4HI7A

Crystal structure of glutathione transferase homolog from drosophilia mojavensis, target efi-501819, with bound glutathione
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
220
structure length
220
Chain Sequence
KPILYGIDASPPVRAVKLTLAALQLPYDYKIVNLMNKEQHSEEYLKKNPQHTVPLLEDGDANIADSHAIMAYLVSKYGKDDSLYPKDLVKRALVDNRMYFESGVVFANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIADFSLISSISSLVAFVPVDAAKYPKLSAWIKRLEQLPYYAENSTGAQQFVAAVKSKPFTVVGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GI20122
publication title Crystal structure of glutathione transferase homolog from drosophilia mojavensis, TARGET EFI-501819, with bound glutathione
rcsb
source organism Drosophila mojavensis
molecule tags Unknown function
total genus 81
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4hi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hi7A01
2VAFA 1SKWB 3IC8A 4O92A 6GSXA 3MAKA 4N10A 1M0UA 2KP1A 1GSSA 1GUMA 4MZWA 1MDJA 2F8AA 1XVWA 3TJGA 5JCGA 3QPMA 1SYRA 2VOCA 1GNWA 1R26A 4J56E 5ECIB 2DC5A 2HNLA 4TVEA 1EP8A 5HFIA 2GSQA 2LRCA 3I43A 4Q5NA 4E8HA 4FIWA 1TXXA 2VLVA 3VK9A 1FB0A 2PN8A 1SL0B 1XWCA 3D6IA 2C3NA 4G0LA 4PNFA 1M99A 8GSSA 3NOFA 3GMFA 5HFGA 4PUAA 1K0MA 4QQ7A 3H4KA 4FYUA 1DUGA 3A2XA 3RPNA 3GV1A 3TDGA 3RBTA 3UVHA 3LG6A 1XBSA 3F6FA 2HQTA 2VM1A 5DVBA 1C72A 3TOTA 1WP0A 4GF0A 3ISOA 4F0BA 2MYGA 2OBIA 3IHQA 4DSRA 3FRCA 2OA7A 2X8CA 3LGCA 1XXUA 4K9ZA 3GSSA 2YWMA 2FWGA 4FYCA 1OC8A 4FO5A 2YCDA 1UA5A 4MJEA 4OO4A 1V58A 3KMOA 4IN0A 1WPIA 2VCVA 3RHBA 2H1AA 3IAM2 2YWOA 4JZQA 4FH8A 1HYUA 3R3EA 4N30A 2C4JA 2MBTA 1A0FA 2B7JA 2JU5A 2YJ7A 4V1Ap 4XS4A 1BX9A 4GSTA 1T8EB 3TKSC 1XWAA 2LQQA 4XS4B 3RDWA 2DBCA 3DRNA 1F9MA 2GSRA 2CZ3A 5CRHA 2DJ1A 1TJDA 4TRXA 4IW9A 3ZYWA 2GT5A 4CW9A 5CO3A 4ZL9A 4Z7XA 1YF0A 2OKAA 4NAXA 1T7PB 1U6TA 2ALBA 3ZITA 2VCZA 4ISDA 1YDKA 3ZLPA 3RAZA 2YWNA 4MP4A 2H75A 2FA4A 1F37A 2B1KA 1OE8A 3FR3A 2ZUPA 4X0XA 5IMDA 3L0HA 4I2UA 1ML6A 2CQ9A 1K0OA 2LJRA 2CVDA 1T00A 3US3A 2LTKA 5G1KA 3ZVJA 1M2AA 1A2JA 2FWEA 3TKSA 4ID0A 2JL4A 3HVVA 5EY6A 3GTUA 4NPBA 4I5QA 3APQA 4KCAA 3GTUB 4IKHA 3FR6A 3QFAC 1B9XC 3EINA 2HZEA 2K18A 20GSA 2KOKA 3FZ4A 4TN8A 2XBQA 1GTBA 1BG5A 2HZEB 1HNAA 1EEMA 3DMLA 2GT6A 3KMNA 1XOAA 2KLXA 1O6JA 1EGRA 1DE1A 1GWCA 5G5EA 1ZL9A 3DVXA 1IYHA 3IBHA 2OE1A 1HQOA 2BJXA 2IJYA 3TJBA 3BJ5A 1F6MC 4WBJA 1TK0B 1GSDA 1ABAA 3E9JB 3ERFA 3M8NA 1JZOA 2DSAA 3EU4A 3IR4A 2VL2C 5GAPD 4ZIJA 4WF5A 3W8JA 2MMNA 4BL7A 4ECBA 1X0RA 4OCFA 4AJ8A 4KNDA 3W6GA 5JCWA 1RK4A 4BL7B 1GSUA 3HYPA 4WKWA 2P0GA 4EXJA 3WT1A 4JR6A 1Z7RA 4KCEA 6GSWA 4MPFA 5EL8A 4BVXA 1TKDB 2HRAA 4TR0A 2R6KA 2FWHA 1O8XA 2YZHA 2YNXA 4BVXB 2VCQA 4L5LA 4ML1A 4I8BA 5KN1A 1GSYA 5B6NA 4K0NA 4N0ZA 3VWWA 3UBKA 1TU8A 2H72A 2KHPA 4Q5RA 4XS6A 4X43A 4KX4A 1EOHA 1XVQA 1O85A 2L57A 2DMLA 4PQ1A 3WD6A 4TW5A 4CDOA 3LSZA 5HR0A 2DJ3A 2VM2A 1GL8A 4TR4A 5BMUA 2FA8A 2F8FA 2V1MA 3BCKA 1GUKA 6GSSA 2FUG2 2DLXA 2I81A 2R3XA 2X8HA 2N5AA 4K7OA 1MTCA 2HXKA 2L5LA 5J5NA 3ZMLA 3GH9A 4OO5A 2IN3A 1I9DA 1BEDA 3G7JA 3EWLA 3MWHA 5FT3A 1V98A 2QSIA 1ZYQB 4O7HA 2IMDA 4ZILA 5LD0A 3H93A 2CA8A 4K8MA 1Z9HA 4IQAA 4OCEA 5JWRB 3D0ZA 1OVNA 2VL3A 4NV2A 4MJBA 4WXTA 1PKZA 3NZNA 1SL2B 2LNSA 5J4UA 2GZYA 3LYKA 1PGTA 5HR2A 3ZTLA 1GTIA 1PA3A 4POKA 4MA9A 5IMVA 3WGEA 3HKRA 2XC2A 4IP6A 1FHEA 4ZB8A 1ON4A 5EPFA 1M2BA 4PQHA 4KAEA 1XWGA 3F3RA 3APOA 4HOJA 3HDCA 6GSVA 12GSA 3A2WA 2YN1A 2ON7A 4ULXA 3Q74A 3FZAA 3C71A 3HCZA 3TJFA 4AJ6A 2JZSA 3IA1A 2OBKA 2IWTA 5CRDA 2HSHA 4KA0A 4PXOA 4KSOA 1H4OA 2C1YA 1M2DA 3DEXA 1LU4A 3ZMKA 3TCOA 4IELA 4GSSA 3VI7A 3GL3A 2CZ2A 2F9SA 4MK3A 1CQHA 1H75A 2I9HA 3UBLA 3D4MA 3EYTA 1ACVA 5CRGA 2MMZA 1YQ1A 2IMEA 4WEYA 4ZBBA 5F05A 2O87A 4V2NA 3LYPA 9GSSA 4GQCA 3HJPA 4KH7A 2P5QA 4K7NA 1Q98A 5EVOA 4O32A 1YZXA 2ES7A 1X5DA 4MMMA 1CQGA 3HY2A 4HQZA 5CP1A 5ELAA 3PR8A 1S3AA 1A2LA 2K8VA 3H79A 3HJMA 1PX6A 3APSA 3IAS2 5JCUA 1WIKA 3HA9A 3FR9A 5IM9A 5IMCA 4TR3A 4N0VA 1QFNA 2EIQA 2G2QA 4MZBA 3GUSA 4TR1A 4HEA2 3VURA 4GCIA 3ZZXA 1DE2A 2D2ZA 4TR1B 2XPDA 5ECHB 1R4WA 3TJKA 4I6XA 3QD9A 5AIXA 3GKKA 2ON5A 1A2MA 3TRQA 3P8WA 2HFDA 2LRTA 3A5WA 3J7Yk 2WDUA 5H5QA 2VCTA 4MJAA 1V40A 2B6MA 2K9FA 3OR5A 3ERWA 3GIXA 4FYBA 3UL3A 3GKNA 3F9UA 5ECRB 2M80A 3DYRA 2VCXA 4L5OA 2VO4A 4KUNA 1QK8A 1S3DA 2YZUA 4MJCA 1LBKA 4F9ZA 3CSJA 5ECQB 2GQKA 1GULA 4MABA 3ZIVA 4V2MA 1PQNA 2NDOA 2XPEA 3ZL5A 4BVYA 2WFCA 2C0EA 6GSUA 5A4VA 2OE3A 5GSSA 4BVYB 2H01A 3LXZA 2O8VB 4WETA 4LLRA 2H73A 1W89A 3UAPA 4MF7A 2GGTA 1ERUA 5IMFA 1AQVA 1BAYA 2WCIA 4F2IA 2L4QA 2E2GA 1THXA 2IIYA 4AF2A 2RM5A 2WULA 4YQMA 2DJ0A 1G6WA 3RPPA 1BJXA 2IMKA 2YOIA 3GURA 2EIOA 1B4QA 2MBSA 3Q19A 2H0GA 1TU7A 2OJLA 1A8LA 4NHWA 5D8IA 3LORA 4IJ3A 2HZFA 1SD9A 1ZMAA 5F07A 1RW1A 1FB6A 5DQYA 5B6MA 1XZOA 1N8JA 5DJLA 1TRVA 1EP7A 1RQMA 1FG4A 1FVKA 1KTEA 4G19A 1U3AA 4BWSA 4GTUA 1BQ7A 2R37A 3VPTA 5DDLA 1JLVA 5A4WA 1F3BA 1WE0A 1Z3EA 2LS5A 5CNWA 3VLNA 2MMAA 2Z9SA 2I4AA 4ZBDA 6GSTA 2O7KA 1GNEA 4NMUA 1PD21 3F63A 1HD2A 2N5FA 3ZIJA 2PPTA 3P7XA 1G0TA 1U88A 2LQOA 1ZOFA 2R5GA 1YY7A 2WRTA 1JZWA 1IYIA 5B7CA 1K3OA 1Z6MA 1R5AA 3LFLA 2TIRA 1V9WA 3L78A 4RUVA 3TRPA 2RLIA 2H30A 4KE3A 4YQVA 3ZVJD 4F0CA 1O7UA 2N5BA 3HZ4A 4OMVA 2CAQA 3EVIA 1SD8A 2L4CA 2DMMA 4IGJA 1GUHA 3GKMA 2L6CA 2AJQB 4JRRA 3E0UA 3UARA 5GSTA 2FLSA 4PUFC 4EL1A 1JFUA 4WR5A 1SYXA 3IRAA 3KH7A 2J23A 4OFTA 1WMJA 2A2SA 1YEXA 3DWVA 5KN0A 5DALA 5D73A 1AUCA 1AQXA 3TOUA 4KDXA 2H0HA 2V41A 3CTGA 5DALB 4K1FA 4XIHA 3F4RA 2GZPA 1A0RP 4IJIA 3L9UA 1M9BA 1ERTA 4HDEA 4EC0A 2A2RA 3C73A 2GQMA 2O85A 5ECLB 3D22A 2K8SA 1T3BA 5IO0A 4E8EA 3HJOA 4G2EA 2G0FA 1USBA 4G10A 4YQUA 2PERA 5CRWA 4PQIA 4Q5FA 2DJ2A 1ERWA 4POLA 2H0IA 3M0FA 5DAKA 1AXDA 2DJKA 3IV4A 2VD1A 5AIVA 1FW1A 1GRXA 5DAKB 3WGDA 2WZ9A 2PGTA 2C0GA 4V2LA 2F51A 4EUYA 2HYXA 3V1WA 1VF4A 1X5CA 3CBUA 4KDUA 3H8QA 4F82A 2AB6A 1DSBA 4EKZA 2MZCA 2VLTA 3W8SA 4RQRA 5ECNB 5A5KA 3DGQA 1JZDA 3N9JA 3K8NA 1U3IA 4K0GA 1MD3A 3EURA 2CV4A 1QQ2A 4GXZA 5G31A 2FNOA 2M72A 1YF1A 2IL3A 2VL9A 5D9XA 3HVSA 4POBA 5JWQB 2VCWA 4HZ4A 1QXHA 2NTOA 1U87A 2H6ZA 2H8LA 2H6YA 4PGTA 3QAVA 4RI6A 2DIZA 4JEDA 1ST9A 2QC7A 4DEJA 1B48A 1K0AA 4TXOA 5F06A 1TTZA 2F3MA 4TXOB 3KCMA 5D96A 1NSWA 5HFKA 1B8XA 2GSSA 5IIZA 2BTOT 4WF4A 3ZFLA 3PPUA 3TUEA 2GSTA 2K6VA 2YPMA 2V6KA 4MDCA 1F2EA 2KUCA 1Z7PA 3Q6OA 4J57E 3GX0A 10GSA 3QR6A 2GDRA 4EDZA 1WJKA 1MDKA 5E59A 4GLTA 4ML6A 3P2AA 4MZCA 4XRDA 1URMA 2X99A 3F8UA 5ENUA 2H1BA 2DJJA 4WBRD 3O76A 3LEFA 3MSZA 3UIWA 3GH6A 1T4YA 3J7Yb 2TRCP 6GSYA 5A4UA 3LXTA 2OACA 2AAWA 3HXSA 2O89A 4I97A 1NHOA 1XOBA 1OAZA 1SENA 1QGVA 1FAAA 5AGYA 5IPGA 5D9WA 1K0DA 5E4WA 4MH3A 4KF9A 16GSA 4POMA 2V2GA 4K2DA 3EMPA 4HUAA 4JR4A 3DKSA 3HD5A 3M9JA 5ABRA 1B9YC 2CT6A 2MMOA 2PUKC 3PINA 4X1UA 2FGXA 5DBQA 1XCCA 2FHEA 2HE3A 4IVFA 2H74A 3F4TA 2H1GA 1SJIA 3CXGA 3FYGA 4NWYA 2CX4A 1V57A 3GNJA 2HSYA 2YANA 1SKRB 4YAVA 1G7EA 1Z5YE 1PSQA 3KD0A 2C80A 2AHEA 4K7IA 3L9SA 3DXBA 3U5RE 1OKDA 2RUFA 1NM3A 1SKSB 2HRKA 3KM6A 1W4VA 5IO2A 2HRKB 1EZKA 4NXIA 4XHMA 3FK8A 3LQ7A 3RHCA 2PVQA 1GTUA 2EIRA 1X9MB 2GVPA 3MDKA 1R5PA 3EE2A 3SWLA 1UN2A 2GLRA 5FWGA 1J08A 5HQPA 4K6XA 1TRWA 1TK8B 3KP8A 3VPQA 4L8EA 1TI1A 3TRXA 2H1DA 3BBYA 3ZREA 3SBCA 14GSA 2E0QA 4PX1A 3IC4A 2CAIA 1ERVA 2H66A 2DIYA 17GSA 2OADA 2X64A 4ECJA 2YV7A 1VRSD 4GWRA 1MEKA 3JCML 4YH2A 1I5GA 1J9BA 1Y6EA 3FKFA 1E2YA 3BD2A 2M46A 3GFKA 1FOVA 4P3YB 1E6BA 1Q4JA 4TOPA 2JZTA 3KGKA 4ZBAA 3UMAA 5F0GA 1EOGA 1JHBA 1EGOA 2LJAA 5ELGA 4BA7A 2XHFA 1PN9A 3UOMA 1KBNA 4EVMA 4KDYA 1GTAA 5ECPB 4DSQA 1WRYA 2PVOC 2YV9A 4MF6A 3I69A 2PWJA 4OFNA 2FWFA 1YKAA 3LWAA 1GSFA 3C7MA 2IMIA 2V6OA 1THOA 2IFQA 4NHZA 3QAGA 5G2ZA 1GLPA 3IXRA 1LJRA 2HRFA 5D93A 2IFQB 5G5FA 1TRUA 1HNCA 4HU9A 5COHA 1ILOA 5G30A 1SJZA 2LV3A 3UJ1A 2LNTA 1M7TA 4LL1B 13GSA 1ZZYA 1K3LA 1NHYA 1K0BA 3D5JA 4QL9A 3A3TA 1A8YA 1GP1A 4GRFA 2C3QA 3EC3A 1X9WB 4ILFA 3QCPA 3WGXA 1PX7A 3AY8A 2XBIA 1MD4A 4ZXGA 1KNGA 1OC3A 4GQFA 1G7OA 3TKRA 4AGSA 4ECIA 3IPZA 4ZL7A 1WOUA 3QMXA 4MH2A 3A2VA 5J41A 4J2FA 3ME7A 2H71A 3CSIA 18GSA 2PMTA 2LKUA 2FCHA 1BYEA 1B4PA 3E3EA 4RQXA 2C0DA 4LMVA 2HRNA 2WS2A 2R2JA 3L4NA 2C0FA 4NV5A 1EV9A 11GSA 3FY7A 3I9V2 3L9VA 4ZB6A 4BPYA 1WWJA 1OYJA 2LRNA 1VGLA 5DCHA 3M1GA 3QOUA 2JADA 4TXVA 3QFBC 3BCIA 4PTSA 3F0IA 1TW9A 1EEJA 5DCGA 5IQYA 2VIMA 3P90A 5H5RA 1TI3A 3O6TA 4MPGA 2RIIA 2OE0A 4TKYA 3D4TA 1G6YA 2JACA 5B8BA 2YP6A 1VF3A 2C8UA 4HI7A 1GH2A 3DIEA 3TJJA 3C1RA 2VUPA 2LEGA 3IE3A 5G1LA 1JZRA 1T1VA 4XCSA 5KN2A 3UVTA 3VWUA 1AAZA 1KEBA 1QUWA 5HR3A 3FZ9A 1YEPA 4I2TA 1XFLA 3FW2A 2HSMA 2TRXA 2X8GA 1JLWA 2HSMB 1PL1A 1PMTA 2WB9A 4G9HA 1AQWA 1XW6A 2B5EA 1ZYEA 3GN3A 1DBYA 4KSMA 5GZZB 4ZB9A 7GSSA 1Y25A 2AV4A 4OD7A 1V2AA 5FHIA 2HI7A 5ECSA 4HU7A 5L71A 3IOSA 2C3TA 4HJMA 2H19A 3HZ8A 4L0WA 4IQ1A 3GRXA 5IOWA 2HLSA 3VI5A 5CYYA 2AUVA 4XRAA 1AW9A 1PKWA 3TGZA 3WT2A 5ID2A 1SK2A 5DQSA 1J0FA 1YKCA 5ID2B 3GA4A 4O5RA 2V32A 1YJ6A 3VWXA 1OC9A 3DD3A 2B7KA 1XIYA 1OC9B 1TRSA 3ZRDA 1K0NA 1XW5A 3IK7A 5KEJA 3TKQA 1GLQA 2J9HA 1UVZA 4XS1A 1EV4A 5IMZA 3BOAA 2GS3A 2IPAA 2L59A 3N5OA 3CTFA 1SJ6A 1GSQA 3KTBA 2WJUA 2E7PA 4F03A 2A4VA 2CVKA 2ZCTA 1Z6NA 2NPBA 4AJ7A 4OWYA 4EE0A 2B3SA 4QL7A 3C8EA 4DVCA 5IOXA 3QAWA 4HQSA 4L0UA 2L6DA 2BMXA 5AN1A 4JU5A 4CHSA 2FD3A 1FO5A 4OFMA 5IMAA 2I3YA 2WGRA 2AYTA 2VD0A 2RM6A 4BWQA 1TOFA 4RI7A 5CREA 2QKEA 2NVLA 5IPHA 1NW2A 3CYNA 1HNBA 4PURA 5INYA 3KP9A 1TP9A 3O3TA 3FZ5A 3KIJA 1EWXA 3CRTA 5C00A 1O73A 3CRUA 5AISA 4PNGA 4USSA 1O81A 2VL2A 3TKSE 4HZ2A 4WR4A 2YJHA 1M9AA 4EO3A 4EDYA 3MNGA 1XPVA 5ECOB 5GAND 4MCUA 4DSSA 2H76A 4MF5A 1XWKA 4ZL8A 4DSSB 1R7HA 3M9KA 4JE1A 4IS0A 2GZZA 4D73A 4KGIA 4LA1A 3FEUA 3VWVA 4V1Ag 3KZQA 3QDNA 5HR1A 3CMIA 3C1SA 5D9VA 5J3RA 2LJKA 4IBPA 2HSNB 1QMVA 4D73B 1SL1B 3UEMA 3KEBA 2I1UA 1AIUA 4EF0A 2ZNMA 3Q18A 3KTLA 1VF1A 1GSEA 5B8AA 3KXOA 5CAXA 5F8BA 3R2QA 5DJMA 2VLUA 2UZ8A 3EU3A 4MLYA 3FHKA 1OKTA 5ECMB 2RUEA 2REMA 1SU9A 1T4ZA 3I6AA 2H6XA 2QGVA 3F3QA 3HHVA 3G9BA 2B1LA 1XW9A 3F4SA 3GKXA 4LL4B 3G7IA 2JZRA 4G0IA 1ZGNA 1OE7A 3M3MA 1X9SB 1PL2A 3U6VA 1A24A 2CVBA 3ERGA 1SK0A 3PH9A 1O8WA 2L5OA 2LSTA 3D21A 3LJRA 3GHAA 3EMXA 2PBJA 3ED3A 3VFIA 4GSNA 5H5SA 4Q5QA 2P5RA 4HS1A 3HVXA 3GSTA 4KW6A 3CSHA 3NIVA 4G0KA 2P31A 3KH9A 1FVJA 3WYWA 3DVWA 4KB3A 5JWOB 1A23A 3IK9A 2YWIA 2JSYA 2NBSA 1X5EA 3GYKA 2B5YA 4XTSA 1PRXA 1VF2A 1TDIA 22GSA 3TB2A 1TK5B 3GL5A 1S3CA 1SK1A 3G7YA 2GTUA 2R4VA 4HJ2A 1K0CA 1ZCPA 3ZFBA 2IMFA 4LMWA 4JBBA 3PGTA 1XWBA 2FY6A 2GQLA 4ECCA 5KN3A 4FQUA 3F6DA 2KP2A 3S9FA 2JSZA 4ACSA 3IDVA 1AC1A 3TKPA 3H1NA 1K3YA 5J9BA 5C04A 4IHUA 5LNKe 5J9CA 1MDIA 2LUSA 4IP1A 2EC4A 1F3AA 2HT9A 19GSA 4YAPA 1N2AA 1UC7A 3GX8A 2CX3A 3KJYA 2H70A 5LCZA 2B5XA 2E2MA 4N11A 5ECKB 3ME8A 4H86A 2PU9C 5D9TA
