5DAKA

Crystal structure of human glutathione transferase pi complexed with a metalloid in the absence of glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
210
structure length
194
Chain Sequence
b'MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 194
sequence length 210
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dakA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dakA01
4JZQA 4Q5NA 4JBBA 2LSTA 5C04A 4PTSA 19GSA 4O32A 4EF0A 3O76A 1TOFA 4ZBAA 3GKNA 4PGTA 1X5CA 2G2QA 2N5AA 3BOAA 1G6WA 5D8IA 1N8JA 4ECBA 1FHEA 1HD2A 2VL2A 1K0NA 4X0XA 4KCEA 3WT2A 2LJRA 1PL2A 1XWCA 2NPBA 3GX0A 4TW5A 1A2LA 1THXA 2R4VA 4ULXA 1GUMA 2VO4A 3IAS2 2FCHA 4IGJA 1V9WA 1SYRA 2C1YA 1GTIA 4OCEA 3TRPA 1TRVA 5FT3A 1Z6NA 3GSTA 1QFNA 3FRCA 5DQSA 2RUFA 3TJFA 5CO3A 5B6MA 3GMFA 3FKFA 5B6NA 3IHQA 4JE1A 4OCFA 3P90A 1X9WB 3WT1A 2EIOA 3QR6A 5GZZB 4WKWA 3UJ1A 5INYA 3GH6A 1QGVA 3WYWA 3E3EA 5CAXA 1EZKA 2LRTA 1F6MC 3RAZA 2OBIA 1V58A 6GSSA 2YJHA 5DAKA 3UVHA 2WGRA 3IC4A 2YWMA 2YWNA 4XRDA 2JSYA 2M80A 3FZ5A 4KH7A 1QQ2A 1ZL9A 2H76A 5L71A 4EL1A 1GTBA 2FNOA 1YKCA 2F9SA 3IDVA 4MH3A 5J41A 4G2EA 2IMKA 1Q98A 4WR4A 1FW1A 5J3RA 2FWHA 4NHZA 2GZYA 13GSA 4KNDA 1V40A 3C7MA 1EEMA 5F0GA 4LLRA 4XTSA 2DMLA 1A2MA 4IP6A 4RQXA 4V2LA 2REMA 1H75A 1VF2A 4KA0A 8GSSA 5DVBA 4K0NA 1PD21 3IRAA 1SL1B 3QAWA 1THOA 1YZXA 4BVYB 3RHCA 1I9DA 2H6ZA 4I8BA 4XS4B 3DGQA 5CYYA 4TR0A 5DALB 5DQYA 3GA4A 4HU9A 1LJRA 4ZL9A 1FOVA 1M9AA 3ZIVA 4NAXA 1GH2A 4TR1B 2VLTA 5IMCA 4E8EA 3KMNA 4DVCA 5AIVA 5CP1A 4JU5A 4YQVA 3GRXA 1G7OA 3F6DA 4OWYA 4I97A 2GQLA 2GT5A 1ZYQB 2FUG2 4HUAA 2GZZA 3BBYA 4AJ7A 3MDKA 5ELGA 4ZXGA 2L6CA 1XWGA 2HZEB 3KEBA 2UZ8A 3WD6A 1EOHA 1EP8A 1I5GA 4L0UA 1J08A 1XWKA 5G1KA 1R5AA 2DBCA 1OYJA 2WFCA 4MF7A 2PVQA 1GSDA 4KAEA 3M9KA 4MJAA 3V1WA 6GSUA 1XFLA 5GAND 1JHBA 1TI1A 4USSA 5GSTA 2NVLA 1XCCA 1PKWA 4KW6A 3A2WA 4ZIJA 5JCUA 4KDYA 1SENA 3TKSA 14GSA 1B9XC 1NM3A 2GT6A 2AUVA 4RQRA 1USBA 5G30A 3EINA 4G0IA 1QMVA 22GSA 3I9V2 1V57A 3BCIA 2CT6A 1MD3A 4FH8A 2IMIA 4KSOA 1J0FA 7GSSA 6GSXA 1AXDA 2D2ZA 4MPGA 3C8EA 2YZHA 4G0LA 4PQIA 4HEA2 4WBRD 5DCHA 4PXOA 2GTUA 4HJ2A 4J2FA 4ML6A 2DIYA 1YDKA 3LXTA 2B5YA 3VWUA 2F51A 2O89A 3BJ5A 3U6VA 3IE3A 2GS3A 1PA3A 2LNTA 1GLPA 2YP6A 1G6YA 3IC8A 1ZMAA 3G7JA 2CAIA 3M3MA 2K8VA 3TUEA 3L4NA 1T3BA 3GIXA 4N11A 2ON5A 4I5QA 4HS1A 4QL9A 2RM5A 4O5RA 2IFQB 2JACA 1IYIA 2ON7A 2GZPA 4RI6A 1GSFA 4IQ1A 1JZRA 1TRUA 2FA8A 3P8WA 1F2EA 1G0TA 3H8QA 3DVWA 3GURA 2IJYA 1TK8B 5IM9A 3ZFLA 2YV9A 2FGXA 4D73B 1EV9A 1S3AA 2M72A 1BAYA 4HZ2A 3KJYA 4PQHA 4TOPA 3KD0A 3FR9A 5D9XA 5DAKB 5ENUA 2YZUA 1T8EB 2N5BA 3TJGA 5ECRB 3Q6OA 2YCDA 3ZVJA 5KN0A 5G5EA 1FB6A 1YQ1A 5ECIB 1A8YA 1S3DA 1TTZA 3UARA 5CRHA 3GNJA 2HT9A 2OBKA 3PR8A 1SD9A 3G7IA 2LTKA 4AF2A 2VM2A 3ZIJA 4EO3A 1RK4A 4TXVA 4ZB8A 1X5EA 4XS1A 4EKZA 2HSMA 3KH9A 1XBSA 2PWJA 1FVKA 3GFKA 3ERGA 4WXTA 5CRWA 5DJLA 3ZVJD 2I1UA 2R3XA 2VD1A 4MCUA 1O7UA 4MJCA 2DJJA 3UVTA 2N5FA 3QCPA 2DSAA 4ZBBA 2LUSA 2HRNA 1PKZA 4TR3A 2VM1A 3WGXA 2GSQA 2L57A 3QOUA 3I43A 2WB9A 4G0KA 3C71A 2X99A 1TRSA 1GSEA 4WBJA 1OC8A 1TJDA 4BL7A 3DKSA 3EC3A 1UC7A 3ERWA 1XW5A 2MMOA 4G19A 2H6XA 2J9HA 4WEYA 4K7IA 4MF5A 2KUCA 3GKKA 16GSA 3HJOA 4MZBA 2X64A 4K0GA 2V6KA 5J4UA 2GDRA 3TKRA 5A4VA 2L5LA 2YPMA 2WS2A 1ABAA 1H4OA 4F82A 2RM6A 1GUKA 3D0ZA 3GSSA 2VL2C 4NHWA 3APSA 3F4SA 3ME8A 1WRYA 3M8NA 2XPEA 4FIWA 1DE2A 1MTCA 3ZRDA 4AJ8A 4LA1A 3NIVA 2B5XA 1X0RA 5HR1A 1T1VA 4MH2A 3H79A 1AQWA 3H4KA 4V1Ap 4TVEA 3ZITA 3O3TA 4GQCA 1OKDA 3HHVA 1A0FA 2LJKA 5F07A 5EL8A 1T00A 3CYNA 2ALBA 4DSRA 1NW2A 4RI7A 1UA5A 2KOKA 3EWLA 4N10A 4J56E 5KN2A 4G9HA 3IR4A 2VCXA 4Z7XA 1LU4A 3DVXA 3VI5A 1RQMA 1Y6EA 3L9UA 1XIYA 1GNWA 4WR5A 3N9JA 1ST9A 2DJKA 1ZYEA 1NHOA 1W4VA 1DE1A 2VL3A 4X1UA 3I6AA 1AQXA 3A2XA 2PN8A 1M2DA 2VLVA 3TOUA 3TDGA 3KCMA 4EUYA 4PX1A 3W8JA 3TJBA 3A5WA 3MNGA 5IOWA 4IW9A 2YWOA 2C0GA 2VCZA 2EC4A 1OC3A 4V1Ag 3HVXA 2Z9SA 2X8GA 3C73A 1O81A 2F8AA 1Z6MA 4L5OA 4ZBDA 5E59A 5ID2A 5AN1A 5ECHB 2B7KA 2FY6A 3L0HA 1LBKA 1DUGA 1F37A 1K3YA 3HDCA 3UEMA 4HJMA 2AV4A 4GF0A 1B4PA 2AB6A 2XPDA 5EY6A 3FZAA 2GSTA 6GSTA 3D4TA 3UL3A 1OC9A 1SYXA 3HY2A 1M99A 2CVDA 4IJIA 2EIRA 1GNEA 3ERFA 3GUSA 4GSSA 2GQKA 4XRAA 1K3LA 4KB3A 2X8HA 1PX7A 1WOUA 2H1GA 4DSSA 1YKAA 3RPNA 2GSRA 4AJ6A 2DIZA 4MLYA 4CHSA 1AUCA 4ZB9A 4PQ1A 1AC1A 4GCIA 1FG4A 1SK2A 1EGRA 5HFKA 1S3CA 3TGZA 2H1BA 4Q5QA 1OVNA 4TRXA 5A4WA 2JADA 2HSMB 2K8SA 1YEPA 2IN3A 1X9MB 4XCSA 5E4WA 1F3BA 2XC2A 2FHEA 2JL4A 4K8MA 2E7PA 3IOSA 2R5GA 3FR3A 4J57E 4DSQA 6GSWA 4KUNA 5ECOB 1PSQA 5JWOB 3TKSC 2DJ1A 5G31A 4F9ZA 4KX4A 2WJUA 1BG5A 4EVMA 4WF5A 3GX8A 1BX9A 2O8VB 4E8HA 3KZQA 1G7EA 4POKA 3GL3A 4HU7A 3EYTA 3LGCA 4BL7B 1Z7RA 1ACVA 3I69A 3PGTA 2V32A 2DC5A 3DD3A 2HLSA 3MAKA 4OD7A 2AYTA 4MJBA 2RLIA 1TKDB 2YOIA 4OMVA 4ID0A 2L4CA 2AAWA 2CZ3A 5LCZA 4FQUA 2PGTA 4NWYA 3EU3A 1JFUA 5HFGA 4IKHA 2CZ2A 5H5SA 4LL1B 2HRKA 4FYUA 2HQTA 4BWQA 3EURA 5COHA 3FZ9A 4IP1A 4HZ4A 4I2TA 5HFIA 2YJ7A 3ZMLA 1MDJA 1GUHA 1HNBA 2MMAA 2RUEA 2C4JA 4L8EA 1K0CA 4TKYA 2NTOA 4MF6A 1XZOA 1CQGA 2A2RA 3UIWA 4N30A 3FYGA 4EE0A 1QUWA 3SWLA 2WZ9A 5G5FA 4K1FA 2H01A 2JU5A 1A0RP 3C1RA 3CBUA 1A23A 4GSTA 1PQNA 2CVKA 1UVZA 4OFTA 1WPIA 1U6TA 5D9TA 3UAPA 4IVFA 1CQHA 1N2AA 2FWEA 3J7Yb 1MD4A 1EP7A 4OO5A 1AW9A 4WETA 5B8BA 1FO5A 1M0UA 2LQOA 4ILFA 3VFIA 4FYBA 2HFDA 4BPYA 3EMXA 2L4QA 3MWHA 5ECMB 3KIJA 2HNLA 3SBCA 3APQA 3QFAC 5J9BA 2OE1A 1BJXA 2FD3A 1SL2B 1HQOA 4ECCA 4PNGA 1V98A 2H8LA 4IJ3A 4ZL8A 2ES7A 4KF9A 1R4WA 1SL0B 1GTUA 3VWXA 1RW1A 1O8XA 1O6JA 3P2AA 2QSIA 2O85A 2VIMA 1DSBA 1YF0A 3LYPA 4FO5A 3RDWA 4EXJA 2P31A 4GRFA 1TU8A 5ID2B 3D4MA 5HR3A 3HZ8A 1TU7A 2FLSA 4NXIA 4ACSA 3KTBA 4P3YB 2P0GA 2PMTA 1TP9A 1K0AA 2CA8A 1ILOA 3HA9A 1WMJA 3KP9A 1HNCA 1GULA 2I81A 3IAM2 4DEJA 1Z5YE 1YEXA 3KGKA 1OC9B 5IPHA 1R5PA 2I3YA 2AJQB 17GSA 2K18A 3HZ4A 1U88A 2HZFA 1PRXA 1E6BA 3TRQA 4IHUA 1WJKA 3FY7A 4TN8A 4BVXA 1PN9A 3QAGA 2B7JA 5FHIA 4DSSB 2HI7A 1GSSA 1BYEA 1B9YC 2QKEA 3VPTA 3FR6A 2K6VA 2HSHA 1X9SB 5D9VA 4QL7A 3MSZA 1XOAA 3CTGA 1M2BA 5HR2A 2HSYA 6GSYA 2H0HA 4K7OA 3F4RA 1XPVA 2PU9C 1JZDA 2JSZA 2DJ2A 2ZNMA 1TK5B 4V2MA 3FEUA 4MP4A 1ZOFA 3ZZXA 1Y25A 2PERA 3CSIA 1C72A 3M0FA 3L9VA 2LV3A 2LEGA 1ML6A 3ZLPA 4BVYA 4FYCA 2GVPA 2YANA 5HQPA 1U87A 1A8LA 3GTUA 4RUVA 5IO2A 2DMMA 1SJIA 1O8WA 2YV7A 2TIRA 3D6IA 4POLA 1PMTA 2CV4A 5JCWA 4CW9A 1OAZA 1SKRB 4YAVA 1SJZA 2CVBA 1JLWA 1R7HA 1K0DA 3VK9A 1URMA 2VD0A 3KM6A 3VWWA 5ABRA 4H86A 2NBSA 4MA9A 2C3QA 4NPBA 3U5RE 3RBTA 5JWRB 10GSA 2IMFA 3LYKA 2HE3A 2ZCTA 3F4TA 1AAZA 2WRTA 3GH9A 3CRTA 3S9FA 2VAFA 2A2SA 3EU4A 5KEJA 1M2AA 4XIHA 3IPZA 1GSYA 3GV1A 3DRNA 3ISOA 4CDOA 5IMVA 5DJMA 2LRCA 2IMDA 3F3QA 3E0UA 1GSUA 1FVJA 2O87A 3IV4A 2L5OA 5IMZA 5B8AA 2HRFA 1YF1A 4EC0A 1TRWA 3KMOA 3GYKA 1F3AA 3VI7A 3W8SA 2H1DA 1FAAA 1GP1A 1U3AA 3F8UA 4YQUA 5LNKe 2JZTA 1QK8A 2HYXA 5F06A 3UOMA 3IK9A 5IPGA 4IBPA 1EOGA 4N0ZA 1SK0A 1ERVA 3HJPA 3ZTLA 3EMPA 3L9SA 4PURA 3LFLA 1EWXA 1JLVA 1SJ6A 3KXOA 4KCAA 5A4UA 3RPPA 4N0VA 5IIZA 3Q74A 2H71A 3TCOA 4KSMA 5F8BA 12GSA 2VLUA 4F2IA 1AIUA 1A2JA 5D73A 1WIKA 4F0BA 4Q5FA 5F05A 1KNGA 4G10A 1NSWA 2H73A 2GSSA 3ZL5A 2CX3A 2IWTA 4ZL7A 2OE3A 18GSA 4KDUA 3DWVA 3ZFBA 2F8FA 4OO4A 2HSNB 4NMUA 2M46A 2P5RA 4EDYA 1MDIA 5DDLA 3LJRA 1EGOA 1XOBA 1F9MA 3TKPA 4ML1A 2IFQA 4YH2A 2H1AA 3OR5A 4MMMA 2VCVA 1XWBA 1HNAA 3KP8A 2XHFA 1VGLA 1W89A 3F63A 3FW2A 5EPFA 1YY7A 3CSHA 2TRXA 2WULA 3QAVA 3Q18A 4BWSA 3HVSA 3DYRA 2H72A 4K2DA 2IIYA 1TXXA 2AHEA 1GL8A 2V6OA 1ERTA 1ZGNA 1M9BA 3IA1A 4D73A 5C00A 4LMWA 2JZRA 1MDKA 3VURA 4I6XA 3D22A 1Z9HA 2I4AA 3G9BA 2QC7A 5CREA 3D21A 1KBNA 3UMAA 1OKTA 3KTLA 2LJAA 5D96A 3LG6A 3ZYWA 4POBA 2KP2A 1GLQA 2MBSA 5CNWA 11GSA 3ME7A 1AQVA 4BVXB 2BMXA 2E2GA 2L6DA 2OADA 3F3RA 4WF4A 1K3OA 2H66A 3GN3A 2E2MA 3TB2A 5HR0A 1TW9A 1B8XA 4GLTA 3DMLA 2QGVA 2B1LA 2R2JA 5CRDA 3HD5A 3GHAA 4HOJA 2H75A 4JR4A 4HQZA 3APOA 3H1NA 4K6XA 2I9HA 3PINA 1JZWA 1B4QA 2MBTA 3HCZA 4HQSA 2C8UA 3GTUB 3QMXA 2DLXA 5KN1A 4IS0A 2YN1A 2OJLA 1VF3A 2H19A 3CTFA 5ECNB 3TJJA 1T7PB 2MYGA 2J23A 2V41A 1KTEA 4KGIA 4GWRA 1VF4A 2IPAA 1XVQA 2K9FA 3JCML 3TOTA 1ON4A 2MZCA 4JRRA 3LWAA 2C0DA 2X8CA 3VWVA 3UBLA 4MABA 1WE0A 2XBIA 1BEDA 3Q19A 3WGDA 2GLRA 2O7KA 5JWQB 4ECIA 4MZCA 3E9JB 4NV5A 3J7Yk 3AY8A 1K0OA 2L59A 2YWIA 4XS6A 5G1LA 4F0CA 2TRCP 2LNSA 2B5EA 1KEBA 4POMA 4V2NA 2F3MA 5D9WA 3TKQA 2DJ0A 3A2VA 3C1SA 3NOFA 1OE8A 3EVIA 4XHMA 2WCIA 4O7HA 3HYPA 5J9CA 4NV2A 9GSSA 3CRUA 3US3A 3RHBA 2FWGA 1OE7A 2RIIA 2WDUA 2KLXA 4GQFA 1V2AA 1YJ6A 5ECPB 3HKRA 3H93A 4TXOA 4BA7A 1B48A 4QQ7A 1ZCPA 4ZILA 1SD8A 2CQ9A 3BCKA 3L78A 2OE0A 1FB0A 2KP1A 5IO0A 1BQ7A 4X43A 2H74A 4IQAA 5ELAA 3P7XA 4LMVA 3PPUA 2PVOC 2CX4A 3K8NA 3NZNA 2G0FA 4JR6A 2C0EA 3BD2A 1UN2A 2OA7A 4K7NA 1WP0A 2H0GA 3ZREA 3LXZA 3FK8A 1Q4JA 4YQMA 2LKUA 1Z3EA 2V1MA 4KDXA 1XVWA 2H6YA 1GRXA 5ECQB 4MDCA 2H70A 2V2GA 5IQYA 3R2QA 3TRXA 4K9ZA 3LORA 2OACA 2B3SA 3IXRA 5GAPD 3CXGA 3CSJA 3GKXA 3R3EA 3QFBC 1O73A 1J9BA 2JZSA 2FA4A 2YNXA 2VL9A 1R26A 4MZWA 3KH7A 4MPFA 4MJEA 5H5RA 4GXZA 2DJ3A 4L5LA 4AGSA 2LQQA 1K0BA 5B7CA 1T4YA 5DBQA 1EEJA 4OFMA 3ZMKA 4YAPA 4IELA 4PUAA 2MMNA 1PX6A 2HXKA 3TKSE 2BTOT 3GKMA 3IK7A 1QXHA 5EVOA 2E0QA 2CAQA 1SK1A 3HVVA 5ECLB 1ZZYA 1GWCA 3UBKA 5AGYA 5CRGA 2C0FA 6GSVA 2C80A 2VCTA 3VPQA 2VOCA 2R37A 3A3TA 3HJMA 5JCGA 4IN0A 5KN3A 3VLNA 5LD0A 1A24A 2FWFA 3QD9A 3QDNA 3IBHA 3LEFA 5ECSA 2PUKC 4F03A 4MK3A 5A5KA 1ERUA 1TK0B 2R6KA 4XS4A 3F0IA 5AISA 5DALA 1SU9A 3TJKA 4TR1A 2GQMA 2C3TA 1U3IA 5J5NA 1EV4A 4EDZA 3ED3A 1O85A 2VCWA 2KHPA 3DEXA 4PNFA 2PPTA 3F6FA 4HI7A 1ERWA 3FZ4A 4L0WA 2H30A 2MMZA 1NHYA 3WGEA 3CMIA 5IMDA 2PBJA 5ECKB 2GGTA 1SKWB 2BJXA 4HDEA 3D5JA 1SKSB 2C3NA 1GSQA 1VF1A 2VCQA 3M1GA 5BMUA 4PUFC 1MEKA 5FWGA 2IL3A 4O92A 2HZEA 4I2UA 4ISDA 2HRAA 1Z7PA 2H0IA 5IMFA 1WWJA 3F9UA 1HYUA 2EIQA 2XBQA 4GSNA 20GSA 4ECJA 3O6TA 1XW6A 2HRKB 2NDOA 1PGTA 1XXUA 1JZOA 3DXBA 1T4ZA 1VRSD 5IOXA 1XWAA 3N5OA 1E2YA 2ZUPA 2OKAA 3PH9A 4KE3A 3HXSA 3FHKA 4TR4A 2A4VA 1TDIA 5IMAA 3DIEA 3W6GA 5G2ZA 5AIXA 3QPMA 1DBYA 1PL1A 1GTAA 5H5QA 2P5QA 4OFNA 1K0MA 5D93A 2VUPA 1TI3A 5DCGA 2B1KA 3M9JA 1XW9A 4Q5RA 1M7TA 3EE2A 2B6MA 5GSSA 3GL5A 4ZB6A 4JEDA 1X5DA 2LRNA 3LSZA 2LS5A 4GTUA 1IYHA 4TXOB 2IMEA 3G7YA 4LL4B 3LQ7A
