1GSQA

Three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure, catalytic properties, and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens S-crystallins of cephalopods.
pubmed doi rcsb
source organism Ommastrephes sloani pacificus
molecule tags Transferase
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1995-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gsqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gsqA01
1ACVA 2E7PA 1E2YA 1AAZA 4IS0A 3M8NA 1NW2A 2AJQB 3FZ4A 2XBQA 1AQVA 3ERWA 1PD21 1K0AA 3SBCA 4ECIA 1K0OA 4K7OA 4Q5RA 1BX9A 4WETA 1LU4A 5AGYA 2HRNA 2A4VA 4X1UA 1DBYA 1O6JA 1GTBA 3A2VA 6GSWA 4POBA 2GSTA 3F6DA 1HYUA 3H8QA 5BMUA 4IJIA 2VL3A 1G7OA 4WR5A 1OKTA 12GSA 2C0GA 1EOHA 1PX7A 2H6YA 4RQXA 2V32A 1PKZA 4KCAA 13GSA 1VF3A 1C72A 1YZXA 1MEKA 4D73A 4MPFA 16GSA 3C71A 4AJ7A 2ALBA 4K0NA 2VUPA 5G30A 2YP6A 3FR3A 2VL2C 2MMZA 1GUHA 3APSA 4K2DA 1GTUA 4OCFA 4XTSA 3IK7A 2HFDA 4PGTA 4JBBA 4XS4B 2CVDA 3KIJA 1OC8A 1Z9HA 1BG5A 3KP9A 5DAKA 2LTKA 3QMXA 2HSNB 3US3A 2H1AA 2HZEA 2XBIA 2FLSA 4I8BA 3IOSA 4GQCA 1K0CA 5DJMA 1F9MA 1M2AA 3CMIA 4KNDA 4V2NA 5DBQA 1SL1B 3WGXA 2GZPA 18GSA 2ES7A 2H74A 3CTGA 1GH2A 3EVIA 1M7TA 2V6KA 2L6CA 4OO5A 5FT3A 4WR4A 1PL2A 2H8LA 3QD9A 4L5LA 5DALA 4ID0A 3HD5A 1FB0A 6GSSA 3HHVA 1J08A 4K0GA 3Q19A 2CAQA 2C3TA 2GT6A 4USSA 3M9KA 2C4JA 2IL3A 1BJXA 3GH9A 4X0XA 1TXXA 2P5RA 3GTUA 4JR6A 3IHQA 2OA7A 4JR4A 1NHOA 5IMVA 4MF7A 2GZYA 3D4TA 3E9JB 2AB6A 3TRPA 3CBUA 4IVFA 1X9MB 2IIYA 4O5RA 1K0BA 3H79A 5EVOA 1TJDA 5GZZB 3QR6A 4IW9A 4CHSA 2RIIA 1HNAA 1B9YC 1Q4JA 1EGRA 1JLVA 4EE0A 4HS1A 3UIWA 2F51A 4BVYB 4BPYA 1RQMA 1WP0A 2KHPA 3GNJA 2HE3A 5CRHA 1JZDA 1YEPA 3F4SA 5DVBA 3HVSA 2MZCA 3ZLPA 2WFCA 4EKZA 1GTAA 3HVVA 4N0ZA 3PH9A 1X5CA 2P5QA 1K3LA 3VWWA 2NDOA 2YZHA 3O3TA 1ZMAA 3GL3A 3D6IA 1UVZA 4PTSA 1A8LA 1GSDA 1F37A 4IQAA 4EVMA 1YY7A 6GSVA 4TKYA 2LV3A 3A2WA 1TK5B 4MH3A 4CDOA 3NIVA 2UZ8A 2FNOA 3HJMA 3VWUA 4P3YB 2H1BA 5A4VA 5B8BA 3L9UA 14GSA 4RUVA 3ZMKA 2JSZA 4G2EA 2GVPA 3LWAA 2IFQB 1V2AA 3ZIJA 3KXOA 2IMFA 4N11A 2E0QA 3HZ4A 3F8UA 2WDUA 4HZ2A 5AN1A 1TI3A 2DIZA 1FG4A 5IPHA 3FR9A 2X8HA 1G6WA 1MD3A 2DMLA 1T00A 5D73A 3ZITA 2PMTA 4XIHA 1CQHA 2L4QA 3UVTA 2GDRA 3ISOA 1AQXA 3RHBA 5HR3A 1ON4A 2VCWA 3C73A 2DJJA 4QL7A 3WYWA 4TRXA 2TRXA 4MABA 1TRUA 2JU5A 2GSRA 1NSWA 3F6FA 3QAVA 5B7CA 1XWAA 2CX3A 3GKKA 3L9SA 3F63A 4OCEA 4BA7A 4KAEA 1W89A 3APQA 1EV4A 4GXZA 4HJ2A 3IE3A 1WE0A 2O7KA 1IYHA 4KDXA 4POMA 2YV9A 6GSXA 4HEA2 1X9WB 5KN0A 4N30A 4XRAA 2XC2A 2H71A 3M1GA 3ERFA 3CTFA 1Z6NA 1QGVA 2OBIA 4AJ8A 1SD9A 2PERA 3UJ1A 3EINA 4TR1B 2C0DA 3GKXA 2NPBA 4ACSA 2HSHA 5ECKB 5D9WA 2PVQA 2B1LA 4HQZA 3IV4A 2YJHA 3PINA 2EIOA 3EMPA 1B4QA 5ENUA 1TK0B 2IWTA 2F8FA 2VLTA 4F82A 1O73A 2AAWA 1U6TA 3TB2A 3CSIA 2O89A 5B6NA 2LNTA 5ECLB 3CSHA 1FHEA 1EGOA 3J7Yb 2KUCA 2H0GA 1GSUA 1TI1A 3N9JA 3KTBA 5CRDA 3WT2A 5GSTA 4MF5A 4BL7B 1YEXA 2MYGA 1GTIA 4ZIJA 2O8VB 2JADA 3ZREA 5ECQB 1U87A 3KMOA 2X8CA 1GSEA 2VOCA 3IAS2 2BTOT 4XCSA 1ZOFA 4ECJA 4XS6A 2DLXA 3GUSA 4LL1B 3HZ8A 2LRNA 3EYTA 1V40A 4NHWA 5CO3A 2V41A 4MA9A 3TKSC 1BEDA 3ME7A 4TXOB 5C00A 3I9V2 5KN3A 2LSTA 4Q5QA 4O92A 3APOA 3LXZA 5F07A 2GQKA 3EU3A 1V9WA 1OYJA 5IOWA 3W8JA 1HNBA 2HZFA 1T1VA 1WOUA 6GSTA 2FD3A 1PKWA 2JZTA 5DQYA 4TOPA 5EPFA 4HJMA 3EE2A 4V2MA 4PUAA 2C1YA 3WGDA 2LRTA 2NBSA 4TN8A 4ZB6A 2F8AA 1ZCPA 5DCGA 3UL3A 3GIXA 5LCZA 2JZSA 4EC0A 1SKRB 3VI5A 3H1NA 3ZYWA 2CZ3A 5IO2A 4V1Ap 3ZRDA 2OACA 4KA0A 5IM9A 3FW2A 2H75A 5JCUA 3DYRA 5JWQB 4PQIA 5DCHA 3TKPA 3EURA 2HSMA 5ECSA 4OFMA 4ECCA 2LJAA 3IBHA 2ON7A 5ID2B 4BWSA 5A5KA 1THOA 3GH6A 3O6TA 3A3TA 4YQVA 4L8EA 2VM1A 4TR4A 4BVXA 5A4WA 20GSA 4LL4B 3F3RA 4DSQA 2A2RA 2E2GA 1JHBA 3D4MA 4ECBA 3DVWA 4JZQA 2R2JA 4GF0A 4WEYA 1SK1A 2LNSA 3UARA 3C1SA 2MMOA 1PL1A 3LSZA 5HFIA 3LG6A 3D21A 4NAXA 2DJ2A 4G10A 3F4RA 2RM6A 4NXIA 1S3CA 2KLXA 3E3EA 2M72A 2YPMA 4MK3A 5J5NA 1RK4A 2I4AA 2E2MA 3GKNA 1OAZA 2H6XA 1PA3A 3GRXA 3F4TA 3F9UA 1SL2B 1XWGA 2DMMA 2FWEA 1R7HA 3RPNA 2NTOA 3IA1A 2PGTA 4GSSA 3S9FA 3TJGA 3UBLA 2H1DA 3RBTA 4GTUA 1FAAA 2CZ2A 1O85A 3UEMA 2GSQA 2YCDA 2FHEA 1BAYA 5D8IA 3CRUA 4D73B 2L4CA 2Z9SA 4TXVA 1YQ1A 4OMVA 3G9BA 5JCWA 2CA8A 1UA5A 4HDEA 1V57A 4GQFA 3EWLA 2D2ZA 2ZCTA 3O76A 4ML1A 5DAKB 1MD4A 1E6BA 2C0EA 2HZEB 3M9JA 1XOAA 4YAPA 4G0LA 2PWJA 3DGQA 1A2LA 2FWGA 3LEFA 3DD3A 1RW1A 5KN2A 1SD8A 4EDZA 2HQTA 4JEDA 4IELA 2N5BA 5G5EA 1TKDB 3GL5A 4HQSA 2H1GA 2WULA 2P31A 3KTLA 2MMNA 2DIYA 3TOTA 1OE8A 4KUNA 3HCZA 4KB3A 2OBKA 1U88A 3ZVJD 3DRNA 5DALB 4K8MA 4FYBA 1FW1A 5J4UA 3HA9A 1H4OA 3KH9A 2BJXA 2L5OA 1GLPA 1N2AA 1EZKA 4F2IA 2VD0A 3VURA 3AY8A 3QCPA 3GTUB 4ZBDA 3L9VA 3M0FA 4PNFA 5LNKe 5CYYA 3KD0A 2GQLA 1T8EB 3CRTA 3KEBA 5G1KA 3VPTA 2IN3A 4POLA 5HR2A 1GRXA 4DVCA 3FZAA 1WMJA 2R6KA 4TW5A 1A23A 3GN3A 2C8UA 2BMXA 5F8BA 3QDNA 5ECHB 2I3YA 1XWCA 4F0CA 2I1UA 1XIYA 3UAPA 1AUCA 3QAWA 4L0WA 1GUMA 1LBKA 4MJAA 1SK2A 3ZFBA 2DJKA 2B5YA 4FIWA 3LYKA 2WGRA 4TR3A 1GSFA 2DJ1A 3ZIVA 4MMMA 2HLSA 1U3IA 3UOMA 2VCXA 4Q5NA 1B9XC 4MZWA 2FUG2 1MTCA 1M2BA 3ME8A 2RLIA 3P7XA 3TJFA 2WRTA 3F0IA 1QUWA 3QFBC 1O8XA 4HZ4A 1XW5A 2WB9A 1O7UA 1WRYA 4NPBA 3ED3A 2B3SA 1GUKA 1NM3A 3BJ5A 5F06A 4YQMA 4DSRA 1PGTA 4ZBBA 5CAXA 4PQHA 1VF4A 5CREA 3A5WA 1MDKA 4KDYA 2FWFA 1XXUA 3BD2A 1PMTA 2YWNA 1KNGA 1QXHA 2FWHA 1R5AA 3U5RE 4MJEA 5CRWA 4POKA 4OWYA 11GSA 3L0HA 2AUVA 1YJ6A 1H75A 1GSYA 4K1FA 2V6OA 1XVWA 1GSSA 3ZZXA 6GSUA 1O81A 1Z6MA 4NHZA 3TRXA 4KH7A 3L4NA 3WGEA 2DJ0A 1NHYA 4MJBA 2OJLA 2J9HA 2VLUA 2C80A 3VLNA 3RPPA 5COHA 3GV1A 5IIZA 5CRGA 5GSSA 1X5DA 4KE3A 5EY6A 5GAND 1F6MC 8GSSA 3PPUA 3VFIA 1JZWA 4E8EA 1S3AA 1TRSA 2GT5A 2OKAA 1URMA 2PPTA 2TRCP 5HQPA 2FCHA 4IBPA 1XWKA 2PU9C 2WCIA 2LQQA 2YN1A 1HD2A 3TJKA 5E4WA 4LLRA 4AGSA 3GYKA 2B1KA 1ERWA 1I5GA 1VF1A 5DDLA 1J9BA 5JWRB 4KCEA 1ML6A 2B7KA 2VCQA 4XS1A 1TP9A 3D22A 2GQMA 3I43A 3C8EA 2JZRA 4MZCA 1PRXA 3KMNA 2YV7A 5LD0A 1WIKA 3PGTA 3EU4A 1TOFA 3C7MA 2VO4A 1PN9A 5IOXA 3C1RA 1GLQA 1EP7A 2LQOA 2V2GA 3FR6A 1K3OA 2L59A 4KX4A 5H5QA 1M9AA 1SYXA 1EV9A 4OO4A 2WZ9A 1BYEA 3HJOA 4N10A 1JZOA 3R3EA 2KP1A 5B8AA 2LUSA 4F0BA 5F05A 1VF2A 1SL0B 1OC9A 2GSSA 1R5PA 2VD1A 1TRWA 2LRCA 1SENA 1AIUA 1KEBA 4DSSA 1IYIA 4V2LA 3GFKA 1ABAA 1A2MA 2LKUA 3R2QA 3KZQA 1K0NA 2VCTA 4YAVA 1SJIA 2K8VA 1HNCA 3FYGA 3H93A 2IPAA 1FO5A 1ZZYA 2HRKA 2MBTA 2F9SA 1LJRA 4EXJA 2TIRA 3KH7A 22GSA 5KN1A 5IMZA 3CXGA 5INYA 4H86A 4MF6A 1TTZA 1X9SB 3GA4A 2HXKA 4ZB8A 1ZYQB 5D9VA 3QOUA 2AHEA 1FVJA 4KF9A 1UN2A 1SYRA 2C0FA 1DSBA 2VCZA 4PQ1A 1B8XA 3FY7A 4PUFC 3TKRA 4KDUA 1THXA 5ECPB 3RHCA 3RDWA 4JU5A 4ZB9A 2CVBA 1UC7A 3HJPA 4GWRA 5H5RA 1VRSD 1G6YA 3LFLA 4K7IA 1PQNA 2DJ3A 3BOAA 1I9DA 4J2FA 2EIQA 3I6AA 2PBJA 2VLVA 3ZVJA 5G31A 2QSIA 3IC4A 2O87A 1F3BA 3TKSE 2NVLA 3UBKA 2B5EA 3HVXA 1ZYEA 4K9ZA 3LQ7A 1A2JA 3ZL5A 1T4ZA 5G2ZA 2HSMB 1Z5YE 5ECMB 1V58A 2OE3A 4L0UA 1R26A 4I2UA 2HI7A 3P8WA 4J57E 2B7JA 4GCIA 4BVXB 1B4PA 2DSAA 3FRCA 4PURA 3UMAA 1EEJA 5AIXA 3DKSA 4K7NA 4NV2A 2GZZA 3DXBA 2YWOA 1AW9A 4OFTA 4AJ6A 1ERUA 1XCCA 2XPDA 4LA1A 2R37A 3IXRA 9GSSA 2WS2A 3PR8A 1WPIA 4ZILA 3TGZA 1G7EA 1DUGA 2M80A 3Q6OA 2H76A 2H72A 1BQ7A 2R5GA 4WF5A 4FQUA 2HNLA 1W4VA 3TDGA 2QKEA 1OE7A 3HYPA 3BCKA 2RUEA 5ECIB 3KJYA 4WBJA 1ZL9A 2JSYA 5FWGA 4E8HA 1TRVA 2CAIA 2YWMA 5J3RA 4KGIA 5KEJA 1XZOA 2CQ9A 1T7PB 1MDIA 4FO5A 2VAFA 4YH2A 3LJRA 2CV4A 2X8GA 3EMXA 3TKSA 1DE2A 3LYPA 4OFNA 3U6VA 4XS4A 4KSOA 10GSA 2ZUPA 2C3NA 5DJLA 2PUKC 4K6XA 2YJ7A 4QQ7A 7GSSA 3KCMA 3TKQA 3FKFA 3GSTA 3GURA 4G19A 2OADA 1XBSA 1HQOA 3HXSA 1ZGNA 1Z7RA 1R4WA 4I6XA 1F3AA 3WD6A 4ZXGA 2H6ZA 4HUAA 2QC7A 3DIEA 1OKDA 1CQGA 1ERVA 3G7JA 2HRAA 2X64A 3H4KA 1J0FA 1EWXA 1JZRA 3TCOA 3LXTA 3P90A 1N8JA 2RM5A 2HYXA 3J7Yk 1S3DA 4WXTA 2C3QA 3A2XA 3IPZA 1M99A 1XWBA 2K18A 4IP6A 3Q74A 1QMVA 3OR5A 1EEMA 3GX0A 5G5FA 1XPVA 3IK9A 4FYCA 1DE1A 5ELGA 1ILOA 2YWIA 2KOKA 1Q98A 1SKSB 4O7HA 2KP2A 4NV5A 1QFNA 4EL1A 2H01A 3EC3A 3V1WA 1FOVA 1AC1A 2X99A 2H70A 3MSZA 1A24A 3HDCA 5ABRA 4G0KA 1GNWA 1TW9A 1QQ2A 4YQUA 4BVYA 5CNWA 4F03A 1V98A 5EL8A 5HFKA 3VWVA 4G9HA 4LMVA 1FB6A 1A8YA 4F9ZA 2REMA 4TR0A 3FK8A 3QFAC 4GSNA 4IJ3A 1SJZA 17GSA 2HSYA 4J56E 5A4UA 2GTUA 3F3QA 3LGCA 4EF0A 3FZ5A 1GL8A 2PN8A 3VK9A 2VL9A 3IAM2 4JRRA 2JACA 5ECRB 3MAKA 3RAZA 4CW9A 4KSMA 2H73A 2M46A 4HI7A 4I2TA 4ZL8A 4Z7XA 1A0FA 4PX1A 1XW9A 4GSTA 3TRQA 3GHAA 4NWYA 3GSSA 2A2SA 2VM2A 3W8SA 1YDKA 5AISA 1AXDA 2B5XA 3BCIA 2G0FA 2VL2A 3GMFA 2IMEA 4XHMA 5ELAA 4G0IA 2ZNMA 3DWVA 4OD7A 3FZ9A 4MP4A 4MCUA 1M0UA 2IFQA 2DBCA 2OE0A 2K6VA 3MWHA 2J23A 1ERTA 5B6MA 1WWJA 2FA4A 5C04A 1KTEA 3TJJA 3HY2A 3Q18A 4ISDA 1PX6A 2YNXA 5IMFA 1Z7PA 1GULA 1VGLA 2N5FA 4IHUA 1USBA 5D96A 2WJUA 3KGKA 4EDYA 4JE1A 5FHIA 3M3MA 3MNGA 1GSQA 2L57A 1K0MA 4WKWA 5J9CA 5IMDA 4EUYA 1TU8A 2I9HA 5ECNB 3DEXA 1M9BA 5G1LA 1Y25A 3K8NA 1PSQA 3TJBA 2FA8A 5HR0A 1GWCA 4Q5FA 1G0TA 5H5SA 3W6GA 3NZNA 2IMKA 5D9XA 1ST9A 2XHFA 3G7IA 3GX8A 5J9BA 2HT9A 3TOUA 3LORA 2XPEA 5J41A 2AYTA 5L71A 4HOJA 2LJKA 4N0VA 1X5EA 3VPQA 2G2QA 2LS5A 1K3YA 4HU9A 4FYUA 4XRDA 1WJKA 4EO3A 5IO0A 4MLYA 4TR1A 1O8WA 3L78A 1U3AA 4WF4A 5D9TA 1XW6A 2N5AA 1K0DA 1JFUA 1TU7A 4X43A 1MDJA 3ZFLA 2IJYA 2VCVA 3IR4A 3ZTLA 3KP8A 3ERGA 5GAPD 1EOGA 2K9FA 2YANA 1JLWA 5D93A 2JL4A 1M2DA 3JCML 2OE1A 2H0HA 2V1MA 3QPMA 1XFLA 2B6MA 5JCGA 5DQSA 3GKMA 3TUEA 1OC3A 3VWXA 2AV4A 2I81A 1SU9A 2F3MA 4BL7A 2CVKA 2H19A 2FY6A 4RI6A 4WBRD 2EIRA 3D5JA 5IQYA 2ON5A 3UVHA 4I5QA 4I97A 1TK8B 5ECOB 2MMAA 2LJRA 1OC9B 3NOFA 1F2EA 1SJ6A 3D0ZA 4LMWA 1GNEA 19GSA 3IDVA 3G7YA 4DSSB 3I69A 2O85A 1SKWB 3IC8A 3BBYA 4RQRA 4MZBA 5E59A 4TXOA 4ULXA 2H0IA 3MDKA 4IP1A 4O32A 5IMAA 1KBNA 4QL9A 3QAGA 3SWLA 2YOIA 4L5OA 1QK8A 2GGTA 4ZBAA 2HRKB 4IGJA 4NMUA 1YF1A 4IKHA 2PVOC 2IMIA 3DMLA 2FGXA 4MDCA 1AQWA 4GRFA 2R4VA 4ML6A 3ZMLA 1YF0A 5IMCA 1TDIA 2H66A 2IMDA 2EC4A 2RUFA 5AIVA 2P0GA 3CSJA 3CYNA 5HR1A 5IPGA 2QGVA 1EP8A 4FH8A 1SK0A 4AF2A 2HRFA 2DC5A 2GLRA 1GP1A 1YKAA 1T3BA 2YZUA 1X0RA 2K8SA 4RI7A 3FEUA 4ILFA 2MBSA 1B48A 3E0UA 3VI7A 1FVKA 1T4YA 4GLTA 4IQ1A 3N5OA 2LEGA 4BWQA 5JWOB 4HU7A 3KM6A 6GSYA 2VIMA 3DVXA 4MH2A 1Z3EA 3FHKA 2L6DA 1OVNA 4DEJA 3P2AA 1A0RP 2CT6A 2CX4A 4IN0A 5HFGA 3WT1A 5ID2A 4V1Ag 2R3XA 5F0GA 4PXOA 4KW6A 3HKRA 4MPGA 4PNGA 4ZL9A 1Y6EA 1XOBA 2L5LA 2H30A 5CP1A 3IRAA 4ZL7A 4MJCA 1YKCA 2GS3A 1XVQA 4TVEA
