1C72A

Tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Tyr115, gln165 and trp209 contribute to the 1, 2-epoxy-3-(p-nitrophenoxy)propane-conjugating activity of glutathione S-transferase cGSTM1-1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 71
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1c72A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1c72A01
4POBA 4KGIA 3TRPA 1TKDB 3HZ4A 2HYXA 3G9BA 2OKAA 3M9JA 3L9UA 1OC8A 4ZXGA 4IJ3A 1K3YA 16GSA 5F06A 3HZ8A 1HNCA 9GSSA 5A4VA 3A2XA 3QAWA 2YWOA 5D9VA 4XS1A 2IMDA 2IPAA 3KMNA 2HRFA 13GSA 2CT6A 2E7PA 4I5QA 1MD3A 4ZB6A 2ON5A 1X5EA 5B6MA 1VF4A 3LORA 2YCDA 4DEJA 1QGVA 5EPFA 4CDOA 4NPBA 1TK0B 2FD3A 1O85A 2B5EA 3VWUA 4GRFA 3A3TA 4Q5NA 1FHEA 4DSSB 3MAKA 2BTOT 2LQQA 5G31A 3ERFA 3GUSA 1A8LA 3NZNA 1JZDA 5IMAA 2RLIA 3TB2A 3LXZA 4MZBA 4GQFA 3CRTA 5IMCA 5FT3A 4FQUA 4ECBA 5FWGA 4MJBA 1ZZYA 3F9UA 1G7OA 2IFQB 2QC7A 3QFBC 2HFDA 4FO5A 2K8SA 1BAYA 1HNAA 4NWYA 4D73A 5H5QA 1FO5A 5DALA 3IC4A 1A8YA 4OFMA 3P7XA 1TRWA 1MTCA 4K9ZA 1JLWA 4MF6A 5HR0A 3WT2A 4IBPA 3FZAA 1TRSA 3D22A 3ZREA 4IS0A 5IMVA 2LS5A 2AYTA 2H1BA 1T8EB 2LJAA 3GNJA 4EE0A 2FA8A 3M0FA 6GSXA 1WIKA 3VI7A 3GKKA 1LBKA 4IGJA 3G7JA 4HQSA 2G2QA 1X9MB 2LTKA 3D5JA 3IK7A 4ID0A 3TCOA 1G0TA 1V2AA 1NHYA 3IRAA 4ULXA 1O8XA 2H0GA 2OE0A 1GTAA 4F82A 2GT5A 4ECIA 3S9FA 1XW9A 3F3RA 2VOCA 1WRYA 4FYUA 1GTIA 2VD0A 1TI1A 1V9WA 1FG4A 4RI6A 3CRUA 5ABRA 2JZRA 1OC9B 3GKMA 5IM9A 4MF5A 5ECIB 2MBSA 4AJ7A 3NIVA 1AC1A 2DMLA 2H1GA 4MPGA 1EP8A 4HS1A 5AIVA 4MABA 1T00A 2JADA 2OJLA 3UOMA 4Q5QA 2R2JA 4ZL9A 2IIYA 2C1YA 3UMAA 1GTBA 3QAVA 1TK8B 2AHEA 1EV9A 3AY8A 2GZZA 2VIMA 3G7YA 1SK0A 4LL4B 2HE3A 4TXOA 1FW1A 2PVQA 5ID2A 4LL1B 3KMOA 3L4NA 1MDIA 2HXKA 4PURA 1K3OA 3CSJA 3O3TA 4GTUA 1WOUA 3CXGA 1W4VA 1M2DA 1A0RP 2WULA 4BL7A 4GQCA 5EL8A 2HSMA 1NHOA 3QCPA 1OAZA 2I4AA 2DIYA 4PTSA 3PPUA 2UZ8A 5KEJA 3UVTA 2V6OA 1SKSB 3C1RA 1SK2A 1QXHA 3GV1A 3D4MA 4L0UA 3ZVJA 4BWSA 1YF1A 4PXOA 1TOFA 2X99A 2PBJA 4BWQA 3G7IA 1VF3A 1F9MA 1GUMA 3FZ5A 2R3XA 4TRXA 3H8QA 2YJHA 4YQUA 1E6BA 2VLTA 2ES7A 1ON4A 3ZRDA 3EURA 1IYHA 3J7Yk 2ON7A 3CMIA 3IAS2 2GT6A 3RBTA 3GYKA 4IN0A 3UL3A 4Q5FA 4PX1A 2R4VA 1BX9A 5ECPB 1ZMAA 4Q5RA 1EZKA 4IJIA 4TVEA 5LNKe 1A0FA 2B3SA 5C00A 2HRKA 1V57A 3TOUA 2GSQA 5EVOA 14GSA 3ZZXA 1T4ZA 2L59A 3GURA 3KCMA 3QR6A 4YAPA 1UN2A 5IIZA 4RUVA 2LQOA 1J9BA 1ZOFA 2VD1A 1XCCA 3W6GA 4GSTA 2FLSA 5IPGA 4HZ4A 4KF9A 1ERTA 4D73B 2F8FA 3DVXA 4K0NA 5IMZA 5DALB 3ME8A 3D6IA 3VPQA 2AV4A 3BD2A 2F3MA 4GSNA 3WT1A 2HNLA 7GSSA 1WMJA 3HHVA 1SENA 4O5RA 5KN1A 2YN1A 1DBYA 5DJMA 4NHZA 4IKHA 5AIXA 3UJ1A 3HVXA 5BMUA 3US3A 1XWGA 1YEXA 2F8AA 2KP1A 3L0HA 4FYBA 1SYRA 2XBQA 1VRSD 5CYYA 2CAIA 3CTGA 3LGCA 2HZEA 4ILFA 3RPPA 4K8MA 2PMTA 3DKSA 1PL1A 1TRUA 1EEMA 2XBIA 2O89A 3DMLA 3H1NA 1KEBA 4PUAA 3C1SA 3KZQA 5F07A 2MMOA 4EDZA 3UEMA 3TJBA 4V1Ap 1OYJA 1GSDA 2GLRA 1JZRA 2GZPA 1YEPA 4RQRA 3KEBA 4EO3A 3VI5A 2X8GA 3TKQA 3ZVJD 2V6KA 1Y6EA 2Z9SA 2V32A 3DYRA 2TRCP 2O8VB 4V2MA 3F8UA 3IDVA 1DE2A 2H73A 3H79A 1J0FA 1WE0A 4OMVA 3Q18A 1BG5A 4I8BA 3EYTA 3Q74A 3VLNA 2YV9A 4TOPA 4KDYA 5D73A 6GSYA 2AAWA 1YKCA 2VCTA 1A23A 3HJMA 1SU9A 4IQAA 2AUVA 2FWEA 2LUSA 3IV4A 2HT9A 1AQXA 4TXOB 3FKFA 5ID2B 2GSSA 4KUNA 1R5PA 4NV2A 1ZL9A 2X8HA 3KD0A 2FGXA 4XS6A 4AJ6A 4G19A 2DLXA 4LMVA 1ZYEA 4IHUA 5IPHA 1EOHA 4IELA 4BL7B 2P5QA 1V40A 1SL0B 2J23A 3ED3A 2HSMB 3P2AA 2NBSA 4G2EA 3HVVA 3KJYA 4PGTA 2BJXA 2DJJA 2C3TA 4MJCA 4YQMA 4G0KA 2PPTA 3U5RE 1X9WB 3NOFA 1VF2A 2XPEA 3L9SA 5ECSA 4CHSA 1GL8A 2C80A 4K7OA 3HJOA 3BCKA 3WGEA 3EMPA 3TJFA 2TRXA 2FHEA 2I81A 2JACA 4KA0A 3GIXA 5J9CA 3FZ9A 1U3AA 4NHWA 4N0ZA 1AIUA 4HDEA 1XXUA 4TXVA 3ZIVA 5D96A 4HU7A 3KIJA 3M1GA 2TIRA 3VPTA 2MMZA 2CX3A 5GZZB 2XC2A 1OKTA 2WCIA 1Z7PA 4YAVA 4MK3A 1F3AA 1NW2A 2IMFA 1GNWA 2K9FA 2HRKB 1Z9HA 3BOAA 3DWVA 4KSMA 4ZB8A 2FWHA 1XPVA 1EV4A 1Z5YE 6GSWA 2HI7A 2CVBA 6GSSA 4GXZA 3UAPA 3ISOA 3ZFBA 2H30A 3IOSA 2H0IA 3TKPA 1K0CA 2O85A 4KB3A 3I43A 5GSSA 2I3YA 5DBQA 5J4UA 3F4RA 1XWKA 5DVBA 2VLVA 1U88A 2PERA 1PX7A 1U6TA 2DJ0A 1FOVA 3FYGA 1KNGA 4MMMA 3O6TA 3QOUA 5J9BA 3TRQA 4DVCA 4BPYA 2HZEB 5ENUA 4WR4A 1I5GA 1TTZA 2VCZA 5IMFA 4G9HA 4LLRA 1MD4A 4L5LA 3FR3A 1XWCA 3HCZA 3IK9A 2VCWA 4F03A 1PKZA 1M9AA 2WGRA 1HD2A 2X8CA 2C4JA 5E59A 2MZCA 6GSUA 1XWBA 2VCVA 4HJMA 3LXTA 4G0IA 5ECHB 3FW2A 1GRXA 5B8AA 4TR0A 3HA9A 4GF0A 5GAPD 3FZ4A 4MJAA 5JCUA 3MNGA 3JCML 5IOXA 5A5KA 5G1KA 4WR5A 1OVNA 3C73A 5CNWA 3GKNA 4OD7A 1T7PB 12GSA 3IC8A 19GSA 2LJRA 2LJKA 3CTFA 1GTUA 2P0GA 2PWJA 4F0BA 2O7KA 5H5SA 2GSRA 2KUCA 2VL3A 1YY7A 1JFUA 1T4YA 5L71A 1DE1A 2JU5A 2FA4A 4MZCA 4V2NA 4F9ZA 1BQ7A 1DSBA 3FR6A 1J08A 2YWIA 1WPIA 4HQZA 1M7TA 1GWCA 1Z6MA 4OFTA 4IP6A 1RK4A 3GA4A 1F2EA 3KH7A 4FIWA 3RDWA 17GSA 2C0GA 1TW9A 2DMMA 4N11A 1UC7A 2RM5A 2B7JA 1SD9A 5E4WA 2YANA 3LQ7A 1SL2B 2VLUA 4K7IA 1HQOA 5EY6A 4X1UA 3PGTA 1XIYA 5GSTA 4O7HA 1F3BA 2YJ7A 1SL1B 2M80A 3WD6A 4KDXA 5JCGA 1GSFA 1GUHA 2HLSA 3KP8A 3U6VA 1ERWA 4EXJA 1JLVA 5ECLB 2C0DA 2PN8A 2HRAA 3R2QA 2LEGA 4HEA2 1AUCA 4KAEA 2OBIA 2KLXA 1EGOA 3DRNA 2C3QA 1EGRA 1U87A 3N5OA 4ML6A 4EF0A 1B9YC 3TGZA 2WS2A 5CRHA 3TRXA 4QL9A 4JBBA 3KXOA 3GFKA 4I6XA 5HFIA 5D8IA 5F0GA 2H70A 2YZHA 4ZIJA 2H1DA 1CQHA 3BCIA 2NTOA 1IYIA 2HZFA 4WBRD 2R37A 4XCSA 3C8EA 1YKAA 4HJ2A 1SK1A 3GTUA 2QKEA 4HU9A 2K6VA 3HKRA 4MP4A 5DAKA 5CRWA 4YH2A 1BYEA 2A4VA 2J9HA 4NV5A 4PUFC 2H1AA 3L9VA 3EVIA 3QFAC 1W89A 3QPMA 5ECRB 2NVLA 3IA1A 2LSTA 4O32A 1FVKA 1K0BA 2EIOA 4PQHA 4RQXA 2V2GA 2F9SA 2NDOA 4PQ1A 4AGSA 5GAND 2AB6A 3F3QA 3EWLA 5ECNB 2I9HA 4EDYA 1GSYA 2VL2A 4KH7A 1OC3A 5D93A 3A2WA 1PKWA 1AW9A 4BVXA 5G5FA 2VUPA 3RAZA 1K0MA 6GSTA 1XZOA 4XS4A 5DQYA 3W8JA 3ZMLA 2RUFA 1HNBA 4BVYA 4ZBAA 2OADA 18GSA 4GLTA 4GSSA 2L5OA 2EIRA 4MH3A 4PNGA 3WYWA 1K0DA 4ECCA 2ZUPA 1AQWA 3MSZA 3TKRA 3BJ5A 3DXBA 3O76A 1QMVA 1URMA 2IJYA 3LYKA 3ZITA 1THXA 4ZILA 3KH9A 1N8JA 4ZBBA 2VL2C 2YWNA 4MA9A 5CREA 1JZOA 5G5EA 1S3DA 3VFIA 2V1MA 4LA1A 1Z6NA 5IQYA 2L5LA 2GQMA 4TKYA 4AJ8A 3VURA 4L8EA 2B7KA 1RW1A 3H93A 1I9DA 4IW9A 3F63A 4NAXA 1DUGA 1GLQA 3GRXA 2YOIA 1R7HA 2H6ZA 3C7MA 4YQVA 3UVHA 1PD21 3E0UA 1PQNA 4G10A 2EIQA 3FR9A 1QK8A 2CVKA 3MWHA 3ERGA 1A2LA 1T3BA 5KN0A 2H19A 5J5NA 1RQMA 1XW6A 1XVWA 3PR8A 2VAFA 4MJEA 3SBCA 3W8SA 4EL1A 1ABAA 1KTEA 2B5YA 1GSUA 2WJUA 1HYUA 3L78A 4K2DA 2B1LA 3A5WA 1M2BA 2IWTA 3D21A 5H5RA 2CQ9A 1TK5B 2DSAA 4AF2A 2H72A 3GX0A 4L5OA 2M46A 2FNOA 3HDCA 3TJGA 2A2SA 2JSYA 1K0AA 1FVJA 4RI7A 3VWWA 5F8BA 3GH9A 4F2IA 2WB9A 5D9TA 1N2AA 5DDLA 3APOA 1ERVA 2I1UA 2PU9C 1A24A 3ERWA 1SKWB 5COHA 3ZFLA 2QSIA 1O6JA 3KTLA 2FUG2 3TKSA 3GMFA 3TJJA 2VM1A 3F6DA 3IXRA 2VO4A 2GQLA 1LU4A 2OA7A 1JHBA 2D2ZA 1EOGA 1O7UA 2M72A 1QUWA 4OFNA 3IR4A 3QAGA 2VCXA 2H76A 3IE3A 3P90A 1ACVA 2GTUA 3DVWA 4MH2A 4OCFA 3E9JB 4MPFA 5HQPA 4TR1A 3M3MA 1X5DA 2IMEA 4WKWA 3KP9A 3GTUB 2DJ3A 2B6MA 3ZMKA 2CX4A 1B4QA 3GKXA 4TW5A 1BJXA 3Q6OA 4MLYA 3F6FA 5DAKB 4JE1A 2RUEA 1QFNA 1MDKA 4KE3A 3TKSC 1SJ6A 5B7CA 1PN9A 1TDIA 1GULA 2GQKA 2RIIA 2R5GA 3CYNA 4WF4A 5J3RA 1EWXA 2GVPA 1UVZA 1A2MA 4PQIA 3UBKA 4BA7A 2C3NA 4ZBDA 4JZQA 2V41A 2P31A 4ISDA 4POKA 1UA5A 11GSA 2L57A 2ALBA 3Q19A 1B9XC 5JCWA 4BVXB 4ZL7A 4V2LA 4ACSA 2YWMA 5ECOB 2FWGA 1O81A 3APSA 2XHFA 4XS4B 1G7EA 4K7NA 1PMTA 2JZTA 4BVYB 10GSA 3IBHA 2YPMA 5ECMB 5LD0A 2X64A 3LWAA 1YQ1A 1SJZA 22GSA 2MMAA 2L6DA 2JL4A 2KP2A 5CRGA 2CZ2A 4XTSA 2G0FA 4J57E 2CVDA 1EP7A 1TXXA 4OO5A 2KOKA 4ECJA 4JR4A 3D0ZA 1Y25A 3EU3A 1TU7A 4EVMA 3MDKA 1V98A 3I69A 5HR1A 4QQ7A 4WEYA 1GSSA 5HR2A 4O92A 1O73A 3RPNA 1A2JA 2FWFA 1FB0A 2PVOC 3LJRA 4EUYA 1OE8A 3HJPA 2HQTA 3ZIJA 4KSOA 5ELAA 2IMKA 2DJ2A 1Z7RA 2A2RA 3QMXA 4MF7A 3BBYA 2RM6A 2H8LA 1PRXA 2H75A 4TN8A 5IOWA 1EEJA 2N5AA 4KNDA 1V58A 3R3EA 2H6XA 4N10A 1TJDA 3FHKA 4OWYA 4MDCA 1K0NA 1XWAA 5CP1A 4PNFA 3F0IA 3TOTA 1TRVA 1XFLA 3IHQA 5IO0A 3M9KA 3ZL5A 4GWRA 3VK9A 1XOAA 1MEKA 3OR5A 2DBCA 4WETA 5F05A 1GLPA 2YZUA 2XPDA 3TJKA 1OKDA 4KX4A 4E8HA 2LRNA 1B48A 3TDGA 1R5AA 4N30A 3LSZA 2YV7A 2LRCA 3EU4A 4XIHA 3LEFA 3F4SA 3FY7A 4WF5A 1Q98A 2E2MA 5HFKA 2DJKA 4J56E 4KW6A 2LV3A 3GL3A 1TU8A 3ZLPA 4J2FA 3EMXA 3VWXA 2H71A 4JRRA 1LJRA 2GZYA 1VGLA 5AISA 2WZ9A 1SJIA 5D9WA 3TKSE 3ME7A 4TR1B 4EC0A 2CAQA 4DSQA 3PINA 4IVFA 2ZCTA 4MCUA 3DEXA 3I9V2 3CBUA 4XRDA 3GSSA 1H75A 2DIZA 2JSZA 4MZWA 5KN3A 1S3AA 2QGVA 1PX6A 4I97A 4X43A 4TR4A 2F51A 8GSSA 4HOJA 3K8NA 2MBTA 4JEDA 3VWVA 5B6NA 2YNXA 4GCIA 2OBKA 3LG6A 5FHIA 4Z7XA 4E8EA 3KM6A 5C04A 1R4WA 1M0UA 1CQGA 1M9BA 2DJ1A 1WP0A 4K1FA 2O87A 5DCGA 3CSHA 1M99A 1ST9A 1AAZA 1AXDA 5DJLA 2FCHA 1B4PA 3UARA 1X5CA 4EKZA 3GX8A 3H4KA 1F6MC 2IL3A 2VCQA 2HRNA 4FH8A 6GSVA 1TP9A 1XBSA 2ZNMA 1X0RA 2HSNB 4USSA 1K3LA 1FAAA 5CRDA 5A4WA 2H74A 1ML6A 1SD8A 1USBA 4POMA 1ZCPA 2NPBA 2C8UA 1T1VA 3UIWA 1G6YA 4L0WA 2PGTA 4CW9A 1YDKA 2MMNA 1XOBA 1PGTA 5ECKB 4ZB9A 2GS3A 1NM3A 1GSQA 3D4TA 1ZGNA 1U3IA 2BMXA 1S3CA 4XHMA 1Z3EA 2FY6A 20GSA 3V1WA 3GL5A 4TR3A 3QD9A 3FRCA 3F4TA 1PL2A 3GN3A 3HYPA 4K0GA 1SKRB 1GP1A 4G0LA 5HFGA 4NMUA 1ZYQB 2H66A 4DSSA 2H6YA 2LNSA 2CZ3A 3A2VA 4POLA 5G30A 3GSTA 3PH9A 1BEDA 2WRTA 2L4QA 5IO2A 1H4OA 2B5XA 4QL7A 5LCZA 3UBLA 1YJ6A 1GNEA 2OACA 1F37A 4K6XA 3M8NA 5AN1A 3J7Yb 3HXSA 1JZWA 2OE1A 5A4UA 2IFQA 1VF1A 1G6WA 1R26A 1NSWA 2YP6A 4KDUA 1TI3A 1WWJA 5KN2A 4NXIA 4ZL8A 2L6CA 3KGKA 3KTBA 5ECQB 2C0FA 3GH6A 2CV4A 2H0HA 5B8BA 1YZXA 3I6AA 2VL9A 2KHPA 2DC5A 3HD5A 3SWLA 2N5FA 1M2AA 4FYCA 1SYXA 3ZTLA 5INYA 4I2TA 2OE3A 3CSIA 3EC3A 5D9XA 3RHCA 1KBNA 1PA3A 3HVSA 2LNTA 4KCEA 1B8XA 1GSEA 5J41A 2WDUA 2WFCA 1AQVA 5JWQB 3DD3A 3FEUA 1Q4JA 2K8VA 2L4CA 4XRAA 1X9SB 2IMIA 2LRTA 1XVQA 1THOA 5JWOB 3EINA 2K18A 1C72A 3E3EA 2B1KA 2E0QA 3WGXA 2REMA 3IAM2 2JZSA 2P5RA 1GH2A 1OC9A 4P3YB 2HSYA 3APQA 2H01A 4DSRA 4X0XA 4KCAA 4H86A 4N0VA 2GSTA 5JWRB 2R6KA 2CA8A 4IP1A 2AJQB 5DQSA 1OE7A 3FK8A 3RHBA 5IMDA 4WBJA 4IQ1A 4HUAA 3QDNA 1FB6A 3EE2A 4I2UA 3LFLA 1XW5A 2EC4A 4OCEA 1PSQA 5G1LA 2GGTA 3ZYWA 1MDJA 4HZ2A 3TUEA 5CAXA 3LYPA 3P8WA 3HY2A 2IN3A 4HI7A 5HR3A 1ILOA 3C71A 4ML1A 2PUKC 5ELGA 5DCHA 1O8WA 1K0OA 2N5BA 3WGDA 1YF0A 5G2ZA 3DIEA 4JR6A 2HSHA 3GHAA 4WXTA 3N9JA 4OO4A 1WJKA 1QQ2A 1E2YA 2GDRA 4LMWA 2E2GA 1ERUA 2VM2A 5AGYA 2MYGA 4JU5A 3IPZA 2C0EA 5CO3A 4F0CA 1GUKA 4V1Ag 3DGQA 2LKUA