chains in the Genus database with same CATH superfamily
4JZQA 4Q5NA 4JBBA 2LSTA 5C04A 4PTSA 19GSA 4O32A 4EF0A 3O76A 1TOFA 4ZBAA 3GKNA 4PGTA 1X5CA 2G2QA 2N5AA 3BOAA 1G6WA 5D8IA 1N8JA 4ECBA 1FHEA 1HD2A 2VL2A 1K0NA 4X0XA 4KCEA 3WT2A 2LJRA 1PL2A 1XWCA 2NPBA 3GX0A 4TW5A 1A2LA 1THXA 2R4VA 4ULXA 1GUMA 2VO4A 3IAS2 2FCHA 4IGJA 1V9WA 1SYRA 2C1YA 1GTIA 4OCEA 3TRPA 1TRVA 5FT3A 1Z6NA 3GSTA 1XG8A 1QFNA 3FRCA 5DQSA 2RUFA 3TJFA 5CO3A 5B6MA 3GMFA 3FKFA 5B6NA 3IHQA 4JE1A 4OCFA 3P90A 1X9WB 3WT1A 2EIOA 3QR6A 4W66A 5GZZB 4WKWA 3UJ1A 5INYA 3GH6A 1QGVA 3WYWA 3E3EA 5CAXA 1EZKA 2LRTA 1F6MC 2O36A 3RAZA 2VKZG 4PI2C 2OBIA 1V58A 6GSSA 2YJHA 5DAKA 3UVHA 2WGRA 3IC4A 2YWMA 2YWNA 4XRDA 2JSYA 2M80A 5A5HB 3FZ5A 4KH7A 1QQ2A 2X49A 1ZL9A 2H76A 5L71A 4EL1A 1GTBA 2FNOA 1YKCA 2F9SA 3IDVA 4MH3A 5J41A 4G2EA 2IMKA 2WVYA 1Q98A 4WR4A 4K5SA 1FW1A 5J3RA 4PHZC 2FWHA 4NHZA 2GZYA 13GSA 4KNDA 1V40A 3C7MA 1EEMA 5F0GA 4LLRA 4XTSA 2DMLA 1A2MA 4IP6A 4RQXA 4O5QA 4V2LA 2REMA 1H75A 1VF2A 4KA0A 8GSSA 5DVBA 4K0NA 1PD21 4BIKA 3IRAA 4K2XA 1SL1B 3QAWA 1THOA 1YZXA 4BVYB 3RHCA 1I9DA 2H6ZA 4I8BA 4XS4B 3DGQA 5CYYA 4TR0A 5DALB 5DQYA 3GA4A 4HU9A 1LJRA 4ZL9A 1FOVA 1M9AA 3ZIVA 4NAXA 1GH2A 4TR1B 2VLTA 5IMCA 4E8EA 3KMNA 4DVCA 5AIVA 5CP1A 4JU5A 4YQVA 3GRXA 1G7OA 3F6DA 4OWYA 4I97A 2GQLA 2GT5A 1ZYQB 2FUG2 4HUAA 2GZZA 3BBYA 1YVLA 2WVXA 4AJ7A 3MDKA 5ELGA 4ZXGA 2L6CA 1XWGA 2HZEB 3KEBA 2QA1A 2UZ8A 3WD6A 1EOHA 1EP8A 1I5GA 4L0UA 1J08A 1XWKA 5G1KA 1R5AA 2DBCA 1OYJA 2WFCA 4MF7A 2PVQA 1GSDA 4KAEA 3M9KA 4MJAA 3V1WA 6GSUA 1XFLA 5GAND 1JHBA 1TI1A 4USSA 5GSTA 2NVLA 1XCCA 1PKWA 4KW6A 3A2WA 4ZIJA 5JCUA 4KDYA 1SENA 3TKSA 14GSA 1B9XC 1NM3A 2GT6A 2AUVA 4RQRA 1USBA 5G30A 3EINA 4G0IA 1QMVA 22GSA 3I9V2 1V57A 3BCIA 2CT6A 1MD3A 4FH8A 2IMIA 4KSOA 1J0FA 7GSSA 6GSXA 1AXDA 2D2ZA 4MPGA 3C8EA 2YZHA 4G0LA 4PQIA 4HEA2 4WBRD 5DCHA 4PXOA 2GTUA 4HJ2A 4J2FA 4ML6A 2DIYA 1YDKA 2H1LA 3LXTA 2B5YA 3VWUA 2F51A 2O89A 3BJ5A 3U6VA 3IE3A 2GS3A 1PA3A 2LNTA 1GLPA 2YP6A 1G6YA 3IC8A 1ZMAA 2HSNA 3G7JA 2CAIA 3M3MA 2K8VA 3TUEA 3L4NA 3GIXA 1T3BA 3CHXC 4N11A 2ON5A 4I5QA 4HS1A 4QL9A 2RM5A 4O5RA 2IFQB 2JACA 1IYIA 2ON7A 2GZPA 4RI6A 4CY6A 1GSFA 4IQ1A 4X4JA 1JZRA 1TRUA 2FA8A 4E68A 3P8WA 3EPTA 1F2EA 2EFCA 1G0TA 3H8QA 2UV8G 3DVWA 3GURA 2IJYA 1TK8B 5IM9A 3ZFLA 2YV9A 2FGXA 4D73B 1EV9A 1S3AA 2M72A 1BAYA 4HZ2A 3KJYA 4PQHA 4TOPA 3KD0A 3FR9A 5D9XA 5DAKB 5ENUA 2YZUA 1T8EB 2N5BA 3TJGA 5ECRB 3Q6OA 2YCDA 3ZVJA 5KN0A 3IHGA 5G5EA 1FB6A 1YQ1A 5ECIB 1A8YA 1S3DA 1TTZA 3UARA 5CRHA 3GNJA 2HT9A 2OBKA 3PR8A 1SD9A 3G7IA 2LTKA 4AF2A 2VM2A 1M3IA 3ZIJA 4EO3A 1RK4A 4TXVA 4ZB8A 1X5EA 4XS1A 4EKZA 2HSMA 3RGBC 3LW9A 3KH9A 1XBSA 2PWJA 1FVKA 5A1NB 3GFKA 3ERGA 4WXTA 5CRWA 5DJLA 3ZVJD 2I1UA 2R3XA 2VD1A 4MCUA 1O7UA 4MJCA 2DJJA 3UVTA 2N5FA 2WW3A 3QCPA 2DSAA 4ZBBA 2LUSA 2HRNA 1PKZA 2O3EA 1S3RA 4TR3A 2VM1A 3WGXA 2GSQA 2L57A 3QOUA 4ZB7A 3I43A 2WB9A 4G0KA 3C71A 2X99A 1TRSA 1GSEA 4WBJA 1OC8A 1TJDA 4BL7A 3DKSA 3EC3A 1UC7A 3ERWA 1XW5A 2MMOA 4G19A 2H6XA 2J9HA 4WEYA 4K7IA 5J4YA 4K5RA 4MF5A 2KUCA 3GKKA 16GSA 3HJOA 4MZBA 2X64A 4K0GA 2V6KA 5J4UA 2EFDA 2GDRA 3TKRA 5A4VA 2L5LA 2YPMA 2WS2A 3CQFA 1ABAA 1H4OA 4F82A 2RM6A 1GUKA 3D0ZA 3GSSA 2VL2C 4NHWA 3APSA 3F4SA 3ME8A 2WVXB 1WRYA 3M8NA 2XPEA 4FIWA 1DE2A 1MTCA 3ZRDA 4AJ8A 4LA1A 5KOXA 3NIVA 2B5XA 1X0RA 5HR1A 1T1VA 4MH2A 3H79A 1AQWA 3H4KA 4V1Ap 4TVEA 3ZITA 3O3TA 4GQCA 1OKDA 1ZYPA 3HHVA 1A0FA 2LJKA 5F07A 5EL8A 1T00A 3CYNA 2ALBA 4DSRA 1NW2A 4RI7A 1UA5A 2KOKA 3EWLA 4N10A 4J56E 5KN2A 4G9HA 3IR4A 2VCXA 4Z7XA 1LU4A 3DVXA 3VI5A 1RQMA 1Y6EA 3L9UA 1XIYA 1GNWA 4WR5A 3N9JA 1ST9A 2DJKA 1ZYEA 1NHOA 1W4VA 1DE1A 2VL3A 4X1UA 3I6AA 1AQXA 3A2XA 2PN8A 1M2DA 2VLVA 3TOUA 3TDGA 3KCMA 4EUYA 5J47A 4PX1A 3W8JA 3TJBA 3A5WA 1BG1A 3MNGA 5IOWA 4IW9A 1PN0A 2YWOA 2C0GA 2VCZA 3CWGA 2EC4A 1OC3A 4V1Ag 3HVXA 2Z9SA 2X8GA 3C73A 1O81A 2F8AA 1Z6MA 4L5OA 4ZBDA 5E59A 5ID2A 5AN1A 5ECHB 2B7KA 2FY6A 3L0HA 1LBKA 1TXUA 1DUGA 1F37A 1K3YA 3HDCA 3UEMA 4HJMA 2AV4A 4GF0A 1B4PA 2AB6A 2XPDA 5EY6A 3FZAA 2GSTA 6GSTA 3D4TA 3UL3A 1OC9A 1SYXA 3TU3B 2QA2A 3HY2A 1M99A 2CVDA 4IJIA 2EIRA 1GNEA 3ERFA 3GUSA 4Z2RA 4GSSA 2GQKA 4XRAA 1K3LA 4KB3A 2X8HA 1PX7A 1WOUA 2H1GA 3MYDA 4DSSA 1YKAA 3RPNA 2GSRA 4AJ6A 2DIZA 4MLYA 4CHSA 1AUCA 4ZB9A 4PQ1A 1AC1A 4GCIA 1FG4A 1SK2A 1EGRA 5HFKA 1S3CA 3TGZA 5KOWA 2H1BA 4Q5QA 1OVNA 4TRXA 5A4WA 2A2PA 2JADA 2HSMB 2K8SA 1YEPA 2IN3A 1X9MB 4XCSA 5E4WA 1F3BA 2XC2A 2FHEA 2JL4A 4K8MA 2E7PA 3IOSA 2R5GA 4FXYP 3FR3A 4J57E 4DSQA 6GSWA 4KUNA 5ECOB 1PSQA 5JWOB 3TKSC 3FMWA 2DJ1A 5G31A 4F9ZA 4KX4A 2WJUA 1BG5A 4EVMA 4WF5A 3GX8A 1BX9A 2O8VB 4E8HA 3KZQA 1G7EA 4POKA 3GL3A 4HU7A 3EYTA 3LGCA 4BL7B 1Z7RA 1ACVA 1M3JA 1SVOA 3I69A 3PGTA 2R0PA 2V32A 2DC5A 3DD3A 2HLSA 3MAKA 4OD7A 2AYTA 4MJBA 2RLIA 1TKDB 5BMUB 4OMVA 2YOIA 4ID0A 1PFOA 2L4CA 2AAWA 2CZ3A 5LCZA 4FQUA 2PGTA 4NWYA 3EU3A 1JFUA 5HFGA 4IKHA 2CZ2A 5H5SA 4LL1B 2HRKA 4FYUA 2HQTA 4BWQA 4EIPA 3EURA 5COHA 3FZ9A 4IP1A 4HZ4A 2A4HA 4I2TA 5HFIA 2YJ7A 3ZMLA 1MDJA 1GUHA 1HNBA 2MMAA 2RUEA 2C4JA 4L8EA 1K0CA 4TKYA 2NTOA 4MF6A 1XZOA 1CQGA 2A2RA 3UIWA 4N30A 3FYGA 4EE0A 1QUWA 3SWLA 4Z2TA 2WZ9A 5G5FA 4K1FA 2H01A 2JU5A 1A0RP 3C1RA 3CBUA 1A23A 4GSTA 1PQNA 2DKHA 2WVZA 2CVKA 1UVZA 4OFTA 1WPIA 1U6TA 5D9TA 3UAPA 4IVFA 1CQHA 1N2AA 2FWEA 3J7Yb 1MD4A 1EP7A 4OO5A 1AW9A 4WETA 5B8BA 1FO5A 1M0UA 2LQOA 4ILFA 3VFIA 4FYBA 2HFDA 4BPYA 3EMXA 2L4QA 3MWHA 5ECMB 3KIJA 2HNLA 3SBCA 3APQA 3QFAC 5J9BA 1SVLA 2OE1A 1BJXA 2FD3A 2WZSA 1SL2B 1HQOA 4ECCA 4PNGA 1V98A 2H8LA 4IJ3A 4ZL8A 5A34A 2ES7A 3A5IA 4KF9A 2OT3A 1R4WA 1SL0B 1GTUA 3VWXA 1RW1A 1O8XA 1O6JA 3P2AA 2QSIA 2O85A 2VIMA 1DSBA 1YF0A 3LYPA 4FO5A 3RDWA 4EXJA 2P31A 4GRFA 1TU8A 1BF5A 4AKGA 5ID2B 3D4MA 1S4BP 5HR3A 2O5VA 3HZ8A 1TU7A 2FLSA 4NXIA 4ACSA 3KTBA 4P3YB 2P0GA 2PMTA 1TP9A 1K0AA 2CA8A 1ILOA 3HA9A 1WMJA 3KP9A 1HNCA 1GULA 2I81A 3IAM2 4DEJA 4G01A 1Z5YE 1YEXA 3KGKA 1OC9B 5IPHA 1R5PA 2I3YA 2AJQB 17GSA 2K18A 3HZ4A 1U88A 2HZFA 5A5HA 1PRXA 1E6BA 3TRQA 4IHUA 1WJKA 3FY7A 4TN8A 4BVXA 1PN9A 3QAGA 2B7JA 5FHIA 4DSSB 2HI7A 1GSSA 1BYEA 1B9YC 2QKEA 3VPTA 3FR6A 2K6VA 2HSHA 1X9SB 5D9VA 4QL7A 3MSZA 1XOAA 3CTGA 1M2BA 5HR2A 2HSYA 6GSYA 4EIQA 2H0HA 4K7OA 2WW1A 3F4RA 1XPVA 2PU9C 1JZDA 2JSZA 2DJ2A 2ZNMA 1TK5B 4V2MA 3FEUA 4MP4A 1ZOFA 3ZZXA 1Y25A 2PERA 3CSIA 1C72A 3M0FA 3L9VA 2LV3A 2LEGA 1ML6A 3ZLPA 4BVYA 4FYCA 2GVPA 2YANA 5HQPA 1U87A 1A8LA 3GTUA 4RUVA 5IO2A 2DMMA 1SJIA 4AKHA 1O8WA 2YV7A 2TIRA 3D6IA 4POLA 1PMTA 2CV4A 5JCWA 4CW9A 1OAZA 1SKRB 2EFEA 4YAVA 1SJZA 2CVBA 1JLWA 1R7HA 1K0DA 3VK9A 1URMA 2VD0A 4PI0C 3KM6A 3VWWA 5ABRA 4H86A 2NBSA 4MA9A 2C3QA 4NPBA 3U5RE 3RBTA 5JWRB 10GSA 2IMFA 3LYKA 2HE3A 2ZCTA 3F4TA 1AAZA 2WRTA 3GH9A 3CRTA 3S9FA 2VAFA 2A2SA 3EU4A 5KEJA 1M2AA 4XIHA 3IPZA 4GDFA 1GSYA 3GV1A 3DRNA 3ISOA 4CY8A 4CDOA 5IMVA 5DJMA 2LRCA 2IMDA 3F3QA 3E0UA 1GSUA 1FVJA 2O87A 3IV4A 2L5OA 5IMZA 5B8AA 2HRFA 1YF1A 2EFHA 4EC0A 1TRWA 3KMOA 3GYKA 1F3AA 3VI7A 3W8SA 2H1DA 1FAAA 1GP1A 1U3AA 3F8UA 4YQUA 5LNKe 2JZTA 1QK8A 2HYXA 5F06A 3UOMA 3IK9A 5IPGA 4IBPA 1EOGA 4N0ZA 1SK0A 1ERVA 3HJPA 3ZTLA 3EMPA 3L9SA 4PURA 3LFLA 1EWXA 1JLVA 1SJ6A 3KXOA 4KCAA 5A4UA 3RPPA 4N0VA 5IIZA 3Q74A 2H71A 3TCOA 4KSMA 5F8BA 12GSA 2VLUA 4F2IA 1AIUA 1A2JA 5D73A 1WIKA 4F0BA 4Q5FA 5F05A 1KNGA 4G10A 1NSWA 2DKIA 2GSSA 2H73A 3ZL5A 2CX3A 2IWTA 4ZL7A 2OE3A 18GSA 4KDUA 3DWVA 3ZFBA 2F8FA 4OO4A 5A34B 2HSNB 4NMUA 2M46A 1I1IP 2P5RA 1FOHA 4EDYA 1MDIA 5DDLA 3LJRA 1EGOA 1XOBA 1F9MA 3TKPA 4ML1A 2IFQA 4YH2A 2H1AA 3OR5A 4MMMA 2VCVA 1XWBA 1HNAA 3KP8A 2XHFA 1VGLA 1W89A 3F63A 3FW2A 5EPFA 1YY7A 3CSHA 2TRXA 2WULA 3QAVA 3Q18A 4BWSA 3HVSA 3DYRA 2H72A 4K2DA 1Y1UA 2IIYA 2R0CA 1TXXA 2AHEA 4Z2UA 1GL8A 4O5UA 2V6OA 1ERTA 1ZGNA 1M9BA 3IA1A 4D73A 5C00A 4LMWA 2JZRA 1MDKA 3VURA 4I6XA 3D22A 1Z9HA 2I4AA 3G9BA 2QC7A 5CREA 3D21A 1KBNA 3UMAA 1OKTA 3KTLA 2LJAA 5D96A 3LG6A 3ZYWA 4POBA 2KP2A 1GLQA 2MBSA 5CNWA 11GSA 3ME7A 1AQVA 4BVXB 2BMXA 2E2GA 2L6DA 2OADA 3F3RA 4WF4A 1K3OA 2H66A 3GN3A 2E2MA 3TB2A 5HR0A 5A1NA 1TW9A 1B8XA 4GLTA 3DMLA 2QGVA 2B1LA 3RFRC 2R2JA 5CRDA 3HD5A 3GHAA 4HOJA 2H75A 4JR4A 2R0GA 4HQZA 3APOA 3H1NA 4K6XA 2I9HA 3PINA 1JZWA 1B4QA 2MBTA 3HCZA 4HQSA 2C8UA 3GTUB 3QMXA 2DLXA 5KN1A 4IS0A 2YN1A 2OJLA 1VF3A 2H19A 3CTFA 5ECNB 3TJJA 1T7PB 2MYGA 2J23A 2V41A 1KTEA 4KGIA 4GWRA 1VF4A 2IPAA 1XVQA 2K9FA 3JCML 3TOTA 1ON4A 2MZCA 4JRRA 3LWAA 2C0DA 2X8CA 3VWVA 3UBLA 4MABA 1WE0A 2XBIA 1BEDA 3Q19A 3WGDA 2GLRA 2O7KA 5JWQB 4ECIA 4MZCA 3E9JB 4NV5A 3J7Yk 3AY8A 1K0OA 2L59A 2YWIA 4XS6A 5G1LA 4F0CA 2TRCP 2LNSA 2B5EA 1KEBA 4POMA 4V2NA 2F3MA 5D9WA 3TKQA 2DJ0A 3A2VA 3C1SA 3NOFA 1OE8A 3EVIA 4XHMA 2WCIA 4O7HA 3HYPA 5J9CA 4NV2A 9GSSA 3CRUA 3US3A 3RHBA 2FWGA 1OE7A 2RIIA 2WDUA 2KLXA 5BRTA 4GQFA 1YEWC 1V2AA 1YJ6A 5ECPB 3HVNA 3HKRA 3H93A 4TXOA 4BA7A 1B48A 4QQ7A 1ZCPA 4ZILA 1SD8A 2CQ9A 3BCKA 3L78A 2OE0A 1FB0A 2KP1A 5IO0A 1BQ7A 4X43A 2H74A 4IQAA 5ELAA 4AI6A 3P7XA 4LMVA 3PPUA 2PVOC 2CX4A 1N25A 3K8NA 3NZNA 2G0FA 4JR6A 2C0EA 3BD2A 1UN2A 2OA7A 4K7NA 1WP0A 2H0GA 3ZREA 3LXZA 3FK8A 1Q4JA 4YQMA 2LKUA 1Z3EA 2V1MA 4KDXA 1XVWA 2H6YA 1GRXA 5ECQB 4MDCA 2H70A 2V2GA 5IQYA 3R2QA 3TRXA 4AKXB 4K9ZA 3LORA 2OACA 2B3SA 3IXRA 5GAPD 2WW2A 3CXGA 3CSJA 2X4AA 3GKXA 3R3EA 3QFBC 1O73A 1J9BA 2JZSA 2FA4A 2YNXA 2VL9A 1R26A 4MZWA 3KH7A 4MPFA 4MJEA 5H5RA 4GXZA 2DJ3A 4L5LA 4AKIA 4AGSA 4N3ZA 2LQQA 1K0BA 5B7CA 1T4YA 5DBQA 1EEJA 4OFMA 3ZMKA 4YAPA 4IELA 4PUAA 2MMNA 1PX6A 2HXKA 3TKSE 2BTOT 3GKMA 3IK7A 4MNNA 1QXHA 5EVOA 2E0QA 2CAQA 1SK1A 3HVVA 5ECLB 1ZZYA 1GWCA 3UBKA 5AGYA 5CRGA 2C0FA 6GSVA 4HSCX 2C80A 2VCTA 3VPQA 2VOCA 2R37A 3A3TA 3HJMA 5J4VA 5JCGA 4IN0A 5KN3A 3VLNA 5LD0A 1A24A 2FWFA 3QD9A 3QDNA 3IBHA 3LEFA 5ECSA 2PUKC 4F03A 4MK3A 5A5KA 1ERUA 1TK0B 2R6KA 4XS4A 3F0IA 5AISA 5DALA 1SU9A 3TJKA 4TR1A 2GQMA 2C3TA 1U3IA 5J5NA 1EV4A 4EDZA 3ED3A 1O85A 2VCWA 2KHPA 3DEXA 4PNFA 2PPTA 3F6FA 4HI7A 1ERWA 3FZ4A 4L0WA 2H30A 2MMZA 1NHYA 3WGEA 3CMIA 5IMDA 2PBJA 5ECKB 2GGTA 1SKWB 2BJXA 4HDEA 3D5JA 1SKSB 3MIXA 2C3NA 1GSQA 1VF1A 2VCQA 3M1GA 5BMUA 4PUFC 1MEKA 5FWGA 4ICYA 2IL3A 4O92A 2HZEA 4YKFA 4ISDA 4I2UA 2HRAA 1Z7PA 2H0IA 5IMFA 1WWJA 3F9UA 4A5PA 1HYUA 2EIQA 2XBQA 4GSNA 20GSA 4ECJA 1SVMA 3O6TA 1XW6A 2HRKB 2NDOA 1PGTA 1XXUA 1ZYNA 1JZOA 3DXBA 1T4ZA 1VRSD 5IOXA 1XWAA 5J40A 3N5OA 1E2YA 2ZUPA 2OKAA 3PH9A 4KE3A 3HXSA 3FHKA 4TR4A 4QMKA 2A4VA 1TDIA 5IMAA 3DIEA 3W6GA 5G2ZA 5AIXA 3QPMA 1DBYA 1PL1A 1GTAA 5H5QA 2WW0A 2P5QA 4OFNA 1K0MA 5D93A 2VUPA 1TI3A 5DCGA 2B1KA 3M9JA 3HMJG 1XW9A 4Q5RA 1M7TA 3EE2A 2B6MA 5GSSA 3GL5A 4ZB6A 4JEDA 1X5DA 2LRNA 3LSZA 2LS5A 4YKGA 4GTUA 1IYHA 4TXOB 2IMEA 3G7YA 4LL4B 3LQ7A
