1C72A

Tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
VVTLGYWDIRGLAHAIRLLLEYTETPYQERRYKAGPAPDFDPSDWTNEKEKLGLDFPNLPYLIDGDVKLTQSNAILRYIARKHNMCGETEVEKQRVDVLENHLMDLRMAFARLCYSPDFEKLKPAYLELLPGKLRQLSRFLGSRSWFVGDKLTFVDFLAYDVLDQQRMFVPDCPELQGNLSQFLQRFEALEKISAYMRSGRFMKAPIFWYTALWNNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GLUTATHIONE S-TRANSFERASE)
publication title Tyr115, gln165 and trp209 contribute to the 1, 2-epoxy-3-(p-nitrophenoxy)propane-conjugating activity of glutathione S-transferase cGSTM1-1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 71
structure length 217
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1c72A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1c72A01
1TK5B 3ERGA 2CA8A 1FW1A 1AQWA 2VLTA 1XIYA 5F05A 1SD9A 2YP6A 2PBJA 2MMNA 4TN8A 2DMMA 1ZMAA 2IFQA 4GQFA 3O3TA 5ELAA 3BCKA 2H6ZA 2LQQA 1RK4A 5DALA 1X5DA 1GH2A 4ZL7A 1PX7A 1PSQA 1TRWA 2CX4A 1KTEA 1EEJA 1SU9A 4X0XA 3CTGA 5G1LA 5AIXA 1YF0A 2C3TA 2BMXA 5J9BA 3DRNA 3CRTA 3FZ4A 3KP8A 2DJKA 3US3A 5JCWA 4F9ZA 2EC4A 2IMKA 2L4CA 3IK7A 2MZCA 1WIKA 1WOUA 4KH7A 3DVWA 1AQVA 2FWGA 3CTFA 5EPFA 3GSTA 4NAXA 3APSA 1ILOA 4EXJA 3CXGA 1YEXA 2L57A 5COHA 3EURA 5D9WA 3APQA 2ZNMA 3GURA 5H5RA 1TRSA 3RBTA 2HT9A 3A5WA 3PH9A 5B8BA 2YWNA 3H93A 2IFQB 5D9TA 3WYWA 3O6TA 2JZTA 4FIWA 4OO4A 1PX6A 1PMTA 1SL1B 5DQSA 1A2MA 4XRAA 1TI1A 2WCIA 4IN0A 4ZIJA 1ZYQB 3HVXA 2L59A 1ERUA 2LEGA 3HXSA 2B5YA 1B4QA 2KLXA 2JZSA 1WRYA 4DEJA 3KD0A 4GCIA 2C80A 3CSJA 1K3YA 1A23A 2WB9A 2GSSA 5ECHB 5ECKB 1Z7RA 2HI7A 3UIWA 2EIOA 1Z6NA 3QCPA 5IOWA 1CQGA 5CRGA 1SJ6A 2IJYA 3UMAA 2GDRA 2VUPA 2H75A 5C04A 2OACA 4F03A 1WE0A 1ERTA 1N8JA 4MJAA 3EYTA 2WS2A 4LA1A 4IELA 4PUFC 2D2ZA 3IK9A 3G9BA 5F8BA 2E7PA 2GS3A 1PL1A 2X8HA 1YQ1A 1RW1A 3TKRA 2K8VA 2MMOA 2K18A 4OCFA 3DIEA 3L9VA 5J5NA 2LJRA 3FEUA 2MBTA 3G7YA 4PNFA 1TRUA 3TRXA 2X8CA 1M2BA 1M99A 3A2WA 1THXA 5B8AA 2XBIA 2KOKA 1V98A 5ECPB 4MA9A 1FVJA 1TOFA 2IIYA 6GSSA 1FHEA 4QL9A 5G31A 4HU7A 3HJPA 3VI7A 2B5XA 5AIVA 3GFKA 5E4WA 1XW6A 3HA9A 4MZWA 3TKSE 5J9CA 2HQTA 4USSA 2GSQA 4WBRD 1NHYA 1M9AA 2H1GA 2IWTA 4IQAA 3GA4A 2HNLA 3GKMA 4HQZA 3U6VA 2VL3A 2LS5A 4RI7A 1XVQA 5J41A 3GX0A 2FY6A 3GH6A 4NV2A 16GSA 1R26A 1EGRA 2QC7A 2HZEA 1EV9A 1Z6MA 3H1NA 4KAEA 1OAZA 4MPFA 3VPTA 3MSZA 4NHWA 2FNOA 2V1MA 3L4NA 2LV3A 1GLQA 3TJJA 1X5EA 3EU4A 3IE3A 4FH8A 3ZRDA 3HVVA 3G7IA 1V57A 2K8SA 2MMZA 1VF2A 2MMAA 1GUMA 2WULA 1U3AA 4MJCA 4BVXA 1TP9A 2LNTA 1JHBA 3D5JA 3HJOA 1TDIA 1MDKA 3MNGA 2OE0A 4EUYA 4MP4A 2YZHA 1BQ7A 1O85A 5EL8A 2R5GA 4RI6A 4ULXA 1F6MC 4NPBA 4OFNA 3HY2A 3I9V2 3HYPA 1ERVA 2LRTA 5HR1A 1U3IA 1R5PA 1ZYEA 1XOBA 1SJZA 1EOHA 19GSA 4IQ1A 3GIXA 2WFCA 5AGYA 3TGZA 4Q5NA 5CP1A 1VGLA 1QFNA 2HRKA 1AIUA 2CX3A 1G6YA 2XPEA 2RM5A 4OO5A 2HRAA 1AQXA 4KSOA 2I1UA 2C3QA 3FHKA 3M1GA 3IBHA 2L4QA 1GSEA 4FO5A 2WZ9A 4GLTA 3HJMA 1GLPA 4XTSA 3IOSA 1XWBA 1OKTA 2FGXA 3IC4A 4TXVA 1GWCA 1JZOA 2AJQB 3FZAA 2NPBA 3NIVA 6GSVA 1H75A 1QK8A 4J2FA 3I6AA 5IQYA 3GN3A 1FO5A 2A2RA 3HHVA 1QGVA 3R2QA 4XS1A 2OE1A 2PVQA 5A4UA 3TUEA 1T1VA 3E3EA 2HRKB 3TOTA 3QOUA 4G19A 1GUHA 3KTBA 3C8EA 3R3EA 3SWLA 2A2SA 2WGRA 3LEFA 2H1AA 3TKSC 2LNSA 2REMA 3IPZA 12GSA 2LSTA 4LMWA 2QSIA 4P3YB 4BVYA 1Y6EA 4KGIA 2RLIA 1HD2A 4TKYA 4F2IA 3TOUA 2G2QA 3N9JA 4WR4A 3P90A 3DD3A 4KDYA 5DVBA 3TJFA 5GAPD 5GSTA 1MDJA 3H4KA 3KH7A 3QDNA 2TIRA 3F4TA 4RQRA 1GSDA 1RQMA 2IMEA 3CBUA 6GSTA 2LTKA 2OBIA 4YQUA 2JADA 2EIQA 2I81A 5JWOB 4RUVA 5IMVA 1OE7A 1WPIA 4HZ2A 2VLVA 3JCML 2GVPA 3W8SA 4MABA 4Q5QA 3FYGA 3TRQA 1M9BA 4Q5FA 2CVKA 4TXOA 4IJ3A 3LG6A 4BVYB 2H76A 2KUCA 4IKHA 3WGEA 3DMLA 1B9YC 3O76A 3BCIA 3E9JB 5B6MA 2DJ2A 2V6OA 2V32A 2G0FA 7GSSA 2OE3A 4WETA 5HR0A 3A3TA 2HRNA 2CAQA 3VURA 3C71A 2Z9SA 1BJXA 3GUSA 4AGSA 4N10A 5DBQA 3Q74A 4ZXGA 3TB2A 3QAWA 2F51A 4KE3A 3EWLA 1M2DA 2VCTA 14GSA 1MD4A 1GSQA 4K9ZA 4PQ1A 1DBYA 5CRWA 2FWHA 3I43A 5D8IA 3QFAC 2DC5A 3NOFA 4MH2A 1A0RP 4I8BA 3A2VA 5DAKA 2DLXA 4CW9A 2VO4A 2XC2A 4TXOB 5G30A 5JCGA 1T7PB 3BOAA 4V2LA 4O7HA 1K0MA 1GSUA 2O87A 2VLUA 3VWVA 1K3LA 5IPHA 1HYUA 3KM6A 4RQXA 3KIJA 3QR6A 3ZL5A 2J9HA 2N5AA 3L9SA 2M46A 3F0IA 1A2JA 1UC7A 4IW9A 2O85A 4TOPA 3PR8A 1FG4A 2VL9A 2E0QA 4POMA 2LQOA 2K9FA 4OCEA 4PUAA 3F4SA 3FR3A 5IO0A 4ZBDA 5CRHA 4XCSA 2H6XA 1Z7PA 2GT5A 3RPNA 1GTIA 1OC9A 5LNKe 4ILFA 5AISA 2VD1A 3F8UA 4K7IA 4FYUA 5ECLB 5DAKB 3ZMKA 5CNWA 1KNGA 4MCUA 5ECOB 4KX4A 5CREA 3WGXA 2H6YA 2YJHA 4JR4A 2GZPA 1ABAA 4F0BA 3P8WA 4MF6A 5E59A 1WJKA 4CHSA 1PD21 2AHEA 4F82A 5JWQB 3D4TA 3M9KA 2GT6A 1XW9A 3UOMA 1SD8A 4ML6A 1K3OA 4K0NA 4N30A 3ZTLA 1T3BA 4G10A 5LCZA 4PURA 4XS6A 5DALB 2VCZA 2B7KA 2PWJA 2HSMA 2V6KA 4ZB6A 3WT2A 3RDWA 2KP2A 2VCXA 3UARA 2LJKA 4AJ8A 1HNCA 5D93A 3KJYA 3FKFA 4NWYA 2J23A 3F6DA 2C8UA 2HFDA 3F3RA 1XVWA 2VCWA 2JZRA 2YWMA 4HEA2 5ABRA 2VCQA 4I2UA 3ZLPA 3KEBA 2A4VA 2GGTA 3N5OA 2LJAA 1EGOA 1X5CA 3ZFBA 3KXOA 4BWSA 2HE3A 1GRXA 3ZREA 1A8YA 3ZZXA 1S3AA 2VL2C 20GSA 2R37A 3FK8A 1M2AA 1SKRB 1GUKA 9GSSA 2BTOT 2O89A 4L0UA 4TW5A 4XRDA 1XFLA 5HR2A 2F3MA 1PQNA 5IPGA 2HSMB 1U6TA 2V41A 3F4RA 1TU7A 1JFUA 5G5FA 3ZIJA 2NVLA 1JLVA 3CMIA 4ECCA 2ZUPA 3D21A 1QQ2A 2CV4A 3ZITA 1M7TA 5JCUA 4X1UA 3D4MA 2YWOA 11GSA 4ZL8A 3LJRA 2E2GA 1YY7A 5CRDA 2CAIA 2OA7A 2P31A 1X9WB 2YANA 3VPQA 4L5OA 3M3MA 5INYA 2PN8A 2YCDA 2DJ0A 2YPMA 4PTSA 2B6MA 4K1FA 1OVNA 3MWHA 2FHEA 2R6KA 1C72A 2QKEA 3DVXA 1X0RA 1KEBA 4BL7A 2MYGA 3C1RA 2NDOA 4K6XA 1G7OA 3F6FA 3DEXA 3D6IA 1G0TA 2M72A 3HVSA 3UBLA 3QFBC 1EV4A 1X9MB 3GKNA 5KEJA 2CZ3A 3HZ4A 1TK8B 4XIHA 4G2EA 2R2JA 4I6XA 3ERFA 4L5LA 3RPPA 6GSXA 3C7MA 3GKXA 2IMIA 5F07A 2DMLA 4ISDA 1GSSA 1R7HA 4Q5RA 2VL2A 4PXOA 1X9SB 2DSAA 3VLNA 3QAGA 4GWRA 3GV1A 3F3QA 1GSYA 1O6JA 4XHMA 4BL7B 2IMDA 3Q18A 3IR4A 2I3YA 3HDCA 1EOGA 5CO3A 3ERWA 4D73A 2JSYA 3DKSA 1XCCA 4OFTA 4IGJA 4IS0A 5D73A 1E6BA 1ML6A 4TRXA 2KHPA 1UVZA 