1VF3A

Cgsta1-1 in complex with glutathione conjugate of cdnb
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
KPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
total genus 82
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf3A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf3A01
4N11A 4I5QA 1S3AA 4OO4A 2I1UA 4PTSA 3CYNA 1SK0A 3VPQA 4J2FA 3KTLA 6GSWA 2HZEA 3EVIA 2AHEA 3IR4A 1HQOA 3ERWA 2H72A 2ON5A 3EURA 2P5RA 3LG6A 2EIRA 3D22A 3GH6A 3VFIA 3CTGA 3HYPA 3GYKA 3ZRDA 4K7OA 3NIVA 2TIRA 1QUWA 3TKQA 4D73A 4DSRA 2IMIA 3KD0A 5F07A 4IP6A 3KM6A 2I81A 3TKPA 4HU9A 2RM5A 4ECCA 3KZQA 2PBJA 1EV4A 4HEA2 4BA7A 3ERGA 4LLRA 2PGTA 1Z7RA 4L0UA 2AUVA 1SK2A 2XPEA 2LQQA 5IOXA 3HVVA 3QDNA 2DJJA 1FG4A 3HJPA 1ABAA 1M99A 2GSRA 2GS3A 2PMTA 1K3LA 3VWVA 5HFGA 1OC8A 1XZOA 4E8EA 1K0NA 5C00A 3WT1A 2J9HA 2EIOA 3DEXA 2EIQA 2MBTA 3WGEA 2NBSA 2DSAA 1GSYA 3UBLA 3LJRA 1LJRA 2E7PA 3HVXA 3CMIA 1O81A 1TU8A 2VCWA 5DDLA 1EZKA 1ZMAA 4K1FA 3C1RA 3EINA 2YPMA 4IQ1A 4K0NA 4TKYA 4TVEA 3US3A 3UL3A 4PQ1A 2M46A 2P31A 5IQYA 1SL1B 4J56E 5H5RA 4MDCA 2OJLA 1O73A 2VL2C 5CRWA 5DCGA 5G5EA 4WETA 1T00A 3RBTA 2MMZA 3KH7A 4NV5A 5ECMB 3FR6A 3GKMA 1JZWA 2VL9A 4K9ZA 2N5AA 3CXGA 4MP4A 1Q98A 3O6TA 2R5GA 2OADA 3M3MA 2C3QA 4MK3A 3RDWA 2C3NA 4TN8A 2R3XA 1YEXA 1RQMA 3I6AA 5HR0A 1URMA 3EMXA 4TXVA 2JL4A 5HR2A 5CRGA 3VI5A 5ID2B 1JZDA 3I43A 2XC2A 3L9SA 2A2RA 2IMDA 3F9UA 4NHZA 1AIUA 1A24A 1ERUA 2O7KA 2YWIA 2HSMA 1X5DA 4G0KA 2H0GA 1R26A 4TW5A 3D4TA 5HFKA 5JCWA 1XWCA 2H73A 1I5GA 1YQ1A 5C04A 4NAXA 1ACVA 1XIYA 2FWHA 2OE3A 4KDXA 2MBSA 1ERVA 4OFTA 5A5KA 1XWAA 4DVCA 4BWSA 2FHEA 3IPZA 1B9XC 1KEBA 5ECSA 2VOCA 1TRVA 2DJ0A 3GNJA 1X0RA 1J08A 4MJAA 4IJ3A 4MH2A 3O76A 3QOUA 1SL0B 1GTAA 1U3AA 3ZLPA 4BL7B 4JR6A 1GNWA 5ECLB 6GSXA 2CVKA 1SD9A 2KUCA 3Q74A 3HCZA 4DEJA 4HJ2A 5DVBA 1AW9A 3ZMLA 3V1WA 1S3CA 4ID0A 2TRXA 4YAVA 1SK1A 3WYWA 4ML6A 3KTBA 1YY7A 3DYRA 1XVQA 5ECOB 1AQXA 1EOGA 2C0FA 3HVSA 2GSTA 3FRCA 2C8UA 3EU4A 5COHA 1WJKA 2X8GA 1B9YC 4F0CA 4ZBBA 3TRPA 1TI3A 5DAKB 1V40A 3G7IA 5IMFA 2OA7A 3NZNA 1A0FA 4LA1A 2DMLA 2PN8A 2Z9SA 1BQ7A 1MD3A 3TJBA 2HSMB 1HYUA 4EXJA 4K7NA 1YF1A 1SYXA 3PH9A 3CRUA 22GSA 3FZ5A 1OC3A 1UC7A 2RUFA 5HQPA 3M8NA 1VGLA 1EP7A 2E0QA 2IJYA 1N2AA 4POBA 3D5JA 2NPBA 1Z6NA 1GP1A 2CZ3A 1F9MA 2H19A 5DCHA 3KCMA 4MZCA 4XS4B 5KN2A 1TRSA 5KN1A 1FO5A 4WKWA 1XCCA 4FYBA 4K8MA 1K0DA 4QQ7A 5A4VA 2P5QA 4DSSA 3FZ9A 2KHPA 2QC7A 4GLTA 4X1UA 1M2AA 5CP1A 3A3TA 2C3TA 1B4QA 1U88A 5AIXA 3FR9A 3D0ZA 7GSSA 1JZOA 4MLYA 2C80A 3DWVA 5ECKB 11GSA 2LRTA 4EDZA 6GSYA 1UN2A 1W89A 1XOBA 2L5OA 4HOJA 1A8YA 2RM6A 2O8VB 3GTUA 2GQKA 3VK9A 1DE2A 5G2ZA 2H71A 2HQTA 3MAKA 1FB6A 4NPBA 2M80A 4X0XA 2V32A 4ZBDA 2JU5A 4ULXA 2HNLA 3QAWA 5ELGA 1ERWA 2KLXA 3FEUA 2JZRA 5J4UA 2ZUPA 1DBYA 2MZCA 2DLXA 3M9KA 1V57A 3UOMA 1GLPA 2RUEA 3ZIVA 2HZFA 1XFLA 5IIZA 4FIWA 1O8XA 1AAZA 2N5BA 2DBCA 3ZTLA 3O3TA 1JFUA 2JSYA 3RHCA 3ZYWA 4HU7A 2H8LA 1PA3A 3CTFA 4TR4A 2HRKB 1GRXA 3AY8A 6GSTA 4MJCA 3FZ4A 4AJ6A 3GIXA 3TOUA 5GAND 4Q5NA 3H79A 3LWAA 3UEMA 3UIWA 2WDUA 5CO3A 4IKHA 2JACA 2H74A 3D6IA 5J3RA 4K6XA 4GQFA 2GSQA 1J0FA 2K9FA 3TJJA 4MF5A 3UARA 1WP0A 2JZSA 3IA1A 1ZOFA 4DSSB 1TW9A 1ZCPA 3QAVA 1AC1A 2PERA 3DMLA 2GDRA 4RQXA 4IBPA 3D21A 1V58A 4KH7A 2FNOA 3A2VA 4LL4B 1X9WB 2MYGA 3FY7A 1A2MA 4CHSA 3LEFA 4JRRA 1B8XA 4ECBA 3BCKA 4L5LA 3G7JA 3GX8A 3GKXA 4F82A 1GLQA 1IYHA 3ZIJA 3HHVA 4O92A 2I3YA 4YQMA 3FR3A 1F37A 3KGKA 1EGRA 2FCHA 1HD2A 3DKSA 1OC9B 2AYTA 1SYRA 1O8WA 5G1KA 2FY6A 3IV4A 2L4QA 3P8WA 4ECIA 1X5EA 5AGYA 1PRXA 2X99A 1N8JA 4G10A 3L0HA 4RQRA 3A2WA 1SJIA 4IJIA 3UVTA 3KXOA 2PU9C 3VWWA 4KF9A 2ON7A 2B1KA 4TR3A 1PL1A 1T3BA 2DC5A 5DJLA 2VCQA 2OKAA 4PQHA 4ZL7A 1OKDA 1PN9A 3WGDA 1QFNA 4IQAA 2OACA 1EEJA 2F51A 1ON4A 4ML1A 3TJGA 2JADA 2CQ9A 2JZTA 2ZCTA 4KCAA 4O7HA 5FHIA 2KOKA 5ID2A 3UMAA 4IHUA 5F0GA 1AQVA 4PXOA 5IOWA 4KGIA 2PVOC 4ZILA 4JU5A 1OVNA 3GUSA 4KDUA 3RPNA 3QCPA 3UJ1A 4IVFA 2DJ2A 3APQA 2R6KA 4MPFA 1GSFA 4DSQA 2K8VA 5CRHA 5E59A 2OE1A 3RAZA 3DVWA 3C73A 2X8CA 4HJMA 5CNWA 5DQYA 3ZREA 4FQUA 4CW9A 1EOHA 3IXRA 2V1MA 3FK8A 3TKRA 1QXHA 5CYYA 3F0IA 4IP1A 3DVXA 1X9SB 3GURA 4GCIA 4TXOB 2IWTA 2F9SA 2UZ8A 2QKEA 4FYUA 4I6XA 4BPYA 3CSHA 3ZFBA 2I4AA 3EU3A 1OAZA 1PSQA 1SJ6A 3LFLA 4OO5A 1YF0A 1JZRA 1PL2A 2V6KA 1T8EB 2YZUA 2HSYA 4BL7A 2H0HA 4L8EA 5J9CA 3A5WA 4JZQA 1R4WA 2B5EA 2WGRA 1FVJA 4V2LA 1YEPA 1K0BA 3D4MA 3KJYA 3I69A 2VAFA 4PQIA 2CX4A 3LXZA 4QL7A 1BAYA 2FUG2 3N9JA 4GXZA 2QSIA 4Q5FA 4ISDA 4RUVA 1VF2A 3ME7A 2R2JA 1TP9A 4GTUA 4GSSA 1BX9A 3J7Yb 5J5NA 2DIZA 2C4JA 1U6TA 4USSA 5A4UA 1TJDA 4Z7XA 5DAKA 1Z5YE 4K0GA 5IM9A 4NV2A 4PX1A 3DXBA 5KN0A 1YZXA 2CA8A 3L4NA 2MMNA 4KSMA 3WGXA 2V6OA 3KIJA 3GH9A 2VLVA 4EDYA 4MZBA 1X5CA 3HJOA 4OWYA 3SWLA 2ZNMA 3EYTA 5GSTA 3IDVA 1GTBA 5CAXA 2N5FA 5FT3A 3Q6OA 1X9MB 3H93A 4XIHA 5EY6A 3LYPA 4YQUA 1HNCA 9GSSA 5HR1A 1J9BA 3QFAC 3TKSA 5EL8A 3LYKA 4XS4A 1BYEA 5INYA 2GVPA 4Q5QA 4L0WA 5IMZA 1K0AA 3F4TA 2FWGA 3QPMA 2B7JA 1XWKA 5IMCA 5G31A 3WT2A 5BMUA 3DIEA 1MEKA 1K3OA 2XBQA 3J7Yk 2PUKC 4OFNA 5ABRA 1A2JA 1R7HA 2QGVA 1Z7PA 5HFIA 1WOUA 2KP1A 1M7TA 1PGTA 2LTKA 2A4VA 4MF6A 4ZIJA 1YDKA 3UAPA 3I9V2 3UBKA 2HRNA 1LBKA 4HS1A 3HZ8A 3HD5A 3F4SA 3APOA 3HKRA 2GQLA 2IFQB 1GUKA 3EC3A 4WEYA 2NDOA 1F6MC 4JEDA 2WS2A 1O7UA 3QR6A 3TDGA 4WR4A 1TDIA 3UVHA 1WMJA 1FVKA 4Q5RA 2H76A 4HDEA 3LSZA 4MA9A 1TU7A 1QGVA 1SENA 2X64A 3VLNA 1Y6EA 3GKKA 1GSEA 2HRKA 2AV4A 1XOAA 3TRQA 3IRAA 1ZYEA 2H6ZA 3KMNA 5IMAA 3W6GA 3RHBA 1AXDA 2F8FA 1Z9HA 1G7EA 3P90A 2K18A 2O85A 4BVYB 2H1BA 3APSA 4G0LA 4XHMA 3N5OA 2DJ1A 3HJMA 2LEGA 4EF0A 4XRAA 5DALB 1XPVA 4MCUA 3H1NA 4ZB8A 1M9BA 2D2ZA 1VF4A 4X43A 2XPDA 3H8QA 4ECJA 3E3EA 4O32A 1H4OA 2I9HA 3JCML 5G5FA 4I2UA 1PKWA 1R5AA 2C1YA 4XRDA 2DMMA 2DIYA 2H1AA 2VCTA 4TR1A 4HQSA 3ED3A 2PVQA 3KP9A 1F2EA 1H75A 4G19A 3TGZA 1DE1A 3BOAA 3HXSA 1TXXA 2CV4A 2H6YA 3LGCA 3P7XA 2L59A 1KTEA 5DBQA 5ENUA 1XXUA 2GT6A 4POKA 3GL5A 4KX4A 4TOPA 4KDYA 1OC9A 1WWJA 1LU4A 2HE3A 2VCXA 1T4YA 3IC8A 2F8AA 3FHKA 4MMMA 1BG5A 3NOFA 2MMOA 4OMVA 1GSUA 2YP6A 1T1VA 1GUHA 3LXTA 5LCZA 3VWXA 2JSZA 1A23A 3L9UA 4WXTA 2AJQB 2O87A 4OD7A 4ZL8A 1GL8A 3F3RA 4LMVA 2J23A 2X8HA 5B6NA 4GSNA 2C0EA 2FWEA 2CAQA 3IHQA 3IBHA 3G9BA 2LNSA 1HNBA 4L5OA 3IAS2 2NTOA 2MMAA 4YAPA 3KP8A 1ST9A 3M1GA 16GSA 1S3DA 3MNGA 2HT9A 2H70A 2RLIA 3M9JA 4F03A 1YKAA 3VPTA 1FAAA 2YNXA 3U6VA 4F9ZA 1B4PA 4TR0A 4JBBA 1RW1A 2GTUA 4FYCA 4N10A 2HLSA 1MDKA 4WF5A 1XW9A 3KMOA 3FZAA 4ZBAA 2CVBA 5D9XA 6GSUA 2DJKA 3IOSA 3QMXA 3EWLA 2GQMA 4HQZA 2YN1A 2HRAA 1PKZA 1V9WA 3ZMKA 1G6YA 3KH9A 2H6XA 1NHYA 2REMA 1E6BA 2B7KA 2ALBA 18GSA 1CQGA 4WBRD 4G0IA 5F06A 2YWMA 1VF3A 2VIMA 3VI7A 4TR1B 4NXIA 3IE3A 5JCUA 4KUNA 4GF0A 3HY2A 10GSA 4EL1A 3ZL5A 4TXOA 4BVXB 2IMFA 5JWRB 1GSDA 3VWUA 1VF1A 4ACSA 2L57A 3SBCA 3TCOA 4MF7A 3GKNA 1BEDA 1FOVA 5JCGA 4I97A 6GSVA 1TK5B 3WD6A 2VLUA 2K6VA 1KBNA 3MWHA 4IW9A 1JLVA 4MPGA 1OKTA 5FWGA 3E0UA 1M9AA 4JR4A 3A2XA 1NHOA 5IMVA 3CSIA 2PWJA 2B3SA 1ILOA 1Z3EA 4AGSA 2YJ7A 4V2NA 1TK8B 2HXKA 3U5RE 2VO4A 2H30A 12GSA 4ZB9A 4IS0A 1K0MA 4EVMA 1GULA 4ZXGA 2GGTA 4IN0A 4YH2A 3ME8A 3PR8A 3QFBC 4ZB6A 1PX6A 4KA0A 2WRTA 3W8SA 4PURA 5J9BA 3GHAA 1EP8A 2WJUA 5A4WA 2HYXA 3BD2A 1OE8A 3EE2A 1PQNA 4FH8A 3Q18A 1BJXA 4HI7A 1XBSA 2WFCA 1V98A 1A8LA 1HNAA 2WZ9A 4KB3A 1B48A 2FA4A 2HRFA 1GUMA 2R4VA 4WR5A 5IMDA 4XTSA 1TRWA 1TTZA 2GZYA 1SKWB 2LUSA 4AJ8A 2HSNB 2CX3A 2V2GA 2GLRA 2DJ3A 5B8AA 3VURA 4CDOA 2H66A 3MSZA 4HZ2A 4KSOA 2VCZA 1Z6MA 2IMEA 3C71A 1WRYA 5ECHB 5G30A 2A2SA 4O5RA 2YV7A 2IL3A 5D73A 2NVLA 2R37A 2L6CA 5ECNB 1THXA 1G6WA 3P2AA 1QMVA 3ZITA 4RI6A 5KEJA 4N0VA 4NWYA 5GSSA 20GSA 3L78A 5AN1A 5D96A 4EE0A 4GSTA 1MDJA 4F2IA 1ZL9A 4G2EA 2C0DA 3H4KA 4POMA 2HFDA 5B8BA 4EC0A 5DJMA 1R5PA 2HZEB 4TRXA 1XWGA 1GSQA 4BWQA 2IPAA 3E9JB 4GWRA 2FD3A 2WULA 3GFKA 5J41A 2YV9A 1FW1A 4EKZA 2OBIA 1A0RP 5B7CA 3TB2A 4PNGA 3TJFA 1GTIA 3R3EA 1EWXA 1F3BA 2GZZA 2VL2A 1U3IA 2WCIA 4N30A 2LS5A 4OCEA 4D73B 1SKSB 3FKFA 4LL1B 1ZGNA 1SD8A 2M72A 5GZZB 2IFQA 3M0FA 1QK8A 2H1GA 3GA4A 2GZPA 2B5XA 1M2BA 2VUPA 1Q4JA 1K0CA 1GH2A 2CT6A 1WIKA 4MJEA 1RK4A 2VM2A 5EPFA 1XVWA 4KCEA 5ECRB 2YANA 5D9VA 2H01A 2LJKA 1KNGA 4OFMA 3FW2A 5IO0A 1SU9A 3IC4A 2YWNA 2FGXA 3TKSC 1U87A 3R2QA 1VRSD 1Y25A 2HI7A 1QQ2A 3DRNA 2L4CA 4KE3A 2BTOT 1WPIA 4BVYA 3IK7A 3GX0A 2XBIA 1GWCA 2XHFA 5DALA 4FO5A 3QAGA 1MTCA 4EO3A 2AB6A 2L5LA 5ELAA 4LMWA 1UA5A 5ECPB 5AIVA 2O89A 3IAM2 2VD1A 4HZ4A 8GSSA 3GRXA 3HDCA 4POLA 4EUYA 3G7YA 1XW5A 3S9FA 2KP2A 1NSWA 2LJAA 2PPTA 3DD3A 1WE0A 5E4WA 1FHEA 2RIIA 4RI7A 3GL3A 2H1DA 3TJKA 2E2GA 4PNFA 1YJ6A 1PD21 1ERTA 5LNKe 2H75A 2IMKA 2B1LA 3ZVJD 1SJZA 5GAPD 3QD9A 3IK9A 1JLWA 1ZZYA 1XWBA 1O6JA 4HUAA 2HSHA 4OCFA 2LQOA 5KN3A 3ERFA 2L6DA 1TOFA 4MH3A 1M0UA 2FA8A 1F3AA 2FWFA 2LNTA 3C8EA 4PUAA 2VM1A 5ECQB 3GSTA 1W4VA 3CRTA 1T4ZA 4GQCA 5D8IA 3ZVJA 1EV9A 1G0TA 2VL3A 5H5QA 3TRXA 14GSA 4I8BA 3F4RA 3LORA 1SKRB 1PX7A 1UVZA 4XS1A 3RPPA 1DSBA 5G1LA 4XS6A 5ECIB 3EMPA 4K7IA 1GNEA 4K2DA 1K3YA 3C1SA 4N0ZA 4AJ7A 13GSA 5AISA 1G7OA 2BJXA 2AAWA 1O85A 1YKCA 2B6MA 5IO2A 2YCDA 3BBYA 2G0FA 4J57E 5D9WA 4F0BA 2P0GA 4V1Ag 3GMFA 3PGTA 4GRFA 1MDIA 3F6DA 3TOTA 1PMTA 3F6FA 5F8BA 19GSA 5CREA 4KW6A 3L9VA 1XW6A 1TRUA 4BVXA 3BJ5A 4H86A 2YOIA 4V1Ap 2IN3A 2LKUA 4ILFA 4IGJA 2G2QA 1IYIA 5L71A 3ZFLA 3GSSA 5H5SA 2TRCP 1OE7A 3ZZXA 1GSSA 3F63A 3GV1A 1EEMA 4YQVA 1ZYQB 5JWOB 2K8SA 4NMUA 1CQHA 4V2MA 2F3MA 2VCVA 3GN3A 1AUCA 2OBKA 1EGOA 2B5YA 1TK0B 2ES7A 3W8JA 4WF4A 1NW2A 3CSJA 3HA9A 3HZ4A 2WB9A 4MABA 4P3YB 3MDKA 1THOA 4IELA 3F8UA 3PPUA 5D9TA 1I9DA 1SL2B 17GSA 3FYGA 2V41A 1OYJA 1GTUA 3PINA 1C72A 1ML6A 5JWQB 2H0IA 1AQWA 4I2TA 4KNDA 2VLTA 2YWOA 4PUFC 2CAIA 2E2MA 3CBUA 1M2DA 4AF2A 2C0GA 5D93A 4QL9A 1NM3A 2CZ2A 2OE0A 1E2YA 4ZL9A 2GT5A 3TUEA 3K8NA 6GSSA 3LQ7A 5CRDA 2LSTA 2YZHA 3F3QA 2VD0A 5HR3A 2LRNA 5IPGA 2LJRA 2FLSA 4MZWA 2BMXA 3OR5A 4PGTA 3TKSE 4E8HA 4KAEA 5DQSA 5LD0A 5B6MA 3KEBA 1FB0A 3BCIA 2GSSA 2IIYA 3ISOA 2YJHA 1K0OA 3Q19A 5EVOA 5IPHA 4NHWA 4JE1A 4WBJA 2LV3A 3C7MA 1V2AA 5F05A 2CVDA 1T7PB 1USBA 4XCSA 4MJBA 4G9HA 1DUGA 1JHBA 2EC4A 3GTUB 2LRCA 1A2LA 1TKDB 1TI1A 3DGQA 1MD4A
