1C72A

Tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Tyr115, gln165 and trp209 contribute to the 1, 2-epoxy-3-(p-nitrophenoxy)propane-conjugating activity of glutathione S-transferase cGSTM1-1.
pubmed doi rcsb
source organism Gallus gallus
total genus 71
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1c72A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1c72A01
3N5OA 3VURA 1SD8A 1Z7PA 2V1MA 3RBTA 1PA3A 1GNWA 2N5AA 2X8HA 1V58A 1GUMA 1GNEA 4GXZA 1JZOA 4LMVA 1CQHA 4EC0A 3WD6A 3KTLA 2PPTA 3C71A 3IC4A 4X1UA 4IP1A 4PUAA 5F06A 4WEYA 4MH3A 1O73A 1W4VA 2K6VA 1GLPA 2DLXA 3GKXA 2CAIA 3HCZA 1BQ7A 2VLVA 2LKUA 3KMOA 5IMCA 2LJRA 4KF9A 2MMZA 4KUNA 3GKMA 3US3A 1TRSA 1TK0B 5DJLA 4DSSA 3EINA 4IVFA 2YWMA 2REMA 4ID0A 5HR0A 1SKRB 5F8BA 2LS5A 4I5QA 3IV4A 2J23A 4GQFA 3W8SA 2C0FA 4OFNA 1E2YA 3FR3A 2H30A 5IPGA 1GSYA 5J9BA 1TOFA 1PX6A 3DMLA 3TDGA 1PD21 4IQAA 2O89A 4ZILA 3FYGA 5HR2A 1SJ6A 1U3IA 3FK8A 2L4CA 3GMFA 2FA8A 2HRAA 3G7JA 2L6DA 2CVDA 4KSMA 1WP0A 1Z3EA 3D21A 1M7TA 4AJ6A 4MDCA 1T4YA 2KP1A 4MH2A 5CREA 1M9AA 1OE8A 3VK9A 5A5KA 3P7XA 2O87A 2M46A 3FEUA 3CBUA 3BBYA 5IOXA 3DVWA 3L0HA 4EXJA 3GL5A 2KLXA 3QAVA 1YF0A 1GP1A 2A2RA 4HQZA 3HA9A 3BCIA 4TRXA 4F9ZA 17GSA 1WWJA 5IM9A 2L59A 4MF5A 3ZRDA 3ZFLA 2YOIA 5B8AA 5F07A 3GHAA 4TR1A 1TXXA 3D22A 1YEXA 4LL1B 4MPFA 3A3TA 2MBSA 2NDOA 3Q74A 1HNAA 2F51A 4AJ8A 1TJDA 2OKAA 3GH6A 2TIRA 1J9BA 2C3NA 1K0CA 3CMIA 5D96A 2VCQA 1DE2A 2Z9SA 5DQYA 1OC3A 3SBCA 1I5GA 2OE3A 1V57A 2X8GA 22GSA 4KGIA 2CT6A 4KSOA 4OMVA 1UN2A 3EU3A 3KTBA 4L5OA 2GVPA 4IJIA 4MP4A 3K8NA 1A2JA 4RI7A 2FWGA 3TRPA 4L8EA 1O8WA 3UOMA 3MWHA 1SL1B 2HZEA 3I9V2 1O7UA 1UA5A 3GX0A 3ZREA 3HKRA 3M9KA 4K7OA 5LCZA 1WOUA 3ISOA 1B9YC 5IO2A 3S9FA 2R4VA 2YZUA 3TKRA 2YP6A 2MZCA 1A24A 4O92A 2V6OA 3RPNA 1EV4A 3VI7A 2P5RA 2E0QA 1PKWA 5H5SA 3WT2A 3F0IA 3TCOA 1WE0A 3GURA 3FZAA 1LU4A 4BWSA 1B8XA 5D73A 2IMKA 3QAWA 2VIMA 1EV9A 1SK2A 4DSQA 1LBKA 4K0NA 1T7PB 3LSZA 4NHWA 3IA1A 2GDRA 3W8JA 2MMNA 1T00A 3CSIA 2XBQA 4IP6A 5C00A 1MDJA 5D9TA 2H6ZA 3GIXA 1NHOA 3TJGA 4PGTA 3VWXA 13GSA 3ME7A 3C1RA 5H5QA 3I69A 2OBKA 1JFUA 1AQWA 5B7CA 2FHEA 2GGTA 1XPVA 2AV4A 2N5FA 2I4AA 3KP9A 3WT1A 1R26A 5J9CA 1GL8A 3DKSA 4PUFC 1ZCPA 2JZSA 5B6NA 1ZGNA 4GCIA 3ZMKA 3APSA 1T3BA 2BMXA 4HI7A 1NSWA 4L0UA 4I97A 2IN3A 1YKAA 1O6JA 5C04A 4ECBA 2QC7A 2EC4A 2HXKA 5D9VA 5J41A 3NIVA 1ERTA 4XRAA 2GSSA 1ZL9A 2ES7A 3APOA 3F8UA 2ZNMA 1DBYA 3OR5A 1GSFA 1VF2A 3CTFA 2LRCA 1SKWB 2WJUA 2HSYA 4TW5A 3UL3A 3ZL5A 1WMJA 4XS4B 1SYRA 1XW6A 1K3YA 1EP7A 3KD0A 2VL3A 1EWXA 3P2AA 1GH2A 3TKPA 3IXRA 4WBRD 3QCPA 4G0KA 2LRTA 3ZLPA 3R3EA 5J4UA 1KEBA 4YAVA 4D73B 4LLRA 1K3LA 2C8UA 2WFCA 4N10A 3GX8A 5JWQB 3MDKA 1KNGA 1VF4A 2YNXA 2LJKA 5E59A 1JZDA 1A23A 2CVBA 4ECCA 4V2MA 1NW2A 2GZYA 1XOAA 3TJFA 3M8NA 2IJYA 5DVBA 1GTIA 5DCHA 4BL7B 3GNJA 2XHFA 4JE1A 4BPYA 4GSSA 2PBJA 3WGDA 2WRTA 3J7Yb 1THXA 4KA0A 1EP8A 3TRXA 1EOHA 4ZL7A 4MMMA 1WIKA 2HSNB 1FO5A 3CXGA 5KN3A 1DUGA 2JZRA 4L0WA 2B7JA 1QQ2A 3KP8A 4FYBA 1MD4A 1GWCA 2FCHA 3O3TA 3MAKA 4WR4A 2FNOA 1BJXA 1EGRA 1THOA 4Q5FA 1X0RA 1BG5A 2UZ8A 4EL1A 4ZIJA 2GZPA 4E8HA 3L9UA 1M9BA 4RQRA 4JR6A 4PX1A 5L71A 3RAZA 4LA1A 4MA9A 4ECIA 2B5XA 5ECNB 4MK3A 2D2ZA 20GSA 5IQYA 3M1GA 2DC5A 4FH8A 1AW9A 4ZB9A 4MLYA 2QKEA 3LYKA 2H71A 1SK0A 1K0MA 3LYPA 1I9DA 2XC2A 1FB0A 1OYJA 5BMUA 1U87A 1PGTA 3I6AA 1Q98A 1DE1A 1FHEA 2C80A 3GN3A 1GULA 2IFQB 2CV4A 1AC1A 4F03A 5DALA 2H66A 2PUKC 1A0RP 2VLUA 2HE3A 2VCVA 4XS4A 2AB6A 3F3RA 2YJ7A 1T4ZA 3GH9A 4FO5A 5B8BA 3WYWA 1GRXA 5DAKB 1XIYA 4OFTA 3AY8A 3O76A 4MJBA 1KTEA 1M2BA 2H74A 1Z5YE 2MMAA 3UMAA 4YH2A 1NM3A 4Q5NA 3U5RE 5COHA 2V2GA 1CQGA 1WRYA 4KW6A 3QOUA 3ZFBA 5G2ZA 4L5LA 1N2AA 4KAEA 3H4KA 1R5AA 2MMOA 4GLTA 2AYTA 1V40A 4QL9A 2HRFA 3VPTA 3M9JA 3HJOA 3LXZA 4F0BA 2PN8A 4MPGA 2F8AA 3TGZA 1OC9B 3DVXA 4ZXGA 4BL7A 1G0TA 4OCFA 1VRSD 3R2QA 16GSA 1SL0B 5KN2A 3ZVJD 4GTUA 1RK4A 1OKTA 2B7KA 2VM1A 5JWRB 4JZQA 3FW2A 1SD9A 3Q18A 2TRCP 4NXIA 5ABRA 3VFIA 2GTUA 3KH9A 3ZIJA 1WJKA 5CP1A 4I8BA 5EL8A 10GSA 4NAXA 2H1GA 1X9WB 2FUG2 2XPEA 1MDKA 4G19A 1NHYA 4IKHA 2LNTA 2OJLA 1R4WA 3VWUA 4FQUA 3DXBA 3RHBA 1IYHA 1A8YA 1TRVA 2HQTA 1ILOA 3KH7A 4HS1A 1HQOA 2H6XA 3UBLA 1EOGA 1TI1A 2H0HA 3I43A 1A8LA 2V41A 5IIZA 1VGLA 5GAPD 5INYA 1XW9A 1EEJA 2YWNA 2CA8A 3LWAA 4KE3A 1U88A 4IBPA 3UARA 5HR3A 1XVWA 4OCEA 3G7YA 1YKCA 3J7Yk 5ECSA 3D5JA 4K9ZA 3PH9A 2J9HA 4KX4A 2FLSA 1XWGA 1PX7A 4HUAA 3LXTA 1H75A 2DJ1A 2ZUPA 2R2JA 3ME8A 3TKSE 3VWWA 4POLA 1U6TA 3WGXA 4LL4B 5G30A 4KDUA 3TJJA 4K7NA 2IFQA 1ZOFA 2VAFA 2IL3A 3NOFA 2OACA 4O32A 2YCDA 2H1DA 1OE7A 4MABA 2ON7A 3TJBA 3Q6OA 2VL9A 1XOBA 5DAKA 2JACA 3HYPA 1Z6MA 3IK7A 1TU7A 3PINA 3VI5A 4KB3A 4RI6A 1ZMAA 2M72A 1IYIA 2CAQA 4KCAA 2VD0A 1ERVA 2M80A 4GQCA 5A4UA 3O6TA 2WS2A 3LGCA 2DJ2A 3ZIVA 5GZZB 3P8WA 1BAYA 4G10A 3DEXA 2I81A 1ZZYA 4IELA 2GS3A 5F05A 2R6KA 5CRDA 4ML1A 4TR0A 5A4WA 2GT6A 4K2DA 3C8EA 1GLQA 3VLNA 5HFIA 1FVJA 4JBBA 3TOUA 4GRFA 4HU9A 2L5OA 1F9MA 3A2WA 3FKFA 2VO4A 2VOCA 1OC9A 11GSA 1TI3A 4K1FA 5ECKB 3LJRA 4HZ4A 4XS6A 1BYEA 1HNBA 5EVOA 1GTUA 5KEJA 5ECOB 1O8XA 2K18A 1RQMA 3HVSA 4HZ2A 1M99A 1AIUA 1OKDA 4F0CA 1R5PA 3F4TA 3KZQA 4EDZA 3ERWA 1H4OA 2A2SA 3IE3A 2LQOA 4BVYB 3ZTLA 2MYGA 1QGVA 3U6VA 1G6YA 3IC8A 2F8FA 3RDWA 2FD3A 4EDYA 2C1YA 4K7IA 1MDIA 4G9HA 3GYKA 2F3MA 1EZKA 2WULA 3H93A 2H73A 2CVKA 2RUEA 3IRAA 5ECMB 2K8VA 1XWAA 2OBIA 2LV3A 2VM2A 1OVNA 3EC3A 1E6BA 1M0UA 5D93A 4BWQA 3ERGA 2GT5A 5CRHA 3LFLA 2JSYA 2GZZA 1OC8A 4MZWA 1B4QA 5CNWA 3KXOA 2NPBA 5A4VA 3FZ9A 2H1BA 4TXOB 5CAXA 4HJ2A 1GTAA 4TN8A 4NMUA 1J0FA 3IPZA 1T8EB 5AN1A 1LJRA 4QL7A 1TK8B 4IJ3A 2OA7A 5KN0A 4WBJA 3EWLA 2JADA 5GAND 4HQSA 2L57A 6GSYA 3H8QA 2QGVA 2H19A 4XCSA 1BEDA 1F6MC 4ULXA 5DJMA 2R3XA 2GLRA 4WR5A 2DMLA 3UAPA 2WDUA 5JCGA 3UVHA 4JR4A 1JZRA 1Z7RA 1F2EA 1TW9A 2X99A 5IMVA 4RQXA 3VPQA 3CSJA 3UJ1A 3BD2A 1K3OA 1TRUA 1X9SB 2LNSA 2BTOT 1X5CA 1XWKA 1TP9A 2H8LA 3KJYA 1XWCA 2P5QA 4OFMA 4TOPA 4POBA 3GTUB 3HJPA 4BA7A 2N5BA 4ZBDA 2TRXA 3EMPA 1TDIA 3N9JA 4X43A 4HOJA 2OE0A 4NHZA 2WB9A 4JEDA 1YEPA 4MZBA 5D8IA 3LORA 3PR8A 3A2VA 4BVYA 2GSRA 5J5NA 4PNFA 4BVXB 3E9JB 1HD2A 1B48A 2DBCA 3RHCA 4PQHA 1S3CA 4O5RA 8GSSA 3VWVA 3TJKA 4OD7A 5JCUA 2C3TA 4PQIA 5H5RA 2PMTA 4Q5QA 4JU5A 1EGOA 2FGXA 2DSAA 4KDXA 4EUYA 5HQPA 4G2EA 5IMAA 1SJZA 3GRXA 1K0OA 1T1VA 5IOWA 1FB6A 1GSDA 2CZ3A 3QFAC 4ZB6A 5IMDA 5ECRB 3FR9A 4KDYA 3EU4A 1JLWA 1EEMA 2RM5A 3E0UA 4TXOA 5ID2B 4DEJA 3HZ8A 1QMVA 5ECPB 6GSUA 3FHKA 2XBIA 4EKZA 1FOVA 1ACVA 4X0XA 3GKNA 2FY6A 5ENUA 2FWEA 5CRGA 5AIVA 3FR6A 4P3YB 4I2UA 4AGSA 4IS0A 3HZ4A 2IMEA 2QSIA 3DGQA 2B1LA 1RW1A 4ZBBA 4N0ZA 4Z7XA 4MJEA 4V1Ag 2YN1A 2O8VB 4FYCA 3CRTA 5EY6A 4CDOA 2YWIA 2VD1A 1YF1A 4GSNA 4LMWA 2V6KA 3GV1A 5J3RA 6GSWA 4ZL8A 4HJMA 1YZXA 3CRUA 2GQMA 4ZBAA 2HFDA 3F4SA 3TKSA 1AQVA 1JZWA 2YWOA 4D73A 2RIIA 2YANA 2L6CA 4RUVA 1ABAA 3IAS2 3D4MA 4USSA 2CX4A 4KH7A 1XCCA 2VCWA 4FYUA 2YPMA 3MNGA 4TR1B 2LQQA 1S3AA 1YQ1A 2DJ3A 1GSEA 4OWYA 2IMIA 2PU9C 4XHMA 2LTKA 2YV7A 5ELAA 4BVXA 1X5EA 1PL1A 4PNGA 2C0DA 5GSSA 1Q4JA 3PGTA 4ILFA 2HRKB 3HHVA 12GSA 2C4JA 5IMFA 4ZL9A 5HR1A 2FWHA 4NPBA 3A5WA 5JWOB 2CZ2A 1C72A 1PKZA 2RM6A 4OO4A 1ST9A 1M2DA 2PVOC 3QD9A 4FIWA 2HZEB 5DCGA 4WXTA 4YQVA 2P0GA 2ZCTA 5FHIA 2JZTA 3UBKA 5HFKA 5G5FA 2HZFA 4O7HA 2LRNA 2ON5A 4MF6A 4NWYA 4CW9A 3EYTA 1UC7A 1B4PA 2I1UA 2H0GA 2OADA 2I9HA 3APQA 3KM6A 1FVKA 1SYXA 4WETA 5G1KA 5ID2A 3IOSA 1ZYQB 4F82A 1SK1A 1PQNA 1TTZA 2KOKA 4XRDA 2F9SA 4WKWA 3H79A 3C73A 2HNLA 4ISDA 4N11A 2H6YA 4E8EA 3ZMLA 1TRWA 4PQ1A 14GSA 1QUWA 2C0EA 3JCML 3KEBA 2V32A 1F3BA 9GSSA 1ML6A 2B1KA 3GL3A 2XPDA 4MF7A 5E4WA 2GSTA 1TK5B 4EO3A 2AJQB 1PL2A 3DD3A 2H76A 4V1Ap 2AHEA 4HU7A 2HYXA 3D0ZA 4TVEA 5CYYA 1A2MA 5KN1A 2L5LA 3G9BA 3ED3A 2H75A 2BJXA 1YY7A 1K0BA 3KGKA 2DIZA 6GSTA 5G31A 3DRNA 2PERA 2C0GA 2HSMB 4N30A 4GF0A 1G7EA 3CSHA 3H1NA 2B5EA 1XBSA 4TXVA 3FRCA 2PWJA 4IN0A 3ZYWA 2IWTA 2B5YA 5D9XA 1Y25A 2IPAA 1HYUA 3HY2A 2AUVA 2H0IA 2JL4A 4GSTA 2LEGA 1MTCA 2H70A 3ZZXA 5ECLB 4GWRA 2RLIA 2YJHA 2I3YA 2OE1A 5ECQB 1G7OA 3UVTA 4YAPA 1XWBA 2HRKA 1FG4A 1GSSA 4TR4A 3EURA 4TR3A 2ALBA 5B6MA 3IDVA 4K6XA 3W6GA 1VF1A 1GUHA 1ERWA 1DSBA 3P90A 2IIYA 3DIEA 3EMXA 4QQ7A 3G7IA 4XS1A 4POMA 2FWFA 2DJJA 2HLSA 5CRWA 5FT3A 1SKSB 1MD3A 4ZB8A 1AXDA 3IK9A 2E2GA 3LQ7A 3GUSA 3IHQA 2EIRA 1B9XC 3TKSC 2PGTA 3Q19A 1YDKA 1W89A 3D6IA 3UIWA 1GUKA 3WGEA 1FW1A 5DDLA 2R37A 3GFKA 3FZ4A 5JCWA 2EIOA 1G6WA 1Z9HA 2WZ9A 4CHSA 3KIJA 3HXSA 1XXUA 4MZCA 3SWLA 3A2XA 3BOAA 4MJAA 1ERUA 2VCZA 1PRXA 4J56E 3QPMA 4POKA 2G2QA 2VCXA 3CYNA 4XTSA 2JU5A 4N0VA 5ECHB 3ERFA 4OO5A 4ECJA 3CTGA 3NZNA 1S3DA 3DWVA 2VLTA 2P31A 6GSXA 1QXHA 2VL2A 19GSA 2JSZA 3GSSA 2WGRA 5G1LA 4G0LA 5AIXA 1URMA 4HEA2 2HT9A 5IMZA 2NTOA 1A2LA 5HFGA 2GQKA 2A4VA 3F6DA 3F63A 4WF5A 3IAM2 3KCMA 2HSMA 2LJAA 3V1WA 4AJ7A 4YQMA 4AF2A 1A0FA 2E7PA 2H1AA 2AAWA 2LUSA 1FAAA 5ECIB 3L9SA 4NV2A 2DJKA 4MCUA 5CO3A 3HD5A 1K0AA 1GSQA 2H72A 4KCEA 1U3AA 2HI7A 2X64A 5DALB 4J57E 4V2LA 2C3QA 2VCTA 2RUFA 7GSSA 1R7HA 3GSTA 4Q5RA 2G0FA 3LEFA 1TKDB 2MBTA 1AAZA 1QK8A 4I2TA 5F0GA 4V2NA 2PVQA 1AUCA 3F4RA 3MSZA 3F3QA 1V2AA 1K0NA 6GSSA 4EVMA 2DJ0A 3RPPA 1MEKA 1QFNA 4DSRA 3PPUA 2GSQA 2H01A 2VUPA 1KBNA 6GSVA 3FY7A 4IGJA 1VF3A 1J08A 3C1SA 5EPFA 5AISA 3QR6A 18GSA 3HJMA 1PN9A 2WCIA 3TOTA 2YV9A 3GKKA 2O7KA 3TKQA 1V9WA 2KP2A 5FWGA 5DBQA 1O81A 3HDCA 2GQLA 3ZITA 2FA4A 5DQSA 3TRQA 4G0IA 2KUCA 1N8JA 4WF4A 1ZYEA 4F2IA 1GSUA 1XZOA 4IW9A 1HNCA 1JHBA 1Z6NA 3EE2A 3DYRA 1GTBA 4EE0A 1SU9A 5ELGA 3LG6A 4ML6A 2K8SA 3HVVA 1BX9A 3M0FA 3KMNA 3TUEA 3TB2A 4IHUA 3L9VA 2L4QA 5AGYA 5IO0A 2IMFA 1AQXA 1WPIA 3M3MA 4EF0A 3F6FA 5LD0A 4K0GA 2X8CA 3F9UA 4DSSB 2NBSA 2DMMA 3UEMA 1TU8A 5D9WA 3HVXA 3IBHA 5LNKe 1YJ6A 1F37A 2HSHA 2B6MA 2LSTA 1USBA 3GA4A 1SL2B 1ON4A 4KNDA 5GSTA 2HRNA 1XFLA 1Y6EA 3EVIA 4NV5A 2B3SA 1X5DA 5G5EA 2KHPA 4PURA 4DVCA 2O85A 3IR4A 1X9MB 4MJCA 1XVQA 4I6XA 3BJ5A 4ACSA 1PMTA 3D4TA 4IQ1A 3QFBC 3L4NA 1M2AA 4TKYA 2IMDA 4XIHA 1XW5A 2K9FA 2YZHA 1OAZA 1JLVA 3GTUA 2CX3A 3E3EA 4K8MA 3QMXA 5IPHA 1K0DA 1O85A 4HDEA 2E2MA 3FZ5A 1V98A 4PTSA 3QAGA 1SJIA 4JRRA 4J2FA 1PSQA 2VL2C 4YQUA 1F3AA 3L78A 2R5GA 1SENA 4PXOA 2DIYA 4H86A 1UVZA 2NVLA 2EIQA 3BCKA 3ZVJA 2CQ9A 3C7MA 3QDNA
