUV A;  4KF9 A;  4JED A;  4GSS A;  3MSZ A;  3HZ4 A;  2CT6 A;  3C7M A;  3HYP A;  3Q6O A;  1EGR A;  4I5Q A;  4EVM A;  4IS0 A;  5E59 A;  3C1R A;  4G0K A;  3M9K A;  2HZE A;  2M72 A;  3FRC A;  4LL1 B;  4K2D A;  4N10 A;  1XWK A;  3EMX A;  1PL2 A;  2O87 A;  4K1F A;  2HXK A;  3CRT A;  1UC7 A;  4BA7 A;  4MH2 A;  5D73 A;  4QL7 A;  1JZO A;  1V9W A;  3DWV A;  4GRF A;  2HNL A;  2JZR A;  4BL7 A;  5FHI A;  4Q5R A;  4JU5 A;  1CQH A;  1SEN A;  4ULX A;  3S9F A;  1O85 A;  2YPM A;  5HFG A;  4KH7 A;  1WJK A;  3TKR A;  2H74 A;  1XWB A;  1N2A A;  4RQR A;  1G6W A;  3QAG A;  1HD2 A;  3I43 A;  2B5X A;  1JLV A;  1G6Y A;  2A2S A;  2G2Q A;  5BMU A;  1EP8 A;  4RQX A;  4CW9 A;  2R4V A;  3P2A A;  3LEF A;  1SK1 A;  2CVB A;  3LJR A;  4EF0 A;  1UN2 A;  4LMW A;  5DAL A;  3RDW A;  4XS4 B;  1TRS A;  3UL3 A;  3F4R A;  4NHW A;  3WGX A;  3FR3 A;  1OVN A;  3TKP A;  5D9W A;  4O7H A;  1WRY A;  1CQG A;  5H5Q A;  1ON4 A;  3PR8 A;  16GS A;  2B5E A;  5EVO A;  1SYX A;  4ML6 A;  4V2N A;  1DBY A;  2I3Y A;  2VL2 C;  2L5O A;  5IO2 A;  3VUR A;  5G1L A;  1KNG A;  4K7N A;  3VWV A;  4USS A;  2GTU A;  2C1Y A;  2IJY A;  1XIY A;  3M9J A;  1AC1 A;  4LA1 A;  1XW6 A;  11GS A;  4FYU A;  1OC3 A;  3GV1 A;  2F3M A;  2L6D A;  3J7Y k;  3F6D A;  2REM A;  2YWN A;  2H70 A;  1SJI A;  3A3T A;  2HQT A;  2IWT A;  1PD2 1;  4KDX A;  2YWO A;  2JAD A;  4DSS A;  3ZIJ A;  3IA1 A;  2DLX A;  4WET A;  1GSF A;  2CAQ A;  2VLV A;  4G19 A;  1TP9 A;  1WWJ A;  1FAA A;  3L9U A;  3CSJ A;  3CTF A;  4PXO A;  3L78 A;  3VWU A;  4Q5N A;  1J08 A;  3E0U A;  4OD7 A;  4KB3 A;  4PUA A;  2KLX A;  2MBS A;  2HI7 A;  2ZUP A;  1MTC A;  1K0D A;  2HFD A;  3DEX A;  3KCM A;  3TJB A;  3F4S A;  3FZ5 A;  1OKT A;  4KUN A;  2GST A;  2DBC A;  5J5N A;  1OC9 B;  4MPF A;  3EUR A;  2QC7 A;  1KBN A;  2FWE A;  4ZL9 A;  2PMT A;  5HFK A;  5B7C A;  1EOG A;  4N11 A;  2B6M A;  1EOH A;  2GT6 A;  3QR6 A;  3GFK A;  3AY8 A;  2C3N A;  4I6X A;  4POB A;  3UEM A;  5IIZ A;  1O73 A;  5G1K A;  3TDG A;  4O32 A;  1V58 A;  3O76 A;  2VCZ A;  1O81 A;  3HD5 A;  4TR4 A;  4MJA A;  4TRX A;  1VF4 A;  4MK3 A;  5H5R A;  2HRN A;  4MA9 A;  3QD9 A;  2MZC A;  3FK8 A;  5D9V A;  3APO A;  1PQN A;  5D8I A;  2DIY A;  1S3C A;  2R2J A;  1MDI A;  2CZ3 A;  1YQ1 A;  3Q19 A;  1X5C A;  2E2M A;  2YCD A;  3F0I A;  4BVY A;  3KTB A;  4QQ7 A;  1BX9 A;  4BVX B;  3FZA A;  3QDN A;  1XW9 A;  2OAC A;  5ELG A;  2VO4 A;  1S3A A;  1ACV A;  4MMM A;  1FB0 A;  4Q5Q A;  1YEP A;  2ON5 A;  3ZL5 A;  1WMJ A;  3P7X A;  2PBJ A;  3NZN A;  5IMZ A;  2WGR A;  5IPH A;  4OMV A;  3GKK A;  1O8X A;  2X64 A;  4JZQ A;  1R5A A;  4ZB8 A;  3DIE A;  3KZQ A;  4JRR A;  2LQQ A;  2PN8 A;  4PTS A;  1PKZ A;  2P0G A;  3VPT A;  2L4Q A;  4TXO B;  5F05 A;  3HXS A;  2YZU A;  2VAF A;  5FT3 A;  1U6T A;  3UBK A;  4L5O A;  3BD2 A;  4DSR A;  4G0L A;  5IOX A;  3ZML A;  3IOS A;  5AGY A;  3KJY A;  2R37 A;  4L0W A;  1Z7R A;  4IN0 A;  1BAY A;  2HT9 A;  2B7J A;  2B7K A;  5DJL A;  4EUY A;  4H86 A;  1SL0 B;  3EIN A;  1TJD A;  4HDE A;  2RII A;  4ZB9 A;  2H6Z A;  4ECI A;  2GLR A;  5KN2 A;  3TOT A;  1SJZ A;  3IE3 A;  2JSY A;  5AN1 A;  3ME7 A;  1T4Y A;  2ZNM A;  4MF6 A;  1HQO A;  3LQ7 A;  1X5D A;  1B48 A;  2L57 A;  4V1A g;  4OFM A;  2H0I A;  2KOK A;  12GS A;  2HRK B;  3O6T A;  2CV4 A;  2TRC P;  5ID2 B;  1NHY A;  2FHE A;  4FH8 A;  4GWR A;  1KEB A;  2AB6 A;  2VCV A;  1ERT A;  4F9Z A;  4AJ7 A;  2VD1 A;  2GSS A;  3LOR A;  5IMC A;  2DJJ A;  1JLW A;  4MF7 A;  1XXU A;  1YF0 A;  2N5F A;  2K9F A;  4NAX A;  2H1A A;  4HQS A;  5COH A;  4IP6 A;  1GUL A;  1X5E A;  2FWH A;  1DSB A;  2FGX A;  5GSS A;  4EKZ A;  3KD0 A;  3APQ A;  2FLS A;  5JCU A;  2CX4 A;  2F8A A;  3M3M A;  2H71 A;  4HQZ A;  1U88 A;  4XIH A;  5CRE A;  2EIQ A;  1V2A A;  3GL5 A;  5J3R A;  3EWL A;  3E3E A;  3C1S A;  5LD0 A;  3F3R A;  4MCU A;  3O3T A;  1WPI A;  4XHM A;  4RI7 A;  1THX A;  2P5Q A;  2JAC A;  1DE2 A;  5F06 A;  3H79 A;  1K3L A;  3EU4 A;  1V40 A;  2DML A;  1XCC A;  1H75 A;  2GDR A;  1EEJ A;  2NVL A;  4KSM A;  5HR3 A;  1GTA A;  1TXX A;  4XS4 A;  1EP7 A;  1E6B A;  2V1M A;  2LEG A;  2BMX A;  4POK A;  2IFQ B;  1A2J A;  4FYC A;  5DQS A;  2GQL A;  9GSS A;  2HRF A;  1TDI A;  6GSW A;  2P5R A;  3UVT A;  1M2A A;  3VI7 A;  2R3X A;  2VUP A;  4MJE A;  4L5L A;  4KA0 A;  3MAK A;  1SU9 A;  3IR4 A;  5DCG A;  4XRD A;  3KH9 A;  1R5P A;  6GSS A;  3BJ5 A;  3EMP A;  1GH2 A;  3LSZ A;  2QGV A;  1WP0 A;  4N0Z A;  1GTU A;  2OE1 A;  4IJI A;  4PQI A;  1X0R A;  3M0F A;  3H93 A;  4KDY A;  1SYR A;  4JR4 A;  1IYH A;  3GX8 A;  4D73 B;  1A24 A;  2O7K A;  4P3Y B;  2L59 A;  5CNW A;  1TW9 A;  4OO5 A;  3SBC A;  4EDZ A;  2C0E A;  2NTO A;  1AW9 A;  3LXZ A;  3GTU B;  2PUK C;  1LJR A;  3IC4 A;  3C8E A;  1K0A A;  4G9H A;  2JU5 A;  19GS A;  2CAI A;  4ECC A;  2K8S A;  4IW9 A;  3KGK A;  4WR5 A;  3MDK A;  1OC9 A;  2H0G A;  2IPA A;  2CQ9 A;  1SD8 A;  2XPD A;  