chains in the Genus database with same CATH superfamily
4N11A 4I5QA 1PN0A 1S3AA 2I1UA 4OO4A 4PTSA 3CYNA 1SK0A 3VPQA 4J2FA 3KTLA 6GSWA 2HZEA 3EVIA 2AHEA 4HSCX 3IR4A 1HQOA 3ERWA 2H72A 2ON5A 3EURA 2P5RA 3LG6A 2EIRA 3D22A 3GH6A 3VFIA 3CTGA 3HYPA 3GYKA 3ZRDA 4K7OA 3NIVA 2TIRA 1QUWA 3TKQA 4D73A 4DSRA 2IMIA 3KD0A 3IHGA 5F07A 4IP6A 3KM6A 2I81A 3TKPA 4HU9A 2RM5A 4ECCA 3KZQA 2PBJA 1EV4A 4HEA2 4BA7A 3ERGA 4LLRA 4K5RA 2PGTA 1Z7RA 4L0UA 4AKIA 2AUVA 4CY8A 1SK2A 2XPEA 2LQQA 5IOXA 3HVVA 3QDNA 2DJJA 1FG4A 3HJPA 1ABAA 1M99A 2GSRA 2H1LA 2GS3A 2PMTA 1K3LA 3VWVA 5HFGA 1OC8A 1XZOA 4E8EA 1K0NA 5C00A 3WT1A 1N25A 1Y1UA 2J9HA 2EIOA 3DEXA 2EIQA 2MBTA 3HVNA 3WGEA 1ZYNA 2NBSA 2DSAA 1GSYA 3UBLA 3LJRA 1LJRA 2E7PA 3HVXA 3CMIA 1O81A 1TU8A 2VCWA 5DDLA 4YKFA 1EZKA 1ZMAA 4K1FA 3C1RA 3EINA 2YPMA 4IQ1A 1M3JA 4K0NA 4TKYA 4TVEA 3US3A 3UL3A 4PQ1A 2M46A 2P31A 5IQYA 1SL1B 4J56E 5H5RA 4MDCA 2OJLA 1O73A 2VL2C 5CRWA 5DCGA 5G5EA 4WETA 1T00A 3RBTA 2MMZA 3KH7A 4NV5A 5ECMB 3FR6A 3GKMA 1JZWA 2VL9A 4K9ZA 2N5AA 3CXGA 4E68A 4MP4A 1Q98A 3O6TA 2R5GA 2OADA 3M3MA 2C3QA 4MK3A 3RDWA 2C3NA 4TN8A 2R3XA 1YEXA 1RQMA 3I6AA 5HR0A 1URMA 3EMXA 4TXVA 2JL4A 5HR2A 5CRGA 3VI5A 5ID2B 1JZDA 3I43A 2XC2A 3L9SA 2A2RA 2IMDA 3F9UA 4NHZA 1AIUA 1A24A 1ERUA 2O7KA 2YWIA 2HSMA 1X5DA 4G0KA 2H0GA 1R26A 4TW5A 3D4TA 5HFKA 5JCWA 1XWCA 4MNNA 2H73A 1I5GA 1YQ1A 5C04A 4Z2TA 4NAXA 1ACVA 1XIYA 2FWHA 2OE3A 4KDXA 2MBSA 1ERVA 4OFTA 5A5KA 1XWAA 4DVCA 4BWSA 2FHEA 3IPZA 1B9XC 1KEBA 1PFOA 5ECSA 2VOCA 1TRVA 2DJ0A 3GNJA 5A34A 1X0RA 1J08A 4MJAA 4IJ3A 4MH2A 3O76A 3QOUA 1SL0B 1GTAA 1U3AA 3ZLPA 4BL7B 4JR6A 1GNWA 5ECLB 6GSXA 2CVKA 1SD9A 2KUCA 3Q74A 3HCZA 4DEJA 4HJ2A 5DVBA 1AW9A 3ZMLA 3V1WA 1S3CA 4ID0A 2TRXA 4YAVA 1SK1A 3WYWA 4ML6A 3KTBA 4N3ZA 1YY7A 3DYRA 1XVQA 5ECOB 1AQXA 1EOGA 3RFRC 2C0FA 3HVSA 2GSTA 3FRCA 3FMWA 2C8UA 3EU4A 5COHA 1WJKA 2X8GA 1B9YC 4F0CA 4ZBBA 3TRPA 1TI3A 5DAKB 1V40A 3G7IA 5IMFA 2OA7A 3NZNA 1A0FA 4LA1A 2DMLA 2PN8A 2Z9SA 1BQ7A 1MD3A 3TJBA 2HSMB 1HYUA 4EXJA 4K7NA 1YF1A 1SYXA 3PH9A 3CRUA 22GSA 3FZ5A 1OC3A 1UC7A 2RUFA 5HQPA 2WVXB 3M8NA 1VGLA 1EP7A 2E0QA 2IJYA 4K2XA 1N2AA 4POBA 3D5JA 2NPBA 1Z6NA 1GP1A 2CZ3A 1F9MA 2H19A 5DCHA 3KCMA 4MZCA 4PI2C 4XS4B 5KN2A 1TRSA 5KN1A 1FO5A 4WKWA 1XCCA 4FYBA 4K8MA 1K0DA 4QQ7A 5A4VA 2P5QA 4DSSA 3FZ9A 2KHPA 2QC7A 4GLTA 4X1UA 1M2AA 5BMUB 5CP1A 3A3TA 2WW1A 2C3TA 1B4QA 1U88A 5AIXA 3FR9A 3D0ZA 7GSSA 1JZOA 4AKXB 4MLYA 2C80A 3DWVA 5ECKB 11GSA 2LRTA 4EDZA 6GSYA 1UN2A 1W89A 1XOBA 3MYDA 2L5OA 4HOJA 1A8YA 2RM6A 2O8VB 3GTUA 2GQKA 3VK9A 5J40A 1DE2A 5G2ZA 2H71A 2HQTA 3MAKA 1FB6A 4NPBA 2M80A 4X0XA 2V32A 4ZBDA 2JU5A 4ULXA 2HNLA 3QAWA 5ELGA 1ERWA 2KLXA 3FEUA 2JZRA 5J4UA 2ZUPA 2O3EA 1DBYA 2MZCA 2DLXA 3M9KA 1V57A 3UOMA 1GLPA 2RUEA 3ZIVA 2HZFA 1XFLA 5IIZA 4FIWA 1O8XA 1AAZA 2N5BA 2DBCA 3ZTLA 3O3TA 1JFUA 2JSYA 3RHCA 3ZYWA 4HU7A 2H8LA 1SVOA 1S4BP 1PA3A 3CTFA 4TR4A 2HRKB 1GRXA 3AY8A 6GSTA 4MJCA 3FZ4A 4AJ6A 3GIXA 3TOUA 5GAND 4Q5NA 3H79A 3LWAA 3UEMA 3UIWA 2WDUA 5CO3A 4IKHA 2JACA 2H74A 3D6IA 5J3RA 4K6XA 4GQFA 1YEWC 2GSQA 1J0FA 2K9FA 3TJJA 4MF5A 3UARA 1WP0A 2JZSA 3IA1A 1ZOFA 4DSSB 1TW9A 1ZCPA 3QAVA 4Z2RA 1AC1A 2PERA 3DMLA 2GDRA 4RQXA 4IBPA 3D21A 1V58A 4KH7A 2FNOA 3A2VA 2VKZG 4LL4B 1X9WB 2MYGA 3FY7A 1A2MA 4CHSA 2A2PA 3LEFA 4JRRA 1B8XA 4ECBA 3BCKA 4L5LA 2O36A 3G7JA 3GX8A 3GKXA 4F82A 1GLQA 1IYHA 2X49A 3ZIJA 5KOXA 3HHVA 4O92A 2I3YA 4YQMA 3FR3A 1F37A 3KGKA 1EGRA 2FCHA 1HD2A 3DKSA 1OC9B 2AYTA 1SYRA 1O8WA 5G1KA 2FY6A 3IV4A 2DKHA 2L4QA 3P8WA 4ECIA 1X5EA 5AGYA 1PRXA 2X99A 3MIXA 1N8JA 4G10A 3L0HA 4RQRA 3A2WA 1SJIA 4IJIA 3UVTA 3KXOA 2PU9C 3VWWA 4KF9A 2ON7A 2B1KA 4ICYA 4TR3A 1PL1A 1T3BA 2DC5A 5DJLA 2VCQA 2OKAA 4PQHA 4ZL7A 1OKDA 1PN9A 3WGDA 4G01A 2EFHA 1QFNA 4IQAA 2OACA 1EEJA 2F51A 1ON4A 4ML1A 2WZSA 3TJGA 2JADA 2CQ9A 2JZTA 2ZCTA 4KCAA 4O7HA 5FHIA 2KOKA 5ID2A 3UMAA 2EFEA 4IHUA 5F0GA 1AQVA 2WW0A 4PXOA 5IOWA 4KGIA 2PVOC 4ZILA 4JU5A 1OVNA 3GUSA 4KDUA 3RPNA 3QCPA 3UJ1A 4IVFA 2DJ2A 3APQA 2R6KA 4MPFA 1GSFA 2WVYA 4DSQA 1I1IP 2K8VA 2R0GA 5CRHA 5E59A 2OE1A 3RAZA 3DVWA 3C73A 2X8CA 4O5UA 4HJMA 5CNWA 5DQYA 3ZREA 4FQUA 4CW9A 2WW3A 1EOHA 3IXRA 2V1MA 3FK8A 3TKRA 1QXHA 5CYYA 3F0IA 4IP1A 3DVXA 1X9SB 3GURA 4GCIA 4TXOB 2IWTA 2F9SA 2UZ8A 2QKEA 4FYUA 4I6XA 4BPYA 3CSHA 3ZFBA 2I4AA 3EU3A 1OAZA 1PSQA 1SJ6A 3LFLA 4OO5A 1YF0A 3CWGA 1JZRA 1PL2A 2V6KA 1T8EB 2YZUA 2HSYA 4BL7A 2H0HA 4L8EA 5J9CA 3A5WA 4JZQA 1R4WA 2B5EA 2WGRA 1FVJA 4V2LA 1YEPA 1K0BA 3D4MA 3KJYA 3I69A 2VAFA 4PQIA 2CX4A 2EFDA 3LXZA 4QL7A 1BAYA 2FUG2 3N9JA 4GXZA 2QSIA 4Q5FA 4ISDA 4RUVA 1VF2A 3ME7A 2R2JA 1TP9A 4GTUA 4GSSA 1BX9A 3J7Yb 5J5NA 2DIZA 2C4JA 1U6TA 4USSA 5A4UA 4W66A 1TJDA 4Z7XA 5DAKA 1Z5YE 5J4VA 3RGBC 4K0GA 4Z2UA 5IM9A 1M3IA 4NV2A 4PX1A 3DXBA 4EIQA 5KN0A 1YZXA 2CA8A 3L4NA 2MMNA 4KSMA 3WGXA 2V6OA 3KIJA 3GH9A 2VLVA 4EDYA 4MZBA 1X5CA 2WVZA 3HJOA 4OWYA 3SWLA 2ZNMA 2EFCA 3EPTA 3EYTA 2WVXA 5GSTA 3IDVA 1GTBA 5CAXA 2N5FA 5FT3A 3Q6OA 1X9MB 3H93A 4XIHA 5EY6A 2R0PA 3LYPA 4AKGA 4YQUA 1HNCA 9GSSA 5HR1A 1J9BA 5J47A 3QFAC 3TKSA 5EL8A 3LYKA 4XS4A 1BYEA 5INYA 2GVPA 4Q5QA 4L0WA 4AI6A 5IMZA 1K0AA 3F4TA 2FWGA 5J4YA 3QPMA 2B7JA 1XWKA 5IMCA 5G31A 3WT2A 5BMUA 3DIEA 1MEKA 1K3OA 2XBQA 3J7Yk 2PUKC 4OFNA 5ABRA 1A2JA 1R7HA 2QGVA 1Z7PA 5HFIA 1WOUA 2KP1A 1M7TA 1PGTA 2LTKA 2A4VA 4MF6A 4ZIJA 1YDKA 3UAPA 3I9V2 3UBKA 2HRNA 1LBKA 1SVMA 4HS1A 3HZ8A 3HD5A 3F4SA 3APOA 3HKRA 2GQLA 2IFQB 1GUKA 3EC3A 4WEYA 2NDOA 1F6MC 4JEDA 2WS2A 1O7UA 3QR6A 3TDGA 4WR4A 1TDIA 3UVHA 1WMJA 1FVKA 4Q5RA 2H76A 4HDEA 3LSZA 4YKGA 4MA9A 1TU7A 1QGVA 1SENA 2X64A 3VLNA 1Y6EA 3GKKA 1GSEA 2HRKA 2AV4A 1XOAA 3TRQA 4BIKA 3IRAA 1ZYEA 2H6ZA 3KMNA 5IMAA 3W6GA 3TU3B 4QMKA 3RHBA 1AXDA 2F8FA 1Z9HA 1G7EA 3P90A 2K18A 2O85A 2A4HA 4BVYB 2H1BA 1FOHA 3APSA 4G0LA 4XHMA 3N5OA 2DJ1A 3HJMA 2LEGA 4EF0A 4XRAA 5DALB 1XPVA 4MCUA 3H1NA 4ZB8A 1M9BA 2D2ZA 1VF4A 4X43A 2XPDA 3H8QA 4ECJA 3E3EA 4O32A 1H4OA 2I9HA 3JCML 5G5FA 4I2UA 1PKWA 1R5AA 2C1YA 4XRDA 2DMMA 2DIYA 2H1AA 2VCTA 4TR1A 4HQSA 1TXUA 3ED3A 2PVQA 3KP9A 1F2EA 1H75A 4G19A 3TGZA 1DE1A 1XG8A 3BOAA 3HXSA 1TXXA 2CV4A 2H6YA 3LGCA 3P7XA 2L59A 1KTEA 5DBQA 5ENUA 1XXUA 2GT6A 1BG1A 4POKA 3GL5A 4KX4A 4TOPA 4KDYA 1OC9A 1WWJA 1LU4A 2HE3A 2VCXA 1T4YA 3IC8A 2F8AA 3FHKA 4MMMA 1BG5A 3NOFA 2MMOA 4OMVA 1GSUA 2YP6A 1T1VA 1GUHA 3LXTA 5LCZA 3VWXA 2JSZA 1A23A 3L9UA 4WXTA 2AJQB 4GDFA 2O87A 4OD7A 4ZL8A 1GL8A 3F3RA 4LMVA 2J23A 2X8HA 4O5QA 5B6NA 4GSNA 4PI0C 2C0EA 2FWEA 2CAQA 3IHQA 3IBHA 3G9BA 2LNSA 1HNBA 4L5OA 3IAS2 2NTOA 2MMAA 4YAPA 3KP8A 1ST9A 3M1GA 16GSA 1S3DA 3MNGA 2HT9A 2H70A 2RLIA 4X4JA 3M9JA 4F03A 1YKAA 3VPTA 1FAAA 2YNXA 3U6VA 4F9ZA 1B4PA 4TR0A 4JBBA 1RW1A 2GTUA 4FYCA 4N10A 2HLSA 1MDKA 4WF5A 1XW9A 3KMOA 4CY6A 3FZAA 4ZBAA 2CVBA 5D9XA 6GSUA 2DJKA 3IOSA 3QMXA 3LW9A 3EWLA 2GQMA 4HQZA 2YN1A 2HRAA 1PKZA 1V9WA 3ZMKA 1G6YA 3KH9A 2O5VA 2H6XA 1NHYA 2REMA 1E6BA 2B7KA 2ALBA 18GSA 1CQGA 4WBRD 4G0IA 5F06A 2YWMA 1VF3A 2VIMA 3VI7A 4TR1B 4NXIA 3IE3A 5JCUA 4KUNA 4GF0A 3HY2A 10GSA 4EL1A 3ZL5A 4TXOA 4BVXB 2IMFA 5JWRB 1GSDA 3VWUA 1VF1A 4ACSA 2L57A 3SBCA 3TCOA 4MF7A 3GKNA 1BEDA 1FOVA 5JCGA 4I97A 6GSVA 1TK5B 3HMJG 3WD6A 2VLUA 2K6VA 1KBNA 3MWHA 4IW9A 1JLVA 4MPGA 1OKTA 5FWGA 3E0UA 1M9AA 2WW2A 4JR4A 3A2XA 1NHOA 5IMVA 3CSIA 2PWJA 2B3SA 1ILOA 1Z3EA 4AGSA 2YJ7A 2R0CA 4V2NA 1TK8B 2HXKA 3U5RE 2VO4A 2H30A 12GSA 4ZB9A 4IS0A 1K0MA 4EVMA 1GULA 4ZXGA 2GGTA 4IN0A 4ZB7A 4YH2A 3ME8A 3PR8A 3QFBC 4ZB6A 1PX6A 4KA0A 2WRTA 5A5HB 3W8SA 4PURA 5J9BA 3GHAA 1EP8A 2WJUA 5A4WA 2HYXA 3BD2A 1OE8A 3EE2A 1PQNA 4FH8A 3Q18A 1BJXA 4HI7A 1XBSA 2WFCA 1V98A 1A8LA 1HNAA 2WZ9A 4KB3A 1B48A 2FA4A 2HRFA 1GUMA 2R4VA 4WR5A 5IMDA 4XTSA 1TRWA 1TTZA 2GZYA 1SKWB 2LUSA 4AJ8A 2HSNB 2CX3A 2V2GA 2GLRA 2DJ3A 5B8AA 3VURA 4CDOA 2H66A 3MSZA 4HZ2A 4KSOA 2VCZA 1Z6MA 2IMEA 3C71A 1WRYA 5ECHB 5G30A 2A2SA 4O5RA 2YV7A 2IL3A 5D73A 2NVLA 2R37A 2L6CA 5ECNB 1THXA 1G6WA 3P2AA 1QMVA 3ZITA 4RI6A 5KEJA 4N0VA 4NWYA 5GSSA 20GSA 3L78A 5AN1A 5D96A 4EE0A 4GSTA 1MDJA 4F2IA 1ZL9A 2QA1A 4G2EA 2C0DA 3H4KA 4POMA 2HFDA 5B8BA 4EC0A 5DJMA 1R5PA 2HZEB 4TRXA 1XWGA 1GSQA 4BWQA 2IPAA 3E9JB 4GWRA 2FD3A 2DKIA 2WULA 3GFKA 5J41A 2YV9A 1FW1A 4EKZA 2OBIA 1A0RP 5B7CA 3TB2A 4PNGA 3TJFA 1GTIA 3R3EA 1EWXA 1F3BA 2GZZA 2VL2A 1U3IA 2WCIA 4N30A 2UV8G 2LS5A 4OCEA 4D73B 1SKSB 3FKFA 4LL1B 1ZGNA 1SD8A 2M72A 5GZZB 2IFQA 3M0FA 1QK8A 2H1GA 3GA4A 2GZPA 2B5XA 1M2BA 2VUPA 1Q4JA 1K0CA 1GH2A 2CT6A 1WIKA 4MJEA 1RK4A 2VM2A 5EPFA 1XVWA 4KCEA 5ECRB 2YANA 5D9VA 2H01A 2LJKA 1KNGA 4OFMA 3FW2A 5IO0A 1SU9A 3IC4A 2YWNA 2FGXA 4EIPA 3TKSC 1U87A 3R2QA 1VRSD 1Y25A 2HI7A 1QQ2A 3DRNA 2L4CA 4KE3A 2BTOT 1WPIA 4BVYA 3IK7A 3GX0A 2XBIA 1S3RA 1GWCA 2OT3A 1YVLA 2XHFA 5DALA 4FO5A 5A1NA 3QAGA 1MTCA 4EO3A 2AB6A 2L5LA 5ELAA 4LMWA 1UA5A 5ECPB 5AIVA 2O89A 3IAM2 2VD1A 4HZ4A 8GSSA 2QA2A 3GRXA 3HDCA 4POLA 4EUYA 3G7YA 1XW5A 3S9FA 2KP2A 1NSWA 2LJAA 2PPTA 3DD3A 1WE0A 5E4WA 1FHEA 2RIIA 4RI7A 3GL3A 2H1DA 3TJKA 2E2GA 2X4AA 4PNFA 1YJ6A 1PD21 1ERTA 5LNKe 2H75A 2IMKA 2B1LA 3ZVJD 1SJZA 5GAPD 3QD9A 3IK9A 1JLWA 1ZZYA 1XWBA 1O6JA 4HUAA 2HSHA 4OCFA 2LQOA 5KN3A 3ERFA 5KOWA 2L6DA 1TOFA 4MH3A 1M0UA 2FA8A 1F3AA 2FWFA 2LNTA 3C8EA 4PUAA 2VM1A 5ECQB 3GSTA 1W4VA 3CRTA 1T4ZA 4GQCA 5D8IA 3ZVJA 1EV9A 1G0TA 2VL3A 5H5QA 3TRXA 14GSA 4I8BA 3F4RA 3LORA 1SKRB 1PX7A 1UVZA 4XS1A 3RPPA 1DSBA 5G1LA 4XS6A 5ECIB 3EMPA 4K7IA 1GNEA 4K2DA 1K3YA 3C1SA 4N0ZA 4AJ7A 13GSA 5AISA 1G7OA 5A1NB 2BJXA 2AAWA 1O85A 1ZYPA 1YKCA 2B6MA 5IO2A 2YCDA 3BBYA 5A34B 2G0FA 4J57E 5D9WA 4F0BA 2P0GA 4A5PA 4V1Ag 3GMFA 3PGTA 4GRFA 4K5SA 1MDIA 3F6DA 3TOTA 1PMTA 3F6FA 5F8BA 19GSA 5CREA 4KW6A 3L9VA 1XW6A 1TRUA 3A5IA 4BVXA 3BJ5A 4H86A 2YOIA 4V1Ap 2IN3A 2LKUA 4ILFA 4IGJA 2G2QA 1IYIA 5L71A 3ZFLA 3GSSA 5H5SA 2TRCP 1OE7A 3ZZXA 1GSSA 3F63A 3GV1A 1EEMA 4YQVA 1ZYQB 5JWOB 2K8SA 4NMUA 1CQHA 4V2MA 4AKHA 2F3MA 2VCVA 3GN3A 1AUCA 2OBKA 1EGOA 2B5YA 3CHXC 1TK0B 2ES7A 3W8JA 4WF4A 1NW2A 3CSJA 3HA9A 3HZ4A 2WB9A 4MABA 4P3YB 3MDKA 1THOA 4IELA 3F8UA 3PPUA 5D9TA 1I9DA 1SL2B 17GSA 3FYGA 2V41A 1OYJA 1GTUA 3PINA 1C72A 1ML6A 5JWQB 2H0IA 1AQWA 4I2TA 4KNDA 2VLTA 5A5HA 2YWOA 1SVLA 5BRTA 1BF5A 4PUFC 2CAIA 2E2MA 3CBUA 1M2DA 4AF2A 2C0GA 5D93A 4QL9A 1NM3A 2CZ2A 2OE0A 1E2YA 4ZL9A 2GT5A 3TUEA 3K8NA 6GSSA 3LQ7A 5CRDA 2LSTA 2YZHA 3F3QA 2VD0A 5HR3A 2LRNA 5IPGA 2LJRA 2FLSA 4MZWA 2BMXA 3OR5A 2HSNA 4PGTA 3TKSE 4E8HA 4KAEA 5DQSA 5LD0A 5B6MA 3KEBA 1FB0A 3BCIA 2GSSA 2IIYA 3ISOA 2YJHA 1K0OA 3Q19A 5EVOA 5IPHA 4NHWA 4JE1A 4WBJA 2LV3A 3C7MA 1V2AA 5F05A 2CVDA 1T7PB 4PHZC 1USBA 4XCSA 4MJBA 4G9HA 1DUGA 1JHBA 2EC4A 3GTUB 2LRCA 1A2LA 1TKDB 3CQFA 4FXYP 1TI1A 3DGQA 1MD4A
