1VF3A

Cgsta1-1 in complex with glutathione conjugate of cdnb
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
KPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf3A01
1A0FA 3GRXA 2H6ZA 2L4QA 5F07A 4G19A 1R5AA 2R5GA 1PQNA 2REMA 3VWVA 1HNAA 3BJ5A 4IJIA 4XCSA 4NMUA 3RPNA 4N30A 1B9XC 3LSZA 2ZNMA 1HYUA 4NXIA 3J7Yb 1TK0B 5G2ZA 4O92A 3NZNA 4K7OA 4EC0A 4ZILA 4F9ZA 5DVBA 3ERGA 2GS3A 1RK4A 2IMKA 1JZOA 3H4KA 4V2MA 2L4CA 1K3YA 4IGJA 2CAIA 2HYXA 3VI5A 3RPPA 4I97A 4KW6A 4XIHA 1AC1A 1JLWA 2VCQA 2GLRA 5ECIB 4ZBAA 5CNWA 1Z7RA 1SJZA 1ZZYA 2H75A 3HVXA 3TB2A 3VWXA 1NW2A 1VF1A 4KCAA 1EGRA 4DEJA 4BVXA 1YDKA 3DGQA 4EKZA 4TRXA 2PERA 4N0VA 2R2JA 2VLTA 3ZYWA 1OC9A 5FWGA 1Q4JA 4X43A 1O6JA 2NPBA 1V40A 4K7NA 3UARA 1ERWA 3D21A 1B4PA 3IV4A 3TKRA 3CRTA 1PD21 4ZL7A 1K0DA 4QQ7A 1YEPA 1FVJA 3FYGA 1Z7PA 2IL3A 1M7TA 4MF7A 2LJAA 2KHPA 3EU3A 1FB0A 5H5RA 3TDGA 3EU4A 2ZCTA 4G2EA 4I6XA 1AXDA 5D93A 1AQVA 3FW2A 4XHMA 3ZIVA 1YZXA 16GSA 4TR1B 5HR3A 2BTOT 1M99A 4NWYA 1AUCA 3VURA 4ZXGA 3KH9A 2VUPA 2OE1A 2H74A 3EC3A 2FLSA 1XWCA 2H30A 4LMWA 2JU5A 2VLUA 2MZCA 2B3SA 5HFGA 2YJ7A 2I1UA 1JZDA 3MNGA 3KMOA 2AJQB 1RW1A 13GSA 3G9BA 1ABAA 1PN9A 2A2SA 1TW9A 1G7EA 2YWMA 4L8EA 3VWUA 3VPTA 4OMVA 3ME7A 2VCTA 3KZQA 3LEFA 5CP1A 3TKQA 3CBUA 3GL5A 3I9V2 1WWJA 1VF3A 3F6DA 1EV9A 1ERVA 2CV4A 4OCEA 22GSA 3GX0A 2GZPA 2WS2A 2R4VA 2LEGA 3DVWA 4L5OA 2L57A 2CT6A 1TRVA 5G30A 2I81A 2NTOA 2B7KA 5EPFA 3GKNA 2H71A 3TOUA 3ZITA 2H6YA 1QXHA 1GWCA 5J9CA 1IYHA 5J5NA 5DDLA 1I5GA 3ZIJA 5C00A 3ED3A 4N0ZA 4G0KA 2IFQA 2L5LA 4JU5A 4MMMA 3RDWA 3WD6A 3SWLA 2FGXA 2WRTA 2OACA 1FB6A 2OJLA 1XXUA 3RHBA 1T8EB 3GKXA 5GSTA 1PRXA 3TRXA 5HR0A 2HZFA 4O5RA 2I4AA 3FZ9A 3EURA 1X0RA 3W8JA 1QK8A 2TIRA 2C1YA 5ECHB 4NHZA 2H1BA 4V1Ap 2VCVA 3OR5A 1KTEA 2VAFA 4Q5NA 5CYYA 3TRPA 2FWGA 5AGYA 1TRWA 9GSSA 3C7MA 3FEUA 2HLSA 1O85A 2HRFA 1GUMA 2NBSA 3DKSA 3PINA 2CX4A 4X1UA 2GTUA 4PQHA 1A2JA 4FH8A 2GT6A 3RAZA 3LQ7A 1U87A 2OA7A 3A5WA 4BVYB 3F3QA 4QL7A 4KSOA 4N10A 4CDOA 4KDUA 5CAXA 1ZGNA 1W89A 4ULXA 5D9WA 3M9KA 4Z7XA 1MEKA 5AIXA 4WBJA 3SBCA 2K6VA 2XBQA 1JZRA 3EVIA 4I2TA 1GRXA 3FZ4A 1NHOA 3GUSA 3P7XA 1YEXA 5DALA 2DJ0A 3DWVA 3AY8A 1Z6NA 3VFIA 1XIYA 3TJFA 4L0UA 2LV3A 2RLIA 2HE3A 3KGKA 1HQOA 4XS6A 3C1RA 4ZL8A 1V58A 3HDCA 4O32A 5J9BA 2H0GA 2CVBA 2JACA 3GKMA 3UJ1A 1EP8A 1HNBA 4OD7A 1PGTA 2QC7A 3L9SA 1GSDA 1M0UA 5D9XA 4I8BA 1PA3A 1CQHA 4RQXA 1B9YC 2KOKA 4NAXA 3PGTA 5IOWA 3HJPA 4ZBDA 3CTGA 5HFKA 3KTBA 4K0NA 3U6VA 3RHCA 5G5FA 5B8AA 3O6TA 3HVVA 4WR5A 1I9DA 4WETA 5JWOB 2AYTA 1X9WB 2VM1A 1SL0B 5GSSA 5F05A 2PVQA 4JEDA 2P5QA 4EL1A 1R7HA 2B7JA 2P31A 3KTLA 5EY6A 1ERUA 4DSRA 3I69A 4L5LA 4YAPA 3L0HA 5H5SA 3F4SA 2LNTA 1G6WA 1GLQA 1K0AA 4MPFA 2WCIA 2M46A 3VK9A 5A5KA 1SK0A 5DAKB 3QCPA 1B4QA 6GSWA 3Q19A 4MZBA 2X8CA 1S3CA 1XCCA 3H8QA 4MK3A 2QSIA 3QAGA 1R26A 2YN1A 2VD0A 3G7IA 6GSTA 3GX8A 3QD9A 4E8HA 3UVTA 2X8GA 2GSQA 3TRQA 2GDRA 1ZL9A 2HRNA 2VOCA 4HOJA 4EE0A 4EUYA 3KJYA 1GTIA 2H1DA 4MH3A 4PQIA 8GSSA 3DRNA 3TJBA 4DSSB 5B7CA 1A2LA 5IM9A 2C8UA 4IP6A 3QMXA 1F6MC 3M9JA 1TRUA 3F4TA 1SL1B 2O7KA 1KNGA 1OVNA 5D9TA 1JLVA 2LS5A 3HY2A 3WT1A 5AISA 3KXOA 4JE1A 3ZVJA 3ZVJD 2RM5A 3D4MA 1XOAA 3MWHA 5D8IA 3ZMLA 5HR2A 2IMIA 2C3QA 4PNGA 1WIKA 4PXOA 4F82A 1VRSD 1WOUA 2FNOA 3GL3A 3GTUA 3ZLPA 1UC7A 3VLNA 3BOAA 2L6CA 3ZZXA 4LLRA 2B5XA 1XVQA 4L0WA 1C72A 1PX6A 1GSEA 1QGVA 4FYBA 1V98A 4PNFA 4FYUA 1Y6EA 4USSA 5D9VA 5JWRB 3ERFA 3D4TA 2PUKC 1GSSA 4WKWA 5D96A 1JHBA 1GUHA 2XC2A 2H73A 1RQMA 4ZIJA 1GLPA 3A3TA 2LSTA 1X9SB 2IMEA 2DIZA 4IQAA 1NM3A 3FHKA 3LXTA 3LXZA 4PGTA 3ZL5A 2CVKA 4K6XA 5ID2A 1SKSB 4BL7A 1Z6MA 3ZFLA 6GSUA 3EYTA 1A8YA 1F9MA 3CRUA 3FR6A 4AGSA 1LBKA 4BVXB 1PMTA 3KEBA 1FHEA 4PURA 3IHQA 2O87A 4AJ8A 3P2AA 2X8HA 2RIIA 1E2YA 3Q74A 2K8VA 3C71A 5CO3A 5J41A 1USBA 3IAS2 3DYRA 4HI7A 1ACVA 3PR8A 1FG4A 3V1WA 1T1VA 4HJ2A 1XW5A 4GCIA 6GSXA 4ILFA 4MF6A 2G2QA 2YJHA 4AJ7A 1V2AA 1S3DA 1X9MB 3LJRA 2I3YA 2OBKA 2A4VA 2CZ2A 4MDCA 5A4WA 3E3EA 2IMDA 2J23A 4TXOB 3MDKA 3FRCA 1TU7A 2DLXA 3GN3A 4KA0A 4IW9A 4ZB8A 1TKDB 1XVWA 2FWFA 3CSJA 3W8SA 1X5CA 2XHFA 4F03A 1XWKA 1W4VA 2V6KA 4JBBA 4DSQA 1WE0A 10GSA 1WJKA 4KUNA 4FO5A 4X0XA 2MBSA 2JADA 2LQQA 1XOBA 5B8BA 2KUCA 3BCIA 1B48A 2L5OA 2FA4A 1FO5A 1ML6A 4POKA 1QUWA 1OC8A 2F8AA 1LU4A 3G7YA 1K0NA 2PWJA 5INYA 2AHEA 4WF5A 3CSHA 2PU9C 4IHUA 5GAND 1TDIA 3GV1A 4JR4A 1TK5B 1QFNA 1A24A 1J9BA 2Z9SA 4MP4A 4G0IA 5DJLA 2MBTA 2F9SA 4H86A 3FY7A 2V41A 4TR4A 2B6MA 4MPGA 5B6NA 1ILOA 3H79A 4OCFA 1XPVA 1EZKA 5JCGA 1M9AA 1NSWA 3GA4A 3EINA 1AIUA 2NDOA 1T7PB 1OKTA 3TUEA 1GTBA 2YNXA 3F3RA 4RI6A 2GZZA 1DE1A 2DJ1A 2CZ3A 1WRYA 2H8LA 1F3BA 5IMZA 4TR3A 1YJ6A 2RM6A 1HD2A 3WYWA 2JZRA 1UN2A 4MJEA 5LCZA 1SJIA 5L71A 2N5BA 2C3NA 1WP0A 4KCEA 4Q5RA 2LJKA 3A2WA 3QOUA 4TR1A 4ML6A 3WGXA 4GXZA 4F0BA 1TRSA 1T4ZA 1AQWA 2H0IA 4IP1A 4PQ1A 1MDIA 2AUVA 1Z3EA 2IMFA 3GH9A 4F2IA 1MD3A 3IE3A 1HNCA 3KP8A 4LMVA 4EDYA 4K2DA 2HT9A 1GULA 1SKRB 3IK9A 4NPBA 2AB6A 4MJCA 3P90A 3P8WA 4GTUA 3UBKA 2YZUA 5IOXA 2YV9A 3FR9A 2H1AA 4GRFA 3HZ4A 3F8UA 3DVXA 1J0FA 1KEBA 1AQXA 4Q5FA 5ECMB 4OWYA 1SK1A 4BA7A 5C04A 2YCDA 3LGCA 2LRTA 3TKPA 4K1FA 1O8XA 3D22A 2GVPA 4KB3A 1VF4A 4XS1A 1URMA 2MMOA 1ZYEA 4MA9A 4MZCA 1K0CA 5E4WA 3ZRDA 1G7OA 2V1MA 2EIQA 3IOSA 1SYXA 5DQYA 3C8EA 5G1LA 4HQZA 3QR6A 2C3TA 2DC5A 2AV4A 4WBRD 1WPIA 1AW9A 4KGIA 3J7Yk 2WULA 1U88A 1YF0A 4RI7A 1GSQA 3ISOA 1BEDA 1XWBA 2DIYA 1H75A 2V32A 3QAWA 3HKRA 12GSA 3ME8A 5IMDA 3IBHA 4P3YB 2VD1A 3BBYA 1ST9A 2OE0A 1K0OA 4XS4B 4GSTA 2HZEB 4FIWA 2HSMB 2D2ZA 3UAPA 3GNJA 2IJYA 4RQRA 1XFLA 1TXXA 2EIRA 3EMPA 3TCOA 3LG6A 2GSRA 2HRKB 5A4UA 3UEMA 1PKZA 1F2EA 1SD9A 3BD2A 1ZCPA 2PPTA 5JWQB 2VCWA 3IAM2 4HEA2 1VF2A 1TI3A 3LYKA 3GIXA 2N5FA 1U6TA 1B8XA 5J4UA 3QDNA 3IC4A 1S3AA 4EVMA 4YH2A 4BVYA 2OBIA 1OYJA 2DMLA 2R6KA 4JR6A 3BCKA 2FCHA 4KH7A 2G0FA 4TR0A 3EMXA 4IJ3A 4YQVA 2FA8A 2F51A 5JCUA 3IDVA 4HU9A 5IIZA 3H1NA 1GSYA 2GT5A 5LNKe 2H1GA 2VL9A 2MYGA 2MMNA 2H01A 1V57A 3HYPA 4V2NA 2KP2A 1U3AA 1TK8B 2JZSA 1G6YA 4GF0A 3APQA 1TJDA 1SYRA 4MLYA 1EGOA 1SENA 2VCZA 4HS1A 4PTSA 1ZOFA 2HFDA 3HVSA 4GLTA 5IMFA 5LD0A 4BWSA 3TJJA 4ZBBA 4K8MA 4XRAA 2A2RA 4GSSA 2WZ9A 4KE3A 1PX7A 4PUAA 1A23A 2OE3A 3F9UA 3GH6A 2JSZA 3JCML 4KAEA 4TVEA 5HFIA 3I43A 5KN3A 4D73B 1SD8A 1FW1A 3LFLA 4XRDA 18GSA 2VM2A 3IK7A 1MD4A 4KDYA 5ECPB 2B1KA 3HD5A 4CW9A 2C4JA 2OADA 1M2AA 3TKSE 4ECIA 3F0IA 5DAKA 3FZ5A 1GNEA 1TU8A 1BYEA 1TI1A 1UVZA 3CXGA 4OO4A 4AJ6A 4GSNA 1Q98A 2CVDA 2ON5A 2I9HA 1M2BA 2WJUA 4J2FA 3QAVA 1GUKA 3GURA 3ERWA 4TW5A 4GQFA 3HA9A 4OFNA 1EOGA 5COHA 1YKAA 1GNWA 4ECJA 2BMXA 5ECQB 4YQUA 3WGDA 4TOPA 1EP7A 2QGVA 2F3MA 1T00A 3R3EA 1ZMAA 1N8JA 2H76A 4DSSA 2O85A 5CRWA 4BPYA 2LRNA 2EIOA 1Y25A 3FR3A 4IN0A 4OFTA 3KP9A 3QFAC 2H66A 2EC4A 2E2GA 1ON4A 2JL4A 3HZ8A 1K0BA 2TRCP 3MSZA 1XZOA 3QFBC 2C0FA 1SK2A 1THOA 4F0CA 1FVKA 5DQSA 1SKWB 4KF9A 2LJRA 2GQMA 4POMA 3M8NA 2K18A 5IMAA 3KD0A 3FK8A 4JZQA 2JSYA 1OE7A 4Q5QA 1OC9B 5ECNB 3PH9A 1BQ7A 2WGRA 2CQ9A 5KEJA 1T4YA 2YPMA 1IYIA 3HJOA 4AF2A 1KBNA 4TKYA 1YY7A 1R5PA 2MMAA 2VL3A 4JRRA 1E6BA 1K3OA 4MH2A 1OAZA 2YOIA 3GMFA 3IC8A 1A2MA 2YWOA 3A2XA 3NOFA 3APOA 4FYCA 2LKUA 2PN8A 2O8VB 3LYPA 1H4OA 3E0UA 4MCUA 1F37A 4ZB9A 3UBLA 2DJ2A 3HCZA 1SL2B 5IPHA 1OE8A 5IMCA 3GSSA 2VIMA 11GSA 5HR1A 1X5EA 2M80A 4LL1B 1YQ1A 5ELGA 1GP1A 4OO5A 4HDEA 3WT2A 5ENUA 2HI7A 2ZUPA 14GSA 4ACSA 2H70A 1ERTA 1LJRA 3M1GA 5IPGA 3GKKA 3Q18A 1O81A 5CREA 2VO4A 1T3BA 2TRXA 4HUAA 2YANA 3HXSA 5B6MA 4LL4B 3L4NA 5J3RA 1DUGA 3APSA 4TXVA 2VCXA 4TXOA 2C80A 4NV5A 1O73A 1K3LA 1OKDA 4BWQA 2M72A 3TJGA 1R4WA 2VL2C 4G0LA 3UIWA 1BJXA 2GQLA 3VWWA 2H6XA 2IPAA 2E2MA 1TOFA 5FHIA 2DJJA 3L78A 5CRDA 5FT3A 3S9FA 4KDXA 5ELAA 3GYKA 3FZAA 2IFQB 2E7PA 3D6IA 3QPMA 1UA5A 5DCHA 4ID0A 3RBTA 3DEXA 2HSYA 1QMVA 2O89A 4ISDA 3DIEA 2MMZA 1PKWA 1JZWA 2WB9A 3TKSA 4K7IA 3UL3A 2HNLA 4GQCA 2HRAA 1M9BA 1J08A 2FUG2 1V9WA 2R37A 2HSHA 2WFCA 3C73A 5EVOA 4G10A 3IRAA 3Q6OA 20GSA 2K9FA 2R3XA 5G31A 1GH2A 2GSSA 4WF4A 3IXRA 4HQSA 4WEYA 1THXA 3CYNA 1CQGA 1BG5A 1Z9HA 3A2VA 3TGZA 1YF1A 3F4RA 5E59A 3DXBA 2OKAA 2PGTA 2C0GA 2GSTA 3FKFA 4KNDA 1G0TA 1TP9A 3R2QA 1EEJA 2YZHA 1O8WA 5ECRB 5IMVA 1XWAA 3ZFBA 3F63A 5DALB 4J56E 3UVHA 1XW6A 5BMUA 2P5RA 2CA8A 3M3MA 1TTZA 5AIVA 1JFUA 1X5DA 4DVCA 1GTAA 3N9JA 5ECOB 1EWXA 3LWAA 4TN8A 2LNSA 2WDUA 2DSAA 2FWHA 5GZZB 1PSQA 2XPEA 3WGEA 4IS0A 1VGLA 3HHVA 2DJ3A 4EF0A 1XW9A 2B1LA 4MABA 3N5OA 3U5RE 1WMJA 2H0HA 2YWIA 3GHAA 3O3TA 2GGTA 2L59A 5DCGA 1NHYA 5F06A 4WXTA 4OFMA 2VLVA 4EO3A 3HJMA 3EE2A 4KX4A 3C1SA 4G9HA 5IO0A 3O76A 2XPDA 3ZMKA 2FY6A 4ECCA 1XBSA 2BJXA 1BAYA 2ALBA 4EXJA 3M0FA 2IN3A 1O7UA 3ZREA 4ZL9A 5ABRA 1ZYQB 4K0GA 3E9JB 4IQ1A 3D5JA 3L9VA 1GTUA 2V2GA 4POLA 4K9ZA 2B5EA 4NHWA 17GSA 4PUFC 4MJBA 1DBYA 4FQUA 3CMIA 5AN1A 3CSIA 1M2DA 4XTSA 4IBPA 1GSUA 4O7HA 5CRGA 3VPQA 2FHEA 3TKSC 3TOTA 5F8BA 2L6DA 1PL2A 2CAQA 5ECKB 5CRHA 2ON7A 4XS4A 1SJ6A 2N5AA 2HZEA 2LUSA 5G5EA 2HSMA 2UZ8A 2LRCA 2C0EA 2H19A 1A0RP 3UOMA 1GSFA 1YKCA 4NV2A 5DBQA 2RUFA 2HRKA 2X64A 3MAKA 3D0ZA 4IELA 3TJKA 3NIVA 2AAWA 3ZTLA 3DMLA 1AAZA 5EL8A 3L9UA 2GQKA 2DMMA 4GWRA 2C0DA 4E8EA 1SU9A 4MJAA 4QL9A 2NVLA 3CTFA 4HJMA 3K8NA 3GTUB 2ES7A 1FOVA 2K8SA 4IKHA 3UMAA 2X99A 3KCMA 3PPUA 4HZ2A 2YWNA 7GSSA 2HSNB 2LQOA 3IR4A 2H72A 4J57E 4POBA 2KLXA 2E0QA 4HU7A 5ECLB 1A8LA 4EDZA 1PL1A 4ML1A 5IQYA 4I5QA 5GAPD 1DE2A 2J9HA 1MDKA 3EWLA 2DBCA 5H5QA 2JZTA 4LA1A 4PX1A 2V6OA 2B5YA 2YP6A 4WR4A 5A4VA 3GSTA 3F6FA 3VI7A 5DJMA 4MZWA 1K0MA 3DD3A 1EEMA 2F8FA 6GSVA 4V2LA 5IO2A 3KIJA 5F0GA 4IVFA 1U3IA 1F3AA 2LTKA 5ID2B 1QQ2A 3KH7A 2RUEA 4I2UA 4BL7B 1OC3A 2KP1A 2YV7A 2VL2A 1XWGA 4RUVA 4KSMA 3W6GA 4D73A 1EOHA 2CX3A 2IIYA 3IPZA 4CHSA 1FAAA 2XBIA 4ECBA 5KN2A 1N2AA 2PMTA 2HQTA 3H93A 5HQPA 4N11A 5KN1A 3US3A 1MDJA 2FWEA 6GSSA 3G7JA 1Z5YE 5G1KA 4YQMA 2FD3A 2P0GA 1EV4A 4V1Ag 3GFKA 5JCWA 2QKEA 5D73A 1MTCA 4ZB6A 1BX9A 2PVOC 2PBJA 4YAVA 1GL8A 4HZ4A 3I6AA 2HXKA 3KMNA 5ECSA 2GZYA 3KM6A 1DSBA 19GSA 2DJKA 6GSYA 4MF5A 2IWTA 3IA1A 3LORA 5KN0A