chains in the Genus database with same CATH superfamily
1ACVA 2E7PA 1E2YA 1AAZA 4IS0A 1ZYNA 3M8NA 1NW2A 2AJQB 3FZ4A 2XBQA 1AQVA 3ERWA 1PD21 1K0AA 3SBCA 4ECIA 1K0OA 4K7OA 4Q5RA 1BX9A 4WETA 5KOXA 1LU4A 5BRTA 5AGYA 2HRNA 2A4VA 2QA2A 4X1UA 1DBYA 1O6JA 1PN0A 1GTBA 3A2VA 6GSWA 4POBA 2GSTA 4K2XA 4FXYP 3F6DA 1HYUA 3H8QA 5BMUA 4IJIA 2VL3A 1G7OA 4WR5A 1OKTA 12GSA 3HVNA 2C0GA 1EOHA 1PX7A 2H6YA 4RQXA 2V32A 1PKZA 4KCAA 13GSA 1VF3A 1C72A 5J47A 1YZXA 1MEKA 4D73A 3CHXC 4MPFA 16GSA 3C71A 4AJ7A 2ALBA 4K0NA 2VUPA 5G30A 2YP6A 3FR3A 2VL2C 2MMZA 1GUHA 3APSA 4K2DA 1GTUA 4OCFA 4XTSA 3IK7A 2HFDA 4PGTA 4JBBA 4XS4B 2CVDA 3KIJA 1OC8A 4A5PA 1Z9HA 1BG5A 3KP9A 5DAKA 2LTKA 3QMXA 2HSNB 3US3A 2H1AA 2HZEA 2XBIA 2FLSA 4I8BA 3IOSA 4GQCA 1K0CA 5DJMA 1F9MA 1M2AA 3CMIA 4KNDA 4V2NA 5DBQA 1SL1B 3WGXA 2GZPA 18GSA 2ES7A 2H74A 3CTGA 1GH2A 3EVIA 1M7TA 2V6KA 2L6CA 4OO5A 5FT3A 4WR4A 1PL2A 2H8LA 3CQFA 3QD9A 4L5LA 5DALA 4ID0A 3HD5A 1FB0A 6GSSA 3HHVA 1J08A 4K0GA 3Q19A 2CAQA 2C3TA 2GT6A 4USSA 3M9KA 2C4JA 4X4JA 2IL3A 1BJXA 3GH9A 4X0XA 1TXXA 2P5RA 2EFCA 3GTUA 4JR6A 3IHQA 2OA7A 4JR4A 1NHOA 5IMVA 4MF7A 2GZYA 3D4TA 3E9JB 2AB6A 3TRPA 3CBUA 4IVFA 1X9MB 2IIYA 4O5RA 1K0BA 3H79A 5EVOA 1TJDA 5GZZB 3QR6A 4IW9A 4CHSA 2RIIA 1HNAA 1B9YC 1Q4JA 1EGRA 1JLVA 4EE0A 4HS1A 3UIWA 2F51A 4BVYB 4BPYA 1RQMA 1WP0A 2KHPA 3GNJA 4N3ZA 2HE3A 5CRHA 1JZDA 1YEPA 3F4SA 5DVBA 1M3JA 3HVSA 2MZCA 3ZLPA 2WFCA 4EKZA 1GTAA 3HVVA 4N0ZA 3PH9A 1X5CA 2P5QA 2QA1A 1K3LA 3VWWA 2NDOA 2YZHA 3O3TA 1ZMAA 3GL3A 3D6IA 1UVZA 4PTSA 1A8LA 1GSDA 1F37A 4IQAA 4EVMA 1S3RA 1YY7A 6GSVA 4TKYA 2LV3A 3A2WA 1BF5A 1TK5B 4MH3A 4CDOA 2O36A 2UZ8A 3NIVA 2FNOA 3HJMA 3VWUA 4P3YB 2H1BA 4PI2C 5A4VA 5B8BA 3L9UA 14GSA 4RUVA 5A5HA 3ZMKA 2JSZA 4G2EA 2GVPA 3LWAA 2IFQB 1V2AA 3ZIJA 3KXOA 2IMFA 3A5IA 4N11A 2E0QA 3HZ4A 3F8UA 2WDUA 4HZ2A 5AN1A 1TI3A 2DIZA 1FG4A 5IPHA 3FR9A 2X8HA 1G6WA 1MD3A 2DMLA 1T00A 5D73A 3ZITA 2PMTA 4XIHA 1CQHA 2L4QA 3UVTA 2GDRA 3ISOA 1AQXA 3RHBA 5HR3A 1ON4A 2VCWA 3C73A 2DJJA 4QL7A 3WYWA 4TRXA 2TRXA 4MABA 1TRUA 2JU5A 2GSRA 1NSWA 3F6FA 3QAVA 5B7CA 1XWAA 2CX3A 3GKKA 3L9SA 3F63A 4OCEA 3IHGA 5J4VA 4BA7A 4KAEA 1W89A 3APQA 1EV4A 4GXZA 4HJ2A 3IE3A 1WE0A 2O7KA 1IYHA 4KDXA 4POMA 2YV9A 6GSXA 4HEA2 1X9WB 5KN0A 4N30A 4XRAA 2XC2A 2H71A 3M1GA 3ERFA 3CTFA 1Z6NA 1QGVA 2OBIA 4AJ8A 2R0GA 1SD9A 2PERA 3UJ1A 3EINA 4TR1B 2C0DA 3GKXA 2NPBA 4ACSA 2HSHA 5ECKB 5D9WA 2PVQA 2B1LA 4HQZA 3IV4A 2YJHA 3PINA 2EIOA 3EMPA 1B4QA 5ENUA 1TK0B 2IWTA 2F8FA 2VLTA 4F82A 1O73A 2AAWA 1U6TA 1XG8A 3TB2A 3CSIA 2O89A 4ZB7A 5B6NA 2LNTA 5ECLB 3CSHA 4EIQA 1FHEA 1EGOA 3J7Yb 2KUCA 2H0GA 1GSUA 1YEWC 4QMKA 1TI1A 3N9JA 3KTBA 4ICYA 5CRDA 3WT2A 5GSTA 4MF5A 4BL7B 1YEXA 2MYGA 1GTIA 4ZIJA 2O8VB 2JADA 3ZREA 5ECQB 1U87A 3KMOA 2X8CA 1GSEA 2VOCA 3IAS2 2BTOT 4XCSA 1ZOFA 4ECJA 4XS6A 2DLXA 3GUSA 4LL1B 3HZ8A 2LRNA 3EYTA 1V40A 4NHWA 5CO3A 2V41A 4MA9A 3TKSC 1BEDA 3ME7A 4TXOB 5C00A 3I9V2 5KN3A 2LSTA 2DKIA 4Q5QA 4O92A 3APOA 3LXZA 5F07A 2GQKA 3EU3A 1V9WA 1OYJA 3EPTA 5IOWA 3W8JA 1HNBA 2HZFA 1T1VA 1WOUA 6GSTA 2FD3A 1PKWA 2JZTA 5DQYA 4TOPA 5EPFA 4HJMA 3EE2A 4V2MA 4PUAA 2C1YA 4YKGA 4O5QA 1SVLA 3WGDA 2LRTA 2NBSA 4TN8A 4ZB6A 2F8AA 1ZCPA 5DCGA 3UL3A 3GIXA 5LCZA 2JZSA 4EC0A 1SKRB 3VI5A 5J40A 3H1NA 3ZYWA 2CZ3A 5IO2A 4V1Ap 2WVXA 3ZRDA 2OACA 4KA0A 5IM9A 3FW2A 2H75A 5JCUA 3DYRA 5JWQB 5J4YA 4PQIA 5DCHA 3TKPA 3EURA 2HSMA 5ECSA 4OFMA 4ECCA 2LJAA 3IBHA 2ON7A 5ID2B 4BWSA 5A5KA 1THOA 3GH6A 3HMJG 3O6TA 3A3TA 4YQVA 4L8EA 2VM1A 4TR4A 4BVXA 5A4WA 20GSA 4LL4B 3F3RA 4DSQA 2A2RA 2E2GA 1JHBA 3D4MA 4ECBA 3DVWA 4JZQA 2R2JA 4GF0A 4WEYA 1SK1A 5A34A 2LNSA 3UARA 3C1SA 2MMOA 1PL1A 3LSZA 5HFIA 3LG6A 3D21A 4NAXA 2DJ2A 4G10A 3F4RA 2RM6A 4NXIA 1S3CA 2KLXA 3E3EA 2M72A 2YPMA 4MK3A 5J5NA 1RK4A 2I4AA 4GDFA 2E2MA 3GKNA 1OAZA 2H6XA 1PA3A 3GRXA 3F4TA 3F9UA 1SL2B 1S4BP 1XWGA 5BMUB 2DMMA 2FWEA 1R7HA 3RPNA 2NTOA 3IA1A 2PGTA 4GSSA 3S9FA 3TJGA 3UBLA 2H1DA 3RBTA 4GTUA 1FAAA 2CZ2A 1O85A 3UEMA 2GSQA 2YCDA 2FHEA 1BAYA 5D8IA 3CRUA 4D73B 2L4CA 4W66A 2Z9SA 4TXVA 1YQ1A 4OMVA 3G9BA 5JCWA 2CA8A 1UA5A 4HDEA 1V57A 4GQFA 3EWLA 2D2ZA 2ZCTA 3O76A 4ML1A 5DAKB 1MD4A 1E6BA 2C0EA 2HZEB 3M9JA 1XOAA 4YAPA 4G0LA 2PWJA 3DGQA 1A2LA 2FWGA 3LEFA 3DD3A 1RW1A 5KN2A 1SD8A 4EDZA 2HQTA 4JEDA 4IELA 2N5BA 5G5EA 1TKDB 3GL5A 4HQSA 2H1GA 2WULA 2P31A 3KTLA 2MMNA 2DIYA 3TOTA 4CY6A 1OE8A 4KUNA 3HCZA 4KB3A 2OBKA 1U88A 3ZVJD 3DRNA 5DALB 4K8MA 4FYBA 1FW1A 5J4UA 3HA9A 1H4OA 3KH9A 2BJXA 2L5OA 1GLPA 1N2AA 1EZKA 4F2IA 2VD0A 3VURA 3AY8A 3QCPA 3GTUB 4ZBDA 3L9VA 3M0FA 4PNFA 5LNKe 5CYYA 3KD0A 2GQLA 1T8EB 3CRTA 3KEBA 5G1KA 3VPTA 2IN3A 4POLA 5HR2A 1GRXA 4DVCA 3FZAA 1WMJA 2R6KA 4TW5A 1A23A 3GN3A 2C8UA 2BMXA 5F8BA 3QDNA 5ECHB 2I3YA 5A1NA 1XWCA 1FOHA 4F0CA 4AKGA 2I1UA 1XIYA 3UAPA 1AUCA 3QAWA 4L0WA 1GUMA 1LBKA 4MJAA 1SK2A 3TU3B 3ZFBA 2DJKA 2B5YA 4FIWA 3LYKA 2WGRA 4TR3A 1GSFA 2DJ1A 3ZIVA 4MMMA 2HLSA 1U3IA 3UOMA 2VCXA 4Q5NA 1B9XC 4MZWA 2FUG2 1MTCA 1M2BA 3ME8A 3CWGA 2RLIA 3P7XA 3TJFA 2WRTA 4AKIA 3F0IA 1QUWA 3QFBC 1O8XA 4HZ4A 1XW5A 2WB9A 1O7UA 2UV8G 1WRYA 4NPBA 3ED3A 3LW9A 2B3SA 1GUKA 1NM3A 3BJ5A 5F06A 4YQMA 4DSRA 1PGTA 4ZBBA 5CAXA 4PQHA 1VF4A 5CREA 3A5WA 1MDKA 1Y1UA 4KDYA 2FWFA 1XXUA 3BD2A 4K5SA 1PMTA 2YWNA 1KNGA 1QXHA 2FWHA 5A5HB 1R5AA 3U5RE 5KOWA 4MJEA 5CRWA 4POKA 4OWYA 11GSA 3L0HA 2AUVA 1YJ6A 1H75A 1GSYA 4K1FA 2V6OA 1XVWA 1GSSA 3ZZXA 6GSUA 1O81A 4G01A 1Z6MA 4NHZA 3TRXA 4KH7A 3L4NA 3WGEA 2DJ0A 1NHYA 4MJBA 2OJLA 2J9HA 2VLUA 2C80A 3VLNA 3RPPA 5COHA 4BIKA 3GV1A 5IIZA 5CRGA 5GSSA 1X5DA 4KE3A 5EY6A 5GAND 1F6MC 8GSSA 3PPUA 3VFIA 1JZWA 4E8EA 1S3AA 1TRSA 2GT5A 2OKAA 1URMA 2PPTA 2TRCP 5HQPA 2FCHA 4IBPA 1XWKA 2PU9C 2WCIA 2LQQA 2YN1A 2OT3A 1HD2A 3TJKA 5E4WA 4LLRA 4AGSA 3GYKA 2B1KA 1ERWA 1I5GA 2WVYA 1VF1A 5DDLA 1J9BA 5JWRB 4KCEA 1ML6A 2B7KA 2VCQA 4MNNA 2R0PA 4XS1A 1TP9A 2H1LA 2GQMA 3D22A 3I43A 3C8EA 2JZRA 4MZCA 1PRXA 3KMNA 2YV7A 5LD0A 1WIKA 3PGTA 3EU4A 1TOFA 3C7MA 2VO4A 1PN9A 5IOXA 3C1RA 1GLQA 1EP7A 2LQOA 2V2GA 3FR6A 1K3OA 2L59A 4KX4A 5H5QA 1M9AA 1SYXA 1EV9A 4OO4A 2EFHA 2WZ9A 1BYEA 3MYDA 3HJOA 4N10A 1JZOA 3R3EA 2KP1A 5B8AA 2LUSA 4F0BA 5F05A 1VF2A 1SL0B 1OC9A 2GSSA 1R5PA 2VD1A 1TRWA 2LRCA 1SENA 4Z2TA 4AKXB 1AIUA 1KEBA 4DSSA 1IYIA 4V2LA 3GFKA 1ABAA 1A2MA 2LKUA 3R2QA 3KZQA 1K0NA 2VCTA 4YAVA 1SJIA 2K8VA 1HNCA 3FYGA 4YKFA 3H93A 2IPAA 1FO5A 2WZSA 1ZZYA 2HRKA 2MBTA 2F9SA 1LJRA 4EXJA 2TIRA 3KH7A 22GSA 5KN1A 5IMZA 3CXGA 5INYA 4H86A 4MF6A 1TTZA 1X9SB 3GA4A 2HXKA 4ZB8A 1ZYQB 5D9VA 3QOUA 2AHEA 1FVJA 4CY8A 4KF9A 1UN2A 1SYRA 2C0FA 1DSBA 2VCZA 4PQ1A 1B8XA 3FY7A 4PUFC 3TKRA 4KDUA 2WW2A 1THXA 5ECPB 3RHCA 3RDWA 4JU5A 4ZB9A 1SVOA 2CVBA 1UC7A 3HJPA 4GWRA 5H5RA 1VRSD 1G6YA 3LFLA 4Z2RA 4K7IA 1PQNA 3RGBC 4AI6A 2DJ3A 3BOAA 1I9DA 4J2FA 2EIQA 3I6AA 2PBJA 2VLVA 3ZVJA 2WVXB 5G31A 2QSIA 3IC4A 2O87A 1F3BA 3TKSE 2NVLA 1I1IP 3UBKA 2B5EA 3HVXA 1ZYEA 4K9ZA 3LQ7A 1A2JA 3ZL5A 1T4ZA 5G2ZA 2HSMB 1Z5YE 5ECMB 1V58A 2OE3A 4L0UA 1R26A 1BG1A 4I2UA 2HI7A 3P8WA 4J57E 2B7JA 4GCIA 4BVXB 1B4PA 2DSAA 3FRCA 4PURA 3UMAA 1EEJA 5AIXA 3DKSA 4K7NA 4NV2A 3FMWA 2GZZA 3DXBA 2YWOA 1AW9A 5A34B 4OFTA 4AJ6A 1ERUA 1XCCA 2XPDA 4LA1A 4Z2UA 2R37A 3IXRA 9GSSA 2WS2A 3PR8A 1WPIA 4ZILA 3TGZA 1G7EA 1DUGA 1PFOA 2M80A 3Q6OA 2H76A 2H72A 1BQ7A 2R5GA 4WF5A 4FQUA 2HNLA 1W4VA 3TDGA 2QKEA 1OE7A 3HYPA 3BCKA 2RUEA 5ECIB 3KJYA 4WBJA 1ZL9A 2DKHA 2JSYA 5FWGA 4E8HA 1TRVA 2CAIA 2YWMA 5J3RA 4KGIA 5KEJA 1XZOA 4O5UA 2CQ9A 1T7PB 1MDIA 4FO5A 2VAFA 4YH2A 3LJRA 2CV4A 2X8GA 3EMXA 3TKSA 1DE2A 3LYPA 4OFNA 3U6VA 4PHZC 4XS4A 4KSOA 10GSA 2ZUPA 2C3NA 5DJLA 2PUKC 4K6XA 2HSNA 1M3IA 2YJ7A 4QQ7A 7GSSA 3KCMA 3TKQA 3FKFA 3GSTA 3GURA 4G19A 2OADA 1XBSA 1HQOA 3HXSA 1ZGNA 1Z7RA 2WVZA 1R4WA 4I6XA 1F3AA 3WD6A 4ZXGA 2H6ZA 4HUAA 2QC7A 3DIEA 1OKDA 1CQGA 1ERVA 3G7JA 2HRAA 2X64A 3H4KA 1J0FA 1EWXA 1JZRA 3TCOA 3LXTA 3P90A 1N8JA 2RM5A 2HYXA 3J7Yk 1S3DA 4WXTA 2C3QA 3A2XA 3IPZA 1M99A 1XWBA 2K18A 4IP6A 3Q74A 1QMVA 3OR5A 1EEMA 3GX0A 5G5FA 1XPVA 3IK9A 4FYCA 1DE1A 5ELGA 1ILOA 2YWIA 2KOKA 1Q98A 1SKSB 4O7HA 2KP2A 2WW1A 1QFNA 4NV5A 4EL1A 2H01A 3EC3A 2X49A 3V1WA 1FOVA 1AC1A 2X99A 2H70A 3MSZA 1A24A 3HDCA 5ABRA 4G0KA 1GNWA 1TW9A 1QQ2A 4YQUA 4BVYA 5CNWA 4EIPA 2EFEA 4F03A 2WW3A 1V98A 5EL8A 5HFKA 3VWVA 4G9HA 5A1NB 4LMVA 1FB6A 1A8YA 4F9ZA 2REMA 4TR0A 3FK8A 3QFAC 4GSNA 4IJ3A 1SJZA 17GSA 2HSYA 4J56E 5A4UA 2VKZG 2GTUA 3F3QA 3LGCA 4EF0A 3FZ5A 1GL8A 2PN8A 3VK9A 2VL9A 3IAM2 4JRRA 2JACA 1YVLA 5ECRB 3MAKA 3RAZA 2O3EA 4CW9A 4KSMA 2H73A 2M46A 4HI7A 4I2TA 4ZL8A 4Z7XA 1A0FA 4PX1A 1XW9A 4GSTA 3TRQA 3GHAA 2R0CA 3GSSA 4NWYA 2A2SA 2EFDA 2VM2A 3W8SA 1YDKA 1N25A 5AISA 1AXDA 2B5XA 3BCIA 2G0FA 2VL2A 3GMFA 2IMEA 4XHMA 5ELAA 4G0IA 2ZNMA 3DWVA 4OD7A 3FZ9A 4MP4A 4MCUA 1M0UA 2IFQA 2DBCA 2OE0A 2K6VA 3MWHA 2J23A 1ERTA 5B6MA 2X4AA 1WWJA 2FA4A 5C04A 1KTEA 3TJJA 3HY2A 3Q18A 4ISDA 1PX6A 2YNXA 5IMFA 2A4HA 1Z7PA 1GULA 1ZYPA 1VGLA 2N5FA 4IHUA 1USBA 5D96A 2WJUA 3KGKA 4EDYA 4JE1A 5FHIA 3M3MA 3MNGA 1GSQA 2L57A 1K0MA 4WKWA 5J9CA 5IMDA 4EUYA 1TU8A 2I9HA 5ECNB 3DEXA 3MIXA 1M9BA 4K5RA 5G1LA 2O5VA 1Y25A 3K8NA 1PSQA 3TJBA 2FA8A 5HR0A 1GWCA 4Q5FA 1G0TA 5H5SA 3W6GA 3NZNA 