chains in the Genus database with same CATH topology
4N11A 4I5QA 1PN0A 1S3AA 2I1UA 4OO4A 4PTSA 3CYNA 1SK0A 3VPQA 4J2FA 3KTLA 6GSWA 2HZEA 3EVIA 2AHEA 3IR4A 1HQOA 3ERWA 2H72A 2ON5A 3EURA 2P5RA 3LG6A 2EIRA 3D22A 3GH6A 3VFIA 3CTGA 3HYPA 3GYKA 3ZRDA 4K7OA 3NIVA 2TIRA 1QUWA 3TKQA 4D73A 4DSRA 2IMIA 3KD0A 3IHGA 5F07A 4IP6A 3KM6A 2I81A 3TKPA 4HU9A 2RM5A 4ECCA 3KZQA 2PBJA 1EV4A 4HEA2 4BA7A 3ERGA 4LLRA 4K5RA 2PGTA 1Z7RA 4L0UA 4AKIA 2AUVA 4CY8A 1SK2A 2XPEA 2LQQA 5IOXA 3HVVA 3QDNA 2DJJA 1FG4A 3HJPA 1ABAA 1M99A 2GSRA 2H1LA 2GS3A 2PMTA 1K3LA 3VWVA 5HFGA 1OC8A 1XZOA 4E8EA 1K0NA 5C00A 3WT1A 1N25A 1Y1UA 2J9HA 2EIOA 3DEXA 2EIQA 2MBTA 3WGEA 1ZYNA 2NBSA 2DSAA 1GSYA 3UBLA 3LJRA 1LJRA 2E7PA 3HVXA 3CMIA 1O81A 1TU8A 2VCWA 5DDLA 4YKFA 1EZKA 1ZMAA 4K1FA 3C1RA 3EINA 2YPMA 4IQ1A 4K0NA 4TKYA 4TVEA 3US3A 3UL3A 4PQ1A 2M46A 2P31A 5IQYA 1SL1B 4J56E 5H5RA 4MDCA 2OJLA 1O73A 2VL2C 5CRWA 5DCGA 5G5EA 4WETA 1T00A 3RBTA 2MMZA 3KH7A 4NV5A 5ECMB 3FR6A 3GKMA 1JZWA 2VL9A 4K9ZA 2N5AA 3CXGA 4E68A 4MP4A 1Q98A 3O6TA 2R5GA 2OADA 3M3MA 2C3QA 4MK3A 3RDWA 2C3NA 4TN8A 2R3XA 1YEXA 1RQMA 3I6AA 5HR0A 1URMA 3EMXA 4TXVA 2JL4A 5HR2A 5CRGA 3VI5A 5ID2B 1JZDA 3I43A 2XC2A 3L9SA 2A2RA 2IMDA 3F9UA 4NHZA 1AIUA 1A24A 1ERUA 2O7KA 2YWIA 2HSMA 1X5DA 4G0KA 2H0GA 1R26A 4TW5A 3D4TA 5HFKA 5JCWA 1XWCA 4MNNA 2H73A 1I5GA 1YQ1A 5C04A 4Z2TA 4NAXA 1ACVA 1XIYA 2FWHA 2OE3A 4KDXA 2MBSA 1ERVA 4OFTA 5A5KA 1XWAA 4DVCA 4BWSA 2FHEA 3IPZA 1B9XC 1KEBA 5ECSA 2VOCA 1TRVA 2DJ0A 3GNJA 5A34A 1X0RA 1J08A 4MJAA 4IJ3A 4MH2A 3O76A 3QOUA 1SL0B 1GTAA 1U3AA 3ZLPA 4BL7B 4JR6A 1GNWA 5ECLB 6GSXA 2CVKA 1SD9A 2KUCA 3Q74A 3HCZA 4DEJA 4HJ2A 5DVBA 1AW9A 3ZMLA 3V1WA 1S3CA 4ID0A 2TRXA 4YAVA 1SK1A 3WYWA 4ML6A 3KTBA 4N3ZA 1YY7A 3DYRA 1XVQA 5ECOB 1AQXA 1EOGA 2C0FA 3HVSA 2GSTA 3FRCA 3FMWA 2C8UA 3EU4A 5COHA 1WJKA 2X8GA 1B9YC 4F0CA 4ZBBA 3TRPA 1TI3A 5DAKB 1V40A 3G7IA 5IMFA 2OA7A 3NZNA 1A0FA 4LA1A 2DMLA 2PN8A 2Z9SA 1BQ7A 1MD3A 3TJBA 2HSMB 1HYUA 4EXJA 4K7NA 1YF1A 1SYXA 3PH9A 3CRUA 22GSA 3FZ5A 1OC3A 1UC7A 2RUFA 5HQPA 3M8NA 1VGLA 1EP7A 2E0QA 2IJYA 4K2XA 1N2AA 4POBA 3D5JA 2NPBA 1Z6NA 1GP1A 2CZ3A 1F9MA 2H19A 5DCHA 3KCMA 4MZCA 4XS4B 5KN2A 1TRSA 5KN1A 1FO5A 4WKWA 1XCCA 4FYBA 4K8MA 1K0DA 4QQ7A 5A4VA 2P5QA 4DSSA 3FZ9A 2KHPA 2QC7A 4GLTA 4X1UA 1M2AA 5BMUB 5CP1A 3A3TA 2C3TA 1B4QA 1U88A 5AIXA 3FR9A 3D0ZA 7GSSA 1JZOA 4AKXB 4MLYA 2C80A 3DWVA 5ECKB 11GSA 2LRTA 4EDZA 6GSYA 1UN2A 1W89A 1XOBA 3MYDA 2L5OA 4HOJA 1A8YA 2RM6A 2O8VB 3GTUA 2GQKA 3VK9A 5J40A 1DE2A 5G2ZA 2H71A 2HQTA 3MAKA 1FB6A 4NPBA 2M80A 4X0XA 2V32A 4ZBDA 2JU5A 4ULXA 2HNLA 3QAWA 5ELGA 1ERWA 2KLXA 3FEUA 2JZRA 5J4UA 2ZUPA 1DBYA 2MZCA 2DLXA 3M9KA 1V57A 3UOMA 1GLPA 2RUEA 3ZIVA 2HZFA 1XFLA 5IIZA 4FIWA 1O8XA 1AAZA 2N5BA 2DBCA 3ZTLA 3O3TA 1JFUA 2JSYA 3RHCA 3ZYWA 4HU7A 2H8LA 1SVOA 1PA3A 3CTFA 4TR4A 2HRKB 1GRXA 3AY8A 6GSTA 4MJCA 3FZ4A 4AJ6A 3GIXA 3TOUA 5GAND 4Q5NA 3H79A 3LWAA 3UEMA 3UIWA 2WDUA 5CO3A 4IKHA 2JACA 2H74A 3D6IA 5J3RA 4K6XA 4GQFA 2GSQA 1J0FA 2K9FA 3TJJA 4MF5A 3UARA 1WP0A 2JZSA 3IA1A 1ZOFA 4DSSB 1TW9A 1ZCPA 3QAVA 4Z2RA 1AC1A 2PERA 3DMLA 2GDRA 4RQXA 4IBPA 3D21A 1V58A 4KH7A 2FNOA 3A2VA 2VKZG 4LL4B 1X9WB 2MYGA 3FY7A 1A2MA 4CHSA 2A2PA 3LEFA 4JRRA 1B8XA 4ECBA 3BCKA 4L5LA 3G7JA 3GX8A 3GKXA 4F82A 1GLQA 1IYHA 2X49A 3ZIJA 5KOXA 3HHVA 4O92A 2I3YA 4YQMA 3FR3A 1F37A 3KGKA 1EGRA 2FCHA 1HD2A 3DKSA 1OC9B 2AYTA 1SYRA 1O8WA 5G1KA 2FY6A 3IV4A 2DKHA 2L4QA 3P8WA 4ECIA 1X5EA 5AGYA 1PRXA 2X99A 3MIXA 1N8JA 4G10A 3L0HA 4RQRA 3A2WA 1SJIA 4IJIA 3UVTA 3KXOA 2PU9C 3VWWA 4KF9A 2ON7A 2B1KA 4ICYA 4TR3A 1PL1A 1T3BA 2DC5A 5DJLA 2VCQA 2OKAA 4PQHA 4ZL7A 1OKDA 1PN9A 3WGDA 4G01A 2EFHA 1QFNA 4IQAA 2OACA 1EEJA 2F51A 1ON4A 4ML1A 3TJGA 2JADA 2CQ9A 2JZTA 2ZCTA 4KCAA 4O7HA 5FHIA 2KOKA 5ID2A 3UMAA 2EFEA 4IHUA 5F0GA 1AQVA 4PXOA 5IOWA 4KGIA 2PVOC 4ZILA 4JU5A 1OVNA 3GUSA 4KDUA 3RPNA 3QCPA 3UJ1A 4IVFA 2DJ2A 3APQA 2R6KA 4MPFA 1GSFA 4DSQA 2K8VA 2R0GA 5CRHA 5E59A 2OE1A 3RAZA 3DVWA 3C73A 2X8CA 4O5UA 4HJMA 5CNWA 5DQYA 3ZREA 4FQUA 4CW9A 1EOHA 3IXRA 2V1MA 3FK8A 3TKRA 1QXHA 5CYYA 3F0IA 4IP1A 3DVXA 1X9SB 3GURA 4GCIA 4TXOB 2IWTA 2F9SA 2UZ8A 2QKEA 4FYUA 4I6XA 4BPYA 3CSHA 3ZFBA 2I4AA 3EU3A 1OAZA 1PSQA 1SJ6A 3LFLA 4OO5A 1YF0A 3CWGA 1JZRA 1PL2A 2V6KA 1T8EB 2YZUA 2HSYA 4BL7A 2H0HA 4L8EA 5J9CA 3A5WA 4JZQA 1R4WA 2B5EA 2WGRA 1FVJA 4V2LA 1YEPA 1K0BA 3D4MA 3KJYA 3I69A 2VAFA 4PQIA 2CX4A 2EFDA 3LXZA 4QL7A 1BAYA 2FUG2 3N9JA 4GXZA 2QSIA 4Q5FA 4ISDA 4RUVA 1VF2A 3ME7A 2R2JA 1TP9A 4GTUA 4GSSA 1BX9A 3J7Yb 5J5NA 2DIZA 2C4JA 1U6TA 4USSA 5A4UA 4W66A 1TJDA 4Z7XA 5DAKA 1Z5YE 5J4VA 4K0GA 4Z2UA 5IM9A 4NV2A 4PX1A 3DXBA 4EIQA 5KN0A 1YZXA 2CA8A 3L4NA 2MMNA 4KSMA 3WGXA 2V6OA 3KIJA 3GH9A 2VLVA 4EDYA 4MZBA 1X5CA 3HJOA 4OWYA 3SWLA 2ZNMA 2EFCA 3EPTA 3EYTA 5GSTA 3IDVA 1GTBA 5CAXA 2N5FA 5FT3A 3Q6OA 1X9MB 3H93A 4XIHA 5EY6A 2R0PA 3LYPA 4AKGA 4YQUA 1HNCA 9GSSA 5HR1A 1J9BA 5J47A 3QFAC 3TKSA 5EL8A 3LYKA 4XS4A 1BYEA 5INYA 2GVPA 4Q5QA 4L0WA 4AI6A 5IMZA 1K0AA 3F4TA 2FWGA 5J4YA 3QPMA 2B7JA 1XWKA 5IMCA 5G31A 3WT2A 5BMUA 3DIEA 1MEKA 1K3OA 2XBQA 3J7Yk 2PUKC 4OFNA 5ABRA 1A2JA 1R7HA 2QGVA 1Z7PA 5HFIA 1WOUA 2KP1A 1M7TA 1PGTA 2LTKA 2A4VA 4MF6A 4ZIJA 1YDKA 3UAPA 3I9V2 3UBKA 2HRNA 1LBKA 1SVMA 4HS1A 3HZ8A 3HD5A 3F4SA 3APOA 3HKRA 2GQLA 2IFQB 1GUKA 3EC3A 4WEYA 2NDOA 1F6MC 4JEDA 2WS2A 1O7UA 3QR6A 3TDGA 4WR4A 1TDIA 3UVHA 1WMJA 1FVKA 4Q5RA 2H76A 4HDEA 3LSZA 4YKGA 4MA9A 1TU7A 1QGVA 1SENA 2X64A 3VLNA 1Y6EA 3GKKA 1GSEA 2HRKA 2AV4A 1XOAA 3TRQA 3IRAA 1ZYEA 2H6ZA 3KMNA 5IMAA 3W6GA 3TU3B 4QMKA 3RHBA 1AXDA 2F8FA 1Z9HA 1G7EA 3P90A 2K18A 2O85A 2A4HA 4BVYB 2H1BA 1FOHA 3APSA 4G0LA 4XHMA 3N5OA 2DJ1A 3HJMA 2LEGA 4EF0A 4XRAA 5DALB 1XPVA 4MCUA 3H1NA 4ZB8A 1M9BA 2D2ZA 1VF4A 4X43A 2XPDA 3H8QA 4ECJA 3E3EA 4O32A 1H4OA 2I9HA 3JCML 5G5FA 4I2UA 1PKWA 1R5AA 2C1YA 4XRDA 2DMMA 2DIYA 2H1AA 2VCTA 4TR1A 4HQSA 1TXUA 3ED3A 2PVQA 3KP9A 1F2EA 1H75A 4G19A 3TGZA 1DE1A 3BOAA 3HXSA 1TXXA 2CV4A 2H6YA 3LGCA 3P7XA 2L59A 1KTEA 5DBQA 5ENUA 1XXUA 2GT6A 1BG1A 4POKA 3GL5A 4KX4A 4TOPA 4KDYA 1OC9A 1WWJA 1LU4A 2HE3A 2VCXA 1T4YA 3IC8A 2F8AA 3FHKA 4MMMA 1BG5A 3NOFA 2MMOA 4OMVA 1GSUA 2YP6A 1T1VA 1GUHA 3LXTA 5LCZA 3VWXA 2JSZA 1A23A 3L9UA 4WXTA 2AJQB 4GDFA 2O87A 4OD7A 4ZL8A 1GL8A 3F3RA 4LMVA 2J23A 2X8HA 4O5QA 5B6NA 4GSNA 2C0EA 2FWEA 2CAQA 3IHQA 3IBHA 3G9BA 2LNSA 1HNBA 4L5OA 3IAS2 2NTOA 2MMAA 4YAPA 3KP8A 1ST9A 3M1GA 16GSA 1S3DA 3MNGA 2HT9A 2H70A 2RLIA 4X4JA 3M9JA 4F03A 1YKAA 3VPTA 1FAAA 2YNXA 3U6VA 4F9ZA 1B4PA 4TR0A 4JBBA 1RW1A 2GTUA 4FYCA 4N10A 2HLSA 1MDKA 4WF5A 1XW9A 3KMOA 4CY6A 3FZAA 4ZBAA 2CVBA 5D9XA 6GSUA 2DJKA 3IOSA 3QMXA 3LW9A 3EWLA 2GQMA 4HQZA 2YN1A 2HRAA 1PKZA 1V9WA 3ZMKA 1G6YA 3KH9A 2O5VA 2H6XA 1NHYA 2REMA 1E6BA 2B7KA 2ALBA 18GSA 1CQGA 4WBRD 4G0IA 5F06A 2YWMA 1VF3A 2VIMA 3VI7A 4TR1B 4NXIA 3IE3A 5JCUA 4KUNA 4GF0A 3HY2A 10GSA 4EL1A 3ZL5A 4TXOA 4BVXB 2IMFA 5JWRB 1GSDA 3VWUA 1VF1A 4ACSA 2L57A 3SBCA 3TCOA 4MF7A 3GKNA 1BEDA 1FOVA 5JCGA 4I97A 6GSVA 1TK5B 3HMJG 3WD6A 2VLUA 2K6VA 1KBNA 3MWHA 4IW9A 1JLVA 4MPGA 1OKTA 5FWGA 3E0UA 1M9AA 4JR4A 3A2XA 1NHOA 5IMVA 3CSIA 2PWJA 2B3SA 1ILOA 1Z3EA 4AGSA 2YJ7A 2R0CA 4V2NA 1TK8B 2HXKA 3U5RE 2VO4A 2H30A 12GSA 4ZB9A 4IS0A 1K0MA 4EVMA 1GULA 4ZXGA 2GGTA 4IN0A 4ZB7A 4YH2A 3ME8A 3PR8A 3QFBC 4ZB6A 1PX6A 4KA0A 2WRTA 5A5HB 3W8SA 4PURA 5J9BA 3GHAA 1EP8A 2WJUA 5A4WA 2HYXA 3BD2A 1OE8A 3EE2A 1PQNA 4FH8A 3Q18A 1BJXA 4HI7A 1XBSA 2WFCA 1V98A 1A8LA 1HNAA 2WZ9A 4KB3A 1B48A 2FA4A 2HRFA 1GUMA 2R4VA 4WR5A 5IMDA 4XTSA 1TRWA 1TTZA 2GZYA 1SKWB 2LUSA 4AJ8A 2HSNB 2CX3A 2V2GA 2GLRA 2DJ3A 5B8AA 3VURA 4CDOA 2H66A 3MSZA 4HZ2A 4KSOA 2VCZA 1Z6MA 2IMEA 3C71A 1WRYA 5ECHB 5G30A 2A2SA 4O5RA 2YV7A 2IL3A 5D73A 2NVLA 2R37A 2L6CA 5ECNB 1THXA 1G6WA 3P2AA 1QMVA 3ZITA 4RI6A 5KEJA 4N0VA 4NWYA 5GSSA 20GSA 3L78A 5AN1A 5D96A 4EE0A 4GSTA 1MDJA 4F2IA 1ZL9A 2QA1A 4G2EA 2C0DA 3H4KA 4POMA 2HFDA 5B8BA 4EC0A 5DJMA 1R5PA 2HZEB 4TRXA 1XWGA 1GSQA 4BWQA 2IPAA 3E9JB 4GWRA 2FD3A 2DKIA 2WULA 3GFKA 5J41A 2YV9A 1FW1A 4EKZA 2OBIA 1A0RP 5B7CA 3TB2A 4PNGA 3TJFA 1GTIA 3R3EA 1EWXA 1F3BA 2GZZA 2VL2A 1U3IA 2WCIA 4N30A 2UV8G 2LS5A 4OCEA 4D73B 1SKSB 3FKFA 4LL1B 1ZGNA 1SD8A 2M72A 5GZZB 2IFQA 3M0FA 1QK8A 2H1GA 3GA4A 2GZPA 2B5XA 1M2BA 2VUPA 1Q4JA 1K0CA 1GH2A 2CT6A 1WIKA 4MJEA 1RK4A 2VM2A 5EPFA 1XVWA 4KCEA 5ECRB 