4PQHA 3FW2A 4MH3A 2RUFA 1TRVA 1BAYA 4GF0A 2R4VA 4MDCA 3LFLA 3IAS2 1PA3A 5DCGA 2B1LA 1IYIA 1FAAA 3HKRA 1EP8A 3KGKA 1XWKA 3GNJA 5HFGA 1ZL9A 5KN1A 5FWGA 4E8EA 3L9UA 3W8JA 2HZEB 4EC0A 4OFMA 4D73B 4WF4A 1PGTA 3F9UA 2FA8A 2H0GA 3PGTA 3Q19A 1W89A 3IV4A 3VWWA 1JZRA 4ZL9A 2LKUA 4L0WA 2HSHA 3HZ8A 5ECQB 4MJBA 1SJIA 2H73A 2H0HA 2TRXA 1K0BA 3QAVA 2L5LA 1URMA 4OD7A 2V2GA 3CRUA 4BVXB 3TJBA 2AUVA 2MBSA 1FVKA 2E2MA 2EIRA 4KCEA 3ZYWA 3EINA 1ERWA 2TRCP 1W4VA 4N0ZA 1AW9A 4DVCA 5IM9A 1ZZYA 5IMCA 1SK0A 2BJXA 1GL8A 1OC3A 2FCHA 4IJIA 5H5SA 4KSMA 2CQ9A 3IC8A 3TRPA 1K0NA 1U88A 1OKDA 2AYTA 2GSTA 2YZUA 1G6WA 1DE2A 4MJEA 1TKDB 3DWVA 3VWUA 5ENUA 1Q98A 4O32A 4KW6A 2OKAA 1VF1A 2H1DA 1HNAA 3QPMA 5D9VA 2F8AA 2I4AA 1DE1A 1V2AA 2PUKC 3QMXA 2C0EA 1V58A 4V1Ag 4X43A 5H5QA 1UA5A 1WMJA 3KMNA 2N5BA 1SKWB 3F63A 3IRAA 4HJ2A 1XPVA 3FR6A 2CVBA 1GSFA 3LQ7A 1YF1A 1XWGA 4ECBA 17GSA 5LD0A 4LLRA 2VCVA 5FHIA 5HQPA 2LUSA 2FUG2 1FOVA 4O5RA 2L6CA 4NXIA 3C1SA 4DSQA 4POBA 2IN3A 1K0CA 1MTCA 3A2XA 1BEDA 1MD3A 2PERA 3FZ9A 2AB6A 5A5KA 2AAWA 3GMFA 3P2AA 3GRXA 4KA0A 1PKZA 2OJLA 3NZNA 3AY8A 1LJRA 3UJ1A 4KNDA 1SK2A 5ECMB 4MK3A 4N0VA 3ME7A 1YEPA 3KCMA 2HXKA 1N2AA 5IMZA 4HI7A 3UVHA 2YWIA 3FRCA 5HFIA 1Z5YE 4J56E 2B3SA 4TR1A 1GNWA 2HRFA 1ON4A 1A8LA 2NTOA 2ON5A 2C0GA 4K0GA 4PQIA 2P0GA 3RAZA 2YV7A 4G0IA 2PVOC 4IVFA 4ACSA 1TU8A 22GSA 4JZQA 2HYXA 4GXZA 4IHUA 2JACA 2YN1A 4DSSA 4WEYA 1AC1A 1PKWA 2JSZA 2P5QA 4ZBBA 4BA7A 1J0FA 1GTAA 1V9WA 2DIYA 3L78A 4YAVA 4JRRA 1MEKA 2C0FA 3TJGA 5CAXA 4TR1B 5HR3A 1CQHA 4MZBA 1F9MA 5GSSA 2C0DA 4L8EA 2B5EA 4KB3A 4HS1A 1LBKA 2ALBA 2NBSA 5B7CA 5IIZA 3UL3A 3SBCA 1U87A 1A24A 1K0AA 3J7Yb 4YQMA 3ZVJD 1THOA 1H4OA 1NM3A 4EKZA 4DSSB 1G7EA 1B4PA 4POKA 3V1WA 3RHCA 1JZDA 4ZB9A 1EWXA 1VRSD 5ELGA 5BMUA 1QUWA 4V2NA 1SKSB 4WKWA 1PN9A 2AV4A 1AUCA 3VFIA 5EY6A 1YKAA 2B1KA 5ECIB 4ML1A 2FWFA 3KP9A 3MAKA 3CSIA 4EDYA 4KDXA 3FZ5A 5EVOA 3VI5A 1T4ZA 4N11A 3EMXA 3K8NA 1PL2A 5L71A 2H1BA 5D96A 2VOCA 1BX9A 3HD5A 3DGQA 3CYNA 1XW5A 3EVIA 3Q6OA 2OBKA 1OC9B 1FB0A 1SENA 3S9FA 2M80A 4GSNA 4MPGA 4H86A 3TKPA 4XS4A 2VM1A 2L5OA 4PX1A 1SYXA 3ZIVA 2GSRA 2H8LA 4V2MA 2VIMA 1YKCA 1TXXA 1T00A 3LWAA 4TR4A 3PPUA 3M9JA 3KZQA 5IOXA 1XWAA 2I9HA 4O92A 4JEDA 2H71A 1S3CA 5DJMA 6GSUA 2RM6A 1A2LA 2GZYA 4KF9A 2CVDA 4TR3A 3VWXA 4KCAA 2PU9C 4I97A 1F3BA 4K8MA 1Y25A 4MZCA 2DIZA 4HUAA 3GKKA 2H30A 4XS4B 3VK9A 2GZZA 4JU5A 3TJKA 3WGDA 1Z3EA 1ST9A 2IL3A 1T8EB 2HSNB 3FY7A 1SL0B 2IPAA 5D9XA 1XBSA 2IMFA 2VAFA 5IMAA 5J4UA 4PGTA 4EO3A 3GHAA 4OMVA 3UBKA 1SK1A 3M0FA 3I69A 4CDOA 1O7UA 2K6VA 1EP7A 2FLSA 3BJ5A 3E0UA 3GH9A 1R4WA 5A4VA 3C73A 3H79A 2C4JA 3U5RE 1AXDA 2YNXA 3P7XA 1GTUA 2XHFA 4G0LA 1O81A 3FR9A 3D22A 2VD0A 1J08A 3PINA 3WD6A 4GQCA 1A0FA 1ZCPA 4ZBAA 1HNBA 4G9HA 4E8HA 2OADA 1V40A 5DJLA 4PNGA 3LYPA 3QD9A 4ECJA 3IA1A 4POLA 5DQYA 3G7JA 5F0GA 2HLSA 2H72A 2PMTA 2R3XA 4FQUA 4WF5A 1TW9A 1SYRA 2DJ3A 5IMDA 2FWEA 4JBBA 4HOJA 4YH2A 5IO2A 2RUEA 1F3AA 4HU9A 5G1KA 5FT3A 2JU5A 2HSYA 3LSZA 3LXTA 4EL1A 2XPDA 1GNEA 1Q4JA 1O8XA 2KP1A 4K7OA 4JE1A 1NSWA 2ES7A 1NW2A 2XBQA 5CYYA 5B6NA 2GLRA 3CSHA 1M0UA 4MMMA 3DXBA 3GL5A 1KBNA 2GQLA 4WR5A 1B9XC 3GSSA 3ZFLA 1TI3A 3KTLA 5GAND 6GSWA 4KDUA 4HDEA 2O8VB 4WXTA 4YAPA 2H70A 4NV5A 4FYBA 4MF7A 1WWJA 4IBPA 4HZ4A 4I2TA 3WT1A 2ZCTA 3LXZA 6GSYA 2O7KA 2F9SA 2H66A 3GYKA 2LRNA 4EE0A 1PRXA 3D0ZA 1JLWA 5DCHA 1T4YA 1J9BA 5AN1A 1AAZA 1S3DA 1HQOA 4JR6A 2LRCA 1UN2A 4EVMA 3ED3A 3J7Yk 4IP6A 2FA4A 3LGCA 1BYEA 4I5QA 2HZFA 2B7JA 4HQSA 2ON7A 4G0KA 4ZB8A 1ACVA 1EEMA 3ZMLA 3EC3A 1IYHA 5ECNB 3IAM2 1FB6A 3ME8A 3TKQA 1NHOA 3BD2A 5ECRB 3RHBA 3APOA 13GSA 5IMFA 5J3RA 1EZKA 2F8FA 2CT6A 1TK0B 2PPTA 3ISOA 2H74A 5DDLA 3H8QA 3KH9A 5KN2A 4QL7A 5KN3A 1R5AA 3GTUA 1DSBA 2P5RA 3OR5A 2X8GA 1O8WA 1OYJA 2GQKA 1SL2B 2WRTA 2CZ2A 1OC8A 2QGVA 1ZOFA 2X64A 1YZXA 1VF3A 1F2EA 3MDKA 1GP1A 10GSA 2PGTA 1XZOA 3UVTA 3M8NA 4KUNA 1QXHA 4GRFA 2DJJA 3GL3A 4BWQA 3UAPA 4IP1A 1O73A 2YOIA 2H01A 4AJ6A 5ECSA 4LL4B 2WDUA 2X99A 1XOAA 1GULA 1WP0A 4BPYA 1F37A 1K0OA 1XWCA 2YV9A 1YDKA 3IDVA 2RIIA 3EMPA 2C3NA 5KN0A 1K0DA 3GTUB 3DYRA 2DBCA 1USBA 1E2YA 3BBYA 1GTBA 1YJ6A 1DUGA 3HCZA 2DJ1A 2N5FA 5ID2A 4V1Ap 1B8XA 2VM2A 2L6DA 2H0IA 4TR0A 1BG5A 3IHQA 4EF0A 2GTUA 8GSSA 3L0HA 3EE2A 3LORA 4MLYA 5G2ZA 3TCOA 5C00A 3W6GA 5A4WA 1B48A 5HFKA 5G5EA 1TTZA 4Z7XA 2C1YA 2WJUA 1Z9HA 4WBJA 3ZVJA 2JL4A 2H19A 1I5GA 2FD3A 3LYKA 4ECIA 4QQ7A 5F06A 3TDGA 18GSA 4ZILA 4FYCA 4K7NA 5GZZB 2YJ7A 4AF2A 4K2DA 4GSTA 4TVEA 1MDIA 4F0CA 3GX8A 1XXUA 5ID2B 1OE8A 3EU3A 4LMVA 4J57E 4AJ7A 4MF5A 1TJDA 3UEMA 3TKSA 5JWRB 2UZ8A 2GQMA 4GTUA 4ID0A 1LU4A 4GSSA 4HJMA 4NMUA 4DSRA 1QMVA 1JZWA 4NHZA 4EDZA 4OWYA 4LL1B 3KMOA 1ZGNA 3IXRA 4YQVA 1VF4A 1I9DA
chains in the Genus database with same CATH superfamily
1TK5B 3ERGA 2CA8A 1FW1A 1AQWA 2VLTA 1XIYA 5F05A 1SD9A 2YP6A 2PBJA 2MMNA 4TN8A 2DMMA 1ZMAA 2IFQA 4GQFA 3O3TA 5ELAA 3BCKA 2H6ZA 2LQQA 1RK4A 5DALA 1X5DA 1XG8A 4PHZC 1GH2A 4ZL7A 1PX7A 1PSQA 1TRWA 2CX4A 1KTEA 1EEJA 1SU9A 4X0XA 3CTGA 5G1LA 5AIXA 1YF0A 2C3TA 2BMXA 5J9BA 1I1IP 3DRNA 3CRTA 1M3IA 3FZ4A 2WVXA 3KP8A 2DJKA 3US3A 5JCWA 4F9ZA 2EC4A 2X49A 2IMKA 2L4CA 4G01A 3IK7A 2MZCA 1WIKA 1WOUA 4KH7A 3DVWA 1AQVA 2FWGA 3CTFA 5EPFA 3GSTA 4NAXA 3APSA 1ILOA 4EXJA 3CXGA 1YEXA 2L57A 5COHA 3EURA 5D9WA 3APQA 2ZNMA 3GURA 5H5RA 1TRSA 3RBTA 2HT9A 3A5WA 3PH9A 5B8BA 2YWNA 3H93A 2IFQB 4O5UA 5D9TA 3WYWA 3O6TA 2JZTA 4FIWA 4OO4A 1PX6A 1PMTA 1SL1B 5DQSA 1A2MA 4XRAA 1TI1A 2WCIA 4IN0A 2O5VA 4ZIJA 1ZYQB 3HVXA 2WVXB 2L59A 1ERUA 2LEGA 3HXSA 2B5YA 1B4QA 2KLXA 2JZSA 1WRYA 4DEJA 3KD0A 4GCIA 2C80A 3CSJA 1K3YA 1A23A 2WB9A 2GSSA 5ECHB 5ECKB 1Z7RA 2HI7A 3UIWA 2EIOA 1Z6NA 3QCPA 5IOWA 1CQGA 5CRGA 1SJ6A 2IJYA 3UMAA 1SVOA 2GDRA 2VUPA 2H75A 5C04A 2OACA 4F03A 1WE0A 1ERTA 1N8JA 4MJAA 3EYTA 2WS2A 4LA1A 4IELA 4PUFC 2D2ZA 3IK9A 3G9BA 4A5PA 5F8BA 