1GSQA

Three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
202
structure length
202
Chain Sequence
PKYTLHYFPLMGRAELCRFVLAAHGEEFTDRVVEMADWPNLKATMYSNAMPVLDIDGTKMSQSMCIARHLAREFGLDGKTSLEKYRVDEITETLQDIFNDVVKIKFAPEAAKEAVQQNYEKSCKRLAPFLEGLLVSNGGGDGFFVGNSMTLADLHCYVALEVPLKHTPELLKDCPKIVALRKRVAECPKIAAYLKKRPVRDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Three-dimensional structure, catalytic properties, and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens S-crystallins of cephalopods.
pubmed doi rcsb
source organism Ommastrephes sloani pacificus
molecule tags Transferase
total genus 74
structure length 202
sequence length 202
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1995-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1gsqA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gsqA01
1TP9A 1QMVA 3TKRA 1GLQA 2OADA 3S9FA 3TKPA 2A2RA 5ECNB 4JZQA 2GT5A 1TK5B 1AAZA 2A4VA 3VWUA 1OC8A 4XRAA 2I3YA 2ON5A 4HZ2A 3F6DA 4MJBA 3LFLA 4AGSA 3TOTA 1X5CA 4PURA 4KW6A 2B5EA 2R5GA 2H71A 1AW9A 1YQ1A 4EVMA 5IPHA 3H93A 20GSA 2H0GA 3KMNA 3DVXA 4IS0A 5GAND 3VWVA 3D0ZA 3DVWA 4KDUA 4Q5RA 1AQXA 4EC0A 1SYXA 3IA1A 4OWYA 3Q18A 5DBQA 1THXA 1N8JA 1WPIA 3GN3A 1QK8A 2QSIA 5IOXA 5A4WA 4BVXB 3VPQA 3LORA 2HZEA 5DDLA 1M7TA 1YF0A 3FR6A 1WE0A 4POKA 4PNFA 3C1RA 3D4TA 3IOSA 2KUCA 4I8BA 2CAIA 2V32A 1Q4JA 2NDOA 5AISA 3VI5A 5D9WA 2JL4A 5IMAA 2YOIA 5G1KA 3TB2A 1TTZA 3UMAA 2MBTA 3DKSA 2L59A 5H5RA 1RK4A 2GQKA 5B6NA 1HNCA 2GTUA 4DSQA 4K0GA 2PMTA 3ZMKA 2K18A 1XBSA 3LQ7A 3IC4A 5GAPD 4HJ2A 2L6DA 4HU9A 5JWOB 2H66A 1PX7A 17GSA 5D9TA 5HFIA 4QQ7A 18GSA 2H70A 2DMLA 4NV2A 3WT1A 4MLYA 2FCHA 3IBHA 5GSSA 4IJ3A 4V1Ap 3TRQA 1PRXA 5AIXA 2YV9A 5DALA 3FZ5A 1T8EB 3BCKA 3GHAA 1U88A 1SYRA 4LL1B 3E9JB 2MMAA 1XPVA 1IYHA 4ZB8A 1A8YA 1PN9A 3M8NA 3KCMA 4IN0A 2LRNA 3IDVA 1XOBA 4LA1A 1M0UA 1XIYA 3HXSA 3SBCA 2V2GA 1KEBA 2K8SA 4IGJA 5B8AA 2Z9SA 5DJMA 3F4TA 1JZWA 1SKWB 4ZIJA 4ZL9A 3G7IA 4K9ZA 5AGYA 2MYGA 5J41A 3HVSA 10GSA 3VFIA 1GUMA 1GTAA 3EURA 5J3RA 3D22A 5CREA 4NWYA 1XCCA 4TRXA 3UIWA 2OBKA 2AJQB 3J7Yk 1UN2A 5C04A 4I97A 2LS5A 2F8FA 3DIEA 2L4CA 2C0EA 2HYXA 22GSA 1ZYEA 3W8SA 5ELAA 2ES7A 2ZNMA 1FB0A 1YKAA 2XC2A 4TXVA 1TU8A 1SJ6A 1R5AA 3D21A 3A2XA 3H79A 4ECIA 2GLRA 2HNLA 5ECKB 2CX3A 4I6XA 1W89A 3DEXA 3QAWA 2YP6A 1K0AA 1VF2A 3BCIA 4ECJA 3GNJA 4PTSA 4LMWA 2EIOA 4K8MA 5CRHA 3D4MA 1VF3A 4PUAA 2VCQA 4GQCA 4DSSB 2VL3A 1X0RA 4MF6A 4TXOB 3IPZA 1KBNA 1K0CA 3FZ9A 3F8UA 2R37A 4MF7A 4KAEA 3RAZA 2LTKA 5F0GA 1SL2B 2TRCP 1OC9A 4BVYA 3ERFA 1PA3A 2MZCA 3HZ4A 1OC9B 5JCGA 2GSTA 4KB3A 4F0CA 5HQPA 2DJ1A 5LNKe 2LJRA 1F37A 2B1KA 4WF5A 4K2DA 3IAS2 2VCWA 3KP9A 1UA5A 16GSA 1X5EA 1OKTA 2GSSA 3L0HA 2H74A 2KHPA 3C1SA 1NM3A 2BJXA 2X99A 1I9DA 4ID0A 2PGTA 3BD2A 2VM1A 4USSA 5J9CA 3HVVA 1M2BA 2CQ9A 4MABA 2A2SA 1USBA 1ACVA 4YQMA 6GSVA 5ID2A 2DMMA 3GL3A 1DE1A 3EE2A 1AUCA 3EWLA 2OE1A 5ECRB 1HNBA 2R6KA 4FO5A 2H75A 2JACA 4GF0A 1ERUA 3KH7A 3IC8A 2GVPA 2E2MA 4G0IA 2FUG2 3FYGA 3FZ4A 2HFDA 5CAXA 1EEJA 2PUKC 1UC7A 3WGEA 3ZREA 4KF9A 2RUEA 3P2AA 2AHEA 2IIYA 1ERVA 2JSYA 1X9MB 5G31A 1ZL9A 3EC3A 1VF1A 4EDZA 3IAM2 4MH3A 1MTCA 1PKWA 4OFMA 4BL7A 2C4JA 4ZL8A 4FYUA 3BJ5A 3FHKA 5E59A 4EKZA 1TU7A 3RBTA 2ON7A 4IHUA 3IR4A 2VD1A 3QDNA 3WGXA 4N0VA 1ZOFA 2DJKA 1XWAA 3N5OA 1BX9A 1JLVA 3QAGA 5CNWA 2HSNB 2CZ2A 1JZOA 1B4QA 3FEUA 3QMXA 1H4OA 1TDIA 4AJ8A 2H0HA 1R7HA 2YWMA 2ZCTA 1OKDA 4GQFA 3GFKA 1GWCA 3QOUA 1VRSD 5COHA 5ENUA 1G6YA 2H1GA 5ECSA 3ZLPA 2YJ7A 3GYKA 2NVLA 2FGXA 3GL5A 2X8GA 3ZFBA 2FWHA 4XCSA 3EMXA 4J57E 2OJLA 1FO5A 2HI7A 1GP1A 4K7OA 2O85A 1SU9A 1M2AA 1NSWA 1XWGA 2LRTA 2OKAA 2MMOA 4J56E 4N11A 3D5JA 4BA7A 2F8AA 4IKHA 1ABAA 1XOAA 3QCPA 6GSSA 3HZ8A 1XVQA 3CRTA 4TR0A 2K8VA 1A2LA 3DXBA 4POBA 3HD5A 2R4VA 2IJYA 1MDIA 5JWQB 5DQYA 3HA9A 2FY6A 5IMDA 2H6ZA 4JRRA 3ZTLA 4WR4A 3GH9A 2K9FA 3VURA 2CAQA 3F4RA 3V1WA 5BMUA 1BG5A 4RUVA 4F9ZA 5HR2A 3IV4A 2PVOC 4N0ZA 4TR1A 2I1UA 3ZITA 2HSMB 4TR3A 2WULA 1XFLA 2EIQA 3APOA 5B6MA 1ZCPA 3KIJA 5JCWA 3UVHA 3K8NA 4ZBBA 3M0FA 1WJKA 1EGRA 1PKZA 3IE3A 1HYUA 4NMUA 1MEKA 4KA0A 2WZ9A 2I9HA 2QGVA 4F82A 1SL1B 1B8XA 1XW6A 5C00A 3CSJA 2AUVA 4XS4A 2B7KA 4DVCA 2P5RA 3RHBA 3G7YA 2C0DA 5HR1A 1K0BA 2DC5A 3AY8A 4ACSA 4WF4A 1H75A 1T4YA 3GKMA 3VWWA 2FA8A 1QQ2A 3TKSE 5D73A 1TRSA 2KLXA 2H1BA 4Z7XA 1MDKA 3FW2A 2HQTA 2G0FA 4IQ1A 2XPDA 4OD7A 2LV3A 5HR3A 4JBBA 4ULXA 4AF2A 3MSZA 4TR4A 1Z7RA 2YZHA 3P7XA 4IP6A 2KP1A 3RDWA 4HJMA 3FY7A 3SWLA 2H19A 2VIMA 3EYTA 3CTGA 4KCAA 3WGDA 4JU5A 3HJPA 4IJIA 1M9BA 6GSTA 1M2DA 1LBKA 1O8XA 4V2LA 4QL9A 1BAYA 1ST9A 2WDUA 2P31A 3KTLA 4NPBA 1LJRA 4TN8A 2HZEB 3ERWA 3P90A 3GX0A 1SJIA 2IMDA 3LJRA 2CVBA 4BWSA 3CTFA 3MWHA 4IQAA 2QKEA 4GXZA 3FR9A 1SJZA 1EP8A 3KD0A 1V2AA 3HCZA 5DAKA 4ILFA 3GKXA 4EO3A 5GSTA 2DJ0A 4JR4A 4GCIA 4NV5A 2B1LA 7GSSA 3KGKA 3OR5A 3HY2A 4X1UA 4WKWA 2HRFA 1TXXA 1ILOA 3KH9A 1EOHA 3LXZA 3NZNA 2X64A 1K0MA 4RQXA 1J0FA 1ERTA 5IM9A 4ISDA 4POLA 2FA4A 4K0NA 2CVKA 3IK7A 2C3NA 4CHSA 3CXGA 4GRFA 1F2EA 4MH2A 5DALB 1PX6A 5ECQB 5DCHA 2FNOA 4PXOA 2HRNA 2X8HA 1AXDA 4WBJA 1XXUA 3I43A 4WXTA 1XW5A 5IQYA 2OE3A 4OFNA 3W6GA 2NPBA 2YWOA 2PN8A 2MBSA 5F06A 1FVJA 3CBUA 2N5BA 2YJHA 2D2ZA 3R2QA 4HUAA 1YKCA 1Z6NA 5EPFA 4KGIA 4Q5FA 1MD4A 3A2WA 4PGTA 2LSTA 4NXIA 4QL7A 4RI7A 2H1AA 5A4VA 2OE0A 5HFKA 1O6JA 3TRXA 3RHCA 5ELGA 2WFCA 6GSXA 2F3MA 3UVTA 2XPEA 2XBIA 4HS1A 3GKNA 5KN0A 2FWGA 2P0GA 2HRKA 3ZVJA 4EE0A 2LQOA 1F9MA 5EVOA 2REMA 4FYBA 1KTEA 2HRKB 3DGQA 2GZPA 1M99A 4TOPA 2OBIA 3H8QA 2RLIA 1QGVA 4V1Ag 3LSZA 1GSDA 1DUGA 4CDOA 5F8BA 1S3DA 3Q6OA 1YEXA 4K7IA 2OA7A 1SENA 3GH6A 3UL3A 1SD8A 3QFAC 4ZB9A 3KMOA 2YCDA 3EVIA 3UAPA 2PBJA 4O32A 1Z3EA 3PH9A 4HDEA 2R3XA 5CYYA 2H01A 3F0IA 4PX1A 2TIRA 3HDCA 4YQUA 1GH2A 1S3AA 1TI1A 1Z7PA 3LYPA 4E8EA 5DQSA 1UVZA 4YAPA 3US3A 3FR3A 1RQMA 3NOFA 3QFBC 4KNDA 3TKSC 2CX4A 5A4UA 4BVYB 9GSSA 4G9HA 4XIHA 5AN1A 5IMCA 2TRXA 1GNEA 3PR8A 2M46A 2BTOT 1J9BA 2IN3A 4KSMA 2V6OA 3GURA 1EGOA 1ML6A 4H86A 2OACA 2J9HA 1GSEA 2YWIA 5AIVA 1K3YA 2XHFA 4PQ1A 5D8IA 5IO2A 2MMZA 3GA4A 3E0UA 3GKKA 2L4QA 5ECMB 1I5GA 1WRYA 1XWKA 2VLVA 4DSRA 5CP1A 5D96A 1EZKA 2DIZA 5CO3A 3TJJA 1JZDA 2GGTA 4MZWA 5D93A 1K3OA 3F63A 1URMA 3UJ1A 5ID2B 3DRNA 2C3QA 3GSTA 1TI3A 2GT6A 1GNWA 1O73A 2BMXA 4K6XA 4TVEA 4WETA 1G6WA 1V98A 1GSFA 4HI7A 2AYTA 3LEFA 3MAKA 2IMEA 1EWXA 1XVWA 4MPGA 1F3AA 1K0OA 2WGRA 4HEA2 4G0LA 4PNGA 4L5OA 5ABRA 4G10A 4KCEA 3GRXA 1WMJA 5JCUA 3LWAA 4MZBA 3MNGA 1Y6EA 4PQHA 1OAZA 1K3LA 4CW9A 2RM6A 1T1VA 4K1FA 2YZUA 5G5FA 2CA8A 3KP8A 3ZIJA 1T00A 2LEGA 3UEMA 3VPTA 2H8LA 4D73A 5GZZB 3HKRA 1WP0A 4BL7B 3WD6A 2VLUA 3LYKA 4HZ4A 3APSA 5LD0A 4JR6A 3L4NA 3TKQA 2E2GA 2HLSA 4LMVA 1WWJA 1NHYA 1Z9HA 5A5KA 3TRPA 1OE8A 1Z6MA 4FYCA 3U6VA 4WR5A 3MDKA 3ZRDA 3H4KA 5IIZA 4XS1A 1FW1A 2M72A 5G1LA 4MJEA 5KN2A 4WBRD 4OO5A 1GLPA 4JE1A 1PL1A 4G19A 2RIIA 4NHZA 2E7PA 2H30A 1FHEA 3P8WA 4TKYA 2FHEA 2H76A 3WT2A 2I4AA 4POMA 1FVKA 3E3EA 2JZTA 5DVBA 3TJGA 2PWJA 2DLXA 4LL4B 5G5EA 5ECOB 1A8LA 1BQ7A 3ED3A 1YJ6A 3M3MA 2H1DA 3GTUA 1BJXA 3ZIVA 3R3EA 2R2JA 5H5SA 2DJ3A 1GTUA 4G0KA 6GSUA 6GSWA 1G0TA 1A2JA 1YEPA 5CRGA 4OCEA 2VL2A 2VOCA 2JSZA 4P3YB 1NW2A 2CT6A 3PGTA 1GUKA 3EU3A 3GX8A 4FH8A 4KUNA 2WRTA 2V1MA 5EY6A 1V57A 14GSA 3J7Yb 1R4WA 2N5AA 4XTSA 1A24A 1E6BA 4MPFA 2HSHA 1SL0B 2I81A 5B8BA 2GDRA 1VGLA 4Q5NA 4TR1B 1Q98A 1KNGA 2KOKA 4FQUA 4L0UA 5KN3A 1OC3A 1ZYQB 1OYJA 3QD9A 1M9AA 1FB6A 1A23A 1EP7A 1GULA 4MK3A 1O8WA 4XS4B 3HVXA 2CVDA 3DD3A 3W8JA 4RI6A 1PSQA 3D6IA 2VLTA 4EXJA 1PD21 3JCML 1HQOA 2VL2C 3DWVA 2AB6A 1ON4A 6GSYA 2VCZA 3A5WA 5E4WA 4YAVA 3M9JA 2LQQA 3CYNA 4L0WA 5HFGA 4IBPA 4F03A 5ECIB 2H73A 3I9V2 2F51A 3IHQA 3O76A 3QAVA 4PQIA 4F0BA 3A2VA 1W4VA 2O87A 2MMNA 2V6KA 13GSA 2HRAA 5DJLA 5FT3A 5CRWA 1OVNA 2VCVA 3BOAA 4ZXGA 3QR6A 2IMFA 1A2MA 2GS3A 1SKRB 2G2QA 5FWGA 2CZ3A 1V58A 2DBCA 5LCZA 4GSNA 4V2NA 1XZOA 3G7JA 3EU4A 3KEBA 4N30A 4OFTA 4BVXA 5CRDA 3C8EA 5KEJA 1B4PA 4HOJA 1U3IA 2GSRA 1HD2A 1GSYA 2AAWA 4ECCA 3ZFLA 4ZILA 1AIUA 3IXRA 5D9VA 1T7PB 4OO4A 1JLWA 3C73A 3HJMA 3FZAA 4NHWA 1YY7A 5ECPB 3VI7A 5DAKB 2H6YA 4WEYA 4I2UA 4IP1A 2UZ8A 1TRWA 3LXTA 2PU9C 2IPAA 2L5LA 3VWXA 2C0FA 2X8CA 3ZMLA 3N9JA 2WJUA 3PPUA 5JWRB 5IMFA 1GL8A 1GTBA 1GSQA 3ZZXA 4KDYA 3WYWA 2JU5A 4FIWA 3GSSA 1U6TA 1FOVA 2C1YA 4IW9A 3EMPA 4XHMA 3L78A 4MA9A 4GLTA 4I5QA 2V41A 4EUYA 1JZRA 2JZSA 1Y25A 5FHIA 3FKFA 4BPYA 1B9YC 2N5FA 1A0RP 4J2FA 2VO4A 1VF4A 3KXOA 5DCGA 2B7JA 3DMLA 1AQWA 2IFQA 4HU7A 2GQLA 2LRCA 2LJAA 3GMFA 2IFQB 4GTUA 1MD3A 3CSIA 3RPPA 1X5DA 3VLNA 1SK0A 4AJ7A 3EINA 3F9UA 1OE7A 4JEDA 2LKUA 2DJJA 4X43A 5IOWA 4YH2A 1R26A 5F07A 1DE2A 1CQGA 2GSQA 2QC7A 3TKSA 1PGTA 2FWFA 1TK0B 4NAXA 3KZQA 4MP4A 11GSA 1ZMAA 2YNXA 1AC1A 1ERWA 4GSTA 3TCOA 4PUFC 3IRAA 1N2AA 3F4SA 4ML6A 1TKDB 4MJCA 3RPNA 2DJ2A 3F3RA 4ZL7A 4HQSA 5IMVA 4XS6A 2O89A 5J4UA 1WIKA 2CV4A 1GSUA 3M9KA 2EIRA 3L9VA 1B9XC 1F3BA 1SK2A 3L9UA 3Q19A 3HJOA 4DSSA 3ZVJD 2KP2A 4TXOA 1G7OA 2C3TA 1GTIA 2JADA 19GSA 3M1GA 3KM6A 1XWBA 3G9BA 5G30A 2EC4A 2FWEA 4MDCA 3CSHA 3KJYA 4K7NA 2J23A 3O3TA 2FD3A 1U3AA 4O7HA 1RW1A 2L6CA 3GIXA 4EDYA 2NBSA 2ZUPA 5ECHB 1SK1A 1A0FA 2F9SA 1Z5YE 4GWRA 1X9SB 4KE3A 3A3TA 2H0IA 1EV9A 2HZFA 2VUPA 2XBQA 1V40A 5IO0A 8GSSA 3NIVA 4OMVA 3TJBA 2B6MA 2HSYA 1TRUA 5G2ZA 3UBKA 3U5RE 1WOUA 3C7MA 4F2IA 1BEDA 5HR0A 1FG4A 3UOMA 4V2MA 5INYA 1TK8B 4L8EA 3O6TA 2GZZA 4L5LA 1QUWA 4RQRA 4ZBAA 3GV1A 4I2TA 1S3CA 1TRVA 1IYIA 2H6XA 2L5OA 4MJAA 4Q5QA 1YDKA 2NTOA 1AQVA 1EOGA 4G2EA 2DSAA 1TOFA 4EF0A 4KDXA 1QFNA 5B7CA 1B48A 1CQHA 3Q74A 2IWTA 2P5QA 2PPTA 3APQA 1BYEA 5IMZA 2RM5A 4ZB6A 2LUSA 3TGZA 1YZXA 1LU4A 4D73B 2O8VB 1O7UA 3LGCA 12GSA 3BBYA 1FAAA 1DBYA 2GZYA 3I69A 4XRDA 2GQMA 3TJKA 2C80A 2IMKA 4MZCA 2E0QA 1XW9A 3VK9A 2LNTA 2LJKA 1DSBA 1K0DA 1GRXA 1X9WB 2YV7A 2YWNA 4E8HA 3CRUA 3FK8A 1G7EA 4YQVA 1XWCA 2B5YA 1F6MC 4TW5A 5J9BA 2AV4A 3UBLA 3LG6A 4O5RA 5H5QA 1K0NA 1V9WA 3TJFA 3TUEA 4EL1A 3GUSA 4DEJA 5EL8A 1U87A 1J08A 2HXKA 2B3SA 2PVQA 2DIYA 2IMIA 2VM2A 1PMTA 2HE3A 2K6VA 3PINA 4ECBA 4AJ6A 1TW9A 1E2YA 3H1NA 2H72A 3HYPA 4MMMA 1EEMA 1HNAA 3GTUB 3I6AA 4ZBDA 3UARA 1PQNA 3TOUA 4X0XA 4KSOA 4HQZA 1C72A 2VCXA 2L57A 2O7KA 3ME7A 1JFUA 3IK9A 1R5PA 5F05A 4IELA 1TJDA 2VL9A 2HT9A 4OCFA 1THOA 3CMIA 3ZYWA 2WCIA 1ZGNA 4ML1A 2PERA 1SKSB 1EV4A 3DYRA 1GUHA 5IPGA 2YANA 3F6FA 2YPMA 1YF1A 3ERGA 4IVFA 2WB9A 3ME8A 1T4ZA 4BWQA 2B5XA 3FRCA 1MDJA 2LNSA 3L9SA 1O85A 4GSSA 3HHVA 2VCTA 3C71A 5KN1A 3ISOA 1QXHA 2C0GA 3TDGA 2HSMA 3F3QA 3ZL5A 2VAFA 2IL3A 4KX4A 2C8UA 4MCUA 2JZRA 2M80A 4O92A 5D9XA 5L71A 2VD0A 1SD9A 1O81A 2FLSA 5ECLB 3KTBA 1ZZYA 4KH7A 1NHOA 3QPMA 2YN1A 4MF5A 4LLRA 1JHBA 2ALBA 2WS2A 1GSSA 2RUFA 1T3BA 1PL2A 4N10A 5J5NA