chains in the Genus database with same CATH superfamily
2VAFA 1SKWB 3IC8A 4O92A 6GSXA 3MAKA 4N10A 1M0UA 2KP1A 1GSSA 1GUMA 4MZWA 1MDJA 2F8AA 1XVWA 3TJGA 5JCGA 3QPMA 4MNNA 1SYRA 2VOCA 1GNWA 1R26A 4J56E 5ECIB 2DC5A 2HNLA 4TVEA 1EP8A 5HFIA 2GSQA 2LRCA 3I43A 4Q5NA 4E8HA 4FIWA 1TXXA 2VLVA 3VK9A 4AKGA 1FB0A 2PN8A 1SL0B 2WW0A 1XWCA 3D6IA 2C3NA 4G0LA 4K2XA 4PNFA 1M99A 8GSSA 3NOFA 3GMFA 5HFGA 4PUAA 1K0MA 4QQ7A 3H4KA 4FYUA 1DUGA 3A2XA 3RPNA 3GV1A 3TDGA 3RBTA 3UVHA 3LG6A 1XBSA 3F6FA 2HQTA 2VM1A 5DVBA 1C72A 3TOTA 1WP0A 4GF0A 3ISOA 4F0BA 2MYGA 2OBIA 3IHQA 4DSRA 3FRCA 2OA7A 2X8CA 1YEWC 3LGCA 5A34A 1XXUA 4K9ZA 3GSSA 2YWMA 2FWGA 4FYCA 1OC8A 4FO5A 2YCDA 1UA5A 5A34B 4MJEA 4OO4A 1V58A 3KMOA 4IN0A 1WPIA 2VCVA 3RHBA 2H1AA 3IAM2 2YWOA 2WVZA 4JZQA 4FH8A 1HYUA 3R3EA 4N30A 2C4JA 2MBTA 1A0FA 3IHGA 2B7JA 2JU5A 2YJ7A 4V1Ap 4XS4A 1BX9A 4GSTA 4PI0C 1T8EB 3TKSC 1XWAA 2LQQA 4XS4B 3RDWA 2DBCA 3DRNA 1F9MA 2GSRA 2CZ3A 5CRHA 2DJ1A 4N3ZA 1TJDA 4TRXA 4IW9A 3ZYWA 2GT5A 4CW9A 5CO3A 4ZL9A 4Z7XA 1YF0A 2OKAA 4NAXA 5J47A 1T7PB 1U6TA 2ALBA 3ZITA 2VCZA 1S3RA 4ISDA 5KOWA 1YDKA 4YKGA 3ZLPA 3RAZA 2YWNA 4MP4A 2H75A 2FA4A 1F37A 2B1KA 1OE8A 1TXUA 3FR3A 2ZUPA 4X0XA 5IMDA 3L0HA 4I2UA 1ML6A 2CQ9A 1K0OA 2LJRA 2CVDA 1T00A 3US3A 2LTKA 4E68A 5G1KA 3ZVJA 1M2AA 1A2JA 2FWEA 3TKSA 4ID0A 2JL4A 3HVVA 5EY6A 3GTUA 4NPBA 4I5QA 3APQA 4KCAA 3GTUB 4IKHA 3FR6A 3QFAC 1B9XC 3EINA 2HZEA 2K18A 20GSA 2KOKA 3FZ4A 4TN8A 2XBQA 1GTBA 4EIQA 1BG5A 2HZEB 1HNAA 1EEMA 3DMLA 2GT6A 3KMNA 1XOAA 2KLXA 1O6JA 1EGRA 4A5PA 1DE1A 1GWCA 5G5EA 1ZL9A 3DVXA 1IYHA 3IBHA 2OE1A 1HQOA 4CY8A 2BJXA 2IJYA 3TJBA 3BJ5A 1F6MC 4WBJA 1TK0B 1GSDA 1ABAA 3E9JB 3ERFA 3M8NA 1JZOA 2DSAA 3EU4A 3IR4A 2VL2C 5GAPD 4ZIJA 5J4VA 4WF5A 3W8JA 2MMNA 4BL7A 4ECBA 1X0RA 4OCFA 4AJ8A 4KNDA 3W6GA 5JCWA 1RK4A 4BL7B 1GSUA 3HYPA 4WKWA 2P0GA 1YVLA 4EXJA 3WT1A 4JR6A 1Z7RA 4KCEA 6GSWA 4MPFA 5EL8A 4BVXA 1TKDB 2HRAA 4TR0A 2R6KA 2FWHA 1O8XA 2YZHA 2YNXA 4BVXB 2VCQA 4L5LA 4ML1A 4I8BA 5KN1A 1GSYA 5B6NA 4K0NA 4N0ZA 3VWWA 3UBKA 1TU8A 2H72A 2KHPA 4Q5RA 4XS6A 4X43A 4KX4A 1EOHA 1XVQA 1O85A 2L57A 2DMLA 2X4AA 4PQ1A 3WD6A 4TW5A 4CDOA 3LSZA 5HR0A 2DJ3A 2VM2A 1GL8A 4TR4A 5BMUA 3EPTA 2FA8A 2F8FA 2V1MA 3BCKA 1GUKA 6GSSA 5BMUB 2FUG2 2DLXA 2I81A 2R3XA 2R0PA 2X8HA 2N5AA 4K7OA 1MTCA 5A1NA 2HXKA 2L5LA 5J5NA 3ZMLA 3GH9A 5A1NB 4OO5A 2IN3A 1I9DA 1BEDA 3G7JA 3EWLA 3MWHA 5FT3A 1V98A 2QSIA 1ZYQB 4O7HA 2IMDA 4ZILA 2X49A 4PI2C 5LD0A 3H93A 2CA8A 4K8MA 2O36A 1Z9HA 4IQAA 4OCEA 5JWRB 3D0ZA 1OVNA 2VL3A 4NV2A 4MJBA 4WXTA 1PKZA 3NZNA 1SL2B 2LNSA 5J4UA 1S4BP 1SVOA 3LYKA 2GZYA 1PGTA 5HR2A 3ZTLA 1GTIA 1PA3A 4POKA 4MA9A 5IMVA 3WGEA 3HKRA 2XC2A 4IP6A 1FHEA 4ZB8A 1ON4A 5EPFA 1M2BA 4PQHA 4KAEA 1XWGA 3F3RA 3APOA 4HOJA 3HDCA 6GSVA 12GSA 3A2WA 4CY6A 2YN1A 2ON7A 4ULXA 3Q74A 3FZAA 2R0GA 3C71A 3HCZA 3TJFA 4AJ6A 2JZSA 2OT3A 3IA1A 2OBKA 2IWTA 5CRDA 2HSHA 4KA0A 4PXOA 4KSOA 1H4OA 2C1YA 1M2DA 3DEXA 1LU4A 3ZMKA 3TCOA 4IELA 4GSSA 2WW3A 3VI7A 3GL3A 2CZ2A 2F9SA 4MK3A 1CQHA 1H75A 2I9HA 3UBLA 3D4MA 3EYTA 1ACVA 5CRGA 2MMZA 1YQ1A 2IMEA 4WEYA 4ZBBA 1SVMA 5F05A 2O87A 4V2NA 3LYPA 9GSSA 4GQCA 3HJPA 4KH7A 2P5QA 4K7NA 1Q98A 5EVOA 4O32A 1YZXA 2ES7A 1X5DA 4MMMA 1CQGA 3HY2A 4HQZA 5CP1A 5ELAA 3PR8A 1S3AA 1A2LA 2K8VA 3H79A 3HJMA 1PX6A 3APSA 3IAS2 5JCUA 1WIKA 2WVYA 3HA9A 3FR9A 5IM9A 5IMCA 4TR3A 4N0VA 1QFNA 2EIQA 2G2QA 4MZBA 3GUSA 4TR1A 4HEA2 3VURA 4GCIA 3ZZXA 1DE2A 2D2ZA 4TR1B 2XPDA 5ECHB 4O5QA 1R4WA 4PHZC 3TJKA 4I6XA 3QD9A 5AIXA 3GKKA 2ON5A 1A2MA 3TRQA 3P8WA 2HFDA 4G01A 2LRTA 3A5WA 2A2PA 3J7Yk 2WDUA 5H5QA 3HMJG 2VCTA 4MJAA 1V40A 2B6MA 2K9FA 3OR5A 3ERWA 3GIXA 4FYBA 3UL3A 2A4HA 3GKNA 4YKFA 3F9UA 5ECRB 5J4YA 1XG8A 2M80A 3DYRA 2VCXA 4L5OA 2VO4A 4KUNA 1QK8A 1S3DA 2YZUA 4MJCA 5KOXA 1LBKA 2DKHA 4F9ZA 3CSJA 5ECQB 2GQKA 1GULA 4MABA 3ZIVA 4V2MA 1PQNA 2NDOA 2XPEA 3ZL5A 4BVYA 2WFCA 2C0EA 6GSUA 5A4VA 4ZB7A 2OE3A 5GSSA 4BVYB 2H01A 3LXZA 2O8VB 4WETA 4LLRA 2H73A 1W89A 3UAPA 4MF7A 2GGTA 1ERUA 5IMFA 1AQVA 1BAYA 2WCIA 4F2IA 2L4QA 2E2GA 1THXA 2IIYA 4AF2A 2RM5A 2WULA 4YQMA 2DJ0A 1G6WA 3RPPA 1BJXA 2IMKA 2YOIA 3GURA 2EIOA 1B4QA 2MBSA 3Q19A 2H0GA 1TU7A 2OJLA 3LW9A 1A8LA 4NHWA 5D8IA 4AI6A 3LORA 4IJ3A 2HZFA 1SD9A 1Y1UA 1ZMAA 5F07A 1RW1A 1FB6A 5DQYA 5B6MA 1XZOA 1N8JA 5DJLA 1TRVA 1EP7A 2WW2A 1RQMA 1FG4A 1FVKA 1KTEA 4G19A 1U3AA 4BWSA 4GTUA 1BQ7A 2R37A 3VPTA 5DDLA 1JLVA 5A4WA 1F3BA 1WE0A 1Z3EA 2LS5A 5CNWA 3VLNA 2MMAA 2Z9SA 2I4AA 4ZBDA 6GSTA 2O7KA 1GNEA 2EFCA 4NMUA 1PD21 3F63A 1HD2A 2N5FA 3ZIJA 2PPTA 3P7XA 1G0TA 1U88A 2LQOA 1ZOFA 2R5GA 1YY7A 2WRTA 1JZWA 1IYIA 5B7CA 1K3OA 1Z6MA 1R5AA 3LFLA 2TIRA 1PFOA 1V9WA 3L78A 4RUVA 3TRPA 2RLIA 3MYDA 2H30A 2WW1A 4KE3A 4YQVA 3ZVJD 4F0CA 1O7UA 2N5BA 2R0CA 3HZ4A 4OMVA 2CAQA 3EVIA 1SD8A 2L4CA 2DMMA 4IGJA 1GUHA 3GKMA 2L6CA 2AJQB 4JRRA 3E0UA 3UARA 5GSTA 2FLSA 4PUFC 4EL1A 1JFUA 4WR5A 1SYXA 3IRAA 3KH7A 2J23A 4OFTA 1WMJA 2A2SA 1YEXA 3DWVA 4BIKA 5KN0A 5DALA 1ZYPA 4Z2UA 5D73A 1AUCA 1AQXA 3TOUA 4KDXA 2H0HA 2V41A 3CTGA 5DALB 4K1FA 4XIHA 3F4RA 2GZPA 1A0RP 4IJIA 3L9UA 1M9BA 1ERTA 4HDEA 4EC0A 4X4JA 2A2RA 3C73A 2GQMA 2O85A 5ECLB 3D22A 2O3EA 2K8SA 1T3BA 5IO0A 4E8EA 3HJOA 4G2EA 2G0FA 1USBA 4G10A 4YQUA 2PERA 5CRWA 4PQIA 4Q5FA 4QMKA 2DJ2A 1ERWA 4POLA 2H0IA 3M0FA 5DAKA 1AXDA 2DJKA 3IV4A 2VD1A 5AIVA 1FW1A 1GRXA 5DAKB 3WGDA 2WZ9A 2PGTA 2C0GA 4V2LA 2F51A 4EUYA 2HYXA 3V1WA 1VF4A 1X5CA 3CBUA 2O5VA 2DKIA 1I1IP 4KDUA 3H8QA 4F82A 3HVNA 2AB6A 1DSBA 4EKZA 2MZCA 2VLTA 3W8SA 4RQRA 5ECNB 5A5KA 3DGQA 1JZDA 3N9JA 3K8NA 1U3IA 4K0GA 1MD3A 3EURA 2CV4A 1QQ2A 4GXZA 5G31A 2FNOA 2UV8G 2M72A 1YF1A 2IL3A 3CQFA 2VL9A 5D9XA 3HVSA 4POBA 5JWQB 2VCWA 4HZ4A 1QXHA 2NTOA 2EFDA 1U87A 2H6ZA 2H8LA 2H6YA 4PGTA 3QAVA 4RI6A 5BRTA 2DIZA 4JEDA 1ST9A 2QC7A 4DEJA 1B48A 1K0AA 4TXOA 5F06A 1TTZA 2F3MA 4TXOB 3KCMA 5D96A 1NSWA 5HFKA 1B8XA 2GSSA 5IIZA 2BTOT 4WF4A 3ZFLA 3PPUA 3TUEA 2GSTA 2K6VA 2YPMA 2V6KA 4MDCA 1F2EA 2KUCA 1Z7PA 3Q6OA 4J57E 3GX0A 10GSA 3QR6A 2GDRA 4EDZA 1WJKA 1MDKA 5E59A 4GLTA 4ML6A 3P2AA 4MZCA 4XRDA 1URMA 2X99A 3F8UA 5ENUA 2H1BA 1M3IA 2DJJA 4WBRD 3O76A 3LEFA 3MSZA 3UIWA 3GH6A 1T4YA 3J7Yb 2TRCP 6GSYA 5A4UA 3LXTA 2OACA 2AAWA 3HXSA 2O89A 4I97A 1NHOA 4HSCX 1XOBA 1OAZA 1SENA 1QGVA 1FAAA 5AGYA 5IPGA 5D9WA 1K0DA 4O5UA 5E4WA 4MH3A 4KF9A 4ICYA 16GSA 4POMA 2V2GA 4K2DA 3EMPA 4HUAA 4JR4A 3DKSA 3HD5A 3M9JA 5ABRA 1B9YC 2CT6A 2MMOA 2PUKC 3PINA 4X1UA 2FGXA 5DBQA 1XCCA 2FHEA 2HE3A 4IVFA 2H74A 3F4TA 2H1GA 1SJIA 3CXGA 3FYGA 4NWYA 2CX4A 1V57A 3GNJA 2HSYA 2YANA 1SKRB 4YAVA 1G7EA 1Z5YE 1PSQA 3KD0A 2C80A 2AHEA 4K7IA 3L9SA 3DXBA 3U5RE 1OKDA 2RUFA 1NM3A 1SKSB 2HRKA 3KM6A 1W4VA 5IO2A 2HRKB 1EZKA 4NXIA 4XHMA 3FK8A 3LQ7A 3RHCA 2PVQA 1GTUA 2EIRA 1X9MB 2GVPA 3MDKA 1R5PA 3EE2A 3SWLA 1UN2A 2GLRA 5FWGA 1J08A 5HQPA 4K6XA 1TRWA 1TK8B 3KP8A 3VPQA 4L8EA 1TI1A 3TRXA 2H1DA 4EIPA 3BBYA 2QA1A 3ZREA 3SBCA 14GSA 2E0QA 1BG1A 4PX1A 3IC4A 2CAIA 1ERVA 2H66A 2DIYA 17GSA 2OADA 2X64A 4ECJA 2YV7A 1VRSD 4GWRA 1MEKA 3JCML 4YH2A 1I5GA 1J9BA 1Y6EA 4K5SA 3FKFA 1E2YA 3BD2A 2M46A 3GFKA 1FOVA 4P3YB 1E6BA 1Q4JA 4TOPA 2JZTA 3KGKA 4ZBAA 3UMAA 5F0GA 1EOGA 1JHBA 1EGOA 2LJAA 5ELGA 4BA7A 2XHFA 1PN9A 3UOMA 1KBNA 4EVMA 4KDYA 1GTAA 5ECPB 4DSQA 1WRYA 2PVOC 2YV9A 4MF6A 3I69A 2PWJA 4OFNA 2FWFA 1YKAA 3LWAA 1GSFA 3C7MA 2IMIA 2V6OA 1THOA 2IFQA 4NHZA 3QAGA 5G2ZA 1GLPA 3IXRA 1LJRA 2HRFA 5D93A 2IFQB 5G5FA 3CHXC 1TRUA 1M3JA 1HNCA 4HU9A 5COHA 1ILOA 5G30A 1SJZA 3RFRC 2LV3A 3UJ1A 2LNTA 1M7TA 4LL1B 13GSA 1ZZYA 1K3LA 1NHYA 1K0BA 3D5JA 4QL9A 3A3TA 1A8YA 1GP1A 4GRFA 2C3QA 3EC3A 1X9WB 4ILFA 3QCPA 3WGXA 1PX7A 3AY8A 2XBIA 1MD4A 4ZXGA 1KNGA 1OC3A 4GQFA 1G7OA 3TKRA 4AGSA 4ECIA 4FXYP 3IPZA 4ZL7A 1WOUA 3QMXA 4MH2A 3A2VA 5J41A 4J2FA 3ME7A 2H71A 3CSIA 18GSA 2PMTA 2LKUA 2FCHA 1BYEA 1B4PA 3E3EA 4RQXA 2C0DA 4LMVA 2HRNA 2WS2A 2R2JA 3L4NA 2C0FA 4NV5A 1EV9A 11GSA 3FY7A 3I9V2 3L9VA 4ZB6A 4BPYA 1WWJA 2WVXA 1OYJA 2LRNA 1VGLA 5DCHA 3M1GA 2WVXB 2JADA 3QOUA 4TXVA 3CWGA 3QFBC 3BCIA 4PTSA 3F0IA 1TW9A 1EEJA 5DCGA 5IQYA 2VIMA 3P90A 5H5RA 1TI3A 3O6TA 4MPGA 2RIIA 2OE0A 4TKYA 3D4TA 1G6YA 2JACA 5B8BA 2YP6A 1VF3A 2C8UA 4HI7A 1GH2A 3DIEA 2H1LA 3TJJA 4Z2TA 3C1RA 2VUPA 2LEGA 3IE3A 5G1LA 2WZSA 1JZRA 1T1VA 4XCSA 5KN2A 3UVTA 3VWUA 1AAZA 1KEBA 1QUWA 5HR3A 2EFHA 3FZ9A 1YEPA 4I2TA 1XFLA 3FW2A 2HSMA 2TRXA 2X8GA 1JLWA 2HSMB 1PL1A 1PN0A 1PMTA 2WB9A 4G9HA 1AQWA 1XW6A 2B5EA 1ZYEA 3GN3A 1DBYA 5A5HA 4KSMA 5GZZB 4ZB9A 7GSSA 5A5HB 1Y25A 2AV4A 4OD7A 1V2AA 5FHIA 2HI7A 5ECSA 4HU7A 5L71A 3IOSA 2C3TA 4HJMA 2H19A 3HZ8A 4L0WA 4IQ1A 3GRXA 5IOWA 2HLSA 3VI5A 5CYYA 1N25A 2AUVA 4XRAA 1AW9A 1PKWA 3TGZA 3WT2A 5ID2A 1SK2A 5DQSA 1J0FA 1YKCA 5ID2B 3TU3B 3GA4A 4O5RA 2V32A 1YJ6A 3VWXA 1OC9A 3DD3A 2B7KA 1XIYA 1OC9B 1TRSA 3ZRDA 1K0NA 1XW5A 3IK7A 5KEJA 3TKQA 1GLQA 2J9HA 1UVZA 4XS1A 3MIXA 1EV4A 