1VF3A

Cgsta1-1 in complex with glutathione conjugate of cdnb
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
KPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 82
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf3A01
2RM6A 2R2JA 1SL2B 5JWOB 1SKSB 3BCKA 2WB9A 2FWEA 3FZAA 1V57A 1TRWA 5D93A 3R3EA 2XBIA 1J08A 1G6WA 2B1LA 1S3CA 2GZZA 3FKFA 1V9WA 4J2FA 2I1UA 3US3A 2LJKA 4TRXA 4L0WA 1UVZA 6GSYA 2LKUA 1TU7A 5ABRA 1K0NA 4DSQA 2LNTA 2D2ZA 3VI5A 2AUVA 2RUEA 3SWLA 1XWGA 5IIZA 4IS0A 5B7CA 2C1YA 2UZ8A 1I5GA 2IWTA 4TN8A 1SL1B 2VAFA 3HD5A 4TR0A 5DALA 3HHVA 4L0UA 1CQGA 1EOHA 5ECPB 2HI7A 3DVXA 2TIRA 4O7HA 4N0VA 1YKAA 5G30A 1OKDA 3EC3A 2WGRA 4ZB8A 3HVSA 1EP8A 3HA9A 4YH2A 2EIOA 5IPHA 2AB6A 2MBTA 5LNKe 4F9ZA 2YN1A 1VF1A 3DYRA 2QGVA 1UN2A 5DAKA 1GSEA 3RAZA 4HZ2A 3BOAA 1FB0A 1PGTA 3UJ1A 1MTCA 3GUSA 10GSA 1TDIA 1SD9A 2J9HA 3F4RA 8GSSA 1DSBA 1QUWA 3DD3A 1ERTA 5CNWA 3GN3A 3DXBA 1AIUA 2YWNA 3QAWA 5F06A 3TKQA 4HU7A 3GTUB 2IN3A 1Q98A 4EDYA 1BQ7A 5L71A 4TOPA 2X99A 1M7TA 4ID0A 4XIHA 3KTLA 4PXOA 1PQNA 2YANA 3FK8A 1NHOA 2OBKA 2IMIA 1B4QA 1EOGA 1XWKA 4Q5FA 4DSSB 2LNSA 1XPVA 3QR6A 2BTOT 2C3NA 2E2GA 5A4VA 1GRXA 3P90A 1PRXA 4P3YB 3KTBA 4KH7A 3VK9A 2O8VB 5IQYA 3ZVJD 3VI7A 5KN0A 4K6XA 4TR1B 3CSIA 5GSTA 2QKEA 4PUAA 3WGDA 3PPUA 2H6ZA 3LXTA 5DQSA 4HJ2A 2GQLA 4NMUA 3LWAA 3TKRA 3EYTA 3PGTA 4MZCA 1A23A 2QSIA 3H8QA 3GX8A 4F0BA 2G0FA 4NV2A 1PKWA 4YQVA 3D22A 2VOCA 4G9HA 2CQ9A 4J56E 2QC7A 3DKSA 2EIRA 2PMTA 4V2MA 2F51A 1PX6A 2JSZA 1PN9A 1FB6A 5CRGA 1SJZA 2RIIA 3HZ4A 3A3TA 5KN1A 3HXSA 1J0FA 2HRFA 2CA8A 2HQTA 4OCFA 3Q6OA 3MWHA 3F6FA 5IMDA 2L6CA 2NPBA 3O3TA 4IQAA 1TI1A 3D5JA 2K9FA 1F2EA 1EZKA 5ECNB 3C7MA 1QGVA 2MYGA 4AJ6A 3GSSA 3IDVA 2H74A 4BPYA 4BVYB 1OVNA 2YV7A 2HLSA 2H6XA 2WJUA 3F9UA 11GSA 1PKZA 3TJFA 4KX4A 3O76A 2XBQA 2VCWA 1O8WA 2KUCA 5A5KA 19GSA 1X5CA 4K1FA 3SBCA 3WT2A 3KM6A 2IJYA 4LL1B 5ENUA 4MA9A 2LRTA 5IO0A 2PGTA 1AAZA 2MMOA 2K8VA 1SD8A 2NTOA 1T8EB 2XC2A 1GSQA 4I97A 4K8MA 2A2SA 1TI3A 4USSA 2F9SA 4H86A 3DRNA 2B5EA 1Z6MA 3APSA 3MDKA 1GUKA 4F2IA 2CAIA 5A4UA 3CSHA 1ERVA 1MDJA 4AGSA 3N5OA 4XS4B 4NHWA 1XWCA 4IJIA 4DEJA 1R26A 1GUMA 2TRXA 2C3QA 1GUHA 3C8EA 3J7Yk 1SJIA 4MZBA 1K3YA 4GLTA 4D73B 4L8EA 2CX3A 5DCGA 3UL3A 5AISA 2HRNA 2VCXA 5AIXA 2HSYA 2IIYA 5C04A 1M2BA 4RUVA 17GSA 4TVEA 2FGXA 2GSRA 4IW9A 1V58A 2DMMA 2JSYA 1O85A 3WGEA 1OC9B 2OKAA 1GNEA 3CYNA 2V6KA 4RI6A 2H75A 1M9AA 3JCML 1AQVA 2FLSA 2VCVA 3IOSA 4IQ1A 4NXIA 2L5LA 4POMA 2VD0A 5GAND 3KMNA 5IMVA 3M3MA 4ZB6A 4L5OA 1XIYA 1PMTA 4G0LA 3FEUA 5ID2A 3E9JB 2E2MA 2VLTA 1FVJA 1M99A 1A8LA 3GKKA 4N0ZA 1LU4A 3F4SA 3GH6A 4OFTA 3GMFA 3KMOA 2E0QA 4ZBDA 4CDOA 4YQUA 1BJXA 1FAAA 4X43A 13GSA 2OE1A 4O32A 2FY6A 3DIEA 1FW1A 4G2EA 2ZUPA 3L9UA 5ECLB 3VLNA 3IAS2 4ACSA 3CSJA 4CHSA 2WCIA 1G0TA 3O6TA 4F82A 3LEFA 4IELA 2C3TA 2M80A 3QCPA 1HYUA 4RI7A 2GGTA 3ED3A 2MZCA 3U6VA 2HRKB 2I9HA 1ERUA 2HT9A 4HU9A 4WR4A 2FWGA 2B6MA 3QFBC 2HE3A 1JFUA 2K6VA 3RHBA 6GSUA 3KGKA 3TOUA 1XW9A 1EGRA 22GSA 5LCZA 1QQ2A 1EP7A 5EY6A 2M46A 4AJ8A 2HNLA 2N5FA 1SK0A 4V2LA 2NBSA 3KH9A 1N2AA 3AY8A 4MF5A 3ME8A 4OO4A 1K3OA 3QAVA 4GQFA 4Q5NA 1A0RP 1U3AA 4GXZA 4MCUA 1A2MA 2HZFA 4XHMA 3TGZA 4KAEA 5HR2A 3M0FA 4BL7B 2YOIA 4G0IA 3KP8A 2F8FA 2YNXA 1BX9A 1JZWA 1Z3EA 1K0DA 3ZIJA 2IMKA 1O8XA 1VRSD 4HDEA 1URMA 1G7EA 3RPNA 2JL4A 3ZLPA 4ZL9A 1THOA 3GHAA 4KW6A 3ZITA 2HSMA 4LLRA 3LORA 1YDKA 2IMDA 4KGIA 5G2ZA 1WWJA 4IJ3A 2PWJA 2V32A 1TW9A 5HR0A 1X0RA 4TR3A 2GSTA 1AQXA 4GF0A 5H5SA 3D21A 4MK3A 4F0CA 5CRHA 1NHYA 5IMZA 3L78A 3KCMA 3BJ5A 2VM2A 2O87A 3M9JA 1HQOA 3KP9A 5AGYA 2O7KA 4OCEA 1MDKA 2LJRA 4EF0A 5COHA 2EIQA 5HR3A 2HRAA 3GRXA 14GSA 3MSZA 1XW6A 2FNOA 4OO5A 3IK9A 2L4CA 1A24A 2VL9A 1XFLA 3LQ7A 5HQPA 2DJ3A 3ZIVA 2CV4A 2IMEA 4DSRA 4MPGA 5J9CA 2VCZA 2JZSA 4WKWA 4N11A 4FQUA 4E8HA 3FYGA 5GZZB 5D96A 4TR4A 2CX4A 5ECKB 1BEDA 1TP9A 5J9BA 1ZZYA 1TRVA 4MH2A 2R3XA 1T1VA 4I5QA 3HCZA 4ZILA 4LMVA 5LD0A 1ML6A 3VURA 3QFAC 1M9BA 5B6MA 2LV3A 1TK0B 1X5DA 3OR5A 2IFQB 1SKWB 1XOBA 2L6DA 1YJ6A 1Z5YE 2I3YA 4KCAA 4QQ7A 2HZEB 3IE3A 4XCSA 2IPAA 1X9MB 2GVPA 5D9VA 1SYXA 4JBBA 1XW5A 5DQYA 4CW9A 4NAXA 3V1WA 2OJLA 3TCOA 2C80A 5HR1A 3KIJA 1XWAA 1GH2A 2FWHA 2JU5A 3H4KA 1Y25A 5KEJA 3EVIA 3DWVA 4HZ4A 5GAPD 3IC8A 1JLWA 2ON7A 4J57E 1K0BA 2VCQA 2FWFA 1F37A 2H0HA 2YZHA 4MPFA 4AJ7A 1YKCA 5JCGA 1V40A 3MNGA 1G6YA 1ZGNA 3H79A 5D8IA 5J3RA 5ECRB 5ELGA 2LSTA 1B9XC 4GSSA 1ZMAA 3HDCA 4HI7A 4FIWA 2J23A 2VLUA 4GWRA 3NOFA 1YZXA 1HNCA 2R6KA 4K0GA 3D4MA 1ZOFA 3F3QA 4WBRD 1J9BA 2P5RA 2P0GA 3C73A 5AIVA 3UMAA 2FHEA 4AF2A 3FR9A 5JCUA 1Z7PA 1DE1A 4V1Ag 3WD6A 3LFLA 1OC8A 1WE0A 2X8GA 1DBYA 2CT6A 3CRTA 1Z6NA 4TW5A 4ZL7A 2E7PA 2L5OA 3EE2A 2OE3A 4N30A 5EPFA 1QFNA 1MD3A 1XZOA 2WS2A 2FCHA 4DVCA 3EINA 5DALB 5D9WA 1AW9A 2H66A 1GTBA 2N5BA 3GFKA 3HKRA 5H5RA 1PL1A 3Q19A 1F6MC 1XOAA 3L9VA 3WYWA 1F3BA 1YEXA 2I4AA 3CRUA 3ZTLA 1O6JA 3CMIA 4IGJA 2HXKA 4MZWA 1A2LA 6GSTA 1GLQA 5DAKB 2GS3A 2NVLA 2OADA 4OFMA 4KDYA 2H01A 2KP2A 4MF7A 2AYTA 3P2AA 1YQ1A 2YWOA 4YAPA 1LJRA 2VM1A 1B9YC 2VCTA 5CP1A 3VFIA 2X64A 5ECHB 2AAWA 1USBA 1UA5A 2C0GA 1THXA 3E3EA 3L4NA 3WGXA 3UOMA 2LRCA 4OFNA 4K9ZA 4XRDA 1RQMA 3KEBA 3F63A 2CAQA 4PNGA 3U5RE 4MJAA 2H0IA 2LRNA 2C0FA 2LQQA 3GA4A 4KCEA 2H8LA 2B7KA 5HFIA 1H75A 2Z9SA 1BYEA 2H1GA 2V1MA 2PBJA 2KP1A 1GL8A 3ERWA 1FO5A 1U88A 3GV1A 1V2AA 1XVQA 3FZ5A 1U3IA 2GLRA 1MDIA 5B6NA 3IPZA 3VWWA 2H0GA 3L9SA 1TRSA 3UEMA 3HJPA 1NW2A 1O7UA 3ERFA 3G9BA 5EVOA 3D0ZA 2DJ1A 4K2DA 3FZ9A 1KTEA 2MMZA 1GLPA 3IC4A 4FYUA 4POBA 1ZYQB 2CVKA 2R5GA 1QXHA 1WPIA 4ML1A 3Q18A 3G7YA 2O89A 2H76A 3VWUA 16GSA 1TJDA 5DDLA 4O5RA 4K7NA 2PVQA 1FHEA 4IP1A 5G5FA 1FVKA 5FHIA 1WP0A 1A2JA 2GTUA 4ECCA 4BVXA 4ZBBA 4PTSA 1BAYA 4G10A 4V2NA 3FW2A 4IP6A 1QK8A 2OBIA 5D9XA 5G1LA 2C0EA 1ZL9A 3BD2A 3GYKA 3HZ8A 2WDUA 4LMWA 3L0HA 4K7IA 2XHFA 5ECIB 1HNAA 3PH9A 3GKMA 4FYCA 1R4WA 3RHCA 4WF5A 1X9WB 3IK7A 3ZREA 1ABAA 2H73A 3FRCA 4PX1A 5GSSA 2YWMA 4TXOA 1TTZA 1T4YA 1SJ6A 4LL4B 2DJKA 1EGOA 3GSTA 2JACA 5JWQB 1XVWA 1VF3A 2R37A 1IYIA 1A8YA 2XPDA 1A0FA 1ILOA 5D9TA 6GSXA 3LGCA 2PERA 2H1DA 2NDOA 1EEMA 4JE1A 3Q74A 1Y6EA 4OMVA 4V1Ap 4MABA 1AC1A 2REMA 4FYBA 2HSHA 5EL8A 5HFGA 2YJ7A 1T4ZA 2XPEA 4IVFA 5E4WA 3LG6A 1PA3A 4WR5A 3M8NA 5FT3A 4MDCA 2KHPA 4KA0A 3EMXA 1T7PB 3ZRDA 2H30A 3LYKA 1Z7RA 3QAGA 1W89A 4GSTA 1Z9HA 1M2AA 3FHKA 3E0UA 4ZXGA 3W6GA 3TJJA 1OAZA 3UIWA 3HVXA 2EC4A 4HOJA 3KD0A 1JZRA 4MP4A 4K7OA 2HYXA 4EO3A 2DIYA 4EUYA 1LBKA 4PQHA 4MJBA 1EV9A 5CRWA 5ECMB 5DBQA 3UAPA 4MLYA 3ZVJA 5IMCA 2WZ9A 18GSA 3APQA 3BBYA 3W8JA 4PQ1A 4BWQA 2RLIA 1GP1A 3GKXA 1JZOA 1TK8B 3UBKA 4X0XA 1OE7A 1DE2A 3KJYA 4JU5A 2ALBA 1PX7A 2RM5A 5IMFA 2LJAA 3C1SA 1X9SB 3TRXA 5CO3A 4KF9A 3UVTA 2FUG2 5ID2B 4K0NA 1SENA 2CZ3A 3GTUA 3CXGA 1EV4A 4Q5RA 5IOWA 3DEXA 4Q5QA 5AN1A 4MMMA 3TKSE 2GQMA 4TKYA 3KH7A 2DIZA 4POLA 4DSSA 2L4QA 2PPTA 2DC5A 4I2UA 4NHZA 2MMNA 1AQWA 2IL3A 3HJMA 3IA1A 3F8UA 5IOXA 1KNGA 3EWLA 1NSWA 4ILFA 3I9V2 3GL5A 4HEA2 3RPPA 1VGLA 4MJEA 2OE0A 4TR1A 1PSQA 1NM3A 1XWBA 3CTGA 2BMXA 4EKZA 1SYRA 2A2RA 2GSQA 1X5EA 4KNDA 1TRUA 3DMLA 2AV4A 4MH3A 4XS1A 3QMXA 2VO4A 4ECBA 3FR3A 2I81A 1F3AA 2GSSA 5F07A 2X8HA 3ZFLA 4JR4A 2GT6A 2L59A 2PU9C 1R5PA 1XCCA 2OA7A 2KOKA 1OYJA 5CREA 1OE8A 5G1KA 5C00A 5IPGA 4ECIA 1K0OA 4QL7A 1ST9A 1TU8A 3RBTA 1B48A 2B5XA 2VLVA 3TDGA 1SL0B 3FZ4A 3QOUA 1N8JA 3EU4A 3N9JA 4PQIA 3R2QA 5B8AA 1ACVA 1HNBA 3TB2A 3HJOA 2DJJA 2CVDA 3TJGA 4XS6A 1S3DA 2HSMB 1KEBA 3P8WA 1GSSA 3TOTA 2V2GA 2ON5A 2ZCTA 5A4WA 3I6AA 1R7HA 3F6DA 4XTSA 3C71A 1K0MA 1GWCA 3M1GA 4BVYA 2V6OA 3ZZXA 1GNWA 3RDWA 2M72A 3W8SA 2HFDA 1TOFA 2TRCP 1F9MA 3D4TA 3GKNA 4WF4A 4L5LA 5J5NA 1T3BA 4I8BA 4PNFA 1HD2A 5INYA 4QL9A 1WJKA 1ERWA 4GCIA 1MEKA 2YWIA 3IXRA 2ES7A 4GQCA 2H72A 2X8CA 2KLXA 1OKTA 6GSSA 2DJ0A 3LJRA 1TKDB 4EE0A 5BMUA 2N5AA 4XS4A 4F03A 4I6XA 1K0CA 4O92A 1EEJA 4KE3A 2K8SA 2LUSA 3GIXA 3TJBA 1KBNA 2YCDA 3DVWA 5CRDA 1U87A 4HQZA 4BWSA 2B3SA 3ZL5A 3H1NA 1GSDA 3LXZA 3ZYWA 3NIVA 4D73A 2C8UA 1B4PA 3F0IA 2A4VA 2LS5A 5H5QA 1WMJA 3M9KA 2LQOA 5JCWA 4NWYA 5G31A 3ISOA 4EC0A 3TUEA 3I69A 2GZYA 1O73A 1K0AA 3EU3A 4WEYA 3KXOA 1OC9A 1R5AA 3IV4A 3FY7A 5CAXA 5ECQB 4JR6A 1JHBA 3HYPA 3FR6A 4GTUA 2H71A 1VF4A 3I43A 3DGQA 1XXUA 2GZPA 7GSSA 5IO2A 1B8XA 4X1UA 2MMAA 3UARA 1EWXA 2B1KA 1GSYA 3MAKA 4HUAA 2H70A 5E59A 2P5QA 1SKRB 2HSNB 1M0UA 1GTAA 1H4OA 4G19A 2G2QA 4IHUA 1PD21 1QMVA 3EURA 1DUGA 4POKA 1RW1A 3GURA 4ZIJA 3UVHA 3TKSA 2F8AA 2DMLA 1YF1A 3H93A 3D6IA 2HRKA 4IKHA 4N10A 4KUNA 3LYPA 1E2YA 3G7IA 3TRPA 1Q4JA 4JZQA 3A2XA 6GSVA 4KSOA 12GSA 1FG4A 4GSNA 3QPMA 2FD3A 3J7Yb 1V98A 4WETA 4IBPA 4WXTA 2GT5A 4WBJA 1PL2A 4IN0A 4YAVA 2LTKA 2YJHA 4XRAA 2ZNMA 4BA7A 5F8BA 3F3RA 3IAM2 2GQKA 1FOVA 2YP6A 4HQSA 1ON4A 2B5YA 1BG5A 3A2VA 1S3AA 3TKSC 3K8NA 5F0GA 3BCIA 1WOUA 3NZNA 3IHQA 1YF0A 2GDRA 5B8BA 3C1RA 4ZBAA 3LSZA 4BL7A 3QDNA 5ECSA 3TJKA 2OACA 5IMAA 4Z7XA 5DJLA 2VD1A 3S9FA 3F4TA 2VUPA 2VL2A 5DCHA 1GSUA 2LEGA 4KSMA 2R4VA 5J4UA 3A2WA 4ZB9A 4MJCA 2IMFA 1U6TA 3ERGA 5KN3A 1WRYA 4RQXA 1XBSA 4ML6A 2DLXA 5G5EA 1WIKA 4PGTA 5FWGA 4OD7A 2FA4A 2O85A 1AUCA 1YEPA 9GSSA 3CTFA 3ME7A 3ZMKA 2DJ2A 2H6YA 4E8EA 1IYHA 5CYYA 1GSFA 3VPTA 2PVOC 1I9DA 1SK2A 2VL2C 2WRTA 2V41A 3IR4A 1E6BA 4ISDA 5D73A 3TRQA 2JZRA 3KZQA 2CZ2A 1TXXA 3VWVA 1RK4A 4PURA 1SU9A 3ZFBA 4RQRA 4PUFC 3IBHA 3CBUA 2BJXA 2PN8A 4OWYA 3WT1A 2VIMA 3A5WA 2YPMA 2H19A 3VPQA 1GTUA 1W4VA 4ULXA 2YV9A 3EMPA 2MBSA 5HFKA 1SK1A 1YY7A 1GTIA 2WFCA 5J41A 1OC3A 2WULA 3TKPA 3UBLA 5IM9A 2DSAA 4YQMA 4I2TA 4ECJA 1O81A 5ECOB 2H1BA 1G7OA 2P31A 3PINA 2L57A 2VL3A 3PR8A 4GRFA 4EVMA 4MF6A 1T00A 2DBCA 5KN2A 3GX0A 4ZL8A 3APOA 1AXDA 1CQHA 2IFQA 4EDZA 1JLVA 2H1AA 2JZTA 3IRAA 3G7JA 1MD4A 3QD9A 5ELAA 4KB3A 5F05A 2HZEA 1C72A 4EL1A 4BVXB 5DVBA 5JWRB 4FO5A 4KDXA 2K18A 4NPBA 2YZUA 20GSA 4HS1A 3ZMLA 4NV5A 2F3MA 1ZCPA 2FA8A 1VF2A 2AJQB 4EXJA 2B7JA 2C4JA 2PUKC 3GL3A 1M2DA 4JEDA 1ZYEA 1GULA 3P7XA 4JRRA 1TK5B 3VWXA 2JADA 4KDUA 4FH8A 3GNJA 3HVVA 3HY2A 1K3LA 4G0KA 2RUFA 4HJMA 2C0DA 2AHEA 3GH9A 4LA1A 4TXVA 4TXOB 1JZDA 1UC7A 5DJMA 6GSWA 2CVBA