chains in the Genus database with same CATH superfamily
3N5OA 3VURA 1SD8A 1Z7PA 2V1MA 3LW9A 3RBTA 1PA3A 1GNWA 2N5AA 2X8HA 1V58A 1GUMA 1GNEA 4GXZA 1JZOA 4LMVA 1CQHA 4EC0A 3WD6A 3KTLA 2PPTA 3C71A 3IC4A 4X1UA 4IP1A 4PUAA 2WVXB 5F06A 4WEYA 4MH3A 1O73A 1W4VA 2K6VA 1GLPA 2DLXA 3GKXA 2CAIA 3HCZA 1BQ7A 1SVLA 2VLVA 2LKUA 3KMOA 5IMCA 2LJRA 4AKHA 4KF9A 2MMZA 4KUNA 3GKMA 3US3A 1TRSA 1TK0B 5DJLA 4DSSA 3EINA 4IVFA 2YWMA 2REMA 4ID0A 5HR0A 1SKRB 5F8BA 2LS5A 4I5QA 2X49A 3IV4A 2J23A 4GDFA 4GQFA 3W8SA 2C0FA 4OFNA 1E2YA 3FR3A 2H30A 5IPGA 1GSYA 5J9BA 1TOFA 1PX6A 3DMLA 3TDGA 1PD21 4IQAA 2O89A 4ZILA 3FYGA 5HR2A 2QA2A 1SJ6A 1U3IA 3FK8A 2L4CA 3GMFA 2FA8A 2HRAA 3G7JA 2L6DA 2CVDA 4KSMA 1WP0A 1Z3EA 3D21A 1M7TA 4AJ6A 1ZYPA 4MDCA 1T4YA 2KP1A 4MH2A 5CREA 1M9AA 1OE8A 3VK9A 5A5KA 3P7XA 2O87A 2M46A 3FEUA 4Z2UA 3CBUA 4X4JA 3BBYA 5IOXA 3DVWA 3L0HA 4EXJA 3GL5A 4AKIA 2KLXA 3QAVA 1YF0A 1GP1A 2A2RA 4HQZA 3HA9A 3BCIA 4EIQA 4TRXA 4F9ZA 17GSA 1WWJA 5IM9A 3HMJG 2L59A 4MF5A 3ZRDA 3ZFLA 2YOIA 5B8AA 5F07A 3GHAA 4TR1A 1TXXA 3D22A 1YEXA 4LL1B 4MPFA 3A3TA 2MBSA 2NDOA 3Q74A 1HNAA 2F51A 1S4BP 4AJ8A 1TJDA 2OKAA 3GH6A 2TIRA 1J9BA 2C3NA 4BIKA 1K0CA 3CMIA 5D96A 2VCQA 1DE2A 2Z9SA 5DQYA 1OC3A 3SBCA 1I5GA 2OE3A 1V57A 2X8GA 22GSA 4KGIA 2CT6A 4KSOA 4OMVA 2R0GA 1UN2A 3EU3A 3KTBA 4L5OA 2GVPA 4IJIA 2WVXA 4MP4A 3K8NA 2WW2A 1A2JA 4RI7A 2FWGA 3TRPA 4L8EA 1O8WA 4K5RA 3UOMA 3MWHA 1SL1B 2HZEA 5J40A 3I9V2 1O7UA 1UA5A 3GX0A 3ZREA 3HKRA 3M9KA 4K7OA 5LCZA 1WOUA 3ISOA 1B9YC 5IO2A 3S9FA 2R4VA 2YZUA 5J4YA 3TKRA 2DKHA 2YP6A 2MZCA 1A24A 4O92A 2V6OA 3RPNA 1EV4A 3VI7A 2P5RA 2E0QA 1PKWA 5H5SA 3WT2A 3F0IA 3TCOA 1WE0A 3GURA 3FZAA 1LU4A 4BWSA 1B8XA 5D73A 2IMKA 3QAWA 2VIMA 4K5SA 1EV9A 1SK2A 4DSQA 1LBKA 4K0NA 1T7PB 3LSZA 4NHWA 3IA1A 2GDRA 3W8JA 2MMNA 1T00A 3CSIA 4Z2RA 2XBQA 4IP6A 5C00A 1MDJA 5D9TA 2H6ZA 3GIXA 1NHOA 3TJGA 4PGTA 3VWXA 13GSA 3ME7A 3C1RA 5H5QA 3I69A 2OBKA 1JFUA 1AQWA 5B7CA 2FHEA 2GGTA 1XPVA 2AV4A 2N5FA 2I4AA 3KP9A 3WT1A 1R26A 5J9CA 1GL8A 3DKSA 4PUFC 1ZCPA 2JZSA 5B6NA 1ZGNA 1BF5A 4GCIA 3ZMKA 3APSA 1T3BA 2BMXA 4HI7A 1NSWA 4L0UA 4I97A 2IN3A 1YKAA 1O6JA 5C04A 5J47A 4ECBA 2QC7A 2EC4A 2HXKA 5D9VA 5J41A 3NIVA 1ERTA 4XRAA 2GSSA 1ZL9A 2ES7A 3APOA 5BMUB 3F8UA 2ZNMA 1DBYA 3OR5A 1GSFA 1VF2A 3CTFA 2LRCA 1SKWB 2WJUA 2HSYA 4TW5A 3UL3A 3ZL5A 1WMJA 5A1NB 4XS4B 1SYRA 1XW6A 1K3YA 1EP7A 3CWGA 2OT3A 3KD0A 2VL3A 2EFCA 4W66A 1EWXA 3P2AA 1GH2A 3TKPA 3IXRA 4WBRD 3QCPA 4G0KA 2LRTA 3ZLPA 3R3EA 1YEWC 5J4UA 1KEBA 4YAVA 2X4AA 4D73B 4LLRA 1K3LA 2C8UA 2WFCA 4N10A 3GX8A 5JWQB 3MDKA 1KNGA 1VF4A 2YNXA 2LJKA 5E59A 1JZDA 1A23A 2CVBA 4ECCA 4V2MA 4PI2C 1NW2A 2GZYA 1XOAA 3TJFA 3M8NA 2IJYA 5DVBA 1GTIA 5DCHA 4BL7B 3GNJA 2XHFA 4JE1A 4BPYA 4GSSA 2PBJA 3WGDA 2WRTA 3J7Yb 1THXA 4KA0A 1EP8A 3TRXA 1EOHA 4ZL7A 4MMMA 1WIKA 2HSNB 1FO5A 3CXGA 5KN3A 1DUGA 5J4VA 2JZRA 4L0WA 2B7JA 1QQ2A 3KP8A 4FYBA 2A4HA 1MD4A 4YKFA 1GWCA 2FCHA 3O3TA 3MAKA 4WR4A 2FNOA 1BJXA 1EGRA 1THOA 4Q5FA 1X0RA 1BG5A 2UZ8A 4EL1A 4ZIJA 2GZPA 4E8HA 3L9UA 1M9BA 4RQRA 4JR6A 4PX1A 5L71A 3RAZA 4LA1A 4MA9A 4ECIA 2B5XA 5ECNB 4MK3A 2D2ZA 20GSA 5IQYA 3M1GA 2DC5A 4FH8A 1AW9A 4ZB9A 4MLYA 2QKEA 2EFHA 3LYKA 2H71A 1SK0A 1K0MA 3LYPA 1I9DA 2XC2A 1FB0A 1OYJA 5BMUA 1U87A 1PGTA 1M3JA 3I6AA 1Q98A 1DE1A 1FHEA 2C80A 3GN3A 1GULA 2IFQB 2CV4A 1AC1A 4F03A 5DALA 2H66A 2PUKC 1A0RP 2VLUA 2HE3A 5A1NA 2VCVA 4XS4A 2AB6A 3F3RA 2YJ7A 1T4ZA 3GH9A 4FO5A 5B8BA 3WYWA 1GRXA 5DAKB 1XIYA 4OFTA 3AY8A 3O76A 4MJBA 1PN0A 1KTEA 1M2BA 2H74A 1Z5YE 2MMAA 3UMAA 4YH2A 1NM3A 1PFOA 4Q5NA 3U5RE 5COHA 2V2GA 1CQGA 1WRYA 4KW6A 3QOUA 3ZFBA 5G2ZA 4L5LA 1N2AA 4KAEA 3H4KA 1R5AA 2R0PA 2MMOA 4GLTA 2AYTA 1V40A 4QL9A 2HRFA 4FXYP 3VPTA 3M9JA 3HJOA 3LXZA 4F0BA 2PN8A 4MPGA 2F8AA 3TGZA 1OC9B 3DVXA 4ZXGA 4BL7A 1G0TA 4OCFA 1VRSD 5KOWA 3R2QA 16GSA 1SL0B 5KN2A 3MIXA 2WVZA 3ZVJD 4GTUA 1RK4A 4G01A 1OKTA 2B7KA 2VM1A 5JWRB 4JZQA 2HSNA 3FW2A 1SD9A 3Q18A 2TRCP 4NXIA 5ABRA 3VFIA 2GTUA 3KH9A 3ZIJA 1WJKA 5CP1A 3MYDA 4I8BA 5EL8A 10GSA 4NAXA 2H1GA 1X9WB 2FUG2 2XPEA 1MDKA 4G19A 1NHYA 4IKHA 2LNTA 2OJLA 1R4WA 3VWUA 4FQUA 3DXBA 3RHBA 1IYHA 1A8YA 1TRVA 2HQTA 1ILOA 3KH7A 4HS1A 1HQOA 2H6XA 3UBLA 1EOGA 4O5QA 1TI1A 2H0HA 3I43A 1A8LA 2V41A 5IIZA 1VGLA 5GAPD 5INYA 5A5HB 1XW9A 1EEJA 2YWNA 2CA8A 3LWAA 4KE3A 1U88A 4IBPA 3UARA 5HR3A 1XVWA 4OCEA 3G7YA 1YKCA 3J7Yk 5ECSA 3D5JA 4K9ZA 3PH9A 2J9HA 4KX4A 2FLSA 1XWGA 1PX7A 4HUAA 3LXTA 1H75A 2DJ1A 2ZUPA 2R2JA 3ME8A 3TKSE 3VWWA 4POLA 1U6TA 3WGXA 4LL4B 5G30A 4KDUA 3TJJA 4K7NA 2IFQA 1ZOFA 2VAFA 2IL3A 3NOFA 2OACA 4O32A 2YCDA 2H1DA 1OE7A 4MABA 2ON7A 3TJBA 3Q6OA 2VL9A 1XOBA 5DAKA 2JACA 3HYPA 1Z6MA 3IK7A 1TU7A 3PINA 3VI5A 4KB3A 4RI6A 1ZMAA 2M72A 1IYIA 1S3RA 2CAQA 4KCAA 2VD0A 1ERVA 2M80A 4GQCA 5A4UA 3O6TA 2WS2A 3LGCA 2VKZG 2DJ2A 3ZIVA 5GZZB 3P8WA 1BAYA 4YKGA 4G10A 3DEXA 2I81A 1ZZYA 4IELA 2GS3A 5F05A 2R6KA 5CRDA 4ML1A 4TR0A 5A4WA 2GT6A 4K2DA 3C8EA 1GLQA 3VLNA 5HFIA 1FVJA 4JBBA 3TOUA 4GRFA 4HU9A 2L5OA 1F9MA 3A2WA 3FKFA 2VO4A 2VOCA 1OC9A 11GSA 1TI3A 4K1FA 5ECKB 3LJRA 4HZ4A 4XS6A 1BYEA 1HNBA 5EVOA 1GTUA 5KEJA 5ECOB 1ZYNA 1O8XA 2K18A 1RQMA 3HVSA 4E68A 4HZ2A 1M99A 1AIUA 1OKDA 4F0CA 1R5PA 3F4TA 3KZQA 4EDZA 3ERWA 1H4OA 2A2SA 3IE3A 2LQOA 4BVYB 3ZTLA 2MYGA 1QGVA 3U6VA 1G6YA 3IC8A 2F8FA 3RDWA 2FD3A 4EDYA 2C1YA 4K7IA 1MDIA 4G9HA 3GYKA 4N3ZA 2F3MA 1EZKA 2WULA 3H93A 2H73A 2CVKA 2RUEA 3IRAA 5ECMB 5A5HA 2K8VA 1XWAA 2OBIA 2LV3A 2O5VA 4QMKA 2VM2A 5KOXA 1OVNA 3EC3A 1E6BA 1M0UA 5D93A 4BWQA 3ERGA 2GT5A 5CRHA 3LFLA 2JSYA 1Y1UA 4EIPA 2GZZA 1OC8A 4MZWA 1B4QA 5CNWA 3KXOA 2NPBA 5A4VA 3FZ9A 2H1BA 4TXOB 5CAXA 4HJ2A 1GTAA 4TN8A 4NMUA 1J0FA 3IPZA 1T8EB 5AN1A 1LJRA 4QL7A 1TK8B 4IJ3A 2OA7A 5KN0A 4WBJA 3EWLA 2JADA 5GAND 2H1LA 4HQSA 2L57A 6GSYA 3H8QA 2QGVA 2H19A 4XCSA 1BEDA 1F6MC 4ULXA 5DJMA 2R3XA 2GLRA 4WR5A 2DMLA 3UAPA 3CHXC 2WDUA 5JCGA 3UVHA 4JR4A 1JZRA 1Z7RA 1F2EA 1TW9A 4K2XA 2X99A 5IMVA 4RQXA 3VPQA 3CSJA 3UJ1A 3BD2A 1K3OA 4PHZC 1TRUA 1X9SB 2LNSA 2BTOT 1X5CA 1XWKA 1TP9A 2H8LA 3KJYA 1XWCA 2P5QA 4OFMA 4TOPA 4POBA 3GTUB 3HJPA 4BA7A 2N5BA 4ZBDA 2R0CA 2TRXA 3EMPA 1TDIA 3N9JA 4X43A 4HOJA 2OE0A 4NHZA 2WB9A 4JEDA 1YEPA 4MZBA 4AKXB 5D8IA 3LORA 3PR8A 4PI0C 3A2VA 4BVYA 2GSRA 5J5NA 4PNFA 4BVXB 3E9JB 1HD2A 1B48A 2DBCA 3RHCA 4PQHA 1S3CA 4O5RA 8GSSA 3VWVA 3TJKA 4OD7A 5JCUA 2C3TA 4PQIA 5H5RA 2PMTA 4Q5QA 4JU5A 1EGOA 2FGXA 2DSAA 4KDXA 4EUYA 5HQPA 4G2EA 5IMAA 1SJZA 3GRXA 1K0OA 1T1VA 5IOWA 1FB6A 1GSDA 2CZ3A 3QFAC 4ZB6A 5IMDA 5ECRB 3FR9A 4KDYA 3EU4A 1JLWA 1EEMA 2RM5A 3E0UA 4TXOA 5BRTA 5ID2B 4DEJA 3HZ8A 1QMVA 5ECPB 6GSUA 3FHKA 2XBIA 4EKZA 1FOVA 1ACVA 4X0XA 3GKNA 2WW3A 2FY6A 5ENUA 2FWEA 5CRGA 5AIVA 3FR6A 4P3YB 4I2UA 4AGSA 4IS0A 3HZ4A 2IMEA 2QSIA 3DGQA 2B1LA 1RW1A 4ZBBA 4N0ZA 4Z7XA 4MJEA 4V1Ag 2EFDA 2YN1A 2O8VB 4FYCA 3CRTA 5EY6A 4CDOA 2YWIA 2VD1A 1YF1A 4GSNA 4LMWA 2V6KA 3GV1A 5J3RA 6GSWA 4ZL8A 4HJMA 1YZXA 3CRUA 2GQMA 4CY6A 2O36A 4ZBAA 2HFDA 3F4SA 3TKSA 1AQVA 1JZWA 2YWOA 3A5IA 4D73A 2RIIA 2YANA 2L6CA 4RUVA 1ABAA 3IAS2 3D4MA 4USSA 2CX4A 4KH7A 1XCCA 1I1IP 2VCWA 4FYUA 2YPMA 3MNGA 4TR1B 2LQQA 1S3AA 1YQ1A 1M3IA 2DJ3A 1GSEA 4OWYA 2IMIA 2PU9C 4XHMA 3RFRC 2LTKA 2YV7A 5ELAA 4BVXA 1X5EA 4CY8A 1PL1A 4PNGA 2C0DA 5GSSA 1Q4JA 3PGTA 4ILFA 2HRKB 3HHVA 12GSA 2C4JA 5IMFA 4ZL9A 5HR1A 3HVNA 2FWHA 4NPBA 3A5WA 5JWOB 2CZ2A 1C72A 1PKZA 2RM6A 4OO4A 1ST9A 1M2DA 2PVOC 3QD9A 4FIWA 2HZEB 5DCGA 4WXTA 4YQVA 2P0GA 2ZCTA 5FHIA 2JZTA 3UBKA 5HFKA 5G5FA 2HZFA 4O7HA 2LRNA 2ON5A 4MF6A 4NWYA 4CW9A 3EYTA 1UC7A 1B4PA 2I1UA 2H0GA 2OADA 2I9HA 3FMWA 3APQA 3KM6A 1FVKA 1SYXA 4WETA 5G1KA 5ID2A 3IOSA 1ZYQB 4F82A 1SK1A 1PQNA 1FOHA 1TTZA 2KOKA 4ZB7A 4XRDA 2F9SA 4WKWA 3H79A 3C73A 2HNLA 4ISDA 4N11A 2H6YA 3TU3B 4E8EA 1TXUA 3ZMLA 1TRWA 4PQ1A 14GSA 1QUWA 2C0EA 3JCML 3KEBA 2V32A 1F3BA 9GSSA 1ML6A 2B1KA 3GL3A 2XPDA 4MF7A 5E4WA 2GSTA 1TK5B 4EO3A 2AJQB 1PL2A 3DD3A 2H76A 4V1Ap 2AHEA 4HU7A 2HYXA 1BG1A 3D0ZA 4TVEA 5CYYA 1A2MA 5KN1A 2L5LA 3G9BA 3ED3A 2H75A 2BJXA 1YY7A 1K0BA 3KGKA 2DIZA 6GSTA 5G31A 3DRNA 2PERA 2C0GA 2HSMB 4N30A 4GF0A 1G7EA 3CSHA 3H1NA 2B5EA 1XBSA 4TXVA 3FRCA 2PWJA 4IN0A 4AKGA 3ZYWA 2IWTA 2B5YA 5D9XA 1Y25A 2IPAA 1HYUA 3HY2A 2AUVA 2H0IA 2JL4A 4GSTA 2LEGA 1MTCA 2H70A 3ZZXA 5ECLB 4GWRA 2RLIA 2YJHA 2I3YA 2OE1A 2QA1A 5A34B 5ECQB 1G7OA 3UVTA 4YAPA 1XWBA 3CQFA 2HRKA 1FG4A 1GSSA 4TR4A 3EURA 2O3EA 4TR3A 2ALBA 1XG8A 5B6MA 3IDVA 3IHGA 4K6XA 3W6GA 1VF1A 1GUHA 1ERWA 1SVMA 1DSBA 3P90A 2IIYA 3DIEA 3EMXA 4QQ7A 3G7IA 4XS1A 4POMA 2FWFA 2DJJA 2HLSA 2UV8G 5CRWA 5FT3A 1SKSB 1MD3A 4ZB8A 1AXDA 3IK9A 2EFEA 2E2GA 3LQ7A 3GUSA 3IHQA 2EIRA 1B9XC 3TKSC 2PGTA 3Q19A 1YDKA 1W89A 3D6IA 3UIWA 1GUKA 3WGEA 1FW1A 5DDLA 2R37A 3GFKA 3FZ4A 5JCWA 2EIOA 1G6WA 1Z9HA 2WZ9A 4CHSA 3KIJA 3HXSA 1XXUA 4MZCA 3SWLA 3A2XA 3BOAA 4MJAA 1ERUA 2VCZA 1PRXA 4J56E 3QPMA 4POKA 2G2QA 2VCXA 3CYNA 4XTSA 2JU5A 4N0VA 1N25A 5ECHB 3ERFA 4OO5A 4ECJA 3CTGA 3NZNA 1S3DA 3DWVA 2VLTA 2P31A 6GSXA 1QXHA 2VL2A 19GSA 2JSZA 3GSSA 2WGRA 5G1LA 4G0LA 5AIXA 1URMA 4HEA2 2HT9A 5IMZA 2NTOA 1A2LA 5HFGA 2GQKA 2A4VA 3F6DA 3F63A 4WF5A 3IAM2 3KCMA 2HSMA 2LJAA 3V1WA 4AJ7A 4YQMA 4AF2A 1A0FA 2E7PA 2H1AA 2AAWA 2LUSA 1FAAA 5ECIB 3L9SA 3EPTA 4NV2A 2DJKA 4MCUA 5CO3A 3HD5A 1K0AA 1GSQA 2H72A 4KCEA 1U3AA 2HI7A 2X64A 4Z2TA 4HSCX 5DALB 4J57E 4V2LA 2C3QA 2VCTA 2DKIA 5A34A 2RUFA 7GSSA 1R7HA 3GSTA 4Q5RA 2G0FA 3LEFA 4MNNA 1TKDB 2MBTA 1AAZA 1QK8A 4I2TA 5F0GA 4V2NA 2PVQA 1AUCA 3F4RA 3MSZA 3F3QA 1V2AA 1K0NA 6GSSA 4O5UA 4EVMA 2DJ0A 3RPPA 1MEKA 1QFNA 4DSRA 3PPUA 2GSQA 2H01A 2VUPA 1KBNA 6GSVA 3FY7A 4IGJA 1VF3A 1J08A 3C1SA 5EPFA 5AISA 4A5PA 3QR6A 18GSA 3HJMA 1PN9A 2WCIA 3TOTA 2YV9A 3GKKA 2O7KA 3TKQA 1V9WA 2KP2A 5FWGA 5DBQA 1O81A 3HDCA 2GQLA 3ZITA 2FA4A 5DQSA 3TRQA 2A2PA 4G0IA 2KUCA 1N8JA 4WF4A 1ZYEA 4F2IA 1GSUA 1XZOA 4IW9A 1HNCA 1JHBA 1Z6NA 3EE2A 3DYRA 1GTBA 4EE0A 1SU9A 5ELGA 3LG6A 4ML6A 2K8SA 3HVVA 1BX9A 3M0FA 3KMNA 3TUEA 3TB2A 4IHUA 2L4QA 3L9VA 5AGYA 5IO0A 2IMFA 1AQXA 1WPIA 3RGBC 3M3MA 4EF0A 3F6FA 5LD0A 4K0GA 2X8CA 3F9UA 4DSSB 2NBSA 2DMMA 3UEMA 1TU8A 5D9WA 3HVXA 3IBHA 5LNKe 1YJ6A 1F37A 2HSHA 2B6MA 2LSTA 1USBA 3GA4A 1SL2B 1ON4A 4ICYA 1YVLA 4KNDA 5GSTA 2WVYA 2WZSA 2HRNA 1XFLA 1Y6EA 3EVIA 4NV5A 2B3SA 1X5DA 5G5EA 2KHPA 4PURA 4DVCA 2O85A 3IR4A 1X9MB 4MJCA 1XVQA 4I6XA 3BJ5A 4ACSA 1PMTA 3D4TA 4IQ1A 3QFBC 3L4NA 1M2AA 4TKYA 2IMDA 4XIHA 1XW5A 2K9FA 2YZHA 1OAZA 1SVOA 1JLVA 3GTUA 2CX3A 3E3EA 4K8MA 3QMXA 5IPHA 1K0DA 1O85A 4HDEA 2E2MA 3FZ5A 1V98A 2WW1A 4PTSA 3QAGA 1SJIA 4JRRA 4J2FA 1PSQA 2VL2C 4YQUA 1F3AA 3L78A 2R5GA 2WW0A 1SENA 4PXOA 2DIYA 4H86A 1UVZA 2NVLA 2EIQA 3BCKA 3ZVJA 4AI6A 2CQ9A 3C7MA 3QDNA
