1GSQA

Three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure, catalytic properties, and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens S-crystallins of cephalopods.
pubmed doi rcsb
source organism Ommastrephes sloani pacificus
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1995-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gsqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gsqA01
2WB9A 3DGQA 2EIQA 1J9BA 4X43A 5A5KA 4V1Ag 1SK1A 4JE1A 3FY7A 3GKKA 4FYCA 4IELA 5FWGA 1PX7A 1PN9A 1V40A 4EC0A 3PGTA 4IP6A 5KEJA 4AGSA 9GSSA 2FWHA 3VLNA 1XPVA 3QPMA 3ZIVA 3VK9A 4F0CA 2JSYA 3HCZA 2YJHA 3L78A 1R5AA 3ZREA 1FB0A 1J08A 1M2AA 2GVPA 1TRWA 2CQ9A 3A2XA 4ZBDA 1GSUA 2WZ9A 4G2EA 3F63A 2JACA 2ALBA 2PU9C 1K0DA 2R4VA 3KEBA 4KDXA 4LL4B 4ZL8A 4ZBAA 5ECMB 2UZ8A 3GV1A 4O7HA 1T4YA 1PQNA 13GSA 2LTKA 4TR1B 2H73A 1WP0A 1G7EA 2IMDA 4GXZA 1PSQA 2KLXA 2X99A 2PPTA 2YV7A 4OD7A 3TRQA 2WFCA 2EIOA 1F9MA 4WR4A 4E8EA 2PERA 3M1GA 1FAAA 1GP1A 4MF5A 1FO5A 3F0IA 1FB6A 2BTOT 2IIYA 2K8SA 6GSUA 2GT6A 1Q4JA 3P90A 2TIRA 2H1BA 2YWIA 4DEJA 2N5AA 2REMA 2G2QA 4BA7A 4CDOA 1U3IA 2DSAA 4K8MA 2LRTA 2A4VA 3EE2A 4FYBA 2GZZA 4JEDA 2I3YA 2MMAA 1AAZA 4JBBA 5A4WA 3PR8A 3TGZA 2P31A 1O6JA 4RQXA 1ABAA 3FR3A 1O85A 5IMCA 4V2MA 2IMFA 2Z9SA 4KCEA 2HZFA 1VRSD 1TK0B 4HQZA 5D96A 2FWGA 3TKQA 5E4WA 1AW9A 3ZMKA 3F4RA 3CTFA 4L8EA 17GSA 3TKSE 3UAPA 2C80A 4ZL9A 3LJRA 4QQ7A 4IKHA 1THXA 3IE3A 1SKWB 3IR4A 2B5YA 2A2RA 3DIEA 1FVJA 5ELAA 3CSJA 1M7TA 3GFKA 4OFNA 3QAWA 4KDUA 3TKSA 3EU4A 3HZ8A 4MZBA 5IMZA 2H0GA 2E2GA 4K0NA 2GQLA 3EC3A 3HKRA 4NWYA 2GSRA 5KN3A 2YPMA 4MZWA 4J56E 3ZVJD 2EC4A 1V98A 1R4WA 4NMUA 3U5RE 3HY2A 5GSSA 2YP6A 3QAGA 4ECJA 3ZIJA 1TDIA 4JU5A 4K7IA 2C0FA 2H72A 1ZCPA 4RI7A 5G2ZA 1OKTA 3H8QA 1BJXA 4J57E 2LJAA 4GSNA 3OR5A 4K7OA 3EYTA 3ME8A 4IN0A 4XS4A 3QMXA 1K0AA 4Q5RA 1S3AA 2RM5A 3IRAA 2HSMA 4ZILA 3UVHA 4XTSA 1BG5A 2VLVA 4XHMA 4KCAA 3IK9A 4IBPA 3Q18A 1RK4A 1PX6A 4FH8A 2VCWA 2RM6A 1VF3A 3RBTA 5HFIA 1EP8A 5AGYA 2V6KA 2L6DA 4ZIJA 4KDYA 4XCSA 5IM9A 4USSA 1XXUA 1TTZA 4EDYA 1DE2A 1N2AA 1QQ2A 2WS2A 1A0RP 4K1FA 4D73B 2GDRA 1UN2A 2ON7A 2M46A 1E2YA 4EUYA 3CYNA 1XZOA 3HYPA 3KXOA 5ABRA 2AB6A 2VLTA 1O8WA 3L9VA 2HZEB 1FVKA 2LQOA 3F6FA 3VWVA 2H71A 2QSIA 3VPQA 2YJ7A 5L71A 5ECPB 2GLRA 3RHBA 2P5RA 2EIRA 2AHEA 3GN3A 2KP2A 4POLA 3L9SA 5DQSA 4NV2A 1XW6A 2CZ3A 3IC4A 3IOSA 5KN0A 2HRNA 3IHQA 5AIVA 1EEJA 4TR3A 3ZTLA 2YZUA 4ML6A 4I6XA 2JZTA 5IMVA 4MA9A 1K0NA 2GSSA 2IL3A 1TOFA 3L4NA 1XW5A 1UA5A 1WE0A 1XWBA 1V57A 2N5BA 1T3BA 5CP1A 1R5PA 3CBUA 4EL1A 2L5LA 5DJLA 3J7Yb 1SENA 2OE0A 1ZYEA 2OADA 4YQVA 1TRUA 2XBQA 4XRAA 4FIWA 4G19A 3D22A 1GTBA 4F2IA 1WWJA 2DMMA 1SKRB 2HRAA 4WF5A 1V58A 1G6WA 1A8LA 1TI1A 1Z5YE 1QFNA 2LUSA 5FT3A 3HA9A 1GNEA 6GSVA 3WGXA 1TXXA 3EMXA 3MSZA 3GH9A 2OA7A 3EU3A 8GSSA 1T7PB 4NAXA 5IPGA 1J0FA 3E0UA 4I97A 2H1GA 1PL2A 2MBSA 5IMAA 5DAKB 2XPEA 3QAVA 4IQ1A 1C72A 2DC5A 2FLSA 1WJKA 5IOXA 1F37A 5H5SA 4WEYA 3ZZXA 3IAM2 5F8BA 2NVLA 4Q5FA 3QOUA 2CAIA 2M80A 1X9SB 1SL0B 4K2DA 1ZL9A 4TR1A 3RDWA 3C1SA 2B1LA 3P8WA 3PPUA 4O5RA 3DKSA 1H4OA 4MPGA 3FKFA 2FGXA 5GZZB 3APQA 2ZUPA 1EV9A 1WMJA 4BVXA 2RUFA 2E0QA 1A24A 4PUAA 1K0MA 5B8AA 1GSEA 3LORA 4GTUA 5D9TA 1PL1A 5HFKA 4XS6A 3O76A 1SU9A 3VFIA 2GQMA 1U6TA 2I1UA 5HR3A 1MDJA 5A4VA 1EEMA 4G0IA 3TOUA 2LKUA 2L5OA 3A3TA 2LS5A 2FHEA 1ILOA 4MJAA 4TOPA 4HZ4A 2VL9A 3HJMA 2MMOA 2VLUA 4N0VA 1M0UA 1GULA 2CVBA 2VL2A 4I2TA 4PQ1A 1DE1A 3ERGA 4ZB9A 4AJ6A 3BJ5A 1B9YC 5LCZA 1S3CA 1OAZA 5IO2A 2I9HA 4IP1A 4G0KA 3FEUA 4GCIA 2YV9A 1DBYA 2YNXA 5A4UA 1NM3A 4LA1A 5JCWA 1NSWA 3C7MA 3D4TA 1SJIA 3GSTA 5DQYA 4BVYB 3H1NA 19GSA 5HR2A 3GH6A 11GSA 3EVIA 4OMVA 3P7XA 3Q6OA 5HR0A 4HI7A 1R26A 1I5GA 1Y6EA 1ST9A 3LSZA 1GH2A 4IGJA 2V2GA 3KM6A 5IPHA 1YJ6A 4F82A 1XFLA 5ID2B 4Z7XA 3W6GA 2OE1A 2C3TA 1AQWA 4LLRA 4WR5A 5F05A 5CREA 1DUGA 3BCIA 4PTSA 5J9CA 1G7OA 5DBQA 2O85A 1JZRA 5LD0A 3GUSA 3DXBA 2PWJA 1IYHA 4GWRA 4HQSA 2IMKA 1Z7PA 5JCGA 4ACSA 2HXKA 4ZXGA 1QGVA 3TJBA 2FY6A 1M9BA 2V32A 1F2EA 2J23A 4QL7A 4N11A 1QMVA 4L0UA 2L4QA 2H70A 1JHBA 4D73A 2HT9A 4MH3A 4KH7A 1QXHA 4BVXB 5LNKe 3BOAA 5D9XA 1B9XC 3WGEA 2O8VB 2LRNA 1XWCA 3M9JA 4MABA 4TXOB 3KP9A 1YKCA 2HZEA 4RI6A 2AV4A 1TRSA 5F06A 1PKWA 1TI3A 3GNJA 1QUWA 3BCKA 3F6DA 2PGTA 1KNGA 4ZBBA 3KP8A 5F0GA 2L57A 2HRKB 1O7UA 4OFMA 1Z3EA 1EOGA 2CX3A 2F9SA 3TJKA 1WOUA 1A2MA 4JRRA 4PGTA 2V6OA 4BPYA 3GIXA 4X1UA 2G0FA 2H1AA 4ILFA 4BL7B 3TCOA 1B4PA 4DSRA 3DYRA 1ML6A 1B48A 2K8VA 4KB3A 4Q5QA 3GMFA 1IYIA 3F4SA 2HSYA 12GSA 4E8HA 3TOTA 1U88A 1XIYA 3F8UA 3RHCA 1AXDA 3GHAA 1ZGNA 3J7Yk 2R5GA 3LXTA 2O7KA 4G10A 3FR9A 5DVBA 2DJ2A 5IO0A 3WYWA 5CO3A 3TDGA 2KP1A 2GSQA 3TRPA 1K3YA 4EKZA 1GLPA 3PINA 2B5EA 3C8EA 2GGTA 4FO5A 4ZL7A 2HSNB 4HS1A 1M2DA 2CVDA 1YDKA 2OJLA 4IJIA 3TJFA 3F9UA 5CRWA 3O3TA 4ID0A 1K0OA 3GA4A 4YQUA 2I4AA 5DAKA 1LBKA 5JWRB 4MDCA 2IMEA 2HI7A 4O32A 1CQGA 3IV4A 2LQQA 5BMUA 2B6MA 2H30A 2NPBA 2QC7A 1O81A 2L6CA 4KW6A 4IQAA 3N5OA 1JLVA 4LL1B 2H76A 2HSHA 2VCXA 1GNWA 1GSYA 3M0FA 2KUCA 3ZITA 5EVOA 2ES7A 3NOFA 3VURA 2ZCTA 2ON5A 2HRFA 2JSZA 3DVXA 5IQYA 1H75A 4DSSB 4KSOA 3E3EA 4GF0A 3H93A 3ERWA 5C04A 3NZNA 2GSTA 1XBSA 4I8BA 3UBKA 4HUAA 5COHA 1BYEA 5G30A 3NIVA 3CXGA 5G5EA 4LMVA 3KTBA 3FW2A 2VM2A 3ZVJA 2PBJA 4AF2A 1GUHA 3KMNA 4I2UA 1TRVA 1VF4A 3FYGA 6GSSA 3BD2A 2YOIA 5G5FA 4HU7A 1VF1A 3GYKA 2E2MA 1JFUA 3IBHA 3UVTA 3D5JA 3IPZA 4MCUA 5H5RA 1X5DA 1UC7A 2C0DA 1AQVA 1PD21 2DBCA 4NHZA 3MWHA 4YAVA 2MYGA 4WF4A 3HVSA 2GT5A 2X8CA 3FK8A 4IVFA 1EV4A 1ZOFA 2I81A 1G6YA 5D9VA 3MDKA 1ERWA 3ED3A 4PURA 3MNGA 2VUPA 1X9WB 1OYJA 3G7IA 5EL8A 1I9DA 2BJXA 3CSHA 3DD3A 2VL3A 5ECQB 4K9ZA 5KN2A 3FZ4A 1YQ1A 1PRXA 1X5CA 5FHIA 1T00A 4ULXA 3KGKA 3VI5A 4RQRA 4K0GA 1Q98A 4TW5A 2HE3A 3UMAA 3DWVA 4BVYA 3CSIA 1SJ6A 5J3RA 2LJRA 2RUEA 22GSA 2J9HA 1EZKA 3FHKA 3R2QA 1AIUA 2CT6A 3GKMA 4OFTA 5DDLA 3BBYA 2DIYA 4JZQA 1GSSA 3F4TA 4IS0A 3L0HA 3CRUA 4AJ8A 3ZFLA 3QDNA 4LMWA 1SJZA 1BAYA 5HQPA 4NXIA 3GKXA 5IOWA 1SK0A 3GSSA 5ID2A 4V1Ap 3RPNA 4ML1A 5CRGA 3VWXA 1YF1A 2X8GA 3D4MA 2MBTA 3QFBC 1GTIA 1Y25A 4TKYA 2NDOA 3IK7A 1KEBA 16GSA 4N30A 1MDKA 1NHYA 1AUCA 3H4KA 1ACVA 2B1KA 4MH2A 2WCIA 2PN8A 1PA3A 4PQHA 4YQMA 1G0TA 3TJJA 2LSTA 3VWWA 4FQUA 4AJ7A 3D0ZA 4PNFA 1ERTA 3KCMA 2LNSA 2YWNA 2DJ3A 3WD6A 7GSSA 2QKEA 2PMTA 1HD2A 1WIKA 2FA4A 2GZYA 3LYPA 1S3DA 1XVQA 1SYRA 3TKPA 4IJ3A 4MMMA 2DIZA 2XHFA 4TXOA 2VCQA 4WETA 5J5NA 2LJKA 1T8EB 3QR6A 2H01A 3KJYA 4PNGA 3O6TA 3GL3A 14GSA 3KIJA 3ME7A 4L0WA 5IMFA 2HRKA 4ISDA 1YEXA 3UOMA 3UBLA 3APSA 1GTAA 4XS1A 1XVWA 4EF0A 3HVXA 1YY7A 4EDZA 2YANA 2VD0A 2BMXA 4TVEA 3EMPA 5DCGA 2E7PA 2H1DA 2H8LA 1A0FA 5G1KA 4ECBA 1A2JA 2R6KA 2KHPA 3M8NA 4MJBA 1GRXA 2OACA 3DVWA 2JZRA 4BL7A 4F0BA 2DJ0A 3HHVA 2WGRA 4HJ2A 3A2VA 5DALB 2AUVA 4I5QA 5HFGA 3VI7A 3I9V2 5CAXA 5E59A 4OWYA 4EXJA 3G7JA 4IHUA 3KH7A 4L5OA 1ZMAA 3TB2A 1VF2A 1F3BA 4MP4A 1FHEA 2AYTA 5AN1A 1DSBA 1R7HA 2KOKA 1EOHA 2P0GA 2K18A 3C1RA 1B8XA 2FA8A 1Z6MA 4KAEA 4ZB6A 2HLSA 2OBKA 4KNDA 1OC9B 4GQFA 4TN8A 1X0RA 4MZCA 2F3MA 2FD3A 3RAZA 1B4QA 2PVQA 1A8YA 2LNTA 1Z6NA 2OKAA 2MZCA 2F8FA 2F8AA 5IMDA 2C3NA 1FW1A 1X5EA 5EPFA 1ERUA 1TJDA 1LJRA 1ZZYA 4KA0A 2R3XA 2CAQA 4TXVA 2V41A 2GS3A 1NHOA 3D21A 3VPTA 5JWQB 3KMOA 3LXZA 5J4UA 3IC8A 4FYUA 5D8IA 4IW9A 2IPAA 3KH9A 2PVOC 3JCML 4EE0A 5J41A 1PKZA 2DJJA 5ECKB 4GSTA 4KUNA 3VWUA 2CV4A 3MAKA 4GRFA 2IFQB 5EY6A 5J9BA 1TP9A 1HYUA 2H6YA 3I69A 2R37A 4DSSA 1SL2B 1XWAA 2K6VA 5CNWA 2ZNMA 1EWXA 1BX9A 1HNCA 3HXSA 6GSWA 2HNLA 4H86A 3TKSC 3FRCA 1N8JA 4TR0A 3GTUB 5D73A 2C1YA 1RW1A 3M9KA 1AQXA 3GL5A 3C73A 3ZL5A 3ZYWA 1V2AA 3A5WA 2FWEA 2H0HA 1XW9A 4G0LA 3D6IA 4WKWA 3W8SA 1WPIA 2FWFA 2VM1A 4KF9A 2YWOA 1PMTA 3QFAC 4V2NA 3ISOA 1OE7A 4KX4A 1TK8B 1O73A 2JADA 3UEMA 2IJYA 1TU7A 4K7NA 4BWSA 2LEGA 3LYKA 1ERVA 2JZSA 4N0ZA 2DMLA 3HDCA 3R3EA 2HFDA 5B7CA 4DVCA 4Q5NA 4PX1A 5GAPD 1Z7RA 5ECOB 5B8BA 4MLYA 2H6XA 4POMA 2H0IA 6GSTA 3HZ4A 1SD8A 2MMZA 2QGVA 3TUEA 2CA8A 3ZRDA 3CRTA 2DLXA 3SBCA 2IMIA 3GURA 4MK3A 3LWAA 2IN3A 3M3MA 3GX0A 2VO4A 2XC2A 4ECCA 20GSA 1Z9HA 4HU9A 1QK8A 3KD0A 2VCVA 1F3AA 4TR4A 3IDVA 4X0XA 2L4CA 4ZB8A 1U3AA 1T1VA 4PXOA 1U87A 5HR1A 5CRHA 1XCCA 3FZ9A 4EO3A 3FZAA 1W89A 3KZQA 2C0GA 5G31A 2H75A 3LQ7A 4GSSA 2VAFA 1XOBA 4NHWA 10GSA 1M99A 4GLTA 3TRXA 2C0EA 3IA1A 5JCUA 1A23A 1YKAA 3DEXA 5JWOB 3LG6A 3HD5A 4V2LA 3N9JA 3U6VA 4WBJA 3DRNA 1TKDB 2XBIA 4OO4A 18GSA 1PGTA 2GTUA 1K0BA 1X9MB 4MPFA 4WXTA 3RPPA 4JR6A 3WGDA 5AISA 4F03A 1SL1B 5ECLB 2YCDA 1GSFA 1JZOA 3ZFBA 1O8XA 1CQHA 2P5QA 3C71A 3EURA 4RUVA 1GSQA 2AAWA 3UL3A 2C8UA 1HNAA 1K0CA 4DSQA 1UVZA 2WDUA 1KTEA 5D9WA 1SKSB 1JLWA 3E9JB 1OE8A 2XPDA 1GSDA 2X64A 3I43A 2B3SA 2YZHA 1LU4A 3US3A 2TRCP 5KN1A 3QD9A 4JR4A 2VOCA 1RQMA 5ECIB 2C3QA 3GX8A 4OO5A 1GTUA 2M72A 1GL8A 4CHSA 2O89A 3F3QA 5DALA 2CVKA 2OBIA 4QL9A 3UJ1A 1K3OA 1OVNA 4BWQA 5CRDA 4K6XA 1V9WA 3L9UA 4TRXA 3W8JA 1ON4A 2L59A 5F07A 3FZ5A 1MD3A 3PH9A 5CYYA 2N5FA 3SWLA 1EGOA 4GQCA 2LV3A 3CTGA 3FR6A 4YAPA 3AY8A 1M2BA 2H6ZA 1FG4A 3TKRA 1OC9A 1SYXA 2D2ZA 1SD9A 1K3LA 2H74A 2RLIA 4J2FA 2LRCA 2F51A 2NBSA 2CZ2A 1YF0A 2FNOA 4NPBA 1GUMA 1FOVA 3HJPA 4MJEA 2VD1A 4WBRD 1F6MC 3UARA 4OCEA 1ZYQB 2B7KA 3P2AA 2V1MA 3IXRA 3S9FA 1JZDA 1YEPA 4KGIA 3H79A 5ECHB 1KBNA 4HJMA 5C00A 3LFLA 5ELGA 1MEKA 3LGCA 2B7JA 4CW9A 5B6MA 3APOA 5H5QA 2IWTA 4XRDA 3CMIA 4XIHA 3ZLPA 2YWMA 4F9ZA 2VCTA 1EGRA 5B6NA 2H19A 2WRTA 2HQTA 4N10A 1TK5B 3QCPA 1M9AA 4MF6A 5ECNB 5AIXA 1OC8A 2FUG2 5ECRB 2VL2C 3WT2A 3WT1A 1TU8A 3GRXA 4HEA2 5ENUA 4POKA 4G9HA 1OC3A 2IFQA 4XS4B 4KSMA 6GSXA 2WJUA 3EINA 4PQIA 1E6BA 2HSMB 1HQOA 2A2SA 2C4JA 1NW2A 2WULA 4MJCA 1GUKA 2AJQB 2MMNA 3I6AA 4EVMA 2NTOA 1BQ7A 2DJKA 2R2JA 2RIIA 3V1WA 3GTUA 1XWKA 2H66A 2YN1A 1MD4A 3F3RA 2K9FA 5INYA 2B5XA 2VIMA 5GAND 3G7YA 3GKNA 2HYXA 1OKDA 1EP7A 3HJOA 1W4VA 1JZWA 2PUKC 1MDIA 1VGLA 1TW9A 3A2WA 5ECSA 5DCHA 1USBA 3K8NA 1GLQA 3KTLA 2VCZA 3Q74A 4HZ2A 1A2LA 1THOA 5GSTA 1YZXA 3Q19A 2TRXA 3G9BA 4KE3A 4ECIA 4NV5A 4MF7A 1T4ZA 3UIWA 3ERFA 2GQKA 3IAS2 1URMA 4O92A 2DJ1A 4PUFC 3EWLA 4L5LA 2OE3A 6GSYA 2CX4A 5IIZA 1GWCA 4HDEA 1SK2A 2FCHA 2GZPA 2JL4A 1BEDA 3ZMLA 4HOJA 3LEFA 5G1LA 3TJGA 2JU5A 1XOAA 4OCFA 4POBA 1HNBA 1MTCA 2X8HA 5DJMA 4P3YB 3HVVA 1WRYA 3DMLA 2O87A 4YH2A 5D93A 1AC1A 1XWGA