5IMZA 3BOAA 2GS3A 2IPAA 2L59A 3N5OA 1FOHA 3CTFA 1SJ6A 1GSQA 3KTBA 2WJUA 2E7PA 4F03A 2A4VA 2CVKA 2ZCTA 1Z6NA 2NPBA 4AJ7A 4OWYA 4EE0A 2B3SA 4QL7A 3C8EA 4DVCA 5IOXA 3QAWA 4HQSA 4L0UA 2L6DA 2BMXA 4AKIA 5AN1A 4JU5A 4CHSA 2FD3A 1FO5A 4OFMA 4GDFA 5IMAA 2I3YA 2WGRA 2AYTA 2VD0A 2RM6A 4BWQA 1TOFA 4RI7A 5CREA 2QKEA 2NVLA 5IPHA 1NW2A 3CYNA 1HNBA 4PURA 5INYA 3KP9A 1TP9A 3O3TA 3FZ5A 3KIJA 1EWXA 3CRTA 5C00A 1O73A 3CRUA 5AISA 4PNGA 4USSA 1O81A 2VL2A 3TKSE 4HZ2A 4WR4A 2YJHA 1M9AA 2EFEA 4EO3A 4EDYA 3MNGA 4AKXB 1XPVA 5ECOB 5GAND 4MCUA 4DSSA 2H76A 4MF5A 5J40A 1XWKA 4ZL8A 4DSSB 1R7HA 3M9KA 2HSNA 4IS0A 2GZZA 4JE1A 4D73A 4KGIA 4LA1A 3FEUA 3VWVA 4V1Ag 3KZQA 3QDNA 5HR1A 3CMIA 3C1SA 5D9VA 5J3RA 2LJKA 4IBPA 2HSNB 1QMVA 4D73B 1SL1B 3UEMA 3KEBA 2I1UA 1AIUA 4EF0A 4W66A 2ZNMA 3Q18A 3KTLA 1VF1A 1GSEA 5B8AA 3KXOA 5CAXA 5F8BA 3R2QA 5DJMA 2VLUA 2UZ8A 3EU3A 4Z2RA 4MLYA 3FHKA 1OKTA 5ECMB 2RUEA 3A5IA 2REMA 1SU9A 1T4ZA 3I6AA 2H6XA 2QGVA 3F3QA 3HHVA 3G9BA 2B1LA 1XW9A 3F4SA 3GKXA 4LL4B 3G7IA 2JZRA 4G0IA 1ZGNA 1OE7A 3M3MA 1X9SB 1PL2A 3U6VA 1BF5A 1A24A 2CVBA 3ERGA 1SK0A 3PH9A 1O8WA 2L5OA 2LSTA 3D21A 3LJRA 3GHAA 3EMXA 2PBJA 3ED3A 3VFIA 4GSNA 5H5SA 4Q5QA 2P5RA 3RGBC 4HS1A 3HVXA 3GSTA 4KW6A 3CSHA 3NIVA 4G0KA 2P31A 3KH9A 1FVJA 3WYWA 3DVWA 4KB3A 5JWOB 1A23A 2VKZG 3IK9A 2YWIA 2JSYA 2NBSA 1X5EA 3GYKA 2B5YA 4XTSA 1PRXA 1VF2A 1TDIA 22GSA 3TB2A 1TK5B 3GL5A 1S3CA 4AKHA 1SK1A 3G7YA 2GTUA 2R4VA 4HJ2A 1K0CA 4K5RA 1SVLA 1ZCPA 3ZFBA 2IMFA 4LMWA 4JBBA 3PGTA 1XWBA 2FY6A 2GQLA 4ECCA 5KN3A 2QA2A 3F6DA 4FQUA 2KP2A 3S9FA 2JSZA 4ACSA 3IDVA 1AC1A 3FMWA 3TKPA 3H1NA 1K3YA 5J9BA 5C04A 4IHUA 5LNKe 5J9CA 1MDIA 2LUSA 4IP1A 2EC4A 1F3AA 2HT9A 19GSA 4YAPA 1N2AA 1UC7A 3GX8A 2CX3A 3KJYA 2H70A 5LCZA 2B5XA 2E2MA 4N11A 1ZYNA 5ECKB 3ME8A 4H86A 2PU9C 5D9TA
chains in the Genus database with same CATH topology
2VAFA 1SKWB 3IC8A 4O92A 6GSXA 3MAKA 4N10A 1M0UA 2KP1A 1GSSA 1GUMA 4MZWA 1MDJA 2F8AA 1XVWA 3TJGA 5JCGA 3QPMA 4MNNA 1SYRA 2VOCA 1GNWA 1R26A 4J56E 5ECIB 2DC5A 2HNLA 4TVEA 1EP8A 5HFIA 2GSQA 2LRCA 3I43A 4Q5NA 4E8HA 4FIWA 1TXXA 2VLVA 3VK9A 4AKGA 1FB0A 2PN8A 1SL0B 1XWCA 3D6IA 2C3NA 4G0LA 4K2XA 4PNFA 1M99A 8GSSA 3NOFA 3GMFA 5HFGA 4PUAA 1K0MA 4QQ7A 3H4KA 4FYUA 1DUGA 3A2XA 3RPNA 3GV1A 3TDGA 3RBTA 3UVHA 3LG6A 1XBSA 3F6FA 2HQTA 2VM1A 5DVBA 1C72A 3TOTA 1WP0A 4GF0A 3ISOA 4F0BA 2MYGA 2OBIA 3IHQA 4DSRA 3FRCA 2OA7A 2X8CA 3LGCA 5A34A 1XXUA 4K9ZA 3GSSA 2YWMA 2FWGA 4FYCA 1OC8A 4FO5A 2YCDA 1UA5A 5A34B 4MJEA 4OO4A 1V58A 3KMOA 4IN0A 1WPIA 2VCVA 3RHBA 2H1AA 3IAM2 2YWOA 4JZQA 4FH8A 1HYUA 3R3EA 4N30A 2C4JA 2MBTA 1A0FA 3IHGA 2B7JA 2JU5A 2YJ7A 4V1Ap 4XS4A 1BX9A 4GSTA 1T8EB 3TKSC 1XWAA 2LQQA 4XS4B 3RDWA 2DBCA 3DRNA 1F9MA 2GSRA 2CZ3A 5CRHA 2DJ1A 4N3ZA 1TJDA 4TRXA 4IW9A 3ZYWA 2GT5A 4CW9A 5CO3A 4ZL9A 4Z7XA 1YF0A 2OKAA 4NAXA 5J47A 1T7PB 1U6TA 2ALBA 3ZITA 2VCZA 4ISDA 5KOWA 1YDKA 4YKGA 3ZLPA 3RAZA 2YWNA 4MP4A 2H75A 2FA4A 1F37A 2B1KA 1OE8A 1TXUA 3FR3A 2ZUPA 4X0XA 5IMDA 3L0HA 4I2UA 1ML6A 2CQ9A 1K0OA 2LJRA 2CVDA 1T00A 3US3A 2LTKA 4E68A 5G1KA 3ZVJA 1M2AA 1A2JA 2FWEA 3TKSA 4ID0A 2JL4A 3HVVA 5EY6A 3GTUA 4NPBA 4I5QA 3APQA 4KCAA 3GTUB 4IKHA 3FR6A 3QFAC 1B9XC 3EINA 2HZEA 2K18A 20GSA 2KOKA 3FZ4A 4TN8A 2XBQA 1GTBA 4EIQA 1BG5A 2HZEB 1HNAA 1EEMA 3DMLA 2GT6A 3KMNA 1XOAA 2KLXA 1O6JA 1EGRA 4A5PA 1DE1A 1GWCA 5G5EA 1ZL9A 3DVXA 1IYHA 3IBHA 2OE1A 1HQOA 4CY8A 2BJXA 2IJYA 3TJBA 3BJ5A 1F6MC 4WBJA 1TK0B 1GSDA 1ABAA 3E9JB 3ERFA 3M8NA 1JZOA 2DSAA 3EU4A 3IR4A 2VL2C 5GAPD 4ZIJA 5J4VA 4WF5A 3W8JA 2MMNA 4BL7A 4ECBA 1X0RA 4OCFA 4AJ8A 4KNDA 3W6GA 5JCWA 1RK4A 4BL7B 1GSUA 3HYPA 4WKWA 2P0GA 1YVLA 4EXJA 3WT1A 4JR6A 1Z7RA 4KCEA 6GSWA 4MPFA 5EL8A 4BVXA 1TKDB 2HRAA 4TR0A 2R6KA 2FWHA 1O8XA 2YZHA 2YNXA 4BVXB 2VCQA 4L5LA 4ML1A 4I8BA 5KN1A 1GSYA 5B6NA 4K0NA 4N0ZA 3VWWA 3UBKA 1TU8A 2H72A 2KHPA 4Q5RA 4XS6A 4X43A 4KX4A 1EOHA 1XVQA 1O85A 2L57A 2DMLA 2X4AA 4PQ1A 3WD6A 4TW5A 4CDOA 3LSZA 5HR0A 2DJ3A 2VM2A 1GL8A 4TR4A 5BMUA 3EPTA 2FA8A 2F8FA 2V1MA 3BCKA 1GUKA 6GSSA 5BMUB 2FUG2 2DLXA 2I81A 2R3XA 2R0PA 2X8HA 2N5AA 4K7OA 1MTCA 5A1NA 2HXKA 2L5LA 5J5NA 3ZMLA 3GH9A 5A1NB 4OO5A 2IN3A 1I9DA 1BEDA 3G7JA 3EWLA 3MWHA 5FT3A 1V98A 2QSIA 1ZYQB 4O7HA 2IMDA 4ZILA 2X49A 5LD0A 3H93A 2CA8A 4K8MA 1Z9HA 4IQAA 4OCEA 5JWRB 3D0ZA 1OVNA 2VL3A 4NV2A 4MJBA 4WXTA 1PKZA 3NZNA 1SL2B 2LNSA 5J4UA 1SVOA 3LYKA 2GZYA 1PGTA 5HR2A 3ZTLA 1GTIA 1PA3A 4POKA 4MA9A 5IMVA 3WGEA 3HKRA 2XC2A 4IP6A 1FHEA 4ZB8A 1ON4A 5EPFA 1M2BA 4PQHA 4KAEA 1XWGA 3F3RA 3APOA 4HOJA 3HDCA 6GSVA 12GSA 3A2WA 4CY6A 2YN1A 2ON7A 4ULXA 3Q74A 3FZAA 2R0GA 3C71A 3HCZA 3TJFA 4AJ6A 2JZSA 2OT3A 3IA1A 2OBKA 2IWTA 5CRDA 2HSHA 4KA0A 4PXOA 4KSOA 1H4OA 2C1YA 1M2DA 3DEXA 1LU4A 3ZMKA 3TCOA 4IELA 4GSSA 3VI7A 3GL3A 2CZ2A 2F9SA 4MK3A 1CQHA 1H75A 2I9HA 3UBLA 3D4MA 3EYTA 1ACVA 5CRGA 2MMZA 1YQ1A 2IMEA 4WEYA 4ZBBA 1SVMA 5F05A 2O87A 4V2NA 3LYPA 9GSSA 4GQCA 3HJPA 4KH7A 2P5QA 4K7NA 1Q98A 5EVOA 4O32A 1YZXA 2ES7A 1X5DA 4MMMA 1CQGA 3HY2A 4HQZA 5CP1A 5ELAA 3PR8A 1S3AA 1A2LA 2K8VA 3H79A 3HJMA 1PX6A 3APSA 3IAS2 5JCUA 1WIKA 3HA9A 3FR9A 5IM9A 5IMCA 4TR3A 4N0VA 1QFNA 2EIQA 2G2QA 4MZBA 3GUSA 4TR1A 4HEA2 3VURA 4GCIA 3ZZXA 1DE2A 2D2ZA 4TR1B 2XPDA 5ECHB 4O5QA 1R4WA 3TJKA 4I6XA 3QD9A 5AIXA 3GKKA 2ON5A 1A2MA 3TRQA 3P8WA 2HFDA 4G01A 2LRTA 3A5WA 2A2PA 3J7Yk 2WDUA 5H5QA 3HMJG 2VCTA 4MJAA 1V40A 2B6MA 2K9FA 3OR5A 3ERWA 3GIXA 4FYBA 3UL3A 2A4HA 3GKNA 4YKFA 3F9UA 5ECRB 5J4YA 2M80A 3DYRA 2VCXA 4L5OA 2VO4A 4KUNA 1QK8A 1S3DA 2YZUA 4MJCA 5KOXA 1LBKA 2DKHA 4F9ZA 3CSJA 5ECQB 2GQKA 1GULA 4MABA 3ZIVA 4V2MA 1PQNA 2NDOA 2XPEA 3ZL5A 4BVYA 2WFCA 2C0EA 6GSUA 5A4VA 4ZB7A 2OE3A 5GSSA 4BVYB 2H01A 3LXZA 2O8VB 4WETA 4LLRA 2H73A 1W89A 3UAPA 4MF7A 2GGTA 1ERUA 5IMFA 1AQVA 1BAYA 2WCIA 4F2IA 2L4QA 2E2GA 1THXA 2IIYA 4AF2A 2RM5A 2WULA 4YQMA 2DJ0A 1G6WA 3RPPA 1BJXA 2IMKA 2YOIA 3GURA 2EIOA 1B4QA 2MBSA 3Q19A 2H0GA 1TU7A 2OJLA 3LW9A 1A8LA 4NHWA 5D8IA 4AI6A 3LORA 4IJ3A 2HZFA 1SD9A 1Y1UA 1ZMAA 5F07A 1RW1A 1FB6A 5DQYA 5B6MA 1XZOA 1N8JA 5DJLA 1TRVA 1EP7A 1RQMA 1FG4A 1FVKA 1KTEA 4G19A 1U3AA 4BWSA 4GTUA 1BQ7A 2R37A 3VPTA 5DDLA 1JLVA 5A4WA 1F3BA 1WE0A 1Z3EA 2LS5A 5CNWA 3VLNA 2MMAA 2Z9SA 2I4AA 4ZBDA 6GSTA 2O7KA 1GNEA 2EFCA 4NMUA 1PD21 3F63A 1HD2A 2N5FA 3ZIJA 2PPTA 3P7XA 1G0TA 1U88A 2LQOA 1ZOFA 2R5GA 1YY7A 2WRTA 1JZWA 1IYIA 5B7CA 1K3OA 1Z6MA 1R5AA 3LFLA 2TIRA 1V9WA 3L78A 4RUVA 3TRPA 2RLIA 3MYDA 2H30A 4KE3A 4YQVA 3ZVJD 4F0CA 1O7UA 2N5BA 2R0CA 3HZ4A 4OMVA 2CAQA 3EVIA 1SD8A 2L4CA 2DMMA 4IGJA 1GUHA 3GKMA 2L6CA 2AJQB 4JRRA 3E0UA 3UARA 5GSTA 2FLSA 4PUFC 4EL1A 1JFUA 4WR5A 1SYXA 3IRAA 3KH7A 2J23A 4OFTA 1WMJA 2A2SA 1YEXA 3DWVA 5KN0A 5DALA 1ZYPA 4Z2UA 5D73A 1AUCA 1AQXA 3TOUA 4KDXA 2H0HA 2V41A 3CTGA 5DALB 4K1FA 4XIHA 3F4RA 2GZPA 1A0RP 4IJIA 3L9UA 1M9BA 1ERTA 4HDEA 4EC0A 4X4JA 2A2RA 3C73A 2GQMA 2O85A 5ECLB 3D22A 2K8SA 1T3BA 5IO0A 4E8EA 3HJOA 4G2EA 2G0FA 1USBA 4G10A 4YQUA 2PERA 5CRWA 4PQIA 4Q5FA 4QMKA 2DJ2A 1ERWA 4POLA 2H0IA 3M0FA 5DAKA 1AXDA 2DJKA 3IV4A 2VD1A 5AIVA 1FW1A 1GRXA 5DAKB 3WGDA 2WZ9A 2PGTA 2C0GA 4V2LA 2F51A 4EUYA 2HYXA 3V1WA 1VF4A 1X5CA 3CBUA 2O5VA 2DKIA 4KDUA 3H8QA 4F82A 2AB6A 1DSBA 4EKZA 2MZCA 2VLTA 3W8SA 4RQRA 5ECNB 5A5KA 3DGQA 1JZDA 3N9JA 3K8NA 1U3IA 4K0GA 1MD3A 3EURA 2CV4A 1QQ2A 4GXZA 5G31A 2FNOA 2UV8G 2M72A 1YF1A 2IL3A 2VL9A 5D9XA 3HVSA 4POBA 5JWQB 2VCWA 4HZ4A 1QXHA 2NTOA 2EFDA 1U87A 2H6ZA 2H8LA 2H6YA 4PGTA 3QAVA 4RI6A 5BRTA 2DIZA 4JEDA 1ST9A 2QC7A 4DEJA 1B48A 1K0AA 4TXOA 5F06A 1TTZA 2F3MA 4TXOB 3KCMA 5D96A 1NSWA 5HFKA 1B8XA 2GSSA 5IIZA 2BTOT 4WF4A 3ZFLA 3PPUA 3TUEA 2GSTA 2K6VA 2YPMA 2V6KA 4MDCA 1F2EA 2KUCA 1Z7PA 3Q6OA 4J57E 3GX0A 10GSA 3QR6A 2GDRA 4EDZA 1WJKA 1MDKA 5E59A 4GLTA 4ML6A 3P2AA 4MZCA 4XRDA 1URMA 2X99A 3F8UA 5ENUA 2H1BA 2DJJA 4WBRD 3O76A 3LEFA 3MSZA 3UIWA 3GH6A 1T4YA 3J7Yb 2TRCP 6GSYA 5A4UA 3LXTA 2OACA 2AAWA 3HXSA 2O89A 4I97A 1NHOA 1XOBA 1OAZA 1SENA 1QGVA 1FAAA 5AGYA 5IPGA 5D9WA 1K0DA 4O5UA 5E4WA 4MH3A 4KF9A 4ICYA 16GSA 4POMA 2V2GA 4K2DA 3EMPA 4HUAA 4JR4A 3DKSA 3HD5A 3M9JA 5ABRA 1B9YC 2CT6A 2MMOA 2PUKC 3PINA 4X1UA 2FGXA 5DBQA 1XCCA 2FHEA 2HE3A 4IVFA 2H74A 3F4TA 2H1GA 1SJIA 3CXGA 3FYGA 4NWYA 2CX4A 1V57A 3GNJA 2HSYA 2YANA 1SKRB 4YAVA 1G7EA 1Z5YE 1PSQA 3KD0A 2C80A 2AHEA 4K7IA 3L9SA 3DXBA 3U5RE 1OKDA 2RUFA 1NM3A 1SKSB 2HRKA 3KM6A 1W4VA 5IO2A 2HRKB 1EZKA 4NXIA 4XHMA 3FK8A 3LQ7A 3RHCA 2PVQA 1GTUA 2EIRA 1X9MB 2GVPA 3MDKA 1R5PA 3EE2A 3SWLA 1UN2A 2GLRA 5FWGA 1J08A 5HQPA 4K6XA 1TRWA 1TK8B 3KP8A 3VPQA 4L8EA 1TI1A 3TRXA 2H1DA 4EIPA 3BBYA 2QA1A 3ZREA 3SBCA 14GSA 2E0QA 1BG1A 4PX1A 3IC4A 2CAIA 1ERVA 2H66A 2DIYA 17GSA 2OADA 2X64A 4ECJA 2YV7A 1VRSD 4GWRA 1MEKA 3JCML 4YH2A 1I5GA 1J9BA 1Y6EA 4K5SA 3FKFA 1E2YA 3BD2A 2M46A 3GFKA 1FOVA 4P3YB 1E6BA 1Q4JA 4TOPA 2JZTA 3KGKA 4ZBAA 3UMAA 5F0GA 1EOGA 1JHBA 1EGOA 2LJAA 5ELGA 4BA7A 2XHFA 1PN9A 3UOMA 1KBNA 4EVMA 4KDYA 1GTAA 5ECPB 4DSQA 1WRYA 2PVOC 2YV9A 4MF6A 3I69A 2PWJA 4OFNA 2FWFA 1YKAA 3LWAA 1GSFA 3C7MA 2IMIA 2V6OA 1THOA 2IFQA 4NHZA 3QAGA 5G2ZA 1GLPA 3IXRA 1LJRA 2HRFA 5D93A 2IFQB 5G5FA 1TRUA 1HNCA 4HU9A 5COHA 1ILOA 5G30A 1SJZA 2LV3A 3UJ1A 2LNTA 1M7TA 4LL1B 13GSA 1ZZYA 1K3LA 1NHYA 1K0BA 3D5JA 4QL9A 3A3TA 1A8YA 1GP1A 4GRFA 2C3QA 3EC3A 1X9WB 4ILFA 3QCPA 3WGXA 1PX7A 3AY8A 2XBIA 1MD4A 4ZXGA 1KNGA 1OC3A 4GQFA 1G7OA 3TKRA 4AGSA 4ECIA 3IPZA 4ZL7A 1WOUA 3QMXA 4MH2A 3A2VA 5J41A 4J2FA 3ME7A 2H71A 3CSIA 18GSA 2PMTA 2LKUA 2FCHA 1BYEA 1B4PA 3E3EA 4RQXA 2C0DA 4LMVA 2HRNA 2WS2A 2R2JA 3L4NA 2C0FA 4NV5A 1EV9A 11GSA 3FY7A 3I9V2 3L9VA 4ZB6A 4BPYA 1WWJA 1OYJA 2LRNA 1VGLA 5DCHA 3M1GA 3QOUA 2JADA 4TXVA 3CWGA 3QFBC 3BCIA 4PTSA 3F0IA 1TW9A 1EEJA 5DCGA 5IQYA 2VIMA 3P90A 5H5RA 1TI3A 3O6TA 4MPGA 2RIIA 2OE0A 4TKYA 3D4TA 1G6YA 2JACA 5B8BA 2YP6A 1VF3A 2C8UA 4HI7A 1GH2A 3DIEA 