chains in the Genus database with same CATH topology
3N5OA 3VURA 1SD8A 1Z7PA 2V1MA 3LW9A 3RBTA 1PA3A 1GNWA 2N5AA 2X8HA 1V58A 1GUMA 1GNEA 4GXZA 1JZOA 4LMVA 1CQHA 4EC0A 3WD6A 3KTLA 2PPTA 3C71A 3IC4A 4X1UA 4IP1A 4PUAA 5F06A 4WEYA 4MH3A 1O73A 1W4VA 2K6VA 1GLPA 2DLXA 3GKXA 2CAIA 3HCZA 1BQ7A 1SVLA 2VLVA 2LKUA 3KMOA 5IMCA 2LJRA 4AKHA 4KF9A 2MMZA 4KUNA 3GKMA 3US3A 1TRSA 1TK0B 5DJLA 4DSSA 3EINA 4IVFA 2YWMA 2REMA 4ID0A 5HR0A 1SKRB 5F8BA 2LS5A 4I5QA 2X49A 3IV4A 2J23A 4GDFA 4GQFA 3W8SA 2C0FA 4OFNA 1E2YA 3FR3A 2H30A 5IPGA 1GSYA 5J9BA 1TOFA 1PX6A 3DMLA 3TDGA 1PD21 4IQAA 2O89A 4ZILA 3FYGA 5HR2A 2QA2A 1SJ6A 1U3IA 3FK8A 2L4CA 3GMFA 2FA8A 2HRAA 3G7JA 2L6DA 2CVDA 4KSMA 1WP0A 1Z3EA 3D21A 1M7TA 4AJ6A 1ZYPA 4MDCA 1T4YA 2KP1A 4MH2A 5CREA 1M9AA 1OE8A 3VK9A 5A5KA 3P7XA 2O87A 2M46A 3FEUA 4Z2UA 3CBUA 4X4JA 3BBYA 5IOXA 3DVWA 3L0HA 4EXJA 3GL5A 4AKIA 2KLXA 3QAVA 1YF0A 1GP1A 2A2RA 4HQZA 3HA9A 3BCIA 4EIQA 4TRXA 4F9ZA 17GSA 1WWJA 5IM9A 3HMJG 2L59A 4MF5A 3ZRDA 3ZFLA 2YOIA 5B8AA 5F07A 3GHAA 4TR1A 1TXXA 3D22A 1YEXA 4LL1B 4MPFA 3A3TA 2MBSA 2NDOA 3Q74A 1HNAA 2F51A 4AJ8A 1TJDA 2OKAA 3GH6A 2TIRA 1J9BA 2C3NA 1K0CA 3CMIA 5D96A 2VCQA 1DE2A 2Z9SA 5DQYA 1OC3A 3SBCA 1I5GA 2OE3A 1V57A 2X8GA 22GSA 4KGIA 2CT6A 4KSOA 4OMVA 2R0GA 1UN2A 3EU3A 3KTBA 4L5OA 2GVPA 4IJIA 4MP4A 3K8NA 1A2JA 4RI7A 2FWGA 3TRPA 4L8EA 1O8WA 4K5RA 3UOMA 3MWHA 1SL1B 2HZEA 5J40A 3I9V2 1O7UA 1UA5A 3GX0A 3ZREA 3HKRA 3M9KA 4K7OA 5LCZA 1WOUA 3ISOA 1B9YC 5IO2A 3S9FA 2R4VA 2YZUA 5J4YA 3TKRA 2DKHA 2YP6A 2MZCA 1A24A 4O92A 2V6OA 3RPNA 1EV4A 3VI7A 2P5RA 2E0QA 1PKWA 5H5SA 3WT2A 3F0IA 3TCOA 1WE0A 3GURA 3FZAA 1LU4A 4BWSA 1B8XA 5D73A 2IMKA 3QAWA 2VIMA 4K5SA 1EV9A 1SK2A 4DSQA 1LBKA 4K0NA 1T7PB 3LSZA 4NHWA 3IA1A 2GDRA 3W8JA 2MMNA 1T00A 3CSIA 4Z2RA 2XBQA 4IP6A 5C00A 1MDJA 5D9TA 2H6ZA 3GIXA 1NHOA 3TJGA 4PGTA 3VWXA 13GSA 3ME7A 3C1RA 5H5QA 3I69A 2OBKA 1JFUA 1AQWA 5B7CA 2FHEA 2GGTA 1XPVA 2AV4A 2N5FA 2I4AA 3KP9A 3WT1A 1R26A 5J9CA 1GL8A 3DKSA 4PUFC 1ZCPA 2JZSA 5B6NA 1ZGNA 1BF5A 4GCIA 3ZMKA 3APSA 1T3BA 2BMXA 4HI7A 1NSWA 4L0UA 4I97A 2IN3A 1YKAA 1O6JA 5C04A 5J47A 4ECBA 2QC7A 2EC4A 2HXKA 5D9VA 5J41A 3NIVA 1ERTA 4XRAA 2GSSA 1ZL9A 2ES7A 3APOA 5BMUB 3F8UA 2ZNMA 1DBYA 3OR5A 1GSFA 1VF2A 3CTFA 2LRCA 1SKWB 2WJUA 2HSYA 4TW5A 3UL3A 3ZL5A 1WMJA 5A1NB 4XS4B 1SYRA 1XW6A 1K3YA 1EP7A 3CWGA 2OT3A 3KD0A 2VL3A 2EFCA 4W66A 1EWXA 3P2AA 1GH2A 3TKPA 3IXRA 4WBRD 3QCPA 4G0KA 2LRTA 3ZLPA 3R3EA 5J4UA 1KEBA 4YAVA 2X4AA 4D73B 4LLRA 1K3LA 2C8UA 2WFCA 4N10A 3GX8A 5JWQB 3MDKA 1KNGA 1VF4A 2YNXA 2LJKA 5E59A 1JZDA 1A23A 2CVBA 4ECCA 4V2MA 1NW2A 2GZYA 1XOAA 3TJFA 3M8NA 2IJYA 5DVBA 1GTIA 5DCHA 4BL7B 3GNJA 2XHFA 4JE1A 4BPYA 4GSSA 2PBJA 3WGDA 2WRTA 3J7Yb 1THXA 4KA0A 1EP8A 3TRXA 1EOHA 4ZL7A 4MMMA 1WIKA 2HSNB 1FO5A 3CXGA 5KN3A 1DUGA 5J4VA 2JZRA 4L0WA 2B7JA 1QQ2A 3KP8A 4FYBA 2A4HA 1MD4A 4YKFA 1GWCA 2FCHA 3O3TA 3MAKA 4WR4A 2FNOA 1BJXA 1EGRA 1THOA 4Q5FA 1X0RA 1BG5A 2UZ8A 4EL1A 4ZIJA 2GZPA 4E8HA 3L9UA 1M9BA 4RQRA 4JR6A 4PX1A 5L71A 3RAZA 4LA1A 4MA9A 4ECIA 2B5XA 5ECNB 4MK3A 2D2ZA 20GSA 5IQYA 3M1GA 2DC5A 4FH8A 1AW9A 4ZB9A 4MLYA 2QKEA 2EFHA 3LYKA 2H71A 1SK0A 1K0MA 3LYPA 1I9DA 2XC2A 1FB0A 1OYJA 5BMUA 1U87A 1PGTA 3I6AA 1Q98A 1DE1A 1FHEA 2C80A 3GN3A 1GULA 2IFQB 2CV4A 1AC1A 4F03A 5DALA 2H66A 2PUKC 1A0RP 2VLUA 2HE3A 5A1NA 2VCVA 4XS4A 2AB6A 3F3RA 2YJ7A 1T4ZA 3GH9A 4FO5A 5B8BA 3WYWA 1GRXA 5DAKB 1XIYA 4OFTA 3AY8A 3O76A 4MJBA 1PN0A 1KTEA 1M2BA 2H74A 1Z5YE 2MMAA 3UMAA 4YH2A 1NM3A 4Q5NA 3U5RE 5COHA 2V2GA 1CQGA 1WRYA 4KW6A 3QOUA 3ZFBA 5G2ZA 4L5LA 1N2AA 4KAEA 3H4KA 1R5AA 2R0PA 2MMOA 4GLTA 2AYTA 1V40A 4QL9A 2HRFA 3VPTA 3M9JA 3HJOA 3LXZA 4F0BA 2PN8A 4MPGA 2F8AA 3TGZA 1OC9B 3DVXA 4ZXGA 4BL7A 1G0TA 4OCFA 1VRSD 5KOWA 3R2QA 16GSA 1SL0B 5KN2A 3MIXA 3ZVJD 4GTUA 1RK4A 4G01A 1OKTA 2B7KA 2VM1A 5JWRB 4JZQA 2HSNA 3FW2A 1SD9A 3Q18A 2TRCP 4NXIA 5ABRA 3VFIA 2GTUA 3KH9A 3ZIJA 1WJKA 5CP1A 3MYDA 4I8BA 5EL8A 10GSA 4NAXA 2H1GA 1X9WB 2FUG2 2XPEA 1MDKA 4G19A 1NHYA 4IKHA 2LNTA 2OJLA 1R4WA 3VWUA 4FQUA 3DXBA 3RHBA 1IYHA 1A8YA 1TRVA 2HQTA 1ILOA 3KH7A 4HS1A 1HQOA 2H6XA 3UBLA 1EOGA 4O5QA 1TI1A 2H0HA 3I43A 1A8LA 2V41A 5IIZA 1VGLA 5GAPD 5INYA 5A5HB 1XW9A 1EEJA 2YWNA 2CA8A 3LWAA 4KE3A 1U88A 4IBPA 3UARA 5HR3A 1XVWA 4OCEA 3G7YA 1YKCA 3J7Yk 5ECSA 3D5JA 4K9ZA 3PH9A 2J9HA 4KX4A 2FLSA 1XWGA 1PX7A 4HUAA 3LXTA 1H75A 2DJ1A 2ZUPA 2R2JA 3ME8A 3TKSE 3VWWA 4POLA 1U6TA 3WGXA 4LL4B 5G30A 4KDUA 3TJJA 4K7NA 2IFQA 1ZOFA 2VAFA 2IL3A 3NOFA 2OACA 4O32A 2YCDA 2H1DA 1OE7A 4MABA 2ON7A 3TJBA 3Q6OA 2VL9A 1XOBA 5DAKA 2JACA 3HYPA 1Z6MA 3IK7A 1TU7A 3PINA 3VI5A 4KB3A 4RI6A 1ZMAA 2M72A 1IYIA 2CAQA 4KCAA 2VD0A 1ERVA 2M80A 4GQCA 5A4UA 3O6TA 2WS2A 3LGCA 2VKZG 2DJ2A 3ZIVA 5GZZB 3P8WA 1BAYA 4YKGA 4G10A 3DEXA 2I81A 1ZZYA 4IELA 2GS3A 5F05A 2R6KA 5CRDA 4ML1A 4TR0A 5A4WA 2GT6A 4K2DA 3C8EA 1GLQA 3VLNA 5HFIA 1FVJA 4JBBA 3TOUA 4GRFA 4HU9A 2L5OA 1F9MA 3A2WA 3FKFA 2VO4A 2VOCA 1OC9A 11GSA 1TI3A 4K1FA 5ECKB 3LJRA 4HZ4A 4XS6A 1BYEA 1HNBA 5EVOA 1GTUA 5KEJA 5ECOB 1ZYNA 1O8XA 2K18A 1RQMA 3HVSA 4E68A 4HZ2A 1M99A 1AIUA 1OKDA 4F0CA 1R5PA 3F4TA 3KZQA 4EDZA 3ERWA 1H4OA 2A2SA 3IE3A 2LQOA 4BVYB 3ZTLA 2MYGA 1QGVA 3U6VA 1G6YA 3IC8A 2F8FA 3RDWA 2FD3A 4EDYA 2C1YA 4K7IA 1MDIA 4G9HA 3GYKA 4N3ZA 2F3MA 1EZKA 2WULA 3H93A 2H73A 2CVKA 2RUEA 3IRAA 5ECMB 5A5HA 2K8VA 1XWAA 2OBIA 2LV3A 2O5VA 4QMKA 2VM2A 5KOXA 1OVNA 3EC3A 1E6BA 1M0UA 5D93A 4BWQA 3ERGA 2GT5A 5CRHA 3LFLA 2JSYA 1Y1UA 4EIPA 2GZZA 1OC8A 4MZWA 1B4QA 5CNWA 3KXOA 2NPBA 5A4VA 3FZ9A 2H1BA 4TXOB 5CAXA 4HJ2A 1GTAA 4TN8A 4NMUA 1J0FA 3IPZA 1T8EB 5AN1A 1LJRA 4QL7A 1TK8B 4IJ3A 2OA7A 5KN0A 4WBJA 3EWLA 2JADA 5GAND 2H1LA 4HQSA 2L57A 6GSYA 3H8QA 2QGVA 2H19A 4XCSA 1BEDA 1F6MC 4ULXA 5DJMA 2R3XA 2GLRA 4WR5A 2DMLA 3UAPA 2WDUA 5JCGA 3UVHA 4JR4A 1JZRA 1Z7RA 1F2EA 1TW9A 4K2XA 2X99A 5IMVA 4RQXA 3VPQA 3CSJA 3UJ1A 3BD2A 1K3OA 1TRUA 1X9SB 2LNSA 2BTOT 1X5CA 1XWKA 1TP9A 2H8LA 3KJYA 1XWCA 2P5QA 4OFMA 4TOPA 4POBA 3GTUB 3HJPA 4BA7A 2N5BA 4ZBDA 2R0CA 2TRXA 3EMPA 1TDIA 3N9JA 4X43A 4HOJA 2OE0A 4NHZA 2WB9A 4JEDA 1YEPA 4MZBA 4AKXB 5D8IA 3LORA 3PR8A 3A2VA 4BVYA 2GSRA 5J5NA 4PNFA 4BVXB 3E9JB 1HD2A 1B48A 2DBCA 3RHCA 4PQHA 1S3CA 4O5RA 8GSSA 3VWVA 3TJKA 4OD7A 5JCUA 2C3TA 4PQIA 5H5RA 2PMTA 4Q5QA 4JU5A 1EGOA 2FGXA 2DSAA 4KDXA 4EUYA 5HQPA 4G2EA 5IMAA 1SJZA 3GRXA 1K0OA 1T1VA 5IOWA 1FB6A 1GSDA 2CZ3A 3QFAC 4ZB6A 5IMDA 5ECRB 3FR9A 4KDYA 3EU4A 1JLWA 1EEMA 2RM5A 3E0UA 4TXOA 5BRTA 5ID2B 4DEJA 3HZ8A 1QMVA 5ECPB 6GSUA 3FHKA 2XBIA 4EKZA 1FOVA 1ACVA 4X0XA 3GKNA 2FY6A 5ENUA 2FWEA 5CRGA 5AIVA 3FR6A 4P3YB 4I2UA 4AGSA 4IS0A 3HZ4A 2IMEA 2QSIA 3DGQA 2B1LA 1RW1A 4ZBBA 4N0ZA 4Z7XA 4MJEA 4V1Ag 2EFDA 2YN1A 2O8VB 4FYCA 3CRTA 5EY6A 4CDOA 2YWIA 2VD1A 1YF1A 4GSNA 4LMWA 2V6KA 3GV1A 5J3RA 6GSWA 4ZL8A 4HJMA 1YZXA 3CRUA 2GQMA 4CY6A 4ZBAA 2HFDA 3F4SA 3TKSA 1AQVA 1JZWA 2YWOA 3A5IA 4D73A 2RIIA 2YANA 2L6CA 4RUVA 1ABAA 3IAS2 3D4MA 4USSA 2CX4A 4KH7A 1XCCA 2VCWA 4FYUA 2YPMA 3MNGA 4TR1B 2LQQA 1S3AA 1YQ1A 2DJ3A 1GSEA 4OWYA 2IMIA 2PU9C 4XHMA 2LTKA 2YV7A 5ELAA 4BVXA 1X5EA 4CY8A 1PL1A 4PNGA 2C0DA 5GSSA 1Q4JA 3PGTA 4ILFA 2HRKB 3HHVA 12GSA 2C4JA 5IMFA 4ZL9A 5HR1A 2FWHA 4NPBA 3A5WA 5JWOB 2CZ2A 1C72A 1PKZA 2RM6A 4OO4A 1ST9A 1M2DA 2PVOC 3QD9A 4FIWA 2HZEB 5DCGA 4WXTA 4YQVA 2P0GA 2ZCTA 5FHIA 2JZTA 3UBKA 5HFKA 5G5FA 2HZFA 4O7HA 2LRNA 2ON5A 4MF6A 4NWYA 4CW9A 3EYTA 1UC7A 1B4PA 2I1UA 2H0GA 2OADA 2I9HA 3FMWA 3APQA 3KM6A 1FVKA 1SYXA 4WETA 5G1KA 5ID2A 3IOSA 1ZYQB 4F82A 1SK1A 1PQNA 1FOHA 1TTZA 2KOKA 4ZB7A 4XRDA 2F9SA 4WKWA 3H79A 3C73A 2HNLA 4ISDA 4N11A 2H6YA 3TU3B 4E8EA 1TXUA 3ZMLA 1TRWA 4PQ1A 14GSA 1QUWA 2C0EA 3JCML 3KEBA 2V32A 1F3BA 9GSSA 1ML6A 2B1KA 3GL3A 2XPDA 4MF7A 5E4WA 2GSTA 1TK5B 4EO3A 2AJQB 1PL2A 3DD3A 2H76A 4V1Ap 2AHEA 4HU7A 2HYXA 1BG1A 3D0ZA 4TVEA 5CYYA 1A2MA 5KN1A 2L5LA 3G9BA 3ED3A 2H75A 2BJXA 1YY7A 1K0BA 3KGKA 2DIZA 6GSTA 5G31A 3DRNA 2PERA 2C0GA 2HSMB 4N30A 4GF0A 1G7EA 3CSHA 3H1NA 2B5EA 1XBSA 4TXVA 3FRCA 2PWJA 4IN0A 4AKGA 3ZYWA 2IWTA 2B5YA 5D9XA 1Y25A 2IPAA 1HYUA 3HY2A 2AUVA 2H0IA 2JL4A 4GSTA 2LEGA 1MTCA 2H70A 3ZZXA 5ECLB 4GWRA 2RLIA 2YJHA 2I3YA 2OE1A 2QA1A 5A34B 5ECQB 1G7OA 3UVTA 4YAPA 1XWBA 2HRKA 1FG4A 1GSSA 4TR4A 3EURA 4TR3A 2ALBA 5B6MA 3IDVA 3IHGA 4K6XA 3W6GA 1VF1A 1GUHA 1ERWA 