1QGV A;  3ZRE A;  4FQU A;  1W89 A;  3IAS 2;  2AYT A;  1VRS D;  1YZX A;  4TN8 A;  4K0N A;  3ED3 A;  4MDC A;  3KXO A;  2V6O A;  5KN0 A;  1PX7 A;  4TW5 A;  5ECN B;  2H1G A;  1A8Y A;  4IBP A;  5ECM B;  4ZL7 A;  3E9J B;  2X8C A;  2GT5 A;  2ON7 A;  3DRN A;  20GS A;  2PGT A;  5AIV A;  4ISD A;  3SWL A;  4EDY A;  5A4V A;  1Q98 A;  4NV2 A;  2XPE A;  2HSM B;  2OBK A;  6GSU A;  4KGI A;  3DGQ A;  4N30 A;  3PH9 A;  4GLT A;  1N8J A;  1HNA A;  4RI6 A;  3R3E A;  4QL9 A;  2MMA A;  2H0H A;  4MLY A;  1M2B A;  1Y6E A;  2MMZ A;  3RHC A;  4BVX A;  2YV9 A;  3RHB A;  4BWS A;  3M8N A;  3APS A;  4TOP A;  2IIY A;  3UAR A;  3PIN A;  3KP8 A;  3L9S A;  1TI3 A;  5IOW A;  4YAV A;  2WDU A;  6GSV A;  4HI7 A;  2AV4 A;  2HZF A;  4PNF A;  5EY6 A;  4HUA A;  4X1U A;  4F2I A;  1GSY A;  2BTO T;  2GS3 A;  4MP4 A;  5ECL B;  2IMD A;  1YF1 A;  4IGJ A;  13GS A;  2YJ7 A;  4PQH A;  2YWI A;  1B4P A;  4POM A;  3WYW A;  5HR2 A;  2EC4 A;  3FY7 A;  4J2F A;  2H6X A;  2L5L A;  1ILO A;  2I9H A;  2AAW A;  4IP1 A;  1EGO A;  2H1D A;  3N9J A;  1V98 A;  1V57 A;  1PX6 A;  1SJ6 A;  4TXO A;  2FWF A;  4O92 A;  2E2G A;  1FVK A;  4BWQ A;  3WGE A;  2IMK A;  2PER A;  2M80 A;  4F0B A;  1THO A;  2VCW A;  3DVW A;  1T8E B;  2C3T A;  3F63 A;  1G0T A;  2VLT A;  1EWX A;  4X43 A;  1AQX A;  3FZ4 A;  1K0B A;  2O8V B;  4HZ4 A;  4MF5 A;  1FVJ A;  1QMV A;  1F2E A;  5CP1 A;  1ZL9 A;  3Q74 A;  5EPF A;  4WF5 A;  3Q18 A;  5CO3 A;  2K6V A;  1HNB A;  1XVQ A;  1ZYE A;  4IQA A;  1FG4 A;  3P90 A;  4IEL A;  1K0M A;  3TJJ A;  3FKF A;  1JZR A;  1AQW A;  4XRA A;  2YZH A;  5HR0 A;  3D4M A;  5ELA A;  3H4K A;  3M1G A;  1LBK A;  1SKS B;  2HRK A;  2H1B A;  3GL3 A;  5ID2 A;  1BYE A;  1PL1 A;  5LCZ A;  4IQ1 A;  1SL1 B;  3UJ1 A;  3UAP A;  2H8L A;  1BG5 A;  1Z9H A;  1K0N A;  1TRW A;  2LJR A;  2C8U A;  1C72 A;  3HJO A;  5DDL A;  4E8E A;  4MZB A;  3F8U A;  2DSA A;  3ME8 A;  2YN1 A;  4BL7 B;  3D0Z A;  2GGT A;  2LJA A;  1ERU A;  2YP6 A;  3US3 A;  2C0D A;  3QMX A;  1TK8 B;  1EV4 A;  3F3Q A;  4DEJ A;  1YKA A;  1EEM A;  3FEU A;  1A2M A;  2PVO C;  3GSS A;  1GL8 A;  1B9Y C;  5G5E A;  3DVX A;  4TR0 A;  2X99 A;  2LKU A;  2PPT A;  3EVI A;  2CZ2 A;  1MDJ A;  1GNE A;  5G5F A;  2OAD A;  3ERW A;  2HLS A;  3GYK A;  2LST A;  1ZYQ B;  1Z6N A;  4ZIL A;  4NWY A;  2C0G A;  1OAZ A;  3QFA C;  4GTU A;  4YQU A;  1QQ2 A;  4F0C A;  1Q4J A;  1A2L A;  4ZB6 A;  3FW2 A;  3P8W A;  4IKH A;  2R5G A;  2WRT A;  3HVS A;  3TGZ A;  3LYP A;  3L4N A;  4PGT A;  2M46 A;  1O7U A;  4OWY A;  3GUR A;  2YNX A;  1O8W A;  1XOA A;  2EIR A;  1H4O A;  3HY2 A;  1QUW A;  3I69 A;  2IFQ A;  3EYT A;  5DQY A;  2E0Q A;  1PRX A;  4TR3 A;  5JCG A;  2FCH A;  4GQC A;  3CRU A;  3RAZ A;  5D9X A;  5D93 A;  3DML A;  2VL3 A;  2V2G A;  2R6K A;  2DJK A;  3A5W A;  2NDO A;  1GTB A;  2GQK A;  3TKS A;  1GSE A;  4DSS B;  5ECP B;  1GSS A;  2RLI A;  5CRD A;  2YV7 A;  3IK9 A;  17GS A;  4NMU A;  2WCI A;  1T7P B;  1ZCP A;  4OCF A; 
#chains in the Genus database with same CATH topology
 4FIW A;  4N0V A;  3DXB A;  1SD9 A;  2P31 A;  5J9B A;  2V6K A;  1RW1 A;  2I4A A;  4OCE A;  1MEK A;  3HZ8 A;  1SL2 B;  2H1L A;  2LQO A;  2YAN A;  4D73 A;  1KTE A;  3GH9 A;  1S3D A;  3UOM A;  2OBI A;  5HR1 A;  3EU3 A;  1U3A A;  1OC8 A;  1M2D A;  3IK7 A;  4I8B A;  1ML6 A;  1F3A A;  1XZO A;  3TJG A;  2DJ2 A;  1JZD A;  1AQV A;  2VKZ G;  3GA4 A;  2JSZ A;  2IMI A;  4J57 E;  1T3B A;  2O89 A;  4GST A;  2N5B A;  3IBH A;  3TB2 A;  3BBY A;  1OYJ A;  4MH3 A;  3TRX A;  1USB A;  1OE7 A;  5CRW A;  3VFI A;  4IVF A;  2HE3 A;  2LTK A;  1PSQ A;  6GSY A;  3FR9 A;  1Y1U A;  4QMK A;  5C00 A;  3N5O A;  3TCO A;  2B1L A;  2UV8 G;  1K3O A;  3CBU A;  1GNW A;  1ABA A;  1M9B A;  2LRT A;  1G7O A;  5AIX A;  2LRN A;  1TK0 B;  2VM1 A;  5GAN D;  1VF2 A;  4HU9 A;  1FOH A;  4HSC X;  3FHK A;  5ECQ B;  1S3R A;  2LNS A;  2FWG A;  2HSN B;  4G2E A;  2D2Z A;  2PWJ A;  3K8N A;  1ZYP A;  2OE0 A;  3KM6 A;  1FHE A;  1PFO A;  1M99 A;  1HNC A;  3C71 A;  3LXT A;  2RM6 A;  2J9H A;  1R4W A;  3BOA A;  4ECJ A;  3LYK A;  4PUR A;  2OKA A;  1F37 A;  2VL2 A;  3F6F A;  4NV5 A;  3GRX A;  4TR1 B;  2HSH A;  2I81 A;  3H1N A;  1OE8 A;  3D21 A;  2LRC A;  2MMN A;  1JFU A;  3HCZ A;  1E2Y A;  3L0H A;  1PMT A;  2A4V A;  3ZVJ A;  5CRG A;  4LL4 B;  1TTZ A;  4G0I A;  3UBL A;  4J56 E;  1YKC A;  3I6A A;  4JBB A;  4KDU A;  2NBS A;  3GHA A;  3IDV A;  1MDK A;  5IMV A;  1Z3E A;  1AIU A;  5IMF A;  2L6C A;  1DUG A;  4YQV A;  5DVB A;  5A5H B;  4ZBA A;  1AUC A;  5IMD A;  3LG6 A;  2XBQ A;  4JR6 A;  3QOU A;  4ZBB A;  1JHB A;  2DJ0 A;  4WR4 A;  2KP1 A;  4YKG A;  4DVC A;  5IO0 A;  3ZIV A;  2CVD A;  3KMN A;  3HJM A;  1I5G A;  2IME A;  4XS1 A;  2WW2 A;  2MMO A;  4BIK A;  2QKE A;  3G9B A;  2VOC A;  3GST A;  4ZBD A;  2RM5 A;  2H75 A;  5J41 A;  4WEY A;  2DC5 A;  1R7H A;  4FO5 A;  1PA3 A;  3D4T A;  1FO5 A;  3UIW A;  3DD3 A;  