chains in the Genus database with same CATH superfamily
1A0FA 3GRXA 2H6ZA 2L4QA 2WVXA 5F07A 2EFEA 4G19A 1R5AA 2R5GA 1PQNA 2REMA 2R0CA 3VWVA 1HNAA 3BJ5A 4IJIA 4XCSA 4NMUA 2O5VA 2WVYA 3RPNA 4N30A 1B9XC 3LSZA 2ZNMA 1HYUA 4NXIA 3J7Yb 1TK0B 5G2ZA 4O92A 3NZNA 4K7OA 4EC0A 4ZILA 4F9ZA 5DVBA 5KOXA 3ERGA 2GS3A 1RK4A 2IMKA 2WW1A 4AKIA 1JZOA 3H4KA 4V2MA 2L4CA 1K3YA 4IGJA 2CAIA 2HYXA 3VI5A 3RPPA 4I97A 4KW6A 4XIHA 1AC1A 1JLWA 2VCQA 2GLRA 5A5HB 5ECIB 4ZBAA 5CNWA 1Z7RA 1SJZA 1ZZYA 2H75A 3HVXA 3TB2A 3VWXA 1NW2A 1VF1A 4KCAA 1EGRA 4DEJA 4BVXA 1YDKA 3DGQA 4EKZA 4TRXA 2PERA 4N0VA 1M3JA 2R2JA 2VLTA 3ZYWA 4QMKA 5FWGA 1OC9A 1Q4JA 4X43A 1O6JA 2NPBA 1V40A 4K7NA 3UARA 1ERWA 3D21A 4YKGA 1B4PA 3IV4A 3TKRA 3CRTA 1PD21 4ZL7A 1K0DA 4QQ7A 1YEPA 1FVJA 3FYGA 1Z7PA 2IL3A 4X4JA 1M7TA 4MF7A 2LJAA 2KHPA 3EU3A 1FB0A 3RGBC 5H5RA 3TDGA 3EU4A 2ZCTA 4G2EA 4I6XA 1AXDA 5D93A 1AQVA 3FW2A 1Y1UA 4XHMA 3ZIVA 1YZXA 16GSA 1SVMA 4TR1B 5HR3A 2BTOT 1M99A 4NWYA 1AUCA 3VURA 4ZXGA 3KH9A 2VUPA 2OE1A 2H74A 3EC3A 2FLSA 1XWCA 2H30A 4LMWA 2JU5A 2VLUA 2MZCA 2B3SA 5HFGA 2YJ7A 3CHXC 2I1UA 1JZDA 3MNGA 3KMOA 2AJQB 1RW1A 13GSA 4G01A 3G9BA 1ABAA 1PN9A 2A2SA 1TW9A 1G7EA 2YWMA 4L8EA 3VWUA 3VPTA 4OMVA 3ME7A 2VCTA 3KZQA 3LEFA 5CP1A 3TKQA 2WZSA 3CBUA 3GL5A 3I9V2 1WWJA 1VF3A 3F6DA 1EV9A 1ERVA 2CV4A 4OCEA 22GSA 3GX0A 2GZPA 2WS2A 2R4VA 2LEGA 3DVWA 4L5OA 2L57A 2CT6A 1TRVA 5G30A 2I81A 2NTOA 2B7KA 5EPFA 4PHZC 3GKNA 5BMUB 2H71A 3TOUA 3ZITA 2H6YA 1QXHA 1GWCA 5J9CA 1IYHA 5J5NA 5DDLA 1I5GA 3ZIJA 5C00A 3ED3A 4N0ZA 4G0KA 2IFQA 2L5LA 4JU5A 4MMMA 3RDWA 3WD6A 3SWLA 2FGXA 2WRTA 2OACA 1FB6A 2OJLA 1XXUA 3RHBA 2X4AA 1T8EB 3GKXA 5GSTA 1PRXA 3TRXA 5HR0A 2HZFA 4O5RA 2I4AA 3FZ9A 3EURA 1X0RA 3W8JA 1QK8A 2TIRA 2C1YA 5ECHB 4NHZA 2H1BA 4V1Ap 2VCVA 3OR5A 1KTEA 2VAFA 4Q5NA 5CYYA 3TRPA 2FWGA 5AGYA 1TRWA 9GSSA 3C7MA 3FEUA 2HLSA 1O85A 2HRFA 1GUMA 2NBSA 3DKSA 3PINA 2CX4A 4X1UA 2GTUA 4PQHA 1A2JA 4FH8A 2GT6A 3RAZA 3LQ7A 2WW0A 1U87A 2OA7A 3A5WA 4BVYB 3F3QA 4QL7A 4KSOA 4N10A 4CDOA 4KDUA 5CAXA 1ZGNA 1W89A 4ULXA 5D9WA 3M9KA 4Z7XA 1MEKA 5AIXA 4AKXB 4WBJA 3SBCA 2K6VA 2XBQA 5J40A 1JZRA 3EVIA 4I2TA 1GRXA 3FZ4A 1NHOA 3GUSA 3P7XA 1YEXA 5DALA 2DJ0A 3DWVA 3AY8A 1Z6NA 3VFIA 1XIYA 3TJFA 4Z2RA 4L0UA 2LV3A 2RLIA 2HE3A 3KGKA 1HQOA 4XS6A 3C1RA 4K5SA 4ZL8A 1V58A 3HDCA 4O32A 5J9BA 2H0GA 2CVBA 2JACA 3GKMA 3UJ1A 1EP8A 1HNBA 4OD7A 1PGTA 2QC7A 3L9SA 1GSDA 1M0UA 5D9XA 4I8BA 1PA3A 1CQHA 4RQXA 1B9YC 2KOKA 4NAXA 3PGTA 5IOWA 3HJPA 4ZBDA 3CTGA 5HFKA 3KTBA 4K0NA 3U6VA 3RHCA 5G5FA 5B8AA 1ZYNA 3O6TA 3HVVA 4WR5A 1I9DA 4WETA 5JWOB 2AYTA 1X9WB 2VM1A 1SL0B 5GSSA 5F05A 2PVQA 4JEDA 2P5QA 4EL1A 1R7HA 2B7JA 2P31A 3KTLA 5EY6A 1ERUA 4DSRA 3I69A 4L5LA 4YAPA 3L0HA 5H5SA 3F4SA 2LNTA 1G6WA 1GLQA 1K0AA 4MPFA 2WCIA 2M46A 3VK9A 5A5KA 1SK0A 5DAKB 3QCPA 1B4QA 6GSWA 3Q19A 4MZBA 2X8CA 1S3CA 1XCCA 3H8QA 4MK3A 2QSIA 3QAGA 3FMWA 1R26A 1TXUA 2YN1A 2VD0A 3G7IA 6GSTA 3GX8A 4K2XA 3QD9A 4E8HA 3UVTA 2X8GA 2GSQA 3TRQA 2GDRA 2OT3A 3LW9A 4Z2TA 1ZL9A 2HRNA 2VOCA 4HOJA 4EE0A 4EUYA 3KJYA 1GTIA 2H1DA 4MH3A 5BRTA 4PQIA 8GSSA 3DRNA 3TJBA 4DSSB 5B7CA 1A2LA 5IM9A 2C8UA 4IP6A 3QMXA 1F6MC 3M9JA 1TRUA 3F4TA 1SL1B 2O7KA 1KNGA 1OVNA 5D9TA 1JLVA 2LS5A 3HY2A 3WT1A 5AISA 3KXOA 4JE1A 3ZVJA 3CWGA 3ZVJD 2RM5A 3D4MA 1XOAA 3MWHA 5D8IA 3ZMLA 5HR2A 2IMIA 2C3QA 4PNGA 1BG1A 1WIKA 4PXOA 4F82A 1VRSD 1WOUA 2FNOA 3GL3A 3GTUA 3ZLPA 1UC7A 3VLNA 3BOAA 4Z2UA 2L6CA 3ZZXA 2HSNA 4LLRA 2B5XA 1XVQA 4L0WA 1C72A 1PX6A 3CQFA 1GSEA 5J4VA 1QGVA 4FYBA 1V98A 4PNFA 4FYUA 1Y6EA 2EFHA 4USSA 5D9VA 5JWRB 3ERFA 3D4TA 2PUKC 1GSSA 4WKWA 5D96A 1JHBA 1GUHA 2XC2A 2H73A 4AKGA 1RQMA 4W66A 4ZIJA 1GLPA 3A3TA 2LSTA 1X9SB 1YEWC 2IMEA 2DIZA 4IQAA 1NM3A 3FHKA 3LXTA 3LXZA 4PGTA 3ZL5A 2CVKA 4K6XA 5ID2A 1SKSB 4BL7A 1Z6MA 3ZFLA 6GSUA 3EYTA 1A8YA 1S4BP 1F9MA 3CRUA 3FR6A 4AGSA 1LBKA 4BVXB 1PMTA 3KEBA 1FHEA 4PURA 3IHQA 2O87A 4AJ8A 3P2AA 2X8HA 2RIIA 1E2YA 3Q74A 2K8VA 3C71A 5CO3A 5J41A 1USBA 3IAS2 3DYRA 4HI7A 1ACVA 3PR8A 1FG4A 3V1WA 2O3EA 1T1VA 4HJ2A 1XW5A 4GCIA 6GSXA 4ILFA 4MF6A 2G2QA 2YJHA 4AJ7A 1V2AA 1S3DA 1X9MB 3LJRA 2I3YA 2OBKA 2A4VA 2CZ2A 4MDCA 5A4WA 3E3EA 2IMDA 2J23A 4TXOB 3MDKA 3FRCA 1TU7A 2DLXA 3GN3A 4KA0A 4IW9A 4ZB8A 1TKDB 1XVWA 2FWFA 3CSJA 2UV8G 3W8SA 1X5CA 2XHFA 4F03A 1XWKA 1W4VA 2V6KA 4JBBA 4DSQA 1WE0A 10GSA 1WJKA 4KUNA 4FO5A 4X0XA 2MBSA 2JADA 1FOHA 2LQQA 1XOBA 5B8BA 2KUCA 3BCIA 1B48A 2L5OA 2FA4A 1FO5A 1ML6A 4POKA 1QUWA 1OC8A 2F8AA 1LU4A 3G7YA 1K0NA 2PWJA 5INYA 2AHEA 4WF5A 3CSHA 2PU9C 4IHUA 5A5HA 2R0GA 5GAND 1TDIA 3GV1A 4JR4A 1TK5B 1QFNA 1A24A 1J9BA 2Z9SA 4MP4A 4G0IA 5DJLA 2MBTA 2F9SA 4H86A 3FY7A 2V41A 4TR4A 2B6MA 4MPGA 5B6NA 1ILOA 3H79A 4OCFA 1XPVA 1EZKA 5JCGA 1M9AA 1NSWA 3GA4A 3EINA 1AIUA 2NDOA 1T7PB 1OKTA 3TUEA 1GTBA 2YNXA 3F3RA 4RI6A 2GZZA 1DE1A 2DJ1A 2CZ3A 1WRYA 2H8LA 1F3BA 5IMZA 4TR3A 1YJ6A 2RM6A 1HD2A 3WYWA 2JZRA 5A34B 1UN2A 4MJEA 5LCZA 1SJIA 5L71A 2N5BA 2DKIA 2C3NA 1WP0A 4KCEA 4Q5RA 2LJKA 3A2WA 3QOUA 4TR1A 4ML6A 3WGXA 4GXZA 4F0BA 1TRSA 1T4ZA 1AQWA 2H0IA 4IP1A 4PQ1A 1MDIA 2AUVA 1Z3EA 2IMFA 3GH9A 4F2IA 1MD3A 3IE3A 1HNCA 3KP8A 4LMVA 4EDYA 4K2DA 2HT9A 3RFRC 1GULA 1SKRB 3IK9A 4NPBA 2AB6A 4MJCA 3P90A 3P8WA 4GTUA 3UBKA 2YZUA 5IOXA 2YV9A 3FR9A 2H1AA 3HZ4A 4GRFA 3F8UA 3DVXA 1J0FA 1KEBA 1AQXA 4Q5FA 5ECMB 4OWYA 1SK1A 4BA7A 5C04A 2YCDA 3LGCA 2LRTA 3TKPA 4K1FA 1O8XA 3D22A 2GVPA 4KB3A 1VF4A 4XS1A 1URMA 1M3IA 2MMOA 1ZYEA 4MA9A 4MZCA 1K0CA 5E4WA 3ZRDA 1G7OA 2V1MA 2EIQA 3IOSA 1SYXA 5DQYA 3C8EA 5G1LA 4HQZA 3QR6A 2C3TA 2DC5A 2AV4A 4WBRD 1WPIA 1AW9A 4KGIA 3J7Yk 2WULA 1U88A 1YF0A 4RI7A 1GSQA 3ISOA 1BEDA 1XWBA 2DIYA 1H75A 2V32A 3QAWA 3HKRA 4CY6A 12GSA 3ME8A 5IMDA 3IBHA 1BF5A 4P3YB 2VD1A 3BBYA 3HVNA 1ST9A 2OE0A 1K0OA 4XS4B 4GSTA 2HZEB 4FIWA 2HSMB 2D2ZA 3UAPA 3GNJA 2IJYA 4RQRA 1XFLA 2VKZG 1TXXA 2EIRA 3EMPA 3TCOA 3LG6A 2GSRA 2HRKB 5A4UA 3UEMA 1XG8A 1PKZA 1F2EA 1SD9A 3BD2A 1ZCPA 2PPTA 5JWQB 2VCWA 3IAM2 4HEA2 1VF2A 1TI3A 3LYKA 3GIXA 2N5FA 1U6TA 1B8XA 5J4UA 3QDNA 3IC4A 1S3AA 4EVMA 4YH2A 4BVYA 2OBIA 1OYJA 2DMLA 2R6KA 4JR6A 3BCKA 2FCHA 4KH7A 2G0FA 4TR0A 3EMXA 4IJ3A 4YQVA 2FA8A 2F51A 5JCUA 3IDVA 4HU9A 5IIZA 3H1NA 1GSYA 2GT5A 5LNKe 2H1GA 2VL9A 2MYGA 2MMNA 2H01A 1V57A 3HYPA 4V2NA 2KP2A 1U3AA 4YKFA 1TK8B 2JZSA 1G6YA 4GF0A 3APQA 1TJDA 1SYRA 4MLYA 1EGOA 1SENA 2VCZA 4HS1A 4PTSA 1ZOFA 2HFDA 3HVSA 4GLTA 5IMFA 5LD0A 4BWSA 3TJJA 4ZBBA 4HSCX 4K8MA 4XRAA 2A2RA 4GSSA 2WZ9A 4KE3A 1PX7A 4PUAA 4E68A 1A23A 2OE3A 3F9UA 3GH6A 2JSZA 3JCML 4KAEA 4TVEA 5HFIA 3I43A 5KN3A 4D73B 1SD8A 1FW1A 3LFLA 4XRDA 5A1NB 18GSA 2VM2A 3IK7A 1MD4A 4KDYA 5ECPB 2B1KA 3HD5A 4CW9A 2C4JA 2OADA 1M2AA 3TKSE 4A5PA 4ECIA 3F0IA 5DAKA 1PN0A 1GNEA 3FZ5A 1TU8A 1BYEA 1TI1A 1UVZA 3CXGA 4OO4A 4AJ6A 4GSNA 1Q98A 2CVDA 2ON5A 2I9HA 1M2BA 2WJUA 4J2FA 3QAVA 1GUKA 3GURA 3ERWA 4TW5A 4GQFA 3HA9A 4OFNA 4PI0C 1EOGA 5COHA 2WVXB 1YKAA 1GNWA 4AKHA 4ECJA 2BMXA 5ECQB 4YQUA 3WGDA 4TOPA 1EP7A 2QGVA 2F3MA 1T00A 3R3EA 1ZMAA 1N8JA 2H76A 2WVZA 4DSSA 2O85A 5CRWA 1PFOA 4BPYA 2LRNA 2EIOA 1Y25A 3FR3A 4IN0A 4OFTA 3KP9A 3QFAC 2H66A 2EC4A 2E2GA 1ON4A 2JL4A 3HZ8A 1K0BA 2TRCP 3MSZA 1XZOA 3QFBC 2C0FA 1SK2A 1THOA 4F0CA 1FVKA 5DQSA 1SKWB 4KF9A 2LJRA 2GQMA 4POMA 3M8NA 2K18A 5IMAA 3KD0A 3FK8A 4JZQA 2JSYA 1OE7A 4Q5QA 1SVLA 1OC9B 5ECNB 3PH9A 1BQ7A 2WGRA 2CQ9A 2R0PA 5KEJA 1T4YA 2YPMA 1IYIA 3HJOA 4AF2A 1KBNA 4TKYA 1YY7A 1R5PA 2MMAA 2VL3A 4JRRA 1E6BA 1K3OA 4MH2A 1OAZA 4MNNA 2YOIA 3GMFA 3IC8A 1A2MA 2DKHA 2YWOA 3A2XA 3NOFA 3APOA 4FYCA 2LKUA 2PN8A 2O8VB 3LYPA 1H4OA 3E0UA 4MCUA 1F37A 2EFCA 4ZB9A 3UBLA 2DJ2A 3HCZA 1SL2B 5IPHA 3EPTA 1OE8A 5IMCA 3GSSA 2VIMA 2H1LA 11GSA 2WW2A 5HR1A 1X5EA 4ZB7A 2M80A 4LL1B 5J4YA 1YQ1A 4AI6A 5ELGA 1GP1A 4OO5A 3HMJG 4HDEA 3WT2A 5ENUA 2HI7A 2ZUPA 14GSA 4ACSA 2H70A 4EIQA 1ERTA 1LJRA 3M1GA 5IPGA 3GKKA 3Q18A 1O81A 5CREA 2VO4A 1T3BA 2TRXA 4HUAA 2YANA 3HXSA 5B6MA 4LL4B 3L4NA 5J3RA 1DUGA 3APSA 4TXVA 2VCXA 4TXOA 2C80A 4NV5A 1O73A 1K3LA 1OKDA 4BWQA 2M72A 3TJGA 1R4WA 2VL2C 4G0LA 3MYDA 3UIWA 1BJXA 2GQLA 3VWWA 2H6XA 2IPAA 2E2MA 1TOFA 5FHIA 2DJJA 3L78A 5CRDA 5FT3A 3S9FA 4KDXA 4PI2C 5ELAA 3GYKA 2QA2A 3FZAA 2IFQB 2E7PA 5J47A 3D6IA 4O5UA 3QPMA 1UA5A 5DCHA 4ID0A 3RBTA 3DEXA 2HSYA 1YVLA 1QMVA 2O89A 4ISDA 3DIEA 2MMZA 4GDFA 1PKWA 1JZWA 2X49A 2WB9A 3TKSA 4K7IA 3UL3A 2HNLA 4GQCA 2HRAA 1M9BA 1J08A 2FUG2 1V9WA 2R37A 2HSHA 2WFCA 3C73A 5EVOA 4G10A 3IRAA 3Q6OA 1S3RA 20GSA 2K9FA 2R3XA 5G31A 2WW3A 1GH2A 2GSSA 4WF4A 3IXRA 4HQSA 4WEYA 4O5QA 1THXA 3CYNA 1CQGA 1BG5A 1Z9HA 3A2VA 3TGZA 4ICYA 1YF1A 3F4RA 5E59A 3DXBA 2OKAA 2PGTA 2C0GA 2GSTA 3FKFA 4KNDA 1G0TA 1TP9A 3R2QA 1EEJA 5A34A 2YZHA 5KOWA 1O8WA 5ECRB 5IMVA 1XWAA 3ZFBA 3F63A 5DALB 4J56E 3UVHA 1XW6A 5BMUA 2P5RA 2CA8A 3M3MA 1TTZA 1ZYPA 5AIVA 1JFUA 1X5DA 4DVCA 1GTAA 3N9JA 5ECOB 1EWXA 4EIPA 3LWAA 4TN8A 2LNSA 2WDUA 2DSAA 2FWHA 5GZZB 1PSQA 2XPEA 3WGEA 4CY8A 4IS0A 1VGLA 3HHVA 2DJ3A 4EF0A 1XW9A 2B1LA 4MABA 3N5OA 3U5RE 1WMJA 2H0HA 2YWIA 3GHAA 3O3TA 2GGTA 2L59A 5DCGA 1NHYA 3MIXA 5F06A 4WXTA 4OFMA 2VLVA 4EO3A 3HJMA 3EE2A 4K5RA 4KX4A 3C1SA 4G9HA 5IO0A 3O76A 2XPDA 3ZMKA 2FY6A 4ECCA 1XBSA 2BJXA 1BAYA 2ALBA 4EXJA 3A5IA 3M0FA 2IN3A 1O7UA 3ZREA 4ZL9A 5ABRA 1ZYQB 2QA1A 4K0GA 3E9JB 4IQ1A 3D5JA 3L9VA 1GTUA 2V2GA 4POLA 4K9ZA 2B5EA 4NHWA 17GSA 4PUFC 4MJBA 1DBYA 4FQUA 3CMIA 5AN1A 3CSIA 1M2DA 4XTSA 4IBPA 1GSUA 4O7HA 5CRGA 3VPQA 2FHEA 3TKSC 3TOTA 5F8BA 2L6DA 1PL2A 2CAQA 5ECKB 5CRHA 2ON7A 4XS4A 1SJ6A 2N5AA 2HZEA 2LUSA 5G5EA 2HSMA 2UZ8A 2LRCA 3IHGA 2A4HA 2C0EA 2H19A 1A0RP 3UOMA 1GSFA 1YKCA 4NV2A 5DBQA 2RUFA 2HRKA 2X64A 3MAKA 3D0ZA 4IELA 3TJKA 3NIVA 2AAWA 3ZTLA 3DMLA 1AAZA 4FXYP 5EL8A 3L9UA 2GQKA 4N3ZA 2DMMA 4GWRA 2C0DA 4E8EA 1SU9A 4MJAA 4QL9A 2NVLA 3CTFA 4HJMA 3K8NA 3GTUB 2ES7A 1FOVA 2K8SA 4IKHA 3UMAA 2X99A 3KCMA 1SVOA 2YWNA 3PPUA 4HZ2A 7GSSA 2HSNB 2LQOA 3IR4A 2H72A 4J57E 4POBA 2KLXA 2E0QA 4HU7A 5ECLB 1A8LA 4EDZA 1PL1A 4ML1A 5IQYA 4I5QA 5GAPD 2EFDA 1DE2A 2J9HA 1MDKA 3EWLA 2DBCA 3TU3B 5H5QA 2JZTA 4LA1A 4PX1A 2A2PA 2V6OA 2B5YA 2YP6A 4WR4A 5A4VA 3GSTA 3F6FA 3VI7A 5DJMA 4MZWA 1K0MA 3DD3A 1EEMA 2F8FA 4BIKA 6GSVA 4V2LA 5IO2A 3KIJA 5F0GA 4IVFA 1N25A 1U3IA 1F3AA 2LTKA 5ID2B 1QQ2A 3KH7A 2RUEA 4I2UA 4BL7B 1OC3A 2KP1A 2YV7A 2VL2A 1XWGA 4RUVA 4KSMA 3W6GA 4D73A 1EOHA 1I1IP 2CX3A 2IIYA 3IPZA 4CHSA 1FAAA 2XBIA 4ECBA 5KN2A 1N2AA 2PMTA 2HQTA 3H93A 5HQPA 4N11A 5A1NA 5KN1A 3US3A 1MDJA 2FWEA 6GSSA 3G7JA 1Z5YE 5G1KA 4YQMA 2FD3A 2P0GA 1EV4A 4V1Ag 3GFKA 5JCWA 2QKEA 5D73A 2O36A 1MTCA 4ZB6A 1BX9A 2PVOC 2PBJA 4YAVA 1GL8A 4HZ4A 3I6AA 2HXKA 3KMNA 5ECSA 2GZYA 3KM6A 1DSBA 19GSA 2DJKA 6GSYA 4MF5A 2IWTA 3IA1A 3LORA 5KN0A