1SVMA 1DSBA 3P90A 2IIYA 3DIEA 3EMXA 4QQ7A 3G7IA 4XS1A 4POMA 2FWFA 2DJJA 2HLSA 2UV8G 5CRWA 5FT3A 1SKSB 1MD3A 4ZB8A 1AXDA 3IK9A 2EFEA 2E2GA 3LQ7A 3GUSA 3IHQA 2EIRA 1B9XC 3TKSC 2PGTA 3Q19A 1YDKA 1W89A 3D6IA 3UIWA 1GUKA 3WGEA 1FW1A 5DDLA 2R37A 3GFKA 3FZ4A 5JCWA 2EIOA 1G6WA 1Z9HA 2WZ9A 4CHSA 3KIJA 3HXSA 1XXUA 4MZCA 3SWLA 3A2XA 3BOAA 4MJAA 1ERUA 2VCZA 1PRXA 4J56E 3QPMA 4POKA 2G2QA 2VCXA 3CYNA 4XTSA 2JU5A 4N0VA 1N25A 5ECHB 3ERFA 4OO5A 4ECJA 3CTGA 3NZNA 1S3DA 3DWVA 2VLTA 2P31A 6GSXA 1QXHA 2VL2A 19GSA 2JSZA 3GSSA 2WGRA 5G1LA 4G0LA 5AIXA 1URMA 4HEA2 2HT9A 5IMZA 2NTOA 1A2LA 5HFGA 2GQKA 2A4VA 3F6DA 3F63A 4WF5A 3IAM2 3KCMA 2HSMA 2LJAA 3V1WA 4AJ7A 4YQMA 4AF2A 1A0FA 2E7PA 2H1AA 2AAWA 2LUSA 1FAAA 5ECIB 3L9SA 3EPTA 4NV2A 2DJKA 4MCUA 5CO3A 3HD5A 1K0AA 1GSQA 2H72A 4KCEA 1U3AA 2HI7A 2X64A 4Z2TA 5DALB 4J57E 4V2LA 2C3QA 2VCTA 2DKIA 5A34A 2RUFA 7GSSA 1R7HA 3GSTA 4Q5RA 2G0FA 3LEFA 4MNNA 1TKDB 2MBTA 1AAZA 1QK8A 4I2TA 5F0GA 4V2NA 2PVQA 1AUCA 3F4RA 3MSZA 3F3QA 1V2AA 1K0NA 6GSSA 4O5UA 4EVMA 2DJ0A 3RPPA 1MEKA 1QFNA 4DSRA 3PPUA 2GSQA 2H01A 2VUPA 1KBNA 6GSVA 3FY7A 4IGJA 1VF3A 1J08A 3C1SA 5EPFA 5AISA 4A5PA 3QR6A 18GSA 3HJMA 1PN9A 2WCIA 3TOTA 2YV9A 3GKKA 2O7KA 3TKQA 1V9WA 2KP2A 5FWGA 5DBQA 1O81A 3HDCA 2GQLA 3ZITA 2FA4A 5DQSA 3TRQA 2A2PA 4G0IA 2KUCA 1N8JA 4WF4A 1ZYEA 4F2IA 1GSUA 1XZOA 4IW9A 1HNCA 1JHBA 1Z6NA 3EE2A 3DYRA 1GTBA 4EE0A 1SU9A 5ELGA 3LG6A 4ML6A 2K8SA 3HVVA 1BX9A 3M0FA 3KMNA 3TUEA 3TB2A 4IHUA 3L9VA 2L4QA 5AGYA 5IO0A 2IMFA 1AQXA 1WPIA 3M3MA 4EF0A 3F6FA 5LD0A 4K0GA 2X8CA 3F9UA 4DSSB 2NBSA 2DMMA 3UEMA 1TU8A 5D9WA 3HVXA 3IBHA 5LNKe 1YJ6A 1F37A 2HSHA 2B6MA 2LSTA 1USBA 3GA4A 1SL2B 1ON4A 4ICYA 1YVLA 4KNDA 5GSTA 2HRNA 1XFLA 1Y6EA 3EVIA 4NV5A 2B3SA 1X5DA 5G5EA 2KHPA 4PURA 4DVCA 2O85A 3IR4A 1X9MB 4MJCA 1XVQA 4I6XA 3BJ5A 4ACSA 1PMTA 3D4TA 4IQ1A 3QFBC 3L4NA 1M2AA 4TKYA 2IMDA 4XIHA 1XW5A 2K9FA 2YZHA 1OAZA 1SVOA 1JLVA 3GTUA 2CX3A 3E3EA 4K8MA 3QMXA 5IPHA 1K0DA 1O85A 4HDEA 2E2MA 3FZ5A 1V98A 4PTSA 3QAGA 1SJIA 4JRRA 4J2FA 1PSQA 2VL2C 4YQUA 1F3AA 3L78A 2R5GA 1SENA 4PXOA 2DIYA 4H86A 1UVZA 2NVLA 2EIQA 3BCKA 3ZVJA 4AI6A 2CQ9A 3C7MA 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5O A;  3VUR A;  1SD8 A;  1Z7P A;  2V1M A;  3RBT A;  1PA3 A;  1GNW A;  2N5A A;  2X8H A;  1V58 A;  1GUM A;  1GNE A;  4GXZ A;  1JZO A;  4LMV A;  1CQH A;  4EC0 A;  3WD6 A;  3KTL A;  2PPT A;  3C71 A;  3IC4 A;  4X1U A;  4IP1 A;  4PUA A;  5F06 A;  4WEY A;  4MH3 A;  1O73 A;  1W4V A;  2K6V A;  1GLP A;  2DLX A;  3GKX A;  2CAI A;  3HCZ A;  1BQ7 A;  2VLV A;  2LKU A;  3KMO A;  5IMC A;  2LJR A;  4KF9 A;  2MMZ A;  4KUN A;  3GKM A;  3US3 A;  1TRS A;  1TK0 B;  5DJL A;  4DSS A;  3EIN A;  4IVF A;  2YWM A;  2REM A;  4ID0 A;  5HR0 A;  1SKR B;  5F8B A;  2LS5 A;  4I5Q A;  3IV4 A;  2J23 A;  4GQF A;  3W8S A;  2C0F A;  4OFN A;  1E2Y A;  3FR3 A;  2H30 A;  5IPG A;  1GSY A;  5J9B A;  1TOF A;  1PX6 A;  3DML A;  3TDG A;  1PD2 1;  4IQA A;  2O89 A;  4ZIL A;  3FYG A;  5HR2 A;  1SJ6 A;  1U3I A;  3FK8 A;  2L4C A;  3GMF A;  2FA8 A;  2HRA A;  3G7J A;  2L6D A;  2CVD A;  4KSM A;  1WP0 A;  1Z3E A;  3D21 A;  1M7T A;  4AJ6 A;  4MDC A;  1T4Y A;  2KP1 A;  4MH2 A;  5CRE A;  1M9A A;  1OE8 A;  3VK9 A;  5A5K A;  3P7X A;  2O87 A;  2M46 A;  3FEU A;  3CBU A;  3BBY A;  5IOX A;  3DVW A;  3L0H A;  4EXJ A;  3GL5 A;  2KLX A;  3QAV A;  1YF0 A;  1GP1 A;  2A2R A;  4HQZ A;  3HA9 A;  3BCI A;  4TRX A;  4F9Z A;  17GS A;  1WWJ A;  5IM9 A;  2L59 A;  4MF5 A;  3ZRD A;  3ZFL A;  2YOI A;  5B8A A;  5F07 A;  3GHA A;  4TR1 A;  1TXX A;  3D22 A;  1YEX A;  4LL1 B;  4MPF A;  3A3T A;  2MBS A;  2NDO A;  3Q74 A;  1HNA A;  2F51 A;  4AJ8 A;  1TJD A;  2OKA A;  3GH6 A;  2TIR A;  1J9B A;  2C3N A;  1K0C A;  3CMI A;  5D96 A;  2VCQ A;  1DE2 A;  2Z9S A;  5DQY A;  1OC3 A;  3SBC A;  1I5G A;  2OE3 A;  1V57 A;  2X8G A;  22GS A;  4KGI A;  2CT6 A;  4KSO A;  4OMV A;  1UN2 A;  3EU3 A;  3KTB A;  4L5O A;  2GVP A;  4IJI A;  4MP4 A;  3K8N A;  1A2J A;  4RI7 A;  2FWG A;  3TRP A;  4L8E A;  1O8W A;  3UOM A;  3MWH A;  1SL1 B;  2HZE A;  3I9V 2;  1O7U A;  1UA5 A;  3GX0 A;  3ZRE A;  3HKR A;  3M9K A;  4K7O A;  5LCZ A;  1WOU A;  3ISO A;  1B9Y C;  5IO2 A;  3S9F A;  2R4V A;  2YZU A;  3TKR A;  2YP6 A;  2MZC A;  1A24 A;  4O92 A;  2V6O A;  3RPN A;  1EV4 A;  3VI7 A;  2P5R A;  2E0Q A;  1PKW A;  5H5S A;  3WT2 A;  3F0I A;  3TCO A;  1WE0 A;  3GUR A;  3FZA A;  1LU4 A;  4BWS A;  1B8X A;  5D73 A;  2IMK A;  3QAW A;  2VIM A;  1EV9 A;  1SK2 A;  4DSQ A;  1LBK A;  4K0N A;  1T7P B;  3LSZ A;  4NHW A;  3IA1 A;  2GDR A;  3W8J A;  2MMN A;  1T00 A;  3CSI A;  2XBQ A;  4IP6 A;  5C00 A;  1MDJ A;  5D9T A;  2H6Z A;  3GIX A;  1NHO A;  3TJG A;  4PGT A;  3VWX A;  13GS A;  3ME7 A;  3C1R A;  5H5Q A;  3I69 A;  2OBK A;  1JFU A;  1AQW A;  5B7C A;  2FHE A;  2GGT A;  1XPV A;  2AV4 A;  2N5F A;  2I4A A;  3KP9 A;  3WT1 A;  1R26 A;  5J9C A;  1GL8 A;  3DKS A;  4PUF C;  1ZCP A;  2JZS A;  5B6N A;  1ZGN A;  4GCI A;  3ZMK A;  3APS A;  1T3B A;  2BMX A;  4HI7 A;  1NSW A;  4L0U A;  4I97 A;  2IN3 A;  1YKA A;  1O6J A;  5C04 A;  4ECB A;  2QC7 A;  2EC4 A;  2HXK A;  5D9V A;  5J41 A;  3NIV A;  1ERT A;  4XRA A;  2GSS A;  1ZL9 A;  2ES7 A;  3APO A;  3F8U A;  2ZNM A;  1DBY A;  3OR5 A;  1GSF A;  1VF2 A;  3CTF A;  2LRC A;  1SKW B;  2WJU A;  2HSY A;  4TW5 A;  3UL3 A;  3ZL5 A;  1WMJ A;  4XS4 B;  1SYR A;  1XW6 A;  1K3Y A;  1EP7 A;  3KD0 A;  2VL3 A;  1EWX A;  3P2A A;  1GH2 A;  3TKP A;  3IXR A;  4WBR D;  3QCP A;  4G0K A;  2LRT A;  3ZLP A;  3R3E A;  5J4U A;  1KEB A;  4YAV A;  4D73 B;  4LLR A;  1K3L A;  2C8U A;  2WFC A;  4N10 A;  3GX8 A;  5JWQ B;  3MDK A;  1KNG A;  1VF4 A;  2YNX A;  2LJK A;  5E59 A;  1JZD A;  1A23 A;  2CVB A;  4ECC A;  4V2M A;  1NW2 A;  2GZY A;  1XOA A;  3TJF A;  3M8N A;  2IJY A;  5DVB A;  1GTI A;  5DCH A;  4BL7 B;  3GNJ A;  2XHF A;  4JE1 A;  4BPY A;  4GSS A;  2PBJ A;  3WGD A;  2WRT A;  3J7Y b;  1THX A;  4KA0 A;  1EP8 A;  3TRX A;  1EOH A;  4ZL7 A;  4MMM A;  1WIK A;  2HSN B;  1FO5 A;  3CXG A;  5KN3 A;  1DUG A;  2JZR A;  4L0W A;  2B7J A;  1QQ2 A;  3KP8 A;  4FYB A;  1MD4 A;  1GWC A;  2FCH A;  3O3T A;  3MAK A;  4WR4 A;  2FNO A;  1BJX A;  1EGR A;  1THO A;  4Q5F A;  1X0R A;  1BG5 A;  2UZ8 A;  4EL1 A;  4ZIJ A;  2GZP A;  4E8H A;  3L9U A;  1M9B A;  4RQR A;  4JR6 A;  4PX1 A;  5L71 A;  3RAZ A;  4LA1 A;  4MA9 A;  4ECI A;  2B5X A;  5ECN B;  4MK3 A;  2D2Z A;  20GS A;  5IQY A;  3M1G A;  2DC5 A;  4FH8 A;  1AW9 A;  4ZB9 A;  4MLY A;  2QKE A;  3LYK A;  2H71 A;  1SK0 A;  1K0M A;  3LYP A;  1I9D A;  2XC2 A;  1FB0 A;  1OYJ A;  5BMU A;  1U87 A;  1PGT A;  3I6A A;  1Q98 A;  1DE1 A;  1FHE A;  2C80 A;  3GN3 A;  1GUL A;  2IFQ B;  2CV4 A;  1AC1 A;  4F03 A;  5DAL A;  2H66 A;  2PUK C;  1A0R P;  2VLU A;  2HE3 A;  2VCV A;  4XS4 A;  2AB6 A;  3F3R A;  2YJ7 A;  1T4Z A;  3GH9 A;  4FO5 A;  5B8B A;  3WYW A;  1GRX A;  5DAK B;  1XIY A;  4OFT A;  3AY8 A;  3O76 A;  4MJB A;  1KTE A;  1M2B A;  2H74 A;  1Z5Y E;  2MMA A;  3UMA A;  4YH2 A;  1NM3 A;  4Q5N A;  3U5R E;  5COH A;  2V2G A;  1CQG A;  1WRY A;  4KW6 A;  3QOU A;  3ZFB A;  5G2Z A;  4L5L A;  1N2A A;  4KAE A;  3H4K A;  1R5A A;  2MMO A;  4GLT A;  2AYT A;  1V40 A;  4QL9 A;  2HRF A;  3VPT A;  3M9J A;  3HJO A;  3LXZ A;  4F0B A;  2PN8 A;  4MPG A;  2F8A A;  3TGZ A;  1OC9 B;  3DVX A;  4ZXG A;  4BL7 A;  1G0T A;  4OCF A;  1VRS D;  3R2Q A;  16GS A;  1SL0 B;  5KN2 A;  3ZVJ D;  4GTU A;  1RK4 A;  1OKT A;  2B7K A;  2VM1 A;  5JWR B;  4JZQ A;  3FW2 A;  1SD9 A;  3Q18 A;  2TRC P;  4NXI A;  5ABR A;  3VFI A;  2GTU A;  3KH9 A;  3ZIJ A;  1WJK A;  5CP1 A;  4I8B A;  5EL8 A;  10GS A;  4NAX A;  2H1G A;  1X9W B;  2FUG 2;  2XPE A;  1MDK A;  4G19 A;  1NHY A;  4IKH A;  2LNT A;  2OJL A;  1R4W A;  3VWU A;  4FQU A;  3DXB A;  3RHB A;  1IYH A;  1A8Y A;  1TRV A;  2HQT A;  1ILO A;  3KH7 A;  4HS1 A;  1HQO A;  2H6X A;  3UBL A;  1EOG A;  1TI1 A;  2H0H A;  3I43 A;  1A8L A;  2V41 A;  5IIZ A;  1VGL A;  5GAP D;  5INY A;  1XW9 A;  1EEJ A;  2YWN A;  2CA8 A;  3LWA A;  4KE3 A;  1U88 A;  4IBP A;  3UAR A;  5HR3 A;  1XVW A;  4OCE A;  3G7Y A;  1YKC A;  3J7Y k;  5ECS A;  3D5J A;  4K9Z A;  3PH9 A;  2J9H A;  4KX4 A;  2FLS A;  1XWG A;  1PX7 A;  4HUA A;  3LXT A;  1H75 A;  2DJ1 A;  2ZUP A;  2R2J A;  3ME8 A;  3TKS E;  3VWW A;  4POL A;  1U6T A;  3WGX A;  4LL4 B;  5G30 A;  4KDU A;  3TJJ A;  4K7N A;  2IFQ A;  1ZOF A;  2VAF A;  2IL3 A;  3NOF A;  2OAC A;  4O32 A;  2YCD A;  2H1D A;  1OE7 A;  4MAB A;  2ON7 A;  3TJB A;  3Q6O A;  2VL9 A;  1XOB A;  5DAK A;  2JAC A;  3HYP A;  1Z6M A;  3IK7 A;  1TU7 A;  3PIN A;  3VI5 A;  4KB3 A;  4RI6 A;  1ZMA A;  2M72 A;  1IYI A;  2CAQ A;  4KCA A;  2VD0 A;  1ERV A;  2M80 A;  4GQC A;  5A4U A;  3O6T A;  2WS2 A;  3LGC A;  2DJ2 A;  3ZIV A;  5GZZ B;  3P8W A;  1BAY A;  4G10 A;  3DEX A;  2I81 A;  1ZZY A;  4IEL A;  2GS3 A;  5F05 A;  2R6K A;  5CRD A;  4ML1 A;  4TR0 A;  5A4W A;  2GT6 A;  4K2D A;  3C8E A;  1GLQ A;  3VLN A;  5HFI A;  1FVJ A;  4JBB A;  3TOU A;  4GRF A;  4HU9 A;  2L5O A;  1F9M A;  3A2W A;  3FKF A;  2VO4 A;  2VOC A;  1OC9 A;  11GS A;  1TI3 A;  4K1F A;  5ECK B;  3LJR A;  4HZ4 A;  4XS6 A;  1BYE A;  1HNB A;  5EVO A;  1GTU A;  5KEJ A;  5ECO B;  1O8X A;  2K18 A;  1RQM A;  3HVS A;  4HZ2 A;  1M99 A;  1AIU A;  1OKD A;  4F0C A;  1R5P A;  3F4T A;  3KZQ A;  4EDZ A;  3ERW A;  1H4O A;  2A2S A;  3IE3 A;  2LQO A;  4BVY B;  3ZTL A;  2MYG A;  1QGV A;  3U6V A;  1G6Y A;  3IC8 A;  2F8F A;  3RDW A;  2FD3 A;  4EDY A;  2C1Y A;  4K7I A;  1MDI A;  4G9H A;  3GYK A;  2F3M A;  1EZK A;  2WUL A;  3H93 A;  2H73 A;  2CVK A;  2RUE A;  3IRA A;  5ECM B;  2K8V A;  1XWA A;  2OBI A;  2LV3 A;  