5DAKA

Crystal structure of human glutathione transferase pi complexed with a metalloid in the absence of glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
194
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 77
structure length 194
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dakA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dakA01
5D8IA 1M9AA 2LKUA 5G1LA 1TK8B 2YV7A 2GZYA 1GTUA 3KEBA 2OKAA 3ZL5A 4HEA2 4J57E 4ECJA 2WCIA 2AHEA 2GZPA 2HXKA 5IO2A 4TR4A 3D0ZA 2IJYA 2EIRA 1M2AA 5AN1A 2X8CA 3LYPA 1KNGA 2MBSA 5G2ZA 1HNCA 2MMOA 5G1KA 1PD21 1TP9A 3UOMA 4OMVA 4K6XA 4NHWA 1RQMA 1PX6A 5FT3A 4Q5FA 2F3MA 3BCKA 5B8BA 2R6KA 1GTBA 2HZEA 1SYXA 5ECMB 5J5NA 4TXOA 1SKSB 3GURA 4KAEA 3Q19A 3MNGA 4NHZA 4K9ZA 3WD6A 4IJ3A 4MH3A 4ZIJA 3F4TA 4KX4A 1H4OA 3TRQA 4BA7A 2C3NA 3IK9A 3KTBA 2GT5A 5HR0A 1VF2A 2VL3A 1Z7PA 1B4QA 16GSA 3LXTA 4X1UA 4TVEA 2ZCTA 5DDLA 3NOFA 2EIQA 3L4NA 2PN8A 5F06A 4EO3A 5J9CA 5ELGA 5ID2B 3ZVJA 4ZB8A 3N5OA 4YAVA 3C1SA 3DKSA 1Y6EA 4TW5A 4JRRA 2OBKA 2IMFA 3FZ5A 3IR4A 2MMZA 1NW2A 3EINA 2WS2A 3GH9A 4N0ZA 1PL1A 1XPVA 3GA4A 4IP1A 3C73A 5ABRA 4DSSA 2WZ9A 2B1LA 2LRCA 2LRTA 2MYGA 1Z3EA 3A3TA 2I4AA 5J4UA 2WJUA 1EP7A 2MBTA 4Q5QA 5KN3A 4G0IA 1A8YA 2V2GA 2VUPA 2V32A 1O85A 3LFLA 1O73A 2O87A 1AUCA 4XRDA 3TKSE 2M72A 1BQ7A 2H8LA 4GLTA 2FWFA 2CVBA 2H1GA 5D93A 4FH8A 3HJOA 1HD2A 3TRPA 5ECQB 2C8UA 4IHUA 3CSJA 1K0MA 4D73A 3QMXA 1JZOA 4GSTA 4I8BA 3LORA 1SU9A 1K0CA 1GL8A 2H66A 2HRAA 5INYA 3UVTA 3CRUA 3A2VA 4KA0A 4KW6A 6GSUA 3CTGA 1Z9HA 1ST9A 1ERUA 3ZVJD 4K0GA 5GZZB 1PSQA 2WRTA 1ZYQB 2C0GA 3QOUA 4MF6A 3C7MA 4WBJA 2NTOA 3BJ5A 3QFAC 2DC5A 1OYJA 1DE1A 5C00A 3LGCA 1GH2A 3KZQA 1QFNA 1UA5A 4K7IA 1PX7A 4GRFA 4ML1A 4POLA 12GSA 5DALA 2FGXA 1ON4A 2DMMA 5LD0A 3QFBC 4ZL9A 5IOXA 1YZXA 1A24A 4IQAA 5CO3A 5F8BA 1MD4A 3FR9A 2H75A 2B1KA 1TU7A 6GSSA 2E7PA 3DRNA 4OFTA 1GSFA 17GSA 1FW1A 3GL3A 1WRYA 3TJJA 5ECOB 1TXXA 2DJ0A 2HLSA 3ZFLA 1XFLA 4PX1A 3APQA 4JBBA 3PINA 2LV3A 1A8LA 1R4WA 1WWJA 4PXOA 4LA1A 2B5YA 3GNJA 3HJMA 2RIIA 3HCZA 4F2IA 3KTLA 3WYWA 5D9WA 2ZUPA 1A2MA 3TB2A 3EC3A 3O76A 4O92A 2H71A 2VM1A 2Z9SA 1LBKA 1TDIA 3ISOA 2QSIA 1MDKA 3DVXA 3GV1A 2CVDA 4KDYA 5AIXA 4NV5A 3TJFA 13GSA 5ECSA 4WR4A 1YKAA 1AIUA 4MJCA 3VFIA 3DVWA 3ERFA 1K0AA 2FWHA 4MZBA 4QL7A 2FWEA 4NMUA 4TXVA 2LQOA 5DQSA 2BMXA 3US3A 2EC4A 5BMUA 2DSAA 2C3QA 4N0VA 1SL1B 3EU3A 5CNWA 3IHQA 2VCVA 4I2TA 1NHYA 4G9HA 1HNAA 4YAPA 5DALB 1SL0B 5HFKA 3Q74A 2P31A 3CMIA 2DJKA 4KB3A 4X0XA 5J3RA 4WKWA 2GS3A 1IYIA 4PNGA 2VL2C 1NM3A 2X8GA 4MH2A 2YJHA 2FA8A 3F3RA 4XIHA 3UIWA 3ME7A 1F37A 5JWQB 4XS6A 3NIVA 3IAM2 2GGTA 3APSA 2AB6A 5ELAA 2GZZA 4HU9A 3M9KA 2REMA 2JSYA 1M9BA 5L71A 1OKTA 2PVOC 2YZUA 3TKSA 1UN2A 5H5SA 1PKZA 1FB0A 4FIWA 1K0NA 5ECLB 3P2AA 4MCUA 5IPHA 3I69A 1EWXA 1X0RA 4KH7A 1G6YA 5EL8A 1YF0A 1V9WA 1XWBA 2PPTA 1PL2A 1ZOFA 2L6DA 3F9UA 3LXZA 4POBA 3ZMLA 2LTKA 4OO4A 1G7EA 1F3AA 4PUFC 1N2AA 5IIZA 4USSA 2P5RA 1OC9A 2LJAA 3F63A 5LCZA 2H73A 9GSSA 4X43A 3GX8A 2R3XA 2HI7A 1XOBA 1PQNA 1XWGA 1FAAA 4K0NA 18GSA 1ZMAA 4G19A 3CBUA 4KNDA 2LEGA 3GN3A 4IS0A 1WJKA 3GL5A 2PWJA 4H86A 2JZSA 2GT6A 3H79A 2DLXA 2O7KA 4RI6A 2YWIA 4KSOA 4XTSA 2NDOA 3HVSA 2VCQA 5EPFA 5D73A 1B8XA 3F4RA 3HA9A 3BCIA 2FD3A 1Q4JA 5AISA 2XC2A 5HR3A 2VD0A 2XPDA 4N11A 4POKA 1J0FA 3H1NA 1TRSA 5JWRB 2XBQA 3EVIA 5J9BA 3G9BA 2KOKA 7GSSA 3ERGA 3D21A 2HQTA 1BYEA 1R7HA 1FVKA 1X5EA 2V6KA 6GSWA 1WPIA 3GTUA 4EXJA 4KF9A 3WGXA 4TR0A 5FWGA 2C0EA 3GHAA 1EGRA 1MEKA 4MJBA 1EV4A 4MABA 2CZ2A 3TUEA 1PN9A 4NV2A 1JHBA 1WIKA 1XWKA 1GUKA 3ERWA 4GCIA 4KDXA 5F07A 3CYNA 1C72A 6GSYA 4ZL7A 2G0FA 2X64A 2KLXA 4Q5NA 2OBIA 2F8AA 4WEYA 2P0GA 1EOGA 4V1Ap 3GKXA 5IMZA 4AGSA 1FOVA 2H74A 3HXSA 4BWSA 3D4MA 1U3AA 3EE2A 2QC7A 2GSTA 5KN2A 1YDKA 1EEJA 3VK9A 3A2XA 3TOTA 1DE2A 5G5EA 3J7Yk 1V57A 3U5RE 3F4SA 1GRXA 4V2MA 3ZLPA 2HSNB 3ED3A 11GSA 1N8JA 2JZTA 5CRDA 2MMAA 3D22A 1GSSA 4ZILA 2B5XA 1ML6A 2BTOT 2YNXA 4AJ6A 4KCAA 2R37A 3BD2A 1XW6A 4L0WA 3WT2A 3FYGA 4DEJA 5HR2A 3G7YA 2IMIA 2PBJA 3IA1A 3N9JA 5F0GA 1PRXA 4MMMA 1AQVA 1ILOA 2WB9A 2OA7A 3LYKA 4QQ7A 2HSMB 2H1DA 2H1BA 3ZIVA 4HUAA 1ACVA 2K9FA 4N30A 1JFUA 3F3QA 4GWRA 4ML6A 3VWVA 2QKEA 1X9SB 3DGQA 3GTUB 4HQZA 2V6OA 2IWTA 3GH6A 5JCGA 2YP6A 20GSA 1YEXA 3JCML 2DMLA 4G0LA 3A2WA 3E0UA 2YANA 1M7TA 1B9YC 1S3DA 1XIYA 2H01A 1EP8A 2EIOA 1K0DA 1XW5A 2WFCA 1AC1A 2K18A 1PGTA 4O7HA 1BX9A 2X8HA 2AYTA 1ZYEA 4NAXA 2VCZA 1TW9A 4IN0A 5EY6A 1XBSA 1GUHA 2TRCP 2F51A 4OFNA 2HFDA 2KP2A 3WGDA 3KH9A 2IMKA 2PU9C 2IMEA 5A4WA 1QUWA 5EVOA 5CYYA 2MMNA 2E2GA 4MK3A 4ZB9A 3TKPA 1W89A 1X9WB 6GSVA 3IOSA 4ACSA 3R3EA 3IBHA 2KP1A 2TIRA 1X5CA 4HZ2A 2O8VB 1TU8A 4F03A 1UVZA 5HFIA 4E8EA 5FHIA 1ZL9A 3WT1A 3DEXA 1H75A 2DIZA 5CREA 5ECPB 4MA9A 1G7OA 2P5QA 2CAQA 4WETA 2HRKB 1TTZA 2GQLA 1ERTA 2F9SA 3GUSA 1SKRB 4OD7A 5G30A 4GSSA 2K8SA 4FQUA 3W8SA 4F0CA 2N5BA 1PA3A 22GSA 1EV9A 4MF7A 5KEJA 1T00A 1A2JA 3GKNA 4YH2A 4I5QA 4J56E 5F05A 1MDIA 1T1VA 4PQIA 1QGVA 4JR4A 2LQQA 4DVCA 2AUVA 5JWOB 4TR3A 3UBLA 1DUGA 1J08A 1SJIA 1SK0A 4HS1A 1QK8A 4RI7A 4MP4A 4RUVA 2XPEA 1OC3A 4L0UA 3KMNA 4GSNA 3TKSC 1OE7A 2B6MA 3VLNA 3KP8A 4OCEA 1AQWA 4I6XA 1R5PA 1V98A 3FK8A 4O32A 1F3BA 4RQRA 2I81A 3S9FA 1GNEA 1HQOA 4TKYA 2HSHA 1EZKA 4TOPA 1TJDA 3L9VA 4K1FA 3MWHA 1PKWA 2H1AA 1AQXA 2AV4A 3DYRA 4MDCA 3LG6A 1GSEA 4F0BA 3SWLA 3LWAA 2VCTA 1GUMA 2FLSA 2CV4A 3IV4A 5JCWA 2JADA 2WGRA 4FYCA 3EWLA 4GQFA 4ZXGA 1M99A 1IYHA 3HHVA 2PMTA 1XW9A 1USBA 1F2EA 2X99A 2FUG2 5GSSA 3EYTA 2VCWA 5GSTA 2CA8A 3TKRA 2DJ1A 3K8NA 4K7NA 1SK1A 3D6IA 4MZCA 4MPFA 3H8QA 2YWOA 4PQHA 2QGVA 1OE8A 1VGLA 2WULA 3FY7A 3BOAA 2L57A 4JU5A 2ZNMA 1AAZA 4MZWA 2H6YA 2OE0A 4I97A 3KGKA 3KMOA 4GTUA 2RUFA 3F8UA 3VPTA 2A2SA 1T7PB 2YZHA 2VOCA 2CT6A 1DSBA 1SENA 3LQ7A 5DJMA 1TI1A 3D5JA 3G7JA 2H0HA 5D9XA 5ECHB 3TDGA 4OWYA 5DAKB 5CP1A 4Z7XA 2A4VA 2L5OA 3M0FA 5DVBA 4AJ8A 2O89A 2YWNA 3DMLA 2DJ3A 4CDOA 2LUSA 4BVXA 1GLQA 4ILFA 4PQ1A 4FO5A 1A23A 3HVXA 1GSYA 4HDEA 3VWWA 3HVVA 2HRNA 1R26A 2V1MA 1KBNA 2C80A 3QDNA 3TGZA 2GDRA 4V2NA 4HI7A 2HSYA 5HFGA 1GSUA 2YPMA 4EDZA 2TRXA 2GSQA 1TRVA 4JE1A 1BG5A 2A2RA 1V40A 1GTAA 4ECBA 3ZRDA 2VAFA 2GLRA 3DWVA 2OE1A 3GIXA 1GWCA 5ECIB 4V2LA 4LMVA 3RPNA 2H72A 2K8VA 2HT9A 3EMXA 5ENUA 2IPAA 3F6DA 3HZ4A 2HYXA 4IBPA 1I5GA 2IL3A 4LMWA 1FG4A 1S3AA 1F6MC 4ZL8A 2J23A 3KIJA 3UMAA 1K3OA 2VCXA 3V1WA 1A0RP 1FVJA 3SBCA 3P8WA 3R2QA 1Z7RA 2C0FA 1E2YA 5GAPD 2H30A 1MDJA 4WF4A 2CX4A 3GX0A 1YY7A 3P90A 3FKFA 4QL9A 2JZRA 1I9DA 4DSQA 2I1UA 5IMCA 3QR6A 3PPUA 3BBYA 1RW1A 3KCMA 2HSMA 4EF0A 4GF0A 4ZBBA 3IK7A 4BVXB 2CX3A 3FZAA 3IDVA 2L4QA 1WMJA 3ZTLA 1Z6MA 2VLTA 5IM9A 4KCEA 2GTUA 3H4KA 3DIEA 4KDUA 3HDCA 2HE3A 1TOFA 4XCSA 4XS4A 4MF5A 3EU4A 2MZCA 3M8NA 3O6TA 8GSSA 1SK2A 1GP1A 4TR1B 1X5DA 4FYBA 4XRAA 1XZOA 2FCHA 5LNKe 3GMFA 3VI5A 4PNFA 1OKDA 3J7Yb 2VLUA 4IJIA 2XHFA 4ISDA 3ME8A 1O81A 3APOA 1V2AA 2B5EA 4PTSA 4EKZA 2H0IA 1EOHA 6GSXA 1OAZA 3L78A 1A0FA 5ECKB 2KHPA 3QAWA 1YF1A 2ON5A 1PMTA 3EMPA 1AW9A 3FZ9A 3LSZA 3C1RA 2GSRA 2B7JA 1T3BA 10GSA 4F82A 3QAGA 3IAS2 1T4ZA 3LEFA 4L5LA 3RPPA 1T8EB 1VF3A 2CVKA 4O5RA 2VLVA 2YWMA 2H0GA 4Q5RA 3MDKA 2FNOA 3ZITA 1EGOA 1B9XC 3D4TA 3UEMA 3FEUA 4YQVA 2RUEA 5H5QA 1AXDA 2OACA 1U3IA 4ULXA 3ZREA 4ID0A 2ES7A 2HRKA 4ECIA 4IVFA 5HQPA 3M9JA 1JZRA 5A4VA 2LS5A 4TN8A 1F9MA 4G0KA 3HJPA 4PUAA 2FWGA 3ZMKA 3FZ4A 4XS4B 1BJXA 2JSZA 3DXBA 3UBKA 5B6NA 1JLWA 2R4VA 4HZ4A 3CXGA 3WGEA 3TOUA 2H6XA 2LNSA 1DBYA 2FA4A 3GKKA 5ECNB 4TRXA 5A4UA 1O6JA 3U6VA 3C8EA 4XS1A 5GAND 1MD3A 5KN1A 5G5FA 4K8MA 4JR6A 1YKCA 4PGTA 1SD8A 5B6MA 3VI7A 1SJZA 1QXHA 1ZZYA 2VL9A 1ERVA 2GSSA 2M46A 3HKRA 4MLYA 2JU5A 1GULA 2N5FA 4BVYA 2L5LA 2LJKA 1XCCA 2L6CA 1X9MB 2AJQB 2ALBA 4EL1A 4LLRA 2G2QA 4LL1B 2C0DA 4L5OA 4IP6A 3RHCA 1K0OA 1XWAA 3EURA 1SKWB 3AY8A 3OR5A 3TCOA 3PH9A 4JZQA 3HYPA 1O8XA 2J9HA 3FW2A 2NBSA 1M0UA 1QMVA 3CSHA 3UVHA 1Z6NA 1BAYA 3GKMA 1SYRA 2PGTA 3UARA 1CQHA 1QQ2A 1THOA 4WR5A 2HZFA 2YCDA 1JZDA 1JZWA 3TRXA 1YJ6A 1V58A 2IMDA 5B8AA 1K3LA 5CRWA 2IIYA 2H76A 6GSTA 3KJYA 2BJXA 3CRTA 4IELA 3ZZXA 4HJ2A 2H19A 4XHMA 1TRUA 5J41A 4PURA 2PUKC 2DIYA 5IMAA 4EDYA 2B7KA 3RDWA 3ZYWA 1KTEA 2HZEB 2IFQA 2WDUA 1LU4A 4ZBDA 4TXOB 2JACA 1ZGNA 2CZ3A 3G7IA 2N5AA 5G31A 1EEMA 2OADA 1BEDA 5IMFA 2B3SA 1WOUA 3MSZA 1A2LA 5IQYA 1G6WA 5HR1A 2JL4A 1Y25A 2I9HA 5D9VA 4ZBAA 1B48A 4HOJA 1OVNA 3MAKA 5DAKA 1KEBA 2L59A 4AJ7A 1J9BA 5DJLA 3FRCA 4BVYB 4P3YB 2FHEA 1SD9A 5E59A 2HNLA 3A5WA 1B4PA 1R5AA 3F0IA 2I3YA 3FR6A 1M2BA 1O7UA 3IC4A 1WP0A 2YV9A 4DSSB 1JLVA 3I9V2 2YJ7A 4K2DA 5IOWA 1LJRA 1VF1A 2C3TA 4FYUA 3CTFA 3PGTA 1OC8A 2PERA 1K3YA 3VPQA 1W4VA 3L0HA 5H5RA 3I43A 5DCHA 3RAZA 2NPBA 4ZB6A 3DD3A 1HYUA 1K0BA 3GSSA 4EVMA 4YQUA 3TJBA 1RK4A 1U87A 4D73B 2R2JA 4HQSA 5AGYA 5A5KA 3E9JB 3M1GA 2LSTA 3GYKA 3IXRA 1FO5A 4ECCA 4WBRD 4LL4B 3ZIJA 1XOAA 19GSA 3IE3A 1VF4A 3QCPA 3VWUA 2IFQB 1VRSD 2GVPA 3HZ8A 2LRNA 1S3CA 2VIMA 2R5GA 4DSRA 1TI3A 1Z5YE 3FR3A 3UJ1A 3FHKA 4CHSA 3F6FA 5DBQA 4NPBA 2YOIA 4BL7A 1E6BA 1ZCPA 1GNWA 1GSDA 3IC8A 3NZNA 4IQ1A 4G10A 3W6GA 4IGJA 2E2MA 4IKHA 4CW9A 4I2UA 4BPYA 3E3EA 1M2DA 4GQCA 4F9ZA 3UAPA 2DBCA 1G0TA 3H93A 4OFMA 4NWYA 3TKQA 4EUYA 3I6AA 1CQGA 1TRWA 4KUNA 3KP9A 5E4WA 4KSMA 4NXIA 3RHBA 1XVWA 3Q18A 3UL3A 2NVLA 2RM5A 2H70A 1NHOA 3KD0A 4TR1A 2VD1A 1YQ1A 2K6VA 1GLPA 4OCFA 2OE3A 4RQXA 3TJKA 3RBTA 2CQ9A 4EE0A 1GSQA 1U88A 1SJ6A 3HD5A 5D96A 5D9TA 1O8WA 4HU7A 1UC7A 3KXOA 5DQYA 2D2ZA 3W8JA 1XVQA 4EC0A 5JCUA 1T4YA 5AIVA 1HNBA 3KM6A 4POMA 3M3MA 2PVQA 2FY6A 2OJLA 2DJ2A 2VO4A 1TKDB 2LJRA 2L4CA 2VM2A 1FHEA 3TJGA 2AAWA 3KH7A 3QAVA 4KGIA 4WXTA 4BL7B 4L8EA 1NSWA 2C1YA 1U6TA 2UZ8A 5CRGA 2GQKA 4J2FA 2O85A 2DJJA 1TK5B 1MTCA 5CAXA 2IN3A 4OO5A 3GSTA 4IW9A 4BWQA 4KE3A 3GRXA 4G2EA 5DCGA 3IPZA 4E8HA 3QPMA 4AF2A 5IO0A 3P7XA 4HJMA 1YEPA 2C4JA 5IMVA 2YN1A 5C04A 1FB6A 3VURA 1XWCA 2V41A 5CRHA 3LJRA 2LNTA 3C71A 2VL2A 14GSA 4V1Ag 2XBIA 2CAIA 5COHA 4N10A 2F8FA 3L9UA 1GTIA 1URMA 3IRAA 5KN0A 4WF5A 2M80A 2ON7A 4JEDA 2RM6A 1ERWA 2KUCA 4K7OA 2GQMA 3PR8A 3L9SA 1SL2B 5IMDA 4MPGA 1Q98A 2H6ZA 4GXZA 1TK0B 1THXA 4MJEA 5IPGA 5ECRB 5B7CA 1OC9B 2HRFA 2E0QA 3GFKA 2RLIA 5ID2A 3Q6OA 3ZFBA 3HY2A 4YQMA 3VWXA 3QD9A 1XXUA 3O3TA 1WE0A 3CSIA 4MJAA 1ABAA