4TKY A;  4WXT A;  5IM9 A;  4PNG A;  2FY6 A;  4YKF A;  3ZMK A;  3GKN A;  3IHG A;  3GX0 A;  4ID0 A;  3GUS A;  3FZ9 A;  3QPM A;  2RUF A;  3TJF A;  3OR5 A;  3CHX C;  3PGT A;  4CDO A;  4O5R A;  1T1V A;  1PKW A;  5FWG A;  3VPQ A;  1T4Z A;  4FXY P;  2B3S A;  5BRT A;  4K7O A;  4L0U A;  5J9C A;  1Y25 A;  1FOV A;  2IN3 A;  5G2Z A;  1TRV A;  4WBR D;  4AJ6 A;  1ZMA A;  5ECS A;  1ERW A;  2GZZ A;  2AHE A;  4AKG A;  2OJL A;  3FYG A;  2JL4 A;  6GST A;  1O6J A;  3CWG A;  2KHP A;  1GRX A;  1GLQ A;  5ECI B;  1EV9 A;  3CSH A;  7GSS A;  2EIO A;  3HA9 A;  2LV3 A;  1FW1 A;  3H8Q A;  3ZFL A;  3HKR A;  3VLN A;  4MZC A;  2WZ9 A;  2C4J A;  2WVZ A;  22GS A;  1AXD A;  1BED A;  3MNG A;  5JCW A;  3WT1 A;  5A4U A;  4FYB A;  2K8V A;  2Z9S A;  2JZS A;  1YDK A;  1F9M A;  3CXG A;  3GNJ A;  5LNK e;  5G31 A;  2X8H A;  4OO4 A;  1ZOF A;  4YQM A;  1XBS A;  3WD6 A;  4X0X A;  4I2U A;  5G30 A;  2OE3 A;  4YH2 A;  2QSI A;  1QXH A;  4TVE A;  2H30 A;  4DSQ A;  4CY6 A;  4LLR A;  1GUH A;  3U5R E;  4RUV A;  3MWH A;  4HU7 A;  3KMO A;  4MNN A;  1DE1 A;  5J4U A;  1GSD A;  4V2M A;  5DAK B;  1GP1 A;  4K6X A;  3TKS E;  2DKH A;  1GWC A;  2WJU A;  1YEX A;  5HQP A;  1ST9 A;  2OA7 A;  18GS A;  1WOU A;  4MJC A;  5A4W A;  3L9V A;  1B8X A;  4GXZ A;  3VI5 A;  3IXR A;  4PHZ C;  2V32 A;  2DJ3 A;  4KE3 A;  3TKQ A;  1MD3 A;  1PN9 A;  1XWC A;  2F51 A;  3R2Q A;  1G7E A;  1XVW A;  14GS A;  1GLP A;  5KOW A;  2H19 A;  3VWX A;  3IAM 2;  3ZIT A;  4CY8 A;  2LS5 A;  2GZP A;  1X9W B;  4G01 A;  5GST A;  1SKW B;  5IPG A;  5ECH B;  4ZL8 A;  4AGS A;  2GSR A;  2LNT A;  4WBJ A;  3HDC A;  3PPU A;  2H73 A;  1LU4 A;  4MJB A;  2PU9 C;  4KW6 A;  4ICY A;  4KCA A;  4OFN A;  3ZYW A;  5DJM A;  1XW5 A;  2I1U A;  2HSY A;  2VL9 A;  4HOJ A;  3TJK A;  3HVX A;  2WUL A;  2J23 A;  5H5S A;  3GKX A;  2HZE B;  3LFL A;  2X8G A;  1F6M C;  1A23 A;  3DKS A;  2O5V A;  4AI6 A;  5ECO B;  3VWW A;  5J47 A;  4K0G A;  4NXI A;  5B8A A;  4KND A;  3TRQ A;  1IYI A;  3VK9 A;  3G7J A;  1HYU A;  1B9X C;  5JWR B;  1SK0 A;  2FA4 A;  3RPN A;  1TK5 B;  1M7T A;  3ZTL A;  1X9S B;  5CYY A;  4BPY A;  2R0C A;  2GSQ A;  3J7Y b;  5KN1 A;  1U87 A;  5EL8 A;  2LUS A;  1SVO A;  1A8L A;  2V41 A;  1TU7 A;  3QAW A;  3CYN A;  4NPB A;  3C73 A;  2H66 A;  1BQ7 A;  3NIV A;  2MBT A;  1OKD A;  3IPZ A;  5E4W A;  1XOB A;  2GZY A;  4K7I A;  1F3B A;  4I97 A;  5KEJ A;  2C0F A;  1K3Y A;  5ENU A;  4MAB A;  3HHV A;  5J4Y A;  1Z6M A;  5DAL B;  5C04 A;  1GSQ A;  2HSN A;  5IQY A;  2VCX A;  4L8E A;  2G0F A;  1NW2 A;  3CSI A;  1ZYN A;  1QFN A;  1R26 A;  4IHU A;  5JWQ B;  1VGL A;  5HFI A;  4XCS A;  4GQF A;  5A5K A;  3GN3 A;  4TR1 A;  4GF0 A;  3CTG A;  3ZFB A;  1NSW A;  1WIK A;  3WT2 A;  3IC8 A;  3HVN A;  1A0R P;  3U6V A;  3ERG A;  2N5A A;  1ERV A;  1Z5Y E;  3W6G A;  2VD0 A;  3HVV A;  5DBQ A;  4JE1 A;  3IV4 A;  1U3I A;  3ERF A;  2B1K A;  4Q5F A;  1S4B P;  4HS1 A;  3LWA A;  3RFR C;  1WE0 A;  1A0F A;  2BJX A;  1TU8 A;  5D96 A;  1YJ6 A;  2MYG A;  5A5H A;  2YJH A;  3V1W A;  4HEA 2;  4KSO A;  4V2L A;  2WS2 A;  5L71 A;  2HYX A;  3GMF A;  3HJP A;  5B6M A;  3WGD A;  5GAP D;  5J40 A;  6GSX A;  2VCQ A;  2K18 A;  2WVY A;  4E68 A;  8GSS A;  1TOF A;  3FR6 A;  4WKW A;  5INY A;  3ISO A;  3TUE A;  2ES7 A;  3F4T A;  2KUC A;  1K0O A;  1M9A A;  1TI1 A;  3CQF A;  4HJ2 A;  4GDF A;  3NOF A;  4TXV A;  3F9U A;  4KCE A;  1SVL A;  4MPG A;  1UA5 A;  4NHZ A;  1EZK A;  4CHS A;  3GTU A;  3QFB C;  3A2W A;  3BCI A;  1QK8 A;  5CRH A;  2XC2 A;  1M0U A;  1NHO A;  2GQM A;  5AIS A;  2ZCT A;  1GSU A;  4Z7X A;  1JZW A;  3I9V 2;  1PGT A;  3TOU A;  5CAX A;  4PQ1 A;  1RK4 A;  1Z7P A;  4AKI A;  4F03 A;  5B6N A;  1XPV A;  1BJX A;  2E7P A;  2FNO A;  3UVH A;  5F0G A;  1XFL A;  4PX1 A;  2WFC A;  4EXJ A;  1B4Q A;  3A2V A;  1XWA A;  2VCT A;  3IHQ A;  1FB6 A;  3TRP A;  2FA8 A;  3G7I A;  4WF4 A;  2C3Q A;  3EE2 A;  4IJ3 A;  2X49 A;  4KAE A;  4XTS A;  5GZZ B;  2B5Y A;  3D5J A;  4EL1 A;  2RUE A;  4BVY B;  4I2T A;  4E8H A;  3W8S A;  2FUG 2;  2DIZ A;  4HJM A;  3QAV A;  2PVQ A;  1GTI A;  3RBT A;  4PUF C;  2WB9 A;  5DCH A;  4GSN A;  1T00 A;  5B8B A;  2HSM A;  5ECK B;  1VF1 A;  1J0F A;  5IMA A;  2DMM A;  2H01 A;  3RPP A;  5A1N B;  3KTL A;  3LGC A;  4YAP A;  2WW0 A;  1NM3 A;  2XHF A;  3GIX A;  2CX3 A;  2YWM A;  2CA8 A;  3UMA A;  3D6I A;  4ZXG A;  2F9S A;  2CVK A;  2H6Y A;  2YOI A;  1N25 A;  3IRA A;  3ZRD A;  1VF3 A;  4ECB A;  2L4C A;  3BCK A;  2ALB A;  5ABR A;  2XBI A;  1GUK A;  2H76 A;  1XWG A;  1ZZY A;  3A2X A;  2F8F A;  1J9B A;  3ZZX A;  4ML1 A;  2UZ8 A;  4G10 A;  4EC0 A;  2TRX A;  3GH6 A;  1X9M B;  1ZGN A;  4GCI A;  2WVX A;  1MD4 A;  4ILF A;  5DAK A;  4XS6 A;  3ZVJ D;  2KP2 A;  2C80 A;  4OFT A;  3MIX A;  4K9Z A;  4AF2 A;  4V1A p;  1YY7 A;  4KX4 A;  5F8B A;  4ACS A;  4AJ8 A;  3RGB C;  2VM2 A;  3W8J A;  2HRA A;  1GUM A;  4POL A;  5JWO B;  1AAZ A;  5KN3 A;  