2VM2 A;  1OVN A;  3EC3 A;  1E6B A;  1M0U A;  5D93 A;  4BWQ A;  3ERG A;  2GT5 A;  5CRH A;  3LFL A;  2JSY A;  2GZZ A;  1OC8 A;  4MZW A;  1B4Q A;  5CNW A;  3KXO A;  2NPB A;  5A4V A;  3FZ9 A;  2H1B A;  4TXO B;  5CAX A;  4HJ2 A;  1GTA A;  4TN8 A;  4NMU A;  1J0F A;  3IPZ A;  1T8E B;  5AN1 A;  1LJR A;  4QL7 A;  1TK8 B;  4IJ3 A;  2OA7 A;  5KN0 A;  4WBJ A;  3EWL A;  2JAD A;  5GAN D;  4HQS A;  2L57 A;  6GSY A;  3H8Q A;  2QGV A;  2H19 A;  4XCS A;  1BED A;  1F6M C;  4ULX A;  5DJM A;  2R3X A;  2GLR A;  4WR5 A;  2DML A;  3UAP A;  2WDU A;  5JCG A;  3UVH A;  4JR4 A;  1JZR A;  1Z7R A;  1F2E A;  1TW9 A;  2X99 A;  5IMV A;  4RQX A;  3VPQ A;  3CSJ A;  3UJ1 A;  3BD2 A;  1K3O A;  1TRU A;  1X9S B;  2LNS A;  2BTO T;  1X5C A;  1XWK A;  1TP9 A;  2H8L A;  3KJY A;  1XWC A;  2P5Q A;  4OFM A;  4TOP A;  4POB A;  3GTU B;  3HJP A;  4BA7 A;  2N5B A;  4ZBD A;  2TRX A;  3EMP A;  1TDI A;  3N9J A;  4X43 A;  4HOJ A;  2OE0 A;  4NHZ A;  2WB9 A;  4JED A;  1YEP A;  4MZB A;  5D8I A;  3LOR A;  3PR8 A;  3A2V A;  4BVY A;  2GSR A;  5J5N A;  4PNF A;  4BVX B;  3E9J B;  1HD2 A;  1B48 A;  2DBC A;  3RHC A;  4PQH A;  1S3C A;  4O5R A;  8GSS A;  3VWV A;  3TJK A;  4OD7 A;  5JCU A;  2C3T A;  4PQI A;  5H5R A;  2PMT A;  4Q5Q A;  4JU5 A;  1EGO A;  2FGX A;  2DSA A;  4KDX A;  4EUY A;  5HQP A;  4G2E A;  5IMA A;  1SJZ A;  3GRX A;  1K0O A;  1T1V A;  5IOW A;  1FB6 A;  1GSD A;  2CZ3 A;  3QFA C;  4ZB6 A;  5IMD A;  5ECR B;  3FR9 A;  4KDY A;  3EU4 A;  1JLW A;  1EEM A;  2RM5 A;  3E0U A;  4TXO A;  5ID2 B;  4DEJ A;  3HZ8 A;  1QMV A;  5ECP B;  6GSU A;  3FHK A;  2XBI A;  4EKZ A;  1FOV A;  1ACV A;  4X0X A;  3GKN A;  2FY6 A;  5ENU A;  2FWE A;  5CRG A;  5AIV A;  3FR6 A;  4P3Y B;  4I2U A;  4AGS A;  4IS0 A;  3HZ4 A;  2IME A;  2QSI A;  3DGQ A;  2B1L A;  1RW1 A;  4ZBB A;  4N0Z A;  4Z7X A;  4MJE A;  4V1A g;  2YN1 A;  2O8V B;  4FYC A;  3CRT A;  5EY6 A;  4CDO A;  2YWI A;  2VD1 A;  1YF1 A;  4GSN A;  4LMW A;  2V6K A;  3GV1 A;  5J3R A;  6GSW A;  4ZL8 A;  4HJM A;  1YZX A;  3CRU A;  2GQM A;  4ZBA A;  2HFD A;  3F4S A;  3TKS A;  1AQV A;  1JZW A;  2YWO A;  4D73 A;  2RII A;  2YAN A;  2L6C A;  4RUV A;  1ABA A;  3IAS 2;  3D4M A;  4USS A;  2CX4 A;  4KH7 A;  1XCC A;  2VCW A;  4FYU A;  2YPM A;  3MNG A;  4TR1 B;  2LQQ A;  1S3A A;  1YQ1 A;  2DJ3 A;  1GSE A;  4OWY A;  2IMI A;  2PU9 C;  4XHM A;  2LTK A;  2YV7 A;  5ELA A;  4BVX A;  1X5E A;  1PL1 A;  4PNG A;  2C0D A;  5GSS A;  1Q4J A;  3PGT A;  4ILF A;  2HRK B;  3HHV A;  12GS A;  2C4J A;  5IMF A;  4ZL9 A;  5HR1 A;  2FWH A;  4NPB A;  3A5W A;  5JWO B;  2CZ2 A;  1C72 A;  1PKZ A;  2RM6 A;  4OO4 A;  1ST9 A;  1M2D A;  2PVO C;  3QD9 A;  4FIW A;  2HZE B;  5DCG A;  4WXT A;  4YQV A;  2P0G A;  2ZCT A;  5FHI A;  2JZT A;  3UBK A;  5HFK A;  5G5F A;  2HZF A;  4O7H A;  2LRN A;  2ON5 A;  4MF6 A;  4NWY A;  4CW9 A;  3EYT A;  1UC7 A;  1B4P A;  2I1U A;  2H0G A;  2OAD A;  2I9H A;  3APQ A;  3KM6 A;  1FVK A;  1SYX A;  4WET A;  5G1K A;  5ID2 A;  3IOS A;  1ZYQ B;  4F82 A;  1SK1 A;  1PQN A;  1TTZ A;  2KOK A;  4XRD A;  2F9S A;  4WKW A;  3H79 A;  3C73 A;  2HNL A;  4ISD A;  4N11 A;  2H6Y A;  4E8E A;  3ZML A;  1TRW A;  4PQ1 A;  14GS A;  1QUW A;  2C0E A;  3JCM L;  3KEB A;  2V32 A;  1F3B A;  9GSS A;  1ML6 A;  2B1K A;  3GL3 A;  2XPD A;  4MF7 A;  5E4W A;  2GST A;  1TK5 B;  4EO3 A;  2AJQ B;  1PL2 A;  3DD3 A;  2H76 A;  4V1A p;  2AHE A;  4HU7 A;  2HYX A;  3D0Z A;  4TVE A;  5CYY A;  1A2M A;  5KN1 A;  2L5L A;  3G9B A;  3ED3 A;  2H75 A;  2BJX A;  1YY7 A;  1K0B A;  3KGK A;  2DIZ A;  6GST A;  5G31 A;  3DRN A;  2PER A;  2C0G A;  2HSM B;  4N30 A;  4GF0 A;  1G7E A;  3CSH A;  3H1N A;  2B5E A;  1XBS A;  4TXV A;  3FRC A;  2PWJ A;  4IN0 A;  3ZYW A;  2IWT A;  2B5Y A;  5D9X A;  1Y25 A;  2IPA A;  1HYU A;  3HY2 A;  2AUV A;  2H0I A;  2JL4 A;  4GST A;  2LEG A;  1MTC A;  2H70 A;  3ZZX A;  5ECL B;  4GWR A;  2RLI A;  2YJH A;  2I3Y A;  2OE1 A;  5ECQ B;  1G7O A;  3UVT A;  4YAP A;  1XWB A;  2HRK A;  1FG4 A;  1GSS A;  4TR4 A;  3EUR A;  4TR3 A;  2ALB A;  5B6M A;  3IDV A;  4K6X A;  3W6G A;  1VF1 A;  1GUH A;  1ERW A;  1DSB A;  3P90 A;  2IIY A;  3DIE A;  3EMX A;  4QQ7 A;  3G7I A;  4XS1 A;  4POM A;  2FWF A;  2DJJ A;  2HLS A;  5CRW A;  5FT3 A;  1SKS B;  1MD3 A;  4ZB8 A;  1AXD A;  3IK9 A;  2E2G A;  3LQ7 A;  3GUS A;  3IHQ A;  2EIR A;  1B9X C;  3TKS C;  2PGT A;  3Q19 A;  1YDK A;  1W89 A;  3D6I A;  3UIW A;  1GUK A;  3WGE A;  1FW1 A;  5DDL A;  2R37 A;  3GFK A;  3FZ4 A;  5JCW A;  2EIO A;  1G6W A;  1Z9H A;  2WZ9 A;  4CHS A;  3KIJ A;  3HXS A;  1XXU A;  4MZC A;  3SWL A;  3A2X A;  3BOA A;  4MJA A;  1ERU A;  2VCZ A;  1PRX A;  4J56 E;  3QPM A;  4POK A;  2G2Q A;  2VCX A;  3CYN A;  4XTS A;  2JU5 A;  4N0V A;  5ECH B;  3ERF A;  4OO5 A;  4ECJ A;  3CTG A;  3NZN A;  1S3D A;  3DWV A;  2VLT A;  2P31 A;  6GSX A;  1QXH A;  2VL2 A;  19GS A;  2JSZ A;  3GSS A;  2WGR A;  5G1L A;  4G0L A;  5AIX A;  1URM A;  4HEA 2;  2HT9 A;  5IMZ A;  2NTO A;  1A2L A;  5HFG A;  2GQK A;  2A4V A;  3F6D A;  3F63 A;  4WF5 A;  3IAM 2;  3KCM A;  2HSM A;  2LJA A;  3V1W A;  4AJ7 A;  4YQM A;  4AF2 A;  1A0F A;  2E7P A;  2H1A A;  2AAW A;  2LUS A;  1FAA A;  5ECI B;  3L9S A;  4NV2 A;  2DJK A;  4MCU A;  5CO3 A;  3HD5 A;  1K0A A;  1GSQ A;  2H72 A;  4KCE A;  1U3A A;  2HI7 A;  2X64 A;  5DAL B;  4J57 E;  4V2L A;  2C3Q A;  2VCT A;  2RUF A;  7GSS A;  1R7H A;  3GST A;  4Q5R A;  2G0F A;  3LEF A;  1TKD B;  2MBT A;  1AAZ A;  1QK8 A;  4I2T A;  5F0G A;  4V2N A;  2PVQ A;  1AUC A;  3F4R A;  3MSZ A;  3F3Q A;  1V2A A;  1K0N A;  6GSS A;  4EVM A;  2DJ0 A;  3RPP A;  1MEK A;  1QFN A;  4DSR A;  3PPU A;  2GSQ A;  2H01 A;  2VUP A;  1KBN A;  6GSV A;  3FY7 A;  4IGJ A;  1VF3 A;  1J08 A;  3C1S A;  5EPF A;  5AIS A;  3QR6 A;  18GS A;  3HJM A;  1PN9 A;  2WCI A;  3TOT A;  2YV9 A;  3GKK A;  2O7K A;  3TKQ A;  1V9W A;  2KP2 A;  5FWG A;  5DBQ A;  1O81 A;  3HDC A;  2GQL A;  3ZIT A;  2FA4 A;  5DQS A;  3TRQ A;  4G0I A;  2KUC A;  1N8J A;  4WF4 A;  1ZYE A;  4F2I A;  1GSU A;  1XZO A;  4IW9 A;  1HNC A;  1JHB A;  1Z6N A;  3EE2 A;  3DYR A;  1GTB A;  4EE0 A;  1SU9 A;  5ELG A;  3LG6 A;  4ML6 A;  2K8S A;  3HVV A;  1BX9 A;  3M0F A;  3KMN A;  3TUE A;  3TB2 A;  4IHU A;  3L9V A;  2L4Q A;  5AGY A;  5IO0 A;  2IMF A;  1AQX A;  1WPI A;  3M3M A;  4EF0 A;  3F6F A;  5LD0 A;  4K0G A;  2X8C A;  3F9U A;  4DSS B;  2NBS A;  2DMM A;  3UEM A;  1TU8 A;  5D9W A;  3HVX A;  3IBH A;  5LNK e;  1YJ6 A;  1F37 A;  2HSH A;  2B6M A;  2LST A;  1USB A;  3GA4 A;  1SL2 B;  1ON4 A;  4KND A;  5GST A;  2HRN A;  1XFL A;  1Y6E A;  3EVI A;  4NV5 A;  2B3S A;  1X5D A;  5G5E A;  2KHP A;  4PUR A;  4DVC A;  2O85 A;  3IR4 A;  1X9M B;  4MJC A;  1XVQ A;  4I6X A;  3BJ5 A;  4ACS A;  1PMT A;  3D4T A;  4IQ1 A;  3QFB C;  3L4N A;  1M2A A;  4TKY A;  2IMD A;  4XIH A;  1XW5 A;  2K9F A;  2YZH A;  1OAZ A;  1JLV A;  3GTU A;  2CX3 A;  3E3E A;  4K8M A;  3QMX A;  5IPH A;  1K0D A;  1O85 A;  4HDE A;  2E2M A;  3FZ5 A;  1V98 A;  4PTS A;  3QAG A;  1SJI A;  4JRR A;  4J2F A;  1PSQ A;  2VL2 C;  4YQU A;  1F3A A;  3L78 A;  2R5G A;  1SEN A;  4PXO A;  2DIY A;  4H86 A;  1UVZ A;  2NVL A;  2EIQ A;  3BCK A;  3ZVJ A;  2CQ9 A;  3C7M A;  3QDN A; 
#chains in the Genus database with same CATH topology
 3N5O A;  3VUR A;  1SD8 A;  1Z7P A;  2V1M A;  3LW9 A;  3RBT A;  1PA3 A;  1GNW A;  2N5A A;  2X8H A;  1V58 A;  1GUM A;  1GNE A;  4GXZ A;  1JZO A;  4LMV A;  1CQH A;  4EC0 A;  3WD6 A;  3KTL A;  2PPT A;  3C71 A;  3IC4 A;  4X1U A;  4IP1 A;  4PUA A;  2WVX B;  5F06 A;  4WEY A;  4MH3 A;  1O73 A;  1W4V A;  2K6V A;  1GLP A;  2DLX A;  3GKX A;  2CAI A;  3HCZ A;  1BQ7 A;  1SVL A;  2VLV A;  2LKU A;  3KMO A;  5IMC A;  2LJR A;  4AKH A;  4KF9 A;  2MMZ A;  4KUN A;  3GKM A;  3US3 A;  1TRS A;  1TK0 B;  5DJL A;  4DSS A;  3EIN A;  4IVF A;  2YWM A;  2REM A;  4ID0 A;  5HR0 A;  1SKR B;  5F8B A;  2LS5 A;  4I5Q A;  2X49 A;  3IV4 A;  2J23 A;  4GDF A;  4GQF A;  3W8S A;  2C0F A;  4OFN A;  1E2Y A;  3FR3 A;  2H30 A;  5IPG A;  1GSY A;  5J9B A;  1TOF A;  1PX6 A;  3DML A;  3TDG A;  1PD2 1;  4IQA A;  2O89 A;  4ZIL A;  3FYG A;  5HR2 A;  2QA2 A;  1SJ6 A;  1U3I A;  3FK8 A;  2L4C A;  3GMF A;  2FA8 A;  2HRA A;  3G7J A;  2L6D A;  2CVD A;  4KSM A;  1WP0 A;  1Z3E A;  3D21 A;  1M7T A;  4AJ6 A;  1ZYP A;  4MDC A;  1T4Y A;  2KP1 A;  4MH2 A;  5CRE A;  1M9A A;  1OE8 A;  3VK9 A;  5A5K A;  3P7X A;  2O87 A;  2M46 A;  3FEU A;  4Z2U A;  3CBU A;  4X4J A;  3BBY A;  5IOX A;  3DVW A;  3L0H A;  4EXJ A;  3GL5 A;  4AKI A;  2KLX A;  3QAV A;  1YF0 A;  1GP1 A;  2A2R A;  4HQZ A;  3HA9 A;  3BCI A;  4EIQ A;  4TRX A;  4F9Z A;  17GS A;  1WWJ A;  5IM9 A;  3HMJ G;  2L59 A;  4MF5 A;  3ZRD A;  3ZFL A;  2YOI A;  5B8A A;  5F07 A;  3GHA A;  4TR1 A;  1TXX A;  3D22 A;  1YEX A;  4LL1 B;  4MPF A;  3A3T A;  2MBS A;  2NDO A;  3Q74 A;  1HNA A;  2F51 A;  1S4B P;  4AJ8 A;  1TJD A;  2OKA A;  3GH6 A;  2TIR A;  1J9B A;  2C3N A;  4BIK A;  1K0C A;  3CMI A;  5D96 A;  2VCQ A;  1DE2 A;  2Z9S A;  5DQY A;  1OC3 A;  3SBC A;  1I5G A;  2OE3 A;  1V57 A;  2X8G A;  22GS A;  4KGI A;  2CT6 A;  4KSO A;  4OMV A;  2R0G A;  1UN2 A;  3EU3 A;  3KTB A;  4L5O A;  2GVP A;  4IJI A;  2WVX A;  4MP4 A;  3K8N A;  2WW2 A;  1A2J A;  4RI7 A;  2FWG A;  3TRP A;  4L8E A;  1O8W A;  4K5R A;  3UOM A;  3MWH A;  1SL1 B;  2HZE A;  5J40 A;  3I9V 2;  1O7U A;  1UA5 A;  3GX0 A;  3ZRE A;  3HKR A;  3M9K A;  4K7O A;  5LCZ A;  1WOU A;  3ISO A;  1B9Y C;  5IO2 A;  3S9F A;  2R4V A;  2YZU A;  5J4Y A;  3TKR A;  2DKH A;  2YP6 A;  2MZC A;  1A24 A;  4O92 A;  2V6O A;  3RPN A;  1EV4 A;  3VI7 A;  2P5R A;  2E0Q A;  1PKW A;  5H5S A;  3WT2 A;  3F0I A;  3TCO A;  1WE0 A;  