chains in the Genus database with same CATH superfamily
2WB9A 3DGQA 2EIQA 1J9BA 4X43A 5A5KA 4V1Ag 1SK1A 4JE1A 3FY7A 3GKKA 4FYCA 4IELA 5FWGA 1PX7A 1PN9A 1V40A 4EC0A 3PGTA 4IP6A 5KEJA 4AGSA 9GSSA 2FWHA 3VLNA 1XPVA 3QPMA 3ZIVA 3VK9A 4F0CA 2JSYA 3HCZA 2YJHA 3L78A 1R5AA 3ZREA 1FB0A 1J08A 1M2AA 2GVPA 1TRWA 2CQ9A 3A2XA 4ZBDA 1GSUA 2WZ9A 4G2EA 3F63A 2JACA 2ALBA 2PU9C 1K0DA 2R4VA 3KEBA 4KDXA 4LL4B 4ZL8A 4ZBAA 5ECMB 2UZ8A 3GV1A 4O7HA 1T4YA 1YVLA 13GSA 1PQNA 2LTKA 2WVZA 4TR1B 2H73A 1WP0A 1G7EA 2IMDA 4GXZA 1PSQA 2KLXA 2X99A 5A1NA 4PI0C 2PPTA 2YV7A 4OD7A 3TRQA 2WFCA 2EIOA 1F9MA 4WR4A 4E8EA 2PERA 3M1GA 1FAAA 1GP1A 4MF5A 1FO5A 3F0IA 1FB6A 2BTOT 2IIYA 2K8SA 6GSUA 2GT6A 1Q4JA 3P90A 2TIRA 2H1BA 2YWIA 4DEJA 5A34B 2N5AA 2REMA 2G2QA 4BA7A 4CDOA 1U3IA 2DSAA 4K8MA 2LRTA 2A4VA 3EE2A 4FYBA 2GZZA 4JEDA 2I3YA 2MMAA 1AAZA 4JBBA 5A4WA 3PR8A 3TGZA 2P31A 1O6JA 4RQXA 1ABAA 3FR3A 1O85A 2VKZG 5IMCA 4V2MA 2IMFA 2Z9SA 4KCEA 2HZFA 1VRSD 1TK0B 4HQZA 5D96A 2FWGA 3TKQA 5E4WA 1AW9A 3ZMKA 1S3RA 3F4RA 3CTFA 1PN0A 4L8EA 17GSA 3TKSE 3UAPA 2C80A 4ZL9A 3LJRA 4QQ7A 4IKHA 1THXA 3IE3A 1SKWB 3IR4A 2B5YA 2A2RA 4PHZC 1FVJA 3DIEA 5ELAA 3CSJA 1M7TA 4N3ZA 3GFKA 4OFNA 3QAWA 4KDUA 3TKSA 3EU4A 3HZ8A 4MZBA 5IMZA 2H0GA 2E2GA 4K0NA 2GQLA 3EC3A 3HKRA 4NWYA 2GSRA 5KN3A 2DKIA 2YPMA 4MZWA 4J56E 3ZVJD 2EC4A 1V98A 1R4WA 4NMUA 3U5RE 3HY2A 5GSSA 2YP6A 3QAGA 4ECJA 3ZIJA 1TDIA 4JU5A 4K7IA 2C0FA 2H72A 1ZCPA 4RI7A 5G2ZA 1OKTA 3H8QA 1BJXA 4J57E 2LJAA 4GSNA 3OR5A 4K7OA 3EYTA 3ME8A 4IN0A 4XS4A 3QMXA 1K0AA 1PFOA 4Q5RA 1S3AA 2RM5A 3IRAA 2HSMA 4ZILA 3UVHA 4XTSA 1BG5A 2VLVA 4XHMA 4KCAA 3IK9A 4IBPA 3Q18A 4G01A 1RK4A 1PX6A 4FH8A 2VCWA 2RM6A 1VF3A 3RBTA 5HFIA 1EP8A 5AGYA 2V6KA 2L6DA 4ZIJA 4KDYA 4XCSA 5IM9A 4USSA 1XXUA 1TTZA 4EDYA 1DE2A 1N2AA 1QQ2A 2WS2A 1A0RP 4K1FA 4D73B 2GDRA 1UN2A 2ON7A 2M46A 1E2YA 2R0GA 4EUYA 3CYNA 1XZOA 3HYPA 3KXOA 5ABRA 2AB6A 2VLTA 1O8WA 5A5HA 3L9VA 2HZEB 1FVKA 2LQOA 3F6FA 3VWVA 2H71A 2QSIA 3VPQA 2YJ7A 5L71A 5ECPB 2GLRA 3CQFA 3RHBA 2P5RA 2EIRA 2AHEA 3GN3A 2KP2A 4POLA 3L9SA 5DQSA 4NV2A 1XW6A 2CZ3A 3IC4A 3IOSA 5KN0A 2HRNA 3IHQA 5AIVA 1EEJA 4TR3A 3ZTLA 2YZUA 4ML6A 4I6XA 2JZTA 5IMVA 4MA9A 2EFEA 1K0NA 2GSSA 2IL3A 1TOFA 3L4NA 1XW5A 1UA5A 1WE0A 1XWBA 1V57A 2N5BA 1T3BA 5CP1A 1R5PA 3CBUA 4EL1A 2X49A 2L5LA 5DJLA 3J7Yb 1SVLA 4ICYA 1SENA 2OE0A 1ZYEA 2OADA 4YQVA 1TRUA 2XBQA 4XRAA 4FIWA 4G19A 3D22A 1GTBA 4F2IA 1WWJA 2DMMA 1SKRB 2HRAA 4WF5A 1V58A 1G6WA 4YKFA 1A8LA 1TI1A 1Z5YE 1QFNA 2LUSA 5FT3A 3HA9A 3HVNA 1GNEA 6GSVA 3WGXA 1TXXA 3EMXA 3MSZA 4PI2C 3GH9A 2OA7A 3EU3A 8GSSA 1T7PB 4NAXA 5IPGA 1J0FA 3E0UA 4I97A 2H1GA 1PL2A 2MBSA 3MIXA 5IMAA 5DAKB 2WZSA 2XPEA 3QAVA 4IQ1A 1C72A 2DC5A 2FLSA 1WJKA 5IOXA 1F37A 5H5SA 4WEYA 5BMUB 3ZZXA 3IAM2 5F8BA 2NVLA 4Q5FA 3QOUA 2CAIA 2M80A 1X9SB 1SL0B 4K2DA 1ZL9A 4TR1A 4CY8A 3RDWA 3C1SA 2B1LA 3P8WA 3PPUA 4O5RA 3DKSA 1H4OA 4MPGA 3FKFA 2FGXA 5GZZB 3APQA 2O3EA 2ZUPA 1EV9A 1FOHA 1WMJA 4BVXA 2RUFA 2E0QA 1A24A 4PUAA 1K0MA 5B8AA 1GSEA 1I1IP 5A34A 4GTUA 5D9TA 3LORA 1PL1A 5HFKA 4XS6A 3O76A 1SU9A 3VFIA 2GQMA 1U6TA 5A5HB 2I1UA 5HR3A 4AKIA 1MDJA 5A4VA 1EEMA 4G0IA 3TOUA 4BIKA 2LKUA 2L5OA 3A3TA 2WW0A 1YEWC 2LS5A 2FHEA 1ILOA 4MJAA 4TOPA 4HZ4A 2VL9A 3HJMA 2MMOA 2VLUA 4N0VA 1M0UA 1GULA 2CVBA 2VL2A 4I2TA 4PQ1A 1DE1A 3ERGA 4ZB9A 4AJ6A 3BJ5A 1B9YC 5LCZA 1S3CA 1OAZA 5IO2A 2I9HA 4IP1A 4G0KA 3FEUA 4GCIA 2YV9A 1DBYA 2YNXA 5A4UA 1NM3A 4LA1A 5JCWA 2EFCA 1NSWA 3C7MA 3D4TA 1SJIA 3GSTA 5DQYA 4BVYB 3H1NA 19GSA 2HSNA 5HR2A 3GH6A 11GSA 3EVIA 4OMVA 3P7XA 3Q6OA 5HR0A 4HI7A 1R26A 1I5GA 1Y6EA 1ST9A 1TXUA 3LSZA 1GH2A 4IGJA 2V2GA 3KM6A 2QA1A 5IPHA 1YJ6A 4F82A 1XFLA 5ID2B 4Z7XA 3W6GA 2OE1A 2C3TA 1AQWA 4LLRA 4WR5A 5F05A 5CREA 1DUGA 3BCIA 4PTSA 5J9CA 1G7OA 5DBQA 2O85A 1JZRA 5LD0A 3GUSA 3DXBA 2PWJA 1IYHA 4O5QA 4GWRA 4HQSA 2IMKA 1Z7PA 5JCGA 4ACSA 2HXKA 4ZXGA 1QGVA 3TJBA 2FY6A 4Z2RA 1M9BA 2V32A 1F2EA 2J23A 4QL7A 1S4BP 4N11A 1QMVA 4L0UA 2L4QA 2H70A 1JHBA 4D73A 2HT9A 4MH3A 4KH7A 1SVOA 1QXHA 4BVXB 5LNKe 3BOAA 5D9XA 1B9XC 2UV8G 3WGEA 2O8VB 2LRNA 1XWCA 3M9JA 3TU3B 4MABA 4TXOB 3KP9A 1YKCA 2HZEA 4RI6A 2AV4A 1TRSA 2WW2A 5F06A 1PKWA 1TI3A 3GNJA 1QUWA 3BCKA 4GDFA 3F6DA 2PGTA 1KNGA 4ZBBA 3KP8A 5F0GA 2L57A 2HRKB 1O7UA 4OFMA 1Z3EA 1EOGA 2CX3A 5KOXA 2F9SA 3TJKA 1WOUA 1A2MA 1SVMA 4JRRA 4PGTA 2V6OA 4BPYA 3GIXA 4X1UA 2G0FA 2H1AA 4ILFA 4BL7B 3TCOA 1B4PA 4DSRA 3DYRA 1ML6A 1B48A 2K8VA 4KB3A 4Q5QA 3GMFA 1IYIA 4AKGA 3F4SA 2HSYA 12GSA 4E8HA 3TOTA 1U88A 1XIYA 3F8UA 3RHCA 1AXDA 3GHAA 1ZGNA 3J7Yk 2R5GA 3LXTA 2O7KA 4G10A 3FR9A 4K2XA 5DVBA 2DJ2A 5IO0A 3WYWA 5CO3A 3TDGA 2KP1A 2GSQA 3TRPA 1K3YA 2H1LA 4EKZA 1GLPA 3PINA 2B5EA 3C8EA 4AKXB 2GGTA 4FO5A 4ZL7A 2HSNB 4HS1A 1M2DA 2CVDA 1YDKA 2OJLA 4IJIA 3TJFA 3F9UA 5CRWA 3O3TA 4ID0A 1K0OA 4YKGA 3GA4A 4YQUA 2I4AA 5DAKA 1LBKA 5JWRB 4MDCA 2IMEA 2HI7A 4O32A 1CQGA 3IV4A 2LQQA 5BMUA 2B6MA 2H30A 2NPBA 2QC7A 1O81A 2L6CA 4KW6A 4IQAA 3N5OA 1JLVA 4LL1B 2H76A 2HSHA 2VCXA 1GNWA 1GSYA 2DKHA 3M0FA 1ZYNA 2KUCA 3ZITA 5EVOA 2ES7A 3NOFA 3VURA 2ZCTA 2ON5A 2HRFA 2JSZA 3DVXA 5IQYA 1H75A 4DSSB 4KSOA 3E3EA 4GF0A 3H93A 3ERWA 5C04A 3NZNA 2GSTA 1XBSA 4I8BA 4MNNA 3UBKA 4HUAA 1ZYPA 5COHA 1BYEA 5G30A 3NIVA 3CXGA 5G5EA 4LMVA 3KTBA 3FW2A 2VM2A 3ZVJA 2PBJA 4AF2A 1GUHA 3KMNA 4I2UA 1TRVA 1VF4A 3FYGA 6GSSA 3BD2A 2YOIA 4FXYP 5G5FA 4HU7A 1VF1A 3GYKA 2E2MA 1JFUA 3IBHA 3UVTA 3D5JA 3IPZA 4MCUA 5H5RA 1X5DA 1UC7A 2C0DA 1AQVA 1PD21 2DBCA 3MYDA 4NHZA 3MWHA 4YAVA 2MYGA 4WF4A 5J40A 3HVSA 2GT5A 2X8CA 3FK8A 4IVFA 1EV4A 1ZOFA 2I81A 1G6YA 5D9VA 3MDKA 1ERWA 3ED3A 4PURA 3HMJG 2VUPA 3MNGA 1X9WB 1OYJA 3G7IA 5EL8A 1I9DA 2BJXA 3CSHA 2WVYA 3DD3A 2VL3A 5ECQB 4K9ZA 5KN2A 3FZ4A 1YQ1A 1PRXA 1X5CA 5FHIA 1T00A 4ULXA 3KGKA 3VI5A 4RQRA 4K0GA 1Q98A 4TW5A 2HE3A 3UMAA 3DWVA 4BVYA 3CSIA 1SJ6A 5J3RA 1BG1A 2LJRA 2RUEA 22GSA 2J9HA 1EZKA 3FHKA 3R2QA 1AIUA 2CT6A 2X4AA 3GKMA 4OFTA 5DDLA 3BBYA 2DIYA 2A4HA 4JZQA 1GSSA 3F4TA 4IS0A 3L0HA 3CRUA 4AJ8A 3ZFLA 3QDNA 4LMWA 1SJZA 3LW9A 1BAYA 5HQPA 4NXIA 3GKXA 5IOWA 1SK0A 3GSSA 5ID2A 4V1Ap 3RPNA 4ML1A 5CRGA 3VWXA 1YF1A 2X8GA 3D4MA 2MBTA 3QFBC 4X4JA 5BRTA 1GTIA 1Y25A 4TKYA 2NDOA 3IK7A 1KEBA 16GSA 4N30A 1MDKA 3FMWA 1NHYA 1AUCA 3H4KA 1ACVA 2B1KA 4MH2A 2WCIA 2PN8A 1PA3A 4PQHA 4YQMA 1G0TA 3TJJA 2LSTA 3VWWA 4FQUA 4AJ7A 3D0ZA 4PNFA 1ERTA 3KCMA 2LNSA 2YWNA 4K5SA 2DJ3A 3WD6A 7GSSA 2QKEA 2PMTA 1HD2A 1WIKA 2FA4A 2GZYA 3LYPA 2O5VA 1S3DA 1XVQA 1SYRA 3TKPA 4IJ3A 4MMMA 2DIZA 2XHFA 4TXOA 2VCQA 4AKHA 4WETA 5J5NA 2LJKA 1T8EB 3QR6A 2H01A 3KJYA 4PNGA 3O6TA 3GL3A 14GSA 3KIJA 3ME7A 4L0WA 5IMFA 2HRKA 4ISDA 1YEXA 3UOMA 3UBLA 3APSA 1GTAA 4XS1A 1XVWA 4EF0A 3HVXA 1YY7A 4EDZA 2YANA 2VD0A 2BMXA 4TVEA 3EMPA 5DCGA 2E7PA 2H1DA 2H8LA 1A0FA 5G1KA 4ECBA 1A2JA 2R6KA 2KHPA 3M8NA 4MJBA 1GRXA 2OACA 3DVWA 2JZRA 4BL7A 4F0BA 2DJ0A 3HHVA 2WGRA 4HJ2A 3A2VA 5DALB 2AUVA 4Z2UA 4I5QA 5HFGA 3VI7A 3I9V2 5CAXA 5E59A 2R0CA 4OWYA 4EXJA 3G7JA 4IHUA 3KH7A 3CHXC 4L5OA 1ZMAA 3TB2A 1VF2A 1F3BA 4MP4A 1FHEA 2AYTA 5AN1A 1DSBA 1R7HA 2KOKA 4ZB7A 1EOHA 2P0GA 2R0PA 2K18A 3C1RA 1B8XA 2FA8A 1Z6MA 4KAEA 4ZB6A 2HLSA 2OBKA 4KNDA 4K5RA 1OC9B 4GQFA 4TN8A 1X0RA 3EPTA 4MZCA 2F3MA 2FD3A 3RAZA 1M3IA 1B4QA 2PVQA 1A8YA 2LNTA 1Z6NA 2OKAA 3IHGA 2MZCA 2F8FA 2F8AA 5IMDA 2C3NA 1FW1A 1X5EA 5EPFA 1ERUA 4O5UA 1TJDA 2OT3A 1LJRA 1ZZYA 4KA0A 2R3XA 2CAQA 4TXVA 2V41A 2GS3A 1NHOA 3D21A 3VPTA 4AI6A 5JWQB 3KMOA 3LXZA 2O36A 5J4UA 3IC8A 2EFDA 4FYUA 5D8IA 4IW9A 2IPAA 3KH9A 2PVOC 3JCML 4EE0A 5J41A 1PKZA 2DJJA 5ECKB 4GSTA 2A2PA 4KUNA 3VWUA 2CV4A 3MAKA 4GRFA 2IFQB 5EY6A 2EFHA 5J9BA 1TP9A 1HYUA 2H6YA 3I69A 2R37A 4DSSA 1SL2B 1XWAA 2WW3A 2K6VA 5CNWA 2ZNMA 1EWXA 1BX9A 1HNCA 3HXSA 6GSWA 2HNLA 4H86A 2QA2A 3TKSC 3FRCA 1N8JA 4TR0A 3GTUB 5D73A 2C1YA 1RW1A 3M9KA 1AQXA 3GL5A 3C73A 3ZL5A 3ZYWA 1V2AA 3A5WA 2FWEA 2H0HA 1XW9A 4G0LA 3D6IA 3RGBC 4WKWA 3W8SA 1WPIA 2FWFA 2VM1A 4KF9A 2YWOA 1PMTA 3QFAC 4HSCX 4V2NA 3ISOA 1OE7A 4KX4A 1TK8B 1O73A 1BF5A 2JADA 3UEMA 2IJYA 1TU7A 4K7NA 4BWSA 2LEGA 3LYKA 1ERVA 2JZSA 4N0ZA 2DMLA 3RFRC 3HDCA 3R3EA 2HFDA 5B7CA 4DVCA 5J4VA 4Q5NA 4PX1A 5GAPD 1Z7RA 2WVXB 5ECOB 5B8BA 4MLYA 2H6XA 4POMA 2H0IA 6GSTA 3A5IA 3HZ4A 1SD8A 2MMZA 2QGVA 3TUEA 2CA8A 3ZRDA 3CRTA 2DLXA 3SBCA 2IMIA 3GURA 4MK3A 3LWAA 2IN3A 3M3MA 3GX0A 2VO4A 2XC2A 4ECCA 20GSA 1Z9HA 4HU9A 1QK8A 3KD0A 2VCVA 1F3AA 4TR4A 3IDVA 4X0XA 2L4CA 4ZB8A 1U3AA 1T1VA 1M3JA 4PXOA 1U87A 5HR1A 5CRHA 1XCCA 3FZ9A 4EO3A 3FZAA 1W89A 3KZQA 4QMKA 2C0GA 5G31A 2H75A 3LQ7A 4GSSA 2VAFA 1XOBA 4NHWA 10GSA 4W66A 1M99A 4GLTA 3TRXA 2C0EA 3IA1A 5JCUA 1A23A 1YKAA 3DEXA 5JWOB 3LG6A 3HD5A 4V2LA 3N9JA 3U6VA 4WBJA 4A5PA 3DRNA 1TKDB 2XBIA 4OO4A 18GSA 1PGTA 2GTUA 1K0BA 1X9MB 4MPFA 4WXTA 3RPPA 4JR6A 3WGDA 5AISA 4F03A 1SL1B 5KOWA 5ECLB 2YCDA 1GSFA 1JZOA 3ZFBA 1O8XA 1CQHA 5A1NB 2P5QA 3C71A 3EURA 4RUVA 1GSQA 2AAWA 3UL3A 2C8UA 1HNAA 1K0CA 4DSQA 1UVZA 2WDUA 1KTEA 5D9WA 1SKSB 1JLWA 3E9JB 1OE8A 2XPDA 1GSDA 2X64A 3I43A 2B3SA 2YZHA 1LU4A 3US3A 2TRCP 5KN1A 3QD9A 4JR4A 2VOCA 1RQMA 5ECIB 2C3QA 3GX8A 4OO5A 1GTUA 2M72A 1GL8A 4CHSA 2O89A 3F3QA 5DALA 2CVKA 2OBIA 4QL9A 3UJ1A 1K3OA 1OVNA 4BWQA 5CRDA 4K6XA 1V9WA 3L9UA 