chains in the Genus database with same CATH superfamily
5D8IA 1M9AA 3IHGA 2LKUA 5G1LA 1TK8B 2YV7A 2GZYA 1GTUA 3KEBA 2OKAA 3ZL5A 4HEA2 4J57E 4ECJA 2WCIA 2AHEA 2GZPA 2HXKA 5IO2A 4TR4A 3D0ZA 2IJYA 2EIRA 1M2AA 5AN1A 2X8CA 3LYPA 1KNGA 2MBSA 5G2ZA 1HNCA 2MMOA 5G1KA 1PD21 1TP9A 3UOMA 4OMVA 4K6XA 4NHWA 1RQMA 2DKIA 1PX6A 5FT3A 4Q5FA 4YKGA 2F3MA 3BCKA 5B8BA 2R6KA 1GTBA 2HZEA 1ZYPA 1SYXA 5ECMB 5J5NA 4TXOA 1PFOA 2WVXB 1SKSB 2WVYA 3GURA 4KAEA 3Q19A 3MNGA 4NHZA 4K9ZA 3WD6A 4IJ3A 4MH3A 5A5HA 4ZIJA 3F4TA 4EIPA 4KX4A 1H4OA 3TRQA 4BA7A 2C3NA 3IK9A 3KTBA 2GT5A 5HR0A 1VF2A 2VL3A 1Z7PA 1B4QA 16GSA 3LXTA 4O5UA 4X1UA 4TVEA 2ZCTA 5DDLA 3NOFA 2H1LA 2EIQA 3L4NA 2PN8A 5F06A 4EO3A 5J9CA 5ELGA 5ID2B 3ZVJA 4ZB8A 3N5OA 4K5RA 4YAVA 3C1SA 3DKSA 1Y6EA 4TW5A 4JRRA 2OBKA 2IMFA 3FZ5A 1BG1A 3IR4A 2MMZA 1NW2A 3EINA 2WS2A 3GH9A 4N0ZA 1PL1A 1XPVA 3GA4A 4IP1A 3C73A 5ABRA 4DSSA 2WZ9A 2B1LA 2LRCA 2LRTA 2MYGA 1Z3EA 3A3TA 2I4AA 4ZB7A 5J4UA 2WJUA 1EP7A 2MBTA 4Q5QA 5KN3A 4G0IA 1A8YA 2V2GA 2VUPA 2V32A 1O85A 3LFLA 1O73A 2O87A 1AUCA 4XRDA 5BRTA 3TKSE 2M72A 1BQ7A 2H8LA 4GLTA 2FWFA 2CVBA 2H1GA 5D93A 4FH8A 3HJOA 1HD2A 3TRPA 5ECQB 2C8UA 4IHUA 3CSJA 1K0MA 4D73A 3QMXA 1JZOA 4GSTA 4I8BA 3LORA 1SU9A 1K0CA 1GL8A 2H66A 2DKHA 2HRAA 5INYA 3UVTA 3CRUA 3A2VA 4KA0A 4KW6A 6GSUA 3CTGA 1Z9HA 1ST9A 1ERUA 3ZVJD 4K0GA 5GZZB 1PSQA 2WRTA 1ZYQB 2C0GA 3QOUA 5A34A 5A1NA 4MF6A 3C7MA 4WBJA 2NTOA 3BJ5A 3QFAC 2DC5A 1OYJA 1DE1A 5C00A 3LGCA 5A5HB 1GH2A 3KZQA 1QFNA 1UA5A 4K7IA 1PX7A 4GRFA 4ML1A 2EFEA 4POLA 12GSA 5DALA 2FGXA 1ON4A 2DMMA 5LD0A 3QFBC 4ZL9A 5IOXA 1YZXA 1A24A 4IQAA 5CO3A 5F8BA 3CWGA 1MD4A 3FR9A 2H75A 2B1KA 1TU7A 6GSSA 2E7PA 3DRNA 4OFTA 1GSFA 17GSA 1FW1A 3GL3A 1WRYA 3TJJA 5ECOB 1TXXA 2DJ0A 2HLSA 3ZFLA 1XFLA 4PX1A 3APQA 4JBBA 3PINA 2LV3A 1A8LA 1R4WA 1WWJA 4PXOA 4LA1A 2B5YA 3GNJA 3HJMA 2RIIA 3HCZA 4F2IA 3KTLA 3WYWA 5D9WA 2ZUPA 1A2MA 3TB2A 3EC3A 3O76A 4O92A 2H71A 2VM1A 2Z9SA 1LBKA 1TDIA 3ISOA 2QSIA 1MDKA 3DVXA 3GV1A 5J47A 2CVDA 4KDYA 5AIXA 4NV5A 3TJFA 13GSA 5ECSA 4WR4A 1YKAA 1AIUA 4MJCA 3VFIA 4K2XA 3DVWA 3ERFA 1K0AA 2FWHA 4MZBA 4QL7A 2FWEA 4NMUA 5A1NB 4TXVA 2LQOA 5DQSA 2BMXA 3US3A 2EC4A 5BMUA 2WW2A 2DSAA 2C3QA 4N0VA 1SL1B 3EU3A 1Y1UA 2O36A 5CNWA 3IHQA 2VCVA 4I2TA 1NHYA 4G9HA 1HNAA 4YAPA 5DALB 1SL0B 5HFKA 3Q74A 2P31A 3CMIA 2DJKA 4KB3A 4X0XA 5J3RA 4WKWA 2GS3A 1IYIA 4PNGA 2VL2C 1NM3A 2X8GA 4MH2A 2YJHA 2FA8A 2WW1A 3F3RA 4XIHA 3UIWA 3ME7A 1F37A 5JWQB 4XS6A 3NIVA 3IAM2 1YVLA 2GGTA 3APSA 1YEWC 2AB6A 5ELAA 2GZZA 4HU9A 3M9KA 2REMA 2JSYA 1M9BA 5L71A 1OKTA 2PVOC 2YZUA 3TKSA 1UN2A 5H5SA 1PKZA 1FB0A 4FIWA 1K0NA 5ECLB 3P2AA 4MCUA 5IPHA 3I69A 1EWXA 1X0RA 4KH7A 1G6YA 5EL8A 1YF0A 1V9WA 1XWBA 2PPTA 1PL2A 1ZOFA 2L6DA 3F9UA 3LXZA 4POBA 3ZMLA 2LTKA 4OO4A 1G7EA 1F3AA 4PUFC 1N2AA 4X4JA 5IIZA 4USSA 2P5RA 1OC9A 2LJAA 3F63A 5LCZA 2H73A 9GSSA 4X43A 3GX8A 2R3XA 2HI7A 1XOBA 1PQNA 1XWGA 1FAAA 4K0NA 18GSA 1ZMAA 4G19A 3CBUA 4KNDA 2LEGA 3GN3A 4IS0A 1WJKA 3GL5A 2PWJA 4H86A 2JZSA 2GT6A 3H79A 2DLXA 2O7KA 4RI6A 2YWIA 4KSOA 4XTSA 2NDOA 3HVSA 2VCQA 5EPFA 5D73A 1B8XA 3F4RA 3HA9A 3BCIA 2FD3A 1Q4JA 5AISA 2XC2A 5HR3A 2VD0A 2XPDA 4N11A 4POKA 1J0FA 3H1NA 1TRSA 5JWRB 2XBQA 3EVIA 5J9BA 3G9BA 3TU3B 2KOKA 4PHZC 7GSSA 3ERGA 3D21A 2HQTA 1BYEA 1R7HA 1FVKA 1X5EA 2V6KA 6GSWA 1WPIA 3GTUA 4EXJA 4KF9A 3WGXA 4TR0A 5FWGA 2C0EA 3GHAA 1EGRA 1MEKA 4MJBA 1EV4A 4MABA 2CZ2A 3TUEA 1PN9A 4NV2A 1JHBA 1WIKA 1XWKA 1GUKA 3ERWA 4GCIA 4KDXA 5F07A 3CYNA 1C72A 6GSYA 4ZL7A 2G0FA 2R0GA 2X64A 2KLXA 4Q5NA 2OBIA 2F8AA 4WEYA 2P0GA 1EOGA 4V1Ap 3GKXA 5IMZA 4AGSA 1FOVA 2H74A 3HXSA 4BWSA 3D4MA 1U3AA 3EE2A 2QC7A 2GSTA 5KN2A 1YDKA 1EEJA 3VK9A 3A2XA 3TOTA 1DE2A 5G5EA 3J7Yk 1V57A 3U5RE 3F4SA 1GRXA 4V2MA 3ZLPA 2HSNB 3ED3A 11GSA 1N8JA 2JZTA 5CRDA 2MMAA 3D22A 1GSSA 4ZILA 2B5XA 1ML6A 2BTOT 2YNXA 4AJ6A 4KCAA 2R37A 4GDFA 3BD2A 2WW0A 1XW6A 4L0WA 3WT2A 3FYGA 4DEJA 5HR2A 3G7YA 2IMIA 2PBJA 3IA1A 3N9JA 5F0GA 1PRXA 2X49A 4MMMA 5J4VA 1AQVA 1ILOA 2WB9A 2OA7A 3LYKA 4QQ7A 2HSMB 2H1DA 2H1BA 3ZIVA 4BIKA 4HUAA 1ACVA 2K9FA 4AKXB 4N30A 1JFUA 3F3QA 4GWRA 4ML6A 3VWVA 2QKEA 1X9SB 3DGQA 3GTUB 4HQZA 2V6OA 3CQFA 2IWTA 3GH6A 5JCGA 2YP6A 20GSA 1YEXA 3JCML 2DMLA 4G0LA 3A2WA 3E0UA 2YANA 1M7TA 1B9YC 1S3DA 1XIYA 2H01A 1EP8A 2EIOA 1K0DA 1XW5A 2WFCA 1AC1A 2K18A 1PGTA 4O7HA 1BX9A 2X8HA 2AYTA 1ZYEA 4CY6A 4NAXA 2VCZA 1TW9A 5EY6A 4IN0A 3MIXA 1XBSA 1GUHA 2TRCP 2F51A 4OFNA 2HFDA 2KP2A 3WGDA 3A5IA 3KH9A 2IMKA 2PU9C 2IMEA 5A4WA 1QUWA 5EVOA 5CYYA 2MMNA 2E2GA 4MK3A 4ZB9A 3TKPA 1W89A 1X9WB 6GSVA 3IOSA 4ACSA 3R3EA 3IBHA 2KP1A 2TIRA 1X5CA 4HZ2A 2O8VB 1TU8A 4F03A 1UVZA 5HFIA 4E8EA 5FHIA 1ZL9A 3WT1A 3DEXA 1H75A 2DIZA 5CREA 5ECPB 4MA9A 1G7OA 2P5QA 2CAQA 4WETA 2HRKB 1TTZA 2GQLA 1ERTA 2F9SA 3GUSA 1SKRB 4OD7A 5G30A 4GSSA 2K8SA 4FQUA 3W8SA 4F0CA 2N5BA 1PA3A 22GSA 1EV9A 4MF7A 5KEJA 1T00A 1A2JA 3GKNA 4YH2A 4I5QA 4J56E 5F05A 1MDIA 1T1VA 4PQIA 1QGVA 4JR4A 2LQQA 4DVCA 2AUVA 5JWOB 4TR3A 3UBLA 1DUGA 1J08A 1SJIA 1SK0A 4HS1A 1QK8A 4RI7A 4MP4A 4RUVA 2XPEA 1OC3A 4L0UA 4PI2C 3KMNA 4GSNA 3TKSC 1OE7A 2B6MA 3VLNA 2WW3A 3KP8A 4OCEA 1AQWA 4I6XA 1R5PA 1V98A 3FK8A 4O32A 1F3BA 4RQRA 2R0CA 2I81A 3S9FA 1GNEA 1HQOA 4TKYA 2HSHA 1EZKA 4TOPA 1TJDA 3L9VA 4K1FA 3MWHA 1PKWA 2H1AA 1AQXA 2AV4A 3DYRA 4MDCA 3LG6A 1GSEA 3EPTA 4F0BA 3SWLA 3LWAA 2VCTA 1GUMA 2FLSA 2CV4A 3IV4A 5JCWA 2JADA 2WGRA 4FYCA 3EWLA 4GQFA 3CHXC 4ZXGA 1M99A 1IYHA 2OT3A 3HHVA 2PMTA 1XW9A 1USBA 1F2EA 2X99A 1TXUA 2FUG2 5GSSA 3EYTA 2VCWA 5GSTA 2CA8A 3TKRA 3HVNA 2DJ1A 3K8NA 4K7NA 1SK1A 3D6IA 4MZCA 4MPFA 3H8QA 2YWOA 4PQHA 2QGVA 1OE8A 1VGLA 4YKFA 2WULA 3FY7A 3BOAA 2L57A 4JU5A 2ZNMA 1AAZA 4MZWA 2H6YA 2OE0A 4I97A 3KGKA 3KMOA 4GTUA 2RUFA 3F8UA 3VPTA 2A2SA 1T7PB 2YZHA 2VOCA 2CT6A 1DSBA 1SENA 3LQ7A 5DJMA 1TI1A 3D5JA 3G7JA 2H0HA 5D9XA 5ECHB 3TDGA 4OWYA 5DAKB 5CP1A 4Z7XA 3MYDA 1SVLA 2A4VA 2L5OA 3M0FA 5DVBA 4AJ8A 2O89A 2YWNA 3DMLA 2DJ3A 4CDOA 2LUSA 4BVXA 1GLQA 4ILFA 4PQ1A 4FO5A 1A23A 3HVXA 1GSYA 4HDEA 3VWWA 3HVVA 2HRNA 4Z2TA 1R26A 2V1MA 1KBNA 2EFHA 2C80A 3QDNA 3TGZA 2GDRA 4V2NA 4N3ZA 4HI7A 2HSYA 5HFGA 1GSUA 2YPMA 4EDZA 2TRXA 2GSQA 1TRVA 4JE1A 1BG5A 2A2RA 1V40A 1GTAA 4ECBA 3ZRDA 2VAFA 2GLRA 3DWVA 2OE1A 3GIXA 1GWCA 5ECIB 4E68A 4V2LA 4LMVA 3RPNA 2H72A 2K8VA 2HT9A 3EMXA 5ENUA 2IPAA 3F6DA 3HZ4A 2HYXA 4IBPA 1I5GA 2IL3A 4LMWA 1FG4A 1S3AA 1F6MC 2HSNA 4ZL8A 2J23A 1S4BP 3KIJA 3UMAA 1K3OA 2VCXA 3V1WA 1A0RP 1FVJA 4QMKA 3SBCA 3P8WA 3R2QA 1Z7RA 2C0FA 1E2YA 4Z2RA 5GAPD 2H30A 2QA1A 4EIQA 1MDJA 4WF4A 2CX4A 3GX0A 1YY7A 3P90A 3FKFA 4QL9A 2JZRA 1I9DA 4DSQA 2I1UA 2WZSA 5IMCA 3QR6A 3PPUA 3BBYA 1RW1A 3KCMA 2HSMA 4EF0A 4GF0A 4ZBBA 1PN0A 4FXYP 3IK7A 4BVXB 2CX3A 3FZAA 3IDVA 2L4QA 1WMJA 3ZTLA 1Z6MA 2VLTA 5IM9A 4KCEA 2GTUA 4CY8A 3H4KA 3DIEA 4KDUA 3HDCA 2HE3A 1TOFA 2WVZA 4XCSA 4XS4A 1I1IP 4MF5A 3EU4A 2MZCA 3M8NA 3O6TA 1N25A 8GSSA 1SK2A 1GP1A 4TR1B 1X5DA 4FYBA 4XRAA 1XZOA 2FCHA 5LNKe 3GMFA 3VI5A 4AKHA 4PNFA 1OKDA 3J7Yb 2VLUA 4IJIA 2XHFA 4ISDA 3ME8A 1O81A 3APOA 1V2AA 2B5EA 4PTSA 4EKZA 2H0IA 1EOHA 6GSXA 1OAZA 3L78A 1A0FA 5ECKB 2KHPA 3QAWA 1YF1A 2ON5A 1PMTA 3EMPA 1AW9A 3FZ9A 3LSZA 3C1RA 2GSRA 2B7JA 1T3BA 10GSA 4F82A 3QAGA 3IAS2 1T4ZA 4AKGA 3LEFA 4L5LA 3RPPA 1T8EB 1VF3A 2CVKA 4O5RA 2VLVA 2YWMA 2H0GA 4Q5RA 3MDKA 2FNOA 3ZITA 1EGOA 1B9XC 3D4TA 3UEMA 3FEUA 4YQVA 2RUEA 5H5QA 1AXDA 2OACA 1U3IA 4ULXA 3ZREA 4ID0A 2ES7A 2HRKA 4ECIA 4IVFA 5HQPA 3FMWA 3M9JA 1JZRA 5A4VA 2LS5A 4TN8A 1F9MA 4PI0C 4G0KA 3HJPA 4PUAA 2FWGA 1BF5A 2EFDA 3ZMKA 3FZ4A 4XS4B 1BJXA 2JSZA 3DXBA 3UBKA 5B6NA 4O5QA 1JLWA 3LW9A 1SVOA 2R4VA 4HZ4A 3CXGA 3WGEA 3TOUA 2QA2A 2H6XA 2LNSA 1DBYA 2FA4A 3RGBC 3GKKA 5ECNB 4TRXA 5A4UA 1O6JA 4K5SA 3U6VA 3C8EA 4XS1A 5GAND 1MD3A 5KN1A 5G5FA 4K8MA 4JR6A 1YKCA 4PGTA 1SD8A 5B6MA 3VI7A 1SJZA 1QXHA 1ZZYA 2VL9A 1ERVA 2GSSA 2M46A 3HKRA 4MLYA 2VKZG 2JU5A 1GULA 2N5FA 4BVYA 2L5LA 2LJKA 1XCCA 2L6CA 1X9MB 2AJQB 2ALBA 4EL1A 4LLRA 2G2QA 4LL1B 2C0DA 4L5OA 4IP6A 3RHCA 1K0OA 1XWAA 3EURA 1SKWB 3AY8A 3OR5A 3TCOA 3PH9A 4HSCX 4JZQA 3HYPA 1O8XA 2J9HA 1M3JA 3FW2A 2NBSA 1M0UA 1QMVA 3CSHA 3UVHA 1Z6NA 1M3IA 1BAYA 5J40A 4AI6A 3GKMA 1SYRA 2PGTA 3UARA 2UV8G 1CQHA 1QQ2A 1THOA 4WR5A 2HZFA 4A5PA 2YCDA 1JZDA 1JZWA 3TRXA 1YJ6A 1V58A 2IMDA 5B8AA 1K3LA 5CRWA 2IIYA 2H76A 6GSTA 3KJYA 2BJXA 3CRTA 4IELA 3ZZXA 4HJ2A 2H19A 4XHMA 1TRUA 5J41A 4PURA 2PUKC 2DIYA 5IMAA 4EDYA 2B7KA 3RDWA 3ZYWA 1KTEA 2HZEB 2IFQA 2WDUA 1LU4A 4ZBDA 4TXOB 2JACA 1ZGNA 2CZ3A 3G7IA 2N5AA 5G31A 1EEMA 2OADA 5J4YA 1BEDA 5IMFA 2B3SA 1WOUA 3MSZA 1A2LA 5IQYA 1G6WA 5HR1A 2JL4A 1Y25A 2I9HA 5D9VA 4ZBAA 1B48A 4HOJA 1OVNA 3MAKA 5DAKA 1KEBA 2L59A 4AJ7A 1J9BA 5DJLA 1S3RA 3FRCA 4BVYB 4P3YB 2FHEA 1SD9A 5E59A 2R0PA 2HNLA 3A5WA 1B4PA 1R5AA 3F0IA 2I3YA 3FR6A 1M2BA 1O7UA 3IC4A 1WP0A 2YV9A 4DSSB 1JLVA 5KOXA 3I9V2 2YJ7A 4K2DA 5IOWA 1LJRA 1VF1A 2C3TA 4FYUA 1ZYNA 3CTFA 3PGTA 1OC8A 2PERA 1K3YA 3VPQA 1W4VA 3L0HA 5H5RA 3I43A 5DCHA 3RAZA 2EFCA 2NPBA 4ZB6A 3DD3A 1HYUA 1K0BA 3GSSA 4EVMA 4YQUA 3TJBA 1RK4A 2A4HA 1U87A 4D73B 2R2JA 4HQSA 5AGYA 5A5KA 3E9JB 3M1GA 2LSTA 3GYKA 3IXRA 1FO5A 4ECCA 4WBRD 4LL4B 3ZIJA 1XOAA 19GSA 3IE3A 1VF4A 3QCPA 3VWUA 2IFQB 1VRSD 2GVPA 3HZ8A 2LRNA 5A34B 1S3CA 2VIMA 2R5GA 4ICYA 4DSRA 1TI3A 1Z5YE 3FR3A 3UJ1A 3FHKA 4CHSA 3F6FA 5DBQA 4NPBA 2YOIA 4BL7A 1E6BA 1ZCPA 1GNWA 1GSDA 3IC8A 3NZNA 4IQ1A 4G10A 3W6GA 4MNNA 4IGJA 2E2MA 4IKHA 4CW9A 4I2UA 4BPYA 3E3EA 1M2DA 4GQCA 4F9ZA 2O3EA 3UAPA 2DBCA 1G0TA 3H93A 1SVMA 4OFMA 4NWYA 3TKQA 4EUYA 3I6AA 1CQGA 1TRWA 4KUNA 3KP9A 5E4WA 4KSMA 4NXIA 3RHBA 1XVWA 3Q18A 4G01A 2NVLA 3UL3A 2A2PA 2RM5A 4AKIA 2H70A 1NHOA 3KD0A 4TR1A 2VD1A 1YQ1A 2K6VA 1GLPA 4OCFA 2OE3A 4RQXA 3TJKA 4W66A 2O5VA 3RBTA 2CQ9A 4EE0A 1GSQA 1U88A 1SJ6A 3HD5A 5D96A 5D9TA 1O8WA 4HU7A 1UC7A 3KXOA 5DQYA 2D2ZA 3W8JA 1XVQA 4EC0A 5JCUA 1T4YA 5AIVA 1HNBA 3KM6A 4POMA 3M3MA 2PVQA 2FY6A 2OJLA 2DJ2A 2VO4A 1TKDB 2LJRA 2L4CA 2VM2A 1FHEA 5BMUB 3TJGA 2AAWA 3KH7A 3QAVA 4KGIA 2X4AA 4Z2UA 4WXTA 4BL7B 1FOHA 4L8EA 1NSWA 2C1YA 1U6TA 2UZ8A 5CRGA 2GQKA 4J2FA 2O85A 2DJJA 1TK5B 1MTCA 5CAXA 2IN3A 4OO5A 3GSTA 4IW9A 4BWQA 4KE3A 3GRXA 4G2EA 5DCGA 3IPZA 4E8HA 3QPMA 4AF2A 5IO0A 3P7XA 4HJMA 1YEPA 2C4JA 5IMVA 2YN1A 5C04A 1FB6A 3VURA 1XWCA 2V41A 5CRHA 3LJRA 2LNTA 3C71A 2VL2A 14GSA 4V1Ag 2WVXA 2XBIA 2CAIA 5COHA 4N10A 2F8FA 3L9UA 1GTIA 1URMA 3IRAA 5KN0A 4WF5A 3RFRC 2M80A 2ON7A 4JEDA 2RM6A 1ERWA 2KUCA 5KOWA 2GQMA 4K7OA 3PR8A 3L9SA 1SL2B 3HMJG 5IMDA 4MPGA 1Q98A 2H6ZA 4GXZA 1TK0B 1THXA 4MJEA 5IPGA 5ECRB 5B7CA 1OC9B 1XG8A 2HRFA 2E0QA 3GFKA 2RLIA 5ID2A 3Q6OA 3ZFBA 3HY2A 4YQMA 3VWXA 3QD9A 1XXUA 3O3TA 1WE0A 3CSIA 4MJAA 1ABAA