2IMKA 5D9XA 1ST9A 2XHFA 3G7IA 3GX8A 5J9BA 2HT9A 3TOUA 3LORA 2XPEA 5J41A 2AYTA 5L71A 4HOJA 2LJKA 4N0VA 1X5EA 3VPQA 2G2QA 2LS5A 1K3YA 4HU9A 4FYUA 4XRDA 1WJKA 4EO3A 5IO0A 4MLYA 4TR1A 1O8WA 3L78A 1U3AA 4WF4A 5D9TA 2A2PA 1XW6A 2N5AA 1K0DA 1JFUA 1TU7A 4X43A 1MDJA 3ZFLA 2IJYA 2VCVA 3IR4A 4PI0C 3ZTLA 3KP8A 3ERGA 2WW0A 5GAPD 1EOGA 2K9FA 2YANA 1JLWA 5D93A 1TXUA 2JL4A 1M2DA 2OE1A 3JCML 2H0HA 2V1MA 3QPMA 1XFLA 2B6MA 5JCGA 5DQSA 4AKHA 3GKMA 3TUEA 1OC3A 3VWXA 2AV4A 2I81A 1SU9A 2F3MA 4BL7A 2CVKA 2H19A 2FY6A 4RI6A 4WBRD 2EIRA 3D5JA 5IQYA 2ON5A 3UVHA 4I5QA 4I97A 1TK8B 5ECOB 2MMAA 2LJRA 1OC9B 3NOFA 4HSCX 1F2EA 1SVMA 1SJ6A 3D0ZA 4LMWA 1GNEA 19GSA 3IDVA 3G7YA 4DSSB 3I69A 4E68A 2O85A 1SKWB 3IC8A 3BBYA 4RQRA 4MZBA 5E59A 4TXOA 4ULXA 2H0IA 3MDKA 4IP1A 4O32A 5IMAA 1KBNA 4QL9A 3QAGA 3SWLA 2YOIA 4L5OA 1QK8A 2GGTA 4ZBAA 2HRKB 4IGJA 4NMUA 1YF1A 4IKHA 2PVOC 2IMIA 3DMLA 2FGXA 4MDCA 1AQWA 4GRFA 2R4VA 4ML6A 3ZMLA 1YF0A 5IMCA 1TDIA 2H66A 2IMDA 2EC4A 2RUFA 5AIVA 2P0GA 3CSJA 3CYNA 5HR1A 5IPGA 2QGVA 1EP8A 4FH8A 1SK0A 4AF2A 2HRFA 2DC5A 2GLRA 1GP1A 1YKAA 1T3BA 2YZUA 1X0RA 2K8SA 4RI7A 3FEUA 4ILFA 2MBSA 1B48A 3E0UA 3VI7A 1FVKA 1T4YA 4GLTA 4IQ1A 3N5OA 2LEGA 4BWQA 5JWOB 4HU7A 3KM6A 6GSYA 2VIMA 3DVXA 4MH2A 1Z3EA 3FHKA 2L6DA 1OVNA 4DEJA 3P2AA 1A0RP 2CT6A 3RFRC 2CX4A 4IN0A 5HFGA 3WT1A 5ID2A 4V1Ag 2R3XA 5F0GA 4PXOA 4KW6A 3HKRA 4MPGA 4PNGA 4ZL9A 1Y6EA 1XOBA 2L5LA 2H30A 5CP1A 3IRAA 4ZL7A 4MJCA 1YKCA 2GS3A 1XVQA 4TVEA
chains in the Genus database with same CATH topology
1ACVA 2E7PA 1E2YA 1AAZA 4IS0A 1ZYNA 3M8NA 1NW2A 2AJQB 3FZ4A 2XBQA 1AQVA 3ERWA 1PD21 1K0AA 3SBCA 4ECIA 1K0OA 4K7OA 4Q5RA 1BX9A 4WETA 5KOXA 1LU4A 5BRTA 5AGYA 2HRNA 2A4VA 2QA2A 4X1UA 1DBYA 1O6JA 1PN0A 1GTBA 3A2VA 6GSWA 4POBA 2GSTA 4K2XA 3F6DA 1HYUA 3H8QA 5BMUA 4IJIA 2VL3A 1G7OA 4WR5A 1OKTA 12GSA 2C0GA 1EOHA 1PX7A 2H6YA 4RQXA 2V32A 1PKZA 4KCAA 13GSA 1VF3A 1C72A 5J47A 1YZXA 1MEKA 4D73A 4MPFA 16GSA 3C71A 4AJ7A 2ALBA 4K0NA 2VUPA 5G30A 2YP6A 3FR3A 2VL2C 2MMZA 1GUHA 3APSA 4K2DA 1GTUA 4OCFA 4XTSA 3IK7A 2HFDA 4PGTA 4JBBA 4XS4B 2CVDA 3KIJA 1OC8A 4A5PA 1Z9HA 1BG5A 3KP9A 5DAKA 2LTKA 3QMXA 2HSNB 3US3A 2H1AA 2HZEA 2XBIA 2FLSA 4I8BA 3IOSA 4GQCA 1K0CA 5DJMA 1F9MA 1M2AA 3CMIA 4KNDA 4V2NA 5DBQA 1SL1B 3WGXA 2GZPA 18GSA 2ES7A 2H74A 3CTGA 1GH2A 3EVIA 1M7TA 2V6KA 2L6CA 4OO5A 5FT3A 4WR4A 1PL2A 2H8LA 3QD9A 4L5LA 5DALA 4ID0A 3HD5A 1FB0A 6GSSA 3HHVA 1J08A 4K0GA 3Q19A 2CAQA 2C3TA 2GT6A 4USSA 3M9KA 2C4JA 4X4JA 2IL3A 1BJXA 3GH9A 4X0XA 1TXXA 2P5RA 2EFCA 3GTUA 4JR6A 3IHQA 2OA7A 4JR4A 1NHOA 5IMVA 4MF7A 2GZYA 3D4TA 3E9JB 2AB6A 3TRPA 3CBUA 4IVFA 1X9MB 2IIYA 4O5RA 1K0BA 3H79A 5EVOA 1TJDA 5GZZB 3QR6A 4IW9A 4CHSA 2RIIA 1HNAA 1B9YC 1Q4JA 1EGRA 1JLVA 4EE0A 4HS1A 3UIWA 2F51A 4BVYB 4BPYA 1RQMA 1WP0A 2KHPA 3GNJA 4N3ZA 2HE3A 5CRHA 1JZDA 1YEPA 3F4SA 5DVBA 3HVSA 2MZCA 3ZLPA 2WFCA 4EKZA 1GTAA 3HVVA 4N0ZA 3PH9A 1X5CA 2P5QA 2QA1A 1K3LA 3VWWA 2NDOA 2YZHA 3O3TA 1ZMAA 3GL3A 3D6IA 1UVZA 4PTSA 1A8LA 1GSDA 1F37A 4IQAA 4EVMA 1YY7A 6GSVA 4TKYA 2LV3A 3A2WA 1BF5A 1TK5B 4MH3A 4CDOA 3NIVA 2UZ8A 2FNOA 3HJMA 3VWUA 4P3YB 2H1BA 5A4VA 5B8BA 3L9UA 14GSA 4RUVA 5A5HA 3ZMKA 2JSZA 4G2EA 2GVPA 3LWAA 2IFQB 1V2AA 3ZIJA 3KXOA 2IMFA 3A5IA 4N11A 2E0QA 3HZ4A 3F8UA 2WDUA 4HZ2A 5AN1A 1TI3A 2DIZA 1FG4A 5IPHA 3FR9A 2X8HA 1G6WA 1MD3A 2DMLA 1T00A 5D73A 3ZITA 2PMTA 4XIHA 1CQHA 2L4QA 3UVTA 2GDRA 3ISOA 1AQXA 3RHBA 5HR3A 1ON4A 2VCWA 3C73A 2DJJA 4QL7A 3WYWA 4TRXA 2TRXA 4MABA 1TRUA 2JU5A 2GSRA 1NSWA 3F6FA 3QAVA 5B7CA 1XWAA 2CX3A 3GKKA 3L9SA 3F63A 4OCEA 3IHGA 5J4VA 4BA7A 4KAEA 1W89A 3APQA 1EV4A 4GXZA 4HJ2A 3IE3A 1WE0A 2O7KA 1IYHA 4KDXA 4POMA 2YV9A 6GSXA 4HEA2 1X9WB 5KN0A 4N30A 4XRAA 2XC2A 2H71A 3M1GA 3ERFA 3CTFA 1Z6NA 1QGVA 2OBIA 4AJ8A 2R0GA 1SD9A 2PERA 3UJ1A 3EINA 4TR1B 2C0DA 3GKXA 2NPBA 4ACSA 2HSHA 5ECKB 5D9WA 2PVQA 2B1LA 4HQZA 3IV4A 2YJHA 3PINA 2EIOA 3EMPA 1B4QA 5ENUA 1TK0B 2IWTA 2F8FA 2VLTA 4F82A 1O73A 2AAWA 1U6TA 3TB2A 3CSIA 2O89A 4ZB7A 5B6NA 2LNTA 5ECLB 3CSHA 4EIQA 1FHEA 1EGOA 3J7Yb 2KUCA 2H0GA 1GSUA 4QMKA 1TI1A 3N9JA 3KTBA 4ICYA 5CRDA 3WT2A 5GSTA 4MF5A 4BL7B 1YEXA 2MYGA 1GTIA 4ZIJA 2O8VB 2JADA 3ZREA 5ECQB 1U87A 3KMOA 2X8CA 1GSEA 2VOCA 3IAS2 2BTOT 4XCSA 1ZOFA 4ECJA 4XS6A 2DLXA 3GUSA 4LL1B 3HZ8A 2LRNA 3EYTA 1V40A 4NHWA 5CO3A 2V41A 4MA9A 3TKSC 1BEDA 3ME7A 4TXOB 5C00A 3I9V2 5KN3A 2LSTA 2DKIA 4Q5QA 4O92A 3APOA 3LXZA 5F07A 2GQKA 3EU3A 1V9WA 1OYJA 3EPTA 5IOWA 3W8JA 1HNBA 2HZFA 1T1VA 1WOUA 6GSTA 2FD3A 1PKWA 2JZTA 5DQYA 4TOPA 5EPFA 4HJMA 3EE2A 4V2MA 4PUAA 2C1YA 4YKGA 4O5QA 1SVLA 3WGDA 2LRTA 2NBSA 4TN8A 4ZB6A 2F8AA 1ZCPA 5DCGA 3UL3A 3GIXA 5LCZA 2JZSA 4EC0A 1SKRB 3VI5A 5J40A 3H1NA 3ZYWA 2CZ3A 5IO2A 4V1Ap 3ZRDA 2OACA 4KA0A 5IM9A 3FW2A 2H75A 5JCUA 3DYRA 5JWQB 5J4YA 4PQIA 5DCHA 3TKPA 3EURA 2HSMA 5ECSA 4OFMA 4ECCA 2LJAA 3IBHA 2ON7A 5ID2B 4BWSA 5A5KA 1THOA 3GH6A 3HMJG 3O6TA 3A3TA 4YQVA 4L8EA 2VM1A 4TR4A 4BVXA 5A4WA 20GSA 4LL4B 3F3RA 4DSQA 2A2RA 2E2GA 1JHBA 3D4MA 4ECBA 3DVWA 4JZQA 2R2JA 4GF0A 4WEYA 1SK1A 5A34A 2LNSA 3UARA 3C1SA 2MMOA 1PL1A 3LSZA 5HFIA 3LG6A 3D21A 4NAXA 2DJ2A 4G10A 3F4RA 2RM6A 4NXIA 1S3CA 2KLXA 3E3EA 2M72A 2YPMA 4MK3A 5J5NA 1RK4A 2I4AA 4GDFA 2E2MA 3GKNA 1OAZA 2H6XA 1PA3A 3GRXA 3F4TA 3F9UA 1SL2B 1XWGA 5BMUB 2DMMA 2FWEA 1R7HA 3RPNA 2NTOA 3IA1A 2PGTA 4GSSA 3S9FA 3TJGA 3UBLA 2H1DA 3RBTA 4GTUA 1FAAA 2CZ2A 1O85A 3UEMA 2GSQA 2YCDA 2FHEA 1BAYA 5D8IA 3CRUA 4D73B 2L4CA 4W66A 2Z9SA 4TXVA 1YQ1A 4OMVA 3G9BA 5JCWA 2CA8A 1UA5A 4HDEA 1V57A 4GQFA 3EWLA 2D2ZA 2ZCTA 3O76A 4ML1A 5DAKB 1MD4A 1E6BA 2C0EA 2HZEB 3M9JA 1XOAA 4YAPA 4G0LA 2PWJA 3DGQA 1A2LA 2FWGA 3LEFA 3DD3A 1RW1A 5KN2A 1SD8A 4EDZA 2HQTA 4JEDA 4IELA 2N5BA 5G5EA 1TKDB 3GL5A 4HQSA 2H1GA 2WULA 2P31A 3KTLA 2MMNA 2DIYA 3TOTA 4CY6A 1OE8A 4KUNA 3HCZA 4KB3A 2OBKA 1U88A 3ZVJD 3DRNA 5DALB 4K8MA 4FYBA 1FW1A 5J4UA 3HA9A 1H4OA 3KH9A 2BJXA 2L5OA 1GLPA 1N2AA 1EZKA 4F2IA 2VD0A 3VURA 3AY8A 3QCPA 3GTUB 4ZBDA 3L9VA 3M0FA 4PNFA 5LNKe 5CYYA 3KD0A 2GQLA 1T8EB 3CRTA 3KEBA 5G1KA 3VPTA 2IN3A 4POLA 5HR2A 1GRXA 4DVCA 3FZAA 1WMJA 2R6KA 4TW5A 1A23A 3GN3A 2C8UA 2BMXA 5F8BA 3QDNA 5ECHB 2I3YA 5A1NA 1XWCA 1FOHA 4F0CA 4AKGA 2I1UA 1XIYA 3UAPA 1AUCA 3QAWA 4L0WA 1GUMA 1LBKA 4MJAA 1SK2A 3TU3B 3ZFBA 2DJKA 2B5YA 4FIWA 3LYKA 2WGRA 4TR3A 1GSFA 2DJ1A 3ZIVA 4MMMA 2HLSA 1U3IA 3UOMA 2VCXA 4Q5NA 1B9XC 4MZWA 2FUG2 1MTCA 1M2BA 3ME8A 3CWGA 2RLIA 3P7XA 3TJFA 2WRTA 4AKIA 3F0IA 1QUWA 3QFBC 1O8XA 4HZ4A 1XW5A 2WB9A 1O7UA 2UV8G 1WRYA 4NPBA 3ED3A 3LW9A 2B3SA 1GUKA 1NM3A 3BJ5A 5F06A 4YQMA 4DSRA 1PGTA 4ZBBA 5CAXA 4PQHA 1VF4A 5CREA 3A5WA 1MDKA 1Y1UA 4KDYA 2FWFA 1XXUA 3BD2A 4K5SA 1PMTA 2YWNA 1KNGA 1QXHA 2FWHA 5A5HB 1R5AA 3U5RE 5KOWA 4MJEA 5CRWA 4POKA 4OWYA 11GSA 3L0HA 2AUVA 1YJ6A 1H75A 1GSYA 4K1FA 2V6OA 1XVWA 1GSSA 3ZZXA 6GSUA 1O81A 4G01A 1Z6MA 4NHZA 3TRXA 4KH7A 3L4NA 3WGEA 2DJ0A 1NHYA 4MJBA 2OJLA 2J9HA 2VLUA 2C80A 3VLNA 3RPPA 5COHA 3GV1A 5IIZA 5CRGA 5GSSA 1X5DA 4KE3A 5EY6A 5GAND 1F6MC 8GSSA 3PPUA 3VFIA 1JZWA 4E8EA 1S3AA 1TRSA 2GT5A 2OKAA 1URMA 2PPTA 2TRCP 5HQPA 2FCHA 4IBPA 1XWKA 2PU9C 2WCIA 2LQQA 2YN1A 2OT3A 1HD2A 3TJKA 5E4WA 4LLRA 4AGSA 3GYKA 2B1KA 1ERWA 1I5GA 1VF1A 5DDLA 1J9BA 5JWRB 4KCEA 1ML6A 2B7KA 2VCQA 4MNNA 2R0PA 4XS1A 1TP9A 2H1LA 2GQMA 3D22A 3I43A 3C8EA 2JZRA 4MZCA 1PRXA 3KMNA 2YV7A 5LD0A 1WIKA 3PGTA 3EU4A 1TOFA 3C7MA 2VO4A 1PN9A 5IOXA 3C1RA 1GLQA 1EP7A 2LQOA 2V2GA 3FR6A 1K3OA 2L59A 4KX4A 5H5QA 1M9AA 1SYXA 1EV9A 4OO4A 2EFHA 2WZ9A 1BYEA 3MYDA 3HJOA 4N10A 1JZOA 3R3EA 2KP1A 5B8AA 2LUSA 4F0BA 5F05A 1VF2A 1SL0B 1OC9A 2GSSA 1R5PA 2VD1A 1TRWA 2LRCA 1SENA 4Z2TA 4AKXB 1AIUA 1KEBA 4DSSA 1IYIA 4V2LA 3GFKA 1ABAA 1A2MA 2LKUA 3R2QA 3KZQA 1K0NA 2VCTA 4YAVA 1SJIA 2K8VA 1HNCA 3FYGA 4YKFA 3H93A 2IPAA 1FO5A 1ZZYA 2HRKA 2MBTA 2F9SA 1LJRA 4EXJA 2TIRA 3KH7A 22GSA 5KN1A 5IMZA 3CXGA 5INYA 4H86A 4MF6A 1TTZA 1X9SB 3GA4A 2HXKA 4ZB8A 1ZYQB 5D9VA 3QOUA 2AHEA 1FVJA 4CY8A 4KF9A 1UN2A 1SYRA 2C0FA 1DSBA 2VCZA 4PQ1A 1B8XA 3FY7A 4PUFC 3TKRA 4KDUA 1THXA 5ECPB 3RHCA 3RDWA 4JU5A 4ZB9A 1SVOA 2CVBA 1UC7A 3HJPA 4GWRA 5H5RA 1VRSD 1G6YA 3LFLA 4Z2RA 4K7IA 1PQNA 4AI6A 2DJ3A 3BOAA 1I9DA 4J2FA 2EIQA 3I6AA 2PBJA 2VLVA 3ZVJA 5G31A 2QSIA 3IC4A 2O87A 1F3BA 3TKSE 2NVLA 3UBKA 2B5EA 3HVXA 1ZYEA 4K9ZA 3LQ7A 1A2JA 3ZL5A 1T4ZA 5G2ZA 2HSMB 1Z5YE 5ECMB 1V58A 2OE3A 4L0UA 1R26A 1BG1A 4I2UA 2HI7A 3P8WA 4J57E 2B7JA 4GCIA 4BVXB 1B4PA 2DSAA 3FRCA 4PURA 3UMAA 1EEJA 5AIXA 3DKSA 4K7NA 4NV2A 3FMWA 2GZZA 3DXBA 2YWOA 1AW9A 5A34B 4OFTA 4AJ6A 1ERUA 1XCCA 2XPDA 4LA1A 4Z2UA 2R37A 3IXRA 9GSSA 2WS2A 3PR8A 1WPIA 4ZILA 3TGZA 1G7EA 1DUGA 2M80A 3Q6OA 2H76A 2H72A 1BQ7A 2R5GA 4WF5A 4FQUA 2HNLA 1W4VA 3TDGA 2QKEA 1OE7A 3HYPA 3BCKA 2RUEA 5ECIB 3KJYA 4WBJA 1ZL9A 2DKHA 2JSYA 5FWGA 4E8HA 1TRVA 2CAIA 2YWMA 5J3RA 4KGIA 5KEJA 1XZOA 4O5UA 2CQ9A 1T7PB 1MDIA 4FO5A 2VAFA 4YH2A 3LJRA 2CV4A 2X8GA 3EMXA 3TKSA 1DE2A 3LYPA 4OFNA 3U6VA 4XS4A 4KSOA 10GSA 2ZUPA 2C3NA 5DJLA 2PUKC 4K6XA 2HSNA 2YJ7A 4QQ7A 7GSSA 3KCMA 3TKQA 3FKFA 3GSTA 3GURA 4G19A 2OADA 1XBSA 1HQOA 3HXSA 1ZGNA 1Z7RA 1R4WA 4I6XA 1F3AA 3WD6A 4ZXGA 2H6ZA 4HUAA 2QC7A 3DIEA 1OKDA 1CQGA 1ERVA 3G7JA 2HRAA 2X64A 3H4KA 1J0FA 1EWXA 1JZRA 3TCOA 3LXTA 3P90A 1N8JA 2RM5A 2HYXA 3J7Yk 1S3DA 4WXTA 2C3QA 3A2XA 3IPZA 1M99A 1XWBA 2K18A 4IP6A 3Q74A 1QMVA 3OR5A 1EEMA 3GX0A 5G5FA 1XPVA 3IK9A 4FYCA 1DE1A 5ELGA 1ILOA 2YWIA 2KOKA 1Q98A 1SKSB 4O7HA 2KP2A 4NV5A 1QFNA 4EL1A 2H01A 3EC3A 2X49A 3V1WA 1FOVA 1AC1A 2X99A 2H70A 3MSZA 1A24A 3HDCA 5ABRA 4G0KA 1GNWA 1TW9A 1QQ2A 4YQUA 4BVYA 5CNWA 4EIPA 2EFEA 4F03A 1V98A 5EL8A 5HFKA 3VWVA 4G9HA 5A1NB 4LMVA 1FB6A 1A8YA 4F9ZA 2REMA 4TR0A 3FK8A 3QFAC 4GSNA 4IJ3A 1SJZA 17GSA 2HSYA 4J56E 5A4UA 2VKZG 2GTUA 3F3QA 3LGCA 4EF0A 3FZ5A 