chains in the Genus database with same CATH superfamily
4POBA 4KGIA 3TRPA 1TKDB 3HZ4A 2HYXA 3G9BA 2OKAA 3M9JA 3L9UA 2EFHA 1M3IA 1OC8A 4ZXGA 4IJ3A 1K3YA 16GSA 5F06A 3HZ8A 1HNCA 9GSSA 5A4VA 3A2XA 3QAWA 2YWOA 5D9VA 4XS1A 4GDFA 2IMDA 2IPAA 3KMNA 2HRFA 13GSA 2CT6A 2E7PA 4I5QA 1MD3A 4ZB6A 2ON5A 1X5EA 5B6MA 1VF4A 3LORA 2YCDA 4DEJA 1QGVA 5EPFA 4CDOA 3RFRC 4NPBA 1TK0B 2FD3A 1O85A 2B5EA 3VWUA 4GRFA 3A3TA 4Q5NA 1FHEA 4DSSB 3MAKA 2BTOT 2LQQA 5G31A 3ERFA 3GUSA 1A8LA 3NZNA 1JZDA 5IMAA 2RLIA 3TB2A 3LXZA 4MZBA 4GQFA 3CRTA 5IMCA 5FT3A 4FQUA 4ECBA 5FWGA 4MJBA 1ZZYA 3F9UA 1G7OA 2IFQB 2QC7A 3QFBC 2HFDA 4FO5A 2K8SA 1BAYA 1HNAA 4NWYA 4D73A 5H5QA 1FO5A 5DALA 3IC4A 1A8YA 1ZYPA 4OFMA 3P7XA 1TRWA 1MTCA 4K9ZA 1JLWA 4MF6A 5HR0A 3WT2A 4IBPA 3FZAA 1TRSA 3D22A 3ZREA 4IS0A 2WVYA 5IMVA 4Z2RA 2LS5A 2AYTA 2H1BA 1T8EB 2LJAA 5BRTA 3GNJA 4EE0A 2FA8A 3M0FA 6GSXA 1WIKA 3VI7A 3GKKA 1LBKA 4IGJA 3G7JA 4HQSA 2G2QA 1X9MB 2LTKA 3D5JA 3IK7A 4ID0A 2EFDA 3TCOA 1G0TA 1V2AA 1NHYA 3IRAA 4ULXA 1O8XA 4K5SA 2H0GA 2OE0A 1GTAA 2WVXA 4F82A 2GT5A 4ECIA 3S9FA 1XW9A 3F3RA 2VOCA 1WRYA 4FYUA 1GTIA 2VD0A 1TI1A 1V9WA 1FG4A 4RI6A 3CRUA 5ABRA 2JZRA 1OC9B 1BG1A 3GKMA 5IM9A 4MF5A 5ECIB 2MBSA 4AJ7A 3NIVA 1AC1A 2DMLA 2H1GA 4MPGA 5J4YA 1EP8A 4HS1A 5AIVA 4MABA 1T00A 2JADA 2OJLA 3UOMA 4Q5QA 2R2JA 4ZL9A 3EPTA 5J40A 2IIYA 2C1YA 3UMAA 4HSCX 1GTBA 3QAVA 1TK8B 2AHEA 1EV9A 3AY8A 2GZZA 2VIMA 3G7YA 1SK0A 3CWGA 2OT3A 4LL4B 2HE3A 4TXOA 1FW1A 2PVQA 5ID2A 4LL1B 3KMOA 3L4NA 1MDIA 4K2XA 2HXKA 4PURA 1K3OA 3CSJA 3O3TA 4GTUA 1WOUA 3CXGA 1W4VA 1M2DA 1A0RP 2WULA 4BL7A 4Z2UA 4GQCA 5EL8A 2HSMA 1NHOA 3QCPA 1OAZA 2I4AA 2DIYA 4PTSA 3PPUA 2UZ8A 5KEJA 3UVTA 2V6OA 1SKSB 3C1RA 1SK2A 1QXHA 3GV1A 3D4MA 4L0UA 3ZVJA 4BWSA 1YF1A 4PXOA 1TOFA 2X99A 3RGBC 2PBJA 4BWQA 3G7IA 1VF3A 1F9MA 1GUMA 3FZ5A 2R3XA 4TRXA 3H8QA 2YJHA 4YQUA 1E6BA 2VLTA 2ES7A 1ON4A 3ZRDA 3EURA 1IYHA 3J7Yk 2ON7A 3CMIA 3IAS2 2GT6A 3RBTA 3GYKA 4IN0A 3UL3A 4Q5FA 4PX1A 2R4VA 1BX9A 5ECPB 1ZMAA 4Q5RA 1EZKA 4IJIA 4TVEA 5LNKe 1A0FA 2B3SA 5C00A 2HRKA 1V57A 3TOUA 2GSQA 5EVOA 14GSA 3ZZXA 1T4ZA 2L59A 3GURA 3KCMA 3QR6A 4YAPA 1UN2A 5IIZA 4RUVA 2LQOA 2X4AA 1J9BA 1ZOFA 2VD1A 1XCCA 3W6GA 4GSTA 2FLSA 5IPGA 4HZ4A 4KF9A 1ERTA 4D73B 2F8FA 3DVXA 4K0NA 5IMZA 5DALB 3ME8A 3D6IA 3VPQA 2AV4A 3BD2A 2F3MA 4GSNA 3WT1A 2HNLA 7GSSA 1WMJA 3HHVA 1SENA 4O5RA 5KN1A 2YN1A 1DBYA 5DJMA 4NHZA 4IKHA 5AIXA 3UJ1A 3HVXA 5BMUA 3US3A 1XWGA 1YEXA 2F8AA 2KP1A 1BF5A 3L0HA 4FYBA 1SYRA 2XBQA 2QA2A 1VRSD 5CYYA 2CAIA 3CTGA 3LGCA 2HZEA 4ILFA 3RPPA 4K8MA 2PMTA 5A5HA 3DKSA 2R0PA 1PL1A 1TRUA 1EEMA 2XBIA 2O89A 3DMLA 3H1NA 1KEBA 4PUAA 3C1SA 3KZQA 5F07A 2MMOA 2WVXB 4EDZA 3UEMA 3TJBA 4Z2TA 4V1Ap 1OYJA 1GSDA 2GLRA 1JZRA 2GZPA 1YEPA 4RQRA 3KEBA 4EO3A 3VI5A 2X8GA 3TKQA 3ZVJD 2V6KA 1Y6EA 2Z9SA 2V32A 3DYRA 2TRCP 4PI2C 2O8VB 4V2MA 3F8UA 3IDVA 1DE2A 2H73A 3H79A 1J0FA 1WE0A 4OMVA 3Q18A 1BG5A 4I8BA 3EYTA 3Q74A 3VLNA 2YV9A 4G01A 4TOPA 4KDYA 5D73A 6GSYA 2AAWA 1YKCA 2VCTA 1A23A 3HJMA 2R0CA 1SU9A 1YVLA 4IQAA 2AUVA 2FWEA 2LUSA 3IV4A 2HT9A 1AQXA 4TXOB 3FKFA 5ID2B 4N3ZA 2GSSA 4KUNA 1R5PA 2WVZA 4NV2A 1ZL9A 2X8HA 3KD0A 2FGXA 4XS6A 4AJ6A 4G19A 2DLXA 4LMVA 1ZYEA 4IHUA 5IPHA 1EOHA 4IELA 4BL7B 2P5QA 1V40A 1SL0B 4X4JA 2J23A 3ED3A 2HSMB 3P2AA 2NBSA 4G2EA 3HVVA 3KJYA 4PGTA 2BJXA 2DJJA 2C3TA 4MJCA 4YQMA 4G0KA 2PPTA 3U5RE 4AKIA 1X9WB 3NOFA 1VF2A 2XPEA 3L9SA 5ECSA 4CHSA 1GL8A 2C80A 4K7OA 3HJOA 3BCKA 3WGEA 3EMPA 3TJFA 2TRXA 2FHEA 2I81A 2JACA 4KA0A 3GIXA 5J9CA 3FZ9A 1U3AA 4NHWA 4N0ZA 1AIUA 4HDEA 1XXUA 4TXVA 3ZIVA 2DKHA 5D96A 4HU7A 3KIJA 3M1GA 2TIRA 3VPTA 2MMZA 2CX3A 5GZZB 2XC2A 1OKTA 2WCIA 1Z7PA 4K5RA 4YAVA 4MK3A 1F3AA 1NW2A 2IMFA 1GNWA 2K9FA 2HRKB 1Z9HA 3BOAA 3DWVA 4KSMA 4ZB8A 2FWHA 1XPVA 1EV4A 1Z5YE 6GSWA 2HI7A 2CVBA 6GSSA 4GXZA 3UAPA 3ISOA 3ZFBA 2H30A 3IOSA 2H0IA 3TKPA 1K0CA 2O85A 4KB3A 3I43A 5GSSA 2I3YA 4ICYA 5DBQA 5J4UA 3F4RA 1XWKA 5DVBA 2VLVA 1U88A 2PERA 1PX7A 1U6TA 5BMUB 2DJ0A 1FOVA 3FYGA 1KNGA 4MMMA 3O6TA 2DKIA 3QOUA 5J9BA 3TRQA 4DVCA 4BPYA 2HZEB 5ENUA 4WR4A 1I5GA 5A34A 1TTZA 2VCZA 5IMFA 5A5HB 4G9HA 4LLRA 1MD4A 4L5LA 3FR3A 1XWCA 3HCZA 3IK9A 2VCWA 4F03A 1PKZA 1M9AA 2WGRA 1HD2A 3MYDA 2X8CA 2C4JA 5E59A 2MZCA 6GSUA 1XWBA 2VCVA 4HJMA 3LXTA 4G0IA 5ECHB 3FW2A 1GRXA 5B8AA 4TR0A 3HA9A 4GF0A 5GAPD 3CHXC 3FZ4A 4MJAA 5JCUA 3MNGA 3JCML 5IOXA 2WW1A 5A5KA 5G1KA 4WR5A 1OVNA 3C73A 5CNWA 3GKNA 4OD7A 1T7PB 12GSA 3IC8A 19GSA 2LJRA 2LJKA 3CTFA 1GTUA 2P0GA 2PWJA 4F0BA 2O7KA 5H5SA 2GSRA 2KUCA 2VL3A 1YY7A 1JFUA 1T4YA 5L71A 1DE1A 2JU5A 2FA4A 4MZCA 4V2NA 4F9ZA 1BQ7A 1DSBA 3FR6A 1J08A 2YWIA 1WPIA 4HQZA 1M7TA 1GWCA 1Z6MA 4OFTA 4IP6A 1RK4A 3GA4A 1F2EA 3KH7A 4FIWA 3RDWA 17GSA 3MIXA 2C0GA 1TW9A 2DMMA 4N11A 1UC7A 2RM5A 2B7JA 1SD9A 5E4WA 2YANA 3LQ7A 1SL2B 2VLUA 4K7IA 1HQOA 5EY6A 4X1UA 3PGTA 1XIYA 5GSTA 3FMWA 4O7HA 1F3BA 2YJ7A 1SL1B 2M80A 1M3JA 3WD6A 4KDXA 5JCGA 1GSFA 1GUHA 2HLSA 3KP8A 3U6VA 1ERWA 4EXJA 1JLVA 5ECLB 3IHGA 2C0DA 2O5VA 2PN8A 2HRAA 3R2QA 2LEGA 4HEA2 1AUCA 4KAEA 2OBIA 2KLXA 1EGOA 3DRNA 2C3QA 1EGRA 1U87A 3N5OA 4ML6A 4EF0A 1B9YC 3TGZA 2WS2A 5CRHA 1SVMA 3TRXA 4QL9A 4JBBA 3KXOA 3GFKA 4I6XA 5HFIA 5D8IA 5F0GA 2H70A 2WW3A 1SVLA 2YZHA 4ZIJA 2H1DA 1CQHA 3BCIA 2NTOA 1IYIA 2HZFA 4WBRD 2R37A 4XCSA 3C8EA 1YKAA 2H1LA 4HJ2A 1SK1A 3GTUA 2QKEA 4AI6A 4HU9A 2K6VA 3HKRA 4CY8A 4MP4A 5DAKA 5CRWA 4YH2A 1BYEA 2A4VA 2J9HA 4NV5A 4PUFC 2H1AA 3L9VA 3EVIA 3QFAC 1W89A 3QPMA 5ECRB 2NVLA 3IA1A 2LSTA 4O32A 1FVKA 1K0BA 2EIOA 4QMKA 4PQHA 4RQXA 2V2GA 2F9SA 2NDOA 4PQ1A 4AGSA 2O3EA 5GAND 2AB6A 3F3QA 3A5IA 2EFCA 3EWLA 5ECNB 2I9HA 4EDYA 1GSYA 2VL2A 4KH7A 1OC3A 5D93A 3A2WA 1PKWA 1AW9A 4BVXA 5G5FA 2VUPA 3RAZA 5A34B 1K0MA 6GSTA 1XZOA 4XS4A 5DQYA 3W8JA 3ZMLA 2RUFA 1HNBA 4BVYA 4ZBAA 2OADA 18GSA 4GLTA 4GSSA 2L5OA 2EIRA 4MH3A 4PNGA 3WYWA 1K0DA 4ECCA 2ZUPA 1AQWA 3MSZA 3TKRA 3BJ5A 2UV8G 3DXBA 3O76A 1QMVA 1URMA 2IJYA 3LYKA 3ZITA 1THXA 4ZILA 3KH9A 1N8JA 4ZBBA 2VL2C 2YWNA 4MA9A 5CREA 1JZOA 2EFEA 5G5EA 1S3DA 3VFIA 1S4BP 2V1MA 4LA1A 4O5QA 1Z6NA 5IQYA 2L5LA 2GQMA 4TKYA 4AJ8A 3VURA 4L8EA 2B7KA 1RW1A 3H93A 1I9DA 4IW9A 3F63A 4NAXA 1DUGA 1GLQA 4PHZC 3GRXA 2YOIA 1R7HA 4MNNA 2H6ZA 3C7MA 4YQVA 3UVHA 1PD21 3E0UA 1PQNA 4G10A 2EIQA 3FR9A 1QK8A 2CVKA 3MWHA 3ERGA 1A2LA 1T3BA 5KN0A 2H19A 5J5NA 1RQMA 1XW6A 1XVWA 3PR8A 2VAFA 4MJEA 3SBCA 3W8SA 4EL1A 1ABAA 1KTEA 2B5YA 1TXUA 1GSUA 2WJUA 1HYUA 3L78A 4K2DA 2B1LA 4EIQA 3A5WA 1Y1UA 1M2BA 2IWTA 3D21A 5H5RA 2CQ9A 1TK5B 2DSAA 4AF2A 2H72A 4YKGA 5A1NA 3GX0A 4L5OA 2M46A 2FNOA 3HDCA 3TJGA 2A2SA 2JSYA 1K0AA 1FVJA 4RI7A 3VWWA 5F8BA 3GH9A 4F2IA 2WB9A 5D9TA 1N2AA 5DDLA 3APOA 1ERVA 2I1UA 2PU9C 1A24A 3ERWA 1SKWB 5COHA 3TU3B 3ZFLA 2QSIA 1O6JA 3KTLA 2FUG2 3TKSA 3GMFA 3TJJA 2VM1A 3F6DA 3IXRA 2VO4A 2GQLA 1LU4A 2OA7A 1JHBA 2D2ZA 1EOGA 1SVOA 1O7UA 2M72A 1QUWA 4OFNA 3IR4A 3QAGA 2VCXA 2H76A 3IE3A 3P90A 1ACVA 2GTUA 3DVWA 4MH2A 4OCFA 3E9JB 4MPFA 5HQPA 4TR1A 3M3MA 1X5DA 2IMEA 4WKWA 3KP9A 3GTUB 2DJ3A 2B6MA 3ZMKA 2CX4A 1B4QA 3GKXA 4TW5A 1BJXA 3Q6OA 4MLYA 3F6FA 5DAKB 4JE1A 2RUEA 1QFNA 1MDKA 4KE3A 3TKSC 1SJ6A 5B7CA 1PN9A 1TDIA 1GULA 2GQKA 2RIIA 2R5GA 3CYNA 4WF4A 5J3RA 1EWXA 2GVPA 1UVZA 5J47A 4PI0C 1A2MA 2WW2A 4PQIA 3UBKA 1XG8A 4BA7A 2C3NA 4ZBDA 4JZQA 4CY6A 2V41A 2P31A 4ISDA 4POKA 1UA5A 11GSA 2L57A 2ALBA 3Q19A 1B9XC 4ZB7A 5JCWA 4BVXB 4ZL7A 4V2LA 4ACSA 2YWMA 2HSNA 5ECOB 2FWGA 1O81A 3APSA 2XHFA 4XS4B 1G7EA 4K7NA 1FOHA 1PMTA 2JZTA 4BVYB 10GSA 4A5PA 3IBHA 2YPMA 5ECMB 5LD0A 2X64A 3LWAA 1YQ1A 1SJZA 1ZYNA 22GSA 5J4VA 2MMAA 2L6DA 2JL4A 2KP2A 5CRGA 2CZ2A 4XTSA 2G0FA 4J57E 2CVDA 1EP7A 1TXXA 4OO5A 2KOKA 4ECJA 4JR4A 3D0ZA 1Y25A 3EU3A 1TU7A 4EVMA 3MDKA 1V98A 4FXYP 3I69A 5HR1A 4AKXB 4QQ7A 4WEYA 1GSSA 5HR2A 4O92A 1O73A 3RPNA 1A2JA 2FWFA 1FB0A 2PVOC 3LJRA 4EUYA 1OE8A 3HJPA 2HQTA 3ZIJA 4KSOA 5ELAA 2IMKA 2DJ2A 1Z7RA 2A2RA 3QMXA 4MF7A 3BBYA 2RM6A 2H8LA 1PRXA 2H75A 4TN8A 5IOWA 1EEJA 2N5AA 4KNDA 1V58A 3R3EA 2H6XA 4N10A 1TJDA 3FHKA 4OWYA 4MDCA 1K0NA 1XWAA 5CP1A 4PNFA 3F0IA 3TOTA 1TRVA 1XFLA 3IHQA 5A1NB 3M9KA 5IO0A 3ZL5A 4GWRA 2A2PA 3VK9A 1XOAA 1MEKA 3OR5A 2DBCA 4WETA 5F05A 1GLPA 2YZUA 2XPDA 3TJKA 1OKDA 4KX4A 4E8HA 2LRNA 1B48A 3TDGA 4YKFA 1R5AA 4N30A 3LSZA 2YV7A 2LRCA 3EU4A 4XIHA 3LEFA 3F4SA 3FY7A 4WF5A 1Q98A 2X49A 2E2MA 5HFKA 2DJKA 4J56E 4KW6A 2LV3A 3GL3A 1TU8A 3ZLPA 4J2FA 3EMXA 3VWXA 2H71A 4JRRA 1LJRA 2GZYA 1VGLA 5AISA 2WZ9A 3HMJG 1SJIA 5D9WA 3TKSE 3ME7A 4TR1B 4EC0A 2CAQA 4DSQA 3PINA 1YEWC 4IVFA 2ZCTA 4MCUA 4EIPA 3DEXA 3I9V2 3CBUA 4XRDA 3GSSA 1H75A 2DIZA 2JSZA 4MZWA 5KN3A 1S3AA 2QGVA 1PX6A 4I97A 4X43A 4TR4A 2F51A 8GSSA 4HOJA 1I1IP 1S3RA 3K8NA 2MBTA 4JEDA 3VWVA 5B6NA 2YNXA 4GCIA 2OBKA 3LG6A 5FHIA 4Z7XA 4E8EA 3KM6A 5C04A 1R4WA 1M0UA 1CQGA 1M9BA 2DJ1A 1WP0A 4K1FA 2O87A 5DCGA 3CSHA 1M99A 1ST9A 1AAZA 1N25A 1AXDA 5DJLA 5KOWA 2FCHA 1B4PA 3UARA 1X5CA 4EKZA 3LW9A 3GX8A 3H4KA 1F6MC 2IL3A 2VCQA 2HRNA 4FH8A 6GSVA 1TP9A 1XBSA 2ZNMA 2R0GA 1X0RA 2HSNB 4USSA 1K3LA 1FAAA 5CRDA 5A4WA 2H74A 1ML6A 1SD8A 1USBA 4POMA 1ZCPA 2NPBA 2C8UA 1T1VA 3UIWA 1G6YA 4L0WA 2PGTA 4CW9A 1YDKA 2MMNA 1XOBA 1PGTA 5ECKB 4ZB9A 2GS3A 1NM3A 1GSQA 3D4TA 1ZGNA 1U3IA 2BMXA 2QA1A 1S3CA 4XHMA 1Z3EA 2FY6A 20GSA 3V1WA 3GL5A 4TR3A 3QD9A 3FRCA 3F4TA 1PL2A 4E68A 3GN3A 3HYPA 4K0GA 1SKRB 1GP1A 1PFOA 4G0LA 2VKZG 5HFGA 4NMUA 1ZYQB 2H66A 4AKGA 4DSSA 2H6YA 2LNSA 2CZ3A 3A2VA 4POLA 5G30A 3GSTA 3PH9A 1BEDA 2WRTA 2L4QA 5IO2A 1H4OA 2B5XA 4QL7A 5LCZA 3UBLA 1YJ6A 1GNEA 2OACA 1F37A 4K6XA 3M8NA 5AN1A 3J7Yb 3HXSA 1JZWA 2OE1A 5A4UA 2IFQA 1VF1A 1G6WA 1R26A 1NSWA 2YP6A 4KDUA 1TI3A 1WWJA 5KN2A 4NXIA 4W66A 4ZL8A 2L6CA 3KGKA 3KTBA 5ECQB 2C0FA 3GH6A 2CV4A 2H0HA 5B8BA 1YZXA 3I6AA 2VL9A 2KHPA 2DC5A 3HD5A 3SWLA 2N5FA 2O36A 1M2AA 4FYCA 1SYXA 3ZTLA 4AKHA 5INYA 4I2TA 2OE3A 3CSIA 3EC3A 5D9XA 3RHCA 1KBNA 1PA3A 3HVSA 2LNTA 4KCEA 1B8XA 1GSEA 5J41A 2WDUA 2WFCA 1AQVA 5JWQB 3DD3A 3FEUA 1Q4JA 2K8VA 2L4CA 4XRAA 1X9SB 2IMIA 2LRTA 1XVQA 1THOA 5JWOB 3EINA 5KOXA 2K18A 1C72A 3E3EA 2B1KA 2WZSA 2E0QA 3WGXA 2REMA 3IAM2 1PN0A 2JZSA 2P5RA 1GH2A 1OC9A 4P3YB 2HSYA 3APQA 2H01A 4DSRA 4X0XA 4KCAA 4H86A 4N0VA 2GSTA 5JWRB 2R6KA 2CA8A 4BIKA 4IP1A 4O5UA 2AJQB 5DQSA 1OE7A 3FK8A 3HVNA 3RHBA 5IMDA 4WBJA 4IQ1A 4HUAA 3QDNA 1FB6A 3EE2A 4I2UA 3LFLA 1XW5A 2WW0A 2EC4A 4OCEA 1PSQA 5G1LA 2GGTA 3ZYWA 1MDJA 4HZ2A 3TUEA 5CAXA 3LYPA 3CQFA 3P8WA 3HY2A 2IN3A 4HI7A 5HR3A 1ILOA 3C71A 4ML1A 2PUKC 5ELGA 5DCHA 1O8WA 1K0OA 2N5BA 3WGDA 1YF0A 5G2ZA 3DIEA 4JR6A 2HSHA 3GHAA 4WXTA 3N9JA 4OO4A 1WJKA 1QQ2A 1E2YA 2GDRA 4LMWA 2E2GA 1ERUA 2VM2A 5AGYA 2MYGA 4JU5A 3IPZA 2C0EA 5CO3A 4F0CA 1GUKA 2A4HA 4V1Ag 3DGQA 2LKUA