chains in the Genus database with same CATH superfamily
2RM6A 2R2JA 1SL2B 5JWOB 1SKSB 3BCKA 2WB9A 2FWEA 3FZAA 1V57A 1TRWA 5D93A 3R3EA 2XBIA 1J08A 1G6WA 2B1LA 1S3CA 2GZZA 3FKFA 1V9WA 4J2FA 2I1UA 3US3A 2LJKA 4TRXA 4L0WA 1UVZA 6GSYA 2LKUA 1TU7A 4N3ZA 1M3JA 5ABRA 1K0NA 4DSQA 2LNTA 2D2ZA 3VI5A 2AUVA 2RUEA 2QA1A 3SWLA 1XWGA 5IIZA 4IS0A 5B7CA 2C1YA 4K2XA 2UZ8A 1I5GA 2IWTA 2R0GA 4TN8A 1SL1B 2VAFA 3HD5A 4TR0A 5DALA 3HHVA 4L0UA 1CQGA 1EOHA 2WVZA 5ECPB 2HI7A 3DVXA 2TIRA 4O7HA 4N0VA 1YKAA 5G30A 1OKDA 3EC3A 2WGRA 4ZB8A 3HVSA 1EP8A 3HA9A 4YH2A 2EIOA 5IPHA 2AB6A 2MBTA 1M3IA 5LNKe 4F9ZA 2YN1A 1VF1A 3DYRA 5J4VA 2QGVA 1UN2A 5DAKA 1GSEA 3RAZA 4HZ2A 3BOAA 1FB0A 4AKHA 1PGTA 3UJ1A 1MTCA 3GUSA 10GSA 1TDIA 1SD9A 2J9HA 3F4RA 8GSSA 1DSBA 1QUWA 3DD3A 1ERTA 5CNWA 3GN3A 4G01A 3DXBA 1AIUA 2YWNA 3QAWA 5F06A 3TKQA 4HU7A 3GTUB 2IN3A 1Q98A 4Z2RA 4EDYA 1BQ7A 5L71A 4TOPA 2X99A 1M7TA 4ID0A 4XIHA 3KTLA 4PXOA 1PQNA 2YANA 3FK8A 1NHOA 2OBKA 2IMIA 1B4QA 1EOGA 1XWKA 4Q5FA 4DSSB 2LNSA 1XPVA 3QR6A 2HSNA 2BTOT 2C3NA 2E2GA 5A4VA 1GRXA 3P90A 1PRXA 4P3YB 3KTBA 4KH7A 3VK9A 2O8VB 5IQYA 3ZVJD 3VI7A 5KN0A 1S3RA 4K6XA 4TR1B 3CSIA 5GSTA 2QKEA 4PUAA 3WGDA 3PPUA 3MIXA 2H6ZA 3LXTA 5DQSA 4HJ2A 2GQLA 4NMUA 3LWAA 3TKRA 3EYTA 3PGTA 4MZCA 1A23A 2QSIA 3H8QA 3GX8A 4F0BA 2G0FA 4NV2A 1PKWA 4YQVA 3D22A 2VOCA 4G9HA 2CQ9A 4J56E 2QC7A 3DKSA 2EIRA 2PMTA 4V2MA 2F51A 1PX6A 2JSZA 1PN9A 1FB6A 5CRGA 1SJZA 2RIIA 3HZ4A 3A3TA 5KN1A 3HXSA 1J0FA 2HRFA 2CA8A 2HQTA 4OCFA 3Q6OA 3MWHA 3F6FA 5IMDA 2L6CA 1TXUA 2NPBA 4AI6A 3O3TA 4IQAA 1TI1A 3D5JA 2K9FA 1F2EA 1EZKA 5ECNB 3C7MA 1QGVA 4YKFA 2MYGA 4AJ6A 3GSSA 3IDVA 2H74A 4BPYA 4BVYB 1OVNA 2YV7A 2HLSA 2H6XA 2WJUA 3F9UA 11GSA 1PKZA 3TJFA 4KX4A 3O76A 2XBQA 2VCWA 1O8WA 2WW3A 2KUCA 5A5KA 19GSA 1X5CA 4K1FA 3SBCA 3WT2A 3KM6A 2IJYA 4LL1B 5ENUA 4MA9A 2LRTA 5IO0A 2PGTA 1AAZA 2MMOA 1PFOA 2K8VA 1SD8A 2NTOA 1T8EB 2XC2A 1GSQA 1YVLA 4I97A 4K8MA 2A2SA 1TI3A 2X4AA 4USSA 2F9SA 4H86A 3DRNA 2B5EA 1Z6MA 3APSA 3MDKA 1GUKA 4F2IA 2CAIA 5A4UA 3CSHA 1ERVA 1MDJA 4AGSA 5BMUB 3N5OA 4XS4B 4NHWA 1XWCA 4IJIA 4DEJA 1R26A 1GUMA 2TRXA 2C3QA 1GUHA 3C8EA 3J7Yk 1SJIA 4MZBA 1K3YA 4GLTA 4D73B 4L8EA 2CX3A 5DCGA 3UL3A 5AISA 2HRNA 2VCXA 5KOXA 5AIXA 2HSYA 2IIYA 5C04A 1I1IP 1M2BA 4RUVA 17GSA 4TVEA 2FGXA 2GSRA 4IW9A 1V58A 2DMMA 2JSYA 1O85A 3WGEA 1OC9B 2OKAA 3CHXC 1GNEA 3CYNA 2V6KA 4RI6A 4A5PA 2H75A 1M9AA 2R0PA 3JCML 1AQVA 2FLSA 2VCVA 3IOSA 4IQ1A 4NXIA 2L5LA 4POMA 2VD0A 5GAND 2EFCA 3KMNA 5IMVA 3M3MA 4ZB6A 4L5OA 1XIYA 1PMTA 4G0LA 3FEUA 5ID2A 3E9JB 2E2MA 2VLTA 1FVJA 1M99A 1A8LA 3GKKA 4N0ZA 1LU4A 3F4SA 3GH6A 4OFTA 3GMFA 3KMOA 2E0QA 2A4HA 4ZBDA 4CDOA 4YQUA 1BJXA 1FAAA 4X43A 13GSA 2OE1A 2EFHA 4O32A 2FY6A 3DIEA 1FW1A 4G2EA 2ZUPA 3L9UA 5ECLB 3VLNA 3IAS2 4ACSA 3CSJA 4CHSA 2WCIA 4PHZC 1G0TA 3O6TA 4F82A 3LEFA 4IELA 2C3TA 2M80A 3QCPA 1HYUA 4RI7A 2GGTA 3ED3A 2MZCA 3U6VA 2HRKB 2I9HA 1ERUA 2HT9A 4HU9A 4WR4A 2FWGA 2B6MA 3QFBC 2HE3A 1JFUA 2K6VA 3RHBA 6GSUA 3KGKA 3TOUA 1XW9A 1EGRA 22GSA 5LCZA 1QQ2A 1EP7A 5EY6A 2M46A 4AJ8A 2HNLA 4CY6A 4AKIA 2N5FA 1SK0A 4V2LA 2NBSA 3KH9A 1N2AA 3AY8A 4MF5A 3ME8A 4OO4A 1K3OA 3QAVA 4GQFA 4Q5NA 1A0RP 1U3AA 4GXZA 4MCUA 1A2MA 4QMKA 2HZFA 4XHMA 3TGZA 1SVMA 4KAEA 5HR2A 3M0FA 5A5HA 4BL7B 2YOIA 4G0IA 3KP8A 2F8FA 2YNXA 1BX9A 1JZWA 1Z3EA 1K0DA 3ZIJA 2IMKA 1O8XA 1VRSD 4HDEA 1URMA 1G7EA 3RPNA 2JL4A 3ZLPA 4ZL9A 1THOA 3GHAA 4KW6A 3ZITA 2HSMA 4LLRA 3LORA 1YDKA 2IMDA 4KGIA 5G2ZA 1WWJA 4IJ3A 2PWJA 2V32A 1TW9A 5HR0A 1X0RA 4TR3A 4PI2C 2GSTA 1AQXA 4GF0A 5H5SA 3D21A 3IHGA 4MK3A 4F0CA 5CRHA 1NHYA 5IMZA 3L78A 3KCMA 3BJ5A 2VM2A 2O87A 3M9JA 1HQOA 3KP9A 5AGYA 2O7KA 4OCEA 1MDKA 2LJRA 4CY8A 4EF0A 5COHA 2EIQA 5HR3A 4EIQA 2HRAA 3GRXA 14GSA 3MSZA 1XW6A 2FNOA 4OO5A 3IK9A 2L4CA 1A24A 2VL9A 1XFLA 3LQ7A 5HQPA 2DJ3A 3ZIVA 2CV4A 2IMEA 4DSRA 4MPGA 5J9CA 2VCZA 2JZSA 4WKWA 4N11A 4FQUA 4E8HA 3FYGA 5GZZB 5D96A 4TR4A 2CX4A 5ECKB 1BEDA 1TP9A 5J9BA 1ZZYA 1TRVA 4MH2A 2R3XA 1T1VA 4I5QA 2O5VA 3HCZA 4ZILA 1SVOA 4LMVA 5LD0A 1ML6A 3VURA 3QFAC 1M9BA 1ZYPA 5B6MA 2LV3A 1TK0B 3HVNA 1X5DA 3OR5A 2IFQB 1SKWB 1XOBA 2L6DA 1YJ6A 1Z5YE 2I3YA 4KCAA 4QQ7A 2HZEB 4MNNA 4ZB7A 3IE3A 4XCSA 2IPAA 1X9MB 2GVPA 5D9VA 1SYXA 4JBBA 1XW5A 5DQYA 4CW9A 4NAXA 3V1WA 5KOWA 2OJLA 3TCOA 2C80A 5HR1A 3KIJA 1XWAA 1GH2A 2FWHA 2JU5A 3H4KA 1Y25A 5KEJA 3EVIA 3DWVA 4HZ4A 5GAPD 3IC8A 1JLWA 2ON7A 4J57E 2WVXA 1K0BA 2VCQA 2FWFA 1F37A 2H0HA 2YZHA 4MPFA 4AJ7A 1YKCA 5JCGA 4X4JA 1V40A 3MNGA 1G6YA 1ZGNA 3H79A 5D8IA 5J3RA 5ECRB 5ELGA 2LSTA 1B9XC 4GSSA 2WW1A 1ZMAA 3HDCA 4HI7A 4FIWA 2J23A 2VLUA 4GWRA 3NOFA 1YZXA 1HNCA 2R6KA 4K0GA 3D4MA 1ZOFA 3F3QA 4WBRD 5A34A 1J9BA 2P5RA 2P0GA 3C73A 2WVYA 5AIVA 3UMAA 2FHEA 4AF2A 3FR9A 5JCUA 1Z7PA 1DE1A 4V1Ag 3WD6A 3LFLA 1OC8A 1WE0A 2X8GA 1DBYA 2CT6A 3CRTA 1Z6NA 4TW5A 4ZL7A 2E7PA 2L5OA 3EE2A 2OE3A 4N30A 5EPFA 1QFNA 1MD3A 1XZOA 2WS2A 2FCHA 4DVCA 3EINA 1FOHA 5DALB 2UV8G 5D9WA 1AW9A 2H66A 1GTBA 2N5BA 3GFKA 3HKRA 5H5RA 1PL1A 3Q19A 1F6MC 1XOAA 3L9VA 3WYWA 1F3BA 1YEXA 2I4AA 3CRUA 3ZTLA 4O5QA 1O6JA 3CMIA 4IGJA 2HXKA 4MZWA 1A2LA 6GSTA 1GLQA 5DAKB 2GS3A 2NVLA 2OADA 4OFMA 4KDYA 2H01A 2KP2A 4MF7A 2AYTA 3P2AA 1YQ1A 2YWOA 4YAPA 1LJRA 2VM1A 1B9YC 2VCTA 5CP1A 3VFIA 2X64A 5ECHB 2AAWA 1USBA 1UA5A 2C0GA 1THXA 3E3EA 3L4NA 3WGXA 3UOMA 2LRCA 4OFNA 4K9ZA 4XRDA 1RQMA 3KEBA 3F63A 2CAQA 4PNGA 3U5RE 4MJAA 2H0IA 2LRNA 2C0FA 2LQQA 3GA4A 4KCEA 2H8LA 2B7KA 5HFIA 1H75A 2Z9SA 1BYEA 2H1GA 2V1MA 2PBJA 2KP1A 1GL8A 3ERWA 1FO5A 1U88A 4AKXB 3GV1A 1V2AA 4YKGA 1XVQA 3FZ5A 1U3IA 2GLRA 1MDIA 5B6NA 3IPZA 3VWWA 2H0GA 3L9SA 1TRSA 3UEMA 4O5UA 5J47A 3HJPA 1NW2A 1O7UA 4PI0C 3ERFA 3G9BA 5EVOA 3D0ZA 2DJ1A 4K2DA 3FZ9A 1KTEA 2MMZA 1GLPA 3IC4A 4FYUA 4POBA 1ZYQB 2CVKA 2R5GA 1QXHA 1WPIA 4ML1A 3Q18A 3G7YA 2O89A 2H76A 4GDFA 4HSCX 3VWUA 16GSA 1TJDA 5DDLA 4O5RA 4K7NA 2PVQA 1FHEA 4IP1A 5G5FA 1FVKA 5FHIA 1WP0A 1A2JA 2GTUA 4AKGA 4ECCA 4BVXA 2R0CA 4ZBBA 4PTSA 1BAYA 4G10A 4V2NA 3FW2A 4IP6A 1QK8A 2EFDA 2OBIA 5D9XA 4ICYA 5G1LA 2C0EA 1ZL9A 3BD2A 3GYKA 3HZ8A 2WDUA 4LMWA 3L0HA 4K7IA 2XHFA 2OT3A 5ECIB 1HNAA 3PH9A 3GKMA 4FYCA 1R4WA 3RHCA 3TU3B 4WF5A 1X9WB 3IK7A 3ZREA 1ABAA 2H73A 3FRCA 4PX1A 5GSSA 2YWMA 4TXOA 1TTZA 1T4YA 1SJ6A 4LL4B 2DJKA 1EGOA 3GSTA 2JACA 5JWQB 1XVWA 2WW0A 1VF3A 2R37A 1IYIA 1A8YA 2XPDA 1A0FA 1ILOA 5D9TA 6GSXA 3LGCA 2PERA 2H1DA 2NDOA 1EEMA 4JE1A 3Q74A 1Y6EA 4OMVA 4V1Ap 4MABA 1AC1A 2REMA 4FYBA 2HSHA 5EL8A 5HFGA 2YJ7A 1T4ZA 2XPEA 4IVFA 5E4WA 3LG6A 1PA3A 4WR5A 3M8NA 5FT3A 4MDCA 2KHPA 4KA0A 1BF5A 3EMXA 1T7PB 3ZRDA 2H30A 3LYKA 1Z7RA 3QAGA 1W89A 4GSTA 5J40A 1Z9HA 1M2AA 3FHKA 3E0UA 4ZXGA 3W6GA 3TJJA 1OAZA 3UIWA 3HVXA 5A1NB 4HOJA 2EC4A 1JZRA 4MP4A 3KD0A 2HYXA 4K7OA 4EO3A 2DIYA 4EUYA 1LBKA 4PQHA 4MJBA 1EV9A 5CRWA 5ECMB 5DBQA 3UAPA 4MLYA 3ZVJA 5IMCA 2WZ9A 18GSA 3APQA 3BBYA 3W8JA 4PQ1A 4E68A 4BWQA 2RLIA 4K5SA 2QA2A 1GP1A 3GKXA 1JZOA 1TK8B 3UBKA 4X0XA 1OE7A 1DE2A 3KJYA 4JU5A 4FXYP 2ALBA 1PX7A 2RM5A 5IMFA 2X49A 2LJAA 3C1SA 1X9SB 3TRXA 5CO3A 4KF9A 3UVTA 2FUG2 5ID2B 4K0NA 1SENA 2CZ3A 3GTUA 3CXGA 1EV4A 4Q5RA 2A2PA 3DEXA 5IOWA 3HMJG 4Q5QA 5AN1A 4MMMA 3TKSE 3RFRC 2GQMA 4TKYA 3KH7A 2DIZA 4POLA 4DSSA 2L4QA 2PPTA 2DC5A 4I2UA 4NHZA 2MMNA 1AQWA 2IL3A 3HJMA 3IA1A 3F8UA 5IOXA 1KNGA 3EWLA 1NSWA 4ILFA 3I9V2 3GL5A 4HEA2 3RPPA 1VGLA 4MJEA 2OE0A 4TR1A 1YEWC 1PSQA 1NM3A 1XWBA 3CTGA 2BMXA 4EKZA 1SYRA 2A2RA 2GSQA 1X5EA 4KNDA 1TRUA 3DMLA 2AV4A 4MH3A 4XS1A 3QMXA 2VO4A 4ECBA 3FR3A 2I81A 1F3AA 2GSSA 5F07A 2X8HA 3ZFLA 4JR4A 2GT6A 2L59A 2PU9C 1R5PA 1XCCA 2OA7A 2KOKA 1OYJA 5CREA 1OE8A 5G1KA 5C00A 5IPGA 1S4BP 4ECIA 1K0OA 4QL7A 1ST9A 1TU8A 3RBTA 1B48A 5A5HB 2B5XA 2VLVA 3TDGA 1SL0B 3FZ4A 3QOUA 1N8JA 3EU4A 3N9JA 4PQIA 3R2QA 5B8AA 1ACVA 1HNBA 3TB2A 3HJOA 2DJJA 3CWGA 2CVDA 3TJGA 4XS6A 1S3DA 2HSMB 1KEBA 3P8WA 1GSSA 3TOTA 2V2GA 2ON5A 2ZCTA 5A4WA 3I6AA 1R7HA 3F6DA 4XTSA 1PN0A 3C71A 1K0MA 1GWCA 3M1GA 4BVYA 2V6OA 3ZZXA 1GNWA 3RDWA 2M72A 3W8SA 2HFDA 1TOFA 2TRCP 1XG8A 1F9MA 3D4TA 3GKNA 4WF4A 4L5LA 5J5NA 1T3BA 4I8BA 4PNFA 1HD2A 5INYA 4QL9A 1WJKA 1ERWA 4EIPA 4GCIA 1MEKA 2YWIA 2DKHA 3IXRA 2ES7A 4GQCA 2H72A 2X8CA 2KLXA 1OKTA 2WW2A 6GSSA 2DJ0A 3LJRA 1TKDB 4EE0A 5BMUA 2N5AA 4XS4A 4F03A 4I6XA 1K0CA 4O92A 1EEJA 4KE3A 2K8SA 2LUSA 3GIXA 3TJBA 1KBNA 2YCDA 3DVWA 5CRDA 1U87A 4HQZA 4BWSA 2B3SA 3ZL5A 3H1NA 1GSDA 3LXZA 3ZYWA 3NIVA 4D73A 2C8UA 1B4PA 3F0IA 2A4VA 2LS5A 5H5QA 1WMJA 3M9KA 2LQOA 5JCWA 4NWYA 5G31A 3ISOA 4EC0A 3TUEA 3I69A 2GZYA 1O73A 1K0AA 3EU3A 4WEYA 3KXOA 1OC9A 1R5AA 3IV4A 3FY7A 2O3EA 5CAXA 5ECQB 2DKIA 4JR6A 1JHBA 2WVXB 3HYPA 3FR6A 4GTUA 2H71A 1VF4A 3I43A 3DGQA 1XXUA 2GZPA 4BIKA 7GSSA 5IO2A 1B8XA 4X1UA 2MMAA 3UARA 1EWXA 2B1KA 1GSYA 3MAKA 4HUAA 2H70A 5E59A 2P5QA 1SKRB 2HSNB 1M0UA 1GTAA 1H4OA 4G19A 2G2QA 5A34B 2EFEA 4IHUA 1PD21 1QMVA 3EURA 1DUGA 4POKA 1RW1A 3GURA 4ZIJA 3UVHA 3TKSA 2F8AA 2DMLA 1YF1A 3H93A 3D6IA 2HRKA 4IKHA 4Z2UA 4N10A 4KUNA 3LYPA 1E2YA 3G7IA 3TRPA 1Q4JA 4JZQA 3A2XA 6GSVA 4KSOA 12GSA 1FG4A 4GSNA 3QPMA 2FD3A 3J7Yb 1V98A 4WETA 4IBPA 4WXTA 2GT5A 4WBJA 1PL2A 4IN0A 4YAVA 2LTKA 2YJHA 4XRAA 2ZNMA 4BA7A 5F8BA 3F3RA 3IAM2 2GQKA 1FOVA 2YP6A 1ON4A 2B5YA 4HQSA 3FMWA 1BG5A 3A2VA 1S3AA 3TKSC 3K8NA 5F0GA 5A1NA 3BCIA 1WOUA 1ZYNA 3NZNA 3IHQA 1YF0A 2GDRA 5B8BA 3C1RA 4ZBAA 3LSZA 4K5RA 4BL7A 3QDNA 3CQFA 5ECSA 3TJKA 2OACA 5IMAA 4Z7XA 5DJLA 2VD1A 3S9FA 3F4TA 2VUPA 2VL2A 5DCHA 1GSUA 2LEGA 4KSMA 2R4VA 5J4UA 3A2WA 4ZB9A 4MJCA 2IMFA 1U6TA 3EPTA 3ERGA 5KN3A 1WRYA 4RQXA 1XBSA 4ML6A 2DLXA 5G5EA 1WIKA 4PGTA 5FWGA 4OD7A 2FA4A 3LW9A 2O85A 1AUCA 1YEPA 9GSSA 3CTFA 3ME7A 3ZMKA 2DJ2A 3MYDA 2H6YA 4E8EA 1IYHA 2VKZG 5CYYA 1GSFA 3VPTA 2PVOC 1I9DA 1SK2A 2VL2C 2WRTA 2V41A 3IR4A 1E6BA 4ISDA 5D73A 3TRQA 2JZRA 3KZQA 2CZ2A 1TXXA 3VWVA 1RK4A 4PURA 3RGBC 1SU9A 3ZFBA 4RQRA 4PUFC 3IBHA 3CBUA 2BJXA 2PN8A 4OWYA 3WT1A 2VIMA 3A5WA 2YPMA 2H19A 3VPQA 1GTUA 1W4VA 4ULXA 2YV9A 4W66A 3EMPA 2MBSA 5HFKA 1SK1A 1YY7A 1GTIA 1Y1UA 2WFCA 5J41A 4Z2TA 5BRTA 1OC3A 2WULA 3TKPA 3UBLA 5IM9A 2WZSA 2DSAA 4YQMA 4I2TA 4ECJA 1O81A 5ECOB 2H1BA 1G7OA 2P31A 3PINA 2L57A 2VL3A 2O36A 3PR8A 4GRFA 5J4YA 4EVMA 4MF6A 1T00A 2DBCA 5KN2A 1N25A 3GX0A 4ZL8A 3APOA 1AXDA 1CQHA 2IFQA 4EDZA 1JLVA 2H1AA 2JZTA 3IRAA 3G7JA 1MD4A 3QD9A 5ELAA 5F05A 4KB3A 2HZEA 1C72A 4EL1A 4BVXB 5DVBA 5JWRB 4FO5A 4KDXA 2K18A 4NPBA 2YZUA 20GSA 4HS1A 2H1LA 3ZMLA 4NV5A 2F3MA 1ZCPA 2FA8A 1VF2A 2AJQB 4EXJA 2B7JA 2C4JA 3A5IA 2PUKC 3GL3A 1M2DA 4JEDA 1ZYEA 1BG1A 1GULA 3P7XA 4JRRA 1TK5B 1SVLA 3VWXA 2JADA 4KDUA 4FH8A 3GNJA 3HVVA 3HY2A 1K3LA 4G0KA 2RUFA 4HJMA 2C0DA 2AHEA 3GH9A 4LA1A 4TXVA 4TXOB 1JZDA 1UC7A 5DJMA 6GSWA 2CVBA