chains in the Genus database with same CATH superfamily
1TP9A 1QMVA 3TKRA 1GLQA 2OADA 3S9FA 3TKPA 2A2RA 1Y1UA 5ECNB 4JZQA 2GT5A 1TK5B 2WW1A 1AAZA 2A4VA 3VWUA 1OC8A 4XRAA 2I3YA 2ON5A 4HZ2A 3F6DA 4MJBA 3LFLA 4AGSA 3TOTA 1X5CA 4PURA 4KW6A 2B5EA 2R5GA 2H71A 1AW9A 1YQ1A 4EVMA 5IPHA 3H93A 20GSA 2H0GA 3KMNA 3DVXA 4IS0A 5GAND 3VWVA 3D0ZA 3DVWA 4KDUA 4Q5RA 4K2XA 1AQXA 4EC0A 1SYXA 3IA1A 4OWYA 3Q18A 5DBQA 1THXA 1N8JA 1WPIA 3GN3A 1QK8A 2QSIA 5IOXA 5A4WA 4BVXB 4GDFA 3VPQA 3LORA 2HZEA 5DDLA 1M7TA 1YF0A 3FR6A 1WE0A 4POKA 4PNFA 3C1RA 3D4TA 3IOSA 2KUCA 4I8BA 2CAIA 4FXYP 2V32A 1Q4JA 2NDOA 5AISA 3VI5A 5D9WA 2JL4A 5IMAA 2YOIA 5G1KA 3TB2A 1TTZA 3UMAA 2MBTA 3DKSA 2L59A 5H5RA 1RK4A 2GQKA 5B6NA 1HNCA 1S4BP 2GTUA 4DSQA 4K0GA 2PMTA 3ZMKA 2K18A 1XBSA 3LQ7A 5A5HB 3IC4A 5GAPD 4HJ2A 2L6DA 4HU9A 5JWOB 2H66A 1PX7A 17GSA 5D9TA 3RGBC 5HFIA 4QQ7A 18GSA 2H70A 2DMLA 5A1NB 4NV2A 3WT1A 4MLYA 2FCHA 3IBHA 5GSSA 4IJ3A 4V1Ap 3TRQA 1PRXA 5AIXA 2YV9A 5DALA 3FZ5A 1T8EB 3BCKA 3GHAA 1U88A 1SYRA 4LL1B 3E9JB 2MMAA 1XPVA 1ZYNA 1IYHA 4ZB8A 1A8YA 1PN9A 3M8NA 3KCMA 4IN0A 2LRNA 3IDVA 1XOBA 2WW0A 4LA1A 1M0UA 2O5VA 1XIYA 3HXSA 3SBCA 3HVNA 2V2GA 1KEBA 1SVOA 2K8SA 4IGJA 5B8AA 2Z9SA 5DJMA 3F4TA 4O5QA 1JZWA 1SKWB 4ZIJA 4ZL9A 3G7IA 4K9ZA 5AGYA 2MYGA 5J41A 3HVSA 10GSA 2O3EA 3VFIA 1GUMA 1GTAA 3EURA 5J3RA 3D22A 5CREA 4NWYA 1XCCA 4TRXA 3UIWA 2OBKA 2AJQB 3J7Yk 1UN2A 5C04A 4I97A 2LS5A 2F8FA 3DIEA 2L4CA 2C0EA 2HYXA 22GSA 1ZYEA 3W8SA 5ELAA 2ES7A 2ZNMA 1FB0A 1YKAA 2XC2A 4TXVA 1TU8A 1SJ6A 1R5AA 3D21A 3A2XA 3H79A 4ECIA 2GLRA 2HNLA 5ECKB 2CX3A 4I6XA 1W89A 3DEXA 3QAWA 2YP6A 1K0AA 1VF2A 3BCIA 4ECJA 3GNJA 5KOWA 4PTSA 4LMWA 2EIOA 4K8MA 5CRHA 5J47A 3D4MA 1VF3A 4PUAA 2VCQA 4GQCA 4DSSB 2VL3A 1X0RA 4MF6A 4TXOB 3IPZA 1KBNA 1K0CA 3FZ9A 3F8UA 2R37A 4MF7A 4KAEA 3RAZA 2LTKA 5F0GA 1SL2B 2TRCP 1OC9A 4BVYA 3ERFA 1PA3A 2MZCA 3HZ4A 1OC9B 5JCGA 2GSTA 2WVXA 4KB3A 4F0CA 5HQPA 4AKIA 2DJ1A 5LNKe 2LJRA 1F37A 2B1KA 4WF5A 4K2DA 3IAS2 2VCWA 3KP9A 1UA5A 16GSA 1X5EA 1OKTA 2GSSA 3L0HA 2H74A 2KHPA 3C1SA 1SVLA 1NM3A 2BJXA 2X99A 1I9DA 4ID0A 2PGTA 3BD2A 2VM1A 4USSA 5J9CA 3HVVA 1M2BA 2CQ9A 4MABA 2A2SA 1USBA 1ACVA 4YQMA 6GSVA 5ID2A 2DMMA 3GL3A 1DE1A 3EE2A 1AUCA 3EWLA 2OE1A 5ECRB 1HNBA 2R6KA 4FO5A 2H75A 2JACA 4GF0A 1ERUA 3KH7A 3IC8A 2GVPA 2E2MA 4G0IA 2FUG2 2X4AA 3FYGA 3FZ4A 2HFDA 4A5PA 5CAXA 5J40A 1EEJA 2PUKC 1UC7A 3WGEA 2EFDA 3ZREA 4KF9A 2RUEA 3P2AA 2AHEA 2IIYA 1ERVA 2JSYA 1X9MB 5G31A 3EC3A 1ZL9A 1VF1A 4EDZA 3IAM2 4MH3A 1MTCA 1PKWA 4OFMA 4BL7A 2C4JA 4ZL8A 4FYUA 3BJ5A 3FHKA 5E59A 4EKZA 1TU7A 3RBTA 2ON7A 4IHUA 3IR4A 2VD1A 3QDNA 3WGXA 4N0VA 1ZOFA 2DJKA 1XWAA 3N5OA 1BX9A 1JLVA 3QAGA 2H1LA 5CNWA 2HSNB 2CZ2A 1JZOA 1B4QA 3FEUA 3QMXA 1H4OA 1TDIA 4AJ8A 2H0HA 1R7HA 2YWMA 2ZCTA 1OKDA 4GQFA 3GFKA 1GWCA 3QOUA 1VRSD 5COHA 5ENUA 1G6YA 2H1GA 5ECSA 3ZLPA 2YJ7A 3GYKA 2NVLA 2FGXA 3GL5A 2X8GA 3ZFBA 2FWHA 4XCSA 3EMXA 4J57E 2OJLA 3LW9A 3MYDA 1FO5A 2HI7A 1GP1A 4K7OA 2O85A 1SU9A 1M2AA 1NSWA 1XWGA 2OT3A 2LRTA 2OKAA 2MMOA 4J56E 4N11A 3D5JA 4BA7A 2F8AA 4IKHA 1ABAA 1XOAA 3QCPA 6GSSA 3HZ8A 1XVQA 3CRTA 4TR0A 2K8VA 1A2LA 3DXBA 4POBA 3HD5A 2R4VA 2IJYA 1MDIA 5JWQB 5DQYA 3HA9A 2FY6A 5IMDA 2H6ZA 4JRRA 4ZB7A 3ZTLA 4WR4A 3GH9A 2K9FA 3VURA 2CAQA 3F4RA 3V1WA 5BMUA 1BG5A 4RUVA 4F9ZA 5HR2A 3IV4A 2PVOC 4N0ZA 4TR1A 2I1UA 3ZITA 2HSMB 4TR3A 2WULA 1XFLA 2EIQA 3APOA 5B6MA 1ZCPA 3KIJA 4PHZC 5JCWA 3UVHA 3K8NA 4ZBBA 3M0FA 1WJKA 1EGRA 1PKZA 3IE3A 1HYUA 4NMUA 1MEKA 4KA0A 2WZ9A 2I9HA 2QGVA 4F82A 1SL1B 1B8XA 1XW6A 5C00A 3CSJA 2AUVA 4XS4A 2B7KA 4DVCA 2P5RA 3RHBA 3G7YA 2C0DA 5HR1A 1K0BA 2DC5A 3AY8A 4ACSA 4WF4A 1H75A 1T4YA 3GKMA 3VWWA 2FA8A 1QQ2A 3TKSE 5D73A 1TRSA 2KLXA 2H1BA 2EFCA 4Z7XA 1MDKA 3FW2A 2HQTA 2G0FA 4IQ1A 2XPDA 4OD7A 2LV3A 5HR3A 4JBBA 4ULXA 4AF2A 3MSZA 4TR4A 1Z7RA 2YZHA 3P7XA 4IP6A 2KP1A 3RDWA 3MIXA 4HJMA 3FY7A 3SWLA 2H19A 2VIMA 3EYTA 3CTGA 3IHGA 4KCAA 3WGDA 4JU5A 3HJPA 4IJIA 1M9BA 6GSTA 1M2DA 1LBKA 1O8XA 4V2LA 4QL9A 1BAYA 3TU3B 1ST9A 2WDUA 2P31A 3KTLA 4NPBA 1LJRA 4TN8A 2HZEB 3ERWA 3P90A 3GX0A 1SJIA 2IMDA 4PI0C 3LJRA 2CVBA 4BWSA 3CTFA 3MWHA 4IQAA 2QKEA 4GXZA 3FR9A 1SJZA 1EP8A 3KD0A 1V2AA 3HCZA 5DAKA 4ILFA 3GKXA 4EO3A 5GSTA 2DJ0A 1FOHA 4JR4A 4GCIA 4NV5A 2B1LA 7GSSA 3KGKA 3OR5A 3HY2A 4X1UA 4WKWA 2HRFA 1TXXA 1ILOA 3KH9A 1EOHA 3LXZA 1ZYPA 3NZNA 2X64A 2R0GA 1K0MA 4RQXA 1J0FA 1ERTA 5IM9A 4ISDA 4POLA 2FA4A 4K0NA 2CVKA 3IK7A 2C3NA 4CHSA 3CXGA 4GRFA 1F2EA 4MH2A 5DALB 1PX6A 5ECQB 5DCHA 2FNOA 4PXOA 2HRNA 2X8HA 1AXDA 4WBJA 1XXUA 3I43A 4WXTA 4AKHA 1XW5A 5IQYA 2OE3A 4OFNA 3W6GA 2NPBA 2YWOA 2PN8A 2MBSA 5F06A 1FVJA 3CBUA 2N5BA 2YJHA 2D2ZA 3R2QA 4HUAA 1YKCA 1Z6NA 5EPFA 4KGIA 4Q5FA 1MD4A 4AKXB 3A2WA 4K5SA 4PGTA 2LSTA 4NXIA 4QL7A 4RI7A 2H1AA 5A4VA 2OE0A 5HFKA 1O6JA 3TRXA 3RHCA 5ELGA 2WFCA 6GSXA 2F3MA 3UVTA 2XPEA 2XBIA 4HS1A 3GKNA 5KN0A 2FWGA 2P0GA 2HRKA 3ZVJA 4EE0A 2LQOA 1F9MA 5EVOA 2REMA 4FYBA 4YKFA 1KTEA 2HRKB 3DGQA 2GZPA 1M99A 5J4VA 4TOPA 3RFRC 2OBIA 3H8QA 2RLIA 1QGVA 4V1Ag 3LSZA 4EIPA 2R0PA 1GSDA 1DUGA 4CDOA 5F8BA 1S3DA 3Q6OA 1YEXA 4K7IA 2OA7A 1SENA 3GH6A 3UL3A 1SD8A 3QFAC 4ZB9A 3KMOA 2YCDA 3EVIA 2O36A 3UAPA 2PBJA 4O32A 1Z3EA 3PH9A 4HDEA 2R3XA 2QA2A 5CYYA 2H01A 3F0IA 4PX1A 2TIRA 3HDCA 4YQUA 1GH2A 1S3AA 1TI1A 1Z7PA 3LYPA 4E8EA 5DQSA 1UVZA 4YAPA 3US3A 3FR3A 1RQMA 3NOFA 3QFBC 4KNDA 3TKSC 2CX4A 5A4UA 4BVYB 9GSSA 4G9HA 4XIHA 5AN1A 5IMCA 2WVXB 2TRXA 1GNEA 3PR8A 2M46A 2BTOT 1J9BA 2IN3A 4KSMA 2V6OA 3GURA 1EGOA 1ML6A 4H86A 2OACA 2J9HA 1GSEA 2YWIA 5AIVA 1K3YA 3HMJG 2XHFA 4PQ1A 5D8IA 5IO2A 2MMZA 3GA4A 3E0UA 3GKKA 4CY6A 2L4QA 5ECMB 1I5GA 1WRYA 1XWKA 2VLVA 4DSRA 5CP1A 5D96A 1EZKA 2DIZA 5CO3A 3TJJA 1JZDA 2GGTA 4MZWA 5D93A 1K3OA 3F63A 1URMA 3UJ1A 5ID2B 3DRNA 2C3QA 3GSTA 1TI3A 2GT6A 1GNWA 1O73A 2BMXA 2X49A 4K6XA 4TVEA 4WETA 1G6WA 1V98A 1GSFA 4HI7A 2AYTA 3LEFA 3MAKA 2IMEA 1EWXA 1XVWA 4MPGA 1F3AA 1K0OA 2WGRA 4HEA2 4YKGA 4G0LA 4PNGA 3CHXC 4L5OA 5ABRA 4G10A 4KCEA 3GRXA 1WMJA 5JCUA 3LWAA 4MZBA 3MNGA 1Y6EA 4PQHA 4E68A 1OAZA 1K3LA 4CW9A 2RM6A 1T1VA 4K1FA 2YZUA 5G5FA 2CA8A 3KP8A 3ZIJA 1T00A 2LEGA 3UEMA 3VPTA 2H8LA 4D73A 5GZZB 3HKRA 1WP0A 4BL7B 3WD6A 2VLUA 3LYKA 4HZ4A 3APSA 5LD0A 3CQFA 4JR6A 3L4NA 3TKQA 2E2GA 2HLSA 4LMVA 1WWJA 1YEWC 1NHYA 1Z9HA 5A5KA 3TRPA 1OE8A 1Z6MA 4FYCA 3U6VA 4WR5A 3MDKA 3ZRDA 3H4KA 5IIZA 4XS1A 1FW1A 2M72A 2QA1A 5G1LA 4MJEA 5KN2A 4WBRD 4OO5A 1GLPA 4JE1A 1PL1A 4G19A 2RIIA 4NHZA 2E7PA 2H30A 1FHEA 2WVYA 3P8WA 4TKYA 5A34A 2FHEA 2H76A 3WT2A 2I4AA 4POMA 5A34B 1FVKA 3E3EA 2JZTA 5DVBA 2EFEA 3TJGA 2PWJA 2DLXA 4LL4B 5G5EA 5ECOB 1A8LA 1BQ7A 3ED3A 1YJ6A 3M3MA 2H1DA 3GTUA 1BJXA 3ZIVA 3R3EA 2R2JA 5H5SA 2DJ3A 1GTUA 4G0KA 6GSUA 6GSWA 1G0TA 1A2JA 4QMKA 1YEPA 5CRGA 4OCEA 2VL2A 2VOCA 2JSZA 4P3YB 1NW2A 2CT6A 4BIKA 3PGTA 1GUKA 3EU3A 3GX8A 4FH8A 4KUNA 2WRTA 2V1MA 5EY6A 1V57A 14GSA 1PN0A 3J7Yb 1R4WA 2N5AA 4XTSA 1A24A 1E6BA 4MPFA 2HSHA 1SL0B 4AKGA 2I81A 4PI2C 5B8BA 5BMUB 2GDRA 4AI6A 1VGLA 4Q5NA 4TR1B 1Q98A 1KNGA 2KOKA 4FQUA 4L0UA 5KN3A 1OC3A 1ZYQB 1OYJA 3QD9A 2WW3A 1M9AA 1FB6A 1A23A 1EP7A 1GULA 4MK3A 1O8WA 4XS4B 3HVXA 2CVDA 3DD3A 3W8JA 4RI6A 1PSQA 3D6IA 2VLTA 4EXJA 1PD21 3JCML 1HQOA 2VL2C 3DWVA 2AB6A 1ON4A 6GSYA 2VCZA 3A5WA 5E4WA 4YAVA 3M9JA 2LQQA 3CYNA 4L0WA 5HFGA 4IBPA 4F03A 5ECIB 2H73A 3I9V2 2F51A 3IHQA 3O76A 3QAVA 4PQIA 4F0BA 3A2VA 1W4VA 2O87A 2MMNA 2V6KA 13GSA 2HRAA 5DJLA 5FT3A 5CRWA 1OVNA 2VCVA 3BOAA 4ZXGA 3QR6A 2VKZG 2IMFA 1A2MA 2GS3A 1SKRB 2G2QA 4K5RA 5FWGA 2CZ3A 1V58A 2DBCA 5LCZA 4GSNA 4V2NA 1XZOA 3G7JA 3EU4A 3KEBA 4N30A 4Z2TA 5KOXA 4OFTA 1TXUA 4BVXA 5CRDA 3C8EA 5KEJA 1B4PA 4HOJA 1U3IA 2GSRA 1HD2A 1GSYA 2AAWA 4ECCA 3ZFLA 4ZILA 1AIUA 3IXRA 5D9VA 1T7PB 4OO4A 1JLWA 3C73A 2DKHA 3HJMA 3FZAA 4NHWA 1YY7A 5ECPB 3VI7A 5DAKB 2H6YA 4WEYA 4I2UA 4IP1A 2UZ8A 1TRWA 3LXTA 2PU9C 5A5HA 2IPAA 3FMWA 2L5LA 3VWXA 2C0FA 4N3ZA 2X8CA 3ZMLA 3N9JA 2WJUA 3PPUA 5JWRB 2A4HA 5IMFA 1GL8A 1GTBA 1GSQA 3ZZXA 4KDYA 3WYWA 2JU5A 4FIWA 3GSSA 1U6TA 5A1NA 1FOVA 2C1YA 4IW9A 3EMPA 4XHMA 3L78A 4MA9A 4GLTA 4I5QA 2V41A 4EUYA 1JZRA 2JZSA 1Y25A 5FHIA 3FKFA 4BPYA 1B9YC 2N5FA 1A0RP 4J2FA 2VO4A 1VF4A 3KXOA 5DCGA 2B7JA 3DMLA 1AQWA 2IFQA 4HU7A 2GQLA 2LRCA 2LJAA 3GMFA 2IFQB 4GTUA 1MD3A 3CSIA 1N25A 3RPPA 1X5DA 3VLNA 1SK0A 4AJ7A 3EINA 3F9UA 1OE7A 4JEDA 2LKUA 2DJJA 4X43A 1SVMA 5IOWA 1M3IA 4YH2A 1R26A 5F07A 1DE2A 1CQGA 2GSQA 2QC7A 3TKSA 1PGTA 2FWFA 1TK0B 4NAXA 3KZQA 4MP4A 11GSA 1ZMAA 2YNXA 1AC1A 1ERWA 4GSTA 3TCOA 4PUFC 3IRAA 1N2AA 3F4SA 4ML6A 1TKDB 4MJCA 3RPNA 2DJ2A 3F3RA 4ZL7A 4HQSA 5IMVA 4XS6A 2O89A 5J4UA 1WIKA 3CWGA 2CV4A 1GSUA 3M9KA 2EIRA 3L9VA 1B9XC 1F3BA 1SK2A 1I1IP 3L9UA 3Q19A 3HJOA 4DSSA 3ZVJD 2KP2A 4TXOA 1G7OA 2C3TA 4O5UA 1GTIA 2JADA 19GSA 3M1GA 4MNNA 3KM6A 1XWBA 3G9BA 5G30A 2EC4A 2FWEA 4MDCA 1XG8A 3CSHA 3KJYA 4K7NA 2J23A 3O3TA 2FD3A 1U3AA 4O7HA 