chains in the Genus database with same CATH topology
4POBA 4KGIA 3TRPA 1TKDB 3HZ4A 2HYXA 3G9BA 2OKAA 3M9JA 3L9UA 2EFHA 1OC8A 4ZXGA 4IJ3A 1K3YA 16GSA 5F06A 3HZ8A 1HNCA 9GSSA 5A4VA 3A2XA 3QAWA 2YWOA 5D9VA 4XS1A 4GDFA 2IMDA 2IPAA 3KMNA 2HRFA 13GSA 2CT6A 2E7PA 4I5QA 1MD3A 4ZB6A 2ON5A 1X5EA 5B6MA 1VF4A 3LORA 2YCDA 4DEJA 1QGVA 5EPFA 4CDOA 4NPBA 1TK0B 2FD3A 1O85A 2B5EA 3VWUA 4GRFA 3A3TA 4Q5NA 1FHEA 4DSSB 3MAKA 2BTOT 2LQQA 5G31A 3ERFA 3GUSA 1A8LA 3NZNA 1JZDA 5IMAA 2RLIA 3TB2A 3LXZA 4MZBA 4GQFA 3CRTA 5IMCA 5FT3A 4FQUA 4ECBA 5FWGA 4MJBA 1ZZYA 3F9UA 1G7OA 2IFQB 2QC7A 3QFBC 2HFDA 4FO5A 2K8SA 1BAYA 1HNAA 4NWYA 4D73A 5H5QA 1FO5A 5DALA 3IC4A 1A8YA 1ZYPA 4OFMA 3P7XA 1TRWA 1MTCA 4K9ZA 1JLWA 4MF6A 5HR0A 3WT2A 4IBPA 3FZAA 1TRSA 3D22A 3ZREA 4IS0A 5IMVA 4Z2RA 2LS5A 2AYTA 2H1BA 1T8EB 2LJAA 5BRTA 3GNJA 4EE0A 2FA8A 3M0FA 6GSXA 1WIKA 3VI7A 3GKKA 1LBKA 4IGJA 3G7JA 4HQSA 2G2QA 1X9MB 2LTKA 3D5JA 3IK7A 4ID0A 2EFDA 3TCOA 1G0TA 1V2AA 1NHYA 3IRAA 4ULXA 1O8XA 4K5SA 2H0GA 2OE0A 1GTAA 4F82A 2GT5A 4ECIA 3S9FA 1XW9A 3F3RA 2VOCA 1WRYA 4FYUA 1GTIA 2VD0A 1TI1A 1V9WA 1FG4A 4RI6A 3CRUA 5ABRA 2JZRA 1OC9B 1BG1A 3GKMA 5IM9A 4MF5A 5ECIB 2MBSA 4AJ7A 3NIVA 1AC1A 2DMLA 2H1GA 4MPGA 5J4YA 1EP8A 4HS1A 5AIVA 4MABA 1T00A 2JADA 2OJLA 3UOMA 4Q5QA 2R2JA 4ZL9A 3EPTA 5J40A 2IIYA 2C1YA 3UMAA 1GTBA 3QAVA 1TK8B 2AHEA 1EV9A 3AY8A 2GZZA 2VIMA 3G7YA 1SK0A 3CWGA 2OT3A 4LL4B 2HE3A 4TXOA 1FW1A 2PVQA 5ID2A 4LL1B 3KMOA 3L4NA 1MDIA 4K2XA 2HXKA 4PURA 1K3OA 3CSJA 3O3TA 4GTUA 1WOUA 3CXGA 1W4VA 1M2DA 1A0RP 2WULA 4BL7A 4Z2UA 4GQCA 5EL8A 2HSMA 1NHOA 3QCPA 1OAZA 2I4AA 2DIYA 4PTSA 3PPUA 2UZ8A 5KEJA 3UVTA 2V6OA 1SKSB 3C1RA 1SK2A 1QXHA 3GV1A 3D4MA 4L0UA 3ZVJA 4BWSA 1YF1A 4PXOA 1TOFA 2X99A 2PBJA 4BWQA 3G7IA 1VF3A 1F9MA 1GUMA 3FZ5A 2R3XA 4TRXA 3H8QA 2YJHA 4YQUA 1E6BA 2VLTA 2ES7A 1ON4A 3ZRDA 3EURA 1IYHA 3J7Yk 2ON7A 3CMIA 3IAS2 2GT6A 3RBTA 3GYKA 4IN0A 3UL3A 4Q5FA 4PX1A 2R4VA 1BX9A 5ECPB 1ZMAA 4Q5RA 1EZKA 4IJIA 4TVEA 5LNKe 1A0FA 2B3SA 5C00A 2HRKA 1V57A 3TOUA 2GSQA 5EVOA 14GSA 3ZZXA 1T4ZA 2L59A 3GURA 3KCMA 3QR6A 4YAPA 1UN2A 5IIZA 4RUVA 2LQOA 2X4AA 1J9BA 1ZOFA 2VD1A 1XCCA 3W6GA 4GSTA 2FLSA 5IPGA 4HZ4A 4KF9A 1ERTA 4D73B 2F8FA 3DVXA 4K0NA 5IMZA 5DALB 3ME8A 3D6IA 3VPQA 2AV4A 3BD2A 2F3MA 4GSNA 3WT1A 2HNLA 7GSSA 1WMJA 3HHVA 1SENA 4O5RA 5KN1A 2YN1A 1DBYA 5DJMA 4NHZA 4IKHA 5AIXA 3UJ1A 3HVXA 5BMUA 3US3A 1XWGA 1YEXA 2F8AA 2KP1A 1BF5A 3L0HA 4FYBA 1SYRA 2XBQA 2QA2A 1VRSD 5CYYA 2CAIA 3CTGA 3LGCA 2HZEA 4ILFA 3RPPA 4K8MA 2PMTA 5A5HA 3DKSA 2R0PA 1PL1A 1TRUA 1EEMA 2XBIA 2O89A 3DMLA 3H1NA 1KEBA 4PUAA 3C1SA 3KZQA 5F07A 2MMOA 4EDZA 3UEMA 3TJBA 4Z2TA 4V1Ap 1OYJA 1GSDA 2GLRA 1JZRA 2GZPA 1YEPA 4RQRA 3KEBA 4EO3A 3VI5A 2X8GA 3TKQA 3ZVJD 2V6KA 1Y6EA 2Z9SA 2V32A 3DYRA 2TRCP 2O8VB 4V2MA 3F8UA 3IDVA 1DE2A 2H73A 3H79A 1J0FA 1WE0A 4OMVA 3Q18A 1BG5A 4I8BA 3EYTA 3Q74A 3VLNA 2YV9A 4G01A 4TOPA 4KDYA 5D73A 6GSYA 2AAWA 1YKCA 2VCTA 1A23A 3HJMA 2R0CA 1SU9A 1YVLA 4IQAA 2AUVA 2FWEA 2LUSA 3IV4A 2HT9A 1AQXA 4TXOB 3FKFA 5ID2B 4N3ZA 2GSSA 4KUNA 1R5PA 4NV2A 1ZL9A 2X8HA 3KD0A 2FGXA 4XS6A 4AJ6A 4G19A 2DLXA 4LMVA 1ZYEA 4IHUA 5IPHA 1EOHA 4IELA 4BL7B 2P5QA 1V40A 1SL0B 4X4JA 2J23A 3ED3A 2HSMB 3P2AA 2NBSA 4G2EA 3HVVA 3KJYA 4PGTA 2BJXA 2DJJA 2C3TA 4MJCA 4YQMA 4G0KA 2PPTA 3U5RE 4AKIA 1X9WB 3NOFA 1VF2A 2XPEA 3L9SA 5ECSA 4CHSA 1GL8A 2C80A 4K7OA 3HJOA 3BCKA 3WGEA 3EMPA 3TJFA 2TRXA 2FHEA 2I81A 2JACA 4KA0A 3GIXA 5J9CA 3FZ9A 1U3AA 4NHWA 4N0ZA 1AIUA 4HDEA 1XXUA 4TXVA 3ZIVA 2DKHA 5D96A 4HU7A 3KIJA 3M1GA 2TIRA 3VPTA 2MMZA 2CX3A 5GZZB 2XC2A 1OKTA 2WCIA 1Z7PA 4K5RA 4YAVA 4MK3A 1F3AA 1NW2A 2IMFA 1GNWA 2K9FA 2HRKB 1Z9HA 3BOAA 3DWVA 4KSMA 4ZB8A 2FWHA 1XPVA 1EV4A 1Z5YE 6GSWA 2HI7A 2CVBA 6GSSA 4GXZA 3UAPA 3ISOA 3ZFBA 2H30A 3IOSA 2H0IA 3TKPA 1K0CA 2O85A 4KB3A 3I43A 5GSSA 2I3YA 4ICYA 5DBQA 5J4UA 3F4RA 1XWKA 5DVBA 2VLVA 1U88A 2PERA 1PX7A 1U6TA 5BMUB 2DJ0A 1FOVA 3FYGA 1KNGA 4MMMA 3O6TA 2DKIA 3QOUA 5J9BA 3TRQA 4DVCA 4BPYA 2HZEB 5ENUA 4WR4A 1I5GA 5A34A 1TTZA 2VCZA 5IMFA 5A5HB 4G9HA 4LLRA 1MD4A 4L5LA 3FR3A 1XWCA 3HCZA 3IK9A 2VCWA 4F03A 1PKZA 1M9AA 2WGRA 1HD2A 3MYDA 2X8CA 2C4JA 5E59A 2MZCA 6GSUA 1XWBA 2VCVA 4HJMA 3LXTA 4G0IA 5ECHB 3FW2A 1GRXA 5B8AA 4TR0A 3HA9A 4GF0A 5GAPD 3FZ4A 4MJAA 5JCUA 3MNGA 3JCML 5IOXA 5A5KA 5G1KA 4WR5A 1OVNA 3C73A 5CNWA 3GKNA 4OD7A 1T7PB 12GSA 3IC8A 19GSA 2LJRA 2LJKA 3CTFA 1GTUA 2P0GA 2PWJA 4F0BA 2O7KA 5H5SA 2GSRA 2KUCA 2VL3A 1YY7A 1JFUA 1T4YA 5L71A 1DE1A 2JU5A 2FA4A 4MZCA 4V2NA 4F9ZA 1BQ7A 1DSBA 3FR6A 1J08A 2YWIA 1WPIA 4HQZA 1M7TA 1GWCA 1Z6MA 4OFTA 4IP6A 1RK4A 3GA4A 1F2EA 3KH7A 4FIWA 3RDWA 17GSA 3MIXA 2C0GA 1TW9A 2DMMA 4N11A 1UC7A 2RM5A 2B7JA 1SD9A 5E4WA 2YANA 3LQ7A 1SL2B 2VLUA 4K7IA 1HQOA 5EY6A 4X1UA 3PGTA 1XIYA 5GSTA 3FMWA 4O7HA 1F3BA 2YJ7A 1SL1B 2M80A 3WD6A 4KDXA 5JCGA 1GSFA 1GUHA 2HLSA 3KP8A 3U6VA 1ERWA 4EXJA 1JLVA 5ECLB 3IHGA 2C0DA 2O5VA 2PN8A 2HRAA 3R2QA 2LEGA 4HEA2 1AUCA 4KAEA 2OBIA 2KLXA 1EGOA 3DRNA 2C3QA 1EGRA 1U87A 3N5OA 4ML6A 4EF0A 1B9YC 3TGZA 2WS2A 5CRHA 1SVMA 3TRXA 4QL9A 4JBBA 3KXOA 3GFKA 4I6XA 5HFIA 5D8IA 5F0GA 2H70A 1SVLA 2YZHA 4ZIJA 2H1DA 1CQHA 3BCIA 2NTOA 1IYIA 2HZFA 4WBRD 2R37A 4XCSA 3C8EA 1YKAA 2H1LA 4HJ2A 1SK1A 3GTUA 2QKEA 4AI6A 4HU9A 2K6VA 3HKRA 4CY8A 4MP4A 5DAKA 5CRWA 4YH2A 1BYEA 2A4VA 2J9HA 4NV5A 4PUFC 2H1AA 3L9VA 3EVIA 3QFAC 1W89A 3QPMA 5ECRB 2NVLA 3IA1A 2LSTA 4O32A 1FVKA 1K0BA 2EIOA 4QMKA 4PQHA 4RQXA 2V2GA 2F9SA 2NDOA 4PQ1A 4AGSA 5GAND 2AB6A 3F3QA 3A5IA 2EFCA 3EWLA 5ECNB 2I9HA 4EDYA 1GSYA 2VL2A 4KH7A 1OC3A 5D93A 3A2WA 1PKWA 1AW9A 4BVXA 5G5FA 2VUPA 3RAZA 5A34B 1K0MA 6GSTA 1XZOA 4XS4A 5DQYA 3W8JA 3ZMLA 2RUFA 1HNBA 4BVYA 4ZBAA 2OADA 18GSA 4GLTA 4GSSA 2L5OA 2EIRA 4MH3A 4PNGA 3WYWA 1K0DA 4ECCA 2ZUPA 1AQWA 3MSZA 3TKRA 3BJ5A 2UV8G 3DXBA 3O76A 1QMVA 1URMA 2IJYA 3LYKA 3ZITA 1THXA 4ZILA 3KH9A 1N8JA 4ZBBA 2VL2C 2YWNA 4MA9A 5CREA 1JZOA 2EFEA 5G5EA 1S3DA 3VFIA 2V1MA 4LA1A 4O5QA 1Z6NA 5IQYA 2L5LA 2GQMA 4TKYA 4AJ8A 3VURA 4L8EA 2B7KA 1RW1A 3H93A 1I9DA 4IW9A 3F63A 4NAXA 1DUGA 1GLQA 3GRXA 2YOIA 1R7HA 4MNNA 2H6ZA 3C7MA 4YQVA 3UVHA 1PD21 3E0UA 1PQNA 4G10A 2EIQA 3FR9A 1QK8A 2CVKA 3MWHA 3ERGA 1A2LA 1T3BA 5KN0A 2H19A 5J5NA 1RQMA 1XW6A 1XVWA 3PR8A 2VAFA 4MJEA 3SBCA 3W8SA 4EL1A 1ABAA 1KTEA 2B5YA 1TXUA 1GSUA 2WJUA 1HYUA 3L78A 4K2DA 2B1LA 4EIQA 3A5WA 1Y1UA 1M2BA 2IWTA 3D21A 5H5RA 2CQ9A 1TK5B 2DSAA 4AF2A 2H72A 4YKGA 5A1NA 3GX0A 4L5OA 2M46A 2FNOA 3HDCA 3TJGA 2A2SA 2JSYA 1K0AA 1FVJA 4RI7A 3VWWA 5F8BA 3GH9A 4F2IA 2WB9A 5D9TA 1N2AA 5DDLA 3APOA 1ERVA 2I1UA 2PU9C 1A24A 3ERWA 1SKWB 5COHA 3TU3B 3ZFLA 2QSIA 1O6JA 3KTLA 2FUG2 3TKSA 3GMFA 3TJJA 2VM1A 3F6DA 3IXRA 2VO4A 2GQLA 1LU4A 2OA7A 1JHBA 2D2ZA 1EOGA 1SVOA 1O7UA 2M72A 1QUWA 4OFNA 3IR4A 3QAGA 2VCXA 2H76A 3IE3A 3P90A 1ACVA 2GTUA 3DVWA 4MH2A 4OCFA 3E9JB 4MPFA 5HQPA 4TR1A 3M3MA 1X5DA 2IMEA 4WKWA 3KP9A 3GTUB 2DJ3A 2B6MA 3ZMKA 2CX4A 1B4QA 3GKXA 4TW5A 1BJXA 3Q6OA 4MLYA 3F6FA 5DAKB 4JE1A 2RUEA 1QFNA 1MDKA 4KE3A 3TKSC 1SJ6A 5B7CA 1PN9A 1TDIA 1GULA 2GQKA 2RIIA 2R5GA 3CYNA 4WF4A 5J3RA 1EWXA 2GVPA 1UVZA 5J47A 1A2MA 4PQIA 3UBKA 4BA7A 2C3NA 4ZBDA 4JZQA 4CY6A 2V41A 2P31A 4ISDA 4POKA 1UA5A 11GSA 2L57A 2ALBA 3Q19A 1B9XC 4ZB7A 5JCWA 4BVXB 4ZL7A 4V2LA 4ACSA 2YWMA 2HSNA 5ECOB 2FWGA 1O81A 3APSA 2XHFA 4XS4B 1G7EA 4K7NA 1FOHA 1PMTA 2JZTA 4BVYB 10GSA 4A5PA 3IBHA 2YPMA 5ECMB 5LD0A 2X64A 3LWAA 1YQ1A 1SJZA 1ZYNA 22GSA 5J4VA 2MMAA 2L6DA 2JL4A 2KP2A 5CRGA 2CZ2A 4XTSA 2G0FA 4J57E 2CVDA 1EP7A 1TXXA 4OO5A 2KOKA 4ECJA 4JR4A 3D0ZA 1Y25A 3EU3A 1TU7A 4EVMA 3MDKA 1V98A 3I69A 5HR1A 4AKXB 4QQ7A 4WEYA 1GSSA 5HR2A 4O92A 1O73A 3RPNA 1A2JA 2FWFA 1FB0A 2PVOC 3LJRA 4EUYA 1OE8A 3HJPA 2HQTA 3ZIJA 4KSOA 5ELAA 2IMKA 2DJ2A 1Z7RA 2A2RA 3QMXA 4MF7A 3BBYA 2RM6A 2H8LA 1PRXA 2H75A 4TN8A 5IOWA 1EEJA 2N5AA 4KNDA 1V58A 3R3EA 2H6XA 4N10A 1TJDA 3FHKA 4OWYA 4MDCA 1K0NA 1XWAA 5CP1A 4PNFA 3F0IA 3TOTA 1TRVA 1XFLA 3IHQA 5A1NB 3M9KA 5IO0A 3ZL5A 4GWRA 2A2PA 3VK9A 1XOAA 1MEKA 3OR5A 2DBCA 4WETA 5F05A 1GLPA 2YZUA 2XPDA 3TJKA 1OKDA 4KX4A 4E8HA 2LRNA 1B48A 3TDGA 4YKFA 1R5AA 4N30A 3LSZA 2YV7A 2LRCA 3EU4A 4XIHA 3LEFA 3F4SA 3FY7A 4WF5A 1Q98A 2X49A 2E2MA 5HFKA 2DJKA 4J56E 4KW6A 2LV3A 3GL3A 1TU8A 3ZLPA 4J2FA 3EMXA 3VWXA 2H71A 4JRRA 1LJRA 2GZYA 1VGLA 5AISA 2WZ9A 3HMJG 