2E7PA 2GS3A 1PL1A 2X8HA 1YQ1A 1RW1A 3TKRA 2K8VA 2MMOA 2K18A 4OCFA 3DIEA 3L9VA 5J5NA 2LJRA 3FEUA 2MBTA 3G7YA 4MNNA 4PNFA 1TRUA 3TRXA 2X8CA 1M2BA 1M99A 3A2WA 1THXA 5B8AA 2XBIA 2KOKA 1V98A 5ECPB 4MA9A 1FVJA 1TOFA 2IIYA 6GSSA 1FHEA 2A2PA 4QL9A 1BG1A 2WVYA 5G31A 4HU7A 3HJPA 3VI7A 2B5XA 5AIVA 4K2XA 3GFKA 5E4WA 1XW6A 3HA9A 4MZWA 3TKSE 5J9CA 2HQTA 4USSA 2GSQA 4WBRD 1NHYA 1M9AA 2H1GA 2IWTA 4IQAA 3GA4A 2HNLA 3GKMA 4HQZA 3U6VA 2VL3A 2LS5A 4RI7A 1XVQA 5J41A 3GX0A 1S3RA 2FY6A 3GH6A 4NV2A 16GSA 1R26A 1EGRA 2QC7A 2HZEA 1EV9A 1Z6MA 3H1NA 4KAEA 1OAZA 4MPFA 3VPTA 3MSZA 4NHWA 2FNOA 2V1MA 3L4NA 2LV3A 4EIQA 1GLQA 3TJJA 1X5EA 3EU4A 3IE3A 4FH8A 3ZRDA 3HVVA 3G7IA 1V57A 2EFDA 2K8SA 2MMZA 1VF2A 2MMAA 1GUMA 2WULA 1U3AA 4MJCA 4BVXA 1TP9A 2LNTA 1JHBA 3D5JA 3HJOA 1TDIA 1MDKA 3MNGA 2OE0A 4EUYA 4MP4A 2YZHA 1BQ7A 1O85A 5EL8A 2R5GA 4RI6A 4ULXA 1F6MC 4NPBA 4OFNA 3HY2A 3I9V2 3HYPA 1ERVA 4X4JA 2LRTA 5HR1A 1U3IA 1R5PA 1ZYEA 1XOBA 1SJZA 1EOHA 19GSA 4Z2RA 4IQ1A 3GIXA 2WFCA 5AGYA 2O3EA 3TGZA 4Q5NA 5CP1A 1VGLA 1QFNA 2HRKA 1AIUA 2CX3A 1G6YA 2XPEA 2RM5A 4OO5A 2HRAA 1AQXA 4KSOA 2I1UA 2C3QA 3FHKA 3M1GA 3IBHA 2OT3A 2L4QA 1GSEA 4FO5A 2WZ9A 4GLTA 3HJMA 1GLPA 4XTSA 3IOSA 1XWBA 1OKTA 2FGXA 3IC4A 4TXVA 1GWCA 1JZOA 2AJQB 3FZAA 2NPBA 3NIVA 6GSVA 5J4VA 1H75A 1QK8A 4J2FA 3I6AA 5IQYA 3GN3A 1FO5A 2A2RA 3HHVA 1QGVA 3R2QA 4XS1A 2OE1A 2PVQA 5A4UA 3TUEA 1T1VA 3E3EA 2HRKB 3TOTA 3QOUA 4G19A 1GUHA 3KTBA 3C8EA 3R3EA 3SWLA 2A2SA 2WGRA 3LEFA 2H1AA 3TKSC 2LNSA 2REMA 3IPZA 12GSA 2LSTA 4LMWA 2QSIA 4P3YB 4BVYA 1Y6EA 4KGIA 2RLIA 1HD2A 4TKYA 4F2IA 4YKGA 3TOUA 2G2QA 3N9JA 4WR4A 3P90A 3DD3A 4AKHA 4KDYA 5DVBA 3TJFA 5GAPD 5GSTA 1MDJA 3H4KA 3KH7A 3QDNA 1TXUA 2WW2A 2TIRA 3F4TA 4RQRA 1GSDA 1RQMA 2IMEA 3CBUA 6GSTA 2LTKA 2OBIA 4YQUA 2JADA 2EIQA 2I81A 5JWOB 2WW3A 4RUVA 5IMVA 1OE7A 1WPIA 4HZ2A 2VLVA 3JCML 2GVPA 3W8SA 4MABA 4Q5QA 3FYGA 3TRQA 1M9BA 4Q5FA 2CVKA 4TXOA 4IJ3A 3LG6A 4BVYB 2H76A 2KUCA 4IKHA 3WGEA 3DMLA 1B9YC 3O76A 2O36A 3BCIA 3E9JB 5B6MA 2DJ2A 2V6OA 2V32A 2G0FA 7GSSA 2OE3A 4WETA 5HR0A 3A3TA 2HRNA 2CAQA 3VURA 3C71A 2Z9SA 1BJXA 1ZYPA 4K5SA 3GUSA 4AGSA 4N10A 5DBQA 3Q74A 4ZXGA 3TB2A 3QAWA 3MIXA 2F51A 4KE3A 3EWLA 1M2DA 2VCTA 14GSA 1MD4A 1GSQA 4K9ZA 4PQ1A 1DBYA 5CRWA 2FWHA 3I43A 5D8IA 3QFAC 2DC5A 3NOFA 4MH2A 1A0RP 4I8BA 3A2VA 5DAKA 2DLXA 4CW9A 2VO4A 2XC2A 4TXOB 5G30A 5JCGA 1T7PB 3BOAA 4V2LA 4O7HA 1K0MA 1GSUA 2O87A 2VLUA 3VWVA 1K3LA 5IPHA 1HYUA 3KM6A 4RQXA 3KIJA 4O5QA 3QR6A 2WW1A 3ZL5A 2J9HA 2N5AA 1FOHA 3L9SA 2M46A 3F0IA 1A2JA 1UC7A 4IW9A 2O85A 4TOPA 3PR8A 1FG4A 2VL9A 2E0QA 2DKHA 2UV8G 4POMA 2LQOA 2K9FA 4OCEA 4PUAA 3F4SA 3FR3A 5IO0A 4ZBDA 5CRHA 4XCSA 2H6XA 1Z7PA 2GT5A 3RPNA 1GTIA 1OC9A 5LNKe 3MYDA 4ILFA 5AISA 2VD1A 3F8UA 4K7IA 4FYUA 3TU3B 5ECLB 5DAKB 3ZMKA 5CNWA 1KNGA 4MCUA 5ECOB 4KX4A 5CREA 3WGXA 2H6YA 2YJHA 4JR4A 2GZPA 4Z2TA 1ABAA 4F0BA 3P8WA 4MF6A 2X4AA 5E59A 1WJKA 4CHSA 1PD21 2AHEA 4F82A 5JWQB 3D4TA 3M9KA 2GT6A 1XW9A 3UOMA 1SD8A 4ML6A 1K3OA 1SVMA 4K0NA 4N30A 3ZTLA 1T3BA 4G10A 5LCZA 4PURA 4XS6A 5DALB 2VCZA 2B7KA 2PWJA 2HSMA 2V6KA 4ZB6A 3WT2A 3RDWA 2KP2A 2VCXA 3UARA 2LJKA 4AJ8A 1HNCA 5D93A 3KJYA 3FKFA 4NWYA 2J23A 3F6DA 2C8UA 2HFDA 3F3RA 1XVWA 2VCWA 2JZRA 2YWMA 4HEA2 5ABRA 2VCQA 4I2UA 3ZLPA 3KEBA 2A4VA 2GGTA 1BF5A 3N5OA 2LJAA 4PI0C 1X5CA 1EGOA 4HSCX 3ZFBA 3KXOA 3FMWA 4BWSA 2HE3A 1GRXA 3HMJG 3ZREA 1A8YA 3ZZXA 1S3AA 2VL2C 20GSA 2R37A 3FK8A 1M2AA 1SKRB 1GUKA 9GSSA 2BTOT 2O89A 4L0UA 4TW5A 4XRDA 1XFLA 5HR2A 2F3MA 1PQNA 5IPGA 2HSMB 1U6TA 2V41A 3F4RA 1TU7A 1JFUA 5G5FA 3ZIJA 2NVLA 1JLVA 3CMIA 4ECCA 2ZUPA 3D21A 1QQ2A 2CV4A 3ZITA 1M7TA 5JCUA 4X1UA 3D4MA 2YWOA 11GSA 4ZL8A 3LJRA 2E2GA 1YY7A 5CRDA 2CAIA 2OA7A 5KOWA 2P31A 1X9WB 4CY6A 2YANA 1M3JA 3VPQA 4L5OA 2EFCA 3M3MA 5INYA 2PN8A 2YCDA 2DJ0A 2YPMA 4PTSA 2B6MA 4K1FA 1OVNA 3MWHA 2FHEA 2R6KA 1C72A 2QKEA 3DVXA 1X0RA 1KEBA 4BL7A 2MYGA 3C1RA 2NDOA 4K6XA 1G7OA 3F6FA 3DEXA 3D6IA 1G0TA 4AKIA 2M72A 3HVSA 3UBLA 3QFBC 1EV4A 1X9MB 3GKNA 5KEJA 2CZ3A 3HZ4A 1TK8B 4XIHA 4G2EA 2R2JA 4I6XA 3ERFA 4L5LA 3RPPA 6GSXA 3C7MA 1ZYNA 3GKXA 2IMIA 5F07A 2DMLA 4ISDA 1GSSA 4K5RA 1R7HA 4Q5RA 2VL2A 4PXOA 1X9SB 2DSAA 3VLNA 3QAGA 4GWRA 3GV1A 2QA1A 3F3QA 1GSYA 1O6JA 4XHMA 4BL7B 2IMDA 3Q18A 3IR4A 2I3YA 3HDCA 1EOGA 5CO3A 3ERWA 4D73A 2JSYA 3DKSA 1XCCA 4OFTA 4IGJA 4IS0A 5D73A 1E6BA 1ML6A 4TRXA 2KHPA 1UVZA 2WVZA 4PQHA 3FW2A 4MH3A 2RUFA 1TRVA 1BAYA 4GF0A 4ZB7A 2R4VA 4PI2C 4MDCA 3LFLA 3IAS2 1PA3A 5DCGA 5J47A 4FXYP 2B1LA 1IYIA 2QA2A 1FAAA 3HKRA 1EP8A 3KGKA 1XWKA 3GNJA 5HFGA 1ZL9A 5KN1A 5FWGA 4E8EA 3L9UA 4Z2UA 3W8JA 2HZEB 4EC0A 4OFMA 4N3ZA 4D73B 4WF4A 1PGTA 3F9UA 2FA8A 2H0GA 3PGTA 3Q19A 1W89A 4BIKA 3IV4A 3VWWA 1JZRA 5J4YA 4ZL9A 2LKUA 4L0WA 2HSHA 3HZ8A 5ECQB 4MJBA 1SJIA 2H73A 2H0HA 2TRXA 1K0BA 3QAVA 2L5LA 1URMA 4OD7A 2V2GA 3CRUA 4BVXB 3TJBA 2AUVA 2MBSA 1FVKA 2E2MA 2EIRA 4KCEA 3ZYWA 3EINA 1ERWA 2TRCP 1W4VA 4EIPA 4N0ZA 1AW9A 4DVCA 5IM9A 1ZZYA 5IMCA 1SK0A 2BJXA 1GL8A 1OC3A 2FCHA 4IJIA 2R0PA 5H5SA 4KSMA 3CQFA 2CQ9A 3IC8A 3TRPA 1K0NA 1U88A 1OKDA 1YEWC 2AYTA 2GSTA 2YZUA 1G6WA 2WZSA 1DE2A 4MJEA 1TKDB 3DWVA 3A5IA 3VWUA 5ENUA 1Q98A 4E68A 4O32A 4KW6A 2OKAA 1VF1A 2H1DA 1HNAA 3QPMA 5D9VA 2F8AA 2I4AA 1DE1A 1V2AA 2PUKC 3QMXA 2C0EA 1V58A 4V1Ag 4X43A 5H5QA 1UA5A 1WMJA 5KOXA 3KMNA 2N5BA 1SKWB 3F63A 3IRAA 4HJ2A 1XPVA 3FR6A 2CVBA 1GSFA 3LQ7A 1YF1A 1XWGA 4ECBA 17GSA 5LD0A 4LLRA 2VCVA 5FHIA 5HQPA 2LUSA 2FUG2 1FOVA 4O5RA 2L6CA 4NXIA 3C1SA 4DSQA 4POBA 2IN3A 1K0CA 1MTCA 3A2XA 1BEDA 1MD3A 2PERA 3FZ9A 2AB6A 5A5KA 2AAWA 3GMFA 3P2AA 3GRXA 4KA0A 1PKZA 2OJLA 3NZNA 3AY8A 5J40A 1LJRA 3UJ1A 4KNDA 1SK2A 5ECMB 4MK3A 4N0VA 3ME7A 1YEPA 3KCMA 2HXKA 1N2AA 5IMZA 4HI7A 3UVHA 2YWIA 3FRCA 5HFIA 1Z5YE 4J56E 2B3SA 4TR1A 1GNWA 2HRFA 1ON4A 4AKGA 1A8LA 2NTOA 2ON5A 2C0GA 4K0GA 4PQIA 2P0GA 3RAZA 2YV7A 4G0IA 2PVOC 