2H1LA 3TJJA 4Z2TA 3C1RA 2VUPA 2LEGA 3IE3A 5G1LA 1JZRA 1T1VA 4XCSA 5KN2A 3UVTA 3VWUA 1AAZA 1KEBA 1QUWA 5HR3A 2EFHA 3FZ9A 1YEPA 4I2TA 1XFLA 3FW2A 2HSMA 2TRXA 2X8GA 1JLWA 2HSMB 1PL1A 1PN0A 1PMTA 2WB9A 4G9HA 1AQWA 1XW6A 2B5EA 1ZYEA 3GN3A 1DBYA 5A5HA 4KSMA 5GZZB 4ZB9A 7GSSA 5A5HB 1Y25A 2AV4A 4OD7A 1V2AA 5FHIA 2HI7A 5ECSA 4HU7A 5L71A 3IOSA 2C3TA 4HJMA 2H19A 3HZ8A 4L0WA 4IQ1A 3GRXA 5IOWA 2HLSA 3VI5A 5CYYA 1N25A 2AUVA 4XRAA 1AW9A 1PKWA 3TGZA 3WT2A 5ID2A 1SK2A 5DQSA 1J0FA 1YKCA 5ID2B 3TU3B 3GA4A 4O5RA 2V32A 1YJ6A 3VWXA 1OC9A 3DD3A 2B7KA 1XIYA 1OC9B 1TRSA 3ZRDA 1K0NA 1XW5A 3IK7A 5KEJA 3TKQA 1GLQA 2J9HA 1UVZA 4XS1A 3MIXA 1EV4A 5IMZA 3BOAA 2GS3A 2IPAA 2L59A 3N5OA 1FOHA 3CTFA 1SJ6A 1GSQA 3KTBA 2WJUA 2E7PA 4F03A 2A4VA 2CVKA 2ZCTA 1Z6NA 2NPBA 4AJ7A 4OWYA 4EE0A 2B3SA 4QL7A 3C8EA 4DVCA 5IOXA 3QAWA 4HQSA 4L0UA 2L6DA 2BMXA 4AKIA 5AN1A 4JU5A 4CHSA 2FD3A 1FO5A 4OFMA 4GDFA 5IMAA 2I3YA 2WGRA 2AYTA 2VD0A 2RM6A 4BWQA 1TOFA 4RI7A 5CREA 2QKEA 2NVLA 5IPHA 1NW2A 3CYNA 1HNBA 4PURA 5INYA 3KP9A 1TP9A 3O3TA 3FZ5A 3KIJA 1EWXA 3CRTA 5C00A 1O73A 3CRUA 5AISA 4PNGA 4USSA 1O81A 2VL2A 3TKSE 4HZ2A 4WR4A 2YJHA 1M9AA 2EFEA 4EO3A 4EDYA 3MNGA 4AKXB 1XPVA 5ECOB 5GAND 4MCUA 4DSSA 2H76A 4MF5A 5J40A 1XWKA 4ZL8A 4DSSB 1R7HA 3M9KA 2HSNA 4IS0A 2GZZA 4JE1A 4D73A 4KGIA 4LA1A 3FEUA 3VWVA 4V1Ag 3KZQA 3QDNA 5HR1A 3CMIA 3C1SA 5D9VA 5J3RA 2LJKA 4IBPA 2HSNB 1QMVA 4D73B 1SL1B 3UEMA 3KEBA 2I1UA 1AIUA 4EF0A 4W66A 2ZNMA 3Q18A 3KTLA 1VF1A 1GSEA 5B8AA 3KXOA 5CAXA 5F8BA 3R2QA 5DJMA 2VLUA 2UZ8A 3EU3A 4Z2RA 4MLYA 3FHKA 1OKTA 5ECMB 2RUEA 3A5IA 2REMA 1SU9A 1T4ZA 3I6AA 2H6XA 2QGVA 3F3QA 3HHVA 3G9BA 2B1LA 1XW9A 3F4SA 3GKXA 4LL4B 3G7IA 2JZRA 4G0IA 1ZGNA 1OE7A 3M3MA 1X9SB 1PL2A 3U6VA 1BF5A 1A24A 2CVBA 3ERGA 1SK0A 3PH9A 1O8WA 2L5OA 2LSTA 3D21A 3LJRA 3GHAA 3EMXA 2PBJA 3ED3A 3VFIA 4GSNA 5H5SA 4Q5QA 2P5RA 4HS1A 3HVXA 3GSTA 4KW6A 3CSHA 3NIVA 4G0KA 2P31A 3KH9A 1FVJA 3WYWA 3DVWA 4KB3A 5JWOB 1A23A 2VKZG 3IK9A 2YWIA 2JSYA 2NBSA 1X5EA 3GYKA 2B5YA 4XTSA 1PRXA 1VF2A 1TDIA 22GSA 3TB2A 1TK5B 3GL5A 1S3CA 4AKHA 1SK1A 3G7YA 2GTUA 2R4VA 4HJ2A 1K0CA 4K5RA 1SVLA 1ZCPA 3ZFBA 2IMFA 4LMWA 4JBBA 3PGTA 1XWBA 2FY6A 2GQLA 4ECCA 5KN3A 2QA2A 3F6DA 4FQUA 2KP2A 3S9FA 2JSZA 4ACSA 3IDVA 1AC1A 3FMWA 3TKPA 3H1NA 1K3YA 5J9BA 5C04A 4IHUA 5LNKe 5J9CA 1MDIA 2LUSA 4IP1A 2EC4A 1F3AA 2HT9A 19GSA 4YAPA 1N2AA 1UC7A 3GX8A 2CX3A 3KJYA 2H70A 5LCZA 2B5XA 2E2MA 4N11A 1ZYNA 5ECKB 3ME8A 4H86A 2PU9C 5D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VAF A;  1SKW B;  3IC8 A;  4O92 A;  6GSX A;  3MAK A;  4N10 A;  1M0U A;  2KP1 A;  1GSS A;  1GUM A;  4MZW A;  1MDJ A;  2F8A A;  1XVW A;  3TJG A;  5JCG A;  3QPM A;  1SYR A;  2VOC A;  1GNW A;  1R26 A;  4J56 E;  5ECI B;  2DC5 A;  2HNL A;  4TVE A;  1EP8 A;  5HFI A;  2GSQ A;  2LRC A;  3I43 A;  4Q5N A;  4E8H A;  4FIW A;  1TXX A;  2VLV A;  3VK9 A;  1FB0 A;  2PN8 A;  1SL0 B;  1XWC A;  3D6I A;  2C3N A;  4G0L A;  4PNF A;  1M99 A;  8GSS A;  3NOF A;  3GMF A;  5HFG A;  4PUA A;  1K0M A;  4QQ7 A;  3H4K A;  4FYU A;  1DUG A;  3A2X A;  3RPN A;  3GV1 A;  3TDG A;  3RBT A;  3UVH A;  3LG6 A;  1XBS A;  3F6F A;  2HQT A;  2VM1 A;  5DVB A;  1C72 A;  3TOT A;  1WP0 A;  4GF0 A;  3ISO A;  4F0B A;  2MYG A;  2OBI A;  3IHQ A;  4DSR A;  3FRC A;  2OA7 A;  2X8C A;  3LGC A;  1XXU A;  4K9Z A;  3GSS A;  2YWM A;  2FWG A;  4FYC A;  1OC8 A;  4FO5 A;  2YCD A;  1UA5 A;  4MJE A;  4OO4 A;  1V58 A;  3KMO A;  4IN0 A;  1WPI A;  2VCV A;  3RHB A;  2H1A A;  3IAM 2;  2YWO A;  4JZQ A;  4FH8 A;  1HYU A;  3R3E A;  4N30 A;  2C4J A;  2MBT A;  1A0F A;  2B7J A;  2JU5 A;  2YJ7 A;  4V1A p;  4XS4 A;  1BX9 A;  4GST A;  1T8E B;  3TKS C;  1XWA A;  2LQQ A;  4XS4 B;  3RDW A;  2DBC A;  3DRN A;  1F9M A;  2GSR A;  2CZ3 A;  5CRH A;  2DJ1 A;  1TJD A;  4TRX A;  4IW9 A;  3ZYW A;  2GT5 A;  4CW9 A;  5CO3 A;  4ZL9 A;  4Z7X A;  1YF0 A;  2OKA A;  4NAX A;  1T7P B;  1U6T A;  2ALB A;  3ZIT A;  2VCZ A;  4ISD A;  1YDK A;  3ZLP A;  3RAZ A;  2YWN A;  4MP4 A;  2H75 A;  2FA4 A;  1F37 A;  2B1K A;  1OE8 A;  3FR3 A;  2ZUP A;  4X0X A;  5IMD A;  3L0H A;  4I2U A;  1ML6 A;  2CQ9 A;  1K0O A;  2LJR A;  2CVD A;  1T00 A;  3US3 A;  2LTK A;  5G1K A;  3ZVJ A;  1M2A A;  1A2J A;  2FWE A;  3TKS A;  4ID0 A;  2JL4 A;  3HVV A;  5EY6 A;  3GTU A;  4NPB A;  4I5Q A;  3APQ A;  4KCA A;  3GTU B;  4IKH A;  3FR6 A;  3QFA C;  1B9X C;  3EIN A;  2HZE A;  2K18 A;  20GS A;  2KOK A;  3FZ4 A;  4TN8 A;  2XBQ A;  1GTB A;  1BG5 A;  2HZE B;  1HNA A;  1EEM A;  3DML A;  2GT6 A;  3KMN A;  1XOA A;  2KLX A;  1O6J A;  1EGR A;  1DE1 A;  1GWC A;  5G5E A;  1ZL9 A;  3DVX A;  1IYH A;  3IBH A;  2OE1 A;  1HQO A;  2BJX A;  2IJY A;  3TJB A;  3BJ5 A;  1F6M C;  4WBJ A;  1TK0 B;  1GSD A;  1ABA A;  3E9J B;  3ERF A;  3M8N A;  1JZO A;  2DSA A;  3EU4 A;  3IR4 A;  2VL2 C;  5GAP D;  4ZIJ A;  4WF5 A;  3W8J A;  2MMN A;  4BL7 A;  4ECB A;  1X0R A;  4OCF A;  4AJ8 A;  4KND A;  3W6G A;  5JCW A;  1RK4 A;  4BL7 B;  1GSU A;  3HYP A;  4WKW A;  2P0G A;  4EXJ A;  3WT1 A;  4JR6 A;  1Z7R A;  4KCE A;  6GSW A;  4MPF A;  5EL8 A;  4BVX A;  1TKD B;  2HRA A;  4TR0 A;  2R6K A;  2FWH A;  1O8X A;  2YZH A;  2YNX A;  4BVX B;  2VCQ A;  4L5L A;  4ML1 A;  4I8B A;  5KN1 A;  1GSY A;  5B6N A;  4K0N A;  4N0Z A;  3VWW A;  3UBK A;  1TU8 A;  2H72 A;  2KHP A;  4Q5R A;  4XS6 A;  4X43 A;  4KX4 A;  1EOH A;  1XVQ A;  1O85 A;  2L57 A;  2DML A;  4PQ1 A;  3WD6 A;  4TW5 A;  4CDO A;  3LSZ A;  5HR0 A;  2DJ3 A;  2VM2 A;  1GL8 A;  4TR4 A;  5BMU A;  2FA8 A;  2F8F A;  2V1M A;  3BCK A;  1GUK A;  6GSS A;  2FUG 2;  2DLX A;  2I81 A;  2R3X A;  2X8H A;  2N5A A;  4K7O A;  1MTC A;  2HXK A;  2L5L A;  5J5N A;  3ZML A;  3GH9 A;  4OO5 A;  2IN3 A;  1I9D A;  1BED A;  3G7J A;  3EWL A;  3MWH A;  5FT3 A;  1V98 A;  2QSI A;  1ZYQ B;  4O7H A;  2IMD A;  4ZIL A;  5LD0 A;  3H93 A;  2CA8 A;  4K8M A;  1Z9H A;  4IQA A;  4OCE A;  5JWR B;  3D0Z A;  1OVN A;  2VL3 A;  4NV2 A;  4MJB A;  4WXT A;  1PKZ A;  3NZN A;  1SL2 B;  2LNS A;  5J4U A;  2GZY A;  3LYK A;  1PGT A;  5HR2 A;  3ZTL A;  1GTI A;  1PA3 A;  4POK A;  4MA9 A;  5IMV A;  3WGE A;  3HKR A;  2XC2 A;  4IP6 A;  1FHE A;  4ZB8 A;  1ON4 A;  5EPF A;  1M2B A;  4PQH A;  4KAE A;  1XWG A;  3F3R A;  3APO A;  4HOJ A;  3HDC A;  6GSV A;  12GS A;  3A2W A;  2YN1 A;  2ON7 A;  4ULX A;  3Q74 A;  3FZA A;  3C71 A;  3HCZ A;  3TJF A;  4AJ6 A;  2JZS A;  3IA1 A;  2OBK A;  2IWT A;  5CRD A;  2HSH A;  4KA0 A;  4PXO A;  4KSO A;  1H4O A;  2C1Y A;  1M2D A;  3DEX A;  1LU4 A;  3ZMK A;  3TCO A;  4IEL A;  4GSS A;  3VI7 A;  3GL3 A;  2CZ2 A;  2F9S A;  4MK3 A;  1CQH A;  1H75 A;  2I9H A;  3UBL A;  3D4M A;  3EYT A;  1ACV A;  5CRG A;  2MMZ A;  1YQ1 A;  2IME A;  4WEY A;  4ZBB A;  5F05 A;  2O87 A;  4V2N A;  3LYP A;  9GSS A;  4GQC A;  3HJP A;  4KH7 A;  2P5Q A;  4K7N A;  1Q98 A;  5EVO A;  4O32 A;  1YZX A;  2ES7 A;  1X5D A;  4MMM A;  1CQG A;  3HY2 A;  4HQZ A;  5CP1 A;  5ELA A;  3PR8 A;  1S3A A;  1A2L A;  2K8V A;  3H79 A;  3HJM A;  1PX6 A;  3APS A;  3IAS 2;  5JCU A;  1WIK A;  3HA9 A;  3FR9 A;  5IM9 A;  5IMC A;  4TR3 A;  4N0V A;  1QFN A;  2EIQ A;  2G2Q A;  4MZB A;  3GUS A;  4TR1 A;  4HEA 2;  3VUR A;  4GCI A;  3ZZX A;  1DE2 A;  2D2Z A;  4TR1 B;  2XPD A;  5ECH B;  1R4W A;  3TJK A;  4I6X A;  3QD9 A;  5AIX A;  3GKK A;  2ON5 A;  1A2M A;  3TRQ A;  3P8W A;  2HFD A;  2LRT A;  3A5W A;  3J7Y k;  2WDU A;  5H5Q A;  2VCT A;  4MJA A;  1V40 A;  2B6M A;  2K9F A;  3OR5 A;  3ERW A;  3GIX A;  4FYB A;  3UL3 A;  3GKN A;  3F9U A;  5ECR B;  2M80 A;  3DYR A;  2VCX A;  4L5O A;  2VO4 A;  4KUN A;  1QK8 A;  1S3D A;  2YZU A;  4MJC A;  1LBK A;  4F9Z A;  3CSJ A;  5ECQ B;  2GQK A;  1GUL A;  4MAB A;  3ZIV A;  4V2M A;  1PQN A;  2NDO A;  2XPE A;  3ZL5 A;  4BVY A;  2WFC A;  2C0E A;  6GSU A;  5A4V A;  2OE3 A;  5GSS A;  4BVY B;  2H01 A;  3LXZ A;  2O8V B;  4WET A;  4LLR A;  2H73 A;  1W89 A;  3UAP A;  4MF7 A;  2GGT A;  1ERU A;  5IMF A;  1AQV A;  1BAY A;  2WCI A;  4F2I A;  2L4Q A;  2E2G A;  1THX A;  2IIY A;  4AF2 A;  2RM5 A;  2WUL A;  4YQM A;  2DJ0 A;  1G6W A;  3RPP A;  1BJX A;  2IMK A;  2YOI A;  3GUR A;  2EIO A;  1B4Q A;  2MBS A;  3Q19 A;  2H0G A;  1TU7 A;  2OJL A;  1A8L A;  4NHW A;  5D8I A;  3LOR A;  4IJ3 A;  2HZF A;  1SD9 A;  1ZMA A;  5F07 A;  1RW1 A;  1FB6 A;  5DQY A;  5B6M A;  1XZO A;  1N8J A;  5DJL A;  1TRV A;  1EP7 A;  1RQM A;  1FG4 A;  1FVK A;  1KTE A;  4G19 A;  1U3A A;  4BWS A;  4GTU A;  1BQ7 A;  2R37 A;  3VPT A;  5DDL A;  1JLV A;  5A4W A;  1F3B A;  1WE0 A;  1Z3E A;  2LS5 A;  5CNW A;  3VLN A;  2MMA A;  2Z9S A;  2I4A A;  4ZBD A;  6GST A;  2O7K A;  1GNE A;  4NMU A;  1PD2 1;  3F63 A;  1HD2 A;  2N5F A;  3ZIJ A;  2PPT A;  3P7X A;  1G0T A;  1U88 A;  2LQO A;  1ZOF A;  2R5G A;  1YY7 A;  2WRT A;  1JZW A;  1IYI A;  5B7C A;  1K3O A;  1Z6M A;  1R5A A;  3LFL A;  2TIR A;  1V9W A;  3L78 A;  4RUV A;  3TRP A;  2RLI A;  2H30 A;  4KE3 A;  4YQV A;  3ZVJ D;  4F0C A;  1O7U A;  2N5B A;  3HZ4 A;  4OMV A;  2CAQ A;  3EVI A;  1SD8 A;  2L4C A;  2DMM A;  4IGJ A;  1GUH A;  3GKM A;  2L6C A;  2AJQ B;  4JRR A;  3E0U A;  3UAR A;  5GST A;  2FLS A;  4PUF C;  4EL1 A;  1JFU A;  4WR5 A;  1SYX A;  3IRA A;  3KH7 A;  2J23 A;  4OFT A;  1WMJ A;  2A2S A;  1YEX A;  3DWV A;  5KN0 A;  5DAL A;  5D73 A;  1AUC A;  1AQX A;  3TOU A;  4KDX A;  2H0H A;  2V41 A;  3CTG A;  5DAL B;  4K1F A;  4XIH A;  3F4R A;  2GZP A;  1A0R P;  4IJI A;  3L9U A;  1M9B A;  1ERT A;  4HDE A;  4EC0 A;  2A2R A;  3C73 A;  2GQM A;  2O85 A;  5ECL B;  3D22 A;  2K8S A;  1T3B A;  5IO0 A;  4E8E A;  3HJO A;  4G2E A;  2G0F A;  1USB A;  4G10 A;  4YQU A;  2PER A;  5CRW A;  4PQI A;  4Q5F A;  2DJ2 A;  1ERW A;  4POL A;  2H0I A;  3M0F A;  5DAK A;  1AXD A;  2DJK A;  3IV4 A;  2VD1 A;  5AIV A;  