1TRU A;  3CMI A;  10GS A;  2NPB A;  2JZT A;  3KP9 A;  4K8M A;  2FD3 A;  2DJ1 A;  4ZIJ A;  3D22 A;  3G7Y A;  3GKM A;  5D9T A;  2TIR A;  4F82 A;  4EE0 A;  3KIJ A;  2IL3 A;  4HZ2 A;  2LJK A;  3EC3 A;  1UVZ A;  3DYR A;  2VLU A;  1RQM A;  3JCM L;  2A2R A;  1SKR B;  4MZW A;  1K0C A;  5F07 A;  5ECR B;  1URM A;  2O85 A;  4EO3 A;  3KH7 A;  1W4V A;  4LMV A;  2IMF A;  3QCP A;  1TKD B;  2AJQ B;  2VIM A;  3TKS C;  1I9D A;  3KEB A;  1SK2 A;  2H72 A;  2GVP A;  3ZLP A;  2AUV A;  4KF9 A;  2O36 A;  4JED A;  4GSS A;  3MSZ A;  3HZ4 A;  2WW1 A;  2CT6 A;  3C7M A;  3HYP A;  3Q6O A;  1EGR A;  4I5Q A;  4EVM A;  4IS0 A;  1BG1 A;  5E59 A;  3C1R A;  4G0K A;  3M9K A;  2HZE A;  2M72 A;  3FRC A;  4LL1 B;  4K2D A;  4N3Z A;  1XWK A;  4N10 A;  3EMX A;  1PL2 A;  2O87 A;  4K1F A;  2HXK A;  2A2P A;  3CRT A;  1UC7 A;  3A5I A;  4BA7 A;  4MH2 A;  2OT3 A;  5D73 A;  4QL7 A;  1JZO A;  1V9W A;  3DWV A;  4GRF A;  2HNL A;  2JZR A;  4BL7 A;  5FHI A;  4Q5R A;  4JU5 A;  1CQH A;  1SEN A;  4ULX A;  3S9F A;  1O85 A;  2YPM A;  5HFG A;  4KH7 A;  1WJK A;  3TKR A;  2H74 A;  1XWB A;  2O3E A;  1N2A A;  4RQR A;  1G6W A;  3QAG A;  1HD2 A;  3I43 A;  2B5X A;  1JLV A;  1G6Y A;  2A2S A;  2G2Q A;  5BMU A;  1EP8 A;  4RQX A;  4CW9 A;  2R4V A;  3P2A A;  3LEF A;  1SK1 A;  2CVB A;  3LJR A;  4EF0 A;  1UN2 A;  4LMW A;  5DAL A;  3RDW A;  4XS4 B;  1TRS A;  3UL3 A;  3F4R A;  4NHW A;  3WGX A;  3FR3 A;  1OVN A;  4X4J A;  3TKP A;  5D9W A;  4O7H A;  1WRY A;  1CQG A;  5H5Q A;  1ON4 A;  3PR8 A;  16GS A;  2B5E A;  5EVO A;  1SYX A;  4ML6 A;  4PI2 C;  4V2N A;  1DBY A;  2I3Y A;  2VL2 C;  2L5O A;  5IO2 A;  3VUR A;  5G1L A;  1KNG A;  4K7N A;  3VWV A;  4USS A;  2GTU A;  2C1Y A;  2IJY A;  1XIY A;  3M9J A;  1AC1 A;  4LA1 A;  1XW6 A;  11GS A;  4FYU A;  1OC3 A;  3GV1 A;  1M3J A;  2F3M A;  2L6D A;  3J7Y k;  3F6D A;  2REM A;  2YWN A;  2H70 A;  1SJI A;  3A3T A;  2HQT A;  2IWT A;  1PD2 1;  4KDX A;  2YWO A;  2JAD A;  4DSS A;  3ZIJ A;  3IA1 A;  2DLX A;  4WET A;  1GSF A;  2CAQ A;  2VLV A;  4G19 A;  4PI0 C;  1TP9 A;  1WWJ A;  1FAA A;  3L9U A;  3CSJ A;  3CTF A;  4PXO A;  3L78 A;  3VWU A;  4Q5N A;  1J08 A;  3E0U A;  4OD7 A;  4KB3 A;  4PUA A;  2KLX A;  2MBS A;  2HI7 A;  4Z2R A;  2ZUP A;  1MTC A;  1K0D A;  2HFD A;  3DEX A;  3KCM A;  3TJB A;  3F4S A;  3FZ5 A;  1OKT A;  4KUN A;  2GST A;  2DBC A;  5J5N A;  1OC9 B;  4MPF A;  1BF5 A;  3EUR A;  2QC7 A;  1KBN A;  2FWE A;  4ZL9 A;  2PMT A;  5HFK A;  5B7C A;  1EOG A;  4N11 A;  2B6M A;  1EOH A;  2GT6 A;  3QR6 A;  3GFK A;  3AY8 A;  2C3N A;  4I6X A;  4POB A;  3UEM A;  5IIZ A;  1O73 A;  5G1K A;  3TDG A;  4O32 A;  1V58 A;  3O76 A;  2VCZ A;  1O81 A;  3HD5 A;  4TR4 A;  4MJA A;  4TRX A;  1VF4 A;  4MK3 A;  5H5R A;  2HRN A;  4MA9 A;  3QD9 A;  2MZC A;  3FK8 A;  5D9V A;  3APO A;  1PQN A;  5D8I A;  4AKX B;  2DIY A;  1S3C A;  2R2J A;  1MDI A;  2CZ3 A;  4EIP A;  5KOX A;  1YQ1 A;  3Q19 A;  1X5C A;  2E2M A;  2YCD A;  3F0I A;  4BVY A;  3KTB A;  4QQ7 A;  1BX9 A;  1YVL A;  4BVX B;  3FZA A;  3QDN A;  1XW9 A;  2OAC A;  5A1N A;  5ELG A;  2VO4 A;  1S3A A;  1ACV A;  2WW3 A;  4ZB7 A;  4MMM A;  1FB0 A;  4Q5Q A;  1YEP A;  2ON5 A;  3ZL5 A;  1WMJ A;  3P7X A;  3EPT A;  2PBJ A;  3NZN A;  5IMZ A;  2WGR A;  5IPH A;  4OMV A;  3GKK A;  1O8X A;  2X64 A;  4JZQ A;  1R5A A;  4ZB8 A;  3DIE A;  3KZQ A;  4JRR A;  1I1I P;  2LQQ A;  2PN8 A;  4PTS A;  1PKZ A;  2P0G A;  3VPT A;  2L4Q A;  4TXO B;  5F05 A;  3HXS A;  2YZU A;  2VAF A;  5FT3 A;  1U6T A;  3UBK A;  4L5O A;  3BD2 A;  4DSR A;  4G0L A;  5IOX A;  3ZML A;  3IOS A;  5AGY A;  3KJY A;  2R37 A;  4L0W A;  1Z7R A;  4IN0 A;  1BAY A;  2HT9 A;  2B7J A;  2B7K A;  5DJL A;  4EUY A;  4H86 A;  1SL0 B;  3EIN A;  1TJD A;  4HDE A;  2RII A;  4ZB9 A;  2H6Z A;  4ECI A;  2GLR A;  5KN2 A;  3TOT A;  1SJZ A;  3IE3 A;  2EFH A;  2JSY A;  5AN1 A;  3ME7 A;  1T4Y A;  2ZNM A;  4MF6 A;  1HQO A;  3LQ7 A;  1X5D A;  1B48 A;  2L57 A;  4V1A g;  4OFM A;  2H0I A;  4Z2U A;  2KOK A;  12GS A;  2HRK B;  3O6T A;  2CV4 A;  2TRC P;  5ID2 B;  1NHY A;  2FHE A;  4FH8 A;  4GWR A;  1KEB A;  2AB6 A;  2VCV A;  1ERT A;  4F9Z A;  4AJ7 A;  4A5P A;  2VD1 A;  2GSS A;  3LOR A;  5IMC A;  2DJJ A;  1JLW A;  4MF7 A;  1XXU A;  1YF0 A;  2N5F A;  2K9F A;  4NAX A;  2H1A A;  4HQS A;  5COH A;  4IP6 A;  1GUL A;  1X5E A;  2FWH A;  1DSB A;  2FGX A;  4AKH A;  5GSS A;  4EKZ A;  3KD0 A;  3APQ A;  2FLS A;  5JCU A;  2CX4 A;  2F8A A;  3M3M A;  2H71 A;  4K2X A;  4HQZ A;  4W66 A;  1U88 A;  4XIH A;  5CRE A;  2EIQ A;  1V2A A;  3GL5 A;  5J3R A;  3EWL A;  3E3E A;  3C1S A;  5LD0 A;  3F3R A;  4MCU A;  3O3T A;  5A34 B;  1WPI A;  4XHM A;  4RI7 A;  1THX A;  2P5Q A;  2JAC A;  1DE2 A;  5F06 A;  3H79 A;  1K3L A;  3EU4 A;  1SVM A;  1V40 A;  2DML A;  1XCC A;  2EFD A;  2GDR A;  1EEJ A;  1H75 A;  2NVL A;  4KSM A;  5HR3 A;  1GTA A;  1TXX A;  4XS4 A;  1EP7 A;  1E6B A;  2V1M A;  2LEG