1RW1A 2L6CA 3GIXA 4EDYA 2NBSA 2ZUPA 5ECHB 1SK1A 1A0FA 2F9SA 1Z5YE 4GWRA 1X9SB 4KE3A 3A3TA 2H0IA 1EV9A 1BG1A 2HZFA 2VUPA 2XBQA 1V40A 5IO0A 8GSSA 2WW2A 3NIVA 4OMVA 5BRTA 3TJBA 2B6MA 2HSYA 1TRUA 5G2ZA 3UBKA 3U5RE 1WOUA 4X4JA 3C7MA 4F2IA 3A5IA 1BEDA 5HR0A 1FG4A 3UOMA 4V2MA 5INYA 4Z2UA 1TK8B 4L8EA 3O6TA 2WZSA 2GZZA 1S3RA 3EPTA 4L5LA 1QUWA 4RQRA 4ZBAA 3GV1A 4I2TA 1S3CA 1TRVA 1IYIA 2H6XA 2L5OA 4MJAA 4Q5QA 1YDKA 2NTOA 1AQVA 1EOGA 4G2EA 2DSAA 2WVZA 1TOFA 4EF0A 4KDXA 1QFNA 5B7CA 1B48A 1CQHA 3Q74A 2IWTA 2P5QA 2PPTA 3APQA 1BYEA 5IMZA 2RM5A 4ZB6A 2LUSA 3TGZA 1YZXA 1LU4A 4D73B 4W66A 2O8VB 1O7UA 3LGCA 12GSA 3BBYA 1FAAA 4CY8A 1DBYA 2GZYA 3I69A 4XRDA 2GQMA 3TJKA 4ICYA 2C80A 4EIQA 2IMKA 4MZCA 2E0QA 1XW9A 3VK9A 2LNTA 2LJKA 1DSBA 1K0DA 1GRXA 1X9WB 2YV7A 2YWNA 4E8HA 3CRUA 2UV8G 3FK8A 1G7EA 4YQVA 1XWCA 2B5YA 2HSNA 1F6MC 4TW5A 5J9BA 2AV4A 3UBLA 3LG6A 4O5RA 5H5QA 1K0NA 1M3JA 1BF5A 1V9WA 3TJFA 3TUEA 4EL1A 3GUSA 4DEJA 5EL8A 4HSCX 1U87A 1J08A 2HXKA 2B3SA 2PVQA 2DIYA 2IMIA 2VM2A 1PMTA 2HE3A 2K6VA 3PINA 4ECBA 4AJ6A 1TW9A 1E2YA 3H1NA 2H72A 3HYPA 4MMMA 1YVLA 1EEMA 1HNAA 3GTUB 3I6AA 4ZBDA 3UARA 1PQNA 3TOUA 4X0XA 4KSOA 2R0CA 5J4YA 4HQZA 1C72A 2VCXA 4Z2RA 2L57A 2O7KA 3ME7A 1JFUA 3IK9A 1R5PA 5F05A 4IELA 1TJDA 2VL9A 2HT9A 4OCFA 1THOA 3CMIA 3ZYWA 2WCIA 1ZGNA 4ML1A 2PERA 1SKSB 1EV4A 3DYRA 1GUHA 5IPGA 2YANA 3F6FA 2YPMA 1YF1A 3ERGA 4IVFA 2WB9A 3ME8A 1T4ZA 4BWQA 2B5XA 3FRCA 1MDJA 2LNSA 3L9SA 1O85A 4GSSA 3HHVA 2VCTA 3C71A 2DKIA 5KN1A 3ISOA 1QXHA 2C0GA 3TDGA 2HSMA 3F3QA 3ZL5A 2VAFA 2IL3A 2EFHA 4KX4A 2C8UA 4MCUA 2JZRA 2M80A 4O92A 5D9XA 5L71A 2VD0A 1SD9A 1O81A 2FLSA 5ECLB 3KTBA 1ZZYA 4KH7A 1NHOA 1PFOA 3QPMA 2YN1A 4MF5A 4G01A 4LLRA 2A2PA 1JHBA 2ALBA 2WS2A 1GSSA 2RUFA 1T3BA 1PL2A 4N10A 5J5NA
chains in the Genus database with same CATH topology
1TP9A 1QMVA 3TKRA 1GLQA 2OADA 3S9FA 3TKPA 2A2RA 1Y1UA 5ECNB 4JZQA 2GT5A 1TK5B 1AAZA 2A4VA 3VWUA 1OC8A 4XRAA 2I3YA 2ON5A 4HZ2A 3F6DA 4MJBA 3LFLA 4AGSA 3TOTA 1X5CA 4PURA 4KW6A 2B5EA 2R5GA 2H71A 1AW9A 1YQ1A 4EVMA 5IPHA 3H93A 20GSA 2H0GA 3KMNA 3DVXA 4IS0A 5GAND 3VWVA 3D0ZA 3DVWA 4KDUA 4Q5RA 4K2XA 1AQXA 4EC0A 1SYXA 3IA1A 4OWYA 3Q18A 5DBQA 1THXA 1N8JA 1WPIA 3GN3A 1QK8A 2QSIA 5IOXA 5A4WA 4BVXB 4GDFA 3VPQA 3LORA 2HZEA 5DDLA 1M7TA 1YF0A 3FR6A 1WE0A 4POKA 4PNFA 3C1RA 3D4TA 3IOSA 2KUCA 4I8BA 2CAIA 2V32A 1Q4JA 2NDOA 5AISA 3VI5A 5D9WA 2JL4A 5IMAA 2YOIA 5G1KA 3TB2A 1TTZA 3UMAA 2MBTA 3DKSA 2L59A 5H5RA 1RK4A 2GQKA 5B6NA 1HNCA 2GTUA 4DSQA 4K0GA 2PMTA 3ZMKA 2K18A 1XBSA 3LQ7A 5A5HB 3IC4A 5GAPD 4HJ2A 2L6DA 4HU9A 5JWOB 2H66A 1PX7A 17GSA 5D9TA 5HFIA 4QQ7A 18GSA 2H70A 2DMLA 5A1NB 4NV2A 3WT1A 4MLYA 2FCHA 3IBHA 5GSSA 4IJ3A 4V1Ap 3TRQA 1PRXA 5AIXA 2YV9A 5DALA 3FZ5A 1T8EB 3BCKA 3GHAA 1U88A 1SYRA 4LL1B 3E9JB 2MMAA 1XPVA 1ZYNA 1IYHA 4ZB8A 1A8YA 1PN9A 3M8NA 3KCMA 4IN0A 2LRNA 3IDVA 1XOBA 4LA1A 1M0UA 2O5VA 1XIYA 3HXSA 3SBCA 2V2GA 1KEBA 1SVOA 2K8SA 4IGJA 5B8AA 2Z9SA 5DJMA 3F4TA 4O5QA 1JZWA 1SKWB 4ZIJA 4ZL9A 3G7IA 4K9ZA 5AGYA 2MYGA 5J41A 3HVSA 10GSA 3VFIA 1GUMA 1GTAA 3EURA 5J3RA 3D22A 5CREA 4NWYA 1XCCA 4TRXA 3UIWA 2OBKA 2AJQB 3J7Yk 1UN2A 5C04A 4I97A 2LS5A 2F8FA 3DIEA 2L4CA 2C0EA 2HYXA 22GSA 1ZYEA 3W8SA 5ELAA 2ES7A 2ZNMA 1FB0A 1YKAA 2XC2A 4TXVA 1TU8A 1SJ6A 1R5AA 3D21A 3A2XA 3H79A 4ECIA 2GLRA 2HNLA 5ECKB 2CX3A 4I6XA 1W89A 3DEXA 3QAWA 2YP6A 1K0AA 1VF2A 3BCIA 4ECJA 3GNJA 5KOWA 4PTSA 4LMWA 2EIOA 4K8MA 5CRHA 5J47A 3D4MA 1VF3A 4PUAA 2VCQA 4GQCA 4DSSB 2VL3A 1X0RA 4MF6A 4TXOB 3IPZA 1KBNA 1K0CA 3FZ9A 3F8UA 2R37A 4MF7A 4KAEA 3RAZA 2LTKA 5F0GA 1SL2B 2TRCP 1OC9A 4BVYA 3ERFA 1PA3A 2MZCA 3HZ4A 1OC9B 5JCGA 2GSTA 4KB3A 4F0CA 5HQPA 4AKIA 2DJ1A 5LNKe 2LJRA 1F37A 2B1KA 4WF5A 4K2DA 3IAS2 2VCWA 3KP9A 1UA5A 16GSA 1X5EA 1OKTA 2GSSA 3L0HA 2H74A 2KHPA 3C1SA 1SVLA 1NM3A 2BJXA 2X99A 1I9DA 4ID0A 2PGTA 3BD2A 2VM1A 4USSA 5J9CA 3HVVA 1M2BA 2CQ9A 4MABA 2A2SA 1USBA 1ACVA 4YQMA 6GSVA 5ID2A 2DMMA 3GL3A 1DE1A 3EE2A 1AUCA 3EWLA 2OE1A 5ECRB 1HNBA 2R6KA 4FO5A 2H75A 2JACA 4GF0A 1ERUA 3KH7A 3IC8A 2GVPA 2E2MA 4G0IA 2FUG2 2X4AA 3FYGA 3FZ4A 2HFDA 4A5PA 5CAXA 5J40A 1EEJA 2PUKC 1UC7A 3WGEA 2EFDA 3ZREA 4KF9A 2RUEA 3P2AA 2AHEA 2IIYA 1ERVA 2JSYA 1X9MB 5G31A 3EC3A 1ZL9A 1VF1A 4EDZA 3IAM2 4MH3A 1MTCA 1PKWA 4OFMA 4BL7A 2C4JA 4ZL8A 4FYUA 3BJ5A 3FHKA 5E59A 4EKZA 1TU7A 3RBTA 2ON7A 4IHUA 3IR4A 2VD1A 3QDNA 3WGXA 4N0VA 1ZOFA 2DJKA 1XWAA 3N5OA 1BX9A 1JLVA 3QAGA 2H1LA 5CNWA 2HSNB 2CZ2A 1JZOA 1B4QA 3FEUA 3QMXA 1H4OA 1TDIA 4AJ8A 2H0HA 1R7HA 2YWMA 2ZCTA 1OKDA 4GQFA 3GFKA 1GWCA 3QOUA 1VRSD 5COHA 5ENUA 1G6YA 2H1GA 5ECSA 3ZLPA 2YJ7A 3GYKA 2NVLA 2FGXA 3GL5A 2X8GA 3ZFBA 2FWHA 4XCSA 3EMXA 4J57E 2OJLA 3LW9A 3MYDA 1FO5A 2HI7A 1GP1A 4K7OA 2O85A 1SU9A 1M2AA 1NSWA 1XWGA 2OT3A 2LRTA 2OKAA 2MMOA 4J56E 4N11A 3D5JA 4BA7A 2F8AA 4IKHA 1ABAA 1XOAA 3QCPA 6GSSA 3HZ8A 1XVQA 3CRTA 4TR0A 2K8VA 1A2LA 3DXBA 4POBA 3HD5A 2R4VA 2IJYA 1MDIA 5JWQB 5DQYA 3HA9A 2FY6A 5IMDA 2H6ZA 4JRRA 4ZB7A 3ZTLA 4WR4A 3GH9A 2K9FA 3VURA 2CAQA 3F4RA 3V1WA 5BMUA 1BG5A 4RUVA 4F9ZA 5HR2A 3IV4A 2PVOC 4N0ZA 4TR1A 2I1UA 3ZITA 2HSMB 4TR3A 2WULA 1XFLA 2EIQA 3APOA 5B6MA 1ZCPA 3KIJA 5JCWA 3UVHA 3K8NA 4ZBBA 3M0FA 1WJKA 1EGRA 1PKZA 3IE3A 1HYUA 4NMUA 1MEKA 4KA0A 2WZ9A 2I9HA 2QGVA 4F82A 1SL1B 1B8XA 1XW6A 5C00A 3CSJA 2AUVA 4XS4A 2B7KA 4DVCA 2P5RA 3RHBA 3G7YA 2C0DA 5HR1A 1K0BA 2DC5A 3AY8A 4ACSA 4WF4A 1H75A 1T4YA 3GKMA 3VWWA 2FA8A 1QQ2A 3TKSE 5D73A 1TRSA 2KLXA 2H1BA 2EFCA 4Z7XA 1MDKA 3FW2A 2HQTA 2G0FA 4IQ1A 2XPDA 4OD7A 2LV3A 5HR3A 4JBBA 4ULXA 4AF2A 3MSZA 4TR4A 1Z7RA 2YZHA 3P7XA 4IP6A 2KP1A 3RDWA 3MIXA 4HJMA 3FY7A 3SWLA 2H19A 2VIMA 3EYTA 3CTGA 3IHGA 4KCAA 3WGDA 4JU5A 3HJPA 4IJIA 1M9BA 6GSTA 1M2DA 1LBKA 1O8XA 4V2LA 4QL9A 1BAYA 3TU3B 1ST9A 2WDUA 2P31A 3KTLA 4NPBA 1LJRA 4TN8A 2HZEB 3ERWA 3P90A 3GX0A 1SJIA 2IMDA 3LJRA 2CVBA 4BWSA 3CTFA 3MWHA 4IQAA 2QKEA 4GXZA 3FR9A 1SJZA 1EP8A 3KD0A 1V2AA 3HCZA 5DAKA 4ILFA 3GKXA 4EO3A 5GSTA 2DJ0A 1FOHA 4JR4A 4GCIA 4NV5A 2B1LA 7GSSA 3KGKA 3OR5A 3HY2A 4X1UA 4WKWA 2HRFA 1TXXA 1ILOA 3KH9A 1EOHA 3LXZA 1ZYPA 3NZNA 2X64A 2R0GA 1K0MA 4RQXA 1J0FA 1ERTA 5IM9A 4ISDA 4POLA 2FA4A 4K0NA 2CVKA 3IK7A 2C3NA 4CHSA 3CXGA 4GRFA 1F2EA 4MH2A 5DALB 1PX6A 5ECQB 5DCHA 2FNOA 4PXOA 2HRNA 2X8HA 1AXDA 4WBJA 1XXUA 3I43A 4WXTA 4AKHA 1XW5A 5IQYA 2OE3A 4OFNA 3W6GA 2NPBA 2YWOA 2PN8A 2MBSA 5F06A 1FVJA 3CBUA 2N5BA 2YJHA 2D2ZA 3R2QA 4HUAA 1YKCA 1Z6NA 5EPFA 4KGIA 4Q5FA 1MD4A 4AKXB 3A2WA 4K5SA 4PGTA 2LSTA 4NXIA 4QL7A 4RI7A 2H1AA 5A4VA 2OE0A 5HFKA 1O6JA 3TRXA 3RHCA 5ELGA 2WFCA 6GSXA 2F3MA 3UVTA 2XPEA 2XBIA 4HS1A 3GKNA 5KN0A 2FWGA 2P0GA 2HRKA 3ZVJA 4EE0A 2LQOA 1F9MA 5EVOA 2REMA 4FYBA 4YKFA 1KTEA 2HRKB 3DGQA 2GZPA 1M99A 5J4VA 4TOPA 2OBIA 3H8QA 2RLIA 1QGVA 4V1Ag 3LSZA 4EIPA 2R0PA 1GSDA 1DUGA 4CDOA 5F8BA 1S3DA 3Q6OA 1YEXA 4K7IA 2OA7A 1SENA 3GH6A 3UL3A 1SD8A 3QFAC 4ZB9A 3KMOA 2YCDA 3EVIA 3UAPA 2PBJA 4O32A 1Z3EA 3PH9A 4HDEA 2R3XA 2QA2A 5CYYA 2H01A 3F0IA 4PX1A 2TIRA 3HDCA 4YQUA 1GH2A 1S3AA 1TI1A 1Z7PA 3LYPA 4E8EA 5DQSA 1UVZA 4YAPA 3US3A 3FR3A 1RQMA 3NOFA 3QFBC 4KNDA 3TKSC 2CX4A 5A4UA 4BVYB 9GSSA 4G9HA 4XIHA 5AN1A 5IMCA 2TRXA 1GNEA 3PR8A 2M46A 2BTOT 1J9BA 2IN3A 4KSMA 2V6OA 3GURA 1EGOA 1ML6A 4H86A 2OACA 2J9HA 1GSEA 2YWIA 5AIVA 1K3YA 3HMJG 2XHFA 4PQ1A 5D8IA 5IO2A 2MMZA 3GA4A 3E0UA 3GKKA 4CY6A 2L4QA 5ECMB 1I5GA 1WRYA 1XWKA 2VLVA 4DSRA 5CP1A 5D96A 1EZKA 2DIZA 5CO3A 3TJJA 1JZDA 2GGTA 4MZWA 5D93A 1K3OA 3F63A 1URMA 3UJ1A 5ID2B 3DRNA 2C3QA 3GSTA 1TI3A 2GT6A 1GNWA 1O73A 2BMXA 2X49A 4K6XA 4TVEA 4WETA 1G6WA 1V98A 1GSFA 4HI7A 2AYTA 3LEFA 3MAKA 2IMEA 1EWXA 1XVWA 4MPGA 1F3AA 1K0OA 2WGRA 4HEA2 4YKGA 4G0LA 4PNGA 4L5OA 5ABRA 4G10A 4KCEA 3GRXA 1WMJA 5JCUA 3LWAA 4MZBA 3MNGA 1Y6EA 4PQHA 4E68A 1OAZA 1K3LA 4CW9A 2RM6A 1T1VA 4K1FA 2YZUA 5G5FA 2CA8A 3KP8A 3ZIJA 1T00A 2LEGA 3UEMA 3VPTA 2H8LA 4D73A 5GZZB 3HKRA 1WP0A 4BL7B 3WD6A 2VLUA 3LYKA 4HZ4A 3APSA 5LD0A 4JR6A 3L4NA 3TKQA 2E2GA 2HLSA 4LMVA 1WWJA 1NHYA 1Z9HA 5A5KA 3TRPA 1OE8A 1Z6MA 4FYCA 3U6VA 4WR5A 3MDKA 3ZRDA 3H4KA 5IIZA 4XS1A 1FW1A 2M72A 2QA1A 5G1LA 4MJEA 5KN2A 4WBRD 4OO5A 1GLPA 4JE1A 1PL1A 4G19A 2RIIA 4NHZA 2E7PA 2H30A 1FHEA 3P8WA 4TKYA 5A34A 2FHEA 2H76A 3WT2A 2I4AA 4POMA 5A34B 1FVKA 3E3EA 2JZTA 5DVBA 2EFEA 3TJGA 2PWJA 2DLXA 4LL4B 5G5EA 5ECOB 1A8LA 1BQ7A 3ED3A 1YJ6A 3M3MA 2H1DA 3GTUA 1BJXA 3ZIVA 3R3EA 2R2JA 5H5SA 2DJ3A 1GTUA 4G0KA 6GSUA 6GSWA 1G0TA 1A2JA 4QMKA 1YEPA 5CRGA 4OCEA 2VL2A 2VOCA 2JSZA 4P3YB 1NW2A 2CT6A 3PGTA 1GUKA 3EU3A 3GX8A 4FH8A 4KUNA 2WRTA 2V1MA 5EY6A 1V57A 14GSA 1PN0A 3J7Yb 1R4WA 2N5AA 4XTSA 1A24A 1E6BA 4MPFA 2HSHA 1SL0B 4AKGA 2I81A 5B8BA 5BMUB 2GDRA 4AI6A 1VGLA 4Q5NA 4TR1B 1Q98A 1KNGA 2KOKA 4FQUA 4L0UA 5KN3A 1OC3A 1ZYQB 1OYJA 3QD9A 1M9AA 1FB6A 1A23A 1EP7A 1GULA 4MK3A 1O8WA 4XS4B 3HVXA 2CVDA 3DD3A 3W8JA 4RI6A 1PSQA 3D6IA 2VLTA 4EXJA 1PD21 3JCML 1HQOA 2VL2C 3DWVA 2AB6A 1ON4A 6GSYA 2VCZA 3A5WA 5E4WA 4YAVA 3M9JA 2LQQA 3CYNA 4L0WA 5HFGA 4IBPA 4F03A 5ECIB 2H73A 3I9V2 2F51A 3IHQA 3O76A 3QAVA 4PQIA 4F0BA 3A2VA 1W4VA 2O87A 2MMNA 2V6KA 13GSA 2HRAA 5DJLA 5FT3A 5CRWA 1OVNA 2VCVA 3BOAA 4ZXGA 3QR6A 2VKZG 2IMFA 1A2MA 2GS3A 1SKRB 2G2QA 4K5RA 5FWGA 2CZ3A 1V58A 2DBCA 5LCZA 4GSNA 4V2NA 1XZOA 3G7JA 3EU4A 3KEBA 4N30A 4Z2TA 5KOXA 4OFTA 1TXUA 4BVXA 5CRDA 3C8EA 5KEJA 1B4PA 4HOJA 1U3IA 2GSRA 1HD2A 1GSYA 2AAWA 4ECCA 3ZFLA 4ZILA 1AIUA 3IXRA 5D9VA 1T7PB 4OO4A 1JLWA 3C73A 2DKHA 3HJMA 3FZAA 4NHWA 1YY7A 5ECPB 3VI7A 5DAKB 2H6YA 4WEYA 4I2UA 4IP1A 2UZ8A 1TRWA 3LXTA 2PU9C 5A5HA 2IPAA 3FMWA 2L5LA 3VWXA 2C0FA 4N3ZA 2X8CA 3ZMLA 3N9JA 2WJUA 3PPUA 5JWRB 2A4HA 5IMFA 1GL8A 1GTBA 1GSQA 3ZZXA 4KDYA 3WYWA 2JU5A 4FIWA 3GSSA 1U6TA 5A1NA 1FOVA 2C1YA 4IW9A 3EMPA 4XHMA 3L78A 4MA9A 4GLTA 4I5QA 2V41A 4EUYA 1JZRA 2JZSA 1Y25A 5FHIA 3FKFA 4BPYA 1B9YC 