chains in the Genus database with same CATH topology
4JZQA 4Q5NA 4JBBA 2LSTA 5C04A 4PTSA 19GSA 4O32A 4EF0A 3O76A 1TOFA 4ZBAA 3GKNA 4PGTA 1X5CA 2G2QA 2N5AA 3BOAA 1G6WA 5D8IA 1N8JA 4ECBA 1FHEA 1HD2A 2VL2A 1K0NA 4X0XA 4KCEA 3WT2A 2LJRA 1PL2A 1XWCA 2NPBA 3GX0A 4TW5A 1A2LA 1THXA 2R4VA 4ULXA 1GUMA 2VO4A 3IAS2 2FCHA 4IGJA 1V9WA 1SYRA 2C1YA 1GTIA 4OCEA 3TRPA 1TRVA 5FT3A 1Z6NA 3GSTA 1QFNA 3FRCA 5DQSA 2RUFA 3TJFA 5CO3A 5B6MA 3GMFA 3FKFA 5B6NA 3IHQA 4JE1A 4OCFA 3P90A 1X9WB 3WT1A 2EIOA 3QR6A 4W66A 5GZZB 4WKWA 3UJ1A 5INYA 3GH6A 1QGVA 3WYWA 3E3EA 5CAXA 1EZKA 2LRTA 1F6MC 3RAZA 2VKZG 2OBIA 1V58A 6GSSA 2YJHA 5DAKA 3UVHA 2WGRA 3IC4A 2YWMA 2YWNA 4XRDA 2JSYA 2M80A 5A5HB 3FZ5A 4KH7A 1QQ2A 2X49A 1ZL9A 2H76A 5L71A 4EL1A 1GTBA 2FNOA 1YKCA 2F9SA 3IDVA 4MH3A 5J41A 4G2EA 2IMKA 1Q98A 4WR4A 4K5SA 1FW1A 5J3RA 2FWHA 4NHZA 2GZYA 13GSA 4KNDA 1V40A 3C7MA 1EEMA 5F0GA 4LLRA 4XTSA 2DMLA 1A2MA 4IP6A 4RQXA 4O5QA 4V2LA 2REMA 1H75A 1VF2A 4KA0A 8GSSA 5DVBA 4K0NA 1PD21 3IRAA 4K2XA 1SL1B 3QAWA 1THOA 1YZXA 4BVYB 3RHCA 1I9DA 2H6ZA 4I8BA 4XS4B 3DGQA 5CYYA 4TR0A 5DALB 5DQYA 3GA4A 4HU9A 1LJRA 4ZL9A 1FOVA 1M9AA 3ZIVA 4NAXA 1GH2A 4TR1B 2VLTA 5IMCA 4E8EA 3KMNA 4DVCA 5AIVA 5CP1A 4JU5A 4YQVA 3GRXA 1G7OA 3F6DA 4OWYA 4I97A 2GQLA 2GT5A 1ZYQB 2FUG2 4HUAA 2GZZA 3BBYA 1YVLA 4AJ7A 3MDKA 5ELGA 4ZXGA 2L6CA 1XWGA 2HZEB 3KEBA 2QA1A 2UZ8A 3WD6A 1EOHA 1EP8A 1I5GA 4L0UA 1J08A 1XWKA 5G1KA 1R5AA 2DBCA 1OYJA 2WFCA 4MF7A 2PVQA 1GSDA 4KAEA 3M9KA 4MJAA 3V1WA 6GSUA 1XFLA 5GAND 1JHBA 1TI1A 4USSA 5GSTA 2NVLA 1XCCA 1PKWA 4KW6A 3A2WA 4ZIJA 5JCUA 4KDYA 1SENA 3TKSA 14GSA 1B9XC 1NM3A 2GT6A 2AUVA 4RQRA 1USBA 5G30A 3EINA 4G0IA 1QMVA 22GSA 3I9V2 1V57A 3BCIA 2CT6A 1MD3A 4FH8A 2IMIA 4KSOA 1J0FA 7GSSA 6GSXA 1AXDA 2D2ZA 4MPGA 3C8EA 2YZHA 4G0LA 4PQIA 4HEA2 4WBRD 5DCHA 4PXOA 2GTUA 4HJ2A 4J2FA 4ML6A 2DIYA 1YDKA 2H1LA 3LXTA 2B5YA 3VWUA 2F51A 2O89A 3BJ5A 3U6VA 3IE3A 2GS3A 1PA3A 2LNTA 1GLPA 2YP6A 1G6YA 3IC8A 1ZMAA 2HSNA 3G7JA 2CAIA 3M3MA 2K8VA 3TUEA 3L4NA 1T3BA 3GIXA 4N11A 2ON5A 4I5QA 4HS1A 4QL9A 2RM5A 4O5RA 2IFQB 2JACA 1IYIA 2ON7A 2GZPA 4RI6A 4CY6A 1GSFA 4IQ1A 4X4JA 1JZRA 1TRUA 2FA8A 4E68A 3P8WA 3EPTA 1F2EA 2EFCA 1G0TA 3H8QA 2UV8G 3DVWA 3GURA 2IJYA 1TK8B 5IM9A 3ZFLA 2YV9A 2FGXA 4D73B 1EV9A 1S3AA 2M72A 1BAYA 4HZ2A 3KJYA 4PQHA 4TOPA 3KD0A 3FR9A 5D9XA 5DAKB 5ENUA 2YZUA 1T8EB 2N5BA 3TJGA 5ECRB 3Q6OA 2YCDA 3ZVJA 5KN0A 3IHGA 5G5EA 1FB6A 1YQ1A 5ECIB 1A8YA 1S3DA 1TTZA 3UARA 5CRHA 3GNJA 2HT9A 2OBKA 3PR8A 1SD9A 3G7IA 2LTKA 4AF2A 2VM2A 3ZIJA 4EO3A 1RK4A 4TXVA 4ZB8A 1X5EA 4XS1A 4EKZA 2HSMA 3LW9A 3KH9A 1XBSA 2PWJA 1FVKA 5A1NB 3GFKA 3ERGA 4WXTA 5CRWA 5DJLA 3ZVJD 2I1UA 2R3XA 2VD1A 4MCUA 1O7UA 4MJCA 2DJJA 3UVTA 2N5FA 3QCPA 2DSAA 4ZBBA 2LUSA 2HRNA 1PKZA 4TR3A 2VM1A 3WGXA 2GSQA 2L57A 3QOUA 4ZB7A 3I43A 2WB9A 4G0KA 3C71A 2X99A 1TRSA 1GSEA 4WBJA 1OC8A 1TJDA 4BL7A 3DKSA 3EC3A 1UC7A 3ERWA 1XW5A 2MMOA 4G19A 2H6XA 2J9HA 4WEYA 4K7IA 5J4YA 4K5RA 4MF5A 2KUCA 3GKKA 16GSA 3HJOA 4MZBA 2X64A 4K0GA 2V6KA 5J4UA 2EFDA 2GDRA 3TKRA 5A4VA 2L5LA 2YPMA 2WS2A 1ABAA 1H4OA 4F82A 2RM6A 1GUKA 3D0ZA 3GSSA 2VL2C 4NHWA 3APSA 3F4SA 3ME8A 1WRYA 3M8NA 2XPEA 4FIWA 1DE2A 1MTCA 3ZRDA 4AJ8A 4LA1A 5KOXA 3NIVA 2B5XA 1X0RA 5HR1A 1T1VA 4MH2A 3H79A 1AQWA 3H4KA 4V1Ap 4TVEA 3ZITA 3O3TA 4GQCA 1OKDA 1ZYPA 3HHVA 1A0FA 2LJKA 5F07A 5EL8A 1T00A 3CYNA 2ALBA 4DSRA 1NW2A 4RI7A 1UA5A 2KOKA 3EWLA 4N10A 4J56E 5KN2A 4G9HA 3IR4A 2VCXA 4Z7XA 1LU4A 3DVXA 3VI5A 1RQMA 1Y6EA 3L9UA 1XIYA 1GNWA 4WR5A 3N9JA 1ST9A 2DJKA 1ZYEA 1NHOA 1W4VA 1DE1A 2VL3A 4X1UA 3I6AA 1AQXA 3A2XA 2PN8A 1M2DA 2VLVA 3TOUA 3TDGA 3KCMA 4EUYA 5J47A 4PX1A 3W8JA 3TJBA 3A5WA 1BG1A 3MNGA 5IOWA 4IW9A 1PN0A 2YWOA 2C0GA 2VCZA 3CWGA 2EC4A 1OC3A 4V1Ag 3HVXA 2Z9SA 2X8GA 3C73A 1O81A 2F8AA 1Z6MA 4L5OA 4ZBDA 5E59A 5ID2A 5AN1A 5ECHB 2B7KA 2FY6A 3L0HA 1LBKA 1TXUA 1DUGA 1F37A 1K3YA 3HDCA 3UEMA 4HJMA 2AV4A 4GF0A 1B4PA 2AB6A 2XPDA 5EY6A 3FZAA 2GSTA 6GSTA 3D4TA 3UL3A 1OC9A 1SYXA 3TU3B 2QA2A 3HY2A 1M99A 2CVDA 4IJIA 2EIRA 1GNEA 3ERFA 3GUSA 4Z2RA 4GSSA 2GQKA 4XRAA 1K3LA 4KB3A 2X8HA 1PX7A 1WOUA 2H1GA 3MYDA 4DSSA 1YKAA 3RPNA 2GSRA 4AJ6A 2DIZA 4MLYA 4CHSA 1AUCA 4ZB9A 4PQ1A 1AC1A 4GCIA 1FG4A 1SK2A 1EGRA 5HFKA 1S3CA 3TGZA 5KOWA 2H1BA 4Q5QA 1OVNA 4TRXA 5A4WA 2A2PA 2JADA 2HSMB 2K8SA 1YEPA 2IN3A 1X9MB 4XCSA 5E4WA 1F3BA 2XC2A 2FHEA 2JL4A 4K8MA 2E7PA 3IOSA 2R5GA 3FR3A 4J57E 4DSQA 6GSWA 4KUNA 5ECOB 1PSQA 5JWOB 3TKSC 3FMWA 2DJ1A 5G31A 4F9ZA 4KX4A 2WJUA 1BG5A 4EVMA 4WF5A 3GX8A 1BX9A 2O8VB 4E8HA 3KZQA 1G7EA 4POKA 3GL3A 4HU7A 3EYTA 3LGCA 4BL7B 1Z7RA 1ACVA 1SVOA 3I69A 3PGTA 2R0PA 2V32A 2DC5A 3DD3A 2HLSA 3MAKA 4OD7A 2AYTA 4MJBA 2RLIA 1TKDB 5BMUB 4OMVA 2YOIA 4ID0A 2L4CA 2AAWA 2CZ3A 5LCZA 4FQUA 2PGTA 4NWYA 3EU3A 1JFUA 5HFGA 4IKHA 2CZ2A 5H5SA 4LL1B 2HRKA 4FYUA 2HQTA 4BWQA 4EIPA 3EURA 5COHA 3FZ9A 4IP1A 4HZ4A 2A4HA 4I2TA 5HFIA 2YJ7A 3ZMLA 1MDJA 1GUHA 1HNBA 2MMAA 2RUEA 2C4JA 4L8EA 1K0CA 4TKYA 2NTOA 4MF6A 1XZOA 1CQGA 2A2RA 3UIWA 4N30A 3FYGA 4EE0A 1QUWA 3SWLA 4Z2TA 2WZ9A 5G5FA 4K1FA 2H01A 2JU5A 1A0RP 3C1RA 3CBUA 1A23A 4GSTA 1PQNA 2DKHA 2CVKA 1UVZA 4OFTA 1WPIA 1U6TA 5D9TA 3UAPA 4IVFA 1CQHA 1N2AA 2FWEA 3J7Yb 1MD4A 1EP7A 4OO5A 1AW9A 4WETA 5B8BA 1FO5A 1M0UA 2LQOA 4ILFA 3VFIA 4FYBA 2HFDA 4BPYA 3EMXA 2L4QA 3MWHA 5ECMB 3KIJA 2HNLA 3SBCA 3APQA 3QFAC 5J9BA 1SVLA 2OE1A 1BJXA 2FD3A 1SL2B 1HQOA 4ECCA 4PNGA 1V98A 2H8LA 4IJ3A 4ZL8A 5A34A 2ES7A 3A5IA 4KF9A 2OT3A 1R4WA 1SL0B 1GTUA 3VWXA 1RW1A 1O8XA 1O6JA 3P2AA 2QSIA 2O85A 2VIMA 1DSBA 1YF0A 3LYPA 4FO5A 3RDWA 4EXJA 2P31A 4GRFA 1TU8A 1BF5A 4AKGA 5ID2B 3D4MA 5HR3A 2O5VA 3HZ8A 1TU7A 2FLSA 4NXIA 4ACSA 3KTBA 4P3YB 2P0GA 2PMTA 1TP9A 1K0AA 2CA8A 1ILOA 3HA9A 1WMJA 3KP9A 1HNCA 1GULA 2I81A 3IAM2 4DEJA 4G01A 1Z5YE 1YEXA 3KGKA 1OC9B 5IPHA 1R5PA 2I3YA 2AJQB 17GSA 2K18A 3HZ4A 1U88A 2HZFA 5A5HA 1PRXA 1E6BA 3TRQA 4IHUA 1WJKA 3FY7A 4TN8A 4BVXA 1PN9A 3QAGA 2B7JA 5FHIA 4DSSB 2HI7A 1GSSA 1BYEA 1B9YC 2QKEA 3VPTA 3FR6A 2K6VA 2HSHA 1X9SB 5D9VA 4QL7A 3MSZA 1XOAA 3CTGA 1M2BA 5HR2A 2HSYA 6GSYA 4EIQA 2H0HA 4K7OA 3F4RA 1XPVA 2PU9C 1JZDA 2JSZA 2DJ2A 2ZNMA 1TK5B 4V2MA 3FEUA 4MP4A 1ZOFA 3ZZXA 1Y25A 2PERA 3CSIA 1C72A 3M0FA 3L9VA 2LV3A 2LEGA 1ML6A 3ZLPA 4BVYA 4FYCA 2GVPA 2YANA 5HQPA 1U87A 1A8LA 3GTUA 4RUVA 5IO2A 2DMMA 1SJIA 4AKHA 1O8WA 2YV7A 2TIRA 3D6IA 4POLA 1PMTA 2CV4A 5JCWA 4CW9A 1OAZA 1SKRB 2EFEA 4YAVA 1SJZA 2CVBA 1JLWA 1R7HA 1K0DA 3VK9A 1URMA 2VD0A 3KM6A 3VWWA 5ABRA 4H86A 2NBSA 4MA9A 2C3QA 4NPBA 3U5RE 3RBTA 5JWRB 10GSA 2IMFA 3LYKA 2HE3A 2ZCTA 3F4TA 1AAZA 2WRTA 3GH9A 3CRTA 3S9FA 2VAFA 2A2SA 3EU4A 5KEJA 1M2AA 4XIHA 3IPZA 4GDFA 1GSYA 3GV1A 3DRNA 3ISOA 4CY8A 4CDOA 5IMVA 5DJMA 2LRCA 2IMDA 3F3QA 3E0UA 1GSUA 1FVJA 2O87A 3IV4A 2L5OA 5IMZA 5B8AA 2HRFA 1YF1A 2EFHA 4EC0A 1TRWA 3KMOA 3GYKA 1F3AA 3VI7A 3W8SA 2H1DA 1FAAA 1GP1A 1U3AA 3F8UA 4YQUA 5LNKe 2JZTA 1QK8A 2HYXA 5F06A 3UOMA 3IK9A 5IPGA 4IBPA 1EOGA 4N0ZA 1SK0A 1ERVA 3HJPA 3ZTLA 3EMPA 3L9SA 4PURA 3LFLA 1EWXA 1JLVA 1SJ6A 3KXOA 4KCAA 5A4UA 3RPPA 4N0VA 5IIZA 3Q74A 2H71A 3TCOA 4KSMA 5F8BA 12GSA 2VLUA 4F2IA 1AIUA 1A2JA 5D73A 1WIKA 4F0BA 4Q5FA 5F05A 1KNGA 4G10A 1NSWA 2DKIA 2GSSA 2H73A 3ZL5A 2CX3A 2IWTA 4ZL7A 2OE3A 18GSA 4KDUA 3DWVA 3ZFBA 2F8FA 4OO4A 5A34B 2HSNB 4NMUA 2M46A 2P5RA 1FOHA 4EDYA 1MDIA 5DDLA 3LJRA 1EGOA 1XOBA 1F9MA 3TKPA 4ML1A 2IFQA 4YH2A 2H1AA 3OR5A 4MMMA 2VCVA 1XWBA 1HNAA 3KP8A 2XHFA 1VGLA 1W89A 3F63A 3FW2A 5EPFA 1YY7A 3CSHA 2TRXA 2WULA 3QAVA 3Q18A 4BWSA 3HVSA 3DYRA 2H72A 4K2DA 1Y1UA 2IIYA 2R0CA 1TXXA 2AHEA 4Z2UA 1GL8A 4O5UA 2V6OA 1ERTA 1ZGNA 1M9BA 3IA1A 4D73A 5C00A 4LMWA 2JZRA 1MDKA 3VURA 4I6XA 3D22A 1Z9HA 2I4AA 3G9BA 2QC7A 5CREA 3D21A 1KBNA 3UMAA 1OKTA 3KTLA 2LJAA 5D96A 3LG6A 3ZYWA 4POBA 2KP2A 1GLQA 2MBSA 5CNWA 11GSA 3ME7A 1AQVA 4BVXB 2BMXA 2E2GA 2L6DA 2OADA 3F3RA 4WF4A 1K3OA 2H66A 3GN3A 2E2MA 3TB2A 5HR0A 5A1NA 1TW9A 1B8XA 4GLTA 3DMLA 2QGVA 2B1LA 2R2JA 5CRDA 3HD5A 3GHAA 4HOJA 2H75A 4JR4A 2R0GA 4HQZA 3APOA 3H1NA 4K6XA 2I9HA 3PINA 1JZWA 1B4QA 2MBTA 3HCZA 4HQSA 2C8UA 3GTUB 3QMXA 2DLXA 5KN1A 4IS0A 2YN1A 2OJLA 1VF3A 2H19A 3CTFA 5ECNB 3TJJA 1T7PB 2MYGA 2J23A 2V41A 1KTEA 4KGIA 4GWRA 1VF4A 2IPAA 1XVQA 2K9FA 3JCML 3TOTA 1ON4A 2MZCA 4JRRA 3LWAA 2C0DA 2X8CA 3VWVA 3UBLA 4MABA 1WE0A 