4TRXA 3W8JA 1ON4A 2L59A 5F07A 3FZ5A 1MD3A 3PH9A 1Y1UA 4E68A 5CYYA 2N5FA 3SWLA 1EGOA 4EIPA 4GQCA 2LV3A 3CTGA 3FR6A 4YAPA 3AY8A 1M2BA 2H6ZA 1FG4A 3TKRA 1OC9A 1SYXA 2D2ZA 1SD9A 1K3LA 2H74A 2RLIA 4J2FA 2LRCA 2F51A 2NBSA 2CZ2A 1YF0A 2FNOA 4NPBA 1GUMA 1FOVA 3HJPA 4MJEA 2VD1A 4WBRD 1F6MC 3UARA 4OCEA 1ZYQB 2B7KA 3P2AA 2V1MA 4EIQA 3IXRA 3S9FA 1JZDA 1YEPA 4KGIA 3H79A 5ECHB 1KBNA 4HJMA 5C00A 3LFLA 5ELGA 1MEKA 3LGCA 2B7JA 4CW9A 5B6MA 3APOA 5H5QA 2IWTA 4XRDA 3CMIA 4XIHA 3ZLPA 2YWMA 4F9ZA 2VCTA 1EGRA 5B6NA 2H19A 2WRTA 2HQTA 4N10A 1TK5B 3QCPA 1M9AA 4MF6A 5ECNB 5AIXA 1OC8A 2FUG2 5ECRB 5J47A 2VL2C 3WT2A 3WT1A 1TU8A 3GRXA 4HEA2 5ENUA 4CY6A 4POKA 4G9HA 1OC3A 2IFQA 4XS4B 4KSMA 6GSXA 2WJUA 3EINA 4Z2TA 4PQIA 1E6BA 2HSMB 1HQOA 2A2SA 1N25A 2C4JA 1NW2A 2WULA 4MJCA 1GUKA 2AJQB 2MMNA 3I6AA 4EVMA 2NTOA 1BQ7A 2DJKA 2R2JA 2RIIA 3V1WA 3GTUA 1XWKA 2H66A 2YN1A 1MD4A 3F3RA 2K9FA 5INYA 2B5XA 2VIMA 5GAND 3G7YA 3GKNA 2HYXA 1OKDA 1EP7A 3HJOA 1W4VA 1JZWA 2PUKC 1MDIA 1VGLA 1TW9A 3A2WA 5ECSA 5DCHA 1USBA 3K8NA 1GLQA 3KTLA 2VCZA 3Q74A 4HZ2A 1A2LA 1THOA 5GSTA 1YZXA 3Q19A 2TRXA 3G9BA 4KE3A 4ECIA 4NV5A 4MF7A 1T4ZA 3UIWA 3ERFA 2WVXA 2GQKA 5J4YA 3IAS2 1XG8A 1URMA 4O92A 2DJ1A 4PUFC 3EWLA 4L5LA 2OE3A 6GSYA 2CX4A 5IIZA 1GWCA 4HDEA 1SK2A 2FCHA 3CWGA 2GZPA 2JL4A 1BEDA 3ZMLA 4HOJA 3LEFA 5G1LA 3TJGA 2JU5A 1XOAA 4OCFA 4POBA 1HNBA 1MTCA 2X8HA 5DJMA 4P3YB 3HVVA 1WRYA 3DMLA 2O87A 2WW1A 4YH2A 5D93A 1AC1A 1XWGA
chains in the Genus database with same CATH topology
2WB9A 3DGQA 2EIQA 1J9BA 4X43A 5A5KA 4V1Ag 1SK1A 4JE1A 3FY7A 3GKKA 4FYCA 4IELA 5FWGA 1PX7A 1PN9A 1V40A 4EC0A 3PGTA 4IP6A 5KEJA 4AGSA 9GSSA 2FWHA 3VLNA 1XPVA 3QPMA 3ZIVA 3VK9A 4F0CA 2JSYA 3HCZA 2YJHA 3L78A 1R5AA 3ZREA 1FB0A 1J08A 1M2AA 2GVPA 1TRWA 2CQ9A 3A2XA 4ZBDA 1GSUA 2WZ9A 4G2EA 3F63A 2JACA 2ALBA 2PU9C 1K0DA 2R4VA 3KEBA 4KDXA 4LL4B 4ZL8A 4ZBAA 5ECMB 2UZ8A 3GV1A 4O7HA 1T4YA 1YVLA 13GSA 1PQNA 2LTKA 4TR1B 2H73A 1WP0A 1G7EA 2IMDA 4GXZA 1PSQA 2KLXA 2X99A 5A1NA 2PPTA 2YV7A 4OD7A 3TRQA 2WFCA 2EIOA 1F9MA 4WR4A 4E8EA 2PERA 3M1GA 1FAAA 1GP1A 4MF5A 1FO5A 3F0IA 1FB6A 2BTOT 2IIYA 2K8SA 6GSUA 2GT6A 1Q4JA 3P90A 2TIRA 2H1BA 2YWIA 4DEJA 5A34B 2N5AA 2REMA 2G2QA 4BA7A 4CDOA 1U3IA 2DSAA 4K8MA 2LRTA 2A4VA 3EE2A 4FYBA 2GZZA 4JEDA 2I3YA 2MMAA 1AAZA 4JBBA 5A4WA 3PR8A 3TGZA 2P31A 1O6JA 4RQXA 1ABAA 3FR3A 1O85A 2VKZG 5IMCA 4V2MA 2IMFA 2Z9SA 4KCEA 2HZFA 1VRSD 1TK0B 4HQZA 5D96A 2FWGA 3TKQA 5E4WA 1AW9A 3ZMKA 3F4RA 3CTFA 1PN0A 4L8EA 17GSA 3TKSE 3UAPA 2C80A 4ZL9A 3LJRA 4QQ7A 4IKHA 1THXA 3IE3A 1SKWB 3IR4A 2B5YA 2A2RA 3DIEA 1FVJA 5ELAA 3CSJA 1M7TA 4N3ZA 3GFKA 4OFNA 3QAWA 4KDUA 3TKSA 3EU4A 3HZ8A 4MZBA 5IMZA 2H0GA 2E2GA 4K0NA 2GQLA 3EC3A 3HKRA 4NWYA 2GSRA 5KN3A 2DKIA 2YPMA 4MZWA 4J56E 3ZVJD 2EC4A 1V98A 1R4WA 4NMUA 3U5RE 3HY2A 5GSSA 2YP6A 3QAGA 4ECJA 3ZIJA 1TDIA 4JU5A 4K7IA 2C0FA 2H72A 1ZCPA 4RI7A 5G2ZA 1OKTA 3H8QA 1BJXA 4J57E 2LJAA 4GSNA 3OR5A 4K7OA 3EYTA 3ME8A 4IN0A 4XS4A 3QMXA 1K0AA 4Q5RA 1S3AA 2RM5A 3IRAA 2HSMA 4ZILA 3UVHA 4XTSA 1BG5A 2VLVA 4XHMA 4KCAA 3IK9A 4IBPA 3Q18A 4G01A 1RK4A 1PX6A 4FH8A 2VCWA 2RM6A 1VF3A 3RBTA 5HFIA 1EP8A 5AGYA 2V6KA 2L6DA 4ZIJA 4KDYA 4XCSA 5IM9A 4USSA 1XXUA 1TTZA 4EDYA 1DE2A 1N2AA 1QQ2A 2WS2A 1A0RP 4K1FA 4D73B 2GDRA 1UN2A 2ON7A 2M46A 1E2YA 2R0GA 4EUYA 3CYNA 1XZOA 3HYPA 3KXOA 5ABRA 2AB6A 2VLTA 1O8WA 5A5HA 3L9VA 2HZEB 1FVKA 2LQOA 3F6FA 3VWVA 2H71A 2QSIA 3VPQA 2YJ7A 5L71A 5ECPB 2GLRA 3RHBA 2P5RA 2EIRA 2AHEA 3GN3A 2KP2A 4POLA 3L9SA 5DQSA 4NV2A 1XW6A 2CZ3A 3IC4A 3IOSA 5KN0A 2HRNA 3IHQA 5AIVA 1EEJA 4TR3A 3ZTLA 2YZUA 4ML6A 4I6XA 2JZTA 5IMVA 4MA9A 2EFEA 1K0NA 2GSSA 2IL3A 1TOFA 3L4NA 1XW5A 1UA5A 1WE0A 1XWBA 1V57A 2N5BA 1T3BA 5CP1A 1R5PA 3CBUA 4EL1A 2X49A 2L5LA 5DJLA 3J7Yb 1SVLA 4ICYA 1SENA 2OE0A 1ZYEA 2OADA 4YQVA 1TRUA 2XBQA 4XRAA 4FIWA 4G19A 3D22A 1GTBA 4F2IA 1WWJA 2DMMA 1SKRB 2HRAA 4WF5A 1V58A 1G6WA 4YKFA 1A8LA 1TI1A 1Z5YE 1QFNA 2LUSA 5FT3A 3HA9A 1GNEA 6GSVA 3WGXA 1TXXA 3EMXA 3MSZA 3GH9A 2OA7A 3EU3A 8GSSA 1T7PB 4NAXA 5IPGA 1J0FA 3E0UA 4I97A 2H1GA 1PL2A 2MBSA 3MIXA 5IMAA 5DAKB 2XPEA 3QAVA 4IQ1A 1C72A 2DC5A 2FLSA 1WJKA 5IOXA 1F37A 5H5SA 4WEYA 5BMUB 3ZZXA 3IAM2 5F8BA 2NVLA 4Q5FA 3QOUA 2CAIA 2M80A 1X9SB 1SL0B 4K2DA 1ZL9A 4TR1A 4CY8A 3RDWA 3C1SA 2B1LA 3P8WA 3PPUA 4O5RA 3DKSA 1H4OA 4MPGA 3FKFA 2FGXA 5GZZB 3APQA 2ZUPA 1EV9A 1FOHA 1WMJA 4BVXA 2RUFA 2E0QA 1A24A 4PUAA 1K0MA 5B8AA 1GSEA 3LORA 5A34A 4GTUA 5D9TA 1PL1A 5HFKA 4XS6A 3O76A 1SU9A 3VFIA 2GQMA 1U6TA 5A5HB 2I1UA 5HR3A 4AKIA 1MDJA 5A4VA 1EEMA 4G0IA 3TOUA 2LKUA 2L5OA 3A3TA 2LS5A 2FHEA 1ILOA 4MJAA 4TOPA 4HZ4A 2VL9A 3HJMA 2MMOA 2VLUA 4N0VA 1M0UA 1GULA 2CVBA 2VL2A 4I2TA 4PQ1A 1DE1A 3ERGA 4ZB9A 4AJ6A 3BJ5A 1B9YC 5LCZA 1S3CA 1OAZA 5IO2A 2I9HA 4IP1A 4G0KA 3FEUA 4GCIA 2YV9A 1DBYA 2YNXA 5A4UA 1NM3A 4LA1A 5JCWA 2EFCA 1NSWA 3C7MA 3D4TA 1SJIA 3GSTA 5DQYA 4BVYB 3H1NA 19GSA 2HSNA 5HR2A 3GH6A 11GSA 3EVIA 4OMVA 3P7XA 3Q6OA 5HR0A 4HI7A 1R26A 1I5GA 1Y6EA 1ST9A 1TXUA 3LSZA 1GH2A 4IGJA 2V2GA 3KM6A 2QA1A 5IPHA 1YJ6A 4F82A 1XFLA 5ID2B 4Z7XA 3W6GA 2OE1A 2C3TA 1AQWA 4LLRA 4WR5A 5F05A 5CREA 1DUGA 3BCIA 4PTSA 5J9CA 1G7OA 5DBQA 2O85A 1JZRA 5LD0A 3GUSA 3DXBA 2PWJA 1IYHA 4O5QA 4GWRA 4HQSA 2IMKA 1Z7PA 5JCGA 4ACSA 2HXKA 4ZXGA 1QGVA 3TJBA 2FY6A 4Z2RA 1M9BA 2V32A 1F2EA 2J23A 4QL7A 4N11A 1QMVA 4L0UA 2L4QA 2H70A 1JHBA 4D73A 2HT9A 4MH3A 4KH7A 1SVOA 1QXHA 4BVXB 5LNKe 3BOAA 5D9XA 1B9XC 2UV8G 3WGEA 2O8VB 2LRNA 1XWCA 3M9JA 3TU3B 4MABA 4TXOB 3KP9A 1YKCA 2HZEA 4RI6A 2AV4A 1TRSA 5F06A 1PKWA 1TI3A 3GNJA 1QUWA 3BCKA 4GDFA 3F6DA 2PGTA 1KNGA 4ZBBA 3KP8A 5F0GA 2L57A 2HRKB 1O7UA 4OFMA 1Z3EA 1EOGA 2CX3A 5KOXA 2F9SA 3TJKA 1WOUA 1A2MA 1SVMA 4JRRA 4PGTA 2V6OA 4BPYA 3GIXA 4X1UA 2G0FA 2H1AA 4ILFA 4BL7B 3TCOA 1B4PA 4DSRA 3DYRA 1ML6A 1B48A 2K8VA 4KB3A 4Q5QA 3GMFA 1IYIA 4AKGA 3F4SA 2HSYA 12GSA 4E8HA 3TOTA 1U88A 1XIYA 3F8UA 3RHCA 1AXDA 3GHAA 1ZGNA 3J7Yk 2R5GA 3LXTA 2O7KA 4G10A 3FR9A 4K2XA 5DVBA 2DJ2A 5IO0A 3WYWA 5CO3A 3TDGA 2KP1A 2GSQA 3TRPA 1K3YA 2H1LA 4EKZA 1GLPA 3PINA 2B5EA 3C8EA 4AKXB 2GGTA 4FO5A 4ZL7A 2HSNB 4HS1A 1M2DA 2CVDA 1YDKA 2OJLA 4IJIA 3TJFA 3F9UA 5CRWA 3O3TA 4ID0A 1K0OA 4YKGA 3GA4A 4YQUA 2I4AA 5DAKA 1LBKA 5JWRB 4MDCA 2IMEA 2HI7A 4O32A 1CQGA 3IV4A 2LQQA 5BMUA 2B6MA 2H30A 2NPBA 2QC7A 1O81A 2L6CA 4KW6A 4IQAA 3N5OA 1JLVA 4LL1B 2H76A 2HSHA 2VCXA 1GNWA 1GSYA 2DKHA 3M0FA 1ZYNA 2KUCA 3ZITA 5EVOA 2ES7A 3NOFA 3VURA 2ZCTA 2ON5A 2HRFA 2JSZA 3DVXA 5IQYA 1H75A 4DSSB 4KSOA 3E3EA 4GF0A 3H93A 3ERWA 5C04A 3NZNA 2GSTA 1XBSA 4I8BA 4MNNA 3UBKA 4HUAA 1ZYPA 5COHA 1BYEA 5G30A 3NIVA 3CXGA 5G5EA 4LMVA 3KTBA 3FW2A 2VM2A 3ZVJA 2PBJA 4AF2A 1GUHA 3KMNA 4I2UA 1TRVA 1VF4A 3FYGA 6GSSA 3BD2A 2YOIA 5G5FA 4HU7A 1VF1A 3GYKA 2E2MA 1JFUA 3IBHA 3UVTA 3D5JA 3IPZA 4MCUA 5H5RA 1X5DA 1UC7A 2C0DA 1AQVA 1PD21 2DBCA 3MYDA 4NHZA 3MWHA 4YAVA 2MYGA 4WF4A 5J40A 3HVSA 2GT5A 2X8CA 3FK8A 4IVFA 1EV4A 1ZOFA 2I81A 1G6YA 5D9VA 3MDKA 1ERWA 3ED3A 4PURA 3HMJG 2VUPA 3MNGA 1X9WB 1OYJA 3G7IA 5EL8A 1I9DA 2BJXA 3CSHA 3DD3A 2VL3A 5ECQB 4K9ZA 5KN2A 3FZ4A 1YQ1A 1PRXA 1X5CA 5FHIA 1T00A 4ULXA 3KGKA 3VI5A 4RQRA 4K0GA 1Q98A 4TW5A 2HE3A 3UMAA 3DWVA 4BVYA 3CSIA 1SJ6A 5J3RA 1BG1A 2LJRA 2RUEA 22GSA 2J9HA 1EZKA 3FHKA 3R2QA 1AIUA 2CT6A 2X4AA 3GKMA 4OFTA 5DDLA 3BBYA 2DIYA 2A4HA 4JZQA 1GSSA 3F4TA 4IS0A 3L0HA 3CRUA 4AJ8A 3ZFLA 3QDNA 4LMWA 1SJZA 3LW9A 1BAYA 5HQPA 4NXIA 3GKXA 5IOWA 1SK0A 3GSSA 5ID2A 4V1Ap 3RPNA 4ML1A 5CRGA 3VWXA 1YF1A 2X8GA 3D4MA 2MBTA 3QFBC 4X4JA 5BRTA 1GTIA 1Y25A 4TKYA 2NDOA 3IK7A 1KEBA 16GSA 4N30A 1MDKA 3FMWA 1NHYA 1AUCA 3H4KA 1ACVA 2B1KA 4MH2A 2WCIA 2PN8A 1PA3A 4PQHA 4YQMA 1G0TA 3TJJA 2LSTA 3VWWA 4FQUA 4AJ7A 3D0ZA 4PNFA 1ERTA 3KCMA 2LNSA 2YWNA 4K5SA 2DJ3A 3WD6A 7GSSA 2QKEA 2PMTA 1HD2A 1WIKA 2FA4A 2GZYA 3LYPA 2O5VA 1S3DA 1XVQA 1SYRA 3TKPA 4IJ3A 4MMMA 2DIZA 2XHFA 4TXOA 2VCQA 4AKHA 4WETA 5J5NA 2LJKA 1T8EB 3QR6A 2H01A 3KJYA 4PNGA 3O6TA 3GL3A 14GSA 3KIJA 3ME7A 4L0WA 5IMFA 2HRKA 4ISDA 1YEXA 3UOMA 3UBLA 3APSA 1GTAA 4XS1A 1XVWA 4EF0A 3HVXA 1YY7A 4EDZA 2YANA 2VD0A 2BMXA 4TVEA 3EMPA 5DCGA 2E7PA 2H1DA 2H8LA 1A0FA 5G1KA 4ECBA 1A2JA 2R6KA 2KHPA 3M8NA 4MJBA 1GRXA 2OACA 3DVWA 2JZRA 4BL7A 4F0BA 2DJ0A 3HHVA 2WGRA 4HJ2A 3A2VA 5DALB 2AUVA 4Z2UA 4I5QA 5HFGA 3VI7A 3I9V2 5CAXA 5E59A 2R0CA 4OWYA 4EXJA 3G7JA 4IHUA 3KH7A 4L5OA 1ZMAA 3TB2A 1VF2A 1F3BA 4MP4A 1FHEA 2AYTA 5AN1A 1DSBA 1R7HA 2KOKA 4ZB7A 1EOHA 2P0GA 2R0PA 2K18A 3C1RA 1B8XA 2FA8A 1Z6MA 4KAEA 4ZB6A 2HLSA 2OBKA 4KNDA 4K5RA 1OC9B 4GQFA 4TN8A 1X0RA 3EPTA 4MZCA 2F3MA 2FD3A 3RAZA 1B4QA 2PVQA 1A8YA 2LNTA 1Z6NA 2OKAA 3IHGA 2MZCA 2F8FA 2F8AA 5IMDA 2C3NA 1FW1A 1X5EA 5EPFA 1ERUA 4O5UA 1TJDA 2OT3A 1LJRA 1ZZYA 4KA0A 2R3XA 2CAQA 4TXVA 2V41A 2GS3A 1NHOA 3D21A 3VPTA 4AI6A 5JWQB 3KMOA 3LXZA 5J4UA 3IC8A 2EFDA 4FYUA 5D8IA 4IW9A 2IPAA 3KH9A 2PVOC 3JCML 4EE0A 5J41A 1PKZA 2DJJA 5ECKB 4GSTA 2A2PA 4KUNA 3VWUA 2CV4A 3MAKA 4GRFA 2IFQB 5EY6A 2EFHA 5J9BA 1TP9A 1HYUA 2H6YA 3I69A 2R37A 4DSSA 1SL2B 1XWAA 2K6VA 5CNWA 2ZNMA 1EWXA 1BX9A 1HNCA 3HXSA 6GSWA 2HNLA 4H86A 2QA2A 3TKSC 3FRCA 1N8JA 4TR0A 3GTUB 5D73A 2C1YA 1RW1A 3M9KA 1AQXA 3GL5A 3C73A 3ZL5A 3ZYWA 1V2AA 3A5WA 2FWEA 2H0HA 1XW9A 4G0LA 3D6IA 4WKWA 3W8SA 1WPIA 2FWFA 2VM1A 4KF9A 2YWOA 1PMTA 3QFAC 4V2NA 3ISOA 1OE7A 4KX4A 1TK8B 1O73A 1BF5A 2JADA 3UEMA 2IJYA 1TU7A 4K7NA 4BWSA 2LEGA 3LYKA 1ERVA 2JZSA 4N0ZA 2DMLA 3HDCA 3R3EA 2HFDA 5B7CA 4DVCA 5J4VA 4Q5NA 4PX1A 5GAPD 1Z7RA 5ECOB 5B8BA 4MLYA 2H6XA 4POMA 2H0IA 6GSTA 3A5IA 3HZ4A 1SD8A 2MMZA 2QGVA 3TUEA 2CA8A 3ZRDA 3CRTA 2DLXA 3SBCA 2IMIA 3GURA 4MK3A 3LWAA 2IN3A 3M3MA 3GX0A 2VO4A 2XC2A 4ECCA 20GSA 1Z9HA 4HU9A 1QK8A 3KD0A 2VCVA 1F3AA 4TR4A 3IDVA 4X0XA 2L4CA 4ZB8A 1U3AA 1T1VA 4PXOA 1U87A 5HR1A 