3GUR A;  3FZA A;  1LU4 A;  4BWS A;  1B8X A;  5D73 A;  2IMK A;  3QAW A;  2VIM A;  4K5S A;  1EV9 A;  1SK2 A;  4DSQ A;  1LBK A;  4K0N A;  1T7P B;  3LSZ A;  4NHW A;  3IA1 A;  2GDR A;  3W8J A;  2MMN A;  1T00 A;  3CSI A;  4Z2R A;  2XBQ A;  4IP6 A;  5C00 A;  1MDJ A;  5D9T A;  2H6Z A;  3GIX A;  1NHO A;  3TJG A;  4PGT A;  3VWX A;  13GS A;  3ME7 A;  3C1R A;  5H5Q A;  3I69 A;  2OBK A;  1JFU A;  1AQW A;  5B7C A;  2FHE A;  2GGT A;  1XPV A;  2AV4 A;  2N5F A;  2I4A A;  3KP9 A;  3WT1 A;  1R26 A;  5J9C A;  1GL8 A;  3DKS A;  4PUF C;  1ZCP A;  2JZS A;  5B6N A;  1ZGN A;  1BF5 A;  4GCI A;  3ZMK A;  3APS A;  1T3B A;  2BMX A;  4HI7 A;  1NSW A;  4L0U A;  4I97 A;  2IN3 A;  1YKA A;  1O6J A;  5C04 A;  5J47 A;  4ECB A;  2QC7 A;  2EC4 A;  2HXK A;  5D9V A;  5J41 A;  3NIV A;  1ERT A;  4XRA A;  2GSS A;  1ZL9 A;  2ES7 A;  3APO A;  5BMU B;  3F8U A;  2ZNM A;  1DBY A;  3OR5 A;  1GSF A;  1VF2 A;  3CTF A;  2LRC A;  1SKW B;  2WJU A;  2HSY A;  4TW5 A;  3UL3 A;  3ZL5 A;  1WMJ A;  5A1N B;  4XS4 B;  1SYR A;  1XW6 A;  1K3Y A;  1EP7 A;  3CWG A;  2OT3 A;  3KD0 A;  2VL3 A;  2EFC A;  4W66 A;  1EWX A;  3P2A A;  1GH2 A;  3TKP A;  3IXR A;  4WBR D;  3QCP A;  4G0K A;  2LRT A;  3ZLP A;  3R3E A;  1YEW C;  5J4U A;  1KEB A;  4YAV A;  2X4A A;  4D73 B;  4LLR A;  1K3L A;  2C8U A;  2WFC A;  4N10 A;  3GX8 A;  5JWQ B;  3MDK A;  1KNG A;  1VF4 A;  2YNX A;  2LJK A;  5E59 A;  1JZD A;  1A23 A;  2CVB A;  4ECC A;  4V2M A;  4PI2 C;  1NW2 A;  2GZY A;  1XOA A;  3TJF A;  3M8N A;  2IJY A;  5DVB A;  1GTI A;  5DCH A;  4BL7 B;  3GNJ A;  2XHF A;  4JE1 A;  4BPY A;  4GSS A;  2PBJ A;  3WGD A;  2WRT A;  3J7Y b;  1THX A;  4KA0 A;  1EP8 A;  3TRX A;  1EOH A;  4ZL7 A;  4MMM A;  1WIK A;  2HSN B;  1FO5 A;  3CXG A;  5KN3 A;  1DUG A;  5J4V A;  2JZR A;  4L0W A;  2B7J A;  1QQ2 A;  3KP8 A;  4FYB A;  2A4H A;  1MD4 A;  4YKF A;  1GWC A;  2FCH A;  3O3T A;  3MAK A;  4WR4 A;  2FNO A;  1BJX A;  1EGR A;  1THO A;  4Q5F A;  1X0R A;  1BG5 A;  2UZ8 A;  4EL1 A;  4ZIJ A;  2GZP A;  4E8H A;  3L9U A;  1M9B A;  4RQR A;  4JR6 A;  4PX1 A;  5L71 A;  3RAZ A;  4LA1 A;  4MA9 A;  4ECI A;  2B5X A;  5ECN B;  4MK3 A;  2D2Z A;  20GS A;  5IQY A;  3M1G A;  2DC5 A;  4FH8 A;  1AW9 A;  4ZB9 A;  4MLY A;  2QKE A;  2EFH A;  3LYK A;  2H71 A;  1SK0 A;  1K0M A;  3LYP A;  1I9D A;  2XC2 A;  1FB0 A;  1OYJ A;  5BMU A;  1U87 A;  1PGT A;  1M3J A;  3I6A A;  1Q98 A;  1DE1 A;  1FHE A;  2C80 A;  3GN3 A;  1GUL A;  2IFQ B;  2CV4 A;  1AC1 A;  4F03 A;  5DAL A;  2H66 A;  2PUK C;  1A0R P;  2VLU A;  2HE3 A;  5A1N A;  2VCV A;  4XS4 A;  2AB6 A;  3F3R A;  2YJ7 A;  1T4Z A;  3GH9 A;  4FO5 A;  5B8B A;  3WYW A;  1GRX A;  5DAK B;  1XIY A;  4OFT A;  3AY8 A;  3O76 A;  4MJB A;  1PN0 A;  1KTE A;  1M2B A;  2H74 A;  1Z5Y E;  2MMA A;  3UMA A;  4YH2 A;  1NM3 A;  1PFO A;  4Q5N A;  3U5R E;  5COH A;  2V2G A;  1CQG A;  1WRY A;  4KW6 A;  3QOU A;  3ZFB A;  5G2Z A;  4L5L A;  1N2A A;  4KAE A;  3H4K A;  1R5A A;  2R0P A;  2MMO A;  4GLT A;  2AYT A;  1V40 A;  4QL9 A;  2HRF A;  4FXY P;  3VPT A;  3M9J A;  3HJO A;  3LXZ A;  4F0B A;  2PN8 A;  4MPG A;  2F8A A;  3TGZ A;  1OC9 B;  3DVX A;  4ZXG A;  4BL7 A;  1G0T A;  4OCF A;  1VRS D;  5KOW A;  3R2Q A;  16GS A;  1SL0 B;  5KN2 A;  3MIX A;  2WVZ A;  3ZVJ D;  4GTU A;  1RK4 A;  4G01 A;  1OKT A;  2B7K A;  2VM1 A;  5JWR B;  4JZQ A;  2HSN A;  3FW2 A;  1SD9 A;  3Q18 A;  2TRC P;  4NXI A;  5ABR A;  3VFI A;  2GTU A;  3KH9 A;  3ZIJ A;  1WJK A;  5CP1 A;  3MYD A;  4I8B A;  5EL8 A;  10GS A;  4NAX A;  2H1G A;  1X9W B;  2FUG 2;  2XPE A;  1MDK A;  4G19 A;  1NHY A;  4IKH A;  2LNT A;  2OJL A;  1R4W A;  3VWU A;  4FQU A;  3DXB A;  3RHB A;  1IYH A;  1A8Y A;  1TRV A;  2HQT A;  1ILO A;  3KH7 A;  4HS1 A;  1HQO A;  2H6X A;  3UBL A;  1EOG A;  4O5Q A;  1TI1 A;  2H0H A;  3I43 A;  1A8L A;  2V41 A;  5IIZ A;  1VGL A;  5GAP D;  5INY A;  5A5H B;  1XW9 A;  1EEJ A;  2YWN A;  2CA8 A;  3LWA A;  4KE3 A;  1U88 A;  4IBP A;  3UAR A;  5HR3 A;  1XVW A;  4OCE A;  3G7Y A;  1YKC A;  3J7Y k;  5ECS A;  3D5J A;  4K9Z A;  3PH9 A;  2J9H A;  4KX4 A;  2FLS A;  1XWG A;  1PX7 A;  4HUA A;  3LXT A;  1H75 A;  2DJ1 A;  2ZUP A;  2R2J A;  3ME8 A;  3TKS E;  3VWW A;  4POL A;  1U6T A;  3WGX A;  4LL4 B;  5G30 A;  4KDU A;  3TJJ A;  4K7N A;  2IFQ A;  1ZOF A;  2VAF A;  2IL3 A;  3NOF A;  2OAC A;  4O32 A;  2YCD A;  2H1D A;  1OE7 A;  4MAB A;  2ON7 A;  3TJB A;  3Q6O A;  2VL9 A;  1XOB A;  5DAK A;  2JAC A;  3HYP A;  1Z6M A;  3IK7 A;  1TU7 A;  3PIN A;  3VI5 A;  4KB3 A;  4RI6 A;  1ZMA A;  2M72 A;  1IYI A;  1S3R A;  2CAQ A;  4KCA A;  2VD0 A;  1ERV A;  2M80 A;  4GQC A;  5A4U A;  3O6T A;  2WS2 A;  3LGC A;  2VKZ G;  2DJ2 A;  3ZIV A;  5GZZ B;  3P8W A;  1BAY A;  4YKG A;  4G10 A;  3DEX A;  2I81 A;  1ZZY A;  4IEL A;  2GS3 A;  5F05 A;  2R6K A;  5CRD A;  4ML1 A;  4TR0 A;  5A4W A;  2GT6 A;  4K2D A;  3C8E A;  1GLQ A;  3VLN A;  5HFI A;  1FVJ A;  4JBB A;  3TOU A;  4GRF A;  4HU9 A;  2L5O A;  1F9M A;  3A2W A;  3FKF A;  2VO4 A;  2VOC A;  1OC9 A;  11GS A;  1TI3 A;  4K1F A;  5ECK B;  3LJR A;  4HZ4 A;  4XS6 A;  1BYE A;  1HNB A;  5EVO A;  1GTU A;  5KEJ A;  5ECO B;  1ZYN A;  1O8X A;  2K18 A;  1RQM A;  3HVS A;  4E68 A;  4HZ2 A;  1M99 A;  1AIU A;  1OKD A;  4F0C A;  1R5P A;  3F4T A;  3KZQ A;  4EDZ A;  3ERW A;  1H4O A;  2A2S A;  3IE3 A;  2LQO A;  4BVY B;  3ZTL A;  2MYG A;  1QGV A;  3U6V A;  1G6Y A;  3IC8 A;  2F8F A;  3RDW A;  2FD3 A;  4EDY A;  2C1Y A;  4K7I A;  1MDI A;  4G9H A;  3GYK A;  4N3Z A;  2F3M A;  1EZK A;  2WUL A;  3H93 A;  2H73 A;  2CVK A;  2RUE A;  3IRA A;  5ECM B;  5A5H A;  2K8V A;  1XWA A;  2OBI A;  2LV3 A;  2O5V A;  4QMK A;  2VM2 A;  5KOX A;  1OVN A;  3EC3 A;  1E6B A;  1M0U A;  5D93 A;  4BWQ A;  3ERG A;  2GT5 A;  5CRH A;  3LFL A;  2JSY A;  1Y1U A;  4EIP A;  2GZZ A;  1OC8 A;  4MZW A;  1B4Q A;  5CNW A;  3KXO A;  2NPB A;  5A4V A;  3FZ9 A;  2H1B A;  4TXO B;  5CAX A;  4HJ2 A;  1GTA A;  4TN8 A;  4NMU A;  1J0F A;  3IPZ A;  1T8E B;  5AN1 A;  1LJR A;  4QL7 A;  1TK8 B;  4IJ3 A;  2OA7 A;  5KN0 A;  4WBJ A;  3EWL A;  2JAD A;  5GAN D;  2H1L A;  4HQS A;  2L57 A;  6GSY A;  3H8Q A;  2QGV A;  2H19 A;  4XCS A;  1BED A;  1F6M C;  4ULX A;  5DJM A;  2R3X A;  2GLR A;  4WR5 A;  2DML A;  3UAP A;  3CHX C;  2WDU A;  5JCG A;  3UVH A;  4JR4 A;  1JZR A;  1Z7R A;  1F2E A;  1TW9 A;  4K2X A;  2X99 A;  5IMV A;  4RQX A;  3VPQ A;  3CSJ A;  3UJ1 A;  3BD2 A;  1K3O A;  4PHZ C;  1TRU A;  1X9S B;  2LNS A;  2BTO T;  1X5C A;  1XWK A;  1TP9 A;  2H8L A;  3KJY A;  1XWC A;  2P5Q A;  4OFM A;  4TOP A;  4POB A;  3GTU B;  3HJP A;  4BA7 A;  2N5B A;  4ZBD A;  2R0C A;  2TRX A;  3EMP A;  1TDI A;  3N9J A;  4X43 A;  4HOJ A;  2OE0 A;  4NHZ A;  2WB9 A;  4JED A;  1YEP A;  4MZB A;  4AKX B;  5D8I A;  3LOR A;  3PR8 A;  4PI0 C;  3A2V A;  4BVY A;  2GSR A;  5J5N A;  4PNF A;  4BVX B;  3E9J B;  1HD2 A;  1B48 A;  2DBC A;  3RHC A;  4PQH A;  1S3C A;  4O5R A;  8GSS A;  3VWV A;  3TJK A;  4OD7 A;  5JCU A;  2C3T A;  4PQI A;  5H5R A;  2PMT A;  4Q5Q A;  4JU5 A;  1EGO A;  2FGX A;  2DSA A;  4KDX A;  4EUY A;  5HQP A;  4G2E A;  5IMA A;  1SJZ A;  3GRX A;  1K0O A;  1T1V A;  5IOW A;  1FB6 A;  1GSD A;  2CZ3 A;  3QFA C;  4ZB6 A;  5IMD A;  5ECR B;  3FR9 A;  4KDY A;  3EU4 A;  1JLW A;  1EEM A;  2RM5 A;  3E0U A;  4TXO A;  5BRT A;  5ID2 B;  4DEJ A;  3HZ8 A;  1QMV A;  5ECP B;  6GSU A;  3FHK A;  2XBI A;  4EKZ A;  1FOV A;  1ACV A;  4X0X A;  3GKN A;  2WW3 A;  2FY6 A;  5ENU A;  2FWE A;  5CRG A;  5AIV A;  3FR6 A;  4P3Y B;  4I2U A;  4AGS A;  4IS0 A;  3HZ4 A;  2IME A;  2QSI A;  3DGQ A;  2B1L A;  1RW1 A;  4ZBB A;  4N0Z A;  4Z7X A;  4MJE A;  4V1A g;  2EFD A;  2YN1 A;  2O8V B;  4FYC A;  3CRT A;  5EY6 A;  4CDO A;  2YWI A;  2VD1 A;  1YF1 A;  4GSN A;  4LMW A;  2V6K A;  3GV1 A;  5J3R A;  6GSW A;  4ZL8 A;  4HJM A;  1YZX A;  3CRU A;  2GQM A;  4CY6 A;  2O36 A;  4ZBA A;  2HFD A;  3F4S A;  3TKS A;  1AQV A;  1JZW A;  2YWO A;  3A5I A;  4D73 A;  2RII A;  2YAN A;  2L6C A;  4RUV A;  1ABA A;  3IAS 2;  3D4M A;  4USS A;  2CX4 A;  4KH7 A;  1XCC A;  1I1I P;  2VCW A;  4FYU A;  2YPM A;  3MNG A;  4TR1 B;  2LQQ A;  1S3A A;  1YQ1 A;  1M3I A;  2DJ3 A;  1GSE A;  4OWY A;  2IMI A;  2PU9 C;  4XHM A;  3RFR C;  2LTK A;  2YV7 A;  5ELA A;  4BVX A;  1X5E A;  4CY8 A;  1PL1 A;  4PNG A;  2C0D A;  5GSS A;  1Q4J A;  3PGT A;  4ILF A;  2HRK B;  3HHV A;  12GS A;  2C4J A;  5IMF A;  4ZL9 A;  5HR1 A;  3HVN A;  2FWH A;  4NPB A;  3A5W A;  5JWO B;  2CZ2 A;  1C72 A;  1PKZ A;  2RM6 A;  4OO4 A;  1ST9 A;  1M2D A;  2PVO C;  3QD9 A;  4FIW A;  2HZE B;  5DCG A;  4WXT A;  4YQV A;  2P0G A;  2ZCT A;  5FHI A;  2JZT A;  3UBK A;  5HFK A;  5G5F A;  2HZF A;  4O7H A;  2LRN A;  2ON5 A;  4MF6 A;  4NWY A;  4CW9 A;  3EYT A;  1UC7 A;  1B4P A;  2I1U A;  2H0G A;  2OAD A;  2I9H A;  3FMW A;  3APQ A;  3KM6 A;  1FVK A;  1SYX A;  4WET A;  5G1K A;  5ID2 A;  3IOS A;  1ZYQ B;  4F82 A;  1SK1 A;  1PQN A;  1FOH A;  1TTZ A;  2KOK A;  4ZB7 A;  4XRD A;  2F9S A;  4WKW A;  3H79 A;  3C73 A;  2HNL A;  4ISD A;  4N11 A;  2H6Y A;  3TU3 B;  4E8E A;  1TXU A;  3ZML A;  1TRW A;  4PQ1 A;  14GS A;  1QUW A;  2C0E A;  3JCM L;  3KEB A;  2V32 A;  1F3B A;  9GSS A;  1ML6 A;  2B1K A;  3GL3 A;  2XPD A;  4MF7 A;  5E4W A;  2GST A;  1TK5 B;  4EO3 A;  2AJQ B;  1PL2 A;  3DD3 A;  2H76 A;  4V1A p;  2AHE A;  4HU7 A;  2HYX A;  1BG1 A;  3D0Z A;  4TVE A;  5CYY A;  1A2M A;  5KN1 A;  2L5L A;  3G9B A;  3ED3 A;  2H75 A;  2BJX A;  1YY7 A;  1K0B A;  3KGK A;  2DIZ A;  6GST A;  5G31 A;  3DRN A;  2PER A;  2C0G A;  2HSM B;  4N30 A;  4GF0 A;  1G7E A;  3CSH A;  3H1N A;  2B5E A;  1XBS A;  4TXV A;  3FRC A;  2PWJ A;  4IN0 A;  4AKG A;  3ZYW A;  2IWT A;  2B5Y