chains in the Genus database with same CATH topology
1A0FA 3GRXA 2H6ZA 2L4QA 5F07A 2EFEA 4G19A 1R5AA 2R5GA 1PQNA 2REMA 2R0CA 3VWVA 1HNAA 3BJ5A 4IJIA 4XCSA 4NMUA 2O5VA 3RPNA 4N30A 1B9XC 3LSZA 2ZNMA 1HYUA 4NXIA 3J7Yb 1TK0B 5G2ZA 4O92A 3NZNA 4K7OA 4EC0A 4ZILA 4F9ZA 5DVBA 5KOXA 3ERGA 2GS3A 1RK4A 2IMKA 4AKIA 1JZOA 3H4KA 4V2MA 2L4CA 1K3YA 4IGJA 2CAIA 2HYXA 3VI5A 3RPPA 4I97A 4KW6A 4XIHA 1AC1A 1JLWA 2VCQA 2GLRA 5A5HB 5ECIB 4ZBAA 5CNWA 1Z7RA 1SJZA 1ZZYA 2H75A 3HVXA 3TB2A 3VWXA 1NW2A 1VF1A 4KCAA 1EGRA 4DEJA 4BVXA 1YDKA 3DGQA 4EKZA 4TRXA 2PERA 4N0VA 2R2JA 2VLTA 3ZYWA 4QMKA 5FWGA 1OC9A 1Q4JA 4X43A 1O6JA 2NPBA 1V40A 4K7NA 3UARA 1ERWA 3D21A 4YKGA 1B4PA 3IV4A 3TKRA 3CRTA 1PD21 4ZL7A 1K0DA 4QQ7A 1YEPA 1FVJA 3FYGA 1Z7PA 2IL3A 4X4JA 1M7TA 4MF7A 2LJAA 2KHPA 3EU3A 1FB0A 5H5RA 3TDGA 3EU4A 2ZCTA 4G2EA 4I6XA 1AXDA 5D93A 1AQVA 3FW2A 1Y1UA 4XHMA 3ZIVA 1YZXA 16GSA 1SVMA 4TR1B 5HR3A 2BTOT 1M99A 4NWYA 1AUCA 3VURA 4ZXGA 3KH9A 2VUPA 2OE1A 2H74A 3EC3A 2FLSA 1XWCA 2H30A 4LMWA 2JU5A 2VLUA 2MZCA 2B3SA 5HFGA 2YJ7A 2I1UA 1JZDA 3MNGA 3KMOA 2AJQB 1RW1A 13GSA 4G01A 3G9BA 1ABAA 1PN9A 2A2SA 1TW9A 1G7EA 2YWMA 4L8EA 3VWUA 3VPTA 4OMVA 3ME7A 2VCTA 3KZQA 3LEFA 5CP1A 3TKQA 3CBUA 3GL5A 3I9V2 1WWJA 1VF3A 3F6DA 1EV9A 1ERVA 2CV4A 4OCEA 22GSA 3GX0A 2GZPA 2WS2A 2R4VA 2LEGA 3DVWA 4L5OA 2L57A 2CT6A 1TRVA 5G30A 2I81A 2NTOA 2B7KA 5EPFA 3GKNA 5BMUB 2H71A 3TOUA 3ZITA 2H6YA 1QXHA 1GWCA 5J9CA 1IYHA 5J5NA 5DDLA 1I5GA 3ZIJA 5C00A 3ED3A 4N0ZA 4G0KA 2IFQA 2L5LA 4JU5A 4MMMA 3RDWA 3WD6A 3SWLA 2FGXA 2WRTA 2OACA 1FB6A 2OJLA 1XXUA 3RHBA 2X4AA 1T8EB 3GKXA 5GSTA 1PRXA 3TRXA 5HR0A 2HZFA 4O5RA 2I4AA 3FZ9A 3EURA 1X0RA 3W8JA 1QK8A 2TIRA 2C1YA 5ECHB 4NHZA 2H1BA 4V1Ap 2VCVA 3OR5A 1KTEA 2VAFA 4Q5NA 5CYYA 3TRPA 2FWGA 5AGYA 1TRWA 9GSSA 3C7MA 3FEUA 2HLSA 1O85A 2HRFA 1GUMA 2NBSA 3DKSA 3PINA 2CX4A 4X1UA 2GTUA 4PQHA 1A2JA 4FH8A 2GT6A 3RAZA 3LQ7A 1U87A 2OA7A 3A5WA 4BVYB 3F3QA 4QL7A 4KSOA 4N10A 4CDOA 4KDUA 5CAXA 1ZGNA 1W89A 4ULXA 5D9WA 3M9KA 4Z7XA 1MEKA 5AIXA 4AKXB 4WBJA 3SBCA 2K6VA 2XBQA 5J40A 1JZRA 3EVIA 4I2TA 1GRXA 3FZ4A 1NHOA 3GUSA 3P7XA 1YEXA 5DALA 2DJ0A 3DWVA 3AY8A 1Z6NA 3VFIA 1XIYA 3TJFA 4Z2RA 4L0UA 2LV3A 2RLIA 2HE3A 3KGKA 1HQOA 4XS6A 3C1RA 4K5SA 4ZL8A 1V58A 3HDCA 4O32A 5J9BA 2H0GA 2CVBA 2JACA 3GKMA 3UJ1A 1EP8A 1HNBA 4OD7A 1PGTA 2QC7A 3L9SA 1GSDA 1M0UA 5D9XA 4I8BA 1PA3A 1CQHA 4RQXA 1B9YC 2KOKA 4NAXA 3PGTA 5IOWA 3HJPA 4ZBDA 3CTGA 5HFKA 3KTBA 4K0NA 3U6VA 3RHCA 5G5FA 5B8AA 1ZYNA 3O6TA 3HVVA 4WR5A 1I9DA 4WETA 5JWOB 2AYTA 1X9WB 2VM1A 1SL0B 5GSSA 5F05A 2PVQA 4JEDA 2P5QA 4EL1A 1R7HA 2B7JA 2P31A 3KTLA 5EY6A 1ERUA 4DSRA 3I69A 4L5LA 4YAPA 3L0HA 5H5SA 3F4SA 2LNTA 1G6WA 1GLQA 1K0AA 4MPFA 2WCIA 2M46A 3VK9A 5A5KA 1SK0A 5DAKB 3QCPA 1B4QA 6GSWA 3Q19A 4MZBA 2X8CA 1S3CA 1XCCA 3H8QA 4MK3A 2QSIA 3QAGA 3FMWA 1R26A 1TXUA 2YN1A 2VD0A 3G7IA 6GSTA 3GX8A 4K2XA 3QD9A 4E8HA 3UVTA 2X8GA 2GSQA 3TRQA 2GDRA 2OT3A 3LW9A 4Z2TA 1ZL9A 2HRNA 2VOCA 4HOJA 4EE0A 4EUYA 3KJYA 1GTIA 2H1DA 4MH3A 5BRTA 4PQIA 8GSSA 3DRNA 3TJBA 4DSSB 5B7CA 1A2LA 5IM9A 2C8UA 4IP6A 3QMXA 1F6MC 3M9JA 1TRUA 3F4TA 1SL1B 2O7KA 1KNGA 1OVNA 5D9TA 1JLVA 2LS5A 3HY2A 3WT1A 5AISA 3KXOA 4JE1A 3ZVJA 3CWGA 3ZVJD 2RM5A 3D4MA 1XOAA 3MWHA 5D8IA 3ZMLA 5HR2A 2IMIA 2C3QA 4PNGA 1BG1A 1WIKA 4PXOA 4F82A 1VRSD 1WOUA 2FNOA 3GL3A 3GTUA 3ZLPA 1UC7A 3VLNA 3BOAA 4Z2UA 2L6CA 3ZZXA 2HSNA 4LLRA 2B5XA 1XVQA 4L0WA 1C72A 1PX6A 1GSEA 5J4VA 1QGVA 4FYBA 1V98A 4PNFA 4FYUA 1Y6EA 2EFHA 4USSA 5D9VA 5JWRB 3ERFA 3D4TA 2PUKC 1GSSA 4WKWA 5D96A 1JHBA 1GUHA 2XC2A 2H73A 4AKGA 1RQMA 4W66A 4ZIJA 1GLPA 3A3TA 2LSTA 1X9SB 2IMEA 2DIZA 4IQAA 1NM3A 3FHKA 3LXTA 3LXZA 4PGTA 3ZL5A 2CVKA 4K6XA 5ID2A 1SKSB 4BL7A 1Z6MA 3ZFLA 6GSUA 3EYTA 1A8YA 1F9MA 3CRUA 3FR6A 4AGSA 1LBKA 4BVXB 1PMTA 3KEBA 1FHEA 4PURA 3IHQA 2O87A 4AJ8A 3P2AA 2X8HA 2RIIA 1E2YA 3Q74A 2K8VA 3C71A 5CO3A 5J41A 1USBA 3IAS2 3DYRA 4HI7A 1ACVA 3PR8A 1FG4A 3V1WA 1T1VA 4HJ2A 1XW5A 4GCIA 6GSXA 4ILFA 4MF6A 2G2QA 2YJHA 4AJ7A 1V2AA 1S3DA 1X9MB 3LJRA 2I3YA 2OBKA 2A4VA 2CZ2A 4MDCA 5A4WA 3E3EA 2IMDA 2J23A 4TXOB 3MDKA 3FRCA 1TU7A 2DLXA 3GN3A 4KA0A 4IW9A 4ZB8A 1TKDB 1XVWA 2FWFA 3CSJA 2UV8G 3W8SA 1X5CA 2XHFA 4F03A 1XWKA 1W4VA 2V6KA 4JBBA 4DSQA 1WE0A 10GSA 1WJKA 4KUNA 4FO5A 4X0XA 2MBSA 2JADA 1FOHA 2LQQA 1XOBA 5B8BA 2KUCA 3BCIA 1B48A 2L5OA 2FA4A 1FO5A 1ML6A 4POKA 1QUWA 1OC8A 2F8AA 1LU4A 3G7YA 1K0NA 2PWJA 5INYA 2AHEA 4WF5A 3CSHA 2PU9C 4IHUA 5A5HA 2R0GA 5GAND 1TDIA 3GV1A 4JR4A 1TK5B 1QFNA 1A24A 1J9BA 2Z9SA 4MP4A 4G0IA 5DJLA 2MBTA 2F9SA 4H86A 3FY7A 2V41A 4TR4A 2B6MA 4MPGA 5B6NA 1ILOA 3H79A 4OCFA 1XPVA 1EZKA 5JCGA 1M9AA 1NSWA 3GA4A 3EINA 1AIUA 2NDOA 1T7PB 1OKTA 3TUEA 1GTBA 2YNXA 3F3RA 4RI6A 2GZZA 1DE1A 2DJ1A 2CZ3A 1WRYA 2H8LA 1F3BA 5IMZA 4TR3A 1YJ6A 2RM6A 1HD2A 3WYWA 2JZRA 5A34B 1UN2A 4MJEA 5LCZA 1SJIA 5L71A 2N5BA 2DKIA 2C3NA 1WP0A 4KCEA 4Q5RA 2LJKA 3A2WA 3QOUA 4TR1A 4ML6A 3WGXA 4GXZA 4F0BA 1TRSA 1T4ZA 1AQWA 2H0IA 4IP1A 4PQ1A 1MDIA 2AUVA 1Z3EA 2IMFA 3GH9A 4F2IA 1MD3A 3IE3A 1HNCA 3KP8A 4LMVA 4EDYA 4K2DA 2HT9A 1GULA 1SKRB 3IK9A 4NPBA 2AB6A 4MJCA 3P90A 3P8WA 4GTUA 3UBKA 2YZUA 5IOXA 2YV9A 3FR9A 2H1AA 3HZ4A 4GRFA 3F8UA 3DVXA 1J0FA 1KEBA 1AQXA 4Q5FA 5ECMB 4OWYA 1SK1A 4BA7A 5C04A 2YCDA 3LGCA 2LRTA 3TKPA 4K1FA 1O8XA 3D22A 2GVPA 4KB3A 1VF4A 4XS1A 1URMA 2MMOA 1ZYEA 4MA9A 4MZCA 1K0CA 5E4WA 3ZRDA 1G7OA 2V1MA 2EIQA 3IOSA 1SYXA 5DQYA 3C8EA 5G1LA 4HQZA 3QR6A 2C3TA 2DC5A 2AV4A 4WBRD 1WPIA 1AW9A 4KGIA 3J7Yk 2WULA 1U88A 1YF0A 4RI7A 1GSQA 3ISOA 1BEDA 1XWBA 2DIYA 1H75A 2V32A 3QAWA 3HKRA 4CY6A 12GSA 3ME8A 5IMDA 3IBHA 1BF5A 4P3YB 2VD1A 3BBYA 1ST9A 2OE0A 1K0OA 4XS4B 4GSTA 2HZEB 4FIWA 2HSMB 2D2ZA 3UAPA 3GNJA 2IJYA 4RQRA 1XFLA 2VKZG 1TXXA 2EIRA 3EMPA 3TCOA 3LG6A 2GSRA 2HRKB 5A4UA 3UEMA 1PKZA 1F2EA 1SD9A 3BD2A 1ZCPA 2PPTA 5JWQB 2VCWA 3IAM2 4HEA2 1VF2A 1TI3A 3LYKA 3GIXA 2N5FA 1U6TA 1B8XA 5J4UA 3QDNA 3IC4A 1S3AA 4EVMA 4YH2A 4BVYA 2OBIA 1OYJA 2DMLA 2R6KA 4JR6A 3BCKA 2FCHA 4KH7A 2G0FA 4TR0A 3EMXA 4IJ3A 4YQVA 2FA8A 2F51A 5JCUA 3IDVA 4HU9A 5IIZA 3H1NA 1GSYA 2GT5A 5LNKe 2H1GA 2VL9A 2MYGA 2MMNA 2H01A 1V57A 3HYPA 4V2NA 2KP2A 1U3AA 4YKFA 1TK8B 2JZSA 1G6YA 4GF0A 3APQA 1TJDA 1SYRA 4MLYA 1EGOA 1SENA 2VCZA 4HS1A 4PTSA 1ZOFA 2HFDA 3HVSA 4GLTA 5IMFA 5LD0A 4BWSA 3TJJA 4ZBBA 4K8MA 4XRAA 2A2RA 4GSSA 2WZ9A 4KE3A 1PX7A 4PUAA 4E68A 1A23A 2OE3A 3F9UA 3GH6A 2JSZA 3JCML 4KAEA 4TVEA 5HFIA 3I43A 5KN3A 4D73B 1SD8A 1FW1A 3LFLA 4XRDA 5A1NB 18GSA 2VM2A 3IK7A 1MD4A 4KDYA 5ECPB 2B1KA 3HD5A 4CW9A 2C4JA 2OADA 1M2AA 3TKSE 4A5PA 4ECIA 3F0IA 5DAKA 1PN0A 1GNEA 3FZ5A 1TU8A 1BYEA 1TI1A 1UVZA 3CXGA 4OO4A 4AJ6A 4GSNA 1Q98A 2CVDA 2ON5A 2I9HA 1M2BA 2WJUA 4J2FA 3QAVA 1GUKA 3GURA 3ERWA 4TW5A 4GQFA 3HA9A 4OFNA 1EOGA 5COHA 1YKAA 1GNWA 4AKHA 4ECJA 2BMXA 5ECQB 4YQUA 3WGDA 4TOPA 1EP7A 2QGVA 2F3MA 1T00A 3R3EA 1ZMAA 1N8JA 2H76A 4DSSA 2O85A 5CRWA 4BPYA 2LRNA 2EIOA 1Y25A 3FR3A 4IN0A 4OFTA 3KP9A 3QFAC 2H66A 2EC4A 2E2GA 1ON4A 2JL4A 3HZ8A 1K0BA 2TRCP 3MSZA 1XZOA 3QFBC 2C0FA 1SK2A 1THOA 4F0CA 1FVKA 5DQSA 1SKWB 4KF9A 2LJRA 2GQMA 4POMA 3M8NA 2K18A 5IMAA 3KD0A 3FK8A 4JZQA 2JSYA 1OE7A 4Q5QA 1SVLA 1OC9B 5ECNB 3PH9A 1BQ7A 2WGRA 2CQ9A 2R0PA 5KEJA 1T4YA 2YPMA 1IYIA 3HJOA 4AF2A 1KBNA 4TKYA 1YY7A 1R5PA 2MMAA 2VL3A 4JRRA 1E6BA 1K3OA 4MH2A 1OAZA 4MNNA 2YOIA 3GMFA 3IC8A 1A2MA 2DKHA 2YWOA 3A2XA 3NOFA 3APOA 4FYCA 2LKUA 2PN8A 2O8VB 3LYPA 1H4OA 3E0UA 4MCUA 1F37A 2EFCA 4ZB9A 3UBLA 2DJ2A 3HCZA 1SL2B 5IPHA 3EPTA 1OE8A 5IMCA 3GSSA 2VIMA 2H1LA 11GSA 5HR1A 1X5EA 4ZB7A 2M80A 4LL1B 5J4YA 1YQ1A 4AI6A 5ELGA 1GP1A 4OO5A 3HMJG 4HDEA 3WT2A 5ENUA 2HI7A 2ZUPA 14GSA 4ACSA 2H70A 4EIQA 1ERTA 1LJRA 3M1GA 5IPGA 3GKKA 3Q18A 1O81A 5CREA 2VO4A 1T3BA 2TRXA 4HUAA 2YANA 3HXSA 5B6MA 4LL4B 3L4NA 5J3RA 1DUGA 3APSA 4TXVA 2VCXA 4TXOA 2C80A 4NV5A 1O73A 1K3LA 1OKDA 4BWQA 2M72A 3TJGA 1R4WA 2VL2C 4G0LA 3MYDA 3UIWA 1BJXA 2GQLA 3VWWA 2H6XA 2IPAA 2E2MA 1TOFA 5FHIA 2DJJA 3L78A 5CRDA 5FT3A 3S9FA 4KDXA 5ELAA 3GYKA 2QA2A 3FZAA 2IFQB 2E7PA 5J47A 3D6IA 4O5UA 3QPMA 1UA5A 5DCHA 4ID0A 3RBTA 3DEXA 2HSYA 1YVLA 1QMVA 2O89A 4ISDA 3DIEA 2MMZA 4GDFA 1PKWA 1JZWA 2X49A 2WB9A 3TKSA 4K7IA 3UL3A 2HNLA 4GQCA 2HRAA 1M9BA 1J08A 2FUG2 1V9WA 2R37A 2HSHA 2WFCA 3C73A 5EVOA 4G10A 3IRAA 3Q6OA 20GSA 2K9FA 2R3XA 5G31A 1GH2A 2GSSA 4WF4A 3IXRA 4HQSA 4WEYA 4O5QA 1THXA 3CYNA 1CQGA 1BG5A 1Z9HA 3A2VA 3TGZA 4ICYA 1YF1A 3F4RA 5E59A 3DXBA 2OKAA 2PGTA 