2N5FA 1A0RP 4J2FA 2VO4A 1VF4A 3KXOA 5DCGA 2B7JA 3DMLA 1AQWA 2IFQA 4HU7A 2GQLA 2LRCA 2LJAA 3GMFA 2IFQB 4GTUA 1MD3A 3CSIA 1N25A 3RPPA 1X5DA 3VLNA 1SK0A 4AJ7A 3EINA 3F9UA 1OE7A 4JEDA 2LKUA 2DJJA 4X43A 1SVMA 5IOWA 4YH2A 1R26A 5F07A 1DE2A 1CQGA 2GSQA 2QC7A 3TKSA 1PGTA 2FWFA 1TK0B 4NAXA 3KZQA 4MP4A 11GSA 1ZMAA 2YNXA 1AC1A 1ERWA 4GSTA 3TCOA 4PUFC 3IRAA 1N2AA 3F4SA 4ML6A 1TKDB 4MJCA 3RPNA 2DJ2A 3F3RA 4ZL7A 4HQSA 5IMVA 4XS6A 2O89A 5J4UA 1WIKA 3CWGA 2CV4A 1GSUA 3M9KA 2EIRA 3L9VA 1B9XC 1F3BA 1SK2A 3L9UA 3Q19A 3HJOA 4DSSA 3ZVJD 2KP2A 4TXOA 1G7OA 2C3TA 4O5UA 1GTIA 2JADA 19GSA 3M1GA 4MNNA 3KM6A 1XWBA 3G9BA 5G30A 2EC4A 2FWEA 4MDCA 3CSHA 3KJYA 4K7NA 2J23A 3O3TA 2FD3A 1U3AA 4O7HA 1RW1A 2L6CA 3GIXA 4EDYA 2NBSA 2ZUPA 5ECHB 1SK1A 1A0FA 2F9SA 1Z5YE 4GWRA 1X9SB 4KE3A 3A3TA 2H0IA 1EV9A 1BG1A 2HZFA 2VUPA 2XBQA 1V40A 5IO0A 8GSSA 3NIVA 4OMVA 5BRTA 3TJBA 2B6MA 2HSYA 1TRUA 5G2ZA 3UBKA 3U5RE 1WOUA 4X4JA 3C7MA 4F2IA 3A5IA 1BEDA 5HR0A 1FG4A 3UOMA 4V2MA 5INYA 4Z2UA 1TK8B 4L8EA 3O6TA 2GZZA 3EPTA 4L5LA 1QUWA 4RQRA 4ZBAA 3GV1A 4I2TA 1S3CA 1TRVA 1IYIA 2H6XA 2L5OA 4MJAA 4Q5QA 1YDKA 2NTOA 1AQVA 1EOGA 4G2EA 2DSAA 1TOFA 4EF0A 4KDXA 1QFNA 5B7CA 1B48A 1CQHA 3Q74A 2IWTA 2P5QA 2PPTA 3APQA 1BYEA 5IMZA 2RM5A 4ZB6A 2LUSA 3TGZA 1YZXA 1LU4A 4D73B 4W66A 2O8VB 1O7UA 3LGCA 12GSA 3BBYA 1FAAA 4CY8A 1DBYA 2GZYA 3I69A 4XRDA 2GQMA 3TJKA 4ICYA 2C80A 4EIQA 2IMKA 4MZCA 2E0QA 1XW9A 3VK9A 2LNTA 2LJKA 1DSBA 1K0DA 1GRXA 1X9WB 2YV7A 2YWNA 4E8HA 3CRUA 2UV8G 3FK8A 1G7EA 4YQVA 1XWCA 2B5YA 2HSNA 1F6MC 4TW5A 5J9BA 2AV4A 3UBLA 3LG6A 4O5RA 5H5QA 1K0NA 1BF5A 1V9WA 3TJFA 3TUEA 4EL1A 3GUSA 4DEJA 5EL8A 1U87A 1J08A 2HXKA 2B3SA 2PVQA 2DIYA 2IMIA 2VM2A 1PMTA 2HE3A 2K6VA 3PINA 4ECBA 4AJ6A 1TW9A 1E2YA 3H1NA 2H72A 3HYPA 4MMMA 1YVLA 1EEMA 1HNAA 3GTUB 3I6AA 4ZBDA 3UARA 1PQNA 3TOUA 4X0XA 4KSOA 2R0CA 5J4YA 4HQZA 1C72A 2VCXA 4Z2RA 2L57A 2O7KA 3ME7A 1JFUA 3IK9A 1R5PA 5F05A 4IELA 1TJDA 2VL9A 2HT9A 4OCFA 1THOA 3CMIA 3ZYWA 2WCIA 1ZGNA 4ML1A 2PERA 1SKSB 1EV4A 3DYRA 1GUHA 5IPGA 2YANA 3F6FA 2YPMA 1YF1A 3ERGA 4IVFA 2WB9A 3ME8A 1T4ZA 4BWQA 2B5XA 3FRCA 1MDJA 2LNSA 3L9SA 1O85A 4GSSA 3HHVA 2VCTA 3C71A 2DKIA 5KN1A 3ISOA 1QXHA 2C0GA 3TDGA 2HSMA 3F3QA 3ZL5A 2VAFA 2IL3A 2EFHA 4KX4A 2C8UA 4MCUA 2JZRA 2M80A 4O92A 5D9XA 5L71A 2VD0A 1SD9A 1O81A 2FLSA 5ECLB 3KTBA 1ZZYA 4KH7A 1NHOA 3QPMA 2YN1A 4MF5A 4G01A 4LLRA 2A2PA 1JHBA 2ALBA 2WS2A 1GSSA 2RUFA 1T3BA 1PL2A 4N10A 5J5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP9 A;  1QMV A;  3TKR A;  1GLQ A;  2OAD A;  3S9F A;  3TKP A;  2A2R A;  5ECN B;  4JZQ A;  2GT5 A;  1TK5 B;  1AAZ A;  2A4V A;  3VWU A;  1OC8 A;  4XRA A;  2I3Y A;  2ON5 A;  4HZ2 A;  3F6D A;  4MJB A;  3LFL A;  4AGS A;  3TOT A;  1X5C A;  4PUR A;  4KW6 A;  2B5E A;  2R5G A;  2H71 A;  1AW9 A;  1YQ1 A;  4EVM A;  5IPH A;  3H93 A;  20GS A;  2H0G A;  3KMN A;  3DVX A;  4IS0 A;  5GAN D;  3VWV A;  3D0Z A;  3DVW A;  4KDU A;  4Q5R A;  1AQX A;  4EC0 A;  1SYX A;  3IA1 A;  4OWY A;  3Q18 A;  5DBQ A;  1THX A;  1N8J A;  1WPI A;  3GN3 A;  1QK8 A;  2QSI A;  5IOX A;  5A4W A;  4BVX B;  3VPQ A;  3LOR A;  2HZE A;  5DDL A;  1M7T A;  1YF0 A;  3FR6 A;  1WE0 A;  4POK A;  4PNF A;  3C1R A;  3D4T A;  3IOS A;  2KUC A;  4I8B A;  2CAI A;  2V32 A;  1Q4J A;  2NDO A;  5AIS A;  3VI5 A;  5D9W A;  2JL4 A;  5IMA A;  2YOI A;  5G1K A;  3TB2 A;  1TTZ A;  3UMA A;  2MBT A;  3DKS A;  2L59 A;  5H5R A;  1RK4 A;  2GQK A;  5B6N A;  1HNC A;  2GTU A;  4DSQ A;  4K0G A;  2PMT A;  3ZMK A;  2K18 A;  1XBS A;  3LQ7 A;  3IC4 A;  5GAP D;  4HJ2 A;  2L6D A;  4HU9 A;  5JWO B;  2H66 A;  1PX7 A;  17GS A;  5D9T A;  5HFI A;  4QQ7 A;  18GS A;  2H70 A;  2DML A;  4NV2 A;  3WT1 A;  4MLY A;  2FCH A;  3IBH A;  5GSS A;  4IJ3 A;  4V1A p;  3TRQ A;  1PRX A;  5AIX A;  2YV9 A;  5DAL A;  3FZ5 A;  1T8E B;  3BCK A;  3GHA A;  1U88 A;  1SYR A;  4LL1 B;  3E9J B;  2MMA A;  1XPV A;  1IYH A;  4ZB8 A;  1A8Y A;  1PN9 A;  3M8N A;  3KCM A;  4IN0 A;  2LRN A;  3IDV A;  1XOB A;  4LA1 A;  1M0U A;  1XIY A;  3HXS A;  3SBC A;  2V2G A;  1KEB A;  2K8S A;  4IGJ A;  5B8A A;  2Z9S A;  5DJM A;  3F4T A;  1JZW A;  1SKW B;  4ZIJ A;  4ZL9 A;  3G7I A;  4K9Z A;  5AGY A;  2MYG A;  5J41 A;  3HVS A;  10GS A;  3VFI A;  1GUM A;  1GTA A;  3EUR A;  5J3R A;  3D22 A;  5CRE A;  4NWY A;  1XCC A;  4TRX A;  3UIW A;  2OBK A;  2AJQ B;  3J7Y k;  1UN2 A;  5C04 A;  4I97 A;  2LS5 A;  2F8F A;  3DIE A;  2L4C A;  2C0E A;  2HYX A;  22GS A;  1ZYE A;  3W8S A;  5ELA A;  2ES7 A;  2ZNM A;  1FB0 A;  1YKA A;  2XC2 A;  4TXV A;  1TU8 A;  1SJ6 A;  1R5A A;  3D21 A;  3A2X A;  3H79 A;  4ECI A;  2GLR A;  2HNL A;  5ECK B;  2CX3 A;  4I6X A;  1W89 A;  3DEX A;  3QAW A;  2YP6 A;  1K0A A;  1VF2 A;  3BCI A;  4ECJ A;  3GNJ A;  4PTS A;  4LMW A;  2EIO A;  4K8M A;  5CRH A;  3D4M A;  1VF3 A;  4PUA A;  2VCQ A;  4GQC A;  4DSS B;  2VL3 A;  1X0R A;  4MF6 A;  4TXO B;  3IPZ A;  1KBN A;  1K0C A;  3FZ9 A;  3F8U A;  2R37 A;  4MF7 A;  4KAE A;  3RAZ A;  2LTK A;  5F0G A;  1SL2 B;  2TRC P;  1OC9 A;  4BVY A;  3ERF A;  1PA3 A;  2MZC A;  3HZ4 A;  1OC9 B;  5JCG A;  2GST A;  4KB3 A;  4F0C A;  5HQP A;  2DJ1 A;  5LNK e;  2LJR A;  1F37 A;  2B1K A;  4WF5 A;  4K2D A;  3IAS 2;  2VCW A;  3KP9 A;  1UA5 A;  16GS A;  1X5E A;  1OKT A;  2GSS A;  3L0H A;  2H74 A;  2KHP A;  3C1S A;  1NM3 A;  2BJX A;  2X99 A;  1I9D A;  4ID0 A;  2PGT A;  3BD2 A;  2VM1 A;  4USS A;  5J9C A;  3HVV A;  1M2B A;  2CQ9 A;  4MAB A;  2A2S A;  1USB A;  1ACV A;  4YQM A;  6GSV A;  5ID2 A;  2DMM A;  3GL3 A;  1DE1 A;  3EE2 A;  1AUC A;  3EWL A;  2OE1 A;  5ECR B;  1HNB A;  2R6K A;  4FO5 A;  2H75 A;  2JAC A;  4GF0 A;  1ERU A;  3KH7 A;  3IC8 A;  2GVP A;  2E2M A;  4G0I A;  2FUG 2;  3FYG A;  3FZ4 A;  2HFD A;  5CAX A;  1EEJ A;  2PUK C;  1UC7 A;  3WGE A;  3ZRE A;  4KF9 A;  2RUE A;  3P2A A;  2AHE A;  2IIY A;  1ERV A;  2JSY A;  1X9M B;  5G31 A;  1ZL9 A;  3EC3 A;  1VF1 A;  4EDZ A;  3IAM 2;  4MH3 A;  1MTC A;  1PKW A;  4OFM A;  4BL7 A;  2C4J A;  4ZL8 A;  4FYU A;  3BJ5 A;  3FHK A;  5E59 A;  4EKZ A;  1TU7 A;  3RBT A;  2ON7 A;  4IHU A;  3IR4 A;  2VD1 A;  3QDN A;  3WGX A;  4N0V A;  1ZOF A;  2DJK A;  1XWA A;  3N5O A;  1BX9 A;  1JLV A;  3QAG A;  5CNW A;  2HSN B;  2CZ2 A;  1JZO A;  1B4Q A;  3FEU A;  3QMX A;  1H4O A;  1TDI A;  4AJ8 A;  2H0H A;  1R7H A;  2YWM A;  2ZCT A;  1OKD A;  4GQF A;  3GFK A;  1GWC A;  3QOU A;  1VRS D;  5COH A;  5ENU A;  1G6Y A;  2H1G A;  5ECS A;  3ZLP A;  2YJ7 A;  3GYK A;  2NVL A;  2FGX A;  3GL5 A;  2X8G A;  3ZFB A;  2FWH A;  4XCS A;  3EMX A;  4J57 E;  2OJL A;  1FO5 A;  2HI7 A;  1GP1 A;  4K7O A;  2O85 A;  1SU9 A;  1M2A A;  1NSW A;  1XWG A;  2LRT A;  2OKA A;  2MMO A;  4J56 E;  4N11 A;  3D5J A;  4BA7 A;  2F8A A;  4IKH A;  1ABA A;  1XOA A;  3QCP A;  6GSS A;  3HZ8 A;  1XVQ A;  3CRT A;  4TR0 A;  2K8V A;  1A2L A;  3DXB A;  4POB A;  3HD5 A;  2R4V A;  2IJY A;  1MDI A;  5JWQ B;  5DQY A;  3HA9 A;  2FY6 A;  5IMD A;  2H6Z A;  4JRR A;  3ZTL A;  4WR4 A;  3GH9 A;  2K9F A;  3VUR A;  2CAQ A;  3F4R A;  3V1W A;  5BMU A;  1BG5 A;  4RUV A;  4F9Z A;  5HR2 A;  3IV4 A;  2PVO C;  4N0Z A;  4TR1 A;  2I1U A;  3ZIT A;  2HSM B;  4TR3 A;  2WUL A;  1XFL A;  2EIQ A;  3APO A;  5B6M A;  1ZCP A;  3KIJ A;  5JCW A;  3UVH A;  3K8N A;  4ZBB A;  3M0F A;  1WJK A;  1EGR A;  1PKZ A;  3IE3 A;  1HYU A;  4NMU A;  1MEK A;  4KA0 A;  2WZ9 A;  2I9H A;  2QGV A;  4F82 A;  1SL1 B;  1B8X A;  1XW6 A;  5C00 A;  3CSJ A;  2AUV A;  4XS4 A;  2B7K A;  4DVC A;  2P5R A;  3RHB A;  3G7Y A;  2C0D A;  5HR1 A;  1K0B A;  2DC5 A;  3AY8 A;  4ACS A;  4WF4 A;  1H75 A;  1T4Y A;  3GKM A;  3VWW A;  2FA8 A;  1QQ2 A;  3TKS E;  5D73 A;  1TRS A;  2KLX A;  2H1B A;  4Z7X A;  1MDK A;  3FW2 A;  2HQT A;  2G0F A;  4IQ1 A;  2XPD A;  4OD7 A;  2LV3 A;  5HR3 A;  4JBB A;  4ULX A;  4AF2 A;  3MSZ A;  4TR4 A;  1Z7R A;  2YZH A;  3P7X A;  4IP6 A;  2KP1 A;  3RDW A;  4HJM A;  3FY7 A;  3SWL A;  2H19 A;  2VIM A;  3EYT A;  3CTG A;  4KCA A;  3WGD A;  4JU5 A;  3HJP A;  4IJI A;  1M9B A;  6GST A;  1M2D A;  1LBK A;  1O8X A;  4V2L A;  4QL9 A;  1BAY A;  1ST9 A;  2WDU A;  2P31 A;  3KTL A;  4NPB A;  1LJR A;  4TN8 A;  2HZE B;  3ERW A;  3P90 A;  3GX0 A;  1SJI A;  2IMD A;  3LJR A;  2CVB A;  4BWS A;  3CTF A;  3MWH A;  4IQA A;  2QKE A;  4GXZ A;  3FR9 A;  1SJZ A;  1EP8 A;  3KD0 A;  1V2A A;  3HCZ A;  5DAK A;  4ILF A;  3GKX A;  4EO3 A;  5GST A;  2DJ0 A;  4JR4 A;  4GCI A;  4NV5 A;  2B1L A;  7GSS A;  3KGK A;  3OR5 A;  3HY2 A;  4X1U A;  4WKW A;  2HRF A;  1TXX A;  1ILO A;  3KH9 A;  1EOH A;  3LXZ A;  3NZN A;  2X64 A;  1K0M A;  4RQX A;  1J0F A;  1ERT A;  5IM9 A;  4ISD A;  4POL A;  2FA4 A;  4K0N A;  2CVK A;  3IK7 A;  2C3N A;  4CHS A;  3CXG A;  4GRF A;  1F2E A;  4MH2 A;  5DAL B;  1PX6 A;  5ECQ B;  5DCH A;  2FNO A;  4PXO A;  2HRN A;  2X8H A;  1AXD A;  4WBJ A;  1XXU A;  3I43 A;  4WXT A;  1XW5 A;  5IQY A;  2OE3 A;  4OFN A;  3W6G A;  2NPB A;  2YWO A;  2PN8 A;  2MBS A;  5F06 A;  1FVJ A;  3CBU A;  2N5B A;  2YJH A;  2D2Z A;  3R2Q A;  4HUA A;  1YKC A;  1Z6N A;  5EPF A;  4KGI A;  4Q5F A;  1MD4 A;  3A2W A;  4PGT A;  2LST A;  4NXI A;  4QL7 A;  4RI7 A;  2H1A A;  5A4V A;  2OE0 A;  5HFK A;  1O6J A;  3TRX A;  3RHC A;  5ELG A;  2WFC A;  6GSX A;  2F3M A;  3UVT A;  2XPE A;  2XBI A;  4HS1 A;  3GKN A;  5KN0 A;  2FWG A;  2P0G A;  2HRK A;  3ZVJ A;  4EE0 A;  2LQO A;  1F9M A;  5EVO A;  2REM A;  4FYB A;  1KTE A;  2HRK B;  3DGQ A;  2GZP A;  1M99 A;  4TOP A;  2OBI A;  3H8Q A;  2RLI A;  1QGV A;  4V1A g;  3LSZ A;  1GSD A;  1DUG A;  4CDO A;  5F8B A;  1S3D A;  3Q6O A;  1YEX A;  4K7I A;  2OA7 A;  1SEN A;  3GH6 A;  3UL3 A;  1SD8 A;  3QFA C;  4ZB9 A;  3KMO A;  2YCD A;  3EVI A;  3UAP A;  2PBJ A;  4O32 A;  1Z3E A;  3PH9 A;  4HDE A;  2R3X A;  