1GL8A 2PN8A 3VK9A 2VL9A 3IAM2 4JRRA 2JACA 1YVLA 5ECRB 3MAKA 3RAZA 4CW9A 4KSMA 2H73A 2M46A 4HI7A 4I2TA 4ZL8A 4Z7XA 1A0FA 4PX1A 1XW9A 4GSTA 3TRQA 3GHAA 2R0CA 3GSSA 4NWYA 2A2SA 2EFDA 2VM2A 3W8SA 1YDKA 1N25A 5AISA 1AXDA 2B5XA 3BCIA 2G0FA 2VL2A 3GMFA 2IMEA 4XHMA 5ELAA 4G0IA 2ZNMA 3DWVA 4OD7A 3FZ9A 4MP4A 4MCUA 1M0UA 2IFQA 2DBCA 2OE0A 2K6VA 3MWHA 2J23A 1ERTA 5B6MA 2X4AA 1WWJA 2FA4A 5C04A 1KTEA 3TJJA 3HY2A 3Q18A 4ISDA 1PX6A 2YNXA 5IMFA 2A4HA 1Z7PA 1GULA 1ZYPA 1VGLA 2N5FA 4IHUA 1USBA 5D96A 2WJUA 3KGKA 4EDYA 4JE1A 5FHIA 3M3MA 3MNGA 1GSQA 2L57A 1K0MA 4WKWA 5J9CA 5IMDA 4EUYA 1TU8A 2I9HA 5ECNB 3DEXA 3MIXA 1M9BA 4K5RA 5G1LA 2O5VA 1Y25A 3K8NA 1PSQA 3TJBA 2FA8A 5HR0A 1GWCA 4Q5FA 1G0TA 5H5SA 3W6GA 3NZNA 2IMKA 5D9XA 1ST9A 2XHFA 3G7IA 3GX8A 5J9BA 2HT9A 3TOUA 3LORA 2XPEA 5J41A 2AYTA 5L71A 4HOJA 2LJKA 4N0VA 1X5EA 3VPQA 2G2QA 2LS5A 1K3YA 4HU9A 4FYUA 4XRDA 1WJKA 4EO3A 5IO0A 4MLYA 4TR1A 1O8WA 3L78A 1U3AA 4WF4A 5D9TA 2A2PA 1XW6A 2N5AA 1K0DA 1JFUA 1TU7A 4X43A 1MDJA 3ZFLA 2IJYA 2VCVA 3IR4A 3ZTLA 3KP8A 3ERGA 5GAPD 1EOGA 2K9FA 2YANA 1JLWA 5D93A 1TXUA 2JL4A 1M2DA 2OE1A 3JCML 2H0HA 2V1MA 3QPMA 1XFLA 2B6MA 5JCGA 5DQSA 4AKHA 3GKMA 3TUEA 1OC3A 3VWXA 2AV4A 2I81A 1SU9A 2F3MA 4BL7A 2CVKA 2H19A 2FY6A 4RI6A 4WBRD 2EIRA 3D5JA 5IQYA 2ON5A 3UVHA 4I5QA 4I97A 1TK8B 5ECOB 2MMAA 2LJRA 1OC9B 3NOFA 1F2EA 1SVMA 1SJ6A 3D0ZA 4LMWA 1GNEA 19GSA 3IDVA 3G7YA 4DSSB 3I69A 4E68A 2O85A 1SKWB 3IC8A 3BBYA 4RQRA 4MZBA 5E59A 4TXOA 4ULXA 2H0IA 3MDKA 4IP1A 4O32A 5IMAA 1KBNA 4QL9A 3QAGA 3SWLA 2YOIA 4L5OA 1QK8A 2GGTA 4ZBAA 2HRKB 4IGJA 4NMUA 1YF1A 4IKHA 2PVOC 2IMIA 3DMLA 2FGXA 4MDCA 1AQWA 4GRFA 2R4VA 4ML6A 3ZMLA 1YF0A 5IMCA 1TDIA 2H66A 2IMDA 2EC4A 2RUFA 5AIVA 2P0GA 3CSJA 3CYNA 5HR1A 5IPGA 2QGVA 1EP8A 4FH8A 1SK0A 4AF2A 2HRFA 2DC5A 2GLRA 1GP1A 1YKAA 1T3BA 2YZUA 1X0RA 2K8SA 4RI7A 3FEUA 4ILFA 2MBSA 1B48A 3E0UA 3VI7A 1FVKA 1T4YA 4GLTA 4IQ1A 3N5OA 2LEGA 4BWQA 5JWOB 4HU7A 3KM6A 6GSYA 2VIMA 3DVXA 4MH2A 1Z3EA 3FHKA 2L6DA 1OVNA 4DEJA 3P2AA 1A0RP 2CT6A 2CX4A 4IN0A 5HFGA 3WT1A 5ID2A 4V1Ag 2R3XA 5F0GA 4PXOA 4KW6A 3HKRA 4MPGA 4PNGA 4ZL9A 1Y6EA 1XOBA 2L5LA 2H30A 5CP1A 3IRAA 4ZL7A 4MJCA 1YKCA 2GS3A 1XVQA 4TVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ACV A;  2E7P A;  1E2Y A;  1AAZ A;  4IS0 A;  3M8N A;  1NW2 A;  2AJQ B;  3FZ4 A;  2XBQ A;  1AQV A;  3ERW A;  1PD2 1;  1K0A A;  3SBC A;  4ECI A;  1K0O A;  4K7O A;  4Q5R A;  1BX9 A;  4WET A;  1LU4 A;  5AGY A;  2HRN A;  2A4V A;  4X1U A;  1DBY A;  1O6J A;  1GTB A;  3A2V A;  6GSW A;  4POB A;  2GST A;  3F6D A;  1HYU A;  3H8Q A;  5BMU A;  4IJI A;  2VL3 A;  1G7O A;  4WR5 A;  1OKT A;  12GS A;  2C0G A;  1EOH A;  1PX7 A;  2H6Y A;  4RQX A;  2V32 A;  1PKZ A;  4KCA A;  13GS A;  1VF3 A;  1C72 A;  1YZX A;  1MEK A;  4D73 A;  4MPF A;  16GS A;  3C71 A;  4AJ7 A;  2ALB A;  4K0N A;  2VUP A;  5G30 A;  2YP6 A;  3FR3 A;  2VL2 C;  2MMZ A;  1GUH A;  3APS A;  4K2D A;  1GTU A;  4OCF A;  4XTS A;  3IK7 A;  2HFD A;  4PGT A;  4JBB A;  4XS4 B;  2CVD A;  3KIJ A;  1OC8 A;  1Z9H A;  1BG5 A;  3KP9 A;  5DAK A;  2LTK A;  3QMX A;  2HSN B;  3US3 A;  2H1A A;  2HZE A;  2XBI A;  2FLS A;  4I8B A;  3IOS A;  4GQC A;  1K0C A;  5DJM A;  1F9M A;  1M2A A;  3CMI A;  4KND A;  4V2N A;  5DBQ A;  1SL1 B;  3WGX A;  2GZP A;  18GS A;  2ES7 A;  2H74 A;  3CTG A;  1GH2 A;  3EVI A;  1M7T A;  2V6K A;  2L6C A;  4OO5 A;  5FT3 A;  4WR4 A;  1PL2 A;  2H8L A;  3QD9 A;  4L5L A;  5DAL A;  4ID0 A;  3HD5 A;  1FB0 A;  6GSS A;  3HHV A;  1J08 A;  4K0G A;  3Q19 A;  2CAQ A;  2C3T A;  2GT6 A;  4USS A;  3M9K A;  2C4J A;  2IL3 A;  1BJX A;  3GH9 A;  4X0X A;  1TXX A;  2P5R A;  3GTU A;  4JR6 A;  3IHQ A;  2OA7 A;  4JR4 A;  1NHO A;  5IMV A;  4MF7 A;  2GZY A;  3D4T A;  3E9J B;  2AB6 A;  3TRP A;  3CBU A;  4IVF A;  1X9M B;  2IIY A;  4O5R A;  1K0B A;  3H79 A;  5EVO A;  1TJD A;  5GZZ B;  3QR6 A;  4IW9 A;  4CHS A;  2RII A;  1HNA A;  1B9Y C;  1Q4J A;  1EGR A;  1JLV A;  4EE0 A;  4HS1 A;  3UIW A;  2F51 A;  4BVY B;  4BPY A;  1RQM A;  1WP0 A;  2KHP A;  3GNJ A;  2HE3 A;  5CRH A;  1JZD A;  1YEP A;  3F4S A;  5DVB A;  3HVS A;  2MZC A;  3ZLP A;  2WFC A;  4EKZ A;  1GTA A;  3HVV A;  4N0Z A;  3PH9 A;  1X5C A;  2P5Q A;  1K3L A;  3VWW A;  2NDO A;  2YZH A;  3O3T A;  1ZMA A;  3GL3 A;  3D6I A;  1UVZ A;  4PTS A;  1A8L A;  1GSD A;  1F37 A;  4IQA A;  4EVM A;  1YY7 A;  6GSV A;  4TKY A;  2LV3 A;  3A2W A;  1TK5 B;  4MH3 A;  4CDO A;  3NIV A;  2UZ8 A;  2FNO A;  3HJM A;  3VWU A;  4P3Y B;  2H1B A;  5A4V A;  5B8B A;  3L9U A;  14GS A;  4RUV A;  3ZMK A;  2JSZ A;  4G2E A;  2GVP A;  3LWA A;  2IFQ B;  1V2A A;  3ZIJ A;  3KXO A;  2IMF A;  4N11 A;  2E0Q A;  3HZ4 A;  3F8U A;  2WDU A;  4HZ2 A;  5AN1 A;  1TI3 A;  2DIZ A;  1FG4 A;  5IPH A;  3FR9 A;  2X8H A;  1G6W A;  1MD3 A;  2DML A;  1T00 A;  5D73 A;  3ZIT A;  2PMT A;  4XIH A;  1CQH A;  2L4Q A;  3UVT A;  2GDR A;  3ISO A;  1AQX A;  3RHB A;  5HR3 A;  1ON4 A;  2VCW A;  3C73 A;  2DJJ A;  4QL7 A;  3WYW A;  4TRX A;  2TRX A;  4MAB A;  1TRU A;  2JU5 A;  2GSR A;  1NSW A;  3F6F A;  3QAV A;  5B7C A;  1XWA A;  2CX3 A;  3GKK A;  3L9S A;  3F63 A;  4OCE A;  4BA7 A;  4KAE A;  1W89 A;  3APQ A;  1EV4 A;  4GXZ A;  4HJ2 A;  3IE3 A;  1WE0 A;  2O7K A;  1IYH A;  4KDX A;  4POM A;  2YV9 A;  6GSX A;  4HEA 2;  1X9W B;  5KN0 A;  4N30 A;  4XRA A;  2XC2 A;  2H71 A;  3M1G A;  3ERF A;  3CTF A;  1Z6N A;  1QGV A;  2OBI A;  4AJ8 A;  1SD9 A;  2PER A;  3UJ1 A;  3EIN A;  4TR1 B;  2C0D A;  3GKX A;  2NPB A;  4ACS A;  2HSH A;  5ECK B;  5D9W A;  2PVQ A;  2B1L A;  4HQZ A;  3IV4 A;  2YJH A;  3PIN A;  2EIO A;  3EMP A;  1B4Q A;  5ENU A;  1TK0 B;  2IWT A;  2F8F A;  2VLT A;  4F82 A;  1O73 A;  2AAW A;  1U6T A;  3TB2 A;  3CSI A;  2O89 A;  5B6N A;  2LNT A;  5ECL B;  3CSH A;  1FHE A;  1EGO A;  3J7Y b;  2KUC A;  2H0G A;  1GSU A;  1TI1 A;  3N9J A;  3KTB A;  5CRD A;  3WT2 A;  5GST A;  4MF5 A;  4BL7 B;  1YEX A;  2MYG A;  1GTI A;  4ZIJ A;  2O8V B;  2JAD A;  3ZRE A;  5ECQ B;  1U87 A;  3KMO A;  2X8C A;  1GSE A;  2VOC A;  3IAS 2;  2BTO T;  4XCS A;  1ZOF A;  4ECJ A;  4XS6 A;  2DLX A;  3GUS A;  4LL1 B;  3HZ8 A;  2LRN A;  3EYT A;  1V40 A;  4NHW A;  5CO3 A;  2V41 A;  4MA9 A;  3TKS C;  1BED A;  3ME7 A;  4TXO B;  5C00 A;  3I9V 2;  5KN3 A;  2LST A;  4Q5Q A;  4O92 A;  3APO A;  3LXZ A;  5F07 A;  2GQK A;  3EU3 A;  1V9W A;  1OYJ A;  5IOW A;  3W8J A;  1HNB A;  2HZF A;  1T1V A;  1WOU A;  6GST A;  2FD3 A;  1PKW A;  2JZT A;  5DQY A;  4TOP A;  5EPF A;  4HJM A;  3EE2 A;  4V2M A;  4PUA A;  2C1Y A;  3WGD A;  2LRT A;  2NBS A;  4TN8 A;  4ZB6 A;  2F8A A;  1ZCP A;  5DCG A;  3UL3 A;  3GIX A;  5LCZ A;  2JZS A;  4EC0 A;  1SKR B;  3VI5 A;  3H1N A;  3ZYW A;  2CZ3 A;  5IO2 A;  4V1A p;  3ZRD A;  2OAC A;  4KA0 A;  5IM9 A;  3FW2 A;  2H75 A;  5JCU A;  3DYR A;  5JWQ B;  4PQI A;  5DCH A;  3TKP A;  3EUR A;  2HSM A;  5ECS A;  4OFM A;  4ECC A;  2LJA A;  3IBH A;  2ON7 A;  5ID2 B;  4BWS A;  5A5K A;  1THO A;  3GH6 A;  3O6T A;  3A3T A;  4YQV A;  4L8E A;  2VM1 A;  4TR4 A;  4BVX A;  5A4W A;  20GS A;  4LL4 B;  3F3R A;  4DSQ A;  2A2R A;  2E2G A;  1JHB A;  3D4M A;  4ECB A;  3DVW A;  4JZQ A;  2R2J A;  4GF0 A;  4WEY A;  1SK1 A;  2LNS A;  3UAR A;  3C1S A;  2MMO A;  1PL1 A;  3LSZ A;  5HFI A;  3LG6 A;  3D21 A;  4NAX A;  2DJ2 A;  4G10 A;  3F4R A;  2RM6 A;  4NXI A;  1S3C A;  2KLX A;  3E3E A;  2M72 A;  2YPM A;  4MK3 A;  5J5N A;  1RK4 A;  2I4A A;  2E2M A;  3GKN A;  1OAZ A;  2H6X A;  1PA3 A;  3GRX A;  3F4T A;  3F9U A;  1SL2 B;  1XWG A;  2DMM A;  2FWE A;  1R7H A;  3RPN A;  2NTO A;  3IA1 A;  2PGT A;  4GSS A;  3S9F A;  3TJG A;  3UBL A;  2H1D A;  3RBT A;  4GTU A;  1FAA A;  2CZ2 A;  1O85 A;  3UEM A;  2GSQ A;  2YCD A;  2FHE A;  1BAY A;  5D8I A;  3CRU A;  4D73 B;  2L4C A;  2Z9S A;  4TXV A;  1YQ1 A;  4OMV A;  3G9B A;  5JCW A;  2CA8 A;  1UA5 A;  4HDE A;  1V57 A;  4GQF A;  3EWL A;  2D2Z A;  2ZCT A;  3O76 A;  4ML1 A;  5DAK B;  1MD4 A;  1E6B A;  2C0E A;  2HZE B;  3M9J A;  1XOA A;  4YAP A;  4G0L A;  2PWJ A;  3DGQ A;  1A2L A;  2FWG A;  3LEF A;  3DD3 A;  1RW1 A;  5KN2 A;  1SD8 A;  4EDZ A;  2HQT A;  4JED A;  4IEL A;  2N5B A;  5G5E A;  1TKD B;  3GL5 A;  4HQS A;  2H1G A;  2WUL A;  2P31 A;  3KTL A;  2MMN A;  2DIY A;  3TOT A;  1OE8 A;  4KUN A;  3HCZ A;  4KB3 A;  2OBK A;  1U88 A;  3ZVJ D;  3DRN A;  5DAL B;  4K8M A;  4FYB A;  1FW1 A;  5J4U A;  3HA9 A;  1H4O A;  3KH9 A;  2BJX A;  2L5O A;  1GLP A;  1N2A A;  1EZK A;  4F2I A;  2VD0 A;  3VUR A;  3AY8 A;  3QCP A;  3GTU B;  4ZBD A;  3L9V A;  3M0F A;  4PNF A;  5LNK e;  5CYY A;  3KD0 A;  2GQL A;  1T8E B;  3CRT A;  3KEB A;  5G1K A;  3VPT A;  2IN3 A;  4POL A;  5HR2 A;  1GRX A;  4DVC A;  3FZA A;  1WMJ A;  2R6K A;  4TW5 A;  1A23 A;  3GN3 A;  2C8U A;  2BMX A;  5F8B A;  3QDN A;  5ECH B;  2I3Y A;  1XWC A;  4F0C A;  2I1U A;  1XIY A;  3UAP A;  1AUC A;  3QAW A;  4L0W A;  1GUM A;  1LBK A;  4MJA A;  1SK2 A;  3ZFB A;  2DJK A;  2B5Y A;  4FIW A;  3LYK A;  2WGR A;  4TR3 A;  1GSF A;  2DJ1 A;  3ZIV A;  4MMM A;  2HLS A;  1U3I A;  3UOM A;  2VCX A;  4Q5N A;  1B9X C;  4MZW A;  2FUG 2;  1MTC A;  1M2B A;  3ME8 A;  2RLI A;  3P7X A;  3TJF A;  2WRT A;  3F0I A;  1QUW A;  3QFB C;  1O8X A;  4HZ4 A;  1XW5 A;  2WB9 A;  1O7U A;  1WRY A;  4NPB A;  3ED3 A;  2B3S A;  1GUK A;  1NM3 A;  3BJ5 A;  5F06 A;  4YQM A;  4DSR A;  1PGT A;  4ZBB A;  5CAX A;  4PQH A;  1VF4 A;  5CRE A;  3A5W A;  1MDK A;  4KDY A;  2FWF A;  1XXU A;  3BD2 A;  1PMT A;  2YWN A;  1KNG A;  1QXH A;  2FWH A;  1R5A A;  3U5R E;  4MJE A;  5CRW A;  4POK A;  4OWY A;  11GS A;  3L0H A;  2AUV A;  1YJ6 A;  1H75 A;  1GSY A;  4K1F A;  2V6O A;  1XVW A;  1GSS A;  3ZZX A;  6GSU A;  1O81 A;  1Z6M A;  4NHZ A;  3TRX A;  4KH7 A;  3L4N A;  3WGE A;  2DJ0 A;  1NHY A;  4MJB A;  2OJL A;  2J9H A;  2VLU A;  2C80 A;  3VLN A;  3RPP A;  5COH A;  3GV1 A;  5IIZ A;  5CRG A;  5GSS A;  1X5D A;  4KE3 A;  5EY6 A;  5GAN D;  1F6M C;  8GSS A;  3PPU A;  3VFI A;  1JZW A;  4E8E A;  1S3A A;  1TRS A;  2GT5 A;  2OKA A;  1URM A;  2PPT A;  2TRC P;  5HQP A;  2FCH A;  4IBP A;  1XWK A;  2PU9 C;  2WCI A;  2LQQ A;  2YN1 A;  1HD2 A;  3TJK A;  5E4W A;  4LLR A;  4AGS A;  3GYK A;  2B1K A;  1ERW A;  1I5G A;  1VF1 A;  5DDL A;  1J9B A;  5JWR B;  4KCE A;  1ML6 A;  2B7K A;  2VCQ A;  4XS1 A;  1TP9 A;  3D22 A;  2GQM A;  3I43 A;  3C8E A;  2JZR A;  4MZC A;  1PRX A;  3KMN A;  2YV7 A;  5LD0 A;  1WIK A;  3PGT A;  3EU4 A;  1TOF A;  3C7M A;  2VO4 A;  1PN9 A;  5IOX A;  3C1R A;  1GLQ A;  1EP7 A;  2LQO A;  2V2G A;  3FR6 A;  1K3O A;  2L59 A;  4KX4 A;  5H5Q A;  1M9A A;  1SYX A;  1EV9 A;  4OO4 A;  2WZ9 A;  1BYE A;  3HJO A;  4N10 A;  1JZO A;  3R3E A;  2KP1 A;  5B8A A;  2LUS A;  4F0B A;  5F05 A;  1VF2 A;  1SL0 B;  1OC9 A;  2GSS A;  1R5P A;  2VD1 A;  1TRW A;  2LRC A;  1SEN A;  1AIU A;  1KEB A;  4DSS A;  1IYI A;  4V2L A;  3GFK A;  1ABA A;  1A2M A;  2LKU A;  3R2Q A;  3KZQ A;  1K0N A;  2VCT A;  4YAV A;  1SJI A;  2K8V A;  1HNC A;  3FYG A;  3H93 A;  2IPA A;  1FO5 A;  1ZZY A;  2HRK A;  2MBT A;  2F9S A;  1LJR A;  4EXJ A;  2TIR A;  3KH7 A;  22GS A;  5KN1 A;  5IMZ A;  3CXG A;  5INY A;  4H86 A;  4MF6 A;  1TTZ A;  1X9S B;  3GA4 A;  2HXK A;  4ZB8 A;  1ZYQ B;  5D9V A;  3QOU A;  2AHE A;  1FVJ A;  4KF9 A;  1UN2 A;  1SYR A;  2C0F A;  1DSB A;  2VCZ A;  4PQ1 A;  1B8X A;  3FY7 A;  4PUF C;  3TKR A;  4KDU A;  1THX A;  5ECP B;  3RHC A;  3RDW A;  4JU5 A;  4ZB9 A;  2CVB A;  1UC7 A;  3HJP A;  4GWR A;  5H5R A;  1VRS D;  1G6Y A;  3LFL A;  4K7I A;  1PQN A;  2DJ3 A;  3BOA A;  1I9D A;  4J2F A;  2EIQ A;  3I6A A;  2PBJ A;  2VLV A;  3ZVJ A;  5G31 A;  2QSI A;  3IC4 A;  2O87 A;  1F3B A;  3TKS E;  2NVL A;  3UBK A;  2B5E A;  3HVX A;  1ZYE A;  4K9Z A;  3LQ7 A;  1A2J A;  3ZL5 A;  1T4Z A;  5G2Z A;  2HSM B;  1Z5Y E;  5ECM B;  1V58 A;  2OE3 A;  4L0U A;  1R26 A;  4I2U A;  2HI7 A;  3P8W A;  4J57 E;  2B7J A;  4GCI A;  4BVX B;  1B4P A;  2DSA A;  3FRC A;  4PUR A;  3UMA A;  1EEJ A;  5AIX A;  3DKS A;  4K7N A;  4NV2 A;  2GZZ A;  3DXB A;  2YWO A;  1AW9 A;  4OFT A;  4AJ6 A;  1ERU A;  1XCC A;  2XPD A;  4LA1 A;  2R37 A;  3IXR A;  9GSS A;  2WS2 A;  3PR8 A;  1WPI A;  4ZIL A;  3TGZ A;  1G7E A;  1DUG A;  2M80 A;  3Q6O A;  2H76 A;  2H72 A;  1BQ7 A;  2R5G A;  4WF5 A;  4FQU A;  2HNL A;  1W4V A;  3TDG A;  2QKE A;  1OE7 A;  3HYP A;  3BCK A;  2RUE A;  5ECI B;  3KJY A;  4WBJ A;  1ZL9 A;  2JSY A;  5FWG A;  4E8H A;  1TRV A;  2CAI A;  2YWM A;  5J3R A;  4KGI A;  5KEJ A;  1XZO A;  2CQ9 A;  1T7P B;  1MDI A;  4FO5 A;  2VAF A;  4YH2 A;  3LJR A;  2CV4 A;  2X8G A;  3EMX A;  3TKS A;  1DE2 A;  3LYP A;  4OFN A;  3U6V A;  4XS4 A;  4KSO A;  10GS A;  2ZUP A;  2C3N A;  5DJL A;  2PUK C;  4K6X A;  2YJ7 A;  4QQ7 A;  7GSS A;  3KCM A;  3TKQ A;  3FKF A;  3GST A;  3GUR A;  4G19 A;  2OAD A;  1XBS A;  1HQO A;  3HXS A;  1ZGN A;  1Z7R A;  1R4W A;  4I6X A;  1F3A A;  3WD6 A;  4ZXG A;  2H6Z A;  4HUA A;  2QC7 A;  3DIE A;  1OKD A;  1CQG A;  1ERV A;  3G7J A;  2HRA A;  2X64 A;  3H4K A;  1J0F A;  1EWX A;  1JZR A;  3TCO A;  3LXT A;  3P90 A;  1N8J A;  2RM5 A;  2HYX A;  3J7Y k;  1S3D A;  4WXT A;  2C3Q A;  3A2X A;  3IPZ A;  1M99 A;  1XWB A;  2K18 A;  4IP6 A;  3Q74 A;  1QMV A;  3OR5 A;  1EEM A;  3GX0 A;  5G5F A;  1XPV A;  3IK9 A;  4FYC A;  1DE1 A;  5ELG A;  1ILO A;  2YWI A;  2KOK A;  1Q98 A;  1SKS B;  4O7H A;  2KP2 A;  4NV5 A;  1QFN A;  4EL1 A;  2H01 A;  3EC3 A;  3V1W A;  1FOV A;  1AC1 A;  2X99 A;  2H70 A;  3MSZ A;  1A24 A;  3HDC A;  5ABR A;  4G0K A;  1GNW A;  1TW9 A;  1QQ2 A;  4YQU A;  4BVY A;  5CNW A;  4F03 A;  1V98 A;  5EL8 A;  5HFK A;  3VWV A;  4G9H A;  4LMV A;  1FB6 A;  1A8Y A;  4F9Z A;  2REM A;  4TR0 A;  3FK8 A;  3QFA C;  4GSN A;  4IJ3 A;  1SJZ A;  17GS A;  2HSY A;  4J56 E;  5A4U A;  2GTU A;  3F3Q A;  3LGC A;  4EF0 A;  3FZ5 A;  1GL8 A;  2PN8 A;  3VK9 A;  2VL9 A;  3IAM 2;  4JRR A;  2JAC A;  5ECR B;  3MAK A;  3RAZ A;  4CW9 A;  4KSM A;  2H73 A;  2M46 A;  4HI7 A;  4I2T A;  4ZL8 A;  4Z7X A;  1A0F A;  4PX1 A;  1XW9 A;  4GST A;  3TRQ A;  3GHA A;  4NWY A;  3GSS A;  2A2S A;  2VM2 A;  3W8S A;  1YDK A;  5AIS A;  1AXD A;  2B5X A;  3BCI A;  2G0F A;  2VL2 A;  3GMF A;  2IME A;  4XHM A;  5ELA A;  4G0I A;  2ZNM A;  3DWV A;  4OD7 A;  3FZ9 A;  4MP4 A;  4MCU A;  1M0U A;  2IFQ A;  2DBC A;  2OE0 A;  2K6V A;  3MWH A;  2J23 A;  1ERT A;  5B6M A;  1WWJ A;  2FA4 A;  5C04 A;  1KTE A;  3TJJ A;  3HY2 A;  3Q18 A;  4ISD A;  1PX6 A;  2YNX A;  5IMF A;  1Z7P A;  1GUL A;  1VGL A;  2N5F A;  4IHU A;  1USB A;  5D96 A;  2WJU A;  3KGK A;  4EDY A;  4JE1 A;  5FHI A;  3M3M A;  3MNG A;  1GSQ A;  2L57 A;  1K0M A;  4WKW A;  5J9C A;  5IMD A;  4EUY A;  1TU8 A;  2I9H A;  5ECN B;  3DEX A;  1M9B A;  5G1L A;  1Y25 A;  3K8N A;  1PSQ A;  3TJB A;  2FA8 A;  5HR0 A;  1GWC A;  4Q5F A;  1G0T A;  5H5S A;  3W6G A;  3NZN A;  2IMK A;  5D9X A;  1ST9 A;  2XHF A;  3G7I A;  3GX8 A;  5J9B A;  2HT9 A;  3TOU A;  3LOR A;  2XPE A;  5J41 A;  2AYT A;  5L71 A;  4HOJ A;  2LJK A;  4N0V A;  1X5E A;  3VPQ A;  2G2Q A;  2LS5 A;  1K3Y A;  4HU9 A;  4FYU A;  4XRD A;  1WJK A;  4EO3 A;  5IO0 A;  4MLY A;  4TR1 A;  1O8W A;  3L78 A;  1U3A A;  4WF4 A;  5D9T A;  1XW6 A;  2N5A A;  1K0D A;  1JFU A;  1TU7 A;  4X43 A;  1MDJ A;  3ZFL A;  2IJY A;  2VCV A;  3IR4 A;  3ZTL A;  3KP8 A;  3ERG A;  5GAP D;  1EOG A;  2K9F A;  2YAN A;  1JLW A;  5D93 A;  2JL4 A;  1M2D A;  3JCM L;  2OE1 A;  2H0H A;  2V1M A;  3QPM A;  1XFL A;  2B6M A;  5JCG A;  5DQS A;  3GKM A;  3TUE A;  1OC3 A;  3VWX A;  2AV4 A;  2I81 A;  1SU9 A;  2F3M A;  4BL7 A;  2CVK A;  2H19 A;  2FY6 A;  4RI6 A;  4WBR D;  2EIR A;  3D5J A;  5IQY A;  2ON5 A;  3UVH A;  4I5Q A;  4I97 A;  1TK8 B;  5ECO B;  2MMA A;  2LJR A;  1OC9 B;  3NOF A;  1F2E A;  1SJ6 A;  3D0Z A;  4LMW A;  1GNE A;  19GS A;  3IDV A;  3G7Y A;  4DSS B;  3I69 A;  2O85 A;  1SKW B;  3IC8 A;  3BBY A;  4RQR A;  4MZB A;  5E59 A;  4TXO A;  4ULX A;  2H0I A;  3MDK A;  4IP1 A;  4O32 A;  5IMA A;  1KBN A;  4QL9 A;  3QAG A;  3SWL A;  2YOI A;  4L5O A;  1QK8 A;  2GGT A;  4ZBA A;  2HRK B;  4IGJ A;  4NMU A;  1YF1 A;  4IKH A;  2PVO C;  2IMI A;  3DML A;  2FGX A;  4MDC A;  1AQW A;  4GRF A;  2R4V A;  4ML6 A;  3ZML A;  1YF0 A;  5IMC A;  1TDI A;  2H66 A;  2IMD A;  2EC4 A;  2RUF A;  5AIV A;  2P0G A;  3CSJ A;  3CYN A;  5HR1 A;  5IPG A;  2QGV A;  1EP8 A;  4FH8 A;  1SK0 A;  4AF2 A;  2HRF A;  2DC5 A;  2GLR A;  1GP1 A;  1YKA A;  1T3B A;  2YZU A;  1X0R A;  2K8S A;  4RI7 A;  3FEU A;  4ILF A;  2MBS A;  1B48 A;  3E0U A;  3VI7 A;  1FVK A;  1T4Y A;  4GLT A;  4IQ1 A;  3N5O A;  2LEG A;  4BWQ A;  5JWO B;  4HU7 A;  3KM6 A;  6GSY A;  2VIM A;  3DVX A;  4MH2 A;  1Z3E A;  3FHK A;  2L6D A;  1OVN A;  4DEJ A;  3P2A A;  1A0R P;  2CT6 A;  2CX4 A;  4IN0 A;  5HFG A;  3WT1 A;  5ID2 A;  4V1A g;  2R3X A;  5F0G A;  4PXO A;  4KW6 A;  3HKR A;  4MPG A;  4PNG A;  4ZL9 A;  1Y6E A;  1XOB A;  2L5L A;  2H30 A;  5CP1 A;  3IRA A;  4ZL7 A;  4MJC A;  1YKC A;  2GS3 A;  1XVQ A;  4TVE A; 
#chains in the Genus database with same CATH topology
 1ACV A;  2E7P A;  1E2Y A;  1AAZ A;  4IS0 A;  1ZYN A;  3M8N A;  1NW2 A;  2AJQ B;  3FZ4 A;  2XBQ A;  1AQV A;  3ERW A;  1PD2 1;  1K0A A;  3SBC A;  4ECI A;  1K0O A;  4K7O A;  4Q5R A;  1BX9 A;  4WET A;  5KOX A;  1LU4 A;  5BRT A;  5AGY A;  2HRN A;  2A4V A;  2QA2 A;  4X1U A;  1DBY A;  1O6J A;  1PN0 A;  1GTB A;  3A2V A;  6GSW A;  4POB A;  2GST A;  4K2X A;  4FXY P;  3F6D A;  1HYU A;  3H8Q A;  5BMU A;  4IJI A;  2VL3 A;  1G7O A;  4WR5 A;  1OKT A;  12GS A;  3HVN A;  2C0G A;  1EOH A;  1PX7 A;  2H6Y A;  4RQX A;  2V32 A;  1PKZ A;  4KCA A;  13GS A;  1VF3 A;  1C72 A;  5J47 A;  1YZX A;  1MEK A;  4D73 A;  3CHX C;  4MPF A;  16GS A;  3C71 A;  4AJ7 A;  2ALB A;  4K0N A;  2VUP A;  5G30 A;  2YP6 A;  3FR3 A;  2VL2 C;  2MMZ A;  1GUH A;  3APS A;  4K2D A;  1GTU A;  4OCF A;  4XTS A;  3IK7 A;  2HFD A;  4PGT A;  4JBB A;  4XS4 B;  2CVD A;  3KIJ A;  1OC8 A;  4A5P A;  1Z9H A;  1BG5 A;  3KP9 A;  5DAK A;  2LTK A;  3QMX A;  2HSN B;  3US3 A;  2H1A A;  2HZE A;  2XBI A;  2FLS A;  4I8B A;  3IOS A;  4GQC A;  1K0C A;  5DJM A;  1F9M A;  1M2A A;  3CMI A;  4KND A;  4V2N A;  5DBQ A;  1SL1 B;  3WGX A;  2GZP A;  18GS A;  2ES7 A;  2H74 A;  3CTG A;  1GH2 A;  3EVI A;  1M7T A;  2V6K A;  2L6C A;  4OO5 A;  5FT3 A;  4WR4 A;  1PL2 A;  2H8L A;  3CQF A;  3QD9 A;  4L5L A;  5DAL A;  4ID0 A;  3HD5 A;  1FB0 A;  6GSS A;  3HHV A;  1J08 A;  4K0G A;  3Q19 A;  2CAQ A;  2C3T A;  2GT6 A;  4USS A;  3M9K A;  2C4J A;  4X4J A;  2IL3 A;  1BJX A;  3GH9 A;  4X0X A;  1TXX A;  2P5R A;  2EFC A;  3GTU A;  4JR6 A;  3IHQ A;  2OA7 A;  4JR4 A;  1NHO A;  5IMV A;  4MF7 A;  2GZY A;  3D4T A;  3E9J B;  2AB6 A;  3TRP A;  3CBU A;  4IVF A;  1X9M B;  2IIY A;  4O5R A;  1K0B A;  3H79 A;  5EVO A;  1TJD A;  5GZZ B;  3QR6 A;  4IW9 A;  4CHS A;  2RII A;  1HNA A;  1B9Y C;  1Q4J A;  1EGR A;  1JLV A;  4EE0 A;  4HS1 A;  3UIW A;  2F51 A;  4BVY B;  4BPY A;  1RQM A;  1WP0 A;  2KHP A;  3GNJ A;  4N3Z A;  2HE3 A;  5CRH A;  1JZD A;  1YEP A;  3F4S A;  5DVB A;  1M3J A;  3HVS A;  2MZC A;  3ZLP A;  2WFC A;  4EKZ A;  1GTA A;  3HVV A;  4N0Z A;  3PH9 A;  1X5C A;  2P5Q A;  2QA1 A;  1K3L A;  3VWW A;  2NDO A;  2YZH A;  3O3T A;  1ZMA A;  3GL3 A;  3D6I A;  1UVZ A;  4PTS A;  1A8L A;  1GSD A;  1F37 A;  4IQA A;  4EVM A;  1S3R A;  1YY7 A;  6GSV A;  4TKY A;  2LV3 A;  3A2W A;  1BF5 A;  1TK5 B;  4MH3 A;  4CDO A;  2O36 A;  2UZ8 