4IVFA 4ACSA 1TU8A 22GSA 4JZQA 2HYXA 4GXZA 4IHUA 2JACA 2YN1A 4DSSA 4WEYA 1AC1A 1PKWA 2JSZA 2P5QA 4ZBBA 4BA7A 1J0FA 1N25A 1GTAA 1V9WA 2DIYA 3L78A 4YAVA 4JRRA 2EFHA 1MEKA 2C0FA 1PFOA 3TJGA 5CAXA 4TR1B 5HR3A 1CQHA 4MZBA 1F9MA 5GSSA 2C0DA 4L8EA 5A5HA 2B5EA 4KB3A 5BRTA 4HS1A 2NBSA 1LBKA 2ALBA 5B7CA 5IIZA 3UL3A 3SBCA 1U87A 1A24A 1K0AA 3J7Yb 4YQMA 3ZVJD 1THOA 1H4OA 1NM3A 4EKZA 4DSSB 1G7EA 1B4PA 4POKA 3V1WA 3RHCA 1JZDA 4ZB9A 1EWXA 1VRSD 5ELGA 1Y1UA 2DKIA 5BMUA 1QUWA 4V2NA 3HVNA 1SKSB 4WKWA 1PN9A 2AV4A 1AUCA 3VFIA 5EY6A 1YKAA 2B1KA 5ECIB 4ML1A 2FWFA 3KP9A 4AKXB 3MAKA 3CSIA 4EDYA 4KDXA 2VKZG 3FZ5A 5EVOA 3VI5A 1T4ZA 4N11A 3IHGA 5A5HB 4YKFA 3EMXA 3K8NA 2H1LA 1PL2A 5L71A 2H1BA 5D96A 2EFEA 2VOCA 1PN0A 1BX9A 3HD5A 3DGQA 3CYNA 1XW5A 3EVIA 3Q6OA 2OBKA 1OC9B 1FB0A 1SENA 3S9FA 2R0GA 2M80A 4GSNA 4MPGA 4H86A 3TKPA 4XS4A 2VM1A 2L5OA 5BMUB 4PX1A 1SYXA 3ZIVA 2HSNA 2GSRA 2H8LA 4V2MA 2VIMA 1YKCA 1TXXA 1T00A 3LWAA 4TR4A 3PPUA 3M9JA 3KZQA 5IOXA 1YVLA 1XWAA 2I9HA 4O92A 4JEDA 2H71A 1S3CA 5DJMA 6GSUA 2RM6A 1A2LA 2GZYA 4KF9A 2CVDA 4TR3A 3VWXA 4KCAA 2PU9C 4I97A 1F3BA 4K8MA 1Y25A 4MZCA 2A4HA 2DIZA 4HUAA 3GKKA 2H30A 4XS4B 3VK9A 2GZZA 4JU5A 3TJKA 3WGDA 1Z3EA 1ST9A 2IL3A 1T8EB 2HSNB 3FY7A 1SL0B 2IPAA 5D9XA 1XBSA 2IMFA 2VAFA 5IMAA 5J4UA 4PGTA 4EO3A 3GHAA 4OMVA 3UBKA 1SK1A 3M0FA 3I69A 4CDOA 1O7UA 2K6VA 1EP7A 2FLSA 3BJ5A 3E0UA 3GH9A 1R4WA 5A4VA 3C73A 3H79A 2C4JA 3U5RE 1AXDA 2YNXA 3P7XA 1GTUA 2XHFA 4G0LA 1O81A 3FR9A 3D22A 2VD0A 1J08A 3PINA 3WD6A 4GQCA 1A0FA 1ZCPA 4ZBAA 1HNBA 4G9HA 4E8HA 2OADA 1V40A 5DJLA 4PNGA 3LYPA 3QD9A 4ECJA 3IA1A 4POLA 5DQYA 3G7JA 5F0GA 2HLSA 2H72A 2PMTA 2R3XA 4FQUA 4WF5A 1TW9A 1SYRA 2DJ3A 5IMDA 2FWEA 4JBBA 4HOJA 4YH2A 5IO2A 2RUEA 1F3AA 4HU9A 5G1KA 5FT3A 2JU5A 2HSYA 3LSZA 3LXTA 4EL1A 2XPDA 1GNEA 1Q4JA 1O8XA 2KP1A 4K7OA 4JE1A 1NSWA 2ES7A 1NW2A 2XBQA 5CYYA 5B6NA 2GLRA 4QMKA 3CSHA 1M0UA 4MMMA 3DXBA 3GL5A 1KBNA 2GQLA 4WR5A 1B9XC 3GSSA 3ZFLA 1TI3A 3KTLA 5GAND 6GSWA 4KDUA 4HDEA 2O8VB 4WXTA 4YAPA 2H70A 4NV5A 4FYBA 4MF7A 1WWJA 4IBPA 4HZ4A 4I2TA 3WT1A 2ZCTA 3LXZA 6GSYA 2O7KA 2F9SA 2H66A 3GYKA 2LRNA 4GDFA 4EE0A 1PRXA 3D0ZA 1JLWA 5DCHA 1T4YA 1J9BA 5AN1A 1AAZA 1S3DA 1HQOA 4JR6A 2LRCA 1UN2A 4EVMA 3ED3A 3J7Yk 4IP6A 2FA4A 3LGCA 1BYEA 4I5QA 2HZFA 2B7JA 4HQSA 2ON7A 4G0KA 4ZB8A 1ACVA 1EEMA 3ZMLA 3EC3A 1IYHA 5ECNB 3IAM2 1FB6A 3ME8A 3TKQA 1NHOA 3BD2A 5ECRB 3RHBA 3APOA 13GSA 5IMFA 5J3RA 1EZKA 2F8FA 2CT6A 1TK0B 2PPTA 3ISOA 2H74A 5DDLA 3H8QA 3KH9A 2WW0A 5KN2A 4QL7A 5KN3A 1R5AA 3GTUA 1DSBA 2P5RA 3LW9A 3OR5A 2R0CA 2X8GA 1O8WA 1OYJA 2GQKA 1SL2B 2WRTA 2CZ2A 1OC8A 2QGVA 4AI6A 1ZOFA 2X64A 1YZXA 1VF3A 1F2EA 3MDKA 1GP1A 10GSA 2PGTA 1XZOA 3UVTA 3M8NA 4KUNA 1QXHA 4GRFA 2DJJA 1S4BP 3GL3A 4BWQA 3UAPA 5A34A 4IP1A 1O73A 2YOIA 2H01A 4AJ6A 5ECSA 4LL4B 2WDUA 2X99A 1XOAA 1GULA 1WP0A 4BPYA 5A1NA 1F37A 1K0OA 1XWCA 2YV9A 1YDKA 3IDVA 2RIIA 3EMPA 2C3NA 5KN0A 1K0DA 3GTUB 3DYRA 2DBCA 1USBA 1E2YA 3RGBC 3CHXC 3BBYA 3EPTA 1GTBA 1YJ6A 1DUGA 3HCZA 2DJ1A 2N5FA 5ID2A 4V1Ap 1B8XA 2VM2A 2L6DA 2H0IA 4TR0A 1BG5A 3IHQA 4EF0A 2GTUA 8GSSA 3L0HA 3EE2A 3LORA 4MLYA 5G2ZA 3TCOA 5C00A 3W6GA 5A4WA 1B48A 5HFKA 5G5EA 3CWGA 1TTZA 1SVLA 4Z7XA 5A34B 2C1YA 2WJUA 1Z9HA 4WBJA 3ZVJA 2JL4A 2H19A 1I5GA 2FD3A 5A1NB 3LYKA 4ECIA 4QQ7A 5F06A 3TDGA 18GSA 3RFRC 4ZILA 4FYCA 4K7NA 5GZZB 2YJ7A 4AF2A 4K2DA 4GSTA 4TVEA 1MDIA 4F0CA 4W66A 3GX8A 1XXUA 5ID2B 1OE8A 4ICYA 3EU3A 4LMVA 4J57E 4AJ7A 4MF5A 1TJDA 3UEMA 3TKSA 5JWRB 2UZ8A 2GQMA 4GTUA 4ID0A 1LU4A 4GSSA 4HJMA 4NMUA 4DSRA 1QMVA 1JZWA 4NHZA 4EDZA 4OWYA 4LL1B 4CY8A 3KMOA 1ZGNA 3IXRA 4YQVA 1VF4A 1I9DA
chains in the Genus database with same CATH topology
1TK5B 3ERGA 2CA8A 1FW1A 1AQWA 2VLTA 1XIYA 5F05A 1SD9A 2YP6A 2PBJA 2MMNA 4TN8A 2DMMA 1ZMAA 2IFQA 4GQFA 3O3TA 5ELAA 3BCKA 2H6ZA 2LQQA 1RK4A 5DALA 1X5DA 1GH2A 4ZL7A 1PX7A 1PSQA 1TRWA 2CX4A 1KTEA 1EEJA 1SU9A 4X0XA 3CTGA 5G1LA 5AIXA 1YF0A 2C3TA 2BMXA 5J9BA 3DRNA 3CRTA 3FZ4A 3KP8A 2DJKA 3US3A 5JCWA 4F9ZA 2EC4A 2X49A 2IMKA 2L4CA 4G01A 3IK7A 2MZCA 1WIKA 1WOUA 4KH7A 3DVWA 1AQVA 2FWGA 3CTFA 5EPFA 3GSTA 4NAXA 3APSA 1ILOA 4EXJA 3CXGA 1YEXA 2L57A 5COHA 3EURA 5D9WA 3APQA 2ZNMA 3GURA 5H5RA 1TRSA 3RBTA 2HT9A 3A5WA 3PH9A 5B8BA 2YWNA 3H93A 2IFQB 4O5UA 5D9TA 3WYWA 3O6TA 2JZTA 4FIWA 4OO4A 1PX6A 1PMTA 1SL1B 5DQSA 1A2MA 4XRAA 1TI1A 2WCIA 4IN0A 2O5VA 4ZIJA 1ZYQB 3HVXA 2L59A 1ERUA 2LEGA 3HXSA 2B5YA 1B4QA 2KLXA 2JZSA 1WRYA 4DEJA 3KD0A 4GCIA 2C80A 3CSJA 1K3YA 1A23A 2WB9A 2GSSA 5ECHB 5ECKB 1Z7RA 2HI7A 3UIWA 2EIOA 1Z6NA 3QCPA 5IOWA 1CQGA 5CRGA 1SJ6A 2IJYA 3UMAA 1SVOA 2GDRA 2VUPA 2H75A 5C04A 2OACA 4F03A 1WE0A 1ERTA 1N8JA 4MJAA 3EYTA 2WS2A 4LA1A 4IELA 4PUFC 2D2ZA 3IK9A 3G9BA 4A5PA 5F8BA 2E7PA 2GS3A 1PL1A 2X8HA 1YQ1A 1RW1A 3TKRA 2K8VA 2MMOA 2K18A 4OCFA 3DIEA 3L9VA 5J5NA 2LJRA 3FEUA 2MBTA 3G7YA 4MNNA 4PNFA 1TRUA 3TRXA 2X8CA 1M2BA 1M99A 3A2WA 1THXA 5B8AA 2XBIA 2KOKA 1V98A 5ECPB 4MA9A 1FVJA 1TOFA 2IIYA 6GSSA 1FHEA 2A2PA 4QL9A 1BG1A 5G31A 4HU7A 3HJPA 3VI7A 2B5XA 5AIVA 4K2XA 3GFKA 5E4WA 1XW6A 3HA9A 4MZWA 3TKSE 5J9CA 2HQTA 4USSA 2GSQA 4WBRD 1NHYA 1M9AA 2H1GA 2IWTA 4IQAA 3GA4A 2HNLA 3GKMA 4HQZA 3U6VA 2VL3A 2LS5A 4RI7A 1XVQA 5J41A 3GX0A 2FY6A 3GH6A 4NV2A 16GSA 1R26A 1EGRA 2QC7A 2HZEA 1EV9A 1Z6MA 3H1NA 4KAEA 1OAZA 4MPFA 3VPTA 3MSZA 4NHWA 2FNOA 2V1MA 3L4NA 2LV3A 4EIQA 1GLQA 3TJJA 1X5EA 3EU4A 3IE3A 4FH8A 3ZRDA 3HVVA 3G7IA 1V57A 2EFDA 2K8SA 2MMZA 1VF2A 2MMAA 1GUMA 2WULA 1U3AA 4MJCA 4BVXA 1TP9A 2LNTA 1JHBA 3D5JA 3HJOA 1TDIA 1MDKA 3MNGA 2OE0A 4EUYA 4MP4A 2YZHA 1BQ7A 1O85A 5EL8A 2R5GA 4RI6A 4ULXA 1F6MC 4NPBA 4OFNA 3HY2A 3I9V2 3HYPA 1ERVA 4X4JA 2LRTA 5HR1A 1U3IA 1R5PA 1ZYEA 1XOBA 1SJZA 1EOHA 19GSA 4Z2RA 4IQ1A 3GIXA 2WFCA 5AGYA 3TGZA 4Q5NA 5CP1A 1VGLA 1QFNA 2HRKA 1AIUA 2CX3A 1G6YA 2XPEA 2RM5A 4OO5A 2HRAA 1AQXA 4KSOA 2I1UA 2C3QA 3FHKA 