chains in the Genus database with same CATH topology
5D8IA 1M9AA 3IHGA 2LKUA 5G1LA 1TK8B 2YV7A 2GZYA 1GTUA 3KEBA 2OKAA 3ZL5A 4HEA2 4J57E 4ECJA 2WCIA 2AHEA 2GZPA 2HXKA 5IO2A 4TR4A 3D0ZA 2IJYA 2EIRA 1M2AA 5AN1A 2X8CA 3LYPA 1KNGA 2MBSA 5G2ZA 1HNCA 2MMOA 5G1KA 1PD21 1TP9A 3UOMA 4OMVA 4K6XA 4NHWA 1RQMA 2DKIA 1PX6A 5FT3A 4Q5FA 4YKGA 2F3MA 3BCKA 5B8BA 2R6KA 1GTBA 2HZEA 1ZYPA 1SYXA 5ECMB 5J5NA 4TXOA 1SKSB 3GURA 4KAEA 3Q19A 3MNGA 4NHZA 4K9ZA 3WD6A 4IJ3A 4MH3A 5A5HA 4ZIJA 3F4TA 4EIPA 4KX4A 1H4OA 3TRQA 4BA7A 2C3NA 3IK9A 3KTBA 2GT5A 5HR0A 1VF2A 2VL3A 1Z7PA 1B4QA 16GSA 3LXTA 4O5UA 4X1UA 4TVEA 2ZCTA 5DDLA 3NOFA 3L4NA 2H1LA 2EIQA 2PN8A 5F06A 4EO3A 5J9CA 5ELGA 5ID2B 3ZVJA 4ZB8A 3N5OA 4K5RA 4YAVA 3C1SA 3DKSA 1Y6EA 4TW5A 4JRRA 2OBKA 2IMFA 3FZ5A 1BG1A 3IR4A 2MMZA 1NW2A 3EINA 2WS2A 3GH9A 4N0ZA 1PL1A 1XPVA 3GA4A 4IP1A 3C73A 5ABRA 4DSSA 2WZ9A 2B1LA 2LRCA 2LRTA 2MYGA 1Z3EA 3A3TA 2I4AA 4ZB7A 5J4UA 2WJUA 1EP7A 2MBTA 4Q5QA 5KN3A 4G0IA 1A8YA 2V2GA 2VUPA 2V32A 1O85A 3LFLA 1O73A 2O87A 1AUCA 4XRDA 5BRTA 3TKSE 2M72A 1BQ7A 2H8LA 4GLTA 2FWFA 2CVBA 2H1GA 5D93A 4FH8A 3HJOA 1HD2A 3TRPA 5ECQB 2C8UA 4IHUA 3CSJA 1K0MA 4D73A 3QMXA 1JZOA 4GSTA 4I8BA 3LORA 1SU9A 1K0CA 1GL8A 2H66A 2DKHA 2HRAA 5INYA 3UVTA 3CRUA 3A2VA 4KA0A 4KW6A 6GSUA 3CTGA 1Z9HA 1ST9A 1ERUA 3ZVJD 4K0GA 5GZZB 1PSQA 2WRTA 1ZYQB 2C0GA 3QOUA 5A34A 5A1NA 4MF6A 3C7MA 4WBJA 2NTOA 3BJ5A 3QFAC 2DC5A 1OYJA 1DE1A 5C00A 3LGCA 5A5HB 1GH2A 3KZQA 1QFNA 1UA5A 4K7IA 1PX7A 4GRFA 4ML1A 2EFEA 4POLA 12GSA 5DALA 2FGXA 1ON4A 2DMMA 5LD0A 3QFBC 4ZL9A 5IOXA 1YZXA 1A24A 4IQAA 5CO3A 5F8BA 3CWGA 1MD4A 3FR9A 2H75A 2B1KA 1TU7A 6GSSA 2E7PA 3DRNA 4OFTA 1GSFA 17GSA 1FW1A 3GL3A 1WRYA 3TJJA 5ECOB 1TXXA 2DJ0A 2HLSA 3ZFLA 1XFLA 4PX1A 3APQA 4JBBA 3PINA 2LV3A 1A8LA 1R4WA 1WWJA 4PXOA 4LA1A 2B5YA 3GNJA 3HJMA 2RIIA 3HCZA 4F2IA 3KTLA 3WYWA 5D9WA 2ZUPA 1A2MA 3TB2A 3EC3A 3O76A 4O92A 2H71A 2VM1A 2Z9SA 1LBKA 1TDIA 3ISOA 2QSIA 1MDKA 3DVXA 3GV1A 5J47A 2CVDA 4KDYA 5AIXA 4NV5A 3TJFA 13GSA 5ECSA 4WR4A 1YKAA 1AIUA 4MJCA 3VFIA 4K2XA 3DVWA 3ERFA 1K0AA 2FWHA 4MZBA 4QL7A 2FWEA 4NMUA 5A1NB 4TXVA 2LQOA 5DQSA 2BMXA 3US3A 2EC4A 5BMUA 2DSAA 2C3QA 4N0VA 1SL1B 3EU3A 1Y1UA 5CNWA 3IHQA 2VCVA 4I2TA 1NHYA 4G9HA 1HNAA 4YAPA 5DALB 1SL0B 5HFKA 3Q74A 2P31A 3CMIA 2DJKA 4KB3A 4X0XA 5J3RA 4WKWA 2GS3A 1IYIA 4PNGA 2VL2C 1NM3A 2X8GA 4MH2A 2YJHA 2FA8A 3F3RA 4XIHA 3UIWA 3ME7A 1F37A 5JWQB 4XS6A 3NIVA 3IAM2 1YVLA 2GGTA 3APSA 2AB6A 5ELAA 2GZZA 4HU9A 3M9KA 2REMA 2JSYA 1M9BA 5L71A 1OKTA 2PVOC 2YZUA 3TKSA 1UN2A 5H5SA 1PKZA 1FB0A 4FIWA 1K0NA 5ECLB 3P2AA 4MCUA 5IPHA 3I69A 1EWXA 1X0RA 4KH7A 1G6YA 5EL8A 1YF0A 1V9WA 1XWBA 2PPTA 1PL2A 1ZOFA 2L6DA 3F9UA 3LXZA 4POBA 3ZMLA 2LTKA 4OO4A 1G7EA 1F3AA 4PUFC 1N2AA 4X4JA 5IIZA 4USSA 2P5RA 1OC9A 2LJAA 3F63A 5LCZA 2H73A 9GSSA 4X43A 3GX8A 2R3XA 2HI7A 1XOBA 1PQNA 1XWGA 1FAAA 4K0NA 18GSA 1ZMAA 4G19A 3CBUA 4KNDA 2LEGA 3GN3A 4IS0A 1WJKA 3GL5A 2PWJA 4H86A 2JZSA 2GT6A 3H79A 2DLXA 2O7KA 4RI6A 2YWIA 4KSOA 4XTSA 2NDOA 3HVSA 2VCQA 5EPFA 5D73A 1B8XA 3F4RA 3HA9A 3BCIA 2FD3A 1Q4JA 5AISA 2XC2A 5HR3A 2VD0A 2XPDA 4N11A 4POKA 1J0FA 3H1NA 1TRSA 5JWRB 2XBQA 3EVIA 5J9BA 3G9BA 3TU3B 2KOKA 7GSSA 3ERGA 3D21A 2HQTA 1BYEA 1R7HA 1FVKA 1X5EA 2V6KA 6GSWA 1WPIA 3GTUA 4EXJA 4KF9A 3WGXA 4TR0A 5FWGA 2C0EA 3GHAA 1EGRA 1MEKA 4MJBA 1EV4A 4MABA 2CZ2A 3TUEA 1PN9A 4NV2A 1JHBA 1WIKA 1XWKA 1GUKA 3ERWA 4GCIA 4KDXA 5F07A 3CYNA 1C72A 6GSYA 4ZL7A 2G0FA 2R0GA 2X64A 2KLXA 4Q5NA 2OBIA 2F8AA 4WEYA 2P0GA 1EOGA 4V1Ap 3GKXA 5IMZA 4AGSA 1FOVA 2H74A 3HXSA 4BWSA 3D4MA 1U3AA 3EE2A 2QC7A 2GSTA 5KN2A 1YDKA 1EEJA 3VK9A 3A2XA 3TOTA 1DE2A 5G5EA 3J7Yk 1V57A 3U5RE 3F4SA 1GRXA 4V2MA 3ZLPA 2HSNB 3ED3A 11GSA 1N8JA 2JZTA 5CRDA 2MMAA 3D22A 1GSSA 4ZILA 2B5XA 1ML6A 2BTOT 2YNXA 4AJ6A 4KCAA 2R37A 4GDFA 3BD2A 1XW6A 4L0WA 3WT2A 3FYGA 4DEJA 5HR2A 3G7YA 2IMIA 2PBJA 3IA1A 3N9JA 5F0GA 1PRXA 2X49A 4MMMA 5J4VA 1AQVA 1ILOA 2WB9A 2OA7A 3LYKA 4QQ7A 2HSMB 2H1DA 2H1BA 3ZIVA 4HUAA 1ACVA 2K9FA 4AKXB 4N30A 1JFUA 3F3QA 4GWRA 4ML6A 3VWVA 2QKEA 1X9SB 3DGQA 3GTUB 4HQZA 2V6OA 2IWTA 3GH6A 5JCGA 2YP6A 20GSA 1YEXA 3JCML 2DMLA 4G0LA 3A2WA 3E0UA 2YANA 1M7TA 1B9YC 1S3DA 1XIYA 2H01A 1EP8A 2EIOA 1K0DA 1XW5A 2WFCA 1AC1A 2K18A 1PGTA 4O7HA 1BX9A 2X8HA 2AYTA 1ZYEA 4CY6A 4NAXA 2VCZA 1TW9A 5EY6A 4IN0A 3MIXA 1XBSA 1GUHA 2TRCP 2F51A 4OFNA 2HFDA 2KP2A 3WGDA 3A5IA 3KH9A 2IMKA 2PU9C 2IMEA 5A4WA 1QUWA 5EVOA 5CYYA 2MMNA 2E2GA 4MK3A 4ZB9A 3TKPA 1W89A 1X9WB 6GSVA 3IOSA 4ACSA 3R3EA 3IBHA 2KP1A 2TIRA 1X5CA 4HZ2A 2O8VB 1TU8A 4F03A 1UVZA 5HFIA 4E8EA 5FHIA 1ZL9A 3WT1A 3DEXA 1H75A 2DIZA 5CREA 5ECPB 4MA9A 1G7OA 2P5QA 2CAQA 4WETA 2HRKB 1TTZA 2GQLA 1ERTA 2F9SA 3GUSA 1SKRB 4OD7A 5G30A 4GSSA 2K8SA 4FQUA 3W8SA 4F0CA 2N5BA 1PA3A 22GSA 1EV9A 4MF7A 5KEJA 1T00A 1A2JA 3GKNA 4YH2A 4I5QA 4J56E 5F05A 1MDIA 1T1VA 4PQIA 1QGVA 4JR4A 2LQQA 4DVCA 2AUVA 5JWOB 4TR3A 3UBLA 1DUGA 1J08A 1SJIA 1SK0A 4HS1A 1QK8A 4RI7A 4MP4A 4RUVA 2XPEA 1OC3A 4L0UA 3KMNA 4GSNA 3TKSC 1OE7A 2B6MA 3VLNA 3KP8A 4OCEA 1AQWA 4I6XA 1R5PA 1V98A 3FK8A 4O32A 1F3BA 4RQRA 2R0CA 2I81A 3S9FA 1GNEA 1HQOA 4TKYA 2HSHA 1EZKA 4TOPA 1TJDA 3L9VA 4K1FA 3MWHA 1PKWA 2H1AA 1AQXA 2AV4A 3DYRA 4MDCA 3LG6A 1GSEA 3EPTA 4F0BA 3SWLA 3LWAA 2VCTA 1GUMA 2FLSA 2CV4A 3IV4A 5JCWA 2JADA 2WGRA 4FYCA 3EWLA 4GQFA 4ZXGA 1M99A 1IYHA 2OT3A 3HHVA 2PMTA 1XW9A 1USBA 1F2EA 2X99A 1TXUA 2FUG2 5GSSA 3EYTA 2VCWA 5GSTA 2CA8A 3TKRA 2DJ1A 3K8NA 4K7NA 1SK1A 3D6IA 4MZCA 4MPFA 3H8QA 2YWOA 4PQHA 2QGVA 1OE8A 1VGLA 4YKFA 2WULA 3FY7A 3BOAA 2L57A 4JU5A 2ZNMA 1AAZA 4MZWA 2H6YA 2OE0A 4I97A 3KGKA 3KMOA 4GTUA 2RUFA 3F8UA 3VPTA 2A2SA 1T7PB 2YZHA 2VOCA 2CT6A 1DSBA 1SENA 3LQ7A 5DJMA 1TI1A 3D5JA 3G7JA 2H0HA 5D9XA 5ECHB 3TDGA 4OWYA 5DAKB 5CP1A 4Z7XA 3MYDA 1SVLA 2A4VA 2L5OA 3M0FA 5DVBA 4AJ8A 2O89A 2YWNA 3DMLA 2DJ3A 4CDOA 2LUSA 4BVXA 1GLQA 4ILFA 4PQ1A 4FO5A 1A23A 3HVXA 1GSYA 4HDEA 3VWWA 3HVVA 2HRNA 4Z2TA 1R26A 2V1MA 1KBNA 2EFHA 2C80A 3QDNA 3TGZA 2GDRA 4V2NA 4N3ZA 4HI7A 2HSYA 5HFGA 1GSUA 2YPMA 4EDZA 2TRXA 2GSQA 1TRVA 4JE1A 1BG5A 2A2RA 1V40A 1GTAA 4ECBA 3ZRDA 2VAFA 2GLRA 3DWVA 2OE1A 3GIXA 1GWCA 5ECIB 4E68A 4V2LA 4LMVA 3RPNA 2H72A 2K8VA 2HT9A 3EMXA 5ENUA 2IPAA 3F6DA 3HZ4A 2HYXA 4IBPA 1I5GA 2IL3A 4LMWA 1FG4A 1S3AA 1F6MC 2HSNA 4ZL8A 2J23A 3KIJA 3UMAA 1K3OA 2VCXA 3V1WA 1A0RP 1FVJA 4QMKA 3SBCA 3P8WA 3R2QA 1Z7RA 2C0FA 1E2YA 4Z2RA 5GAPD 2H30A 2QA1A 4EIQA 1MDJA 4WF4A 2CX4A 3GX0A 1YY7A 3P90A 3FKFA 4QL9A 2JZRA 1I9DA 4DSQA 2I1UA 5IMCA 3QR6A 3PPUA 3BBYA 1RW1A 3KCMA 2HSMA 4EF0A 4GF0A 4ZBBA 1PN0A 3IK7A 4BVXB 2CX3A 3FZAA 3IDVA 2L4QA 1WMJA 3ZTLA 1Z6MA 2VLTA 5IM9A 4KCEA 2GTUA 4CY8A 3H4KA 3DIEA 4KDUA 3HDCA 2HE3A 1TOFA 4XCSA 4XS4A 4MF5A 3EU4A 2MZCA 3M8NA 3O6TA 1N25A 8GSSA 1SK2A 1GP1A 4TR1B 1X5DA 4FYBA 4XRAA 1XZOA 2FCHA 5LNKe 3GMFA 3VI5A 4AKHA 4PNFA 1OKDA 3J7Yb 2VLUA 4IJIA 2XHFA 4ISDA 3ME8A 1O81A 3APOA 1V2AA 2B5EA 4PTSA 4EKZA 2H0IA 1EOHA 6GSXA 1OAZA 3L78A 1A0FA 5ECKB 2KHPA 3QAWA 1YF1A 2ON5A 1PMTA 3EMPA 1AW9A 3FZ9A 3LSZA 3C1RA 2GSRA 2B7JA 1T3BA 10GSA 4F82A 3QAGA 3IAS2 1T4ZA 4AKGA 3LEFA 4L5LA 3RPPA 1T8EB 1VF3A 2CVKA 4O5RA 2VLVA 2YWMA 2H0GA 4Q5RA 3MDKA 2FNOA 3ZITA 1EGOA 1B9XC 3D4TA 3UEMA 3FEUA 4YQVA 2RUEA 5H5QA 1AXDA 2OACA 1U3IA 4ULXA 3ZREA 4ID0A 2ES7A 2HRKA 4ECIA 4IVFA 5HQPA 3FMWA 3M9JA 1JZRA 5A4VA 2LS5A 4TN8A 1F9MA 4G0KA 3HJPA 4PUAA 2FWGA 1BF5A 2EFDA 3ZMKA 3FZ4A 4XS4B 1BJXA 2JSZA 3DXBA 3UBKA 5B6NA 4O5QA 1JLWA 3LW9A 1SVOA 2R4VA 4HZ4A 3CXGA 3WGEA 3TOUA 2QA2A 2H6XA 2LNSA 1DBYA 2FA4A 3GKKA 5ECNB 4TRXA 5A4UA 1O6JA 4K5SA 3U6VA 3C8EA 4XS1A 5GAND 1MD3A 5KN1A 5G5FA 4K8MA 4JR6A 1YKCA 4PGTA 1SD8A 5B6MA 3VI7A 1SJZA 1QXHA 1ZZYA 2VL9A 1ERVA 2GSSA 2M46A 3HKRA 4MLYA 2VKZG 2JU5A 1GULA 2N5FA 4BVYA 2L5LA 2LJKA 1XCCA 2L6CA 1X9MB 2AJQB 2ALBA 4EL1A 4LLRA 2G2QA 4LL1B 2C0DA 4L5OA 4IP6A 3RHCA 1K0OA 1XWAA 3EURA 1SKWB 3AY8A 3OR5A 3TCOA 3PH9A 4JZQA 3HYPA 1O8XA 2J9HA 3FW2A 2NBSA 1M0UA 1QMVA 3CSHA 3UVHA 1Z6NA 1BAYA 5J40A 4AI6A 3GKMA 1SYRA 2PGTA 3UARA 2UV8G 1CQHA 1QQ2A 1THOA 4WR5A 2HZFA 4A5PA 2YCDA 1JZDA 1JZWA 3TRXA 1YJ6A 1V58A 2IMDA 5B8AA 1K3LA 5CRWA 2IIYA 2H76A 6GSTA 3KJYA 2BJXA 3CRTA 4IELA 3ZZXA 4HJ2A 2H19A 4XHMA 1TRUA 5J41A 4PURA 2PUKC 2DIYA 5IMAA 4EDYA 2B7KA 3RDWA 3ZYWA 1KTEA 2HZEB 2IFQA 2WDUA 1LU4A 4ZBDA 4TXOB 