5CRHA 1XCCA 3FZ9A 4EO3A 3FZAA 1W89A 3KZQA 4QMKA 2C0GA 5G31A 2H75A 3LQ7A 4GSSA 2VAFA 1XOBA 4NHWA 10GSA 4W66A 1M99A 4GLTA 3TRXA 2C0EA 3IA1A 5JCUA 1A23A 1YKAA 3DEXA 5JWOB 3LG6A 3HD5A 4V2LA 3N9JA 3U6VA 4WBJA 4A5PA 3DRNA 1TKDB 2XBIA 4OO4A 18GSA 1PGTA 2GTUA 1K0BA 1X9MB 4MPFA 4WXTA 3RPPA 4JR6A 3WGDA 5AISA 4F03A 1SL1B 5KOWA 5ECLB 2YCDA 1GSFA 1JZOA 3ZFBA 1O8XA 1CQHA 5A1NB 2P5QA 3C71A 3EURA 4RUVA 1GSQA 2AAWA 3UL3A 2C8UA 1HNAA 1K0CA 4DSQA 1UVZA 2WDUA 1KTEA 5D9WA 1SKSB 1JLWA 3E9JB 1OE8A 2XPDA 1GSDA 2X64A 3I43A 2B3SA 2YZHA 1LU4A 3US3A 2TRCP 5KN1A 3QD9A 4JR4A 2VOCA 1RQMA 5ECIB 2C3QA 3GX8A 4OO5A 1GTUA 2M72A 1GL8A 4CHSA 2O89A 3F3QA 5DALA 2CVKA 2OBIA 4QL9A 3UJ1A 1K3OA 1OVNA 4BWQA 5CRDA 4K6XA 1V9WA 3L9UA 4TRXA 3W8JA 1ON4A 2L59A 5F07A 3FZ5A 1MD3A 3PH9A 1Y1UA 4E68A 5CYYA 2N5FA 3SWLA 1EGOA 4EIPA 4GQCA 2LV3A 3CTGA 3FR6A 4YAPA 3AY8A 1M2BA 2H6ZA 1FG4A 3TKRA 1OC9A 1SYXA 2D2ZA 1SD9A 1K3LA 2H74A 2RLIA 4J2FA 2LRCA 2F51A 2NBSA 2CZ2A 1YF0A 2FNOA 4NPBA 1GUMA 1FOVA 3HJPA 4MJEA 2VD1A 4WBRD 1F6MC 3UARA 4OCEA 1ZYQB 2B7KA 3P2AA 2V1MA 4EIQA 3IXRA 3S9FA 1JZDA 1YEPA 4KGIA 3H79A 5ECHB 1KBNA 4HJMA 5C00A 3LFLA 5ELGA 1MEKA 3LGCA 2B7JA 4CW9A 5B6MA 3APOA 5H5QA 2IWTA 4XRDA 3CMIA 4XIHA 3ZLPA 2YWMA 4F9ZA 2VCTA 1EGRA 5B6NA 2H19A 2WRTA 2HQTA 4N10A 1TK5B 3QCPA 1M9AA 4MF6A 5ECNB 5AIXA 1OC8A 2FUG2 5ECRB 5J47A 2VL2C 3WT2A 3WT1A 1TU8A 3GRXA 4HEA2 5ENUA 4CY6A 4POKA 4G9HA 1OC3A 2IFQA 4XS4B 4KSMA 6GSXA 2WJUA 3EINA 4Z2TA 4PQIA 1E6BA 2HSMB 1HQOA 2A2SA 1N25A 2C4JA 1NW2A 2WULA 4MJCA 1GUKA 2AJQB 2MMNA 3I6AA 4EVMA 2NTOA 1BQ7A 2DJKA 2R2JA 2RIIA 3V1WA 3GTUA 1XWKA 2H66A 2YN1A 1MD4A 3F3RA 2K9FA 5INYA 2B5XA 2VIMA 5GAND 3G7YA 3GKNA 2HYXA 1OKDA 1EP7A 3HJOA 1W4VA 1JZWA 2PUKC 1MDIA 1VGLA 1TW9A 3A2WA 5ECSA 5DCHA 1USBA 3K8NA 1GLQA 3KTLA 2VCZA 3Q74A 4HZ2A 1A2LA 1THOA 5GSTA 1YZXA 3Q19A 2TRXA 3G9BA 4KE3A 4ECIA 4NV5A 4MF7A 1T4ZA 3UIWA 3ERFA 2GQKA 5J4YA 3IAS2 1URMA 4O92A 2DJ1A 4PUFC 3EWLA 4L5LA 2OE3A 6GSYA 2CX4A 5IIZA 1GWCA 4HDEA 1SK2A 2FCHA 3CWGA 2GZPA 2JL4A 1BEDA 3ZMLA 4HOJA 3LEFA 5G1LA 3TJGA 2JU5A 1XOAA 4OCFA 4POBA 1HNBA 1MTCA 2X8HA 5DJMA 4P3YB 3HVVA 1WRYA 3DMLA 2O87A 4YH2A 5D93A 1AC1A 1XWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB9 A;  3DGQ A;  2EIQ A;  1J9B A;  4X43 A;  5A5K A;  4V1A g;  1SK1 A;  4JE1 A;  3FY7 A;  3GKK A;  4FYC A;  4IEL A;  5FWG A;  1PX7 A;  1PN9 A;  1V40 A;  4EC0 A;  3PGT A;  4IP6 A;  5KEJ A;  4AGS A;  9GSS A;  2FWH A;  3VLN A;  1XPV A;  3QPM A;  3ZIV A;  3VK9 A;  4F0C A;  2JSY A;  3HCZ A;  2YJH A;  3L78 A;  1R5A A;  3ZRE A;  1FB0 A;  1J08 A;  1M2A A;  2GVP A;  1TRW A;  2CQ9 A;  3A2X A;  4ZBD A;  1GSU A;  2WZ9 A;  4G2E A;  3F63 A;  2JAC A;  2ALB A;  2PU9 C;  1K0D A;  2R4V A;  3KEB A;  4KDX A;  4LL4 B;  4ZL8 A;  4ZBA A;  5ECM B;  2UZ8 A;  3GV1 A;  4O7H A;  1T4Y A;  1PQN A;  13GS A;  2LTK A;  4TR1 B;  2H73 A;  1WP0 A;  1G7E A;  2IMD A;  4GXZ A;  1PSQ A;  2KLX A;  2X99 A;  2PPT A;  2YV7 A;  4OD7 A;  3TRQ A;  2WFC A;  2EIO A;  1F9M A;  4WR4 A;  4E8E A;  2PER A;  3M1G A;  1FAA A;  1GP1 A;  4MF5 A;  1FO5 A;  3F0I A;  1FB6 A;  2BTO T;  2IIY A;  2K8S A;  6GSU A;  2GT6 A;  1Q4J A;  3P90 A;  2TIR A;  2H1B A;  2YWI A;  4DEJ A;  2N5A A;  2REM A;  2G2Q A;  4BA7 A;  4CDO A;  1U3I A;  2DSA A;  4K8M A;  2LRT A;  2A4V A;  3EE2 A;  4FYB A;  2GZZ A;  4JED A;  2I3Y A;  2MMA A;  1AAZ A;  4JBB A;  5A4W A;  3PR8 A;  3TGZ A;  2P31 A;  1O6J A;  4RQX A;  1ABA A;  3FR3 A;  1O85 A;  5IMC A;  4V2M A;  2IMF A;  2Z9S A;  4KCE A;  2HZF A;  1VRS D;  1TK0 B;  4HQZ A;  5D96 A;  2FWG A;  3TKQ A;  5E4W A;  1AW9 A;  3ZMK A;  3F4R A;  3CTF A;  4L8E A;  17GS A;  3TKS E;  3UAP A;  2C80 A;  4ZL9 A;  3LJR A;  4QQ7 A;  4IKH A;  1THX A;  3IE3 A;  1SKW B;  3IR4 A;  2B5Y A;  2A2R A;  3DIE A;  1FVJ A;  5ELA A;  3CSJ A;  1M7T A;  3GFK A;  4OFN A;  3QAW A;  4KDU A;  3TKS A;  3EU4 A;  3HZ8 A;  4MZB A;  5IMZ A;  2H0G A;  2E2G A;  4K0N A;  2GQL A;  3EC3 A;  3HKR A;  4NWY A;  2GSR A;  5KN3 A;  2YPM A;  4MZW A;  4J56 E;  3ZVJ D;  2EC4 A;  1V98 A;  1R4W A;  4NMU A;  3U5R E;  3HY2 A;  5GSS A;  2YP6 A;  3QAG A;  4ECJ A;  3ZIJ A;  1TDI A;  4JU5 A;  4K7I A;  2C0F A;  2H72 A;  1ZCP A;  4RI7 A;  5G2Z A;  1OKT A;  3H8Q A;  1BJX A;  4J57 E;  2LJA A;  4GSN A;  3OR5 A;  4K7O A;  3EYT A;  3ME8 A;  4IN0 A;  4XS4 A;  3QMX A;  1K0A A;  4Q5R A;  1S3A A;  2RM5 A;  3IRA A;  2HSM A;  4ZIL A;  3UVH A;  4XTS A;  1BG5 A;  2VLV A;  4XHM A;  4KCA A;  3IK9 A;  4IBP A;  3Q18 A;  1RK4 A;  1PX6 A;  4FH8 A;  2VCW A;  2RM6 A;  1VF3 A;  3RBT A;  5HFI A;  1EP8 A;  5AGY A;  2V6K A;  2L6D A;  4ZIJ A;  4KDY A;  4XCS A;  5IM9 A;  4USS A;  1XXU A;  1TTZ A;  4EDY A;  1DE2 A;  1N2A A;  1QQ2 A;  2WS2 A;  1A0R P;  4K1F A;  4D73 B;  2GDR A;  1UN2 A;  2ON7 A;  2M46 A;  1E2Y A;  4EUY A;  3CYN A;  1XZO A;  3HYP A;  3KXO A;  5ABR A;  2AB6 A;  2VLT A;  1O8W A;  3L9V A;  2HZE B;  1FVK A;  2LQO A;  3F6F A;  3VWV A;  2H71 A;  2QSI A;  3VPQ A;  2YJ7 A;  5L71 A;  5ECP B;  2GLR A;  3RHB A;  2P5R A;  2EIR A;  2AHE A;  3GN3 A;  2KP2 A;  4POL A;  3L9S A;  5DQS A;  4NV2 A;  1XW6 A;  2CZ3 A;  3IC4 A;  3IOS A;  5KN0 A;  2HRN A;  3IHQ A;  5AIV A;  1EEJ A;  4TR3 A;  3ZTL A;  2YZU A;  4ML6 A;  4I6X A;  2JZT A;  5IMV A;  4MA9 A;  1K0N A;  2GSS A;  2IL3 A;  1TOF A;  3L4N A;  1XW5 A;  1UA5 A;  1WE0 A;  1XWB A;  1V57 A;  2N5B A;  1T3B A;  5CP1 A;  1R5P A;  3CBU A;  4EL1 A;  2L5L A;  5DJL A;  3J7Y b;  1SEN A;  2OE0 A;  1ZYE A;  2OAD A;  4YQV A;  1TRU A;  2XBQ A;  4XRA A;  4FIW A;  4G19 A;  3D22 A;  1GTB A;  4F2I A;  1WWJ A;  2DMM A;  1SKR B;  2HRA A;  4WF5 A;  1V58 A;  1G6W A;  1A8L A;  1TI1 A;  1Z5Y E;  1QFN A;  2LUS A;  5FT3 A;  3HA9 A;  1GNE A;  6GSV A;  3WGX A;  1TXX A;  3EMX A;  3MSZ A;  3GH9 A;  2OA7 A;  3EU3 A;  8GSS A;  1T7P B;  4NAX A;  5IPG A;  1J0F A;  3E0U A;  4I97 A;  2H1G A;  1PL2 A;  2MBS A;  5IMA A;  5DAK B;  2XPE A;  3QAV A;  4IQ1 A;  1C72 A;  2DC5 A;  2FLS A;  1WJK A;  5IOX A;  1F37 A;  5H5S A;  4WEY A;  3ZZX A;  3IAM 2;  5F8B A;  2NVL A;  4Q5F A;  3QOU A;  2CAI A;  2M80 A;  1X9S B;  1SL0 B;  4K2D A;  1ZL9 A;  4TR1 A;  3RDW A;  3C1S A;  2B1L A;  3P8W A;  3PPU A;  4O5R A;  3DKS A;  1H4O A;  4MPG A;  3FKF A;  2FGX A;  5GZZ B;  3APQ A;  2ZUP A;  1EV9 A;  1WMJ A;  4BVX A;  2RUF A;  2E0Q A;  1A24 A;  4PUA A;  1K0M A;  5B8A A;  1GSE A;  3LOR A;  4GTU A;  5D9T A;  1PL1 A;  5HFK A;  4XS6 A;  3O76 A;  1SU9 A;  3VFI A;  2GQM A;  1U6T A;  2I1U A;  5HR3 A;  1MDJ A;  5A4V A;  1EEM A;  4G0I A;  3TOU A;  2LKU A;  2L5O A;  3A3T A;  2LS5 A;  2FHE A;  1ILO A;  4MJA A;  4TOP A;  4HZ4 A;  2VL9 A;  3HJM A;  2MMO A;  2VLU A;  4N0V A;  1M0U A;  1GUL A;  2CVB A;  2VL2 A;  4I2T A;  4PQ1 A;  1DE1 A;  3ERG A;  4ZB9 A;  4AJ6 A;  3BJ5 A;  1B9Y C;  5LCZ A;  1S3C A;  1OAZ A;  5IO2 A;  2I9H A;  4IP1 A;  4G0K A;  3FEU A;  4GCI A;  2YV9 A;  1DBY A;  2YNX A;  5A4U A;  1NM3 A;  4LA1 A;  5JCW A;  1NSW A;  3C7M A;  3D4T A;  1SJI A;  3GST A;  5DQY A;  4BVY B;  3H1N A;  19GS A;  5HR2 A;  3GH6 A;  11GS A;  3EVI A;  4OMV A;  3P7X A;  3Q6O A;  5HR0 A;  4HI7 A;  1R26 A;  1I5G A;  1Y6E A;  1ST9 A;  3LSZ A;  1GH2 A;  4IGJ A;  2V2G A;  3KM6 A;  5IPH A;  1YJ6 A;  4F82 A;  1XFL A;  5ID2 B;  4Z7X A;  3W6G A;  2OE1 A;  2C3T A;  1AQW A;  4LLR A;  4WR5 A;  5F05 A;  5CRE A;  1DUG A;  3BCI A;  4PTS A;  5J9C A;  1G7O A;  5DBQ A;  2O85 A;  1JZR A;  5LD0 A;  3GUS A;  3DXB A;  2PWJ A;  1IYH A;  4GWR A;  4HQS A;  2IMK A;  1Z7P A;  5JCG A;  4ACS A;  2HXK A;  4ZXG A;  1QGV A;  3TJB A;  2FY6 A;  1M9B A;  2V32 A;  1F2E A;  2J23 A;  4QL7 A;  4N11 A;  1QMV A;  4L0U A;  2L4Q A;  2H70 A;  1JHB A;  4D73 A;  2HT9 A;  4MH3 A;  4KH7 A;  1QXH A;  4BVX B;  5LNK e;  3BOA A;  5D9X A;  1B9X C;  3WGE A;  2O8V B;  2LRN A;  1XWC A;  3M9J A;  4MAB A;  4TXO B;  3KP9 A;  1YKC A;  2HZE A;  4RI6 A;  2AV4 A;  1TRS A;  5F06 A;  1PKW A;  1TI3 A;  3GNJ A;  1QUW A;  3BCK A;  3F6D A;  2PGT A;  1KNG A;  4ZBB A;  3KP8 A;  5F0G A;  2L57 A;  2HRK B;  1O7U A;  4OFM A;  1Z3E A;  1EOG A;  2CX3 A;  2F9S A;  3TJK A;  1WOU A;  1A2M A;  4JRR A;  4PGT A;  2V6O A;  4BPY A;  3GIX A;  4X1U A;  2G0F A;  2H1A A;  4ILF A;  4BL7 B;  3TCO A;  1B4P A;  4DSR A;  3DYR A;  1ML6 A;  1B48 A;  2K8V A;  4KB3 A;  4Q5Q A;  3GMF A;  1IYI A;  3F4S A;  2HSY A;  12GS A;  4E8H A;  3TOT A;  1U88 A;  1XIY A;  3F8U A;  3RHC A;  1AXD A;  3GHA A;  1ZGN A;  3J7Y k;  2R5G A;  3LXT A;  2O7K A;  4G10 A;  3FR9 A;  5DVB A;  2DJ2 A;  5IO0 A;  3WYW A;  5CO3 A;  3TDG A;  2KP1 A;  2GSQ A;  3TRP A;  1K3Y A;  4EKZ A;  1GLP A;  3PIN A;  2B5E A;  3C8E A;  2GGT A;  4FO5 A;  4ZL7 A;  2HSN B;  4HS1 A;  1M2D A;  2CVD A;  1YDK A;  2OJL A;  4IJI A;  3TJF A;  3F9U A;  5CRW A;  3O3T A;  4ID0 A;  1K0O A;  3GA4 A;  4YQU A;  2I4A A;  5DAK A;  1LBK A;  5JWR B;  4MDC A;  2IME A;  2HI7 A;  4O32 A;  1CQG A;  3IV4 A;  2LQQ A;  5BMU A;  2B6M A;  2H30 A;  2NPB A;  2QC7 A;  1O81 A;  2L6C A;  4KW6 A;  4IQA A;  3N5O A;  1JLV A;  4LL1 B;  2H76 A;  2HSH A;  2VCX A;  1GNW A;  1GSY A;  3M0F A;  2KUC A;  3ZIT A;  5EVO A;  2ES7 A;  3NOF A;  3VUR A;  2ZCT A;  2ON5 A;  2HRF A;  2JSZ A;  3DVX A;  5IQY A;  1H75 A;  4DSS B;  4KSO A;  3E3E A;  4GF0 A;  3H93 A;  3ERW A;  5C04 A;  3NZN A;  2GST A;  1XBS A;  4I8B A;  3UBK A;  4HUA A;  5COH A;  1BYE A;  5G30 A;  3NIV A;  3CXG A;  5G5E A;  4LMV A;  3KTB A;  3FW2 A;  2VM2 A;  3ZVJ A;  2PBJ A;  4AF2 A;  1GUH A;  3KMN A;  4I2U A;  1TRV A;  1VF4 A;  3FYG A;  6GSS A;  3BD2 A;  2YOI A;  5G5F A;  4HU7 A;  1VF1 A;  3GYK A;  2E2M A;  1JFU A;  3IBH A;  3UVT A;  3D5J A;  3IPZ A;  4MCU A;  5H5R A;  