3M1GA 3IBHA 2OT3A 2L4QA 1GSEA 4FO5A 2WZ9A 4GLTA 3HJMA 1GLPA 4XTSA 3IOSA 1XWBA 1OKTA 2FGXA 3IC4A 4TXVA 1GWCA 1JZOA 2AJQB 3FZAA 2NPBA 3NIVA 6GSVA 5J4VA 1H75A 1QK8A 4J2FA 3I6AA 5IQYA 3GN3A 1FO5A 2A2RA 3HHVA 1QGVA 3R2QA 4XS1A 2OE1A 2PVQA 5A4UA 3TUEA 1T1VA 3E3EA 2HRKB 3TOTA 3QOUA 4G19A 1GUHA 3KTBA 3C8EA 3R3EA 3SWLA 2A2SA 2WGRA 3LEFA 2H1AA 3TKSC 2LNSA 2REMA 3IPZA 12GSA 2LSTA 4LMWA 2QSIA 4P3YB 4BVYA 1Y6EA 4KGIA 2RLIA 1HD2A 4TKYA 4F2IA 4YKGA 3TOUA 2G2QA 3N9JA 4WR4A 3P90A 3DD3A 4AKHA 4KDYA 5DVBA 3TJFA 5GAPD 5GSTA 1MDJA 3H4KA 3KH7A 3QDNA 1TXUA 2TIRA 3F4TA 4RQRA 1GSDA 1RQMA 2IMEA 3CBUA 6GSTA 2LTKA 2OBIA 4YQUA 2JADA 2EIQA 2I81A 5JWOB 4RUVA 5IMVA 1OE7A 1WPIA 4HZ2A 2VLVA 3JCML 2GVPA 3W8SA 4MABA 4Q5QA 3FYGA 3TRQA 1M9BA 4Q5FA 2CVKA 4TXOA 4IJ3A 3LG6A 4BVYB 2H76A 2KUCA 4IKHA 3WGEA 3DMLA 1B9YC 3O76A 3BCIA 3E9JB 5B6MA 2DJ2A 2V6OA 2V32A 2G0FA 7GSSA 2OE3A 4WETA 5HR0A 3A3TA 2HRNA 2CAQA 3VURA 3C71A 2Z9SA 1BJXA 1ZYPA 4K5SA 3GUSA 4AGSA 4N10A 5DBQA 3Q74A 4ZXGA 3TB2A 3QAWA 3MIXA 2F51A 4KE3A 3EWLA 1M2DA 2VCTA 14GSA 1MD4A 1GSQA 4K9ZA 4PQ1A 1DBYA 5CRWA 2FWHA 3I43A 5D8IA 3QFAC 2DC5A 3NOFA 4MH2A 1A0RP 4I8BA 3A2VA 5DAKA 2DLXA 4CW9A 2VO4A 2XC2A 4TXOB 5G30A 5JCGA 1T7PB 3BOAA 4V2LA 4O7HA 1K0MA 1GSUA 2O87A 2VLUA 3VWVA 1K3LA 5IPHA 1HYUA 3KM6A 4RQXA 3KIJA 4O5QA 3QR6A 3ZL5A 2J9HA 2N5AA 1FOHA 3L9SA 2M46A 3F0IA 1A2JA 1UC7A 4IW9A 2O85A 4TOPA 3PR8A 1FG4A 2VL9A 2E0QA 2DKHA 2UV8G 4POMA 2LQOA 2K9FA 4OCEA 4PUAA 3F4SA 3FR3A 5IO0A 4ZBDA 5CRHA 4XCSA 2H6XA 1Z7PA 2GT5A 3RPNA 1GTIA 1OC9A 5LNKe 3MYDA 4ILFA 5AISA 2VD1A 3F8UA 4K7IA 4FYUA 3TU3B 5ECLB 5DAKB 3ZMKA 5CNWA 1KNGA 4MCUA 5ECOB 4KX4A 5CREA 3WGXA 2H6YA 2YJHA 4JR4A 2GZPA 4Z2TA 1ABAA 4F0BA 3P8WA 4MF6A 2X4AA 5E59A 1WJKA 4CHSA 1PD21 2AHEA 4F82A 5JWQB 3D4TA 3M9KA 2GT6A 1XW9A 3UOMA 1SD8A 4ML6A 1K3OA 1SVMA 4K0NA 4N30A 3ZTLA 1T3BA 4G10A 5LCZA 4PURA 4XS6A 5DALB 2VCZA 2B7KA 2PWJA 2HSMA 2V6KA 4ZB6A 3WT2A 3RDWA 2KP2A 2VCXA 3UARA 2LJKA 4AJ8A 1HNCA 5D93A 3KJYA 3FKFA 4NWYA 2J23A 3F6DA 2C8UA 2HFDA 3F3RA 1XVWA 2VCWA 2JZRA 2YWMA 4HEA2 5ABRA 2VCQA 4I2UA 3ZLPA 3KEBA 2A4VA 2GGTA 1BF5A 3N5OA 2LJAA 1EGOA 1X5CA 3ZFBA 3KXOA 3FMWA 4BWSA 2HE3A 1GRXA 3HMJG 3ZREA 1A8YA 3ZZXA 1S3AA 2VL2C 20GSA 2R37A 3FK8A 1M2AA 1SKRB 1GUKA 9GSSA 2BTOT 2O89A 4L0UA 4TW5A 4XRDA 1XFLA 5HR2A 2F3MA 1PQNA 5IPGA 2HSMB 1U6TA 2V41A 3F4RA 1TU7A 1JFUA 5G5FA 3ZIJA 2NVLA 1JLVA 3CMIA 4ECCA 2ZUPA 3D21A 1QQ2A 2CV4A 3ZITA 1M7TA 5JCUA 4X1UA 3D4MA 2YWOA 11GSA 4ZL8A 3LJRA 2E2GA 1YY7A 5CRDA 2CAIA 2OA7A 5KOWA 2P31A 1X9WB 4CY6A 2YANA 3VPQA 4L5OA 2EFCA 3M3MA 5INYA 2PN8A 2YCDA 2DJ0A 2YPMA 4PTSA 2B6MA 4K1FA 1OVNA 3MWHA 2FHEA 2R6KA 1C72A 2QKEA 3DVXA 1X0RA 1KEBA 4BL7A 2MYGA 3C1RA 2NDOA 4K6XA 1G7OA 3F6FA 3DEXA 3D6IA 1G0TA 4AKIA 2M72A 3HVSA 3UBLA 3QFBC 1EV4A 1X9MB 3GKNA 5KEJA 2CZ3A 3HZ4A 1TK8B 4XIHA 4G2EA 2R2JA 4I6XA 3ERFA 4L5LA 3RPPA 6GSXA 3C7MA 1ZYNA 3GKXA 2IMIA 5F07A 2DMLA 4ISDA 1GSSA 4K5RA 1R7HA 4Q5RA 2VL2A 4PXOA 1X9SB 2DSAA 3VLNA 3QAGA 4GWRA 3GV1A 2QA1A 3F3QA 1GSYA 1O6JA 4XHMA 4BL7B 2IMDA 3Q18A 3IR4A 2I3YA 3HDCA 1EOGA 5CO3A 3ERWA 4D73A 2JSYA 3DKSA 1XCCA 4OFTA 4IGJA 4IS0A 5D73A 1E6BA 1ML6A 4TRXA 2KHPA 1UVZA 4PQHA 3FW2A 4MH3A 2RUFA 1TRVA 1BAYA 4GF0A 4ZB7A 2R4VA 4MDCA 3LFLA 3IAS2 1PA3A 5DCGA 5J47A 2B1LA 1IYIA 2QA2A 1FAAA 3HKRA 1EP8A 3KGKA 1XWKA 3GNJA 5HFGA 1ZL9A 5KN1A 5FWGA 4E8EA 3L9UA 4Z2UA 3W8JA 2HZEB 4EC0A 4OFMA 4N3ZA 4D73B 4WF4A 1PGTA 3F9UA 2FA8A 2H0GA 3PGTA 3Q19A 1W89A 3IV4A 3VWWA 1JZRA 5J4YA 4ZL9A 2LKUA 4L0WA 2HSHA 3HZ8A 5ECQB 4MJBA 1SJIA 2H73A 2H0HA 2TRXA 1K0BA 3QAVA 2L5LA 1URMA 4OD7A 2V2GA 3CRUA 4BVXB 3TJBA 2AUVA 2MBSA 1FVKA 2E2MA 2EIRA 4KCEA 3ZYWA 3EINA 1ERWA 2TRCP 1W4VA 4EIPA 4N0ZA 1AW9A 4DVCA 5IM9A 1ZZYA 5IMCA 1SK0A 2BJXA 1GL8A 1OC3A 2FCHA 4IJIA 2R0PA 5H5SA 4KSMA 2CQ9A 3IC8A 3TRPA 1K0NA 1U88A 1OKDA 2AYTA 2GSTA 2YZUA 1G6WA 1DE2A 4MJEA 1TKDB 3DWVA 3A5IA 3VWUA 5ENUA 1Q98A 4E68A 4O32A 4KW6A 2OKAA 1VF1A 2H1DA 1HNAA 3QPMA 5D9VA 2F8AA 2I4AA 1DE1A 1V2AA 2PUKC 3QMXA 2C0EA 1V58A 4V1Ag 4X43A 5H5QA 1UA5A 1WMJA 5KOXA 3KMNA 2N5BA 1SKWB 3F63A 3IRAA 4HJ2A 1XPVA 3FR6A 2CVBA 1GSFA 3LQ7A 1YF1A 1XWGA 4ECBA 17GSA 5LD0A 4LLRA 2VCVA 5FHIA 5HQPA 2LUSA 2FUG2 1FOVA 4O5RA 2L6CA 4NXIA 3C1SA 4DSQA 4POBA 2IN3A 1K0CA 1MTCA 3A2XA 1BEDA 1MD3A 2PERA 3FZ9A 2AB6A 5A5KA 2AAWA 3GMFA 3P2AA 3GRXA 4KA0A 1PKZA 2OJLA 3NZNA 3AY8A 5J40A 1LJRA 3UJ1A 4KNDA 1SK2A 5ECMB 4MK3A 4N0VA 3ME7A 1YEPA 3KCMA 2HXKA 1N2AA 5IMZA 4HI7A 3UVHA 2YWIA 3FRCA 5HFIA 1Z5YE 4J56E 2B3SA 4TR1A 1GNWA 2HRFA 1ON4A 4AKGA 1A8LA 2NTOA 2ON5A 2C0GA 4K0GA 4PQIA 2P0GA 3RAZA 2YV7A 4G0IA 2PVOC 4IVFA 4ACSA 1TU8A 22GSA 4JZQA 2HYXA 4GXZA 4IHUA 2JACA 2YN1A 4DSSA 4WEYA 1AC1A 1PKWA 2JSZA 2P5QA 4ZBBA 4BA7A 1J0FA 1N25A 1GTAA 1V9WA 2DIYA 3L78A 4YAVA 4JRRA 2EFHA 1MEKA 2C0FA 3TJGA 5CAXA 4TR1B 5HR3A 1CQHA 4MZBA 1F9MA 5GSSA 2C0DA 4L8EA 5A5HA 2B5EA 4KB3A 5BRTA 4HS1A 2NBSA 1LBKA 2ALBA 5B7CA 5IIZA 3UL3A 3SBCA 1U87A 1A24A 1K0AA 3J7Yb 4YQMA 3ZVJD 1THOA 1H4OA 1NM3A 4EKZA 4DSSB 1G7EA 1B4PA 4POKA 3V1WA 3RHCA 1JZDA 4ZB9A 1EWXA 1VRSD 5ELGA 1Y1UA 2DKIA 5BMUA 1QUWA 4V2NA 1SKSB 4WKWA 1PN9A 2AV4A 1AUCA 3VFIA 5EY6A 1YKAA 2B1KA 5ECIB 4ML1A 2FWFA 3KP9A 4AKXB 3MAKA 3CSIA 4EDYA 4KDXA 2VKZG 3FZ5A 5EVOA 3VI5A 1T4ZA 4N11A 3IHGA 5A5HB 4YKFA 3EMXA 3K8NA 2H1LA 1PL2A 5L71A 2H1BA 5D96A 2EFEA 2VOCA 1PN0A 1BX9A 3HD5A 3DGQA 3CYNA 1XW5A 3EVIA 3Q6OA 2OBKA 1OC9B 1FB0A 1SENA 3S9FA 2R0GA 2M80A 4GSNA 4MPGA 4H86A 3TKPA 4XS4A 2VM1A 2L5OA 5BMUB 4PX1A 1SYXA 3ZIVA 2HSNA 2GSRA 2H8LA 4V2MA 2VIMA 1YKCA 1TXXA 1T00A 3LWAA 4TR4A 3PPUA 3M9JA 3KZQA 5IOXA 1YVLA 1XWAA 2I9HA 4O92A 4JEDA 2H71A 1S3CA 5DJMA 6GSUA 2RM6A 1A2LA 2GZYA 4KF9A 2CVDA 4TR3A 3VWXA 4KCAA 2PU9C 4I97A 1F3BA 4K8MA 1Y25A 4MZCA 2A4HA 2DIZA 4HUAA 3GKKA 2H30A 4XS4B 3VK9A 2GZZA 4JU5A 3TJKA 3WGDA 1Z3EA 1ST9A 2IL3A 1T8EB 2HSNB 