1SJIA 5D9WA 3TKSE 3ME7A 4TR1B 4EC0A 2CAQA 4DSQA 3PINA 4IVFA 2ZCTA 4MCUA 4EIPA 3DEXA 3I9V2 3CBUA 4XRDA 3GSSA 1H75A 2DIZA 2JSZA 4MZWA 5KN3A 1S3AA 2QGVA 1PX6A 4I97A 4X43A 4TR4A 2F51A 8GSSA 4HOJA 3K8NA 2MBTA 4JEDA 3VWVA 5B6NA 2YNXA 4GCIA 2OBKA 3LG6A 5FHIA 4Z7XA 4E8EA 3KM6A 5C04A 1R4WA 1M0UA 1CQGA 1M9BA 2DJ1A 1WP0A 4K1FA 2O87A 5DCGA 3CSHA 1M99A 1ST9A 1AAZA 1N25A 1AXDA 5DJLA 5KOWA 2FCHA 1B4PA 3UARA 1X5CA 4EKZA 3LW9A 3GX8A 3H4KA 1F6MC 2IL3A 2VCQA 2HRNA 4FH8A 6GSVA 1TP9A 1XBSA 2ZNMA 2R0GA 1X0RA 2HSNB 4USSA 1K3LA 1FAAA 5CRDA 5A4WA 2H74A 1ML6A 1SD8A 1USBA 4POMA 1ZCPA 2NPBA 2C8UA 1T1VA 3UIWA 1G6YA 4L0WA 2PGTA 4CW9A 1YDKA 2MMNA 1XOBA 1PGTA 5ECKB 4ZB9A 2GS3A 1NM3A 1GSQA 3D4TA 1ZGNA 1U3IA 2BMXA 2QA1A 1S3CA 4XHMA 1Z3EA 2FY6A 20GSA 3V1WA 3GL5A 4TR3A 3QD9A 3FRCA 3F4TA 1PL2A 4E68A 3GN3A 3HYPA 4K0GA 1SKRB 1GP1A 4G0LA 2VKZG 5HFGA 4NMUA 1ZYQB 2H66A 4AKGA 4DSSA 2H6YA 2LNSA 2CZ3A 3A2VA 4POLA 5G30A 3GSTA 3PH9A 1BEDA 2WRTA 2L4QA 5IO2A 1H4OA 2B5XA 4QL7A 5LCZA 3UBLA 1YJ6A 1GNEA 2OACA 1F37A 4K6XA 3M8NA 5AN1A 3J7Yb 3HXSA 1JZWA 2OE1A 5A4UA 2IFQA 1VF1A 1G6WA 1R26A 1NSWA 2YP6A 4KDUA 1TI3A 1WWJA 5KN2A 4NXIA 4W66A 4ZL8A 2L6CA 3KGKA 3KTBA 5ECQB 2C0FA 3GH6A 2CV4A 2H0HA 5B8BA 1YZXA 3I6AA 2VL9A 2KHPA 2DC5A 3HD5A 3SWLA 2N5FA 1M2AA 4FYCA 1SYXA 3ZTLA 4AKHA 5INYA 4I2TA 2OE3A 3CSIA 3EC3A 5D9XA 3RHCA 1KBNA 1PA3A 3HVSA 2LNTA 4KCEA 1B8XA 1GSEA 5J41A 2WDUA 2WFCA 1AQVA 5JWQB 3DD3A 3FEUA 1Q4JA 2K8VA 2L4CA 4XRAA 1X9SB 2IMIA 2LRTA 1XVQA 1THOA 5JWOB 3EINA 5KOXA 2K18A 1C72A 3E3EA 2B1KA 2E0QA 3WGXA 2REMA 3IAM2 1PN0A 2JZSA 2P5RA 1GH2A 1OC9A 4P3YB 2HSYA 3APQA 2H01A 4DSRA 4X0XA 4KCAA 4H86A 4N0VA 2GSTA 5JWRB 2R6KA 2CA8A 4IP1A 4O5UA 2AJQB 5DQSA 1OE7A 3FK8A 3RHBA 5IMDA 4WBJA 4IQ1A 4HUAA 3QDNA 1FB6A 3EE2A 4I2UA 3LFLA 1XW5A 2EC4A 4OCEA 1PSQA 5G1LA 2GGTA 3ZYWA 1MDJA 4HZ2A 3TUEA 5CAXA 3LYPA 3P8WA 3HY2A 2IN3A 4HI7A 5HR3A 1ILOA 3C71A 4ML1A 2PUKC 5ELGA 5DCHA 1O8WA 1K0OA 2N5BA 3WGDA 1YF0A 5G2ZA 3DIEA 4JR6A 2HSHA 3GHAA 4WXTA 3N9JA 4OO4A 1WJKA 1QQ2A 1E2YA 2GDRA 4LMWA 2E2GA 1ERUA 2VM2A 5AGYA 2MYGA 4JU5A 3IPZA 2C0EA 5CO3A 4F0CA 1GUKA 2A4HA 4V1Ag 3DGQA 2LKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POB A;  4KGI A;  3TRP A;  1TKD B;  3HZ4 A;  2HYX A;  3G9B A;  2OKA A;  3M9J A;  3L9U A;  1OC8 A;  4ZXG A;  4IJ3 A;  1K3Y A;  16GS A;  5F06 A;  3HZ8 A;  1HNC A;  9GSS A;  5A4V A;  3A2X A;  3QAW A;  2YWO A;  5D9V A;  4XS1 A;  2IMD A;  2IPA A;  3KMN A;  2HRF A;  13GS A;  2CT6 A;  2E7P A;  4I5Q A;  1MD3 A;  4ZB6 A;  2ON5 A;  1X5E A;  5B6M A;  1VF4 A;  3LOR A;  2YCD A;  4DEJ A;  1QGV A;  5EPF A;  4CDO A;  4NPB A;  1TK0 B;  2FD3 A;  1O85 A;  2B5E A;  3VWU A;  4GRF A;  3A3T A;  4Q5N A;  1FHE A;  4DSS B;  3MAK A;  2BTO T;  2LQQ A;  5G31 A;  3ERF A;  3GUS A;  1A8L A;  3NZN A;  1JZD A;  5IMA A;  2RLI A;  3TB2 A;  3LXZ A;  4MZB A;  4GQF A;  3CRT A;  5IMC A;  5FT3 A;  4FQU A;  4ECB A;  5FWG A;  4MJB A;  1ZZY A;  3F9U A;  1G7O A;  2IFQ B;  2QC7 A;  3QFB C;  2HFD A;  4FO5 A;  2K8S A;  1BAY A;  1HNA A;  4NWY A;  4D73 A;  5H5Q A;  1FO5 A;  5DAL A;  3IC4 A;  1A8Y A;  4OFM A;  3P7X A;  1TRW A;  1MTC A;  4K9Z A;  1JLW A;  4MF6 A;  5HR0 A;  3WT2 A;  4IBP A;  3FZA A;  1TRS A;  3D22 A;  3ZRE A;  4IS0 A;  5IMV A;  2LS5 A;  2AYT A;  2H1B A;  1T8E B;  2LJA A;  3GNJ A;  4EE0 A;  2FA8 A;  3M0F A;  6GSX A;  1WIK A;  3VI7 A;  3GKK A;  1LBK A;  4IGJ A;  3G7J A;  4HQS A;  2G2Q A;  1X9M B;  2LTK A;  3D5J A;  3IK7 A;  4ID0 A;  3TCO A;  1G0T A;  1V2A A;  1NHY A;  3IRA A;  4ULX A;  1O8X A;  2H0G A;  2OE0 A;  1GTA A;  4F82 A;  2GT5 A;  4ECI A;  3S9F A;  1XW9 A;  3F3R A;  2VOC A;  1WRY A;  4FYU A;  1GTI A;  2VD0 A;  1TI1 A;  1V9W A;  1FG4 A;  4RI6 A;  3CRU A;  5ABR A;  2JZR A;  1OC9 B;  3GKM A;  5IM9 A;  4MF5 A;  5ECI B;  2MBS A;  4AJ7 A;  3NIV A;  1AC1 A;  2DML A;  2H1G A;  4MPG A;  1EP8 A;  4HS1 A;  5AIV A;  4MAB A;  1T00 A;  2JAD A;  2OJL A;  3UOM A;  4Q5Q A;  2R2J A;  4ZL9 A;  2IIY A;  2C1Y A;  3UMA A;  1GTB A;  3QAV A;  1TK8 B;  2AHE A;  1EV9 A;  3AY8 A;  2GZZ A;  2VIM A;  3G7Y A;  1SK0 A;  4LL4 B;  2HE3 A;  4TXO A;  1FW1 A;  2PVQ A;  5ID2 A;  4LL1 B;  3KMO A;  3L4N A;  1MDI A;  2HXK A;  4PUR A;  1K3O A;  3CSJ A;  3O3T A;  4GTU A;  1WOU A;  3CXG A;  1W4V A;  1M2D A;  1A0R P;  2WUL A;  4BL7 A;  4GQC A;  5EL8 A;  2HSM A;  1NHO A;  3QCP A;  1OAZ A;  2I4A A;  2DIY A;  4PTS A;  3PPU A;  2UZ8 A;  5KEJ A;  3UVT A;  2V6O A;  1SKS B;  3C1R A;  1SK2 A;  1QXH A;  3GV1 A;  3D4M A;  4L0U A;  3ZVJ A;  4BWS A;  1YF1 A;  4PXO A;  1TOF A;  2X99 A;  2PBJ A;  4BWQ A;  3G7I A;  1VF3 A;  1F9M A;  1GUM A;  3FZ5 A;  2R3X A;  4TRX A;  3H8Q A;  2YJH A;  4YQU A;  1E6B A;  2VLT A;  2ES7 A;  1ON4 A;  3ZRD A;  3EUR A;  1IYH A;  3J7Y k;  2ON7 A;  3CMI A;  3IAS 2;  2GT6 A;  3RBT A;  3GYK A;  4IN0 A;  3UL3 A;  4Q5F A;  4PX1 A;  2R4V A;  1BX9 A;  5ECP B;  1ZMA A;  4Q5R A;  1EZK A;  4IJI A;  4TVE A;  5LNK e;  1A0F A;  2B3S A;  5C00 A;  2HRK A;  1V57 A;  3TOU A;  2GSQ A;  5EVO A;  14GS A;  3ZZX A;  1T4Z A;  2L59 A;  3GUR A;  3KCM A;  3QR6 A;  4YAP A;  1UN2 A;  5IIZ A;  4RUV A;  2LQO A;  1J9B A;  1ZOF A;  2VD1 A;  1XCC A;  3W6G A;  4GST A;  2FLS A;  5IPG A;  4HZ4 A;  4KF9 A;  1ERT A;  4D73 B;  2F8F A;  3DVX A;  4K0N A;  5IMZ A;  5DAL B;  3ME8 A;  3D6I A;  3VPQ A;  2AV4 A;  3BD2 A;  2F3M A;  4GSN A;  3WT1 A;  2HNL A;  7GSS A;  1WMJ A;  3HHV A;  1SEN A;  4O5R A;  5KN1 A;  2YN1 A;  1DBY A;  5DJM A;  4NHZ A;  4IKH A;  5AIX A;  3UJ1 A;  3HVX A;  5BMU A;  3US3 A;  1XWG A;  1YEX A;  2F8A A;  2KP1 A;  3L0H A;  4FYB A;  1SYR A;  2XBQ A;  1VRS D;  5CYY A;  2CAI A;  3CTG A;  3LGC A;  2HZE A;  4ILF A;  3RPP A;  4K8M A;  2PMT A;  3DKS A;  1PL1 A;  1TRU A;  1EEM A;  2XBI A;  2O89 A;  3DML A;  3H1N A;  1KEB A;  4PUA A;  3C1S A;  3KZQ A;  5F07 A;  2MMO A;  4EDZ A;  3UEM A;  3TJB A;  4V1A p;  1OYJ A;  1GSD A;  2GLR A;  1JZR A;  2GZP A;  1YEP A;  4RQR A;  3KEB A;  4EO3 A;  3VI5 A;  2X8G A;  3TKQ A;  3ZVJ D;  2V6K A;  1Y6E A;  2Z9S A;  2V32 A;  3DYR A;  2TRC P;  2O8V B;  4V2M A;  3F8U A;  3IDV A;  1DE2 A;  2H73 A;  3H79 A;  1J0F A;  1WE0 A;  4OMV A;  3Q18 A;  1BG5 A;  4I8B A;  3EYT A;  3Q74 A;  3VLN A;  2YV9 A;  4TOP A;  4KDY A;  5D73 A;  6GSY A;  2AAW A;  1YKC A;  2VCT A;  1A23 A;  3HJM A;  1SU9 A;  4IQA A;  2AUV A;  2FWE A;  2LUS A;  3IV4 A;  2HT9 A;  1AQX A;  4TXO B;  3FKF A;  5ID2 B;  2GSS A;  4KUN A;  1R5P A;  4NV2 A;  1ZL9 A;  2X8H A;  3KD0 A;  2FGX A;  4XS6 A;  4AJ6 A;  4G19 A;  2DLX A;  4LMV A;  1ZYE A;  4IHU A;  5IPH A;  1EOH A;  4IEL A;  4BL7 B;  2P5Q A;  1V40 A;  1SL0 B;  2J23 A;  3ED3 A;  2HSM B;  3P2A A;  2NBS A;  4G2E A;  3HVV A;  3KJY A;  4PGT A;  2BJX A;  2DJJ A;  2C3T A;  4MJC A;  4YQM A;  4G0K A;  2PPT A;  3U5R E;  1X9W B;  3NOF A;  1VF2 A;  2XPE A;  3L9S A;  5ECS A;  4CHS A;  1GL8 A;  2C80 A;  4K7O A;  3HJO A;  3BCK A;  3WGE A;  3EMP A;  3TJF A;  2TRX A;  2FHE A;  2I81 A;  2JAC A;  4KA0 A;  3GIX A;  5J9C A;  3FZ9 A;  1U3A A;  4NHW A;  4N0Z A;  1AIU A;  4HDE A;  1XXU A;  4TXV A;  3ZIV A;  5D96 A;  4HU7 A;  3KIJ A;  3M1G A;  2TIR A;  3VPT A;  2MMZ A;  2CX3 A;  5GZZ B;  2XC2 A;  1OKT A;  2WCI A;  1Z7P A;  4YAV A;  4MK3 A;  1F3A A;  1NW2 A;  2IMF A;  1GNW A;  2K9F A;  2HRK B;  1Z9H A;  3BOA A;  3DWV A;  4KSM A;  4ZB8 A;  2FWH A;  1XPV A;  1EV4 A;  1Z5Y E;  6GSW A;  2HI7 A;  2CVB A;  6GSS A;  4GXZ A;  3UAP A;  3ISO A;  3ZFB A;  2H30 A;  3IOS A;  2H0I A;  3TKP A;  1K0C A;  2O85 A;  4KB3 A;  3I43 A;  5GSS A;  2I3Y A;  5DBQ A;  5J4U A;  3F4R A;  1XWK A;  5DVB A;  2VLV A;  1U88 A;  2PER A;  1PX7 A;  1U6T A;  2DJ0 A;  1FOV A;  3FYG A;  1KNG A;  4MMM A;  3O6T A;  3QOU A;  5J9B A;  3TRQ A;  4DVC A;  4BPY A;  2HZE B;  5ENU A;  4WR4 A;  1I5G A;  1TTZ A;  2VCZ A;  5IMF A;  4G9H A;  4LLR A;  1MD4 A;  4L5L A;  3FR3 A;  1XWC A;  3HCZ A;  3IK9 A;  2VCW A;  4F03 A;  1PKZ A;  1M9A A;  2WGR A;  1HD2 A;  2X8C A;  2C4J A;  5E59 A;  2MZC A;  6GSU A;  1XWB A;  2VCV A;  4HJM A;  3LXT A;  4G0I A;  5ECH B;  3FW2 A;  1GRX A;  5B8A A;  4TR0 A;  3HA9 A;  4GF0 A;  5GAP D;  3FZ4 A;  4MJA A;  5JCU A;  3MNG A;  3JCM L;  5IOX A;  5A5K A;  5G1K A;  4WR5 A;  1OVN A;  3C73 A;  5CNW A;  3GKN A;  4OD7 A;  1T7P B;  12GS A;  3IC8 A;  19GS A;  2LJR A;  2LJK A;  3CTF A;  1GTU A;  2P0G A;  2PWJ A;  4F0B A;  2O7K A;  5H5S A;  2GSR A;  2KUC A;  2VL3 A;  1YY7 A;  1JFU A;  1T4Y A;  5L71 A;  1DE1 A;  2JU5 A;  2FA4 A;  4MZC A;  4V2N A;  4F9Z A;  1BQ7 A;  1DSB A;  3FR6 A;  1J08 A;  2YWI A;  1WPI A;  4HQZ A;  1M7T A;  1GWC A;  1Z6M A;  4OFT A;  4IP6 A;  1RK4 A;  3GA4 A;  1F2E A;  3KH7 A;  4FIW A;  3RDW A;  17GS A;  2C0G A;  1TW9 A;  2DMM A;  4N11 A;  1UC7 A;  2RM5 A;  2B7J A;  1SD9 A;  5E4W A;  2YAN A;  3LQ7 A;  1SL2 B;  2VLU A;  4K7I A;  1HQO A;  5EY6 A;  4X1U A;  3PGT A;  1XIY A;  5GST A;  4O7H A;  1F3B A;  2YJ7 A;  1SL1 B;  2M80 A;  3WD6 A;  4KDX A;  5JCG A;  1GSF A;  1GUH A;  2HLS A;  3KP8 A;  3U6V A;  1ERW A;  4EXJ A;  1JLV A;  5ECL B;  2C0D A;  2PN8 A;  2HRA A;  3R2Q A;  2LEG A;  4HEA 2;  1AUC A;  4KAE A;  2OBI A;  2KLX A;  1EGO A;  3DRN A;  2C3Q A;  1EGR A;  1U87 A;  3N5O A;  4ML6 A;  4EF0 A;  1B9Y C;  3TGZ A;  2WS2 A;  5CRH A;  3TRX A;  4QL9 A;  4JBB A;  3KXO A;  3GFK A;  4I6X A;  5HFI A;  5D8I A;  5F0G A;  2H70 A;  2YZH A;  4ZIJ A;  2H1D A;  1CQH A;  3BCI A;  2NTO A;  1IYI A;  2HZF A;  4WBR D;  2R37 A;  4XCS A;  3C8E A;  1YKA A;  4HJ2 A;  1SK1 A;  3GTU A;  2QKE A;  4HU9 A;  2K6V A;  3HKR A;  4MP4 A;  5DAK A;  5CRW A;  4YH2 A;  1BYE A;  2A4V A;  2J9H A;  4NV5 A;  4PUF C;  2H1A A;  3L9V