2JACA 1ZGNA 2CZ3A 3G7IA 2N5AA 5G31A 1EEMA 2OADA 5J4YA 1BEDA 5IMFA 2B3SA 1WOUA 3MSZA 1A2LA 5IQYA 1G6WA 5HR1A 2JL4A 1Y25A 2I9HA 5D9VA 4ZBAA 1B48A 4HOJA 1OVNA 3MAKA 5DAKA 1KEBA 2L59A 4AJ7A 1J9BA 5DJLA 3FRCA 4BVYB 4P3YB 2FHEA 1SD9A 5E59A 2R0PA 2HNLA 3A5WA 1B4PA 1R5AA 3F0IA 2I3YA 3FR6A 1M2BA 1O7UA 3IC4A 1WP0A 2YV9A 4DSSB 1JLVA 5KOXA 3I9V2 2YJ7A 4K2DA 5IOWA 1LJRA 1VF1A 2C3TA 4FYUA 1ZYNA 3CTFA 3PGTA 1OC8A 2PERA 1K3YA 3VPQA 1W4VA 3L0HA 5H5RA 3I43A 5DCHA 3RAZA 2EFCA 2NPBA 4ZB6A 3DD3A 1HYUA 1K0BA 3GSSA 4EVMA 4YQUA 3TJBA 1RK4A 2A4HA 1U87A 4D73B 2R2JA 4HQSA 5AGYA 5A5KA 3E9JB 3M1GA 2LSTA 3GYKA 3IXRA 1FO5A 4ECCA 4WBRD 4LL4B 3ZIJA 1XOAA 19GSA 3IE3A 1VF4A 3QCPA 3VWUA 2IFQB 1VRSD 2GVPA 3HZ8A 2LRNA 5A34B 1S3CA 2VIMA 2R5GA 4ICYA 4DSRA 1TI3A 1Z5YE 3FR3A 3UJ1A 3FHKA 4CHSA 3F6FA 5DBQA 4NPBA 2YOIA 4BL7A 1E6BA 1ZCPA 1GNWA 1GSDA 3IC8A 3NZNA 4IQ1A 4G10A 3W6GA 4MNNA 4IGJA 2E2MA 4IKHA 4CW9A 4I2UA 4BPYA 3E3EA 1M2DA 4GQCA 4F9ZA 3UAPA 2DBCA 1G0TA 3H93A 1SVMA 4OFMA 4NWYA 3TKQA 4EUYA 3I6AA 1CQGA 1TRWA 4KUNA 3KP9A 5E4WA 4KSMA 4NXIA 3RHBA 1XVWA 3Q18A 4G01A 2NVLA 3UL3A 2A2PA 2RM5A 4AKIA 2H70A 1NHOA 3KD0A 4TR1A 2VD1A 1YQ1A 2K6VA 1GLPA 4OCFA 2OE3A 4RQXA 3TJKA 4W66A 2O5VA 3RBTA 2CQ9A 4EE0A 1GSQA 1U88A 1SJ6A 3HD5A 5D96A 5D9TA 1O8WA 4HU7A 1UC7A 3KXOA 5DQYA 2D2ZA 3W8JA 1XVQA 4EC0A 5JCUA 1T4YA 5AIVA 1HNBA 3KM6A 4POMA 3M3MA 2PVQA 2FY6A 2OJLA 2DJ2A 2VO4A 1TKDB 2LJRA 2L4CA 2VM2A 1FHEA 5BMUB 3TJGA 2AAWA 3KH7A 3QAVA 4KGIA 2X4AA 4Z2UA 4WXTA 4BL7B 1FOHA 4L8EA 1NSWA 2C1YA 1U6TA 2UZ8A 5CRGA 2GQKA 4J2FA 2O85A 2DJJA 1TK5B 1MTCA 5CAXA 2IN3A 4OO5A 3GSTA 4IW9A 4BWQA 4KE3A 3GRXA 4G2EA 5DCGA 3IPZA 4E8HA 3QPMA 4AF2A 5IO0A 3P7XA 4HJMA 1YEPA 2C4JA 5IMVA 2YN1A 5C04A 1FB6A 3VURA 1XWCA 2V41A 5CRHA 3LJRA 2LNTA 3C71A 2VL2A 14GSA 4V1Ag 2XBIA 2CAIA 5COHA 4N10A 2F8FA 3L9UA 1GTIA 1URMA 3IRAA 5KN0A 4WF5A 2M80A 2ON7A 4JEDA 2RM6A 1ERWA 2KUCA 5KOWA 2GQMA 4K7OA 3PR8A 3L9SA 1SL2B 3HMJG 5IMDA 4MPGA 1Q98A 2H6ZA 4GXZA 1TK0B 1THXA 4MJEA 5IPGA 5ECRB 5B7CA 1OC9B 2HRFA 2E0QA 3GFKA 2RLIA 5ID2A 3Q6OA 3ZFBA 3HY2A 4YQMA 3VWXA 3QD9A 1XXUA 3O3TA 1WE0A 3CSIA 4MJAA 1ABAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D8I A;  1M9A A;  2LKU A;  5G1L A;  1TK8 B;  2YV7 A;  2GZY A;  1GTU A;  3KEB A;  2OKA A;  3ZL5 A;  4HEA 2;  4J57 E;  4ECJ A;  2WCI A;  2AHE A;  2GZP A;  2HXK A;  5IO2 A;  4TR4 A;  3D0Z A;  2IJY A;  2EIR A;  1M2A A;  5AN1 A;  2X8C A;  3LYP A;  1KNG A;  2MBS A;  5G2Z A;  1HNC A;  2MMO A;  5G1K A;  1PD2 1;  1TP9 A;  3UOM A;  4OMV A;  4K6X A;  4NHW A;  1RQM A;  1PX6 A;  5FT3 A;  4Q5F A;  2F3M A;  3BCK A;  5B8B A;  2R6K A;  1GTB A;  2HZE A;  1SYX A;  5ECM B;  5J5N A;  4TXO A;  1SKS B;  3GUR A;  4KAE A;  3Q19 A;  3MNG A;  4NHZ A;  4K9Z A;  3WD6 A;  4IJ3 A;  4MH3 A;  4ZIJ A;  3F4T A;  4KX4 A;  1H4O A;  3TRQ A;  4BA7 A;  2C3N A;  3IK9 A;  3KTB A;  2GT5 A;  5HR0 A;  1VF2 A;  2VL3 A;  1Z7P A;  1B4Q A;  16GS A;  3LXT A;  4X1U A;  4TVE A;  2ZCT A;  5DDL A;  3NOF A;  2EIQ A;  3L4N A;  2PN8 A;  5F06 A;  4EO3 A;  5J9C A;  5ELG A;  5ID2 B;  3ZVJ A;  4ZB8 A;  3N5O A;  4YAV A;  3C1S A;  3DKS A;  1Y6E A;  4TW5 A;  4JRR A;  2OBK A;  2IMF A;  3FZ5 A;  3IR4 A;  2MMZ A;  1NW2 A;  3EIN A;  2WS2 A;  3GH9 A;  4N0Z A;  1PL1 A;  1XPV A;  3GA4 A;  4IP1 A;  3C73 A;  5ABR A;  4DSS A;  2WZ9 A;  2B1L A;  2LRC A;  2LRT A;  2MYG A;  1Z3E A;  3A3T A;  2I4A A;  5J4U A;  2WJU A;  1EP7 A;  2MBT A;  4Q5Q A;  5KN3 A;  4G0I A;  1A8Y A;  2V2G A;  2VUP A;  2V32 A;  1O85 A;  3LFL A;  1O73 A;  2O87 A;  1AUC A;  4XRD A;  3TKS E;  2M72 A;  1BQ7 A;  2H8L A;  4GLT A;  2FWF A;  2CVB A;  2H1G A;  5D93 A;  4FH8 A;  3HJO A;  1HD2 A;  3TRP A;  5ECQ B;  2C8U A;  4IHU A;  3CSJ A;  1K0M A;  4D73 A;  3QMX A;  1JZO A;  4GST A;  4I8B A;  3LOR A;  1SU9 A;  1K0C A;  1GL8 A;  2H66 A;  2HRA A;  5INY A;  3UVT A;  3CRU A;  3A2V A;  4KA0 A;  4KW6 A;  6GSU A;  3CTG A;  1Z9H A;  1ST9 A;  1ERU A;  3ZVJ D;  4K0G A;  5GZZ B;  1PSQ A;  2WRT A;  1ZYQ B;  2C0G A;  3QOU A;  4MF6 A;  3C7M A;  4WBJ A;  2NTO A;  3BJ5 A;  3QFA C;  2DC5 A;  1OYJ A;  1DE1 A;  5C00 A;  3LGC A;  1GH2 A;  3KZQ A;  1QFN A;  1UA5 A;  4K7I A;  1PX7 A;  4GRF A;  4ML1 A;  4POL A;  12GS A;  5DAL A;  2FGX A;  1ON4 A;  2DMM A;  5LD0 A;  3QFB C;  4ZL9 A;  5IOX A;  1YZX A;  1A24 A;  4IQA A;  5CO3 A;  5F8B A;  1MD4 A;  3FR9 A;  2H75 A;  2B1K A;  1TU7 A;  6GSS A;  2E7P A;  3DRN A;  4OFT A;  1GSF A;  17GS A;  1FW1 A;  3GL3 A;  1WRY A;  3TJJ A;  5ECO B;  1TXX A;  2DJ0 A;  2HLS A;  3ZFL A;  1XFL A;  4PX1 A;  3APQ A;  4JBB A;  3PIN A;  2LV3 A;  1A8L A;  1R4W A;  1WWJ A;  4PXO A;  4LA1 A;  2B5Y A;  3GNJ A;  3HJM A;  2RII A;  3HCZ A;  4F2I A;  3KTL A;  3WYW A;  5D9W A;  2ZUP A;  1A2M A;  3TB2 A;  3EC3 A;  3O76 A;  4O92 A;  2H71 A;  2VM1 A;  2Z9S A;  1LBK A;  1TDI A;  3ISO A;  2QSI A;  1MDK A;  3DVX A;  3GV1 A;  2CVD A;  4KDY A;  5AIX A;  4NV5 A;  3TJF A;  13GS A;  5ECS A;  4WR4 A;  1YKA A;  1AIU A;  4MJC A;  3VFI A;  3DVW A;  3ERF A;  1K0A A;  2FWH A;  4MZB A;  4QL7 A;  2FWE A;  4NMU A;  4TXV A;  2LQO A;  5DQS A;  2BMX A;  3US3 A;  2EC4 A;  5BMU A;  2DSA A;  2C3Q A;  4N0V A;  1SL1 B;  3EU3 A;  5CNW A;  3IHQ A;  2VCV A;  4I2T A;  1NHY A;  4G9H A;  1HNA A;  4YAP A;  5DAL B;  1SL0 B;  5HFK A;  3Q74 A;  2P31 A;  3CMI A;  2DJK A;  4KB3 A;  4X0X A;  5J3R A;  4WKW A;  2GS3 A;  1IYI A;  4PNG A;  2VL2 C;  1NM3 A;  2X8G A;  4MH2 A;  2YJH A;  2FA8 A;  3F3R A;  4XIH A;  3UIW A;  3ME7 A;  1F37 A;  5JWQ B;  4XS6 A;  3NIV A;  3IAM 2;  2GGT A;  3APS A;  2AB6 A;  5ELA A;  2GZZ A;  4HU9 A;  3M9K A;  2REM A;  2JSY A;  1M9B A;  5L71 A;  1OKT A;  2PVO C;  2YZU A;  3TKS A;  1UN2 A;  5H5S A;  1PKZ A;  1FB0 A;  4FIW A;  1K0N A;  5ECL B;  3P2A A;  4MCU A;  5IPH A;  3I69 A;  1EWX A;  1X0R A;  4KH7 A;  1G6Y A;  5EL8 A;  1YF0 A;  1V9W A;  1XWB A;  2PPT A;  1PL2 A;  1ZOF A;  2L6D A;  3F9U A;  3LXZ A;  4POB A;  3ZML A;  2LTK A;  4OO4 A;  1G7E A;  1F3A A;  4PUF C;  1N2A A;  5IIZ A;  4USS A;  2P5R A;  1OC9 A;  2LJA A;  3F63 A;  5LCZ A;  2H73 A;  9GSS A;  4X43 A;  3GX8 A;  2R3X A;  2HI7 A;  1XOB A;  1PQN A;  1XWG A;  1FAA A;  4K0N A;  18GS A;  1ZMA A;  4G19 A;  3CBU A;  4KND A;  2LEG A;  3GN3 A;  4IS0 A;  1WJK A;  3GL5 A;  2PWJ A;  4H86 A;  2JZS A;  2GT6 A;  3H79 A;  2DLX A;  2O7K A;  4RI6 A;  2YWI A;  4KSO A;  4XTS A;  2NDO A;  3HVS A;  2VCQ A;  5EPF A;  5D73 A;  1B8X A;  3F4R A;  3HA9 A;  3BCI A;  2FD3 A;  1Q4J A;  5AIS A;  2XC2 A;  5HR3 A;  2VD0 A;  2XPD A;  4N11 A;  4POK A;  1J0F A;  3H1N A;  1TRS A;  5JWR B;  2XBQ A;  3EVI A;  5J9B A;  3G9B A;  2KOK A;  7GSS A;  3ERG A;  3D21 A;  2HQT A;  1BYE A;  1R7H A;  1FVK A;  1X5E A;  2V6K A;  6GSW A;  1WPI A;  3GTU A;  4EXJ A;  4KF9 A;  3WGX A;  4TR0 A;  5FWG A;  2C0E A;  3GHA A;  1EGR A;  1MEK A;  4MJB A;  1EV4 A;  4MAB A;  2CZ2 A;  3TUE A;  1PN9 A;  4NV2 A;  1JHB A;  1WIK A;  1XWK A;  1GUK A;  3ERW A;  4GCI A;  4KDX A;  5F07 A;  3CYN A;  1C72 A;  6GSY A;  4ZL7 A;  2G0F A;  2X64 A;  2KLX A;  4Q5N A;  2OBI A;  2F8A A;  4WEY A;  2P0G A;  1EOG A;  4V1A p;  3GKX A;  5IMZ A;  4AGS A;  1FOV A;  2H74 A;  3HXS A;  4BWS A;  3D4M A;  1U3A A;  3EE2 A;  2QC7 A;  2GST A;  5KN2 A;  1YDK A;  1EEJ A;  3VK9 A;  3A2X A;  3TOT A;  1DE2 A;  5G5E A;  3J7Y k;  1V57 A;  3U5R E;  3F4S A;  1GRX A;  4V2M A;  3ZLP A;  2HSN B;  3ED3 A;  11GS A;  1N8J A;  2JZT A;  5CRD A;  2MMA A;  3D22 A;  1GSS A;  4ZIL A;  2B5X A;  1ML6 A;  2BTO T;  2YNX A;  4AJ6 A;  4KCA A;  2R37 A;  3BD2 A;  1XW6 A;  4L0W A;  3WT2 A;  3FYG A;  4DEJ A;  5HR2 A;  3G7Y A;  2IMI A;  2PBJ A;  3IA1 A;  3N9J A;  5F0G A;  1PRX A;  4MMM A;  1AQV A;  1ILO A;  2WB9 A;  2OA7 A;  3LYK A;  4QQ7 A;  2HSM B;  2H1D A;  2H1B A;  3ZIV A;  4HUA A;  1ACV A;  2K9F A;  4N30 A;  1JFU A;  3F3Q A;  4GWR A;  4ML6 A;  3VWV A;  2QKE A;  1X9S B;  3DGQ A;  3GTU B;  4HQZ A;  2V6O A;  2IWT A;  3GH6 A;  5JCG A;  2YP6 A;  20GS A;  1YEX A;  3JCM L;  2DML A;  4G0L A;  3A2W A;  3E0U A;  2YAN A;  1M7T A;  1B9Y C;  1S3D A;  1XIY A;  2H01 A;  1EP8 A;  2EIO A;  1K0D A;  1XW5 A;  2WFC A;  1AC1 A;  2K18 A;  1PGT A;  4O7H A;  1BX9 A;  2X8H A;  2AYT A;  1ZYE A;  4NAX A;  2VCZ A;  1TW9 A;  4IN0 A;  5EY6 A;  1XBS A;  1GUH A;  2TRC P;  2F51 A;  4OFN A;  2HFD A;  2KP2 A;  3WGD A;  3KH9 A;  2IMK A;  2PU9 C;  2IME A;  5A4W A;  1QUW A;  5EVO A;  5CYY A;  2MMN A;  2E2G A;  4MK3 A;  4ZB9 A;  3TKP A;  1W89 A;  1X9W B;  6GSV A;  3IOS A;  4ACS A;  3R3E A;  3IBH A;  2KP1 A;  2TIR A;  1X5C A;  4HZ2 A;  2O8V B;  1TU8 A;  4F03 A;  1UVZ A;  5HFI A;  4E8E A;  5FHI A;  1ZL9 A;  3WT1 A;  3DEX A;  1H75 A;  2DIZ A;  5CRE A;  5ECP B;  4MA9 A;  1G7O A;  2P5Q A;  2CAQ A;  4WET A;  2HRK B;  1TTZ A;  2GQL A;  1ERT A;  2F9S A;  3GUS A;  1SKR B;  4OD7 A;  5G30 A;  4GSS A;  2K8S A;  4FQU A;  3W8S A;  4F0C A;  2N5B A;  1PA3 A;  22GS A;  1EV9 A;  4MF7 A;  5KEJ A;  1T00 A;  1A2J A;  3GKN A;  4YH2 A;  4I5Q A;  4J56 E;  5F05 A;  1MDI A;  1T1V A;  4PQI A;  1QGV A;  4JR4 A;  2LQQ A;  4DVC A;  2AUV A;  5JWO B;  4TR3 A;  3UBL A;  1DUG A;  1J08 A;  1SJI A;  1SK0 A;  4HS1 A;  1QK8 A;  4RI7 A;  4MP4 A;  4RUV A;  2XPE A;  1OC3 A;  4L0U A;  3KMN A;  4GSN A;  3TKS C;  1OE7 A;  2B6M A;  3VLN A;  3KP8 A;  4OCE A;  1AQW A;  4I6X A;  1R5P A;  1V98 A;  3FK8 A;  4O32 A;  1F3B A;  4RQR A;  2I81 A;  3S9F A;  1GNE A;  1HQO A;  4TKY A;  2HSH A;  1EZK A;  4TOP A;  1TJD A;  3L9V A;  4K1F A;  3MWH A;  1PKW A;  2H1A A;  1AQX A;  2AV4 A;  3DYR A;  4MDC A;  3LG6 A;  1GSE A;  4F0B A;  3SWL A;  3LWA A;  2VCT A;  1GUM A;  2FLS A;  2CV4 A;  3IV4 A;  5JCW