2C0GA 2GSTA 3FKFA 4KNDA 1G0TA 1TP9A 3R2QA 1EEJA 5A34A 2YZHA 5KOWA 1O8WA 5ECRB 5IMVA 1XWAA 3ZFBA 3F63A 5DALB 4J56E 3UVHA 1XW6A 5BMUA 2P5RA 2CA8A 3M3MA 1TTZA 1ZYPA 5AIVA 1JFUA 1X5DA 4DVCA 1GTAA 3N9JA 5ECOB 1EWXA 4EIPA 3LWAA 4TN8A 2LNSA 2WDUA 2DSAA 2FWHA 5GZZB 1PSQA 2XPEA 3WGEA 4CY8A 4IS0A 1VGLA 3HHVA 2DJ3A 4EF0A 1XW9A 2B1LA 4MABA 3N5OA 3U5RE 1WMJA 2H0HA 2YWIA 3GHAA 3O3TA 2GGTA 2L59A 5DCGA 1NHYA 3MIXA 5F06A 4WXTA 4OFMA 2VLVA 4EO3A 3HJMA 3EE2A 4K5RA 4KX4A 3C1SA 4G9HA 5IO0A 3O76A 2XPDA 3ZMKA 2FY6A 4ECCA 1XBSA 2BJXA 1BAYA 2ALBA 4EXJA 3A5IA 3M0FA 2IN3A 1O7UA 3ZREA 4ZL9A 5ABRA 1ZYQB 2QA1A 4K0GA 3E9JB 4IQ1A 3D5JA 3L9VA 1GTUA 2V2GA 4POLA 4K9ZA 2B5EA 4NHWA 17GSA 4PUFC 4MJBA 1DBYA 4FQUA 3CMIA 5AN1A 3CSIA 1M2DA 4XTSA 4IBPA 1GSUA 4O7HA 5CRGA 3VPQA 2FHEA 3TKSC 3TOTA 5F8BA 2L6DA 1PL2A 2CAQA 5ECKB 5CRHA 2ON7A 4XS4A 1SJ6A 2N5AA 2HZEA 2LUSA 5G5EA 2HSMA 2UZ8A 2LRCA 3IHGA 2A4HA 2C0EA 2H19A 1A0RP 3UOMA 1GSFA 1YKCA 4NV2A 5DBQA 2RUFA 2HRKA 2X64A 3MAKA 3D0ZA 4IELA 3TJKA 3NIVA 2AAWA 3ZTLA 3DMLA 1AAZA 5EL8A 3L9UA 2GQKA 4N3ZA 2DMMA 4GWRA 2C0DA 4E8EA 1SU9A 4MJAA 4QL9A 2NVLA 3CTFA 4HJMA 3K8NA 3GTUB 2ES7A 1FOVA 2K8SA 4IKHA 3UMAA 2X99A 3KCMA 1SVOA 2YWNA 3PPUA 4HZ2A 7GSSA 2HSNB 2LQOA 3IR4A 2H72A 4J57E 4POBA 2KLXA 2E0QA 4HU7A 5ECLB 1A8LA 4EDZA 1PL1A 4ML1A 5IQYA 4I5QA 5GAPD 2EFDA 1DE2A 2J9HA 1MDKA 3EWLA 2DBCA 3TU3B 5H5QA 2JZTA 4LA1A 4PX1A 2A2PA 2V6OA 2B5YA 2YP6A 4WR4A 5A4VA 3GSTA 3F6FA 3VI7A 5DJMA 4MZWA 1K0MA 3DD3A 1EEMA 2F8FA 6GSVA 4V2LA 5IO2A 3KIJA 5F0GA 4IVFA 1N25A 1U3IA 1F3AA 2LTKA 5ID2B 1QQ2A 3KH7A 2RUEA 4I2UA 4BL7B 1OC3A 2KP1A 2YV7A 2VL2A 1XWGA 4RUVA 4KSMA 3W6GA 4D73A 1EOHA 2CX3A 2IIYA 3IPZA 4CHSA 1FAAA 2XBIA 4ECBA 5KN2A 1N2AA 2PMTA 2HQTA 3H93A 5HQPA 4N11A 5A1NA 5KN1A 3US3A 1MDJA 2FWEA 6GSSA 3G7JA 1Z5YE 5G1KA 4YQMA 2FD3A 2P0GA 1EV4A 4V1Ag 3GFKA 5JCWA 2QKEA 5D73A 1MTCA 4ZB6A 1BX9A 2PVOC 2PBJA 4YAVA 1GL8A 4HZ4A 3I6AA 2HXKA 3KMNA 5ECSA 2GZYA 3KM6A 1DSBA 19GSA 2DJKA 6GSYA 4MF5A 2IWTA 3IA1A 3LORA 5KN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0F A;  3GRX A;  2H6Z A;  2L4Q A;  5F07 A;  4G19 A;  1R5A A;  2R5G A;  1PQN A;  2REM A;  3VWV A;  1HNA A;  3BJ5 A;  4IJI A;  4XCS A;  4NMU A;  3RPN A;  4N30 A;  1B9X C;  3LSZ A;  2ZNM A;  1HYU A;  4NXI A;  3J7Y b;  1TK0 B;  5G2Z A;  4O92 A;  3NZN A;  4K7O A;  4EC0 A;  4ZIL A;  4F9Z A;  5DVB A;  3ERG A;  2GS3 A;  1RK4 A;  2IMK A;  1JZO A;  3H4K A;  4V2M A;  2L4C A;  1K3Y A;  4IGJ A;  2CAI A;  2HYX A;  3VI5 A;  3RPP A;  4I97 A;  4KW6 A;  4XIH A;  1AC1 A;  1JLW A;  2VCQ A;  2GLR A;  5ECI B;  4ZBA A;  5CNW A;  1Z7R A;  1SJZ A;  1ZZY A;  2H75 A;  3HVX A;  3TB2 A;  3VWX A;  1NW2 A;  1VF1 A;  4KCA A;  1EGR A;  4DEJ A;  4BVX A;  1YDK A;  3DGQ A;  4EKZ A;  4TRX A;  2PER A;  4N0V A;  2R2J A;  2VLT A;  3ZYW A;  1OC9 A;  5FWG A;  1Q4J A;  4X43 A;  1O6J A;  2NPB A;  1V40 A;  4K7N A;  3UAR A;  1ERW A;  3D21 A;  1B4P A;  3IV4 A;  3TKR A;  3CRT A;  1PD2 1;  4ZL7 A;  1K0D A;  4QQ7 A;  1YEP A;  1FVJ A;  3FYG A;  1Z7P A;  2IL3 A;  1M7T A;  4MF7 A;  2LJA A;  2KHP A;  3EU3 A;  1FB0 A;  5H5R A;  3TDG A;  3EU4 A;  2ZCT A;  4G2E A;  4I6X A;  1AXD A;  5D93 A;  1AQV A;  3FW2 A;  4XHM A;  3ZIV A;  1YZX A;  16GS A;  4TR1 B;  5HR3 A;  2BTO T;  1M99 A;  4NWY A;  1AUC A;  3VUR A;  4ZXG A;  3KH9 A;  2VUP A;  2OE1 A;  2H74 A;  3EC3 A;  2FLS A;  1XWC A;  2H30 A;  4LMW A;  2JU5 A;  2VLU A;  2MZC A;  2B3S A;  5HFG A;  2YJ7 A;  2I1U A;  1JZD A;  3MNG A;  3KMO A;  2AJQ B;  1RW1 A;  13GS A;  3G9B A;  1ABA A;  1PN9 A;  2A2S A;  1TW9 A;  1G7E A;  2YWM A;  4L8E A;  3VWU A;  3VPT A;  4OMV A;  3ME7 A;  2VCT A;  3KZQ A;  3LEF A;  5CP1 A;  3TKQ A;  3CBU A;  3GL5 A;  3I9V 2;  1WWJ A;  1VF3 A;  3F6D A;  1EV9 A;  1ERV A;  2CV4 A;  4OCE A;  22GS A;  3GX0 A;  2GZP A;  2WS2 A;  2R4V A;  2LEG A;  3DVW A;  4L5O A;  2L57 A;  2CT6 A;  1TRV A;  5G30 A;  2I81 A;  2NTO A;  2B7K A;  5EPF A;  3GKN A;  2H71 A;  3TOU A;  3ZIT A;  2H6Y A;  1QXH A;  1GWC A;  5J9C A;  1IYH A;  5J5N A;  5DDL A;  1I5G A;  3ZIJ A;  5C00 A;  3ED3 A;  4N0Z A;  4G0K A;  2IFQ A;  2L5L A;  4JU5 A;  4MMM A;  3RDW A;  3WD6 A;  3SWL A;  2FGX A;  2WRT A;  2OAC A;  1FB6 A;  2OJL A;  1XXU A;  3RHB A;  1T8E B;  3GKX A;  5GST A;  1PRX A;  3TRX A;  5HR0 A;  2HZF A;  4O5R A;  2I4A A;  3FZ9 A;  3EUR A;  1X0R A;  3W8J A;  1QK8 A;  2TIR A;  2C1Y A;  5ECH B;  4NHZ A;  2H1B A;  4V1A p;  2VCV A;  3OR5 A;  1KTE A;  2VAF A;  4Q5N A;  5CYY A;  3TRP A;  2FWG A;  5AGY A;  1TRW A;  9GSS A;  3C7M A;  3FEU A;  2HLS A;  1O85 A;  2HRF A;  1GUM A;  2NBS A;  3DKS A;  3PIN A;  2CX4 A;  4X1U A;  2GTU A;  4PQH A;  1A2J A;  4FH8 A;  2GT6 A;  3RAZ A;  3LQ7 A;  1U87 A;  2OA7 A;  3A5W A;  4BVY B;  3F3Q A;  4QL7 A;  4KSO A;  4N10 A;  4CDO A;  4KDU A;  5CAX A;  1ZGN A;  1W89 A;  4ULX A;  5D9W A;  3M9K A;  4Z7X A;  1MEK A;  5AIX A;  4WBJ A;  3SBC A;  2K6V A;  2XBQ A;  1JZR A;  3EVI A;  4I2T A;  1GRX A;  3FZ4 A;  1NHO A;  3GUS A;  3P7X A;  1YEX A;  5DAL A;  2DJ0 A;  3DWV A;  3AY8 A;  1Z6N A;  3VFI A;  1XIY A;  3TJF A;  4L0U A;  2LV3 A;  2RLI A;  2HE3 A;  3KGK A;  1HQO A;  4XS6 A;  3C1R A;  4ZL8 A;  1V58 A;  3HDC A;  4O32 A;  5J9B A;  2H0G A;  2CVB A;  2JAC A;  3GKM A;  3UJ1 A;  1EP8 A;  1HNB A;  4OD7 A;  1PGT A;  2QC7 A;  3L9S A;  1GSD A;  1M0U A;  5D9X A;  4I8B A;  1PA3 A;  1CQH A;  4RQX A;  1B9Y C;  2KOK A;  4NAX A;  3PGT A;  5IOW A;  3HJP A;  4ZBD A;  3CTG A;  5HFK A;  3KTB A;  4K0N A;  3U6V A;  3RHC A;  5G5F A;  5B8A A;  3O6T A;  3HVV A;  4WR5 A;  1I9D A;  4WET A;  5JWO B;  2AYT A;  1X9W B;  2VM1 A;  1SL0 B;  5GSS A;  5F05 A;  2PVQ A;  4JED A;  2P5Q A;  4EL1 A;  1R7H A;  2B7J A;  2P31 A;  3KTL A;  5EY6 A;  1ERU A;  4DSR A;  3I69 A;  4L5L A;  4YAP A;  3L0H A;  5H5S A;  3F4S A;  2LNT A;  1G6W A;  1GLQ A;  1K0A A;  4MPF A;  2WCI A;  2M46 A;  3VK9 A;  5A5K A;  1SK0 A;  5DAK B;  3QCP A;  1B4Q A;  6GSW A;  3Q19 A;  4MZB A;  2X8C A;  1S3C A;  1XCC A;  3H8Q A;  4MK3 A;  2QSI A;  3QAG A;  1R26 A;  2YN1 A;  2VD0 A;  3G7I A;  6GST A;  3GX8 A;  3QD9 A;  4E8H A;  3UVT A;  2X8G A;  2GSQ A;  3TRQ A;  2GDR A;  1ZL9 A;  2HRN A;  2VOC A;  4HOJ A;  4EE0 A;  4EUY A;  3KJY A;  1GTI A;  2H1D A;  4MH3 A;  4PQI A;  8GSS A;  3DRN A;  3TJB A;  4DSS B;  5B7C A;  1A2L A;  5IM9 A;  2C8U A;  4IP6 A;  3QMX A;  1F6M C;  3M9J A;  1TRU A;  3F4T A;  1SL1 B;  2O7K A;  1KNG A;  1OVN A;  5D9T A;  1JLV A;  2LS5 A;  3HY2 A;  3WT1 A;  5AIS A;  3KXO A;  4JE1 A;  3ZVJ A;  3ZVJ D;  2RM5 A;  3D4M A;  1XOA A;  3MWH A;  5D8I A;  3ZML A;  5HR2 A;  2IMI A;  2C3Q A;  4PNG A;  1WIK A;  4PXO A;  4F82 A;  1VRS D;  1WOU A;  2FNO A;  3GL3 A;  3GTU A;  3ZLP A;  1UC7 A;  3VLN A;  3BOA A;  2L6C A;  3ZZX A;  4LLR A;  2B5X A;  1XVQ A;  4L0W A;  1C72 A;  1PX6 A;  1GSE A;  1QGV A;  4FYB A;  1V98 A;  4PNF A;  4FYU A;  1Y6E A;  4USS A;  5D9V A;  5JWR B;  3ERF A;  3D4T A;  2PUK C;  1GSS A;  4WKW A;  5D96 A;  1JHB A;  1GUH A;  2XC2 A;  2H73 A;  1RQM A;  4ZIJ A;  1GLP A;  3A3T A;  2LST A;  1X9S B;  2IME A;  2DIZ A;  4IQA A;  1NM3 A;  3FHK A;  3LXT A;  3LXZ A;  4PGT A;  3ZL5 A;  2CVK A;  4K6X A;  5ID2 A;  1SKS B;  4BL7 A;  1Z6M A;  3ZFL A;  6GSU A;  3EYT A;  1A8Y A;  1F9M A;  3CRU A;  3FR6 A;  4AGS A;  1LBK A;  4BVX B;  1PMT A;  3KEB A;  1FHE A;  4PUR A;  3IHQ A;  2O87 A;  4AJ8 A;  3P2A A;  2X8H A;  2RII A;  1E2Y A;  3Q74 A;  2K8V A;  3C71 A;  5CO3 A;  5J41 A;  1USB A;  3IAS 2;  3DYR A;  4HI7 A;  1ACV A;  3PR8 A;  1FG4 A;  3V1W A;  1T1V A;  4HJ2 A;  1XW5 A;  4GCI A;  6GSX A;  4ILF A;  4MF6 A;  2G2Q A;  2YJH A;  4AJ7 A;  1V2A A;  1S3D A;  1X9M B;  3LJR A;  2I3Y A;  2OBK A;  2A4V A;  2CZ2 A;  4MDC A;  5A4W A;  3E3E A;  2IMD A;  2J23 A;  4TXO B;  3MDK A;  3FRC A;  1TU7 A;  2DLX A;  3GN3 A;  4KA0 A;  4IW9 A;  4ZB8 A;  1TKD B;  1XVW A;  2FWF A;  3CSJ A;  3W8S A;  1X5C A;  2XHF A;  4F03 A;  1XWK A;  1W4V A;  2V6K A;  4JBB A;  4DSQ A;  1WE0 A;  10GS A;  1WJK A;  4KUN A;  4FO5 A;  4X0X A;  2MBS A;  2JAD A;  2LQQ A;  1XOB A;  5B8B A;  2KUC A;  3BCI A;  1B48 A;  2L5O A;  2FA4 A;  1FO5 A;  1ML6 A;  4POK A;  1QUW A;  1OC8 A;  2F8A A;  1LU4 A;  3G7Y A;  1K0N A;  2PWJ A;  5INY A;  2AHE A;  4WF5 A;  3CSH A;  2PU9 C;  4IHU A;  5GAN D;  1TDI A;  3GV1 A;  4JR4 A;  1TK5 B;  1QFN A;  1A24 A;  1J9B A;  2Z9S A;  4MP4 A;  4G0I A;  5DJL A;  2MBT A;  2F9S A;  4H86 A;  3FY7 A;  2V41 A;  4TR4 A;  2B6M A;  4MPG A;  5B6N A;  1ILO A;  3H79 A;  4OCF A;  1XPV A;  1EZK A;  5JCG A;  1M9A A;  1NSW A;  3GA4 A;  3EIN A;  1AIU A;  2NDO A;  1T7P B;  1OKT A;  3TUE A;  1GTB A;  2YNX A;  3F3R A;  4RI6 A;  2GZZ A;  1DE1 A;  2DJ1 A;  2CZ3 A;  1WRY A;  2H8L A;  1F3B A;  5IMZ A;  4TR3 A;  1YJ6 A;  2RM6 A;  1HD2 A;  3WYW A;  2JZR A;  1UN2 A;  4MJE A;  5LCZ A;  1SJI A;  5L71 A;  2N5B A;  2C3N A;  1WP0 A;  4KCE A;  4Q5R A;  2LJK A;  3A2W A;  3QOU A;  4TR1 A;  4ML6 A;  3WGX A;  4GXZ A;  4F0B A;  1TRS A;  1T4Z A;  1AQW A;  2H0I A;  4IP1 A;  4PQ1 A;  1MDI A;  2AUV A;  1Z3E A;  2IMF A;  3GH9 A;  4F2I A;  1MD3 A;  3IE3 A;  1HNC A;  3KP8 A;  4LMV A;  4EDY A;  4K2D A;  2HT9 A;  1GUL A;  1SKR B;  3IK9 A;  4NPB A;  2AB6 A;  4MJC A;  3P90 A;  3P8W A;  4GTU A;  3UBK A;  2YZU A;  5IOX A;  2YV9 A;  3FR9 A;  2H1A A;  4GRF A;  3HZ4 A;  3F8U A;  3DVX A;  1J0F A;  1KEB A;  1AQX A;  4Q5F A;  5ECM B;  4OWY A;  1SK1 A;  4BA7 A;  5C04 A;  2YCD A;  3LGC A;  2LRT A;  3TKP A;  4K1F A;  1O8X A;  3D22 A;  2GVP A;  4KB3 A;  1VF4 A;  4XS1 A;  1URM A;  2MMO A;  1ZYE A;  4MA9 A;  4MZC A;  1K0C A;  5E4W A;  3ZRD A;  1G7O A;  2V1M A;  2EIQ A;  3IOS A;  1SYX A;  5DQY A;  3C8E A;  5G1L A;  4HQZ A;  3QR6 A;  2C3T A;  2DC5 A;  2AV4 A;  4WBR D;  1WPI A;  1AW9 A;  4KGI A;  3J7Y k;  2WUL A;  1U88 A;  1YF0 A;  4RI7 A;  1GSQ A;  3ISO A;  1BED A;  1XWB A;  2DIY A;  1H75 A;  2V32 A;  3QAW A;  3HKR A;  12GS A;  3ME8 A;  5IMD A;  3IBH A;  4P3Y B;  2VD1 A;  3BBY A;  1ST9 A;  2OE0 A;  1K0O A;  4XS4 B;  4GST A;  2HZE B;  4FIW A;  2HSM B;  2D2Z A;  3UAP A;  3GNJ A;  2IJY A;  4RQR A;  1XFL A;  1TXX A;  2EIR A;  3EMP A;  3TCO A;  3LG6 A;  2GSR A;  2HRK B;  5A4U A;  3UEM A;  1PKZ A;  1F2E A;  1SD9 A;  3BD2 A;  1ZCP A;  2PPT A;  5JWQ B;  2VCW A;  3IAM 2;  4HEA 2;  1VF2 A;  1TI3 A;  3LYK A;  3GIX A;  2N5F A;  1U6T A;  1B8X A;  5J4U A;  3QDN A;  3IC4 A;  1S3A A;  4EVM A;  4YH2 A;  4BVY A;  2OBI A;  1OYJ A;  2DML A;  2R6K A;  4JR6 A;  3BCK A;  2FCH A;  4KH7 A;  2G0F A;  4TR0 A;  3EMX A;  4IJ3 A;  4YQV A;  2FA8 A;  2F51 A;  5JCU A;  3IDV A;  4HU9 A;  5IIZ A;  3H1N A;  1GSY A;  2GT5 A;  5LNK e;  2H1G A;  2VL9 A;  2MYG A;  2MMN A;  2H01 A;  1V57 A;  3HYP A;  4V2N A;  2KP2 A;  1U3A A;  1TK8 B;  2JZS A;  1G6Y A;  4GF0 A;  3APQ A;  1TJD A;  1SYR A;  4MLY A;  1EGO A;  1SEN A;  2VCZ A;  4HS1 A;  4PTS A;  1ZOF A;  2HFD A;  3HVS A;  4GLT A;  5IMF A;  5LD0 A;  4BWS A;  3TJJ A;  4ZBB A;  4K8M A;  4XRA A;  2A2R A;  4GSS A;  2WZ9 A;  4KE3 A;  1PX7 A;  4PUA A;  1A23 A;  2OE3 A;  3F9U A;  3GH6 A;  2JSZ A;  3JCM L;  4KAE A;  4TVE A;  5HFI A;  3I43 A;  5KN3 A;  4D73 B;  1SD8 A;  1FW1 A;  3LFL A;  4XRD A;  18GS A;  2VM2 A;  3IK7 A;  1MD4 A;  4KDY A;  5ECP B;  2B1K A;  3HD5 A;  4CW9 A;  2C4J A;  2OAD A;  1M2A A;  3TKS E;  4ECI A;  3F0I A;  5DAK A;  3FZ5 A;  1GNE A;  1TU8 A;  1BYE A;  1TI1 A;  1UVZ A;  3CXG A;  4OO4 A;  4AJ6 A;  4GSN A;  1Q98 A;  2CVD A;  2ON5 A;  2I9H A;  1M2B A;  2WJU A;  4J2F A;  3QAV A;  1GUK A;  3GUR A;  3ERW A;  4TW5 A;  4GQF A;  3HA9 A;  4OFN A;  1EOG A;  5COH A;  1YKA A;  1GNW A;  4ECJ A;  2BMX A;  5ECQ B;  4YQU A;  3WGD A;  4TOP A;  1EP7 A;  2QGV A;  2F3M A;  1T00 A;  3R3E A;  1ZMA A;  1N8J A;  2H76 A;  4DSS A;  2O85 A;  5CRW A;  4BPY A;  2LRN A;  2EIO A;  1Y25 A;  3FR3 A;  4IN0 A;  4OFT A;  3KP9 A;  3QFA C;  2H66 A;  2EC4 A;  2E2G A;  1ON4 A;  2JL4 A;  3HZ8 A;  1K0B A;  2TRC P;  3MSZ A;  1XZO A;  3QFB C;  2C0F A;  1SK2 A;  1THO A;  4F0C A;  1FVK A;  5DQS A;  1SKW B;  4KF9 A;  2LJR A;  2GQM A;  4POM A;  3M8N A;  2K18 A;  5IMA A;  3KD0 A;  3FK8 A;  4JZQ A;  2JSY A;  1OE7 A;  4Q5Q A;  1OC9 B;  5ECN B;  3PH9 A;  1BQ7 A;  2WGR A;  2CQ9 A;  5KEJ A;  1T4Y A;  2YPM A;  1IYI A;  3HJO A;  4AF2 A;  1KBN A;  4TKY A;  1YY7 A;  1R5P A;  2MMA A;  2VL3 A;  4JRR A;  1E6B A;  1K3O A;  4MH2 A;  1OAZ A;  2YOI A;  3GMF A;  3IC8 A;  1A2M A;  2YWO A;  3A2X A;  3NOF A;  3APO A;  4FYC A;  2LKU A;  2PN8 A;  2O8V B;  3LYP A;  1H4O A;  3E0U A;  4MCU A;  1F37 A;  4ZB9 A;  3UBL A;  2DJ2 A;  3HCZ A;  1SL2 B;  5IPH A;  1OE8 A;  5IMC A;  3GSS A;  2VIM A;  11GS A;  5HR1 A;  1X5E A;  2M80 A;  4LL1 B;  1YQ1 A;  5ELG A;  1GP1 A;  4OO5 A;  4HDE A;  3WT2 A;  5ENU A;  2HI7 A;  2ZUP A;  14GS A;  4ACS A;  2H70 A;  1ERT A;  1LJR A;  3M1G A;  5IPG A;  3GKK A;  3Q18 A;  1O81 A;  5CRE A;  2VO4 A;  1T3B A;  2TRX A;  4HUA A;  2YAN A;  3HXS A;  5B6M A;  4LL4 B;  3L4N A;  5J3R A;  1DUG A;  3APS A;  4TXV A;  2VCX A;  4TXO A;  2C80 A;  4NV5 A;  1O73 A;  1K3L A;  1OKD A;  4BWQ A;  2M72 A;  3TJG A;  1R4W A;  2VL2 C;  4G0L A;  3UIW A;  1BJX A;  2GQL A;  3VWW A;  2H6X A;  2IPA A;  2E2M A;  1TOF A;  5FHI A;  2DJJ A;  3L78 A;  5CRD A;  5FT3 A;  3S9F A;  4KDX A;  5ELA A;  3GYK A;  3FZA A;  2IFQ B;  2E7P A;  3D6I A;  3QPM A;  1UA5 A;  5DCH A;  4ID0 A;  3RBT A;  3DEX A;  2HSY A;  1QMV A;  2O89 A;  4ISD A;  3DIE A;  2MMZ A;  1PKW A;  1JZW A;  2WB9 A;  3TKS A;  4K7I A;  3UL3 A;  2HNL A;  4GQC A;  2HRA A;  1M9B A;  1J08 A;  2FUG 2;  1V9W A;  2R37 A;  2HSH A;  2WFC A;  3C73 A;  5EVO A;  4G10 A;  3IRA A;  3Q6O A;  20GS A;  2K9F A;  2R3X A;  5G31 A;  1GH2 A;  2GSS A;  4WF4 A;  3IXR A;  4HQS A;  4WEY A;  1THX A;  3CYN A;  1CQG A;  1BG5 A;  1Z9H A;  3A2V A;  3TGZ A;  1YF1 A;  3F4R A;  5E59 A;  3DXB A;  2OKA A;  2PGT A;  2C0G A;  2GST A;  3FKF A;  4KND A;  1G0T A;  1TP9 A;  3R2Q A;  1EEJ A;  2YZH A;  1O8W A;  5ECR B;  5IMV A;  1XWA A;  3ZFB A;  3F63 A;  5DAL B;  4J56 E;  3UVH A;  1XW6 A;  5BMU A;  2P5R A;  2CA8 A;  3M3M A;  1TTZ A;  5AIV A;  1JFU A;  1X5D A;  4DVC A;  1GTA A;  3N9J A;  5ECO B;  1EWX A;  3LWA A;  4TN8 A;  2LNS A;  2WDU A;  2DSA A;  2FWH A;  5GZZ B;  1PSQ A;  2XPE A;  3WGE A;  4IS0 A;  1VGL A;  3HHV A;  2DJ3 A;  4EF0 A;  1XW9 A;  2B1L A;  4MAB A;  3N5O A;  3U5R E;  1WMJ A;  2H0H A;  2YWI A;  3GHA A;  3O3T A;  2GGT A;  2L59 A;  5DCG A;  1NHY A;  5F06 A;  4WXT A;  4OFM A;  2VLV A;  4EO3 A;  3HJM A;  3EE2 A;  4KX4 A;  3C1S A;  4G9H A;  5IO0 A;  3O76 A;  2XPD A;  3ZMK A;  2FY6 A;  4ECC A;  1XBS A;  2BJX A;  1BAY A;  2ALB A;  4EXJ A;  3M0F A;  2IN3 A;  1O7U A;  3ZRE A;  4ZL9 A;  5ABR A;  1ZYQ B;  4K0G A;  3E9J B;  4IQ1 A;  3D5J A;  3L9V A;  1GTU A;  2V2G A;  4POL A;  4K9Z A;  2B5E A;  4NHW A;  17GS A;  4PUF C;  4MJB A;  1DBY A;  4FQU A;  3CMI A;  5AN1 A;  3CSI A;  1M2D A;  4XTS A;  4IBP A;  1GSU A;  4O7H A;  5CRG A;  3VPQ A;  2FHE A;  3TKS C;  3TOT A;  5F8B A;  2L6D A;  1PL2 A;  2CAQ A;  5ECK B;  5CRH A;  2ON7 A;  4XS4 A;  1SJ6 A;  2N5A A;  2HZE A;  2LUS A;  5G5E A;  2HSM A;  2UZ8 A;  2LRC A;  2C0E A;  2H19 A;  1A0R P;  3UOM A;  1GSF A;  1YKC A;  4NV2 A;  5DBQ A;  2RUF A;  2HRK A;  2X64 A;  3MAK A;  3D0Z A;  4IEL A;  3TJK A;  3NIV A;  2AAW A;  3ZTL A;  3DML A;  1AAZ A;  5EL8 A;  3L9U A;  2GQK A;  2DMM A;  4GWR A;  2C0D A;  4E8E A;  1SU9 A;  4MJA A;  4QL9 A;  2NVL A;  3CTF A;  4HJM A;  3K8N A;  3GTU B;  2ES7 A;  1FOV A;  2K8S A;  4IKH A;  3UMA A;  2X99 A;  3KCM A;  3PPU A;  4HZ2 A;  2YWN A;  7GSS A;  2HSN B;  2LQO A;  3IR4 A;  2H72 A;  4J57 E;  4POB A;  2KLX A;  2E0Q A;  4HU7 A;  5ECL B;  1A8L A;  4EDZ A;  1PL1 A;  4ML1 A;  5IQY A;  4I5Q A;  5GAP D;  1DE2 A;  2J9H A;  1MDK A;  3EWL A;  2DBC A;  5H5Q A;  2JZT A;  4LA1 A;  4PX1 A;  2V6O A;  2B5Y A;  2YP6 A;  4WR4 A;  5A4V A;  3GST A;  3F6F A;  3VI7 A;  5DJM A;  4MZW A;  1K0M A;  3DD3 A;  1EEM A;  2F8F A;  6GSV A;  4V2L A;  5IO2 A;  3KIJ A;  5F0G A;  4IVF A;  1U3I A;  1F3A A;  2LTK A;  5ID2 B;  1QQ2 A;  3KH7 A;  2RUE A;  4I2U A;  4BL7 B;  1OC3 A;  2KP1 A;  2YV7 A;  2VL2 A;  1XWG A;  4RUV A;  4KSM A;  3W6G A;  4D73 A;  1EOH A;  2CX3 A;  2IIY A;  3IPZ A;  4CHS A;  1FAA A;  2XBI A;  4ECB A;  5KN2 A;  1N2A A;  2PMT A;  2HQT A;  3H93 A;  5HQP A;  4N11 A;  5KN1 A;  3US3 A;  1MDJ A;  2FWE A;  6GSS A;  3G7J A;  1Z5Y E;  5G1K A;  4YQM A;  2FD3 A;  2P0G A;  1EV4 A;  4V1A g;  3GFK A;  5JCW A;  2QKE A;  5D73 A;  1MTC A;  4ZB6 A;  1BX9 A;  2PVO C;  2PBJ A;  4YAV A;  1GL8 A;  4HZ4 A;  3I6A A;  2HXK A;  3KMN A;  5ECS A;  2GZY A;  3KM6 A;  1DSB A;  19GS A;  2DJK A;  6GSY A;  4MF5 A;  2IWT A;  3IA1 A;  3LOR A;  5KN0 A; 
#chains in the Genus database with same CATH topology
 1A0F A;  3GRX A;  2H6Z A;  2L4Q A;  2WVX A;  5F07 A;  2EFE A;  4G19 A;  1R5A A;  2R5G A;  1PQN A;  2REM A;  2R0C A;  3VWV A;  1HNA A;  3BJ5 A;  4IJI A;  4XCS A;  4NMU A;  2O5V A;  2WVY A;  3RPN A;  4N30 A;  1B9X C;  3LSZ A;  2ZNM A;  1HYU A;  4NXI A;  3J7Y b;  1TK0 B;  5G2Z A;  4O92 A;  3NZN A;  4K7O A;  4EC0 A;  4ZIL A;  4F9Z A;  5DVB A;  5KOX A;  3ERG A;  2GS3 A;  1RK4 A;  2IMK A;  2WW1 A;  4AKI A;  1JZO A;  3H4K A;  4V2M A;  2L4C A;  1K3Y A;  4IGJ A;  2CAI A;  2HYX A;  3VI5 A;  3RPP A;  4I97 A;  4KW6 A;  4XIH A;  1AC1 A;  1JLW A;  2VCQ A;  2GLR A;  5A5H B;  5ECI B;  4ZBA A;  5CNW A;  1Z7R A;  1SJZ A;  1ZZY A;  2H75 A;  3HVX A;  3TB2 A;  3VWX A;  1NW2 A;  1VF1 A;  4KCA A;  1EGR A;  4DEJ A;  4BVX A;  1YDK A;  3DGQ A;  4EKZ A;  4TRX A;  2PER A;  4N0V A;  1M3J A;  2R2J A;  2VLT A;  3ZYW A;  4QMK A;  5FWG A;  1OC9 A;  1Q4J A;  4X43 A;  1O6J A;  2NPB A;  1V40 A;  4K7N A;  3UAR A;  1ERW A;  3D21 A;  4YKG A;  1B4P A;  3IV4 A;  3TKR A;  3CRT A;  1PD2 1;  4ZL7 A;  1K0D A;  4QQ7 A;  1YEP A;  1FVJ A;  3FYG A;  1Z7P A;  2IL3 A;  4X4J A;  1M7T A;  4MF7 A;  2LJA A;  2KHP A;  3EU3 A;  1FB0 A;  3RGB C;  5H5R A;  3TDG A;  3EU4 A;  2ZCT A;  4G2E A;  4I6X A;  1AXD A;  5D93 A;  1AQV A;  3FW2 A;  1Y1U A;  4XHM A;  3ZIV A;  1YZX A;  16GS A;  1SVM A;  4TR1 B;  5HR3 A;  2BTO T;  1M99 A;  4NWY A;  1AUC A;  3VUR A;  4ZXG A;  3KH9 A;  2VUP A;  2OE1 A;  2H74 A;  3EC3 A;  2FLS A;  1XWC A;  2H30 A;  4LMW A;  2JU5 A;  2VLU A;  2MZC A;  2B3S A;  5HFG A;  2YJ7 A;  3CHX C;  2I1U A;  1JZD A;  3MNG A;  3KMO A;  2AJQ B;  1RW1 A;  13GS A;  4G01 A;  3G9B A;  1ABA A;  1PN9 A;  2A2S A;  1TW9 A;  1G7E A;  2YWM A;  4L8E A;  3VWU A;  3VPT A;  4OMV A;  3ME7 A;  2VCT A;  3KZQ A;  3LEF A;  5CP1 A;  3TKQ A;  2WZS A;  3CBU A;  3GL5 A;  3I9V 2;  1WWJ A;  1VF3 A;  3F6D A;  1EV9 A;  1ERV A;  2CV4 A;  4OCE A;  22GS A;  3GX0 A;  2GZP A;  2WS2 A;  2R4V A;  2LEG A;  3DVW A;  4L5O A;  2L57 A;  2CT6 A;  1TRV A;  5G30 A;  2I81 A;  2NTO A;  2B7K A;  5EPF A;  4PHZ C;  3GKN A;  5BMU B;  2H71 A;  3TOU A;  3ZIT A;  2H6Y A;  1QXH A;  1GWC A;  5J9C A;  1IYH A;  5J5N A;  5DDL A;  1I5G A;  3ZIJ A;  5C00 A;  3ED3 A;  4N0Z A;  4G0K A;  2IFQ A;  2L5L A;  4JU5 A;  4MMM A;  3RDW A;  3WD6 A;  3SWL A;  2FGX A;  2WRT A;  2OAC A;  1FB6 A;  2OJL A;  1XXU A;  3RHB A;  2X4A A;  1T8E B;  3GKX A;  5GST A;  1PRX A;  3TRX A;  5HR0 A;  2HZF A;  4O5R A;  2I4A A;  3FZ9 A;  3EUR