1X5D A;  1UC7 A;  2C0D A;  1AQV A;  1PD2 1;  2DBC A;  4NHZ A;  3MWH A;  4YAV A;  2MYG A;  4WF4 A;  3HVS A;  2GT5 A;  2X8C A;  3FK8 A;  4IVF A;  1EV4 A;  1ZOF A;  2I81 A;  1G6Y A;  5D9V A;  3MDK A;  1ERW A;  3ED3 A;  4PUR A;  3MNG A;  2VUP A;  1X9W B;  1OYJ A;  3G7I A;  5EL8 A;  1I9D A;  2BJX A;  3CSH A;  3DD3 A;  2VL3 A;  5ECQ B;  4K9Z A;  5KN2 A;  3FZ4 A;  1YQ1 A;  1PRX A;  1X5C A;  5FHI A;  1T00 A;  4ULX A;  3KGK A;  3VI5 A;  4RQR A;  4K0G A;  1Q98 A;  4TW5 A;  2HE3 A;  3UMA A;  3DWV A;  4BVY A;  3CSI A;  1SJ6 A;  5J3R A;  2LJR A;  2RUE A;  22GS A;  2J9H A;  1EZK A;  3FHK A;  3R2Q A;  1AIU A;  2CT6 A;  3GKM A;  4OFT A;  5DDL A;  3BBY A;  2DIY A;  4JZQ A;  1GSS A;  3F4T A;  4IS0 A;  3L0H A;  3CRU A;  4AJ8 A;  3ZFL A;  3QDN A;  4LMW A;  1SJZ A;  1BAY A;  5HQP A;  4NXI A;  3GKX A;  5IOW A;  1SK0 A;  3GSS A;  5ID2 A;  4V1A p;  3RPN A;  4ML1 A;  5CRG A;  3VWX A;  1YF1 A;  2X8G A;  3D4M A;  2MBT A;  3QFB C;  1GTI A;  1Y25 A;  4TKY A;  2NDO A;  3IK7 A;  1KEB A;  16GS A;  4N30 A;  1MDK A;  1NHY A;  1AUC A;  3H4K A;  1ACV A;  2B1K A;  4MH2 A;  2WCI A;  2PN8 A;  1PA3 A;  4PQH A;  4YQM A;  1G0T A;  3TJJ A;  2LST A;  3VWW A;  4FQU A;  4AJ7 A;  3D0Z A;  4PNF A;  1ERT A;  3KCM A;  2LNS A;  2YWN A;  2DJ3 A;  3WD6 A;  7GSS A;  2QKE A;  2PMT A;  1HD2 A;  1WIK A;  2FA4 A;  2GZY A;  3LYP A;  1S3D A;  1XVQ A;  1SYR A;  3TKP A;  4IJ3 A;  4MMM A;  2DIZ A;  2XHF A;  4TXO A;  2VCQ A;  4WET A;  5J5N A;  2LJK A;  1T8E B;  3QR6 A;  2H01 A;  3KJY A;  4PNG A;  3O6T A;  3GL3 A;  14GS A;  3KIJ A;  3ME7 A;  4L0W A;  5IMF A;  2HRK A;  4ISD A;  1YEX A;  3UOM A;  3UBL A;  3APS A;  1GTA A;  4XS1 A;  1XVW A;  4EF0 A;  3HVX A;  1YY7 A;  4EDZ A;  2YAN A;  2VD0 A;  2BMX A;  4TVE A;  3EMP A;  5DCG A;  2E7P A;  2H1D A;  2H8L A;  1A0F A;  5G1K A;  4ECB A;  1A2J A;  2R6K A;  2KHP A;  3M8N A;  4MJB A;  1GRX A;  2OAC A;  3DVW A;  2JZR A;  4BL7 A;  4F0B A;  2DJ0 A;  3HHV A;  2WGR A;  4HJ2 A;  3A2V A;  5DAL B;  2AUV A;  4I5Q A;  5HFG A;  3VI7 A;  3I9V 2;  5CAX A;  5E59 A;  4OWY A;  4EXJ A;  3G7J A;  4IHU A;  3KH7 A;  4L5O A;  1ZMA A;  3TB2 A;  1VF2 A;  1F3B A;  4MP4 A;  1FHE A;  2AYT A;  5AN1 A;  1DSB A;  1R7H A;  2KOK A;  1EOH A;  2P0G A;  2K18 A;  3C1R A;  1B8X A;  2FA8 A;  1Z6M A;  4KAE A;  4ZB6 A;  2HLS A;  2OBK A;  4KND A;  1OC9 B;  4GQF A;  4TN8 A;  1X0R A;  4MZC A;  2F3M A;  2FD3 A;  3RAZ A;  1B4Q A;  2PVQ A;  1A8Y A;  2LNT A;  1Z6N A;  2OKA A;  2MZC A;  2F8F A;  2F8A A;  5IMD A;  2C3N A;  1FW1 A;  1X5E A;  5EPF A;  1ERU A;  1TJD A;  1LJR A;  1ZZY A;  4KA0 A;  2R3X A;  2CAQ A;  4TXV A;  2V41 A;  2GS3 A;  1NHO A;  3D21 A;  3VPT A;  5JWQ B;  3KMO A;  3LXZ A;  5J4U A;  3IC8 A;  4FYU A;  5D8I A;  4IW9 A;  2IPA A;  3KH9 A;  2PVO C;  3JCM L;  4EE0 A;  5J41 A;  1PKZ A;  2DJJ A;  5ECK B;  4GST A;  4KUN A;  3VWU A;  2CV4 A;  3MAK A;  4GRF A;  2IFQ B;  5EY6 A;  5J9B A;  1TP9 A;  1HYU A;  2H6Y A;  3I69 A;  2R37 A;  4DSS A;  1SL2 B;  1XWA A;  2K6V A;  5CNW A;  2ZNM A;  1EWX A;  1BX9 A;  1HNC A;  3HXS A;  6GSW A;  2HNL A;  4H86 A;  3TKS C;  3FRC A;  1N8J A;  4TR0 A;  3GTU B;  5D73 A;  2C1Y A;  1RW1 A;  3M9K A;  1AQX A;  3GL5 A;  3C73 A;  3ZL5 A;  3ZYW A;  1V2A A;  3A5W A;  2FWE A;  2H0H A;  1XW9 A;  4G0L A;  3D6I A;  4WKW A;  3W8S A;  1WPI A;  2FWF A;  2VM1 A;  4KF9 A;  2YWO A;  1PMT A;  3QFA C;  4V2N A;  3ISO A;  1OE7 A;  4KX4 A;  1TK8 B;  1O73 A;  2JAD A;  3UEM A;  2IJY A;  1TU7 A;  4K7N A;  4BWS A;  2LEG A;  3LYK A;  1ERV A;  2JZS A;  4N0Z A;  2DML A;  3HDC A;  3R3E A;  2HFD A;  5B7C A;  4DVC A;  4Q5N A;  4PX1 A;  5GAP D;  1Z7R A;  5ECO B;  5B8B A;  4MLY A;  2H6X A;  4POM A;  2H0I A;  6GST A;  3HZ4 A;  1SD8 A;  2MMZ A;  2QGV A;  3TUE A;  2CA8 A;  3ZRD A;  3CRT A;  2DLX A;  3SBC A;  2IMI A;  3GUR A;  4MK3 A;  3LWA A;  2IN3 A;  3M3M A;  3GX0 A;  2VO4 A;  2XC2 A;  4ECC A;  20GS A;  1Z9H A;  4HU9 A;  1QK8 A;  3KD0 A;  2VCV A;  1F3A A;  4TR4 A;  3IDV A;  4X0X A;  2L4C A;  4ZB8 A;  1U3A A;  1T1V A;  4PXO A;  1U87 A;  5HR1 A;  5CRH A;  1XCC A;  3FZ9 A;  4EO3 A;  3FZA A;  1W89 A;  3KZQ A;  2C0G A;  5G31 A;  2H75 A;  3LQ7 A;  4GSS A;  2VAF A;  1XOB A;  4NHW A;  10GS A;  1M99 A;  4GLT A;  3TRX A;  2C0E A;  3IA1 A;  5JCU A;  1A23 A;  1YKA A;  3DEX A;  5JWO B;  3LG6 A;  3HD5 A;  4V2L A;  3N9J A;  3U6V A;  4WBJ A;  3DRN A;  1TKD B;  2XBI A;  4OO4 A;  18GS A;  1PGT A;  2GTU A;  1K0B A;  1X9M B;  4MPF A;  4WXT A;  3RPP A;  4JR6 A;  3WGD A;  5AIS A;  4F03 A;  1SL1 B;  5ECL B;  2YCD A;  1GSF A;  1JZO A;  3ZFB A;  1O8X A;  1CQH A;  2P5Q A;  3C71 A;  3EUR A;  4RUV A;  1GSQ A;  2AAW A;  3UL3 A;  2C8U A;  1HNA A;  1K0C A;  4DSQ A;  1UVZ A;  2WDU A;  1KTE A;  5D9W A;  1SKS B;  1JLW A;  3E9J B;  1OE8 A;  2XPD A;  1GSD A;  2X64 A;  3I43 A;  2B3S A;  2YZH A;  1LU4 A;  3US3 A;  2TRC P;  5KN1 A;  3QD9 A;  4JR4 A;  2VOC A;  1RQM A;  5ECI B;  2C3Q A;  3GX8 A;  4OO5 A;  1GTU A;  2M72 A;  1GL8 A;  4CHS A;  2O89 A;  3F3Q A;  5DAL A;  2CVK A;  2OBI A;  4QL9 A;  3UJ1 A;  1K3O A;  1OVN A;  4BWQ A;  5CRD A;  4K6X A;  1V9W A;  3L9U A;  4TRX A;  3W8J A;  1ON4 A;  2L59 A;  5F07 A;  3FZ5 A;  1MD3 A;  3PH9 A;  5CYY A;  2N5F A;  3SWL A;  1EGO A;  4GQC A;  2LV3 A;  3CTG A;  3FR6 A;  4YAP A;  3AY8 A;  1M2B A;  2H6Z A;  1FG4 A;  3TKR A;  1OC9 A;  1SYX A;  2D2Z A;  1SD9 A;  1K3L A;  2H74 A;  2RLI A;  4J2F A;  2LRC A;  2F51 A;  2NBS A;  2CZ2 A;  1YF0 A;  2FNO A;  4NPB A;  1GUM A;  1FOV A;  3HJP A;  4MJE A;  2VD1 A;  4WBR D;  1F6M C;  3UAR A;  4OCE A;  1ZYQ B;  2B7K A;  3P2A A;  2V1M A;  3IXR A;  3S9F A;  1JZD A;  1YEP A;  4KGI A;  3H79 A;  5ECH B;  1KBN A;  4HJM A;  5C00 A;  3LFL A;  5ELG A;  1MEK A;  3LGC A;  2B7J A;  4CW9 A;  5B6M A;  3APO A;  5H5Q A;  2IWT A;  4XRD A;  3CMI A;  4XIH A;  3ZLP A;  2YWM A;  4F9Z A;  2VCT A;  1EGR A;  5B6N A;  2H19 A;  2WRT A;  2HQT A;  4N10 A;  1TK5 B;  3QCP A;  1M9A A;  4MF6 A;  5ECN B;  5AIX A;  1OC8 A;  2FUG 2;  5ECR B;  2VL2 C;  3WT2 A;  3WT1 A;  1TU8 A;  3GRX A;  4HEA 2;  5ENU A;  4POK A;  4G9H A;  1OC3 A;  2IFQ A;  4XS4 B;  4KSM A;  6GSX A;  2WJU A;  3EIN A;  4PQI A;  1E6B A;  2HSM B;  1HQO A;  2A2S A;  2C4J A;  1NW2 A;  2WUL A;  4MJC A;  1GUK A;  2AJQ B;  2MMN A;  3I6A A;  4EVM A;  2NTO A;  1BQ7 A;  2DJK A;  2R2J A;  2RII A;  3V1W A;  3GTU A;  1XWK A;  2H66 A;  2YN1 A;  1MD4 A;  3F3R A;  2K9F A;  5INY A;  2B5X A;  2VIM A;  5GAN D;  3G7Y A;  3GKN A;  2HYX A;  1OKD A;  1EP7 A;  3HJO A;  1W4V A;  1JZW A;  2PUK C;  1MDI A;  1VGL A;  1TW9 A;  3A2W A;  5ECS A;  5DCH A;  1USB A;  3K8N A;  1GLQ A;  3KTL A;  2VCZ A;  3Q74 A;  4HZ2 A;  1A2L A;  1THO A;  5GST A;  1YZX A;  3Q19 A;  2TRX A;  3G9B A;  4KE3 A;  4ECI A;  4NV5 A;  4MF7 A;  1T4Z A;  3UIW A;  3ERF A;  2GQK A;  3IAS 2;  1URM A;  4O92 A;  2DJ1 A;  4PUF C;  3EWL A;  4L5L A;  2OE3 A;  6GSY A;  2CX4 A;  5IIZ A;  1GWC A;  4HDE A;  1SK2 A;  2FCH A;  2GZP A;  2JL4 A;  1BED A;  3ZML A;  4HOJ A;  3LEF A;  5G1L A;  3TJG A;  2JU5 A;  1XOA A;  4OCF A;  4POB A;  1HNB A;  1MTC A;  2X8H A;  5DJM A;  4P3Y B;  3HVV A;  1WRY A;  3DML A;  2O87 A;  4YH2 A;  5D93 A;  1AC1 A;  1XWG A; 
#chains in the Genus database with same CATH topology
 2WB9 A;  3DGQ A;  2EIQ A;  1J9B A;  4X43 A;  5A5K A;  4V1A g;  1SK1 A;  4JE1 A;  3FY7 A;  3GKK A;  4FYC A;  4IEL A;  5FWG A;  1PX7 A;  1PN9 A;  1V40 A;  4EC0 A;  3PGT A;  4IP6 A;  5KEJ A;  4AGS A;  9GSS A;  2FWH A;  3VLN A;  1XPV A;  3QPM A;  3ZIV A;  3VK9 A;  4F0C A;  2JSY A;  3HCZ A;  2YJH A;  3L78 A;  1R5A A;  3ZRE A;  1FB0 A;  1J08 A;  1M2A A;  2GVP A;  1TRW A;  2CQ9 A;  3A2X A;  4ZBD A;  1GSU A;  2WZ9 A;  4G2E A;  3F63 A;  2JAC A;  2ALB A;  2PU9 C;  1K0D A;  2R4V A;  3KEB A;  4KDX A;  4LL4 B;  4ZL8 A;  4ZBA A;  5ECM B;  2UZ8 A;  3GV1 A;  4O7H A;  1T4Y A;  1YVL A;  13GS A;  1PQN A;  2LTK A;  2WVZ A;  4TR1 B;  2H73 A;  1WP0 A;  1G7E A;  2IMD A;  4GXZ A;  1PSQ A;  2KLX A;  2X99 A;  5A1N A;  4PI0 C;  2PPT A;  2YV7 A;  4OD7 A;  3TRQ A;  2WFC A;  2EIO A;  1F9M A;  4WR4 A;  4E8E A;  2PER A;  3M1G A;  1FAA A;  1GP1 A;  4MF5 A;  1FO5 A;  3F0I A;  1FB6 A;  2BTO T;  2IIY A;  2K8S A;  6GSU A;  2GT6 A;  1Q4J A;  3P90 A;  2TIR A;  2H1B A;  2YWI A;  4DEJ A;  5A34 B;  2N5A A;  2REM A;  2G2Q A;  4BA7 A;  4CDO A;  1U3I A;  2DSA A;  4K8M A;  2LRT A;  2A4V A;  3EE2 A;  4FYB A;  2GZZ A;  4JED A;  2I3Y A;  2MMA A;  1AAZ A;  4JBB A;  5A4W A;  3PR8 A;  3TGZ A;  2P31 A;  1O6J A;  4RQX A;  1ABA A;  3FR3 A;  1O85 A;  2VKZ G;  5IMC A;  4V2M A;  2IMF A;  2Z9S A;  4KCE A;  2HZF A;  1VRS D;  1TK0 B;  4HQZ A;  5D96 A;  2FWG A;  3TKQ A;  5E4W A;  1AW9 A;  3ZMK A;  1S3R A;  3F4R A;  3CTF A;  1PN0 A;  4L8E A;  17GS A;  3TKS E;  3UAP A;  2C80 A;  4ZL9 A;  3LJR A;  4QQ7 A;  4IKH A;  1THX A;  3IE3 A;  1SKW B;  3IR4 A;  2B5Y A;  2A2R A;  4PHZ C;  1FVJ A;  3DIE A;  5ELA A;  3CSJ A;  1M7T A;  4N3Z A;  3GFK A;  4OFN A;  3QAW A;  4KDU A;  3TKS A;  3EU4 A;  3HZ8 A;  4MZB A;  5IMZ A;  2H0G A;  2E2G A;  4K0N A;  2GQL A;  3EC3 A;  3HKR A;  4NWY A;  2GSR A;  5KN3 A;  2DKI A;  2YPM A;  4MZW A;  4J56 E;  3ZVJ D;  2EC4 A;  1V98 A;  1R4W A;  4NMU A;  3U5R E;  3HY2 A;  5GSS A;  2YP6 A;  3QAG A;  4ECJ A;  3ZIJ A;  1TDI A;  4JU5 A;  4K7I A;  2C0F A;  2H72 A;  1ZCP A;  4RI7 A;  5G2Z A;  1OKT A;  3H8Q A;  1BJX A;  4J57 E;  2LJA A;  4GSN A;  3OR5 A;  4K7O A;  3EYT A;  3ME8 A;  4IN0 A;  4XS4 A;  3QMX A;  1K0A A;  1PFO A;  4Q5R A;  1S3A A;  2RM5 A;  3IRA A;  2HSM A;  4ZIL A;  3UVH A;  4XTS A;  1BG5 A;  2VLV A;  4XHM A;  4KCA A;  3IK9 A;  4IBP A;  3Q18 A;  4G01 