1FW1 A;  1GRX A;  5DAK B;  3WGD A;  2WZ9 A;  2PGT A;  2C0G A;  4V2L A;  2F51 A;  4EUY A;  2HYX A;  3V1W A;  1VF4 A;  1X5C A;  3CBU A;  4KDU A;  3H8Q A;  4F82 A;  2AB6 A;  1DSB A;  4EKZ A;  2MZC A;  2VLT A;  3W8S A;  4RQR A;  5ECN B;  5A5K A;  3DGQ A;  1JZD A;  3N9J A;  3K8N A;  1U3I A;  4K0G A;  1MD3 A;  3EUR A;  2CV4 A;  1QQ2 A;  4GXZ A;  5G31 A;  2FNO A;  2M72 A;  1YF1 A;  2IL3 A;  2VL9 A;  5D9X A;  3HVS A;  4POB A;  5JWQ B;  2VCW A;  4HZ4 A;  1QXH A;  2NTO A;  1U87 A;  2H6Z A;  2H8L A;  2H6Y A;  4PGT A;  3QAV A;  4RI6 A;  2DIZ A;  4JED A;  1ST9 A;  2QC7 A;  4DEJ A;  1B48 A;  1K0A A;  4TXO A;  5F06 A;  1TTZ A;  2F3M A;  4TXO B;  3KCM A;  5D96 A;  1NSW A;  5HFK A;  1B8X A;  2GSS A;  5IIZ A;  2BTO T;  4WF4 A;  3ZFL A;  3PPU A;  3TUE A;  2GST A;  2K6V A;  2YPM A;  2V6K A;  4MDC A;  1F2E A;  2KUC A;  1Z7P A;  3Q6O A;  4J57 E;  3GX0 A;  10GS A;  3QR6 A;  2GDR A;  4EDZ A;  1WJK A;  1MDK A;  5E59 A;  4GLT A;  4ML6 A;  3P2A A;  4MZC A;  4XRD A;  1URM A;  2X99 A;  3F8U A;  5ENU A;  2H1B A;  2DJJ A;  4WBR D;  3O76 A;  3LEF A;  3MSZ A;  3UIW A;  3GH6 A;  1T4Y A;  3J7Y b;  2TRC P;  6GSY A;  5A4U A;  3LXT A;  2OAC A;  2AAW A;  3HXS A;  2O89 A;  4I97 A;  1NHO A;  1XOB A;  1OAZ A;  1SEN A;  1QGV A;  1FAA A;  5AGY A;  5IPG A;  5D9W A;  1K0D A;  5E4W A;  4MH3 A;  4KF9 A;  16GS A;  4POM A;  2V2G A;  4K2D A;  3EMP A;  4HUA A;  4JR4 A;  3DKS A;  3HD5 A;  3M9J A;  5ABR A;  1B9Y C;  2CT6 A;  2MMO A;  2PUK C;  3PIN A;  4X1U A;  2FGX A;  5DBQ A;  1XCC A;  2FHE A;  2HE3 A;  4IVF A;  2H74 A;  3F4T A;  2H1G A;  1SJI A;  3CXG A;  3FYG A;  4NWY A;  2CX4 A;  1V57 A;  3GNJ A;  2HSY A;  2YAN A;  1SKR B;  4YAV A;  1G7E A;  1Z5Y E;  1PSQ A;  3KD0 A;  2C80 A;  2AHE A;  4K7I A;  3L9S A;  3DXB A;  3U5R E;  1OKD A;  2RUF A;  1NM3 A;  1SKS B;  2HRK A;  3KM6 A;  1W4V A;  5IO2 A;  2HRK B;  1EZK A;  4NXI A;  4XHM A;  3FK8 A;  3LQ7 A;  3RHC A;  2PVQ A;  1GTU A;  2EIR A;  1X9M B;  2GVP A;  3MDK A;  1R5P A;  3EE2 A;  3SWL A;  1UN2 A;  2GLR A;  5FWG A;  1J08 A;  5HQP A;  4K6X A;  1TRW A;  1TK8 B;  3KP8 A;  3VPQ A;  4L8E A;  1TI1 A;  3TRX A;  2H1D A;  3BBY A;  3ZRE A;  3SBC A;  14GS A;  2E0Q A;  4PX1 A;  3IC4 A;  2CAI A;  1ERV A;  2H66 A;  2DIY A;  17GS A;  2OAD A;  2X64 A;  4ECJ A;  2YV7 A;  1VRS D;  4GWR A;  1MEK A;  3JCM L;  4YH2 A;  1I5G A;  1J9B A;  1Y6E A;  3FKF A;  1E2Y A;  3BD2 A;  2M46 A;  3GFK A;  1FOV A;  4P3Y B;  1E6B A;  1Q4J A;  4TOP A;  2JZT A;  3KGK A;  4ZBA A;  3UMA A;  5F0G A;  1EOG A;  1JHB A;  1EGO A;  2LJA A;  5ELG A;  4BA7 A;  2XHF A;  1PN9 A;  3UOM A;  1KBN A;  4EVM A;  4KDY A;  1GTA A;  5ECP B;  4DSQ A;  1WRY A;  2PVO C;  2YV9 A;  4MF6 A;  3I69 A;  2PWJ A;  4OFN A;  2FWF A;  1YKA A;  3LWA A;  1GSF A;  3C7M A;  2IMI A;  2V6O A;  1THO A;  2IFQ A;  4NHZ A;  3QAG A;  5G2Z A;  1GLP A;  3IXR A;  1LJR A;  2HRF A;  5D93 A;  2IFQ B;  5G5F A;  1TRU A;  1HNC A;  4HU9 A;  5COH A;  1ILO A;  5G30 A;  1SJZ A;  2LV3 A;  3UJ1 A;  2LNT A;  1M7T A;  4LL1 B;  13GS A;  1ZZY A;  1K3L A;  1NHY A;  1K0B A;  3D5J A;  4QL9 A;  3A3T A;  1A8Y A;  1GP1 A;  4GRF A;  2C3Q A;  3EC3 A;  1X9W B;  4ILF A;  3QCP A;  3WGX A;  1PX7 A;  3AY8 A;  2XBI A;  1MD4 A;  4ZXG A;  1KNG A;  1OC3 A;  4GQF A;  1G7O A;  3TKR A;  4AGS A;  4ECI A;  3IPZ A;  4ZL7 A;  1WOU A;  3QMX A;  4MH2 A;  3A2V A;  5J41 A;  4J2F A;  3ME7 A;  2H71 A;  3CSI A;  18GS A;  2PMT A;  2LKU A;  2FCH A;  1BYE A;  1B4P A;  3E3E A;  4RQX A;  2C0D A;  4LMV A;  2HRN A;  2WS2 A;  2R2J A;  3L4N A;  2C0F A;  4NV5 A;  1EV9 A;  11GS A;  3FY7 A;  3I9V 2;  3L9V A;  4ZB6 A;  4BPY A;  1WWJ A;  1OYJ A;  2LRN A;  1VGL A;  5DCH A;  3M1G A;  3QOU A;  2JAD A;  4TXV A;  3QFB C;  3BCI A;  4PTS A;  3F0I A;  1TW9 A;  1EEJ A;  5DCG A;  5IQY A;  2VIM A;  3P90 A;  5H5R A;  1TI3 A;  3O6T A;  4MPG A;  2RII A;  2OE0 A;  4TKY A;  3D4T A;  1G6Y A;  2JAC A;  5B8B A;  2YP6 A;  1VF3 A;  2C8U A;  4HI7 A;  1GH2 A;  3DIE A;  3TJJ A;  3C1R A;  2VUP A;  2LEG A;  3IE3 A;  5G1L A;  1JZR A;  1T1V A;  4XCS A;  5KN2 A;  3UVT A;  3VWU A;  1AAZ A;  1KEB A;  1QUW A;  5HR3 A;  3FZ9 A;  1YEP A;  4I2T A;  1XFL A;  3FW2 A;  2HSM A;  2TRX A;  2X8G A;  1JLW A;  2HSM B;  1PL1 A;  1PMT A;  2WB9 A;  4G9H A;  1AQW A;  1XW6 A;  2B5E A;  1ZYE A;  3GN3 A;  1DBY A;  4KSM A;  5GZZ B;  4ZB9 A;  7GSS A;  1Y25 A;  2AV4 A;  4OD7 A;  1V2A A;  5FHI A;  2HI7 A;  5ECS A;  4HU7 A;  5L71 A;  3IOS A;  2C3T A;  4HJM A;  2H19 A;  3HZ8 A;  4L0W A;  4IQ1 A;  3GRX A;  5IOW A;  2HLS A;  3VI5 A;  5CYY A;  2AUV A;  4XRA A;  1AW9 A;  1PKW A;  3TGZ A;  3WT2 A;  5ID2 A;  1SK2 A;  5DQS A;  1J0F A;  1YKC A;  5ID2 B;  3GA4 A;  4O5R A;  2V32 A;  1YJ6 A;  3VWX A;  1OC9 A;  3DD3 A;  2B7K A;  1XIY A;  1OC9 B;  1TRS A;  3ZRD A;  1K0N A;  1XW5 A;  3IK7 A;  5KEJ A;  3TKQ A;  1GLQ A;  2J9H A;  1UVZ A;  4XS1 A;  1EV4 A;  5IMZ A;  3BOA A;  2GS3 A;  2IPA A;  2L59 A;  3N5O A;  3CTF A;  1SJ6 A;  1GSQ A;  3KTB A;  2WJU A;  2E7P A;  4F03 A;  2A4V A;  2CVK A;  2ZCT A;  1Z6N A;  2NPB A;  4AJ7 A;  4OWY A;  4EE0 A;  2B3S A;  4QL7 A;  3C8E A;  4DVC A;  5IOX A;  3QAW A;  4HQS A;  4L0U A;  2L6D A;  2BMX A;  5AN1 A;  4JU5 A;  4CHS A;  2FD3 A;  1FO5 A;  4OFM A;  5IMA A;  2I3Y A;  2WGR A;  2AYT A;  2VD0 A;  2RM6 A;  4BWQ A;  1TOF A;  4RI7 A;  5CRE A;  2QKE A;  2NVL A;  5IPH A;  1NW2 A;  3CYN A;  1HNB A;  4PUR A;  5INY A;  3KP9 A;  1TP9 A;  3O3T A;  3FZ5 A;  3KIJ A;  1EWX A;  3CRT A;  5C00 A;  1O73 A;  3CRU A;  5AIS A;  4PNG A;  4USS A;  1O81 A;  2VL2 A;  3TKS E;  4HZ2 A;  4WR4 A;  2YJH A;  1M9A A;  4EO3 A;  4EDY A;  3MNG A;  1XPV A;  5ECO B;  5GAN D;  4MCU A;  4DSS A;  2H76 A;  4MF5 A;  1XWK A;  4ZL8 A;  4DSS B;  1R7H A;  3M9K A;  4JE1 A;  4IS0 A;  2GZZ A;  4D73 A;  4KGI A;  4LA1 A;  3FEU A;  3VWV A;  4V1A g;  3KZQ A;  3QDN A;  5HR1 A;  3CMI A;  3C1S A;  5D9V A;  5J3R A;  2LJK A;  4IBP A;  2HSN B;  1QMV A;  4D73 B;  1SL1 B;  3UEM A;  3KEB A;  2I1U A;  1AIU A;  4EF0 A;  2ZNM A;  3Q18 A;  3KTL A;  1VF1 A;  1GSE A;  5B8A A;  3KXO A;  5CAX A;  5F8B A;  3R2Q A;  5DJM A;  2VLU A;  2UZ8 A;  3EU3 A;  4MLY A;  3FHK A;  1OKT A;  5ECM B;  2RUE A;  2REM A;  1SU9 A;  1T4Z A;  3I6A A;  2H6X A;  2QGV A;  3F3Q A;  3HHV A;  3G9B A;  2B1L A;  1XW9 A;  3F4S A;  3GKX A;  4LL4 B;  3G7I A;  2JZR A;  4G0I A;  1ZGN A;  1OE7 A;  3M3M A;  1X9S B;  1PL2 A;  3U6V A;  1A24 A;  2CVB A;  3ERG A;  1SK0 A;  3PH9 A;  1O8W A;  2L5O A;  2LST A;  3D21 A;  3LJR A;  3GHA A;  3EMX A;  2PBJ A;  3ED3 A;  3VFI A;  4GSN A;  5H5S A;  4Q5Q A;  2P5R A;  4HS1 A;  3HVX A;  3GST A;  4KW6 A;  3CSH A;  3NIV A;  4G0K A;  2P31 A;  3KH9 A;  1FVJ A;  3WYW A;  3DVW A;  4KB3 A;  5JWO B;  1A23 A;  3IK9 A;  2YWI A;  2JSY A;  2NBS A;  1X5E A;  3GYK A;  2B5Y A;  4XTS A;  1PRX A;  1VF2 A;  1TDI A;  22GS A;  3TB2 A;  1TK5 B;  3GL5 A;  1S3C A;  1SK1 A;  3G7Y A;  2GTU A;  2R4V A;  4HJ2 A;  1K0C A;  1ZCP A;  3ZFB A;  2IMF A;  4LMW A;  4JBB A;  3PGT A;  1XWB A;  2FY6 A;  2GQL A;  4ECC A;  5KN3 A;  4FQU A;  3F6D A;  2KP2 A;  3S9F A;  2JSZ A;  4ACS A;  3IDV A;  1AC1 A;  3TKP A;  3H1N A;  1K3Y A;  5J9B A;  5C04 A;  4IHU A;  5LNK e;  5J9C A;  1MDI A;  2LUS A;  4IP1 A;  2EC4 A;  1F3A A;  2HT9 A;  19GS A;  4YAP A;  1N2A A;  1UC7 A;  3GX8 A;  2CX3 A;  3KJY A;  2H70 A;  5LCZ A;  2B5X A;  2E2M A;  4N11 A;  5ECK B;  3ME8 A;  4H86 A;  2PU9 C;  5D9T A; 
#chains in the Genus database with same CATH topology
 2VAF A;  1SKW B;  3IC8 A;  4O92 A;  6GSX A;  3MAK A;  4N10 A;  1M0U A;  2KP1 A;  1GSS A;  1GUM A;  4MZW A;  1MDJ A;  2F8A A;  1XVW A;  3TJG A;  5JCG A;  3QPM A;  4MNN A;  1SYR A;  2VOC A;  1GNW A;  1R26 A;  4J56 E;  5ECI B;  2DC5 A;  2HNL A;  4TVE A;  1EP8 A;  5HFI A;  2GSQ A;  2LRC A;  3I43 A;  4Q5N A;  4E8H A;  4FIW A;  1TXX A;  2VLV A;  3VK9 A;  4AKG A;  1FB0 A;  2PN8 A;  1SL0 B;  2WW0 A;  1XWC A;  3D6I A;  2C3N A;  4G0L A;  4K2X A;  4PNF A;  1M99 A;  8GSS A;  3NOF A;  3GMF A;  5HFG A;  4PUA A;  1K0M A;  4QQ7 A;  3H4K A;  4FYU A;  1DUG A;  3A2X A;  3RPN A;  3GV1 A;  3TDG A;  3RBT A;  3UVH A;  3LG6 A;  1XBS A;  3F6F A;  2HQT A;  2VM1 A;  5DVB A;  1C72 A;  3TOT A;  1WP0 A;  4GF0 A;  3ISO A;  4F0B A;  2MYG A;  2OBI A;  3IHQ A;  4DSR A;  3FRC A;  2OA7 A;  2X8C A;  1YEW C;  3LGC A;  5A34 A;  1XXU A;  4K9Z A;  3GSS A;  2YWM A;  2FWG A;  4FYC A;  1OC8 A;  4FO5 A;  2YCD A;  1UA5 A;  5A34 B;  4MJE A;  4OO4 A;  1V58 A;  3KMO A;  4IN0 A;  1WPI A;  2VCV A;  3RHB A;  2H1A A;  3IAM 2;  2YWO A;  2WVZ A;  4JZQ A;  4FH8 A;  1HYU A;  3R3E A;  4N30 A;  2C4J A;  2MBT A;  1A0F A;  3IHG A;  2B7J A;  2JU5 A;  2YJ7 A;  4V1A p;  4XS4 A;  1BX9 A;  4GST A;  4PI0 C;  1T8E B;  3TKS C;  1XWA A;  2LQQ A;  4XS4 B;  3RDW A;  2DBC A;  3DRN A;  1F9M A;  2GSR A;  2CZ3 A;  5CRH A;  2DJ1 A;  4N3Z A;  1TJD A;  4TRX A;  4IW9 A;  3ZYW A;  2GT5 A;  4CW9 A;  5CO3 A;  4ZL9 A;  4Z7X A;  1YF0 A;  2OKA A;  4NAX A;  5J47 A;  1T7P B;  1U6T A;  2ALB A;  3ZIT A;  2VCZ A;  1S3R A;  4ISD A;  5KOW A;  1YDK A;  4YKG A;  3ZLP A;  3RAZ A;  2YWN A;  4MP4 A;  2H75 A;  2FA4 A;  1F37 A;  2B1K A;  1OE8 A;  1TXU A;  3FR3 A;  2ZUP A;  4X0X A;  5IMD A;  3L0H A;  4I2U A;  1ML6 A;  2CQ9 A;  1K0O A;  2LJR A;  2CVD A;  1T00 A;  3US3 A;  2LTK A;  4E68 A;  5G1K A;  3ZVJ A;  1M2A A;  1A2J A;  2FWE A;  3TKS A;  4ID0 A;  2JL4 A;  3HVV A;  5EY6 A;  3GTU A;  4NPB A;  4I5Q A;  3APQ A;  4KCA A;  3GTU B;  4IKH A;  3FR6 A;  3QFA C;  1B9X C;  3EIN A;  2HZE A;  2K18 A;  20GS A;  2KOK A;  3FZ4 A;  4TN8 A;  2XBQ A;  1GTB A;  4EIQ A;  1BG5 A;  2HZE B;  1HNA A;  1EEM A;  3DML A;  2GT6 A;  3KMN A;  1XOA A;  2KLX A;  1O6J A;  1EGR A;  4A5P A;  1DE1 A;  1GWC A;  5G5E A;  1ZL9 A;  3DVX A;  1IYH A;  3IBH A;  2OE1 A;  1HQO A;  4CY8 A;  2BJX A;  2IJY A;  3TJB A;  3BJ5 A;  1F6M C;  4WBJ A;  1TK0 B;  1GSD A;  1ABA A;  3E9J B;  3ERF A;  3M8N A;  1JZO A;  2DSA A;  3EU4 A;  3IR4 A;  2VL2 C;  5GAP D;  4ZIJ A;  5J4V A;  4WF5 A;  3W8J A;  2MMN A;  4BL7 A;  4ECB A;  1X0R A;  4OCF A;  4AJ8 A;  4KND A;  3W6G A;  5JCW A;  1RK4 A;  4BL7 B;  1GSU A;  3HYP A;  4WKW A;  2P0G A;  1YVL A;  4EXJ A;  3WT1 A;  4JR6 A;  1Z7R A;  4KCE A;  6GSW A;  4MPF A;  5EL8 A;  4BVX A;  1TKD B;  2HRA A;  4TR0 A;  2R6K A;  2FWH A;  1O8X A;  2YZH A;  2YNX A;  4BVX B;  2VCQ A;  4L5L A;  4ML1 A;  4I8B A;  5KN1 A;  1GSY A;  5B6N A;  4K0N A;  4N0Z A;  3VWW A;  3UBK A;  1TU8 A;  2H72 A;  2KHP A;  4Q5R A;  4XS6 A;  4X43 A;  4KX4 A;  1EOH A;  1XVQ A;  1O85 A;  2L57 A;  2DML A;  2X4A A;  4PQ1 A;  3WD6 A;  4TW5 A;  4CDO A;  3LSZ A;  5HR0 A;  2DJ3 A;  2VM2 A;  1GL8 A;  4TR4 A;  5BMU A;  3EPT A;  2FA8 A;  2F8F A;  2V1M A;  3BCK A;  1GUK A;  6GSS A;  5BMU B;  2FUG 2;  2DLX A;  2I81 A;  2R3X A;  2R0P A;  2X8H A;  2N5A A;  4K7O A;  1MTC A;  5A1N A;  2HXK A;  2L5L A;  5J5N A;  3ZML A;  3GH9 A;  5A1N B;  4OO5 A;  2IN3 A;  1I9D A;  1BED A;  3G7J A;  3EWL A;  3MWH A;  5FT3 A;  1V98 A;  2QSI A;  1ZYQ B;  4O7H A;  2IMD A;  4ZIL A;  2X49 A;  4PI2 C;  5LD0 A;  3H93 A;  2CA8 A;  4K8M A;  2O36 A;  1Z9H A;  4IQA A;  4OCE A;  5JWR B;  3D0Z A;  1OVN A;  2VL3 A;  4NV2 A;  4MJB A;  4WXT A;  1PKZ A;  3NZN A;  1SL2 B;  2LNS A;  5J4U A;  1S4B P;  1SVO A;  3LYK A;  2GZY A;  1PGT A;  5HR2 A;  3ZTL A;  1GTI A;  1PA3 A;  4POK A;  4MA9 A;  5IMV A;  3WGE A;  3HKR A;  2XC2 A;  4IP6 A;  1FHE A;  4ZB8 A;  1ON4 A;  5EPF A;  1M2B A;  4PQH A;  4KAE A;  1XWG A;  3F3R A;  3APO A;  4HOJ A;  3HDC A;  6GSV A;  12GS A;  3A2W A;  4CY6 A;  2YN1 A;  2ON7 A;  4ULX A;  3Q74 A;  3FZA A;  2R0G A;  3C71 A;  3HCZ A;  3TJF A;  4AJ6 A;  2JZS A;  2OT3 A;  3IA1 A;  2OBK A;  2IWT A;  5CRD A;  2HSH A;  4KA0 A;  4PXO A;  4KSO A;  1H4O A;  2C1Y A;  1M2D A;  3DEX A;  1LU4 A;  3ZMK A;  3TCO A;  4IEL A;  4GSS A;  2WW3 A;  3VI7 A;  3GL3 A;  2CZ2 A;  2F9S A;  4MK3 A;  1CQH A;  1H75 A;  2I9H A;  3UBL A;  3D4M A;  3EYT A;  1ACV A;  5CRG A;  2MMZ A;  1YQ1 A;  2IME A;  4WEY A;  4ZBB A;  1SVM A;  5F05 A;  2O87 A;  4V2N A;  3LYP A;  9GSS A;  4GQC A;  3HJP A;  4KH7 A;  2P5Q A;  4K7N A;  1Q98 A;  5EVO A;  4O32 A;  1YZX A;  2ES7 A;  1X5D A;  4MMM A;  1CQG A;  3HY2 A;  4HQZ A;  5CP1 A;  5ELA A;  3PR8 A;  1S3A A;  1A2L A;  2K8V A;  3H79 A;  3HJM A;  1PX6 A;  3APS A;  3IAS 2;  5JCU A;  1WIK A;  2WVY A;  3HA9 A;  3FR9 A;  5IM9 A;  5IMC A;  4TR3 A;  4N0V A;  1QFN A;  2EIQ A;  2G2Q A;  4MZB A;  3GUS A;  4TR1 A;  4HEA 2;  3VUR A;  4GCI A;  3ZZX A;  1DE2 A;  2D2Z A;  4TR1 B;  2XPD A;  5ECH B;  4O5Q A;  1R4W A;  4PHZ C;  3TJK A;  4I6X A;  3QD9 A;  5AIX A;  3GKK A;  2ON5 A;  1A2M A;  3TRQ A;  3P8W A;  2HFD A;  4G01 A;  2LRT A;  3A5W A;  2A2P A;  3J7Y k;  2WDU A;  5H5Q A;  3HMJ G;  2VCT A;  4MJA A;  1V40 A;  2B6M A;  2K9F A;  3OR5 A;  3ERW A;  3GIX A;  4FYB A;  3UL3 A;  2A4H A;  3GKN A;  4YKF A;  3F9U A;  5ECR B;  5J4Y A;  1XG8 A;  2M80 A;  3DYR A;  2VCX A;  4L5O A;  2VO4 A;  4KUN A;  1QK8 A;  1S3D A;  2YZU A;  4MJC A;  5KOX A;  1LBK A;  2DKH A;  4F9Z A;  3CSJ A;  5ECQ B;  2GQK A;  1GUL A;  4MAB A;  3ZIV A;  4V2M A;  1PQN A;  2NDO A;  2XPE A;  3ZL5 A;  4BVY A;  2WFC A;  2C0E A;  6GSU A;  5A4V A;  4ZB7 A;  2OE3 A;  5GSS A;  4BVY B;  2H01 A;  3LXZ A;  2O8V B;  4WET A;  4LLR A;  2H73 A;  1W89 A;  3UAP A;  4MF7 A;  2GGT A;  1ERU A;  5IMF A;  1AQV A;  1BAY A;  2WCI A;  4F2I A;  2L4Q A;  2E2G A;  1THX A;  2IIY A;  4AF2 A;  2RM5 A;  2WUL A;  4YQM A;  2DJ0 A;  1G6W A;  3RPP A;  1BJX A;  2IMK A;  2YOI A;  3GUR A;  2EIO A;  1B4Q A;  2MBS A;  3Q19 A;  2H0G A;  1TU7 A;  2OJL A;  3LW9 A;  1A8L A;  4NHW A;  5D8I A;  4AI6 A;  3LOR A;  4IJ3 A;  2HZF A;  1SD9 A;  1Y1U A;  1ZMA A;  5F07 A;  1RW1 A;  1FB6 A;  5DQY A;  5B6M A;  1XZO A;  1N8J A;  5DJL A;  1TRV A;  1EP7 A;  2WW2 A;  1RQM A;  1FG4 A;  1FVK A;  1KTE A;  4G19 A;  1U3A A;  4BWS A;  4GTU A;  1BQ7 A;  2R37 A;  3VPT A;  5DDL A;  1JLV A;  5A4W A;  1F3B A;  1WE0 A;  1Z3E A;  2LS5 A;  5CNW A;  3VLN A;  2MMA A;  2Z9S A;  2I4A A;  4ZBD A;  6GST A;  2O7K A;  1GNE A;  2EFC A;  4NMU A;  1PD2 1;  3F63 A;  1HD2 A;  2N5F A;  3ZIJ A;  2PPT A;  3P7X A;  1G0T A;  1U88 A;  2LQO A;  1ZOF A;  2R5G A;  1YY7 A;  2WRT A;  1JZW A;  1IYI A;  5B7C A;  1K3O A;  1Z6M A;  1R5A A;  3LFL A;  2TIR A;  1PFO A;  1V9W A;  3L78 A;  4RUV A;  3TRP A;  2RLI A;  3MYD A;  2H30 A;  2WW1 A;  4KE3 A;  4YQV A;  3ZVJ D;  4F0C A;  1O7U A;  2N5B A;  2R0C A;  3HZ4 A;  4OMV A;  2CAQ A;  3EVI A;  1SD8 A;  2L4C A;  2DMM A;  4IGJ A;  1GUH A;  3GKM A;  2L6C A;  2AJQ B;  4JRR A;  3E0U A;  3UAR A;  5GST A;  2FLS A;  4PUF C;  4EL1 A;  1JFU A;  4WR5 A;  1SYX A;  3IRA A;  3KH7 A;  2J23 A;  4OFT A;  1WMJ A;  2A2S A;  1YEX A;  3DWV A;  4BIK A;  5KN0 A;  5DAL A;  1ZYP A;  4Z2U A;  5D73 A;  1AUC A;  1AQX A;  3TOU A;  4KDX A;  2H0H A;  2V41 A;  3CTG A;  5DAL B;  4K1F A;  4XIH A;  3F4R A;  2GZP A;  1A0R P;  4IJI A;  3L9U A;  1M9B A;  1ERT A;  4HDE A;  4EC0 A;  4X4J A;  2A2R A;  3C73 A;  2GQM A;  2O85 A;  5ECL B;  3D22 A;  2O3E A;  2K8S A;  1T3B A;  5IO0 A;  4E8E A;  3HJO A;  4G2E A;  2G0F A;  1USB A;  4G10 A;  4YQU A;  2PER A;  5CRW A;  4PQI A;  4Q5F A;  4QMK A;  2DJ2 A;  1ERW A;  4POL A;  2H0I A;  3M0F A;  5DAK A;  1AXD A;  2DJK A;  3IV4 A;  2VD1 A;  5AIV A;  1FW1 A;  1GRX A;  5DAK B;  3WGD A;  2WZ9 A;  2PGT A;  2C0G A;  4V2L A;  2F51 A;  4EUY A;  2HYX A;  3V1W A;  1VF4 A;  1X5C A;  3CBU A;  2O5V A;  2DKI A;  1I1I P;  4KDU A;  3H8Q A;  4F82 A;  3HVN A;  2AB6 A;  1DSB A;  4EKZ A;  2MZC A;  2VLT A;  3W8S A;  4RQR A;  5ECN B;  5A5K A;  3DGQ A;  1JZD A;  3N9J A;  3K8N A;  1U3I A;  4K0G A;  1MD3 A;  3EUR A;  2CV4 A;  1QQ2 A;  4GXZ A;  5G31 A;  2FNO A;  2UV8 G;  2M72 A;  1YF1 A;  2IL3 A;  3CQF A;  2VL9 A;  5D9X A;  3HVS A;  4POB A;  5JWQ B;  2VCW A;  4HZ4 A;  1QXH A;  2NTO A;  2EFD A;  1U87 A;  2H6Z A;  2H8L A;  2H6Y A;  4PGT A;  3QAV A;  4RI6 A;  5BRT A;  2DIZ A;  4JED A;  1ST9 A;  2QC7 A;  4DEJ A;  1B48 A;  1K0A A;  4TXO A;  5F06 A;  1TTZ A;  2F3M A;  4TXO B;  3KCM A;  5D96 A;  1NSW A;  5HFK A;  1B8X A;  2GSS A;  5IIZ A;  2BTO T;  4WF4 A;  3ZFL A;  3PPU A;  3TUE A;  2GST A;  2K6V A;  2YPM A;  2V6K A;  4MDC A;  1F2E A;  2KUC A;  1Z7P A;  3Q6O A;  4J57 E;  3GX0 A;  10GS A;  3QR6 A;  2GDR A;  4EDZ A;  1WJK A;  1MDK A;  5E59 A;  4GLT A;  4ML6 A;  3P2A A;  4MZC A;  4XRD A;  1URM A;  2X99 A;  3F8U A;  5ENU A;  2H1B A;  1M3I A;  2DJJ A;  4WBR D;  3O76 A;  3LEF A;  3MSZ A;  3UIW A;  3GH6 A;  1T4Y A;  3J7Y b;  2TRC P;  6GSY A;  5A4U A;  3LXT A;  2OAC A;  2AAW A;  3HXS A;  2O89 A;  4I97 A;  1NHO A;  4HSC X;  1XOB A;  1OAZ A;  1SEN A;  1QGV A;  1FAA A;  5AGY A;  5IPG A;  5D9W A;  1K0D A;  4O5U A;  5E4W A;  4MH3 A;  4KF9 A;  4ICY A;  16GS A;  4POM A;  2V2G A;  4K2D A;  3EMP A;  4HUA A;  4JR4 A;  3DKS A;  3HD5 A;  3M9J A;  5ABR A;  1B9Y C;  2CT6 A;  2MMO A;  2PUK C;  3PIN A;  4X1U A;  2FGX A;  5DBQ A;  1XCC A;  2FHE A;  2HE3 A;  4IVF A;  2H74 A;  3F4T A;  2H1G A;  1SJI A;  3CXG A;  3FYG A;  4NWY A;  2CX4 A;  1V57 A;  3GNJ A;  2HSY A;  2YAN A;  1SKR B;  4YAV A;  1G7E A;  1Z5Y E;  1PSQ A;  3KD0 A;  2C80 A;  2AHE A;  4K7I A;  3L9S A;  3DXB A;  3U5R E;  1OKD A;  2RUF A;  1NM3 A;  1SKS B;  2HRK A;  3KM6 A;  1W4V A;  5IO2 A;  2HRK B;  1EZK A;  4NXI A;  4XHM A;  3FK8 A;  3LQ7 A;  3RHC A;  2PVQ A;  1GTU A;  2EIR A;  1X9M B;  2GVP A;  3MDK A;  1R5P A;  3EE2 A;  3SWL A;  1UN2 A;  2GLR A;  5FWG A;  1J08 A;  5HQP A;  4K6X A;  1TRW A;  1TK8 B;  3KP8 A;  3VPQ A;  4L8E A;  1TI1 A;  3TRX A;  2H1D A;  4EIP A;  3BBY A;  2QA1 A;  3ZRE A;  3SBC A;  14GS A;  2E0Q A;  1BG1 A;  4PX1 A;  3IC4 A;  2CAI A;  1ERV A;  2H66 A;  2DIY A;  17GS A;  2OAD A;  2X64 A;  4ECJ A;  2YV7 A;  1VRS D;  4GWR A;  1MEK A;  3JCM L;  4YH2 A;  1I5G A;  1J9B A;  1Y6E A;  4K5S A;  3FKF A;  1E2Y A;  3BD2 A;  2M46 A;  3GFK A;  1FOV A;  4P3Y B;  1E6B A;  1Q4J A;  4TOP A;  2JZT A;  3KGK A;  4ZBA A;  3UMA A;  5F0G A;  1EOG A;  1JHB A;  1EGO A;  2LJA A;  5ELG A;  4BA7 A;  2XHF A;  1PN9 A;  3UOM A;  1KBN A;  4EVM A;  4KDY A;  1GTA A;  5ECP B;  4DSQ A;  1WRY A;  2PVO C;  2YV9 A;  4MF6 A;  3I69 A;  2PWJ A;  4OFN A;  2FWF A;  1YKA A;  3LWA A;  1GSF A;  3C7M A;  2IMI A;  2V6O A;  1THO A;  2IFQ A;  4NHZ A;  3QAG A;  5G2Z A;  1GLP A;  3IXR A;  1LJR A;  2HRF A;  5D93 A;  2IFQ B;  5G5F A;  3CHX C;  1TRU A;  1M3J A;  1HNC A;  4HU9 A;  5COH A;  1ILO A;  5G30 A;  1SJZ A;  3RFR C;  2LV3 A;  3UJ1 A;  2LNT A;  1M7T A;  4LL1 B;  13GS A;  1ZZY A;  1K3L A;  1NHY A;  1K0B A;  3D5J A;  4QL9 A;  3A3T A;  1A8Y A;  1GP1 A;  4GRF A;  2C3Q A;  3EC3 A;  1X9W B;  4ILF A;  3QCP A;  3WGX A;  1PX7 A;  3AY8 A;  2XBI A;  1MD4 A;  4ZXG A;  1KNG A;  1OC3 A;  4GQF A;  1G7O A;  3TKR A;  4AGS A;  4ECI A;  4FXY P;  3IPZ A;  4ZL7 A;  1WOU A;  3QMX A;  4MH2 A;  3A2V A;  5J41 A;  4J2F A;  3ME7 A;  2H71 A;  3CSI A;  18GS A;  2PMT A;  2LKU A;  2FCH A;  1BYE A;  1B4P A;  3E3E A;  4RQX A;  2C0D A;  4LMV A;  2HRN A;  2WS2 A;  2R2J A;  3L4N A;  2C0F A;  4NV5 A;  1EV9 A;  11GS A;  3FY7 A;  3I9V 2;  3L9V A;  4ZB6 A;  4BPY A;  1WWJ A;  2WVX A;  1OYJ A;  2LRN A;  1VGL A;  5DCH A;  3M1G A;  2WVX B;  2JAD A;  3QOU A;  4TXV A;  3CWG A;  3QFB C;  3BCI A;  4PTS A;  3F0I A;  1TW9 A;  1EEJ A;  5DCG A;  5IQY A;  2VIM A;  3P90 A;  5H5R A;  1TI3 A;  3O6T A;  4MPG A;  2RII