2XBIA 1BEDA 3Q19A 3WGDA 2GLRA 2O7KA 5JWQB 4ECIA 4MZCA 3E9JB 4NV5A 3J7Yk 3AY8A 1K0OA 2L59A 2YWIA 4XS6A 5G1LA 4F0CA 2TRCP 2LNSA 2B5EA 1KEBA 4POMA 4V2NA 2F3MA 5D9WA 3TKQA 2DJ0A 3A2VA 3C1SA 3NOFA 1OE8A 3EVIA 4XHMA 2WCIA 4O7HA 3HYPA 5J9CA 4NV2A 9GSSA 3CRUA 3US3A 3RHBA 2FWGA 1OE7A 2RIIA 2WDUA 2KLXA 5BRTA 4GQFA 1V2AA 1YJ6A 5ECPB 3HKRA 3H93A 4TXOA 4BA7A 1B48A 4QQ7A 1ZCPA 4ZILA 1SD8A 2CQ9A 3BCKA 3L78A 2OE0A 1FB0A 2KP1A 5IO0A 1BQ7A 4X43A 2H74A 4IQAA 5ELAA 4AI6A 3P7XA 4LMVA 3PPUA 2PVOC 2CX4A 1N25A 3K8NA 3NZNA 2G0FA 4JR6A 2C0EA 3BD2A 1UN2A 2OA7A 4K7NA 1WP0A 2H0GA 3ZREA 3LXZA 3FK8A 1Q4JA 4YQMA 2LKUA 1Z3EA 2V1MA 4KDXA 1XVWA 2H6YA 1GRXA 5ECQB 4MDCA 2H70A 2V2GA 5IQYA 3R2QA 3TRXA 4AKXB 4K9ZA 3LORA 2OACA 2B3SA 3IXRA 5GAPD 3CXGA 3CSJA 2X4AA 3GKXA 3R3EA 3QFBC 1O73A 1J9BA 2JZSA 2FA4A 2YNXA 2VL9A 1R26A 4MZWA 3KH7A 4MPFA 4MJEA 5H5RA 4GXZA 2DJ3A 4L5LA 4AKIA 4AGSA 4N3ZA 2LQQA 1K0BA 5B7CA 1T4YA 5DBQA 1EEJA 4OFMA 3ZMKA 4YAPA 4IELA 4PUAA 2MMNA 1PX6A 2HXKA 3TKSE 2BTOT 3GKMA 3IK7A 4MNNA 1QXHA 5EVOA 2E0QA 2CAQA 1SK1A 3HVVA 5ECLB 1ZZYA 1GWCA 3UBKA 5AGYA 5CRGA 2C0FA 6GSVA 2C80A 2VCTA 3VPQA 2VOCA 2R37A 3A3TA 3HJMA 5J4VA 5JCGA 4IN0A 5KN3A 3VLNA 5LD0A 1A24A 2FWFA 3QD9A 3QDNA 3IBHA 3LEFA 5ECSA 2PUKC 4F03A 4MK3A 5A5KA 1ERUA 1TK0B 2R6KA 4XS4A 3F0IA 5AISA 5DALA 1SU9A 3TJKA 4TR1A 2GQMA 2C3TA 1U3IA 5J5NA 1EV4A 4EDZA 3ED3A 1O85A 2VCWA 2KHPA 3DEXA 4PNFA 2PPTA 3F6FA 4HI7A 1ERWA 3FZ4A 4L0WA 2H30A 2MMZA 1NHYA 3WGEA 3CMIA 5IMDA 2PBJA 5ECKB 2GGTA 1SKWB 2BJXA 4HDEA 3D5JA 1SKSB 3MIXA 2C3NA 1GSQA 1VF1A 2VCQA 3M1GA 5BMUA 4PUFC 1MEKA 5FWGA 4ICYA 2IL3A 4O92A 2HZEA 4YKFA 4ISDA 4I2UA 2HRAA 1Z7PA 2H0IA 5IMFA 1WWJA 3F9UA 4A5PA 1HYUA 2EIQA 2XBQA 4GSNA 20GSA 4ECJA 1SVMA 3O6TA 1XW6A 2HRKB 2NDOA 1PGTA 1XXUA 1ZYNA 1JZOA 3DXBA 1T4ZA 1VRSD 5IOXA 1XWAA 5J40A 3N5OA 1E2YA 2ZUPA 2OKAA 3PH9A 4KE3A 3HXSA 3FHKA 4TR4A 4QMKA 2A4VA 1TDIA 5IMAA 3DIEA 3W6GA 5G2ZA 5AIXA 3QPMA 1DBYA 1PL1A 1GTAA 5H5QA 2P5QA 4OFNA 1K0MA 5D93A 2VUPA 1TI3A 5DCGA 2B1KA 3M9JA 3HMJG 1XW9A 4Q5RA 1M7TA 3EE2A 2B6MA 5GSSA 3GL5A 4ZB6A 4JEDA 1X5DA 2LRNA 3LSZA 2LS5A 4YKGA 4GTUA 1IYHA 4TXOB 2IMEA 3G7YA 4LL4B 3LQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZQ A;  4Q5N A;  4JBB A;  2LST A;  5C04 A;  4PTS A;  19GS A;  4O32 A;  4EF0 A;  3O76 A;  1TOF A;  4ZBA A;  3GKN A;  4PGT A;  1X5C A;  2G2Q A;  2N5A A;  3BOA A;  1G6W A;  5D8I A;  1N8J A;  4ECB A;  1FHE A;  1HD2 A;  2VL2 A;  1K0N A;  4X0X A;  4KCE A;  3WT2 A;  2LJR A;  1PL2 A;  1XWC A;  2NPB A;  3GX0 A;  4TW5 A;  1A2L A;  1THX A;  2R4V A;  4ULX A;  1GUM A;  2VO4 A;  3IAS 2;  2FCH A;  4IGJ A;  1V9W A;  1SYR A;  2C1Y A;  1GTI A;  4OCE A;  3TRP A;  1TRV A;  5FT3 A;  1Z6N A;  3GST A;  1QFN A;  3FRC A;  5DQS A;  2RUF A;  3TJF A;  5CO3 A;  5B6M A;  3GMF A;  3FKF A;  5B6N A;  3IHQ A;  4JE1 A;  4OCF A;  3P90 A;  1X9W B;  3WT1 A;  2EIO A;  3QR6 A;  5GZZ B;  4WKW A;  3UJ1 A;  5INY A;  3GH6 A;  1QGV A;  3WYW A;  3E3E A;  5CAX A;  1EZK A;  2LRT A;  1F6M C;  3RAZ A;  2OBI A;  1V58 A;  6GSS A;  2YJH A;  5DAK A;  3UVH A;  2WGR A;  3IC4 A;  2YWM A;  2YWN A;  4XRD A;  2JSY A;  2M80 A;  3FZ5 A;  4KH7 A;  1QQ2 A;  1ZL9 A;  2H76 A;  5L71 A;  4EL1 A;  1GTB A;  2FNO A;  1YKC A;  2F9S A;  3IDV A;  4MH3 A;  5J41 A;  4G2E A;  2IMK A;  1Q98 A;  4WR4 A;  1FW1 A;  5J3R A;  2FWH A;  4NHZ A;  2GZY A;  13GS A;  4KND A;  1V40 A;  3C7M A;  1EEM A;  5F0G A;  4LLR A;  4XTS A;  2DML A;  1A2M A;  4IP6 A;  4RQX A;  4V2L A;  2REM A;  1H75 A;  1VF2 A;  4KA0 A;  8GSS A;  5DVB A;  4K0N A;  1PD2 1;  3IRA A;  1SL1 B;  3QAW A;  1THO A;  1YZX A;  4BVY B;  3RHC A;  1I9D A;  2H6Z A;  4I8B A;  4XS4 B;  3DGQ A;  5CYY A;  4TR0 A;  5DAL B;  5DQY A;  3GA4 A;  4HU9 A;  1LJR A;  4ZL9 A;  1FOV A;  1M9A A;  3ZIV A;  4NAX A;  1GH2 A;  4TR1 B;  2VLT A;  5IMC A;  4E8E A;  3KMN A;  4DVC A;  5AIV A;  5CP1 A;  4JU5 A;  4YQV A;  3GRX A;  1G7O A;  3F6D A;  4OWY A;  4I97 A;  2GQL A;  2GT5 A;  1ZYQ B;  2FUG 2;  4HUA A;  2GZZ A;  3BBY A;  4AJ7 A;  3MDK A;  5ELG A;  4ZXG A;  2L6C A;  1XWG A;  2HZE B;  3KEB A;  2UZ8 A;  3WD6 A;  1EOH A;  1EP8 A;  1I5G A;  4L0U A;  1J08 A;  1XWK A;  5G1K A;  1R5A A;  2DBC A;  1OYJ A;  2WFC A;  4MF7 A;  2PVQ A;  1GSD A;  4KAE A;  3M9K A;  4MJA A;  3V1W A;  6GSU A;  1XFL A;  5GAN D;  1JHB A;  1TI1 A;  4USS A;  5GST A;  2NVL A;  1XCC A;  1PKW A;  4KW6 A;  3A2W A;  4ZIJ A;  5JCU A;  4KDY A;  1SEN A;  3TKS A;  14GS A;  1B9X C;  1NM3 A;  2GT6 A;  2AUV A;  4RQR A;  1USB A;  5G30 A;  3EIN A;  4G0I A;  1QMV A;  22GS A;  3I9V 2;  1V57 A;  3BCI A;  2CT6 A;  1MD3 A;  4FH8 A;  2IMI A;  4KSO A;  1J0F A;  7GSS A;  6GSX A;  1AXD A;  2D2Z A;  4MPG A;  3C8E A;  2YZH A;  4G0L A;  4PQI A;  4HEA 2;  4WBR D;  5DCH A;  4PXO A;  2GTU A;  4HJ2 A;  4J2F A;  4ML6 A;  2DIY A;  1YDK A;  3LXT A;  2B5Y A;  3VWU A;  2F51 A;  2O89 A;  3BJ5 A;  3U6V A;  3IE3 A;  2GS3 A;  1PA3 A;  2LNT A;  1GLP A;  2YP6 A;  1G6Y A;  3IC8 A;  1ZMA A;  3G7J A;  2CAI A;  3M3M A;  2K8V A;  3TUE A;  3L4N A;  1T3B A;  3GIX A;  4N11 A;  2ON5 A;  4I5Q A;  4HS1 A;  4QL9 A;  2RM5 A;  4O5R A;  2IFQ B;  2JAC A;  1IYI A;  2ON7 A;  2GZP A;  4RI6 A;  1GSF A;  4IQ1 A;  1JZR A;  1TRU A;  2FA8 A;  3P8W A;  1F2E A;  1G0T A;  3H8Q A;  3DVW A;  3GUR A;  2IJY A;  1TK8 B;  5IM9 A;  3ZFL A;  2YV9 A;  2FGX A;  4D73 B;  1EV9 A;  1S3A A;  2M72 A;  1BAY A;  4HZ2 A;  3KJY A;  4PQH A;  4TOP A;  3KD0 A;  3FR9 A;  5D9X A;  5DAK B;  5ENU A;  2YZU A;  1T8E B;  2N5B A;  3TJG A;  5ECR B;  3Q6O A;  2YCD A;  3ZVJ A;  5KN0 A;  5G5E A;  1FB6 A;  1YQ1 A;  5ECI B;  1A8Y A;  1S3D A;  1TTZ A;  3UAR A;  5CRH A;  3GNJ A;  2HT9 A;  2OBK A;  3PR8 A;  1SD9 A;  3G7I A;  2LTK A;  4AF2 A;  2VM2 A;  3ZIJ A;  4EO3 A;  1RK4 A;  4TXV A;  4ZB8 A;  1X5E A;  4XS1 A;  4EKZ A;  2HSM A;  3KH9 A;  1XBS A;  2PWJ A;  1FVK A;  3GFK A;  3ERG A;  4WXT A;  5CRW A;  5DJL A;  3ZVJ D;  2I1U A;  2R3X A;  2VD1 A;  4MCU A;  1O7U A;  4MJC A;  2DJJ A;  3UVT A;  2N5F A;  3QCP A;  2DSA A;  4ZBB A;  2LUS A;  2HRN A;  1PKZ A;  4TR3 A;  2VM1 A;  3WGX A;  2GSQ A;  2L57 A;  3QOU A;  3I43 A;  2WB9 A;  4G0K A;  3C71 A;  2X99 A;  1TRS A;  1GSE A;  4WBJ A;  1OC8 A;  1TJD A;  4BL7 A;  3DKS A;  3EC3 A;  1UC7 A;  3ERW A;  1XW5 A;  2MMO A;  4G19 A;  2H6X A;  2J9H A;  4WEY A;  4K7I A;  4MF5 A;  2KUC A;  3GKK A;  16GS A;  3HJO A;  4MZB A;  2X64 A;  4K0G A;  2V6K A;  5J4U A;  2GDR A;  3TKR A;  5A4V A;  2L5L A;  2YPM A;  2WS2 A;  1ABA A;  1H4O A;  4F82 A;  2RM6 A;  1GUK A;  3D0Z A;  3GSS A;  2VL2 C;  4NHW A;  3APS A;  3F4S A;  3ME8 A;  1WRY A;  3M8N A;  2XPE A;  4FIW A;  1DE2 A;  1MTC A;  3ZRD A;  4AJ8 A;  4LA1 A;  3NIV A;  2B5X A;  1X0R A;  5HR1 A;  1T1V A;  4MH2 A;  3H79 A;  1AQW A;  3H4K A;  4V1A p;  4TVE A;  3ZIT A;  3O3T A;  4GQC A;  1OKD A;  3HHV A;  1A0F A;  2LJK A;  5F07 A;  5EL8 A;  1T00 A;  3CYN A;  2ALB A;  4DSR A;  1NW2 A;  4RI7 A;  1UA5 A;  2KOK A;  3EWL A;  4N10 A;  4J56 E;  5KN2 A;  4G9H A;  3IR4 A;  2VCX A;  4Z7X A;  1LU4 A;  3DVX A;  3VI5 A;  1RQM A;  1Y6E A;  3L9U A;  1XIY A;  1GNW A;  4WR5 A;  3N9J A;  1ST9 A;  2DJK A;  1ZYE A;  1NHO A;  1W4V A;  1DE1 A;  2VL3 A;  4X1U A;  3I6A A;  1AQX A;  3A2X A;  2PN8 A;  1M2D A;  2VLV A;  3TOU A;  3TDG A;  3KCM A;  4EUY A;  4PX1 A;  3W8J A;  3TJB A;  3A5W A;  3MNG A;  5IOW A;  4IW9 A;  2YWO A;  2C0G A;  2VCZ A;  2EC4 A;  1OC3 A;  4V1A g;  3HVX A;  2Z9S A;  2X8G A;  3C73 A;  1O81 A;  2F8A A;  1Z6M A;  4L5O A;  4ZBD A;  5E59 A;  5ID2 A;  5AN1 A;  5ECH B;  2B7K A;  2FY6 A;  3L0H A;  1LBK A;  1DUG A;  1F37 A;  1K3Y A;  3HDC A;  3UEM A;  4HJM A;  2AV4 A;  4GF0 A;  1B4P A;  2AB6 A;  2XPD A;  5EY6 A;  3FZA A;  2GST A;  6GST A;  3D4T A;  3UL3 A;  1OC9 A;  1SYX A;  3HY2 A;  1M99 A;  2CVD A;  4IJI A;  2EIR A;  1GNE A;  3ERF A;  3GUS A;  4GSS A;  2GQK A;  4XRA A;  1K3L A;  4KB3 A;  2X8H A;  1PX7 A;  1WOU A;  2H1G A;  4DSS A;  1YKA A;  3RPN A;  2GSR A;  4AJ6 A;  2DIZ A;  4MLY A;  4CHS A;  1AUC A;  4ZB9 A;  4PQ1 A;  1AC1 A;  4GCI A;  1FG4 A;  1SK2 A;  1EGR A;  5HFK A;  1S3C A;  3TGZ A;  2H1B A;  4Q5Q A;  1OVN A;  4TRX A;  5A4W A;  2JAD A;  2HSM B;  2K8S A;  1YEP A;  2IN3 A;  1X9M B;  4XCS A;  5E4W A;  1F3B A;  2XC2 A;  2FHE A;  2JL4 A;  4K8M A;  2E7P A;  3IOS A;  2R5G A;  3FR3 A;  4J57 E;  4DSQ A;  6GSW A;  4KUN A;  5ECO B;  1PSQ A;  5JWO B;  3TKS C;  2DJ1 A;  5G31 A;  4F9Z A;  4KX4 A;  2WJU A;  1BG5 A;  4EVM A;  4WF5 A;  3GX8 A;  1BX9 A;  2O8V B;  4E8H A;  3KZQ A;  1G7E A;  4POK A;  3GL3 A;  4HU7 A;  3EYT A;  3LGC A;  4BL7 B;  1Z7R A;  1ACV A;  3I69 A;  3PGT A;  2V32 A;  2DC5 A;  3DD3 A;  2HLS A;  3MAK A;  4OD7 A;  2AYT A;  4MJB A;  2RLI A;  1TKD B;  2YOI A;  4OMV A;  4ID0 A;  2L4C A;  2AAW A;  2CZ3 A;  5LCZ A;  4FQU A;  2PGT A;  4NWY A;  3EU3 A;  1JFU A;  5HFG A;  4IKH A;  2CZ2 A;  5H5S A;  4LL1 B;  2HRK A;  4FYU A;  2HQT A;  4BWQ A;  3EUR A;  5COH A;  3FZ9 A;  4IP1 A;  4HZ4 A;  4I2T A;  5HFI A;  2YJ7 A;  3ZML A;  1MDJ A;  1GUH A;  1HNB A;  2MMA A;  2RUE A;  2C4J A;  4L8E A;  1K0C A;  4TKY A;  2NTO A;  4MF6 A;  1XZO A;  1CQG A;  2A2R A;  3UIW A;  4N30 A;  3FYG A;  4EE0 A;  1QUW A;  3SWL A;  2WZ9 A;  5G5F A;  4K1F A;  2H01 A;  2JU5 A;  1A0R P;  3C1R A;  3CBU A;  1A23 A;  4GST A;  1PQN A;  2CVK A;  1UVZ A;  4OFT A;  1WPI A;  1U6T A;  5D9T A;  3UAP A;  4IVF A;  1CQH A;  1N2A A;  2FWE A;  3J7Y b;  1MD4 A;  1EP7 A;  4OO5 A;  1AW9 A;  4WET A;  5B8B A;  1FO5 A;  1M0U A;  2LQO A;  4ILF A;  3VFI A;  4FYB A;  2HFD A;  4BPY A;  3EMX A;  2L4Q A;  3MWH A;  5ECM B;  3KIJ A;  2HNL A;  3SBC A;  3APQ A;  3QFA C;  