A;  1RK4 A;  1PX6 A;  4FH8 A;  2VCW A;  2RM6 A;  1VF3 A;  3RBT A;  5HFI A;  1EP8 A;  5AGY A;  2V6K A;  2L6D A;  4ZIJ A;  4KDY A;  4XCS A;  5IM9 A;  4USS A;  1XXU A;  1TTZ A;  4EDY A;  1DE2 A;  1N2A A;  1QQ2 A;  2WS2 A;  1A0R P;  4K1F A;  4D73 B;  2GDR A;  1UN2 A;  2ON7 A;  2M46 A;  1E2Y A;  2R0G A;  4EUY A;  3CYN A;  1XZO A;  3HYP A;  3KXO A;  5ABR A;  2AB6 A;  2VLT A;  1O8W A;  5A5H A;  3L9V A;  2HZE B;  1FVK A;  2LQO A;  3F6F A;  3VWV A;  2H71 A;  2QSI A;  3VPQ A;  2YJ7 A;  5L71 A;  5ECP B;  2GLR A;  3CQF A;  3RHB A;  2P5R A;  2EIR A;  2AHE A;  3GN3 A;  2KP2 A;  4POL A;  3L9S A;  5DQS A;  4NV2 A;  1XW6 A;  2CZ3 A;  3IC4 A;  3IOS A;  5KN0 A;  2HRN A;  3IHQ A;  5AIV A;  1EEJ A;  4TR3 A;  3ZTL A;  2YZU A;  4ML6 A;  4I6X A;  2JZT A;  5IMV A;  4MA9 A;  2EFE A;  1K0N A;  2GSS A;  2IL3 A;  1TOF A;  3L4N A;  1XW5 A;  1UA5 A;  1WE0 A;  1XWB A;  1V57 A;  2N5B A;  1T3B A;  5CP1 A;  1R5P A;  3CBU A;  4EL1 A;  2X49 A;  2L5L A;  5DJL A;  3J7Y b;  1SVL A;  4ICY A;  1SEN A;  2OE0 A;  1ZYE A;  2OAD A;  4YQV A;  1TRU A;  2XBQ A;  4XRA A;  4FIW A;  4G19 A;  3D22 A;  1GTB A;  4F2I A;  1WWJ A;  2DMM A;  1SKR B;  2HRA A;  4WF5 A;  1V58 A;  1G6W A;  4YKF A;  1A8L A;  1TI1 A;  1Z5Y E;  1QFN A;  2LUS A;  5FT3 A;  3HA9 A;  3HVN A;  1GNE A;  6GSV A;  3WGX A;  1TXX A;  3EMX A;  3MSZ A;  4PI2 C;  3GH9 A;  2OA7 A;  3EU3 A;  8GSS A;  1T7P B;  4NAX A;  5IPG A;  1J0F A;  3E0U A;  4I97 A;  2H1G A;  1PL2 A;  2MBS A;  3MIX A;  5IMA A;  5DAK B;  2WZS A;  2XPE A;  3QAV A;  4IQ1 A;  1C72 A;  2DC5 A;  2FLS A;  1WJK A;  5IOX A;  1F37 A;  5H5S A;  4WEY A;  5BMU B;  3ZZX A;  3IAM 2;  5F8B A;  2NVL A;  4Q5F A;  3QOU A;  2CAI A;  2M80 A;  1X9S B;  1SL0 B;  4K2D A;  1ZL9 A;  4TR1 A;  4CY8 A;  3RDW A;  3C1S A;  2B1L A;  3P8W A;  3PPU A;  4O5R A;  3DKS A;  1H4O A;  4MPG A;  3FKF A;  2FGX A;  5GZZ B;  3APQ A;  2O3E A;  2ZUP A;  1EV9 A;  1FOH A;  1WMJ A;  4BVX A;  2RUF A;  2E0Q A;  1A24 A;  4PUA A;  1K0M A;  5B8A A;  1GSE A;  1I1I P;  5A34 A;  4GTU A;  5D9T A;  3LOR A;  1PL1 A;  5HFK A;  4XS6 A;  3O76 A;  1SU9 A;  3VFI A;  2GQM A;  1U6T A;  5A5H B;  2I1U A;  5HR3 A;  4AKI A;  1MDJ A;  5A4V A;  1EEM A;  4G0I A;  3TOU A;  4BIK A;  2LKU A;  2L5O A;  3A3T A;  2WW0 A;  1YEW C;  2LS5 A;  2FHE A;  1ILO A;  4MJA A;  4TOP A;  4HZ4 A;  2VL9 A;  3HJM A;  2MMO A;  2VLU A;  4N0V A;  1M0U A;  1GUL A;  2CVB A;  2VL2 A;  4I2T A;  4PQ1 A;  1DE1 A;  3ERG A;  4ZB9 A;  4AJ6 A;  3BJ5 A;  1B9Y C;  5LCZ A;  1S3C A;  1OAZ A;  5IO2 A;  2I9H A;  4IP1 A;  4G0K A;  3FEU A;  4GCI A;  2YV9 A;  1DBY A;  2YNX A;  5A4U A;  1NM3 A;  4LA1 A;  5JCW A;  2EFC A;  1NSW A;  3C7M A;  3D4T A;  1SJI A;  3GST A;  5DQY A;  4BVY B;  3H1N A;  19GS A;  2HSN A;  5HR2 A;  3GH6 A;  11GS A;  3EVI A;  4OMV A;  3P7X A;  3Q6O A;  5HR0 A;  4HI7 A;  1R26 A;  1I5G A;  1Y6E A;  1ST9 A;  1TXU A;  3LSZ A;  1GH2 A;  4IGJ A;  2V2G A;  3KM6 A;  2QA1 A;  5IPH A;  1YJ6 A;  4F82 A;  1XFL A;  5ID2 B;  4Z7X A;  3W6G A;  2OE1 A;  2C3T A;  1AQW A;  4LLR A;  4WR5 A;  5F05 A;  5CRE A;  1DUG A;  3BCI A;  4PTS A;  5J9C A;  1G7O A;  5DBQ A;  2O85 A;  1JZR A;  5LD0 A;  3GUS A;  3DXB A;  2PWJ A;  1IYH A;  4O5Q A;  4GWR A;  4HQS A;  2IMK A;  1Z7P A;  5JCG A;  4ACS A;  2HXK A;  4ZXG A;  1QGV A;  3TJB A;  2FY6 A;  4Z2R A;  1M9B A;  2V32 A;  1F2E A;  2J23 A;  4QL7 A;  1S4B P;  4N11 A;  1QMV A;  4L0U A;  2L4Q A;  2H70 A;  1JHB A;  4D73 A;  2HT9 A;  4MH3 A;  4KH7 A;  1SVO A;  1QXH A;  4BVX B;  5LNK e;  3BOA A;  5D9X A;  1B9X C;  2UV8 G;  3WGE A;  2O8V B;  2LRN A;  1XWC A;  3M9J A;  3TU3 B;  4MAB A;  4TXO B;  3KP9 A;  1YKC A;  2HZE A;  4RI6 A;  2AV4 A;  1TRS A;  2WW2 A;  5F06 A;  1PKW A;  1TI3 A;  3GNJ A;  1QUW A;  3BCK A;  4GDF A;  3F6D A;  2PGT A;  1KNG A;  4ZBB A;  3KP8 A;  5F0G A;  2L57 A;  2HRK B;  1O7U A;  4OFM A;  1Z3E A;  1EOG A;  2CX3 A;  5KOX A;  2F9S A;  3TJK A;  1WOU A;  1A2M A;  1SVM A;  4JRR A;  4PGT A;  2V6O A;  4BPY A;  3GIX A;  4X1U A;  2G0F A;  2H1A A;  4ILF A;  4BL7 B;  3TCO A;  1B4P A;  4DSR A;  3DYR A;  1ML6 A;  1B48 A;  2K8V A;  4KB3 A;  4Q5Q A;  3GMF A;  1IYI A;  4AKG A;  3F4S A;  2HSY A;  12GS A;  4E8H A;  3TOT A;  1U88 A;  1XIY A;  3F8U A;  3RHC A;  1AXD A;  3GHA A;  1ZGN A;  3J7Y k;  2R5G A;  3LXT A;  2O7K A;  4G10 A;  3FR9 A;  4K2X A;  5DVB A;  2DJ2 A;  5IO0 A;  3WYW A;  5CO3 A;  3TDG A;  2KP1 A;  2GSQ A;  3TRP A;  1K3Y A;  2H1L A;  4EKZ A;  1GLP A;  3PIN A;  2B5E A;  3C8E A;  4AKX B;  2GGT A;  4FO5 A;  4ZL7 A;  2HSN B;  4HS1 A;  1M2D A;  2CVD A;  1YDK A;  2OJL A;  4IJI A;  3TJF A;  3F9U A;  5CRW A;  3O3T A;  4ID0 A;  1K0O A;  4YKG A;  3GA4 A;  4YQU A;  2I4A A;  5DAK A;  1LBK A;  5JWR B;  4MDC A;  2IME A;  2HI7 A;  4O32 A;  1CQG A;  3IV4 A;  2LQQ A;  5BMU A;  2B6M A;  2H30 A;  2NPB A;  2QC7 A;  1O81 A;  2L6C A;  4KW6 A;  4IQA A;  3N5O A;  1JLV A;  4LL1 B;  2H76 A;  2HSH A;  2VCX A;  1GNW A;  1GSY A;  2DKH A;  3M0F A;  1ZYN A;  2KUC A;  3ZIT A;  5EVO A;  2ES7 A;  3NOF A;  3VUR A;  2ZCT A;  2ON5 A;  2HRF A;  2JSZ A;  3DVX A;  5IQY A;  1H75 A;  4DSS B;  4KSO A;  3E3E A;  4GF0 A;  3H93 A;  3ERW A;  5C04 A;  3NZN A;  2GST A;  1XBS A;  4I8B A;  4MNN A;  3UBK A;  4HUA A;  1ZYP A;  5COH A;  1BYE A;  5G30 A;  3NIV A;  3CXG A;  5G5E A;  4LMV A;  3KTB A;  3FW2 A;  2VM2 A;  3ZVJ A;  2PBJ A;  4AF2 A;  1GUH A;  3KMN A;  4I2U A;  1TRV A;  1VF4 A;  3FYG A;  6GSS A;  3BD2 A;  2YOI A;  4FXY P;  5G5F A;  4HU7 A;  1VF1 A;  3GYK A;  2E2M A;  1JFU A;  3IBH A;  3UVT A;  3D5J A;  3IPZ A;  4MCU A;  5H5R A;  1X5D A;  1UC7 A;  2C0D A;  1AQV A;  1PD2 1;  2DBC A;  3MYD A;  4NHZ A;  3MWH A;  4YAV A;  2MYG A;  4WF4 A;  5J40 A;  3HVS A;  2GT5 A;  2X8C A;  3FK8 A;  4IVF A;  1EV4 A;  1ZOF A;  2I81 A;  1G6Y A;  5D9V A;  3MDK A;  1ERW A;  3ED3 A;  4PUR A;  3HMJ G;  2VUP A;  3MNG A;  1X9W B;  1OYJ A;  3G7I A;  5EL8 A;  1I9D A;  2BJX A;  3CSH A;  2WVY A;  3DD3 A;  2VL3 A;  5ECQ B;  4K9Z A;  5KN2 A;  3FZ4 A;  1YQ1 A;  1PRX A;  1X5C A;  5FHI A;  1T00 A;  4ULX A;  3KGK A;  3VI5 A;  4RQR A;  4K0G A;  1Q98 A;  4TW5 A;  2HE3 A;  3UMA A;  3DWV A;  4BVY A;  3CSI A;  1SJ6 A;  5J3R A;  1BG1 A;  2LJR A;  2RUE A;  22GS A;  2J9H A;  1EZK A;  3FHK A;  3R2Q A;  1AIU A;  2CT6 A;  2X4A A;  3GKM A;  4OFT A;  5DDL A;  3BBY A;  2DIY A;  2A4H A;  4JZQ A;  1GSS A;  3F4T A;  4IS0 A;  3L0H A;  3CRU A;  4AJ8 A;  3ZFL A;  3QDN A;  4LMW A;  1SJZ A;  3LW9 A;  1BAY A;  5HQP A;  4NXI A;  3GKX A;  5IOW A;  1SK0 A;  3GSS A;  5ID2 A;  4V1A p;  3RPN A;  4ML1 A;  5CRG A;  3VWX A;  1YF1 A;  2X8G A;  3D4M A;  2MBT A;  3QFB C;  4X4J A;  5BRT A;  1GTI A;  1Y25 A;  4TKY A;  2NDO A;  3IK7 A;  1KEB A;  16GS A;  4N30 A;  1MDK A;  3FMW A;  1NHY A;  1AUC A;  3H4K A;  1ACV A;  2B1K A;  4MH2 A;  2WCI A;  2PN8 A;  1PA3 A;  4PQH A;  4YQM A;  1G0T A;  3TJJ A;  2LST A;  3VWW A;  4FQU A;  4AJ7 A;  3D0Z A;  4PNF A;  1ERT A;  3KCM A;  2LNS A;  2YWN A;  4K5S A;  2DJ3 A;  3WD6 A;  7GSS A;  2QKE A;  2PMT A;  1HD2 A;  1WIK A;  2FA4 A;  2GZY A;  3LYP A;  2O5V A;  1S3D A;  1XVQ A;  1SYR A;  3TKP A;  4IJ3 A;  4MMM A;  2DIZ A;  2XHF A;  4TXO A;  2VCQ A;  4AKH A;  4WET A;  5J5N A;  2LJK A;  1T8E B;  3QR6 A;  2H01 A;  3KJY A;  4PNG A;  3O6T A;  3GL3 A;  14GS A;  3KIJ A;  3ME7 A;  4L0W A;  5IMF A;  2HRK A;  4ISD A;  1YEX A;  3UOM A;  3UBL A;  3APS A;  1GTA A;  4XS1 A;  1XVW A;  4EF0 A;  3HVX A;  1YY7 A;  4EDZ A;  2YAN A;  2VD0 A;  2BMX A;  4TVE A;  3EMP A;  5DCG A;  2E7P A;  2H1D A;  2H8L A;  1A0F A;  5G1K A;  4ECB A;  1A2J A;  2R6K A;  2KHP A;  3M8N A;  4MJB A;  1GRX A;  2OAC A;  3DVW A;  2JZR A;  4BL7 A;  4F0B A;  2DJ0 A;  3HHV A;  2WGR A;  4HJ2 A;  3A2V A;  5DAL B;  2AUV A;  4Z2U A;  4I5Q A;  5HFG A;  3VI7 A;  3I9V 2;  5CAX A;  5E59 A;  2R0C A;  4OWY A;  4EXJ A;  3G7J A;  4IHU A;  3KH7 A;  3CHX C;  4L5O A;  1ZMA A;  3TB2 A;  1VF2 A;  1F3B A;  4MP4 A;  1FHE A;  2AYT A;  5AN1 A;  1DSB A;  1R7H A;  2KOK A;  4ZB7 A;  1EOH A;  2P0G A;  2R0P A;  2K18 A;  3C1R A;  1B8X A;  2FA8 A;  1Z6M A;  4KAE A;  4ZB6 A;  2HLS A;  2OBK A;  4KND A;  4K5R A;  1OC9 B;  4GQF A;  4TN8 A;  1X0R A;  3EPT A;  4MZC A;  2F3M A;  2FD3 A;  3RAZ A;  1M3I A;  1B4Q A;  2PVQ A;  1A8Y A;  2LNT A;  1Z6N A;  2OKA A;  3IHG A;  2MZC A;  2F8F A;  2F8A A;  5IMD A;  2C3N A;  1FW1 A;  1X5E A;  5EPF A;  1ERU A;  4O5U A;  1TJD A;  2OT3 A;  1LJR A;  1ZZY A;  4KA0 A;  2R3X A;  2CAQ A;  4TXV A;  2V41 A;  2GS3 A;  1NHO A;  3D21 A;  3VPT A;  4AI6 A;  5JWQ B;  3KMO A;  3LXZ A;  2O36 A;  5J4U A;  3IC8 A;  2EFD A;  4FYU A;  5D8I A;  4IW9 A;  2IPA A;  3KH9 A;  2PVO C;  3JCM L;  4EE0 A;  5J41 A;  1PKZ A;  2DJJ A;  5ECK B;  4GST A;  2A2P A;  4KUN A;  3VWU A;  2CV4 A;  3MAK A;  4GRF A;  2IFQ B;  5EY6 A;  2EFH A;  5J9B A;  1TP9 A;  1HYU A;  2H6Y A;  3I69 A;  2R37 A;  4DSS A;  1SL2 B;  1XWA A;  2WW3 A;  2K6V A;  5CNW A;  2ZNM A;  1EWX A;  1BX9 A;  1HNC A;  3HXS A;  6GSW A;  2HNL A;  4H86 A;  2QA2 A;  3TKS C;  3FRC A;  1N8J A;  4TR0 A;  3GTU B;  5D73 A;  2C1Y A;  1RW1 A;  3M9K A;  1AQX A;  3GL5 A;  3C73 A;  3ZL5 A;  3ZYW A;  1V2A A;  3A5W A;  2FWE A;  2H0H A;  1XW9 A;  4G0L A;  3D6I A;  3RGB C;  4WKW A;  3W8S A;  1WPI A;  2FWF A;  2VM1 A;  4KF9 A;  2YWO A;  1PMT A;  3QFA C;  4HSC X;  4V2N A;  3ISO A;  1OE7 A;  4KX4 A;  1TK8 B;  1O73 A;  1BF5 A;  2JAD A;  3UEM A;  2IJY A;  1TU7 A;  4K7N A;  4BWS A;  2LEG A;  3LYK A;  1ERV A;  2JZS A;  4N0Z A;  2DML A;  3RFR C;  3HDC A;  3R3E A;  2HFD A;  5B7C A;  4DVC A;  5J4V A;  4Q5N A;  4PX1 A;  5GAP D;  1Z7R A;  2WVX B;  5ECO B;  5B8B A;  