2YANA 5D9VA 2H01A 2LJKA 1KNGA 4OFMA 3FW2A 5IO0A 1SU9A 3IC4A 2YWNA 2FGXA 4EIPA 3TKSC 1U87A 3R2QA 1VRSD 1Y25A 2HI7A 1QQ2A 3DRNA 2L4CA 4KE3A 2BTOT 1WPIA 4BVYA 3IK7A 3GX0A 2XBIA 1GWCA 2OT3A 1YVLA 2XHFA 5DALA 4FO5A 5A1NA 3QAGA 1MTCA 4EO3A 2AB6A 2L5LA 5ELAA 4LMWA 1UA5A 5ECPB 5AIVA 2O89A 3IAM2 2VD1A 4HZ4A 8GSSA 2QA2A 3GRXA 3HDCA 4POLA 4EUYA 3G7YA 1XW5A 3S9FA 2KP2A 1NSWA 2LJAA 2PPTA 3DD3A 1WE0A 5E4WA 1FHEA 2RIIA 4RI7A 3GL3A 2H1DA 3TJKA 2E2GA 2X4AA 4PNFA 1YJ6A 1PD21 1ERTA 5LNKe 2H75A 2IMKA 2B1LA 3ZVJD 1SJZA 5GAPD 3QD9A 3IK9A 1JLWA 1ZZYA 1XWBA 1O6JA 4HUAA 2HSHA 4OCFA 2LQOA 5KN3A 3ERFA 5KOWA 2L6DA 1TOFA 4MH3A 1M0UA 2FA8A 1F3AA 2FWFA 2LNTA 3C8EA 4PUAA 2VM1A 5ECQB 3GSTA 1W4VA 3CRTA 1T4ZA 4GQCA 5D8IA 3ZVJA 1EV9A 1G0TA 2VL3A 5H5QA 3TRXA 14GSA 4I8BA 3F4RA 3LORA 1SKRB 1PX7A 1UVZA 4XS1A 3RPPA 1DSBA 5G1LA 4XS6A 5ECIB 3EMPA 4K7IA 1GNEA 4K2DA 1K3YA 3C1SA 4N0ZA 4AJ7A 13GSA 5AISA 1G7OA 5A1NB 2BJXA 2AAWA 1O85A 1ZYPA 1YKCA 2B6MA 5IO2A 2YCDA 3BBYA 5A34B 2G0FA 4J57E 5D9WA 4F0BA 2P0GA 4A5PA 4V1Ag 3GMFA 3PGTA 4GRFA 4K5SA 1MDIA 3F6DA 3TOTA 1PMTA 3F6FA 5F8BA 19GSA 5CREA 4KW6A 3L9VA 1XW6A 1TRUA 3A5IA 4BVXA 3BJ5A 4H86A 2YOIA 4V1Ap 2IN3A 2LKUA 4ILFA 4IGJA 2G2QA 1IYIA 5L71A 3ZFLA 3GSSA 5H5SA 2TRCP 1OE7A 3ZZXA 1GSSA 3F63A 3GV1A 1EEMA 4YQVA 1ZYQB 5JWOB 2K8SA 4NMUA 1CQHA 4V2MA 4AKHA 2F3MA 2VCVA 3GN3A 1AUCA 2OBKA 1EGOA 2B5YA 1TK0B 2ES7A 3W8JA 4WF4A 1NW2A 3CSJA 3HA9A 3HZ4A 2WB9A 4MABA 4P3YB 3MDKA 1THOA 4IELA 3F8UA 3PPUA 5D9TA 1I9DA 1SL2B 17GSA 3FYGA 2V41A 1OYJA 1GTUA 3PINA 1C72A 1ML6A 5JWQB 2H0IA 1AQWA 4I2TA 4KNDA 2VLTA 5A5HA 2YWOA 1SVLA 5BRTA 1BF5A 4PUFC 2CAIA 2E2MA 3CBUA 1M2DA 4AF2A 2C0GA 5D93A 4QL9A 1NM3A 2CZ2A 2OE0A 1E2YA 4ZL9A 2GT5A 3TUEA 3K8NA 6GSSA 3LQ7A 5CRDA 2LSTA 2YZHA 3F3QA 2VD0A 5HR3A 2LRNA 5IPGA 2LJRA 2FLSA 4MZWA 2BMXA 3OR5A 2HSNA 4PGTA 3TKSE 4E8HA 4KAEA 5DQSA 5LD0A 5B6MA 3KEBA 1FB0A 3BCIA 2GSSA 2IIYA 3ISOA 2YJHA 1K0OA 3Q19A 5EVOA 5IPHA 4NHWA 4JE1A 4WBJA 2LV3A 3C7MA 1V2AA 5F05A 2CVDA 1T7PB 1USBA 4XCSA 4MJBA 4G9HA 1DUGA 1JHBA 2EC4A 3GTUB 2LRCA 1A2LA 1TKDB 1TI1A 3DGQA 1MD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N11 A;  4I5Q A;  1S3A A;  4OO4 A;  2I1U A;  4PTS A;  3CYN A;  1SK0 A;  3VPQ A;  4J2F A;  3KTL A;  6GSW A;  2HZE A;  3EVI A;  2AHE A;  3IR4 A;  1HQO A;  3ERW A;  2H72 A;  2ON5 A;  3EUR A;  2P5R A;  3LG6 A;  2EIR A;  3D22 A;  3GH6 A;  3VFI A;  3CTG A;  3HYP A;  3GYK A;  3ZRD A;  4K7O A;  3NIV A;  2TIR A;  1QUW A;  3TKQ A;  4D73 A;  4DSR A;  2IMI A;  3KD0 A;  5F07 A;  4IP6 A;  3KM6 A;  2I81 A;  3TKP A;  4HU9 A;  2RM5 A;  4ECC A;  3KZQ A;  2PBJ A;  1EV4 A;  4HEA 2;  4BA7 A;  3ERG A;  4LLR A;  2PGT A;  1Z7R A;  4L0U A;  2AUV A;  1SK2 A;  2XPE A;  2LQQ A;  5IOX A;  3HVV A;  3QDN A;  2DJJ A;  1FG4 A;  3HJP A;  1ABA A;  1M99 A;  2GSR A;  2GS3 A;  2PMT A;  1K3L A;  3VWV A;  5HFG A;  1OC8 A;  1XZO A;  4E8E A;  1K0N A;  5C00 A;  3WT1 A;  2J9H A;  2EIO A;  3DEX A;  2EIQ A;  2MBT A;  3WGE A;  2NBS A;  2DSA A;  1GSY A;  3UBL A;  3LJR A;  1LJR A;  2E7P A;  3HVX A;  3CMI A;  1O81 A;  1TU8 A;  2VCW A;  5DDL A;  1EZK A;  1ZMA A;  4K1F A;  3C1R A;  3EIN A;  2YPM A;  4IQ1 A;  4K0N A;  4TKY A;  4TVE A;  3US3 A;  3UL3 A;  4PQ1 A;  2M46 A;  2P31 A;  5IQY A;  1SL1 B;  4J56 E;  5H5R A;  4MDC A;  2OJL A;  1O73 A;  2VL2 C;  5CRW A;  5DCG A;  5G5E A;  4WET A;  1T00 A;  3RBT A;  2MMZ A;  3KH7 A;  4NV5 A;  5ECM B;  3FR6 A;  3GKM A;  1JZW A;  2VL9 A;  4K9Z A;  2N5A A;  3CXG A;  4MP4 A;  1Q98 A;  3O6T A;  2R5G A;  2OAD A;  3M3M A;  2C3Q A;  4MK3 A;  3RDW A;  2C3N A;  4TN8 A;  2R3X A;  1YEX A;  1RQM A;  3I6A A;  5HR0 A;  1URM A;  3EMX A;  4TXV A;  2JL4 A;  5HR2 A;  5CRG A;  3VI5 A;  5ID2 B;  1JZD A;  3I43 A;  2XC2 A;  3L9S A;  2A2R A;  2IMD A;  3F9U A;  4NHZ A;  1AIU A;  1A24 A;  1ERU A;  2O7K A;  2YWI A;  2HSM A;  1X5D A;  4G0K A;  2H0G A;  1R26 A;  4TW5 A;  3D4T A;  5HFK A;  5JCW A;  1XWC A;  2H73 A;  1I5G A;  1YQ1 A;  5C04 A;  4NAX A;  1ACV A;  1XIY A;  2FWH A;  2OE3 A;  4KDX A;  2MBS A;  1ERV A;  4OFT A;  5A5K A;  1XWA A;  4DVC A;  4BWS A;  2FHE A;  3IPZ A;  1B9X C;  1KEB A;  5ECS A;  2VOC A;  1TRV A;  2DJ0 A;  3GNJ A;  1X0R A;  1J08 A;  4MJA A;  4IJ3 A;  4MH2 A;  3O76 A;  3QOU A;  1SL0 B;  1GTA A;  1U3A A;  3ZLP A;  4BL7 B;  4JR6 A;  1GNW A;  5ECL B;  6GSX A;  2CVK A;  1SD9 A;  2KUC A;  3Q74 A;  3HCZ A;  4DEJ A;  4HJ2 A;  5DVB A;  1AW9 A;  3ZML A;  3V1W A;  1S3C A;  4ID0 A;  2TRX A;  4YAV A;  1SK1 A;  3WYW A;  4ML6 A;  3KTB A;  1YY7 A;  3DYR A;  1XVQ A;  5ECO B;  1AQX A;  1EOG A;  2C0F A;  3HVS A;  2GST A;  3FRC A;  2C8U A;  3EU4 A;  5COH A;  1WJK A;  2X8G A;  1B9Y C;  4F0C A;  4ZBB A;  3TRP A;  1TI3 A;  5DAK B;  1V40 A;  3G7I A;  5IMF A;  2OA7 A;  3NZN A;  1A0F A;  4LA1 A;  2DML A;  2PN8 A;  2Z9S A;  1BQ7 A;  1MD3 A;  3TJB A;  2HSM B;  1HYU A;  4EXJ A;  4K7N A;  1YF1 A;  1SYX A;  3PH9 A;  3CRU A;  22GS A;  3FZ5 A;  1OC3 A;  1UC7 A;  2RUF A;  5HQP A;  3M8N A;  1VGL A;  1EP7 A;  2E0Q A;  2IJY A;  1N2A A;  4POB A;  3D5J A;  2NPB A;  1Z6N A;  1GP1 A;  2CZ3 A;  1F9M A;  2H19 A;  5DCH A;  3KCM A;  4MZC A;  4XS4 B;  5KN2 A;  1TRS A;  5KN1 A;  1FO5 A;  4WKW A;  1XCC A;  4FYB A;  4K8M A;  1K0D A;  4QQ7 A;  5A4V A;  2P5Q A;  4DSS A;  3FZ9 A;  2KHP A;  2QC7 A;  4GLT A;  4X1U A;  1M2A A;  5CP1 A;  3A3T A;  2C3T A;  1B4Q A;  1U88 A;  5AIX A;  3FR9 A;  3D0Z A;  7GSS A;  1JZO A;  4MLY A;  2C80 A;  3DWV A;  5ECK B;  11GS A;  2LRT A;  4EDZ A;  6GSY A;  1UN2 A;  1W89 A;  1XOB A;  2L5O A;  4HOJ A;  1A8Y A;  2RM6 A;  2O8V B;  3GTU A;  2GQK A;  3VK9 A;  1DE2 A;  5G2Z A;  2H71 A;  2HQT A;  3MAK A;  1FB6 A;  4NPB A;  2M80 A;  4X0X A;  2V32 A;  4ZBD A;  2JU5 A;  4ULX A;  2HNL A;  3QAW A;  5ELG A;  1ERW A;  2KLX A;  3FEU A;  2JZR A;  5J4U A;  2ZUP A;  1DBY A;  2MZC A;  2DLX A;  3M9K A;  1V57 A;  3UOM A;  1GLP A;  2RUE A;  3ZIV A;  2HZF A;  1XFL A;  5IIZ A;  4FIW A;  1O8X A;  1AAZ A;  2N5B A;  2DBC A;  3ZTL A;  3O3T A;  1JFU A;  2JSY A;  3RHC A;  3ZYW A;  4HU7 A;  2H8L A;  1PA3 A;  3CTF A;  4TR4 A;  2HRK B;  1GRX A;  3AY8 A;  6GST A;  4MJC A;  3FZ4 A;  4AJ6 A;  3GIX A;  3TOU A;  5GAN D;  4Q5N A;  3H79 A;  3LWA A;  3UEM A;  3UIW A;  2WDU A;  5CO3 A;  4IKH A;  2JAC A;  2H74 A;  3D6I A;  5J3R A;  4K6X A;  4GQF A;  2GSQ A;  1J0F A;  2K9F A;  3TJJ A;  4MF5 A;  3UAR A;  1WP0 A;  2JZS A;  3IA1 A;  1ZOF A;  4DSS B;  1TW9 A;  1ZCP A;  3QAV A;  1AC1 A;  2PER A;  3DML A;  2GDR A;  4RQX A;  4IBP A;  3D21 A;  1V58 A;  4KH7 A;  2FNO A;  3A2V A;  4LL4 B;  1X9W B;  2MYG A;  3FY7 A;  1A2M A;  4CHS A;  3LEF A;  4JRR A;  1B8X A;  4ECB A;  3BCK A;  4L5L A;  3G7J A;  3GX8 A;  3GKX A;  4F82 A;  1GLQ A;  1IYH A;  3ZIJ A;  3HHV A;  4O92 A;  2I3Y A;  4YQM A;  3FR3 A;  1F37 A;  3KGK A;  1EGR A;  2FCH A;  1HD2 A;  3DKS A;  1OC9 B;  2AYT A;  1SYR A;  1O8W A;  5G1K A;  2FY6 A;  3IV4 A;  2L4Q A;  3P8W A;  4ECI A;  1X5E A;  5AGY A;  1PRX A;  2X99 A;  1N8J A;  4G10 A;  3L0H A;  4RQR A;  3A2W A;  1SJI A;  4IJI A;  3UVT A;  3KXO A;  2PU9 C;  3VWW A;  4KF9 A;  2ON7 A;  2B1K A;  4TR3 A;  1PL1 A;  1T3B A;  2DC5 A;  5DJL A;  2VCQ A;  2OKA A;  4PQH A;  4ZL7 A;  1OKD A;  1PN9 A;  3WGD A;  1QFN A;  4IQA A;  2OAC A;  1EEJ A;  2F51 A;  1ON4 A;  4ML1 A;  3TJG A;  2JAD A;  2CQ9 A;  2JZT A;  2ZCT A;  4KCA A;  4O7H A;  5FHI A;  2KOK A;  5ID2 A;  3UMA A;  4IHU A;  5F0G A;  1AQV A;  4PXO A;  5IOW A;  4KGI A;  2PVO C;  4ZIL A;  4JU5 A;  1OVN A;  3GUS A;  4KDU A;  3RPN A;  3QCP A;  3UJ1 A;  4IVF A;  2DJ2 A;  3APQ A;  2R6K A;  4MPF A;  1GSF A;  4DSQ A;  2K8V A;  5CRH A;  5E59 A;  2OE1 A;  3RAZ A;  3DVW A;  3C73 A;  2X8C A;  4HJM A;  5CNW A;  5DQY A;  3ZRE A;  4FQU A;  4CW9 A;  1EOH A;  3IXR A;  2V1M A;  3FK8 A;  3TKR A;  1QXH A;  5CYY A;  3F0I A;  4IP1 A;  3DVX A;  1X9S B;  3GUR A;  4GCI A;  4TXO B;  2IWT A;  2F9S A;  2UZ8 A;  2QKE A;  4FYU A;  4I6X A;  4BPY A;  3CSH A;  3ZFB A;  2I4A A;  3EU3 A;  1OAZ A;  1PSQ A;  1SJ6 A;  3LFL A;  4OO5 A;  1YF0 A;  1JZR A;  1PL2 A;  2V6K A;  1T8E B;  2YZU A;  2HSY A;  4BL7 A;  2H0H A;  4L8E A;  5J9C A;  3A5W A;  4JZQ A;  1R4W A;  2B5E A;  2WGR A;  1FVJ A;  4V2L A;  1YEP A;  1K0B A;  3D4M A;  3KJY A;  3I69 A;  2VAF A;  4PQI A;  2CX4 A;  3LXZ A;  4QL7 A;  1BAY A;  2FUG 2;  3N9J A;  4GXZ A;  2QSI A;  4Q5F A;  4ISD A;  4RUV A;  1VF2 A;  3ME7 A;  2R2J A;  1TP9 A;  4GTU A;  4GSS A;  1BX9 A;  3J7Y b;  5J5N A;  2DIZ A;  2C4J A;  1U6T A;  4USS A;  5A4U A;  1TJD A;  4Z7X A;  5DAK A;  1Z5Y E;  4K0G A;  5IM9 A;  4NV2 A;  4PX1 A;  3DXB A;  5KN0 A;  1YZX A;  2CA8 A;  3L4N A;  2MMN A;  4KSM A;  3WGX A;  2V6O A;  3KIJ A;  3GH9 A;  2VLV A;  4EDY A;  4MZB A;  1X5C A;  3HJO A;  4OWY A;  3SWL A;  2ZNM A;  3EYT A;  5GST A;  3IDV A;  1GTB A;  5CAX A;  2N5F A;  5FT3 A;  3Q6O A;  1X9M B;  3H93 A;  4XIH A;  5EY6 A;  3LYP A;  4YQU A;  1HNC A;  9GSS A;  5HR1 A;  1J9B A;  3QFA C;  3TKS A;  5EL8 A;  3LYK A;  4XS4 A;  1BYE A;  5INY A;  2GVP A;  4Q5Q A;  4L0W A;  5IMZ A;  1K0A A;  3F4T A;  2FWG A;  3QPM A;  2B7J A;  1XWK A;  5IMC A;  5G31 A;  3WT2 A;  5BMU A;  3DIE A;  1MEK A;  1K3O A;  2XBQ A;  3J7Y k;  2PUK C;  4OFN A;  5ABR A;  1A2J A;  1R7H A;  2QGV A;  1Z7P A;  5HFI A;  1WOU A;  2KP1 A;  1M7T A;  1PGT A;  2LTK A;  2A4V A;  4MF6 A;  4ZIJ A;  1YDK A;  3UAP A;  3I9V 2;  3UBK A;  2HRN A;  1LBK A;  4HS1 A;  3HZ8 A;  3HD5 A;  3F4S A;  3APO A;  3HKR A;  2GQL A;  2IFQ B;  1GUK A;  3EC3 A;  4WEY A;  2NDO A;  1F6M C;  4JED A;  2WS2 A;  1O7U A;  3QR6 A;  3TDG A;  4WR4 A;  1TDI A;  3UVH A;  1WMJ A;  1FVK A;  4Q5R