5CYY A;  2H01 A;  3F0I A;  4PX1 A;  2TIR A;  3HDC A;  4YQU A;  1GH2 A;  1S3A A;  1TI1 A;  1Z7P A;  3LYP A;  4E8E A;  5DQS A;  1UVZ A;  4YAP A;  3US3 A;  3FR3 A;  1RQM A;  3NOF A;  3QFB C;  4KND A;  3TKS C;  2CX4 A;  5A4U A;  4BVY B;  9GSS A;  4G9H A;  4XIH A;  5AN1 A;  5IMC A;  2TRX A;  1GNE A;  3PR8 A;  2M46 A;  2BTO T;  1J9B A;  2IN3 A;  4KSM A;  2V6O A;  3GUR A;  1EGO A;  1ML6 A;  4H86 A;  2OAC A;  2J9H A;  1GSE A;  2YWI A;  5AIV A;  1K3Y A;  2XHF A;  4PQ1 A;  5D8I A;  5IO2 A;  2MMZ A;  3GA4 A;  3E0U A;  3GKK A;  2L4Q A;  5ECM B;  1I5G A;  1WRY A;  1XWK A;  2VLV A;  4DSR A;  5CP1 A;  5D96 A;  1EZK A;  2DIZ A;  5CO3 A;  3TJJ A;  1JZD A;  2GGT A;  4MZW A;  5D93 A;  1K3O A;  3F63 A;  1URM A;  3UJ1 A;  5ID2 B;  3DRN A;  2C3Q A;  3GST A;  1TI3 A;  2GT6 A;  1GNW A;  1O73 A;  2BMX A;  4K6X A;  4TVE A;  4WET A;  1G6W A;  1V98 A;  1GSF A;  4HI7 A;  2AYT A;  3LEF A;  3MAK A;  2IME A;  1EWX A;  1XVW A;  4MPG A;  1F3A A;  1K0O A;  2WGR A;  4HEA 2;  4G0L A;  4PNG A;  4L5O A;  5ABR A;  4G10 A;  4KCE A;  3GRX A;  1WMJ A;  5JCU A;  3LWA A;  4MZB A;  3MNG A;  1Y6E A;  4PQH A;  1OAZ A;  1K3L A;  4CW9 A;  2RM6 A;  1T1V A;  4K1F A;  2YZU A;  5G5F A;  2CA8 A;  3KP8 A;  3ZIJ A;  1T00 A;  2LEG A;  3UEM A;  3VPT A;  2H8L A;  4D73 A;  5GZZ B;  3HKR A;  1WP0 A;  4BL7 B;  3WD6 A;  2VLU A;  3LYK A;  4HZ4 A;  3APS A;  5LD0 A;  4JR6 A;  3L4N A;  3TKQ A;  2E2G A;  2HLS A;  4LMV A;  1WWJ A;  1NHY A;  1Z9H A;  5A5K A;  3TRP A;  1OE8 A;  1Z6M A;  4FYC A;  3U6V A;  4WR5 A;  3MDK A;  3ZRD A;  3H4K A;  5IIZ A;  4XS1 A;  1FW1 A;  2M72 A;  5G1L A;  4MJE A;  5KN2 A;  4WBR D;  4OO5 A;  1GLP A;  4JE1 A;  1PL1 A;  4G19 A;  2RII A;  4NHZ A;  2E7P A;  2H30 A;  1FHE A;  3P8W A;  4TKY A;  2FHE A;  2H76 A;  3WT2 A;  2I4A A;  4POM A;  1FVK A;  3E3E A;  2JZT A;  5DVB A;  3TJG A;  2PWJ A;  2DLX A;  4LL4 B;  5G5E A;  5ECO B;  1A8L A;  1BQ7 A;  3ED3 A;  1YJ6 A;  3M3M A;  2H1D A;  3GTU A;  1BJX A;  3ZIV A;  3R3E A;  2R2J A;  5H5S A;  2DJ3 A;  1GTU A;  4G0K A;  6GSU A;  6GSW A;  1G0T A;  1A2J A;  1YEP A;  5CRG A;  4OCE A;  2VL2 A;  2VOC A;  2JSZ A;  4P3Y B;  1NW2 A;  2CT6 A;  3PGT A;  1GUK A;  3EU3 A;  3GX8 A;  4FH8 A;  4KUN A;  2WRT A;  2V1M A;  5EY6 A;  1V57 A;  14GS A;  3J7Y b;  1R4W A;  2N5A A;  4XTS A;  1A24 A;  1E6B A;  4MPF A;  2HSH A;  1SL0 B;  2I81 A;  5B8B A;  2GDR A;  1VGL A;  4Q5N A;  4TR1 B;  1Q98 A;  1KNG A;  2KOK A;  4FQU A;  4L0U A;  5KN3 A;  1OC3 A;  1ZYQ B;  1OYJ A;  3QD9 A;  1M9A A;  1FB6 A;  1A23 A;  1EP7 A;  1GUL A;  4MK3 A;  1O8W A;  4XS4 B;  3HVX A;  2CVD A;  3DD3 A;  3W8J A;  4RI6 A;  1PSQ A;  3D6I A;  2VLT A;  4EXJ A;  1PD2 1;  3JCM L;  1HQO A;  2VL2 C;  3DWV A;  2AB6 A;  1ON4 A;  6GSY A;  2VCZ A;  3A5W A;  5E4W A;  4YAV A;  3M9J A;  2LQQ A;  3CYN A;  4L0W A;  5HFG A;  4IBP A;  4F03 A;  5ECI B;  2H73 A;  3I9V 2;  2F51 A;  3IHQ A;  3O76 A;  3QAV A;  4PQI A;  4F0B A;  3A2V A;  1W4V A;  2O87 A;  2MMN A;  2V6K A;  13GS A;  2HRA A;  5DJL A;  5FT3 A;  5CRW A;  1OVN A;  2VCV A;  3BOA A;  4ZXG A;  3QR6 A;  2IMF A;  1A2M A;  2GS3 A;  1SKR B;  2G2Q A;  5FWG A;  2CZ3 A;  1V58 A;  2DBC A;  5LCZ A;  4GSN A;  4V2N A;  1XZO A;  3G7J A;  3EU4 A;  3KEB A;  4N30 A;  4OFT A;  4BVX A;  5CRD A;  3C8E A;  5KEJ A;  1B4P A;  4HOJ A;  1U3I A;  2GSR A;  1HD2 A;  1GSY A;  2AAW A;  4ECC A;  3ZFL A;  4ZIL A;  1AIU A;  3IXR A;  5D9V A;  1T7P B;  4OO4 A;  1JLW A;  3C73 A;  3HJM A;  3FZA A;  4NHW A;  1YY7 A;  5ECP B;  3VI7 A;  5DAK B;  2H6Y A;  4WEY A;  4I2U A;  4IP1 A;  2UZ8 A;  1TRW A;  3LXT A;  2PU9 C;  2IPA A;  2L5L A;  3VWX A;  2C0F A;  2X8C A;  3ZML A;  3N9J A;  2WJU A;  3PPU A;  5JWR B;  5IMF A;  1GL8 A;  1GTB A;  1GSQ A;  3ZZX A;  4KDY A;  3WYW A;  2JU5 A;  4FIW A;  3GSS A;  1U6T A;  1FOV A;  2C1Y A;  4IW9 A;  3EMP A;  4XHM A;  3L78 A;  4MA9 A;  4GLT A;  4I5Q A;  2V41 A;  4EUY A;  1JZR A;  2JZS A;  1Y25 A;  5FHI A;  3FKF A;  4BPY A;  1B9Y C;  2N5F A;  1A0R P;  4J2F A;  2VO4 A;  1VF4 A;  3KXO A;  5DCG A;  2B7J A;  3DML A;  1AQW A;  2IFQ A;  4HU7 A;  2GQL A;  2LRC A;  2LJA A;  3GMF A;  2IFQ B;  4GTU A;  1MD3 A;  3CSI A;  3RPP A;  1X5D A;  3VLN A;  1SK0 A;  4AJ7 A;  3EIN A;  3F9U A;  1OE7 A;  4JED A;  2LKU A;  2DJJ A;  4X43 A;  5IOW A;  4YH2 A;  1R26 A;  5F07 A;  1DE2 A;  1CQG A;  2GSQ A;  2QC7 A;  3TKS A;  1PGT A;  2FWF A;  1TK0 B;  4NAX A;  3KZQ A;  4MP4 A;  11GS A;  1ZMA A;  2YNX A;  1AC1 A;  1ERW A;  4GST A;  3TCO A;  4PUF C;  3IRA A;  1N2A A;  3F4S A;  4ML6 A;  1TKD B;  4MJC A;  3RPN A;  2DJ2 A;  3F3R A;  4ZL7 A;  4HQS A;  5IMV A;  4XS6 A;  2O89 A;  5J4U A;  1WIK A;  2CV4 A;  1GSU A;  3M9K A;  2EIR A;  3L9V A;  1B9X C;  1F3B A;  1SK2 A;  3L9U A;  3Q19 A;  3HJO A;  4DSS A;  3ZVJ D;  2KP2 A;  4TXO A;  1G7O A;  2C3T A;  1GTI A;  2JAD A;  19GS A;  3M1G A;  3KM6 A;  1XWB A;  3G9B A;  5G30 A;  2EC4 A;  2FWE A;  4MDC A;  3CSH A;  3KJY A;  4K7N A;  2J23 A;  3O3T A;  2FD3 A;  1U3A A;  4O7H A;  1RW1 A;  2L6C A;  3GIX A;  4EDY A;  2NBS A;  2ZUP A;  5ECH B;  1SK1 A;  1A0F A;  2F9S A;  1Z5Y E;  4GWR A;  1X9S B;  4KE3 A;  3A3T A;  2H0I A;  1EV9 A;  2HZF A;  2VUP A;  2XBQ A;  1V40 A;  5IO0 A;  8GSS A;  3NIV A;  4OMV A;  3TJB A;  2B6M A;  2HSY A;  1TRU A;  5G2Z A;  3UBK A;  3U5R E;  1WOU A;  3C7M A;  4F2I A;  1BED A;  5HR0 A;  1FG4 A;  3UOM A;  4V2M A;  5INY A;  1TK8 B;  4L8E A;  3O6T A;  2GZZ A;  4L5L A;  1QUW A;  4RQR A;  4ZBA A;  3GV1 A;  4I2T A;  1S3C A;  1TRV A;  1IYI A;  2H6X A;  2L5O A;  4MJA A;  4Q5Q A;  1YDK A;  2NTO A;  1AQV A;  1EOG A;  4G2E A;  2DSA A;  1TOF A;  4EF0 A;  4KDX A;  1QFN A;  5B7C A;  1B48 A;  1CQH A;  3Q74 A;  2IWT A;  2P5Q A;  2PPT A;  3APQ A;  1BYE A;  5IMZ A;  2RM5 A;  4ZB6 A;  2LUS A;  3TGZ A;  1YZX A;  1LU4 A;  4D73 B;  2O8V B;  1O7U A;  3LGC A;  12GS A;  3BBY A;  1FAA A;  1DBY A;  2GZY A;  3I69 A;  4XRD A;  2GQM A;  3TJK A;  2C80 A;  2IMK A;  4MZC A;  2E0Q A;  1XW9 A;  3VK9 A;  2LNT A;  2LJK A;  1DSB A;  1K0D A;  1GRX A;  1X9W B;  2YV7 A;  2YWN A;  4E8H A;  3CRU A;  3FK8 A;  1G7E A;  4YQV A;  1XWC A;  2B5Y A;  1F6M C;  4TW5 A;  5J9B A;  2AV4 A;  3UBL A;  3LG6 A;  4O5R A;  5H5Q A;  1K0N A;  1V9W A;  3TJF A;  3TUE A;  4EL1 A;  3GUS A;  4DEJ A;  5EL8 A;  1U87 A;  1J08 A;  2HXK A;  2B3S A;  2PVQ A;  2DIY A;  2IMI A;  2VM2 A;  1PMT A;  2HE3 A;  2K6V A;  3PIN A;  4ECB A;  4AJ6 A;  1TW9 A;  1E2Y A;  3H1N A;  2H72 A;  3HYP A;  4MMM A;  1EEM A;  1HNA A;  3GTU B;  3I6A A;  4ZBD A;  3UAR A;  1PQN A;  3TOU A;  4X0X A;  4KSO A;  4HQZ A;  1C72 A;  2VCX A;  2L57 A;  2O7K A;  3ME7 A;  1JFU A;  3IK9 A;  1R5P A;  5F05 A;  4IEL A;  1TJD A;  2VL9 A;  2HT9 A;  4OCF A;  1THO A;  3CMI A;  3ZYW A;  2WCI A;  1ZGN A;  4ML1 A;  2PER A;  1SKS B;  1EV4 A;  3DYR A;  1GUH A;  5IPG A;  2YAN A;  3F6F A;  2YPM A;  1YF1 A;  3ERG A;  4IVF A;  2WB9 A;  3ME8 A;  1T4Z A;  4BWQ A;  2B5X A;  3FRC A;  1MDJ A;  2LNS A;  3L9S A;  1O85 A;  4GSS A;  3HHV A;  2VCT A;  3C71 A;  5KN1 A;  3ISO A;  1QXH A;  2C0G A;  3TDG A;  2HSM A;  3F3Q A;  3ZL5 A;  2VAF A;  2IL3 A;  4KX4 A;  2C8U A;  4MCU A;  2JZR A;  2M80 A;  4O92 A;  5D9X A;  5L71 A;  2VD0 A;  1SD9 A;  1O81 A;  2FLS A;  5ECL B;  3KTB A;  1ZZY A;  4KH7 A;  1NHO A;  3QPM A;  2YN1 A;  4MF5 A;  4LLR A;  1JHB A;  2ALB A;  2WS2 A;  1GSS A;  2RUF A;  1T3B A;  1PL2 A;  4N10 A;  5J5N A; 
#chains in the Genus database with same CATH topology
 1TP9 A;  1QMV A;  3TKR A;  1GLQ A;  2OAD A;  3S9F A;  3TKP A;  2A2R A;  1Y1U A;  5ECN B;  4JZQ A;  2GT5 A;  1TK5 B;  2WW1 A;  1AAZ A;  2A4V A;  3VWU A;  1OC8 A;  4XRA A;  2I3Y A;  2ON5 A;  4HZ2 A;  3F6D A;  4MJB A;  3LFL A;  4AGS A;  3TOT A;  1X5C A;  4PUR A;  4KW6 A;  2B5E A;  2R5G A;  2H71 A;  1AW9 A;  1YQ1 A;  4EVM A;  5IPH A;  3H93 A;  20GS A;  2H0G A;  3KMN A;  3DVX A;  4IS0 A;  5GAN D;  3VWV A;  3D0Z A;  3DVW A;  4KDU A;  4Q5R A;  4K2X A;  1AQX A;  4EC0 A;  1SYX A;  3IA1 A;  4OWY A;  3Q18 A;  5DBQ A;  1THX A;  1N8J A;  1WPI A;  3GN3 A;  1QK8 A;  2QSI A;  5IOX A;  5A4W A;  4BVX B;  4GDF A;  3VPQ A;  3LOR A;  2HZE A;  5DDL A;  1M7T A;  1YF0 A;  3FR6 A;  1WE0 A;  4POK A;  4PNF A;  3C1R A;  3D4T A;  3IOS A;  2KUC A;  4I8B A;  2CAI A;  4FXY P;  2V32 A;  1Q4J A;  2NDO A;  5AIS A;  3VI5 A;  5D9W A;  2JL4 A;  5IMA A;  2YOI A;  5G1K A;  3TB2 A;  1TTZ A;  3UMA A;  2MBT A;  3DKS A;  2L59 A;  5H5R A;  1RK4 A;  2GQK A;  5B6N A;  1HNC A;  1S4B P;  2GTU A;  4DSQ A;  4K0G A;  2PMT A;  3ZMK A;  2K18 A;  1XBS A;  3LQ7 A;  5A5H B;  3IC4 A;  5GAP D;  4HJ2 A;  2L6D A;  4HU9 A;  5JWO B;  2H66 A;  1PX7 A;  17GS A;  5D9T A;  3RGB C;  5HFI A;  4QQ7 A;  18GS A;  2H70 A;  2DML A;  5A1N B;  4NV2 A;  3WT1 A;  4MLY A;  2FCH A;  3IBH A;  5GSS A;  4IJ3 A;  4V1A p;  3TRQ A;  1PRX A;  5AIX A;  2YV9 A;  5DAL A;  3FZ5 A;  1T8E B;  3BCK A;  3GHA A;  1U88 A;  1SYR A;  4LL1 B;  3E9J B;  2MMA A;  1XPV A;  1ZYN A;  1IYH A;  4ZB8 A;  1A8Y A;  1PN9 A;  3M8N A;  3KCM A;  4IN0 A;  2LRN A;  3IDV A;  1XOB A;  2WW0 A;  4LA1 A;  1M0U A;  2O5V A;  1XIY A;  3HXS A;  3SBC A;  3HVN A;  2V2G A;  1KEB A;  1SVO A;  2K8S A;  4IGJ A;  5B8A A;  2Z9S A;  5DJM A;  3F4T A;  4O5Q A;  1JZW A;  1SKW B;  4ZIJ A;  4ZL9 A;  3G7I A;  4K9Z A;  5AGY A;  2MYG A;  5J41 A;  3HVS A;  10GS A;  2O3E A;  3VFI A;  1GUM A;  1GTA A;  3EUR A;  5J3R A;  3D22 A;  5CRE A;  4NWY A;  1XCC A;  4TRX A;  3UIW A;  2OBK A;  2AJQ B;  3J7Y k;  1UN2 A;  5C04 A;  4I97 A;  2LS5 A;  2F8F A;  3DIE A;  2L4C A;  2C0E A;  2HYX A;  22GS A;  1ZYE A;  3W8S A;  5ELA A;  2ES7 A;  2ZNM A;  1FB0 A;  1YKA A;  2XC2 A;  4TXV A;  1TU8 A;  1SJ6 A;  1R5A A;  3D21 