chains in the Genus database with same CATH topology
2RM6A 2R2JA 1SL2B 5JWOB 1SKSB 3BCKA 2WB9A 2FWEA 3FZAA 1V57A 1TRWA 5D93A 3R3EA 2XBIA 1J08A 1G6WA 2B1LA 1S3CA 2GZZA 3FKFA 1V9WA 4J2FA 2I1UA 3US3A 2LJKA 4TRXA 4L0WA 1UVZA 6GSYA 2LKUA 1TU7A 4N3ZA 5ABRA 1K0NA 4DSQA 2LNTA 2D2ZA 3VI5A 2AUVA 2RUEA 2QA1A 3SWLA 1XWGA 5IIZA 4IS0A 5B7CA 2C1YA 4K2XA 2UZ8A 1I5GA 2IWTA 2R0GA 4TN8A 1SL1B 2VAFA 3HD5A 4TR0A 5DALA 3HHVA 4L0UA 1CQGA 1EOHA 5ECPB 2HI7A 3DVXA 2TIRA 4O7HA 4N0VA 1YKAA 5G30A 1OKDA 3EC3A 2WGRA 4ZB8A 3HVSA 1EP8A 3HA9A 4YH2A 2EIOA 5IPHA 2AB6A 2MBTA 5LNKe 4F9ZA 2YN1A 1VF1A 3DYRA 5J4VA 2QGVA 1UN2A 5DAKA 1GSEA 3RAZA 4HZ2A 3BOAA 1FB0A 4AKHA 1PGTA 3UJ1A 1MTCA 3GUSA 10GSA 1TDIA 1SD9A 2J9HA 3F4RA 8GSSA 1DSBA 1QUWA 3DD3A 1ERTA 5CNWA 3GN3A 4G01A 3DXBA 1AIUA 2YWNA 3QAWA 5F06A 3TKQA 4HU7A 3GTUB 2IN3A 1Q98A 4Z2RA 4EDYA 1BQ7A 5L71A 4TOPA 2X99A 1M7TA 4ID0A 4XIHA 3KTLA 4PXOA 1PQNA 2YANA 3FK8A 1NHOA 2OBKA 2IMIA 1B4QA 1EOGA 1XWKA 4Q5FA 4DSSB 2LNSA 1XPVA 3QR6A 2HSNA 2BTOT 2C3NA 2E2GA 5A4VA 1GRXA 3P90A 1PRXA 4P3YB 3KTBA 4KH7A 3VK9A 2O8VB 5IQYA 3ZVJD 3VI7A 5KN0A 4K6XA 4TR1B 3CSIA 5GSTA 2QKEA 4PUAA 3WGDA 3PPUA 3MIXA 2H6ZA 3LXTA 5DQSA 4HJ2A 2GQLA 4NMUA 3LWAA 3TKRA 3EYTA 3PGTA 4MZCA 1A23A 2QSIA 3H8QA 3GX8A 4F0BA 2G0FA 4NV2A 1PKWA 4YQVA 3D22A 2VOCA 4G9HA 2CQ9A 4J56E 2QC7A 3DKSA 2EIRA 2PMTA 4V2MA 2F51A 1PX6A 2JSZA 1PN9A 1FB6A 5CRGA 1SJZA 2RIIA 3HZ4A 3A3TA 5KN1A 3HXSA 1J0FA 2HRFA 2CA8A 2HQTA 4OCFA 3Q6OA 3MWHA 3F6FA 5IMDA 2L6CA 1TXUA 2NPBA 4AI6A 3O3TA 4IQAA 1TI1A 3D5JA 2K9FA 1F2EA 1EZKA 5ECNB 3C7MA 1QGVA 4YKFA 2MYGA 4AJ6A 3GSSA 3IDVA 2H74A 4BPYA 4BVYB 1OVNA 2YV7A 2HLSA 2H6XA 2WJUA 3F9UA 11GSA 1PKZA 3TJFA 4KX4A 3O76A 2XBQA 2VCWA 1O8WA 2KUCA 5A5KA 19GSA 1X5CA 4K1FA 3SBCA 3WT2A 3KM6A 2IJYA 4LL1B 5ENUA 4MA9A 2LRTA 5IO0A 2PGTA 1AAZA 2MMOA 2K8VA 1SD8A 2NTOA 1T8EB 2XC2A 1GSQA 1YVLA 4I97A 4K8MA 2A2SA 1TI3A 2X4AA 4USSA 2F9SA 4H86A 3DRNA 2B5EA 1Z6MA 3APSA 3MDKA 1GUKA 4F2IA 2CAIA 5A4UA 3CSHA 1ERVA 1MDJA 4AGSA 5BMUB 3N5OA 4XS4B 4NHWA 1XWCA 4IJIA 4DEJA 1R26A 1GUMA 2TRXA 2C3QA 1GUHA 3C8EA 3J7Yk 1SJIA 4MZBA 1K3YA 4GLTA 4D73B 4L8EA 2CX3A 5DCGA 3UL3A 5AISA 2HRNA 2VCXA 5KOXA 5AIXA 2HSYA 2IIYA 5C04A 1M2BA 4RUVA 17GSA 4TVEA 2FGXA 2GSRA 4IW9A 1V58A 2DMMA 2JSYA 1O85A 3WGEA 1OC9B 2OKAA 1GNEA 3CYNA 2V6KA 4RI6A 4A5PA 2H75A 1M9AA 2R0PA 3JCML 1AQVA 2FLSA 2VCVA 3IOSA 4IQ1A 4NXIA 2L5LA 4POMA 2VD0A 5GAND 2EFCA 3KMNA 5IMVA 3M3MA 4ZB6A 4L5OA 1XIYA 1PMTA 4G0LA 3FEUA 5ID2A 3E9JB 2E2MA 2VLTA 1FVJA 1M99A 1A8LA 3GKKA 4N0ZA 1LU4A 3F4SA 3GH6A 4OFTA 3GMFA 3KMOA 2E0QA 2A4HA 4ZBDA 4CDOA 4YQUA 1BJXA 1FAAA 4X43A 13GSA 2OE1A 2EFHA 4O32A 2FY6A 3DIEA 1FW1A 4G2EA 2ZUPA 3L9UA 5ECLB 3VLNA 3IAS2 4ACSA 3CSJA 4CHSA 2WCIA 1G0TA 3O6TA 4F82A 3LEFA 4IELA 2C3TA 2M80A 3QCPA 1HYUA 4RI7A 2GGTA 3ED3A 2MZCA 3U6VA 2HRKB 2I9HA 1ERUA 2HT9A 4HU9A 4WR4A 2FWGA 2B6MA 3QFBC 2HE3A 1JFUA 2K6VA 3RHBA 6GSUA 3KGKA 3TOUA 1XW9A 1EGRA 22GSA 5LCZA 1QQ2A 1EP7A 5EY6A 2M46A 4AJ8A 2HNLA 4CY6A 4AKIA 2N5FA 1SK0A 4V2LA 2NBSA 3KH9A 1N2AA 3AY8A 4MF5A 3ME8A 4OO4A 1K3OA 3QAVA 4GQFA 4Q5NA 1A0RP 1U3AA 4GXZA 4MCUA 1A2MA 4QMKA 2HZFA 4XHMA 3TGZA 1SVMA 4KAEA 5HR2A 3M0FA 5A5HA 4BL7B 2YOIA 4G0IA 3KP8A 2F8FA 2YNXA 1BX9A 1JZWA 1Z3EA 1K0DA 3ZIJA 2IMKA 1O8XA 1VRSD 4HDEA 1URMA 1G7EA 3RPNA 2JL4A 3ZLPA 4ZL9A 1THOA 3GHAA 4KW6A 3ZITA 2HSMA 4LLRA 3LORA 1YDKA 2IMDA 4KGIA 5G2ZA 1WWJA 4IJ3A 2PWJA 2V32A 1TW9A 5HR0A 1X0RA 4TR3A 2GSTA 1AQXA 4GF0A 5H5SA 3D21A 3IHGA 4MK3A 4F0CA 5CRHA 1NHYA 5IMZA 3L78A 3KCMA 3BJ5A 2VM2A 2O87A 3M9JA 1HQOA 3KP9A 5AGYA 2O7KA 4OCEA 1MDKA 2LJRA 4CY8A 4EF0A 5COHA 2EIQA 5HR3A 4EIQA 2HRAA 3GRXA 14GSA 3MSZA 1XW6A 2FNOA 4OO5A 3IK9A 2L4CA 1A24A 2VL9A 1XFLA 3LQ7A 5HQPA 2DJ3A 3ZIVA 2CV4A 2IMEA 4DSRA 4MPGA 5J9CA 2VCZA 2JZSA 4WKWA 4N11A 4FQUA 4E8HA 3FYGA 5GZZB 5D96A 4TR4A 2CX4A 5ECKB 1BEDA 1TP9A 5J9BA 1ZZYA 1TRVA 4MH2A 2R3XA 1T1VA 4I5QA 2O5VA 3HCZA 4ZILA 1SVOA 4LMVA 5LD0A 1ML6A 3VURA 3QFAC 1M9BA 1ZYPA 5B6MA 2LV3A 1TK0B 1X5DA 3OR5A 2IFQB 1SKWB 1XOBA 2L6DA 1YJ6A 1Z5YE 2I3YA 4KCAA 4QQ7A 2HZEB 4MNNA 4ZB7A 3IE3A 4XCSA 2IPAA 1X9MB 2GVPA 5D9VA 1SYXA 4JBBA 1XW5A 5DQYA 4CW9A 4NAXA 3V1WA 5KOWA 2OJLA 3TCOA 2C80A 5HR1A 3KIJA 1XWAA 1GH2A 2FWHA 2JU5A 3H4KA 1Y25A 5KEJA 3EVIA 3DWVA 4HZ4A 5GAPD 3IC8A 1JLWA 2ON7A 4J57E 1K0BA 2VCQA 2FWFA 1F37A 2H0HA 2YZHA 4MPFA 4AJ7A 1YKCA 5JCGA 4X4JA 1V40A 3MNGA 1G6YA 1ZGNA 3H79A 5D8IA 5J3RA 5ECRB 5ELGA 2LSTA 1B9XC 4GSSA 1ZMAA 3HDCA 4HI7A 4FIWA 2J23A 2VLUA 4GWRA 3NOFA 1YZXA 1HNCA 2R6KA 4K0GA 3D4MA 1ZOFA 3F3QA 4WBRD 5A34A 1J9BA 2P5RA 2P0GA 3C73A 5AIVA 3UMAA 2FHEA 4AF2A 3FR9A 5JCUA 1Z7PA 1DE1A 4V1Ag 3WD6A 3LFLA 1OC8A 1WE0A 2X8GA 1DBYA 2CT6A 3CRTA 1Z6NA 4TW5A 4ZL7A 2E7PA 2L5OA 3EE2A 2OE3A 4N30A 5EPFA 1QFNA 1MD3A 1XZOA 2WS2A 2FCHA 4DVCA 3EINA 1FOHA 5DALB 2UV8G 5D9WA 1AW9A 2H66A 1GTBA 2N5BA 3GFKA 3HKRA 5H5RA 1PL1A 3Q19A 1F6MC 1XOAA 3L9VA 3WYWA 1F3BA 1YEXA 2I4AA 3CRUA 3ZTLA 4O5QA 1O6JA 3CMIA 4IGJA 2HXKA 4MZWA 1A2LA 6GSTA 1GLQA 5DAKB 2GS3A 2NVLA 2OADA 4OFMA 4KDYA 2H01A 2KP2A 4MF7A 2AYTA 3P2AA 1YQ1A 2YWOA 4YAPA 1LJRA 2VM1A 1B9YC 2VCTA 5CP1A 3VFIA 2X64A 5ECHB 2AAWA 1USBA 1UA5A 2C0GA 1THXA 3E3EA 3L4NA 3WGXA 3UOMA 2LRCA 4OFNA 4K9ZA 4XRDA 1RQMA 3KEBA 3F63A 2CAQA 4PNGA 3U5RE 4MJAA 2H0IA 2LRNA 2C0FA 2LQQA 3GA4A 4KCEA 2H8LA 2B7KA 5HFIA 1H75A 2Z9SA 1BYEA 2H1GA 2V1MA 2PBJA 2KP1A 1GL8A 3ERWA 1FO5A 1U88A 4AKXB 3GV1A 1V2AA 4YKGA 1XVQA 3FZ5A 1U3IA 2GLRA 1MDIA 5B6NA 3IPZA 3VWWA 2H0GA 3L9SA 1TRSA 3UEMA 4O5UA 5J47A 3HJPA 1NW2A 1O7UA 3ERFA 3G9BA 5EVOA 3D0ZA 2DJ1A 4K2DA 3FZ9A 1KTEA 2MMZA 1GLPA 3IC4A 4FYUA 4POBA 1ZYQB 2CVKA 2R5GA 1QXHA 1WPIA 4ML1A 3Q18A 3G7YA 2O89A 2H76A 4GDFA 3VWUA 16GSA 1TJDA 5DDLA 4O5RA 4K7NA 2PVQA 1FHEA 4IP1A 5G5FA 1FVKA 5FHIA 1WP0A 1A2JA 2GTUA 4AKGA 4ECCA 4BVXA 2R0CA 4ZBBA 4PTSA 1BAYA 4G10A 4V2NA 3FW2A 4IP6A 1QK8A 2EFDA 2OBIA 5D9XA 4ICYA 5G1LA 2C0EA 1ZL9A 3BD2A 3GYKA 3HZ8A 2WDUA 4LMWA 3L0HA 4K7IA 2XHFA 2OT3A 5ECIB 1HNAA 3PH9A 3GKMA 4FYCA 1R4WA 3RHCA 3TU3B 4WF5A 1X9WB 3IK7A 3ZREA 1ABAA 2H73A 3FRCA 4PX1A 5GSSA 2YWMA 4TXOA 1TTZA 1T4YA 1SJ6A 4LL4B 2DJKA 1EGOA 3GSTA 2JACA 5JWQB 1XVWA 1VF3A 2R37A 1IYIA 1A8YA 2XPDA 1A0FA 1ILOA 5D9TA 6GSXA 3LGCA 2PERA 2H1DA 2NDOA 1EEMA 4JE1A 3Q74A 1Y6EA 4OMVA 4V1Ap 4MABA 1AC1A 2REMA 4FYBA 2HSHA 5EL8A 5HFGA 2YJ7A 1T4ZA 2XPEA 4IVFA 5E4WA 3LG6A 1PA3A 4WR5A 3M8NA 5FT3A 4MDCA 2KHPA 4KA0A 1BF5A 3EMXA 1T7PB 3ZRDA 2H30A 3LYKA 1Z7RA 3QAGA 1W89A 4GSTA 5J40A 1Z9HA 1M2AA 3FHKA 3E0UA 4ZXGA 3W6GA 3TJJA 1OAZA 3UIWA 3HVXA 5A1NB 4HOJA 2EC4A 1JZRA 4MP4A 3KD0A 2HYXA 4K7OA 4EO3A 2DIYA 4EUYA 1LBKA 4PQHA 4MJBA 1EV9A 5CRWA 5ECMB 5DBQA 3UAPA 4MLYA 3ZVJA 5IMCA 2WZ9A 18GSA 3APQA 3BBYA 3W8JA 4PQ1A 4E68A 4BWQA 2RLIA 4K5SA 2QA2A 1GP1A 3GKXA 1JZOA 1TK8B 3UBKA 4X0XA 1OE7A 1DE2A 3KJYA 4JU5A 2ALBA 1PX7A 2RM5A 5IMFA 2X49A 2LJAA 3C1SA 1X9SB 3TRXA 5CO3A 4KF9A 3UVTA 2FUG2 5ID2B 4K0NA 1SENA 2CZ3A 3GTUA 3CXGA 1EV4A 4Q5RA 2A2PA 3DEXA 5IOWA 3HMJG 4Q5QA 5AN1A 4MMMA 3TKSE 2GQMA 4TKYA 3KH7A 2DIZA 4POLA 4DSSA 2L4QA 2PPTA 2DC5A 4I2UA 4NHZA 2MMNA 1AQWA 2IL3A 3HJMA 3IA1A 3F8UA 5IOXA 1KNGA 3EWLA 1NSWA 4ILFA 3I9V2 3GL5A 4HEA2 3RPPA 1VGLA 4MJEA 2OE0A 4TR1A 1PSQA 1NM3A 1XWBA 3CTGA 2BMXA 4EKZA 1SYRA 2A2RA 2GSQA 1X5EA 4KNDA 1TRUA 3DMLA 2AV4A 4MH3A 4XS1A 3QMXA 2VO4A 4ECBA 3FR3A 2I81A 1F3AA 2GSSA 5F07A 2X8HA 3ZFLA 4JR4A 2GT6A 2L59A 2PU9C 1R5PA 1XCCA 2OA7A 2KOKA 1OYJA 5CREA 1OE8A 5G1KA 5C00A 5IPGA 4ECIA 1K0OA 4QL7A 1ST9A 1TU8A 3RBTA 1B48A 5A5HB 2B5XA 2VLVA 3TDGA 1SL0B 3FZ4A 3QOUA 1N8JA 3EU4A 3N9JA 4PQIA 3R2QA 5B8AA 1ACVA 1HNBA 3TB2A 3HJOA 2DJJA 3CWGA 2CVDA 3TJGA 4XS6A 1S3DA 2HSMB 1KEBA 3P8WA 1GSSA 3TOTA 2V2GA 2ON5A 2ZCTA 5A4WA 3I6AA 1R7HA 3F6DA 4XTSA 1PN0A 3C71A 1K0MA 1GWCA 3M1GA 4BVYA 2V6OA 3ZZXA 1GNWA 3RDWA 2M72A 3W8SA 2HFDA 1TOFA 2TRCP 1F9MA 3D4TA 3GKNA 4WF4A 4L5LA 5J5NA 1T3BA 4I8BA 4PNFA 1HD2A 5INYA 4QL9A 1WJKA 1ERWA 4EIPA 4GCIA 1MEKA 2YWIA 2DKHA 3IXRA 2ES7A 4GQCA 2H72A 2X8CA 2KLXA 1OKTA 6GSSA 2DJ0A 3LJRA 1TKDB 4EE0A 5BMUA 2N5AA 4XS4A 4F03A 4I6XA 1K0CA 4O92A 1EEJA 4KE3A 2K8SA 2LUSA 3GIXA 3TJBA 1KBNA 2YCDA 3DVWA 5CRDA 1U87A 4HQZA 4BWSA 2B3SA 3ZL5A 3H1NA 1GSDA 3LXZA 3ZYWA 3NIVA 4D73A 2C8UA 1B4PA 3F0IA 2A4VA 2LS5A 5H5QA 1WMJA 3M9KA 2LQOA 5JCWA 4NWYA 5G31A 3ISOA 4EC0A 3TUEA 3I69A 2GZYA 1O73A 1K0AA 3EU3A 4WEYA 3KXOA 1OC9A 1R5AA 3IV4A 