A;  2H76 A;  4HDE A;  3LSZ A;  4MA9 A;  1TU7 A;  1QGV A;  1SEN A;  2X64 A;  3VLN A;  1Y6E A;  3GKK A;  1GSE A;  2HRK A;  2AV4 A;  1XOA A;  3TRQ A;  3IRA A;  1ZYE A;  2H6Z A;  3KMN A;  5IMA A;  3W6G A;  3RHB A;  1AXD A;  2F8F A;  1Z9H A;  1G7E A;  3P90 A;  2K18 A;  2O85 A;  4BVY B;  2H1B A;  3APS A;  4G0L A;  4XHM A;  3N5O A;  2DJ1 A;  3HJM A;  2LEG A;  4EF0 A;  4XRA A;  5DAL B;  1XPV A;  4MCU A;  3H1N A;  4ZB8 A;  1M9B A;  2D2Z A;  1VF4 A;  4X43 A;  2XPD A;  3H8Q A;  4ECJ A;  3E3E A;  4O32 A;  1H4O A;  2I9H A;  3JCM L;  5G5F A;  4I2U A;  1PKW A;  1R5A A;  2C1Y A;  4XRD A;  2DMM A;  2DIY A;  2H1A A;  2VCT A;  4TR1 A;  4HQS A;  3ED3 A;  2PVQ A;  3KP9 A;  1F2E A;  1H75 A;  4G19 A;  3TGZ A;  1DE1 A;  3BOA A;  3HXS A;  1TXX A;  2CV4 A;  2H6Y A;  3LGC A;  3P7X A;  2L59 A;  1KTE A;  5DBQ A;  5ENU A;  1XXU A;  2GT6 A;  4POK A;  3GL5 A;  4KX4 A;  4TOP A;  4KDY A;  1OC9 A;  1WWJ A;  1LU4 A;  2HE3 A;  2VCX A;  1T4Y A;  3IC8 A;  2F8A A;  3FHK A;  4MMM A;  1BG5 A;  3NOF A;  2MMO A;  4OMV A;  1GSU A;  2YP6 A;  1T1V A;  1GUH A;  3LXT A;  5LCZ A;  3VWX A;  2JSZ A;  1A23 A;  3L9U A;  4WXT A;  2AJQ B;  2O87 A;  4OD7 A;  4ZL8 A;  1GL8 A;  3F3R A;  4LMV A;  2J23 A;  2X8H A;  5B6N A;  4GSN A;  2C0E A;  2FWE A;  2CAQ A;  3IHQ A;  3IBH A;  3G9B A;  2LNS A;  1HNB A;  4L5O A;  3IAS 2;  2NTO A;  2MMA A;  4YAP A;  3KP8 A;  1ST9 A;  3M1G A;  16GS A;  1S3D A;  3MNG A;  2HT9 A;  2H70 A;  2RLI A;  3M9J A;  4F03 A;  1YKA A;  3VPT A;  1FAA A;  2YNX A;  3U6V A;  4F9Z A;  1B4P A;  4TR0 A;  4JBB A;  1RW1 A;  2GTU A;  4FYC A;  4N10 A;  2HLS A;  1MDK A;  4WF5 A;  1XW9 A;  3KMO A;  3FZA A;  4ZBA A;  2CVB A;  5D9X A;  6GSU A;  2DJK A;  3IOS A;  3QMX A;  3EWL A;  2GQM A;  4HQZ A;  2YN1 A;  2HRA A;  1PKZ A;  1V9W A;  3ZMK A;  1G6Y A;  3KH9 A;  2H6X A;  1NHY A;  2REM A;  1E6B A;  2B7K A;  2ALB A;  18GS A;  1CQG A;  4WBR D;  4G0I A;  5F06 A;  2YWM A;  1VF3 A;  2VIM A;  3VI7 A;  4TR1 B;  4NXI A;  3IE3 A;  5JCU A;  4KUN A;  4GF0 A;  3HY2 A;  10GS A;  4EL1 A;  3ZL5 A;  4TXO A;  4BVX B;  2IMF A;  5JWR B;  1GSD A;  3VWU A;  1VF1 A;  4ACS A;  2L57 A;  3SBC A;  3TCO A;  4MF7 A;  3GKN A;  1BED A;  1FOV A;  5JCG A;  4I97 A;  6GSV A;  1TK5 B;  3WD6 A;  2VLU A;  2K6V A;  1KBN A;  3MWH A;  4IW9 A;  1JLV A;  4MPG A;  1OKT A;  5FWG A;  3E0U A;  1M9A A;  4JR4 A;  3A2X A;  1NHO A;  5IMV A;  3CSI A;  2PWJ A;  2B3S A;  1ILO A;  1Z3E A;  4AGS A;  2YJ7 A;  4V2N A;  1TK8 B;  2HXK A;  3U5R E;  2VO4 A;  2H30 A;  12GS A;  4ZB9 A;  4IS0 A;  1K0M A;  4EVM A;  1GUL A;  4ZXG A;  2GGT A;  4IN0 A;  4YH2 A;  3ME8 A;  3PR8 A;  3QFB C;  4ZB6 A;  1PX6 A;  4KA0 A;  2WRT A;  3W8S A;  4PUR A;  5J9B A;  3GHA A;  1EP8 A;  2WJU A;  5A4W A;  2HYX A;  3BD2 A;  1OE8 A;  3EE2 A;  1PQN A;  4FH8 A;  3Q18 A;  1BJX A;  4HI7 A;  1XBS A;  2WFC A;  1V98 A;  1A8L A;  1HNA A;  2WZ9 A;  4KB3 A;  1B48 A;  2FA4 A;  2HRF A;  1GUM A;  2R4V A;  4WR5 A;  5IMD A;  4XTS A;  1TRW A;  1TTZ A;  2GZY A;  1SKW B;  2LUS A;  4AJ8 A;  2HSN B;  2CX3 A;  2V2G A;  2GLR A;  2DJ3 A;  5B8A A;  3VUR A;  4CDO A;  2H66 A;  3MSZ A;  4HZ2 A;  4KSO A;  2VCZ A;  1Z6M A;  2IME A;  3C71 A;  1WRY A;  5ECH B;  5G30 A;  2A2S A;  4O5R A;  2YV7 A;  2IL3 A;  5D73 A;  2NVL A;  2R37 A;  2L6C A;  5ECN B;  1THX A;  1G6W A;  3P2A A;  1QMV A;  3ZIT A;  4RI6 A;  5KEJ A;  4N0V A;  4NWY A;  5GSS A;  20GS A;  3L78 A;  5AN1 A;  5D96 A;  4EE0 A;  4GST A;  1MDJ A;  4F2I A;  1ZL9 A;  4G2E A;  2C0D A;  3H4K A;  4POM A;  2HFD A;  5B8B A;  4EC0 A;  5DJM A;  1R5P A;  2HZE B;  4TRX A;  1XWG A;  1GSQ A;  4BWQ A;  2IPA A;  3E9J B;  4GWR A;  2FD3 A;  2WUL A;  3GFK A;  5J41 A;  2YV9 A;  1FW1 A;  4EKZ A;  2OBI A;  1A0R P;  5B7C A;  3TB2 A;  4PNG A;  3TJF A;  1GTI A;  3R3E A;  1EWX A;  1F3B A;  2GZZ A;  2VL2 A;  1U3I A;  2WCI A;  4N30 A;  2LS5 A;  4OCE A;  4D73 B;  1SKS B;  3FKF A;  4LL1 B;  1ZGN A;  1SD8 A;  2M72 A;  5GZZ B;  2IFQ A;  3M0F A;  1QK8 A;  2H1G A;  3GA4 A;  2GZP A;  2B5X A;  1M2B A;  2VUP A;  1Q4J A;  1K0C A;  1GH2 A;  2CT6 A;  1WIK A;  4MJE A;  1RK4 A;  2VM2 A;  5EPF A;  1XVW A;  4KCE A;  5ECR B;  2YAN A;  5D9V A;  2H01 A;  2LJK A;  1KNG A;  4OFM A;  3FW2 A;  5IO0 A;  1SU9 A;  3IC4 A;  2YWN A;  2FGX A;  3TKS C;  1U87 A;  3R2Q A;  1VRS D;  1Y25 A;  2HI7 A;  1QQ2 A;  3DRN A;  2L4C A;  4KE3 A;  2BTO T;  1WPI A;  4BVY A;  3IK7 A;  3GX0 A;  2XBI A;  1GWC A;  2XHF A;  5DAL A;  4FO5 A;  3QAG A;  1MTC A;  4EO3 A;  2AB6 A;  2L5L A;  5ELA A;  4LMW A;  1UA5 A;  5ECP B;  5AIV A;  2O89 A;  3IAM 2;  2VD1 A;  4HZ4 A;  8GSS A;  3GRX A;  3HDC A;  4POL A;  4EUY A;  3G7Y A;  1XW5 A;  3S9F A;  2KP2 A;  1NSW A;  2LJA A;  2PPT A;  3DD3 A;  1WE0 A;  5E4W A;  1FHE A;  2RII A;  4RI7 A;  3GL3 A;  2H1D A;  3TJK A;  2E2G A;  4PNF A;  1YJ6 A;  1PD2 1;  1ERT A;  5LNK e;  2H75 A;  2IMK A;  2B1L A;  3ZVJ D;  1SJZ A;  5GAP D;  3QD9 A;  3IK9 A;  1JLW A;  1ZZY A;  1XWB A;  1O6J A;  4HUA A;  2HSH A;  4OCF A;  2LQO A;  5KN3 A;  3ERF A;  2L6D A;  1TOF A;  4MH3 A;  1M0U A;  2FA8 A;  1F3A A;  2FWF A;  2LNT A;  3C8E A;  4PUA A;  2VM1 A;  5ECQ B;  3GST A;  1W4V A;  3CRT A;  1T4Z A;  4GQC A;  5D8I A;  3ZVJ A;  1EV9 A;  1G0T A;  2VL3 A;  5H5Q A;  3TRX A;  14GS A;  4I8B A;  3F4R A;  3LOR A;  1SKR B;  1PX7 A;  1UVZ A;  4XS1 A;  3RPP A;  1DSB A;  5G1L A;  4XS6 A;  5ECI B;  3EMP A;  4K7I A;  1GNE A;  4K2D A;  1K3Y A;  3C1S A;  4N0Z A;  4AJ7 A;  13GS A;  5AIS A;  1G7O A;  2BJX A;  2AAW A;  1O85 A;  1YKC A;  2B6M A;  5IO2 A;  2YCD A;  3BBY A;  2G0F A;  4J57 E;  5D9W A;  4F0B A;  2P0G A;  4V1A g;  3GMF A;  3PGT A;  4GRF A;  1MDI A;  3F6D A;  3TOT A;  1PMT A;  3F6F A;  5F8B A;  19GS A;  5CRE A;  4KW6 A;  3L9V A;  1XW6 A;  1TRU A;  4BVX A;  3BJ5 A;  4H86 A;  2YOI A;  4V1A p;  2IN3 A;  2LKU A;  4ILF A;  4IGJ A;  2G2Q A;  1IYI A;  5L71 A;  3ZFL A;  3GSS A;  5H5S A;  2TRC P;  1OE7 A;  3ZZX A;  1GSS A;  3F63 A;  3GV1 A;  1EEM A;  4YQV A;  1ZYQ B;  5JWO B;  2K8S A;  4NMU A;  1CQH A;  4V2M A;  2F3M A;  2VCV A;  3GN3 A;  1AUC A;  2OBK A;  1EGO A;  2B5Y A;  1TK0 B;  2ES7 A;  3W8J A;  4WF4 A;  1NW2 A;  3CSJ A;  3HA9 A;  3HZ4 A;  2WB9 A;  4MAB A;  4P3Y B;  3MDK A;  1THO A;  4IEL A;  3F8U A;  3PPU A;  5D9T A;  1I9D A;  1SL2 B;  17GS A;  3FYG A;  2V41 A;  1OYJ A;  1GTU A;  3PIN A;  1C72 A;  1ML6 A;  5JWQ B;  2H0I A;  1AQW A;  4I2T A;  4KND A;  2VLT A;  2YWO A;  4PUF C;  2CAI A;  2E2M A;  3CBU A;  1M2D A;  4AF2 A;  2C0G A;  5D93 A;  4QL9 A;  1NM3 A;  2CZ2 A;  2OE0 A;  1E2Y A;  4ZL9 A;  2GT5 A;  3TUE A;  3K8N A;  6GSS A;  3LQ7 A;  5CRD A;  2LST A;  2YZH A;  3F3Q A;  2VD0 A;  5HR3 A;  2LRN A;  5IPG A;  2LJR A;  2FLS A;  4MZW A;  2BMX A;  3OR5 A;  4PGT A;  3TKS E;  4E8H A;  4KAE A;  5DQS A;  5LD0 A;  5B6M A;  3KEB A;  1FB0 A;  3BCI A;  2GSS A;  2IIY A;  3ISO A;  2YJH A;  1K0O A;  3Q19 A;  5EVO A;  5IPH A;  4NHW A;  4JE1 A;  4WBJ A;  2LV3 A;  3C7M A;  1V2A A;  5F05 A;  2CVD A;  1T7P B;  1USB A;  4XCS A;  4MJB A;  4G9H A;  1DUG A;  1JHB A;  2EC4 A;  3GTU B;  2LRC A;  1A2L A;  1TKD B;  1TI1 A;  3DGQ A;  1MD4 A; 
#chains in the Genus database with same CATH topology
 4N11 A;  4I5Q A;  1PN0 A;  1S3A A;  2I1U A;  4OO4 A;  4PTS A;  3CYN A;  1SK0 A;  3VPQ A;  4J2F A;  3KTL A;  6GSW A;  2HZE A;  3EVI A;  2AHE A;  4HSC X;  3IR4 A;  1HQO A;  3ERW A;  2H72 A;  2ON5 A;  3EUR A;  2P5R A;  3LG6 A;  2EIR A;  3D22 A;  3GH6 A;  3VFI A;  3CTG A;  3HYP A;  3GYK A;  3ZRD A;  4K7O A;  3NIV A;  2TIR A;  1QUW A;  3TKQ A;  4D73 A;  4DSR A;  2IMI A;  3KD0 A;  3IHG A;  5F07 A;  4IP6 A;  3KM6 A;  2I81 A;  3TKP A;  4HU9 A;  2RM5 A;  4ECC A;  3KZQ A;  2PBJ A;  1EV4 A;  4HEA 2;  4BA7 A;  3ERG A;  4LLR A;  4K5R A;  2PGT A;  1Z7R A;  4L0U A;  4AKI A;  2AUV A;  4CY8 A;  1SK2 A;  2XPE A;  2LQQ A;  5IOX A;  3HVV A;  3QDN A;  2DJJ A;  1FG4 A;  3HJP A;  1ABA A;  1M99 A;  2GSR A;  2H1L A;  2GS3 A;  2PMT A;  1K3L A;  3VWV A;  5HFG A;  1OC8 A;  1XZO A;  4E8E A;  1K0N A;  5C00 A;  3WT1 A;  1N25 A;  1Y1U A;  2J9H A;  2EIO A;  3DEX A;  2EIQ A;  2MBT A;  3HVN A;  3WGE A;  1ZYN A;  2NBS A;  2DSA A;  1GSY A;  3UBL A;  3LJR A;  1LJR A;  2E7P A;  3HVX A;  3CMI A;  1O81 A;  1TU8 A;  2VCW A;  5DDL A;  4YKF A;  1EZK A;  1ZMA A;  4K1F A;  3C1R A;  3EIN A;  2YPM A;  4IQ1 A;  1M3J A;  4K0N A;  4TKY A;  4TVE A;  3US3 A;  3UL3 A;  4PQ1 A;  2M46 A;  2P31 A;  5IQY A;  1SL1 B;  4J56 E;  5H5R A;  4MDC A;  2OJL A;  1O73 A;  2VL2 C;  5CRW A;  5DCG A;  5G5E A;  4WET A;  1T00 A;  3RBT A;  2MMZ A;  3KH7 A;  4NV5 A;  5ECM B;  3FR6 A;  3GKM A;  1JZW A;  2VL9 A;  4K9Z A;  2N5A A;  3CXG A;  4E68 A;  4MP4 A;  1Q98 A;  3O6T A;  2R5G A;  2OAD A;  3M3M A;  2C3Q A;  4MK3 A;  3RDW A;  2C3N A;  4TN8 A;  2R3X A;  1YEX A;  1RQM A;  3I6A A;  5HR0 A;  1URM A;  3EMX A;  4TXV A;  2JL4 A;  5HR2 A;  5CRG A;  3VI5 A;  5ID2 B;  1JZD A;  3I43 A;  2XC2 A;  3L9S A;  2A2R A;  2IMD A;  3F9U A;  4NHZ A;  1AIU A;  1A24 A;  1ERU A;  2O7K A;  2YWI A;  2HSM A;  1X5D A;  4G0K A;  2H0G A;  1R26 A;  4TW5 A;  3D4T A;  5HFK A;  5JCW A;  1XWC A;  4MNN A;  2H73 A;  1I5G A;  1YQ1 A;  5C04 A;  4Z2T A;  4NAX A;  1ACV A;  1XIY A;  2FWH A;  2OE3 A;  4KDX A;  2MBS A;  1ERV A;  4OFT A;  5A5K A;  1XWA A;  4DVC A;  4BWS A;  2FHE A;  3IPZ A;  1B9X C;  1KEB A;  1PFO A;  5ECS A;  2VOC A;  1TRV A;  2DJ0 A;  3GNJ A;  5A34 A;  1X0R A;  1J08 A;  4MJA A;  4IJ3 A;  4MH2 A;  3O76 A;  3QOU A;  1SL0 B;  1GTA A;  1U3A A;  3ZLP A;  4BL7 B;  4JR6 A;  1GNW A;  5ECL B;  6GSX A;  2CVK A;  1SD9 A;  2KUC A;  3Q74 A;  3HCZ A;  4DEJ A;  4HJ2 