A;  3EVI A;  3QFA C;  1W89 A;  3QPM A;  5ECR B;  2NVL A;  3IA1 A;  2LST A;  4O32 A;  1FVK A;  1K0B A;  2EIO A;  4PQH A;  4RQX A;  2V2G A;  2F9S A;  2NDO A;  4PQ1 A;  4AGS A;  5GAN D;  2AB6 A;  3F3Q A;  3EWL A;  5ECN B;  2I9H A;  4EDY A;  1GSY A;  2VL2 A;  4KH7 A;  1OC3 A;  5D93 A;  3A2W A;  1PKW A;  1AW9 A;  4BVX A;  5G5F A;  2VUP A;  3RAZ A;  1K0M A;  6GST A;  1XZO A;  4XS4 A;  5DQY A;  3W8J A;  3ZML A;  2RUF A;  1HNB A;  4BVY A;  4ZBA A;  2OAD A;  18GS A;  4GLT A;  4GSS A;  2L5O A;  2EIR A;  4MH3 A;  4PNG A;  3WYW A;  1K0D A;  4ECC A;  2ZUP A;  1AQW A;  3MSZ A;  3TKR A;  3BJ5 A;  3DXB A;  3O76 A;  1QMV A;  1URM A;  2IJY A;  3LYK A;  3ZIT A;  1THX A;  4ZIL A;  3KH9 A;  1N8J A;  4ZBB A;  2VL2 C;  2YWN A;  4MA9 A;  5CRE A;  1JZO A;  5G5E A;  1S3D A;  3VFI A;  2V1M A;  4LA1 A;  1Z6N A;  5IQY A;  2L5L A;  2GQM A;  4TKY A;  4AJ8 A;  3VUR A;  4L8E A;  2B7K A;  1RW1 A;  3H93 A;  1I9D A;  4IW9 A;  3F63 A;  4NAX A;  1DUG A;  1GLQ A;  3GRX A;  2YOI A;  1R7H A;  2H6Z A;  3C7M A;  4YQV A;  3UVH A;  1PD2 1;  3E0U A;  1PQN A;  4G10 A;  2EIQ A;  3FR9 A;  1QK8 A;  2CVK A;  3MWH A;  3ERG A;  1A2L A;  1T3B A;  5KN0 A;  2H19 A;  5J5N A;  1RQM A;  1XW6 A;  1XVW A;  3PR8 A;  2VAF A;  4MJE A;  3SBC A;  3W8S A;  4EL1 A;  1ABA A;  1KTE A;  2B5Y A;  1GSU A;  2WJU A;  1HYU A;  3L78 A;  4K2D A;  2B1L A;  3A5W A;  1M2B A;  2IWT A;  3D21 A;  5H5R A;  2CQ9 A;  1TK5 B;  2DSA A;  4AF2 A;  2H72 A;  3GX0 A;  4L5O A;  2M46 A;  2FNO A;  3HDC A;  3TJG A;  2A2S A;  2JSY A;  1K0A A;  1FVJ A;  4RI7 A;  3VWW A;  5F8B A;  3GH9 A;  4F2I A;  2WB9 A;  5D9T A;  1N2A A;  5DDL A;  3APO A;  1ERV A;  2I1U A;  2PU9 C;  1A24 A;  3ERW A;  1SKW B;  5COH A;  3ZFL A;  2QSI A;  1O6J A;  3KTL A;  2FUG 2;  3TKS A;  3GMF A;  3TJJ A;  2VM1 A;  3F6D A;  3IXR A;  2VO4 A;  2GQL A;  1LU4 A;  2OA7 A;  1JHB A;  2D2Z A;  1EOG A;  1O7U A;  2M72 A;  1QUW A;  4OFN A;  3IR4 A;  3QAG A;  2VCX A;  2H76 A;  3IE3 A;  3P90 A;  1ACV A;  2GTU A;  3DVW A;  4MH2 A;  4OCF A;  3E9J B;  4MPF A;  5HQP A;  4TR1 A;  3M3M A;  1X5D A;  2IME A;  4WKW A;  3KP9 A;  3GTU B;  2DJ3 A;  2B6M A;  3ZMK A;  2CX4 A;  1B4Q A;  3GKX A;  4TW5 A;  1BJX A;  3Q6O A;  4MLY A;  3F6F A;  5DAK B;  4JE1 A;  2RUE A;  1QFN A;  1MDK A;  4KE3 A;  3TKS C;  1SJ6 A;  5B7C A;  1PN9 A;  1TDI A;  1GUL A;  2GQK A;  2RII A;  2R5G A;  3CYN A;  4WF4 A;  5J3R A;  1EWX A;  2GVP A;  1UVZ A;  1A2M A;  4PQI A;  3UBK A;  4BA7 A;  2C3N A;  4ZBD A;  4JZQ A;  2V41 A;  2P31 A;  4ISD A;  4POK A;  1UA5 A;  11GS A;  2L57 A;  2ALB A;  3Q19 A;  1B9X C;  5JCW A;  4BVX B;  4ZL7 A;  4V2L A;  4ACS A;  2YWM A;  5ECO B;  2FWG A;  1O81 A;  3APS A;  2XHF A;  4XS4 B;  1G7E A;  4K7N A;  1PMT A;  2JZT A;  4BVY B;  10GS A;  3IBH A;  2YPM A;  5ECM B;  5LD0 A;  2X64 A;  3LWA A;  1YQ1 A;  1SJZ A;  22GS A;  2MMA A;  2L6D A;  2JL4 A;  2KP2 A;  5CRG A;  2CZ2 A;  4XTS A;  2G0F A;  4J57 E;  2CVD A;  1EP7 A;  1TXX A;  4OO5 A;  2KOK A;  4ECJ A;  4JR4 A;  3D0Z A;  1Y25 A;  3EU3 A;  1TU7 A;  4EVM A;  3MDK A;  1V98 A;  3I69 A;  5HR1 A;  4QQ7 A;  4WEY A;  1GSS A;  5HR2 A;  4O92 A;  1O73 A;  3RPN A;  1A2J A;  2FWF A;  1FB0 A;  2PVO C;  3LJR A;  4EUY A;  1OE8 A;  3HJP A;  2HQT A;  3ZIJ A;  4KSO A;  5ELA A;  2IMK A;  2DJ2 A;  1Z7R A;  2A2R A;  3QMX A;  4MF7 A;  3BBY A;  2RM6 A;  2H8L A;  1PRX A;  2H75 A;  4TN8 A;  5IOW A;  1EEJ A;  2N5A A;  4KND A;  1V58 A;  3R3E A;  2H6X A;  4N10 A;  1TJD A;  3FHK A;  4OWY A;  4MDC A;  1K0N A;  1XWA A;  5CP1 A;  4PNF A;  3F0I A;  3TOT A;  1TRV A;  1XFL A;  3IHQ A;  5IO0 A;  3M9K A;  3ZL5 A;  4GWR A;  3VK9 A;  1XOA A;  1MEK A;  3OR5 A;  2DBC A;  4WET A;  5F05 A;  1GLP A;  2YZU A;  2XPD A;  3TJK A;  1OKD A;  4KX4 A;  4E8H A;  2LRN A;  1B48 A;  3TDG A;  1R5A A;  4N30 A;  3LSZ A;  2YV7 A;  2LRC A;  3EU4 A;  4XIH A;  3LEF A;  3F4S A;  3FY7 A;  4WF5 A;  1Q98 A;  2E2M A;  5HFK A;  2DJK A;  4J56 E;  4KW6 A;  2LV3 A;  3GL3 A;  1TU8 A;  3ZLP A;  4J2F A;  3EMX A;  3VWX A;  2H71 A;  4JRR A;  1LJR A;  2GZY A;  1VGL A;  5AIS A;  2WZ9 A;  1SJI A;  5D9W A;  3TKS E;  3ME7 A;  4TR1 B;  4EC0 A;  2CAQ A;  4DSQ A;  3PIN A;  4IVF A;  2ZCT A;  4MCU A;  3DEX A;  3I9V 2;  3CBU A;  4XRD A;  3GSS A;  1H75 A;  2DIZ A;  2JSZ A;  4MZW A;  5KN3 A;  1S3A A;  2QGV A;  1PX6 A;  4I97 A;  4X43 A;  4TR4 A;  2F51 A;  8GSS A;  4HOJ A;  3K8N A;  2MBT A;  4JED A;  3VWV A;  5B6N A;  2YNX A;  4GCI A;  2OBK A;  3LG6 A;  5FHI A;  4Z7X A;  4E8E A;  3KM6 A;  5C04 A;  1R4W A;  1M0U A;  1CQG A;  1M9B A;  2DJ1 A;  1WP0 A;  4K1F A;  2O87 A;  5DCG A;  3CSH A;  1M99 A;  1ST9 A;  1AAZ A;  1AXD A;  5DJL A;  2FCH A;  1B4P A;  3UAR A;  1X5C A;  4EKZ A;  3GX8 A;  3H4K A;  1F6M C;  2IL3 A;  2VCQ A;  2HRN A;  4FH8 A;  6GSV A;  1TP9 A;  1XBS A;  2ZNM A;  1X0R A;  2HSN B;  4USS A;  1K3L A;  1FAA A;  5CRD A;  5A4W A;  2H74 A;  1ML6 A;  1SD8 A;  1USB A;  4POM A;  1ZCP A;  2NPB A;  2C8U A;  1T1V A;  3UIW A;  1G6Y A;  4L0W A;  2PGT A;  4CW9 A;  1YDK A;  2MMN A;  1XOB A;  1PGT A;  5ECK B;  4ZB9 A;  2GS3 A;  1NM3 A;  1GSQ A;  3D4T A;  1ZGN A;  1U3I A;  2BMX A;  1S3C A;  4XHM A;  1Z3E A;  2FY6 A;  20GS A;  3V1W A;  3GL5 A;  4TR3 A;  3QD9 A;  3FRC A;  3F4T A;  1PL2 A;  3GN3 A;  3HYP A;  4K0G A;  1SKR B;  1GP1 A;  4G0L A;  5HFG A;  4NMU A;  1ZYQ B;  2H66 A;  4DSS A;  2H6Y A;  2LNS A;  2CZ3 A;  3A2V A;  4POL A;  5G30 A;  3GST A;  3PH9 A;  1BED A;  2WRT A;  2L4Q A;  5IO2 A;  1H4O A;  2B5X A;  4QL7 A;  5LCZ A;  3UBL A;  1YJ6 A;  1GNE A;  2OAC A;  1F37 A;  4K6X A;  3M8N A;  5AN1 A;  3J7Y b;  3HXS A;  1JZW A;  2OE1 A;  5A4U A;  2IFQ A;  1VF1 A;  1G6W A;  1R26 A;  1NSW A;  2YP6 A;  4KDU A;  1TI3 A;  1WWJ A;  5KN2 A;  4NXI A;  4ZL8 A;  2L6C A;  3KGK A;  3KTB A;  5ECQ B;  2C0F A;  3GH6 A;  2CV4 A;  2H0H A;  5B8B A;  1YZX A;  3I6A A;  2VL9 A;  2KHP A;  2DC5 A;  3HD5 A;  3SWL A;  2N5F A;  1M2A A;  4FYC A;  1SYX A;  3ZTL A;  5INY A;  4I2T A;  2OE3 A;  3CSI A;  3EC3 A;  5D9X A;  3RHC A;  1KBN A;  1PA3 A;  3HVS A;  2LNT A;  4KCE A;  1B8X A;  1GSE A;  5J41 A;  2WDU A;  2WFC A;  1AQV A;  5JWQ B;  3DD3 A;  3FEU A;  1Q4J A;  2K8V A;  2L4C A;  4XRA A;  1X9S B;  2IMI A;  2LRT A;  1XVQ A;  1THO A;  5JWO B;  3EIN A;  2K18 A;  1C72 A;  3E3E A;  2B1K A;  2E0Q A;  3WGX A;  2REM A;  3IAM 2;  2JZS A;  2P5R A;  1GH2 A;  1OC9 A;  4P3Y B;  2HSY A;  3APQ A;  2H01 A;  4DSR A;  4X0X A;  4KCA A;  4H86 A;  4N0V A;  2GST A;  5JWR B;  2R6K A;  2CA8 A;  4IP1 A;  2AJQ B;  5DQS A;  1OE7 A;  3FK8 A;  3RHB A;  5IMD A;  4WBJ A;  4IQ1 A;  4HUA A;  3QDN A;  1FB6 A;  3EE2 A;  4I2U A;  3LFL A;  1XW5 A;  2EC4 A;  4OCE A;  1PSQ A;  5G1L A;  2GGT A;  3ZYW A;  1MDJ A;  4HZ2 A;  3TUE A;  5CAX A;  3LYP A;  3P8W A;  3HY2 A;  2IN3 A;  4HI7 A;  5HR3 A;  1ILO A;  3C71 A;  4ML1 A;  2PUK C;  5ELG A;  5DCH A;  1O8W A;  1K0O A;  2N5B A;  3WGD A;  1YF0 A;  5G2Z A;  3DIE A;  4JR6 A;  2HSH A;  3GHA A;  4WXT A;  3N9J A;  4OO4 A;  1WJK A;  1QQ2 A;  1E2Y A;  2GDR A;  4LMW A;  2E2G A;  1ERU A;  2VM2 A;  5AGY A;  2MYG A;  4JU5 A;  3IPZ A;  2C0E A;  5CO3 A;  4F0C A;  1GUK A;  4V1A g;  3DGQ A;  2LKU A; 
#chains in the Genus database with same CATH topology
 4POB A;  4KGI A;  3TRP A;  1TKD B;  3HZ4 A;  2HYX A;  3G9B A;  2OKA A;  3M9J A;  3L9U A;  2EFH A;  1M3I A;  1OC8 A;  4ZXG A;  4IJ3 A;  1K3Y A;  16GS A;  5F06 A;  3HZ8 A;  1HNC A;  9GSS A;  5A4V A;  3A2X A;  3QAW A;  2YWO A;  5D9V A;  4XS1 A;  4GDF A;  2IMD A;  2IPA A;  3KMN A;  2HRF A;  13GS A;  2CT6 A;  2E7P A;  4I5Q A;  1MD3 A;  4ZB6 A;  2ON5 A;  1X5E A;  5B6M A;  1VF4 A;  3LOR A;  2YCD A;  4DEJ A;  1QGV A;  5EPF A;  4CDO A;  3RFR C;  4NPB A;  1TK0 B;  2FD3 A;  1O85 A;  2B5E A;  3VWU A;  4GRF A;  3A3T A;  4Q5N A;  1FHE A;  4DSS B;  3MAK A;  2BTO T;  2LQQ A;  5G31 A;  3ERF A;  3GUS A;  1A8L A;  3NZN A;  1JZD A;  5IMA A;  2RLI A;  3TB2 A;  3LXZ A;  4MZB A;  4GQF A;  3CRT A;  5IMC A;  5FT3 A;  4FQU A;  4ECB A;  5FWG A;  4MJB A;  1ZZY A;  3F9U A;  1G7O A;  2IFQ B;  2QC7 A;  3QFB C;  2HFD A;  4FO5 A;  2K8S A;  1BAY A;  1HNA A;  4NWY A;  4D73 A;  5H5Q A;  1FO5 A;  5DAL A;  3IC4 A;  1A8Y A;  1ZYP A;  4OFM A;  3P7X A;  1TRW A;  1MTC A;  4K9Z A;  1JLW A;  4MF6 A;  5HR0 A;  3WT2 A;  4IBP A;  3FZA A;  1TRS A;  3D22 A;  3ZRE A;  4IS0 A;  2WVY A;  5IMV A;  4Z2R A;  2LS5 A;  2AYT A;  2H1B A;  1T8E B;  2LJA A;  5BRT A;  3GNJ A;  4EE0 A;  2FA8 A;  3M0F A;  6GSX A;  1WIK A;  3VI7 A;  3GKK A;  1LBK A;  4IGJ A;  3G7J A;  4HQS A;  2G2Q A;  1X9M B;  2LTK A;  3D5J A;  3IK7 A;  4ID0 A;  2EFD A;  3TCO A;  1G0T A;  1V2A A;  1NHY A;  3IRA A;  4ULX A;  1O8X A;  4K5S A;  2H0G A;  2OE0 A;  1GTA A;  2WVX A;  4F82 A;  2GT5 A;  4ECI A;  3S9F A;  1XW9 A;  3F3R A;  2VOC A;  1WRY A;  4FYU A;  1GTI A;  2VD0 A;  1TI1 A;  1V9W A;  1FG4 A;  4RI6 A;  3CRU A;  5ABR A;  2JZR A;  1OC9 B;  1BG1 A;  3GKM A;  5IM9 A;  4MF5 A;  5ECI B;  2MBS A;  4AJ7 A;  3NIV A;  1AC1 A;  2DML A;  2H1G A;  4MPG A;  5J4Y A;  1EP8 A;  4HS1 A;  5AIV A;  4MAB A;  1T00 A;  2JAD A;  2OJL A;  3UOM A;  4Q5Q A;  2R2J A;  4ZL9 A;  3EPT A;  5J40 A;  2IIY A;  2C1Y A;  3UMA A;  4HSC X;  1GTB A;  3QAV A;  1TK8 B;  2AHE A;  1EV9 A;  3AY8 A;  2GZZ A;  2VIM A;  3G7Y A;  1SK0 A;  3CWG A;  2OT3 A;  4LL4 B;  2HE3 A;  4TXO A;  1FW1 A;  2PVQ A;  5ID2 A;  4LL1 B;  3KMO A;  3L4N A;  1MDI A;  4K2X A;  2HXK A;  4PUR A;  1K3O A;  3CSJ A;  3O3T A;  4GTU A;  1WOU A;  3CXG A;  1W4V A;  1M2D A;  1A0R P;  2WUL A;  4BL7 A;  4Z2U A;  4GQC A;  5EL8 A;  2HSM A;  1NHO A;  3QCP A;  1OAZ A;  2I4A A;  2DIY A;  4PTS A;  