3FY7A 5CAXA 5ECQB 2DKIA 4JR6A 1JHBA 3HYPA 3FR6A 4GTUA 2H71A 1VF4A 3I43A 3DGQA 1XXUA 2GZPA 7GSSA 5IO2A 1B8XA 4X1UA 2MMAA 3UARA 1EWXA 2B1KA 1GSYA 3MAKA 4HUAA 2H70A 5E59A 2P5QA 1SKRB 2HSNB 1M0UA 1GTAA 1H4OA 4G19A 2G2QA 5A34B 2EFEA 4IHUA 1PD21 1QMVA 3EURA 1DUGA 4POKA 1RW1A 3GURA 4ZIJA 3UVHA 3TKSA 2F8AA 2DMLA 1YF1A 3H93A 3D6IA 2HRKA 4IKHA 4Z2UA 4N10A 4KUNA 3LYPA 1E2YA 3G7IA 3TRPA 1Q4JA 4JZQA 3A2XA 6GSVA 4KSOA 12GSA 1FG4A 4GSNA 3QPMA 2FD3A 3J7Yb 1V98A 4WETA 4IBPA 4WXTA 2GT5A 4WBJA 1PL2A 4IN0A 4YAVA 2LTKA 2YJHA 4XRAA 2ZNMA 4BA7A 5F8BA 3F3RA 3IAM2 2GQKA 1FOVA 2YP6A 1ON4A 2B5YA 4HQSA 3FMWA 1BG5A 3A2VA 1S3AA 3TKSC 3K8NA 5F0GA 5A1NA 3BCIA 1WOUA 1ZYNA 3NZNA 3IHQA 1YF0A 2GDRA 5B8BA 3C1RA 4ZBAA 3LSZA 4K5RA 4BL7A 3QDNA 5ECSA 3TJKA 2OACA 5IMAA 4Z7XA 5DJLA 2VD1A 3S9FA 3F4TA 2VUPA 2VL2A 5DCHA 1GSUA 2LEGA 4KSMA 2R4VA 5J4UA 3A2WA 4ZB9A 4MJCA 2IMFA 1U6TA 3EPTA 3ERGA 5KN3A 1WRYA 4RQXA 1XBSA 4ML6A 2DLXA 5G5EA 1WIKA 4PGTA 5FWGA 4OD7A 2FA4A 3LW9A 2O85A 1AUCA 1YEPA 9GSSA 3CTFA 3ME7A 3ZMKA 2DJ2A 3MYDA 2H6YA 4E8EA 1IYHA 2VKZG 5CYYA 1GSFA 3VPTA 2PVOC 1I9DA 1SK2A 2VL2C 2WRTA 2V41A 3IR4A 1E6BA 4ISDA 5D73A 3TRQA 2JZRA 3KZQA 2CZ2A 1TXXA 3VWVA 1RK4A 4PURA 1SU9A 3ZFBA 4RQRA 4PUFC 3IBHA 3CBUA 2BJXA 2PN8A 4OWYA 3WT1A 2VIMA 3A5WA 2YPMA 2H19A 3VPQA 1GTUA 1W4VA 4ULXA 2YV9A 4W66A 3EMPA 2MBSA 5HFKA 1SK1A 1YY7A 1GTIA 1Y1UA 2WFCA 5J41A 4Z2TA 5BRTA 1OC3A 2WULA 3TKPA 3UBLA 5IM9A 2DSAA 4YQMA 4I2TA 4ECJA 1O81A 5ECOB 2H1BA 1G7OA 2P31A 3PINA 2L57A 2VL3A 3PR8A 4GRFA 5J4YA 4EVMA 4MF6A 1T00A 2DBCA 5KN2A 1N25A 3GX0A 4ZL8A 3APOA 1AXDA 1CQHA 2IFQA 4EDZA 1JLVA 2H1AA 2JZTA 3IRAA 3G7JA 1MD4A 3QD9A 5ELAA 5F05A 4KB3A 2HZEA 1C72A 4EL1A 4BVXB 5DVBA 5JWRB 4FO5A 4KDXA 2K18A 4NPBA 2YZUA 20GSA 4HS1A 2H1LA 3ZMLA 4NV5A 2F3MA 1ZCPA 2FA8A 1VF2A 2AJQB 4EXJA 2B7JA 2C4JA 3A5IA 2PUKC 3GL3A 1M2DA 4JEDA 1ZYEA 1BG1A 1GULA 3P7XA 4JRRA 1TK5B 1SVLA 3VWXA 2JADA 4KDUA 4FH8A 3GNJA 3HVVA 3HY2A 1K3LA 4G0KA 2RUFA 4HJMA 2C0DA 2AHEA 3GH9A 4LA1A 4TXVA 4TXOB 1JZDA 1UC7A 5DJMA 6GSWA 2CVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RM6 A;  2R2J A;  1SL2 B;  5JWO B;  1SKS B;  3BCK A;  2WB9 A;  2FWE A;  3FZA A;  1V57 A;  1TRW A;  5D93 A;  3R3E A;  2XBI A;  1J08 A;  1G6W A;  2B1L A;  1S3C A;  2GZZ A;  3FKF A;  1V9W A;  4J2F A;  2I1U A;  3US3 A;  2LJK A;  4TRX A;  4L0W A;  1UVZ A;  6GSY A;  2LKU A;  1TU7 A;  5ABR A;  1K0N A;  4DSQ A;  2LNT A;  2D2Z A;  3VI5 A;  2AUV A;  2RUE A;  3SWL A;  1XWG A;  5IIZ A;  4IS0 A;  5B7C A;  2C1Y A;  2UZ8 A;  1I5G A;  2IWT A;  4TN8 A;  1SL1 B;  2VAF A;  3HD5 A;  4TR0 A;  5DAL A;  3HHV A;  4L0U A;  1CQG A;  1EOH A;  5ECP B;  2HI7 A;  3DVX A;  2TIR A;  4O7H A;  4N0V A;  1YKA A;  5G30 A;  1OKD A;  3EC3 A;  2WGR A;  4ZB8 A;  3HVS A;  1EP8 A;  3HA9 A;  4YH2 A;  2EIO A;  5IPH A;  2AB6 A;  2MBT A;  5LNK e;  4F9Z A;  2YN1 A;  1VF1 A;  3DYR A;  2QGV A;  1UN2 A;  5DAK A;  1GSE A;  3RAZ A;  4HZ2 A;  3BOA A;  1FB0 A;  1PGT A;  3UJ1 A;  1MTC A;  3GUS A;  10GS A;  1TDI A;  1SD9 A;  2J9H A;  3F4R A;  8GSS A;  1DSB A;  1QUW A;  3DD3 A;  1ERT A;  5CNW A;  3GN3 A;  3DXB A;  1AIU A;  2YWN A;  3QAW A;  5F06 A;  3TKQ A;  4HU7 A;  3GTU B;  2IN3 A;  1Q98 A;  4EDY A;  1BQ7 A;  5L71 A;  4TOP A;  2X99 A;  1M7T A;  4ID0 A;  4XIH A;  3KTL A;  4PXO A;  1PQN A;  2YAN A;  3FK8 A;  1NHO A;  2OBK A;  2IMI A;  1B4Q A;  1EOG A;  1XWK A;  4Q5F A;  4DSS B;  2LNS A;  1XPV A;  3QR6 A;  2BTO T;  2C3N A;  2E2G A;  5A4V A;  1GRX A;  3P90 A;  1PRX A;  4P3Y B;  3KTB A;  4KH7 A;  3VK9 A;  2O8V B;  5IQY A;  3ZVJ D;  3VI7 A;  5KN0 A;  4K6X A;  4TR1 B;  3CSI A;  5GST A;  2QKE A;  4PUA A;  3WGD A;  3PPU A;  2H6Z A;  3LXT A;  5DQS A;  4HJ2 A;  2GQL A;  4NMU A;  3LWA A;  3TKR A;  3EYT A;  3PGT A;  4MZC A;  1A23 A;  2QSI A;  3H8Q A;  3GX8 A;  4F0B A;  2G0F A;  4NV2 A;  1PKW A;  4YQV A;  3D22 A;  2VOC A;  4G9H A;  2CQ9 A;  4J56 E;  2QC7 A;  3DKS A;  2EIR A;  2PMT A;  4V2M A;  2F51 A;  1PX6 A;  2JSZ A;  1PN9 A;  1FB6 A;  5CRG A;  1SJZ A;  2RII A;  3HZ4 A;  3A3T A;  5KN1 A;  3HXS A;  1J0F A;  2HRF A;  2CA8 A;  2HQT A;  4OCF A;  3Q6O A;  3MWH A;  3F6F A;  5IMD A;  2L6C A;  2NPB A;  3O3T A;  4IQA A;  1TI1 A;  3D5J A;  2K9F A;  1F2E A;  1EZK A;  5ECN B;  3C7M A;  1QGV A;  2MYG A;  4AJ6 A;  3GSS A;  3IDV A;  2H74 A;  4BPY A;  4BVY B;  1OVN A;  2YV7 A;  2HLS A;  2H6X A;  2WJU A;  3F9U A;  11GS A;  1PKZ A;  3TJF A;  4KX4 A;  3O76 A;  2XBQ A;  2VCW A;  1O8W A;  2KUC A;  5A5K A;  19GS A;  1X5C A;  4K1F A;  3SBC A;  3WT2 A;  3KM6 A;  2IJY A;  4LL1 B;  5ENU A;  4MA9 A;  2LRT A;  5IO0 A;  2PGT A;  1AAZ A;  2MMO A;  2K8V A;  1SD8 A;  2NTO A;  1T8E B;  2XC2 A;  1GSQ A;  4I97 A;  4K8M A;  2A2S A;  1TI3 A;  4USS A;  2F9S A;  4H86 A;  3DRN A;  2B5E A;  1Z6M A;  3APS A;  3MDK A;  1GUK A;  4F2I A;  2CAI A;  5A4U A;  3CSH A;  1ERV A;  1MDJ A;  4AGS A;  3N5O A;  4XS4 B;  4NHW A;  1XWC A;  4IJI A;  4DEJ A;  1R26 A;  1GUM A;  2TRX A;  2C3Q A;  1GUH A;  3C8E A;  3J7Y k;  1SJI A;  4MZB A;  1K3Y A;  4GLT A;  4D73 B;  4L8E A;  2CX3 A;  5DCG A;  3UL3 A;  5AIS A;  2HRN A;  2VCX A;  5AIX A;  2HSY A;  2IIY A;  5C04 A;  1M2B A;  4RUV A;  17GS A;  4TVE A;  2FGX A;  2GSR A;  4IW9 A;  1V58 A;  2DMM A;  2JSY A;  1O85 A;  3WGE A;  1OC9 B;  2OKA A;  1GNE A;  3CYN A;  2V6K A;  4RI6 A;  2H75 A;  1M9A A;  3JCM L;  1AQV A;  2FLS A;  2VCV A;  3IOS A;  4IQ1 A;  4NXI A;  2L5L A;  4POM A;  2VD0 A;  5GAN D;  3KMN A;  5IMV A;  3M3M A;  4ZB6 A;  4L5O A;  1XIY A;  1PMT A;  4G0L A;  3FEU A;  5ID2 A;  3E9J B;  2E2M A;  2VLT A;  1FVJ A;  1M99 A;  1A8L A;  3GKK A;  4N0Z A;  1LU4 A;  3F4S A;  3GH6 A;  4OFT A;  3GMF A;  3KMO A;  2E0Q A;  4ZBD A;  4CDO A;  4YQU A;  1BJX A;  1FAA A;  4X43 A;  13GS A;  2OE1 A;  4O32 A;  2FY6 A;  3DIE A;  1FW1 A;  4G2E A;  2ZUP A;  3L9U A;  5ECL B;  3VLN A;  3IAS 2;  4ACS A;  3CSJ A;  4CHS A;  2WCI A;  1G0T A;  3O6T A;  4F82 A;  3LEF A;  4IEL A;  2C3T A;  2M80 A;  3QCP A;  1HYU A;  4RI7 A;  2GGT A;  3ED3 A;  2MZC A;  3U6V A;  2HRK B;  2I9H A;  1ERU A;  2HT9 A;  4HU9 A;  4WR4 A;  2FWG A;  2B6M A;  3QFB C;  2HE3 A;  1JFU A;  2K6V A;  3RHB A;  6GSU A;  3KGK A;  3TOU A;  1XW9 A;  1EGR A;  22GS A;  5LCZ A;  1QQ2 A;  1EP7 A;  5EY6 A;  2M46 A;  4AJ8 A;  2HNL A;  2N5F A;  1SK0 A;  4V2L A;  2NBS A;  3KH9 A;  1N2A A;  3AY8 A;  4MF5 A;  3ME8 A;  4OO4 A;  1K3O A;  3QAV A;  4GQF A;  4Q5N A;  1A0R P;  1U3A A;  4GXZ A;  4MCU A;  1A2M A;  2HZF A;  4XHM A;  3TGZ A;  4KAE A;  5HR2 A;  3M0F A;  4BL7 B;  2YOI A;  4G0I A;  3KP8 A;  2F8F A;  2YNX A;  1BX9 A;  1JZW A;  1Z3E A;  1K0D A;  3ZIJ A;  2IMK A;  1O8X A;  1VRS D;  4HDE A;  1URM A;  1G7E A;  3RPN A;  2JL4 A;  3ZLP A;  4ZL9 A;  1THO A;  3GHA A;  4KW6 A;  3ZIT A;  2HSM A;  4LLR A;  3LOR A;  1YDK A;  2IMD A;  4KGI A;  5G2Z A;  1WWJ A;  4IJ3 A;  2PWJ A;  2V32 A;  1TW9 A;  5HR0 A;  1X0R A;  4TR3 A;  2GST A;  1AQX A;  4GF0 A;  5H5S A;  3D21 A;  4MK3 A;  4F0C A;  5CRH A;  1NHY A;  5IMZ A;  3L78 A;  3KCM A;  3BJ5 A;  2VM2 A;  2O87 A;  3M9J A;  1HQO A;  3KP9 A;  5AGY A;  2O7K A;  4OCE A;  1MDK A;  2LJR A;  4EF0 A;  5COH A;  2EIQ A;  5HR3 A;  2HRA A;  3GRX A;  14GS A;  3MSZ A;  1XW6 A;  2FNO A;  4OO5 A;  3IK9 A;  2L4C A;  1A24 A;  2VL9 A;  1XFL A;  3LQ7 A;  5HQP A;  2DJ3 A;  3ZIV A;  2CV4 A;  2IME A;  4DSR A;  4MPG A;  5J9C A;  2VCZ A;  2JZS A;  4WKW A;  4N11 A;  4FQU A;  4E8H A;  3FYG A;  5GZZ B;  5D96 A;  4TR4 A;  2CX4 A;  5ECK B;  1BED A;  1TP9 A;  5J9B A;  1ZZY A;  1TRV A;  4MH2 A;  2R3X A;  1T1V A;  4I5Q A;  3HCZ A;  4ZIL A;  4LMV A;  5LD0 A;  1ML6 A;  3VUR A;  3QFA C;  1M9B A;  5B6M A;  2LV3 A;  1TK0 B;  1X5D A;  3OR5 A;  2IFQ B;  1SKW B;  1XOB A;  2L6D A;  1YJ6 A;  1Z5Y E;  2I3Y A;  4KCA A;  4QQ7 A;  2HZE B;  3IE3 A;  4XCS A;  2IPA A;  1X9M B;  2GVP A;  5D9V A;  1SYX A;  4JBB A;  1XW5 A;  5DQY A;  4CW9 A;  4NAX A;  3V1W A;  2OJL A;  3TCO A;  2C80 A;  5HR1 A;  3KIJ A;  1XWA A;  1GH2 A;  2FWH A;  2JU5 A;  3H4K A;  1Y25 A;  5KEJ A;  3EVI A;  3DWV A;  4HZ4 A;  5GAP D;  3IC8 A;  1JLW A;  2ON7 A;  4J57 E;  1K0B A;  2VCQ A;  2FWF A;  1F37 A;  2H0H A;  2YZH A;  4MPF A;  4AJ7 A;  1YKC A;  5JCG A;  1V40 A;  3MNG A;  1G6Y A;  1ZGN A;  3H79 A;  5D8I A;  5J3R A;  5ECR B;  5ELG A;  2LST A;  1B9X C;  4GSS A;  1ZMA A;  3HDC A;  4HI7 A;  4FIW A;  2J23 A;  2VLU A;  4GWR A;  3NOF A;  1YZX A;  1HNC A;  2R6K A;  4K0G A;  3D4M A;  1ZOF A;  3F3Q A;  4WBR D;  1J9B A;  2P5R A;  2P0G A;  3C73 A;  5AIV A;  3UMA A;  2FHE A;  4AF2 A;  3FR9 A;  5JCU A;  1Z7P A;  1DE1 A;  4V1A g;  3WD6 A;  3LFL A;  1OC8 A;  1WE0 A;  2X8G A;  1DBY A;  2CT6 A;  3CRT A;  1Z6N A;  4TW5 A;  4ZL7 A;  2E7P A;  2L5O A;  3EE2 A;  2OE3 A;  4N30 A;  5EPF A;  1QFN A;  1MD3 A;  1XZO A;  2WS2 A;  2FCH A;  4DVC A;  3EIN A;  5DAL B;  5D9W A;  1AW9 A;  2H66 A;  1GTB A;  2N5B A;  3GFK A;  3HKR A;  5H5R A;  1PL1 A;  3Q19 A;  1F6M C;  1XOA A;  3L9V A;  3WYW A;  1F3B A;  1YEX A;  2I4A A;  3CRU A;  3ZTL A;  1O6J A;  3CMI A;  4IGJ A;  2HXK A;  4MZW A;  1A2L A;  6GST A;  1GLQ A;  5DAK B;  2GS3 A;  2NVL A;  2OAD A;  4OFM A;  4KDY A;  2H01 A;  2KP2 A;  4MF7 A;  2AYT A;  3P2A A;  1YQ1 A;  2YWO A;  4YAP A;  1LJR A;  2VM1 A;  1B9Y C;  2VCT A;  5CP1 A;  3VFI A;  2X64 A;  5ECH B;  2AAW A;  1USB A;  1UA5 A;  2C0G A;  1THX A;  3E3E A;  3L4N A;  3WGX A;  3UOM A;  2LRC A;  4OFN A;  4K9Z A;  4XRD A;  1RQM A;  3KEB A;  3F63 A;  2CAQ A;  4PNG A;  3U5R E;  4MJA A;  2H0I A;  2LRN A;  2C0F A;  2LQQ A;  3GA4 A;  4KCE A;  2H8L A;  2B7K A;  5HFI A;  1H75 A;  2Z9S A;  1BYE A;  2H1G