A;  2OE0 A;  4TKY A;  3D4T A;  1G6Y A;  2JAC A;  5B8B A;  2YP6 A;  1VF3 A;  2C8U A;  4HI7 A;  1GH2 A;  3DIE A;  2H1L A;  3TJJ A;  4Z2T A;  3C1R A;  2VUP A;  2LEG A;  3IE3 A;  5G1L A;  2WZS A;  1JZR A;  1T1V A;  4XCS A;  5KN2 A;  3UVT A;  3VWU A;  1AAZ A;  1KEB A;  1QUW A;  5HR3 A;  2EFH A;  3FZ9 A;  1YEP A;  4I2T A;  1XFL A;  3FW2 A;  2HSM A;  2TRX A;  2X8G A;  1JLW A;  2HSM B;  1PL1 A;  1PN0 A;  1PMT A;  2WB9 A;  4G9H A;  1AQW A;  1XW6 A;  2B5E A;  1ZYE A;  3GN3 A;  1DBY A;  5A5H A;  4KSM A;  5GZZ B;  4ZB9 A;  7GSS A;  5A5H B;  1Y25 A;  2AV4 A;  4OD7 A;  1V2A A;  5FHI A;  2HI7 A;  5ECS A;  4HU7 A;  5L71 A;  3IOS A;  2C3T A;  4HJM A;  2H19 A;  3HZ8 A;  4L0W A;  4IQ1 A;  3GRX A;  5IOW A;  2HLS A;  3VI5 A;  5CYY A;  1N25 A;  2AUV A;  4XRA A;  1AW9 A;  1PKW A;  3TGZ A;  3WT2 A;  5ID2 A;  1SK2 A;  5DQS A;  1J0F A;  1YKC A;  5ID2 B;  3TU3 B;  3GA4 A;  4O5R A;  2V32 A;  1YJ6 A;  3VWX A;  1OC9 A;  3DD3 A;  2B7K A;  1XIY A;  1OC9 B;  1TRS A;  3ZRD A;  1K0N A;  1XW5 A;  3IK7 A;  5KEJ A;  3TKQ A;  1GLQ A;  2J9H A;  1UVZ A;  4XS1 A;  3MIX A;  1EV4 A;  5IMZ A;  3BOA A;  2GS3 A;  2IPA A;  2L59 A;  3N5O A;  1FOH A;  3CTF A;  1SJ6 A;  1GSQ A;  3KTB A;  2WJU A;  2E7P A;  4F03 A;  2A4V A;  2CVK A;  2ZCT A;  1Z6N A;  2NPB A;  4AJ7 A;  4OWY A;  4EE0 A;  2B3S A;  4QL7 A;  3C8E A;  4DVC A;  5IOX A;  3QAW A;  4HQS A;  4L0U A;  2L6D A;  2BMX A;  4AKI A;  5AN1 A;  4JU5 A;  4CHS A;  2FD3 A;  1FO5 A;  4OFM A;  4GDF A;  5IMA A;  2I3Y A;  2WGR A;  2AYT A;  2VD0 A;  2RM6 A;  4BWQ A;  1TOF A;  4RI7 A;  5CRE A;  2QKE A;  2NVL A;  5IPH A;  1NW2 A;  3CYN A;  1HNB A;  4PUR A;  5INY A;  3KP9 A;  1TP9 A;  3O3T A;  3FZ5 A;  3KIJ A;  1EWX A;  3CRT A;  5C00 A;  1O73 A;  3CRU A;  5AIS A;  4PNG A;  4USS A;  1O81 A;  2VL2 A;  3TKS E;  4HZ2 A;  4WR4 A;  2YJH A;  1M9A A;  2EFE A;  4EO3 A;  4EDY A;  3MNG A;  4AKX B;  1XPV A;  5ECO B;  5GAN D;  4MCU A;  4DSS A;  2H76 A;  4MF5 A;  5J40 A;  1XWK A;  4ZL8 A;  4DSS B;  1R7H A;  3M9K A;  2HSN A;  4IS0 A;  2GZZ A;  4JE1 A;  4D73 A;  4KGI A;  4LA1 A;  3FEU A;  3VWV A;  4V1A g;  3KZQ A;  3QDN A;  5HR1 A;  3CMI A;  3C1S A;  5D9V A;  5J3R A;  2LJK A;  4IBP A;  2HSN B;  1QMV A;  4D73 B;  1SL1 B;  3UEM A;  3KEB A;  2I1U A;  1AIU A;  4EF0 A;  4W66 A;  2ZNM A;  3Q18 A;  3KTL A;  1VF1 A;  1GSE A;  5B8A A;  3KXO A;  5CAX A;  5F8B A;  3R2Q A;  5DJM A;  2VLU A;  2UZ8 A;  3EU3 A;  4Z2R A;  4MLY A;  3FHK A;  1OKT A;  5ECM B;  2RUE A;  3A5I A;  2REM A;  1SU9 A;  1T4Z A;  3I6A A;  2H6X A;  2QGV A;  3F3Q A;  3HHV A;  3G9B A;  2B1L A;  1XW9 A;  3F4S A;  3GKX A;  4LL4 B;  3G7I A;  2JZR A;  4G0I A;  1ZGN A;  1OE7 A;  3M3M A;  1X9S B;  1PL2 A;  3U6V A;  1BF5 A;  1A24 A;  2CVB A;  3ERG A;  1SK0 A;  3PH9 A;  1O8W A;  2L5O A;  2LST A;  3D21 A;  3LJR A;  3GHA A;  3EMX A;  2PBJ A;  3ED3 A;  3VFI A;  4GSN A;  5H5S A;  4Q5Q A;  2P5R A;  3RGB C;  4HS1 A;  3HVX A;  3GST A;  4KW6 A;  3CSH A;  3NIV A;  4G0K A;  2P31 A;  3KH9 A;  1FVJ A;  3WYW A;  3DVW A;  4KB3 A;  5JWO B;  1A23 A;  2VKZ G;  3IK9 A;  2YWI A;  2JSY A;  2NBS A;  1X5E A;  3GYK A;  2B5Y A;  4XTS A;  1PRX A;  1VF2 A;  1TDI A;  22GS A;  3TB2 A;  1TK5 B;  3GL5 A;  1S3C A;  4AKH A;  1SK1 A;  3G7Y A;  2GTU A;  2R4V A;  4HJ2 A;  1K0C A;  4K5R A;  1SVL A;  1ZCP A;  3ZFB A;  2IMF A;  4LMW A;  4JBB A;  3PGT A;  1XWB A;  2FY6 A;  2GQL A;  4ECC A;  5KN3 A;  2QA2 A;  3F6D A;  4FQU A;  2KP2 A;  3S9F A;  2JSZ A;  4ACS A;  3IDV A;  1AC1 A;  3FMW A;  3TKP A;  3H1N A;  1K3Y A;  5J9B A;  5C04 A;  4IHU A;  5LNK e;  5J9C A;  1MDI A;  2LUS A;  4IP1 A;  2EC4 A;  1F3A A;  2HT9 A;  19GS A;  4YAP A;  1N2A A;  1UC7 A;  3GX8 A;  2CX3 A;  3KJY A;  2H70 A;  5LCZ A;  2B5X A;  2E2M A;  4N11 A;  1ZYN A;  5ECK B;  3ME8 A;  4H86 A;  2PU9 C;  5D9T A; 
#chains in the Genus database with same CATH homology
 2VAF A;  1SKW B;  3IC8 A;  4O92 A;  6GSX A;  3MAK A;  4N10 A;  1M0U A;  2KP1 A;  1GSS A;  1GUM A;  4MZW A;  1MDJ A;  2F8A A;  1XVW A;  3TJG A;  5JCG A;  3QPM A;  4MNN A;  1SYR A;  2VOC A;  1GNW A;  1R26 A;  4J56 E;  5ECI B;  2DC5 A;  2HNL A;  4TVE A;  1EP8 A;  5HFI A;  2GSQ A;  2LRC A;  3I43 A;  4Q5N A;  4E8H A;  4FIW A;  1TXX A;  2VLV A;  3VK9 A;  4AKG A;  1FB0 A;  2PN8 A;  1SL0 B;  1XWC A;  3D6I A;  2C3N A;  4G0L A;  4K2X A;  4PNF A;  1M99 A;  8GSS A;  3NOF A;  3GMF A;  5HFG A;  4PUA A;  1K0M A;  4QQ7 A;  3H4K A;  4FYU A;  1DUG A;  3A2X A;  3RPN A;  3GV1 A;  3TDG A;  3RBT A;  3UVH A;  3LG6 A;  1XBS A;  3F6F A;  2HQT A;  2VM1 A;  5DVB A;  1C72 A;  3TOT A;  1WP0 A;  4GF0 A;  3ISO A;  4F0B A;  2MYG A;  2OBI A;  3IHQ A;  4DSR A;  3FRC A;  2OA7 A;  2X8C A;  3LGC A;  5A34 A;  1XXU A;  4K9Z A;  3GSS A;  2YWM A;  2FWG A;  4FYC A;  1OC8 A;  4FO5 A;  2YCD A;  1UA5 A;  5A34 B;  4MJE A;  4OO4 A;  1V58 A;  3KMO A;  4IN0 A;  1WPI A;  2VCV A;  3RHB A;  2H1A A;  3IAM 2;  2YWO A;  4JZQ A;  4FH8 A;  1HYU A;  3R3E A;  4N30 A;  2C4J A;  2MBT A;  1A0F A;  3IHG A;  2B7J A;  2JU5 A;  2YJ7 A;  4V1A p;  4XS4 A;  1BX9 A;  4GST A;  1T8E B;  3TKS C;  1XWA A;  2LQQ A;  4XS4 B;  3RDW A;  2DBC A;  3DRN A;  1F9M A;  2GSR A;  2CZ3 A;  5CRH A;  2DJ1 A;  4N3Z A;  1TJD A;  4TRX A;  4IW9 A;  3ZYW A;  2GT5 A;  4CW9 A;  5CO3 A;  4ZL9 A;  4Z7X A;  1YF0 A;  2OKA A;  4NAX A;  5J47 A;  1T7P B;  1U6T A;  2ALB A;  3ZIT A;  2VCZ A;  4ISD A;  5KOW A;  1YDK A;  4YKG A;  3ZLP A;  3RAZ A;  2YWN A;  4MP4 A;  2H75 A;  2FA4 A;  1F37 A;  2B1K A;  1OE8 A;  1TXU A;  3FR3 A;  2ZUP A;  4X0X A;  5IMD A;  3L0H A;  4I2U A;  1ML6 A;  2CQ9 A;  1K0O A;  2LJR A;  2CVD A;  1T00 A;  3US3 A;  2LTK A;  4E68 A;  5G1K A;  3ZVJ A;  1M2A A;  1A2J A;  2FWE A;  3TKS A;  4ID0 A;  2JL4 A;  3HVV A;  5EY6 A;  3GTU A;  4NPB A;  4I5Q A;  3APQ A;  4KCA A;  3GTU B;  4IKH A;  3FR6 A;  3QFA C;  1B9X C;  3EIN A;  2HZE A;  2K18 A;  20GS A;  2KOK A;  3FZ4 A;  4TN8 A;  2XBQ A;  1GTB A;  4EIQ A;  1BG5 A;  2HZE B;  1HNA A;  1EEM A;  3DML A;  2GT6 A;  3KMN A;  1XOA A;  2KLX A;  1O6J A;  1EGR A;  4A5P A;  1DE1 A;  1GWC A;  5G5E A;  1ZL9 A;  3DVX A;  1IYH A;  3IBH A;  2OE1 A;  1HQO A;  4CY8 A;  2BJX A;  2IJY A;  3TJB A;  3BJ5 A;  1F6M C;  4WBJ A;  1TK0 B;  1GSD A;  1ABA A;  3E9J B;  3ERF A;  3M8N A;  1JZO A;  2DSA A;  3EU4 A;  3IR4 A;  2VL2 C;  5GAP D;  4ZIJ A;  5J4V A;  4WF5 A;  3W8J A;  2MMN A;  4BL7 A;  4ECB A;  1X0R A;  4OCF A;  4AJ8 A;  4KND A;  3W6G A;  5JCW A;  1RK4 A;  4BL7 B;  1GSU A;  3HYP A;  4WKW A;  2P0G A;  1YVL A;  4EXJ A;  3WT1 A;  4JR6 A;  1Z7R A;  4KCE A;  6GSW A;  4MPF A;  5EL8 A;  4BVX A;  1TKD B;  2HRA A;  4TR0 A;  2R6K A;  2FWH A;  1O8X A;  2YZH A;  2YNX A;  4BVX B;  2VCQ A;  4L5L A;  4ML1 A;  4I8B A;  5KN1 A;  1GSY A;  5B6N A;  4K0N A;  4N0Z A;  3VWW A;  3UBK A;  1TU8 A;  2H72 A;  2KHP A;  4Q5R A;  4XS6 A;  4X43 A;  4KX4 A;  1EOH A;  1XVQ A;  1O85 A;  2L57 A;  2DML A;  2X4A A;  4PQ1 A;  3WD6 A;  4TW5 A;  4CDO A;  3LSZ A;  5HR0 A;  2DJ3 A;  2VM2 A;  1GL8 A;  4TR4 A;  5BMU A;  3EPT A;  2FA8 A;  2F8F A;  2V1M A;  3BCK A;  1GUK A;  6GSS A;  5BMU B;  2FUG 2;  2DLX A;  2I81 A;  2R3X A;  2R0P A;  2X8H A;  2N5A A;  4K7O A;  1MTC A;  5A1N A;  2HXK A;  2L5L A;  5J5N A;  3ZML A;  3GH9 A;  5A1N B;  4OO5 A;  2IN3 A;  1I9D A;  1BED A;  3G7J A;  3EWL A;  3MWH A;  5FT3 A;  1V98 A;  2QSI A;  1ZYQ B;  4O7H A;  2IMD A;  4ZIL A;  2X49 A;  5LD0 A;  3H93 A;  2CA8 A;  4K8M A;  1Z9H A;  4IQA A;  4OCE A;  5JWR B;  3D0Z A;  1OVN A;  2VL3 A;  4NV2 A;  4MJB A;  4WXT A;  1PKZ A;  3NZN A;  1SL2 B;  2LNS A;  5J4U A;  1SVO A;  3LYK A;  2GZY A;  1PGT A;  5HR2 A;  3ZTL A;  1GTI A;  1PA3 A;  4POK A;  4MA9 A;  5IMV A;  3WGE A;  3HKR A;  2XC2 A;  4IP6 A;  1FHE A;  4ZB8 A;  1ON4 A;  5EPF A;  1M2B A;  4PQH A;  4KAE A;  1XWG A;  3F3R A;  3APO A;  4HOJ A;  3HDC A;  6GSV A;  12GS A;  3A2W A;  4CY6 A;  2YN1 A;  2ON7 A;  4ULX A;  3Q74 A;  3FZA A;  2R0G A;  3C71 A;  3HCZ A;  3TJF A;  4AJ6 A;  2JZS A;  2OT3 A;  3IA1 A;  2OBK A;  2IWT A;  5CRD A;  2HSH A;  4KA0 A;  4PXO A;  4KSO A;  1H4O A;  2C1Y A;  1M2D A;  3DEX A;  1LU4 A;  3ZMK A;  3TCO A;  4IEL A;  4GSS A;  3VI7 A;  3GL3 A;  2CZ2 A;  2F9S A;  4MK3 A;  1CQH A;  1H75 A;  2I9H A;  3UBL A;  3D4M A;  3EYT A;  1ACV A;  5CRG A;  2MMZ A;  1YQ1 A;  2IME A;  4WEY A;  4ZBB A;  1SVM A;  5F05 A;  2O87 A;  4V2N A;  3LYP A;  9GSS A;  4GQC A;  3HJP A;  4KH7 A;  2P5Q A;  4K7N A;  1Q98 A;  5EVO A;  4O32 A;  1YZX A;  2ES7 A;  1X5D A;  4MMM A;  1CQG A;  3HY2 A;  4HQZ A;  5CP1 A;  5ELA A;  3PR8 A;  1S3A A;  1A2L A;  2K8V A;  3H79 A;  3HJM A;  1PX6 A;  3APS A;  3IAS 2;  5JCU A;  1WIK A;  3HA9 A;  3FR9 A;  5IM9 A;  5IMC A;  4TR3 A;  4N0V A;  1QFN A;  2EIQ A;  2G2Q A;  4MZB A;  3GUS A;  4TR1 A;  4HEA 2;  3VUR A;  4GCI A;  3ZZX A;  1DE2 A;  2D2Z A;  4TR1 B;  2XPD A;  5ECH B;  4O5Q A;  1R4W A;  3TJK A;  4I6X A;  3QD9 A;  5AIX A;  3GKK A;  2ON5 A;  1A2M A;  3TRQ A;  3P8W A;  2HFD A;  4G01 A;  2LRT A;  3A5W A;  2A2P A;  3J7Y k;  2WDU A;  5H5Q A;  3HMJ G;  2VCT A;  4MJA A;  1V40 A;  2B6M A;  2K9F A;  3OR5 A;  3ERW A;  3GIX A;  4FYB A;  3UL3 A;  2A4H A;  3GKN A;  4YKF A;  3F9U A;  5ECR B;  5J4Y A;  2M80 A;  3DYR A;  2VCX A;  4L5O A;  2VO4 A;  4KUN A;  1QK8 A;  1S3D A;  2YZU A;  4MJC A;  5KOX A;  1LBK A;  2DKH A;  4F9Z A;  3CSJ A;  5ECQ B;  2GQK A;  1GUL A;  4MAB A;  3ZIV A;  4V2M A;  1PQN A;  2NDO A;  2XPE A;  3ZL5 A;  4BVY A;  2WFC A;  2C0E A;  6GSU A;  5A4V A;  4ZB7 A;  2OE3 A;  5GSS A;  4BVY B;  2H01 A;  3LXZ A;  2O8V B;  4WET A;  4LLR A;  2H73 A;  1W89 A;  3UAP A;  4MF7 A;  2GGT A;  1ERU A;  5IMF A;  1AQV A;  1BAY A;  2WCI A;  4F2I A;  2L4Q A;  2E2G A;  