A;  3A2X A;  3H79 A;  4ECI A;  2GLR A;  2HNL A;  5ECK B;  2CX3 A;  4I6X A;  1W89 A;  3DEX A;  3QAW A;  2YP6 A;  1K0A A;  1VF2 A;  3BCI A;  4ECJ A;  3GNJ A;  5KOW A;  4PTS A;  4LMW A;  2EIO A;  4K8M A;  5CRH A;  5J47 A;  3D4M A;  1VF3 A;  4PUA A;  2VCQ A;  4GQC A;  4DSS B;  2VL3 A;  1X0R A;  4MF6 A;  4TXO B;  3IPZ A;  1KBN A;  1K0C A;  3FZ9 A;  3F8U A;  2R37 A;  4MF7 A;  4KAE A;  3RAZ A;  2LTK A;  5F0G A;  1SL2 B;  2TRC P;  1OC9 A;  4BVY A;  3ERF A;  1PA3 A;  2MZC A;  3HZ4 A;  1OC9 B;  5JCG A;  2GST A;  2WVX A;  4KB3 A;  4F0C A;  5HQP A;  4AKI A;  2DJ1 A;  5LNK e;  2LJR A;  1F37 A;  2B1K A;  4WF5 A;  4K2D A;  3IAS 2;  2VCW A;  3KP9 A;  1UA5 A;  16GS A;  1X5E A;  1OKT A;  2GSS A;  3L0H A;  2H74 A;  2KHP A;  3C1S A;  1SVL A;  1NM3 A;  2BJX A;  2X99 A;  1I9D A;  4ID0 A;  2PGT A;  3BD2 A;  2VM1 A;  4USS A;  5J9C A;  3HVV A;  1M2B A;  2CQ9 A;  4MAB A;  2A2S A;  1USB A;  1ACV A;  4YQM A;  6GSV A;  5ID2 A;  2DMM A;  3GL3 A;  1DE1 A;  3EE2 A;  1AUC A;  3EWL A;  2OE1 A;  5ECR B;  1HNB A;  2R6K A;  4FO5 A;  2H75 A;  2JAC A;  4GF0 A;  1ERU A;  3KH7 A;  3IC8 A;  2GVP A;  2E2M A;  4G0I A;  2FUG 2;  2X4A A;  3FYG A;  3FZ4 A;  2HFD A;  4A5P A;  5CAX A;  5J40 A;  1EEJ A;  2PUK C;  1UC7 A;  3WGE A;  2EFD A;  3ZRE A;  4KF9 A;  2RUE A;  3P2A A;  2AHE A;  2IIY A;  1ERV A;  2JSY A;  1X9M B;  5G31 A;  3EC3 A;  1ZL9 A;  1VF1 A;  4EDZ A;  3IAM 2;  4MH3 A;  1MTC A;  1PKW A;  4OFM A;  4BL7 A;  2C4J A;  4ZL8 A;  4FYU A;  3BJ5 A;  3FHK A;  5E59 A;  4EKZ A;  1TU7 A;  3RBT A;  2ON7 A;  4IHU A;  3IR4 A;  2VD1 A;  3QDN A;  3WGX A;  4N0V A;  1ZOF A;  2DJK A;  1XWA A;  3N5O A;  1BX9 A;  1JLV A;  3QAG A;  2H1L A;  5CNW A;  2HSN B;  2CZ2 A;  1JZO A;  1B4Q A;  3FEU A;  3QMX A;  1H4O A;  1TDI A;  4AJ8 A;  2H0H A;  1R7H A;  2YWM A;  2ZCT A;  1OKD A;  4GQF A;  3GFK A;  1GWC A;  3QOU A;  1VRS D;  5COH A;  5ENU A;  1G6Y A;  2H1G A;  5ECS A;  3ZLP A;  2YJ7 A;  3GYK A;  2NVL A;  2FGX A;  3GL5 A;  2X8G A;  3ZFB A;  2FWH A;  4XCS A;  3EMX A;  4J57 E;  2OJL A;  3LW9 A;  3MYD A;  1FO5 A;  2HI7 A;  1GP1 A;  4K7O A;  2O85 A;  1SU9 A;  1M2A A;  1NSW A;  1XWG A;  2OT3 A;  2LRT A;  2OKA A;  2MMO A;  4J56 E;  4N11 A;  3D5J A;  4BA7 A;  2F8A A;  4IKH A;  1ABA A;  1XOA A;  3QCP A;  6GSS A;  3HZ8 A;  1XVQ A;  3CRT A;  4TR0 A;  2K8V A;  1A2L A;  3DXB A;  4POB A;  3HD5 A;  2R4V A;  2IJY A;  1MDI A;  5JWQ B;  5DQY A;  3HA9 A;  2FY6 A;  5IMD A;  2H6Z A;  4JRR A;  4ZB7 A;  3ZTL A;  4WR4 A;  3GH9 A;  2K9F A;  3VUR A;  2CAQ A;  3F4R A;  3V1W A;  5BMU A;  1BG5 A;  4RUV A;  4F9Z A;  5HR2 A;  3IV4 A;  2PVO C;  4N0Z A;  4TR1 A;  2I1U A;  3ZIT A;  2HSM B;  4TR3 A;  2WUL A;  1XFL A;  2EIQ A;  3APO A;  5B6M A;  1ZCP A;  3KIJ A;  4PHZ C;  5JCW A;  3UVH A;  3K8N A;  4ZBB A;  3M0F A;  1WJK A;  1EGR A;  1PKZ A;  3IE3 A;  1HYU A;  4NMU A;  1MEK A;  4KA0 A;  2WZ9 A;  2I9H A;  2QGV A;  4F82 A;  1SL1 B;  1B8X A;  1XW6 A;  5C00 A;  3CSJ A;  2AUV A;  4XS4 A;  2B7K A;  4DVC A;  2P5R A;  3RHB A;  3G7Y A;  2C0D A;  5HR1 A;  1K0B A;  2DC5 A;  3AY8 A;  4ACS A;  4WF4 A;  1H75 A;  1T4Y A;  3GKM A;  3VWW A;  2FA8 A;  1QQ2 A;  3TKS E;  5D73 A;  1TRS A;  2KLX A;  2H1B A;  2EFC A;  4Z7X A;  1MDK A;  3FW2 A;  2HQT A;  2G0F A;  4IQ1 A;  2XPD A;  4OD7 A;  2LV3 A;  5HR3 A;  4JBB A;  4ULX A;  4AF2 A;  3MSZ A;  4TR4 A;  1Z7R A;  2YZH A;  3P7X A;  4IP6 A;  2KP1 A;  3RDW A;  3MIX A;  4HJM A;  3FY7 A;  3SWL A;  2H19 A;  2VIM A;  3EYT A;  3CTG A;  3IHG A;  4KCA A;  3WGD A;  4JU5 A;  3HJP A;  4IJI A;  1M9B A;  6GST A;  1M2D A;  1LBK A;  1O8X A;  4V2L A;  4QL9 A;  1BAY A;  3TU3 B;  1ST9 A;  2WDU A;  2P31 A;  3KTL A;  4NPB A;  1LJR A;  4TN8 A;  2HZE B;  3ERW A;  3P90 A;  3GX0 A;  1SJI A;  2IMD A;  4PI0 C;  3LJR A;  2CVB A;  4BWS A;  3CTF A;  3MWH A;  4IQA A;  2QKE A;  4GXZ A;  3FR9 A;  1SJZ A;  1EP8 A;  3KD0 A;  1V2A A;  3HCZ A;  5DAK A;  4ILF A;  3GKX A;  4EO3 A;  5GST A;  2DJ0 A;  1FOH A;  4JR4 A;  4GCI A;  4NV5 A;  2B1L A;  7GSS A;  3KGK A;  3OR5 A;  3HY2 A;  4X1U A;  4WKW A;  2HRF A;  1TXX A;  1ILO A;  3KH9 A;  1EOH A;  3LXZ A;  1ZYP A;  3NZN A;  2X64 A;  2R0G A;  1K0M A;  4RQX A;  1J0F A;  1ERT A;  5IM9 A;  4ISD A;  4POL A;  2FA4 A;  4K0N A;  2CVK A;  3IK7 A;  2C3N A;  4CHS A;  3CXG A;  4GRF A;  1F2E A;  4MH2 A;  5DAL B;  1PX6 A;  5ECQ B;  5DCH A;  2FNO A;  4PXO A;  2HRN A;  2X8H A;  1AXD A;  4WBJ A;  1XXU A;  3I43 A;  4WXT A;  4AKH A;  1XW5 A;  5IQY A;  2OE3 A;  4OFN A;  3W6G A;  2NPB A;  2YWO A;  2PN8 A;  2MBS A;  5F06 A;  1FVJ A;  3CBU A;  2N5B A;  2YJH A;  2D2Z A;  3R2Q A;  4HUA A;  1YKC A;  1Z6N A;  5EPF A;  4KGI A;  4Q5F A;  1MD4 A;  4AKX B;  3A2W A;  4K5S A;  4PGT A;  2LST A;  4NXI A;  4QL7 A;  4RI7 A;  2H1A A;  5A4V A;  2OE0 A;  5HFK A;  1O6J A;  3TRX A;  3RHC A;  5ELG A;  2WFC A;  6GSX A;  2F3M A;  3UVT A;  2XPE A;  2XBI A;  4HS1 A;  3GKN A;  5KN0 A;  2FWG A;  2P0G A;  2HRK A;  3ZVJ A;  4EE0 A;  2LQO A;  1F9M A;  5EVO A;  2REM A;  4FYB A;  4YKF A;  1KTE A;  2HRK B;  3DGQ A;  2GZP A;  1M99 A;  5J4V A;  4TOP A;  3RFR C;  2OBI A;  3H8Q A;  2RLI A;  1QGV A;  4V1A g;  3LSZ A;  4EIP A;  2R0P A;  1GSD A;  1DUG A;  4CDO A;  5F8B A;  1S3D A;  3Q6O A;  1YEX A;  4K7I A;  2OA7 A;  1SEN A;  3GH6 A;  3UL3 A;  1SD8 A;  3QFA C;  4ZB9 A;  3KMO A;  2YCD A;  3EVI A;  2O36 A;  3UAP A;  2PBJ A;  4O32 A;  1Z3E A;  3PH9 A;  4HDE A;  2R3X A;  2QA2 A;  5CYY A;  2H01 A;  3F0I A;  4PX1 A;  2TIR A;  3HDC A;  4YQU A;  1GH2 A;  1S3A A;  1TI1 A;  1Z7P A;  3LYP A;  4E8E A;  5DQS A;  1UVZ A;  4YAP A;  3US3 A;  3FR3 A;  1RQM A;  3NOF A;  3QFB C;  4KND A;  3TKS C;  2CX4 A;  5A4U A;  4BVY B;  9GSS A;  4G9H A;  4XIH A;  5AN1 A;  5IMC A;  2WVX B;  2TRX A;  1GNE A;  3PR8 A;  2M46 A;  2BTO T;  1J9B A;  2IN3 A;  4KSM A;  2V6O A;  3GUR A;  1EGO A;  1ML6 A;  4H86 A;  2OAC A;  2J9H A;  1GSE A;  2YWI A;  5AIV A;  1K3Y A;  3HMJ G;  2XHF A;  4PQ1 A;  5D8I A;  5IO2 A;  2MMZ A;  3GA4 A;  3E0U A;  3GKK A;  4CY6 A;  2L4Q A;  5ECM B;  1I5G A;  1WRY A;  1XWK A;  2VLV A;  4DSR A;  5CP1 A;  5D96 A;  1EZK A;  2DIZ A;  5CO3 A;  3TJJ A;  1JZD A;  2GGT A;  4MZW A;  5D93 A;  1K3O A;  3F63 A;  1URM A;  3UJ1 A;  5ID2 B;  3DRN A;  2C3Q A;  3GST A;  1TI3 A;  2GT6 A;  1GNW A;  1O73 A;  2BMX A;  2X49 A;  4K6X A;  4TVE A;  4WET A;  1G6W A;  1V98 A;  1GSF A;  4HI7 A;  2AYT A;  3LEF A;  3MAK A;  2IME A;  1EWX A;  1XVW A;  4MPG A;  1F3A A;  1K0O A;  2WGR A;  4HEA 2;  4YKG A;  4G0L A;  4PNG A;  3CHX C;  4L5O A;  5ABR A;  4G10 A;  4KCE A;  3GRX A;  1WMJ A;  5JCU A;  3LWA A;  4MZB A;  3MNG A;  1Y6E A;  4PQH A;  4E68 A;  1OAZ A;  1K3L A;  4CW9 A;  2RM6 A;  1T1V A;  4K1F A;  2YZU A;  5G5F A;  2CA8 A;  3KP8 A;  3ZIJ A;  1T00 A;  2LEG A;  3UEM A;  3VPT A;  2H8L A;  4D73 A;  5GZZ B;  3HKR A;  1WP0 A;  4BL7 B;  3WD6 A;  2VLU A;  3LYK A;  4HZ4 A;  3APS A;  5LD0 A;  3CQF A;  4JR6 A;  3L4N A;  3TKQ A;  2E2G A;  2HLS A;  4LMV A;  1WWJ A;  1YEW C;  1NHY A;  1Z9H A;  5A5K A;  3TRP A;  1OE8 A;  1Z6M A;  4FYC A;  3U6V A;  4WR5 A;  3MDK A;  3ZRD A;  3H4K A;  5IIZ A;  4XS1 A;  1FW1 A;  2M72 A;  2QA1 A;  5G1L A;  4MJE A;  5KN2 A;  4WBR D;  4OO5 A;  1GLP A;  4JE1 A;  1PL1 A;  4G19 A;  2RII A;  4NHZ A;  2E7P A;  2H30 A;  1FHE A;  2WVY A;  3P8W A;  4TKY A;  5A34 A;  2FHE A;  2H76 A;  3WT2 A;  2I4A A;  4POM A;  5A34 B;  1FVK A;  3E3E A;  2JZT A;  5DVB A;  2EFE A;  3TJG A;  2PWJ A;  2DLX A;  4LL4 B;  5G5E A;  5ECO B;  1A8L A;  1BQ7 A;  3ED3 A;  1YJ6 A;  3M3M A;  2H1D A;  3GTU A;  1BJX A;  3ZIV A;  3R3E A;  2R2J A;  5H5S A;  2DJ3 A;  1GTU A;  4G0K A;  6GSU A;  6GSW A;  1G0T A;  1A2J A;  4QMK A;  1YEP A;  5CRG A;  4OCE A;  2VL2 A;  2VOC A;  2JSZ A;  4P3Y B;  1NW2 A;  2CT6 A;  4BIK A;  3PGT A;  1GUK A;  3EU3 A;  3GX8 A;  4FH8 A;  4KUN A;  2WRT A;  2V1M A;  5EY6 A;  1V57 A;  14GS A;  1PN0 A;  3J7Y b;  1R4W A;  2N5A A;  4XTS A;  1A24 A;  1E6B A;  4MPF A;  2HSH A;  1SL0 B;  4AKG A;  2I81 A;  4PI2 C;  5B8B A;  5BMU B;  2GDR A;  4AI6 A;  1VGL A;  4Q5N A;  4TR1 B;  1Q98 A;  1KNG A;  2KOK A;  4FQU A;  4L0U A;  5KN3 A;  1OC3 A;  1ZYQ B;  1OYJ A;  3QD9 A;  2WW3 A;  1M9A A;  1FB6 A;  1A23 A;  1EP7 A;  1GUL A;  4MK3 A;  1O8W A;  4XS4 B;  3HVX A;  2CVD A;  3DD3 A;  3W8J A;  4RI6 A;  1PSQ A;  3D6I A;  2VLT A;  4EXJ A;  1PD2 1;  3JCM L;  1HQO A;  2VL2 C;  3DWV A;  2AB6 A;  1ON4 A;  6GSY A;  2VCZ A;  3A5W A;  5E4W A;  4YAV A;  3M9J A;  2LQQ A;  3CYN A;  4L0W A;  5HFG A;  4IBP A;  4F03 A;  5ECI B;  2H73 A;  3I9V 2;  2F51 A;  3IHQ A;  3O76 A;  3QAV A;  4PQI A;  4F0B A;  3A2V A;  1W4V A;  2O87 A;  2MMN A;  2V6K A;  13GS A;  2HRA A;  5DJL A;  5FT3 A;  5CRW A;  1OVN A;  2VCV A;  3BOA A;  4ZXG A;  3QR6 A;  2VKZ G;  2IMF A;  1A2M A;  2GS3 A;  1SKR B;  2G2Q A;  4K5R A;  5FWG A;  2CZ3 A;  1V58 A;  2DBC A;  5LCZ A;  4GSN A;  4V2N A;  1XZO A;  3G7J A;  3EU4 A;  3KEB A;  4N30 A;  4Z2T A;  5KOX A;  4OFT A;  1TXU A;  4BVX A;  5CRD A;  3C8E A;  5KEJ A;  1B4P A;  4HOJ A;  1U3I A;  2GSR A;  1HD2 A;  1GSY A;  2AAW A;  4ECC A;  3ZFL A;  4ZIL A;  1AIU A;  3IXR A;  5D9V A;  1T7P B;  4OO4 A;  1JLW A;  3C73 A;  2DKH A;  3HJM A;  3FZA A;  4NHW A;  1YY7 A;  5ECP B;  3VI7 A;  5DAK B;  2H6Y A;  4WEY A;  4I2U A;  4IP1 A;  2UZ8 A;  1TRW A;  3LXT A;  2PU9 C;  5A5H A;  2IPA A;  3FMW A;  2L5L A;  3VWX A;  2C0F A;  4N3Z A;  2X8C A;  3ZML A;  3N9J A;  2WJU A;  3PPU A;  5JWR B;  2A4H A;  5IMF A;  1GL8 A;  1GTB A;  1GSQ A;  3ZZX A;  4KDY A;  3WYW A;  2JU5 A;  4FIW A;  3GSS A;  1U6T A;  5A1N A;  1FOV A;  2C1Y A;  4IW9 A;  3EMP A;  4XHM A;  3L78 A;  4MA9 A;  4GLT A;  4I5Q A;  2V41 A;  4EUY A;  1JZR