3PPU A;  2UZ8 A;  5KEJ A;  3UVT A;  2V6O A;  1SKS B;  3C1R A;  1SK2 A;  1QXH A;  3GV1 A;  3D4M A;  4L0U A;  3ZVJ A;  4BWS A;  1YF1 A;  4PXO A;  1TOF A;  2X99 A;  3RGB C;  2PBJ A;  4BWQ A;  3G7I A;  1VF3 A;  1F9M A;  1GUM A;  3FZ5 A;  2R3X A;  4TRX A;  3H8Q A;  2YJH A;  4YQU A;  1E6B A;  2VLT A;  2ES7 A;  1ON4 A;  3ZRD A;  3EUR A;  1IYH A;  3J7Y k;  2ON7 A;  3CMI A;  3IAS 2;  2GT6 A;  3RBT A;  3GYK A;  4IN0 A;  3UL3 A;  4Q5F A;  4PX1 A;  2R4V A;  1BX9 A;  5ECP B;  1ZMA A;  4Q5R A;  1EZK A;  4IJI A;  4TVE A;  5LNK e;  1A0F A;  2B3S A;  5C00 A;  2HRK A;  1V57 A;  3TOU A;  2GSQ A;  5EVO A;  14GS A;  3ZZX A;  1T4Z A;  2L59 A;  3GUR A;  3KCM A;  3QR6 A;  4YAP A;  1UN2 A;  5IIZ A;  4RUV A;  2LQO A;  2X4A A;  1J9B A;  1ZOF A;  2VD1 A;  1XCC A;  3W6G A;  4GST A;  2FLS A;  5IPG A;  4HZ4 A;  4KF9 A;  1ERT A;  4D73 B;  2F8F A;  3DVX A;  4K0N A;  5IMZ A;  5DAL B;  3ME8 A;  3D6I A;  3VPQ A;  2AV4 A;  3BD2 A;  2F3M A;  4GSN A;  3WT1 A;  2HNL A;  7GSS A;  1WMJ A;  3HHV A;  1SEN A;  4O5R A;  5KN1 A;  2YN1 A;  1DBY A;  5DJM A;  4NHZ A;  4IKH A;  5AIX A;  3UJ1 A;  3HVX A;  5BMU A;  3US3 A;  1XWG A;  1YEX A;  2F8A A;  2KP1 A;  1BF5 A;  3L0H A;  4FYB A;  1SYR A;  2XBQ A;  2QA2 A;  1VRS D;  5CYY A;  2CAI A;  3CTG A;  3LGC A;  2HZE A;  4ILF A;  3RPP A;  4K8M A;  2PMT A;  5A5H A;  3DKS A;  2R0P A;  1PL1 A;  1TRU A;  1EEM A;  2XBI A;  2O89 A;  3DML A;  3H1N A;  1KEB A;  4PUA A;  3C1S A;  3KZQ A;  5F07 A;  2MMO A;  2WVX B;  4EDZ A;  3UEM A;  3TJB A;  4Z2T A;  4V1A p;  1OYJ A;  1GSD A;  2GLR A;  1JZR A;  2GZP A;  1YEP A;  4RQR A;  3KEB A;  4EO3 A;  3VI5 A;  2X8G A;  3TKQ A;  3ZVJ D;  2V6K A;  1Y6E A;  2Z9S A;  2V32 A;  3DYR A;  2TRC P;  4PI2 C;  2O8V B;  4V2M A;  3F8U A;  3IDV A;  1DE2 A;  2H73 A;  3H79 A;  1J0F A;  1WE0 A;  4OMV A;  3Q18 A;  1BG5 A;  4I8B A;  3EYT A;  3Q74 A;  3VLN A;  2YV9 A;  4G01 A;  4TOP A;  4KDY A;  5D73 A;  6GSY A;  2AAW A;  1YKC A;  2VCT A;  1A23 A;  3HJM A;  2R0C A;  1SU9 A;  1YVL A;  4IQA A;  2AUV A;  2FWE A;  2LUS A;  3IV4 A;  2HT9 A;  1AQX A;  4TXO B;  3FKF A;  5ID2 B;  4N3Z A;  2GSS A;  4KUN A;  1R5P A;  2WVZ A;  4NV2 A;  1ZL9 A;  2X8H A;  3KD0 A;  2FGX A;  4XS6 A;  4AJ6 A;  4G19 A;  2DLX A;  4LMV A;  1ZYE A;  4IHU A;  5IPH A;  1EOH A;  4IEL A;  4BL7 B;  2P5Q A;  1V40 A;  1SL0 B;  4X4J A;  2J23 A;  3ED3 A;  2HSM B;  3P2A A;  2NBS A;  4G2E A;  3HVV A;  3KJY A;  4PGT A;  2BJX A;  2DJJ A;  2C3T A;  4MJC A;  4YQM A;  4G0K A;  2PPT A;  3U5R E;  4AKI A;  1X9W B;  3NOF A;  1VF2 A;  2XPE A;  3L9S A;  5ECS A;  4CHS A;  1GL8 A;  2C80 A;  4K7O A;  3HJO A;  3BCK A;  3WGE A;  3EMP A;  3TJF A;  2TRX A;  2FHE A;  2I81 A;  2JAC A;  4KA0 A;  3GIX A;  5J9C A;  3FZ9 A;  1U3A A;  4NHW A;  4N0Z A;  1AIU A;  4HDE A;  1XXU A;  4TXV A;  3ZIV A;  2DKH A;  5D96 A;  4HU7 A;  3KIJ A;  3M1G A;  2TIR A;  3VPT A;  2MMZ A;  2CX3 A;  5GZZ B;  2XC2 A;  1OKT A;  2WCI A;  1Z7P A;  4K5R A;  4YAV A;  4MK3 A;  1F3A A;  1NW2 A;  2IMF A;  1GNW A;  2K9F A;  2HRK B;  1Z9H A;  3BOA A;  3DWV A;  4KSM A;  4ZB8 A;  2FWH A;  1XPV A;  1EV4 A;  1Z5Y E;  6GSW A;  2HI7 A;  2CVB A;  6GSS A;  4GXZ A;  3UAP A;  3ISO A;  3ZFB A;  2H30 A;  3IOS A;  2H0I A;  3TKP A;  1K0C A;  2O85 A;  4KB3 A;  3I43 A;  5GSS A;  2I3Y A;  4ICY A;  5DBQ A;  5J4U A;  3F4R A;  1XWK A;  5DVB A;  2VLV A;  1U88 A;  2PER A;  1PX7 A;  1U6T A;  5BMU B;  2DJ0 A;  1FOV A;  3FYG A;  1KNG A;  4MMM A;  3O6T A;  2DKI A;  3QOU A;  5J9B A;  3TRQ A;  4DVC A;  4BPY A;  2HZE B;  5ENU A;  4WR4 A;  1I5G A;  5A34 A;  1TTZ A;  2VCZ A;  5IMF A;  5A5H B;  4G9H A;  4LLR A;  1MD4 A;  4L5L A;  3FR3 A;  1XWC A;  3HCZ A;  3IK9 A;  2VCW A;  4F03 A;  1PKZ A;  1M9A A;  2WGR A;  1HD2 A;  3MYD A;  2X8C A;  2C4J A;  5E59 A;  2MZC A;  6GSU A;  1XWB A;  2VCV A;  4HJM A;  3LXT A;  4G0I A;  5ECH B;  3FW2 A;  1GRX A;  5B8A A;  4TR0 A;  3HA9 A;  4GF0 A;  5GAP D;  3CHX C;  3FZ4 A;  4MJA A;  5JCU A;  3MNG A;  3JCM L;  5IOX A;  2WW1 A;  5A5K A;  5G1K A;  4WR5 A;  1OVN A;  3C73 A;  5CNW A;  3GKN A;  4OD7 A;  1T7P B;  12GS A;  3IC8 A;  19GS A;  2LJR A;  2LJK A;  3CTF A;  1GTU A;  2P0G A;  2PWJ A;  4F0B A;  2O7K A;  5H5S A;  2GSR A;  2KUC A;  2VL3 A;  1YY7 A;  1JFU A;  1T4Y A;  5L71 A;  1DE1 A;  2JU5 A;  2FA4 A;  4MZC A;  4V2N A;  4F9Z A;  1BQ7 A;  1DSB A;  3FR6 A;  1J08 A;  2YWI A;  1WPI A;  4HQZ A;  1M7T A;  1GWC A;  1Z6M A;  4OFT A;  4IP6 A;  1RK4 A;  3GA4 A;  1F2E A;  3KH7 A;  4FIW A;  3RDW A;  17GS A;  3MIX A;  2C0G A;  1TW9 A;  2DMM A;  4N11 A;  1UC7 A;  2RM5 A;  2B7J A;  1SD9 A;  5E4W A;  2YAN A;  3LQ7 A;  1SL2 B;  2VLU A;  4K7I A;  1HQO A;  5EY6 A;  4X1U A;  3PGT A;  1XIY A;  5GST A;  3FMW A;  4O7H A;  1F3B A;  2YJ7 A;  1SL1 B;  2M80 A;  1M3J A;  3WD6 A;  4KDX A;  5JCG A;  1GSF A;  1GUH A;  2HLS A;  3KP8 A;  3U6V A;  1ERW A;  4EXJ A;  1JLV A;  5ECL B;  3IHG A;  2C0D A;  2O5V A;  2PN8 A;  2HRA A;  3R2Q A;  2LEG A;  4HEA 2;  1AUC A;  4KAE A;  2OBI A;  2KLX A;  1EGO A;  3DRN A;  2C3Q A;  1EGR A;  1U87 A;  3N5O A;  4ML6 A;  4EF0 A;  1B9Y C;  3TGZ A;  2WS2 A;  5CRH A;  1SVM A;  3TRX A;  4QL9 A;  4JBB A;  3KXO A;  3GFK A;  4I6X A;  5HFI A;  5D8I A;  5F0G A;  2H70 A;  2WW3 A;  1SVL A;  2YZH A;  4ZIJ A;  2H1D A;  1CQH A;  3BCI A;  2NTO A;  1IYI A;  2HZF A;  4WBR D;  2R37 A;  4XCS A;  3C8E A;  1YKA A;  2H1L A;  4HJ2 A;  1SK1 A;  3GTU A;  2QKE A;  4AI6 A;  4HU9 A;  2K6V A;  3HKR A;  4CY8 A;  4MP4 A;  5DAK A;  5CRW A;  4YH2 A;  1BYE A;  2A4V A;  2J9H A;  4NV5 A;  4PUF C;  2H1A A;  3L9V A;  3EVI A;  3QFA C;  1W89 A;  3QPM A;  5ECR B;  2NVL A;  3IA1 A;  2LST A;  4O32 A;  1FVK A;  1K0B A;  2EIO A;  4QMK A;  4PQH A;  4RQX A;  2V2G A;  2F9S A;  2NDO A;  4PQ1 A;  4AGS A;  2O3E A;  5GAN D;  2AB6 A;  3F3Q A;  3A5I A;  2EFC A;  3EWL A;  5ECN B;  2I9H A;  4EDY A;  1GSY A;  2VL2 A;  4KH7 A;  1OC3 A;  5D93 A;  3A2W A;  1PKW A;  1AW9 A;  4BVX A;  5G5F A;  2VUP A;  3RAZ A;  5A34 B;  1K0M A;  6GST A;  1XZO A;  4XS4 A;  5DQY A;  3W8J A;  3ZML A;  2RUF A;  1HNB A;  4BVY A;  4ZBA A;  2OAD A;  18GS A;  4GLT A;  4GSS A;  2L5O A;  2EIR A;  4MH3 A;  4PNG A;  3WYW A;  1K0D A;  4ECC A;  2ZUP A;  1AQW A;  3MSZ A;  3TKR A;  3BJ5 A;  2UV8 G;  3DXB A;  3O76 A;  1QMV A;  1URM A;  2IJY A;  3LYK A;  3ZIT A;  1THX A;  4ZIL A;  3KH9 A;  1N8J A;  4ZBB A;  2VL2 C;  2YWN A;  4MA9 A;  5CRE A;  1JZO A;  2EFE A;  5G5E A;  1S3D A;  3VFI A;  1S4B P;  2V1M A;  4LA1 A;  4O5Q A;  1Z6N A;  5IQY A;  2L5L A;  2GQM A;  4TKY A;  4AJ8 A;  3VUR A;  4L8E A;  2B7K A;  1RW1 A;  3H93 A;  1I9D A;  4IW9 A;  3F63 A;  4NAX A;  1DUG A;  1GLQ A;  4PHZ C;  3GRX A;  2YOI A;  1R7H A;  4MNN A;  2H6Z A;  3C7M A;  4YQV A;  3UVH A;  1PD2 1;  3E0U A;  1PQN A;  4G10 A;  2EIQ A;  3FR9 A;  1QK8 A;  2CVK A;  3MWH A;  3ERG A;  1A2L A;  1T3B A;  5KN0 A;  2H19 A;  5J5N A;  1RQM A;  1XW6 A;  1XVW A;  3PR8 A;  2VAF A;  4MJE A;  3SBC A;  3W8S A;  4EL1 A;  1ABA A;  1KTE A;  2B5Y A;  1TXU A;  1GSU A;  2WJU A;  1HYU A;  3L78 A;  4K2D A;  2B1L A;  4EIQ A;  3A5W A;  1Y1U A;  1M2B A;  2IWT A;  3D21 A;  5H5R A;  2CQ9 A;  1TK5 B;  2DSA A;  4AF2 A;  2H72 A;  4YKG A;  5A1N A;  3GX0 A;  4L5O A;  2M46 A;  2FNO A;  3HDC A;  3TJG A;  2A2S A;  2JSY A;  1K0A A;  1FVJ A;  4RI7 A;  3VWW A;  5F8B A;  3GH9 A;  4F2I A;  2WB9 A;  5D9T A;  1N2A A;  5DDL A;  3APO A;  1ERV A;  2I1U A;  2PU9 C;  1A24 A;  3ERW A;  1SKW B;  5COH A;  3TU3 B;  3ZFL A;  2QSI A;  1O6J A;  3KTL A;  2FUG 2;  3TKS A;  3GMF A;  3TJJ A;  2VM1 A;  3F6D A;  3IXR A;  2VO4 A;  2GQL A;  1LU4 A;  2OA7 A;  1JHB A;  2D2Z A;  1EOG A;  1SVO A;  1O7U A;  2M72 A;  1QUW A;  4OFN A;  3IR4 A;  3QAG A;  2VCX A;  2H76 A;  3IE3 A;  3P90 A;  1ACV A;  2GTU A;  3DVW A;  4MH2 A;  4OCF A;  3E9J B;  4MPF A;  5HQP A;  4TR1 A;  3M3M A;  1X5D A;  2IME A;  4WKW A;  3KP9 A;  3GTU B;  2DJ3 A;  2B6M A;  3ZMK A;  2CX4 A;  1B4Q A;  3GKX A;  4TW5 A;  1BJX A;  3Q6O A;  4MLY A;  3F6F A;  5DAK B;  4JE1 A;  2RUE A;  1QFN A;  1MDK A;  4KE3 A;  3TKS C;  1SJ6 A;  5B7C A;  1PN9 A;  1TDI A;  1GUL A;  2GQK A;  2RII A;  2R5G A;  3CYN A;  4WF4 A;  5J3R A;  1EWX A;  2GVP A;  1UVZ A;  5J47 A;  4PI0 C;  1A2M A;  2WW2 A;  4PQI A;  3UBK A;  1XG8 A;  4BA7 A;  2C3N A;  4ZBD A;  4JZQ A;  4CY6 A;  2V41 A;  2P31 A;  4ISD A;  4POK A;  1UA5 A;  11GS A;  2L57 A;  2ALB A;  3Q19 A;  1B9X C;  4ZB7 A;  5JCW A;  4BVX B;  4ZL7 A;  4V2L A;  4ACS A;  2YWM A;  2HSN A;  5ECO B;  2FWG A;  1O81 A;  3APS A;  2XHF A;  4XS4 B;  1G7E A;  4K7N A;  1FOH A;  1PMT A;  2JZT A;  4BVY B;  10GS A;  4A5P A;  3IBH A;  2YPM A;  5ECM B;  5LD0 A;  2X64 A;  3LWA A;  1YQ1 A;  1SJZ A;  1ZYN A;  22GS A;  5J4V A;  2MMA A;  2L6D A;  2JL4 A;  2KP2 A;  5CRG A;  2CZ2 A;  4XTS A;  2G0F A;  4J57 E;  2CVD A;  1EP7 A;  1TXX A;  4OO5 A;  2KOK A;  4ECJ A;  4JR4 A;  3D0Z A;  1Y25 A;  3EU3 A;  1TU7 A;  4EVM A;  3MDK A;  1V98 A;  4FXY P;  3I69 A;  5HR1 A;  4AKX B;  4QQ7 A;  4WEY A;  1GSS A;  5HR2 A;  4O92 A;  1O73 A;  3RPN A;  1A2J A;  2FWF A;  1FB0 A;  2PVO C;  3LJR A;  4EUY A;  1OE8 A;  3HJP A;  2HQT A;  3ZIJ A;  4KSO A;  5ELA A;  2IMK A;  2DJ2 A;  1Z7R A;  2A2R A;  3QMX A;  4MF7 A;  3BBY A;  2RM6 A;  2H8L A;  1PRX A;  2H75 A;  4TN8 A;  5IOW A;  1EEJ A;  2N5A A;  4KND A;  1V58 A;  3R3E A;  2H6X A;  4N10 A;  1TJD A;  3FHK A;  4OWY A;  4MDC A;  1K0N A;  1XWA A;  5CP1 A;  4PNF A;  3F0I A;  3TOT A;  1TRV A;  1XFL A;  3IHQ A;  5A1N B;  3M9K A;  5IO0 A;  3ZL5 A;  4GWR A;  2A2P A;  3VK9 A;  1XOA A;  1MEK A;  3OR5 A;  2DBC A;  4WET A;  5F05 A;  1GLP A;  2YZU A;  2XPD A;  