A;  3NIV A;  2FNO A;  3HJM A;  3VWU A;  4P3Y B;  2H1B A;  4PI2 C;  5A4V A;  5B8B A;  3L9U A;  14GS A;  4RUV A;  5A5H A;  3ZMK A;  2JSZ A;  4G2E A;  2GVP A;  3LWA A;  2IFQ B;  1V2A A;  3ZIJ A;  3KXO A;  2IMF A;  3A5I A;  4N11 A;  2E0Q A;  3HZ4 A;  3F8U A;  2WDU A;  4HZ2 A;  5AN1 A;  1TI3 A;  2DIZ A;  1FG4 A;  5IPH A;  3FR9 A;  2X8H A;  1G6W A;  1MD3 A;  2DML A;  1T00 A;  5D73 A;  3ZIT A;  2PMT A;  4XIH A;  1CQH A;  2L4Q A;  3UVT A;  2GDR A;  3ISO A;  1AQX A;  3RHB A;  5HR3 A;  1ON4 A;  2VCW A;  3C73 A;  2DJJ A;  4QL7 A;  3WYW A;  4TRX A;  2TRX A;  4MAB A;  1TRU A;  2JU5 A;  2GSR A;  1NSW A;  3F6F A;  3QAV A;  5B7C A;  1XWA A;  2CX3 A;  3GKK A;  3L9S A;  3F63 A;  4OCE A;  3IHG A;  5J4V A;  4BA7 A;  4KAE A;  1W89 A;  3APQ A;  1EV4 A;  4GXZ A;  4HJ2 A;  3IE3 A;  1WE0 A;  2O7K A;  1IYH A;  4KDX A;  4POM A;  2YV9 A;  6GSX A;  4HEA 2;  1X9W B;  5KN0 A;  4N30 A;  4XRA A;  2XC2 A;  2H71 A;  3M1G A;  3ERF A;  3CTF A;  1Z6N A;  1QGV A;  2OBI A;  4AJ8 A;  2R0G A;  1SD9 A;  2PER A;  3UJ1 A;  3EIN A;  4TR1 B;  2C0D A;  3GKX A;  2NPB A;  4ACS A;  2HSH A;  5ECK B;  5D9W A;  2PVQ A;  2B1L A;  4HQZ A;  3IV4 A;  2YJH A;  3PIN A;  2EIO A;  3EMP A;  1B4Q A;  5ENU A;  1TK0 B;  2IWT A;  2F8F A;  2VLT A;  4F82 A;  1O73 A;  2AAW A;  1U6T A;  1XG8 A;  3TB2 A;  3CSI A;  2O89 A;  4ZB7 A;  5B6N A;  2LNT A;  5ECL B;  3CSH A;  4EIQ A;  1FHE A;  1EGO A;  3J7Y b;  2KUC A;  2H0G A;  1GSU A;  1YEW C;  4QMK A;  1TI1 A;  3N9J A;  3KTB A;  4ICY A;  5CRD A;  3WT2 A;  5GST A;  4MF5 A;  4BL7 B;  1YEX A;  2MYG A;  1GTI A;  4ZIJ A;  2O8V B;  2JAD A;  3ZRE A;  5ECQ B;  1U87 A;  3KMO A;  2X8C A;  1GSE A;  2VOC A;  3IAS 2;  2BTO T;  4XCS A;  1ZOF A;  4ECJ A;  4XS6 A;  2DLX A;  3GUS A;  4LL1 B;  3HZ8 A;  2LRN A;  3EYT A;  1V40 A;  4NHW A;  5CO3 A;  2V41 A;  4MA9 A;  3TKS C;  1BED A;  3ME7 A;  4TXO B;  5C00 A;  3I9V 2;  5KN3 A;  2LST A;  2DKI A;  4Q5Q A;  4O92 A;  3APO A;  3LXZ A;  5F07 A;  2GQK A;  3EU3 A;  1V9W A;  1OYJ A;  3EPT A;  5IOW A;  3W8J A;  1HNB A;  2HZF A;  1T1V A;  1WOU A;  6GST A;  2FD3 A;  1PKW A;  2JZT A;  5DQY A;  4TOP A;  5EPF A;  4HJM A;  3EE2 A;  4V2M A;  4PUA A;  2C1Y A;  4YKG A;  4O5Q A;  1SVL A;  3WGD A;  2LRT A;  2NBS A;  4TN8 A;  4ZB6 A;  2F8A A;  1ZCP A;  5DCG A;  3UL3 A;  3GIX A;  5LCZ A;  2JZS A;  4EC0 A;  1SKR B;  3VI5 A;  5J40 A;  3H1N A;  3ZYW A;  2CZ3 A;  5IO2 A;  4V1A p;  2WVX A;  3ZRD A;  2OAC A;  4KA0 A;  5IM9 A;  3FW2 A;  2H75 A;  5JCU A;  3DYR A;  5JWQ B;  5J4Y A;  4PQI A;  5DCH A;  3TKP A;  3EUR A;  2HSM A;  5ECS A;  4OFM A;  4ECC A;  2LJA A;  3IBH A;  2ON7 A;  5ID2 B;  4BWS A;  5A5K A;  1THO A;  3GH6 A;  3HMJ G;  3O6T A;  3A3T A;  4YQV A;  4L8E A;  2VM1 A;  4TR4 A;  4BVX A;  5A4W A;  20GS A;  4LL4 B;  3F3R A;  4DSQ A;  2A2R A;  2E2G A;  1JHB A;  3D4M A;  4ECB A;  3DVW A;  4JZQ A;  2R2J A;  4GF0 A;  4WEY A;  1SK1 A;  5A34 A;  2LNS A;  3UAR A;  3C1S A;  2MMO A;  1PL1 A;  3LSZ A;  5HFI A;  3LG6 A;  3D21 A;  4NAX A;  2DJ2 A;  4G10 A;  3F4R A;  2RM6 A;  4NXI A;  1S3C A;  2KLX A;  3E3E A;  2M72 A;  2YPM A;  4MK3 A;  5J5N A;  1RK4 A;  2I4A A;  4GDF A;  2E2M A;  3GKN A;  1OAZ A;  2H6X A;  1PA3 A;  3GRX A;  3F4T A;  3F9U A;  1SL2 B;  1S4B P;  1XWG A;  5BMU B;  2DMM A;  2FWE A;  1R7H A;  3RPN A;  2NTO A;  3IA1 A;  2PGT A;  4GSS A;  3S9F A;  3TJG A;  3UBL A;  2H1D A;  3RBT A;  4GTU A;  1FAA A;  2CZ2 A;  1O85 A;  3UEM A;  2GSQ A;  2YCD A;  2FHE A;  1BAY A;  5D8I A;  3CRU A;  4D73 B;  2L4C A;  4W66 A;  2Z9S A;  4TXV A;  1YQ1 A;  4OMV A;  3G9B A;  5JCW A;  2CA8 A;  1UA5 A;  4HDE A;  1V57 A;  4GQF A;  3EWL A;  2D2Z A;  2ZCT A;  3O76 A;  4ML1 A;  5DAK B;  1MD4 A;  1E6B A;  2C0E A;  2HZE B;  3M9J A;  1XOA A;  4YAP A;  4G0L A;  2PWJ A;  3DGQ A;  1A2L A;  2FWG A;  3LEF A;  3DD3 A;  1RW1 A;  5KN2 A;  1SD8 A;  4EDZ A;  2HQT A;  4JED A;  4IEL A;  2N5B A;  5G5E A;  1TKD B;  3GL5 A;  4HQS A;  2H1G A;  2WUL A;  2P31 A;  3KTL A;  2MMN A;  2DIY A;  3TOT A;  4CY6 A;  1OE8 A;  4KUN A;  3HCZ A;  4KB3 A;  2OBK A;  1U88 A;  3ZVJ D;  3DRN A;  5DAL B;  4K8M A;  4FYB A;  1FW1 A;  5J4U A;  3HA9 A;  1H4O A;  3KH9 A;  2BJX A;  2L5O A;  1GLP A;  1N2A A;  1EZK A;  4F2I A;  2VD0 A;  3VUR A;  3AY8 A;  3QCP A;  3GTU B;  4ZBD A;  3L9V A;  3M0F A;  4PNF A;  5LNK e;  5CYY A;  3KD0 A;  2GQL A;  1T8E B;  3CRT A;  3KEB A;  5G1K A;  3VPT A;  2IN3 A;  4POL A;  5HR2 A;  1GRX A;  4DVC A;  3FZA A;  1WMJ A;  2R6K A;  4TW5 A;  1A23 A;  3GN3 A;  2C8U A;  2BMX A;  5F8B A;  3QDN A;  5ECH B;  2I3Y A;  5A1N A;  1XWC A;  1FOH A;  4F0C A;  4AKG A;  2I1U A;  1XIY A;  3UAP A;  1AUC A;  3QAW A;  4L0W A;  1GUM A;  1LBK A;  4MJA A;  1SK2 A;  3TU3 B;  3ZFB A;  2DJK A;  2B5Y A;  4FIW A;  3LYK A;  2WGR A;  4TR3 A;  1GSF A;  2DJ1 A;  3ZIV A;  4MMM A;  2HLS A;  1U3I A;  3UOM A;  2VCX A;  4Q5N A;  1B9X C;  4MZW A;  2FUG 2;  1MTC A;  1M2B A;  3ME8 A;  3CWG A;  2RLI A;  3P7X A;  3TJF A;  2WRT A;  4AKI A;  3F0I A;  1QUW A;  3QFB C;  1O8X A;  4HZ4 A;  1XW5 A;  2WB9 A;  1O7U A;  2UV8 G;  1WRY A;  4NPB A;  3ED3 A;  3LW9 A;  2B3S A;  1GUK A;  1NM3 A;  3BJ5 A;  5F06 A;  4YQM A;  4DSR A;  1PGT A;  4ZBB A;  5CAX A;  4PQH A;  1VF4 A;  5CRE A;  3A5W A;  1MDK A;  1Y1U A;  4KDY A;  2FWF A;  1XXU A;  3BD2 A;  4K5S A;  1PMT A;  2YWN A;  1KNG A;  1QXH A;  2FWH A;  5A5H B;  1R5A A;  3U5R E;  5KOW A;  4MJE A;  5CRW A;  4POK A;  4OWY A;  11GS A;  3L0H A;  2AUV A;  1YJ6 A;  1H75 A;  1GSY A;  4K1F A;  2V6O A;  1XVW A;  1GSS A;  3ZZX A;  6GSU A;  1O81 A;  4G01 A;  1Z6M A;  4NHZ A;  3TRX A;  4KH7 A;  3L4N A;  3WGE A;  2DJ0 A;  1NHY A;  4MJB A;  2OJL A;  2J9H A;  2VLU A;  2C80 A;  3VLN A;  3RPP A;  5COH A;  4BIK A;  3GV1 A;  5IIZ A;  5CRG A;  5GSS A;  1X5D A;  4KE3 A;  5EY6 A;  5GAN D;  1F6M C;  8GSS A;  3PPU A;  3VFI A;  1JZW A;  4E8E A;  1S3A A;  1TRS A;  2GT5 A;  2OKA A;  1URM A;  2PPT A;  2TRC P;  5HQP A;  2FCH A;  4IBP A;  1XWK A;  2PU9 C;  2WCI A;  2LQQ A;  2YN1 A;  2OT3 A;  1HD2 A;  3TJK A;  5E4W A;  4LLR A;  4AGS A;  3GYK A;  2B1K A;  1ERW A;  1I5G A;  2WVY A;  1VF1 A;  5DDL A;  1J9B A;  5JWR B;  4KCE A;  1ML6 A;  2B7K A;  2VCQ A;  4MNN A;  2R0P A;  4XS1 A;  1TP9 A;  2H1L A;  2GQM A;  3D22 A;  3I43 A;  3C8E A;  2JZR A;  4MZC A;  1PRX A;  3KMN A;  2YV7 A;  5LD0 A;  1WIK A;  3PGT A;  3EU4 A;  1TOF A;  3C7M A;  2VO4 A;  1PN9 A;  5IOX A;  3C1R A;  1GLQ A;  1EP7 A;  2LQO A;  2V2G A;  3FR6 A;  1K3O A;  2L59 A;  4KX4 A;  5H5Q A;  1M9A A;  1SYX A;  1EV9 A;  4OO4 A;  2EFH A;  2WZ9 A;  1BYE A;  3MYD A;  3HJO A;  4N10 A;  1JZO A;  3R3E A;  2KP1 A;  5B8A A;  2LUS A;  4F0B A;  5F05 A;  1VF2 A;  1SL0 B;  1OC9 A;  2GSS A;  1R5P A;  2VD1 A;  1TRW A;  2LRC A;  1SEN A;  4Z2T A;  4AKX B;  1AIU A;  1KEB A;  4DSS A;  1IYI A;  4V2L A;  3GFK A;  1ABA A;  1A2M A;  2LKU A;  3R2Q A;  3KZQ A;  1K0N A;  2VCT A;  4YAV A;  1SJI A;  2K8V A;  1HNC A;  3FYG A;  4YKF A;  3H93 A;  2IPA A;  1FO5 A;  2WZS A;  1ZZY A;  2HRK A;  2MBT A;  2F9S A;  1LJR A;  4EXJ A;  2TIR A;  3KH7 A;  22GS A;  5KN1 A;  5IMZ A;  3CXG A;  5INY A;  4H86 A;  4MF6 A;  1TTZ A;  1X9S B;  3GA4 A;  2HXK A;  4ZB8 A;  1ZYQ B;  5D9V A;  3QOU A;  2AHE A;  1FVJ A;  4CY8 A;  4KF9 A;  1UN2 A;  1SYR A;  2C0F A;  1DSB A;  2VCZ A;  4PQ1 A;  1B8X A;  3FY7 A;  4PUF C;  3TKR A;  4KDU A;  2WW2 A;  1THX A;  5ECP B;  3RHC A;  3RDW A;  4JU5 A;  4ZB9 A;  1SVO A;  2CVB A;  1UC7 A;  3HJP A;  4GWR A;  5H5R A;  1VRS D;  1G6Y A;  3LFL A;  4Z2R A;  4K7I A;  1PQN A;  3RGB C;  4AI6 A;  2DJ3 A;  3BOA A;  1I9D A;  4J2F A;  2EIQ A;  3I6A A;  2PBJ A;  2VLV A;  3ZVJ A;  2WVX B;  5G31 A;  2QSI A;  3IC4 A;  2O87 A;  1F3B A;  3TKS E;  2NVL A;  1I1I P;  3UBK A;  2B5E A;  3HVX A;  1ZYE A;  4K9Z A;  3LQ7 A;  1A2J A;  3ZL5 A;  1T4Z A;  5G2Z A;  2HSM B;  1Z5Y E;  5ECM B;  1V58 A;  2OE3 A;  4L0U A;  1R26 A;  1BG1 A;  4I2U A;  2HI7 A;  3P8W A;  4J57 E;  2B7J A;  4GCI A;  4BVX B;  1B4P A;  2DSA A;  3FRC A;  4PUR A;  3UMA A;  1EEJ A;  5AIX A;  3DKS A;  4K7N A;  4NV2 A;  3FMW A;  2GZZ A;  3DXB A;  2YWO A;  1AW9 A;  5A34 B;  4OFT A;  4AJ6 A;  1ERU A;  1XCC A;  2XPD A;  4LA1 A;  4Z2U A;  2R37 A;  3IXR A;  9GSS A;  2WS2 A;  3PR8 A;  1WPI A;  4ZIL A;  3TGZ A;  1G7E A;  1DUG A;  1PFO A;  2M80 A;  3Q6O A;  2H76 A;  2H72 A;  1BQ7 A;  2R5G A;  4WF5 A;  4FQU A;  2HNL A;  1W4V A;  3TDG A;  2QKE A;  1OE7 A;  3HYP A;  3BCK A;  2RUE A;  5ECI B;  3KJY A;  4WBJ A;  1ZL9 A;  2DKH A;  2JSY A;  5FWG A;  4E8H A;  1TRV A;  2CAI A;  2YWM A;  5J3R A;  4KGI A;  5KEJ A;  1XZO A;  4O5U A;  2CQ9 A;  1T7P B;  1MDI A;  4FO5 A;  2VAF A;  4YH2 A;  3LJR A;  2CV4 A;  2X8G A;  3EMX A;  3TKS A;  1DE2 A;  3LYP A;  4OFN A;  3U6V A;  4PHZ C;  4XS4 A;  4KSO A;  10GS A;  2ZUP A;  2C3N A;  5DJL A;  2PUK C;  4K6X A;  2HSN A;  1M3I A;  2YJ7 A;  4QQ7 A;  7GSS A;  3KCM A;  3TKQ A;  3FKF A;  3GST A;  3GUR A;  4G19 A;  2OAD A;  1XBS A;  1HQO A;  3HXS A;  1ZGN A;  1Z7R A;  2WVZ A;  1R4W A;  4I6X A;  1F3A A;  3WD6 A;  4ZXG A;  2H6Z A;  4HUA A;  2QC7 A;  3DIE A;  1OKD A;  1CQG A;  1ERV A;  3G7J A;  2HRA A;  2X64 A;  3H4K A;  1J0F A;  1EWX A;  1JZR A;  3TCO A;  3LXT A;  3P90 A;  1N8J A;  2RM5 A;  2HYX A;  3J7Y k;  1S3D A;  4WXT A;  2C3Q A;  3A2X A;  3IPZ A;  1M99 A;  1XWB A;  2K18 A;  4IP6 A;  3Q74 A;  1QMV A;  3OR5 A;  1EEM A;  3GX0 A;  5G5F A;  1XPV A;  3IK9 A;  4FYC A;  1DE1 A;  5ELG A;  1ILO A;  2YWI A;  2KOK A;  1Q98 A;  1SKS B;  4O7H A;  2KP2 A;  2WW1 A;  1QFN A;  4NV5 A;  4EL1 A;  2H01 A;  3EC3 A;  2X49 A;  3V1W A;  1FOV A;  1AC1 A;  2X99 A;  2H70 A;  3MSZ A;  