A;  2V1M A;  2PBJ A;  2KP1 A;  1GL8 A;  3ERW A;  1FO5 A;  1U88 A;  3GV1 A;  1V2A A;  1XVQ A;  3FZ5 A;  1U3I A;  2GLR A;  1MDI A;  5B6N A;  3IPZ A;  3VWW A;  2H0G A;  3L9S A;  1TRS A;  3UEM A;  3HJP A;  1NW2 A;  1O7U A;  3ERF A;  3G9B A;  5EVO A;  3D0Z A;  2DJ1 A;  4K2D A;  3FZ9 A;  1KTE A;  2MMZ A;  1GLP A;  3IC4 A;  4FYU A;  4POB A;  1ZYQ B;  2CVK A;  2R5G A;  1QXH A;  1WPI A;  4ML1 A;  3Q18 A;  3G7Y A;  2O89 A;  2H76 A;  3VWU A;  16GS A;  1TJD A;  5DDL A;  4O5R A;  4K7N A;  2PVQ A;  1FHE A;  4IP1 A;  5G5F A;  1FVK A;  5FHI A;  1WP0 A;  1A2J A;  2GTU A;  4ECC A;  4BVX A;  4ZBB A;  4PTS A;  1BAY A;  4G10 A;  4V2N A;  3FW2 A;  4IP6 A;  1QK8 A;  2OBI A;  5D9X A;  5G1L A;  2C0E A;  1ZL9 A;  3BD2 A;  3GYK A;  3HZ8 A;  2WDU A;  4LMW A;  3L0H A;  4K7I A;  2XHF A;  5ECI B;  1HNA A;  3PH9 A;  3GKM A;  4FYC A;  1R4W A;  3RHC A;  4WF5 A;  1X9W B;  3IK7 A;  3ZRE A;  1ABA A;  2H73 A;  3FRC A;  4PX1 A;  5GSS A;  2YWM A;  4TXO A;  1TTZ A;  1T4Y A;  1SJ6 A;  4LL4 B;  2DJK A;  1EGO A;  3GST A;  2JAC A;  5JWQ B;  1XVW A;  1VF3 A;  2R37 A;  1IYI A;  1A8Y A;  2XPD A;  1A0F A;  1ILO A;  5D9T A;  6GSX A;  3LGC A;  2PER A;  2H1D A;  2NDO A;  1EEM A;  4JE1 A;  3Q74 A;  1Y6E A;  4OMV A;  4V1A p;  4MAB A;  1AC1 A;  2REM A;  4FYB A;  2HSH A;  5EL8 A;  5HFG A;  2YJ7 A;  1T4Z A;  2XPE A;  4IVF A;  5E4W A;  3LG6 A;  1PA3 A;  4WR5 A;  3M8N A;  5FT3 A;  4MDC A;  2KHP A;  4KA0 A;  3EMX A;  1T7P B;  3ZRD A;  2H30 A;  3LYK A;  1Z7R A;  3QAG A;  1W89 A;  4GST A;  1Z9H A;  1M2A A;  3FHK A;  3E0U A;  4ZXG A;  3W6G A;  3TJJ A;  1OAZ A;  3UIW A;  3HVX A;  2EC4 A;  4HOJ A;  3KD0 A;  1JZR A;  4MP4 A;  4K7O A;  2HYX A;  4EO3 A;  2DIY A;  4EUY A;  1LBK A;  4PQH A;  4MJB A;  1EV9 A;  5CRW A;  5ECM B;  5DBQ A;  3UAP A;  4MLY A;  3ZVJ A;  5IMC A;  2WZ9 A;  18GS A;  3APQ A;  3BBY A;  3W8J A;  4PQ1 A;  4BWQ A;  2RLI A;  1GP1 A;  3GKX A;  1JZO A;  1TK8 B;  3UBK A;  4X0X A;  1OE7 A;  1DE2 A;  3KJY A;  4JU5 A;  2ALB A;  1PX7 A;  2RM5 A;  5IMF A;  2LJA A;  3C1S A;  1X9S B;  3TRX A;  5CO3 A;  4KF9 A;  3UVT A;  2FUG 2;  5ID2 B;  4K0N A;  1SEN A;  2CZ3 A;  3GTU A;  3CXG A;  1EV4 A;  4Q5R A;  5IOW A;  3DEX A;  4Q5Q A;  5AN1 A;  4MMM A;  3TKS E;  2GQM A;  4TKY A;  3KH7 A;  2DIZ A;  4POL A;  4DSS A;  2L4Q A;  2PPT A;  2DC5 A;  4I2U A;  4NHZ A;  2MMN A;  1AQW A;  2IL3 A;  3HJM A;  3IA1 A;  3F8U A;  5IOX A;  1KNG A;  3EWL A;  1NSW A;  4ILF A;  3I9V 2;  3GL5 A;  4HEA 2;  3RPP A;  1VGL A;  4MJE A;  2OE0 A;  4TR1 A;  1PSQ A;  1NM3 A;  1XWB A;  3CTG A;  2BMX A;  4EKZ A;  1SYR A;  2A2R A;  2GSQ A;  1X5E A;  4KND A;  1TRU A;  3DML A;  2AV4 A;  4MH3 A;  4XS1 A;  3QMX A;  2VO4 A;  4ECB A;  3FR3 A;  2I81 A;  1F3A A;  2GSS A;  5F07 A;  2X8H A;  3ZFL A;  4JR4 A;  2GT6 A;  2L59 A;  2PU9 C;  1R5P A;  1XCC A;  2OA7 A;  2KOK A;  1OYJ A;  5CRE A;  1OE8 A;  5G1K A;  5C00 A;  5IPG A;  4ECI A;  1K0O A;  4QL7 A;  1ST9 A;  1TU8 A;  3RBT A;  1B48 A;  2B5X A;  2VLV A;  3TDG A;  1SL0 B;  3FZ4 A;  3QOU A;  1N8J A;  3EU4 A;  3N9J A;  4PQI A;  3R2Q A;  5B8A A;  1ACV A;  1HNB A;  3TB2 A;  3HJO A;  2DJJ A;  2CVD A;  3TJG A;  4XS6 A;  1S3D A;  2HSM B;  1KEB A;  3P8W A;  1GSS A;  3TOT A;  2V2G A;  2ON5 A;  2ZCT A;  5A4W A;  3I6A A;  1R7H A;  3F6D A;  4XTS A;  3C71 A;  1K0M A;  1GWC A;  3M1G A;  4BVY A;  2V6O A;  3ZZX A;  1GNW A;  3RDW A;  2M72 A;  3W8S A;  2HFD A;  1TOF A;  2TRC P;  1F9M A;  3D4T A;  3GKN A;  4WF4 A;  4L5L A;  5J5N A;  1T3B A;  4I8B A;  4PNF A;  1HD2 A;  5INY A;  4QL9 A;  1WJK A;  1ERW A;  4GCI A;  1MEK A;  2YWI A;  3IXR A;  2ES7 A;  4GQC A;  2H72 A;  2X8C A;  2KLX A;  1OKT A;  6GSS A;  2DJ0 A;  3LJR A;  1TKD B;  4EE0 A;  5BMU A;  2N5A A;  4XS4 A;  4F03 A;  4I6X A;  1K0C A;  4O92 A;  1EEJ A;  4KE3 A;  2K8S A;  2LUS A;  3GIX A;  3TJB A;  1KBN A;  2YCD A;  3DVW A;  5CRD A;  1U87 A;  4HQZ A;  4BWS A;  2B3S A;  3ZL5 A;  3H1N A;  1GSD A;  3LXZ A;  3ZYW A;  3NIV A;  4D73 A;  2C8U A;  1B4P A;  3F0I A;  2A4V A;  2LS5 A;  5H5Q A;  1WMJ A;  3M9K A;  2LQO A;  5JCW A;  4NWY A;  5G31 A;  3ISO A;  4EC0 A;  3TUE A;  3I69 A;  2GZY A;  1O73 A;  1K0A A;  3EU3 A;  4WEY A;  3KXO A;  1OC9 A;  1R5A A;  3IV4 A;  3FY7 A;  5CAX A;  5ECQ B;  4JR6 A;  1JHB A;  3HYP A;  3FR6 A;  4GTU A;  2H71 A;  1VF4 A;  3I43 A;  3DGQ A;  1XXU A;  2GZP A;  7GSS A;  5IO2 A;  1B8X A;  4X1U A;  2MMA A;  3UAR A;  1EWX A;  2B1K A;  1GSY A;  3MAK A;  4HUA A;  2H70 A;  5E59 A;  2P5Q A;  1SKR B;  2HSN B;  1M0U A;  1GTA A;  1H4O A;  4G19 A;  2G2Q A;  4IHU A;  1PD2 1;  1QMV A;  3EUR A;  1DUG A;  4POK A;  1RW1 A;  3GUR A;  4ZIJ A;  3UVH A;  3TKS A;  2F8A A;  2DML A;  1YF1 A;  3H93 A;  3D6I A;  2HRK A;  4IKH A;  4N10 A;  4KUN A;  3LYP A;  1E2Y A;  3G7I A;  3TRP A;  1Q4J A;  4JZQ A;  3A2X A;  6GSV A;  4KSO A;  12GS A;  1FG4 A;  4GSN A;  3QPM A;  2FD3 A;  3J7Y b;  1V98 A;  4WET A;  4IBP A;  4WXT A;  2GT5 A;  4WBJ A;  1PL2 A;  4IN0 A;  4YAV A;  2LTK A;  2YJH A;  4XRA A;  2ZNM A;  4BA7 A;  5F8B A;  3F3R A;  3IAM 2;  2GQK A;  1FOV A;  2YP6 A;  4HQS A;  1ON4 A;  2B5Y A;  1BG5 A;  3A2V A;  1S3A A;  3TKS C;  3K8N A;  5F0G A;  3BCI A;  1WOU A;  3NZN A;  3IHQ A;  1YF0 A;  2GDR A;  5B8B A;  3C1R A;  4ZBA A;  3LSZ A;  4BL7 A;  3QDN A;  5ECS A;  3TJK A;  2OAC A;  5IMA A;  4Z7X A;  5DJL A;  2VD1 A;  3S9F A;  3F4T A;  2VUP A;  2VL2 A;  5DCH A;  1GSU A;  2LEG A;  4KSM A;  2R4V A;  5J4U A;  3A2W A;  4ZB9 A;  4MJC A;  2IMF A;  1U6T A;  3ERG A;  5KN3 A;  1WRY A;  4RQX A;  1XBS A;  4ML6 A;  2DLX A;  5G5E A;  1WIK A;  4PGT A;  5FWG A;  4OD7 A;  2FA4 A;  2O85 A;  1AUC A;  1YEP A;  9GSS A;  3CTF A;  3ME7 A;  3ZMK A;  2DJ2 A;  2H6Y A;  4E8E A;  1IYH A;  5CYY A;  1GSF A;  3VPT A;  2PVO C;  1I9D A;  1SK2 A;  2VL2 C;  2WRT A;  2V41 A;  3IR4 A;  1E6B A;  4ISD A;  5D73 A;  3TRQ A;  2JZR A;  3KZQ A;  2CZ2 A;  1TXX A;  3VWV A;  1RK4 A;  4PUR A;  1SU9 A;  3ZFB A;  4RQR A;  4PUF C;  3IBH A;  3CBU A;  2BJX A;  2PN8 A;  4OWY A;  3WT1 A;  2VIM A;  3A5W A;  2YPM A;  2H19 A;  3VPQ A;  1GTU A;  1W4V A;  4ULX A;  2YV9 A;  3EMP A;  2MBS A;  5HFK A;  1SK1 A;  1YY7 A;  1GTI A;  2WFC A;  5J41 A;  1OC3 A;  2WUL A;  3TKP A;  3UBL A;  5IM9 A;  2DSA A;  4YQM A;  4I2T A;  4ECJ A;  1O81 A;  5ECO B;  2H1B A;  1G7O A;  2P31 A;  3PIN A;  2L57 A;  2VL3 A;  3PR8 A;  4GRF A;  4EVM A;  4MF6 A;  1T00 A;  2DBC A;  5KN2 A;  3GX0 A;  4ZL8 A;  3APO A;  1AXD A;  1CQH A;  2IFQ A;  4EDZ A;  1JLV A;  2H1A A;  2JZT A;  3IRA A;  3G7J A;  1MD4 A;  3QD9 A;  5ELA A;  4KB3 A;  5F05 A;  2HZE A;  1C72 A;  4EL1 A;  4BVX B;  5DVB A;  5JWR B;  4FO5 A;  4KDX A;  2K18 A;  4NPB A;  2YZU A;  20GS A;  4HS1 A;  3ZML A;  4NV5 A;  2F3M A;  1ZCP A;  2FA8 A;  1VF2 A;  2AJQ B;  4EXJ A;  2B7J A;  2C4J A;  2PUK C;  3GL3 A;  1M2D A;  4JED A;  1ZYE A;  1GUL A;  3P7X A;  4JRR A;  1TK5 B;  3VWX A;  2JAD A;  4KDU A;  4FH8 A;  3GNJ A;  3HVV A;  3HY2 A;  1K3L A;  4G0K A;  2RUF A;  4HJM A;  2C0D A;  2AHE A;  3GH9 A;  4LA1 A;  4TXV A;  4TXO B;  1JZD A;  1UC7 A;  5DJM A;  6GSW A;  2CVB A; 
#chains in the Genus database with same CATH topology
 2RM6 A;  2R2J A;  1SL2 B;  5JWO B;  1SKS B;  3BCK A;  2WB9 A;  2FWE A;  3FZA A;  1V57 A;  1TRW A;  5D93 A;  3R3E A;  2XBI A;  1J08 A;  1G6W A;  2B1L A;  1S3C A;  2GZZ A;  3FKF A;  1V9W A;  4J2F A;  2I1U A;  3US3 A;  2LJK A;  4TRX A;  4L0W A;  1UVZ A;  6GSY A;  2LKU A;  1TU7 A;  4N3Z A;  1M3J A;  5ABR A;  1K0N A;  4DSQ A;  2LNT A;  2D2Z A;  3VI5 A;  2AUV A;  2RUE A;  2QA1 A;  3SWL A;  1XWG A;  5IIZ A;  4IS0 A;  5B7C A;  2C1Y A;  4K2X A;  2UZ8 A;  1I5G A;  2IWT A;  2R0G A;  4TN8 A;  1SL1 B;  2VAF A;  3HD5 A;  4TR0 A;  5DAL A;  3HHV A;  4L0U A;  1CQG A;  1EOH A;  2WVZ A;  5ECP B;  2HI7 A;  3DVX A;  2TIR A;  4O7H A;  4N0V A;  1YKA A;  5G30 A;  1OKD A;  3EC3 A;  2WGR A;  4ZB8 A;  3HVS A;  1EP8 A;  3HA9 A;  4YH2 A;  2EIO A;  5IPH A;  2AB6 A;  2MBT A;  1M3I A;  5LNK e;  4F9Z A;  2YN1 A;  1VF1 A;  3DYR A;  5J4V A;  2QGV A;  1UN2 A;  5DAK A;  1GSE A;  3RAZ A;  4HZ2 A;  3BOA A;  1FB0 A;  4AKH A;  1PGT A;  3UJ1 A;  1MTC A;  3GUS A;  10GS A;  1TDI A;  1SD9 A;  2J9H A;  3F4R A;  8GSS A;  1DSB A;  1QUW A;  3DD3 A;  1ERT A;  5CNW A;  3GN3 A;  4G01 A;  3DXB A;  1AIU A;  2YWN A;  3QAW A;  5F06 A;  3TKQ A;  4HU7 A;  3GTU B;  2IN3 A;  1Q98 A;  4Z2R A;  4EDY A;  1BQ7 A;  5L71 A;  4TOP A;  2X99 A;  1M7T A;  4ID0 A;  4XIH A;  3KTL A;  4PXO A;  1PQN A;  2YAN A;  3FK8 A;  1NHO A;  2OBK A;  2IMI A;  1B4Q A;  1EOG A;  1XWK A;  4Q5F A;  4DSS B;  2LNS A;  1XPV A;  3QR6 A;  2HSN A;  2BTO T;  2C3N A;  2E2G A;  5A4V A;  1GRX A;  3P90 A;  1PRX A;  4P3Y B;  3KTB A;  4KH7 A;  3VK9 A;  2O8V B;  5IQY A;  3ZVJ D;  3VI7 A;  5KN0 A;  1S3R A;  4K6X A;  4TR1 B;  3CSI A;  5GST A;  2QKE A;  4PUA A;  3WGD A;  3PPU A;  3MIX A;  2H6Z A;  3LXT A;  5DQS A;  4HJ2 A;  2GQL A;  4NMU A;  3LWA A;  3TKR A;  3EYT A;  3PGT A;  4MZC A;  1A23 A;  2QSI A;  3H8Q A;  3GX8 A;  4F0B A;  2G0F A;  4NV2 A;  1PKW A;  4YQV A;  3D22 A;  2VOC A;  4G9H A;  2CQ9 A;  4J56 E;  2QC7 A;  3DKS A;  2EIR A;  2PMT A;  4V2M A;  2F51 A;  1PX6 A;  2JSZ A;  1PN9 A;  1FB6 A;  5CRG A;  1SJZ A;  2RII A;  3HZ4 A;  3A3T A;  5KN1 A;  3HXS A;  1J0F A;  2HRF A;  2CA8 A;  2HQT A;  4OCF A;  3Q6O A;  3MWH A;  3F6F A;  5IMD A;  2L6C A;  1TXU A;  2NPB A;  4AI6 A;  3O3T A;  4IQA A;  1TI1 A;  3D5J A;  2K9F A;  1F2E A;  1EZK A;  5ECN B;  3C7M A;  1QGV A;  4YKF A;  2MYG A;  4AJ6 A;  3GSS A;  3IDV A;  2H74 A;  4BPY A;  4BVY B;  1OVN A;  2YV7 A;  2HLS A;  2H6X A;  2WJU A;  