A;  2BMX A;  4POK A;  2IFQ B;  1A2J A;  4FYC A;  5DQS A;  2GQL A;  9GSS A;  2HRF A;  1TDI A;  6GSW A;  2P5R A;  3UVT A;  1M2A A;  3VI7 A;  2R3X A;  2VUP A;  4MJE A;  4L5L A;  4KA0 A;  3MAK A;  1SU9 A;  3IR4 A;  5DCG A;  4XRD A;  3MYD A;  3KH9 A;  1R5P A;  6GSS A;  3BJ5 A;  3EMP A;  1GH2 A;  3LSZ A;  2QGV A;  1WP0 A;  4N0Z A;  1GTU A;  2R0P A;  2OE1 A;  4IJI A;  4PQI A;  1X0R A;  3M0F A;  3H93 A;  4KDY A;  1SYR A;  4JR4 A;  1IYH A;  3GX8 A;  4D73 B;  1A24 A;  2O7K A;  4P3Y B;  2L59 A;  5CNW A;  1TW9 A;  4OO5 A;  3SBC A;  4EDZ A;  2C0E A;  2NTO A;  1AW9 A;  3LXZ A;  3GTU B;  2PUK C;  1LJR A;  3IC4 A;  3C8E A;  1K0A A;  4G9H A;  2JU5 A;  19GS A;  2CAI A;  4ECC A;  2K8S A;  4IW9 A;  3KGK A;  4WR5 A;  3MDK A;  1OC9 A;  2H0G A;  2IPA A;  2CQ9 A;  1SD8 A;  2XPD A;  1QGV A;  3ZRE A;  4FQU A;  1W89 A;  3IAS 2;  2R0G A;  2AYT A;  1VRS D;  1YZX A;  4TN8 A;  4K0N A;  3ED3 A;  4MDC A;  3KXO A;  2V6O A;  5KN0 A;  1PX7 A;  4TW5 A;  5ECN B;  2H1G A;  4EIQ A;  1A8Y A;  4IBP A;  5ECM B;  4ZL7 A;  3E9J B;  2X4A A;  2X8C A;  2GT5 A;  2ON7 A;  3DRN A;  20GS A;  2PGT A;  5AIV A;  1TXU A;  4ISD A;  3SWL A;  4EDY A;  5A4V A;  1Q98 A;  4NV2 A;  2XPE A;  2HSM B;  2OBK A;  6GSU A;  4KGI A;  3DGQ A;  4N30 A;  3PH9 A;  4GLT A;  1N8J A;  2EFC A;  1HNA A;  4RI6 A;  1XG8 A;  3R3E A;  4QL9 A;  2MMA A;  2H0H A;  4MLY A;  1M2B A;  1Y6E A;  2MMZ A;  3RHC A;  4BVX A;  2YV9 A;  3RHB A;  4BWS A;  3M8N A;  3APS A;  4TOP A;  2IIY A;  3UAR A;  3PIN A;  3KP8 A;  3L9S A;  1TI3 A;  3LW9 A;  5IOW A;  4YAV A;  2WDU A;  2WZS A;  6GSV A;  4HI7 A;  2WVX B;  2AV4 A;  3HMJ G;  2HZF A;  4PNF A;  4K5S A;  5EY6 A;  4HUA A;  4X1U A;  4F2I A;  1GSY A;  2BTO T;  2GS3 A;  4MP4 A;  5ECL B;  2IMD A;  1YF1 A;  4IGJ A;  13GS A;  2YJ7 A;  4PQH A;  2YWI A;  1B4P A;  2QA1 A;  4POM A;  3WYW A;  5HR2 A;  2EC4 A;  3FY7 A;  4J2F A;  2H6X A;  2L5L A;  1ILO A;  4O5U A;  2I9H A;  2AAW A;  4IP1 A;  1EGO A;  2H1D A;  3N9J A;  1V98 A;  1V57 A;  1PX6 A;  1SJ6 A;  4TXO A;  2FWF A;  4O92 A;  2E2G A;  1FVK A;  4BWQ A;  3WGE A;  2IMK A;  2PER A;  2M80 A;  4F0B A;  1THO A;  2A4H A;  2VCW A;  3FMW A;  3DVW A;  1T8E B;  2C3T A;  3F63 A;  1G0T A;  2VLT A;  1EWX A;  4X43 A;  1AQX A;  3FZ4 A;  1K0B A;  2O8V B;  4HZ4 A;  2QA2 A;  4MF5 A;  1FVJ A;  1QMV A;  1F2E A;  5CP1 A;  1ZL9 A;  3Q74 A;  5EPF A;  4WF5 A;  3Q18 A;  5CO3 A;  2K6V A;  1HNB A;  1XVQ A;  1ZYE A;  4IQA A;  1FG4 A;  3P90 A;  4IEL A;  1K0M A;  3TJJ A;  3FKF A;  1JZR A;  1AQW A;  5J4V A;  4XRA A;  2YZH A;  5HR0 A;  3D4M A;  4K5R A;  5ELA A;  3H4K A;  3M1G A;  1LBK A;  1SKS B;  2HRK A;  2H1B A;  3GL3 A;  5ID2 A;  1BYE A;  1PL1 A;  5LCZ A;  4IQ1 A;  1SL1 B;  3UJ1 A;  3UAP A;  2H8L A;  1BG5 A;  1M3I A;  1Z9H A;  1K0N A;  1TRW A;  2LJR A;  2C8U A;  1C72 A;  3HJO A;  5DDL A;  4E8E A;  4MZB A;  3F8U A;  2DSA A;  3ME8 A;  2YN1 A;  4BL7 B;  3D0Z A;  2GGT A;  2LJA A;  1ERU A;  2YP6 A;  4Z2T A;  3US3 A;  2C0D A;  3QMX A;  1TK8 B;  1EV4 A;  3F3Q A;  4DEJ A;  1YKA A;  1EEM A;  2DKI A;  3FEU A;  5BMU B;  4O5Q A;  1A2M A;  2PVO C;  3GSS A;  1GL8 A;  1B9Y C;  5G5E A;  3DVX A;  4TR0 A;  3TU3 B;  2X99 A;  2LKU A;  2PPT A;  3EVI A;  2CZ2 A;  1MDJ A;  1GNE A;  5G5F A;  2OAD A;  3ERW A;  2HLS A;  5A34 A;  3GYK A;  2LST A;  1ZYQ B;  1Z6N A;  4ZIL A;  4NWY A;  2C0G A;  1OAZ A;  3QFA C;  4GTU A;  4YQU A;  1QQ2 A;  4F0C A;  1Q4J A;  1A2L A;  4ZB6 A;  3FW2 A;  3P8W A;  4IKH A;  2R5G A;  2WRT A;  3HVS A;  3TGZ A;  3LYP A;  3L4N A;  4PGT A;  2M46 A;  1O7U A;  4OWY A;  3GUR A;  2YNX A;  1O8W A;  1XOA A;  2EIR A;  1H4O A;  3HY2 A;  1QUW A;  3I69 A;  2IFQ A;  3EYT A;  2EFE A;  5DQY A;  2E0Q A;  1PRX A;  4TR3 A;  5JCG A;  2FCH A;  4GQC A;  3CRU A;  3RAZ A;  5D9X A;  5D93 A;  3DML A;  2VL3 A;  2V2G A;  2R6K A;  2DJK A;  3A5W A;  2NDO A;  1GTB A;  1YEW C;  2GQK A;  3TKS A;  1GSE A;  4DSS B;  5ECP B;  1GSS A;  2RLI A;  5CRD A;  2YV7 A;  3IK9 A;  17GS A;  4NMU A;  2WCI A;  1T7P B;  1ZCP A;  4OCF A;  1PN0 A; 
#chains in the Genus database with same CATH homology
 4FIW A;  4N0V A;  3DXB A;  1SD9 A;  2P31 A;  5J9B A;  2V6K A;  1RW1 A;  2I4A A;  4OCE A;  1MEK A;  3HZ8 A;  1SL2 B;  2H1L A;  2LQO A;  2YAN A;  4D73 A;  1KTE A;  3GH9 A;  1S3D A;  3UOM A;  2OBI A;  5HR1 A;  3EU3 A;  1U3A A;  1OC8 A;  1M2D A;  3IK7 A;  4I8B A;  1ML6 A;  1F3A A;  1XZO A;  3TJG A;  2DJ2 A;  1JZD A;  1AQV A;  2VKZ G;  3GA4 A;  2JSZ A;  2IMI A;  4J57 E;  1T3B A;  2O89 A;  4GST A;  2N5B A;  3IBH A;  3TB2 A;  3BBY A;  1OYJ A;  4MH3 A;  3TRX A;  1USB A;  1OE7 A;  5CRW A;  3VFI A;  4IVF A;  2HE3 A;  2LTK A;  1PSQ A;  6GSY A;  3FR9 A;  1Y1U A;  4QMK A;  5C00 A;  3N5O A;  3TCO A;  2B1L A;  2UV8 G;  1K3O A;  3CBU A;  1GNW A;  1ABA A;  1M9B A;  2LRT A;  1G7O A;  5AIX A;  2LRN A;  1TK0 B;  2VM1 A;  5GAN D;  1VF2 A;  4HU9 A;  1FOH A;  