A;  1X0R A;  3W8J A;  1QK8 A;  2TIR A;  2C1Y A;  5ECH B;  4NHZ A;  2H1B A;  4V1A p;  2VCV A;  3OR5 A;  1KTE A;  2VAF A;  4Q5N A;  5CYY A;  3TRP A;  2FWG A;  5AGY A;  1TRW A;  9GSS A;  3C7M A;  3FEU A;  2HLS A;  1O85 A;  2HRF A;  1GUM A;  2NBS A;  3DKS A;  3PIN A;  2CX4 A;  4X1U A;  2GTU A;  4PQH A;  1A2J A;  4FH8 A;  2GT6 A;  3RAZ A;  3LQ7 A;  2WW0 A;  1U87 A;  2OA7 A;  3A5W A;  4BVY B;  3F3Q A;  4QL7 A;  4KSO A;  4N10 A;  4CDO A;  4KDU A;  5CAX A;  1ZGN A;  1W89 A;  4ULX A;  5D9W A;  3M9K A;  4Z7X A;  1MEK A;  5AIX A;  4AKX B;  4WBJ A;  3SBC A;  2K6V A;  2XBQ A;  5J40 A;  1JZR A;  3EVI A;  4I2T A;  1GRX A;  3FZ4 A;  1NHO A;  3GUS A;  3P7X A;  1YEX A;  5DAL A;  2DJ0 A;  3DWV A;  3AY8 A;  1Z6N A;  3VFI A;  1XIY A;  3TJF A;  4Z2R A;  4L0U A;  2LV3 A;  2RLI A;  2HE3 A;  3KGK A;  1HQO A;  4XS6 A;  3C1R A;  4K5S A;  4ZL8 A;  1V58 A;  3HDC A;  4O32 A;  5J9B A;  2H0G A;  2CVB A;  2JAC A;  3GKM A;  3UJ1 A;  1EP8 A;  1HNB A;  4OD7 A;  1PGT A;  2QC7 A;  3L9S A;  1GSD A;  1M0U A;  5D9X A;  4I8B A;  1PA3 A;  1CQH A;  4RQX A;  1B9Y C;  2KOK A;  4NAX A;  3PGT A;  5IOW A;  3HJP A;  4ZBD A;  3CTG A;  5HFK A;  3KTB A;  4K0N A;  3U6V A;  3RHC A;  5G5F A;  5B8A A;  1ZYN A;  3O6T A;  3HVV A;  4WR5 A;  1I9D A;  4WET A;  5JWO B;  2AYT A;  1X9W B;  2VM1 A;  1SL0 B;  5GSS A;  5F05 A;  2PVQ A;  4JED A;  2P5Q A;  4EL1 A;  1R7H A;  2B7J A;  2P31 A;  3KTL A;  5EY6 A;  1ERU A;  4DSR A;  3I69 A;  4L5L A;  4YAP A;  3L0H A;  5H5S A;  3F4S A;  2LNT A;  1G6W A;  1GLQ A;  1K0A A;  4MPF A;  2WCI A;  2M46 A;  3VK9 A;  5A5K A;  1SK0 A;  5DAK B;  3QCP A;  1B4Q A;  6GSW A;  3Q19 A;  4MZB A;  2X8C A;  1S3C A;  1XCC A;  3H8Q A;  4MK3 A;  2QSI A;  3QAG A;  3FMW A;  1R26 A;  1TXU A;  2YN1 A;  2VD0 A;  3G7I A;  6GST A;  3GX8 A;  4K2X A;  3QD9 A;  4E8H A;  3UVT A;  2X8G A;  2GSQ A;  3TRQ A;  2GDR A;  2OT3 A;  3LW9 A;  4Z2T A;  1ZL9 A;  2HRN A;  2VOC A;  4HOJ A;  4EE0 A;  4EUY A;  3KJY A;  1GTI A;  2H1D A;  4MH3 A;  5BRT A;  4PQI A;  8GSS A;  3DRN A;  3TJB A;  4DSS B;  5B7C A;  1A2L A;  5IM9 A;  2C8U A;  4IP6 A;  3QMX A;  1F6M C;  3M9J A;  1TRU A;  3F4T A;  1SL1 B;  2O7K A;  1KNG A;  1OVN A;  5D9T A;  1JLV A;  2LS5 A;  3HY2 A;  3WT1 A;  5AIS A;  3KXO A;  4JE1 A;  3ZVJ A;  3CWG A;  3ZVJ D;  2RM5 A;  3D4M A;  1XOA A;  3MWH A;  5D8I A;  3ZML A;  5HR2 A;  2IMI A;  2C3Q A;  4PNG A;  1BG1 A;  1WIK A;  4PXO A;  4F82 A;  1VRS D;  1WOU A;  2FNO A;  3GL3 A;  3GTU A;  3ZLP A;  1UC7 A;  3VLN A;  3BOA A;  4Z2U A;  2L6C A;  3ZZX A;  2HSN A;  4LLR A;  2B5X A;  1XVQ A;  4L0W A;  1C72 A;  1PX6 A;  3CQF A;  1GSE A;  5J4V A;  1QGV A;  4FYB A;  1V98 A;  4PNF A;  4FYU A;  1Y6E A;  2EFH A;  4USS A;  5D9V A;  5JWR B;  3ERF A;  3D4T A;  2PUK C;  1GSS A;  4WKW A;  5D96 A;  1JHB A;  1GUH A;  2XC2 A;  2H73 A;  4AKG A;  1RQM A;  4W66 A;  4ZIJ A;  1GLP A;  3A3T A;  2LST A;  1X9S B;  1YEW C;  2IME A;  2DIZ A;  4IQA A;  1NM3 A;  3FHK A;  3LXT A;  3LXZ A;  4PGT A;  3ZL5 A;  2CVK A;  4K6X A;  5ID2 A;  1SKS B;  4BL7 A;  1Z6M A;  3ZFL A;  6GSU A;  3EYT A;  1A8Y A;  1S4B P;  1F9M A;  3CRU A;  3FR6 A;  4AGS A;  1LBK A;  4BVX B;  1PMT A;  3KEB A;  1FHE A;  4PUR A;  3IHQ A;  2O87 A;  4AJ8 A;  3P2A A;  2X8H A;  2RII A;  1E2Y A;  3Q74 A;  2K8V A;  3C71 A;  5CO3 A;  5J41 A;  1USB A;  3IAS 2;  3DYR A;  4HI7 A;  1ACV A;  3PR8 A;  1FG4 A;  3V1W A;  2O3E A;  1T1V A;  4HJ2 A;  1XW5 A;  4GCI A;  6GSX A;  4ILF A;  4MF6 A;  2G2Q A;  2YJH A;  4AJ7 A;  1V2A A;  1S3D A;  1X9M B;  3LJR A;  2I3Y A;  2OBK A;  2A4V A;  2CZ2 A;  4MDC A;  5A4W A;  3E3E A;  2IMD A;  2J23 A;  4TXO B;  3MDK A;  3FRC A;  1TU7 A;  2DLX A;  3GN3 A;  4KA0 A;  4IW9 A;  4ZB8 A;  1TKD B;  1XVW A;  2FWF A;  3CSJ A;  2UV8 G;  3W8S A;  1X5C A;  2XHF A;  4F03 A;  1XWK A;  1W4V A;  2V6K A;  4JBB A;  4DSQ A;  1WE0 A;  10GS A;  1WJK A;  4KUN A;  4FO5 A;  4X0X A;  2MBS A;  2JAD A;  1FOH A;  2LQQ A;  1XOB A;  5B8B A;  2KUC A;  3BCI A;  1B48 A;  2L5O A;  2FA4 A;  1FO5 A;  1ML6 A;  4POK A;  1QUW A;  1OC8 A;  2F8A A;  1LU4 A;  3G7Y A;  1K0N A;  2PWJ A;  5INY A;  2AHE A;  4WF5 A;  3CSH A;  2PU9 C;  4IHU A;  5A5H A;  2R0G A;  5GAN D;  1TDI A;  3GV1 A;  4JR4 A;  1TK5 B;  1QFN A;  1A24 A;  1J9B A;  2Z9S A;  4MP4 A;  4G0I A;  5DJL A;  2MBT A;  2F9S A;  4H86 A;  3FY7 A;  2V41 A;  4TR4 A;  2B6M A;  4MPG A;  5B6N A;  1ILO A;  3H79 A;  4OCF A;  1XPV A;  1EZK A;  5JCG A;  1M9A A;  1NSW A;  3GA4 A;  3EIN A;  1AIU A;  2NDO A;  1T7P B;  1OKT A;  3TUE A;  1GTB A;  2YNX A;  3F3R A;  4RI6 A;  2GZZ A;  1DE1 A;  2DJ1 A;  2CZ3 A;  1WRY A;  2H8L A;  1F3B A;  5IMZ A;  4TR3 A;  1YJ6 A;  2RM6 A;  1HD2 A;  3WYW A;  2JZR A;  5A34 B;  1UN2 A;  4MJE A;  5LCZ A;  1SJI A;  5L71 A;  2N5B A;  2DKI A;  2C3N A;  1WP0 A;  4KCE A;  4Q5R A;  2LJK A;  3A2W A;  3QOU A;  4TR1 A;  4ML6 A;  3WGX A;  4GXZ A;  4F0B A;  1TRS A;  1T4Z A;  1AQW A;  2H0I A;  4IP1 A;  4PQ1 A;  1MDI A;  2AUV A;  1Z3E A;  2IMF A;  3GH9 A;  4F2I A;  1MD3 A;  3IE3 A;  1HNC A;  3KP8 A;  4LMV A;  4EDY A;  4K2D A;  2HT9 A;  3RFR C;  1GUL A;  1SKR B;  3IK9 A;  4NPB A;  2AB6 A;  4MJC A;  3P90 A;  3P8W A;  4GTU A;  3UBK A;  2YZU A;  5IOX A;  2YV9 A;  3FR9 A;  2H1A A;  3HZ4 A;  4GRF A;  3F8U A;  3DVX A;  1J0F A;  1KEB A;  1AQX A;  4Q5F A;  5ECM B;  4OWY A;  1SK1 A;  4BA7 A;  5C04 A;  2YCD A;  3LGC A;  2LRT A;  3TKP A;  4K1F A;  1O8X A;  3D22 A;  2GVP A;  4KB3 A;  1VF4 A;  4XS1 A;  1URM A;  1M3I A;  2MMO A;  1ZYE A;  4MA9 A;  4MZC A;  1K0C A;  5E4W A;  3ZRD A;  1G7O A;  2V1M A;  2EIQ A;  3IOS A;  1SYX A;  5DQY A;  3C8E A;  5G1L A;  4HQZ A;  3QR6 A;  2C3T A;  2DC5 A;  2AV4 A;  4WBR D;  1WPI A;  1AW9 A;  4KGI A;  3J7Y k;  2WUL A;  1U88 A;  1YF0 A;  4RI7 A;  1GSQ A;  3ISO A;  1BED A;  1XWB A;  2DIY A;  1H75 A;  2V32 A;  3QAW A;  3HKR A;  4CY6 A;  12GS A;  3ME8 A;  5IMD A;  3IBH A;  1BF5 A;  4P3Y B;  2VD1 A;  3BBY A;  3HVN A;  1ST9 A;  2OE0 A;  1K0O A;  4XS4 B;  4GST A;  2HZE B;  4FIW A;  2HSM B;  2D2Z A;  3UAP A;  3GNJ A;  2IJY A;  4RQR A;  1XFL A;  2VKZ G;  1TXX A;  2EIR A;  3EMP A;  3TCO A;  3LG6 A;  2GSR A;  2HRK B;  5A4U A;  3UEM A;  1XG8 A;  1PKZ A;  1F2E A;  1SD9 A;  3BD2 A;  1ZCP A;  2PPT A;  5JWQ B;  2VCW A;  3IAM 2;  4HEA 2;  1VF2 A;  1TI3 A;  3LYK A;  3GIX A;  2N5F A;  1U6T A;  1B8X A;  5J4U A;  3QDN A;  3IC4 A;  1S3A A;  4EVM A;  4YH2 A;  4BVY A;  2OBI A;  1OYJ A;  2DML A;  2R6K A;  4JR6 A;  3BCK A;  2FCH A;  4KH7 A;  2G0F A;  4TR0 A;  3EMX A;  4IJ3 A;  4YQV A;  2FA8 A;  2F51 A;  5JCU A;  3IDV A;  4HU9 A;  5IIZ A;  3H1N A;  1GSY A;  2GT5 A;  5LNK e;  2H1G A;  2VL9 A;  2MYG A;  2MMN A;  2H01 A;  1V57 A;  3HYP A;  4V2N A;  2KP2 A;  1U3A A;  4YKF A;  1TK8 B;  2JZS A;  1G6Y A;  4GF0 A;  3APQ A;  1TJD A;  1SYR A;  4MLY A;  1EGO A;  1SEN A;  2VCZ A;  4HS1 A;  4PTS A;  1ZOF A;  2HFD A;  3HVS A;  4GLT A;  5IMF A;  5LD0 A;  4BWS A;  3TJJ A;  4ZBB A;  4HSC X;  4K8M A;  4XRA A;  2A2R A;  4GSS A;  2WZ9 A;  4KE3 A;  1PX7 A;  4PUA A;  4E68 A;  1A23 A;  2OE3 A;  3F9U A;  3GH6 A;  2JSZ A;  3JCM L;  4KAE A;  4TVE A;  5HFI A;  3I43 A;  5KN3 A;  4D73 B;  1SD8 A;  1FW1 A;  3LFL A;  4XRD A;  5A1N B;  18GS A;  2VM2 A;  3IK7 A;  1MD4 A;  4KDY A;  5ECP B;  2B1K A;  3HD5 A;  4CW9 A;  2C4J A;  2OAD A;  1M2A A;  3TKS E;  4A5P A;  4ECI A;  3F0I A;  5DAK A;  1PN0 A;  1GNE A;  3FZ5 A;  1TU8 A;  1BYE A;  1TI1 A;  1UVZ A;  3CXG A;  4OO4 A;  4AJ6 A;  4GSN A;  1Q98 A;  2CVD A;  2ON5 A;  2I9H A;  1M2B A;  2WJU A;  4J2F A;  3QAV A;  1GUK A;  3GUR A;  3ERW A;  4TW5 A;  4GQF A;  3HA9 A;  4OFN A;  4PI0 C;  1EOG A;  5COH A;  2WVX B;  1YKA A;  1GNW A;  4AKH A;  4ECJ A;  2BMX A;  5ECQ B;  4YQU A;  3WGD A;  4TOP A;  1EP7 A;  2QGV A;  2F3M A;  1T00 A;  3R3E A;  1ZMA A;  1N8J A;  2H76 A;  2WVZ A;  4DSS A;  2O85 A;  5CRW A;  1PFO A;  4BPY A;  2LRN A;  2EIO A;  1Y25 A;  3FR3 A;  4IN0 A;  4OFT A;  3KP9 A;  3QFA C;  2H66 A;  2EC4 A;  2E2G A;  1ON4 A;  2JL4 A;  3HZ8 A;  1K0B A;  2TRC P;  3MSZ A;  1XZO A;  3QFB C;  2C0F A;  1SK2 A;  1THO A;  4F0C A;  1FVK A;  5DQS A;  1SKW B;  4KF9 A;  2LJR A;  2GQM A;  4POM A;  3M8N A;  2K18 A;  5IMA A;  3KD0 A;  3FK8 A;  4JZQ A;  2JSY A;  1OE7 A;  4Q5Q A;  1SVL A;  1OC9 B;  5ECN B;  3PH9 A;  1BQ7 A;  2WGR A;  2CQ9 A;  2R0P A;  5KEJ A;  1T4Y A;  2YPM A;  1IYI A;  3HJO A;  4AF2 A;  1KBN A;  4TKY A;  1YY7 A;  1R5P A;  2MMA A;  2VL3 A;  4JRR A;  1E6B A;  1K3O A;  4MH2 A;  1OAZ A;  4MNN A;  2YOI A;  3GMF A;  3IC8 A;  1A2M A;  2DKH A;  2YWO A;  3A2X A;  3NOF A;  3APO A;  4FYC A;  2LKU A;  2PN8 A;  2O8V B;  3LYP A;  1H4O A;  3E0U A;  4MCU A;  1F37 A;  2EFC A;  4ZB9 A;  3UBL A;  2DJ2 A;  3HCZ A;  1SL2 B;  5IPH A;  3EPT A;  1OE8 A;  5IMC A;  3GSS A;  2VIM A;  2H1L A;  11GS A;  2WW2 A;  5HR1 A;  1X5E A;  4ZB7 A;  2M80 A;  4LL1 B;  5J4Y A;  1YQ1 A;  4AI6 A;  5ELG A;  1GP1 A;  4OO5 A;  3HMJ G;  4HDE A;  3WT2 A;  5ENU A;  2HI7 A;  2ZUP A;  14GS A;  4ACS A;  2H70 A;  4EIQ A;  1ERT A;  1LJR A;  3M1G A;  5IPG A;  3GKK A;  3Q18 A;  1O81 A;  5CRE A;  2VO4 A;  1T3B A;  2TRX A;  4HUA A;  2YAN A;  3HXS A;  5B6M A;  4LL4 B;  3L4N A;  5J3R A;  1DUG A;  3APS A;  4TXV A;  2VCX A;  4TXO A;  2C80 A;  4NV5 A;  1O73 A;  1K3L A;  1OKD A;  4BWQ A;  2M72 A;  3TJG A;  1R4W A;  2VL2 C;  4G0L A;  3MYD A;  3UIW A;  1BJX A;  2GQL A;  3VWW A;  2H6X A;  2IPA A;  2E2M A;  1TOF A;  5FHI A;  2DJJ A;  3L78 A;  5CRD A;  5FT3 A;  3S9F A;  4KDX A;  4PI2 C;  5ELA A;  3GYK A;  2QA2 A;  3FZA A;  2IFQ B;  2E7P A;  5J47 A;  3D6I A;  4O5U A;  3QPM A;  1UA5 