A;  2JZS A;  1Y25 A;  5FHI A;  3FKF A;  4BPY A;  1B9Y C;  2N5F A;  1A0R P;  4J2F A;  2VO4 A;  1VF4 A;  3KXO A;  5DCG A;  2B7J A;  3DML A;  1AQW A;  2IFQ A;  4HU7 A;  2GQL A;  2LRC A;  2LJA A;  3GMF A;  2IFQ B;  4GTU A;  1MD3 A;  3CSI A;  1N25 A;  3RPP A;  1X5D A;  3VLN A;  1SK0 A;  4AJ7 A;  3EIN A;  3F9U A;  1OE7 A;  4JED A;  2LKU A;  2DJJ A;  4X43 A;  1SVM A;  5IOW A;  1M3I A;  4YH2 A;  1R26 A;  5F07 A;  1DE2 A;  1CQG A;  2GSQ A;  2QC7 A;  3TKS A;  1PGT A;  2FWF A;  1TK0 B;  4NAX A;  3KZQ A;  4MP4 A;  11GS A;  1ZMA A;  2YNX A;  1AC1 A;  1ERW A;  4GST A;  3TCO A;  4PUF C;  3IRA A;  1N2A A;  3F4S A;  4ML6 A;  1TKD B;  4MJC A;  3RPN A;  2DJ2 A;  3F3R A;  4ZL7 A;  4HQS A;  5IMV A;  4XS6 A;  2O89 A;  5J4U A;  1WIK A;  3CWG A;  2CV4 A;  1GSU A;  3M9K A;  2EIR A;  3L9V A;  1B9X C;  1F3B A;  1SK2 A;  1I1I P;  3L9U A;  3Q19 A;  3HJO A;  4DSS A;  3ZVJ D;  2KP2 A;  4TXO A;  1G7O A;  2C3T A;  4O5U A;  1GTI A;  2JAD A;  19GS A;  3M1G A;  4MNN A;  3KM6 A;  1XWB A;  3G9B A;  5G30 A;  2EC4 A;  2FWE A;  4MDC A;  1XG8 A;  3CSH A;  3KJY A;  4K7N A;  2J23 A;  3O3T A;  2FD3 A;  1U3A A;  4O7H A;  1RW1 A;  2L6C A;  3GIX A;  4EDY A;  2NBS A;  2ZUP A;  5ECH B;  1SK1 A;  1A0F A;  2F9S A;  1Z5Y E;  4GWR A;  1X9S B;  4KE3 A;  3A3T A;  2H0I A;  1EV9 A;  1BG1 A;  2HZF A;  2VUP A;  2XBQ A;  1V40 A;  5IO0 A;  8GSS A;  2WW2 A;  3NIV A;  4OMV A;  5BRT A;  3TJB A;  2B6M A;  2HSY A;  1TRU A;  5G2Z A;  3UBK A;  3U5R E;  1WOU A;  4X4J A;  3C7M A;  4F2I A;  3A5I A;  1BED A;  5HR0 A;  1FG4 A;  3UOM A;  4V2M A;  5INY A;  4Z2U A;  1TK8 B;  4L8E A;  3O6T A;  2WZS A;  2GZZ A;  1S3R A;  3EPT A;  4L5L A;  1QUW A;  4RQR A;  4ZBA A;  3GV1 A;  4I2T A;  1S3C A;  1TRV A;  1IYI A;  2H6X A;  2L5O A;  4MJA A;  4Q5Q A;  1YDK A;  2NTO A;  1AQV A;  1EOG A;  4G2E A;  2DSA A;  2WVZ A;  1TOF A;  4EF0 A;  4KDX A;  1QFN A;  5B7C A;  1B48 A;  1CQH A;  3Q74 A;  2IWT A;  2P5Q A;  2PPT A;  3APQ A;  1BYE A;  5IMZ A;  2RM5 A;  4ZB6 A;  2LUS A;  3TGZ A;  1YZX A;  1LU4 A;  4D73 B;  4W66 A;  2O8V B;  1O7U A;  3LGC A;  12GS A;  3BBY A;  1FAA A;  4CY8 A;  1DBY A;  2GZY A;  3I69 A;  4XRD A;  2GQM A;  3TJK A;  4ICY A;  2C80 A;  4EIQ A;  2IMK A;  4MZC A;  2E0Q A;  1XW9 A;  3VK9 A;  2LNT A;  2LJK A;  1DSB A;  1K0D A;  1GRX A;  1X9W B;  2YV7 A;  2YWN A;  4E8H A;  3CRU A;  2UV8 G;  3FK8 A;  1G7E A;  4YQV A;  1XWC A;  2B5Y A;  2HSN A;  1F6M C;  4TW5 A;  5J9B A;  2AV4 A;  3UBL A;  3LG6 A;  4O5R A;  5H5Q A;  1K0N A;  1M3J A;  1BF5 A;  1V9W A;  3TJF A;  3TUE A;  4EL1 A;  3GUS A;  4DEJ A;  5EL8 A;  4HSC X;  1U87 A;  1J08 A;  2HXK A;  2B3S A;  2PVQ A;  2DIY A;  2IMI A;  2VM2 A;  1PMT A;  2HE3 A;  2K6V A;  3PIN A;  4ECB A;  4AJ6 A;  1TW9 A;  1E2Y A;  3H1N A;  2H72 A;  3HYP A;  4MMM A;  1YVL A;  1EEM A;  1HNA A;  3GTU B;  3I6A A;  4ZBD A;  3UAR A;  1PQN A;  3TOU A;  4X0X A;  4KSO A;  2R0C A;  5J4Y A;  4HQZ A;  1C72 A;  2VCX A;  4Z2R A;  2L57 A;  2O7K A;  3ME7 A;  1JFU A;  3IK9 A;  1R5P A;  5F05 A;  4IEL A;  1TJD A;  2VL9 A;  2HT9 A;  4OCF A;  1THO A;  3CMI A;  3ZYW A;  2WCI A;  1ZGN A;  4ML1 A;  2PER A;  1SKS B;  1EV4 A;  3DYR A;  1GUH A;  5IPG A;  2YAN A;  3F6F A;  2YPM A;  1YF1 A;  3ERG A;  4IVF A;  2WB9 A;  3ME8 A;  1T4Z A;  4BWQ A;  2B5X A;  3FRC A;  1MDJ A;  2LNS A;  3L9S A;  1O85 A;  4GSS A;  3HHV A;  2VCT A;  3C71 A;  2DKI A;  5KN1 A;  3ISO A;  1QXH A;  2C0G A;  3TDG A;  2HSM A;  3F3Q A;  3ZL5 A;  2VAF A;  2IL3 A;  2EFH A;  4KX4 A;  2C8U A;  4MCU A;  2JZR A;  2M80 A;  4O92 A;  5D9X A;  5L71 A;  2VD0 A;  1SD9 A;  1O81 A;  2FLS A;  5ECL B;  3KTB A;  1ZZY A;  4KH7 A;  1NHO A;  1PFO A;  3QPM A;  2YN1 A;  4MF5 A;  4G01 A;  4LLR A;  2A2P A;  1JHB A;  2ALB A;  2WS2 A;  1GSS A;  2RUF A;  1T3B A;  1PL2 A;  4N10 A;  5J5N A; 
#chains in the Genus database with same CATH homology
 1TP9 A;  1QMV A;  3TKR A;  1GLQ A;  2OAD A;  3S9F A;  3TKP A;  2A2R A;  1Y1U A;  5ECN B;  4JZQ A;  2GT5 A;  1TK5 B;  1AAZ A;  2A4V A;  3VWU A;  1OC8 A;  4XRA A;  2I3Y A;  2ON5 A;  4HZ2 A;  3F6D A;  4MJB A;  3LFL A;  4AGS A;  3TOT A;  1X5C A;  4PUR A;  4KW6 A;  2B5E A;  2R5G A;  2H71 A;  1AW9 A;  1YQ1 A;  4EVM A;  5IPH A;  3H93 A;  20GS A;  2H0G A;  3KMN A;  3DVX A;  4IS0 A;  5GAN D;  3VWV A;  3D0Z A;  3DVW A;  4KDU A;  4Q5R A;  4K2X A;  1AQX A;  4EC0 A;  1SYX A;  3IA1 A;  4OWY A;  3Q18 A;  5DBQ A;  1THX A;  1N8J A;  1WPI A;  3GN3 A;  1QK8 A;  2QSI A;  5IOX A;  5A4W A;  4BVX B;  4GDF A;  3VPQ A;  3LOR A;  2HZE A;  5DDL A;  1M7T A;  1YF0 A;  3FR6 A;  1WE0 A;  4POK A;  4PNF A;  3C1R A;  3D4T A;  3IOS A;  2KUC A;  4I8B A;  2CAI A;  2V32 A;  1Q4J A;  2NDO A;  5AIS A;  3VI5 A;  5D9W A;  2JL4 A;  5IMA A;  2YOI A;  5G1K A;  3TB2 A;  1TTZ A;  3UMA A;  2MBT A;  3DKS A;  2L59 A;  5H5R A;  1RK4 A;  2GQK A;  5B6N A;  1HNC A;  2GTU A;  4DSQ A;  4K0G A;  2PMT A;  3ZMK A;  2K18 A;  1XBS A;  3LQ7 A;  5A5H B;  3IC4 A;  5GAP D;  4HJ2 A;  2L6D A;  4HU9 A;  5JWO B;  2H66 A;  1PX7 A;  17GS A;  5D9T A;  5HFI A;  4QQ7 A;  18GS A;  2H70 A;  2DML A;  5A1N B;  4NV2 A;  3WT1 A;  4MLY A;  2FCH A;  3IBH A;  5GSS A;  4IJ3 A;  4V1A p;  3TRQ A;  1PRX A;  5AIX A;  2YV9 A;  5DAL A;  3FZ5 A;  1T8E B;  3BCK A;  3GHA A;  1U88 A;  1SYR A;  4LL1 B;  3E9J B;  2MMA A;  1XPV A;  1ZYN A;  1IYH A;  4ZB8 A;  1A8Y A;  1PN9 A;  3M8N A;  3KCM A;  4IN0 A;  2LRN A;  3IDV A;  1XOB A;  4LA1 A;  1M0U A;  2O5V A;  1XIY A;  3HXS A;  3SBC A;  2V2G A;  1KEB A;  1SVO A;  2K8S A;  4IGJ A;  5B8A A;  2Z9S A;  5DJM A;  3F4T A;  4O5Q A;  1JZW A;  1SKW B;  4ZIJ A;  4ZL9 A;  3G7I A;  4K9Z A;  5AGY A;  2MYG A;  5J41 A;  3HVS A;  10GS A;  3VFI A;  1GUM A;  1GTA A;  3EUR A;  5J3R A;  3D22 A;  5CRE A;  4NWY A;  1XCC A;  4TRX A;  3UIW A;  2OBK A;  2AJQ B;  3J7Y k;  1UN2 A;  5C04 A;  4I97 A;  2LS5 A;  2F8F A;  3DIE A;  2L4C A;  2C0E A;  2HYX A;  22GS A;  1ZYE A;  3W8S A;  5ELA A;  2ES7 A;  2ZNM A;  1FB0 A;  1YKA A;  2XC2 A;  4TXV A;  1TU8 A;  1SJ6 A;  1R5A A;  3D21 A;  3A2X A;  3H79 A;  4ECI A;  2GLR A;  2HNL A;  5ECK B;  2CX3 A;  4I6X A;  1W89 A;  3DEX A;  3QAW A;  2YP6 A;  1K0A A;  1VF2 A;  3BCI A;  4ECJ A;  3GNJ A;  5KOW A;  4PTS A;  4LMW A;  2EIO A;  4K8M A;  5CRH A;  5J47 A;  3D4M A;  1VF3 A;  4PUA A;  2VCQ A;  4GQC A;  4DSS B;  2VL3 A;  1X0R A;  4MF6 A;  4TXO B;  3IPZ A;  1KBN A;  1K0C A;  3FZ9 A;  3F8U A;  2R37 A;  4MF7 A;  4KAE A;  3RAZ A;  2LTK A;  5F0G A;  1SL2 B;  2TRC P;  1OC9 A;  4BVY A;  3ERF A;  1PA3 A;  2MZC A;  3HZ4 A;  1OC9 B;  5JCG A;  2GST A;  4KB3 A;  4F0C A;  5HQP A;  4AKI A;  2DJ1 A;  5LNK e;  2LJR A;  1F37 A;  2B1K A;  4WF5 A;  4K2D A;  3IAS 2;  2VCW A;  3KP9 A;  1UA5 A;  16GS A;  1X5E A;  1OKT A;  2GSS A;  3L0H A;  2H74 A;  2KHP A;  3C1S A;  1SVL A;  1NM3 A;  2BJX A;  2X99 A;  1I9D A;  4ID0 A;  2PGT A;  3BD2 A;  2VM1 A;  4USS A;  5J9C A;  3HVV A;  1M2B A;  2CQ9 A;  4MAB A;  2A2S A;  1USB A;  1ACV A;  4YQM A;  6GSV A;  5ID2 A;  2DMM A;  3GL3 A;  1DE1 A;  3EE2 A;  1AUC A;  3EWL A;  2OE1 A;  5ECR B;  1HNB A;  2R6K A;  4FO5 A;  2H75 A;  2JAC A;  4GF0 A;  1ERU A;  3KH7 A;  3IC8 A;  2GVP A;  2E2M A;  4G0I A;  2FUG 2;  2X4A A;  3FYG A;  3FZ4 A;  2HFD A;  4A5P A;  5CAX A;  5J40 A;  1EEJ A;  2PUK C;  1UC7 A;  3WGE A;  2EFD A;  3ZRE A;  4KF9 A;  2RUE A;  3P2A A;  2AHE A;  2IIY A;  1ERV A;  2JSY A;  1X9M B;  5G31 A;  3EC3 A;  1ZL9 A;  1VF1 A;  4EDZ A;  3IAM 2;  4MH3 A;  1MTC A;  1PKW A;  4OFM A;  4BL7 A;  2C4J A;  4ZL8 A;  4FYU A;  3BJ5 A;  3FHK A;  5E59 A;  4EKZ A;  1TU7 A;  3RBT A;  2ON7 A;  4IHU A;  3IR4 A;  2VD1 A;  3QDN A;  3WGX A;  4N0V A;  1ZOF A;  2DJK A;  1XWA A;  3N5O A;  1BX9 A;  1JLV A;  3QAG A;  2H1L A;  5CNW A;  2HSN B;  2CZ2 A;  1JZO A;  1B4Q A;  3FEU A;  3QMX A;  1H4O A;  1TDI A;  4AJ8 A;  2H0H A;  1R7H A;  2YWM A;  2ZCT A;  1OKD A;  4GQF A;  3GFK A;  1GWC A;  3QOU A;  1VRS D;  5COH A;  5ENU A;  1G6Y A;  2H1G A;  5ECS A;  3ZLP A;  2YJ7 A;  3GYK A;  2NVL A;  2FGX A;  3GL5 A;  2X8G A;  3ZFB A;  2FWH A;  4XCS A;  3EMX A;  4J57 E;  2OJL A;  3LW9 A;  3MYD A;  1FO5 A;  2HI7 A;  1GP1 A;  4K7O A;  2O85 A;  1SU9 A;  1M2A A;  1NSW A;  1XWG A;  2OT3 A;  2LRT A;  2OKA A;  2MMO A;  4J56 E;  4N11 A;  3D5J A;  4BA7 A;  2F8A A;  4IKH A;  1ABA A;  1XOA A;  3QCP A;  6GSS A;  3HZ8 A;  1XVQ A;  3CRT A;  4TR0 A;  2K8V A;  1A2L A;  3DXB A;  4POB A;  3HD5 A;  2R4V A;  2IJY A;  1MDI A;  5JWQ B;  5DQY A;  3HA9 A;  2FY6 A;  5IMD A;  2H6Z A;  4JRR A;  4ZB7 A;  3ZTL A;  4WR4 A;  3GH9 A;  2K9F A;  3VUR A;  2CAQ A;  3F4R A;  3V1W A;  5BMU A;  1BG5 A;  4RUV A;  4F9Z A;  5HR2 A;  3IV4 A;  2PVO C;  4N0Z A;  4TR1 A;  2I1U A;  3ZIT A;  2HSM B;  4TR3 A;  2WUL A;  1XFL A;  2EIQ A;  3APO A;  5B6M A;  1ZCP A;  3KIJ A;  5JCW A;  3UVH A;  3K8N A;  4ZBB A;  3M0F A;  1WJK A;  1EGR A;  1PKZ A;  3IE3 A;  1HYU A;  4NMU A;  1MEK A;  4KA0 A;  2WZ9 A;  2I9H A;  2QGV A;  4F82 A;  1SL1 B;  1B8X A;  1XW6 A;  5C00 A;  3CSJ A;  2AUV A;  4XS4 A;  2B7K A;  4DVC A;  2P5R A;  3RHB A;  3G7Y A;  2C0D A;  5HR1 A;  1K0B A;  2DC5 A;  3AY8 A;  4ACS A;  4WF4 A;  1H75 A;  1T4Y A;  3GKM A;  3VWW A;  2FA8 A;  1QQ2 A;  3TKS E;  5D73 A;  1TRS A;  2KLX A;  2H1B A;  2EFC A;  4Z7X A;  1MDK A;  3FW2 A;  2HQT A;  2G0F A;  4IQ1 A;  2XPD A;  4OD7 A;  2LV3 A;  5HR3 A;  4JBB A;  4ULX A;  4AF2 A;  3MSZ A;  4TR4 A;  1Z7R A;  2YZH A;  3P7X A;  4IP6 A;  2KP1 A;  3RDW A;  3MIX A;  4HJM A;  3FY7 A;  3SWL A;  2H19 A;  2VIM A;  3EYT A;  3CTG A;  3IHG A;  4KCA A;  3WGD A;  4JU5 A;  3HJP A;  4IJI A;  1M9B A;  6GST A;  1M2D A;  1LBK A;  1O8X A;  4V2L A;  4QL9 A;  1BAY A;  3TU3 B;  1ST9 A;  2WDU A;  2P31 