3FHK A;  5ECQ B;  2LNS A;  2FWG A;  2HSN B;  4G2E A;  2D2Z A;  2PWJ A;  3K8N A;  1ZYP A;  2OE0 A;  3KM6 A;  1FHE A;  1M99 A;  1HNC A;  3C71 A;  3LXT A;  2RM6 A;  2J9H A;  1R4W A;  3BOA A;  4ECJ A;  3LYK A;  4PUR A;  2OKA A;  1F37 A;  2VL2 A;  3F6F A;  4NV5 A;  3GRX A;  4TR1 B;  2HSH A;  2I81 A;  3H1N A;  1OE8 A;  3D21 A;  2LRC A;  2MMN A;  1JFU A;  3HCZ A;  1E2Y A;  3L0H A;  1PMT A;  2A4V A;  3ZVJ A;  5CRG A;  4LL4 B;  1TTZ A;  4G0I A;  3UBL A;  4J56 E;  1YKC A;  3I6A A;  4JBB A;  4KDU A;  2NBS A;  3GHA A;  3IDV A;  1MDK A;  5IMV A;  1Z3E A;  1AIU A;  5IMF A;  2L6C A;  1DUG A;  4YQV A;  5DVB A;  5A5H B;  4ZBA A;  1AUC A;  5IMD A;  3LG6 A;  2XBQ A;  4JR6 A;  3QOU A;  4ZBB A;  1JHB A;  2DJ0 A;  4WR4 A;  2KP1 A;  4YKG A;  4DVC A;  5IO0 A;  3ZIV A;  2CVD A;  3KMN A;  3HJM A;  1I5G A;  2IME A;  4XS1 A;  2MMO A;  2QKE A;  3G9B A;  2VOC A;  3GST A;  4ZBD A;  2RM5 A;  2H75 A;  5J41 A;  4WEY A;  2DC5 A;  1R7H A;  4FO5 A;  1PA3 A;  3D4T A;  1FO5 A;  3UIW A;  3DD3 A;  4TKY A;  4WXT A;  5IM9 A;  4PNG A;  2FY6 A;  4YKF A;  3ZMK A;  3GKN A;  3IHG A;  3GX0 A;  4ID0 A;  3GUS A;  3FZ9 A;  3QPM A;  2RUF A;  3TJF A;  3OR5 A;  3PGT A;  4CDO A;  4O5R A;  1T1V A;  1PKW A;  5FWG A;  3VPQ A;  1T4Z A;  2B3S A;  5BRT A;  4K7O A;  4L0U A;  5J9C A;  1Y25 A;  1FOV A;  2IN3 A;  5G2Z A;  1TRV A;  4WBR D;  4AJ6 A;  1ZMA A;  5ECS A;  1ERW A;  2GZZ A;  2AHE A;  4AKG A;  2OJL A;  3FYG A;  2JL4 A;  6GST A;  1O6J A;  3CWG A;  2KHP A;  1GRX A;  1GLQ A;  5ECI B;  1EV9 A;  3CSH A;  7GSS A;  2EIO A;  3HA9 A;  2LV3 A;  1FW1 A;  3H8Q A;  3ZFL A;  3HKR A;  3VLN A;  4MZC A;  2WZ9 A;  2C4J A;  22GS A;  1AXD A;  1BED A;  3MNG A;  5JCW A;  3WT1 A;  5A4U A;  4FYB A;  2K8V A;  2Z9S A;  2JZS A;  1YDK A;  1F9M A;  3CXG A;  3GNJ A;  5LNK e;  5G31 A;  2X8H A;  4OO4 A;  1ZOF A;  4YQM A;  1XBS A;  3WD6 A;  4X0X A;  4I2U A;  5G30 A;  2OE3 A;  4YH2 A;  2QSI A;  1QXH A;  4TVE A;  2H30 A;  4DSQ A;  4CY6 A;  4LLR A;  1GUH A;  3U5R E;  4RUV A;  3MWH A;  4HU7 A;  3KMO A;  4MNN A;  1DE1 A;  5J4U A;  1GSD A;  4V2M A;  5DAK B;  1GP1 A;  4K6X A;  3TKS E;  2DKH A;  1GWC A;  2WJU A;  1YEX A;  5HQP A;  1ST9 A;  2OA7 A;  18GS A;  1WOU A;  4MJC A;  5A4W A;  3L9V A;  1B8X A;  4GXZ A;  3VI5 A;  3IXR A;  2V32 A;  2DJ3 A;  4KE3 A;  3TKQ A;  1MD3 A;  1PN9 A;  1XWC A;  2F51 A;  3R2Q A;  1G7E A;  1XVW A;  14GS A;  1GLP A;  5KOW A;  2H19 A;  3VWX A;  3IAM 2;  3ZIT A;  4CY8 A;  2LS5 A;  2GZP A;  1X9W B;  4G01 A;  5GST A;  1SKW B;  5IPG A;  5ECH B;  4ZL8 A;  4AGS A;  2GSR A;  2LNT A;  4WBJ A;  3HDC A;  3PPU A;  2H73 A;  1LU4 A;  4MJB A;  2PU9 C;  4KW6 A;  4ICY A;  4KCA A;  4OFN A;  3ZYW A;  5DJM A;  1XW5 A;  2I1U A;  2HSY A;  2VL9 A;  4HOJ A;  3TJK A;  3HVX A;  2WUL A;  2J23 A;  5H5S A;  3GKX A;  2HZE B;  3LFL A;  2X8G A;  1F6M C;  1A23 A;  3DKS A;  2O5V A;  4AI6 A;  5ECO B;  3VWW A;  5J47 A;  4K0G A;  4NXI A;  5B8A A;  4KND A;  3TRQ A;  1IYI A;  3VK9 A;  3G7J A;  1HYU A;  1B9X C;  5JWR B;  1SK0 A;  2FA4 A;  3RPN A;  1TK5 B;  1M7T A;  3ZTL A;  1X9S B;  5CYY A;  4BPY A;  2R0C A;  2GSQ A;  3J7Y b;  5KN1 A;  1U87 A;  5EL8 A;  2LUS A;  1SVO A;  1A8L A;  2V41 A;  1TU7 A;  3QAW A;  3CYN A;  4NPB A;  3C73 A;  2H66 A;  1BQ7 A;  3NIV A;  2MBT A;  1OKD A;  3IPZ A;  5E4W A;  1XOB A;  2GZY A;  4K7I A;  1F3B A;  4I97 A;  5KEJ A;  2C0F A;  1K3Y A;  5ENU A;  4MAB A;  3HHV A;  5J4Y A;  1Z6M A;  5DAL B;  5C04 A;  1GSQ A;  2HSN A;  5IQY A;  2VCX A;  4L8E A;  2G0F A;  1NW2 A;  3CSI A;  1ZYN A;  1QFN A;  1R26 A;  4IHU A;  5JWQ B;  1VGL A;  5HFI A;  4XCS A;  4GQF A;  5A5K A;  3GN3 A;  4TR1 A;  4GF0 A;  3CTG A;  3ZFB A;  1NSW A;  1WIK A;  3WT2 A;  3IC8 A;  1A0R P;  3U6V A;  3ERG A;  2N5A A;  1ERV A;  1Z5Y E;  3W6G A;  2VD0 A;  3HVV A;  5DBQ A;  4JE1 A;  3IV4 A;  1U3I A;  3ERF A;  2B1K A;  4Q5F A;  4HS1 A;  3LWA A;  1WE0 A;  1A0F A;  2BJX A;  1TU8 A;  5D96 A;  1YJ6 A;  2MYG A;  5A5H A;  2YJH A;  3V1W A;  4HEA 2;  4KSO A;  4V2L A;  2WS2 A;  5L71 A;  2HYX A;  3GMF A;  3HJP A;  5B6M A;  3WGD A;  5GAP D;  5J40 A;  6GSX A;  2VCQ A;  2K18 A;  4E68 A;  8GSS A;  1TOF A;  3FR6 A;  4WKW A;  5INY A;  3ISO A;  3TUE A;  2ES7 A;  3F4T A;  2KUC A;  1K0O A;  1M9A A;  1TI1 A;  4HJ2 A;  4GDF A;  3NOF A;  4TXV A;  3F9U A;  4KCE A;  1SVL A;  4MPG A;  1UA5 A;  4NHZ A;  1EZK A;  4CHS A;  3GTU A;  3QFB C;  3A2W A;  3BCI A;  1QK8 A;  5CRH A;  2XC2 A;  1M0U A;  1NHO A;  2GQM A;  5AIS A;  2ZCT A;  1GSU A;  4Z7X A;  1JZW A;  3I9V 2;  1PGT A;  3TOU A;  5CAX A;  4PQ1 A;  1RK4 A;  1Z7P A;  4AKI A;  4F03 A;  5B6N A;  1XPV A;  1BJX A;  2E7P A;  2FNO A;  3UVH A;  5F0G A;  1XFL A;  4PX1 A;  2WFC A;  4EXJ A;  1B4Q A;  3A2V A;  1XWA A;  2VCT A;  3IHQ A;  1FB6 A;  3TRP A;  2FA8 A;  3G7I A;  4WF4 A;  2C3Q A;  3EE2 A;  4IJ3 A;  2X49 A;  4KAE A;  4XTS A;  5GZZ B;  2B5Y A;  3D5J