5J9B A;  2OE1 A;  1BJX A;  2FD3 A;  1SL2 B;  1HQO A;  4ECC A;  4PNG A;  1V98 A;  2H8L A;  4IJ3 A;  4ZL8 A;  2ES7 A;  4KF9 A;  1R4W A;  1SL0 B;  1GTU A;  3VWX A;  1RW1 A;  1O8X A;  1O6J A;  3P2A A;  2QSI A;  2O85 A;  2VIM A;  1DSB A;  1YF0 A;  3LYP A;  4FO5 A;  3RDW A;  4EXJ A;  2P31 A;  4GRF A;  1TU8 A;  5ID2 B;  3D4M A;  5HR3 A;  3HZ8 A;  1TU7 A;  2FLS A;  4NXI A;  4ACS A;  3KTB A;  4P3Y B;  2P0G A;  2PMT A;  1TP9 A;  1K0A A;  2CA8 A;  1ILO A;  3HA9 A;  1WMJ A;  3KP9 A;  1HNC A;  1GUL A;  2I81 A;  3IAM 2;  4DEJ A;  1Z5Y E;  1YEX A;  3KGK A;  1OC9 B;  5IPH A;  1R5P A;  2I3Y A;  2AJQ B;  17GS A;  2K18 A;  3HZ4 A;  1U88 A;  2HZF A;  1PRX A;  1E6B A;  3TRQ A;  4IHU A;  1WJK A;  3FY7 A;  4TN8 A;  4BVX A;  1PN9 A;  3QAG A;  2B7J A;  5FHI A;  4DSS B;  2HI7 A;  1GSS A;  1BYE A;  1B9Y C;  2QKE A;  3VPT A;  3FR6 A;  2K6V A;  2HSH A;  1X9S B;  5D9V A;  4QL7 A;  3MSZ A;  1XOA A;  3CTG A;  1M2B A;  5HR2 A;  2HSY A;  6GSY A;  2H0H A;  4K7O A;  3F4R A;  1XPV A;  2PU9 C;  1JZD A;  2JSZ A;  2DJ2 A;  2ZNM A;  1TK5 B;  4V2M A;  3FEU A;  4MP4 A;  1ZOF A;  3ZZX A;  1Y25 A;  2PER A;  3CSI A;  1C72 A;  3M0F A;  3L9V A;  2LV3 A;  2LEG A;  1ML6 A;  3ZLP A;  4BVY A;  4FYC A;  2GVP A;  2YAN A;  5HQP A;  1U87 A;  1A8L A;  3GTU A;  4RUV A;  5IO2 A;  2DMM A;  1SJI A;  1O8W A;  2YV7 A;  2TIR A;  3D6I A;  4POL A;  1PMT A;  2CV4 A;  5JCW A;  4CW9 A;  1OAZ A;  1SKR B;  4YAV A;  1SJZ A;  2CVB A;  1JLW A;  1R7H A;  1K0D A;  3VK9 A;  1URM A;  2VD0 A;  3KM6 A;  3VWW A;  5ABR A;  4H86 A;  2NBS A;  4MA9 A;  2C3Q A;  4NPB A;  3U5R E;  3RBT A;  5JWR B;  10GS A;  2IMF A;  3LYK A;  2HE3 A;  2ZCT A;  3F4T A;  1AAZ A;  2WRT A;  3GH9 A;  3CRT A;  3S9F A;  2VAF A;  2A2S A;  3EU4 A;  5KEJ A;  1M2A A;  4XIH A;  3IPZ A;  1GSY A;  3GV1 A;  3DRN A;  3ISO A;  4CDO A;  5IMV A;  5DJM A;  2LRC A;  2IMD A;  3F3Q A;  3E0U A;  1GSU A;  1FVJ A;  2O87 A;  3IV4 A;  2L5O A;  5IMZ A;  5B8A A;  2HRF A;  1YF1 A;  4EC0 A;  1TRW A;  3KMO A;  3GYK A;  1F3A A;  3VI7 A;  3W8S A;  2H1D A;  1FAA A;  1GP1 A;  1U3A A;  3F8U A;  4YQU A;  5LNK e;  2JZT A;  1QK8 A;  2HYX A;  5F06 A;  3UOM A;  3IK9 A;  5IPG A;  4IBP A;  1EOG A;  4N0Z A;  1SK0 A;  1ERV A;  3HJP A;  3ZTL A;  3EMP A;  3L9S A;  4PUR A;  3LFL A;  1EWX A;  1JLV A;  1SJ6 A;  3KXO A;  4KCA A;  5A4U A;  3RPP A;  4N0V A;  5IIZ A;  3Q74 A;  2H71 A;  3TCO A;  4KSM A;  5F8B A;  12GS A;  2VLU A;  4F2I A;  1AIU A;  1A2J A;  5D73 A;  1WIK A;  4F0B A;  4Q5F A;  5F05 A;  1KNG A;  4G10 A;  1NSW A;  2H73 A;  2GSS A;  3ZL5 A;  2CX3 A;  2IWT A;  4ZL7 A;  2OE3 A;  18GS A;  4KDU A;  3DWV A;  3ZFB A;  2F8F A;  4OO4 A;  2HSN B;  4NMU A;  2M46 A;  2P5R A;  4EDY A;  1MDI A;  5DDL A;  3LJR A;  1EGO A;  1XOB A;  1F9M A;  3TKP A;  4ML1 A;  2IFQ A;  4YH2 A;  2H1A A;  3OR5 A;  4MMM A;  2VCV A;  1XWB A;  1HNA A;  3KP8 A;  2XHF A;  1VGL A;  1W89 A;  3F63 A;  3FW2 A;  5EPF A;  1YY7 A;  3CSH A;  2TRX A;  2WUL A;  3QAV A;  3Q18 A;  4BWS A;  3HVS A;  3DYR A;  2H72 A;  4K2D A;  2IIY A;  1TXX A;  2AHE A;  1GL8 A;  2V6O A;  1ERT A;  1ZGN A;  1M9B A;  3IA1 A;  4D73 A;  5C00 A;  4LMW A;  2JZR A;  1MDK A;  3VUR A;  4I6X A;  3D22 A;  1Z9H A;  2I4A A;  3G9B A;  2QC7 A;  5CRE A;  3D21 A;  1KBN A;  3UMA A;  1OKT A;  3KTL A;  2LJA A;  5D96 A;  3LG6 A;  3ZYW A;  4POB A;  2KP2 A;  1GLQ A;  2MBS A;  5CNW A;  11GS A;  3ME7 A;  1AQV A;  4BVX B;  2BMX A;  2E2G A;  2L6D A;  2OAD A;  3F3R A;  4WF4 A;  1K3O A;  2H66 A;  3GN3 A;  2E2M A;  3TB2 A;  5HR0 A;  1TW9 A;  1B8X A;  4GLT A;  3DML A;  2QGV A;  2B1L A;  2R2J A;  5CRD A;  3HD5 A;  3GHA A;  4HOJ A;  2H75 A;  4JR4 A;  4HQZ A;  3APO A;  3H1N A;  4K6X A;  2I9H A;  3PIN A;  1JZW A;  1B4Q A;  2MBT A;  3HCZ A;  4HQS A;  2C8U A;  3GTU B;  3QMX A;  2DLX A;  5KN1 A;  4IS0 A;  2YN1 A;  2OJL A;  1VF3 A;  2H19 A;  3CTF A;  5ECN B;  3TJJ A;  1T7P B;  2MYG A;  2J23 A;  2V41 A;  1KTE A;  4KGI A;  4GWR A;  1VF4 A;  2IPA A;  1XVQ A;  2K9F A;  3JCM L;  3TOT A;  1ON4 A;  2MZC A;  4JRR A;  3LWA A;  2C0D A;  2X8C A;  3VWV A;  3UBL A;  4MAB A;  1WE0 A;  2XBI A;  1BED A;  3Q19 A;  3WGD A;  2GLR A;  2O7K A;  5JWQ B;  4ECI A;  4MZC A;  3E9J B;  4NV5 A;  3J7Y k;  3AY8 A;  1K0O A;  2L59 A;  2YWI A;  4XS6 A;  5G1L A;  4F0C A;  2TRC P;  2LNS A;  2B5E A;  1KEB A;  4POM A;  4V2N A;  2F3M A;  5D9W A;  3TKQ A;  2DJ0 A;  3A2V A;  3C1S A;  3NOF A;  1OE8 A;  3EVI A;  4XHM A;  2WCI A;  4O7H A;  3HYP A;  5J9C A;  4NV2 A;  9GSS A;  3CRU A;  3US3 A;  3RHB A;  2FWG A;  1OE7 A;  2RII A;  2WDU A;  2KLX A;  4GQF A;  1V2A A;  1YJ6 A;  5ECP B;  3HKR A;  3H93 A;  4TXO A;  4BA7 A;  1B48 A;  4QQ7 A;  1ZCP A;  4ZIL A;  1SD8 A;  2CQ9 A;  3BCK A;  3L78 A;  2OE0 A;  1FB0 A;  2KP1 A;  5IO0 A;  1BQ7 A;  4X43 A;  2H74 A;  4IQA A;  5ELA A;  3P7X A;  4LMV A;  3PPU A;  2PVO C;  2CX4 A;  3K8N A;  3NZN A;  2G0F A;  4JR6 A;  2C0E A;  3BD2 A;  1UN2 A;  2OA7 A;  4K7N A;  1WP0 A;  2H0G A;  3ZRE A;  3LXZ A;  3FK8 A;  1Q4J A;  4YQM A;  2LKU A;  1Z3E A;  2V1M A;  4KDX A;  1XVW A;  2H6Y A;  1GRX A;  5ECQ B;  4MDC A;  2H70 A;  2V2G A;  5IQY A;  3R2Q A;  3TRX A;  4K9Z A;  3LOR A;  2OAC A;  2B3S A;  3IXR A;  5GAP D;  3CXG A;  3CSJ A;  3GKX A;  3R3E A;  3QFB C;  1O73 A;  1J9B A;  2JZS A;  2FA4 A;  2YNX A;  2VL9 A;  1R26 A;  4MZW A;  3KH7 A;  4MPF A;  4MJE A;  5H5R A;  4GXZ A;  2DJ3 A;  4L5L A;  4AGS A;  2LQQ A;  1K0B A;  5B7C A;  1T4Y A;  5DBQ A;  1EEJ A;  4OFM A;  3ZMK A;  4YAP A;  4IEL A;  4PUA A;  2MMN A;  1PX6 A;  2HXK A;  3TKS E;  2BTO T;  3GKM A;  3IK7 A;  1QXH A;  5EVO A;  2E0Q A;  2CAQ A;  1SK1 A;  3HVV A;  5ECL B;  1ZZY A;  1GWC A;  3UBK A;  5AGY A;  5CRG A;  2C0F A;  6GSV A;  2C80 A;  2VCT A;  3VPQ A;  2VOC A;  2R37 A;  3A3T A;  3HJM A;  5JCG A;  4IN0 A;  5KN3 A;  3VLN A;  5LD0 A;  1A24 A;  2FWF A;  3QD9 A;  3QDN A;  3IBH A;  3LEF A;  5ECS A;  2PUK C;  4F03 A;  4MK3 A;  5A5K A;  1ERU A;  1TK0 B;  2R6K A;  4XS4 A;  3F0I A;  5AIS A;  5DAL A;  1SU9 A;  3TJK A;  4TR1 A;  2GQM A;  2C3T A;  1U3I A;  5J5N A;  1EV4 A;  4EDZ A;  3ED3 A;  1O85 A;  2VCW A;  2KHP A;  3DEX A;  4PNF A;  2PPT A;  3F6F A;  4HI7 A;  1ERW A;  3FZ4 A;  4L0W A;  2H30 A;  2MMZ A;  1NHY A;  3WGE A;  3CMI A;  5IMD A;  2PBJ A;  5ECK B;  2GGT A;  1SKW B;  2BJX A;  4HDE A;  3D5J A;  1SKS B;  2C3N A;  1GSQ A;  1VF1 A;  2VCQ A;  3M1G A;  5BMU A;  4PUF C;  1MEK A;  5FWG A;  2IL3 A;  4O92 A;  2HZE A;  4I2U A;  4ISD A;  2HRA A;  1Z7P A;  2H0I A;  5IMF A;  1WWJ A;  3F9U A;  1HYU A;  2EIQ A;  2XBQ A;  4GSN A;  20GS A;  4ECJ A;  3O6T A;  1XW6 A;  2HRK B;  2NDO A;  1PGT A;  1XXU A;  1JZO A;  3DXB A;  1T4Z A;  1VRS D;  5IOX A;  1XWA A;  3N5O A;  1E2Y A;  2ZUP A;  2OKA A;  3PH9 A;  4KE3 A;  3HXS A;  3FHK A;  4TR4 A;  2A4V A;  1TDI A;  5IMA A;  3DIE A;  3W6G A;  5G2Z A;  5AIX A;  3QPM A;  1DBY A;  1PL1 A;  1GTA A;  5H5Q A;  2P5Q A;  4OFN A;  1K0M A;  5D93 A;  2VUP A;  1TI3 A;  5DCG A;  2B1K A;  3M9J A;  1XW9 A;  4Q5R A;  1M7T A;  3EE2 A;  2B6M A;  5GSS A;  3GL5 A;  4ZB6 A;  4JED A;  1X5D A;  2LRN A;  3LSZ A;  2LS5 A;  4GTU A;  1IYH A;  4TXO B;  2IME A;  3G7Y A;  4LL4 B;  3LQ7 A; 
#chains in the Genus database with same CATH topology
 4JZQ A;  4Q5N A;  4JBB A;  2LST A;  5C04 A;  4PTS A;  19GS A;  4O32 A;  4EF0 A;  3O76 A;  1TOF A;  4ZBA A;  3GKN A;  4PGT A;  1X5C A;  2G2Q A;  2N5A A;  3BOA A;  1G6W A;  5D8I A;  1N8J A;  4ECB A;  1FHE A;  1HD2 A;  2VL2 A;  1K0N A;  4X0X A;  4KCE A;  3WT2 A;  2LJR A;  1PL2 A;  1XWC A;  2NPB A;  3GX0 A;  4TW5 A;  1A2L A;  1THX A;  2R4V A;  4ULX A;  1GUM A;  2VO4 A;  3IAS 2;  2FCH A;  4IGJ A;  1V9W A;  1SYR A;  2C1Y A;  1GTI A;  4OCE A;  3TRP A;  1TRV A;  5FT3 A;  1Z6N A;  3GST A;  1XG8 A;  1QFN A;  3FRC A;  5DQS A;  2RUF A;  3TJF A;  5CO3 A;  5B6M A;  3GMF A;  3FKF A;  5B6N A;  3IHQ A;  4JE1 A;  4OCF A;  3P90 A;  1X9W B;  3WT1 A;  2EIO A;  3QR6 A;  4W66 A;  5GZZ B;  4WKW A;  3UJ1 A;  5INY A;  3GH6 A;  1QGV A;  3WYW A;  3E3E A;  5CAX A;  1EZK A;  2LRT A;  1F6M C;  2O36 A;  3RAZ A;  2VKZ G;  4PI2 C;  2OBI A;  1V58 A;  6GSS A;  2YJH A;  5DAK A;  3UVH A;  2WGR A;  3IC4 A;  2YWM A;  2YWN A;  4XRD A;  2JSY A;  2M80 A;  5A5H B;  3FZ5 A;  4KH7 A;  1QQ2 A;  2X49 A;  1ZL9 A;  2H76 A;  5L71 A;  4EL1 A;  1GTB A;  2FNO A;  1YKC A;  2F9S A;  3IDV A;  4MH3 A;  5J41 A;  4G2E A;  2IMK A;  2WVY A;  1Q98 A;  4WR4 A;  4K5S A;  1FW1 A;  5J3R A;  4PHZ C;  2FWH A;  4NHZ A;  2GZY A;  13GS A;  4KND A;  1V40 A;  3C7M A;  1EEM A;  5F0G A;  4LLR A;  4XTS A;  2DML A;  1A2M A;  4IP6 A;  4RQX A;  4O5Q A;  4V2L A;  2REM A;  1H75 A;  1VF2 A;  4KA0 A;  8GSS A;  5DVB A;  4K0N A;  1PD2 1;  4BIK A;  3IRA A;  4K2X A;  1SL1 B;  3QAW A;  1THO A;  1YZX A;  4BVY B;  3RHC A;  1I9D A;  2H6Z A;  4I8B A;  4XS4 B;  3DGQ A;  5CYY A;  4TR0 A;  5DAL B;  5DQY A;  3GA4 A;  4HU9 A;  1LJR A;  4ZL9 A;  1FOV A;  1M9A A;  3ZIV A;  4NAX A;  1GH2 A;  4TR1 B;  2VLT A;  5IMC A;  4E8E A;  3KMN A;  4DVC A;  5AIV A;  5CP1 A;  4JU5 A;  4YQV A;  3GRX A;  1G7O A;  3F6D A;  4OWY A;  4I97 A;  2GQL A;  2GT5 A;  1ZYQ B;  2FUG 2;  4HUA A;  2GZZ A;  3BBY A;  1YVL A;  2WVX A;  4AJ7 A;  3MDK A;  5ELG A;  4ZXG A;  2L6C A;  1XWG A;  2HZE B;  3KEB A;  2QA1 A;  2UZ8 A;  3WD6 A;  1EOH A;  1EP8 A;  1I5G A;  4L0U A;  1J08 A;  1XWK A;  5G1K A;  1R5A A;  2DBC A;  1OYJ A;  2WFC A;  4MF7 A;  2PVQ A;  1GSD A;  4KAE A;  3M9K A;  4MJA A;  3V1W A;  6GSU A;  1XFL A;  5GAN D;  1JHB A;  1TI1 A;  4USS A;  5GST A;  2NVL A;  1XCC A;  1PKW A;  4KW6 A;  3A2W A;  4ZIJ A;  5JCU A;  4KDY A;  1SEN A;  3TKS A;  14GS