A;  3KTL A;  4NPB A;  1LJR A;  4TN8 A;  2HZE B;  3ERW A;  3P90 A;  3GX0 A;  1SJI A;  2IMD A;  3LJR A;  2CVB A;  4BWS A;  3CTF A;  3MWH A;  4IQA A;  2QKE A;  4GXZ A;  3FR9 A;  1SJZ A;  1EP8 A;  3KD0 A;  1V2A A;  3HCZ A;  5DAK A;  4ILF A;  3GKX A;  4EO3 A;  5GST A;  2DJ0 A;  1FOH A;  4JR4 A;  4GCI A;  4NV5 A;  2B1L A;  7GSS A;  3KGK A;  3OR5 A;  3HY2 A;  4X1U A;  4WKW A;  2HRF A;  1TXX A;  1ILO A;  3KH9 A;  1EOH A;  3LXZ A;  1ZYP A;  3NZN A;  2X64 A;  2R0G A;  1K0M A;  4RQX A;  1J0F A;  1ERT A;  5IM9 A;  4ISD A;  4POL A;  2FA4 A;  4K0N A;  2CVK A;  3IK7 A;  2C3N A;  4CHS A;  3CXG A;  4GRF A;  1F2E A;  4MH2 A;  5DAL B;  1PX6 A;  5ECQ B;  5DCH A;  2FNO A;  4PXO A;  2HRN A;  2X8H A;  1AXD A;  4WBJ A;  1XXU A;  3I43 A;  4WXT A;  4AKH A;  1XW5 A;  5IQY A;  2OE3 A;  4OFN A;  3W6G A;  2NPB A;  2YWO A;  2PN8 A;  2MBS A;  5F06 A;  1FVJ A;  3CBU A;  2N5B A;  2YJH A;  2D2Z A;  3R2Q A;  4HUA A;  1YKC A;  1Z6N A;  5EPF A;  4KGI A;  4Q5F A;  1MD4 A;  4AKX B;  3A2W A;  4K5S A;  4PGT A;  2LST A;  4NXI A;  4QL7 A;  4RI7 A;  2H1A A;  5A4V A;  2OE0 A;  5HFK A;  1O6J A;  3TRX A;  3RHC A;  5ELG A;  2WFC A;  6GSX A;  2F3M A;  3UVT A;  2XPE A;  2XBI A;  4HS1 A;  3GKN A;  5KN0 A;  2FWG A;  2P0G A;  2HRK A;  3ZVJ A;  4EE0 A;  2LQO A;  1F9M A;  5EVO A;  2REM A;  4FYB A;  4YKF A;  1KTE A;  2HRK B;  3DGQ A;  2GZP A;  1M99 A;  5J4V A;  4TOP A;  2OBI A;  3H8Q A;  2RLI A;  1QGV A;  4V1A g;  3LSZ A;  4EIP A;  2R0P A;  1GSD A;  1DUG A;  4CDO A;  5F8B A;  1S3D A;  3Q6O A;  1YEX A;  4K7I A;  2OA7 A;  1SEN A;  3GH6 A;  3UL3 A;  1SD8 A;  3QFA C;  4ZB9 A;  3KMO A;  2YCD A;  3EVI A;  3UAP A;  2PBJ A;  4O32 A;  1Z3E A;  3PH9 A;  4HDE A;  2R3X A;  2QA2 A;  5CYY A;  2H01 A;  3F0I A;  4PX1 A;  2TIR A;  3HDC A;  4YQU A;  1GH2 A;  1S3A A;  1TI1 A;  1Z7P A;  3LYP A;  4E8E A;  5DQS A;  1UVZ A;  4YAP A;  3US3 A;  3FR3 A;  1RQM A;  3NOF A;  3QFB C;  4KND A;  3TKS C;  2CX4 A;  5A4U A;  4BVY B;  9GSS A;  4G9H A;  4XIH A;  5AN1 A;  5IMC A;  2TRX A;  1GNE A;  3PR8 A;  2M46 A;  2BTO T;  1J9B A;  2IN3 A;  4KSM A;  2V6O A;  3GUR A;  1EGO A;  1ML6 A;  4H86 A;  2OAC A;  2J9H A;  1GSE A;  2YWI A;  5AIV A;  1K3Y A;  3HMJ G;  2XHF A;  4PQ1 A;  5D8I A;  5IO2 A;  2MMZ A;  3GA4 A;  3E0U A;  3GKK A;  4CY6 A;  2L4Q A;  5ECM B;  1I5G A;  1WRY A;  1XWK A;  2VLV A;  4DSR A;  5CP1 A;  5D96 A;  1EZK A;  2DIZ A;  5CO3 A;  3TJJ A;  1JZD A;  2GGT A;  4MZW A;  5D93 A;  1K3O A;  3F63 A;  1URM A;  3UJ1 A;  5ID2 B;  3DRN A;  2C3Q A;  3GST A;  1TI3 A;  2GT6 A;  1GNW A;  1O73 A;  2BMX A;  2X49 A;  4K6X A;  4TVE A;  4WET A;  1G6W A;  1V98 A;  1GSF A;  4HI7 A;  2AYT A;  3LEF A;  3MAK A;  2IME A;  1EWX A;  1XVW A;  4MPG A;  1F3A A;  1K0O A;  2WGR A;  4HEA 2;  4YKG A;  4G0L A;  4PNG A;  4L5O A;  5ABR A;  4G10 A;  4KCE A;  3GRX A;  1WMJ A;  5JCU A;  3LWA A;  4MZB A;  3MNG A;  1Y6E A;  4PQH A;  4E68 A;  1OAZ A;  1K3L A;  4CW9 A;  2RM6 A;  1T1V A;  4K1F A;  2YZU A;  5G5F A;  2CA8 A;  3KP8 A;  3ZIJ A;  1T00 A;  2LEG A;  3UEM A;  3VPT A;  2H8L A;  4D73 A;  5GZZ B;  3HKR A;  1WP0 A;  4BL7 B;  3WD6 A;  2VLU A;  3LYK A;  4HZ4 A;  3APS A;  5LD0 A;  4JR6 A;  3L4N A;  3TKQ A;  2E2G A;  2HLS A;  4LMV A;  1WWJ A;  1NHY A;  1Z9H A;  5A5K A;  3TRP A;  1OE8 A;  1Z6M A;  4FYC A;  3U6V A;  4WR5 A;  3MDK A;  3ZRD A;  3H4K A;  5IIZ A;  4XS1 A;  1FW1 A;  2M72 A;  2QA1 A;  5G1L A;  4MJE A;  5KN2 A;  4WBR D;  4OO5 A;  1GLP A;  4JE1 A;  1PL1 A;  4G19 A;  2RII A;  4NHZ A;  2E7P A;  2H30 A;  1FHE A;  3P8W A;  4TKY A;  5A34 A;  2FHE A;  2H76 A;  3WT2 A;  2I4A A;  4POM A;  5A34 B;  1FVK A;  3E3E A;  2JZT A;  5DVB A;  2EFE A;  3TJG A;  2PWJ A;  2DLX A;  4LL4 B;  5G5E A;  5ECO B;  1A8L A;  1BQ7 A;  3ED3 A;  1YJ6 A;  3M3M A;  2H1D A;  3GTU A;  1BJX A;  3ZIV A;  3R3E A;  2R2J A;  5H5S A;  2DJ3 A;  1GTU A;  4G0K A;  6GSU A;  6GSW A;  1G0T A;  1A2J A;  4QMK A;  1YEP A;  5CRG A;  4OCE A;  2VL2 A;  2VOC A;  2JSZ A;  4P3Y B;  1NW2 A;  2CT6 A;  3PGT A;  1GUK A;  3EU3 A;  3GX8 A;  4FH8 A;  4KUN A;  2WRT A;  2V1M A;  5EY6 A;  1V57 A;  14GS A;  1PN0 A;  3J7Y b;  1R4W A;  2N5A A;  4XTS A;  1A24 A;  1E6B A;  4MPF A;  2HSH A;  1SL0 B;  4AKG A;  2I81 A;  5B8B A;  5BMU B;  2GDR A;  4AI6 A;  1VGL A;  4Q5N A;  4TR1 B;  1Q98 A;  1KNG A;  2KOK A;  4FQU A;  4L0U A;  5KN3 A;  1OC3 A;  1ZYQ B;  1OYJ A;  3QD9 A;  1M9A A;  1FB6 A;  1A23 A;  1EP7 A;  1GUL A;  4MK3 A;  1O8W A;  4XS4 B;  3HVX A;  2CVD A;  3DD3 A;  3W8J A;  4RI6 A;  1PSQ A;  3D6I A;  2VLT A;  4EXJ A;  1PD2 1;  3JCM L;  1HQO A;  2VL2 C;  3DWV A;  2AB6 A;  1ON4 A;  6GSY A;  2VCZ A;  3A5W A;  5E4W A;  4YAV A;  3M9J A;  2LQQ A;  3CYN A;  4L0W A;  5HFG A;  4IBP A;  4F03 A;  5ECI B;  2H73 A;  3I9V 2;  2F51 A;  3IHQ A;  3O76 A;  3QAV A;  4PQI A;  4F0B A;  3A2V A;  1W4V A;  2O87 A;  2MMN A;  2V6K A;  13GS A;  2HRA A;  5DJL A;  5FT3 A;  5CRW A;  1OVN A;  2VCV A;  3BOA A;  4ZXG A;  3QR6 A;  2VKZ G;  2IMF A;  1A2M A;  2GS3 A;  1SKR B;  2G2Q A;  4K5R A;  5FWG A;  2CZ3 A;  1V58 A;  2DBC A;  5LCZ A;  4GSN A;  4V2N A;  1XZO A;  3G7J A;  3EU4 A;  3KEB A;  4N30 A;  4Z2T A;  5KOX A;  4OFT A;  1TXU A;  4BVX A;  5CRD A;  3C8E A;  5KEJ A;  1B4P A;  4HOJ A;  1U3I A;  2GSR A;  1HD2 A;  1GSY A;  2AAW A;  4ECC A;  3ZFL A;  4ZIL A;  1AIU A;  3IXR A;  5D9V A;  1T7P B;  4OO4 A;  1JLW A;  3C73 A;  2DKH A;  3HJM A;  3FZA A;  4NHW A;  1YY7 A;  5ECP B;  3VI7 A;  5DAK B;  2H6Y A;  4WEY A;  4I2U A;  4IP1 A;  2UZ8 A;  1TRW A;  3LXT A;  2PU9 C;  5A5H A;  2IPA A;  3FMW A;  2L5L A;  3VWX A;  2C0F A;  4N3Z A;  2X8C A;  3ZML A;  3N9J A;  2WJU A;  3PPU A;  5JWR B;  2A4H A;  5IMF A;  1GL8 A;  1GTB A;  1GSQ A;  3ZZX A;  4KDY A;  3WYW A;  2JU5 A;  4FIW A;  3GSS A;  1U6T A;  5A1N A;  1FOV A;  2C1Y A;  4IW9 A;  3EMP A;  4XHM A;  3L78 A;  4MA9 A;  4GLT A;  4I5Q A;  2V41 A;  4EUY A;  1JZR A;  2JZS A;  1Y25 A;  5FHI A;  3FKF A;  4BPY A;  1B9Y C;  2N5F A;  1A0R P;  4J2F A;  2VO4 A;  1VF4 A;  3KXO A;  5DCG A;  2B7J A;  3DML A;  1AQW A;  2IFQ A;  4HU7 A;  2GQL A;  2LRC A;  2LJA A;  3GMF A;  2IFQ B;  4GTU A;  1MD3 A;  3CSI A;  1N25 A;  3RPP A;  1X5D A;  3VLN A;  1SK0 A;  4AJ7 A;  3EIN A;  3F9U A;  1OE7 A;  4JED A;  2LKU A;  2DJJ A;  4X43 A;  1SVM A;  5IOW A;  4YH2 A;  1R26 A;  5F07 A;  1DE2 A;  1CQG A;  2GSQ A;  2QC7 A;  3TKS A;  1PGT A;  2FWF A;  1TK0 B;  4NAX A;  3KZQ A;  4MP4 A;  11GS A;  1ZMA A;  2YNX A;  1AC1 A;  1ERW A;  4GST A;  3TCO A;  4PUF C;  3IRA A;  1N2A A;  3F4S A;  4ML6 A;  1TKD B;  4MJC A;  3RPN A;  2DJ2 A;  3F3R A;  4ZL7 A;  4HQS A;  5IMV A;  4XS6 A;  2O89 A;  5J4U A;  1WIK A;  3CWG A;  2CV4 A;  1GSU A;  3M9K A;  2EIR A;  3L9V A;  1B9X C;  1F3B A;  1SK2 A;  3L9U A;  3Q19 A;  3HJO A;  4DSS A;  3ZVJ D;  2KP2 A;  4TXO A;  1G7O A;  2C3T A;  4O5U A;  1GTI A;  2JAD A;  19GS A;  3M1G A;  4MNN A;  3KM6 A;  1XWB A;  3G9B A;  5G30 A;  2EC4 A;  2FWE A;  4MDC A;  3CSH A;  3KJY A;  4K7N A;  2J23 A;  3O3T A;  2FD3 A;  1U3A A;  4O7H A;  1RW1 A;  2L6C A;  3GIX A;  4EDY A;  2NBS A;  2ZUP A;  5ECH B;  1SK1 A;  1A0F A;  2F9S A;  1Z5Y E;  4GWR A;  1X9S B;  4KE3 A;  3A3T A;  2H0I A;  1EV9 A;  1BG1 A;  2HZF A;  2VUP A;  2XBQ A;  1V40 A;  5IO0 A;  8GSS A;  3NIV A;  4OMV A;  5BRT A;  3TJB A;  2B6M A;  2HSY A;  1TRU A;  5G2Z A;  3UBK A;  3U5R E;  1WOU A;  4X4J A;  3C7M A;  4F2I A;  3A5I A;  1BED A;  5HR0 A;  1FG4 A;  3UOM A;  4V2M A;  5INY A;  4Z2U A;  1TK8 B;  4L8E A;  3O6T A;  2GZZ A;  3EPT A;  4L5L A;  1QUW A;  4RQR A;  4ZBA A;  3GV1 A;  4I2T A;  1S3C A;  1TRV A;  1IYI A;  2H6X A;  2L5O A;  4MJA A;  4Q5Q A;  1YDK A;  2NTO A;  1AQV A;  1EOG A;  4G2E A;  2DSA A;  1TOF A;  4EF0 A;  4KDX A;  1QFN A;  5B7C A;  1B48 A;  1CQH A;  3Q74 A;  2IWT A;  2P5Q A;  2PPT A;  3APQ A;  1BYE A;  5IMZ A;  2RM5 A;  4ZB6 A;  2LUS A;  3TGZ A;  1YZX A;  1LU4 A;  4D73 B;  4W66 A;  2O8V B;  1O7U A;  3LGC A;  12GS A;  3BBY A;  1FAA A;  4CY8 A;  1DBY A;  2GZY A;  3I69 A;  4XRD A;  2GQM A;  3TJK A;  4ICY A;  2C80 A;  4EIQ A;  2IMK A;  4MZC A;  2E0Q A;  1XW9 A;  3VK9 A;  2LNT A;  2LJK A;  1DSB A;  1K0D A;  1GRX A;  1X9W B;  2YV7 A;  2YWN A;  4E8H A;  3CRU A;  2UV8 G;  3FK8 A;  1G7E A;  4YQV A;  1XWC A;  2B5Y A;  2HSN A;  1F6M C;  4TW5 A;  5J9B A;  2AV4 A;  3UBL A;  3LG6 A;  4O5R A;  5H5Q A;  1K0N A;  1BF5 A;  1V9W A;  3TJF A;  3TUE A;  4EL1 A;  3GUS A;  4DEJ A;  5EL8 A;  1U87 A;  1J08 A;  2HXK A;  2B3S A;  2PVQ A;  2DIY A;  2IMI A;  2VM2 A;  1PMT A;  2HE3 A;  2K6V A;  3PIN A;  4ECB A;  4AJ6 A;  1TW9 A;  1E2Y A;  3H1N A;  2H72 A;  3HYP A;  4MMM A;  1YVL A;  1EEM A;  1HNA A;  3GTU B;  3I6A A;  4ZBD A;  3UAR A;  1PQN A;  3TOU A;  4X0X A;  4KSO A;  2R0C A;  5J4Y A;  4HQZ A;  1C72 A;  2VCX A;  4Z2R A;  2L57 A;  2O7K A;  3ME7 A;  1JFU A;  3IK9 A;  1R5P A;  5F05 A;  4IEL A;  1TJD A;  2VL9 A;  2HT9 A;  4OCF A;  1THO A;  3CMI A;  3ZYW A;  2WCI A;  1ZGN A;  4ML1 A;  2PER A;  1SKS B;  1EV4 A;  3DYR A;  1GUH A;  5IPG A;  2YAN A;  3F6F A;  2YPM A;  1YF1 A;  3ERG A;  4IVF A;  2WB9 A;  3ME8 A;  1T4Z A;  4BWQ A;  2B5X A;  3FRC A;  1MDJ A;  2LNS A;  3L9S A;  1O85 A;  4GSS A;  3HHV A;  2VCT A;  3C71 A;  2DKI A;  5KN1 A;  3ISO A;  1QXH A;  2C0G A;  3TDG A;  2HSM A;  3F3Q A;  3ZL5 A;  2VAF A;  2IL3 A;  2EFH A;  4KX4 A;  2C8U A;  4MCU A;  2JZR A;  2M80 A;  4O92 A;  5D9X A;  5L71 A;  2VD0 A;  1SD9 A;  1O81 A;  2FLS A;  5ECL B;  3KTB A;  1ZZY A;  4KH7 A;  1NHO A;  3QPM A;  2YN1 A;  4MF5 A;  4G01 A;  4LLR A;  2A2P A;  1JHB A;  2ALB A;  2WS2 A;  1GSS A;  2RUF A;  1T3B A;  1PL2 A;  4N10 A;  5J5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...