3TJK A;  1OKD A;  4KX4 A;  4E8H A;  2LRN A;  1B48 A;  3TDG A;  4YKF A;  1R5A A;  4N30 A;  3LSZ A;  2YV7 A;  2LRC A;  3EU4 A;  4XIH A;  3LEF A;  3F4S A;  3FY7 A;  4WF5 A;  1Q98 A;  2X49 A;  2E2M A;  5HFK A;  2DJK A;  4J56 E;  4KW6 A;  2LV3 A;  3GL3 A;  1TU8 A;  3ZLP A;  4J2F A;  3EMX A;  3VWX A;  2H71 A;  4JRR A;  1LJR A;  2GZY A;  1VGL A;  5AIS A;  2WZ9 A;  3HMJ G;  1SJI A;  5D9W A;  3TKS E;  3ME7 A;  4TR1 B;  4EC0 A;  2CAQ A;  4DSQ A;  3PIN A;  1YEW C;  4IVF A;  2ZCT A;  4MCU A;  4EIP A;  3DEX A;  3I9V 2;  3CBU A;  4XRD A;  3GSS A;  1H75 A;  2DIZ A;  2JSZ A;  4MZW A;  5KN3 A;  1S3A A;  2QGV A;  1PX6 A;  4I97 A;  4X43 A;  4TR4 A;  2F51 A;  8GSS A;  4HOJ A;  1I1I P;  1S3R A;  3K8N A;  2MBT A;  4JED A;  3VWV A;  5B6N A;  2YNX A;  4GCI A;  2OBK A;  3LG6 A;  5FHI A;  4Z7X A;  4E8E A;  3KM6 A;  5C04 A;  1R4W A;  1M0U A;  1CQG A;  1M9B A;  2DJ1 A;  1WP0 A;  4K1F A;  2O87 A;  5DCG A;  3CSH A;  1M99 A;  1ST9 A;  1AAZ A;  1N25 A;  1AXD A;  5DJL A;  5KOW A;  2FCH A;  1B4P A;  3UAR A;  1X5C A;  4EKZ A;  3LW9 A;  3GX8 A;  3H4K A;  1F6M C;  2IL3 A;  2VCQ A;  2HRN A;  4FH8 A;  6GSV A;  1TP9 A;  1XBS A;  2ZNM A;  2R0G A;  1X0R A;  2HSN B;  4USS A;  1K3L A;  1FAA A;  5CRD A;  5A4W A;  2H74 A;  1ML6 A;  1SD8 A;  1USB A;  4POM A;  1ZCP A;  2NPB A;  2C8U A;  1T1V A;  3UIW A;  1G6Y A;  4L0W A;  2PGT A;  4CW9 A;  1YDK A;  2MMN A;  1XOB A;  1PGT A;  5ECK B;  4ZB9 A;  2GS3 A;  1NM3 A;  1GSQ A;  3D4T A;  1ZGN A;  1U3I A;  2BMX A;  2QA1 A;  1S3C A;  4XHM A;  1Z3E A;  2FY6 A;  20GS A;  3V1W A;  3GL5 A;  4TR3 A;  3QD9 A;  3FRC A;  3F4T A;  1PL2 A;  4E68 A;  3GN3 A;  3HYP A;  4K0G A;  1SKR B;  1GP1 A;  1PFO A;  4G0L A;  2VKZ G;  5HFG A;  4NMU A;  1ZYQ B;  2H66 A;  4AKG A;  4DSS A;  2H6Y A;  2LNS A;  2CZ3 A;  3A2V A;  4POL A;  5G30 A;  3GST A;  3PH9 A;  1BED A;  2WRT A;  2L4Q A;  5IO2 A;  1H4O A;  2B5X A;  4QL7 A;  5LCZ A;  3UBL A;  1YJ6 A;  1GNE A;  2OAC A;  1F37 A;  4K6X A;  3M8N A;  5AN1 A;  3J7Y b;  3HXS A;  1JZW A;  2OE1 A;  5A4U A;  2IFQ A;  1VF1 A;  1G6W A;  1R26 A;  1NSW A;  2YP6 A;  4KDU A;  1TI3 A;  1WWJ A;  5KN2 A;  4NXI A;  4W66 A;  4ZL8 A;  2L6C A;  3KGK A;  3KTB A;  5ECQ B;  2C0F A;  3GH6 A;  2CV4 A;  2H0H A;  5B8B A;  1YZX A;  3I6A A;  2VL9 A;  2KHP A;  2DC5 A;  3HD5 A;  3SWL A;  2N5F A;  2O36 A;  1M2A A;  4FYC A;  1SYX A;  3ZTL A;  4AKH A;  5INY A;  4I2T A;  2OE3 A;  3CSI A;  3EC3 A;  5D9X A;  3RHC A;  1KBN A;  1PA3 A;  3HVS A;  2LNT A;  4KCE A;  1B8X A;  1GSE A;  5J41 A;  2WDU A;  2WFC A;  1AQV A;  5JWQ B;  3DD3 A;  3FEU A;  1Q4J A;  2K8V A;  2L4C A;  4XRA A;  1X9S B;  2IMI A;  2LRT A;  1XVQ A;  1THO A;  5JWO B;  3EIN A;  5KOX A;  2K18 A;  1C72 A;  3E3E A;  2B1K A;  2WZS A;  2E0Q A;  3WGX A;  2REM A;  3IAM 2;  1PN0 A;  2JZS A;  2P5R A;  1GH2 A;  1OC9 A;  4P3Y B;  2HSY A;  3APQ A;  2H01 A;  4DSR A;  4X0X A;  4KCA A;  4H86 A;  4N0V A;  2GST A;  5JWR B;  2R6K A;  2CA8 A;  4BIK A;  4IP1 A;  4O5U A;  2AJQ B;  5DQS A;  1OE7 A;  3FK8 A;  3HVN A;  3RHB A;  5IMD A;  4WBJ A;  4IQ1 A;  4HUA A;  3QDN A;  1FB6 A;  3EE2 A;  4I2U A;  3LFL A;  1XW5 A;  2WW0 A;  2EC4 A;  4OCE A;  1PSQ A;  5G1L A;  2GGT A;  3ZYW A;  1MDJ A;  4HZ2 A;  3TUE A;  5CAX A;  3LYP A;  3CQF A;  3P8W A;  3HY2 A;  2IN3 A;  4HI7 A;  5HR3 A;  1ILO A;  3C71 A;  4ML1 A;  2PUK C;  5ELG A;  5DCH A;  1O8W A;  1K0O A;  2N5B A;  3WGD A;  1YF0 A;  5G2Z A;  3DIE A;  4JR6 A;  2HSH A;  3GHA A;  4WXT A;  3N9J A;  4OO4 A;  1WJK A;  1QQ2 A;  1E2Y A;  2GDR A;  4LMW A;  2E2G A;  1ERU A;  2VM2 A;  5AGY A;  2MYG A;  4JU5 A;  3IPZ A;  2C0E A;  5CO3 A;  4F0C A;  1GUK A;  2A4H A;  4V1A g;  3DGQ A;  2LKU A; 
#chains in the Genus database with same CATH homology
 4POB A;  4KGI A;  3TRP A;  1TKD B;  3HZ4 A;  2HYX A;  3G9B A;  2OKA A;  3M9J A;  3L9U A;  2EFH A;  1OC8 A;  4ZXG A;  4IJ3 A;  1K3Y A;  16GS A;  5F06 A;  3HZ8 A;  1HNC A;  9GSS A;  5A4V A;  3A2X A;  3QAW A;  2YWO A;  5D9V A;  4XS1 A;  4GDF A;  2IMD A;  2IPA A;  3KMN A;  2HRF A;  13GS A;  2CT6 A;  2E7P A;  4I5Q A;  1MD3 A;  4ZB6 A;  2ON5 A;  1X5E A;  5B6M A;  1VF4 A;  3LOR A;  2YCD A;  4DEJ A;  1QGV A;  5EPF A;  4CDO A;  4NPB A;  1TK0 B;  2FD3 A;  1O85 A;  2B5E A;  3VWU A;  4GRF A;  3A3T A;  4Q5N A;  1FHE A;  4DSS B;  3MAK A;  2BTO T;  2LQQ A;  5G31 A;  3ERF A;  3GUS A;  1A8L A;  3NZN A;  1JZD A;  5IMA A;  2RLI A;  3TB2 A;  3LXZ A;  4MZB A;  4GQF A;  3CRT A;  5IMC A;  5FT3 A;  4FQU A;  4ECB A;  5FWG A;  4MJB A;  1ZZY A;  3F9U A;  1G7O A;  2IFQ B;  2QC7 A;  3QFB C;  2HFD A;  4FO5 A;  2K8S A;  1BAY A;  1HNA A;  4NWY A;  4D73 A;  5H5Q A;  1FO5 A;  5DAL A;  3IC4 A;  1A8Y A;  1ZYP A;  4OFM A;  3P7X A;  1TRW A;  1MTC A;  4K9Z A;  1JLW A;  4MF6 A;  5HR0 A;  3WT2 A;  4IBP A;  3FZA A;  1TRS A;  3D22 A;  3ZRE A;  4IS0 A;  5IMV A;  4Z2R A;  2LS5 A;  2AYT A;  2H1B A;  1T8E B;  2LJA A;  5BRT A;  3GNJ A;  4EE0 A;  2FA8 A;  3M0F A;  6GSX A;  1WIK A;  3VI7 A;  3GKK A;  1LBK A;  4IGJ A;  3G7J A;  4HQS A;  2G2Q A;  1X9M B;  2LTK A;  3D5J A;  3IK7 A;  4ID0 A;  2EFD A;  3TCO A;  1G0T A;  1V2A A;  1NHY A;  3IRA A;  4ULX A;  1O8X A;  4K5S A;  2H0G A;  2OE0 A;  1GTA A;  4F82 A;  2GT5 A;  4ECI A;  3S9F A;  1XW9 A;  3F3R A;  2VOC A;  1WRY A;  4FYU A;  1GTI A;  2VD0 A;  1TI1 A;  1V9W A;  1FG4 A;  4RI6 A;  3CRU A;  5ABR A;  2JZR A;  1OC9 B;  1BG1 A;  3GKM A;  5IM9 A;  4MF5 A;  5ECI B;  2MBS A;  4AJ7 A;  3NIV A;  1AC1 A;  2DML A;  2H1G A;  4MPG A;  5J4Y A;  1EP8 A;  4HS1 A;  5AIV A;  4MAB A;  1T00 A;  2JAD A;  2OJL A;  3UOM A;  4Q5Q A;  2R2J A;  4ZL9 A;  3EPT A;  5J40 A;  2IIY A;  2C1Y A;  3UMA A;  1GTB A;  3QAV A;  1TK8 B;  2AHE A;  1EV9 A;  3AY8 A;  2GZZ A;  2VIM A;  3G7Y A;  1SK0 A;  3CWG A;  2OT3 A;  4LL4 B;  2HE3 A;  4TXO A;  1FW1 A;  2PVQ A;  5ID2 A;  4LL1 B;  3KMO A;  3L4N A;  1MDI A;  4K2X A;  2HXK A;  4PUR A;  1K3O A;  3CSJ A;  3O3T A;  4GTU A;  1WOU A;  3CXG A;  1W4V A;  1M2D A;  1A0R P;  2WUL A;  4BL7 A;  4Z2U A;  4GQC A;  5EL8 A;  2HSM A;  1NHO A;  3QCP A;  1OAZ A;  2I4A A;  2DIY A;  4PTS A;  3PPU A;  2UZ8 A;  5KEJ A;  3UVT A;  2V6O A;  1SKS B;  3C1R A;  1SK2 A;  1QXH A;  3GV1 A;  3D4M A;  4L0U A;  3ZVJ A;  4BWS A;  1YF1 A;  4PXO A;  1TOF A;  2X99 A;  2PBJ A;  4BWQ A;  3G7I A;  1VF3 A;  1F9M A;  1GUM A;  3FZ5 A;  2R3X A;  4TRX A;  3H8Q A;  2YJH A;  4YQU A;  1E6B A;  2VLT A;  2ES7 A;  1ON4 A;  3ZRD A;  3EUR A;  1IYH A;  3J7Y k;  2ON7 A;  3CMI A;  3IAS 2;  2GT6 A;  3RBT A;  3GYK A;  4IN0 A;  3UL3 A;  4Q5F A;  4PX1 A;  2R4V A;  1BX9 A;  5ECP B;  1ZMA A;  4Q5R A;  1EZK A;  4IJI A;  4TVE A;  5LNK e;  1A0F A;  2B3S A;  5C00 A;  2HRK A;  1V57 A;  3TOU A;  2GSQ A;  5EVO A;  14GS A;  3ZZX A;  1T4Z A;  2L59 A;  3GUR A;  3KCM A;  3QR6 A;  4YAP A;  1UN2 A;  5IIZ A;  4RUV A;  2LQO A;  2X4A A;  1J9B A;  1ZOF A;  2VD1 A;  1XCC A;  3W6G A;  4GST A;  2FLS A;  5IPG A;  4HZ4 A;  4KF9 A;  1ERT A;  4D73 B;  2F8F A;  3DVX A;  4K0N A;  5IMZ A;  5DAL B;  3ME8 A;  3D6I A;  3VPQ A;  2AV4 A;  3BD2 A;  2F3M A;  4GSN A;  3WT1 A;  2HNL A;  7GSS A;  1WMJ A;  3HHV A;  1SEN A;  4O5R A;  5KN1 A;  2YN1 A;  1DBY A;  5DJM A;  4NHZ A;  4IKH A;  5AIX A;  3UJ1 A;  3HVX A;  5BMU A;  3US3 A;  1XWG A;  1YEX A;  2F8A A;  2KP1 A;  1BF5 A;  3L0H A;  4FYB A;  1SYR A;  2XBQ A;  2QA2 A;  1VRS D;  5CYY A;  2CAI A;  3CTG A;  3LGC A;  2HZE A;  4ILF A;  3RPP A;  4K8M A;  2PMT A;  5A5H A;  3DKS A;  2R0P A;  1PL1 A;  1TRU A;  1EEM A;  2XBI A;  2O89 A;  3DML A;  3H1N A;  1KEB A;  4PUA A;  3C1S A;  3KZQ A;  5F07 A;  2MMO A;  4EDZ A;  3UEM A;  3TJB A;  4Z2T A;  4V1A p;  1OYJ A;  1GSD A;  2GLR A;  1JZR A;  2GZP A;  1YEP A;  4RQR A;  3KEB A;  4EO3 A;  3VI5 A;  2X8G A;  3TKQ A;  3ZVJ D;  2V6K A;  1Y6E A;  2Z9S A;  2V32 A;  3DYR A;  2TRC P;  2O8V B;  4V2M A;  3F8U A;  3IDV A;  1DE2 A;  2H73 A;  3H79 A;  1J0F A;  1WE0 A;  4OMV A;  3Q18 A;  1BG5 A;  4I8B A;  3EYT A;  3Q74 A;  3VLN A;  2YV9 A;  4G01 A;  4TOP A;  4KDY A;  5D73 A;  6GSY A;  2AAW A;  1YKC A;  2VCT A;  1A23 A;  3HJM A;  2R0C A;  1SU9 A;  1YVL A;  4IQA A;  2AUV A;  2FWE A;  2LUS A;  3IV4 A;  2HT9 A;  1AQX A;  4TXO B;  3FKF A;  5ID2 B;  4N3Z A;  2GSS A;  4KUN A;  1R5P A;  4NV2 A;  1ZL9 A;  2X8H A;  3KD0 A;  2FGX A;  4XS6 A;  4AJ6 A;  4G19 A;  2DLX A;  4LMV A;  1ZYE A;  4IHU A;  5IPH A;  1EOH A;  4IEL A;  4BL7 B;  2P5Q A;  1V40 A;  1SL0 B;  4X4J A;  2J23 A;  3ED3 A;  2HSM B;  3P2A A;  2NBS A;  4G2E A;  3HVV A;  3KJY A;  4PGT A;  2BJX A;  2DJJ A;  2C3T A;  4MJC A;  4YQM A;  4G0K A;  2PPT A;  3U5R E;  4AKI A;  1X9W B;  3NOF A;  1VF2 A;  2XPE A;  3L9S A;  5ECS A;  4CHS A;  1GL8 A;  2C80 A;  4K7O A;  3HJO A;  3BCK A;  3WGE A;  3EMP A;  3TJF A;  2TRX A;  2FHE A;  2I81 A;  2JAC A;  4KA0 A;  3GIX A;  5J9C A;  3FZ9 A;  1U3A A;  4NHW A;  4N0Z A;  1AIU A;  4HDE A;  1XXU A;  4TXV A;  3ZIV A;  2DKH A;  5D96 A;  4HU7 A;  3KIJ A;  3M1G A;  2TIR A;  3VPT A;  2MMZ A;  2CX3 A;  5GZZ B;  2XC2 A;  1OKT A;  2WCI A;  1Z7P A;  4K5R A;  4YAV A;  4MK3 A;  1F3A A;  1NW2 A;  2IMF A;  1GNW A;  2K9F A;  2HRK B;  1Z9H A;  3BOA A;  3DWV A;  4KSM A;  4ZB8 A;  2FWH A;  1XPV A;  1EV4 A;  1Z5Y E;  6GSW A;  2HI7 A;  2CVB A;  6GSS A;  4GXZ A;  3UAP A;  3ISO A;  3ZFB A;  2H30 A;  3IOS A;  2H0I A;  3TKP A;  1K0C A;  2O85 A;  4KB3 A;  3I43 A;  5GSS A;  2I3Y A;  4ICY A;  5DBQ A;  5J4U A;  3F4R A;  1XWK A;  5DVB A;  2VLV A;  1U88 A;  2PER A;  1PX7 A;  1U6T A;  5BMU B;  2DJ0 A;  1FOV A;  3FYG A;  1KNG A;  4MMM A;  3O6T A;  2DKI A;  3QOU A;  5J9B A;  3TRQ A;  4DVC A;  4BPY A;  2HZE B;  5ENU