3F9U A;  11GS A;  1PKZ A;  3TJF A;  4KX4 A;  3O76 A;  2XBQ A;  2VCW A;  1O8W A;  2WW3 A;  2KUC A;  5A5K A;  19GS A;  1X5C A;  4K1F A;  3SBC A;  3WT2 A;  3KM6 A;  2IJY A;  4LL1 B;  5ENU A;  4MA9 A;  2LRT A;  5IO0 A;  2PGT A;  1AAZ A;  2MMO A;  1PFO A;  2K8V A;  1SD8 A;  2NTO A;  1T8E B;  2XC2 A;  1GSQ A;  1YVL A;  4I97 A;  4K8M A;  2A2S A;  1TI3 A;  2X4A A;  4USS A;  2F9S A;  4H86 A;  3DRN A;  2B5E A;  1Z6M A;  3APS A;  3MDK A;  1GUK A;  4F2I A;  2CAI A;  5A4U A;  3CSH A;  1ERV A;  1MDJ A;  4AGS A;  5BMU B;  3N5O A;  4XS4 B;  4NHW A;  1XWC A;  4IJI A;  4DEJ A;  1R26 A;  1GUM A;  2TRX A;  2C3Q A;  1GUH A;  3C8E A;  3J7Y k;  1SJI A;  4MZB A;  1K3Y A;  4GLT A;  4D73 B;  4L8E A;  2CX3 A;  5DCG A;  3UL3 A;  5AIS A;  2HRN A;  2VCX A;  5KOX A;  5AIX A;  2HSY A;  2IIY A;  5C04 A;  1I1I P;  1M2B A;  4RUV A;  17GS A;  4TVE A;  2FGX A;  2GSR A;  4IW9 A;  1V58 A;  2DMM A;  2JSY A;  1O85 A;  3WGE A;  1OC9 B;  2OKA A;  3CHX C;  1GNE A;  3CYN A;  2V6K A;  4RI6 A;  4A5P A;  2H75 A;  1M9A A;  2R0P A;  3JCM L;  1AQV A;  2FLS A;  2VCV A;  3IOS A;  4IQ1 A;  4NXI A;  2L5L A;  4POM A;  2VD0 A;  5GAN D;  2EFC A;  3KMN A;  5IMV A;  3M3M A;  4ZB6 A;  4L5O A;  1XIY A;  1PMT A;  4G0L A;  3FEU A;  5ID2 A;  3E9J B;  2E2M A;  2VLT A;  1FVJ A;  1M99 A;  1A8L A;  3GKK A;  4N0Z A;  1LU4 A;  3F4S A;  3GH6 A;  4OFT A;  3GMF A;  3KMO A;  2E0Q A;  2A4H A;  4ZBD A;  4CDO A;  4YQU A;  1BJX A;  1FAA A;  4X43 A;  13GS A;  2OE1 A;  2EFH A;  4O32 A;  2FY6 A;  3DIE A;  1FW1 A;  4G2E A;  2ZUP A;  3L9U A;  5ECL B;  3VLN A;  3IAS 2;  4ACS A;  3CSJ A;  4CHS A;  2WCI A;  4PHZ C;  1G0T A;  3O6T A;  4F82 A;  3LEF A;  4IEL A;  2C3T A;  2M80 A;  3QCP A;  1HYU A;  4RI7 A;  2GGT A;  3ED3 A;  2MZC A;  3U6V A;  2HRK B;  2I9H A;  1ERU A;  2HT9 A;  4HU9 A;  4WR4 A;  2FWG A;  2B6M A;  3QFB C;  2HE3 A;  1JFU A;  2K6V A;  3RHB A;  6GSU A;  3KGK A;  3TOU A;  1XW9 A;  1EGR A;  22GS A;  5LCZ A;  1QQ2 A;  1EP7 A;  5EY6 A;  2M46 A;  4AJ8 A;  2HNL A;  4CY6 A;  4AKI A;  2N5F A;  1SK0 A;  4V2L A;  2NBS A;  3KH9 A;  1N2A A;  3AY8 A;  4MF5 A;  3ME8 A;  4OO4 A;  1K3O A;  3QAV A;  4GQF A;  4Q5N A;  1A0R P;  1U3A A;  4GXZ A;  4MCU A;  1A2M A;  4QMK A;  2HZF A;  4XHM A;  3TGZ A;  1SVM A;  4KAE A;  5HR2 A;  3M0F A;  5A5H A;  4BL7 B;  2YOI A;  4G0I A;  3KP8 A;  2F8F A;  2YNX A;  1BX9 A;  1JZW A;  1Z3E A;  1K0D A;  3ZIJ A;  2IMK A;  1O8X A;  1VRS D;  4HDE A;  1URM A;  1G7E A;  3RPN A;  2JL4 A;  3ZLP A;  4ZL9 A;  1THO A;  3GHA A;  4KW6 A;  3ZIT A;  2HSM A;  4LLR A;  3LOR A;  1YDK A;  2IMD A;  4KGI A;  5G2Z A;  1WWJ A;  4IJ3 A;  2PWJ A;  2V32 A;  1TW9 A;  5HR0 A;  1X0R A;  4TR3 A;  4PI2 C;  2GST A;  1AQX A;  4GF0 A;  5H5S A;  3D21 A;  3IHG A;  4MK3 A;  4F0C A;  5CRH A;  1NHY A;  5IMZ A;  3L78 A;  3KCM A;  3BJ5 A;  2VM2 A;  2O87 A;  3M9J A;  1HQO A;  3KP9 A;  5AGY A;  2O7K A;  4OCE A;  1MDK A;  2LJR A;  4CY8 A;  4EF0 A;  5COH A;  2EIQ A;  5HR3 A;  4EIQ A;  2HRA A;  3GRX A;  14GS A;  3MSZ A;  1XW6 A;  2FNO A;  4OO5 A;  3IK9 A;  2L4C A;  1A24 A;  2VL9 A;  1XFL A;  3LQ7 A;  5HQP A;  2DJ3 A;  3ZIV A;  2CV4 A;  2IME A;  4DSR A;  4MPG A;  5J9C A;  2VCZ A;  2JZS A;  4WKW A;  4N11 A;  4FQU A;  4E8H A;  3FYG A;  5GZZ B;  5D96 A;  4TR4 A;  2CX4 A;  5ECK B;  1BED A;  1TP9 A;  5J9B A;  1ZZY A;  1TRV A;  4MH2 A;  2R3X A;  1T1V A;  4I5Q A;  2O5V A;  3HCZ A;  4ZIL A;  1SVO A;  4LMV A;  5LD0 A;  1ML6 A;  3VUR A;  3QFA C;  1M9B A;  1ZYP A;  5B6M A;  2LV3 A;  1TK0 B;  3HVN A;  1X5D A;  3OR5 A;  2IFQ B;  1SKW B;  1XOB A;  2L6D A;  1YJ6 A;  1Z5Y E;  2I3Y A;  4KCA A;  4QQ7 A;  2HZE B;  4MNN A;  4ZB7 A;  3IE3 A;  4XCS A;  2IPA A;  1X9M B;  2GVP A;  5D9V A;  1SYX A;  4JBB A;  1XW5 A;  5DQY A;  4CW9 A;  4NAX A;  3V1W A;  5KOW A;  2OJL A;  3TCO A;  2C80 A;  5HR1 A;  3KIJ A;  1XWA A;  1GH2 A;  2FWH A;  2JU5 A;  3H4K A;  1Y25 A;  5KEJ A;  3EVI A;  3DWV A;  4HZ4 A;  5GAP D;  3IC8 A;  1JLW A;  2ON7 A;  4J57 E;  2WVX A;  1K0B A;  2VCQ A;  2FWF A;  1F37 A;  2H0H A;  2YZH A;  4MPF A;  4AJ7 A;  1YKC A;  5JCG A;  4X4J A;  1V40 A;  3MNG A;  1G6Y A;  1ZGN A;  3H79 A;  5D8I A;  5J3R A;  5ECR B;  5ELG A;  2LST A;  1B9X C;  4GSS A;  2WW1 A;  1ZMA A;  3HDC A;  4HI7 A;  4FIW A;  2J23 A;  2VLU A;  4GWR A;  3NOF A;  1YZX A;  1HNC A;  2R6K A;  4K0G A;  3D4M A;  1ZOF A;  3F3Q A;  4WBR D;  5A34 A;  1J9B A;  2P5R A;  2P0G A;  3C73 A;  2WVY A;  5AIV A;  3UMA A;  2FHE A;  4AF2 A;  3FR9 A;  5JCU A;  1Z7P A;  1DE1 A;  4V1A g;  3WD6 A;  3LFL A;  1OC8 A;  1WE0 A;  2X8G A;  1DBY A;  2CT6 A;  3CRT A;  1Z6N A;  4TW5 A;  4ZL7 A;  2E7P A;  2L5O A;  3EE2 A;  2OE3 A;  4N30 A;  5EPF A;  1QFN A;  1MD3 A;  1XZO A;  2WS2 A;  2FCH A;  4DVC A;  3EIN A;  1FOH A;  5DAL B;  2UV8 G;  5D9W A;  1AW9 A;  2H66 A;  1GTB A;  2N5B A;  3GFK A;  3HKR A;  5H5R A;  1PL1 A;  3Q19 A;  1F6M C;  1XOA A;  3L9V A;  3WYW A;  1F3B A;  1YEX A;  2I4A A;  3CRU A;  3ZTL A;  4O5Q A;  1O6J A;  3CMI A;  4IGJ A;  2HXK A;  4MZW A;  1A2L A;  6GST A;  1GLQ A;  5DAK B;  2GS3 A;  2NVL A;  2OAD A;  4OFM A;  4KDY A;  2H01 A;  2KP2 A;  4MF7 A;  2AYT A;  3P2A A;  1YQ1 A;  2YWO A;  4YAP A;  1LJR A;  2VM1 A;  1B9Y C;  2VCT A;  5CP1 A;  3VFI A;  2X64 A;  5ECH B;  2AAW A;  1USB A;  1UA5 A;  2C0G A;  1THX A;  3E3E A;  3L4N A;  3WGX A;  3UOM A;  2LRC A;  4OFN A;  4K9Z A;  4XRD A;  1RQM A;  3KEB A;  3F63 A;  2CAQ A;  4PNG A;  3U5R E;  4MJA A;  2H0I A;  2LRN A;  2C0F A;  2LQQ A;  3GA4 A;  4KCE A;  2H8L A;  2B7K A;  5HFI A;  1H75 A;  2Z9S A;  1BYE A;  2H1G A;  2V1M A;  2PBJ A;  2KP1 A;  1GL8 A;  3ERW A;  1FO5 A;  1U88 A;  4AKX B;  3GV1 A;  1V2A A;  4YKG A;  1XVQ A;  3FZ5 A;  1U3I A;  2GLR A;  1MDI A;  5B6N A;  3IPZ A;  3VWW A;  2H0G A;  3L9S A;  1TRS A;  3UEM A;  4O5U A;  5J47 A;  3HJP A;  1NW2 A;  1O7U A;  4PI0 C;  3ERF A;  3G9B A;  5EVO A;  3D0Z A;  2DJ1 A;  4K2D A;  3FZ9 A;  1KTE A;  2MMZ A;  1GLP A;  3IC4 A;  4FYU A;  4POB A;  1ZYQ B;  2CVK A;  2R5G A;  1QXH A;  1WPI A;  4ML1 A;  3Q18 A;  3G7Y A;  2O89 A;  2H76 A;  4GDF A;  4HSC X;  3VWU A;  16GS A;  1TJD A;  5DDL A;  4O5R A;  4K7N A;  2PVQ A;  1FHE A;  4IP1 A;  5G5F A;  1FVK A;  5FHI A;  1WP0 A;  1A2J A;  2GTU A;  4AKG A;  4ECC A;  4BVX A;  2R0C A;  4ZBB A;  4PTS A;  1BAY A;  4G10 A;  4V2N A;  3FW2 A;  4IP6 A;  1QK8 A;  2EFD A;  2OBI A;  5D9X A;  4ICY A;  5G1L A;  2C0E A;  1ZL9 A;  3BD2 A;  3GYK A;  3HZ8 A;  2WDU A;  4LMW A;  3L0H A;  4K7I A;  2XHF A;  2OT3 A;  5ECI B;  1HNA A;  3PH9 A;  3GKM A;  4FYC A;  1R4W A;  3RHC A;  3TU3 B;  4WF5 A;  1X9W B;  3IK7 A;  3ZRE A;  1ABA A;  2H73 A;  3FRC A;  4PX1 A;  5GSS A;  2YWM A;  4TXO A;  1TTZ A;  1T4Y A;  1SJ6 A;  4LL4 B;  2DJK A;  1EGO A;  3GST A;  2JAC A;  5JWQ B;  1XVW A;  2WW0 A;  1VF3 A;  2R37 A;  1IYI A;  1A8Y A;  2XPD A;  1A0F A;  1ILO A;  5D9T A;  6GSX A;  3LGC A;  2PER A;  2H1D A;  2NDO A;  1EEM A;  4JE1 A;  3Q74 A;  1Y6E A;  4OMV A;  4V1A p;  4MAB A;  1AC1 A;  2REM A;  4FYB A;  2HSH A;  5EL8 A;  5HFG A;  2YJ7 A;  1T4Z A;  2XPE A;  4IVF A;  5E4W A;  3LG6 A;  1PA3 A;  4WR5 A;  3M8N A;  5FT3 A;  4MDC A;  2KHP A;  4KA0 A;  1BF5 A;  3EMX A;  1T7P B;  3ZRD A;  2H30 A;  3LYK A;  1Z7R A;  3QAG A;  1W89 A;  4GST A;  5J40 A;  1Z9H A;  1M2A A;  3FHK A;  3E0U A;  4ZXG A;  3W6G A;  3TJJ A;  1OAZ A;  3UIW A;  3HVX A;  5A1N B;  4HOJ A;  2EC4 A;  1JZR A;  4MP4 A;  3KD0 A;  2HYX A;  4K7O A;  4EO3 A;  2DIY A;  4EUY A;  1LBK A;  4PQH A;  4MJB A;  1EV9 A;  5CRW A;  5ECM B;  5DBQ A;  3UAP A;  4MLY A;  3ZVJ A;  5IMC A;  2WZ9 A;  18GS A;  3APQ A;  3BBY A;  3W8J A;  4PQ1 A;  4E68 A;  4BWQ A;  2RLI A;  4K5S A;  2QA2 A;  1GP1 A;  3GKX A;  1JZO A;  1TK8 B;  3UBK A;  4X0X A;  1OE7 A;  1DE2 A;  3KJY A;  4JU5 A;  4FXY P;  2ALB A;  1PX7 A;  2RM5 A;  5IMF A;  2X49 A;  2LJA A;  3C1S A;  1X9S B;  3TRX A;  5CO3 A;  4KF9 A;  3UVT A;  2FUG 2;  5ID2 B;  4K0N A;  1SEN A;  2CZ3 A;  3GTU A;  3CXG A;  1EV4 A;  4Q5R A;  2A2P A;  3DEX A;  5IOW A;  3HMJ G;  4Q5Q A;  5AN1 A;  4MMM A;  3TKS E;  3RFR C;  2GQM A;  4TKY A;  3KH7 A;  2DIZ A;  4POL A;  4DSS A;  2L4Q A;  2PPT A;  2DC5 A;  4I2U A;  4NHZ A;  2MMN A;  1AQW A;  2IL3 A;  3HJM A;  3IA1 A;  3F8U A;  5IOX A;  1KNG A;  3EWL A;  1NSW A;  4ILF A;  3I9V 2;  3GL5 A;  4HEA 2;  3RPP A;  1VGL A;  4MJE A;  2OE0 A;  4TR1 A;  1YEW C;  1PSQ A;  1NM3 A;  1XWB A;  3CTG A;  2BMX A;  4EKZ A;  1SYR A;  2A2R A;  2GSQ A;  1X5E A;  4KND A;  1TRU A;  3DML A;  2AV4 A;  4MH3 A;  4XS1 A;  3QMX A;  2VO4 A;  4ECB A;  3FR3 A;  2I81 A;  1F3A A;  2GSS A;  5F07 A;  2X8H A;  3ZFL A;  4JR4 A;  2GT6 A;  2L59 A;  2PU9 C;  1R5P A;  1XCC A;  2OA7 A;  2KOK A;  1OYJ A;  5CRE A;  1OE8 A;  5G1K A;  5C00 A;  5IPG A;  1S4B P;  4ECI A;  1K0O A;  4QL7 A;  1ST9 A;  1TU8 A;  3RBT A;  1B48 A;  5A5H B;  2B5X A;  2VLV A;  3TDG A;  1SL0 B;  3FZ4 A;  3QOU A;  1N8J A;  3EU4 A;  3N9J A;  4PQI A;  3R2Q A;  5B8A A;  1ACV A;  1HNB A;  3TB2 A;  3HJO A;  2DJJ A;  3CWG A;  2CVD A;  3TJG A;  4XS6 A;  1S3D A;  2HSM B;  1KEB A;  3P8W A;  1GSS A;  3TOT A;  2V2G A;  2ON5 A;  2ZCT A;  5A4W A;  3I6A A;  1R7H A;  3F6D A;  4XTS A;  1PN0 A;  3C71 A;  1K0M A;  1GWC A;  3M1G A;  4BVY A;  2V6O A;  3ZZX A;  1GNW A;  3RDW A;  2M72 A;  3W8S A;  2HFD A;  1TOF A;  2TRC P;  1XG8 A;  1F9M A;  3D4T A;  3GKN A;  4WF4 A;  4L5L A;  5J5N A;  1T3B A;  4I8B A;  4PNF A;  1HD2 A;  5INY A;  4QL9 A;  1WJK A;  1ERW A;  4EIP A;  4GCI A;  1MEK A;  2YWI A;  2DKH A;  3IXR A;  2ES7 A;  4GQC A;  2H72 A;  2X8C A;  2KLX A;  1OKT A;  2WW2 A;  6GSS A;  2DJ0 A;  3LJR A;  