1THX A;  2IIY A;  4AF2 A;  2RM5 A;  2WUL A;  4YQM A;  2DJ0 A;  1G6W A;  3RPP A;  1BJX A;  2IMK A;  2YOI A;  3GUR A;  2EIO A;  1B4Q A;  2MBS A;  3Q19 A;  2H0G A;  1TU7 A;  2OJL A;  3LW9 A;  1A8L A;  4NHW A;  5D8I A;  4AI6 A;  3LOR A;  4IJ3 A;  2HZF A;  1SD9 A;  1Y1U A;  1ZMA A;  5F07 A;  1RW1 A;  1FB6 A;  5DQY A;  5B6M A;  1XZO A;  1N8J A;  5DJL A;  1TRV A;  1EP7 A;  1RQM A;  1FG4 A;  1FVK A;  1KTE A;  4G19 A;  1U3A A;  4BWS A;  4GTU A;  1BQ7 A;  2R37 A;  3VPT A;  5DDL A;  1JLV A;  5A4W A;  1F3B A;  1WE0 A;  1Z3E A;  2LS5 A;  5CNW A;  3VLN A;  2MMA A;  2Z9S A;  2I4A A;  4ZBD A;  6GST A;  2O7K A;  1GNE A;  2EFC A;  4NMU A;  1PD2 1;  3F63 A;  1HD2 A;  2N5F A;  3ZIJ A;  2PPT A;  3P7X A;  1G0T A;  1U88 A;  2LQO A;  1ZOF A;  2R5G A;  1YY7 A;  2WRT A;  1JZW A;  1IYI A;  5B7C A;  1K3O A;  1Z6M A;  1R5A A;  3LFL A;  2TIR A;  1V9W A;  3L78 A;  4RUV A;  3TRP A;  2RLI A;  3MYD A;  2H30 A;  4KE3 A;  4YQV A;  3ZVJ D;  4F0C A;  1O7U A;  2N5B A;  2R0C A;  3HZ4 A;  4OMV A;  2CAQ A;  3EVI A;  1SD8 A;  2L4C A;  2DMM A;  4IGJ A;  1GUH A;  3GKM A;  2L6C A;  2AJQ B;  4JRR A;  3E0U A;  3UAR A;  5GST A;  2FLS A;  4PUF C;  4EL1 A;  1JFU A;  4WR5 A;  1SYX A;  3IRA A;  3KH7 A;  2J23 A;  4OFT A;  1WMJ A;  2A2S A;  1YEX A;  3DWV A;  5KN0 A;  5DAL A;  1ZYP A;  4Z2U A;  5D73 A;  1AUC A;  1AQX A;  3TOU A;  4KDX A;  2H0H A;  2V41 A;  3CTG A;  5DAL B;  4K1F A;  4XIH A;  3F4R A;  2GZP A;  1A0R P;  4IJI A;  3L9U A;  1M9B A;  1ERT A;  4HDE A;  4EC0 A;  4X4J A;  2A2R A;  3C73 A;  2GQM A;  2O85 A;  5ECL B;  3D22 A;  2K8S A;  1T3B A;  5IO0 A;  4E8E A;  3HJO A;  4G2E A;  2G0F A;  1USB A;  4G10 A;  4YQU A;  2PER A;  5CRW A;  4PQI A;  4Q5F A;  4QMK A;  2DJ2 A;  1ERW A;  4POL A;  2H0I A;  3M0F A;  5DAK A;  1AXD A;  2DJK A;  3IV4 A;  2VD1 A;  5AIV A;  1FW1 A;  1GRX A;  5DAK B;  3WGD A;  2WZ9 A;  2PGT A;  2C0G A;  4V2L A;  2F51 A;  4EUY A;  2HYX A;  3V1W A;  1VF4 A;  1X5C A;  3CBU A;  2O5V A;  2DKI A;  4KDU A;  3H8Q A;  4F82 A;  2AB6 A;  1DSB A;  4EKZ A;  2MZC A;  2VLT A;  3W8S A;  4RQR A;  5ECN B;  5A5K A;  3DGQ A;  1JZD A;  3N9J A;  3K8N A;  1U3I A;  4K0G A;  1MD3 A;  3EUR A;  2CV4 A;  1QQ2 A;  4GXZ A;  5G31 A;  2FNO A;  2UV8 G;  2M72 A;  1YF1 A;  2IL3 A;  2VL9 A;  5D9X A;  3HVS A;  4POB A;  5JWQ B;  2VCW A;  4HZ4 A;  1QXH A;  2NTO A;  2EFD A;  1U87 A;  2H6Z A;  2H8L A;  2H6Y A;  4PGT A;  3QAV A;  4RI6 A;  5BRT A;  2DIZ A;  4JED A;  1ST9 A;  2QC7 A;  4DEJ A;  1B48 A;  1K0A A;  4TXO A;  5F06 A;  1TTZ A;  2F3M A;  4TXO B;  3KCM A;  5D96 A;  1NSW A;  5HFK A;  1B8X A;  2GSS A;  5IIZ A;  2BTO T;  4WF4 A;  3ZFL A;  3PPU A;  3TUE A;  2GST A;  2K6V A;  2YPM A;  2V6K A;  4MDC A;  1F2E A;  2KUC A;  1Z7P A;  3Q6O A;  4J57 E;  3GX0 A;  10GS A;  3QR6 A;  2GDR A;  4EDZ A;  1WJK A;  1MDK A;  5E59 A;  4GLT A;  4ML6 A;  3P2A A;  4MZC A;  4XRD A;  1URM A;  2X99 A;  3F8U A;  5ENU A;  2H1B A;  2DJJ A;  4WBR D;  3O76 A;  3LEF A;  3MSZ A;  3UIW A;  3GH6 A;  1T4Y A;  3J7Y b;  2TRC P;  6GSY A;  5A4U A;  3LXT A;  2OAC A;  2AAW A;  3HXS A;  2O89 A;  4I97 A;  1NHO A;  1XOB A;  1OAZ A;  1SEN A;  1QGV A;  1FAA A;  5AGY A;  5IPG A;  5D9W A;  1K0D A;  4O5U A;  5E4W A;  4MH3 A;  4KF9 A;  4ICY A;  16GS A;  4POM A;  2V2G A;  4K2D A;  3EMP A;  4HUA A;  4JR4 A;  3DKS A;  3HD5 A;  3M9J A;  5ABR A;  1B9Y C;  2CT6 A;  2MMO A;  2PUK C;  3PIN A;  4X1U A;  2FGX A;  5DBQ A;  1XCC A;  2FHE A;  2HE3 A;  4IVF A;  2H74 A;  3F4T A;  2H1G A;  1SJI A;  3CXG A;  3FYG A;  4NWY A;  2CX4 A;  1V57 A;  3GNJ A;  2HSY A;  2YAN A;  1SKR B;  4YAV A;  1G7E A;  1Z5Y E;  1PSQ A;  3KD0 A;  2C80 A;  2AHE A;  4K7I A;  3L9S A;  3DXB A;  3U5R E;  1OKD A;  2RUF A;  1NM3 A;  1SKS B;  2HRK A;  3KM6 A;  1W4V A;  5IO2 A;  2HRK B;  1EZK A;  4NXI A;  4XHM A;  3FK8 A;  3LQ7 A;  3RHC A;  2PVQ A;  1GTU A;  2EIR A;  1X9M B;  2GVP A;  3MDK A;  1R5P A;  3EE2 A;  3SWL A;  1UN2 A;  2GLR A;  5FWG A;  1J08 A;  5HQP A;  4K6X A;  1TRW A;  1TK8 B;  3KP8 A;  3VPQ A;  4L8E A;  1TI1 A;  3TRX A;  2H1D A;  4EIP A;  3BBY A;  2QA1 A;  3ZRE A;  3SBC A;  14GS A;  2E0Q A;  1BG1 A;  4PX1 A;  3IC4 A;  2CAI A;  1ERV A;  2H66 A;  2DIY A;  17GS A;  2OAD A;  2X64 A;  4ECJ A;  2YV7 A;  1VRS D;  4GWR A;  1MEK A;  3JCM L;  4YH2 A;  1I5G A;  1J9B A;  1Y6E A;  4K5S A;  3FKF A;  1E2Y A;  3BD2 A;  2M46 A;  3GFK A;  1FOV A;  4P3Y B;  1E6B A;  1Q4J A;  4TOP A;  2JZT A;  3KGK A;  4ZBA A;  3UMA A;  5F0G A;  1EOG A;  1JHB A;  1EGO A;  2LJA A;  5ELG A;  4BA7 A;  2XHF A;  1PN9 A;  3UOM A;  1KBN A;  4EVM A;  4KDY A;  1GTA A;  5ECP B;  4DSQ A;  1WRY A;  2PVO C;  2YV9 A;  4MF6 A;  3I69 A;  2PWJ A;  4OFN A;  2FWF A;  1YKA A;  3LWA A;  1GSF A;  3C7M A;  2IMI A;  2V6O A;  1THO A;  2IFQ A;  4NHZ A;  3QAG A;  5G2Z A;  1GLP A;  3IXR A;  1LJR A;  2HRF A;  5D93 A;  2IFQ B;  5G5F A;  1TRU A;  1HNC A;  4HU9 A;  5COH A;  1ILO A;  5G30 A;  1SJZ A;  2LV3 A;  3UJ1 A;  2LNT A;  1M7T A;  4LL1 B;  13GS A;  1ZZY A;  1K3L A;  1NHY A;  1K0B A;  3D5J A;  4QL9 A;  3A3T A;  1A8Y A;  1GP1 A;  4GRF A;  2C3Q A;  3EC3 A;  1X9W B;  4ILF A;  3QCP A;  3WGX A;  1PX7 A;  3AY8 A;  2XBI A;  1MD4 A;  4ZXG A;  1KNG A;  1OC3 A;  4GQF A;  1G7O A;  3TKR A;  4AGS A;  4ECI A;  3IPZ A;  4ZL7 A;  1WOU A;  3QMX A;  4MH2 A;  3A2V A;  5J41 A;  4J2F A;  3ME7 A;  2H71 A;  3CSI A;  18GS A;  2PMT A;  2LKU A;  2FCH A;  1BYE A;  1B4P A;  3E3E A;  4RQX A;  2C0D A;  4LMV A;  2HRN A;  2WS2 A;  2R2J A;  3L4N A;  2C0F A;  4NV5 A;  1EV9 A;  11GS A;  3FY7 A;  3I9V 2;  3L9V A;  4ZB6 A;  4BPY A;  1WWJ A;  1OYJ A;  2LRN A;  1VGL A;  5DCH A;  3M1G A;  3QOU A;  2JAD A;  4TXV A;  3CWG A;  3QFB C;  3BCI A;  4PTS A;  3F0I A;  1TW9 A;  1EEJ A;  5DCG A;  5IQY A;  2VIM A;  3P90 A;  5H5R A;  1TI3 A;  3O6T A;  4MPG A;  2RII A;  2OE0 A;  4TKY A;  3D4T A;  1G6Y A;  2JAC A;  5B8B A;  2YP6 A;  1VF3 A;  2C8U A;  4HI7 A;  1GH2 A;  3DIE A;  2H1L A;  3TJJ A;  4Z2T A;  3C1R A;  2VUP A;  2LEG A;  3IE3 A;  5G1L A;  1JZR A;  1T1V A;  4XCS A;  5KN2 A;  3UVT A;  3VWU A;  1AAZ A;  1KEB A;  1QUW A;  5HR3 A;  2EFH A;  3FZ9 A;  1YEP A;  4I2T A;  1XFL A;  3FW2 A;  2HSM A;  2TRX A;  2X8G A;  1JLW A;  2HSM B;  1PL1 A;  1PN0 A;  1PMT A;  2WB9 A;  4G9H A;  1AQW A;  1XW6 A;  2B5E A;  1ZYE A;  3GN3 A;  1DBY A;  5A5H A;  4KSM A;  5GZZ B;  4ZB9 A;  7GSS A;  5A5H B;  1Y25 A;  2AV4 A;  4OD7 A;  1V2A A;  5FHI A;  2HI7 A;  5ECS A;  4HU7 A;  5L71 A;  3IOS A;  2C3T A;  4HJM A;  2H19 A;  3HZ8 A;  4L0W A;  4IQ1 A;  3GRX A;  5IOW A;  2HLS A;  3VI5 A;  5CYY A;  1N25 A;  2AUV A;  4XRA A;  1AW9 A;  1PKW A;  3TGZ A;  3WT2 A;  5ID2 A;  1SK2 A;  5DQS A;  1J0F A;  1YKC A;  5ID2 B;  3TU3 B;  3GA4 A;  4O5R A;  2V32 A;  1YJ6 A;  3VWX A;  1OC9 A;  3DD3 A;  2B7K A;  1XIY A;  1OC9 B;  1TRS A;  3ZRD A;  1K0N A;  1XW5 A;  3IK7 A;  5KEJ A;  3TKQ A;  1GLQ A;  2J9H A;  1UVZ A;  4XS1 A;  3MIX A;  1EV4 A;  5IMZ A;  3BOA A;  2GS3 A;  2IPA A;  2L59 A;  3N5O A;  1FOH A;  3CTF A;  1SJ6 A;  1GSQ A;  3KTB A;  2WJU A;  2E7P A;  4F03 A;  2A4V A;  2CVK A;  2ZCT A;  1Z6N A;  2NPB A;  4AJ7 A;  4OWY A;  4EE0 A;  2B3S A;  4QL7 A;  3C8E A;  4DVC A;  5IOX A;  3QAW A;  4HQS A;  4L0U A;  2L6D A;  2BMX A;  4AKI A;  5AN1 A;  4JU5 A;  4CHS A;  2FD3 A;  1FO5 A;  4OFM A;  4GDF A;  5IMA A;  2I3Y A;  2WGR A;  2AYT A;  2VD0 A;  2RM6 A;  4BWQ A;  1TOF A;  4RI7 A;  5CRE A;  2QKE A;  2NVL A;  5IPH A;  1NW2 A;  3CYN A;  1HNB A;  4PUR A;  5INY A;  3KP9 A;  1TP9 A;  3O3T A;  3FZ5 A;  3KIJ A;  1EWX A;  3CRT A;  5C00 A;  1O73 A;  3CRU A;  5AIS A;  4PNG A;  4USS A;  1O81 A;  2VL2 A;  3TKS E;  4HZ2 A;  4WR4 A;  2YJH A;  1M9A A;  2EFE A;  4EO3 A;  4EDY A;  3MNG A;  4AKX B;  1XPV A;  5ECO B;  5GAN D;  4MCU A;  4DSS A;  2H76 A;  4MF5 A;  5J40 A;  1XWK A;  4ZL8 A;  4DSS B;  1R7H A;  3M9K A;  2HSN A;  4IS0 A;  2GZZ A;  4JE1 A;  4D73 A;  4KGI A;  4LA1 A;  3FEU A;  3VWV A;  4V1A g;  3KZQ A;  3QDN A;  5HR1 A;  3CMI A;  3C1S A;  5D9V A;  5J3R A;  2LJK A;  4IBP A;  2HSN B;  1QMV A;  4D73 B;  1SL1 B;  3UEM A;  3KEB A;  2I1U A;  1AIU A;  4EF0 A;  4W66 A;  2ZNM A;  3Q18 A;  3KTL A;  1VF1 A;  1GSE A;  5B8A A;  3KXO A;  5CAX A;  5F8B A;  3R2Q A;  5DJM A;  2VLU A;  2UZ8 A;  3EU3 A;  4Z2R A;  4MLY A;  3FHK A;  1OKT A;  5ECM B;  2RUE A;  3A5I A;  2REM A;  1SU9 A;  1T4Z A;  3I6A A;  2H6X A;  2QGV A;  3F3Q A;  3HHV A;  3G9B A;  2B1L A;  1XW9 A;  3F4S A;  3GKX A;  4LL4 B;  3G7I A;  2JZR A;  4G0I A;  1ZGN A;  1OE7 A;  3M3M A;  1X9S B;  1PL2 A;  3U6V A;  1BF5 A;  1A24 A;  2CVB A;  3ERG A;  1SK0 A;  3PH9 A;  1O8W A;  2L5O A;  2LST A;  3D21 A;  3LJR A;  3GHA A;  3EMX A;  2PBJ A;  3ED3 A;  3VFI A;  4GSN A;  5H5S A;  4Q5Q A;  2P5R A;  4HS1 A;  3HVX A;  3GST A;  4KW6 A;  3CSH A;  3NIV A;  4G0K A;  2P31 A;  3KH9 A;  1FVJ A;  3WYW A;  3DVW A;  4KB3 A;  5JWO B;  1A23 A;  2VKZ G;  3IK9 A;  2YWI A;  2JSY A;  2NBS A;  1X5E A;  3GYK A;  2B5Y A;  4XTS A;  1PRX A;  1VF2 A;  1TDI A;  22GS A;  3TB2 A;  1TK5 B;  3GL5 A;  1S3C A;  4AKH A;  1SK1 A;  3G7Y A;  2GTU A;  2R4V A;  4HJ2 A;  1K0C A;  4K5R A;  1SVL A;  1ZCP A;  3ZFB A;  2IMF A;  4LMW A;  4JBB A;  3PGT A;  1XWB A;  2FY6 A;  2GQL A;  4ECC A;  5KN3 A;  2QA2 A;  3F6D A;  4FQU A;  2KP2 A;  3S9F A;  2JSZ A;  4ACS A;  3IDV A;  1AC1 A;  3FMW A;  3TKP A;  3H1N A;  1K3Y A;  5J9B A;  5C04 A;  4IHU A;  5LNK e;  5J9C A;  1MDI A;  2LUS A;  4IP1 A;  2EC4 A;  1F3A A;  2HT9 A;  19GS A;  4YAP A;  1N2A A;  1UC7 A;  3GX8 A;  2CX3 A;  3KJY A;  2H70 A;  5LCZ A;  2B5X A;  2E2M A;  4N11 A;  1ZYN A;  5ECK B;  3ME8 A;  4H86 A;  2PU9 C;  5D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...