A;  2JAD A;  2WGR A;  4FYC A;  3EWL A;  4GQF A;  4ZXG A;  1M99 A;  1IYH A;  3HHV A;  2PMT A;  1XW9 A;  1USB A;  1F2E A;  2X99 A;  2FUG 2;  5GSS A;  3EYT A;  2VCW A;  5GST A;  2CA8 A;  3TKR A;  2DJ1 A;  3K8N A;  4K7N A;  1SK1 A;  3D6I A;  4MZC A;  4MPF A;  3H8Q A;  2YWO A;  4PQH A;  2QGV A;  1OE8 A;  1VGL A;  2WUL A;  3FY7 A;  3BOA A;  2L57 A;  4JU5 A;  2ZNM A;  1AAZ A;  4MZW A;  2H6Y A;  2OE0 A;  4I97 A;  3KGK A;  3KMO A;  4GTU A;  2RUF A;  3F8U A;  3VPT A;  2A2S A;  1T7P B;  2YZH A;  2VOC A;  2CT6 A;  1DSB A;  1SEN A;  3LQ7 A;  5DJM A;  1TI1 A;  3D5J A;  3G7J A;  2H0H A;  5D9X A;  5ECH B;  3TDG A;  4OWY A;  5DAK B;  5CP1 A;  4Z7X A;  2A4V A;  2L5O A;  3M0F A;  5DVB A;  4AJ8 A;  2O89 A;  2YWN A;  3DML A;  2DJ3 A;  4CDO A;  2LUS A;  4BVX A;  1GLQ A;  4ILF A;  4PQ1 A;  4FO5 A;  1A23 A;  3HVX A;  1GSY A;  4HDE A;  3VWW A;  3HVV A;  2HRN A;  1R26 A;  2V1M A;  1KBN A;  2C80 A;  3QDN A;  3TGZ A;  2GDR A;  4V2N A;  4HI7 A;  2HSY A;  5HFG A;  1GSU A;  2YPM A;  4EDZ A;  2TRX A;  2GSQ A;  1TRV A;  4JE1 A;  1BG5 A;  2A2R A;  1V40 A;  1GTA A;  4ECB A;  3ZRD A;  2VAF A;  2GLR A;  3DWV A;  2OE1 A;  3GIX A;  1GWC A;  5ECI B;  4V2L A;  4LMV A;  3RPN A;  2H72 A;  2K8V A;  2HT9 A;  3EMX A;  5ENU A;  2IPA A;  3F6D A;  3HZ4 A;  2HYX A;  4IBP A;  1I5G A;  2IL3 A;  4LMW A;  1FG4 A;  1S3A A;  1F6M C;  4ZL8 A;  2J23 A;  3KIJ A;  3UMA A;  1K3O A;  2VCX A;  3V1W A;  1A0R P;  1FVJ A;  3SBC A;  3P8W A;  3R2Q A;  1Z7R A;  2C0F A;  1E2Y A;  5GAP D;  2H30 A;  1MDJ A;  4WF4 A;  2CX4 A;  3GX0 A;  1YY7 A;  3P90 A;  3FKF A;  4QL9 A;  2JZR A;  1I9D A;  4DSQ A;  2I1U A;  5IMC A;  3QR6 A;  3PPU A;  3BBY A;  1RW1 A;  3KCM A;  2HSM A;  4EF0 A;  4GF0 A;  4ZBB A;  3IK7 A;  4BVX B;  2CX3 A;  3FZA A;  3IDV A;  2L4Q A;  1WMJ A;  3ZTL A;  1Z6M A;  2VLT A;  5IM9 A;  4KCE A;  2GTU A;  3H4K A;  3DIE A;  4KDU A;  3HDC A;  2HE3 A;  1TOF A;  4XCS A;  4XS4 A;  4MF5 A;  3EU4 A;  2MZC A;  3M8N A;  3O6T A;  8GSS A;  1SK2 A;  1GP1 A;  4TR1 B;  1X5D A;  4FYB A;  4XRA A;  1XZO A;  2FCH A;  5LNK e;  3GMF A;  3VI5 A;  4PNF A;  1OKD A;  3J7Y b;  2VLU A;  4IJI A;  2XHF A;  4ISD A;  3ME8 A;  1O81 A;  3APO A;  1V2A A;  2B5E A;  4PTS A;  4EKZ A;  2H0I A;  1EOH A;  6GSX A;  1OAZ A;  3L78 A;  1A0F A;  5ECK B;  2KHP A;  3QAW A;  1YF1 A;  2ON5 A;  1PMT A;  3EMP A;  1AW9 A;  3FZ9 A;  3LSZ A;  3C1R A;  2GSR A;  2B7J A;  1T3B A;  10GS A;  4F82 A;  3QAG A;  3IAS 2;  1T4Z A;  3LEF A;  4L5L A;  3RPP A;  1T8E B;  1VF3 A;  2CVK A;  4O5R A;  2VLV A;  2YWM A;  2H0G A;  4Q5R A;  3MDK A;  2FNO A;  3ZIT A;  1EGO A;  1B9X C;  3D4T A;  3UEM A;  3FEU A;  4YQV A;  2RUE A;  5H5Q A;  1AXD A;  2OAC A;  1U3I A;  4ULX A;  3ZRE A;  4ID0 A;  2ES7 A;  2HRK A;  4ECI A;  4IVF A;  5HQP A;  3M9J A;  1JZR A;  5A4V A;  2LS5 A;  4TN8 A;  1F9M A;  4G0K A;  3HJP A;  4PUA A;  2FWG A;  3ZMK A;  3FZ4 A;  4XS4 B;  1BJX A;  2JSZ A;  3DXB A;  3UBK A;  5B6N A;  1JLW A;  2R4V A;  4HZ4 A;  3CXG A;  3WGE A;  3TOU A;  2H6X A;  2LNS A;  1DBY A;  2FA4 A;  3GKK A;  5ECN B;  4TRX A;  5A4U A;  1O6J A;  3U6V A;  3C8E A;  4XS1 A;  5GAN D;  1MD3 A;  5KN1 A;  5G5F A;  4K8M A;  4JR6 A;  1YKC A;  4PGT A;  1SD8 A;  5B6M A;  3VI7 A;  1SJZ A;  1QXH A;  1ZZY A;  2VL9 A;  1ERV A;  2GSS A;  2M46 A;  3HKR A;  4MLY A;  2JU5 A;  1GUL A;  2N5F A;  4BVY A;  2L5L A;  2LJK A;  1XCC A;  2L6C A;  1X9M B;  2AJQ B;  2ALB A;  4EL1 A;  4LLR A;  2G2Q A;  4LL1 B;  2C0D A;  4L5O A;  4IP6 A;  3RHC A;  1K0O A;  1XWA A;  3EUR A;  1SKW B;  3AY8 A;  3OR5 A;  3TCO A;  3PH9 A;  4JZQ A;  3HYP A;  1O8X A;  2J9H A;  3FW2 A;  2NBS A;  1M0U A;  1QMV A;  3CSH A;  3UVH A;  1Z6N A;  1BAY A;  3GKM A;  1SYR A;  2PGT A;  3UAR A;  1CQH A;  1QQ2 A;  1THO A;  4WR5 A;  2HZF A;  2YCD A;  1JZD A;  1JZW A;  3TRX A;  1YJ6 A;  1V58 A;  2IMD A;  5B8A A;  1K3L A;  5CRW A;  2IIY A;  2H76 A;  6GST A;  3KJY A;  2BJX A;  3CRT A;  4IEL A;  3ZZX A;  4HJ2 A;  2H19 A;  4XHM A;  1TRU A;  5J41 A;  4PUR A;  2PUK C;  2DIY A;  5IMA A;  4EDY A;  2B7K A;  3RDW A;  3ZYW A;  1KTE A;  2HZE B;  2IFQ A;  2WDU A;  1LU4 A;  4ZBD A;  4TXO B;  2JAC A;  1ZGN A;  2CZ3 A;  3G7I A;  2N5A A;  5G31 A;  1EEM A;  2OAD A;  1BED A;  5IMF A;  2B3S A;  1WOU A;  3MSZ A;  1A2L A;  5IQY A;  1G6W A;  5HR1 A;  2JL4 A;  1Y25 A;  2I9H A;  5D9V A;  4ZBA A;  1B48 A;  4HOJ A;  1OVN A;  3MAK A;  5DAK A;  1KEB A;  2L59 A;  4AJ7 A;  1J9B A;  5DJL A;  3FRC A;  4BVY B;  4P3Y B;  2FHE A;  1SD9 A;  5E59 A;  2HNL A;  3A5W A;  1B4P A;  1R5A A;  3F0I A;  2I3Y A;  3FR6 A;  1M2B A;  1O7U A;  3IC4 A;  1WP0 A;  2YV9 A;  4DSS B;  1JLV A;  3I9V 2;  2YJ7 A;  4K2D A;  5IOW A;  1LJR A;  1VF1 A;  2C3T A;  4FYU A;  3CTF A;  3PGT A;  1OC8 A;  2PER A;  1K3Y A;  3VPQ A;  1W4V A;  3L0H A;  5H5R A;  3I43 A;  5DCH A;  3RAZ A;  2NPB A;  4ZB6 A;  3DD3 A;  1HYU A;  1K0B A;  3GSS A;  4EVM A;  4YQU A;  3TJB A;  1RK4 A;  1U87 A;  4D73 B;  2R2J A;  4HQS A;  5AGY A;  5A5K A;  3E9J B;  3M1G A;  2LST A;  3GYK A;  3IXR A;  1FO5 A;  4ECC A;  4WBR D;  4LL4 B;  3ZIJ A;  1XOA A;  19GS A;  3IE3 A;  1VF4 A;  3QCP A;  3VWU A;  2IFQ B;  1VRS D;  2GVP A;  3HZ8 A;  2LRN A;  1S3C A;  2VIM A;  2R5G A;  4DSR A;  1TI3 A;  1Z5Y E;  3FR3 A;  3UJ1 A;  3FHK A;  4CHS A;  3F6F A;  5DBQ A;  4NPB A;  2YOI A;  4BL7 A;  1E6B A;  1ZCP A;  1GNW A;  1GSD A;  3IC8 A;  3NZN A;  4IQ1 A;  4G10 A;  3W6G A;  4IGJ A;  2E2M A;  4IKH A;  4CW9 A;  4I2U A;  4BPY A;  3E3E A;  1M2D A;  4GQC A;  4F9Z A;  3UAP A;  2DBC A;  1G0T A;  3H93 A;  4OFM A;  4NWY A;  3TKQ A;  4EUY A;  3I6A A;  1CQG A;  1TRW A;  4KUN A;  3KP9 A;  5E4W A;  4KSM A;  4NXI A;  3RHB A;  1XVW A;  3Q18 A;  3UL3 A;  2NVL A;  2RM5 A;  2H70 A;  1NHO A;  3KD0 A;  4TR1 A;  2VD1 A;  1YQ1 A;  2K6V A;  1GLP A;  4OCF A;  2OE3 A;  4RQX A;  3TJK A;  3RBT A;  2CQ9 A;  4EE0 A;  1GSQ A;  1U88 A;  1SJ6 A;  3HD5 A;  5D96 A;  5D9T A;  1O8W A;  4HU7 A;  1UC7 A;  3KXO A;  5DQY A;  2D2Z A;  3W8J A;  1XVQ A;  4EC0 A;  5JCU A;  1T4Y A;  5AIV A;  1HNB A;  3KM6 A;  4POM A;  3M3M A;  2PVQ A;  2FY6 A;  2OJL A;  2DJ2 A;  2VO4 A;  1TKD B;  2LJR A;  2L4C A;  2VM2 A;  1FHE A;  3TJG A;  2AAW A;  3KH7 A;  3QAV A;  4KGI A;  4WXT A;  4BL7 B;  4L8E A;  1NSW A;  2C1Y A;  1U6T A;  2UZ8 A;  5CRG A;  2GQK A;  4J2F A;  2O85 A;  2DJJ A;  1TK5 B;  1MTC A;  5CAX A;  2IN3 A;  4OO5 A;  3GST A;  4IW9 A;  4BWQ A;  4KE3 A;  3GRX A;  4G2E A;  5DCG A;  3IPZ A;  4E8H A;  3QPM A;  4AF2 A;  5IO0 A;  3P7X A;  4HJM A;  1YEP A;  2C4J A;  5IMV A;  2YN1 A;  5C04 A;  1FB6 A;  3VUR A;  1XWC A;  2V41 A;  5CRH A;  3LJR A;  2LNT A;  3C71 A;  2VL2 A;  14GS A;  4V1A g;  2XBI A;  2CAI A;  5COH A;  4N10 A;  2F8F A;  3L9U A;  1GTI A;  1URM A;  3IRA A;  5KN0 A;  4WF5 A;  2M80 A;  2ON7 A;  4JED A;  2RM6 A;  1ERW A;  2KUC A;  4K7O A;  2GQM A;  3PR8 A;  3L9S A;  1SL2 B;  5IMD A;  4MPG A;  1Q98 A;  2H6Z A;  4GXZ A;  1TK0 B;  1THX A;  4MJE A;  5IPG A;  5ECR B;  5B7C A;  1OC9 B;  2HRF A;  2E0Q A;  3GFK A;  2RLI A;  5ID2 A;  3Q6O A;  3ZFB A;  3HY2 A;  4YQM A;  3VWX A;  3QD9 A;  1XXU A;  3O3T A;  1WE0 A;  3CSI A;  4MJA A;  1ABA A; 
#chains in the Genus database with same CATH topology
 5D8I A;  1M9A A;  3IHG A;  2LKU A;  5G1L A;  1TK8 B;  2YV7 A;  2GZY A;  1GTU A;  3KEB A;  2OKA A;  3ZL5 A;  4HEA 2;  4J57 E;  4ECJ A;  2WCI A;  2AHE A;  2GZP A;  2HXK A;  5IO2 A;  4TR4 A;  3D0Z A;  2IJY A;  2EIR A;  1M2A A;  5AN1 A;  2X8C A;  3LYP A;  1KNG A;  2MBS A;  5G2Z A;  1HNC A;  2MMO A;  5G1K A;  1PD2 1;  1TP9 A;  3UOM A;  4OMV A;  4K6X A;  4NHW A;  1RQM A;  2DKI A;  1PX6 A;  5FT3 A;  4Q5F A;  4YKG A;  2F3M A;  3BCK A;  5B8B A;  2R6K A;  1GTB A;  2HZE A;  1ZYP A;  1SYX A;  5ECM B;  5J5N A;  4TXO A;  1PFO A;  2WVX B;  1SKS B;  2WVY A;  3GUR A;  4KAE A;  3Q19 A;  3MNG A;  4NHZ A;  4K9Z A;  3WD6 A;  4IJ3 A;  4MH3 A;  5A5H A;  4ZIJ A;  3F4T A;  4EIP A;  4KX4 A;  1H4O A;  3TRQ A;  4BA7 A;  2C3N A;  3IK9 A;  3KTB A;  2GT5 A;  5HR0 A;  1VF2 A;  2VL3 A;  1Z7P A;  1B4Q A;  16GS A;  3LXT A;  4O5U A;  4X1U A;  4TVE A;  2ZCT A;  5DDL A;  3NOF A;  2H1L A;  2EIQ A;  3L4N A;  2PN8 A;  5F06 A;  4EO3 A;  5J9C A;  5ELG A;  5ID2 B;  3ZVJ A;  4ZB8 A;  3N5O A;  4K5R A;  4YAV A;  3C1S A;  3DKS A;  1Y6E A;  4TW5 A;  4JRR A;  2OBK A;  2IMF A;  3FZ5 A;  1BG1 A;  3IR4 A;  2MMZ A;  1NW2 A;  3EIN A;  2WS2 A;  3GH9 A;  4N0Z A;  1PL1 A;  1XPV A;  3GA4 A;  4IP1 A;  3C73 A;  5ABR A;  4DSS A;  2WZ9 A;  2B1L A;  2LRC A;  2LRT A;  2MYG A;  1Z3E A;  3A3T A;  2I4A A;  4ZB7 A;  5J4U A;  2WJU A;  1EP7 A;  2MBT A;  4Q5Q A;  5KN3 A;  4G0I A;  1A8Y A;  2V2G A;  2VUP A;  2V32 A;  1O85 A;  3LFL A;  1O73 A;  2O87 A;  1AUC A;  4XRD A;  5BRT A;  3TKS E;  2M72 A;  1BQ7 A;  2H8L A;  4GLT A;  2FWF A;  2CVB A;  2H1G A;  5D93 A;  4FH8 A;  3HJO A;  1HD2 A;  3TRP A;  5ECQ B;  2C8U A;  4IHU A;  3CSJ A;  1K0M A;  4D73 A;  3QMX A;  1JZO A;  4GST A;  4I8B A;  3LOR A;  1SU9 A;  1K0C A;  1GL8 A;  2H66 A;  2DKH A;  2HRA A;  5INY A;  3UVT A;  3CRU A;  3A2V A;  4KA0 A;  4KW6 A;  6GSU A;  3CTG A;  1Z9H A;  1ST9 A;  1ERU A;  3ZVJ D;  4K0G A;  5GZZ B;  1PSQ A;  2WRT A;  1ZYQ B;  2C0G A;  3QOU A;  5A34 A;  5A1N A;  4MF6 A;  3C7M A;  4WBJ A;  2NTO A;  3BJ5 A;  3QFA C;  2DC5 A;  1OYJ A;  1DE1 A;  5C00 A;  3LGC A;  5A5H B;  1GH2 A;  3KZQ A;  1QFN A;  1UA5 A;  4K7I A;  1PX7 A;  4GRF A;  4ML1 A;  2EFE A;  4POL A;  12GS A;  5DAL A;  2FGX A;  1ON4 A;  2DMM A;  5LD0 A;  3QFB C;  4ZL9 A;  5IOX A;  1YZX A;  1A24 A;  4IQA A;  5CO3 A;  5F8B A;  3CWG A;  1MD4 A;  3FR9 A;  2H75 A;  2B1K A;  1TU7 A;  