4MLY A;  2H6X A;  4POM A;  2H0I A;  6GST A;  3A5I A;  3HZ4 A;  1SD8 A;  2MMZ A;  2QGV A;  3TUE A;  2CA8 A;  3ZRD A;  3CRT A;  2DLX A;  3SBC A;  2IMI A;  3GUR A;  4MK3 A;  3LWA A;  2IN3 A;  3M3M A;  3GX0 A;  2VO4 A;  2XC2 A;  4ECC A;  20GS A;  1Z9H A;  4HU9 A;  1QK8 A;  3KD0 A;  2VCV A;  1F3A A;  4TR4 A;  3IDV A;  4X0X A;  2L4C A;  4ZB8 A;  1U3A A;  1T1V A;  1M3J A;  4PXO A;  1U87 A;  5HR1 A;  5CRH A;  1XCC A;  3FZ9 A;  4EO3 A;  3FZA A;  1W89 A;  3KZQ A;  4QMK A;  2C0G A;  5G31 A;  2H75 A;  3LQ7 A;  4GSS A;  2VAF A;  1XOB A;  4NHW A;  10GS A;  4W66 A;  1M99 A;  4GLT A;  3TRX A;  2C0E A;  3IA1 A;  5JCU A;  1A23 A;  1YKA A;  3DEX A;  5JWO B;  3LG6 A;  3HD5 A;  4V2L A;  3N9J A;  3U6V A;  4WBJ A;  4A5P A;  3DRN A;  1TKD B;  2XBI A;  4OO4 A;  18GS A;  1PGT A;  2GTU A;  1K0B A;  1X9M B;  4MPF A;  4WXT A;  3RPP A;  4JR6 A;  3WGD A;  5AIS A;  4F03 A;  1SL1 B;  5KOW A;  5ECL B;  2YCD A;  1GSF A;  1JZO A;  3ZFB A;  1O8X A;  1CQH A;  5A1N B;  2P5Q A;  3C71 A;  3EUR A;  4RUV A;  1GSQ A;  2AAW A;  3UL3 A;  2C8U A;  1HNA A;  1K0C A;  4DSQ A;  1UVZ A;  2WDU A;  1KTE A;  5D9W A;  1SKS B;  1JLW A;  3E9J B;  1OE8 A;  2XPD A;  1GSD A;  2X64 A;  3I43 A;  2B3S A;  2YZH A;  1LU4 A;  3US3 A;  2TRC P;  5KN1 A;  3QD9 A;  4JR4 A;  2VOC A;  1RQM A;  5ECI B;  2C3Q A;  3GX8 A;  4OO5 A;  1GTU A;  2M72 A;  1GL8 A;  4CHS A;  2O89 A;  3F3Q A;  5DAL A;  2CVK A;  2OBI A;  4QL9 A;  3UJ1 A;  1K3O A;  1OVN A;  4BWQ A;  5CRD A;  4K6X A;  1V9W A;  3L9U A;  4TRX A;  3W8J A;  1ON4 A;  2L59 A;  5F07 A;  3FZ5 A;  1MD3 A;  3PH9 A;  1Y1U A;  4E68 A;  5CYY A;  2N5F A;  3SWL A;  1EGO A;  4EIP A;  4GQC A;  2LV3 A;  3CTG A;  3FR6 A;  4YAP A;  3AY8 A;  1M2B A;  2H6Z A;  1FG4 A;  3TKR A;  1OC9 A;  1SYX A;  2D2Z A;  1SD9 A;  1K3L A;  2H74 A;  2RLI A;  4J2F A;  2LRC A;  2F51 A;  2NBS A;  2CZ2 A;  1YF0 A;  2FNO A;  4NPB A;  1GUM A;  1FOV A;  3HJP A;  4MJE A;  2VD1 A;  4WBR D;  1F6M C;  3UAR A;  4OCE A;  1ZYQ B;  2B7K A;  3P2A A;  2V1M A;  4EIQ A;  3IXR A;  3S9F A;  1JZD A;  1YEP A;  4KGI A;  3H79 A;  5ECH B;  1KBN A;  4HJM A;  5C00 A;  3LFL A;  5ELG A;  1MEK A;  3LGC A;  2B7J A;  4CW9 A;  5B6M A;  3APO A;  5H5Q A;  2IWT A;  4XRD A;  3CMI A;  4XIH A;  3ZLP A;  2YWM A;  4F9Z A;  2VCT A;  1EGR A;  5B6N A;  2H19 A;  2WRT A;  2HQT A;  4N10 A;  1TK5 B;  3QCP A;  1M9A A;  4MF6 A;  5ECN B;  5AIX A;  1OC8 A;  2FUG 2;  5ECR B;  5J47 A;  2VL2 C;  3WT2 A;  3WT1 A;  1TU8 A;  3GRX A;  4HEA 2;  5ENU A;  4CY6 A;  4POK A;  4G9H A;  1OC3 A;  2IFQ A;  4XS4 B;  4KSM A;  6GSX A;  2WJU A;  3EIN A;  4Z2T A;  4PQI A;  1E6B A;  2HSM B;  1HQO A;  2A2S A;  1N25 A;  2C4J A;  1NW2 A;  2WUL A;  4MJC A;  1GUK A;  2AJQ B;  2MMN A;  3I6A A;  4EVM A;  2NTO A;  1BQ7 A;  2DJK A;  2R2J A;  2RII A;  3V1W A;  3GTU A;  1XWK A;  2H66 A;  2YN1 A;  1MD4 A;  3F3R A;  2K9F A;  5INY A;  2B5X A;  2VIM A;  5GAN D;  3G7Y A;  3GKN A;  2HYX A;  1OKD A;  1EP7 A;  3HJO A;  1W4V A;  1JZW A;  2PUK C;  1MDI A;  1VGL A;  1TW9 A;  3A2W A;  5ECS A;  5DCH A;  1USB A;  3K8N A;  1GLQ A;  3KTL A;  2VCZ A;  3Q74 A;  4HZ2 A;  1A2L A;  1THO A;  5GST A;  1YZX A;  3Q19 A;  2TRX A;  3G9B A;  4KE3 A;  4ECI A;  4NV5 A;  4MF7 A;  1T4Z A;  3UIW A;  3ERF A;  2WVX A;  2GQK A;  5J4Y A;  3IAS 2;  1XG8 A;  1URM A;  4O92 A;  2DJ1 A;  4PUF C;  3EWL A;  4L5L A;  2OE3 A;  6GSY A;  2CX4 A;  5IIZ A;  1GWC A;  4HDE A;  1SK2 A;  2FCH A;  3CWG A;  2GZP A;  2JL4 A;  1BED A;  3ZML A;  4HOJ A;  3LEF A;  5G1L A;  3TJG A;  2JU5 A;  1XOA A;  4OCF A;  4POB A;  1HNB A;  1MTC A;  2X8H A;  5DJM A;  4P3Y B;  3HVV A;  1WRY A;  3DML A;  2O87 A;  2WW1 A;  4YH2 A;  5D93 A;  1AC1 A;  1XWG A; 
#chains in the Genus database with same CATH homology
 2WB9 A;  3DGQ A;  2EIQ A;  1J9B A;  4X43 A;  5A5K A;  4V1A g;  1SK1 A;  4JE1 A;  3FY7 A;  3GKK A;  4FYC A;  4IEL A;  5FWG A;  1PX7 A;  1PN9 A;  1V40 A;  4EC0 A;  3PGT A;  4IP6 A;  5KEJ A;  4AGS A;  9GSS A;  2FWH A;  3VLN A;  1XPV A;  3QPM A;  3ZIV A;  3VK9 A;  4F0C A;  2JSY A;  3HCZ A;  2YJH A;  3L78 A;  1R5A A;  3ZRE A;  1FB0 A;  1J08 A;  1M2A A;  2GVP A;  1TRW A;  2CQ9 A;  3A2X A;  4ZBD A;  1GSU A;  2WZ9 A;  4G2E A;  3F63 A;  2JAC A;  2ALB A;  2PU9 C;  1K0D A;  2R4V A;  3KEB A;  4KDX A;  4LL4 B;  4ZL8 A;  4ZBA A;  5ECM B;  2UZ8 A;  3GV1 A;  4O7H A;  1T4Y A;  1YVL A;  13GS A;  1PQN A;  2LTK A;  4TR1 B;  2H73 A;  1WP0 A;  1G7E A;  2IMD A;  4GXZ A;  1PSQ A;  2KLX A;  2X99 A;  5A1N A;  2PPT A;  2YV7 A;  4OD7 A;  3TRQ A;  2WFC A;  2EIO A;  1F9M A;  4WR4 A;  4E8E A;  2PER A;  3M1G A;  1FAA A;  1GP1 A;  4MF5 A;  1FO5 A;  3F0I A;  1FB6 A;  2BTO T;  2IIY A;  2K8S A;  6GSU A;  2GT6 A;  1Q4J A;  3P90 A;  2TIR A;  2H1B A;  2YWI A;  4DEJ A;  5A34 B;  2N5A A;  2REM A;  2G2Q A;  4BA7 A;  4CDO A;  1U3I A;  2DSA A;  4K8M A;  2LRT A;  2A4V A;  3EE2 A;  4FYB A;  2GZZ A;  4JED A;  2I3Y A;  2MMA A;  1AAZ A;  4JBB A;  5A4W A;  3PR8 A;  3TGZ A;  2P31 A;  1O6J A;  4RQX A;  1ABA A;  3FR3 A;  1O85 A;  2VKZ G;  5IMC A;  4V2M A;  2IMF A;  2Z9S A;  4KCE A;  2HZF A;  1VRS D;  1TK0 B;  4HQZ A;  5D96 A;  2FWG A;  3TKQ A;  5E4W A;  1AW9 A;  3ZMK A;  3F4R A;  3CTF A;  1PN0 A;  4L8E A;  17GS A;  3TKS E;  3UAP A;  2C80 A;  4ZL9 A;  3LJR A;  4QQ7 A;  4IKH A;  1THX A;  3IE3 A;  1SKW B;  3IR4 A;  2B5Y A;  2A2R A;  3DIE A;  1FVJ A;  5ELA A;  3CSJ A;  1M7T A;  4N3Z A;  3GFK A;  4OFN A;  3QAW A;  4KDU A;  3TKS A;  3EU4 A;  3HZ8 A;  4MZB A;  5IMZ A;  2H0G A;  2E2G A;  4K0N A;  2GQL A;  3EC3 A;  3HKR A;  4NWY A;  2GSR A;  5KN3 A;  2DKI A;  2YPM A;  4MZW A;  4J56 E;  3ZVJ D;  2EC4 A;  1V98 A;  1R4W A;  4NMU A;  3U5R E;  3HY2 A;  5GSS A;  2YP6 A;  3QAG A;  4ECJ A;  3ZIJ A;  1TDI A;  4JU5 A;  4K7I A;  2C0F A;  2H72 A;  1ZCP A;  4RI7 A;  5G2Z A;  1OKT A;  3H8Q A;  1BJX A;  4J57 E;  2LJA A;  4GSN A;  3OR5 A;  4K7O A;  3EYT A;  3ME8 A;  4IN0 A;  4XS4 A;  3QMX A;  1K0A A;  4Q5R A;  1S3A A;  2RM5 A;  3IRA A;  2HSM A;  4ZIL A;  3UVH A;  4XTS A;  1BG5 A;  2VLV A;  4XHM A;  4KCA A;  3IK9 A;  4IBP A;  3Q18 A;  4G01 A;  1RK4 A;  1PX6 A;  4FH8 A;  2VCW A;  2RM6 A;  1VF3 A;  3RBT A;  5HFI A;  1EP8 A;  5AGY A;  2V6K A;  2L6D A;  4ZIJ A;  4KDY A;  4XCS A;  5IM9 A;  4USS A;  1XXU A;  1TTZ A;  4EDY A;  1DE2 A;  1N2A A;  1QQ2 A;  2WS2 A;  1A0R P;  4K1F A;  4D73 B;  2GDR A;  1UN2 A;  2ON7 A;  2M46 A;  1E2Y A;  2R0G A;  4EUY A;  3CYN A;  1XZO A;  3HYP A;  3KXO A;  5ABR A;  2AB6 A;  2VLT A;  1O8W A;  5A5H A;  3L9V A;  2HZE B;  1FVK A;  2LQO A;  3F6F A;  3VWV A;  2H71 A;  2QSI A;  3VPQ A;  2YJ7 A;  5L71 A;  5ECP B;  2GLR A;  3RHB A;  2P5R A;  2EIR A;  2AHE A;  3GN3 A;  2KP2 A;  4POL A;  3L9S A;  5DQS A;  4NV2 A;  1XW6 A;  2CZ3 A;  3IC4 A;  3IOS A;  5KN0 A;  2HRN A;  3IHQ A;  5AIV A;  1EEJ A;  4TR3 A;  3ZTL A;  2YZU A;  4ML6 A;  4I6X A;  2JZT A;  5IMV A;  4MA9 A;  2EFE A;  1K0N A;  2GSS A;  2IL3 A;  1TOF A;  3L4N A;  1XW5 A;  1UA5 A;  1WE0 A;  1XWB A;  1V57 A;  2N5B A;  1T3B A;  5CP1 A;  1R5P A;  3CBU A;  4EL1 A;  2X49 A;  2L5L A;  5DJL A;  3J7Y b;  1SVL A;  4ICY A;  1SEN A;  2OE0 A;  1ZYE A;  2OAD A;  4YQV A;  1TRU A;  2XBQ A;  4XRA A;  4FIW A;  4G19 A;  3D22 A;  1GTB A;  4F2I A;  1WWJ A;  2DMM A;  1SKR B;  2HRA A;  4WF5 A;  1V58 A;  1G6W A;  4YKF A;  1A8L A;  1TI1 A;  1Z5Y E;  1QFN A;  2LUS A;  5FT3 A;  3HA9 A;  1GNE A;  6GSV A;  3WGX A;  1TXX A;  3EMX A;  3MSZ A;  3GH9 A;  2OA7 A;  3EU3 A;  8GSS A;  1T7P B;  4NAX A;  5IPG A;  1J0F A;  3E0U A;  4I97 A;  2H1G A;  1PL2 A;  2MBS A;  3MIX A;  5IMA A;  5DAK B;  2XPE A;  3QAV A;  4IQ1 A;  1C72 A;  2DC5 A;  2FLS A;  1WJK A;  5IOX A;  1F37 A;  5H5S A;  4WEY A;  5BMU B;  3ZZX A;  3IAM 2;  5F8B A;  2NVL A;  4Q5F A;  3QOU A;  2CAI A;  2M80 A;  1X9S B;  1SL0 B;  4K2D A;  1ZL9 A;  4TR1 A;  4CY8 A;  3RDW A;  3C1S A;  2B1L A;  3P8W A;  3PPU A;  4O5R A;  3DKS A;  1H4O A;  4MPG A;  3FKF A;  2FGX A;  5GZZ B;  3APQ A;  2ZUP A;  1EV9 A;  1FOH A;  1WMJ A;  4BVX A;  2RUF A;  2E0Q A;  1A24 A;  4PUA A;  1K0M A;  5B8A A;  1GSE A;  3LOR A;  5A34 A;  4GTU A;  5D9T A;  1PL1 A;  5HFK A;  4XS6 A;  3O76 A;  1SU9 A;  3VFI A;  2GQM A;  1U6T A;  5A5H B;  2I1U A;  5HR3 A;  4AKI A;  1MDJ A;  5A4V A;  1EEM A;  4G0I A;  3TOU A;  2LKU A;  2L5O A;  3A3T A;  2LS5 A;  2FHE A;  1ILO A;  4MJA A;  4TOP A;  4HZ4 A;  2VL9 A;  3HJM A;  2MMO A;  2VLU A;  4N0V A;  1M0U A;  1GUL A;  2CVB A;  2VL2 A;  4I2T A;  4PQ1 A;  1DE1 A;  3ERG A;  4ZB9 A;  4AJ6 A;  3BJ5 A;  1B9Y C;  5LCZ A;  1S3C A;  1OAZ A;  5IO2 A;  2I9H A;  4IP1 A;  4G0K A;  3FEU A;  4GCI A;  2YV9 A;  1DBY A;  2YNX A;  5A4U A;  1NM3 A;  4LA1 A;  5JCW A;  2EFC A;  1NSW A;  3C7M A;  3D4T A;  1SJI A;  3GST A;  5DQY A;  4BVY B;  3H1N A;  19GS A;  2HSN A;  5HR2 A;  3GH6 A;  11GS A;  3EVI A;  4OMV A;  3P7X A;  3Q6O A;  5HR0 A;  4HI7 A;  1R26 A;  1I5G A;  1Y6E A;  1ST9 A;  1TXU A;  3LSZ A;  1GH2 A;  4IGJ A;  2V2G A;  3KM6 A;  2QA1 A;  5IPH A;  1YJ6 A;  4F82 A;  1XFL A;  5ID2 B;  4Z7X A;  3W6G A;  2OE1 A;  2C3T A;  1AQW A;  4LLR A;  4WR5 A;  5F05 A;  5CRE A;  1DUG A;  3BCI A;  4PTS A;  5J9C A;  1G7O A;  5DBQ A;  2O85 A;  1JZR A;  5LD0 A;  3GUS A;  3DXB A;  2PWJ A;  1IYH A;  4O5Q A;  4GWR A;  4HQS A;  2IMK A;  1Z7P A;  5JCG A;  4ACS A;  2HXK A;  4ZXG A;  1QGV A;  3TJB A;  2FY6 A;  4Z2R A;  1M9B A;  2V32 A;  1F2E A;  2J23 A;  4QL7 A;  4N11 A;  1QMV A;  4L0U A;  2L4Q A;  2H70 A;  1JHB A;  4D73 A;  2HT9 A;  4MH3 A;  4KH7 A;  1SVO A;  1QXH A;  4BVX B;  5LNK e;  3BOA A;  5D9X A;  1B9X C;  2UV8 G;  3WGE A;  2O8V B;  2LRN A;  1XWC A;  3M9J A;  