A;  5DVB A;  1AW9 A;  3ZML A;  3V1W A;  1S3C A;  4ID0 A;  2TRX A;  4YAV A;  1SK1 A;  3WYW A;  4ML6 A;  3KTB A;  4N3Z A;  1YY7 A;  3DYR A;  1XVQ A;  5ECO B;  1AQX A;  1EOG A;  3RFR C;  2C0F A;  3HVS A;  2GST A;  3FRC A;  3FMW A;  2C8U A;  3EU4 A;  5COH A;  1WJK A;  2X8G A;  1B9Y C;  4F0C A;  4ZBB A;  3TRP A;  1TI3 A;  5DAK B;  1V40 A;  3G7I A;  5IMF A;  2OA7 A;  3NZN A;  1A0F A;  4LA1 A;  2DML A;  2PN8 A;  2Z9S A;  1BQ7 A;  1MD3 A;  3TJB A;  2HSM B;  1HYU A;  4EXJ A;  4K7N A;  1YF1 A;  1SYX A;  3PH9 A;  3CRU A;  22GS A;  3FZ5 A;  1OC3 A;  1UC7 A;  2RUF A;  5HQP A;  2WVX B;  3M8N A;  1VGL A;  1EP7 A;  2E0Q A;  2IJY A;  4K2X A;  1N2A A;  4POB A;  3D5J A;  2NPB A;  1Z6N A;  1GP1 A;  2CZ3 A;  1F9M A;  2H19 A;  5DCH A;  3KCM A;  4MZC A;  4PI2 C;  4XS4 B;  5KN2 A;  1TRS A;  5KN1 A;  1FO5 A;  4WKW A;  1XCC A;  4FYB A;  4K8M A;  1K0D A;  4QQ7 A;  5A4V A;  2P5Q A;  4DSS A;  3FZ9 A;  2KHP A;  2QC7 A;  4GLT A;  4X1U A;  1M2A A;  5BMU B;  5CP1 A;  3A3T A;  2WW1 A;  2C3T A;  1B4Q A;  1U88 A;  5AIX A;  3FR9 A;  3D0Z A;  7GSS A;  1JZO A;  4AKX B;  4MLY A;  2C80 A;  3DWV A;  5ECK B;  11GS A;  2LRT A;  4EDZ A;  6GSY A;  1UN2 A;  1W89 A;  1XOB A;  3MYD A;  2L5O A;  4HOJ A;  1A8Y A;  2RM6 A;  2O8V B;  3GTU A;  2GQK A;  3VK9 A;  5J40 A;  1DE2 A;  5G2Z A;  2H71 A;  2HQT A;  3MAK A;  1FB6 A;  4NPB A;  2M80 A;  4X0X A;  2V32 A;  4ZBD A;  2JU5 A;  4ULX A;  2HNL A;  3QAW A;  5ELG A;  1ERW A;  2KLX A;  3FEU A;  2JZR A;  5J4U A;  2ZUP A;  2O3E A;  1DBY A;  2MZC A;  2DLX A;  3M9K A;  1V57 A;  3UOM A;  1GLP A;  2RUE A;  3ZIV A;  2HZF A;  1XFL A;  5IIZ A;  4FIW A;  1O8X A;  1AAZ A;  2N5B A;  2DBC A;  3ZTL A;  3O3T A;  1JFU A;  2JSY A;  3RHC A;  3ZYW A;  4HU7 A;  2H8L A;  1SVO A;  1S4B P;  1PA3 A;  3CTF A;  4TR4 A;  2HRK B;  1GRX A;  3AY8 A;  6GST A;  4MJC A;  3FZ4 A;  4AJ6 A;  3GIX A;  3TOU A;  5GAN D;  4Q5N A;  3H79 A;  3LWA A;  3UEM A;  3UIW A;  2WDU A;  5CO3 A;  4IKH A;  2JAC A;  2H74 A;  3D6I A;  5J3R A;  4K6X A;  4GQF A;  1YEW C;  2GSQ A;  1J0F A;  2K9F A;  3TJJ A;  4MF5 A;  3UAR A;  1WP0 A;  2JZS A;  3IA1 A;  1ZOF A;  4DSS B;  1TW9 A;  1ZCP A;  3QAV A;  4Z2R A;  1AC1 A;  2PER A;  3DML A;  2GDR A;  4RQX A;  4IBP A;  3D21 A;  1V58 A;  4KH7 A;  2FNO A;  3A2V A;  2VKZ G;  4LL4 B;  1X9W B;  2MYG A;  3FY7 A;  1A2M A;  4CHS A;  2A2P A;  3LEF A;  4JRR A;  1B8X A;  4ECB A;  3BCK A;  4L5L A;  2O36 A;  3G7J A;  3GX8 A;  3GKX A;  4F82 A;  1GLQ A;  1IYH A;  2X49 A;  3ZIJ A;  5KOX A;  3HHV A;  4O92 A;  2I3Y A;  4YQM A;  3FR3 A;  1F37 A;  3KGK A;  1EGR A;  2FCH A;  1HD2 A;  3DKS A;  1OC9 B;  2AYT A;  1SYR A;  1O8W A;  5G1K A;  2FY6 A;  3IV4 A;  2DKH A;  2L4Q A;  3P8W A;  4ECI A;  1X5E A;  5AGY A;  1PRX A;  2X99 A;  3MIX A;  1N8J A;  4G10 A;  3L0H A;  4RQR A;  3A2W A;  1SJI A;  4IJI A;  3UVT A;  3KXO A;  2PU9 C;  3VWW A;  4KF9 A;  2ON7 A;  2B1K A;  4ICY A;  4TR3 A;  1PL1 A;  1T3B A;  2DC5 A;  5DJL A;  2VCQ A;  2OKA A;  4PQH A;  4ZL7 A;  1OKD A;  1PN9 A;  3WGD A;  4G01 A;  2EFH A;  1QFN A;  4IQA A;  2OAC A;  1EEJ A;  2F51 A;  1ON4 A;  4ML1 A;  2WZS A;  3TJG A;  2JAD A;  2CQ9 A;  2JZT A;  2ZCT A;  4KCA A;  4O7H A;  5FHI A;  2KOK A;  5ID2 A;  3UMA A;  2EFE A;  4IHU A;  5F0G A;  1AQV A;  2WW0 A;  4PXO A;  5IOW A;  4KGI A;  2PVO C;  4ZIL A;  4JU5 A;  1OVN A;  3GUS A;  4KDU A;  3RPN A;  3QCP A;  3UJ1 A;  4IVF A;  2DJ2 A;  3APQ A;  2R6K A;  4MPF A;  1GSF A;  2WVY A;  4DSQ A;  1I1I P;  2K8V A;  2R0G A;  5CRH A;  5E59 A;  2OE1 A;  3RAZ A;  3DVW A;  3C73 A;  2X8C A;  4O5U A;  4HJM A;  5CNW A;  5DQY A;  3ZRE A;  4FQU A;  4CW9 A;  2WW3 A;  1EOH A;  3IXR A;  2V1M A;  3FK8 A;  3TKR A;  1QXH A;  5CYY A;  3F0I A;  4IP1 A;  3DVX A;  1X9S B;  3GUR A;  4GCI A;  4TXO B;  2IWT A;  2F9S A;  2UZ8 A;  2QKE A;  4FYU A;  4I6X A;  4BPY A;  3CSH A;  3ZFB A;  2I4A A;  3EU3 A;  1OAZ A;  1PSQ A;  1SJ6 A;  3LFL A;  4OO5 A;  1YF0 A;  3CWG A;  1JZR A;  1PL2 A;  2V6K A;  1T8E B;  2YZU A;  2HSY A;  4BL7 A;  2H0H A;  4L8E A;  5J9C A;  3A5W A;  4JZQ A;  1R4W A;  2B5E A;  2WGR A;  1FVJ A;  4V2L A;  1YEP A;  1K0B A;  3D4M A;  3KJY A;  3I69 A;  2VAF A;  4PQI A;  2CX4 A;  2EFD A;  3LXZ A;  4QL7 A;  1BAY A;  2FUG 2;  3N9J A;  4GXZ A;  2QSI A;  4Q5F A;  4ISD A;  4RUV A;  1VF2 A;  3ME7 A;  2R2J A;  1TP9 A;  4GTU A;  4GSS A;  1BX9 A;  3J7Y b;  5J5N A;  2DIZ A;  2C4J A;  1U6T A;  4USS A;  5A4U A;  4W66 A;  1TJD A;  4Z7X A;  5DAK A;  1Z5Y E;  5J4V A;  3RGB C;  4K0G A;  4Z2U A;  5IM9 A;  1M3I A;  4NV2 A;  4PX1 A;  3DXB A;  4EIQ A;  5KN0 A;  1YZX A;  2CA8 A;  3L4N A;  2MMN A;  4KSM A;  3WGX A;  2V6O A;  3KIJ A;  3GH9 A;  2VLV A;  4EDY A;  4MZB A;  1X5C A;  2WVZ A;  3HJO A;  4OWY A;  3SWL A;  2ZNM A;  2EFC A;  3EPT A;  3EYT A;  2WVX A;  5GST A;  3IDV A;  1GTB A;  5CAX A;  2N5F A;  5FT3 A;  3Q6O A;  1X9M B;  3H93 A;  4XIH A;  5EY6 A;  2R0P A;  3LYP A;  4AKG A;  4YQU A;  1HNC A;  9GSS A;  5HR1 A;  1J9B A;  5J47 A;  3QFA C;  3TKS A;  5EL8 A;  3LYK A;  4XS4 A;  1BYE A;  5INY A;  2GVP A;  4Q5Q A;  4L0W A;  4AI6 A;  5IMZ A;  1K0A A;  3F4T A;  2FWG A;  5J4Y A;  3QPM A;  2B7J A;  1XWK A;  5IMC A;  5G31 A;  3WT2 A;  5BMU A;  3DIE A;  1MEK A;  1K3O A;  2XBQ A;  3J7Y k;  2PUK C;  4OFN A;  5ABR A;  1A2J A;  1R7H A;  2QGV A;  1Z7P A;  5HFI A;  1WOU A;  2KP1 A;  1M7T A;  1PGT A;  2LTK A;  2A4V A;  4MF6 A;  4ZIJ A;  1YDK A;  3UAP A;  3I9V 2;  3UBK A;  2HRN A;  1LBK A;  1SVM A;  4HS1 A;  3HZ8 A;  3HD5 A;  3F4S A;  3APO A;  3HKR A;  2GQL A;  2IFQ B;  1GUK A;  3EC3 A;  4WEY A;  2NDO A;  1F6M C;  4JED A;  2WS2 A;  1O7U A;  3QR6 A;  3TDG A;  4WR4 A;  1TDI A;  3UVH A;  1WMJ A;  1FVK A;  4Q5R A;  2H76 A;  4HDE A;  3LSZ A;  4YKG A;  4MA9 A;  1TU7 A;  1QGV A;  1SEN A;  2X64 A;  3VLN A;  1Y6E A;  3GKK A;  1GSE A;  2HRK A;  2AV4 A;  1XOA A;  3TRQ A;  4BIK A;  3IRA A;  1ZYE A;  2H6Z A;  3KMN A;  5IMA A;  3W6G A;  3TU3 B;  4QMK A;  3RHB A;  1AXD A;  2F8F A;  1Z9H A;  1G7E A;  3P90 A;  2K18 A;  2O85 A;  2A4H A;  4BVY B;  2H1B A;  1FOH A;  3APS A;  4G0L A;  4XHM A;  3N5O A;  2DJ1 A;  3HJM A;  2LEG A;  4EF0 A;  4XRA A;  5DAL B;  1XPV A;  4MCU A;  3H1N A;  4ZB8 A;  1M9B A;  2D2Z A;  1VF4 A;  4X43 A;  2XPD A;  3H8Q A;  4ECJ A;  3E3E A;  4O32 A;  1H4O A;  2I9H A;  3JCM L;  5G5F A;  4I2U A;  1PKW A;  1R5A A;  2C1Y A;  4XRD A;  2DMM A;  2DIY A;  2H1A A;  2VCT A;  4TR1 A;  4HQS A;  1TXU A;  3ED3 A;  2PVQ A;  3KP9 A;  1F2E A;  1H75 A;  4G19 A;  3TGZ A;  1DE1 A;  1XG8 A;  3BOA A;  3HXS A;  1TXX A;  2CV4 A;  2H6Y A;  3LGC A;  3P7X A;  2L59 A;  1KTE A;  5DBQ A;  5ENU A;  1XXU A;  2GT6 A;  1BG1 A;  4POK A;  3GL5 A;  4KX4 A;  4TOP A;  4KDY A;  1OC9 A;  1WWJ A;  1LU4 A;  2HE3 A;  2VCX A;  1T4Y A;  3IC8 A;  2F8A A;  3FHK A;  4MMM A;  1BG5 A;  3NOF A;  2MMO A;  4OMV A;  1GSU A;  2YP6 A;  1T1V A;  1GUH A;  3LXT A;  5LCZ A;  3VWX A;  2JSZ A;  1A23 A;  3L9U A;  4WXT A;  2AJQ B;  4GDF A;  2O87 A;  4OD7 A;  4ZL8 A;  1GL8 A;  3F3R A;  4LMV A;  2J23 A;  2X8H A;  4O5Q A;  5B6N A;  4GSN A;  4PI0 C;  2C0E A;  2FWE A;  2CAQ A;  3IHQ A;  3IBH A;  3G9B A;  2LNS A;  1HNB A;  4L5O A;  3IAS 2;  2NTO A;  2MMA A;  4YAP A;  3KP8 A;  1ST9 A;  3M1G A;  16GS A;  1S3D A;  3MNG A;  2HT9 A;  2H70 A;  2RLI A;  4X4J A;  3M9J A;  4F03 A;  1YKA A;  3VPT A;  1FAA A;  2YNX A;  3U6V A;  4F9Z A;  1B4P A;  4TR0 A;  4JBB A;  1RW1 A;  2GTU A;  4FYC A;  4N10 A;  2HLS A;  1MDK A;  4WF5 A;  1XW9 A;  3KMO A;  4CY6 A;  3FZA A;  4ZBA A;  2CVB A;  5D9X A;  6GSU A;  2DJK A;  3IOS A;  3QMX A;  3LW9 A;  3EWL A;  2GQM A;  4HQZ A;  2YN1 A;  2HRA A;  1PKZ A;  1V9W A;  3ZMK A;  1G6Y A;  3KH9 A;  2O5V A;  2H6X A;  1NHY A;  2REM A;  1E6B A;  2B7K A;  2ALB A;  18GS A;  1CQG A;  4WBR D;  4G0I A;  5F06 A;  2YWM A;  1VF3 A;  2VIM A;  3VI7 A;  4TR1 B;  4NXI A;  3IE3 A;  5JCU A;  4KUN A;  4GF0 A;  3HY2 A;  10GS A;  4EL1 A;  3ZL5 A;  4TXO A;  4BVX B;  2IMF A;  5JWR B;  1GSD A;  3VWU A;  1VF1 A;  4ACS A;  2L57 A;  3SBC A;  3TCO A;  4MF7 A;  3GKN A;  1BED A;  1FOV A;  5JCG A;  4I97 A;  6GSV A;  1TK5 B;  3HMJ G;  3WD6 A;  2VLU A;  2K6V A;  1KBN A;  3MWH A;  4IW9 A;  1JLV A;  4MPG A;  1OKT A;  5FWG A;  3E0U A;  1M9A A;  2WW2 A;  4JR4 A;  3A2X A;  1NHO A;  5IMV A;  3CSI A;  2PWJ A;  2B3S A;  1ILO A;  1Z3E A;  4AGS A;  2YJ7 A;  2R0C A;  4V2N A;  1TK8 B;  2HXK A;  3U5R E;  2VO4 A;  2H30 A;  12GS A;  4ZB9 A;  4IS0 A;  1K0M A;  4EVM A;  1GUL A;  4ZXG A;  2GGT A;  4IN0 A;  4ZB7 A;  4YH2 A;  3ME8 A;  3PR8 A;  3QFB C;  4ZB6 A;  1PX6 A;  4KA0 A;  2WRT A;  5A5H B;  3W8S A;  4PUR A;  5J9B A;  3GHA A;  1EP8 A;  2WJU A;  5A4W A;  2HYX A;  3BD2 A;  1OE8 A;  3EE2 A;  1PQN A;  4FH8 A;  3Q18 A;  1BJX A;  4HI7 A;  1XBS A;  2WFC A;  1V98 A;  1A8L A;  1HNA A;  2WZ9 A;  4KB3 A;  1B48 A;  2FA4 A;  2HRF A;  1GUM A;  2R4V A;  4WR5 A;  5IMD A;  4XTS A;  1TRW A;  1TTZ A;  2GZY A;  1SKW B;  2LUS A;  4AJ8 A;  2HSN B;  2CX3 A;  2V2G A;  2GLR A;  2DJ3 A;  5B8A A;  3VUR A;  4CDO A;  2H66 A;  3MSZ A;  4HZ2 A;  4KSO A;  2VCZ A;  1Z6M A;  2IME A;  3C71 A;  1WRY A;  5ECH B;  5G30 A;  2A2S A;  4O5R A;  2YV7 A;  2IL3 A;  5D73 A;  2NVL A;  2R37 A;  2L6C A;  5ECN B;  1THX A;  1G6W A;  3P2A A;  1QMV A;  3ZIT A;  4RI6 A;  5KEJ A;  4N0V A;  4NWY A;  5GSS A;  20GS A;  3L78 A;  5AN1 A;  5D96 A;  4EE0 A;  4GST A;  1MDJ A;  4F2I A;  1ZL9 A;  2QA1 A;  4G2E A;  2C0D A;  3H4K A;  4POM A;  2HFD A;  5B8B A;  4EC0 A;  5DJM A;  1R5P A;  2HZE B;  4TRX A;  1XWG A;  1GSQ A;  4BWQ A;  2IPA A;  3E9J B;  4GWR A;  2FD3 A;  2DKI A;  2WUL A;  3GFK A;  5J41 A;  2YV9 A;  1FW1 A;  4EKZ A;  2OBI A;  1A0R P;  5B7C A;  3TB2 A;  4PNG A;  3TJF A;  1GTI A;  3R3E A;  1EWX A;  1F3B A;  2GZZ A;  2VL2 A;  1U3I A;  2WCI A;  4N30 A;  2UV8 G;  2LS5 A;  4OCE A;  4D73 B;  1SKS B;  3FKF A;  4LL1 B;  1ZGN A;  1SD8 A;  2M72 A;  5GZZ B;  2IFQ A;  3M0F A;  1QK8 A;  2H1G A;  3GA4 A;  2GZP A;  2B5X A;  1M2B A;  2VUP A;  1Q4J A;  1K0C A;  1GH2 A;  2CT6 A;  1WIK A;  4MJE A;  1RK4 A;  2VM2 A;  5EPF A;  1XVW A;  4KCE A;  5ECR B;  2YAN A;  5D9V A;  2H01 A;  2LJK A;  1KNG A;  4OFM A;  3FW2 A;  5IO0 A;  1SU9 A;  3IC4 A;  2YWN A;  2FGX A;  4EIP A;  3TKS C;  1U87 A;  3R2Q A;  1VRS D;  1Y25 A;  2HI7 A;  1QQ2 A;  3DRN A;  2L4C A;  4KE3 A;  2BTO T;  1WPI A;  4BVY A;  3IK7 A;  3GX0 A;  2XBI A;  1S3R A;  1GWC A;  2OT3 A;  1YVL A;  2XHF A;  5DAL A;  4FO5 A;  5A1N A;  3QAG A;  1MTC A;  4EO3 A;  2AB6 A;  2L5L A;  5ELA A;  4LMW A;  1UA5 A;  5ECP B;  5AIV A;  2O89 A;  3IAM 2;  2VD1 A;  4HZ4 A;  8GSS A;  2QA2 A;  3GRX A;  3HDC A;  4POL A;  4EUY A;  3G7Y A;  1XW5 A;  3S9F A;  2KP2 A;  1NSW A;  2LJA A;  2PPT A;  3DD3 A;  1WE0 A;  5E4W A;  1FHE A;  2RII A;  4RI7 A;  3GL3 A;  2H1D A;  3TJK A;  2E2G A;  2X4A A;  4PNF A;  1YJ6 A;  1PD2 1;  1ERT A;  5LNK e;  2H75 A;  2IMK A;  2B1L A;  3ZVJ D;  1SJZ A;  5GAP D;  3QD9 A;  3IK9 A;  1JLW A;  1ZZY A;  1XWB A;  1O6J A;  4HUA A;  2HSH A;  4OCF A;  2LQO A;  5KN3 A;  3ERF A;  5KOW A;  2L6D A;  1TOF A;  4MH3 A;  1M0U A;  2FA8 A;  1F3A A;  2FWF A;  2LNT A;  3C8E A;  4PUA A;  2VM1 A;  5ECQ B;  3GST A;  1W4V A;  3CRT A;  1T4Z A;  4GQC A;  5D8I A;  3ZVJ A;  1EV9 A;  1G0T A;  2VL3 A;  5H5Q A;  3TRX A;  14GS A;  4I8B A;  3F4R A;  3LOR A;  1SKR B;  1PX7 A;  1UVZ A;  4XS1 A;  3RPP A;  1DSB A;  5G1L A;  4XS6 A;  5ECI B;  3EMP A;  4K7I A;  1GNE A;  4K2D A;  1K3Y A;  3C1S A;  4N0Z A;  4AJ7 A;  13GS A;  5AIS A;  1G7O A;  5A1N B;  2BJX A;  2AAW A;  1O85 A;  1ZYP A;  1YKC A;  2B6M A;  5IO2 A;  2YCD A;  3BBY A;  5A34 B;  2G0F A;  4J57 E;  5D9W A;  4F0B A;  2P0G A;  4A5P A;  4V1A g;  3GMF A;  3PGT A;  4GRF A;  4K5S A;  1MDI A;  3F6D A;  3TOT A;  1PMT A;  3F6F A;  5F8B A;  19GS A;  5CRE A;  4KW6 A;  3L9V A;  1XW6 A;  1TRU A;  3A5I A;  4BVX A;  3BJ5 A;  4H86 A;  2YOI A;  4V1A p;  2IN3 A;  2LKU A;  4ILF A;  4IGJ A;  2G2Q A;  1IYI A;  5L71 A;  3ZFL A;  3GSS A;  5H5S A;  2TRC P;  1OE7 A;  3ZZX A;  1GSS A;  3F63 A;  3GV1 A;  1EEM A;  4YQV A;  1ZYQ B;  5JWO B;  2K8S A;  4NMU A;  1CQH A;  4V2M A;  4AKH A;  2F3M A;  2VCV A;  3GN3 A;  1AUC A;  2OBK A;  1EGO A;  2B5Y A;  3CHX C;  1TK0 B;  2ES7 A;  3W8J A;  4WF4 A;  1NW2 A;  3CSJ A;  3HA9 A;  3HZ4 A;  2WB9 A;  4MAB A;  4P3Y B;  3MDK A;  1THO A;  4IEL A;  3F8U A;  3PPU A;  5D9T A;  1I9D A;  1SL2 B;  17GS A;  3FYG A;  2V41 A;  1OYJ A;  1GTU A;  3PIN A;  1C72 A;  1ML6 A;  5JWQ B;  2H0I A;  1AQW A;  4I2T A;  4KND A;  2VLT A;  5A5H A;  2YWO A;  1SVL A;  5BRT A;  1BF5 A;  4PUF C;  2CAI A;  2E2M A;  3CBU A;  1M2D A;  4AF2 A;  2C0G A;  5D93 A;  4QL9 A;  1NM3 A;  2CZ2 A;  2OE0 A;  1E2Y A;  4ZL9 A;  2GT5 A;  3TUE A;  3K8N A;  6GSS A;  3LQ7 A;  5CRD A;  2LST A;  2YZH A;  3F3Q A;  2VD0 A;  5HR3 A;  2LRN A;  5IPG A;  2LJR A;  2FLS A;  4MZW A;  2BMX A;  3OR5 A;  2HSN A;  4PGT A;  3TKS E;  4E8H A;  4KAE A;  5DQS A;  5LD0 A;  5B6M A;  3KEB A;  1FB0 A;  3BCI A;  2GSS A;  2IIY A;  3ISO A;  2YJH A;  1K0O A;  3Q19 A;  5EVO A;  5IPH A;  4NHW A;  4JE1 A;  4WBJ A;  2LV3 A;  3C7M A;  1V2A A;  5F05 A;  2CVD A;  1T7P B;  4PHZ C;  1USB A;  4XCS A;  4MJB A;  4G9H A;  1DUG A;  1JHB A;  2EC4 A;  3GTU B;  2LRC A;  1A2L A;  1TKD B;  3CQF A;  4FXY P;  1TI1 A;  3DGQ A;  1MD4 A; 
#chains in the Genus database with same CATH homology
 4N11 A;  4I5Q A;  1PN0 A;  1S3A A;  2I1U A;  4OO4 A;  4PTS A;  3CYN A;  1SK0 A;  3VPQ A;  4J2F A;  3KTL A;  6GSW A;  2HZE A;  3EVI A;  2AHE A;  3IR4 A;  1HQO A;  3ERW A;  2H72 A;  2ON5 A;  3EUR A;  2P5R A;  3LG6 A;  2EIR A;  3D22 A;  3GH6 A;  3VFI A;  3CTG A;  3HYP A;  3GYK A;  3ZRD A;  4K7O A;  3NIV A;  2TIR A;  1QUW A;  3TKQ A;  4D73 A;  4DSR A;  2IMI A;  3KD0 A;  3IHG A;  5F07 A;  4IP6 A;  3KM6 A;  2I81 A;  3TKP A;  4HU9 A;  2RM5 A;  4ECC A;  3KZQ A;  2PBJ A;  1EV4 A;  4HEA 2;  4BA7 A;  3ERG A;  4LLR A;  4K5R A;  2PGT A;  1Z7R A;  4L0U A;  4AKI A;  2AUV A;  4CY8 A;  1SK2 A;  2XPE A;  2LQQ A;  5IOX A;  3HVV A;  3QDN A;  2DJJ A;  1FG4 A;  3HJP A;  1ABA A;  1M99 A;  2GSR A;  2H1L A;  2GS3 A;  2PMT A;  1K3L A;  3VWV A;  5HFG A;  1OC8 A;  1XZO A;  4E8E A;  1K0N A;  5C00 A;  3WT1 A;  1N25 A;  1Y1U A;  2J9H A;  2EIO A;  3DEX A;  2EIQ A;  2MBT A;  3WGE A;  1ZYN A;  2NBS A;  2DSA A;  1GSY A;  3UBL A;  3LJR A;  1LJR A;  2E7P A;  3HVX A;  3CMI A;  1O81 A;  1TU8 A;  2VCW A;  5DDL A;  4YKF A;  1EZK A;  1ZMA A;  4K1F A;  3C1R A;  3EIN A;  2YPM A;  4IQ1 A;  4K0N A;  4TKY A;  4TVE A;  3US3 A;  3UL3 A;  4PQ1 A;  2M46 A;  2P31 A;  5IQY A;  1SL1 B;  4J56 E;  5H5R A;  4MDC A;  2OJL A;  1O73 A;  2VL2 C;  5CRW A;  5DCG A;  5G5E A;  4WET A;  1T00 A;  3RBT A;  2MMZ A;  3KH7 A;  4NV5 A;  5ECM B;  3FR6 A;  3GKM A;  1JZW A;  2VL9 A;  4K9Z A;  2N5A A;  3CXG A;  4E68 A;  4MP4 A;  1Q98 A;  3O6T A;  2R5G A;  2OAD A;  3M3M A;  2C3Q A;  4MK3 A;  3RDW A;  2C3N A;  4TN8 A;  2R3X A;  1YEX A;  1RQM A;  3I6A A;  5HR0 A;  1URM A;  3EMX A;  4TXV A;  2JL4 A;  5HR2 A;  5CRG A;  3VI5 A;  5ID2 B;  1JZD A;  3I43 A;  2XC2 A;  3L9S A;  2A2R A;  2IMD A;  3F9U A;  4NHZ A;  1AIU A;  1A24 A;  1ERU A;  2O7K A;  2YWI A;  2HSM A;  1X5D A;  4G0K A;  2H0G A;  1R26 A;  4TW5 A;  3D4T A;  5HFK A;  5JCW A;  1XWC A;  4MNN A;  2H73 A;  1I5G A;  1YQ1 A;  5C04 A;  4Z2T A;  4NAX A;  1ACV A;  1XIY A;  2FWH A;  2OE3 A;  4KDX A;  2MBS A;  1ERV A;  4OFT A;  5A5K A;  1XWA A;  4DVC A;  4BWS A;  2FHE A;  3IPZ A;  1B9X C;  1KEB A;  5ECS A;  2VOC A;  1TRV A;  2DJ0 A;  3GNJ A;  5A34 A;  1X0R A;  1J08 A;  4MJA A;  4IJ3 A;  4MH2 A;  3O76 A;  3QOU A;  1SL0 B;  1GTA A;  1U3A A;  3ZLP A;  4BL7 B;  4JR6 A;  1GNW A;  5ECL B;  6GSX A;  2CVK A;  1SD9 A;  2KUC A;  3Q74 A;  3HCZ A;  4DEJ A;  4HJ2 A;  5DVB A;  1AW9 A;  3ZML A;  3V1W A;  1S3C A;  4ID0 A;  2TRX A;  4YAV A;  1SK1 A;  3WYW A;  4ML6 A;  3KTB A;  4N3Z A;  1YY7 A;  3DYR A;  1XVQ A;  5ECO B;  1AQX A;  1EOG A;  2C0F A;  3HVS A;  2GST A;  3FRC A;  3FMW A;  2C8U A;  3EU4 A;  5COH A;  1WJK A;  2X8G A;  1B9Y C;  4F0C A;  4ZBB A;  3TRP A;  1TI3 A;  5DAK B;  1V40 A;  3G7I A;  5IMF A;  2OA7 A;  3NZN A;  1A0F A;  4LA1 A;  2DML A;  2PN8 A;  2Z9S A;  1BQ7 A;  1MD3 A;  3TJB A;  2HSM B;  1HYU A;  4EXJ A;  4K7N A;  1YF1 A;  1SYX A;  3PH9 A;  3CRU A;  22GS A;  3FZ5 A;  1OC3 A;  1UC7 A;  2RUF A;  5HQP A;  3M8N A;  1VGL A;  1EP7 A;  2E0Q A;  2IJY A;  4K2X A;  1N2A A;  4POB A;  3D5J A;  2NPB A;  1Z6N A;  1GP1 A;  2CZ3 A;  1F9M A;  2H19 A;  5DCH A;  3KCM A;  4MZC A;  4XS4 B;  5KN2 A;  1TRS A;  5KN1 A;  1FO5 A;  4WKW A;  1XCC A;  4FYB A;  4K8M A;  1K0D A;  4QQ7 A;  5A4V A;  2P5Q A;  4DSS A;  3FZ9 A;  2KHP A;  2QC7 A;  4GLT A;  4X1U A;  1M2A A;  5BMU B;  5CP1 A;  3A3T A;  2C3T A;  1B4Q A;  1U88 A;  5AIX A;  3FR9 A;  3D0Z A;  7GSS A;  1JZO A;  4AKX B;  4MLY A;  2C80 A;  3DWV A;  5ECK B;  11GS A;  2LRT A;  4EDZ A;  6GSY A;  1UN2 A;  1W89 A;  1XOB A;  3MYD A;  2L5O A;  4HOJ A;  1A8Y A;  2RM6 A;  2O8V B;  3GTU A;  2GQK A;  3VK9 A;  5J40 A;  1DE2 A;  5G2Z A;  2H71 A;  2HQT A;  3MAK A;  1FB6 A;  4NPB A;  2M80 A;  4X0X A;  2V32 A;  4ZBD A;  2JU5 A;  4ULX A;  2HNL A;  3QAW A;  5ELG A;  1ERW A;  2KLX A;  3FEU A;  2JZR A;  5J4U A;  2ZUP A;  1DBY A;  2MZC A;  2DLX A;  3M9K A;  1V57 A;  3UOM A;  1GLP A;  2RUE A;  3ZIV A;  2HZF A;  1XFL A;  5IIZ A;  4FIW A;  1O8X A;  1AAZ A;  2N5B A;  2DBC A;  3ZTL A;  3O3T A;  1JFU A;  2JSY A;  3RHC A;  3ZYW A;  4HU7 A;  2H8L A;  1SVO A;  1PA3 A;  3CTF A;  4TR4 A;  2HRK B;  1GRX A;  3AY8 A;  6GST A;  4MJC A;  3FZ4 A;  4AJ6 A;  3GIX A;  3TOU A;  5GAN D;  4Q5N A;  3H79 A;  3LWA A;  3UEM A;  3UIW A;  2WDU A;  5CO3 A;  4IKH A;  2JAC A;  2H74 A;  3D6I A;  5J3R A;  4K6X A;  4GQF A;  2GSQ A;  1J0F A;  2K9F A;  3TJJ A;  4MF5 A;  3UAR A;  1WP0 A;  2JZS A;  3IA1 A;  1ZOF A;  4DSS B;  1TW9 A;  1ZCP A;  3QAV A;  4Z2R A;  1AC1 A;  2PER A;  3DML A;  2GDR A;  4RQX A;  4IBP A;  3D21 A;  1V58 A;  4KH7 A;  2FNO A;  3A2V A;  2VKZ G;  4LL4 B;  1X9W B;  2MYG A;  3FY7 A;  1A2M A;  4CHS A;  2A2P A;  3LEF A;  4JRR A;  1B8X A;  4ECB A;  3BCK A;  4L5L A;  3G7J A;  3GX8 A;  3GKX A;  4F82 A;  1GLQ A;  1IYH A;  2X49 A;  3ZIJ A;  5KOX A;  3HHV A;  4O92 A;  2I3Y A;  4YQM A;  3FR3 A;  1F37 A;  3KGK A;  1EGR A;  2FCH A;  1HD2 A;  3DKS A;  1OC9 B;  2AYT A;  1SYR A;  1O8W A;  5G1K A;  2FY6 A;  3IV4 A;  2DKH A;  2L4Q A;  3P8W A;  4ECI A;  1X5E A;  5AGY A;  1PRX A;  2X99 A;  3MIX A;  1N8J A;  4G10 A;  3L0H A;  4RQR A;  3A2W A;  1SJI A;  4IJI A;  3UVT A;  3KXO A;  2PU9 C;  3VWW A;  4KF9 A;  2ON7 A;  2B1K A;  4ICY A;  4TR3 A;  1PL1 A;  1T3B A;  2DC5 A;  5DJL A;  2VCQ A;  2OKA A;  4PQH A;  4ZL7 A;  1OKD A;  1PN9 A;  3WGD A;  4G01 A;  2EFH A;  1QFN A;  4IQA A;  2OAC A;  1EEJ A;  2F51 A;  1ON4 A;  4ML1 A;  3TJG A;  2JAD A;  2CQ9 A;  2JZT A;  2ZCT A;  4KCA A;  4O7H A;  5FHI A;  2KOK A;  5ID2 A;  3UMA A;  2EFE A;  4IHU A;  5F0G A;  1AQV A;  4PXO A;  5IOW A;  4KGI A;  2PVO C;  4ZIL A;  4JU5 A;  1OVN A;  3GUS A;  4KDU A;  3RPN A;  3QCP A;  3UJ1 A;  4IVF A;  2DJ2 A;  3APQ A;  2R6K A;  4MPF A;  1GSF A;  4DSQ A;  2K8V A;  2R0G A;  5CRH A;  5E59 A;  2OE1 A;  3RAZ A;  3DVW A;  3C73 A;  2X8C A;  4O5U A;  4HJM