6GSS A;  2E7P A;  3DRN A;  4OFT A;  1GSF A;  17GS A;  1FW1 A;  3GL3 A;  1WRY A;  3TJJ A;  5ECO B;  1TXX A;  2DJ0 A;  2HLS A;  3ZFL A;  1XFL A;  4PX1 A;  3APQ A;  4JBB A;  3PIN A;  2LV3 A;  1A8L A;  1R4W A;  1WWJ A;  4PXO A;  4LA1 A;  2B5Y A;  3GNJ A;  3HJM A;  2RII A;  3HCZ A;  4F2I A;  3KTL A;  3WYW A;  5D9W A;  2ZUP A;  1A2M A;  3TB2 A;  3EC3 A;  3O76 A;  4O92 A;  2H71 A;  2VM1 A;  2Z9S A;  1LBK A;  1TDI A;  3ISO A;  2QSI A;  1MDK A;  3DVX A;  3GV1 A;  5J47 A;  2CVD A;  4KDY A;  5AIX A;  4NV5 A;  3TJF A;  13GS A;  5ECS A;  4WR4 A;  1YKA A;  1AIU A;  4MJC A;  3VFI A;  4K2X A;  3DVW A;  3ERF A;  1K0A A;  2FWH A;  4MZB A;  4QL7 A;  2FWE A;  4NMU A;  5A1N B;  4TXV A;  2LQO A;  5DQS A;  2BMX A;  3US3 A;  2EC4 A;  5BMU A;  2WW2 A;  2DSA A;  2C3Q A;  4N0V A;  1SL1 B;  3EU3 A;  1Y1U A;  2O36 A;  5CNW A;  3IHQ A;  2VCV A;  4I2T A;  1NHY A;  4G9H A;  1HNA A;  4YAP A;  5DAL B;  1SL0 B;  5HFK A;  3Q74 A;  2P31 A;  3CMI A;  2DJK A;  4KB3 A;  4X0X A;  5J3R A;  4WKW A;  2GS3 A;  1IYI A;  4PNG A;  2VL2 C;  1NM3 A;  2X8G A;  4MH2 A;  2YJH A;  2FA8 A;  2WW1 A;  3F3R A;  4XIH A;  3UIW A;  3ME7 A;  1F37 A;  5JWQ B;  4XS6 A;  3NIV A;  3IAM 2;  1YVL A;  2GGT A;  3APS A;  1YEW C;  2AB6 A;  5ELA A;  2GZZ A;  4HU9 A;  3M9K A;  2REM A;  2JSY A;  1M9B A;  5L71 A;  1OKT A;  2PVO C;  2YZU A;  3TKS A;  1UN2 A;  5H5S A;  1PKZ A;  1FB0 A;  4FIW A;  1K0N A;  5ECL B;  3P2A A;  4MCU A;  5IPH A;  3I69 A;  1EWX A;  1X0R A;  4KH7 A;  1G6Y A;  5EL8 A;  1YF0 A;  1V9W A;  1XWB A;  2PPT A;  1PL2 A;  1ZOF A;  2L6D A;  3F9U A;  3LXZ A;  4POB A;  3ZML A;  2LTK A;  4OO4 A;  1G7E A;  1F3A A;  4PUF C;  1N2A A;  4X4J A;  5IIZ A;  4USS A;  2P5R A;  1OC9 A;  2LJA A;  3F63 A;  5LCZ A;  2H73 A;  9GSS A;  4X43 A;  3GX8 A;  2R3X A;  2HI7 A;  1XOB A;  1PQN A;  1XWG A;  1FAA A;  4K0N A;  18GS A;  1ZMA A;  4G19 A;  3CBU A;  4KND A;  2LEG A;  3GN3 A;  4IS0 A;  1WJK A;  3GL5 A;  2PWJ A;  4H86 A;  2JZS A;  2GT6 A;  3H79 A;  2DLX A;  2O7K A;  4RI6 A;  2YWI A;  4KSO A;  4XTS A;  2NDO A;  3HVS A;  2VCQ A;  5EPF A;  5D73 A;  1B8X A;  3F4R A;  3HA9 A;  3BCI A;  2FD3 A;  1Q4J A;  5AIS A;  2XC2 A;  5HR3 A;  2VD0 A;  2XPD A;  4N11 A;  4POK A;  1J0F A;  3H1N A;  1TRS A;  5JWR B;  2XBQ A;  3EVI A;  5J9B A;  3G9B A;  3TU3 B;  2KOK A;  4PHZ C;  7GSS A;  3ERG A;  3D21 A;  2HQT A;  1BYE A;  1R7H A;  1FVK A;  1X5E A;  2V6K A;  6GSW A;  1WPI A;  3GTU A;  4EXJ A;  4KF9 A;  3WGX A;  4TR0 A;  5FWG A;  2C0E A;  3GHA A;  1EGR A;  1MEK A;  4MJB A;  1EV4 A;  4MAB A;  2CZ2 A;  3TUE A;  1PN9 A;  4NV2 A;  1JHB A;  1WIK A;  1XWK A;  1GUK A;  3ERW A;  4GCI A;  4KDX A;  5F07 A;  3CYN A;  1C72 A;  6GSY A;  4ZL7 A;  2G0F A;  2R0G A;  2X64 A;  2KLX A;  4Q5N A;  2OBI A;  2F8A A;  4WEY A;  2P0G A;  1EOG A;  4V1A p;  3GKX A;  5IMZ A;  4AGS A;  1FOV A;  2H74 A;  3HXS A;  4BWS A;  3D4M A;  1U3A A;  3EE2 A;  2QC7 A;  2GST A;  5KN2 A;  1YDK A;  1EEJ A;  3VK9 A;  3A2X A;  3TOT A;  1DE2 A;  5G5E A;  3J7Y k;  1V57 A;  3U5R E;  3F4S A;  1GRX A;  4V2M A;  3ZLP A;  2HSN B;  3ED3 A;  11GS A;  1N8J A;  2JZT A;  5CRD A;  2MMA A;  3D22 A;  1GSS A;  4ZIL A;  2B5X A;  1ML6 A;  2BTO T;  2YNX A;  4AJ6 A;  4KCA A;  2R37 A;  4GDF A;  3BD2 A;  2WW0 A;  1XW6 A;  4L0W A;  3WT2 A;  3FYG A;  4DEJ A;  5HR2 A;  3G7Y A;  2IMI A;  2PBJ A;  3IA1 A;  3N9J A;  5F0G A;  1PRX A;  2X49 A;  4MMM A;  5J4V A;  1AQV A;  1ILO A;  2WB9 A;  2OA7 A;  3LYK A;  4QQ7 A;  2HSM B;  2H1D A;  2H1B A;  3ZIV A;  4BIK A;  4HUA A;  1ACV A;  2K9F A;  4AKX B;  4N30 A;  1JFU A;  3F3Q A;  4GWR A;  4ML6 A;  3VWV A;  2QKE A;  1X9S B;  3DGQ A;  3GTU B;  4HQZ A;  2V6O A;  3CQF A;  2IWT A;  3GH6 A;  5JCG A;  2YP6 A;  20GS A;  1YEX A;  3JCM L;  2DML A;  4G0L A;  3A2W A;  3E0U A;  2YAN A;  1M7T A;  1B9Y C;  1S3D A;  1XIY A;  2H01 A;  1EP8 A;  2EIO A;  1K0D A;  1XW5 A;  2WFC A;  1AC1 A;  2K18 A;  1PGT A;  4O7H A;  1BX9 A;  2X8H A;  2AYT A;  1ZYE A;  4CY6 A;  4NAX A;  2VCZ A;  1TW9 A;  5EY6 A;  4IN0 A;  3MIX A;  1XBS A;  1GUH A;  2TRC P;  2F51 A;  4OFN A;  2HFD A;  2KP2 A;  3WGD A;  3A5I A;  3KH9 A;  2IMK A;  2PU9 C;  2IME A;  5A4W A;  1QUW A;  5EVO A;  5CYY A;  2MMN A;  2E2G A;  4MK3 A;  4ZB9 A;  3TKP A;  1W89 A;  1X9W B;  6GSV A;  3IOS A;  4ACS A;  3R3E A;  3IBH A;  2KP1 A;  2TIR A;  1X5C A;  4HZ2 A;  2O8V B;  1TU8 A;  4F03 A;  1UVZ A;  5HFI A;  4E8E A;  5FHI A;  1ZL9 A;  3WT1 A;  3DEX A;  1H75 A;  2DIZ A;  5CRE A;  5ECP B;  4MA9 A;  1G7O A;  2P5Q A;  2CAQ A;  4WET A;  2HRK B;  1TTZ A;  2GQL A;  1ERT A;  2F9S A;  3GUS A;  1SKR B;  4OD7 A;  5G30 A;  4GSS A;  2K8S A;  4FQU A;  3W8S A;  4F0C A;  2N5B A;  1PA3 A;  22GS A;  1EV9 A;  4MF7 A;  5KEJ A;  1T00 A;  1A2J A;  3GKN A;  4YH2 A;  4I5Q A;  4J56 E;  5F05 A;  1MDI A;  1T1V A;  4PQI A;  1QGV A;  4JR4 A;  2LQQ A;  4DVC A;  2AUV A;  5JWO B;  4TR3 A;  3UBL A;  1DUG A;  1J08 A;  1SJI A;  1SK0 A;  4HS1 A;  1QK8 A;  4RI7 A;  4MP4 A;  4RUV A;  2XPE A;  1OC3 A;  4L0U A;  4PI2 C;  3KMN A;  4GSN A;  3TKS C;  1OE7 A;  2B6M A;  3VLN A;  2WW3 A;  3KP8 A;  4OCE A;  1AQW A;  4I6X A;  1R5P A;  1V98 A;  3FK8 A;  4O32 A;  1F3B A;  4RQR A;  2R0C A;  2I81 A;  3S9F A;  1GNE A;  1HQO A;  4TKY A;  2HSH A;  1EZK A;  4TOP A;  1TJD A;  3L9V A;  4K1F A;  3MWH A;  1PKW A;  2H1A A;  1AQX A;  2AV4 A;  3DYR A;  4MDC A;  3LG6 A;  1GSE A;  3EPT A;  4F0B A;  3SWL A;  3LWA A;  2VCT A;  1GUM A;  2FLS A;  2CV4 A;  3IV4 A;  5JCW A;  2JAD A;  2WGR A;  4FYC A;  3EWL A;  4GQF A;  3CHX C;  4ZXG A;  1M99 A;  1IYH A;  2OT3 A;  3HHV A;  2PMT A;  1XW9 A;  1USB A;  1F2E A;  2X99 A;  1TXU A;  2FUG 2;  5GSS A;  3EYT A;  2VCW A;  5GST A;  2CA8 A;  3TKR A;  3HVN A;  2DJ1 A;  3K8N A;  4K7N A;  1SK1 A;  3D6I A;  4MZC A;  4MPF A;  3H8Q A;  2YWO A;  4PQH A;  2QGV A;  1OE8 A;  1VGL A;  4YKF A;  2WUL A;  3FY7 A;  3BOA A;  2L57 A;  4JU5 A;  2ZNM A;  1AAZ A;  4MZW A;  2H6Y A;  2OE0 A;  4I97 A;  3KGK A;  3KMO A;  4GTU A;  2RUF A;  3F8U A;  3VPT A;  2A2S A;  1T7P B;  2YZH A;  2VOC A;  2CT6 A;  1DSB A;  1SEN A;  3LQ7 A;  5DJM A;  1TI1 A;  3D5J A;  3G7J A;  2H0H A;  5D9X A;  5ECH B;  3TDG A;  4OWY A;  5DAK B;  5CP1 A;  4Z7X A;  3MYD A;  1SVL A;  2A4V A;  2L5O A;  3M0F A;  5DVB A;  4AJ8 A;  2O89 A;  2YWN A;  3DML A;  2DJ3 A;  4CDO A;  2LUS A;  4BVX A;  1GLQ A;  4ILF A;  4PQ1 A;  4FO5 A;  1A23 A;  3HVX A;  1GSY A;  4HDE A;  3VWW A;  3HVV A;  2HRN A;  4Z2T A;  1R26 A;  2V1M A;  1KBN A;  2EFH A;  2C80 A;  3QDN A;  3TGZ A;  2GDR A;  4V2N A;  4N3Z A;  4HI7 A;  2HSY A;  5HFG A;  1GSU A;  2YPM A;  4EDZ A;  2TRX A;  2GSQ A;  1TRV A;  4JE1 A;  1BG5 A;  2A2R A;  1V40 A;  1GTA A;  4ECB A;  3ZRD A;  2VAF A;  2GLR A;  3DWV A;  2OE1 A;  3GIX A;  1GWC A;  5ECI B;  4E68 A;  4V2L A;  4LMV A;  3RPN A;  2H72 A;  2K8V A;  2HT9 A;  3EMX A;  5ENU A;  2IPA A;  3F6D A;  3HZ4 A;  2HYX A;  4IBP A;  1I5G A;  2IL3 A;  4LMW A;  1FG4 A;  1S3A A;  1F6M C;  2HSN A;  4ZL8 A;  2J23 A;  1S4B P;  3KIJ A;  3UMA A;  1K3O A;  2VCX A;  3V1W A;  1A0R P;  1FVJ A;  4QMK A;  3SBC A;  3P8W A;  3R2Q A;  1Z7R A;  2C0F A;  1E2Y A;  4Z2R A;  5GAP D;  2H30 A;  2QA1 A;  4EIQ A;  1MDJ A;  4WF4 A;  2CX4 A;  3GX0 A;  1YY7 A;  3P90 A;  3FKF A;  4QL9 A;  2JZR A;  1I9D A;  4DSQ A;  2I1U A;  2WZS A;  5IMC A;  3QR6 A;  3PPU A;  3BBY A;  1RW1 A;  3KCM A;  2HSM A;  4EF0 A;  4GF0 A;  4ZBB A;  1PN0 A;  4FXY P;  3IK7 A;  4BVX B;  2CX3 A;  3FZA A;  3IDV A;  2L4Q A;  1WMJ A;  3ZTL A;  1Z6M A;  2VLT A;  5IM9 A;  4KCE A;  2GTU A;  4CY8 A;  3H4K A;  3DIE A;  4KDU A;  3HDC A;  2HE3 A;  1TOF A;  2WVZ A;  4XCS A;  4XS4 A;  1I1I P;  4MF5 A;  3EU4 A;  2MZC A;  3M8N A;  3O6T A;  1N25 A;  8GSS A;  1SK2 A;  1GP1 A;  4TR1 B;  1X5D A;  4FYB A;  4XRA A;  1XZO A;  2FCH A;  5LNK e;  3GMF A;  3VI5 A;  4AKH A;  4PNF A;  1OKD A;  3J7Y b;  2VLU A;  4IJI A;  2XHF A;  4ISD A;  3ME8 A;  1O81 A;  3APO A;  1V2A A;  2B5E A;  4PTS A;  4EKZ A;  2H0I A;  1EOH A;  6GSX A;  1OAZ A;  3L78 A;  1A0F A;  5ECK B;  2KHP A;  3QAW A;  1YF1 A;  2ON5 A;  1PMT A;  3EMP A;  1AW9 A;  3FZ9 A;  3LSZ A;  3C1R A;  2GSR A;  2B7J A;  1T3B A;  10GS A;  4F82 A;  3QAG A;  3IAS 2;  1T4Z A;  4AKG A;  3LEF A;  4L5L A;  3RPP A;  1T8E B;  1VF3 A;  2CVK A;  4O5R A;  2VLV A;  2YWM A;  2H0G A;  4Q5R A;  3MDK A;  2FNO A;  3ZIT A;  1EGO A;  1B9X C;  3D4T A;  3UEM A;  3FEU A;  4YQV A;  2RUE A;  5H5Q A;  1AXD A;  2OAC A;  1U3I A;  4ULX A;  3ZRE A;  4ID0 A;  2ES7 A;  2HRK A;  4ECI A;  4IVF A;  5HQP A;  3FMW A;  3M9J A;  1JZR A;  5A4V A;  2LS5 A;  4TN8 A;  1F9M A;  4PI0 C;  4G0K A;  3HJP A;  4PUA A;  2FWG A;  1BF5 A;  2EFD A;  3ZMK A;  3FZ4 A;  4XS4 B;  1BJX A;  2JSZ A;  3DXB A;  3UBK A;  5B6N A;  4O5Q A;  1JLW A;  3LW9 A;  1SVO A;  2R4V A;  4HZ4 A;  3CXG A;  3WGE A;  3TOU A;  2QA2 A;  2H6X A;  2LNS A;  1DBY A;  2FA4 A;  3RGB C;  3GKK A;  5ECN B;  4TRX A;  5A4U A;  1O6J A;  4K5S A;  3U6V A;  3C8E A;  4XS1 A;  5GAN D;  1MD3 A;  5KN1 A;  5G5F A;  4K8M A;  4JR6 A;  1YKC A;  4PGT A;  1SD8 A;  5B6M A;  3VI7 A;  1SJZ A;  1QXH A;  1ZZY A;  2VL9 A;  1ERV A;  2GSS A;  2M46 A;  3HKR A;  4MLY A;  2VKZ G;  2JU5 A;  1GUL A;  2N5F A;  4BVY A;  2L5L A;  2LJK A;  1XCC A;  2L6C A;  1X9M B;  2AJQ B;  2ALB A;  4EL1 A;  4LLR A;  2G2Q A;  4LL1 B;  2C0D A;  4L5O A;  4IP6 A;  3RHC A;  1K0O A;  1XWA A;  3EUR A;  1SKW B;  3AY8 A;  3OR5 A;  3TCO A;  3PH9 A;  4HSC X;  4JZQ A;  3HYP A;  1O8X A;  2J9H A;  1M3J A;  3FW2 A;  2NBS A;  1M0U A;  1QMV A;  3CSH A;  3UVH A;  1Z6N A;  1M3I A;  1BAY A;  5J40 A;  4AI6 A;  3GKM A;  1SYR A;  2PGT