A;  5D9X A;  1Y25 A;  2IPA A;  1HYU A;  3HY2 A;  2AUV A;  2H0I A;  2JL4 A;  4GST A;  2LEG A;  1MTC A;  2H70 A;  3ZZX A;  5ECL B;  4GWR A;  2RLI A;  2YJH A;  2I3Y A;  2OE1 A;  2QA1 A;  5A34 B;  5ECQ B;  1G7O A;  3UVT A;  4YAP A;  1XWB A;  3CQF A;  2HRK A;  1FG4 A;  1GSS A;  4TR4 A;  3EUR A;  2O3E A;  4TR3 A;  2ALB A;  1XG8 A;  5B6M A;  3IDV A;  3IHG A;  4K6X A;  3W6G A;  1VF1 A;  1GUH A;  1ERW A;  1SVM A;  1DSB A;  3P90 A;  2IIY A;  3DIE A;  3EMX A;  4QQ7 A;  3G7I A;  4XS1 A;  4POM A;  2FWF A;  2DJJ A;  2HLS A;  2UV8 G;  5CRW A;  5FT3 A;  1SKS B;  1MD3 A;  4ZB8 A;  1AXD A;  3IK9 A;  2EFE A;  2E2G A;  3LQ7 A;  3GUS A;  3IHQ A;  2EIR A;  1B9X C;  3TKS C;  2PGT A;  3Q19 A;  1YDK A;  1W89 A;  3D6I A;  3UIW A;  1GUK A;  3WGE A;  1FW1 A;  5DDL A;  2R37 A;  3GFK A;  3FZ4 A;  5JCW A;  2EIO A;  1G6W A;  1Z9H A;  2WZ9 A;  4CHS A;  3KIJ A;  3HXS A;  1XXU A;  4MZC A;  3SWL A;  3A2X A;  3BOA A;  4MJA A;  1ERU A;  2VCZ A;  1PRX A;  4J56 E;  3QPM A;  4POK A;  2G2Q A;  2VCX A;  3CYN A;  4XTS A;  2JU5 A;  4N0V A;  1N25 A;  5ECH B;  3ERF A;  4OO5 A;  4ECJ A;  3CTG A;  3NZN A;  1S3D A;  3DWV A;  2VLT A;  2P31 A;  6GSX A;  1QXH A;  2VL2 A;  19GS A;  2JSZ A;  3GSS A;  2WGR A;  5G1L A;  4G0L A;  5AIX A;  1URM A;  4HEA 2;  2HT9 A;  5IMZ A;  2NTO A;  1A2L A;  5HFG A;  2GQK A;  2A4V A;  3F6D A;  3F63 A;  4WF5 A;  3IAM 2;  3KCM A;  2HSM A;  2LJA A;  3V1W A;  4AJ7 A;  4YQM A;  4AF2 A;  1A0F A;  2E7P A;  2H1A A;  2AAW A;  2LUS A;  1FAA A;  5ECI B;  3L9S A;  3EPT A;  4NV2 A;  2DJK A;  4MCU A;  5CO3 A;  3HD5 A;  1K0A A;  1GSQ A;  2H72 A;  4KCE A;  1U3A A;  2HI7 A;  2X64 A;  4Z2T A;  4HSC X;  5DAL B;  4J57 E;  4V2L A;  2C3Q A;  2VCT A;  2DKI A;  5A34 A;  2RUF A;  7GSS A;  1R7H A;  3GST A;  4Q5R A;  2G0F A;  3LEF A;  4MNN A;  1TKD B;  2MBT A;  1AAZ A;  1QK8 A;  4I2T A;  5F0G A;  4V2N A;  2PVQ A;  1AUC A;  3F4R A;  3MSZ A;  3F3Q A;  1V2A A;  1K0N A;  6GSS A;  4O5U A;  4EVM A;  2DJ0 A;  3RPP A;  1MEK A;  1QFN A;  4DSR A;  3PPU A;  2GSQ A;  2H01 A;  2VUP A;  1KBN A;  6GSV A;  3FY7 A;  4IGJ A;  1VF3 A;  1J08 A;  3C1S A;  5EPF A;  5AIS A;  4A5P A;  3QR6 A;  18GS A;  3HJM A;  1PN9 A;  2WCI A;  3TOT A;  2YV9 A;  3GKK A;  2O7K A;  3TKQ A;  1V9W A;  2KP2 A;  5FWG A;  5DBQ A;  1O81 A;  3HDC A;  2GQL A;  3ZIT A;  2FA4 A;  5DQS A;  3TRQ A;  2A2P A;  4G0I A;  2KUC A;  1N8J A;  4WF4 A;  1ZYE A;  4F2I A;  1GSU A;  1XZO A;  4IW9 A;  1HNC A;  1JHB A;  1Z6N A;  3EE2 A;  3DYR A;  1GTB A;  4EE0 A;  1SU9 A;  5ELG A;  3LG6 A;  4ML6 A;  2K8S A;  3HVV A;  1BX9 A;  3M0F A;  3KMN A;  3TUE A;  3TB2 A;  4IHU A;  2L4Q A;  3L9V A;  5AGY A;  5IO0 A;  2IMF A;  1AQX A;  1WPI A;  3RGB C;  3M3M A;  4EF0 A;  3F6F A;  5LD0 A;  4K0G A;  2X8C A;  3F9U A;  4DSS B;  2NBS A;  2DMM A;  3UEM A;  1TU8 A;  5D9W A;  3HVX A;  3IBH A;  5LNK e;  1YJ6 A;  1F37 A;  2HSH A;  2B6M A;  2LST A;  1USB A;  3GA4 A;  1SL2 B;  1ON4 A;  4ICY A;  1YVL A;  4KND A;  5GST A;  2WVY A;  2WZS A;  2HRN A;  1XFL A;  1Y6E A;  3EVI A;  4NV5 A;  2B3S A;  1X5D A;  5G5E A;  2KHP A;  4PUR A;  4DVC A;  2O85 A;  3IR4 A;  1X9M B;  4MJC A;  1XVQ A;  4I6X A;  3BJ5 A;  4ACS A;  1PMT A;  3D4T A;  4IQ1 A;  3QFB C;  3L4N A;  1M2A A;  4TKY A;  2IMD A;  4XIH A;  1XW5 A;  2K9F A;  2YZH A;  1OAZ A;  1SVO A;  1JLV A;  3GTU A;  2CX3 A;  3E3E A;  4K8M A;  3QMX A;  5IPH A;  1K0D A;  1O85 A;  4HDE A;  2E2M A;  3FZ5 A;  1V98 A;  2WW1 A;  4PTS A;  3QAG A;  1SJI A;  4JRR A;  4J2F A;  1PSQ A;  2VL2 C;  4YQU A;  1F3A A;  3L78 A;  2R5G A;  2WW0 A;  1SEN A;  4PXO A;  2DIY A;  4H86 A;  1UVZ A;  2NVL A;  2EIQ A;  3BCK A;  3ZVJ A;  4AI6 A;  2CQ9 A;  3C7M A;  3QDN A; 
#chains in the Genus database with same CATH homology
 3N5O A;  3VUR A;  1SD8 A;  1Z7P A;  2V1M A;  3LW9 A;  3RBT A;  1PA3 A;  1GNW A;  2N5A A;  2X8H A;  1V58 A;  1GUM A;  1GNE A;  4GXZ A;  1JZO A;  4LMV A;  1CQH A;  4EC0 A;  3WD6 A;  3KTL A;  2PPT A;  3C71 A;  3IC4 A;  4X1U A;  4IP1 A;  4PUA A;  5F06 A;  4WEY A;  4MH3 A;  1O73 A;  1W4V A;  2K6V A;  1GLP A;  2DLX A;  3GKX A;  2CAI A;  3HCZ A;  1BQ7 A;  1SVL A;  2VLV A;  2LKU A;  3KMO A;  5IMC A;  2LJR A;  4AKH A;  4KF9 A;  2MMZ A;  4KUN A;  3GKM A;  3US3 A;  1TRS A;  1TK0 B;  5DJL A;  4DSS A;  3EIN A;  4IVF A;  2YWM A;  2REM A;  4ID0 A;  5HR0 A;  1SKR B;  5F8B A;  2LS5 A;  4I5Q A;  2X49 A;  3IV4 A;  2J23 A;  4GDF A;  4GQF A;  3W8S A;  2C0F A;  4OFN A;  1E2Y A;  3FR3 A;  2H30 A;  5IPG A;  1GSY A;  5J9B A;  1TOF A;  1PX6 A;  3DML A;  3TDG A;  1PD2 1;  4IQA A;  2O89 A;  4ZIL A;  3FYG A;  5HR2 A;  2QA2 A;  1SJ6 A;  1U3I A;  3FK8 A;  2L4C A;  3GMF A;  2FA8 A;  2HRA A;  3G7J A;  2L6D A;  2CVD A;  4KSM A;  1WP0 A;  1Z3E A;  3D21 A;  1M7T A;  4AJ6 A;  1ZYP A;  4MDC A;  1T4Y A;  2KP1 A;  4MH2 A;  5CRE A;  1M9A A;  1OE8 A;  3VK9 A;  5A5K A;  3P7X A;  2O87 A;  2M46 A;  3FEU A;  4Z2U A;  3CBU A;  4X4J A;  3BBY A;  5IOX A;  3DVW A;  3L0H A;  4EXJ A;  3GL5 A;  4AKI A;  2KLX A;  3QAV A;  1YF0 A;  1GP1 A;  2A2R A;  4HQZ A;  3HA9 A;  3BCI A;  4EIQ A;  4TRX A;  4F9Z A;  17GS A;  1WWJ A;  5IM9 A;  3HMJ G;  2L59 A;  4MF5 A;  3ZRD A;  3ZFL A;  2YOI A;  5B8A A;  5F07 A;  3GHA A;  4TR1 A;  1TXX A;  3D22 A;  1YEX A;  4LL1 B;  4MPF A;  3A3T A;  2MBS A;  2NDO A;  3Q74 A;  1HNA A;  2F51 A;  4AJ8 A;  1TJD A;  2OKA A;  3GH6 A;  2TIR A;  1J9B A;  2C3N A;  1K0C A;  3CMI A;  5D96 A;  2VCQ A;  1DE2 A;  2Z9S A;  5DQY A;  1OC3 A;  3SBC A;  1I5G A;  2OE3 A;  1V57 A;  2X8G A;  22GS A;  4KGI A;  2CT6 A;  4KSO A;  4OMV A;  2R0G A;  1UN2 A;  3EU3 A;  3KTB A;  4L5O A;  2GVP A;  4IJI A;  4MP4 A;  3K8N A;  1A2J A;  4RI7 A;  2FWG A;  3TRP A;  4L8E A;  1O8W A;  4K5R A;  3UOM A;  3MWH A;  1SL1 B;  2HZE A;  5J40 A;  3I9V 2;  1O7U A;  1UA5 A;  3GX0 A;  3ZRE A;  3HKR A;  3M9K A;  4K7O A;  5LCZ A;  1WOU A;  3ISO A;  1B9Y C;  5IO2 A;  3S9F A;  2R4V A;  2YZU A;  5J4Y A;  3TKR A;  2DKH A;  2YP6 A;  2MZC A;  1A24 A;  4O92 A;  2V6O A;  3RPN A;  1EV4 A;  3VI7 A;  2P5R A;  2E0Q A;  1PKW A;  5H5S A;  3WT2 A;  3F0I A;  3TCO A;  1WE0 A;  3GUR A;  3FZA A;  1LU4 A;  4BWS A;  1B8X A;  5D73 A;  2IMK A;  3QAW A;  2VIM A;  4K5S A;  1EV9 A;  1SK2 A;  4DSQ A;  1LBK A;  4K0N A;  1T7P B;  3LSZ A;  4NHW A;  3IA1 A;  2GDR A;  3W8J A;  2MMN A;  1T00 A;  3CSI A;  4Z2R A;  2XBQ A;  4IP6 A;  5C00 A;  1MDJ A;  5D9T A;  2H6Z A;  3GIX A;  1NHO A;  3TJG A;  4PGT A;  3VWX A;  13GS A;  3ME7 A;  3C1R A;  5H5Q A;  3I69 A;  2OBK A;  1JFU A;  1AQW A;  5B7C A;  2FHE A;  2GGT A;  1XPV A;  2AV4 A;  2N5F A;  2I4A A;  3KP9 A;  3WT1 A;  1R26 A;  5J9C A;  1GL8 A;  3DKS A;  4PUF C;  1ZCP A;  2JZS A;  5B6N A;  1ZGN A;  1BF5 A;  4GCI A;  3ZMK A;  3APS A;  1T3B A;  2BMX A;  4HI7 A;  1NSW A;  4L0U A;  4I97 A;  2IN3 A;  1YKA A;  1O6J A;  5C04 A;  5J47 A;  4ECB A;  2QC7 A;  2EC4 A;  2HXK A;  5D9V A;  5J41 A;  3NIV A;  1ERT A;  4XRA A;  2GSS A;  1ZL9 A;  2ES7 A;  3APO A;  5BMU B;  3F8U A;  2ZNM A;  1DBY A;  3OR5 A;  1GSF A;  1VF2 A;  3CTF A;  2LRC A;  1SKW B;  2WJU A;  2HSY A;  4TW5 A;  3UL3 A;  3ZL5 A;  1WMJ A;  5A1N B;  4XS4 B;  1SYR A;  1XW6 A;  1K3Y A;  1EP7 A;  3CWG A;  2OT3 A;  3KD0 A;  2VL3 A;  2EFC A;  4W66 A;  1EWX A;  3P2A A;  1GH2 A;  3TKP A;  3IXR A;  4WBR D;  3QCP A;  4G0K A;  2LRT A;  3ZLP A;  3R3E A;  5J4U A;  1KEB A;  4YAV A;  2X4A A;  4D73 B;  4LLR A;  1K3L A;  2C8U A;  2WFC A;  4N10 A;  3GX8 A;  5JWQ B;  3MDK A;  1KNG A;  1VF4 A;  2YNX A;  2LJK A;  5E59 A;  1JZD A;  1A23 A;  2CVB A;  4ECC A;  4V2M A;  1NW2 A;  2GZY A;  1XOA A;  3TJF A;  3M8N A;  2IJY A;  5DVB A;  1GTI A;  5DCH A;  4BL7 B;  3GNJ A;  2XHF A;  4JE1 A;  4BPY A;  4GSS A;  2PBJ A;  3WGD A;  2WRT A;  3J7Y b;  1THX A;  4KA0 A;  1EP8 A;  3TRX A;  1EOH A;  4ZL7 A;  4MMM A;  1WIK A;  2HSN B;  1FO5 A;  3CXG A;  5KN3 A;  1DUG A;  5J4V A;  2JZR A;  4L0W A;  2B7J A;  1QQ2 A;  3KP8 A;  4FYB A;  2A4H A;  1MD4 A;  4YKF A;  1GWC A;  2FCH A;  3O3T A;  3MAK A;  4WR4 A;  2FNO A;  1BJX A;  1EGR A;  1THO A;  4Q5F A;  1X0R A;  1BG5 A;  2UZ8 A;  4EL1 A;  4ZIJ A;  2GZP A;  4E8H A;  3L9U A;  1M9B A;  4RQR A;  4JR6 A;  4PX1 A;  5L71 A;  3RAZ A;  4LA1 A;  4MA9 A;  4ECI A;  2B5X A;  5ECN B;  4MK3 A;  2D2Z A;  20GS A;  5IQY A;  3M1G A;  2DC5 A;  4FH8 A;  1AW9 A;  4ZB9 A;  4MLY A;  2QKE A;  2EFH A;  3LYK A;  2H71 A;  1SK0 A;  1K0M A;  3LYP A;  1I9D A;  2XC2 A;  1FB0 A;  1OYJ A;  5BMU A;  1U87 A;  1PGT A;  3I6A A;  1Q98 A;  1DE1 A;  1FHE A;  2C80 A;  3GN3 A;  1GUL A;  2IFQ B;  2CV4 A;  1AC1 A;  4F03 A;  5DAL A;  2H66 A;  2PUK C;  1A0R P;  2VLU A;  2HE3 A;  5A1N A;  2VCV A;  4XS4 A;  2AB6 A;  3F3R A;  2YJ7 A;  1T4Z A;  3GH9 A;  4FO5 A;  5B8B A;  3WYW A;  1GRX A;  5DAK B;  1XIY A;  4OFT A;  3AY8 A;  3O76 A;  4MJB A;  1PN0 A;  1KTE A;  1M2B A;  2H74 A;  1Z5Y E;  2MMA A;  3UMA A;  4YH2 A;  1NM3 A;  4Q5N A;  3U5R E;  5COH A;  2V2G A;  1CQG A;  1WRY A;  4KW6 A;  3QOU A;  3ZFB A;  5G2Z A;  4L5L A;  1N2A A;  4KAE A;  3H4K A;  1R5A A;  2R0P A;  2MMO A;  4GLT A;  2AYT A;  1V40 A;  4QL9 A;  2HRF A;  3VPT A;  3M9J A;  3HJO A;  3LXZ A;  4F0B A;  2PN8 A;  4MPG A;  2F8A A;  3TGZ A;  1OC9 B;  3DVX A;  4ZXG A;  4BL7 A;  1G0T A;  4OCF A;  1VRS D;  5KOW A;  3R2Q A;  16GS A;  1SL0 B;  5KN2 A;  3MIX A;  3ZVJ D;  4GTU A;  1RK4 A;  4G01 A;  1OKT A;  2B7K A;  2VM1 A;  5JWR B;  4JZQ A;  2HSN A;  3FW2 A;  1SD9 A;  3Q18 A;  2TRC P;  4NXI A;  5ABR A;  3VFI A;  2GTU A;  3KH9 A;  3ZIJ A;  1WJK A;  5CP1 A;  3MYD A;  4I8B A;  5EL8 A;  10GS A;  4NAX A;  2H1G A;  1X9W B;  2FUG 2;  2XPE A;  1MDK A;  4G19 A;  