3FY7A 1SL0B 2IPAA 5D9XA 1XBSA 2IMFA 2VAFA 5IMAA 5J4UA 4PGTA 4EO3A 3GHAA 4OMVA 3UBKA 1SK1A 3M0FA 3I69A 4CDOA 1O7UA 2K6VA 1EP7A 2FLSA 3BJ5A 3E0UA 3GH9A 1R4WA 5A4VA 3C73A 3H79A 2C4JA 3U5RE 1AXDA 2YNXA 3P7XA 1GTUA 2XHFA 4G0LA 1O81A 3FR9A 3D22A 2VD0A 1J08A 3PINA 3WD6A 4GQCA 1A0FA 1ZCPA 4ZBAA 1HNBA 4G9HA 4E8HA 2OADA 1V40A 5DJLA 4PNGA 3LYPA 3QD9A 4ECJA 3IA1A 4POLA 5DQYA 3G7JA 5F0GA 2HLSA 2H72A 2PMTA 2R3XA 4FQUA 4WF5A 1TW9A 1SYRA 2DJ3A 5IMDA 2FWEA 4JBBA 4HOJA 4YH2A 5IO2A 2RUEA 1F3AA 4HU9A 5G1KA 5FT3A 2JU5A 2HSYA 3LSZA 3LXTA 4EL1A 2XPDA 1GNEA 1Q4JA 1O8XA 2KP1A 4K7OA 4JE1A 1NSWA 2ES7A 1NW2A 2XBQA 5CYYA 5B6NA 2GLRA 4QMKA 3CSHA 1M0UA 4MMMA 3DXBA 3GL5A 1KBNA 2GQLA 4WR5A 1B9XC 3GSSA 3ZFLA 1TI3A 3KTLA 5GAND 6GSWA 4KDUA 4HDEA 2O8VB 4WXTA 4YAPA 2H70A 4NV5A 4FYBA 4MF7A 1WWJA 4IBPA 4HZ4A 4I2TA 3WT1A 2ZCTA 3LXZA 6GSYA 2O7KA 2F9SA 2H66A 3GYKA 2LRNA 4GDFA 4EE0A 1PRXA 3D0ZA 1JLWA 5DCHA 1T4YA 1J9BA 5AN1A 1AAZA 1S3DA 1HQOA 4JR6A 2LRCA 1UN2A 4EVMA 3ED3A 3J7Yk 4IP6A 2FA4A 3LGCA 1BYEA 4I5QA 2HZFA 2B7JA 4HQSA 2ON7A 4G0KA 4ZB8A 1ACVA 1EEMA 3ZMLA 3EC3A 1IYHA 5ECNB 3IAM2 1FB6A 3ME8A 3TKQA 1NHOA 3BD2A 5ECRB 3RHBA 3APOA 13GSA 5IMFA 5J3RA 1EZKA 2F8FA 2CT6A 1TK0B 2PPTA 3ISOA 2H74A 5DDLA 3H8QA 3KH9A 5KN2A 4QL7A 5KN3A 1R5AA 3GTUA 1DSBA 2P5RA 3LW9A 3OR5A 2R0CA 2X8GA 1O8WA 1OYJA 2GQKA 1SL2B 2WRTA 2CZ2A 1OC8A 2QGVA 4AI6A 1ZOFA 2X64A 1YZXA 1VF3A 1F2EA 3MDKA 1GP1A 10GSA 2PGTA 1XZOA 3UVTA 3M8NA 4KUNA 1QXHA 4GRFA 2DJJA 3GL3A 4BWQA 3UAPA 5A34A 4IP1A 1O73A 2YOIA 2H01A 4AJ6A 5ECSA 4LL4B 2WDUA 2X99A 1XOAA 1GULA 1WP0A 4BPYA 5A1NA 1F37A 1K0OA 1XWCA 2YV9A 1YDKA 3IDVA 2RIIA 3EMPA 2C3NA 5KN0A 1K0DA 3GTUB 3DYRA 2DBCA 1USBA 1E2YA 3BBYA 3EPTA 1GTBA 1YJ6A 1DUGA 3HCZA 2DJ1A 2N5FA 5ID2A 4V1Ap 1B8XA 2VM2A 2L6DA 2H0IA 4TR0A 1BG5A 3IHQA 4EF0A 2GTUA 8GSSA 3L0HA 3EE2A 3LORA 4MLYA 5G2ZA 3TCOA 5C00A 3W6GA 5A4WA 1B48A 5HFKA 5G5EA 3CWGA 1TTZA 1SVLA 4Z7XA 5A34B 2C1YA 2WJUA 1Z9HA 4WBJA 3ZVJA 2JL4A 2H19A 1I5GA 2FD3A 5A1NB 3LYKA 4ECIA 4QQ7A 5F06A 3TDGA 18GSA 4ZILA 4FYCA 4K7NA 5GZZB 2YJ7A 4AF2A 4K2DA 4GSTA 4TVEA 1MDIA 4F0CA 4W66A 3GX8A 1XXUA 5ID2B 1OE8A 4ICYA 3EU3A 4LMVA 4J57E 4AJ7A 4MF5A 1TJDA 3UEMA 3TKSA 5JWRB 2UZ8A 2GQMA 4GTUA 4ID0A 1LU4A 4GSSA 4HJMA 4NMUA 4DSRA 1QMVA 1JZWA 4NHZA 4EDZA 4OWYA 4LL1B 4CY8A 3KMOA 1ZGNA 3IXRA 4YQVA 1VF4A 1I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK5 B;  3ERG A;  2CA8 A;  1FW1 A;  1AQW A;  2VLT A;  1XIY A;  5F05 A;  1SD9 A;  2YP6 A;  2PBJ A;  2MMN A;  4TN8 A;  2DMM A;  1ZMA A;  2IFQ A;  4GQF A;  3O3T A;  5ELA A;  3BCK A;  2H6Z A;  2LQQ A;  1RK4 A;  5DAL A;  1X5D A;  1GH2 A;  4ZL7 A;  1PX7 A;  1PSQ A;  1TRW A;  2CX4 A;  1KTE A;  1EEJ A;  1SU9 A;  4X0X A;  3CTG A;  5G1L A;  5AIX A;  1YF0 A;  2C3T A;  2BMX A;  5J9B A;  3DRN A;  3CRT A;  3FZ4 A;  3KP8 A;  2DJK A;  3US3 A;  5JCW A;  4F9Z A;  2EC4 A;  2IMK A;  2L4C A;  3IK7 A;  2MZC A;  1WIK A;  1WOU A;  4KH7 A;  3DVW A;  1AQV A;  2FWG A;  3CTF A;  5EPF A;  3GST A;  4NAX A;  3APS A;  1ILO A;  4EXJ A;  3CXG A;  1YEX A;  2L57 A;  5COH A;  3EUR A;  5D9W A;  3APQ A;  2ZNM A;  3GUR A;  5H5R A;  1TRS A;  3RBT A;  2HT9 A;  3A5W A;  3PH9 A;  5B8B A;  2YWN A;  3H93 A;  2IFQ B;  5D9T A;  3WYW A;  3O6T A;  2JZT A;  4FIW A;  4OO4 A;  1PX6 A;  1PMT A;  1SL1 B;  5DQS A;  1A2M A;  4XRA A;  1TI1 A;  2WCI A;  4IN0 A;  4ZIJ A;  1ZYQ B;  3HVX A;  2L59 A;  1ERU A;  2LEG A;  3HXS A;  2B5Y A;  1B4Q A;  2KLX A;  2JZS A;  1WRY A;  4DEJ A;  3KD0 A;  4GCI A;  2C80 A;  3CSJ A;  1K3Y A;  1A23 A;  2WB9 A;  2GSS A;  5ECH B;  5ECK B;  1Z7R A;  2HI7 A;  3UIW A;  2EIO A;  1Z6N A;  3QCP A;  5IOW A;  1CQG A;  5CRG A;  1SJ6 A;  2IJY A;  3UMA A;  2GDR A;  2VUP A;  2H75 A;  5C04 A;  2OAC A;  4F03 A;  1WE0 A;  1ERT A;  1N8J A;  4MJA A;  3EYT A;  2WS2 A;  4LA1 A;  4IEL A;  4PUF C;  2D2Z A;  3IK9 A;  3G9B A;  5F8B A;  2E7P A;  2GS3 A;  1PL1 A;  2X8H A;  1YQ1 A;  1RW1 A;  3TKR A;  2K8V A;  2MMO A;  2K18 A;  4OCF A;  3DIE A;  3L9V A;  5J5N A;  2LJR A;  3FEU A;  2MBT A;  3G7Y A;  4PNF A;  1TRU A;  3TRX A;  2X8C A;  1M2B A;  1M99 A;  3A2W A;  1THX A;  5B8A A;  2XBI A;  2KOK A;  1V98 A;  5ECP B;  4MA9 A;  1FVJ A;  1TOF A;  2IIY A;  6GSS A;  1FHE A;  4QL9 A;  5G31 A;  4HU7 A;  3HJP A;  3VI7 A;  2B5X A;  5AIV A;  3GFK A;  5E4W A;  1XW6 A;  3HA9 A;  4MZW A;  3TKS E;  5J9C A;  2HQT A;  4USS A;  2GSQ A;  4WBR D;  1NHY A;  1M9A A;  2H1G A;  2IWT A;  4IQA A;  3GA4 A;  2HNL A;  3GKM A;  4HQZ A;  3U6V A;  2VL3 A;  2LS5 A;  4RI7 A;  1XVQ A;  5J41 A;  3GX0 A;  2FY6 A;  3GH6 A;  4NV2 A;  16GS A;  1R26 A;  1EGR A;  2QC7 A;  2HZE A;  1EV9 A;  1Z6M A;  3H1N A;  4KAE A;  1OAZ A;  4MPF A;  3VPT A;  3MSZ A;  4NHW A;  2FNO A;  2V1M A;  3L4N A;  2LV3 A;  1GLQ A;  3TJJ A;  1X5E A;  3EU4 A;  3IE3 A;  4FH8 A;  3ZRD A;  3HVV A;  3G7I A;  1V57 A;  2K8S A;  2MMZ A;  1VF2 A;  2MMA A;  1GUM A;  2WUL A;  1U3A A;  4MJC A;  4BVX A;  1TP9 A;  2LNT A;  1JHB A;  3D5J A;  3HJO A;  1TDI A;  1MDK A;  3MNG A;  2OE0 A;  4EUY A;  4MP4 A;  2YZH A;  1BQ7 A;  1O85 A;  5EL8 A;  2R5G A;  4RI6 A;  4ULX A;  1F6M C;  4NPB A;  4OFN A;  3HY2 A;  3I9V 2;  3HYP A;  1ERV A;  2LRT A;  5HR1 A;  1U3I A;  1R5P A;  1ZYE A;  1XOB A;  1SJZ A;  1EOH A;  19GS A;  4IQ1 A;  3GIX A;  2WFC A;  5AGY A;  3TGZ A;  4Q5N A;  5CP1 A;  1VGL A;  1QFN A;  2HRK A;  1AIU A;  2CX3 A;  1G6Y A;  2XPE A;  2RM5 A;  4OO5 A;  2HRA A;  1AQX A;  4KSO A;  2I1U A;  2C3Q A;  3FHK A;  3M1G A;  3IBH A;  2L4Q A;  1GSE A;  4FO5 A;  2WZ9 A;  4GLT A;  3HJM A;  1GLP A;  4XTS A;  3IOS A;  1XWB A;  1OKT A;  2FGX A;  3IC4 A;  4TXV A;  1GWC A;  1JZO A;  2AJQ B;  3FZA A;  2NPB A;  3NIV A;  6GSV A;  1H75 A;  1QK8 A;  4J2F A;  3I6A A;  5IQY A;  3GN3 A;  1FO5 A;  2A2R A;  3HHV A;  1QGV A;  3R2Q A;  4XS1 A;  2OE1 