1A24 A;  3HDC A;  5ABR A;  4G0K A;  1GNW A;  1TW9 A;  1QQ2 A;  4YQU A;  4BVY A;  5CNW A;  4EIP A;  2EFE A;  4F03 A;  2WW3 A;  1V98 A;  5EL8 A;  5HFK A;  3VWV A;  4G9H A;  5A1N B;  4LMV A;  1FB6 A;  1A8Y A;  4F9Z A;  2REM A;  4TR0 A;  3FK8 A;  3QFA C;  4GSN A;  4IJ3 A;  1SJZ A;  17GS A;  2HSY A;  4J56 E;  5A4U A;  2VKZ G;  2GTU A;  3F3Q A;  3LGC A;  4EF0 A;  3FZ5 A;  1GL8 A;  2PN8 A;  3VK9 A;  2VL9 A;  3IAM 2;  4JRR A;  2JAC A;  1YVL A;  5ECR B;  3MAK A;  3RAZ A;  2O3E A;  4CW9 A;  4KSM A;  2H73 A;  2M46 A;  4HI7 A;  4I2T A;  4ZL8 A;  4Z7X A;  1A0F A;  4PX1 A;  1XW9 A;  4GST A;  3TRQ A;  3GHA A;  2R0C A;  3GSS A;  4NWY A;  2A2S A;  2EFD A;  2VM2 A;  3W8S A;  1YDK A;  1N25 A;  5AIS A;  1AXD A;  2B5X A;  3BCI A;  2G0F A;  2VL2 A;  3GMF A;  2IME A;  4XHM A;  5ELA A;  4G0I A;  2ZNM A;  3DWV A;  4OD7 A;  3FZ9 A;  4MP4 A;  4MCU A;  1M0U A;  2IFQ A;  2DBC A;  2OE0 A;  2K6V A;  3MWH A;  2J23 A;  1ERT A;  5B6M A;  2X4A A;  1WWJ A;  2FA4 A;  5C04 A;  1KTE A;  3TJJ A;  3HY2 A;  3Q18 A;  4ISD A;  1PX6 A;  2YNX A;  5IMF A;  2A4H A;  1Z7P A;  1GUL A;  1ZYP A;  1VGL A;  2N5F A;  4IHU A;  1USB A;  5D96 A;  2WJU A;  3KGK A;  4EDY A;  4JE1 A;  5FHI A;  3M3M A;  3MNG A;  1GSQ A;  2L57 A;  1K0M A;  4WKW A;  5J9C A;  5IMD A;  4EUY A;  1TU8 A;  2I9H A;  5ECN B;  3DEX A;  3MIX A;  1M9B A;  4K5R A;  5G1L A;  2O5V A;  1Y25 A;  3K8N A;  1PSQ A;  3TJB A;  2FA8 A;  5HR0 A;  1GWC A;  4Q5F A;  1G0T A;  5H5S A;  3W6G A;  3NZN A;  2IMK A;  5D9X A;  1ST9 A;  2XHF A;  3G7I A;  3GX8 A;  5J9B A;  2HT9 A;  3TOU A;  3LOR A;  2XPE A;  5J41 A;  2AYT A;  5L71 A;  4HOJ A;  2LJK A;  4N0V A;  1X5E A;  3VPQ A;  2G2Q A;  2LS5 A;  1K3Y A;  4HU9 A;  4FYU A;  4XRD A;  1WJK A;  4EO3 A;  5IO0 A;  4MLY A;  4TR1 A;  1O8W A;  3L78 A;  1U3A A;  4WF4 A;  5D9T A;  2A2P A;  1XW6 A;  2N5A A;  1K0D A;  1JFU A;  1TU7 A;  4X43 A;  1MDJ A;  3ZFL A;  2IJY A;  2VCV A;  3IR4 A;  4PI0 C;  3ZTL A;  3KP8 A;  3ERG A;  2WW0 A;  5GAP D;  1EOG A;  2K9F A;  2YAN A;  1JLW A;  5D93 A;  1TXU A;  2JL4 A;  1M2D A;  2OE1 A;  3JCM L;  2H0H A;  2V1M A;  3QPM A;  1XFL A;  2B6M A;  5JCG A;  5DQS A;  4AKH A;  3GKM A;  3TUE A;  1OC3 A;  3VWX A;  2AV4 A;  2I81 A;  1SU9 A;  2F3M A;  4BL7 A;  2CVK A;  2H19 A;  2FY6 A;  4RI6 A;  4WBR D;  2EIR A;  3D5J A;  5IQY A;  2ON5 A;  3UVH A;  4I5Q A;  4I97 A;  1TK8 B;  5ECO B;  2MMA A;  2LJR A;  1OC9 B;  3NOF A;  4HSC X;  1F2E A;  1SVM A;  1SJ6 A;  3D0Z A;  4LMW A;  1GNE A;  19GS A;  3IDV A;  3G7Y A;  4DSS B;  3I69 A;  4E68 A;  2O85 A;  1SKW B;  3IC8 A;  3BBY A;  4RQR A;  4MZB A;  5E59 A;  4TXO A;  4ULX A;  2H0I A;  3MDK A;  4IP1 A;  4O32 A;  5IMA A;  1KBN A;  4QL9 A;  3QAG A;  3SWL A;  2YOI A;  4L5O A;  1QK8 A;  2GGT A;  4ZBA A;  2HRK B;  4IGJ A;  4NMU A;  1YF1 A;  4IKH A;  2PVO C;  2IMI A;  3DML A;  2FGX A;  4MDC A;  1AQW A;  4GRF A;  2R4V A;  4ML6 A;  3ZML A;  1YF0 A;  5IMC A;  1TDI A;  2H66 A;  2IMD A;  2EC4 A;  2RUF A;  5AIV A;  2P0G A;  3CSJ A;  3CYN A;  5HR1 A;  5IPG A;  2QGV A;  1EP8 A;  4FH8 A;  1SK0 A;  4AF2 A;  2HRF A;  2DC5 A;  2GLR A;  1GP1 A;  1YKA A;  1T3B A;  2YZU A;  1X0R A;  2K8S A;  4RI7 A;  3FEU A;  4ILF A;  2MBS A;  1B48 A;  3E0U A;  3VI7 A;  1FVK A;  1T4Y A;  4GLT A;  4IQ1 A;  3N5O A;  2LEG A;  4BWQ A;  5JWO B;  4HU7 A;  3KM6 A;  6GSY A;  2VIM A;  3DVX A;  4MH2 A;  1Z3E A;  3FHK A;  2L6D A;  1OVN A;  4DEJ A;  3P2A A;  1A0R P;  2CT6 A;  3RFR C;  2CX4 A;  4IN0 A;  5HFG A;  3WT1 A;  5ID2 A;  4V1A g;  2R3X A;  5F0G A;  4PXO A;  4KW6 A;  3HKR A;  4MPG A;  4PNG A;  4ZL9 A;  1Y6E A;  1XOB A;  2L5L A;  2H30 A;  5CP1 A;  3IRA A;  4ZL7 A;  4MJC A;  1YKC A;  2GS3 A;  1XVQ A;  4TVE A; 
#chains in the Genus database with same CATH homology
 1ACV A;  2E7P A;  1E2Y A;  1AAZ A;  4IS0 A;  1ZYN A;  3M8N A;  1NW2 A;  2AJQ B;  3FZ4 A;  2XBQ A;  1AQV A;  3ERW A;  1PD2 1;  1K0A A;  3SBC A;  4ECI A;  1K0O A;  4K7O A;  4Q5R A;  1BX9 A;  4WET A;  5KOX A;  1LU4 A;  5BRT A;  5AGY A;  2HRN A;  2A4V A;  2QA2 A;  4X1U A;  1DBY A;  1O6J A;  1PN0 A;  1GTB A;  3A2V A;  6GSW A;  4POB A;  2GST A;  4K2X A;  3F6D A;  1HYU A;  3H8Q A;  5BMU A;  4IJI A;  2VL3 A;  1G7O A;  4WR5 A;  1OKT A;  12GS A;  2C0G A;  1EOH A;  1PX7 A;  2H6Y A;  4RQX A;  2V32 A;  1PKZ A;  4KCA A;  13GS A;  1VF3 A;  1C72 A;  5J47 A;  1YZX A;  1MEK A;  4D73 A;  4MPF A;  16GS A;  3C71 A;  4AJ7 A;  2ALB A;  4K0N A;  2VUP A;  5G30 A;  2YP6 A;  3FR3 A;  2VL2 C;  2MMZ A;  1GUH A;  3APS A;  4K2D A;  1GTU A;  4OCF A;  4XTS A;  3IK7 A;  2HFD A;  4PGT A;  4JBB A;  4XS4 B;  2CVD A;  3KIJ A;  1OC8 A;  4A5P A;  1Z9H A;  1BG5 A;  3KP9 A;  5DAK A;  2LTK A;  3QMX A;  2HSN B;  3US3 A;  2H1A A;  2HZE A;  2XBI A;  2FLS A;  4I8B A;  3IOS A;  4GQC A;  1K0C A;  5DJM A;  1F9M A;  1M2A A;  3CMI A;  4KND A;  4V2N A;  5DBQ A;  1SL1 B;  3WGX A;  2GZP A;  18GS A;  2ES7 A;  2H74 A;  3CTG A;  1GH2 A;  3EVI A;  1M7T A;  2V6K A;  2L6C A;  4OO5 A;  5FT3 A;  4WR4 A;  1PL2 A;  2H8L A;  3QD9 A;  4L5L A;  5DAL A;  4ID0 A;  3HD5 A;  1FB0 A;  6GSS A;  3HHV A;  1J08 A;  4K0G A;  3Q19 A;  2CAQ A;  2C3T A;  2GT6 A;  4USS A;  3M9K A;  2C4J A;  4X4J A;  2IL3 A;  1BJX A;  3GH9 A;  4X0X A;  1TXX A;  2P5R A;  2EFC A;  3GTU A;  4JR6 A;  3IHQ A;  2OA7 A;  4JR4 A;  1NHO A;  5IMV A;  4MF7 A;  2GZY A;  3D4T A;  3E9J B;  2AB6 A;  3TRP A;  3CBU A;  4IVF A;  1X9M B;  2IIY A;  4O5R A;  1K0B A;  3H79 A;  5EVO A;  1TJD A;  5GZZ B;  3QR6 A;  4IW9 A;  4CHS A;  2RII A;  1HNA A;  1B9Y C;  1Q4J A;  1EGR A;  1JLV A;  4EE0 A;  4HS1 A;  3UIW A;  2F51 A;  4BVY B;  4BPY A;  1RQM A;  1WP0 A;  2KHP A;  3GNJ A;  4N3Z A;  2HE3 A;  5CRH A;  1JZD A;  1YEP A;  3F4S A;  5DVB A;  3HVS A;  2MZC A;  3ZLP A;  2WFC A;  4EKZ A;  1GTA A;  3HVV A;  4N0Z A;  3PH9 A;  1X5C A;  2P5Q A;  2QA1 A;  1K3L A;  3VWW A;  2NDO A;  2YZH A;  3O3T A;  1ZMA A;  3GL3 A;  3D6I A;  1UVZ A;  4PTS A;  1A8L A;  1GSD A;  1F37 A;  4IQA A;  4EVM A;  1YY7 A;  6GSV A;  4TKY A;  2LV3 A;  3A2W A;  1BF5 A;  1TK5 B;  4MH3 A;  4CDO A;  3NIV A;  2UZ8 A;  2FNO A;  3HJM A;  3VWU A;  4P3Y B;  2H1B A;  5A4V A;  5B8B A;  3L9U A;  14GS A;  4RUV A;  5A5H A;  3ZMK A;  2JSZ A;  4G2E A;  2GVP A;  3LWA A;  2IFQ B;  1V2A A;  3ZIJ A;  3KXO A;  2IMF A;  3A5I A;  4N11 A;  2E0Q A;  3HZ4 A;  3F8U A;  2WDU A;  4HZ2 A;  5AN1 A;  1TI3 A;  2DIZ A;  1FG4 A;  5IPH A;  3FR9 A;  2X8H A;  1G6W A;  1MD3 A;  2DML A;  1T00 A;  5D73 A;  3ZIT A;  2PMT A;  4XIH A;  1CQH A;  2L4Q A;  3UVT A;  2GDR A;  3ISO A;  1AQX A;  3RHB A;  5HR3 A;  1ON4 A;  2VCW A;  3C73 A;  2DJJ A;  4QL7 A;  3WYW A;  4TRX A;  2TRX A;  4MAB A;  1TRU A;  2JU5 A;  2GSR A;  1NSW A;  3F6F A;  3QAV A;  5B7C A;  1XWA A;  2CX3 A;  3GKK A;  3L9S A;  3F63 A;  4OCE A;  3IHG A;  5J4V A;  4BA7 A;  4KAE A;  1W89 A;  3APQ A;  1EV4 A;  4GXZ A;  4HJ2 A;  3IE3 A;  1WE0 A;  2O7K A;  1IYH A;  4KDX A;  4POM A;  2YV9 A;  6GSX A;  4HEA 2;  1X9W B;  5KN0 A;  4N30 A;  4XRA A;  2XC2 A;  2H71 A;  3M1G A;  3ERF A;  3CTF A;  1Z6N A;  1QGV A;  2OBI A;  4AJ8 A;  2R0G A;  1SD9 A;  2PER A;  3UJ1 A;  3EIN A;  4TR1 B;  2C0D A;  3GKX A;  2NPB A;  4ACS A;  2HSH A;  5ECK B;  5D9W A;  2PVQ A;  2B1L A;  4HQZ A;  3IV4 A;  2YJH A;  3PIN A;  2EIO A;  3EMP A;  1B4Q A;  5ENU A;  1TK0 B;  2IWT A;  2F8F A;  2VLT A;  4F82 A;  1O73 A;  2AAW A;  1U6T A;  3TB2 A;  3CSI A;  2O89 A;  4ZB7 A;  5B6N A;  2LNT A;  5ECL B;  3CSH A;  4EIQ A;  1FHE A;  1EGO A;  3J7Y b;  2KUC A;  2H0G A;  1GSU A;  4QMK A;  1TI1 A;  3N9J A;  3KTB A;  4ICY A;  5CRD A;  3WT2 A;  5GST A;  4MF5 A;  4BL7 B;  1YEX A;  2MYG A;  1GTI A;  4ZIJ A;  2O8V B;  2JAD A;  3ZRE A;  5ECQ B;  1U87 A;  3KMO A;  2X8C A;  1GSE A;  2VOC A;  3IAS 2;  2BTO T;  4XCS A;  1ZOF A;  4ECJ A;  4XS6 A;  2DLX A;  3GUS A;  4LL1 B;  3HZ8 A;  2LRN A;  3EYT A;  1V40 A;  4NHW A;  5CO3 A;  2V41 A;  4MA9 A;  3TKS C;  1BED A;  3ME7 A;  4TXO B;  5C00 A;  3I9V 2;  5KN3 A;  2LST A;  2DKI A;  4Q5Q A;  4O92 A;  3APO A;  3LXZ A;  5F07 A;  2GQK A;  3EU3 A;  1V9W A;  1OYJ A;  3EPT A;  5IOW A;  3W8J A;  1HNB A;  2HZF A;  1T1V A;  1WOU A;  6GST A;  2FD3 A;  1PKW A;  2JZT A;  5DQY A;  4TOP A;  5EPF A;  4HJM A;  3EE2 A;  4V2M A;  4PUA A;  2C1Y A;  4YKG A;  4O5Q A;  1SVL A;  3WGD A;  2LRT A;  2NBS A;  4TN8 A;  4ZB6 A;  2F8A A;  1ZCP A;  5DCG A;  3UL3 A;  3GIX A;  5LCZ A;  2JZS A;  4EC0 A;  1SKR B;  3VI5 A;  5J40 A;  3H1N A;  3ZYW A;  2CZ3 A;  5IO2 A;  4V1A p;  3ZRD A;  2OAC A;  4KA0 A;  5IM9 A;  3FW2 A;  2H75 A;  5JCU A;  3DYR A;  5JWQ B;  5J4Y A;  4PQI A;  5DCH A;  3TKP A;  3EUR A;  2HSM A;  5ECS A;  4OFM A;  4ECC A;  2LJA A;  3IBH A;  2ON7 A;  5ID2 B;  4BWS A;  5A5K A;  1THO A;  3GH6 A;  3HMJ G;  3O6T A;  3A3T A;  4YQV A;  4L8E A;  2VM1 A;  4TR4 A;  4BVX A;  5A4W A;  20GS A;  4LL4 B;  3F3R A;  4DSQ A;  2A2R A;  2E2G A;  1JHB A;  3D4M A;  4ECB A;  3DVW A;  4JZQ A;  2R2J A;  4GF0 A;  4WEY A;  1SK1 A;  5A34 A;  2LNS A;  3UAR A;  3C1S A;  2MMO A;  1PL1 A;  3LSZ A;  5HFI A;  3LG6 A;  3D21 A;  4NAX A;  2DJ2 A;  4G10 A;  3F4R A;  2RM6 A;  4NXI A;  1S3C A;  2KLX A;  3E3E A;  2M72 A;  2YPM A;  4MK3 A;  5J5N A;  1RK4 A;  2I4A A;  4GDF A;  2E2M A;  3GKN A;  1OAZ A;  2H6X A;  1PA3 A;  3GRX A;  3F4T A;  3F9U A;  1SL2 B;  1XWG A;  5BMU B;  2DMM A;  2FWE A;  1R7H A;  3RPN A;  2NTO A;  3IA1 A;  2PGT A;  4GSS A;  3S9F A;  3TJG A;  3UBL A;  2H1D A;  3RBT A;  4GTU A;  1FAA A;  2CZ2 A;  1O85 A;  3UEM A;  2GSQ A;  2YCD A;  2FHE A;  1BAY A;  5D8I A;  3CRU A;  4D73 B;  2L4C A;  4W66 A;  2Z9S A;  4TXV A;  1YQ1 A;  4OMV A;  3G9B A;  5JCW A;  