1TKD B;  4EE0 A;  5BMU A;  2N5A A;  4XS4 A;  4F03 A;  4I6X A;  1K0C A;  4O92 A;  1EEJ A;  4KE3 A;  2K8S A;  2LUS A;  3GIX A;  3TJB A;  1KBN A;  2YCD A;  3DVW A;  5CRD A;  1U87 A;  4HQZ A;  4BWS A;  2B3S A;  3ZL5 A;  3H1N A;  1GSD A;  3LXZ A;  3ZYW A;  3NIV A;  4D73 A;  2C8U A;  1B4P A;  3F0I A;  2A4V A;  2LS5 A;  5H5Q A;  1WMJ A;  3M9K A;  2LQO A;  5JCW A;  4NWY A;  5G31 A;  3ISO A;  4EC0 A;  3TUE A;  3I69 A;  2GZY A;  1O73 A;  1K0A A;  3EU3 A;  4WEY A;  3KXO A;  1OC9 A;  1R5A A;  3IV4 A;  3FY7 A;  2O3E A;  5CAX A;  5ECQ B;  2DKI A;  4JR6 A;  1JHB A;  2WVX B;  3HYP A;  3FR6 A;  4GTU A;  2H71 A;  1VF4 A;  3I43 A;  3DGQ A;  1XXU A;  2GZP A;  4BIK A;  7GSS A;  5IO2 A;  1B8X A;  4X1U A;  2MMA A;  3UAR A;  1EWX A;  2B1K A;  1GSY A;  3MAK A;  4HUA A;  2H70 A;  5E59 A;  2P5Q A;  1SKR B;  2HSN B;  1M0U A;  1GTA A;  1H4O A;  4G19 A;  2G2Q A;  5A34 B;  2EFE A;  4IHU A;  1PD2 1;  1QMV A;  3EUR A;  1DUG A;  4POK A;  1RW1 A;  3GUR A;  4ZIJ A;  3UVH A;  3TKS A;  2F8A A;  2DML A;  1YF1 A;  3H93 A;  3D6I A;  2HRK A;  4IKH A;  4Z2U A;  4N10 A;  4KUN A;  3LYP A;  1E2Y A;  3G7I A;  3TRP A;  1Q4J A;  4JZQ A;  3A2X A;  6GSV A;  4KSO A;  12GS A;  1FG4 A;  4GSN A;  3QPM A;  2FD3 A;  3J7Y b;  1V98 A;  4WET A;  4IBP A;  4WXT A;  2GT5 A;  4WBJ A;  1PL2 A;  4IN0 A;  4YAV A;  2LTK A;  2YJH A;  4XRA A;  2ZNM A;  4BA7 A;  5F8B A;  3F3R A;  3IAM 2;  2GQK A;  1FOV A;  2YP6 A;  1ON4 A;  2B5Y A;  4HQS A;  3FMW A;  1BG5 A;  3A2V A;  1S3A A;  3TKS C;  3K8N A;  5F0G A;  5A1N A;  3BCI A;  1WOU A;  1ZYN A;  3NZN A;  3IHQ A;  1YF0 A;  2GDR A;  5B8B A;  3C1R A;  4ZBA A;  3LSZ A;  4K5R A;  4BL7 A;  3QDN A;  3CQF A;  5ECS A;  3TJK A;  2OAC A;  5IMA A;  4Z7X A;  5DJL A;  2VD1 A;  3S9F A;  3F4T A;  2VUP A;  2VL2 A;  5DCH A;  1GSU A;  2LEG A;  4KSM A;  2R4V A;  5J4U A;  3A2W A;  4ZB9 A;  4MJC A;  2IMF A;  1U6T A;  3EPT A;  3ERG A;  5KN3 A;  1WRY A;  4RQX A;  1XBS A;  4ML6 A;  2DLX A;  5G5E A;  1WIK A;  4PGT A;  5FWG A;  4OD7 A;  2FA4 A;  3LW9 A;  2O85 A;  1AUC A;  1YEP A;  9GSS A;  3CTF A;  3ME7 A;  3ZMK A;  2DJ2 A;  3MYD A;  2H6Y A;  4E8E A;  1IYH A;  2VKZ G;  5CYY A;  1GSF A;  3VPT A;  2PVO C;  1I9D A;  1SK2 A;  2VL2 C;  2WRT A;  2V41 A;  3IR4 A;  1E6B A;  4ISD A;  5D73 A;  3TRQ A;  2JZR A;  3KZQ A;  2CZ2 A;  1TXX A;  3VWV A;  1RK4 A;  4PUR A;  3RGB C;  1SU9 A;  3ZFB A;  4RQR A;  4PUF C;  3IBH A;  3CBU A;  2BJX A;  2PN8 A;  4OWY A;  3WT1 A;  2VIM A;  3A5W A;  2YPM A;  2H19 A;  3VPQ A;  1GTU A;  1W4V A;  4ULX A;  2YV9 A;  4W66 A;  3EMP A;  2MBS A;  5HFK A;  1SK1 A;  1YY7 A;  1GTI A;  1Y1U A;  2WFC A;  5J41 A;  4Z2T A;  5BRT A;  1OC3 A;  2WUL A;  3TKP A;  3UBL A;  5IM9 A;  2WZS A;  2DSA A;  4YQM A;  4I2T A;  4ECJ A;  1O81 A;  5ECO B;  2H1B A;  1G7O A;  2P31 A;  3PIN A;  2L57 A;  2VL3 A;  2O36 A;  3PR8 A;  4GRF A;  5J4Y A;  4EVM A;  4MF6 A;  1T00 A;  2DBC A;  5KN2 A;  1N25 A;  3GX0 A;  4ZL8 A;  3APO A;  1AXD A;  1CQH A;  2IFQ A;  4EDZ A;  1JLV A;  2H1A A;  2JZT A;  3IRA A;  3G7J A;  1MD4 A;  3QD9 A;  5ELA A;  5F05 A;  4KB3 A;  2HZE A;  1C72 A;  4EL1 A;  4BVX B;  5DVB A;  5JWR B;  4FO5 A;  4KDX A;  2K18 A;  4NPB A;  2YZU A;  20GS A;  4HS1 A;  2H1L A;  3ZML A;  4NV5 A;  2F3M A;  1ZCP A;  2FA8 A;  1VF2 A;  2AJQ B;  4EXJ A;  2B7J A;  2C4J A;  3A5I A;  2PUK C;  3GL3 A;  1M2D A;  4JED A;  1ZYE A;  1BG1 A;  1GUL A;  3P7X A;  4JRR A;  1TK5 B;  1SVL A;  3VWX A;  2JAD A;  4KDU A;  4FH8 A;  3GNJ A;  3HVV A;  3HY2 A;  1K3L A;  4G0K A;  2RUF A;  4HJM A;  2C0D A;  2AHE A;  3GH9 A;  4LA1 A;  4TXV A;  4TXO B;  1JZD A;  1UC7 A;  5DJM A;  6GSW A;  2CVB A; 
#chains in the Genus database with same CATH homology
 2RM6 A;  2R2J A;  1SL2 B;  5JWO B;  1SKS B;  3BCK A;  2WB9 A;  2FWE A;  3FZA A;  1V57 A;  1TRW A;  5D93 A;  3R3E A;  2XBI A;  1J08 A;  1G6W A;  2B1L A;  1S3C A;  2GZZ A;  3FKF A;  1V9W A;  4J2F A;  2I1U A;  3US3 A;  2LJK A;  4TRX A;  4L0W A;  1UVZ A;  6GSY A;  2LKU A;  1TU7 A;  4N3Z A;  5ABR A;  1K0N A;  4DSQ A;  2LNT A;  2D2Z A;  3VI5 A;  2AUV A;  2RUE A;  2QA1 A;  3SWL A;  1XWG A;  5IIZ A;  4IS0 A;  5B7C A;  2C1Y A;  4K2X A;  2UZ8 A;  1I5G A;  2IWT A;  2R0G A;  4TN8 A;  1SL1 B;  2VAF A;  3HD5 A;  4TR0 A;  5DAL A;  3HHV A;  4L0U A;  1CQG A;  1EOH A;  5ECP B;  2HI7 A;  3DVX A;  2TIR A;  4O7H A;  4N0V A;  1YKA A;  5G30 A;  1OKD A;  3EC3 A;  2WGR A;  4ZB8 A;  3HVS A;  1EP8 A;  3HA9 A;  4YH2 A;  2EIO A;  5IPH A;  2AB6 A;  2MBT A;  5LNK e;  4F9Z A;  2YN1 A;  1VF1 A;  3DYR A;  5J4V A;  2QGV A;  1UN2 A;  5DAK A;  1GSE A;  3RAZ A;  4HZ2 A;  3BOA A;  1FB0 A;  4AKH A;  1PGT A;  3UJ1 A;  1MTC A;  3GUS A;  10GS A;  1TDI A;  1SD9 A;  2J9H A;  3F4R A;  8GSS A;  1DSB A;  1QUW A;  3DD3 A;  1ERT A;  5CNW A;  3GN3 A;  4G01 A;  3DXB A;  1AIU A;  2YWN A;  3QAW A;  5F06 A;  3TKQ A;  4HU7 A;  3GTU B;  2IN3 A;  1Q98 A;  4Z2R A;  4EDY A;  1BQ7 A;  5L71 A;  4TOP A;  2X99 A;  1M7T A;  4ID0 A;  4XIH A;  3KTL A;  4PXO A;  1PQN A;  2YAN A;  3FK8 A;  1NHO A;  2OBK A;  2IMI A;  1B4Q A;  1EOG A;  1XWK A;  4Q5F A;  4DSS B;  2LNS A;  1XPV A;  3QR6 A;  2HSN A;  2BTO T;  2C3N A;  2E2G A;  5A4V A;  1GRX A;  3P90 A;  1PRX A;  4P3Y B;  3KTB A;  4KH7 A;  3VK9 A;  2O8V B;  5IQY A;  3ZVJ D;  3VI7 A;  5KN0 A;  4K6X A;  4TR1 B;  3CSI A;  5GST A;  2QKE A;  4PUA A;  3WGD A;  3PPU A;  3MIX A;  2H6Z A;  3LXT A;  5DQS A;  4HJ2 A;  2GQL A;  4NMU A;  3LWA A;  3TKR A;  3EYT A;  3PGT A;  4MZC A;  1A23 A;  2QSI A;  3H8Q A;  3GX8 A;  4F0B A;  2G0F A;  4NV2 A;  1PKW A;  4YQV A;  3D22 A;  2VOC A;  4G9H A;  2CQ9 A;  4J56 E;  2QC7 A;  3DKS A;  2EIR A;  2PMT A;  4V2M A;  2F51 A;  1PX6 A;  2JSZ A;  1PN9 A;  1FB6 A;  5CRG A;  1SJZ A;  2RII A;  3HZ4 A;  3A3T A;  5KN1 A;  3HXS A;  1J0F A;  2HRF A;  2CA8 A;  2HQT A;  4OCF A;  3Q6O A;  3MWH A;  3F6F A;  5IMD A;  2L6C A;  1TXU A;  2NPB A;  4AI6 A;  3O3T A;  4IQA A;  1TI1 A;  3D5J A;  2K9F A;  1F2E A;  1EZK A;  5ECN B;  3C7M A;  1QGV A;  4YKF A;  2MYG A;  4AJ6 A;  3GSS A;  3IDV A;  2H74 A;  4BPY A;  4BVY B;  1OVN A;  2YV7 A;  2HLS A;  2H6X A;  2WJU A;  3F9U A;  11GS A;  1PKZ A;  3TJF A;  4KX4 A;  3O76 A;  2XBQ A;  2VCW A;  1O8W A;  2KUC A;  5A5K A;  19GS A;  1X5C A;  4K1F A;  3SBC A;  3WT2 A;  3KM6 A;  2IJY A;  4LL1 B;  5ENU A;  4MA9 A;  2LRT A;  5IO0 A;  2PGT A;  1AAZ A;  2MMO A;  2K8V A;  1SD8 A;  2NTO A;  1T8E B;  2XC2 A;  1GSQ A;  1YVL A;  4I97 A;  4K8M A;  2A2S A;  1TI3 A;  2X4A A;  4USS A;  2F9S A;  4H86 A;  3DRN A;  2B5E A;  1Z6M A;  3APS A;  3MDK A;  1GUK A;  4F2I A;  2CAI A;  5A4U A;  3CSH A;  1ERV A;  1MDJ A;  4AGS A;  5BMU B;  3N5O A;  4XS4 B;  4NHW A;  1XWC A;  4IJI A;  4DEJ A;  1R26 A;  1GUM A;  2TRX A;  2C3Q A;  1GUH A;  3C8E A;  3J7Y k;  1SJI A;  4MZB A;  1K3Y A;  4GLT A;  4D73 B;  4L8E A;  2CX3 A;  5DCG A;  3UL3 A;  5AIS A;  2HRN A;  2VCX A;  5KOX A;  5AIX A;  2HSY A;  2IIY A;  5C04 A;  1M2B A;  4RUV A;  17GS A;  4TVE A;  2FGX A;  2GSR A;  4IW9 A;  1V58 A;  2DMM A;  2JSY A;  1O85 A;  3WGE A;  1OC9 B;  2OKA A;  1GNE A;  3CYN A;  2V6K A;  4RI6 A;  4A5P A;  2H75 A;  1M9A A;  2R0P A;  3JCM L;  1AQV A;  2FLS A;  2VCV A;  3IOS A;  4IQ1 A;  4NXI A;  2L5L A;  4POM A;  2VD0 A;  5GAN D;  2EFC A;  3KMN A;  5IMV A;  3M3M A;  4ZB6 A;  4L5O A;  1XIY A;  1PMT A;  4G0L A;  3FEU A;  5ID2 A;  3E9J B;  2E2M A;  2VLT A;  1FVJ A;  1M99 A;  1A8L A;  3GKK A;  4N0Z A;  1LU4 A;  3F4S A;  3GH6 A;  4OFT A;  3GMF A;  3KMO A;  2E0Q A;  2A4H A;  4ZBD A;  4CDO A;  4YQU A;  1BJX A;  1FAA A;  4X43 A;  13GS A;  2OE1 A;  2EFH A;  4O32 A;  2FY6 A;  3DIE A;  1FW1 A;  4G2E A;  2ZUP A;  3L9U A;  5ECL B;  3VLN A;  3IAS 2;  4ACS A;  3CSJ A;  4CHS A;  2WCI A;  1G0T A;  3O6T A;  4F82 A;  3LEF A;  4IEL A;  2C3T A;  2M80 A;  3QCP A;  1HYU A;  4RI7 A;  2GGT A;  3ED3 A;  2MZC A;  3U6V A;  2HRK B;  2I9H A;  1ERU A;  2HT9 A;  4HU9 A;  4WR4 A;  2FWG A;  2B6M A;  3QFB C;  2HE3 A;  1JFU A;  2K6V A;  3RHB A;  6GSU A;  3KGK A;  3TOU A;  1XW9 A;  1EGR A;  22GS A;  5LCZ A;  1QQ2 A;  1EP7 A;  5EY6 A;  2M46 A;  4AJ8 A;  2HNL A;  4CY6 A;  4AKI A;  2N5F A;  1SK0 A;  4V2L A;  2NBS A;  3KH9 A;  1N2A A;  3AY8 A;  4MF5 A;  3ME8 A;  4OO4 A;  1K3O A;  3QAV A;  4GQF A;  4Q5N A;  1A0R P;  1U3A A;  4GXZ A;  4MCU A;  1A2M A;  4QMK A;  2HZF A;  4XHM A;  3TGZ A;  1SVM A;  4KAE A;  5HR2 A;  3M0F A;  5A5H A;  4BL7 B;  2YOI A;  4G0I A;  3KP8 A;  2F8F A;  2YNX A;  1BX9 A;  1JZW A;  1Z3E A;  1K0D A;  3ZIJ A;  2IMK A;  1O8X A;  1VRS D;  4HDE A;  1URM A;  1G7E A;  3RPN A;  2JL4 A;  3ZLP A;  4ZL9 A;  1THO A;  3GHA A;  4KW6 A;  3ZIT A;  2HSM A;  4LLR A;  3LOR A;  1YDK A;  2IMD A;  4KGI A;  5G2Z A;  1WWJ A;  4IJ3 A;  2PWJ A;  2V32 A;  1TW9 A;  5HR0 A;  1X0R A;  4TR3 A;  2GST A;  1AQX A;  4GF0 A;  5H5S A;  3D21 A;  3IHG A;  4MK3 A;  4F0C A;  5CRH A;  1NHY A;  5IMZ A;  3L78 A;  3KCM A;  3BJ5 A;  2VM2 A;  2O87 A;  3M9J A;  1HQO A;  3KP9 A;  5AGY A;  2O7K A;  4OCE A;  1MDK A;  2LJR A;  4CY8 A;  4EF0 A;  5COH A;  2EIQ A;  5HR3 A;  4EIQ A;  2HRA A;  3GRX A;  14GS A;  3MSZ A;  1XW6 A;  2FNO A;  4OO5 A;  3IK9 A;  2L4C A;  1A24 A;  2VL9 A;  1XFL A;  3LQ7 A;  5HQP A;  2DJ3 A;  3ZIV A;  2CV4 A;  2IME A;  4DSR A;  4MPG A;  5J9C A;  2VCZ A;  2JZS A;  4WKW A;  4N11 A;  4FQU A;  4E8H A;  3FYG A;  5GZZ B;  5D96 A;  4TR4 A;  2CX4 A;  5ECK B;  1BED A;  1TP9 A;  5J9B A;  1ZZY A;  1TRV A;  4MH2 A;  2R3X A;  1T1V A;  4I5Q A;  2O5V A;  3HCZ A;  4ZIL A;  1SVO A;  4LMV A;  5LD0 A;  1ML6 A;  3VUR A;  3QFA C;  1M9B A;  1ZYP A;  5B6M A;  2LV3 A;  1TK0 