A;  4EL1 A;  2RUE A;  4BVY B;  4I2T A;  4E8H A;  3W8S A;  2FUG 2;  2DIZ A;  4HJM A;  3QAV A;  2PVQ A;  1GTI A;  3RBT A;  4PUF C;  2WB9 A;  5DCH A;  4GSN A;  1T00 A;  5B8B A;  2HSM A;  5ECK B;  1VF1 A;  1J0F A;  5IMA A;  2DMM A;  2H01 A;  3RPP A;  5A1N B;  3KTL A;  3LGC A;  4YAP A;  1NM3 A;  2XHF A;  3GIX A;  2CX3 A;  2YWM A;  2CA8 A;  3UMA A;  3D6I A;  4ZXG A;  2F9S A;  2CVK A;  2H6Y A;  2YOI A;  1N25 A;  3IRA A;  3ZRD A;  1VF3 A;  4ECB A;  2L4C A;  3BCK A;  2ALB A;  5ABR A;  2XBI A;  1GUK A;  2H76 A;  1XWG A;  1ZZY A;  3A2X A;  2F8F A;  1J9B A;  3ZZX A;  4ML1 A;  2UZ8 A;  4G10 A;  4EC0 A;  2TRX A;  3GH6 A;  1X9M B;  1ZGN A;  4GCI A;  1MD4 A;  4ILF A;  5DAK A;  4XS6 A;  3ZVJ D;  2KP2 A;  2C80 A;  4OFT A;  3MIX A;  4K9Z A;  4AF2 A;  4V1A p;  1YY7 A;  4KX4 A;  5F8B A;  4ACS A;  4AJ8 A;  2VM2 A;  3W8J A;  2HRA A;  1GUM A;  4POL A;  5JWO B;  1AAZ A;  5KN3 A;  1TRU A;  3CMI A;  10GS A;  2NPB A;  2JZT A;  3KP9 A;  4K8M A;  2FD3 A;  2DJ1 A;  4ZIJ A;  3D22 A;  3G7Y A;  3GKM A;  5D9T A;  2TIR A;  4F82 A;  4EE0 A;  3KIJ A;  2IL3 A;  4HZ2 A;  2LJK A;  3EC3 A;  1UVZ A;  3DYR A;  2VLU A;  1RQM A;  3JCM L;  2A2R A;  1SKR B;  4MZW A;  1K0C A;  5F07 A;  5ECR B;  1URM A;  2O85 A;  4EO3 A;  3KH7 A;  1W4V A;  4LMV A;  2IMF A;  3QCP A;  1TKD B;  2AJQ B;  2VIM A;  3TKS C;  1I9D A;  3KEB A;  1SK2 A;  2H72 A;  2GVP A;  3ZLP A;  2AUV A;  4KF9 A;  4JED A;  4GSS A;  3MSZ A;  3HZ4 A;  2CT6 A;  3C7M A;  3HYP A;  3Q6O A;  1EGR A;  4I5Q A;  4EVM A;  4IS0 A;  1BG1 A;  5E59 A;  3C1R A;  4G0K A;  3M9K A;  2HZE A;  2M72 A;  3FRC A;  4LL1 B;  4K2D A;  4N3Z A;  1XWK A;  4N10 A;  3EMX A;  1PL2 A;  2O87 A;  4K1F A;  2HXK A;  2A2P A;  3CRT A;  1UC7 A;  3A5I A;  4BA7 A;  4MH2 A;  2OT3 A;  5D73 A;  4QL7 A;  1JZO A;  1V9W A;  3DWV A;  4GRF A;  2HNL A;  2JZR A;  4BL7 A;  5FHI A;  4Q5R A;  4JU5 A;  1CQH A;  1SEN A;  4ULX A;  3S9F A;  1O85 A;  2YPM A;  5HFG A;  4KH7 A;  1WJK A;  3TKR A;  2H74 A;  1XWB A;  1N2A A;  4RQR A;  1G6W A;  3QAG A;  1HD2 A;  3I43 A;  2B5X A;  1JLV A;  1G6Y A;  2A2S A;  2G2Q A;  5BMU A;  1EP8 A;  4RQX A;  4CW9 A;  2R4V A;  3P2A A;  3LEF A;  1SK1 A;  2CVB A;  3LJR A;  4EF0 A;  1UN2 A;  4LMW A;  5DAL A;  3RDW A;  4XS4 B;  1TRS A;  3UL3 A;  3F4R A;  4NHW A;  3WGX A;  3FR3 A;  1OVN A;  4X4J A;  3TKP A;  5D9W A;  4O7H A;  1WRY A;  1CQG A;  5H5Q A;  1ON4 A;  3PR8 A;  16GS A;  2B5E A;  5EVO A;  1SYX A;  4ML6 A;  4V2N A;  1DBY A;  2I3Y A;  2VL2 C;  2L5O A;  5IO2 A;  3VUR A;  5G1L A;  1KNG A;  4K7N A;  3VWV A;  4USS A;  2GTU A;  2C1Y A;  2IJY A;  1XIY A;  3M9J A;  1AC1 A;  4LA1 A;  1XW6 A;  11GS A;  4FYU A;  1OC3 A;  3GV1 A;  2F3M A;  2L6D A;  3J7Y k;  3F6D A;  2REM A;  2YWN A;  2H70 A;  1SJI A;  3A3T A;  2HQT A;  2IWT A;  1PD2 1;  4KDX A;  2YWO A;  2JAD A;  4DSS A;  3ZIJ A;  3IA1 A;  2DLX A;  4WET A;  1GSF A;  2CAQ A;  2VLV A;  4G19 A;  1TP9 A;  1WWJ A;  1FAA A;  3L9U A;  3CSJ A;  3CTF A;  4PXO A;  3L78 A;  3VWU A;  4Q5N A;  1J08 A;  3E0U A;  4OD7 A;  4KB3 A;  4PUA A;  2KLX A;  2MBS A;  2HI7 A;  4Z2R A;  2ZUP A;  1MTC A;  1K0D A;  2HFD A;  3DEX A;  3KCM A;  3TJB A;  3F4S A;  3FZ5 A;  1OKT A;  4KUN A;  2GST A;  2DBC A;  5J5N A;  1OC9 B;  4MPF A;  1BF5 A;  3EUR A;  2QC7 A;  1KBN A;  2FWE A;  4ZL9 A;  2PMT A;  5HFK A;  5B7C A;  1EOG A;  4N11 A;  2B6M A;  1EOH A;  2GT6 A;  3QR6 A;  3GFK A;  3AY8 A;  2C3N A;  4I6X A;  4POB A;  3UEM A;  5IIZ A;  1O73 A;  5G1K A;  3TDG A;  4O32 A;  1V58 A;  3O76 A;  2VCZ A;  1O81 A;  3HD5 A;  4TR4 A;  4MJA A;  4TRX A;  1VF4 A;  4MK3 A;  5H5R A;  2HRN A;  4MA9 A;  3QD9 A;  2MZC A;  3FK8 A;  5D9V A;  3APO A;  1PQN A;  5D8I A;  4AKX B;  2DIY A;  1S3C A;  2R2J A;  1MDI A;  2CZ3 A;  4EIP A;  5KOX A;  1YQ1 A;  3Q19 A;  1X5C A;  2E2M A;  2YCD A;  3F0I A;  4BVY A;  3KTB A;  4QQ7 A;  1BX9 A;  1YVL A;  4BVX B;  3FZA A;  3QDN A;  1XW9 A;  2OAC A;  5A1N A;  5ELG A;  2VO4 A;  1S3A A;  1ACV A;  4ZB7 A;  4MMM A;  1FB0 A;  4Q5Q A;  1YEP A;  2ON5 A;  3ZL5 A;  1WMJ A;  3P7X A;  3EPT A;  2PBJ A;  3NZN A;  5IMZ A;  2WGR A;  5IPH A;  4OMV A;  3GKK A;  1O8X A;  2X64 A;  4JZQ A;  1R5A A;  4ZB8 A;  3DIE A;  3KZQ A;  4JRR A;  2LQQ A;  2PN8 A;  4PTS A;  1PKZ A;  2P0G A;  3VPT A;  2L4Q A;  4TXO B;  5F05 A;  3HXS A;  2YZU A;  2VAF A;  5FT3 A;  1U6T A;  3UBK A;  4L5O A;  3BD2 A;  4DSR A;  4G0L A;  5IOX A;  3ZML A;  3IOS A;  5AGY A;  3KJY A;  2R37 A;  4L0W A;  1Z7R A;  4IN0 A;  1BAY A;  2HT9 A;  2B7J A;  2B7K A;  5DJL A;  4EUY A;  4H86 A;  1SL0 B;  3EIN A;  1TJD A;  4HDE A;  2RII A;  4ZB9 A;  2H6Z A;  4ECI A;  2GLR A;  5KN2 A;  3TOT A;  1SJZ A;  3IE3 A;  2EFH A;  2JSY A;  5AN1 A;  3ME7 A;  1T4Y A;  2ZNM A;  4MF6 A;  1HQO A;  3LQ7 A;  1X5D A;  1B48 A;  2L57 A;  4V1A g;  4OFM A;  2H0I A;  4Z2U A;  2KOK A;  12GS A;  2HRK B;  3O6T A;  2CV4 A;  2TRC P;  5ID2 B;  1NHY A;  