A;  2PVQ A;  5A4U A;  3TUE A;  1T1V A;  3E3E A;  2HRK B;  3TOT A;  3QOU A;  4G19 A;  1GUH A;  3KTB A;  3C8E A;  3R3E A;  3SWL A;  2A2S A;  2WGR A;  3LEF A;  2H1A A;  3TKS C;  2LNS A;  2REM A;  3IPZ A;  12GS A;  2LST A;  4LMW A;  2QSI A;  4P3Y B;  4BVY A;  1Y6E A;  4KGI A;  2RLI A;  1HD2 A;  4TKY A;  4F2I A;  3TOU A;  2G2Q A;  3N9J A;  4WR4 A;  3P90 A;  3DD3 A;  4KDY A;  5DVB A;  3TJF A;  5GAP D;  5GST A;  1MDJ A;  3H4K A;  3KH7 A;  3QDN A;  2TIR A;  3F4T A;  4RQR A;  1GSD A;  1RQM A;  2IME A;  3CBU A;  6GST A;  2LTK A;  2OBI A;  4YQU A;  2JAD A;  2EIQ A;  2I81 A;  5JWO B;  4RUV A;  5IMV A;  1OE7 A;  1WPI A;  4HZ2 A;  2VLV A;  3JCM L;  2GVP A;  3W8S A;  4MAB A;  4Q5Q A;  3FYG A;  3TRQ A;  1M9B A;  4Q5F A;  2CVK A;  4TXO A;  4IJ3 A;  3LG6 A;  4BVY B;  2H76 A;  2KUC A;  4IKH A;  3WGE A;  3DML A;  1B9Y C;  3O76 A;  3BCI A;  3E9J B;  5B6M A;  2DJ2 A;  2V6O A;  2V32 A;  2G0F A;  7GSS A;  2OE3 A;  4WET A;  5HR0 A;  3A3T A;  2HRN A;  2CAQ A;  3VUR A;  3C71 A;  2Z9S A;  1BJX A;  3GUS A;  4AGS A;  4N10 A;  5DBQ A;  3Q74 A;  4ZXG A;  3TB2 A;  3QAW A;  2F51 A;  4KE3 A;  3EWL A;  1M2D A;  2VCT A;  14GS A;  1MD4 A;  1GSQ A;  4K9Z A;  4PQ1 A;  1DBY A;  5CRW A;  2FWH A;  3I43 A;  5D8I A;  3QFA C;  2DC5 A;  3NOF A;  4MH2 A;  1A0R P;  4I8B A;  3A2V A;  5DAK A;  2DLX A;  4CW9 A;  2VO4 A;  2XC2 A;  4TXO B;  5G30 A;  5JCG A;  1T7P B;  3BOA A;  4V2L A;  4O7H A;  1K0M A;  1GSU A;  2O87 A;  2VLU A;  3VWV A;  1K3L A;  5IPH A;  1HYU A;  3KM6 A;  4RQX A;  3KIJ A;  3QR6 A;  3ZL5 A;  2J9H A;  2N5A A;  3L9S A;  2M46 A;  3F0I A;  1A2J A;  1UC7 A;  4IW9 A;  2O85 A;  4TOP A;  3PR8 A;  1FG4 A;  2VL9 A;  2E0Q A;  4POM A;  2LQO A;  2K9F A;  4OCE A;  4PUA A;  3F4S A;  3FR3 A;  5IO0 A;  4ZBD A;  5CRH A;  4XCS A;  2H6X A;  1Z7P A;  2GT5 A;  3RPN A;  1GTI A;  1OC9 A;  5LNK e;  4ILF A;  5AIS A;  2VD1 A;  3F8U A;  4K7I A;  4FYU A;  5ECL B;  5DAK B;  3ZMK A;  5CNW A;  1KNG A;  4MCU A;  5ECO B;  4KX4 A;  5CRE A;  3WGX A;  2H6Y A;  2YJH A;  4JR4 A;  2GZP A;  1ABA A;  4F0B A;  3P8W A;  4MF6 A;  5E59 A;  1WJK A;  4CHS A;  1PD2 1;  2AHE A;  4F82 A;  5JWQ B;  3D4T A;  3M9K A;  2GT6 A;  1XW9 A;  3UOM A;  1SD8 A;  4ML6 A;  1K3O A;  4K0N A;  4N30 A;  3ZTL A;  1T3B A;  4G10 A;  5LCZ A;  4PUR A;  4XS6 A;  5DAL B;  2VCZ A;  2B7K A;  2PWJ A;  2HSM A;  2V6K A;  4ZB6 A;  3WT2 A;  3RDW A;  2KP2 A;  2VCX A;  3UAR A;  2LJK A;  4AJ8 A;  1HNC A;  5D93 A;  3KJY A;  3FKF A;  4NWY A;  2J23 A;  3F6D A;  2C8U A;  2HFD A;  3F3R A;  1XVW A;  2VCW A;  2JZR A;  2YWM A;  4HEA 2;  5ABR A;  2VCQ A;  4I2U A;  3ZLP A;  3KEB A;  2A4V A;  2GGT A;  3N5O A;  2LJA A;  1EGO A;  1X5C A;  3ZFB A;  3KXO A;  4BWS A;  2HE3 A;  1GRX A;  3ZRE A;  1A8Y A;  3ZZX A;  1S3A A;  2VL2 C;  20GS A;  2R37 A;  3FK8 A;  1M2A A;  1SKR B;  1GUK A;  9GSS A;  2BTO T;  2O89 A;  4L0U A;  4TW5 A;  4XRD A;  1XFL A;  5HR2 A;  2F3M A;  1PQN A;  5IPG A;  2HSM B;  1U6T A;  2V41 A;  3F4R A;  1TU7 A;  1JFU A;  5G5F A;  3ZIJ A;  2NVL A;  1JLV A;  3CMI A;  4ECC A;  2ZUP A;  3D21 A;  1QQ2 A;  2CV4 A;  3ZIT A;  1M7T A;  5JCU A;  4X1U A;  3D4M A;  2YWO A;  11GS A;  4ZL8 A;  3LJR A;  2E2G A;  1YY7 A;  5CRD A;  2CAI A;  2OA7 A;  2P31 A;  1X9W B;  2YAN A;  3VPQ A;  4L5O A;  3M3M A;  5INY A;  2PN8 A;  2YCD A;  2DJ0 A;  2YPM A;  4PTS A;  2B6M A;  4K1F A;  1OVN A;  3MWH A;  2FHE A;  2R6K A;  1C72 A;  2QKE A;  3DVX A;  1X0R A;  1KEB A;  4BL7 A;  2MYG A;  3C1R A;  2NDO A;  4K6X A;  1G7O A;  3F6F A;  3DEX A;  3D6I A;  1G0T A;  2M72 A;  3HVS A;  3UBL A;  3QFB C;  1EV4 A;  1X9M B;  3GKN A;  5KEJ A;  2CZ3 A;  3HZ4 A;  1TK8 B;  4XIH A;  4G2E A;  2R2J A;  4I6X A;  3ERF A;  4L5L A;  3RPP A;  6GSX A;  3C7M A;  3GKX A;  2IMI A;  5F07 A;  2DML A;  4ISD A;  1GSS A;  1R7H A;  4Q5R A;  2VL2 A;  4PXO A;  1X9S B;  2DSA A;  3VLN A;  3QAG A;  4GWR A;  3GV1 A;  3F3Q A;  1GSY A;  1O6J A;  4XHM A;  4BL7 B;  2IMD A;  3Q18 A;  3IR4 A;  2I3Y A;  3HDC A;  1EOG A;  5CO3 A;  3ERW A;  4D73 A;  2JSY A;  3DKS A;  1XCC A;  4OFT A;  4IGJ A;  4IS0 A;  5D73 A;  1E6B A;  1ML6 A;  4TRX A;  2KHP A;  1UVZ A;  4PQH A;  3FW2 A;  4MH3 A;  2RUF A;  1TRV A;  1BAY A;  4GF0 A;  2R4V A;  4MDC A;  3LFL A;  3IAS 2;  1PA3 A;  5DCG A;  2B1L A;  1IYI A;  1FAA A;  3HKR A;  1EP8 A;  3KGK A;  1XWK A;  3GNJ A;  5HFG A;  1ZL9 A;  5KN1 A;  5FWG A;  4E8E A;  3L9U A;  3W8J A;  2HZE B;  4EC0 A;  4OFM A;  4D73 B;  4WF4 A;  1PGT A;  3F9U A;  2FA8 A;  2H0G A;  3PGT A;  3Q19 A;  1W89 A;  3IV4 A;  3VWW A;  1JZR A;  4ZL9 A;  2LKU A;  4L0W A;  2HSH A;  3HZ8 A;  5ECQ B;  4MJB A;  1SJI A;  2H73 A;  2H0H A;  2TRX A;  1K0B A;  3QAV A;  2L5L A;  1URM A;  4OD7 A;  2V2G A;  3CRU A;  4BVX B;  3TJB A;  2AUV A;  2MBS A;  1FVK A;  2E2M A;  2EIR A;  4KCE A;  3ZYW A;  3EIN A;  1ERW A;  2TRC P;  1W4V A;  4N0Z A;  1AW9 A;  4DVC A;  5IM9 A;  1ZZY A;  5IMC A;  1SK0 A;  2BJX A;  1GL8 A;  1OC3 A;  2FCH A;  4IJI A;  5H5S A;  4KSM A;  2CQ9 A;  3IC8 A;  3TRP A;  1K0N A;  1U88 A;  1OKD A;  2AYT A;  2GST A;  2YZU A;  1G6W A;  1DE2 A;  4MJE A;  1TKD B;  3DWV A;  3VWU A;  5ENU A;  1Q98 A;  4O32 A;  4KW6 A;  2OKA A;  1VF1 A;  2H1D A;  1HNA A;  3QPM A;  5D9V A;  2F8A A;  2I4A A;  1DE1 A;  1V2A A;  2PUK C;  3QMX A;  2C0E A;  1V58 A;  4V1A g;  4X43 A;  5H5Q A;  1UA5 A;  1WMJ A;  3KMN A;  2N5B A;  1SKW B;  3F63 A;  3IRA A;  4HJ2 A;  1XPV A;  3FR6 A;  2CVB A;  1GSF A;  3LQ7 A;  1YF1 A;  1XWG A;  4ECB A;  17GS A;  5LD0 A;  4LLR A;  2VCV A;  5FHI A;  5HQP A;  2LUS A;  2FUG 2;  1FOV A;  4O5R A;  2L6C A;  4NXI A;  3C1S A;  4DSQ A;  4POB A;  2IN3 A;  1K0C A;  1MTC A;  3A2X A;  1BED A;  1MD3 A;  2PER A;  3FZ9 A;  2AB6 A;  5A5K A;  2AAW A;  3GMF A;  3P2A A;  3GRX A;  4KA0 A;  1PKZ A;  2OJL A;  3NZN A;  