B;  1X5D A;  3OR5 A;  2IFQ B;  1SKW B;  1XOB A;  2L6D A;  1YJ6 A;  1Z5Y E;  2I3Y A;  4KCA A;  4QQ7 A;  2HZE B;  4MNN A;  4ZB7 A;  3IE3 A;  4XCS A;  2IPA A;  1X9M B;  2GVP A;  5D9V A;  1SYX A;  4JBB A;  1XW5 A;  5DQY A;  4CW9 A;  4NAX A;  3V1W A;  5KOW A;  2OJL A;  3TCO A;  2C80 A;  5HR1 A;  3KIJ A;  1XWA A;  1GH2 A;  2FWH A;  2JU5 A;  3H4K A;  1Y25 A;  5KEJ A;  3EVI A;  3DWV A;  4HZ4 A;  5GAP D;  3IC8 A;  1JLW A;  2ON7 A;  4J57 E;  1K0B A;  2VCQ A;  2FWF A;  1F37 A;  2H0H A;  2YZH A;  4MPF A;  4AJ7 A;  1YKC A;  5JCG A;  4X4J A;  1V40 A;  3MNG A;  1G6Y A;  1ZGN A;  3H79 A;  5D8I A;  5J3R A;  5ECR B;  5ELG A;  2LST A;  1B9X C;  4GSS A;  1ZMA A;  3HDC A;  4HI7 A;  4FIW A;  2J23 A;  2VLU A;  4GWR A;  3NOF A;  1YZX A;  1HNC A;  2R6K A;  4K0G A;  3D4M A;  1ZOF A;  3F3Q A;  4WBR D;  5A34 A;  1J9B A;  2P5R A;  2P0G A;  3C73 A;  5AIV A;  3UMA A;  2FHE A;  4AF2 A;  3FR9 A;  5JCU A;  1Z7P A;  1DE1 A;  4V1A g;  3WD6 A;  3LFL A;  1OC8 A;  1WE0 A;  2X8G A;  1DBY A;  2CT6 A;  3CRT A;  1Z6N A;  4TW5 A;  4ZL7 A;  2E7P A;  2L5O A;  3EE2 A;  2OE3 A;  4N30 A;  5EPF A;  1QFN A;  1MD3 A;  1XZO A;  2WS2 A;  2FCH A;  4DVC A;  3EIN A;  1FOH A;  5DAL B;  2UV8 G;  5D9W A;  1AW9 A;  2H66 A;  1GTB A;  2N5B A;  3GFK A;  3HKR A;  5H5R A;  1PL1 A;  3Q19 A;  1F6M C;  1XOA A;  3L9V A;  3WYW A;  1F3B A;  1YEX A;  2I4A A;  3CRU A;  3ZTL A;  4O5Q A;  1O6J A;  3CMI A;  4IGJ A;  2HXK A;  4MZW A;  1A2L A;  6GST A;  1GLQ A;  5DAK B;  2GS3 A;  2NVL A;  2OAD A;  4OFM A;  4KDY A;  2H01 A;  2KP2 A;  4MF7 A;  2AYT A;  3P2A A;  1YQ1 A;  2YWO A;  4YAP A;  1LJR A;  2VM1 A;  1B9Y C;  2VCT A;  5CP1 A;  3VFI A;  2X64 A;  5ECH B;  2AAW A;  1USB A;  1UA5 A;  2C0G A;  1THX A;  3E3E A;  3L4N A;  3WGX A;  3UOM A;  2LRC A;  4OFN A;  4K9Z A;  4XRD A;  1RQM A;  3KEB A;  3F63 A;  2CAQ A;  4PNG A;  3U5R E;  4MJA A;  2H0I A;  2LRN A;  2C0F A;  2LQQ A;  3GA4 A;  4KCE A;  2H8L A;  2B7K A;  5HFI A;  1H75 A;  2Z9S A;  1BYE A;  2H1G A;  2V1M A;  2PBJ A;  2KP1 A;  1GL8 A;  3ERW A;  1FO5 A;  1U88 A;  4AKX B;  3GV1 A;  1V2A A;  4YKG A;  1XVQ A;  3FZ5 A;  1U3I A;  2GLR A;  1MDI A;  5B6N A;  3IPZ A;  3VWW A;  2H0G A;  3L9S A;  1TRS A;  3UEM A;  4O5U A;  5J47 A;  3HJP A;  1NW2 A;  1O7U A;  3ERF A;  3G9B A;  5EVO A;  3D0Z A;  2DJ1 A;  4K2D A;  3FZ9 A;  1KTE A;  2MMZ A;  1GLP A;  3IC4 A;  4FYU A;  4POB A;  1ZYQ B;  2CVK A;  2R5G A;  1QXH A;  1WPI A;  4ML1 A;  3Q18 A;  3G7Y A;  2O89 A;  2H76 A;  4GDF A;  3VWU A;  16GS A;  1TJD A;  5DDL A;  4O5R A;  4K7N A;  2PVQ A;  1FHE A;  4IP1 A;  5G5F A;  1FVK A;  5FHI A;  1WP0 A;  1A2J A;  2GTU A;  4AKG A;  4ECC A;  4BVX A;  2R0C A;  4ZBB A;  4PTS A;  1BAY A;  4G10 A;  4V2N A;  3FW2 A;  4IP6 A;  1QK8 A;  2EFD A;  2OBI A;  5D9X A;  4ICY A;  5G1L A;  2C0E A;  1ZL9 A;  3BD2 A;  3GYK A;  3HZ8 A;  2WDU A;  4LMW A;  3L0H A;  4K7I A;  2XHF A;  2OT3 A;  5ECI B;  1HNA A;  3PH9 A;  3GKM A;  4FYC A;  1R4W A;  3RHC A;  3TU3 B;  4WF5 A;  1X9W B;  3IK7 A;  3ZRE A;  1ABA A;  2H73 A;  3FRC A;  4PX1 A;  5GSS A;  2YWM A;  4TXO A;  1TTZ A;  1T4Y A;  1SJ6 A;  4LL4 B;  2DJK A;  1EGO A;  3GST A;  2JAC A;  5JWQ B;  1XVW A;  1VF3 A;  2R37 A;  1IYI A;  1A8Y A;  2XPD A;  1A0F A;  1ILO A;  5D9T A;  6GSX A;  3LGC A;  2PER A;  2H1D A;  2NDO A;  1EEM A;  4JE1 A;  3Q74 A;  1Y6E A;  4OMV A;  4V1A p;  4MAB A;  1AC1 A;  2REM A;  4FYB A;  2HSH A;  5EL8 A;  5HFG A;  2YJ7 A;  1T4Z A;  2XPE A;  4IVF A;  5E4W A;  3LG6 A;  1PA3 A;  4WR5 A;  3M8N A;  5FT3 A;  4MDC A;  2KHP A;  4KA0 A;  1BF5 A;  3EMX A;  1T7P B;  3ZRD A;  2H30 A;  3LYK A;  1Z7R A;  3QAG A;  1W89 A;  4GST A;  5J40 A;  1Z9H A;  1M2A A;  3FHK A;  3E0U A;  4ZXG A;  3W6G A;  3TJJ A;  1OAZ A;  3UIW A;  3HVX A;  5A1N B;  4HOJ A;  2EC4 A;  1JZR A;  4MP4 A;  3KD0 A;  2HYX A;  4K7O A;  4EO3 A;  2DIY A;  4EUY A;  1LBK A;  4PQH A;  4MJB A;  1EV9 A;  5CRW A;  5ECM B;  5DBQ A;  3UAP A;  4MLY A;  3ZVJ A;  5IMC A;  2WZ9 A;  18GS A;  3APQ A;  3BBY A;  3W8J A;  4PQ1 A;  4E68 A;  4BWQ A;  2RLI A;  4K5S A;  2QA2 A;  1GP1 A;  3GKX A;  1JZO A;  1TK8 B;  3UBK A;  4X0X A;  1OE7 A;  1DE2 A;  3KJY A;  4JU5 A;  2ALB A;  1PX7 A;  2RM5 A;  5IMF A;  2X49 A;  2LJA A;  3C1S A;  1X9S B;  3TRX A;  5CO3 A;  4KF9 A;  3UVT A;  2FUG 2;  5ID2 B;  4K0N A;  1SEN A;  2CZ3 A;  3GTU A;  3CXG A;  1EV4 A;  4Q5R A;  2A2P A;  3DEX A;  5IOW A;  3HMJ G;  4Q5Q A;  5AN1 A;  4MMM A;  3TKS E;  2GQM A;  4TKY A;  3KH7 A;  2DIZ A;  4POL A;  4DSS A;  2L4Q A;  2PPT A;  2DC5 A;  4I2U A;  4NHZ A;  2MMN A;  1AQW A;  2IL3 A;  3HJM A;  3IA1 A;  3F8U A;  5IOX A;  1KNG A;  3EWL A;  1NSW A;  4ILF A;  3I9V 2;  3GL5 A;  4HEA 2;  3RPP A;  1VGL A;  4MJE A;  2OE0 A;  4TR1 A;  1PSQ A;  1NM3 A;  1XWB A;  3CTG A;  2BMX A;  4EKZ A;  1SYR A;  2A2R A;  2GSQ A;  1X5E A;  4KND A;  1TRU A;  3DML A;  2AV4 A;  4MH3 A;  4XS1 A;  3QMX A;  2VO4 A;  4ECB A;  3FR3 A;  2I81 A;  1F3A A;  2GSS A;  5F07 A;  2X8H A;  3ZFL A;  4JR4 A;  2GT6 A;  2L59 A;  2PU9 C;  1R5P A;  1XCC A;  2OA7 A;  2KOK A;  1OYJ A;  5CRE A;  1OE8 A;  5G1K A;  5C00 A;  5IPG A;  4ECI A;  1K0O A;  4QL7 A;  1ST9 A;  1TU8 A;  3RBT A;  1B48 A;  5A5H B;  2B5X A;  2VLV A;  3TDG A;  1SL0 B;  3FZ4 A;  3QOU A;  1N8J A;  3EU4 A;  3N9J A;  4PQI A;  3R2Q A;  5B8A A;  1ACV A;  1HNB A;  3TB2 A;  3HJO A;  2DJJ A;  3CWG A;  2CVD A;  3TJG A;  4XS6 A;  1S3D A;  2HSM B;  1KEB A;  3P8W A;  1GSS A;  3TOT A;  2V2G A;  2ON5 A;  2ZCT A;  5A4W A;  3I6A A;  1R7H A;  3F6D A;  4XTS A;  1PN0 A;  3C71 A;  1K0M A;  1GWC A;  3M1G A;  4BVY A;  2V6O A;  3ZZX A;  1GNW A;  3RDW A;  2M72 A;  3W8S A;  2HFD A;  1TOF A;  2TRC P;  1F9M A;  3D4T A;  3GKN A;  4WF4 A;  4L5L A;  5J5N A;  1T3B A;  4I8B A;  4PNF A;  1HD2 A;  5INY A;  4QL9 A;  1WJK A;  1ERW A;  4EIP A;  4GCI A;  1MEK A;  2YWI A;  2DKH A;  3IXR A;  2ES7 A;  4GQC A;  2H72 A;  2X8C A;  2KLX A;  1OKT A;  6GSS A;  2DJ0 A;  3LJR A;  1TKD B;  4EE0 A;  5BMU A;  2N5A A;  4XS4 A;  4F03 A;  4I6X A;  1K0C A;  4O92 A;  1EEJ A;  4KE3 A;  2K8S A;  2LUS A;  3GIX A;  3TJB A;  1KBN A;  2YCD A;  3DVW A;  5CRD A;  1U87 A;  4HQZ A;  4BWS A;  2B3S A;  3ZL5 A;  3H1N A;  1GSD A;  3LXZ A;  3ZYW A;  3NIV A;  4D73 A;  2C8U A;  1B4P A;  3F0I A;  2A4V A;  2LS5 A;  5H5Q A;  1WMJ A;  3M9K A;  2LQO A;  5JCW A;  4NWY A;  5G31 A;  3ISO A;  4EC0 A;  3TUE A;  3I69 A;  2GZY A;  1O73 A;  1K0A A;  3EU3 A;  4WEY A;  3KXO A;  1OC9 A;  1R5A A;  3IV4 A;  3FY7 A;  5CAX A;  5ECQ B;  2DKI A;  4JR6 A;  1JHB A;  3HYP A;  3FR6 A;  4GTU A;  2H71 A;  1VF4 A;  3I43 A;  3DGQ A;  1XXU A;  2GZP A;  7GSS A;  5IO2 A;  1B8X A;  4X1U A;  2MMA A;  3UAR A;  1EWX A;  2B1K A;  1GSY A;  3MAK A;  4HUA A;  2H70 A;  5E59 A;  2P5Q A;  1SKR B;  2HSN B;  1M0U A;  1GTA A;  1H4O A;  4G19 A;  2G2Q A;  5A34 B;  2EFE A;  4IHU A;  1PD2 1;  1QMV A;  3EUR A;  1DUG A;  4POK A;  1RW1 A;  3GUR A;  4ZIJ A;  3UVH A;  3TKS A;  2F8A A;  2DML A;  1YF1 A;  3H93 A;  3D6I A;  2HRK A;  4IKH A;  4Z2U A;  4N10 A;  4KUN A;  3LYP A;  1E2Y A;  3G7I A;  3TRP A;  1Q4J A;  4JZQ A;  3A2X A;  6GSV A;  4KSO A;  12GS A;  1FG4 A;  4GSN A;  3QPM A;  2FD3 A;  3J7Y b;  1V98 A;  4WET A;  4IBP A;  4WXT A;  2GT5 A;  4WBJ A;  1PL2 A;  4IN0 A;  4YAV A;  2LTK A;  2YJH A;  4XRA A;  2ZNM A;  4BA7 A;  5F8B A;  3F3R A;  3IAM 2;  2GQK A;  1FOV A;  2YP6 A;  1ON4 A;  2B5Y A;  4HQS A;  3FMW A;  1BG5 A;  3A2V A;  1S3A A;  3TKS C;  3K8N A;  5F0G A;  5A1N A;  3BCI A;  1WOU A;  1ZYN A;  3NZN A;  3IHQ A;  1YF0 A;  2GDR A;  5B8B A;  3C1R A;  4ZBA A;  3LSZ A;  4K5R A;  4BL7 A;  3QDN A;  5ECS A;  3TJK A;  2OAC A;  5IMA A;  4Z7X A;  5DJL A;  2VD1 A;  3S9F A;  3F4T A;  2VUP A;  2VL2 A;  5DCH A;  1GSU A;  2LEG A;  4KSM A;  2R4V A;  5J4U A;  3A2W A;  4ZB9 A;  4MJC A;  2IMF A;  1U6T A;  3EPT A;  3ERG A;  5KN3 A;  1WRY A;  4RQX A;  1XBS A;  4ML6 A;  2DLX A;  5G5E A;  1WIK A;  4PGT A;  5FWG A;  4OD7 A;  2FA4 A;  3LW9 A;  2O85 A;  1AUC A;  1YEP A;  9GSS A;  3CTF A;  3ME7 A;  3ZMK A;  2DJ2 A;  3MYD A;  2H6Y A;  4E8E A;  1IYH A;  2VKZ G;  5CYY A;  1GSF A;  3VPT A;  2PVO C;  1I9D A;  1SK2 A;  2VL2 C;  2WRT A;  2V41 A;  3IR4 A;  1E6B A;  4ISD A;  5D73 A;  3TRQ A;  2JZR A;  3KZQ A;  2CZ2 A;  1TXX A;  3VWV A;  1RK4 A;  4PUR A;  1SU9 A;  3ZFB A;  4RQR A;  4PUF C;  3IBH A;  3CBU A;  2BJX A;  2PN8 A;  4OWY A;  3WT1 A;  2VIM A;  3A5W A;  2YPM A;  2H19 A;  3VPQ A;  1GTU A;  1W4V A;  4ULX A;  2YV9 A;  4W66 A;  3EMP A;  2MBS A;  5HFK A;  1SK1 A;  1YY7 A;  1GTI A;  1Y1U A;  2WFC A;  5J41 A;  4Z2T A;  5BRT A;  1OC3 A;  2WUL A;  3TKP A;  3UBL A;  5IM9 A;  2DSA A;  4YQM A;  4I2T A;  4ECJ A;  1O81 A;  5ECO B;  2H1B A;  1G7O A;  2P31 A;  3PIN A;  2L57 A;  2VL3 A;  3PR8 A;  4GRF A;  5J4Y A;  4EVM A;  4MF6 A;  1T00 A;  2DBC A;  5KN2 A;  1N25 A;  3GX0 A;  4ZL8 A;  3APO A;  1AXD A;  1CQH A;  2IFQ A;  4EDZ A;  1JLV A;  2H1A A;  2JZT A;  3IRA A;  3G7J A;  1MD4 A;  3QD9 A;  5ELA A;  5F05 A;  4KB3 A;  2HZE A;  1C72 A;  4EL1 A;  4BVX B;  5DVB A;  5JWR B;  4FO5 A;  4KDX A;  2K18 A;  4NPB A;  2YZU A;  20GS A;  4HS1 A;  2H1L A;  3ZML A;  4NV5 A;  2F3M A;  1ZCP A;  2FA8 A;  1VF2 A;  2AJQ B;  4EXJ A;  2B7J A;  2C4J A;  3A5I A;  2PUK C;  3GL3 A;  1M2D A;  4JED A;  1ZYE A;  1BG1 A;  1GUL A;  3P7X A;  4JRR A;  1TK5 B;  1SVL A;  3VWX A;  2JAD A;  4KDU A;  4FH8 A;  3GNJ A;  3HVV A;  3HY2 A;  1K3L A;  4G0K A;  2RUF A;  4HJM A;  2C0D A;  2AHE A;  3GH9 A;  4LA1 A;  4TXV A;  4TXO B;  1JZD A;  1UC7 A;  5DJM A;  6GSW A;  2CVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...