1NHY A;  4IKH A;  2LNT A;  2OJL A;  1R4W A;  3VWU A;  4FQU A;  3DXB A;  3RHB A;  1IYH A;  1A8Y A;  1TRV A;  2HQT A;  1ILO A;  3KH7 A;  4HS1 A;  1HQO A;  2H6X A;  3UBL A;  1EOG A;  4O5Q A;  1TI1 A;  2H0H A;  3I43 A;  1A8L A;  2V41 A;  5IIZ A;  1VGL A;  5GAP D;  5INY A;  5A5H B;  1XW9 A;  1EEJ A;  2YWN A;  2CA8 A;  3LWA A;  4KE3 A;  1U88 A;  4IBP A;  3UAR A;  5HR3 A;  1XVW A;  4OCE A;  3G7Y A;  1YKC A;  3J7Y k;  5ECS A;  3D5J A;  4K9Z A;  3PH9 A;  2J9H A;  4KX4 A;  2FLS A;  1XWG A;  1PX7 A;  4HUA A;  3LXT A;  1H75 A;  2DJ1 A;  2ZUP A;  2R2J A;  3ME8 A;  3TKS E;  3VWW A;  4POL A;  1U6T A;  3WGX A;  4LL4 B;  5G30 A;  4KDU A;  3TJJ A;  4K7N A;  2IFQ A;  1ZOF A;  2VAF A;  2IL3 A;  3NOF A;  2OAC A;  4O32 A;  2YCD A;  2H1D A;  1OE7 A;  4MAB A;  2ON7 A;  3TJB A;  3Q6O A;  2VL9 A;  1XOB A;  5DAK A;  2JAC A;  3HYP A;  1Z6M A;  3IK7 A;  1TU7 A;  3PIN A;  3VI5 A;  4KB3 A;  4RI6 A;  1ZMA A;  2M72 A;  1IYI A;  2CAQ A;  4KCA A;  2VD0 A;  1ERV A;  2M80 A;  4GQC A;  5A4U A;  3O6T A;  2WS2 A;  3LGC A;  2VKZ G;  2DJ2 A;  3ZIV A;  5GZZ B;  3P8W A;  1BAY A;  4YKG A;  4G10 A;  3DEX A;  2I81 A;  1ZZY A;  4IEL A;  2GS3 A;  5F05 A;  2R6K A;  5CRD A;  4ML1 A;  4TR0 A;  5A4W A;  2GT6 A;  4K2D A;  3C8E A;  1GLQ A;  3VLN A;  5HFI A;  1FVJ A;  4JBB A;  3TOU A;  4GRF A;  4HU9 A;  2L5O A;  1F9M A;  3A2W A;  3FKF A;  2VO4 A;  2VOC A;  1OC9 A;  11GS A;  1TI3 A;  4K1F A;  5ECK B;  3LJR A;  4HZ4 A;  4XS6 A;  1BYE A;  1HNB A;  5EVO A;  1GTU A;  5KEJ A;  5ECO B;  1ZYN A;  1O8X A;  2K18 A;  1RQM A;  3HVS A;  4E68 A;  4HZ2 A;  1M99 A;  1AIU A;  1OKD A;  4F0C A;  1R5P A;  3F4T A;  3KZQ A;  4EDZ A;  3ERW A;  1H4O A;  2A2S A;  3IE3 A;  2LQO A;  4BVY B;  3ZTL A;  2MYG A;  1QGV A;  3U6V A;  1G6Y A;  3IC8 A;  2F8F A;  3RDW A;  2FD3 A;  4EDY A;  2C1Y A;  4K7I A;  1MDI A;  4G9H A;  3GYK A;  4N3Z A;  2F3M A;  1EZK A;  2WUL A;  3H93 A;  2H73 A;  2CVK A;  2RUE A;  3IRA A;  5ECM B;  5A5H A;  2K8V A;  1XWA A;  2OBI A;  2LV3 A;  2O5V A;  4QMK A;  2VM2 A;  5KOX A;  1OVN A;  3EC3 A;  1E6B A;  1M0U A;  5D93 A;  4BWQ A;  3ERG A;  2GT5 A;  5CRH A;  3LFL A;  2JSY A;  1Y1U A;  4EIP A;  2GZZ A;  1OC8 A;  4MZW A;  1B4Q A;  5CNW A;  3KXO A;  2NPB A;  5A4V A;  3FZ9 A;  2H1B A;  4TXO B;  5CAX A;  4HJ2 A;  1GTA A;  4TN8 A;  4NMU A;  1J0F A;  3IPZ A;  1T8E B;  5AN1 A;  1LJR A;  4QL7 A;  1TK8 B;  4IJ3 A;  2OA7 A;  5KN0 A;  4WBJ A;  3EWL A;  2JAD A;  5GAN D;  2H1L A;  4HQS A;  2L57 A;  6GSY A;  3H8Q A;  2QGV A;  2H19 A;  4XCS A;  1BED A;  1F6M C;  4ULX A;  5DJM A;  2R3X A;  2GLR A;  4WR5 A;  2DML A;  3UAP A;  2WDU A;  5JCG A;  3UVH A;  4JR4 A;  1JZR A;  1Z7R A;  1F2E A;  1TW9 A;  4K2X A;  2X99 A;  5IMV A;  4RQX A;  3VPQ A;  3CSJ A;  3UJ1 A;  3BD2 A;  1K3O A;  1TRU A;  1X9S B;  2LNS A;  2BTO T;  1X5C A;  1XWK A;  1TP9 A;  2H8L A;  3KJY A;  1XWC A;  2P5Q A;  4OFM A;  4TOP A;  4POB A;  3GTU B;  3HJP A;  4BA7 A;  2N5B A;  4ZBD A;  2R0C A;  2TRX A;  3EMP A;  1TDI A;  3N9J A;  4X43 A;  4HOJ A;  2OE0 A;  4NHZ A;  2WB9 A;  4JED A;  1YEP A;  4MZB A;  4AKX B;  5D8I A;  3LOR A;  3PR8 A;  3A2V A;  4BVY A;  2GSR A;  5J5N A;  4PNF A;  4BVX B;  3E9J B;  1HD2 A;  1B48 A;  2DBC A;  3RHC A;  4PQH A;  1S3C A;  4O5R A;  8GSS A;  3VWV A;  3TJK A;  4OD7 A;  5JCU A;  2C3T A;  4PQI A;  5H5R A;  2PMT A;  4Q5Q A;  4JU5 A;  1EGO A;  2FGX A;  2DSA A;  4KDX A;  4EUY A;  5HQP A;  4G2E A;  5IMA A;  1SJZ A;  3GRX A;  1K0O A;  1T1V A;  5IOW A;  1FB6 A;  1GSD A;  2CZ3 A;  3QFA C;  4ZB6 A;  5IMD A;  5ECR B;  3FR9 A;  4KDY A;  3EU4 A;  1JLW A;  1EEM A;  2RM5 A;  3E0U A;  4TXO A;  5BRT A;  5ID2 B;  4DEJ A;  3HZ8 A;  1QMV A;  5ECP B;  6GSU A;  3FHK A;  2XBI A;  4EKZ A;  1FOV A;  1ACV A;  4X0X A;  3GKN A;  2FY6 A;  5ENU A;  2FWE A;  5CRG A;  5AIV A;  3FR6 A;  4P3Y B;  4I2U A;  4AGS A;  4IS0 A;  3HZ4 A;  2IME A;  2QSI A;  3DGQ A;  2B1L A;  1RW1 A;  4ZBB A;  4N0Z A;  4Z7X A;  4MJE A;  4V1A g;  2EFD A;  2YN1 A;  2O8V B;  4FYC A;  3CRT A;  5EY6 A;  4CDO A;  2YWI A;  2VD1 A;  1YF1 A;  4GSN A;  4LMW A;  2V6K A;  3GV1 A;  5J3R A;  6GSW A;  4ZL8 A;  4HJM A;  1YZX A;  3CRU A;  2GQM A;  4CY6 A;  4ZBA A;  2HFD A;  3F4S A;  3TKS A;  1AQV A;  1JZW A;  2YWO A;  3A5I A;  4D73 A;  2RII A;  2YAN A;  2L6C A;  4RUV A;  1ABA A;  3IAS 2;  3D4M A;  4USS A;  2CX4 A;  4KH7 A;  1XCC A;  2VCW A;  4FYU A;  2YPM A;  3MNG A;  4TR1 B;  2LQQ A;  1S3A A;  1YQ1 A;  2DJ3 A;  1GSE A;  4OWY A;  2IMI A;  2PU9 C;  4XHM A;  2LTK A;  2YV7 A;  5ELA A;  4BVX A;  1X5E A;  4CY8 A;  1PL1 A;  4PNG A;  2C0D A;  5GSS A;  1Q4J A;  3PGT A;  4ILF A;  2HRK B;  3HHV A;  12GS A;  2C4J A;  5IMF A;  4ZL9 A;  5HR1 A;  2FWH A;  4NPB A;  3A5W A;  5JWO B;  2CZ2 A;  1C72 A;  1PKZ A;  2RM6 A;  4OO4 A;  1ST9 A;  1M2D A;  2PVO C;  3QD9 A;  4FIW A;  2HZE B;  5DCG A;  4WXT A;  4YQV A;  2P0G A;  2ZCT A;  5FHI A;  2JZT A;  3UBK A;  5HFK A;  5G5F A;  2HZF A;  4O7H A;  2LRN A;  2ON5 A;  4MF6 A;  4NWY A;  4CW9 A;  3EYT A;  1UC7 A;  1B4P A;  2I1U A;  2H0G A;  2OAD A;  2I9H A;  3FMW A;  3APQ A;  3KM6 A;  1FVK A;  1SYX A;  4WET A;  5G1K A;  5ID2 A;  3IOS A;  1ZYQ B;  4F82 A;  1SK1 A;  1PQN A;  1FOH A;  1TTZ A;  2KOK A;  4ZB7 A;  4XRD A;  2F9S A;  4WKW A;  3H79 A;  3C73 A;  2HNL A;  4ISD A;  4N11 A;  2H6Y A;  3TU3 B;  4E8E A;  1TXU A;  3ZML A;  1TRW A;  4PQ1 A;  14GS A;  1QUW A;  2C0E A;  3JCM L;  3KEB A;  2V32 A;  1F3B A;  9GSS A;  1ML6 A;  2B1K A;  3GL3 A;  2XPD A;  4MF7 A;  5E4W A;  2GST A;  1TK5 B;  4EO3 A;  2AJQ B;  1PL2 A;  3DD3 A;  2H76 A;  4V1A p;  2AHE A;  4HU7 A;  2HYX A;  1BG1 A;  3D0Z A;  4TVE A;  5CYY A;  1A2M A;  5KN1 A;  2L5L A;  3G9B A;  3ED3 A;  2H75 A;  2BJX A;  1YY7 A;  1K0B A;  3KGK A;  2DIZ A;  6GST A;  5G31 A;  3DRN A;  2PER A;  2C0G A;  2HSM B;  4N30 A;  4GF0 A;  1G7E A;  3CSH A;  3H1N A;  2B5E A;  1XBS A;  4TXV A;  3FRC A;  2PWJ A;  4IN0 A;  4AKG A;  3ZYW A;  2IWT A;  2B5Y A;  5D9X A;  1Y25 A;  2IPA A;  1HYU A;  3HY2 A;  2AUV A;  2H0I A;  2JL4 A;  4GST A;  2LEG A;  1MTC A;  2H70 A;  3ZZX A;  5ECL B;  4GWR A;  2RLI A;  2YJH A;  2I3Y A;  2OE1 A;  2QA1 A;  5A34 B;  5ECQ B;  1G7O A;  3UVT A;  4YAP A;  1XWB A;  2HRK A;  1FG4 A;  1GSS A;  4TR4 A;  3EUR A;  4TR3 A;  2ALB A;  5B6M A;  3IDV A;  3IHG A;  4K6X A;  3W6G A;  1VF1 A;  1GUH A;  1ERW A;  1SVM A;  1DSB A;  3P90 A;  2IIY A;  3DIE A;  3EMX A;  4QQ7 A;  3G7I A;  4XS1 A;  4POM A;  2FWF A;  2DJJ A;  2HLS A;  2UV8 G;  5CRW A;  5FT3 A;  1SKS B;  1MD3 A;  4ZB8 A;  1AXD A;  3IK9 A;  2EFE A;  2E2G A;  3LQ7 A;  3GUS A;  3IHQ A;  2EIR A;  1B9X C;  3TKS C;  2PGT A;  3Q19 A;  1YDK A;  1W89 A;  3D6I A;  3UIW A;  1GUK A;  3WGE A;  1FW1 A;  5DDL A;  2R37 A;  3GFK A;  3FZ4 A;  5JCW A;  2EIO A;  1G6W A;  1Z9H A;  2WZ9 A;  4CHS A;  3KIJ A;  3HXS A;  1XXU A;  4MZC A;  3SWL A;  3A2X A;  3BOA A;  4MJA A;  1ERU A;  2VCZ A;  1PRX A;  4J56 E;  3QPM A;  4POK A;  2G2Q A;  2VCX A;  3CYN A;  4XTS A;  2JU5 A;  4N0V A;  1N25 A;  5ECH B;  3ERF A;  4OO5 A;  4ECJ A;  3CTG A;  3NZN A;  1S3D A;  3DWV A;  2VLT A;  2P31 A;  6GSX A;  1QXH A;  2VL2 A;  19GS A;  2JSZ A;  3GSS A;  2WGR A;  5G1L A;  4G0L A;  5AIX A;  1URM A;  4HEA 2;  2HT9 A;  5IMZ A;  2NTO A;  1A2L A;  5HFG A;  2GQK A;  2A4V A;  3F6D A;  3F63 A;  4WF5 A;  3IAM 2;  3KCM A;  2HSM A;  2LJA A;  3V1W A;  4AJ7 A;  4YQM A;  4AF2 A;  1A0F A;  2E7P A;  2H1A A;  2AAW A;  2LUS A;  1FAA A;  5ECI B;  3L9S A;  3EPT A;  4NV2 A;  2DJK A;  4MCU A;  5CO3 A;  3HD5 A;  1K0A A;  1GSQ A;  2H72 A;  4KCE A;  1U3A A;  2HI7 A;  2X64 A;  4Z2T A;  5DAL B;  4J57 E;  4V2L A;  2C3Q A;  2VCT A;  2DKI A;  5A34 A;  2RUF A;  7GSS A;  1R7H A;  3GST A;  4Q5R A;  2G0F A;  3LEF A;  4MNN A;  1TKD B;  2MBT A;  1AAZ A;  1QK8 A;  4I2T A;  5F0G A;  4V2N A;  2PVQ A;  1AUC A;  3F4R A;  3MSZ A;  3F3Q A;  1V2A A;  1K0N A;  6GSS A;  4O5U A;  4EVM A;  2DJ0 A;  3RPP A;  1MEK A;  1QFN A;  4DSR A;  3PPU A;  2GSQ A;  2H01 A;  2VUP A;  1KBN A;  6GSV A;  3FY7 A;  4IGJ A;  1VF3 A;  1J08 A;  3C1S A;  5EPF A;  5AIS A;  4A5P A;  3QR6 A;  18GS A;  3HJM A;  1PN9 A;  2WCI A;  3TOT A;  2YV9 A;  3GKK A;  2O7K A;  3TKQ A;  1V9W A;  2KP2 A;  5FWG A;  5DBQ A;  1O81 A;  3HDC A;  2GQL A;  3ZIT A;  2FA4 A;  5DQS A;  3TRQ A;  2A2P A;  4G0I A;  2KUC A;  1N8J A;  4WF4 A;  1ZYE A;  4F2I A;  1GSU A;  1XZO A;  4IW9 A;  1HNC A;  1JHB A;  1Z6N A;  3EE2 A;  3DYR A;  1GTB A;  4EE0 A;  1SU9 A;  5ELG A;  3LG6 A;  4ML6 A;  2K8S A;  3HVV A;  1BX9 A;  3M0F A;  3KMN A;  3TUE A;  3TB2 A;  4IHU A;  3L9V A;  2L4Q A;  5AGY A;  5IO0 A;  2IMF A;  1AQX A;  1WPI A;  3M3M A;  4EF0 A;  3F6F A;  5LD0 A;  4K0G A;  2X8C A;  3F9U A;  4DSS B;  2NBS A;  2DMM A;  3UEM A;  1TU8 A;  5D9W A;  3HVX A;  3IBH A;  5LNK e;  1YJ6 A;  1F37 A;  2HSH A;  2B6M A;  2LST A;  1USB A;  3GA4 A;  1SL2 B;  1ON4 A;  4ICY A;  1YVL A;  4KND A;  5GST A;  2HRN A;  1XFL A;  1Y6E A;  3EVI A;  4NV5 A;  2B3S A;  1X5D A;  5G5E A;  2KHP A;  4PUR A;  4DVC A;  2O85 A;  3IR4 A;  1X9M B;  4MJC A;  1XVQ A;  4I6X A;  3BJ5 A;  4ACS A;  1PMT A;  3D4T A;  4IQ1 A;  3QFB C;  3L4N A;  1M2A A;  4TKY A;  2IMD A;  4XIH A;  1XW5 A;  2K9F A;  2YZH A;  1OAZ A;  1SVO A;  1JLV A;  3GTU A;  2CX3 A;  3E3E A;  4K8M A;  3QMX A;  5IPH A;  1K0D A;  1O85 A;  4HDE A;  2E2M A;  3FZ5 A;  1V98 A;  4PTS A;  3QAG A;  1SJI A;  4JRR A;  4J2F A;  1PSQ A;  2VL2 C;  4YQU A;  1F3A A;  3L78 A;  2R5G A;  1SEN A;  4PXO A;  2DIY A;  4H86 A;  1UVZ A;  2NVL A;  2EIQ A;  3BCK A;  3ZVJ A;  4AI6 A;  2CQ9 A;  3C7M A;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...