A;  3UAR A;  2UV8 G;  1CQH A;  1QQ2 A;  1THO A;  4WR5 A;  2HZF A;  4A5P A;  2YCD A;  1JZD A;  1JZW A;  3TRX A;  1YJ6 A;  1V58 A;  2IMD A;  5B8A A;  1K3L A;  5CRW A;  2IIY A;  2H76 A;  6GST A;  3KJY A;  2BJX A;  3CRT A;  4IEL A;  3ZZX A;  4HJ2 A;  2H19 A;  4XHM A;  1TRU A;  5J41 A;  4PUR A;  2PUK C;  2DIY A;  5IMA A;  4EDY A;  2B7K A;  3RDW A;  3ZYW A;  1KTE A;  2HZE B;  2IFQ A;  2WDU A;  1LU4 A;  4ZBD A;  4TXO B;  2JAC A;  1ZGN A;  2CZ3 A;  3G7I A;  2N5A A;  5G31 A;  1EEM A;  2OAD A;  5J4Y A;  1BED A;  5IMF A;  2B3S A;  1WOU A;  3MSZ A;  1A2L A;  5IQY A;  1G6W A;  5HR1 A;  2JL4 A;  1Y25 A;  2I9H A;  5D9V A;  4ZBA A;  1B48 A;  4HOJ A;  1OVN A;  3MAK A;  5DAK A;  1KEB A;  2L59 A;  4AJ7 A;  1J9B A;  5DJL A;  1S3R A;  3FRC A;  4BVY B;  4P3Y B;  2FHE A;  1SD9 A;  5E59 A;  2R0P A;  2HNL A;  3A5W A;  1B4P A;  1R5A A;  3F0I A;  2I3Y A;  3FR6 A;  1M2B A;  1O7U A;  3IC4 A;  1WP0 A;  2YV9 A;  4DSS B;  1JLV A;  5KOX A;  3I9V 2;  2YJ7 A;  4K2D A;  5IOW A;  1LJR A;  1VF1 A;  2C3T A;  4FYU A;  1ZYN A;  3CTF A;  3PGT A;  1OC8 A;  2PER A;  1K3Y A;  3VPQ A;  1W4V A;  3L0H A;  5H5R A;  3I43 A;  5DCH A;  3RAZ A;  2EFC A;  2NPB A;  4ZB6 A;  3DD3 A;  1HYU A;  1K0B A;  3GSS A;  4EVM A;  4YQU A;  3TJB A;  1RK4 A;  2A4H A;  1U87 A;  4D73 B;  2R2J A;  4HQS A;  5AGY A;  5A5K A;  3E9J B;  3M1G A;  2LST A;  3GYK A;  3IXR A;  1FO5 A;  4ECC A;  4WBR D;  4LL4 B;  3ZIJ A;  1XOA A;  19GS A;  3IE3 A;  1VF4 A;  3QCP A;  3VWU A;  2IFQ B;  1VRS D;  2GVP A;  3HZ8 A;  2LRN A;  5A34 B;  1S3C A;  2VIM A;  2R5G A;  4ICY A;  4DSR A;  1TI3 A;  1Z5Y E;  3FR3 A;  3UJ1 A;  3FHK A;  4CHS A;  3F6F A;  5DBQ A;  4NPB A;  2YOI A;  4BL7 A;  1E6B A;  1ZCP A;  1GNW A;  1GSD A;  3IC8 A;  3NZN A;  4IQ1 A;  4G10 A;  3W6G A;  4MNN A;  4IGJ A;  2E2M A;  4IKH A;  4CW9 A;  4I2U A;  4BPY A;  3E3E A;  1M2D A;  4GQC A;  4F9Z A;  2O3E A;  3UAP A;  2DBC A;  1G0T A;  3H93 A;  1SVM A;  4OFM A;  4NWY A;  3TKQ A;  4EUY A;  3I6A A;  1CQG A;  1TRW A;  4KUN A;  3KP9 A;  5E4W A;  4KSM A;  4NXI A;  3RHB A;  1XVW A;  3Q18 A;  4G01 A;  2NVL A;  3UL3 A;  2A2P A;  2RM5 A;  4AKI A;  2H70 A;  1NHO A;  3KD0 A;  4TR1 A;  2VD1 A;  1YQ1 A;  2K6V A;  1GLP A;  4OCF A;  2OE3 A;  4RQX A;  3TJK A;  4W66 A;  2O5V A;  3RBT A;  2CQ9 A;  4EE0 A;  1GSQ A;  1U88 A;  1SJ6 A;  3HD5 A;  5D96 A;  5D9T A;  1O8W A;  4HU7 A;  1UC7 A;  3KXO A;  5DQY A;  2D2Z A;  3W8J A;  1XVQ A;  4EC0 A;  5JCU A;  1T4Y A;  5AIV A;  1HNB A;  3KM6 A;  4POM A;  3M3M A;  2PVQ A;  2FY6 A;  2OJL A;  2DJ2 A;  2VO4 A;  1TKD B;  2LJR A;  2L4C A;  2VM2 A;  1FHE A;  5BMU B;  3TJG A;  2AAW A;  3KH7 A;  3QAV A;  4KGI A;  2X4A A;  4Z2U A;  4WXT A;  4BL7 B;  1FOH A;  4L8E A;  1NSW A;  2C1Y A;  1U6T A;  2UZ8 A;  5CRG A;  2GQK A;  4J2F A;  2O85 A;  2DJJ A;  1TK5 B;  1MTC A;  5CAX A;  2IN3 A;  4OO5 A;  3GST A;  4IW9 A;  4BWQ A;  4KE3 A;  3GRX A;  4G2E A;  5DCG A;  3IPZ A;  4E8H A;  3QPM A;  4AF2 A;  5IO0 A;  3P7X A;  4HJM A;  1YEP A;  2C4J A;  5IMV A;  2YN1 A;  5C04 A;  1FB6 A;  3VUR A;  1XWC A;  2V41 A;  5CRH A;  3LJR A;  2LNT A;  3C71 A;  2VL2 A;  14GS A;  4V1A g;  2WVX A;  2XBI A;  2CAI A;  5COH A;  4N10 A;  2F8F A;  3L9U A;  1GTI A;  1URM A;  3IRA A;  5KN0 A;  4WF5 A;  3RFR C;  2M80 A;  2ON7 A;  4JED A;  2RM6 A;  1ERW A;  2KUC A;  5KOW A;  2GQM A;  4K7O A;  3PR8 A;  3L9S A;  1SL2 B;  3HMJ G;  5IMD A;  4MPG A;  1Q98 A;  2H6Z A;  4GXZ A;  1TK0 B;  1THX A;  4MJE A;  5IPG A;  5ECR B;  5B7C A;  1OC9 B;  1XG8 A;  2HRF A;  2E0Q A;  3GFK A;  2RLI A;  5ID2 A;  3Q6O A;  3ZFB A;  3HY2 A;  4YQM A;  3VWX A;  3QD9 A;  1XXU A;  3O3T A;  1WE0 A;  3CSI A;  4MJA A;  1ABA A; 
#chains in the Genus database with same CATH homology
 5D8I A;  1M9A A;  3IHG A;  2LKU A;  5G1L A;  1TK8 B;  2YV7 A;  2GZY A;  1GTU A;  3KEB A;  2OKA A;  3ZL5 A;  4HEA 2;  4J57 E;  4ECJ A;  2WCI A;  2AHE A;  2GZP A;  2HXK A;  5IO2 A;  4TR4 A;  3D0Z A;  2IJY A;  2EIR A;  1M2A A;  5AN1 A;  2X8C A;  3LYP A;  1KNG A;  2MBS A;  5G2Z A;  1HNC A;  2MMO A;  5G1K A;  1PD2 1;  1TP9 A;  3UOM A;  4OMV A;  4K6X A;  4NHW A;  1RQM A;  2DKI A;  1PX6 A;  5FT3 A;  4Q5F A;  4YKG A;  2F3M A;  3BCK A;  5B8B A;  2R6K A;  1GTB A;  2HZE A;  1ZYP A;  1SYX A;  5ECM B;  5J5N A;  4TXO A;  1SKS B;  3GUR A;  4KAE A;  3Q19 A;  3MNG A;  4NHZ A;  4K9Z A;  3WD6 A;  4IJ3 A;  4MH3 A;  5A5H A;  4ZIJ A;  3F4T A;  4EIP A;  4KX4 A;  1H4O A;  3TRQ A;  4BA7 A;  2C3N A;  3IK9 A;  3KTB A;  2GT5 A;  5HR0 A;  1VF2 A;  2VL3 A;  1Z7P A;  1B4Q A;  16GS A;  3LXT A;  4O5U A;  4X1U A;  4TVE A;  2ZCT A;  5DDL A;  3NOF A;  3L4N A;  2H1L A;  2EIQ A;  2PN8 A;  5F06 A;  4EO3 A;  5J9C A;  5ELG A;  5ID2 B;  3ZVJ A;  4ZB8 A;  3N5O A;  4K5R A;  4YAV A;  3C1S A;  3DKS A;  1Y6E A;  4TW5 A;  4JRR A;  2OBK A;  2IMF A;  3FZ5 A;  1BG1 A;  3IR4 A;  2MMZ A;  1NW2 A;  3EIN A;  2WS2 A;  3GH9 A;  4N0Z A;  1PL1 A;  1XPV A;  3GA4 A;  4IP1 A;  3C73 A;  5ABR A;  4DSS A;  2WZ9 A;  2B1L A;  2LRC A;  2LRT A;  2MYG A;  1Z3E A;  3A3T A;  2I4A A;  4ZB7 A;  5J4U A;  2WJU A;  1EP7 A;  2MBT A;  4Q5Q A;  5KN3 A;  4G0I A;  1A8Y A;  2V2G A;  2VUP A;  2V32 A;  1O85 A;  3LFL A;  1O73 A;  2O87 A;  1AUC A;  4XRD A;  5BRT A;  3TKS E;  2M72 A;  1BQ7 A;  2H8L A;  4GLT A;  2FWF A;  2CVB A;  2H1G A;  5D93 A;  4FH8 A;  3HJO A;  1HD2 A;  3TRP A;  5ECQ B;  2C8U A;  4IHU A;  3CSJ A;  1K0M A;  4D73 A;  3QMX A;  1JZO A;  4GST A;  4I8B A;  3LOR A;  1SU9 A;  1K0C A;  1GL8 A;  2H66 A;  2DKH A;  2HRA A;  5INY A;  3UVT A;  3CRU A;  3A2V A;  4KA0 A;  4KW6 A;  6GSU A;  3CTG A;  1Z9H A;  1ST9 A;  1ERU A;  3ZVJ D;  4K0G A;  5GZZ B;  1PSQ A;  2WRT A;  1ZYQ B;  2C0G A;  3QOU A;  5A34 A;  5A1N A;  4MF6 A;  3C7M A;  4WBJ A;  2NTO A;  3BJ5 A;  3QFA C;  2DC5 A;  1OYJ A;  1DE1 A;  5C00 A;  3LGC A;  5A5H B;  1GH2 A;  3KZQ A;  1QFN A;  1UA5 A;  4K7I A;  1PX7 A;  4GRF A;  4ML1 A;  2EFE A;  4POL A;  12GS A;  5DAL A;  2FGX A;  1ON4 A;  2DMM A;  5LD0 A;  3QFB C;  4ZL9 A;  5IOX A;  1YZX A;  1A24 A;  4IQA A;  5CO3 A;  5F8B A;  3CWG A;  1MD4 A;  3FR9 A;  2H75 A;  2B1K A;  1TU7 A;  6GSS A;  2E7P A;  3DRN A;  4OFT A;  1GSF A;  17GS A;  1FW1 A;  3GL3 A;  1WRY A;  3TJJ A;  5ECO B;  1TXX A;  2DJ0 A;  2HLS A;  3ZFL A;  1XFL A;  4PX1 A;  3APQ A;  4JBB A;  3PIN A;  2LV3 A;  1A8L A;  1R4W A;  1WWJ A;  4PXO A;  4LA1 A;  2B5Y A;  3GNJ A;  3HJM A;  2RII A;  3HCZ A;  4F2I A;  3KTL A;  3WYW A;  5D9W A;  2ZUP A;  1A2M A;  3TB2 A;  3EC3 A;  3O76 A;  4O92 A;  2H71 A;  2VM1 A;  2Z9S A;  1LBK A;  1TDI A;  3ISO A;  2QSI A;  1MDK A;  3DVX A;  3GV1 A;  5J47 A;  2CVD A;  4KDY A;  5AIX A;  4NV5 A;  3TJF A;  13GS A;  5ECS A;  4WR4 A;  1YKA A;  1AIU A;  4MJC A;  3VFI A;  4K2X A;  3DVW A;  3ERF A;  1K0A A;  2FWH A;  4MZB A;  4QL7 A;  2FWE A;  4NMU A;  5A1N B;  4TXV A;  2LQO A;  5DQS A;  2BMX A;  3US3 A;  2EC4 A;  5BMU A;  2DSA A;  2C3Q A;  4N0V A;  1SL1 B;  3EU3 A;  1Y1U A;  5CNW A;  3IHQ A;  2VCV A;  4I2T A;  1NHY A;  4G9H A;  1HNA A;  4YAP A;  5DAL B;  1SL0 B;  5HFK A;  3Q74 A;  2P31 A;  3CMI A;  2DJK A;  4KB3 A;  4X0X A;  5J3R A;  4WKW A;  2GS3 A;  1IYI A;  4PNG A;  2VL2 C;  1NM3 A;  2X8G A;  4MH2 A;  2YJH A;  2FA8 A;  3F3R A;  4XIH A;  3UIW A;  3ME7 A;  1F37 A;  5JWQ B;  4XS6 A;  3NIV A;  3IAM 2;  1YVL A;  2GGT A;  3APS A;  2AB6 A;  5ELA A;  2GZZ A;  4HU9 A;  3M9K A;  2REM A;  2JSY A;  1M9B A;  5L71 A;  1OKT A;  2PVO C;  2YZU A;  3TKS A;  1UN2 A;  5H5S A;  1PKZ A;  1FB0 A;  4FIW A;  1K0N A;  5ECL B;  3P2A A;  4MCU A;  5IPH A;  3I69 A;  1EWX A;  1X0R A;  4KH7 A;  1G6Y A;  5EL8 A;  1YF0 A;  1V9W A;  1XWB A;  2PPT A;  1PL2 A;  1ZOF A;  2L6D A;  3F9U A;  3LXZ A;  4POB A;  3ZML A;  2LTK A;  4OO4 A;  1G7E A;  1F3A A;  4PUF C;  1N2A A;  4X4J A;  5IIZ A;  4USS A;  2P5R A;  1OC9 A;  2LJA A;  3F63 A;  5LCZ A;  2H73 A;  9GSS A;  4X43 A;  3GX8 A;  2R3X A;  2HI7 A;  1XOB A;  1PQN A;  1XWG A;  1FAA A;  4K0N A;  18GS A;  1ZMA A;  4G19 A;  3CBU A;  4KND A;  2LEG A;  3GN3 A;  4IS0 A;  1WJK A;  3GL5 A;  2PWJ A;  4H86 A;  2JZS A;  2GT6 A;  3H79 A;  2DLX A;  2O7K A;  4RI6 A;  2YWI A;  4KSO A;  4XTS A;  2NDO A;  3HVS A;  2VCQ A;  5EPF A;  5D73 A;  1B8X A;  3F4R A;  3HA9 A;  3BCI A;  2FD3 A;  1Q4J A;  5AIS A;  2XC2 A;  5HR3 A;  2VD0 A;  2XPD A;  4N11 A;  4POK A;  1J0F A;  3H1N A;  1TRS A;  5JWR B;  2XBQ A;  3EVI A;  5J9B A;  3G9B A;  3TU3 B;  2KOK A;  7GSS A;  3ERG A;  3D21 A;  2HQT A;  1BYE A;  1R7H A;  1FVK A;  1X5E A;  2V6K A;  6GSW A;  1WPI A;  3GTU A;  4EXJ A;  4KF9 A;  3WGX A;  4TR0 A;  5FWG A;  2C0E A;  3GHA A;  1EGR A;  1MEK A;  4MJB A;  1EV4 A;  4MAB A;  2CZ2 A;  3TUE A;  1PN9 A;  4NV2 A;  1JHB A;  1WIK A;  1XWK A;  1GUK A;  3ERW A;  4GCI A;  4KDX A;  5F07 A;  3CYN A;  1C72 A;  6GSY A;  4ZL7 A;  2G0F A;  2R0G A;  2X64 A;  2KLX A;  4Q5N A;  2OBI A;  2F8A A;  4WEY A;  2P0G A;  1EOG A;  4V1A p;  3GKX A;  5IMZ A;  4AGS A;  1FOV A;  2H74 A;  3HXS A;  4BWS A;  3D4M A;  1U3A A;  3EE2 A;  2QC7 A;  2GST A;  5KN2 A;  1YDK A;  1EEJ A;  3VK9 A;  3A2X A;  3TOT A;  1DE2 A;  5G5E A;  3J7Y k;  1V57 A;  3U5R E;  3F4S A;  1GRX A;  4V2M A;  3ZLP A;  2HSN B;  3ED3 A;  11GS A;  1N8J A;  2JZT A;  5CRD A;  2MMA A;  3D22 A;  1GSS A;  4ZIL A;  2B5X A;  1ML6 A;  2BTO T;  2YNX A;  4AJ6 A;  4KCA A;  2R37 A;  4GDF A;  3BD2 A;  1XW6 A;  4L0W A;  3WT2 A;  3FYG A;  4DEJ A;  5HR2 A;  3G7Y A;  2IMI A;  2PBJ A;  3IA1 A;  3N9J A;  5F0G A;  1PRX A;  2X49 A;  4MMM A;  5J4V A;  1AQV A;  1ILO A;  2WB9 A;  2OA7 A;  3LYK A;  4QQ7 A;  2HSM B;  2H1D A;  2H1B A;  3ZIV A;  4HUA A;  1ACV A;  