A;  5DCH A;  4ID0 A;  3RBT A;  3DEX A;  2HSY A;  1YVL A;  1QMV A;  2O89 A;  4ISD A;  3DIE A;  2MMZ A;  4GDF A;  1PKW A;  1JZW A;  2X49 A;  2WB9 A;  3TKS A;  4K7I A;  3UL3 A;  2HNL A;  4GQC A;  2HRA A;  1M9B A;  1J08 A;  2FUG 2;  1V9W A;  2R37 A;  2HSH A;  2WFC A;  3C73 A;  5EVO A;  4G10 A;  3IRA A;  3Q6O A;  1S3R A;  20GS A;  2K9F A;  2R3X A;  5G31 A;  2WW3 A;  1GH2 A;  2GSS A;  4WF4 A;  3IXR A;  4HQS A;  4WEY A;  4O5Q A;  1THX A;  3CYN A;  1CQG A;  1BG5 A;  1Z9H A;  3A2V A;  3TGZ A;  4ICY A;  1YF1 A;  3F4R A;  5E59 A;  3DXB A;  2OKA A;  2PGT A;  2C0G A;  2GST A;  3FKF A;  4KND A;  1G0T A;  1TP9 A;  3R2Q A;  1EEJ A;  5A34 A;  2YZH A;  5KOW A;  1O8W A;  5ECR B;  5IMV A;  1XWA A;  3ZFB A;  3F63 A;  5DAL B;  4J56 E;  3UVH A;  1XW6 A;  5BMU A;  2P5R A;  2CA8 A;  3M3M A;  1TTZ A;  1ZYP A;  5AIV A;  1JFU A;  1X5D A;  4DVC A;  1GTA A;  3N9J A;  5ECO B;  1EWX A;  4EIP A;  3LWA A;  4TN8 A;  2LNS A;  2WDU A;  2DSA A;  2FWH A;  5GZZ B;  1PSQ A;  2XPE A;  3WGE A;  4CY8 A;  4IS0 A;  1VGL A;  3HHV A;  2DJ3 A;  4EF0 A;  1XW9 A;  2B1L A;  4MAB A;  3N5O A;  3U5R E;  1WMJ A;  2H0H A;  2YWI A;  3GHA A;  3O3T A;  2GGT A;  2L59 A;  5DCG A;  1NHY A;  3MIX A;  5F06 A;  4WXT A;  4OFM A;  2VLV A;  4EO3 A;  3HJM A;  3EE2 A;  4K5R A;  4KX4 A;  3C1S A;  4G9H A;  5IO0 A;  3O76 A;  2XPD A;  3ZMK A;  2FY6 A;  4ECC A;  1XBS A;  2BJX A;  1BAY A;  2ALB A;  4EXJ A;  3A5I A;  3M0F A;  2IN3 A;  1O7U A;  3ZRE A;  4ZL9 A;  5ABR A;  1ZYQ B;  2QA1 A;  4K0G A;  3E9J B;  4IQ1 A;  3D5J A;  3L9V A;  1GTU A;  2V2G A;  4POL A;  4K9Z A;  2B5E A;  4NHW A;  17GS A;  4PUF C;  4MJB A;  1DBY A;  4FQU A;  3CMI A;  5AN1 A;  3CSI A;  1M2D A;  4XTS A;  4IBP A;  1GSU A;  4O7H A;  5CRG A;  3VPQ A;  2FHE A;  3TKS C;  3TOT A;  5F8B A;  2L6D A;  1PL2 A;  2CAQ A;  5ECK B;  5CRH A;  2ON7 A;  4XS4 A;  1SJ6 A;  2N5A A;  2HZE A;  2LUS A;  5G5E A;  2HSM A;  2UZ8 A;  2LRC A;  3IHG A;  2A4H A;  2C0E A;  2H19 A;  1A0R P;  3UOM A;  1GSF A;  1YKC A;  4NV2 A;  5DBQ A;  2RUF A;  2HRK A;  2X64 A;  3MAK A;  3D0Z A;  4IEL A;  3TJK A;  3NIV A;  2AAW A;  3ZTL A;  3DML A;  1AAZ A;  4FXY P;  5EL8 A;  3L9U A;  2GQK A;  4N3Z A;  2DMM A;  4GWR A;  2C0D A;  4E8E A;  1SU9 A;  4MJA A;  4QL9 A;  2NVL A;  3CTF A;  4HJM A;  3K8N A;  3GTU B;  2ES7 A;  1FOV A;  2K8S A;  4IKH A;  3UMA A;  2X99 A;  3KCM A;  1SVO A;  2YWN A;  3PPU A;  4HZ2 A;  7GSS A;  2HSN B;  2LQO A;  3IR4 A;  2H72 A;  4J57 E;  4POB A;  2KLX A;  2E0Q A;  4HU7 A;  5ECL B;  1A8L A;  4EDZ A;  1PL1 A;  4ML1 A;  5IQY A;  4I5Q A;  5GAP D;  2EFD A;  1DE2 A;  2J9H A;  1MDK A;  3EWL A;  2DBC A;  3TU3 B;  5H5Q A;  2JZT A;  4LA1 A;  4PX1 A;  2A2P A;  2V6O A;  2B5Y A;  2YP6 A;  4WR4 A;  5A4V A;  3GST A;  3F6F A;  3VI7 A;  5DJM A;  4MZW A;  1K0M A;  3DD3 A;  1EEM A;  2F8F A;  4BIK A;  6GSV A;  4V2L A;  5IO2 A;  3KIJ A;  5F0G A;  4IVF A;  1N25 A;  1U3I A;  1F3A A;  2LTK A;  5ID2 B;  1QQ2 A;  3KH7 A;  2RUE A;  4I2U A;  4BL7 B;  1OC3 A;  2KP1 A;  2YV7 A;  2VL2 A;  1XWG A;  4RUV A;  4KSM A;  3W6G A;  4D73 A;  1EOH A;  1I1I P;  2CX3 A;  2IIY A;  3IPZ A;  4CHS A;  1FAA A;  2XBI A;  4ECB A;  5KN2 A;  1N2A A;  2PMT A;  2HQT A;  3H93 A;  5HQP A;  4N11 A;  5A1N A;  5KN1 A;  3US3 A;  1MDJ A;  2FWE A;  6GSS A;  3G7J A;  1Z5Y E;  5G1K A;  4YQM A;  2FD3 A;  2P0G A;  1EV4 A;  4V1A g;  3GFK A;  5JCW A;  2QKE A;  5D73 A;  2O36 A;  1MTC A;  4ZB6 A;  1BX9 A;  2PVO C;  2PBJ A;  4YAV A;  1GL8 A;  4HZ4 A;  3I6A A;  2HXK A;  3KMN A;  5ECS A;  2GZY A;  3KM6 A;  1DSB A;  19GS A;  2DJK A;  6GSY A;  4MF5 A;  2IWT A;  3IA1 A;  3LOR A;  5KN0 A; 
#chains in the Genus database with same CATH homology
 1A0F A;  3GRX A;  2H6Z A;  2L4Q A;  5F07 A;  2EFE A;  4G19 A;  1R5A A;  2R5G A;  1PQN A;  2REM A;  2R0C A;  3VWV A;  1HNA A;  3BJ5 A;  4IJI A;  4XCS A;  4NMU A;  2O5V A;  3RPN A;  4N30 A;  1B9X C;  3LSZ A;  2ZNM A;  1HYU A;  4NXI A;  3J7Y b;  1TK0 B;  5G2Z A;  4O92 A;  3NZN A;  4K7O A;  4EC0 A;  4ZIL A;  4F9Z A;  5DVB A;  5KOX A;  3ERG A;  2GS3 A;  1RK4 A;  2IMK A;  4AKI A;  1JZO A;  3H4K A;  4V2M A;  2L4C A;  1K3Y A;  4IGJ A;  2CAI A;  2HYX A;  3VI5 A;  3RPP A;  4I97 A;  4KW6 A;  4XIH A;  1AC1 A;  1JLW A;  2VCQ A;  2GLR A;  5A5H B;  5ECI B;  4ZBA A;  5CNW A;  1Z7R A;  1SJZ A;  1ZZY A;  2H75 A;  3HVX A;  3TB2 A;  3VWX A;  1NW2 A;  1VF1 A;  4KCA A;  1EGR A;  4DEJ A;  4BVX A;  1YDK A;  3DGQ A;  4EKZ A;  4TRX A;  2PER A;  4N0V A;  2R2J A;  2VLT A;  3ZYW A;  4QMK A;  5FWG A;  1OC9 A;  1Q4J A;  4X43 A;  1O6J A;  2NPB A;  1V40 A;  4K7N A;  3UAR A;  1ERW A;  3D21 A;  4YKG A;  1B4P A;  3IV4 A;  3TKR A;  3CRT A;  1PD2 1;  4ZL7 A;  1K0D A;  4QQ7 A;  1YEP A;  1FVJ A;  3FYG A;  1Z7P A;  2IL3 A;  4X4J A;  1M7T A;  4MF7 A;  2LJA A;  2KHP A;  3EU3 A;  1FB0 A;  5H5R A;  3TDG A;  3EU4 A;  2ZCT A;  4G2E A;  4I6X A;  1AXD A;  5D93 A;  1AQV A;  3FW2 A;  1Y1U A;  4XHM A;  3ZIV A;  1YZX A;  16GS A;  1SVM A;  4TR1 B;  5HR3 A;  2BTO T;  1M99 A;  4NWY A;  1AUC A;  3VUR A;  4ZXG A;  3KH9 A;  2VUP A;  2OE1 A;  2H74 A;  3EC3 A;  2FLS A;  1XWC A;  2H30 A;  4LMW A;  2JU5 A;  2VLU A;  2MZC A;  2B3S A;  5HFG A;  2YJ7 A;  2I1U A;  1JZD A;  3MNG A;  3KMO A;  2AJQ B;  1RW1 A;  13GS A;  4G01 A;  3G9B A;  1ABA A;  1PN9 A;  2A2S A;  1TW9 A;  1G7E A;  2YWM A;  4L8E A;  3VWU A;  3VPT A;  4OMV A;  3ME7 A;  2VCT A;  3KZQ A;  3LEF A;  5CP1 A;  3TKQ A;  3CBU A;  3GL5 A;  3I9V 2;  1WWJ A;  1VF3 A;  3F6D A;  1EV9 A;  1ERV A;  2CV4 A;  4OCE A;  22GS A;  3GX0 A;  2GZP A;  2WS2 A;  2R4V A;  2LEG A;  3DVW A;  4L5O A;  2L57 A;  2CT6 A;  1TRV A;  5G30 A;  2I81 A;  2NTO A;  2B7K A;  5EPF A;  3GKN A;  5BMU B;  2H71 A;  3TOU A;  3ZIT A;  2H6Y A;  1QXH A;  1GWC A;  5J9C A;  1IYH A;  5J5N A;  5DDL A;  1I5G A;  3ZIJ A;  5C00 A;  3ED3 A;  4N0Z A;  4G0K A;  2IFQ A;  2L5L A;  4JU5 A;  4MMM A;  3RDW A;  3WD6 A;  3SWL A;  2FGX A;  2WRT A;  2OAC A;  1FB6 A;  2OJL A;  1XXU A;  3RHB A;  2X4A A;  1T8E B;  3GKX A;  5GST A;  1PRX A;  3TRX A;  5HR0 A;  2HZF A;  4O5R A;  2I4A A;  3FZ9 A;  3EUR A;  1X0R A;  3W8J A;  1QK8 A;  2TIR A;  2C1Y A;  5ECH B;  4NHZ A;  2H1B A;  4V1A p;  2VCV A;  3OR5 A;  1KTE A;  2VAF A;  4Q5N A;  5CYY A;  3TRP A;  2FWG A;  5AGY A;  1TRW A;  9GSS A;  3C7M A;  3FEU A;  2HLS A;  1O85 A;  2HRF A;  1GUM A;  2NBS A;  3DKS A;  3PIN A;  2CX4 A;  4X1U A;  2GTU A;  4PQH A;  1A2J A;  4FH8 A;  2GT6 A;  3RAZ A;  3LQ7 A;  1U87 A;  2OA7 A;  3A5W A;  4BVY B;  3F3Q A;  4QL7 A;  4KSO A;  4N10 A;  4CDO A;  4KDU A;  5CAX A;  1ZGN A;  1W89 A;  4ULX A;  5D9W A;  3M9K A;  4Z7X A;  1MEK A;  5AIX A;  4AKX B;  4WBJ A;  3SBC A;  2K6V A;  2XBQ A;  5J40 A;  1JZR A;  3EVI A;  4I2T A;  1GRX A;  3FZ4 A;  1NHO A;  3GUS A;  3P7X A;  1YEX A;  5DAL A;  2DJ0 A;  3DWV A;  3AY8 A;  1Z6N A;  3VFI A;  1XIY A;  3TJF A;  4Z2R A;  4L0U A;  2LV3 A;  2RLI A;  2HE3 A;  3KGK A;  1HQO A;  4XS6 A;  3C1R A;  4K5S A;  4ZL8 A;  1V58 A;  3HDC A;  4O32 A;  5J9B A;  2H0G A;  2CVB A;  2JAC A;  3GKM A;  3UJ1 A;  1EP8 A;  1HNB A;  4OD7 A;  1PGT A;  2QC7 A;  3L9S A;  1GSD A;  1M0U A;  5D9X A;  4I8B A;  1PA3 A;  1CQH A;  4RQX A;  1B9Y C;  2KOK A;  4NAX A;  3PGT A;  5IOW A;  3HJP A;  4ZBD A;  3CTG A;  5HFK A;  3KTB A;  4K0N A;  3U6V A;  3RHC A;  5G5F A;  5B8A A;  1ZYN A;  3O6T A;  3HVV A;  4WR5 A;  1I9D A;  4WET A;  5JWO B;  2AYT A;  1X9W B;  2VM1 A;  1SL0 B;  5GSS A;  5F05 A;  2PVQ A;  4JED A;  2P5Q A;  4EL1 A;  1R7H A;  2B7J A;  2P31 A;  3KTL A;  5EY6 A;  1ERU A;  4DSR A;  3I69 A;  4L5L A;  4YAP A;  3L0H A;  5H5S A;  3F4S A;  2LNT A;  1G6W A;  1GLQ A;  1K0A A;  4MPF A;  2WCI A;  2M46 A;  3VK9 A;  5A5K A;  1SK0 A;  5DAK B;  3QCP A;  1B4Q A;  6GSW A;  3Q19 A;  4MZB A;  2X8C A;  1S3C A;  1XCC A;  3H8Q A;  4MK3 A;  2QSI A;  3QAG A;  3FMW A;  1R26 A;  1TXU A;  2YN1 A;  2VD0 A;  3G7I A;  6GST A;  3GX8 A;  4K2X A;  3QD9 A;  4E8H A;  3UVT A;  2X8G A;  2GSQ A;  3TRQ A;  2GDR A;  2OT3 A;  3LW9 A;  4Z2T A;  1ZL9 A;  2HRN A;  2VOC A;  4HOJ A;  4EE0 A;  4EUY A;  3KJY A;  1GTI A;  2H1D A;  4MH3 A;  5BRT A;  4PQI A;  8GSS A;  3DRN A;  3TJB A;  4DSS B;  5B7C A;  1A2L A;  5IM9 A;  2C8U A;  4IP6 A;  3QMX A;  1F6M C;  3M9J A;  1TRU A;  3F4T A;  1SL1 B;  2O7K A;  1KNG A;  1OVN A;  5D9T A;  1JLV A;  2LS5 A;  3HY2 A;  3WT1 A;  5AIS A;  3KXO A;  4JE1 A;  3ZVJ A;  3CWG A;  3ZVJ D;  2RM5 A;  3D4M A;  1XOA A;  3MWH A;  5D8I A;  3ZML A;  5HR2 A;  2IMI A;  2C3Q A;  4PNG A;  1BG1 A;  1WIK A;  4PXO A;  4F82 A;  1VRS D;  1WOU A;  2FNO A;  3GL3 A;  3GTU A;  3ZLP A;  1UC7 A;  3VLN A;  3BOA A;  4Z2U A;  2L6C A;  3ZZX A;  2HSN A;  4LLR A;  2B5X A;  1XVQ A;  4L0W A;  1C72 A;  1PX6 A;  1GSE A;  5J4V A;  1QGV A;  4FYB A;  1V98 A;  4PNF A;  4FYU A;  1Y6E A;  2EFH A;  4USS A;  5D9V A;  5JWR B;  3ERF A;  3D4T A;  2PUK C;  1GSS A;  4WKW A;  5D96 A;  1JHB A;  1GUH A;  2XC2 A;  2H73 A;  4AKG A;  1RQM A;  4W66 A;  4ZIJ A;  1GLP A;  3A3T A;  2LST A;  1X9S B;  2IME A;  2DIZ A;  4IQA A;  1NM3 A;  3FHK A;  3LXT A;  3LXZ A;  4PGT A;  3ZL5 A;  2CVK A;  4K6X A;  5ID2 A;  1SKS B;  4BL7 A;  1Z6M A;  3ZFL A;  6GSU A;  3EYT A;  1A8Y A;  1F9M A;  3CRU A;  3FR6 A;  4AGS A;  1LBK A;  4BVX B;  1PMT A;  3KEB A;  1FHE A;  4PUR A;  3IHQ A;  2O87 A;  4AJ8 A;  3P2A A;  2X8H A;  2RII A;  1E2Y A;  3Q74 A;  2K8V A;  3C71 A;  5CO3 A;  5J41 A;  1USB A;  3IAS 2;  3DYR A;  4HI7 A;  1ACV A;  3PR8 A;  1FG4 A;  3V1W A;  1T1V A;  4HJ2 A;  1XW5 A;  4GCI A;  6GSX A;  4ILF A;  4MF6 A;  2G2Q A;  2YJH A;  4AJ7 A;  1V2A A;  1S3D A;  1X9M