A;  4WR4 A;  1I5G A;  5A34 A;  1TTZ A;  2VCZ A;  5IMF A;  5A5H B;  4G9H A;  4LLR A;  1MD4 A;  4L5L A;  3FR3 A;  1XWC A;  3HCZ A;  3IK9 A;  2VCW A;  4F03 A;  1PKZ A;  1M9A A;  2WGR A;  1HD2 A;  3MYD A;  2X8C A;  2C4J A;  5E59 A;  2MZC A;  6GSU A;  1XWB A;  2VCV A;  4HJM A;  3LXT A;  4G0I A;  5ECH B;  3FW2 A;  1GRX A;  5B8A A;  4TR0 A;  3HA9 A;  4GF0 A;  5GAP D;  3FZ4 A;  4MJA A;  5JCU A;  3MNG A;  3JCM L;  5IOX A;  5A5K A;  5G1K A;  4WR5 A;  1OVN A;  3C73 A;  5CNW A;  3GKN A;  4OD7 A;  1T7P B;  12GS A;  3IC8 A;  19GS A;  2LJR A;  2LJK A;  3CTF A;  1GTU A;  2P0G A;  2PWJ A;  4F0B A;  2O7K A;  5H5S A;  2GSR A;  2KUC A;  2VL3 A;  1YY7 A;  1JFU A;  1T4Y A;  5L71 A;  1DE1 A;  2JU5 A;  2FA4 A;  4MZC A;  4V2N A;  4F9Z A;  1BQ7 A;  1DSB A;  3FR6 A;  1J08 A;  2YWI A;  1WPI A;  4HQZ A;  1M7T A;  1GWC A;  1Z6M A;  4OFT A;  4IP6 A;  1RK4 A;  3GA4 A;  1F2E A;  3KH7 A;  4FIW A;  3RDW A;  17GS A;  3MIX A;  2C0G A;  1TW9 A;  2DMM A;  4N11 A;  1UC7 A;  2RM5 A;  2B7J A;  1SD9 A;  5E4W A;  2YAN A;  3LQ7 A;  1SL2 B;  2VLU A;  4K7I A;  1HQO A;  5EY6 A;  4X1U A;  3PGT A;  1XIY A;  5GST A;  3FMW A;  4O7H A;  1F3B A;  2YJ7 A;  1SL1 B;  2M80 A;  3WD6 A;  4KDX A;  5JCG A;  1GSF A;  1GUH A;  2HLS A;  3KP8 A;  3U6V A;  1ERW A;  4EXJ A;  1JLV A;  5ECL B;  3IHG A;  2C0D A;  2O5V A;  2PN8 A;  2HRA A;  3R2Q A;  2LEG A;  4HEA 2;  1AUC A;  4KAE A;  2OBI A;  2KLX A;  1EGO A;  3DRN A;  2C3Q A;  1EGR A;  1U87 A;  3N5O A;  4ML6 A;  4EF0 A;  1B9Y C;  3TGZ A;  2WS2 A;  5CRH A;  1SVM A;  3TRX A;  4QL9 A;  4JBB A;  3KXO A;  3GFK A;  4I6X A;  5HFI A;  5D8I A;  5F0G A;  2H70 A;  1SVL A;  2YZH A;  4ZIJ A;  2H1D A;  1CQH A;  3BCI A;  2NTO A;  1IYI A;  2HZF A;  4WBR D;  2R37 A;  4XCS A;  3C8E A;  1YKA A;  2H1L A;  4HJ2 A;  1SK1 A;  3GTU A;  2QKE A;  4AI6 A;  4HU9 A;  2K6V A;  3HKR A;  4CY8 A;  4MP4 A;  5DAK A;  5CRW A;  4YH2 A;  1BYE A;  2A4V A;  2J9H A;  4NV5 A;  4PUF C;  2H1A A;  3L9V A;  3EVI A;  3QFA C;  1W89 A;  3QPM A;  5ECR B;  2NVL A;  3IA1 A;  2LST A;  4O32 A;  1FVK A;  1K0B A;  2EIO A;  4QMK A;  4PQH A;  4RQX A;  2V2G A;  2F9S A;  2NDO A;  4PQ1 A;  4AGS A;  5GAN D;  2AB6 A;  3F3Q A;  3A5I A;  2EFC A;  3EWL A;  5ECN B;  2I9H A;  4EDY A;  1GSY A;  2VL2 A;  4KH7 A;  1OC3 A;  5D93 A;  3A2W A;  1PKW A;  1AW9 A;  4BVX A;  5G5F A;  2VUP A;  3RAZ A;  5A34 B;  1K0M A;  6GST A;  1XZO A;  4XS4 A;  5DQY A;  3W8J A;  3ZML A;  2RUF A;  1HNB A;  4BVY A;  4ZBA A;  2OAD A;  18GS A;  4GLT A;  4GSS A;  2L5O A;  2EIR A;  4MH3 A;  4PNG A;  3WYW A;  1K0D A;  4ECC A;  2ZUP A;  1AQW A;  3MSZ A;  3TKR A;  3BJ5 A;  2UV8 G;  3DXB A;  3O76 A;  1QMV A;  1URM A;  2IJY A;  3LYK A;  3ZIT A;  1THX A;  4ZIL A;  3KH9 A;  1N8J A;  4ZBB A;  2VL2 C;  2YWN A;  4MA9 A;  5CRE A;  1JZO A;  2EFE A;  5G5E A;  1S3D A;  3VFI A;  2V1M A;  4LA1 A;  4O5Q A;  1Z6N A;  5IQY A;  2L5L A;  2GQM A;  4TKY A;  4AJ8 A;  3VUR A;  4L8E A;  2B7K A;  1RW1 A;  3H93 A;  1I9D A;  4IW9 A;  3F63 A;  4NAX A;  1DUG A;  1GLQ A;  3GRX A;  2YOI A;  1R7H A;  4MNN A;  2H6Z A;  3C7M A;  4YQV A;  3UVH A;  1PD2 1;  3E0U A;  1PQN A;  4G10 A;  2EIQ A;  3FR9 A;  1QK8 A;  2CVK A;  3MWH A;  3ERG A;  1A2L A;  1T3B A;  5KN0 A;  2H19 A;  5J5N A;  1RQM A;  1XW6 A;  1XVW A;  3PR8 A;  2VAF A;  4MJE A;  3SBC A;  3W8S A;  4EL1 A;  1ABA A;  1KTE A;  2B5Y A;  1TXU A;  1GSU A;  2WJU A;  1HYU A;  3L78 A;  4K2D A;  2B1L A;  4EIQ A;  3A5W A;  1Y1U A;  1M2B A;  2IWT A;  3D21 A;  5H5R A;  2CQ9 A;  1TK5 B;  2DSA A;  4AF2 A;  2H72 A;  4YKG A;  5A1N A;  3GX0 A;  4L5O A;  2M46 A;  2FNO A;  3HDC A;  3TJG A;  2A2S A;  2JSY A;  1K0A A;  1FVJ A;  4RI7 A;  3VWW A;  5F8B A;  3GH9 A;  4F2I A;  2WB9 A;  5D9T A;  1N2A A;  5DDL A;  3APO A;  1ERV A;  2I1U A;  2PU9 C;  1A24 A;  3ERW A;  1SKW B;  5COH A;  3TU3 B;  3ZFL A;  2QSI A;  1O6J A;  3KTL A;  2FUG 2;  3TKS A;  3GMF A;  3TJJ A;  2VM1 A;  3F6D A;  3IXR A;  2VO4 A;  2GQL A;  1LU4 A;  2OA7 A;  1JHB A;  2D2Z A;  1EOG A;  1SVO A;  1O7U A;  2M72 A;  1QUW A;  4OFN A;  3IR4 A;  3QAG A;  2VCX A;  2H76 A;  3IE3 A;  3P90 A;  1ACV A;  2GTU A;  3DVW A;  4MH2 A;  4OCF A;  3E9J B;  4MPF A;  5HQP A;  4TR1 A;  3M3M A;  1X5D A;  2IME A;  4WKW A;  3KP9 A;  3GTU B;  2DJ3 A;  2B6M A;  3ZMK A;  2CX4 A;  1B4Q A;  3GKX A;  4TW5 A;  1BJX A;  3Q6O A;  4MLY A;  3F6F A;  5DAK B;  4JE1 A;  2RUE A;  1QFN A;  1MDK A;  4KE3 A;  3TKS C;  1SJ6 A;  5B7C A;  1PN9 A;  1TDI A;  1GUL A;  2GQK A;  2RII A;  2R5G A;  3CYN A;  4WF4 A;  5J3R A;  1EWX A;  2GVP A;  1UVZ A;  5J47 A;  1A2M A;  4PQI A;  3UBK A;  4BA7 A;  2C3N A;  4ZBD A;  4JZQ A;  4CY6 A;  2V41 A;  2P31 A;  4ISD A;  4POK A;  1UA5 A;  11GS A;  2L57 A;  2ALB A;  3Q19 A;  1B9X C;  4ZB7 A;  5JCW A;  4BVX B;  4ZL7 A;  4V2L A;  4ACS A;  2YWM A;  2HSN A;  5ECO B;  2FWG A;  1O81 A;  3APS A;  2XHF A;  4XS4 B;  1G7E A;  4K7N A;  1FOH A;  1PMT A;  2JZT A;  4BVY B;  10GS A;  4A5P A;  3IBH A;  2YPM A;  5ECM B;  5LD0 A;  2X64 A;  3LWA A;  1YQ1 A;  1SJZ A;  1ZYN A;  22GS A;  5J4V A;  2MMA A;  2L6D A;  2JL4 A;  2KP2 A;  5CRG A;  2CZ2 A;  4XTS A;  2G0F A;  4J57 E;  2CVD A;  1EP7 A;  1TXX A;  4OO5 A;  2KOK A;  4ECJ A;  4JR4 A;  3D0Z A;  1Y25 A;  3EU3 A;  1TU7 A;  4EVM A;  3MDK A;  1V98 A;  3I69 A;  5HR1 A;  4AKX B;  4QQ7 A;  4WEY A;  1GSS A;  5HR2 A;  4O92 A;  1O73 A;  3RPN A;  1A2J A;  2FWF A;  1FB0 A;  2PVO C;  3LJR A;  4EUY A;  1OE8 A;  3HJP A;  2HQT A;  3ZIJ A;  4KSO A;  5ELA A;  2IMK A;  2DJ2 A;  1Z7R A;  2A2R A;  3QMX A;  4MF7 A;  3BBY A;  2RM6 A;  2H8L A;  1PRX A;  2H75 A;  4TN8 A;  5IOW A;  1EEJ A;  2N5A A;  4KND A;  1V58 A;  3R3E A;  2H6X A;  4N10 A;  1TJD A;  3FHK A;  4OWY A;  4MDC A;  1K0N A;  1XWA A;  5CP1 A;  4PNF A;  3F0I A;  3TOT A;  1TRV A;  1XFL A;  3IHQ A;  5A1N B;  3M9K A;  5IO0 A;  3ZL5 A;  4GWR A;  2A2P A;  3VK9 A;  1XOA A;  1MEK A;  3OR5 A;  2DBC A;  4WET A;  5F05 A;  1GLP A;  2YZU A;  2XPD A;  3TJK A;  1OKD A;  4KX4 A;  4E8H A;  2LRN A;  1B48 A;  3TDG A;  4YKF A;  1R5A A;  4N30 A;  3LSZ A;  2YV7 A;  2LRC A;  3EU4 A;  4XIH A;  3LEF A;  3F4S A;  3FY7 A;  4WF5 A;  1Q98 A;  2X49 A;  2E2M A;  5HFK A;  2DJK A;  4J56 E;  4KW6 A;  2LV3 A;  3GL3 A;  1TU8 A;  3ZLP A;  4J2F A;  3EMX A;  3VWX A;  2H71 A;  4JRR A;  1LJR A;  2GZY A;  1VGL A;  5AIS A;  2WZ9 A;  3HMJ G;  1SJI A;  5D9W A;  3TKS E;  3ME7 A;  4TR1 B;  4EC0 A;  2CAQ A;  4DSQ A;  3PIN A;  4IVF A;  2ZCT A;  4MCU A;  4EIP A;  3DEX A;  3I9V 2;  3CBU A;  4XRD A;  3GSS A;  1H75 A;  2DIZ A;  2JSZ A;  4MZW A;  5KN3 A;  1S3A A;  2QGV A;  1PX6 A;  4I97 A;  4X43 A;  4TR4 A;  2F51 A;  8GSS A;  4HOJ A;  3K8N A;  2MBT A;  4JED A;  3VWV A;  5B6N A;  2YNX A;  4GCI A;  2OBK A;  3LG6 A;  5FHI A;  4Z7X A;  4E8E A;  3KM6 A;  5C04 A;  1R4W A;  1M0U A;  1CQG A;  1M9B A;  2DJ1 A;  1WP0 A;  4K1F A;  2O87 A;  5DCG A;  3CSH A;  1M99 A;  1ST9 A;  1AAZ A;  1N25 A;  1AXD A;  5DJL A;  5KOW A;  2FCH A;  1B4P A;  3UAR A;  1X5C A;  4EKZ A;  3LW9 A;  3GX8 A;  3H4K A;  1F6M C;  2IL3 A;  2VCQ A;  2HRN A;  4FH8 A;  6GSV A;  1TP9 A;  1XBS A;  2ZNM A;  2R0G A;  1X0R A;  2HSN B;  4USS A;  1K3L A;  1FAA A;  5CRD A;  5A4W A;  2H74 A;  1ML6 A;  1SD8 A;  1USB A;  4POM A;  1ZCP A;  2NPB A;  2C8U A;  1T1V A;  3UIW A;  1G6Y A;  4L0W A;  2PGT A;  4CW9 A;  1YDK A;  2MMN A;  1XOB A;  1PGT A;  5ECK B;  4ZB9 A;  2GS3 A;  1NM3 A;  1GSQ A;  3D4T A;  1ZGN A;  1U3I A;  2BMX A;  2QA1 A;  1S3C A;  4XHM A;  1Z3E A;  2FY6 A;  20GS A;  3V1W A;  3GL5 A;  4TR3 A;  3QD9 A;  3FRC A;  3F4T A;  1PL2 A;  4E68 A;  3GN3 A;  3HYP A;  4K0G A;  1SKR B;  1GP1 A;  4G0L A;  2VKZ G;  5HFG A;  4NMU A;  1ZYQ B;  2H66 A;  4AKG A;  4DSS A;  2H6Y A;  2LNS A;  2CZ3 A;  3A2V A;  4POL A;  5G30 A;  3GST A;  3PH9 A;  1BED A;  2WRT A;  2L4Q A;  5IO2 A;  1H4O A;  2B5X A;  4QL7 A;  5LCZ A;  3UBL A;  1YJ6 A;  1GNE A;  2OAC A;  1F37 A;  4K6X A;  3M8N A;  5AN1 A;  3J7Y b;  3HXS A;  1JZW A;  2OE1 A;  5A4U A;  2IFQ A;  1VF1 A;  1G6W A;  1R26 A;  1NSW A;  2YP6 A;  4KDU A;  1TI3 A;  1WWJ A;  5KN2 A;  4NXI A;  4W66 A;  4ZL8 A;  2L6C A;  3KGK A;  3KTB A;  5ECQ B;  2C0F A;  3GH6 A;  2CV4 A;  2H0H A;  5B8B A;  1YZX A;  3I6A A;  2VL9 A;  2KHP A;  2DC5 A;  3HD5 A;  3SWL A;  2N5F A;  1M2A A;  4FYC A;  1SYX A;  3ZTL A;  4AKH A;  5INY A;  4I2T A;  2OE3 A;  3CSI A;  3EC3 A;  5D9X A;  3RHC A;  1KBN A;  1PA3 A;  3HVS A;  2LNT A;  4KCE A;  1B8X A;  1GSE A;  5J41 A;  2WDU A;  2WFC A;  1AQV A;  5JWQ B;  3DD3 A;  3FEU A;  1Q4J A;  2K8V A;  2L4C A;  4XRA A;  1X9S B;  2IMI A;  2LRT A;  1XVQ A;  1THO A;  5JWO B;  3EIN A;  5KOX A;  2K18 A;  1C72 A;  3E3E A;  2B1K A;  2E0Q A;  3WGX A;  2REM A;  3IAM 2;  1PN0 A;  2JZS A;  2P5R A;  1GH2 A;  1OC9 A;  4P3Y B;  2HSY A;  3APQ A;  2H01 A;  4DSR A;  4X0X A;  4KCA A;  4H86 A;  4N0V A;  2GST A;  5JWR B;  2R6K A;  2CA8 A;  4IP1 A;  4O5U A;  2AJQ B;  5DQS A;  1OE7 A;  3FK8 A;  3RHB A;  5IMD A;  4WBJ A;  4IQ1 A;  4HUA A;  3QDN A;  1FB6 A;  3EE2 A;  4I2U A;  3LFL A;  1XW5 A;  2EC4 A;  4OCE A;  1PSQ A;  5G1L A;  2GGT A;  3ZYW A;  1MDJ A;  4HZ2 A;  3TUE A;  5CAX A;  3LYP A;  3P8W A;  3HY2 A;  2IN3 A;  4HI7 A;  5HR3 A;  1ILO A;  3C71 A;  4ML1 A;  2PUK C;  5ELG A;  5DCH A;  1O8W A;  1K0O A;  2N5B A;  3WGD A;  1YF0 A;  5G2Z A;  3DIE A;  4JR6 A;  2HSH A;  3GHA A;  4WXT A;  3N9J A;  4OO4 A;  1WJK A;  1QQ2 A;  1E2Y A;  2GDR A;  4LMW A;  2E2G A;  1ERU A;  2VM2 A;  5AGY A;  2MYG A;  4JU5 A;  3IPZ A;  2C0E A;  5CO3 A;  4F0C A;  1GUK A;  2A4H A;  4V1A g;  3DGQ A;  2LKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...