2K9F A;  4AKX B;  4N30 A;  1JFU A;  3F3Q A;  4GWR A;  4ML6 A;  3VWV A;  2QKE A;  1X9S B;  3DGQ A;  3GTU B;  4HQZ A;  2V6O A;  2IWT A;  3GH6 A;  5JCG A;  2YP6 A;  20GS A;  1YEX A;  3JCM L;  2DML A;  4G0L A;  3A2W A;  3E0U A;  2YAN A;  1M7T A;  1B9Y C;  1S3D A;  1XIY A;  2H01 A;  1EP8 A;  2EIO A;  1K0D A;  1XW5 A;  2WFC A;  1AC1 A;  2K18 A;  1PGT A;  4O7H A;  1BX9 A;  2X8H A;  2AYT A;  1ZYE A;  4CY6 A;  4NAX A;  2VCZ A;  1TW9 A;  5EY6 A;  4IN0 A;  3MIX A;  1XBS A;  1GUH A;  2TRC P;  2F51 A;  4OFN A;  2HFD A;  2KP2 A;  3WGD A;  3A5I A;  3KH9 A;  2IMK A;  2PU9 C;  2IME A;  5A4W A;  1QUW A;  5EVO A;  5CYY A;  2MMN A;  2E2G A;  4MK3 A;  4ZB9 A;  3TKP A;  1W89 A;  1X9W B;  6GSV A;  3IOS A;  4ACS A;  3R3E A;  3IBH A;  2KP1 A;  2TIR A;  1X5C A;  4HZ2 A;  2O8V B;  1TU8 A;  4F03 A;  1UVZ A;  5HFI A;  4E8E A;  5FHI A;  1ZL9 A;  3WT1 A;  3DEX A;  1H75 A;  2DIZ A;  5CRE A;  5ECP B;  4MA9 A;  1G7O A;  2P5Q A;  2CAQ A;  4WET A;  2HRK B;  1TTZ A;  2GQL A;  1ERT A;  2F9S A;  3GUS A;  1SKR B;  4OD7 A;  5G30 A;  4GSS A;  2K8S A;  4FQU A;  3W8S A;  4F0C A;  2N5B A;  1PA3 A;  22GS A;  1EV9 A;  4MF7 A;  5KEJ A;  1T00 A;  1A2J A;  3GKN A;  4YH2 A;  4I5Q A;  4J56 E;  5F05 A;  1MDI A;  1T1V A;  4PQI A;  1QGV A;  4JR4 A;  2LQQ A;  4DVC A;  2AUV A;  5JWO B;  4TR3 A;  3UBL A;  1DUG A;  1J08 A;  1SJI A;  1SK0 A;  4HS1 A;  1QK8 A;  4RI7 A;  4MP4 A;  4RUV A;  2XPE A;  1OC3 A;  4L0U A;  3KMN A;  4GSN A;  3TKS C;  1OE7 A;  2B6M A;  3VLN A;  3KP8 A;  4OCE A;  1AQW A;  4I6X A;  1R5P A;  1V98 A;  3FK8 A;  4O32 A;  1F3B A;  4RQR A;  2R0C A;  2I81 A;  3S9F A;  1GNE A;  1HQO A;  4TKY A;  2HSH A;  1EZK A;  4TOP A;  1TJD A;  3L9V A;  4K1F A;  3MWH A;  1PKW A;  2H1A A;  1AQX A;  2AV4 A;  3DYR A;  4MDC A;  3LG6 A;  1GSE A;  3EPT A;  4F0B A;  3SWL A;  3LWA A;  2VCT A;  1GUM A;  2FLS A;  2CV4 A;  3IV4 A;  5JCW A;  2JAD A;  2WGR A;  4FYC A;  3EWL A;  4GQF A;  4ZXG A;  1M99 A;  1IYH A;  2OT3 A;  3HHV A;  2PMT A;  1XW9 A;  1USB A;  1F2E A;  2X99 A;  1TXU A;  2FUG 2;  5GSS A;  3EYT A;  2VCW A;  5GST A;  2CA8 A;  3TKR A;  2DJ1 A;  3K8N A;  4K7N A;  1SK1 A;  3D6I A;  4MZC A;  4MPF A;  3H8Q A;  2YWO A;  4PQH A;  2QGV A;  1OE8 A;  1VGL A;  4YKF A;  2WUL A;  3FY7 A;  3BOA A;  2L57 A;  4JU5 A;  2ZNM A;  1AAZ A;  4MZW A;  2H6Y A;  2OE0 A;  4I97 A;  3KGK A;  3KMO A;  4GTU A;  2RUF A;  3F8U A;  3VPT A;  2A2S A;  1T7P B;  2YZH A;  2VOC A;  2CT6 A;  1DSB A;  1SEN A;  3LQ7 A;  5DJM A;  1TI1 A;  3D5J A;  3G7J A;  2H0H A;  5D9X A;  5ECH B;  3TDG A;  4OWY A;  5DAK B;  5CP1 A;  4Z7X A;  3MYD A;  1SVL A;  2A4V A;  2L5O A;  3M0F A;  5DVB A;  4AJ8 A;  2O89 A;  2YWN A;  3DML A;  2DJ3 A;  4CDO A;  2LUS A;  4BVX A;  1GLQ A;  4ILF A;  4PQ1 A;  4FO5 A;  1A23 A;  3HVX A;  1GSY A;  4HDE A;  3VWW A;  3HVV A;  2HRN A;  4Z2T A;  1R26 A;  2V1M A;  1KBN A;  2EFH A;  2C80 A;  3QDN A;  3TGZ A;  2GDR A;  4V2N A;  4N3Z A;  4HI7 A;  2HSY A;  5HFG A;  1GSU A;  2YPM A;  4EDZ A;  2TRX A;  2GSQ A;  1TRV A;  4JE1 A;  1BG5 A;  2A2R A;  1V40 A;  1GTA A;  4ECB A;  3ZRD A;  2VAF A;  2GLR A;  3DWV A;  2OE1 A;  3GIX A;  1GWC A;  5ECI B;  4E68 A;  4V2L A;  4LMV A;  3RPN A;  2H72 A;  2K8V A;  2HT9 A;  3EMX A;  5ENU A;  2IPA A;  3F6D A;  3HZ4 A;  2HYX A;  4IBP A;  1I5G A;  2IL3 A;  4LMW A;  1FG4 A;  1S3A A;  1F6M C;  2HSN A;  4ZL8 A;  2J23 A;  3KIJ A;  3UMA A;  1K3O A;  2VCX A;  3V1W A;  1A0R P;  1FVJ A;  4QMK A;  3SBC A;  3P8W A;  3R2Q A;  1Z7R A;  2C0F A;  1E2Y A;  4Z2R A;  5GAP D;  2H30 A;  2QA1 A;  4EIQ A;  1MDJ A;  4WF4 A;  2CX4 A;  3GX0 A;  1YY7 A;  3P90 A;  3FKF A;  4QL9 A;  2JZR A;  1I9D A;  4DSQ A;  2I1U A;  5IMC A;  3QR6 A;  3PPU A;  3BBY A;  1RW1 A;  3KCM A;  2HSM A;  4EF0 A;  4GF0 A;  4ZBB A;  1PN0 A;  3IK7 A;  4BVX B;  2CX3 A;  3FZA A;  3IDV A;  2L4Q A;  1WMJ A;  3ZTL A;  1Z6M A;  2VLT A;  5IM9 A;  4KCE A;  2GTU A;  4CY8 A;  3H4K A;  3DIE A;  4KDU A;  3HDC A;  2HE3 A;  1TOF A;  4XCS A;  4XS4 A;  4MF5 A;  3EU4 A;  2MZC A;  3M8N A;  3O6T A;  1N25 A;  8GSS A;  1SK2 A;  1GP1 A;  4TR1 B;  1X5D A;  4FYB A;  4XRA A;  1XZO A;  2FCH A;  5LNK e;  3GMF A;  3VI5 A;  4AKH A;  4PNF A;  1OKD A;  3J7Y b;  2VLU A;  4IJI A;  2XHF A;  4ISD A;  3ME8 A;  1O81 A;  3APO A;  1V2A A;  2B5E A;  4PTS A;  4EKZ A;  2H0I A;  1EOH A;  6GSX A;  1OAZ A;  3L78 A;  1A0F A;  5ECK B;  2KHP A;  3QAW A;  1YF1 A;  2ON5 A;  1PMT A;  3EMP A;  1AW9 A;  3FZ9 A;  3LSZ A;  3C1R A;  2GSR A;  2B7J A;  1T3B A;  10GS A;  4F82 A;  3QAG A;  3IAS 2;  1T4Z A;  4AKG A;  3LEF A;  4L5L A;  3RPP A;  1T8E B;  1VF3 A;  2CVK A;  4O5R A;  2VLV A;  2YWM A;  2H0G A;  4Q5R A;  3MDK A;  2FNO A;  3ZIT A;  1EGO A;  1B9X C;  3D4T A;  3UEM A;  3FEU A;  4YQV A;  2RUE A;  5H5Q A;  1AXD A;  2OAC A;  1U3I A;  4ULX A;  3ZRE A;  4ID0 A;  2ES7 A;  2HRK A;  4ECI A;  4IVF A;  5HQP A;  3FMW A;  3M9J A;  1JZR A;  5A4V A;  2LS5 A;  4TN8 A;  1F9M A;  4G0K A;  3HJP A;  4PUA A;  2FWG A;  1BF5 A;  2EFD A;  3ZMK A;  3FZ4 A;  4XS4 B;  1BJX A;  2JSZ A;  3DXB A;  3UBK A;  5B6N A;  4O5Q A;  1JLW A;  3LW9 A;  1SVO A;  2R4V A;  4HZ4 A;  3CXG A;  3WGE A;  3TOU A;  2QA2 A;  2H6X A;  2LNS A;  1DBY A;  2FA4 A;  3GKK A;  5ECN B;  4TRX A;  5A4U A;  1O6J A;  4K5S A;  3U6V A;  3C8E A;  4XS1 A;  5GAN D;  1MD3 A;  5KN1 A;  5G5F A;  4K8M A;  4JR6 A;  1YKC A;  4PGT A;  1SD8 A;  5B6M A;  3VI7 A;  1SJZ A;  1QXH A;  1ZZY A;  2VL9 A;  1ERV A;  2GSS A;  2M46 A;  3HKR A;  4MLY A;  2VKZ G;  2JU5 A;  1GUL A;  2N5F A;  4BVY A;  2L5L A;  2LJK A;  1XCC A;  2L6C A;  1X9M B;  2AJQ B;  2ALB A;  4EL1 A;  4LLR A;  2G2Q A;  4LL1 B;  2C0D A;  4L5O A;  4IP6 A;  3RHC A;  1K0O A;  1XWA A;  3EUR A;  1SKW B;  3AY8 A;  3OR5 A;  3TCO A;  3PH9 A;  4JZQ A;  3HYP A;  1O8X A;  2J9H A;  3FW2 A;  2NBS A;  1M0U A;  1QMV A;  3CSH A;  3UVH A;  1Z6N A;  1BAY A;  5J40 A;  4AI6 A;  3GKM A;  1SYR A;  2PGT A;  3UAR A;  2UV8 G;  1CQH A;  1QQ2 A;  1THO A;  4WR5 A;  2HZF A;  4A5P A;  2YCD A;  1JZD A;  1JZW A;  3TRX A;  1YJ6 A;  1V58 A;  2IMD A;  5B8A A;  1K3L A;  5CRW A;  2IIY A;  2H76 A;  6GST A;  3KJY A;  2BJX A;  3CRT A;  4IEL A;  3ZZX A;  4HJ2 A;  2H19 A;  4XHM A;  1TRU A;  5J41 A;  4PUR A;  2PUK C;  2DIY A;  5IMA A;  4EDY A;  2B7K A;  3RDW A;  3ZYW A;  1KTE A;  2HZE B;  2IFQ A;  2WDU A;  1LU4 A;  4ZBD A;  4TXO B;  2JAC A;  1ZGN A;  2CZ3 A;  3G7I A;  2N5A A;  5G31 A;  1EEM A;  2OAD A;  5J4Y A;  1BED A;  5IMF A;  2B3S A;  1WOU A;  3MSZ A;  1A2L A;  5IQY A;  1G6W A;  5HR1 A;  2JL4 A;  1Y25 A;  2I9H A;  5D9V A;  4ZBA A;  1B48 A;  4HOJ A;  1OVN A;  3MAK A;  5DAK A;  1KEB A;  2L59 A;  4AJ7 A;  1J9B A;  5DJL A;  3FRC A;  4BVY B;  4P3Y B;  2FHE A;  1SD9 A;  5E59 A;  2R0P A;  2HNL A;  3A5W A;  1B4P A;  1R5A A;  3F0I A;  2I3Y A;  3FR6 A;  1M2B A;  1O7U A;  3IC4 A;  1WP0 A;  2YV9 A;  4DSS B;  1JLV A;  5KOX A;  3I9V 2;  2YJ7 A;  4K2D A;  5IOW A;  1LJR A;  1VF1 A;  2C3T A;  4FYU A;  1ZYN A;  3CTF A;  3PGT A;  1OC8 A;  2PER A;  1K3Y A;  3VPQ A;  1W4V A;  3L0H A;  5H5R A;  3I43 A;  5DCH A;  3RAZ A;  2EFC A;  2NPB A;  4ZB6 A;  3DD3 A;  1HYU A;  1K0B A;  3GSS A;  4EVM A;  4YQU A;  3TJB A;  1RK4 A;  2A4H A;  1U87 A;  4D73 B;  2R2J A;  4HQS A;  5AGY A;  5A5K A;  3E9J B;  3M1G A;  2LST A;  3GYK A;  3IXR A;  1FO5 A;  4ECC A;  4WBR D;  4LL4 B;  3ZIJ A;  1XOA A;  19GS A;  3IE3 A;  1VF4 A;  3QCP A;  3VWU A;  2IFQ B;  1VRS D;  2GVP A;  3HZ8 A;  2LRN A;  5A34 B;  1S3C A;  2VIM A;  2R5G A;  4ICY A;  4DSR A;  1TI3 A;  1Z5Y E;  3FR3 A;  3UJ1 A;  3FHK A;  4CHS A;  3F6F A;  5DBQ A;  4NPB A;  2YOI A;  4BL7 A;  1E6B A;  1ZCP A;  1GNW A;  1GSD A;  3IC8 A;  3NZN A;  4IQ1 A;  4G10 A;  3W6G A;  4MNN A;  4IGJ A;  2E2M A;  4IKH A;  4CW9 A;  4I2U A;  4BPY A;  3E3E A;  1M2D A;  4GQC A;  4F9Z A;  3UAP A;  2DBC A;  1G0T A;  3H93 A;  1SVM A;  4OFM A;  4NWY A;  3TKQ A;  4EUY A;  3I6A A;  1CQG A;  1TRW A;  4KUN A;  3KP9 A;  5E4W A;  4KSM A;  4NXI A;  3RHB A;  1XVW A;  3Q18 A;  4G01 A;  2NVL A;  3UL3 A;  2A2P A;  2RM5 A;  4AKI A;  2H70 A;  1NHO A;  3KD0 A;  4TR1 A;  2VD1 A;  1YQ1 A;  2K6V A;  1GLP A;  4OCF A;  2OE3 A;  4RQX A;  3TJK A;  4W66 A;  2O5V A;  3RBT A;  2CQ9 A;  4EE0 A;  1GSQ A;  1U88 A;  1SJ6 A;  3HD5 A;  5D96 A;  5D9T A;  1O8W A;  4HU7 A;  1UC7 A;  3KXO A;  5DQY A;  2D2Z A;  3W8J A;  1XVQ A;  4EC0 A;  5JCU A;  1T4Y A;  5AIV A;  1HNB A;  3KM6 A;  4POM A;  3M3M A;  2PVQ A;  2FY6 A;  2OJL A;  2DJ2 A;  2VO4 A;  1TKD B;  2LJR A;  2L4C A;  2VM2 A;  1FHE A;  5BMU B;  3TJG A;  2AAW A;  3KH7 A;  3QAV A;  4KGI A;  2X4A A;  4Z2U A;  4WXT A;  4BL7 B;  1FOH A;  4L8E A;  1NSW A;  2C1Y A;  1U6T A;  2UZ8 A;  5CRG A;  2GQK A;  4J2F A;  2O85 A;  2DJJ A;  1TK5 B;  1MTC A;  5CAX A;  2IN3 A;  4OO5 A;  3GST A;  4IW9 A;  4BWQ A;  4KE3 A;  3GRX A;  4G2E A;  5DCG A;  3IPZ A;  4E8H A;  3QPM A;  4AF2 A;  5IO0 A;  3P7X A;  4HJM A;  1YEP A;  2C4J A;  5IMV A;  2YN1 A;  5C04 A;  1FB6 A;  3VUR A;  1XWC A;  2V41 A;  5CRH A;  3LJR A;  2LNT A;  3C71 A;  2VL2 A;  14GS A;  4V1A g;  2XBI A;  2CAI A;  5COH A;  4N10 A;  2F8F A;  3L9U A;  1GTI A;  1URM A;  3IRA A;  5KN0 A;  4WF5 A;  2M80 A;  2ON7 A;  4JED A;  2RM6 A;  1ERW A;  2KUC A;  5KOW A;  2GQM A;  4K7O A;  3PR8 A;  3L9S A;  1SL2 B;  3HMJ G;  5IMD A;  4MPG A;  1Q98 A;  2H6Z A;  4GXZ A;  1TK0 B;  1THX A;  4MJE A;  5IPG A;  5ECR B;  5B7C A;  1OC9 B;  2HRF A;  2E0Q A;  3GFK A;  2RLI A;  5ID2 A;  3Q6O A;  3ZFB A;  3HY2 A;  4YQM A;  3VWX A;  3QD9 A;  1XXU A;  3O3T A;  1WE0 A;  3CSI A;  4MJA A;  1ABA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...