3TU3 B;  4MAB A;  4TXO B;  3KP9 A;  1YKC A;  2HZE A;  4RI6 A;  2AV4 A;  1TRS A;  5F06 A;  1PKW A;  1TI3 A;  3GNJ A;  1QUW A;  3BCK A;  4GDF A;  3F6D A;  2PGT A;  1KNG A;  4ZBB A;  3KP8 A;  5F0G A;  2L57 A;  2HRK B;  1O7U A;  4OFM A;  1Z3E A;  1EOG A;  2CX3 A;  5KOX A;  2F9S A;  3TJK A;  1WOU A;  1A2M A;  1SVM A;  4JRR A;  4PGT A;  2V6O A;  4BPY A;  3GIX A;  4X1U A;  2G0F A;  2H1A A;  4ILF A;  4BL7 B;  3TCO A;  1B4P A;  4DSR A;  3DYR A;  1ML6 A;  1B48 A;  2K8V A;  4KB3 A;  4Q5Q A;  3GMF A;  1IYI A;  4AKG A;  3F4S A;  2HSY A;  12GS A;  4E8H A;  3TOT A;  1U88 A;  1XIY A;  3F8U A;  3RHC A;  1AXD A;  3GHA A;  1ZGN A;  3J7Y k;  2R5G A;  3LXT A;  2O7K A;  4G10 A;  3FR9 A;  4K2X A;  5DVB A;  2DJ2 A;  5IO0 A;  3WYW A;  5CO3 A;  3TDG A;  2KP1 A;  2GSQ A;  3TRP A;  1K3Y A;  2H1L A;  4EKZ A;  1GLP A;  3PIN A;  2B5E A;  3C8E A;  4AKX B;  2GGT A;  4FO5 A;  4ZL7 A;  2HSN B;  4HS1 A;  1M2D A;  2CVD A;  1YDK A;  2OJL A;  4IJI A;  3TJF A;  3F9U A;  5CRW A;  3O3T A;  4ID0 A;  1K0O A;  4YKG A;  3GA4 A;  4YQU A;  2I4A A;  5DAK A;  1LBK A;  5JWR B;  4MDC A;  2IME A;  2HI7 A;  4O32 A;  1CQG A;  3IV4 A;  2LQQ A;  5BMU A;  2B6M A;  2H30 A;  2NPB A;  2QC7 A;  1O81 A;  2L6C A;  4KW6 A;  4IQA A;  3N5O A;  1JLV A;  4LL1 B;  2H76 A;  2HSH A;  2VCX A;  1GNW A;  1GSY A;  2DKH A;  3M0F A;  1ZYN A;  2KUC A;  3ZIT A;  5EVO A;  2ES7 A;  3NOF A;  3VUR A;  2ZCT A;  2ON5 A;  2HRF A;  2JSZ A;  3DVX A;  5IQY A;  1H75 A;  4DSS B;  4KSO A;  3E3E A;  4GF0 A;  3H93 A;  3ERW A;  5C04 A;  3NZN A;  2GST A;  1XBS A;  4I8B A;  4MNN A;  3UBK A;  4HUA A;  1ZYP A;  5COH A;  1BYE A;  5G30 A;  3NIV A;  3CXG A;  5G5E A;  4LMV A;  3KTB A;  3FW2 A;  2VM2 A;  3ZVJ A;  2PBJ A;  4AF2 A;  1GUH A;  3KMN A;  4I2U A;  1TRV A;  1VF4 A;  3FYG A;  6GSS A;  3BD2 A;  2YOI A;  5G5F A;  4HU7 A;  1VF1 A;  3GYK A;  2E2M A;  1JFU A;  3IBH A;  3UVT A;  3D5J A;  3IPZ A;  4MCU A;  5H5R A;  1X5D A;  1UC7 A;  2C0D A;  1AQV A;  1PD2 1;  2DBC A;  3MYD A;  4NHZ A;  3MWH A;  4YAV A;  2MYG A;  4WF4 A;  5J40 A;  3HVS A;  2GT5 A;  2X8C A;  3FK8 A;  4IVF A;  1EV4 A;  1ZOF A;  2I81 A;  1G6Y A;  5D9V A;  3MDK A;  1ERW A;  3ED3 A;  4PUR A;  3HMJ G;  2VUP A;  3MNG A;  1X9W B;  1OYJ A;  3G7I A;  5EL8 A;  1I9D A;  2BJX A;  3CSH A;  3DD3 A;  2VL3 A;  5ECQ B;  4K9Z A;  5KN2 A;  3FZ4 A;  1YQ1 A;  1PRX A;  1X5C A;  5FHI A;  1T00 A;  4ULX A;  3KGK A;  3VI5 A;  4RQR A;  4K0G A;  1Q98 A;  4TW5 A;  2HE3 A;  3UMA A;  3DWV A;  4BVY A;  3CSI A;  1SJ6 A;  5J3R A;  1BG1 A;  2LJR A;  2RUE A;  22GS A;  2J9H A;  1EZK A;  3FHK A;  3R2Q A;  1AIU A;  2CT6 A;  2X4A A;  3GKM A;  4OFT A;  5DDL A;  3BBY A;  2DIY A;  2A4H A;  4JZQ A;  1GSS A;  3F4T A;  4IS0 A;  3L0H A;  3CRU A;  4AJ8 A;  3ZFL A;  3QDN A;  4LMW A;  1SJZ A;  3LW9 A;  1BAY A;  5HQP A;  4NXI A;  3GKX A;  5IOW A;  1SK0 A;  3GSS A;  5ID2 A;  4V1A p;  3RPN A;  4ML1 A;  5CRG A;  3VWX A;  1YF1 A;  2X8G A;  3D4M A;  2MBT A;  3QFB C;  4X4J A;  5BRT A;  1GTI A;  1Y25 A;  4TKY A;  2NDO A;  3IK7 A;  1KEB A;  16GS A;  4N30 A;  1MDK A;  3FMW A;  1NHY A;  1AUC A;  3H4K A;  1ACV A;  2B1K A;  4MH2 A;  2WCI A;  2PN8 A;  1PA3 A;  4PQH A;  4YQM A;  1G0T A;  3TJJ A;  2LST A;  3VWW A;  4FQU A;  4AJ7 A;  3D0Z A;  4PNF A;  1ERT A;  3KCM A;  2LNS A;  2YWN A;  4K5S A;  2DJ3 A;  3WD6 A;  7GSS A;  2QKE A;  2PMT A;  1HD2 A;  1WIK A;  2FA4 A;  2GZY A;  3LYP A;  2O5V A;  1S3D A;  1XVQ A;  1SYR A;  3TKP A;  4IJ3 A;  4MMM A;  2DIZ A;  2XHF A;  4TXO A;  2VCQ A;  4AKH A;  4WET A;  5J5N A;  2LJK A;  1T8E B;  3QR6 A;  2H01 A;  3KJY A;  4PNG A;  3O6T A;  3GL3 A;  14GS A;  3KIJ A;  3ME7 A;  4L0W A;  5IMF A;  2HRK A;  4ISD A;  1YEX A;  3UOM A;  3UBL A;  3APS A;  1GTA A;  4XS1 A;  1XVW A;  4EF0 A;  3HVX A;  1YY7 A;  4EDZ A;  2YAN A;  2VD0 A;  2BMX A;  4TVE A;  3EMP A;  5DCG A;  2E7P A;  2H1D A;  2H8L A;  1A0F A;  5G1K A;  4ECB A;  1A2J A;  2R6K A;  2KHP A;  3M8N A;  4MJB A;  1GRX A;  2OAC A;  3DVW A;  2JZR A;  4BL7 A;  4F0B A;  2DJ0 A;  3HHV A;  2WGR A;  4HJ2 A;  3A2V A;  5DAL B;  2AUV A;  4Z2U A;  4I5Q A;  5HFG A;  3VI7 A;  3I9V 2;  5CAX A;  5E59 A;  2R0C A;  4OWY A;  4EXJ A;  3G7J A;  4IHU A;  3KH7 A;  4L5O A;  1ZMA A;  3TB2 A;  1VF2 A;  1F3B A;  4MP4 A;  1FHE A;  2AYT A;  5AN1 A;  1DSB A;  1R7H A;  2KOK A;  4ZB7 A;  1EOH A;  2P0G A;  2R0P A;  2K18 A;  3C1R A;  1B8X A;  2FA8 A;  1Z6M A;  4KAE A;  4ZB6 A;  2HLS A;  2OBK A;  4KND A;  4K5R A;  1OC9 B;  4GQF A;  4TN8 A;  1X0R A;  3EPT A;  4MZC A;  2F3M A;  2FD3 A;  3RAZ A;  1B4Q A;  2PVQ A;  1A8Y A;  2LNT A;  1Z6N A;  2OKA A;  3IHG A;  2MZC A;  2F8F A;  2F8A A;  5IMD A;  2C3N A;  1FW1 A;  1X5E A;  5EPF A;  1ERU A;  4O5U A;  1TJD A;  2OT3 A;  1LJR A;  1ZZY A;  4KA0 A;  2R3X A;  2CAQ A;  4TXV A;  2V41 A;  2GS3 A;  1NHO A;  3D21 A;  3VPT A;  4AI6 A;  5JWQ B;  3KMO A;  3LXZ A;  5J4U A;  3IC8 A;  2EFD A;  4FYU A;  5D8I A;  4IW9 A;  2IPA A;  3KH9 A;  2PVO C;  3JCM L;  4EE0 A;  5J41 A;  1PKZ A;  2DJJ A;  5ECK B;  4GST A;  2A2P A;  4KUN A;  3VWU A;  2CV4 A;  3MAK A;  4GRF A;  2IFQ B;  5EY6 A;  2EFH A;  5J9B A;  1TP9 A;  1HYU A;  2H6Y A;  3I69 A;  2R37 A;  4DSS A;  1SL2 B;  1XWA A;  2K6V A;  5CNW A;  2ZNM A;  1EWX A;  1BX9 A;  1HNC A;  3HXS A;  6GSW A;  2HNL A;  4H86 A;  2QA2 A;  3TKS C;  3FRC A;  1N8J A;  4TR0 A;  3GTU B;  5D73 A;  2C1Y A;  1RW1 A;  3M9K A;  1AQX A;  3GL5 A;  3C73 A;  3ZL5 A;  3ZYW A;  1V2A A;  3A5W A;  2FWE A;  2H0H A;  1XW9 A;  4G0L A;  3D6I A;  4WKW A;  3W8S A;  1WPI A;  2FWF A;  2VM1 A;  4KF9 A;  2YWO A;  1PMT A;  3QFA C;  4V2N A;  3ISO A;  1OE7 A;  4KX4 A;  1TK8 B;  1O73 A;  1BF5 A;  2JAD A;  3UEM A;  2IJY A;  1TU7 A;  4K7N A;  4BWS A;  2LEG A;  3LYK A;  1ERV A;  2JZS A;  4N0Z A;  2DML A;  3HDC A;  3R3E A;  2HFD A;  5B7C A;  4DVC A;  5J4V A;  4Q5N A;  4PX1 A;  5GAP D;  1Z7R A;  5ECO B;  5B8B A;  4MLY A;  2H6X A;  4POM A;  2H0I A;  6GST A;  3A5I A;  3HZ4 A;  1SD8 A;  2MMZ A;  2QGV A;  3TUE A;  2CA8 A;  3ZRD A;  3CRT A;  2DLX A;  3SBC A;  2IMI A;  3GUR A;  4MK3 A;  3LWA A;  2IN3 A;  3M3M A;  3GX0 A;  2VO4 A;  2XC2 A;  4ECC A;  20GS A;  1Z9H A;  4HU9 A;  1QK8 A;  3KD0 A;  2VCV A;  1F3A A;  4TR4 A;  3IDV A;  4X0X A;  2L4C A;  4ZB8 A;  1U3A A;  1T1V A;  4PXO A;  1U87 A;  5HR1 A;  5CRH A;  1XCC A;  3FZ9 A;  4EO3 A;  3FZA A;  1W89 A;  3KZQ A;  4QMK A;  2C0G A;  5G31 A;  2H75 A;  3LQ7 A;  4GSS A;  2VAF A;  1XOB A;  4NHW A;  10GS A;  4W66 A;  1M99 A;  4GLT A;  3TRX A;  2C0E A;  3IA1 A;  5JCU A;  1A23 A;  1YKA A;  3DEX A;  5JWO B;  3LG6 A;  3HD5 A;  4V2L A;  3N9J A;  3U6V A;  4WBJ A;  4A5P A;  3DRN A;  1TKD B;  2XBI A;  4OO4 A;  18GS A;  1PGT A;  2GTU A;  1K0B A;  1X9M B;  4MPF A;  4WXT A;  3RPP A;  4JR6 A;  3WGD A;  5AIS A;  4F03 A;  1SL1 B;  5KOW A;  5ECL B;  2YCD A;  1GSF A;  1JZO A;  3ZFB A;  1O8X A;  1CQH A;  5A1N B;  2P5Q A;  3C71 A;  3EUR A;  4RUV A;  1GSQ A;  2AAW A;  3UL3 A;  2C8U A;  1HNA A;  1K0C A;  4DSQ A;  1UVZ A;  2WDU A;  1KTE A;  5D9W A;  1SKS B;  1JLW A;  3E9J B;  1OE8 A;  2XPD A;  1GSD A;  2X64 A;  3I43 A;  2B3S A;  2YZH A;  1LU4 A;  3US3 A;  2TRC P;  5KN1 A;  3QD9 A;  4JR4 A;  2VOC A;  1RQM A;  5ECI B;  2C3Q A;  3GX8 A;  4OO5 A;  1GTU A;  2M72 A;  1GL8 A;  4CHS A;  2O89 A;  3F3Q A;  5DAL A;  2CVK A;  2OBI A;  4QL9 A;  3UJ1 A;  1K3O A;  1OVN A;  4BWQ A;  5CRD A;  4K6X A;  1V9W A;  3L9U A;  4TRX A;  3W8J A;  1ON4 A;  2L59 A;  5F07 A;  3FZ5 A;  1MD3 A;  3PH9 A;  1Y1U A;  4E68 A;  5CYY A;  2N5F A;  3SWL A;  1EGO A;  4EIP A;  4GQC A;  2LV3 A;  3CTG A;  3FR6 A;  4YAP A;  3AY8 A;  1M2B A;  2H6Z A;  1FG4 A;  3TKR A;  1OC9 A;  1SYX A;  2D2Z A;  1SD9 A;  1K3L A;  2H74 A;  2RLI A;  4J2F A;  2LRC A;  2F51 A;  2NBS A;  2CZ2 A;  1YF0 A;  2FNO A;  4NPB A;  1GUM A;  1FOV A;  3HJP A;  4MJE A;  2VD1 A;  4WBR D;  1F6M C;  3UAR A;  4OCE A;  1ZYQ B;  2B7K A;  3P2A A;  2V1M A;  4EIQ A;  3IXR A;  3S9F A;  1JZD A;  1YEP A;  4KGI A;  3H79 A;  5ECH B;  1KBN A;  4HJM A;  5C00 A;  3LFL A;  5ELG A;  1MEK A;  3LGC A;  2B7J A;  4CW9 A;  5B6M A;  3APO A;  5H5Q A;  2IWT A;  4XRD A;  3CMI A;  4XIH A;  3ZLP A;  2YWM A;  4F9Z A;  2VCT A;  1EGR A;  5B6N A;  2H19 A;  2WRT A;  2HQT A;  4N10 A;  1TK5 B;  3QCP A;  1M9A A;  4MF6 A;  5ECN B;  5AIX A;  1OC8 A;  2FUG 2;  5ECR B;  5J47 A;  2VL2 C;  3WT2 A;  3WT1 A;  1TU8 A;  3GRX A;  4HEA 2;  5ENU A;  4CY6 A;  4POK A;  4G9H A;  1OC3 A;  2IFQ A;  4XS4 B;  4KSM A;  6GSX A;  2WJU A;  3EIN A;  4Z2T A;  4PQI A;  1E6B A;  2HSM B;  1HQO A;  2A2S A;  1N25 A;  2C4J A;  1NW2 A;  2WUL A;  4MJC A;  1GUK A;  2AJQ B;  2MMN A;  3I6A A;  4EVM A;  2NTO A;  1BQ7 A;  2DJK A;  2R2J A;  2RII A;  3V1W A;  3GTU A;  1XWK A;  2H66 A;  2YN1 A;  1MD4 A;  3F3R A;  2K9F A;  5INY A;  2B5X A;  2VIM A;  5GAN D;  3G7Y A;  3GKN A;  2HYX A;  1OKD A;  1EP7 A;  3HJO A;  1W4V A;  1JZW A;  2PUK C;  1MDI A;  1VGL A;  1TW9 A;  3A2W A;  5ECS A;  5DCH A;  1USB A;  3K8N A;  1GLQ A;  3KTL A;  2VCZ A;  3Q74 A;  4HZ2 A;  1A2L A;  1THO A;  5GST A;  1YZX A;  3Q19 A;  2TRX A;  3G9B A;  4KE3 A;  4ECI A;  4NV5 A;  4MF7 A;  1T4Z A;  3UIW A;  3ERF A;  2GQK A;  5J4Y A;  3IAS 2;  1URM A;  4O92 A;  2DJ1 A;  4PUF C;  3EWL A;  4L5L A;  2OE3 A;  6GSY A;  2CX4 A;  5IIZ A;  1GWC A;  4HDE A;  1SK2 A;  2FCH A;  3CWG A;  2GZP A;  2JL4 A;  1BED A;  3ZML A;  4HOJ A;  3LEF A;  5G1L A;  3TJG A;  2JU5 A;  1XOA A;  4OCF A;  4POB A;  1HNB A;  1MTC A;  2X8H A;  5DJM A;  4P3Y B;  3HVV A;  1WRY A;  3DML A;  2O87 A;  4YH2 A;  5D93 A;  1AC1 A;  1XWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...