2CA8 A;  1UA5 A;  4HDE A;  1V57 A;  4GQF A;  3EWL A;  2D2Z A;  2ZCT A;  3O76 A;  4ML1 A;  5DAK B;  1MD4 A;  1E6B A;  2C0E A;  2HZE B;  3M9J A;  1XOA A;  4YAP A;  4G0L A;  2PWJ A;  3DGQ A;  1A2L A;  2FWG A;  3LEF A;  3DD3 A;  1RW1 A;  5KN2 A;  1SD8 A;  4EDZ A;  2HQT A;  4JED A;  4IEL A;  2N5B A;  5G5E A;  1TKD B;  3GL5 A;  4HQS A;  2H1G A;  2WUL A;  2P31 A;  3KTL A;  2MMN A;  2DIY A;  3TOT A;  4CY6 A;  1OE8 A;  4KUN A;  3HCZ A;  4KB3 A;  2OBK A;  1U88 A;  3ZVJ D;  3DRN A;  5DAL B;  4K8M A;  4FYB A;  1FW1 A;  5J4U A;  3HA9 A;  1H4O A;  3KH9 A;  2BJX A;  2L5O A;  1GLP A;  1N2A A;  1EZK A;  4F2I A;  2VD0 A;  3VUR A;  3AY8 A;  3QCP A;  3GTU B;  4ZBD A;  3L9V A;  3M0F A;  4PNF A;  5LNK e;  5CYY A;  3KD0 A;  2GQL A;  1T8E B;  3CRT A;  3KEB A;  5G1K A;  3VPT A;  2IN3 A;  4POL A;  5HR2 A;  1GRX A;  4DVC A;  3FZA A;  1WMJ A;  2R6K A;  4TW5 A;  1A23 A;  3GN3 A;  2C8U A;  2BMX A;  5F8B A;  3QDN A;  5ECH B;  2I3Y A;  5A1N A;  1XWC A;  1FOH A;  4F0C A;  4AKG A;  2I1U A;  1XIY A;  3UAP A;  1AUC A;  3QAW A;  4L0W A;  1GUM A;  1LBK A;  4MJA A;  1SK2 A;  3TU3 B;  3ZFB A;  2DJK A;  2B5Y A;  4FIW A;  3LYK A;  2WGR A;  4TR3 A;  1GSF A;  2DJ1 A;  3ZIV A;  4MMM A;  2HLS A;  1U3I A;  3UOM A;  2VCX A;  4Q5N A;  1B9X C;  4MZW A;  2FUG 2;  1MTC A;  1M2B A;  3ME8 A;  3CWG A;  2RLI A;  3P7X A;  3TJF A;  2WRT A;  4AKI A;  3F0I A;  1QUW A;  3QFB C;  1O8X A;  4HZ4 A;  1XW5 A;  2WB9 A;  1O7U A;  2UV8 G;  1WRY A;  4NPB A;  3ED3 A;  3LW9 A;  2B3S A;  1GUK A;  1NM3 A;  3BJ5 A;  5F06 A;  4YQM A;  4DSR A;  1PGT A;  4ZBB A;  5CAX A;  4PQH A;  1VF4 A;  5CRE A;  3A5W A;  1MDK A;  1Y1U A;  4KDY A;  2FWF A;  1XXU A;  3BD2 A;  4K5S A;  1PMT A;  2YWN A;  1KNG A;  1QXH A;  2FWH A;  5A5H B;  1R5A A;  3U5R E;  5KOW A;  4MJE A;  5CRW A;  4POK A;  4OWY A;  11GS A;  3L0H A;  2AUV A;  1YJ6 A;  1H75 A;  1GSY A;  4K1F A;  2V6O A;  1XVW A;  1GSS A;  3ZZX A;  6GSU A;  1O81 A;  4G01 A;  1Z6M A;  4NHZ A;  3TRX A;  4KH7 A;  3L4N A;  3WGE A;  2DJ0 A;  1NHY A;  4MJB A;  2OJL A;  2J9H A;  2VLU A;  2C80 A;  3VLN A;  3RPP A;  5COH A;  3GV1 A;  5IIZ A;  5CRG A;  5GSS A;  1X5D A;  4KE3 A;  5EY6 A;  5GAN D;  1F6M C;  8GSS A;  3PPU A;  3VFI A;  1JZW A;  4E8E A;  1S3A A;  1TRS A;  2GT5 A;  2OKA A;  1URM A;  2PPT A;  2TRC P;  5HQP A;  2FCH A;  4IBP A;  1XWK A;  2PU9 C;  2WCI A;  2LQQ A;  2YN1 A;  2OT3 A;  1HD2 A;  3TJK A;  5E4W A;  4LLR A;  4AGS A;  3GYK A;  2B1K A;  1ERW A;  1I5G A;  1VF1 A;  5DDL A;  1J9B A;  5JWR B;  4KCE A;  1ML6 A;  2B7K A;  2VCQ A;  4MNN A;  2R0P A;  4XS1 A;  1TP9 A;  2H1L A;  2GQM A;  3D22 A;  3I43 A;  3C8E A;  2JZR A;  4MZC A;  1PRX A;  3KMN A;  2YV7 A;  5LD0 A;  1WIK A;  3PGT A;  3EU4 A;  1TOF A;  3C7M A;  2VO4 A;  1PN9 A;  5IOX A;  3C1R A;  1GLQ A;  1EP7 A;  2LQO A;  2V2G A;  3FR6 A;  1K3O A;  2L59 A;  4KX4 A;  5H5Q A;  1M9A A;  1SYX A;  1EV9 A;  4OO4 A;  2EFH A;  2WZ9 A;  1BYE A;  3MYD A;  3HJO A;  4N10 A;  1JZO A;  3R3E A;  2KP1 A;  5B8A A;  2LUS A;  4F0B A;  5F05 A;  1VF2 A;  1SL0 B;  1OC9 A;  2GSS A;  1R5P A;  2VD1 A;  1TRW A;  2LRC A;  1SEN A;  4Z2T A;  4AKX B;  1AIU A;  1KEB A;  4DSS A;  1IYI A;  4V2L A;  3GFK A;  1ABA A;  1A2M A;  2LKU A;  3R2Q A;  3KZQ A;  1K0N A;  2VCT A;  4YAV A;  1SJI A;  2K8V A;  1HNC A;  3FYG A;  4YKF A;  3H93 A;  2IPA A;  1FO5 A;  1ZZY A;  2HRK A;  2MBT A;  2F9S A;  1LJR A;  4EXJ A;  2TIR A;  3KH7 A;  22GS A;  5KN1 A;  5IMZ A;  3CXG A;  5INY A;  4H86 A;  4MF6 A;  1TTZ A;  1X9S B;  3GA4 A;  2HXK A;  4ZB8 A;  1ZYQ B;  5D9V A;  3QOU A;  2AHE A;  1FVJ A;  4CY8 A;  4KF9 A;  1UN2 A;  1SYR A;  2C0F A;  1DSB A;  2VCZ A;  4PQ1 A;  1B8X A;  3FY7 A;  4PUF C;  3TKR A;  4KDU A;  1THX A;  5ECP B;  3RHC A;  3RDW A;  4JU5 A;  4ZB9 A;  1SVO A;  2CVB A;  1UC7 A;  3HJP A;  4GWR A;  5H5R A;  1VRS D;  1G6Y A;  3LFL A;  4Z2R A;  4K7I A;  1PQN A;  4AI6 A;  2DJ3 A;  3BOA A;  1I9D A;  4J2F A;  2EIQ A;  3I6A A;  2PBJ A;  2VLV A;  3ZVJ A;  5G31 A;  2QSI A;  3IC4 A;  2O87 A;  1F3B A;  3TKS E;  2NVL A;  3UBK A;  2B5E A;  3HVX A;  1ZYE A;  4K9Z A;  3LQ7 A;  1A2J A;  3ZL5 A;  1T4Z A;  5G2Z A;  2HSM B;  1Z5Y E;  5ECM B;  1V58 A;  2OE3 A;  4L0U A;  1R26 A;  1BG1 A;  4I2U A;  2HI7 A;  3P8W A;  4J57 E;  2B7J A;  4GCI A;  4BVX B;  1B4P A;  2DSA A;  3FRC A;  4PUR A;  3UMA A;  1EEJ A;  5AIX A;  3DKS A;  4K7N A;  4NV2 A;  3FMW A;  2GZZ A;  3DXB A;  2YWO A;  1AW9 A;  5A34 B;  4OFT A;  4AJ6 A;  1ERU A;  1XCC A;  2XPD A;  4LA1 A;  4Z2U A;  2R37 A;  3IXR A;  9GSS A;  2WS2 A;  3PR8 A;  1WPI A;  4ZIL A;  3TGZ A;  1G7E A;  1DUG A;  2M80 A;  3Q6O A;  2H76 A;  2H72 A;  1BQ7 A;  2R5G A;  4WF5 A;  4FQU A;  2HNL A;  1W4V A;  3TDG A;  2QKE A;  1OE7 A;  3HYP A;  3BCK A;  2RUE A;  5ECI B;  3KJY A;  4WBJ A;  1ZL9 A;  2DKH A;  2JSY A;  5FWG A;  4E8H A;  1TRV A;  2CAI A;  2YWM A;  5J3R A;  4KGI A;  5KEJ A;  1XZO A;  4O5U A;  2CQ9 A;  1T7P B;  1MDI A;  4FO5 A;  2VAF A;  4YH2 A;  3LJR A;  2CV4 A;  2X8G A;  3EMX A;  3TKS A;  1DE2 A;  3LYP A;  4OFN A;  3U6V A;  4XS4 A;  4KSO A;  10GS A;  2ZUP A;  2C3N A;  5DJL A;  2PUK C;  4K6X A;  2HSN A;  2YJ7 A;  4QQ7 A;  7GSS A;  3KCM A;  3TKQ A;  3FKF A;  3GST A;  3GUR A;  4G19 A;  2OAD A;  1XBS A;  1HQO A;  3HXS A;  1ZGN A;  1Z7R A;  1R4W A;  4I6X A;  1F3A A;  3WD6 A;  4ZXG A;  2H6Z A;  4HUA A;  2QC7 A;  3DIE A;  1OKD A;  1CQG A;  1ERV A;  3G7J A;  2HRA A;  2X64 A;  3H4K A;  1J0F A;  1EWX A;  1JZR A;  3TCO A;  3LXT A;  3P90 A;  1N8J A;  2RM5 A;  2HYX A;  3J7Y k;  1S3D A;  4WXT A;  2C3Q A;  3A2X A;  3IPZ A;  1M99 A;  1XWB A;  2K18 A;  4IP6 A;  3Q74 A;  1QMV A;  3OR5 A;  1EEM A;  3GX0 A;  5G5F A;  1XPV A;  3IK9 A;  4FYC A;  1DE1 A;  5ELG A;  1ILO A;  2YWI A;  2KOK A;  1Q98 A;  1SKS B;  4O7H A;  2KP2 A;  4NV5 A;  1QFN A;  4EL1 A;  2H01 A;  3EC3 A;  2X49 A;  3V1W A;  1FOV A;  1AC1 A;  2X99 A;  2H70 A;  3MSZ A;  1A24 A;  3HDC A;  5ABR A;  4G0K A;  1GNW A;  1TW9 A;  1QQ2 A;  4YQU A;  4BVY A;  5CNW A;  4EIP A;  2EFE A;  4F03 A;  1V98 A;  5EL8 A;  5HFK A;  3VWV A;  4G9H A;  5A1N B;  4LMV A;  1FB6 A;  1A8Y A;  4F9Z A;  2REM A;  4TR0 A;  3FK8 A;  3QFA C;  4GSN A;  4IJ3 A;  1SJZ A;  17GS A;  2HSY A;  4J56 E;  5A4U A;  2VKZ G;  2GTU A;  3F3Q A;  3LGC A;  4EF0 A;  3FZ5 A;  1GL8 A;  2PN8 A;  3VK9 A;  2VL9 A;  3IAM 2;  4JRR A;  2JAC A;  1YVL A;  5ECR B;  3MAK A;  3RAZ A;  4CW9 A;  4KSM A;  2H73 A;  2M46 A;  4HI7 A;  4I2T A;  4ZL8 A;  4Z7X A;  1A0F A;  4PX1 A;  1XW9 A;  4GST A;  3TRQ A;  3GHA A;  2R0C A;  3GSS A;  4NWY A;  2A2S A;  2EFD A;  2VM2 A;  3W8S A;  1YDK A;  1N25 A;  5AIS A;  1AXD A;  2B5X A;  3BCI A;  2G0F A;  2VL2 A;  3GMF A;  2IME A;  4XHM A;  5ELA A;  4G0I A;  2ZNM A;  3DWV A;  4OD7 A;  3FZ9 A;  4MP4 A;  4MCU A;  1M0U A;  2IFQ A;  2DBC A;  2OE0 A;  2K6V A;  3MWH A;  2J23 A;  1ERT A;  5B6M A;  2X4A A;  1WWJ A;  2FA4 A;  5C04 A;  1KTE A;  3TJJ A;  3HY2 A;  3Q18 A;  4ISD A;  1PX6 A;  2YNX A;  5IMF A;  2A4H A;  1Z7P A;  1GUL A;  1ZYP A;  1VGL A;  2N5F A;  4IHU A;  1USB A;  5D96 A;  2WJU A;  3KGK A;  4EDY A;  4JE1 A;  5FHI A;  3M3M A;  3MNG A;  1GSQ A;  2L57 A;  1K0M A;  4WKW A;  5J9C A;  5IMD A;  4EUY A;  1TU8 A;  2I9H A;  5ECN B;  3DEX A;  3MIX A;  1M9B A;  4K5R A;  5G1L A;  2O5V A;  1Y25 A;  3K8N A;  1PSQ A;  3TJB A;  2FA8 A;  5HR0 A;  1GWC A;  4Q5F A;  1G0T A;  5H5S A;  3W6G A;  3NZN A;  2IMK A;  5D9X A;  1ST9 A;  2XHF A;  3G7I A;  3GX8 A;  5J9B A;  2HT9 A;  3TOU A;  3LOR A;  2XPE A;  5J41 A;  2AYT A;  5L71 A;  4HOJ A;  2LJK A;  4N0V A;  1X5E A;  3VPQ A;  2G2Q A;  2LS5 A;  1K3Y A;  4HU9 A;  4FYU A;  4XRD A;  1WJK A;  4EO3 A;  5IO0 A;  4MLY A;  4TR1 A;  1O8W A;  3L78 A;  1U3A A;  4WF4 A;  5D9T A;  2A2P A;  1XW6 A;  2N5A A;  1K0D A;  1JFU A;  1TU7 A;  4X43 A;  1MDJ A;  3ZFL A;  2IJY A;  2VCV A;  3IR4 A;  3ZTL A;  3KP8 A;  3ERG A;  5GAP D;  1EOG A;  2K9F A;  2YAN A;  1JLW A;  5D93 A;  1TXU A;  2JL4 A;  1M2D A;  2OE1 A;  3JCM L;  2H0H A;  2V1M A;  3QPM A;  1XFL A;  2B6M A;  5JCG A;  5DQS A;  4AKH A;  3GKM A;  3TUE A;  1OC3 A;  3VWX A;  2AV4 A;  2I81 A;  1SU9 A;  2F3M A;  4BL7 A;  2CVK A;  2H19 A;  2FY6 A;  4RI6 A;  4WBR D;  2EIR A;  3D5J A;  5IQY A;  2ON5 A;  3UVH A;  4I5Q A;  4I97 A;  1TK8 B;  5ECO B;  2MMA A;  2LJR A;  1OC9 B;  3NOF A;  1F2E A;  1SVM A;  1SJ6 A;  3D0Z A;  4LMW A;  1GNE A;  19GS A;  3IDV A;  3G7Y A;  4DSS B;  3I69 A;  4E68 A;  2O85 A;  1SKW B;  3IC8 A;  3BBY A;  4RQR A;  4MZB A;  5E59 A;  4TXO A;  4ULX A;  2H0I A;  3MDK A;  4IP1 A;  4O32 A;  5IMA A;  1KBN A;  4QL9 A;  3QAG A;  3SWL A;  2YOI A;  4L5O A;  1QK8 A;  2GGT A;  4ZBA A;  2HRK B;  4IGJ A;  4NMU A;  1YF1 A;  4IKH A;  2PVO C;  2IMI A;  3DML A;  2FGX A;  4MDC A;  1AQW A;  4GRF A;  2R4V A;  4ML6 A;  3ZML A;  1YF0 A;  5IMC A;  1TDI A;  2H66 A;  2IMD A;  2EC4 A;  2RUF A;  5AIV A;  2P0G A;  3CSJ A;  3CYN A;  5HR1 A;  5IPG A;  2QGV A;  1EP8 A;  4FH8 A;  1SK0 A;  4AF2 A;  2HRF A;  2DC5 A;  2GLR A;  1GP1 A;  1YKA A;  1T3B A;  2YZU A;  1X0R A;  2K8S A;  4RI7 A;  3FEU A;  4ILF A;  2MBS A;  1B48 A;  3E0U A;  3VI7 A;  1FVK A;  1T4Y A;  4GLT A;  4IQ1 A;  3N5O A;  2LEG A;  4BWQ A;  5JWO B;  4HU7 A;  3KM6 A;  6GSY A;  2VIM A;  3DVX A;  4MH2 A;  1Z3E A;  3FHK A;  2L6D A;  1OVN A;  4DEJ A;  3P2A A;  1A0R P;  2CT6 A;  2CX4 A;  4IN0 A;  5HFG A;  3WT1 A;  5ID2 A;  4V1A g;  2R3X A;  5F0G A;  4PXO A;  4KW6 A;  3HKR A;  4MPG A;  4PNG A;  4ZL9 A;  1Y6E A;  1XOB A;  2L5L A;  2H30 A;  5CP1 A;  3IRA A;  4ZL7 A;  4MJC A;  1YKC A;  2GS3 A;  1XVQ A;  4TVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...