A;  1B9X C;  1NM3 A;  2GT6 A;  2AUV A;  4RQR A;  1USB A;  5G30 A;  3EIN A;  4G0I A;  1QMV A;  22GS A;  3I9V 2;  1V57 A;  3BCI A;  2CT6 A;  1MD3 A;  4FH8 A;  2IMI A;  4KSO A;  1J0F A;  7GSS A;  6GSX A;  1AXD A;  2D2Z A;  4MPG A;  3C8E A;  2YZH A;  4G0L A;  4PQI A;  4HEA 2;  4WBR D;  5DCH A;  4PXO A;  2GTU A;  4HJ2 A;  4J2F A;  4ML6 A;  2DIY A;  1YDK A;  2H1L A;  3LXT A;  2B5Y A;  3VWU A;  2F51 A;  2O89 A;  3BJ5 A;  3U6V A;  3IE3 A;  2GS3 A;  1PA3 A;  2LNT A;  1GLP A;  2YP6 A;  1G6Y A;  3IC8 A;  1ZMA A;  2HSN A;  3G7J A;  2CAI A;  3M3M A;  2K8V A;  3TUE A;  3L4N A;  3GIX A;  1T3B A;  3CHX C;  4N11 A;  2ON5 A;  4I5Q A;  4HS1 A;  4QL9 A;  2RM5 A;  4O5R A;  2IFQ B;  2JAC A;  1IYI A;  2ON7 A;  2GZP A;  4RI6 A;  4CY6 A;  1GSF A;  4IQ1 A;  4X4J A;  1JZR A;  1TRU A;  2FA8 A;  4E68 A;  3P8W A;  3EPT A;  1F2E A;  2EFC A;  1G0T A;  3H8Q A;  2UV8 G;  3DVW A;  3GUR A;  2IJY A;  1TK8 B;  5IM9 A;  3ZFL A;  2YV9 A;  2FGX A;  4D73 B;  1EV9 A;  1S3A A;  2M72 A;  1BAY A;  4HZ2 A;  3KJY A;  4PQH A;  4TOP A;  3KD0 A;  3FR9 A;  5D9X A;  5DAK B;  5ENU A;  2YZU A;  1T8E B;  2N5B A;  3TJG A;  5ECR B;  3Q6O A;  2YCD A;  3ZVJ A;  5KN0 A;  3IHG A;  5G5E A;  1FB6 A;  1YQ1 A;  5ECI B;  1A8Y A;  1S3D A;  1TTZ A;  3UAR A;  5CRH A;  3GNJ A;  2HT9 A;  2OBK A;  3PR8 A;  1SD9 A;  3G7I A;  2LTK A;  4AF2 A;  2VM2 A;  1M3I A;  3ZIJ A;  4EO3 A;  1RK4 A;  4TXV A;  4ZB8 A;  1X5E A;  4XS1 A;  4EKZ A;  2HSM A;  3RGB C;  3LW9 A;  3KH9 A;  1XBS A;  2PWJ A;  1FVK A;  5A1N B;  3GFK A;  3ERG A;  4WXT A;  5CRW A;  5DJL A;  3ZVJ D;  2I1U A;  2R3X A;  2VD1 A;  4MCU A;  1O7U A;  4MJC A;  2DJJ A;  3UVT A;  2N5F A;  2WW3 A;  3QCP A;  2DSA A;  4ZBB A;  2LUS A;  2HRN A;  1PKZ A;  2O3E A;  1S3R A;  4TR3 A;  2VM1 A;  3WGX A;  2GSQ A;  2L57 A;  3QOU A;  4ZB7 A;  3I43 A;  2WB9 A;  4G0K A;  3C71 A;  2X99 A;  1TRS A;  1GSE A;  4WBJ A;  1OC8 A;  1TJD A;  4BL7 A;  3DKS A;  3EC3 A;  1UC7 A;  3ERW A;  1XW5 A;  2MMO A;  4G19 A;  2H6X A;  2J9H A;  4WEY A;  4K7I A;  5J4Y A;  4K5R A;  4MF5 A;  2KUC A;  3GKK A;  16GS A;  3HJO A;  4MZB A;  2X64 A;  4K0G A;  2V6K A;  5J4U A;  2EFD A;  2GDR A;  3TKR A;  5A4V A;  2L5L A;  2YPM A;  2WS2 A;  3CQF A;  1ABA A;  1H4O A;  4F82 A;  2RM6 A;  1GUK A;  3D0Z A;  3GSS A;  2VL2 C;  4NHW A;  3APS A;  3F4S A;  3ME8 A;  2WVX B;  1WRY A;  3M8N A;  2XPE A;  4FIW A;  1DE2 A;  1MTC A;  3ZRD A;  4AJ8 A;  4LA1 A;  5KOX A;  3NIV A;  2B5X A;  1X0R A;  5HR1 A;  1T1V A;  4MH2 A;  3H79 A;  1AQW A;  3H4K A;  4V1A p;  4TVE A;  3ZIT A;  3O3T A;  4GQC A;  1OKD A;  1ZYP A;  3HHV A;  1A0F A;  2LJK A;  5F07 A;  5EL8 A;  1T00 A;  3CYN A;  2ALB A;  4DSR A;  1NW2 A;  4RI7 A;  1UA5 A;  2KOK A;  3EWL A;  4N10 A;  4J56 E;  5KN2 A;  4G9H A;  3IR4 A;  2VCX A;  4Z7X A;  1LU4 A;  3DVX A;  3VI5 A;  1RQM A;  1Y6E A;  3L9U A;  1XIY A;  1GNW A;  4WR5 A;  3N9J A;  1ST9 A;  2DJK A;  1ZYE A;  1NHO A;  1W4V A;  1DE1 A;  2VL3 A;  4X1U A;  3I6A A;  1AQX A;  3A2X A;  2PN8 A;  1M2D A;  2VLV A;  3TOU A;  3TDG A;  3KCM A;  4EUY A;  5J47 A;  4PX1 A;  3W8J A;  3TJB A;  3A5W A;  1BG1 A;  3MNG A;  5IOW A;  4IW9 A;  1PN0 A;  2YWO A;  2C0G A;  2VCZ A;  3CWG A;  2EC4 A;  1OC3 A;  4V1A g;  3HVX A;  2Z9S A;  2X8G A;  3C73 A;  1O81 A;  2F8A A;  1Z6M A;  4L5O A;  4ZBD A;  5E59 A;  5ID2 A;  5AN1 A;  5ECH B;  2B7K A;  2FY6 A;  3L0H A;  1LBK A;  1TXU A;  1DUG A;  1F37 A;  1K3Y A;  3HDC A;  3UEM A;  4HJM A;  2AV4 A;  4GF0 A;  1B4P A;  2AB6 A;  2XPD A;  5EY6 A;  3FZA A;  2GST A;  6GST A;  3D4T A;  3UL3 A;  1OC9 A;  1SYX A;  3TU3 B;  2QA2 A;  3HY2 A;  1M99 A;  2CVD A;  4IJI A;  2EIR A;  1GNE A;  3ERF A;  3GUS A;  4Z2R A;  4GSS A;  2GQK A;  4XRA A;  1K3L A;  4KB3 A;  2X8H A;  1PX7 A;  1WOU A;  2H1G A;  3MYD A;  4DSS A;  1YKA A;  3RPN A;  2GSR A;  4AJ6 A;  2DIZ A;  4MLY A;  4CHS A;  1AUC A;  4ZB9 A;  4PQ1 A;  1AC1 A;  4GCI A;  1FG4 A;  1SK2 A;  1EGR A;  5HFK A;  1S3C A;  3TGZ A;  5KOW A;  2H1B A;  4Q5Q A;  1OVN A;  4TRX A;  5A4W A;  2A2P A;  2JAD A;  2HSM B;  2K8S A;  1YEP A;  2IN3 A;  1X9M B;  4XCS A;  5E4W A;  1F3B A;  2XC2 A;  2FHE A;  2JL4 A;  4K8M A;  2E7P A;  3IOS A;  2R5G A;  4FXY P;  3FR3 A;  4J57 E;  4DSQ A;  6GSW A;  4KUN A;  5ECO B;  1PSQ A;  5JWO B;  3TKS C;  3FMW A;  2DJ1 A;  5G31 A;  4F9Z A;  4KX4 A;  2WJU A;  1BG5 A;  4EVM A;  4WF5 A;  3GX8 A;  1BX9 A;  2O8V B;  4E8H A;  3KZQ A;  1G7E A;  4POK A;  3GL3 A;  4HU7 A;  3EYT A;  3LGC A;  4BL7 B;  1Z7R A;  1ACV A;  1M3J A;  1SVO A;  3I69 A;  3PGT A;  2R0P A;  2V32 A;  2DC5 A;  3DD3 A;  2HLS A;  3MAK A;  4OD7 A;  2AYT A;  4MJB A;  2RLI A;  1TKD B;  5BMU B;  4OMV A;  2YOI A;  4ID0 A;  1PFO A;  2L4C A;  2AAW A;  2CZ3 A;  5LCZ A;  4FQU A;  2PGT A;  4NWY A;  3EU3 A;  1JFU A;  5HFG A;  4IKH A;  2CZ2 A;  5H5S A;  4LL1 B;  2HRK A;  4FYU A;  2HQT A;  4BWQ A;  4EIP A;  3EUR A;  5COH A;  3FZ9 A;  4IP1 A;  4HZ4 A;  2A4H A;  4I2T A;  5HFI A;  2YJ7 A;  3ZML A;  1MDJ A;  1GUH A;  1HNB A;  2MMA A;  2RUE A;  2C4J A;  4L8E A;  1K0C A;  4TKY A;  2NTO A;  4MF6 A;  1XZO A;  1CQG A;  2A2R A;  3UIW A;  4N30 A;  3FYG A;  4EE0 A;  1QUW A;  3SWL A;  4Z2T A;  2WZ9 A;  5G5F A;  4K1F A;  2H01 A;  2JU5 A;  1A0R P;  3C1R A;  3CBU A;  1A23 A;  4GST A;  1PQN A;  2DKH A;  2WVZ A;  2CVK A;  1UVZ A;  4OFT A;  1WPI A;  1U6T A;  5D9T A;  3UAP A;  4IVF A;  1CQH A;  1N2A A;  2FWE A;  3J7Y b;  1MD4 A;  1EP7 A;  4OO5 A;  1AW9 A;  4WET A;  5B8B A;  1FO5 A;  1M0U A;  2LQO A;  4ILF A;  3VFI A;  4FYB A;  2HFD A;  4BPY A;  3EMX A;  2L4Q A;  3MWH A;  5ECM B;  3KIJ A;  2HNL A;  3SBC A;  3APQ A;  3QFA C;  5J9B A;  1SVL A;  2OE1 A;  1BJX A;  2FD3 A;  2WZS A;  1SL2 B;  1HQO A;  4ECC A;  4PNG A;  1V98 A;  2H8L A;  4IJ3 A;  4ZL8 A;  5A34 A;  2ES7 A;  3A5I A;  4KF9 A;  2OT3 A;  1R4W A;  1SL0 B;  1GTU A;  3VWX A;  1RW1 A;  1O8X A;  1O6J A;  3P2A A;  2QSI A;  2O85 A;  2VIM A;  1DSB A;  1YF0 A;  3LYP A;  4FO5 A;  3RDW A;  4EXJ A;  2P31 A;  4GRF A;  1TU8 A;  1BF5 A;  4AKG A;  5ID2 B;  3D4M A;  1S4B P;  5HR3 A;  2O5V A;  3HZ8 A;  1TU7 A;  2FLS A;  4NXI A;  4ACS A;  3KTB A;  4P3Y B;  2P0G A;  2PMT A;  1TP9 A;  1K0A A;  2CA8 A;  1ILO A;  3HA9 A;  1WMJ A;  3KP9 A;  1HNC A;  1GUL A;  2I81 A;  3IAM 2;  4DEJ A;  4G01 A;  1Z5Y E;  1YEX A;  3KGK A;  1OC9 B;  5IPH A;  1R5P A;  2I3Y A;  2AJQ B;  17GS A;  2K18 A;  3HZ4 A;  1U88 A;  2HZF A;  5A5H A;  1PRX A;  1E6B A;  3TRQ A;  4IHU A;  1WJK A;  3FY7 A;  4TN8 A;  4BVX A;  1PN9 A;  3QAG A;  2B7J A;  5FHI A;  4DSS B;  2HI7 A;  1GSS A;  1BYE A;  1B9Y C;  2QKE A;  3VPT A;  3FR6 A;  2K6V A;  2HSH A;  1X9S B;  5D9V A;  4QL7 A;  3MSZ A;  1XOA A;  3CTG A;  1M2B A;  5HR2 A;  2HSY A;  6GSY A;  4EIQ A;  2H0H A;  4K7O A;  2WW1 A;  3F4R A;  1XPV A;  2PU9 C;  1JZD A;  2JSZ A;  2DJ2 A;  2ZNM A;  1TK5 B;  4V2M A;  3FEU A;  4MP4 A;  1ZOF A;  3ZZX A;  1Y25 A;  2PER A;  3CSI A;  1C72 A;  3M0F A;  3L9V A;  2LV3 A;  2LEG A;  1ML6 A;  3ZLP A;  4BVY A;  4FYC A;  2GVP A;  2YAN A;  5HQP A;  1U87 A;  1A8L A;  3GTU A;  4RUV A;  5IO2 A;  2DMM A;  1SJI A;  4AKH A;  1O8W A;  2YV7 A;  2TIR A;  3D6I A;  4POL A;  1PMT A;  2CV4 A;  5JCW A;  4CW9 A;  1OAZ A;  1SKR B;  2EFE A;  4YAV A;  1SJZ A;  2CVB A;  1JLW A;  1R7H A;  1K0D A;  3VK9 A;  1URM A;  2VD0 A;  4PI0 C;  3KM6 A;  3VWW A;  5ABR A;  4H86 A;  2NBS A;  4MA9 A;  2C3Q A;  4NPB A;  3U5R E;  3RBT A;  5JWR B;  10GS A;  2IMF A;  3LYK A;  2HE3 A;  2ZCT A;  3F4T A;  1AAZ A;  2WRT A;  3GH9 A;  3CRT A;  3S9F A;  2VAF A;  2A2S A;  3EU4 A;  5KEJ A;  1M2A A;  4XIH A;  3IPZ A;  4GDF A;  1GSY A;  3GV1 A;  3DRN A;  3ISO A;  4CY8 A;  4CDO A;  5IMV A;  5DJM A;  2LRC A;  2IMD A;  3F3Q A;  3E0U A;  1GSU A;  1FVJ A;  2O87 A;  3IV4 A;  2L5O A;  5IMZ A;  5B8A A;  2HRF A;  1YF1 A;  2EFH A;  4EC0 A;  1TRW A;  3KMO A;  3GYK A;  1F3A A;  3VI7 A;  3W8S A;  2H1D A;  1FAA A;  1GP1 A;  1U3A A;  3F8U A;  4YQU A;  5LNK e;  2JZT A;  1QK8 A;  2HYX A;  5F06 A;  3UOM A;  3IK9 A;  5IPG A;  4IBP A;  1EOG A;  4N0Z A;  1SK0 A;  1ERV A;  3HJP A;  3ZTL A;  3EMP A;  3L9S A;  4PUR A;  3LFL A;  1EWX A;  1JLV A;  1SJ6 A;  3KXO A;  4KCA A;  5A4U A;  3RPP A;  4N0V A;  5IIZ A;  3Q74 A;  2H71 A;  3TCO A;  4KSM A;  5F8B A;  12GS A;  2VLU A;  4F2I A;  1AIU A;  1A2J A;  5D73 A;  1WIK A;  4F0B A;  4Q5F A;  5F05 A;  1KNG A;  4G10 A;  1NSW A;  2DKI A;  2GSS A;  2H73 A;  3ZL5 A;  2CX3 A;  2IWT A;  4ZL7 A;  2OE3 A;  18GS A;  4KDU A;  3DWV A;  3ZFB A;  2F8F A;  4OO4 A;  5A34 B;  2HSN B;  4NMU A;  2M46 A;  1I1I P;  2P5R A;  1FOH A;  4EDY A;  1MDI A;  5DDL A;  3LJR A;  1EGO A;  1XOB A;  1F9M A;  3TKP A;  4ML1 A;  2IFQ A;  4YH2 A;  2H1A A;  3OR5 A;  4MMM A;  2VCV A;  1XWB A;  1HNA A;  3KP8 A;  2XHF A;  1VGL A;  1W89 A;  3F63 A;  3FW2 A;  5EPF A;  1YY7 A;  3CSH A;  2TRX A;  2WUL A;  3QAV A;  3Q18 A;  4BWS A;  3HVS A;  3DYR A;  2H72 A;  4K2D A;  1Y1U A;  2IIY A;  2R0C A;  1TXX A;  2AHE A;  4Z2U A;  1GL8 A;  4O5U A;  2V6O A;  1ERT A;  1ZGN A;  1M9B A;  3IA1 A;  4D73 A;  5C00 A;  4LMW A;  2JZR A;  1MDK A;  3VUR A;  4I6X A;  3D22 A;  1Z9H A;  2I4A A;  3G9B A;  2QC7 A;  5CRE A;  3D21 A;  1KBN A;  3UMA A;  1OKT A;  3KTL A;  2LJA A;  5D96 A;  3LG6 A;  3ZYW A;  4POB A;  2KP2 A;  1GLQ A;  2MBS A;  5CNW A;  11GS A;  3ME7 A;  1AQV A;  4BVX B;  2BMX A;  2E2G A;  2L6D A;  2OAD A;  3F3R A;  4WF4 A;  1K3O A;  2H66 A;  3GN3 A;  2E2M A;  3TB2 A;  5HR0 A;  5A1N A;  1TW9 A;  1B8X A;  4GLT A;  3DML A;  2QGV A;  2B1L A;  3RFR C;  2R2J A;  5CRD A;  3HD5 A;  3GHA A;  4HOJ A;  2H75 A;  4JR4 A;  2R0G A;  4HQZ A;  3APO A;  3H1N A;  4K6X