A;  5CNW A;  5DQY A;  3ZRE A;  4FQU A;  4CW9 A;  1EOH A;  3IXR A;  2V1M A;  3FK8 A;  3TKR A;  1QXH A;  5CYY A;  3F0I A;  4IP1 A;  3DVX A;  1X9S B;  3GUR A;  4GCI A;  4TXO B;  2IWT A;  2F9S A;  2UZ8 A;  2QKE A;  4FYU A;  4I6X A;  4BPY A;  3CSH A;  3ZFB A;  2I4A A;  3EU3 A;  1OAZ A;  1PSQ A;  1SJ6 A;  3LFL A;  4OO5 A;  1YF0 A;  3CWG A;  1JZR A;  1PL2 A;  2V6K A;  1T8E B;  2YZU A;  2HSY A;  4BL7 A;  2H0H A;  4L8E A;  5J9C A;  3A5W A;  4JZQ A;  1R4W A;  2B5E A;  2WGR A;  1FVJ A;  4V2L A;  1YEP A;  1K0B A;  3D4M A;  3KJY A;  3I69 A;  2VAF A;  4PQI A;  2CX4 A;  2EFD A;  3LXZ A;  4QL7 A;  1BAY A;  2FUG 2;  3N9J A;  4GXZ A;  2QSI A;  4Q5F A;  4ISD A;  4RUV A;  1VF2 A;  3ME7 A;  2R2J A;  1TP9 A;  4GTU A;  4GSS A;  1BX9 A;  3J7Y b;  5J5N A;  2DIZ A;  2C4J A;  1U6T A;  4USS A;  5A4U A;  4W66 A;  1TJD A;  4Z7X A;  5DAK A;  1Z5Y E;  5J4V A;  4K0G A;  4Z2U A;  5IM9 A;  4NV2 A;  4PX1 A;  3DXB A;  4EIQ A;  5KN0 A;  1YZX A;  2CA8 A;  3L4N A;  2MMN A;  4KSM A;  3WGX A;  2V6O A;  3KIJ A;  3GH9 A;  2VLV A;  4EDY A;  4MZB A;  1X5C A;  3HJO A;  4OWY A;  3SWL A;  2ZNM A;  2EFC A;  3EPT A;  3EYT A;  5GST A;  3IDV A;  1GTB A;  5CAX A;  2N5F A;  5FT3 A;  3Q6O A;  1X9M B;  3H93 A;  4XIH A;  5EY6 A;  2R0P A;  3LYP A;  4AKG A;  4YQU A;  1HNC A;  9GSS A;  5HR1 A;  1J9B A;  5J47 A;  3QFA C;  3TKS A;  5EL8 A;  3LYK A;  4XS4 A;  1BYE A;  5INY A;  2GVP A;  4Q5Q A;  4L0W A;  4AI6 A;  5IMZ A;  1K0A A;  3F4T A;  2FWG A;  5J4Y A;  3QPM A;  2B7J A;  1XWK A;  5IMC A;  5G31 A;  3WT2 A;  5BMU A;  3DIE A;  1MEK A;  1K3O A;  2XBQ A;  3J7Y k;  2PUK C;  4OFN A;  5ABR A;  1A2J A;  1R7H A;  2QGV A;  1Z7P A;  5HFI A;  1WOU A;  2KP1 A;  1M7T A;  1PGT A;  2LTK A;  2A4V A;  4MF6 A;  4ZIJ A;  1YDK A;  3UAP A;  3I9V 2;  3UBK A;  2HRN A;  1LBK A;  1SVM A;  4HS1 A;  3HZ8 A;  3HD5 A;  3F4S A;  3APO A;  3HKR A;  2GQL A;  2IFQ B;  1GUK A;  3EC3 A;  4WEY A;  2NDO A;  1F6M C;  4JED A;  2WS2 A;  1O7U A;  3QR6 A;  3TDG A;  4WR4 A;  1TDI A;  3UVH A;  1WMJ A;  1FVK A;  4Q5R A;  2H76 A;  4HDE A;  3LSZ A;  4YKG A;  4MA9 A;  1TU7 A;  1QGV A;  1SEN A;  2X64 A;  3VLN A;  1Y6E A;  3GKK A;  1GSE A;  2HRK A;  2AV4 A;  1XOA A;  3TRQ A;  3IRA A;  1ZYE A;  2H6Z A;  3KMN A;  5IMA A;  3W6G A;  3TU3 B;  4QMK A;  3RHB A;  1AXD A;  2F8F A;  1Z9H A;  1G7E A;  3P90 A;  2K18 A;  2O85 A;  2A4H A;  4BVY B;  2H1B A;  1FOH A;  3APS A;  4G0L A;  4XHM A;  3N5O A;  2DJ1 A;  3HJM A;  2LEG A;  4EF0 A;  4XRA A;  5DAL B;  1XPV A;  4MCU A;  3H1N A;  4ZB8 A;  1M9B A;  2D2Z A;  1VF4 A;  4X43 A;  2XPD A;  3H8Q A;  4ECJ A;  3E3E A;  4O32 A;  1H4O A;  2I9H A;  3JCM L;  5G5F A;  4I2U A;  1PKW A;  1R5A A;  2C1Y A;  4XRD A;  2DMM A;  2DIY A;  2H1A A;  2VCT A;  4TR1 A;  4HQS A;  1TXU A;  3ED3 A;  2PVQ A;  3KP9 A;  1F2E A;  1H75 A;  4G19 A;  3TGZ A;  1DE1 A;  3BOA A;  3HXS A;  1TXX A;  2CV4 A;  2H6Y A;  3LGC A;  3P7X A;  2L59 A;  1KTE A;  5DBQ A;  5ENU A;  1XXU A;  2GT6 A;  1BG1 A;  4POK A;  3GL5 A;  4KX4 A;  4TOP A;  4KDY A;  1OC9 A;  1WWJ A;  1LU4 A;  2HE3 A;  2VCX A;  1T4Y A;  3IC8 A;  2F8A A;  3FHK A;  4MMM A;  1BG5 A;  3NOF A;  2MMO A;  4OMV A;  1GSU A;  2YP6 A;  1T1V A;  1GUH A;  3LXT A;  5LCZ A;  3VWX A;  2JSZ A;  1A23 A;  3L9U A;  4WXT A;  2AJQ B;  4GDF A;  2O87 A;  4OD7 A;  4ZL8 A;  1GL8 A;  3F3R A;  4LMV A;  2J23 A;  2X8H A;  4O5Q A;  5B6N A;  4GSN A;  2C0E A;  2FWE A;  2CAQ A;  3IHQ A;  3IBH A;  3G9B A;  2LNS A;  1HNB A;  4L5O A;  3IAS 2;  2NTO A;  2MMA A;  4YAP A;  3KP8 A;  1ST9 A;  3M1G A;  16GS A;  1S3D A;  3MNG A;  2HT9 A;  2H70 A;  2RLI A;  4X4J A;  3M9J A;  4F03 A;  1YKA A;  3VPT A;  1FAA A;  2YNX A;  3U6V A;  4F9Z A;  1B4P A;  4TR0 A;  4JBB A;  1RW1 A;  2GTU A;  4FYC A;  4N10 A;  2HLS A;  1MDK A;  4WF5 A;  1XW9 A;  3KMO A;  4CY6 A;  3FZA A;  4ZBA A;  2CVB A;  5D9X A;  6GSU A;  2DJK A;  3IOS A;  3QMX A;  3LW9 A;  3EWL A;  2GQM A;  4HQZ A;  2YN1 A;  2HRA A;  1PKZ A;  1V9W A;  3ZMK A;  1G6Y A;  3KH9 A;  2O5V A;  2H6X A;  1NHY A;  2REM A;  1E6B A;  2B7K A;  2ALB A;  18GS A;  1CQG A;  4WBR D;  4G0I A;  5F06 A;  2YWM A;  1VF3 A;  2VIM A;  3VI7 A;  4TR1 B;  4NXI A;  3IE3 A;  5JCU A;  4KUN A;  4GF0 A;  3HY2 A;  10GS A;  4EL1 A;  3ZL5 A;  4TXO A;  4BVX B;  2IMF A;  5JWR B;  1GSD A;  3VWU A;  1VF1 A;  4ACS A;  2L57 A;  3SBC A;  3TCO A;  4MF7 A;  3GKN A;  1BED A;  1FOV A;  5JCG A;  4I97 A;  6GSV A;  1TK5 B;  3HMJ G;  3WD6 A;  2VLU A;  2K6V A;  1KBN A;  3MWH A;  4IW9 A;  1JLV A;  4MPG A;  1OKT A;  5FWG A;  3E0U A;  1M9A A;  4JR4 A;  3A2X A;  1NHO A;  5IMV A;  3CSI A;  2PWJ A;  2B3S A;  1ILO A;  1Z3E A;  4AGS A;  2YJ7 A;  2R0C A;  4V2N A;  1TK8 B;  2HXK A;  3U5R E;  2VO4 A;  2H30 A;  12GS A;  4ZB9 A;  4IS0 A;  1K0M A;  4EVM A;  1GUL A;  4ZXG A;  2GGT A;  4IN0 A;  4ZB7 A;  4YH2 A;  3ME8 A;  3PR8 A;  3QFB C;  4ZB6 A;  1PX6 A;  4KA0 A;  2WRT A;  5A5H B;  3W8S A;  4PUR A;  5J9B A;  3GHA A;  1EP8 A;  2WJU A;  5A4W A;  2HYX A;  3BD2 A;  1OE8 A;  3EE2 A;  1PQN A;  4FH8 A;  3Q18 A;  1BJX A;  4HI7 A;  1XBS A;  2WFC A;  1V98 A;  1A8L A;  1HNA A;  2WZ9 A;  4KB3 A;  1B48 A;  2FA4 A;  2HRF A;  1GUM A;  2R4V A;  4WR5 A;  5IMD A;  4XTS A;  1TRW A;  1TTZ A;  2GZY A;  1SKW B;  2LUS A;  4AJ8 A;  2HSN B;  2CX3 A;  2V2G A;  2GLR A;  2DJ3 A;  5B8A A;  3VUR A;  4CDO A;  2H66 A;  3MSZ A;  4HZ2 A;  4KSO A;  2VCZ A;  1Z6M A;  2IME A;  3C71 A;  1WRY A;  5ECH B;  5G30 A;  2A2S A;  4O5R A;  2YV7 A;  2IL3 A;  5D73 A;  2NVL A;  2R37 A;  2L6C A;  5ECN B;  1THX A;  1G6W A;  3P2A A;  1QMV A;  3ZIT A;  4RI6 A;  5KEJ A;  4N0V A;  4NWY A;  5GSS A;  20GS A;  3L78 A;  5AN1 A;  5D96 A;  4EE0 A;  4GST A;  1MDJ A;  4F2I A;  1ZL9 A;  2QA1 A;  4G2E A;  2C0D A;  3H4K A;  4POM A;  2HFD A;  5B8B A;  4EC0 A;  5DJM A;  1R5P A;  2HZE B;  4TRX A;  1XWG A;  1GSQ A;  4BWQ A;  2IPA A;  3E9J B;  4GWR A;  2FD3 A;  2DKI A;  2WUL A;  3GFK A;  5J41 A;  2YV9 A;  1FW1 A;  4EKZ A;  2OBI A;  1A0R P;  5B7C A;  3TB2 A;  4PNG A;  3TJF A;  1GTI A;  3R3E A;  1EWX A;  1F3B A;  2GZZ A;  2VL2 A;  1U3I A;  2WCI A;  4N30 A;  2UV8 G;  2LS5 A;  4OCE A;  4D73 B;  1SKS B;  3FKF A;  4LL1 B;  1ZGN A;  1SD8 A;  2M72 A;  5GZZ B;  2IFQ A;  3M0F A;  1QK8 A;  2H1G A;  3GA4 A;  2GZP A;  2B5X A;  1M2B A;  2VUP A;  1Q4J A;  1K0C A;  1GH2 A;  2CT6 A;  1WIK A;  4MJE A;  1RK4 A;  2VM2 A;  5EPF A;  1XVW A;  4KCE A;  5ECR B;  2YAN A;  5D9V A;  2H01 A;  2LJK A;  1KNG A;  4OFM A;  3FW2 A;  5IO0 A;  1SU9 A;  3IC4 A;  2YWN A;  2FGX A;  4EIP A;  3TKS C;  1U87 A;  3R2Q A;  1VRS D;  1Y25 A;  2HI7 A;  1QQ2 A;  3DRN A;  2L4C A;  4KE3 A;  2BTO T;  1WPI A;  4BVY A;  3IK7 A;  3GX0 A;  2XBI A;  1GWC A;  2OT3 A;  1YVL A;  2XHF A;  5DAL A;  4FO5 A;  5A1N A;  3QAG A;  1MTC A;  4EO3 A;  2AB6 A;  2L5L A;  5ELA A;  4LMW A;  1UA5 A;  5ECP B;  5AIV A;  2O89 A;  3IAM 2;  2VD1 A;  4HZ4 A;  8GSS A;  2QA2 A;  3GRX A;  3HDC A;  4POL A;  4EUY A;  3G7Y A;  1XW5 A;  3S9F A;  2KP2 A;  1NSW A;  2LJA A;  2PPT A;  3DD3 A;  1WE0 A;  5E4W A;  1FHE A;  2RII A;  4RI7 A;  3GL3 A;  2H1D A;  3TJK A;  2E2G A;  2X4A A;  4PNF A;  1YJ6 A;  1PD2 1;  1ERT A;  5LNK e;  2H75 A;  2IMK A;  2B1L A;  3ZVJ D;  1SJZ A;  5GAP D;  3QD9 A;  3IK9 A;  1JLW A;  1ZZY A;  1XWB A;  1O6J A;  4HUA A;  2HSH A;  4OCF A;  2LQO A;  5KN3 A;  3ERF A;  5KOW A;  2L6D A;  1TOF A;  4MH3 A;  1M0U A;  2FA8 A;  1F3A A;  2FWF A;  2LNT A;  3C8E A;  4PUA A;  2VM1 A;  5ECQ B;  3GST A;  1W4V A;  3CRT A;  1T4Z A;  4GQC A;  5D8I A;  3ZVJ A;  1EV9 A;  1G0T A;  2VL3 A;  5H5Q A;  3TRX A;  14GS A;  4I8B A;  3F4R A;  3LOR A;  1SKR B;  1PX7 A;  1UVZ A;  4XS1 A;  3RPP A;  1DSB A;  5G1L A;  4XS6 A;  5ECI B;  3EMP A;  4K7I A;  1GNE A;  4K2D A;  1K3Y A;  3C1S A;  4N0Z A;  4AJ7 A;  13GS A;  5AIS A;  1G7O A;  5A1N B;  2BJX A;  2AAW A;  1O85 A;  1ZYP A;  1YKC A;  2B6M A;  5IO2 A;  2YCD A;  3BBY A;  5A34 B;  2G0F A;  4J57 E;  5D9W A;  4F0B A;  2P0G A;  4A5P A;  4V1A g;  3GMF A;  3PGT A;  4GRF A;  4K5S A;  1MDI A;  3F6D A;  3TOT A;  1PMT A;  3F6F A;  5F8B A;  19GS A;  5CRE A;  4KW6 A;  3L9V A;  1XW6 A;  1TRU A;  3A5I A;  4BVX A;  3BJ5 A;  4H86 A;  2YOI A;  4V1A p;  2IN3 A;  2LKU A;  4ILF A;  4IGJ A;  2G2Q A;  1IYI A;  5L71 A;  3ZFL A;  3GSS A;  5H5S A;  2TRC P;  1OE7 A;  3ZZX A;  1GSS A;  3F63 A;  3GV1 A;  1EEM A;  4YQV A;  1ZYQ B;  5JWO B;  2K8S A;  4NMU A;  1CQH A;  4V2M A;  4AKH A;  2F3M A;  2VCV A;  3GN3 A;  1AUC A;  2OBK A;  1EGO A;  2B5Y A;  1TK0 B;  2ES7 A;  3W8J A;  4WF4 A;  1NW2 A;  3CSJ A;  3HA9 A;  3HZ4 A;  2WB9 A;  4MAB A;  4P3Y B;  3MDK A;  1THO A;  4IEL A;  3F8U A;  3PPU A;  5D9T A;  1I9D A;  1SL2 B;  17GS A;  3FYG A;  2V41 A;  1OYJ A;  1GTU A;  3PIN A;  1C72 A;  1ML6 A;  5JWQ B;  2H0I A;  1AQW A;  4I2T A;  4KND A;  2VLT A;  5A5H A;  2YWO A;  1SVL A;  5BRT A;  1BF5 A;  4PUF C;  2CAI A;  2E2M A;  3CBU A;  1M2D A;  4AF2 A;  2C0G A;  5D93 A;  4QL9 A;  1NM3 A;  2CZ2 A;  2OE0 A;  1E2Y A;  4ZL9 A;  2GT5 A;  3TUE A;  3K8N A;  6GSS A;  3LQ7 A;  5CRD A;  2LST A;  2YZH A;  3F3Q A;  2VD0 A;  5HR3 A;  2LRN A;  5IPG A;  2LJR A;  2FLS A;  4MZW A;  2BMX A;  3OR5 A;  2HSN A;  4PGT A;  3TKS E;  4E8H A;  4KAE A;  5DQS A;  5LD0 A;  5B6M A;  3KEB A;  1FB0 A;  3BCI A;  2GSS A;  2IIY A;  3ISO A;  2YJH A;  1K0O A;  3Q19 A;  5EVO A;  5IPH A;  4NHW A;  4JE1 A;  4WBJ A;  2LV3 A;  3C7M A;  1V2A A;  5F05 A;  2CVD A;  1T7P B;  1USB A;  4XCS A;  4MJB A;  4G9H A;  1DUG A;  1JHB A;  2EC4 A;  3GTU B;  2LRC A;  1A2L A;  1TKD B;  1TI1 A;  3DGQ A;  1MD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...