B;  3LJR A;  2I3Y A;  2OBK A;  2A4V A;  2CZ2 A;  4MDC A;  5A4W A;  3E3E A;  2IMD A;  2J23 A;  4TXO B;  3MDK A;  3FRC A;  1TU7 A;  2DLX A;  3GN3 A;  4KA0 A;  4IW9 A;  4ZB8 A;  1TKD B;  1XVW A;  2FWF A;  3CSJ A;  2UV8 G;  3W8S A;  1X5C A;  2XHF A;  4F03 A;  1XWK A;  1W4V A;  2V6K A;  4JBB A;  4DSQ A;  1WE0 A;  10GS A;  1WJK A;  4KUN A;  4FO5 A;  4X0X A;  2MBS A;  2JAD A;  1FOH A;  2LQQ A;  1XOB A;  5B8B A;  2KUC A;  3BCI A;  1B48 A;  2L5O A;  2FA4 A;  1FO5 A;  1ML6 A;  4POK A;  1QUW A;  1OC8 A;  2F8A A;  1LU4 A;  3G7Y A;  1K0N A;  2PWJ A;  5INY A;  2AHE A;  4WF5 A;  3CSH A;  2PU9 C;  4IHU A;  5A5H A;  2R0G A;  5GAN D;  1TDI A;  3GV1 A;  4JR4 A;  1TK5 B;  1QFN A;  1A24 A;  1J9B A;  2Z9S A;  4MP4 A;  4G0I A;  5DJL A;  2MBT A;  2F9S A;  4H86 A;  3FY7 A;  2V41 A;  4TR4 A;  2B6M A;  4MPG A;  5B6N A;  1ILO A;  3H79 A;  4OCF A;  1XPV A;  1EZK A;  5JCG A;  1M9A A;  1NSW A;  3GA4 A;  3EIN A;  1AIU A;  2NDO A;  1T7P B;  1OKT A;  3TUE A;  1GTB A;  2YNX A;  3F3R A;  4RI6 A;  2GZZ A;  1DE1 A;  2DJ1 A;  2CZ3 A;  1WRY A;  2H8L A;  1F3B A;  5IMZ A;  4TR3 A;  1YJ6 A;  2RM6 A;  1HD2 A;  3WYW A;  2JZR A;  5A34 B;  1UN2 A;  4MJE A;  5LCZ A;  1SJI A;  5L71 A;  2N5B A;  2DKI A;  2C3N A;  1WP0 A;  4KCE A;  4Q5R A;  2LJK A;  3A2W A;  3QOU A;  4TR1 A;  4ML6 A;  3WGX A;  4GXZ A;  4F0B A;  1TRS A;  1T4Z A;  1AQW A;  2H0I A;  4IP1 A;  4PQ1 A;  1MDI A;  2AUV A;  1Z3E A;  2IMF A;  3GH9 A;  4F2I A;  1MD3 A;  3IE3 A;  1HNC A;  3KP8 A;  4LMV A;  4EDY A;  4K2D A;  2HT9 A;  1GUL A;  1SKR B;  3IK9 A;  4NPB A;  2AB6 A;  4MJC A;  3P90 A;  3P8W A;  4GTU A;  3UBK A;  2YZU A;  5IOX A;  2YV9 A;  3FR9 A;  2H1A A;  3HZ4 A;  4GRF A;  3F8U A;  3DVX A;  1J0F A;  1KEB A;  1AQX A;  4Q5F A;  5ECM B;  4OWY A;  1SK1 A;  4BA7 A;  5C04 A;  2YCD A;  3LGC A;  2LRT A;  3TKP A;  4K1F A;  1O8X A;  3D22 A;  2GVP A;  4KB3 A;  1VF4 A;  4XS1 A;  1URM A;  2MMO A;  1ZYE A;  4MA9 A;  4MZC A;  1K0C A;  5E4W A;  3ZRD A;  1G7O A;  2V1M A;  2EIQ A;  3IOS A;  1SYX A;  5DQY A;  3C8E A;  5G1L A;  4HQZ A;  3QR6 A;  2C3T A;  2DC5 A;  2AV4 A;  4WBR D;  1WPI A;  1AW9 A;  4KGI A;  3J7Y k;  2WUL A;  1U88 A;  1YF0 A;  4RI7 A;  1GSQ A;  3ISO A;  1BED A;  1XWB A;  2DIY A;  1H75 A;  2V32 A;  3QAW A;  3HKR A;  4CY6 A;  12GS A;  3ME8 A;  5IMD A;  3IBH A;  1BF5 A;  4P3Y B;  2VD1 A;  3BBY A;  1ST9 A;  2OE0 A;  1K0O A;  4XS4 B;  4GST A;  2HZE B;  4FIW A;  2HSM B;  2D2Z A;  3UAP A;  3GNJ A;  2IJY A;  4RQR A;  1XFL A;  2VKZ G;  1TXX A;  2EIR A;  3EMP A;  3TCO A;  3LG6 A;  2GSR A;  2HRK B;  5A4U A;  3UEM A;  1PKZ A;  1F2E A;  1SD9 A;  3BD2 A;  1ZCP A;  2PPT A;  5JWQ B;  2VCW A;  3IAM 2;  4HEA 2;  1VF2 A;  1TI3 A;  3LYK A;  3GIX A;  2N5F A;  1U6T A;  1B8X A;  5J4U A;  3QDN A;  3IC4 A;  1S3A A;  4EVM A;  4YH2 A;  4BVY A;  2OBI A;  1OYJ A;  2DML A;  2R6K A;  4JR6 A;  3BCK A;  2FCH A;  4KH7 A;  2G0F A;  4TR0 A;  3EMX A;  4IJ3 A;  4YQV A;  2FA8 A;  2F51 A;  5JCU A;  3IDV A;  4HU9 A;  5IIZ A;  3H1N A;  1GSY A;  2GT5 A;  5LNK e;  2H1G A;  2VL9 A;  2MYG A;  2MMN A;  2H01 A;  1V57 A;  3HYP A;  4V2N A;  2KP2 A;  1U3A A;  4YKF A;  1TK8 B;  2JZS A;  1G6Y A;  4GF0 A;  3APQ A;  1TJD A;  1SYR A;  4MLY A;  1EGO A;  1SEN A;  2VCZ A;  4HS1 A;  4PTS A;  1ZOF A;  2HFD A;  3HVS A;  4GLT A;  5IMF A;  5LD0 A;  4BWS A;  3TJJ A;  4ZBB A;  4K8M A;  4XRA A;  2A2R A;  4GSS A;  2WZ9 A;  4KE3 A;  1PX7 A;  4PUA A;  4E68 A;  1A23 A;  2OE3 A;  3F9U A;  3GH6 A;  2JSZ A;  3JCM L;  4KAE A;  4TVE A;  5HFI A;  3I43 A;  5KN3 A;  4D73 B;  1SD8 A;  1FW1 A;  3LFL A;  4XRD A;  5A1N B;  18GS A;  2VM2 A;  3IK7 A;  1MD4 A;  4KDY A;  5ECP B;  2B1K A;  3HD5 A;  4CW9 A;  2C4J A;  2OAD A;  1M2A A;  3TKS E;  4A5P A;  4ECI A;  3F0I A;  5DAK A;  1PN0 A;  1GNE A;  3FZ5 A;  1TU8 A;  1BYE A;  1TI1 A;  1UVZ A;  3CXG A;  4OO4 A;  4AJ6 A;  4GSN A;  1Q98 A;  2CVD A;  2ON5 A;  2I9H A;  1M2B A;  2WJU A;  4J2F A;  3QAV A;  1GUK A;  3GUR A;  3ERW A;  4TW5 A;  4GQF A;  3HA9 A;  4OFN A;  1EOG A;  5COH A;  1YKA A;  1GNW A;  4AKH A;  4ECJ A;  2BMX A;  5ECQ B;  4YQU A;  3WGD A;  4TOP A;  1EP7 A;  2QGV A;  2F3M A;  1T00 A;  3R3E A;  1ZMA A;  1N8J A;  2H76 A;  4DSS A;  2O85 A;  5CRW A;  4BPY A;  2LRN A;  2EIO A;  1Y25 A;  3FR3 A;  4IN0 A;  4OFT A;  3KP9 A;  3QFA C;  2H66 A;  2EC4 A;  2E2G A;  1ON4 A;  2JL4 A;  3HZ8 A;  1K0B A;  2TRC P;  3MSZ A;  1XZO A;  3QFB C;  2C0F A;  1SK2 A;  1THO A;  4F0C A;  1FVK A;  5DQS A;  1SKW B;  4KF9 A;  2LJR A;  2GQM A;  4POM A;  3M8N A;  2K18 A;  5IMA A;  3KD0 A;  3FK8 A;  4JZQ A;  2JSY A;  1OE7 A;  4Q5Q A;  1SVL A;  1OC9 B;  5ECN B;  3PH9 A;  1BQ7 A;  2WGR A;  2CQ9 A;  2R0P A;  5KEJ A;  1T4Y A;  2YPM A;  1IYI A;  3HJO A;  4AF2 A;  1KBN A;  4TKY A;  1YY7 A;  1R5P A;  2MMA A;  2VL3 A;  4JRR A;  1E6B A;  1K3O A;  4MH2 A;  1OAZ A;  4MNN A;  2YOI A;  3GMF A;  3IC8 A;  1A2M A;  2DKH A;  2YWO A;  3A2X A;  3NOF A;  3APO A;  4FYC A;  2LKU A;  2PN8 A;  2O8V B;  3LYP A;  1H4O A;  3E0U A;  4MCU A;  1F37 A;  2EFC A;  4ZB9 A;  3UBL A;  2DJ2 A;  3HCZ A;  1SL2 B;  5IPH A;  3EPT A;  1OE8 A;  5IMC A;  3GSS A;  2VIM A;  2H1L A;  11GS A;  5HR1 A;  1X5E A;  4ZB7 A;  2M80 A;  4LL1 B;  5J4Y A;  1YQ1 A;  4AI6 A;  5ELG A;  1GP1 A;  4OO5 A;  3HMJ G;  4HDE A;  3WT2 A;  5ENU A;  2HI7 A;  2ZUP A;  14GS A;  4ACS A;  2H70 A;  4EIQ A;  1ERT A;  1LJR A;  3M1G A;  5IPG A;  3GKK A;  3Q18 A;  1O81 A;  5CRE A;  2VO4 A;  1T3B A;  2TRX A;  4HUA A;  2YAN A;  3HXS A;  5B6M A;  4LL4 B;  3L4N A;  5J3R A;  1DUG A;  3APS A;  4TXV A;  2VCX A;  4TXO A;  2C80 A;  4NV5 A;  1O73 A;  1K3L A;  1OKD A;  4BWQ A;  2M72 A;  3TJG A;  1R4W A;  2VL2 C;  4G0L A;  3MYD A;  3UIW A;  1BJX A;  2GQL A;  3VWW A;  2H6X A;  2IPA A;  2E2M A;  1TOF A;  5FHI A;  2DJJ A;  3L78 A;  5CRD A;  5FT3 A;  3S9F A;  4KDX A;  5ELA A;  3GYK A;  2QA2 A;  3FZA A;  2IFQ B;  2E7P A;  5J47 A;  3D6I A;  4O5U A;  3QPM A;  1UA5 A;  5DCH A;  4ID0 A;  3RBT A;  3DEX A;  2HSY A;  1YVL A;  1QMV A;  2O89 A;  4ISD A;  3DIE A;  2MMZ A;  4GDF A;  1PKW A;  1JZW A;  2X49 A;  2WB9 A;  3TKS A;  4K7I A;  3UL3 A;  2HNL A;  4GQC A;  2HRA A;  1M9B A;  1J08 A;  2FUG 2;  1V9W A;  2R37 A;  2HSH A;  2WFC A;  3C73 A;  5EVO A;  4G10 A;  3IRA A;  3Q6O A;  20GS A;  2K9F A;  2R3X A;  5G31 A;  1GH2 A;  2GSS A;  4WF4 A;  3IXR A;  4HQS A;  4WEY A;  4O5Q A;  1THX A;  3CYN A;  1CQG A;  1BG5 A;  1Z9H A;  3A2V A;  3TGZ A;  4ICY A;  1YF1 A;  3F4R A;  5E59 A;  3DXB A;  2OKA A;  2PGT A;  2C0G A;  2GST A;  3FKF A;  4KND A;  1G0T A;  1TP9 A;  3R2Q A;  1EEJ A;  5A34 A;  2YZH A;  5KOW A;  1O8W A;  5ECR B;  5IMV A;  1XWA A;  3ZFB A;  3F63 A;  5DAL B;  4J56 E;  3UVH A;  1XW6 A;  5BMU A;  2P5R A;  2CA8 A;  3M3M A;  1TTZ A;  1ZYP A;  5AIV A;  1JFU A;  1X5D A;  4DVC A;  1GTA A;  3N9J A;  5ECO B;  1EWX A;  4EIP A;  3LWA A;  4TN8 A;  2LNS A;  2WDU A;  2DSA A;  2FWH A;  5GZZ B;  1PSQ A;  2XPE A;  3WGE A;  4CY8 A;  4IS0 A;  1VGL A;  3HHV A;  2DJ3 A;  4EF0 A;  1XW9 A;  2B1L A;  4MAB A;  3N5O A;  3U5R E;  1WMJ A;  2H0H A;  2YWI A;  3GHA A;  3O3T A;  2GGT A;  2L59 A;  5DCG A;  1NHY A;  3MIX A;  5F06 A;  4WXT A;  4OFM A;  2VLV A;  4EO3 A;  3HJM A;  3EE2 A;  4K5R A;  4KX4 A;  3C1S A;  4G9H A;  5IO0 A;  3O76 A;  2XPD A;  3ZMK A;  2FY6 A;  4ECC A;  1XBS A;  2BJX A;  1BAY A;  2ALB A;  4EXJ A;  3A5I A;  3M0F A;  2IN3 A;  1O7U A;  3ZRE A;  4ZL9 A;  5ABR A;  1ZYQ B;  2QA1 A;  4K0G A;  3E9J B;  4IQ1 A;  3D5J A;  3L9V A;  1GTU A;  2V2G A;  4POL A;  4K9Z A;  2B5E A;  4NHW A;  17GS A;  4PUF C;  4MJB A;  1DBY A;  4FQU A;  3CMI A;  5AN1 A;  3CSI A;  1M2D A;  4XTS A;  4IBP A;  1GSU A;  4O7H A;  5CRG A;  3VPQ A;  2FHE A;  3TKS C;  3TOT A;  5F8B A;  2L6D A;  1PL2 A;  2CAQ A;  5ECK B;  5CRH A;  2ON7 A;  4XS4 A;  1SJ6 A;  2N5A A;  2HZE A;  2LUS A;  5G5E A;  2HSM A;  2UZ8 A;  2LRC A;  3IHG A;  2A4H A;  2C0E A;  2H19 A;  1A0R P;  3UOM A;  1GSF A;  1YKC A;  4NV2 A;  5DBQ A;  2RUF A;  2HRK A;  2X64 A;  3MAK A;  3D0Z A;  4IEL A;  3TJK A;  3NIV A;  2AAW A;  3ZTL A;  3DML A;  1AAZ A;  5EL8 A;  3L9U A;  2GQK A;  4N3Z A;  2DMM A;  4GWR A;  2C0D A;  4E8E A;  1SU9 A;  4MJA A;  4QL9 A;  2NVL A;  3CTF A;  4HJM A;  3K8N A;  3GTU B;  2ES7 A;  1FOV A;  2K8S A;  4IKH A;  3UMA A;  2X99 A;  3KCM A;  1SVO A;  2YWN A;  3PPU A;  4HZ2 A;  7GSS A;  2HSN B;  2LQO A;  3IR4 A;  2H72 A;  4J57 E;  4POB A;  2KLX A;  2E0Q A;  4HU7 A;  5ECL B;  1A8L A;  4EDZ A;  1PL1 A;  4ML1 A;  5IQY A;  4I5Q A;  5GAP D;  2EFD A;  1DE2 A;  2J9H A;  1MDK A;  3EWL A;  2DBC A;  3TU3 B;  5H5Q A;  2JZT A;  4LA1 A;  4PX1 A;  2A2P A;  2V6O A;  2B5Y A;  2YP6 A;  4WR4 A;  5A4V A;  3GST A;  3F6F A;  3VI7 A;  5DJM A;  4MZW A;  1K0M A;  3DD3 A;  1EEM A;  2F8F A;  6GSV A;  4V2L A;  5IO2 A;  3KIJ A;  5F0G A;  4IVF A;  1N25 A;  1U3I A;  1F3A A;  2LTK A;  5ID2 B;  1QQ2 A;  3KH7 A;  2RUE A;  4I2U A;  4BL7 B;  1OC3 A;  2KP1 A;  2YV7 A;  2VL2 A;  1XWG A;  4RUV A;  4KSM A;  3W6G A;  4D73 A;  1EOH A;  2CX3 A;  2IIY A;  3IPZ A;  4CHS A;  1FAA A;  2XBI A;  4ECB A;  5KN2 A;  1N2A A;  2PMT A;  2HQT A;  3H93 A;  5HQP A;  4N11 A;  5A1N A;  5KN1 A;  3US3 A;  1MDJ A;  2FWE A;  6GSS A;  3G7J A;  1Z5Y E;  5G1K A;  4YQM A;  2FD3 A;  2P0G A;  1EV4 A;  4V1A g;  3GFK A;  5JCW A;  2QKE A;  5D73 A;  1MTC A;  4ZB6 A;  1BX9 A;  2PVO C;  2PBJ A;  4YAV A;  1GL8 A;  4HZ4 A;  3I6A A;  2HXK A;  3KMN A;  5ECS A;  2GZY A;  3KM6 A;  1DSB A;  19GS A;  2DJK A;  6GSY A;  4MF5 A;  2IWT A;  3IA1 A;  3LOR A;  5KN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...