A;  2I9H A;  3PIN A;  1JZW A;  1B4Q A;  2MBT A;  3HCZ A;  4HQS A;  2C8U A;  3GTU B;  3QMX A;  2DLX A;  5KN1 A;  4IS0 A;  2YN1 A;  2OJL A;  1VF3 A;  2H19 A;  3CTF A;  5ECN B;  3TJJ A;  1T7P B;  2MYG A;  2J23 A;  2V41 A;  1KTE A;  4KGI A;  4GWR A;  1VF4 A;  2IPA A;  1XVQ A;  2K9F A;  3JCM L;  3TOT A;  1ON4 A;  2MZC A;  4JRR A;  3LWA A;  2C0D A;  2X8C A;  3VWV A;  3UBL A;  4MAB A;  1WE0 A;  2XBI A;  1BED A;  3Q19 A;  3WGD A;  2GLR A;  2O7K A;  5JWQ B;  4ECI A;  4MZC A;  3E9J B;  4NV5 A;  3J7Y k;  3AY8 A;  1K0O A;  2L59 A;  2YWI A;  4XS6 A;  5G1L A;  4F0C A;  2TRC P;  2LNS A;  2B5E A;  1KEB A;  4POM A;  4V2N A;  2F3M A;  5D9W A;  3TKQ A;  2DJ0 A;  3A2V A;  3C1S A;  3NOF A;  1OE8 A;  3EVI A;  4XHM A;  2WCI A;  4O7H A;  3HYP A;  5J9C A;  4NV2 A;  9GSS A;  3CRU A;  3US3 A;  3RHB A;  2FWG A;  1OE7 A;  2RII A;  2WDU A;  2KLX A;  5BRT A;  4GQF A;  1YEW C;  1V2A A;  1YJ6 A;  5ECP B;  3HVN A;  3HKR A;  3H93 A;  4TXO A;  4BA7 A;  1B48 A;  4QQ7 A;  1ZCP A;  4ZIL A;  1SD8 A;  2CQ9 A;  3BCK A;  3L78 A;  2OE0 A;  1FB0 A;  2KP1 A;  5IO0 A;  1BQ7 A;  4X43 A;  2H74 A;  4IQA A;  5ELA A;  4AI6 A;  3P7X A;  4LMV A;  3PPU A;  2PVO C;  2CX4 A;  1N25 A;  3K8N A;  3NZN A;  2G0F A;  4JR6 A;  2C0E A;  3BD2 A;  1UN2 A;  2OA7 A;  4K7N A;  1WP0 A;  2H0G A;  3ZRE A;  3LXZ A;  3FK8 A;  1Q4J A;  4YQM A;  2LKU A;  1Z3E A;  2V1M A;  4KDX A;  1XVW A;  2H6Y A;  1GRX A;  5ECQ B;  4MDC A;  2H70 A;  2V2G A;  5IQY A;  3R2Q A;  3TRX A;  4AKX B;  4K9Z A;  3LOR A;  2OAC A;  2B3S A;  3IXR A;  5GAP D;  2WW2 A;  3CXG A;  3CSJ A;  2X4A A;  3GKX A;  3R3E A;  3QFB C;  1O73 A;  1J9B A;  2JZS A;  2FA4 A;  2YNX A;  2VL9 A;  1R26 A;  4MZW A;  3KH7 A;  4MPF A;  4MJE A;  5H5R A;  4GXZ A;  2DJ3 A;  4L5L A;  4AKI A;  4AGS A;  4N3Z A;  2LQQ A;  1K0B A;  5B7C A;  1T4Y A;  5DBQ A;  1EEJ A;  4OFM A;  3ZMK A;  4YAP A;  4IEL A;  4PUA A;  2MMN A;  1PX6 A;  2HXK A;  3TKS E;  2BTO T;  3GKM A;  3IK7 A;  4MNN A;  1QXH A;  5EVO A;  2E0Q A;  2CAQ A;  1SK1 A;  3HVV A;  5ECL B;  1ZZY A;  1GWC A;  3UBK A;  5AGY A;  5CRG A;  2C0F A;  6GSV A;  4HSC X;  2C80 A;  2VCT A;  3VPQ A;  2VOC A;  2R37 A;  3A3T A;  3HJM A;  5J4V A;  5JCG A;  4IN0 A;  5KN3 A;  3VLN A;  5LD0 A;  1A24 A;  2FWF A;  3QD9 A;  3QDN A;  3IBH A;  3LEF A;  5ECS A;  2PUK C;  4F03 A;  4MK3 A;  5A5K A;  1ERU A;  1TK0 B;  2R6K A;  4XS4 A;  3F0I A;  5AIS A;  5DAL A;  1SU9 A;  3TJK A;  4TR1 A;  2GQM A;  2C3T A;  1U3I A;  5J5N A;  1EV4 A;  4EDZ A;  3ED3 A;  1O85 A;  2VCW A;  2KHP A;  3DEX A;  4PNF A;  2PPT A;  3F6F A;  4HI7 A;  1ERW A;  3FZ4 A;  4L0W A;  2H30 A;  2MMZ A;  1NHY A;  3WGE A;  3CMI A;  5IMD A;  2PBJ A;  5ECK B;  2GGT A;  1SKW B;  2BJX A;  4HDE A;  3D5J A;  1SKS B;  3MIX A;  2C3N A;  1GSQ A;  1VF1 A;  2VCQ A;  3M1G A;  5BMU A;  4PUF C;  1MEK A;  5FWG A;  4ICY A;  2IL3 A;  4O92 A;  2HZE A;  4YKF A;  4ISD A;  4I2U A;  2HRA A;  1Z7P A;  2H0I A;  5IMF A;  1WWJ A;  3F9U A;  4A5P A;  1HYU A;  2EIQ A;  2XBQ A;  4GSN A;  20GS A;  4ECJ A;  1SVM A;  3O6T A;  1XW6 A;  2HRK B;  2NDO A;  1PGT A;  1XXU A;  1ZYN A;  1JZO A;  3DXB A;  1T4Z A;  1VRS D;  5IOX A;  1XWA A;  5J40 A;  3N5O A;  1E2Y A;  2ZUP A;  2OKA A;  3PH9 A;  4KE3 A;  3HXS A;  3FHK A;  4TR4 A;  4QMK A;  2A4V A;  1TDI A;  5IMA A;  3DIE A;  3W6G A;  5G2Z A;  5AIX A;  3QPM A;  1DBY A;  1PL1 A;  1GTA A;  5H5Q A;  2WW0 A;  2P5Q A;  4OFN A;  1K0M A;  5D93 A;  2VUP A;  1TI3 A;  5DCG A;  2B1K A;  3M9J A;  3HMJ G;  1XW9 A;  4Q5R A;  1M7T A;  3EE2 A;  2B6M A;  5GSS A;  3GL5 A;  4ZB6 A;  4JED A;  1X5D A;  2LRN A;  3LSZ A;  2LS5 A;  4YKG A;  4GTU A;  1IYH A;  4TXO B;  2IME A;  3G7Y A;  4LL4 B;  3LQ7 A; 
#chains in the Genus database with same CATH homology
 4JZQ A;  4Q5N A;  4JBB A;  2LST A;  5C04 A;  4PTS A;  19GS A;  4O32 A;  4EF0 A;  3O76 A;  1TOF A;  4ZBA A;  3GKN A;  4PGT A;  1X5C A;  2G2Q A;  2N5A A;  3BOA A;  1G6W A;  5D8I A;  1N8J A;  4ECB A;  1FHE A;  1HD2 A;  2VL2 A;  1K0N A;  4X0X A;  4KCE A;  3WT2 A;  2LJR A;  1PL2 A;  1XWC A;  2NPB A;  3GX0 A;  4TW5 A;  1A2L A;  1THX A;  2R4V A;  4ULX A;  1GUM A;  2VO4 A;  3IAS 2;  2FCH A;  4IGJ A;  1V9W A;  1SYR A;  2C1Y A;  1GTI A;  4OCE A;  3TRP A;  1TRV A;  5FT3 A;  1Z6N A;  3GST A;  1QFN A;  3FRC A;  5DQS A;  2RUF A;  3TJF A;  5CO3 A;  5B6M A;  3GMF A;  3FKF A;  5B6N A;  3IHQ A;  4JE1 A;  4OCF A;  3P90 A;  1X9W B;  3WT1 A;  2EIO A;  3QR6 A;  4W66 A;  5GZZ B;  4WKW A;  3UJ1 A;  5INY A;  3GH6 A;  1QGV A;  3WYW A;  3E3E A;  5CAX A;  1EZK A;  2LRT A;  1F6M C;  3RAZ A;  2VKZ G;  2OBI A;  1V58 A;  6GSS A;  2YJH A;  5DAK A;  3UVH A;  2WGR A;  3IC4 A;  2YWM A;  2YWN A;  4XRD A;  2JSY A;  2M80 A;  5A5H B;  3FZ5 A;  4KH7 A;  1QQ2 A;  2X49 A;  1ZL9 A;  2H76 A;  5L71 A;  4EL1 A;  1GTB A;  2FNO A;  1YKC A;  2F9S A;  3IDV A;  4MH3 A;  5J41 A;  4G2E A;  2IMK A;  1Q98 A;  4WR4 A;  4K5S A;  1FW1 A;  5J3R A;  2FWH A;  4NHZ A;  2GZY A;  13GS A;  4KND A;  1V40 A;  3C7M A;  1EEM A;  5F0G A;  4LLR A;  4XTS A;  2DML A;  1A2M A;  4IP6 A;  4RQX A;  4O5Q A;  4V2L A;  2REM A;  1H75 A;  1VF2 A;  4KA0 A;  8GSS A;  5DVB A;  4K0N A;  1PD2 1;  3IRA A;  4K2X A;  1SL1 B;  3QAW A;  1THO A;  1YZX A;  4BVY B;  3RHC A;  1I9D A;  2H6Z A;  4I8B A;  4XS4 B;  3DGQ A;  5CYY A;  4TR0 A;  5DAL B;  5DQY A;  3GA4 A;  4HU9 A;  1LJR A;  4ZL9 A;  1FOV A;  1M9A A;  3ZIV A;  4NAX A;  1GH2 A;  4TR1 B;  2VLT A;  5IMC A;  4E8E A;  3KMN A;  4DVC A;  5AIV A;  5CP1 A;  4JU5 A;  4YQV A;  3GRX A;  1G7O A;  3F6D A;  4OWY A;  4I97 A;  2GQL A;  2GT5 A;  1ZYQ B;  2FUG 2;  4HUA A;  2GZZ A;  3BBY A;  1YVL A;  4AJ7 A;  3MDK A;  5ELG A;  4ZXG A;  2L6C A;  1XWG A;  2HZE B;  3KEB A;  2QA1 A;  2UZ8 A;  3WD6 A;  1EOH A;  1EP8 A;  1I5G A;  4L0U A;  1J08 A;  1XWK A;  5G1K A;  1R5A A;  2DBC A;  1OYJ A;  2WFC A;  4MF7 A;  2PVQ A;  1GSD A;  4KAE A;  3M9K A;  4MJA A;  3V1W A;  6GSU A;  1XFL A;  5GAN D;  1JHB A;  1TI1 A;  4USS A;  5GST A;  2NVL A;  1XCC A;  1PKW A;  4KW6 A;  3A2W A;  4ZIJ A;  5JCU A;  4KDY A;  1SEN A;  3TKS A;  14GS A;  1B9X C;  1NM3 A;  2GT6 A;  2AUV A;  4RQR A;  1USB A;  5G30 A;  3EIN A;  4G0I A;  1QMV A;  22GS A;  3I9V 2;  1V57 A;  3BCI A;  2CT6 A;  1MD3 A;  4FH8 A;  2IMI A;  4KSO A;  1J0F A;  7GSS A;  6GSX A;  1AXD A;  2D2Z A;  4MPG A;  3C8E A;  2YZH A;  4G0L A;  4PQI A;  4HEA 2;  4WBR D;  5DCH A;  4PXO A;  2GTU A;  4HJ2 A;  4J2F A;  4ML6 A;  2DIY A;  1YDK A;  2H1L A;  3LXT A;  2B5Y A;  3VWU A;  2F51 A;  2O89 A;  3BJ5 A;  3U6V A;  3IE3 A;  2GS3 A;  1PA3 A;  2LNT A;  1GLP A;  2YP6 A;  1G6Y A;  3IC8 A;  1ZMA A;  2HSN A;  3G7J A;  2CAI A;  3M3M A;  2K8V A;  3TUE A;  3L4N A;  1T3B A;  3GIX A;  4N11 A;  2ON5 A;  4I5Q A;  4HS1 A;  4QL9 A;  2RM5 A;  4O5R A;  2IFQ B;  2JAC A;  1IYI A;  2ON7 A;  2GZP A;  4RI6 A;  4CY6 A;  1GSF A;  4IQ1 A;  4X4J A;  1JZR A;  1TRU A;  2FA8 A;  4E68 A;  3P8W A;  3EPT A;  1F2E A;  2EFC A;  1G0T A;  3H8Q A;  2UV8 G;  3DVW A;  3GUR A;  2IJY A;  1TK8 B;  5IM9 A;  3ZFL A;  2YV9 A;  2FGX A;  4D73 B;  1EV9 A;  1S3A A;  2M72 A;  1BAY A;  4HZ2 A;  3KJY A;  4PQH A;  4TOP A;  3KD0 A;  3FR9 A;  5D9X A;  5DAK B;  5ENU A;  2YZU A;  1T8E B;  2N5B A;  3TJG A;  5ECR B;  3Q6O A;  2YCD A;  3ZVJ A;  5KN0 A;  3IHG A;  5G5E A;  1FB6 A;  1YQ1 A;  5ECI B;  1A8Y A;  1S3D A;  1TTZ A;  3UAR A;  5CRH A;  3GNJ A;  2HT9 A;  2OBK A;  3PR8 A;  1SD9 A;  3G7I A;  2LTK A;  4AF2 A;  2VM2 A;  3ZIJ A;  4EO3 A;  1RK4 A;  4TXV A;  4ZB8 A;  1X5E A;  4XS1 A;  4EKZ A;  2HSM A;  3LW9 A;  3KH9 A;  1XBS A;  2PWJ A;  1FVK A;  5A1N B;  3GFK A;  3ERG A;  4WXT A;  5CRW A;  5DJL A;  3ZVJ D;  2I1U A;  2R3X A;  2VD1 A;  4MCU A;  1O7U A;  4MJC A;  2DJJ A;  3UVT A;  2N5F A;  3QCP A;  2DSA A;  4ZBB A;  2LUS A;  2HRN A;  1PKZ A;  4TR3 A;  2VM1 A;  3WGX A;  2GSQ A;  2L57 A;  3QOU A;  4ZB7 A;  3I43 A;  2WB9 A;  4G0K A;  3C71 A;  2X99 A;  1TRS A;  1GSE A;  4WBJ A;  1OC8 A;  1TJD A;  4BL7 A;  3DKS A;  3EC3 A;  1UC7 A;  3ERW A;  1XW5 A;  2MMO A;  4G19 A;  2H6X A;  2J9H A;  4WEY A;  4K7I A;  5J4Y A;  4K5R A;  4MF5 A;  2KUC A;  3GKK A;  16GS A;  3HJO A;  4MZB A;  2X64 A;  4K0G A;  2V6K A;  5J4U A;  2EFD A;  2GDR A;  3TKR A;  5A4V A;  2L5L A;  2YPM A;  2WS2 A;  1ABA A;  1H4O A;  4F82 A;  2RM6 A;  1GUK A;  3D0Z A;  3GSS A;  2VL2 C;  4NHW A;  3APS A;  3F4S A;  3ME8 A;  1WRY A;  3M8N A;  2XPE A;  4FIW A;  1DE2 A;  1MTC A;  3ZRD A;  4AJ8 A;  4LA1 A;  5KOX A;  3NIV A;  2B5X A;  1X0R A;  5HR1 A;  1T1V A;  4MH2 A;  3H79 A;  1AQW A;  3H4K A;  4V1A p;  4TVE A;  3ZIT A;  3O3T A;  4GQC A;  1OKD A;  1ZYP A;  3HHV A;  1A0F A;  2LJK A;  5F07 A;  5EL8 A;  1T00 A;  3CYN A;  2ALB A;  4DSR A;  1NW2 A;  4RI7 A;  1UA5 A;  2KOK A;  3EWL A;  4N10 A;  4J56 E;  5KN2 A;  4G9H A;  3IR4 A;  2VCX A;  4Z7X A;  1LU4 A;  3DVX A;  3VI5 A;  1RQM A;  1Y6E A;  3L9U A;  1XIY A;  1GNW A;  4WR5 A;  3N9J A;  1ST9 A;  2DJK A;  1ZYE A;  1NHO A;  1W4V A;  1DE1 A;  2VL3 A;  4X1U A;  3I6A A;  1AQX A;  3A2X A;  2PN8 A;  1M2D A;  2VLV A;  3TOU A;  3TDG A;  3KCM A;  4EUY A;  5J47 A;  4PX1 A;  3W8J A;  3TJB A;  3A5W A;  1BG1 A;  3MNG A;  5IOW A;  4IW9 A;  1PN0 A;  2YWO A;  2C0G A;  2VCZ A;  3CWG A;  2EC4 A;  1OC3 A;  4V1A g;  3HVX A;  2Z9S A;  2X8G A;  3C73 A;  1O81 A;  2F8A A;  1Z6M A;  4L5O A;  4ZBD A;  5E59 A;  5ID2 A;  5AN1 A;  5ECH B;  2B7K A;  2FY6 A;  3L0H A;  1LBK A;  1TXU A;  1DUG A;  1F37 A;  1K3Y A;  3HDC A;  3UEM A;  4HJM A;  2AV4 A;  4GF0 A;  1B4P A;  2AB6 A;  2XPD A;  5EY6 A;  3FZA A;  2GST A;  6GST A;  3D4T A;  3UL3 A;  1OC9 A;  1SYX A;  3TU3 B;  2QA2 A;  3HY2 