2FHE A;  4FH8 A;  4GWR A;  1KEB A;  2AB6 A;  2VCV A;  1ERT A;  4F9Z A;  4AJ7 A;  4A5P A;  2VD1 A;  2GSS A;  3LOR A;  5IMC A;  2DJJ A;  1JLW A;  4MF7 A;  1XXU A;  1YF0 A;  2N5F A;  2K9F A;  4NAX A;  2H1A A;  4HQS A;  5COH A;  4IP6 A;  1GUL A;  1X5E A;  2FWH A;  1DSB A;  2FGX A;  4AKH A;  5GSS A;  4EKZ A;  3KD0 A;  3APQ A;  2FLS A;  5JCU A;  2CX4 A;  2F8A A;  3M3M A;  2H71 A;  4K2X A;  4HQZ A;  4W66 A;  1U88 A;  4XIH A;  5CRE A;  2EIQ A;  1V2A A;  3GL5 A;  5J3R A;  3EWL A;  3E3E A;  3C1S A;  5LD0 A;  3F3R A;  4MCU A;  3O3T A;  5A34 B;  1WPI A;  4XHM A;  4RI7 A;  1THX A;  2P5Q A;  2JAC A;  1DE2 A;  5F06 A;  3H79 A;  1K3L A;  3EU4 A;  1SVM A;  1V40 A;  2DML A;  1XCC A;  2EFD A;  2GDR A;  1EEJ A;  1H75 A;  2NVL A;  4KSM A;  5HR3 A;  1GTA A;  1TXX A;  4XS4 A;  1EP7 A;  1E6B A;  2V1M A;  2LEG A;  2BMX A;  4POK A;  2IFQ B;  1A2J A;  4FYC A;  5DQS A;  2GQL A;  9GSS A;  2HRF A;  1TDI A;  6GSW A;  2P5R A;  3UVT A;  1M2A A;  3VI7 A;  2R3X A;  2VUP A;  4MJE A;  4L5L A;  4KA0 A;  3MAK A;  1SU9 A;  3IR4 A;  5DCG A;  4XRD A;  3MYD A;  3KH9 A;  1R5P A;  6GSS A;  3BJ5 A;  3EMP A;  1GH2 A;  3LSZ A;  2QGV A;  1WP0 A;  4N0Z A;  1GTU A;  2R0P A;  2OE1 A;  4IJI A;  4PQI A;  1X0R A;  3M0F A;  3H93 A;  4KDY A;  1SYR A;  4JR4 A;  1IYH A;  3GX8 A;  4D73 B;  1A24 A;  2O7K A;  4P3Y B;  2L59 A;  5CNW A;  1TW9 A;  4OO5 A;  3SBC A;  4EDZ A;  2C0E A;  2NTO A;  1AW9 A;  3LXZ A;  3GTU B;  2PUK C;  1LJR A;  3IC4 A;  3C8E A;  1K0A A;  4G9H A;  2JU5 A;  19GS A;  2CAI A;  4ECC A;  2K8S A;  4IW9 A;  3KGK A;  4WR5 A;  3MDK A;  1OC9 A;  2H0G A;  2IPA A;  2CQ9 A;  1SD8 A;  2XPD A;  1QGV A;  3ZRE A;  4FQU A;  1W89 A;  3IAS 2;  2R0G A;  2AYT A;  1VRS D;  1YZX A;  4TN8 A;  4K0N A;  3ED3 A;  4MDC A;  3KXO A;  2V6O A;  5KN0 A;  1PX7 A;  4TW5 A;  5ECN B;  2H1G A;  4EIQ A;  1A8Y A;  4IBP A;  5ECM B;  4ZL7 A;  3E9J B;  2X4A A;  2X8C A;  2GT5 A;  2ON7 A;  3DRN A;  20GS A;  2PGT A;  5AIV A;  1TXU A;  4ISD A;  3SWL A;  4EDY A;  5A4V A;  1Q98 A;  4NV2 A;  2XPE A;  2HSM B;  2OBK A;  6GSU A;  4KGI A;  3DGQ A;  4N30 A;  3PH9 A;  4GLT A;  1N8J A;  2EFC A;  1HNA A;  4RI6 A;  3R3E A;  4QL9 A;  2MMA A;  2H0H A;  4MLY A;  1M2B A;  1Y6E A;  2MMZ A;  3RHC A;  4BVX A;  2YV9 A;  3RHB A;  4BWS A;  3M8N A;  3APS A;  4TOP A;  2IIY A;  3UAR A;  3PIN A;  3KP8 A;  3L9S A;  1TI3 A;  3LW9 A;  5IOW A;  4YAV A;  2WDU A;  6GSV A;  4HI7 A;  2AV4 A;  3HMJ G;  2HZF A;  4PNF A;  4K5S A;  5EY6 A;  4HUA A;  4X1U A;  4F2I A;  1GSY A;  2BTO T;  2GS3 A;  4MP4 A;  5ECL B;  2IMD A;  1YF1 A;  4IGJ A;  13GS A;  2YJ7 A;  4PQH A;  2YWI A;  1B4P A;  2QA1 A;  4POM A;  3WYW A;  5HR2 A;  2EC4 A;  3FY7 A;  4J2F A;  2H6X A;  2L5L A;  1ILO A;  4O5U A;  2I9H A;  2AAW A;  4IP1 A;  1EGO A;  2H1D A;  3N9J A;  1V98 A;  1V57 A;  1PX6 A;  1SJ6 A;  4TXO A;  2FWF A;  4O92 A;  2E2G A;  1FVK A;  4BWQ A;  3WGE A;  2IMK A;  2PER A;  2M80 A;  4F0B A;  1THO A;  2A4H A;  2VCW A;  3FMW A;  3DVW A;  1T8E B;  2C3T A;  3F63 A;  1G0T A;  2VLT A;  1EWX A;  4X43 A;  1AQX A;  3FZ4 A;  1K0B A;  2O8V B;  4HZ4 A;  2QA2 A;  4MF5 A;  1FVJ A;  1QMV A;  1F2E A;  5CP1 A;  1ZL9 A;  3Q74 A;  5EPF A;  4WF5 A;  3Q18 A;  5CO3 A;  2K6V A;  1HNB A;  1XVQ A;  1ZYE A;  4IQA A;  1FG4 A;  3P90 A;  4IEL A;  1K0M A;  3TJJ A;  3FKF A;  1JZR A;  1AQW A;  5J4V A;  4XRA A;  2YZH A;  5HR0 A;  3D4M A;  4K5R A;  5ELA A;  3H4K A;  3M1G A;  1LBK A;  1SKS B;  2HRK A;  2H1B A;  3GL3 A;  5ID2 A;  1BYE A;  1PL1 A;  5LCZ A;  4IQ1 A;  1SL1 B;  3UJ1 A;  3UAP A;  2H8L A;  1BG5 A;  1Z9H A;  1K0N A;  1TRW A;  2LJR A;  2C8U A;  1C72 A;  3HJO A;  5DDL A;  4E8E A;  4MZB A;  3F8U A;  2DSA A;  3ME8 A;  2YN1 A;  4BL7 B;  3D0Z A;  2GGT A;  2LJA A;  1ERU A;  2YP6 A;  4Z2T A;  3US3 A;  2C0D A;  3QMX A;  1TK8 B;  1EV4 A;  3F3Q A;  4DEJ A;  1YKA A;  1EEM A;  2DKI A;  3FEU A;  5BMU B;  4O5Q A;  1A2M A;  2PVO C;  3GSS A;  1GL8 A;  1B9Y C;  5G5E A;  3DVX A;  4TR0 A;  3TU3 B;  2X99 A;  2LKU A;  2PPT A;  3EVI A;  2CZ2 A;  1MDJ A;  1GNE A;  5G5F A;  2OAD A;  3ERW A;  2HLS A;  5A34 A;  3GYK A;  2LST A;  1ZYQ B;  1Z6N A;  4ZIL A;  4NWY A;  2C0G A;  1OAZ A;  3QFA C;  4GTU A;  4YQU A;  1QQ2 A;  4F0C A;  1Q4J A;  1A2L A;  4ZB6 A;  3FW2 A;  3P8W A;  4IKH A;  2R5G A;  2WRT A;  3HVS A;  3TGZ A;  3LYP A;  3L4N A;  4PGT A;  2M46 A;  1O7U A;  4OWY A;  3GUR A;  2YNX A;  1O8W A;  1XOA A;  2EIR A;  1H4O A;  3HY2 A;  1QUW A;  3I69 A;  2IFQ A;  3EYT A;  2EFE A;  5DQY A;  2E0Q A;  1PRX A;  4TR3 A;  5JCG A;  2FCH A;  4GQC A;  3CRU A;  3RAZ A;  5D9X A;  5D93 A;  3DML A;  2VL3 A;  2V2G A;  2R6K A;  2DJK A;  3A5W A;  2NDO A;  1GTB A;  2GQK A;  3TKS A;  1GSE A;  4DSS B;  5ECP B;  1GSS A;  2RLI A;  5CRD A;  2YV7 A;  3IK9 A;  17GS A;  4NMU A;  2WCI A;  1T7P B;  1ZCP A;  4OCF A;  1PN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...