A;  1M99 A;  2CVD A;  4IJI A;  2EIR A;  1GNE A;  3ERF A;  3GUS A;  4Z2R A;  4GSS A;  2GQK A;  4XRA A;  1K3L A;  4KB3 A;  2X8H A;  1PX7 A;  1WOU A;  2H1G A;  3MYD A;  4DSS A;  1YKA A;  3RPN A;  2GSR A;  4AJ6 A;  2DIZ A;  4MLY A;  4CHS A;  1AUC A;  4ZB9 A;  4PQ1 A;  1AC1 A;  4GCI A;  1FG4 A;  1SK2 A;  1EGR A;  5HFK A;  1S3C A;  3TGZ A;  5KOW A;  2H1B A;  4Q5Q A;  1OVN A;  4TRX A;  5A4W A;  2A2P A;  2JAD A;  2HSM B;  2K8S A;  1YEP A;  2IN3 A;  1X9M B;  4XCS A;  5E4W A;  1F3B A;  2XC2 A;  2FHE A;  2JL4 A;  4K8M A;  2E7P A;  3IOS A;  2R5G A;  3FR3 A;  4J57 E;  4DSQ A;  6GSW A;  4KUN A;  5ECO B;  1PSQ A;  5JWO B;  3TKS C;  3FMW A;  2DJ1 A;  5G31 A;  4F9Z A;  4KX4 A;  2WJU A;  1BG5 A;  4EVM A;  4WF5 A;  3GX8 A;  1BX9 A;  2O8V B;  4E8H A;  3KZQ A;  1G7E A;  4POK A;  3GL3 A;  4HU7 A;  3EYT A;  3LGC A;  4BL7 B;  1Z7R A;  1ACV A;  1SVO A;  3I69 A;  3PGT A;  2R0P A;  2V32 A;  2DC5 A;  3DD3 A;  2HLS A;  3MAK A;  4OD7 A;  2AYT A;  4MJB A;  2RLI A;  1TKD B;  5BMU B;  4OMV A;  2YOI A;  4ID0 A;  2L4C A;  2AAW A;  2CZ3 A;  5LCZ A;  4FQU A;  2PGT A;  4NWY A;  3EU3 A;  1JFU A;  5HFG A;  4IKH A;  2CZ2 A;  5H5S A;  4LL1 B;  2HRK A;  4FYU A;  2HQT A;  4BWQ A;  4EIP A;  3EUR A;  5COH A;  3FZ9 A;  4IP1 A;  4HZ4 A;  2A4H A;  4I2T A;  5HFI A;  2YJ7 A;  3ZML A;  1MDJ A;  1GUH A;  1HNB A;  2MMA A;  2RUE A;  2C4J A;  4L8E A;  1K0C A;  4TKY A;  2NTO A;  4MF6 A;  1XZO A;  1CQG A;  2A2R A;  3UIW A;  4N30 A;  3FYG A;  4EE0 A;  1QUW A;  3SWL A;  4Z2T A;  2WZ9 A;  5G5F A;  4K1F A;  2H01 A;  2JU5 A;  1A0R P;  3C1R A;  3CBU A;  1A23 A;  4GST A;  1PQN A;  2DKH A;  2CVK A;  1UVZ A;  4OFT A;  1WPI A;  1U6T A;  5D9T A;  3UAP A;  4IVF A;  1CQH A;  1N2A A;  2FWE A;  3J7Y b;  1MD4 A;  1EP7 A;  4OO5 A;  1AW9 A;  4WET A;  5B8B A;  1FO5 A;  1M0U A;  2LQO A;  4ILF A;  3VFI A;  4FYB A;  2HFD A;  4BPY A;  3EMX A;  2L4Q A;  3MWH A;  5ECM B;  3KIJ A;  2HNL A;  3SBC A;  3APQ A;  3QFA C;  5J9B A;  1SVL A;  2OE1 A;  1BJX A;  2FD3 A;  1SL2 B;  1HQO A;  4ECC A;  4PNG A;  1V98 A;  2H8L A;  4IJ3 A;  4ZL8 A;  5A34 A;  2ES7 A;  3A5I A;  4KF9 A;  2OT3 A;  1R4W A;  1SL0 B;  1GTU A;  3VWX A;  1RW1 A;  1O8X A;  1O6J A;  3P2A A;  2QSI A;  2O85 A;  2VIM A;  1DSB A;  1YF0 A;  3LYP A;  4FO5 A;  3RDW A;  4EXJ A;  2P31 A;  4GRF A;  1TU8 A;  1BF5 A;  4AKG A;  5ID2 B;  3D4M A;  5HR3 A;  2O5V A;  3HZ8 A;  1TU7 A;  2FLS A;  4NXI A;  4ACS A;  3KTB A;  4P3Y B;  2P0G A;  2PMT A;  1TP9 A;  1K0A A;  2CA8 A;  1ILO A;  3HA9 A;  1WMJ A;  3KP9 A;  1HNC A;  1GUL A;  2I81 A;  3IAM 2;  4DEJ A;  4G01 A;  1Z5Y E;  1YEX A;  3KGK A;  1OC9 B;  5IPH A;  1R5P A;  2I3Y A;  2AJQ B;  17GS A;  2K18 A;  3HZ4 A;  1U88 A;  2HZF A;  5A5H A;  1PRX A;  1E6B A;  3TRQ A;  4IHU A;  1WJK A;  3FY7 A;  4TN8 A;  4BVX A;  1PN9 A;  3QAG A;  2B7J A;  5FHI A;  4DSS B;  2HI7 A;  1GSS A;  1BYE A;  1B9Y C;  2QKE A;  3VPT A;  3FR6 A;  2K6V A;  2HSH A;  1X9S B;  5D9V A;  4QL7 A;  3MSZ A;  1XOA A;  3CTG A;  1M2B A;  5HR2 A;  2HSY A;  6GSY A;  4EIQ A;  2H0H A;  4K7O A;  3F4R A;  1XPV A;  2PU9 C;  1JZD A;  2JSZ A;  2DJ2 A;  2ZNM A;  1TK5 B;  4V2M A;  3FEU A;  4MP4 A;  1ZOF A;  3ZZX A;  1Y25 A;  2PER A;  3CSI A;  1C72 A;  3M0F A;  3L9V A;  2LV3 A;  2LEG A;  1ML6 A;  3ZLP A;  4BVY A;  4FYC A;  2GVP A;  2YAN A;  5HQP A;  1U87 A;  1A8L A;  3GTU A;  4RUV A;  5IO2 A;  2DMM A;  1SJI A;  4AKH A;  1O8W A;  2YV7 A;  2TIR A;  3D6I A;  4POL A;  1PMT A;  2CV4 A;  5JCW A;  4CW9 A;  1OAZ A;  1SKR B;  2EFE A;  4YAV A;  1SJZ A;  2CVB A;  1JLW A;  1R7H A;  1K0D A;  3VK9 A;  1URM A;  2VD0 A;  3KM6 A;  3VWW A;  5ABR A;  4H86 A;  2NBS A;  4MA9 A;  2C3Q A;  4NPB A;  3U5R E;  3RBT A;  5JWR B;  10GS A;  2IMF A;  3LYK A;  2HE3 A;  2ZCT A;  3F4T A;  1AAZ A;  2WRT A;  3GH9 A;  3CRT A;  3S9F A;  2VAF A;  2A2S A;  3EU4 A;  5KEJ A;  1M2A A;  4XIH A;  3IPZ A;  4GDF A;  1GSY A;  3GV1 A;  3DRN A;  3ISO A;  4CY8 A;  4CDO A;  5IMV A;  5DJM A;  2LRC A;  2IMD A;  3F3Q A;  3E0U A;  1GSU A;  1FVJ A;  2O87 A;  3IV4 A;  2L5O A;  5IMZ A;  5B8A A;  2HRF A;  1YF1 A;  2EFH A;  4EC0 A;  1TRW A;  3KMO A;  3GYK A;  1F3A A;  3VI7 A;  3W8S A;  2H1D A;  1FAA A;  1GP1 A;  1U3A A;  3F8U A;  4YQU A;  5LNK e;  2JZT A;  1QK8 A;  2HYX A;  5F06 A;  3UOM A;  3IK9 A;  5IPG A;  4IBP A;  1EOG A;  4N0Z A;  1SK0 A;  1ERV A;  3HJP A;  3ZTL A;  3EMP A;  3L9S A;  4PUR A;  3LFL A;  1EWX A;  1JLV A;  1SJ6 A;  3KXO A;  4KCA A;  5A4U A;  3RPP A;  4N0V A;  5IIZ A;  3Q74 A;  2H71 A;  3TCO A;  4KSM A;  5F8B A;  12GS A;  2VLU A;  4F2I A;  1AIU A;  1A2J A;  5D73 A;  1WIK A;  4F0B A;  4Q5F A;  5F05 A;  1KNG A;  4G10 A;  1NSW A;  2DKI A;  2GSS A;  2H73 A;  3ZL5 A;  2CX3 A;  2IWT A;  4ZL7 A;  2OE3 A;  18GS A;  4KDU A;  3DWV A;  3ZFB A;  2F8F A;  4OO4 A;  5A34 B;  2HSN B;  4NMU A;  2M46 A;  2P5R A;  1FOH A;  4EDY A;  1MDI A;  5DDL A;  3LJR A;  1EGO A;  1XOB A;  1F9M A;  3TKP A;  4ML1 A;  2IFQ A;  4YH2 A;  2H1A A;  3OR5 A;  4MMM A;  2VCV A;  1XWB A;  1HNA A;  3KP8 A;  2XHF A;  1VGL A;  1W89 A;  3F63 A;  3FW2 A;  5EPF A;  1YY7 A;  3CSH A;  2TRX A;  2WUL A;  3QAV A;  3Q18 A;  4BWS A;  3HVS A;  3DYR A;  2H72 A;  4K2D A;  1Y1U A;  2IIY A;  2R0C A;  1TXX A;  2AHE A;  4Z2U A;  1GL8 A;  4O5U A;  2V6O A;  1ERT A;  1ZGN A;  1M9B A;  3IA1 A;  4D73 A;  5C00 A;  4LMW A;  2JZR A;  1MDK A;  3VUR A;  4I6X A;  3D22 A;  1Z9H A;  2I4A A;  3G9B A;  2QC7 A;  5CRE A;  3D21 A;  1KBN A;  3UMA A;  1OKT A;  3KTL A;  2LJA A;  5D96 A;  3LG6 A;  3ZYW A;  4POB A;  2KP2 A;  1GLQ A;  2MBS A;  5CNW A;  11GS A;  3ME7 A;  1AQV A;  4BVX B;  2BMX A;  2E2G A;  2L6D A;  2OAD A;  3F3R A;  4WF4 A;  1K3O A;  2H66 A;  3GN3 A;  2E2M A;  3TB2 A;  5HR0 A;  5A1N A;  1TW9 A;  1B8X A;  4GLT A;  3DML A;  2QGV A;  2B1L A;  2R2J A;  5CRD A;  3HD5 A;  3GHA A;  4HOJ A;  2H75 A;  4JR4 A;  2R0G A;  4HQZ A;  3APO A;  3H1N A;  4K6X A;  2I9H A;  3PIN A;  1JZW A;  1B4Q A;  2MBT A;  3HCZ A;  4HQS A;  2C8U A;  3GTU B;  3QMX A;  2DLX A;  5KN1 A;  4IS0 A;  2YN1 A;  2OJL A;  1VF3 A;  2H19 A;  3CTF A;  5ECN B;  3TJJ A;  1T7P B;  2MYG A;  2J23 A;  2V41 A;  1KTE A;  4KGI A;  4GWR A;  1VF4 A;  2IPA A;  1XVQ A;  2K9F A;  3JCM L;  3TOT A;  1ON4 A;  2MZC A;  4JRR A;  3LWA A;  2C0D A;  2X8C A;  3VWV A;  3UBL A;  4MAB A;  1WE0 A;  2XBI A;  1BED A;  3Q19 A;  3WGD A;  2GLR A;  2O7K A;  5JWQ B;  4ECI A;  4MZC A;  3E9J B;  4NV5 A;  3J7Y k;  3AY8 A;  1K0O A;  2L59 A;  2YWI A;  4XS6 A;  5G1L A;  4F0C A;  2TRC P;  2LNS A;  2B5E A;  1KEB A;  4POM A;  4V2N A;  2F3M A;  5D9W A;  3TKQ A;  2DJ0 A;  3A2V A;  3C1S A;  3NOF A;  1OE8 A;  3EVI A;  4XHM A;  2WCI A;  4O7H A;  3HYP A;  5J9C A;  4NV2 A;  9GSS A;  3CRU A;  3US3 A;  3RHB A;  2FWG A;  1OE7 A;  2RII A;  2WDU A;  2KLX A;  5BRT A;  4GQF A;  1V2A A;  1YJ6 A;  5ECP B;  3HKR A;  3H93 A;  4TXO A;  4BA7 A;  1B48 A;  4QQ7 A;  1ZCP A;  4ZIL A;  1SD8 A;  2CQ9 A;  3BCK A;  3L78 A;  2OE0 A;  1FB0 A;  2KP1 A;  5IO0 A;  1BQ7 A;  4X43 A;  2H74 A;  4IQA A;  5ELA A;  4AI6 A;  3P7X A;  4LMV A;  3PPU A;  2PVO C;  2CX4 A;  1N25 A;  3K8N A;  3NZN A;  2G0F A;  4JR6 A;  2C0E A;  3BD2 A;  1UN2 A;  2OA7 A;  4K7N A;  1WP0 A;  2H0G A;  3ZRE A;  3LXZ A;  3FK8 A;  1Q4J A;  4YQM A;  2LKU A;  1Z3E A;  2V1M A;  4KDX A;  1XVW A;  2H6Y A;  1GRX A;  5ECQ B;  4MDC A;  2H70 A;  2V2G A;  5IQY A;  3R2Q A;  3TRX A;  4AKX B;  4K9Z A;  3LOR A;  2OAC A;  2B3S A;  3IXR A;  5GAP D;  3CXG A;  3CSJ A;  2X4A A;  3GKX A;  3R3E A;  3QFB C;  1O73 A;  1J9B A;  2JZS A;  2FA4 A;  2YNX A;  2VL9 A;  1R26 A;  4MZW A;  3KH7 A;  4MPF A;  4MJE A;  5H5R A;  4GXZ A;  2DJ3 A;  4L5L A;  4AKI A;  4AGS A;  4N3Z A;  2LQQ A;  1K0B A;  5B7C A;  1T4Y A;  5DBQ A;  1EEJ A;  4OFM A;  3ZMK A;  4YAP A;  4IEL A;  4PUA A;  2MMN A;  1PX6 A;  2HXK A;  3TKS E;  2BTO T;  3GKM A;  3IK7 A;  4MNN A;  1QXH A;  5EVO A;  2E0Q A;  2CAQ A;  1SK1 A;  3HVV A;  5ECL B;  1ZZY A;  1GWC A;  3UBK A;  5AGY A;  5CRG A;  2C0F A;  6GSV A;  2C80 A;  2VCT A;  3VPQ A;  2VOC A;  2R37 A;  3A3T A;  3HJM A;  5J4V A;  5JCG A;  4IN0 A;  5KN3 A;  3VLN A;  5LD0 A;  1A24 A;  2FWF A;  3QD9 A;  3QDN A;  3IBH A;  3LEF A;  5ECS A;  2PUK C;  4F03 A;  4MK3 A;  5A5K A;  1ERU A;  1TK0 B;  2R6K A;  4XS4 A;  3F0I A;  5AIS A;  5DAL A;  1SU9 A;  3TJK A;  4TR1 A;  2GQM A;  2C3T A;  1U3I A;  5J5N A;  1EV4 A;  4EDZ A;  3ED3 A;  1O85 A;  2VCW A;  2KHP A;  3DEX A;  4PNF A;  2PPT A;  3F6F A;  4HI7 A;  1ERW A;  3FZ4 A;  4L0W A;  2H30 A;  2MMZ A;  1NHY A;  3WGE A;  3CMI A;  5IMD A;  2PBJ A;  5ECK B;  2GGT A;  1SKW B;  2BJX A;  4HDE A;  3D5J A;  1SKS B;  3MIX A;  2C3N A;  1GSQ A;  1VF1 A;  2VCQ A;  3M1G A;  5BMU A;  4PUF C;  1MEK A;  5FWG A;  4ICY A;  2IL3 A;  4O92 A;  2HZE A;  4YKF A;  4ISD A;  4I2U A;  2HRA A;  1Z7P A;  2H0I A;  5IMF A;  1WWJ A;  3F9U A;  4A5P A;  1HYU A;  2EIQ A;  2XBQ A;  4GSN A;  20GS A;  4ECJ A;  1SVM A;  3O6T A;  1XW6 A;  2HRK B;  2NDO A;  1PGT A;  1XXU A;  1ZYN A;  1JZO A;  3DXB A;  1T4Z A;  1VRS D;  5IOX A;  1XWA A;  5J40 A;  3N5O A;  1E2Y A;  2ZUP A;  2OKA A;  3PH9 A;  4KE3 A;  3HXS A;  3FHK A;  4TR4 A;  4QMK A;  2A4V A;  1TDI A;  5IMA A;  3DIE A;  3W6G A;  5G2Z A;  5AIX A;  3QPM A;  1DBY A;  1PL1 A;  1GTA A;  5H5Q A;  2P5Q A;  4OFN A;  1K0M A;  5D93 A;  2VUP A;  1TI3 A;  5DCG A;  2B1K A;  3M9J A;  3HMJ G;  1XW9 A;  4Q5R A;  1M7T A;  3EE2 A;  2B6M A;  5GSS A;  3GL5 A;  4ZB6 A;  4JED A;  1X5D A;  2LRN A;  3LSZ A;  2LS5 A;  4YKG A;  4GTU A;  1IYH A;  4TXO B;  2IME A;  3G7Y A;  4LL4 B;  3LQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...