3AY8 A;  1LJR A;  3UJ1 A;  4KND A;  1SK2 A;  5ECM B;  4MK3 A;  4N0V A;  3ME7 A;  1YEP A;  3KCM A;  2HXK A;  1N2A A;  5IMZ A;  4HI7 A;  3UVH A;  2YWI A;  3FRC A;  5HFI A;  1Z5Y E;  4J56 E;  2B3S A;  4TR1 A;  1GNW A;  2HRF A;  1ON4 A;  1A8L A;  2NTO A;  2ON5 A;  2C0G A;  4K0G A;  4PQI A;  2P0G A;  3RAZ A;  2YV7 A;  4G0I A;  2PVO C;  4IVF A;  4ACS A;  1TU8 A;  22GS A;  4JZQ A;  2HYX A;  4GXZ A;  4IHU A;  2JAC A;  2YN1 A;  4DSS A;  4WEY A;  1AC1 A;  1PKW A;  2JSZ A;  2P5Q A;  4ZBB A;  4BA7 A;  1J0F A;  1GTA A;  1V9W A;  2DIY A;  3L78 A;  4YAV A;  4JRR A;  1MEK A;  2C0F A;  3TJG A;  5CAX A;  4TR1 B;  5HR3 A;  1CQH A;  4MZB A;  1F9M A;  5GSS A;  2C0D A;  4L8E A;  2B5E A;  4KB3 A;  4HS1 A;  1LBK A;  2ALB A;  2NBS A;  5B7C A;  5IIZ A;  3UL3 A;  3SBC A;  1U87 A;  1A24 A;  1K0A A;  3J7Y b;  4YQM A;  3ZVJ D;  1THO A;  1H4O A;  1NM3 A;  4EKZ A;  4DSS B;  1G7E A;  1B4P A;  4POK A;  3V1W A;  3RHC A;  1JZD A;  4ZB9 A;  1EWX A;  1VRS D;  5ELG A;  5BMU A;  1QUW A;  4V2N A;  1SKS B;  4WKW A;  1PN9 A;  2AV4 A;  1AUC A;  3VFI A;  5EY6 A;  1YKA A;  2B1K A;  5ECI B;  4ML1 A;  2FWF A;  3KP9 A;  3MAK A;  3CSI A;  4EDY A;  4KDX A;  3FZ5 A;  5EVO A;  3VI5 A;  1T4Z A;  4N11 A;  3EMX A;  3K8N A;  1PL2 A;  5L71 A;  2H1B A;  5D96 A;  2VOC A;  1BX9 A;  3HD5 A;  3DGQ A;  3CYN A;  1XW5 A;  3EVI A;  3Q6O A;  2OBK A;  1OC9 B;  1FB0 A;  1SEN A;  3S9F A;  2M80 A;  4GSN A;  4MPG A;  4H86 A;  3TKP A;  4XS4 A;  2VM1 A;  2L5O A;  4PX1 A;  1SYX A;  3ZIV A;  2GSR A;  2H8L A;  4V2M A;  2VIM A;  1YKC A;  1TXX A;  1T00 A;  3LWA A;  4TR4 A;  3PPU A;  3M9J A;  3KZQ A;  5IOX A;  1XWA A;  2I9H A;  4O92 A;  4JED A;  2H71 A;  1S3C A;  5DJM A;  6GSU A;  2RM6 A;  1A2L A;  2GZY A;  4KF9 A;  2CVD A;  4TR3 A;  3VWX A;  4KCA A;  2PU9 C;  4I97 A;  1F3B A;  4K8M A;  1Y25 A;  4MZC A;  2DIZ A;  4HUA A;  3GKK A;  2H30 A;  4XS4 B;  3VK9 A;  2GZZ A;  4JU5 A;  3TJK A;  3WGD A;  1Z3E A;  1ST9 A;  2IL3 A;  1T8E B;  2HSN B;  3FY7 A;  1SL0 B;  2IPA A;  5D9X A;  1XBS A;  2IMF A;  2VAF A;  5IMA A;  5J4U A;  4PGT A;  4EO3 A;  3GHA A;  4OMV A;  3UBK A;  1SK1 A;  3M0F A;  3I69 A;  4CDO A;  1O7U A;  2K6V A;  1EP7 A;  2FLS A;  3BJ5 A;  3E0U A;  3GH9 A;  1R4W A;  5A4V A;  3C73 A;  3H79 A;  2C4J A;  3U5R E;  1AXD A;  2YNX A;  3P7X A;  1GTU A;  2XHF A;  4G0L A;  1O81 A;  3FR9 A;  3D22 A;  2VD0 A;  1J08 A;  3PIN A;  3WD6 A;  4GQC A;  1A0F A;  1ZCP A;  4ZBA A;  1HNB A;  4G9H A;  4E8H A;  2OAD A;  1V40 A;  5DJL A;  4PNG A;  3LYP A;  3QD9 A;  4ECJ A;  3IA1 A;  4POL A;  5DQY A;  3G7J A;  5F0G A;  2HLS A;  2H72 A;  2PMT A;  2R3X A;  4FQU A;  4WF5 A;  1TW9 A;  1SYR A;  2DJ3 A;  5IMD A;  2FWE A;  4JBB A;  4HOJ A;  4YH2 A;  5IO2 A;  2RUE A;  1F3A A;  4HU9 A;  5G1K A;  5FT3 A;  2JU5 A;  2HSY A;  3LSZ A;  3LXT A;  4EL1 A;  2XPD A;  1GNE A;  1Q4J A;  1O8X A;  2KP1 A;  4K7O A;  4JE1 A;  1NSW A;  2ES7 A;  1NW2 A;  2XBQ A;  5CYY A;  5B6N A;  2GLR A;  3CSH A;  1M0U A;  4MMM A;  3DXB A;  3GL5 A;  1KBN A;  2GQL A;  4WR5 A;  1B9X C;  3GSS A;  3ZFL A;  1TI3 A;  3KTL A;  5GAN D;  6GSW A;  4KDU A;  4HDE A;  2O8V B;  4WXT A;  4YAP A;  2H70 A;  4NV5 A;  4FYB A;  4MF7 A;  1WWJ A;  4IBP A;  4HZ4 A;  4I2T A;  3WT1 A;  2ZCT A;  3LXZ A;  6GSY A;  2O7K A;  2F9S A;  2H66 A;  3GYK A;  2LRN A;  4EE0 A;  1PRX A;  3D0Z A;  1JLW A;  5DCH A;  1T4Y A;  1J9B A;  5AN1 A;  1AAZ A;  1S3D A;  1HQO A;  4JR6 A;  2LRC A;  1UN2 A;  4EVM A;  3ED3 A;  3J7Y k;  4IP6 A;  2FA4 A;  3LGC A;  1BYE A;  4I5Q A;  2HZF A;  2B7J A;  4HQS A;  2ON7 A;  4G0K A;  4ZB8 A;  1ACV A;  1EEM A;  3ZML A;  3EC3 A;  1IYH A;  5ECN B;  3IAM 2;  1FB6 A;  3ME8 A;  3TKQ A;  1NHO A;  3BD2 A;  5ECR B;  3RHB A;  3APO A;  13GS A;  5IMF A;  5J3R A;  1EZK A;  2F8F A;  2CT6 A;  1TK0 B;  2PPT A;  3ISO A;  2H74 A;  5DDL A;  3H8Q A;  3KH9 A;  5KN2 A;  4QL7 A;  5KN3 A;  1R5A A;  3GTU A;  1DSB A;  2P5R A;  3OR5 A;  2X8G A;  1O8W A;  1OYJ A;  2GQK A;  1SL2 B;  2WRT A;  2CZ2 A;  1OC8 A;  2QGV A;  1ZOF A;  2X64 A;  1YZX A;  1VF3 A;  1F2E A;  3MDK A;  1GP1 A;  10GS A;  2PGT A;  1XZO A;  3UVT A;  3M8N A;  4KUN A;  1QXH A;  4GRF A;  2DJJ A;  3GL3 A;  4BWQ A;  3UAP A;  4IP1 A;  1O73 A;  2YOI A;  2H01 A;  4AJ6 A;  5ECS A;  4LL4 B;  2WDU A;  2X99 A;  1XOA A;  1GUL A;  1WP0 A;  4BPY A;  1F37 A;  1K0O A;  1XWC A;  2YV9 A;  1YDK A;  3IDV A;  2RII A;  3EMP A;  2C3N A;  5KN0 A;  1K0D A;  3GTU B;  3DYR A;  2DBC A;  1USB A;  1E2Y A;  3BBY A;  1GTB A;  1YJ6 A;  1DUG A;  3HCZ A;  2DJ1 A;  2N5F A;  5ID2 A;  4V1A p;  1B8X A;  2VM2 A;  2L6D A;  2H0I A;  4TR0 A;  1BG5 A;  3IHQ A;  4EF0 A;  2GTU A;  8GSS A;  3L0H A;  3EE2 A;  3LOR A;  4MLY A;  5G2Z A;  3TCO A;  5C00 A;  3W6G A;  5A4W A;  1B48 A;  5HFK A;  5G5E A;  1TTZ A;  4Z7X A;  2C1Y A;  2WJU A;  1Z9H A;  4WBJ A;  3ZVJ A;  2JL4 A;  2H19 A;  1I5G A;  2FD3 A;  3LYK A;  4ECI A;  4QQ7 A;  5F06 A;  3TDG A;  18GS A;  4ZIL A;  4FYC A;  4K7N A;  5GZZ B;  2YJ7 A;  4AF2 A;  4K2D A;  4GST A;  4TVE A;  1MDI A;  4F0C A;  3GX8 A;  1XXU A;  5ID2 B;  1OE8 A;  3EU3 A;  4LMV A;  4J57 E;  4AJ7 A;  4MF5 A;  1TJD A;  3UEM A;  3TKS A;  5JWR B;  2UZ8 A;  2GQM A;  4GTU A;  4ID0 A;  1LU4 A;  4GSS A;  4HJM A;  4NMU A;  4DSR A;  1QMV A;  1JZW A;  4NHZ A;  4EDZ A;  4OWY A;  4LL1 B;  3KMO A;  1ZGN A;  3IXR A;  4YQV A;  1VF4 A;  1I9D A; 
#chains in the Genus database with same CATH topology
 1TK5 B;  3ERG A;  2CA8 A;  1FW1 A;  1AQW A;  2VLT A;  1XIY A;  5F05 A;  1SD9 A;  2YP6 A;  2PBJ A;  2MMN A;  4TN8 A;  2DMM A;  1ZMA A;  2IFQ A;  4GQF A;  3O3T A;  5ELA A;  3BCK A;  2H6Z A;  2LQQ A;  1RK4 A;  5DAL A;  1X5D A;  1XG8 A;  4PHZ C;  1GH2 A;  4ZL7 A;  1PX7 A;  1PSQ A;  1TRW A;  2CX4 A;  1KTE A;  1EEJ A;  1SU9 A;  4X0X A;  3CTG A;  5G1L A;  5AIX A;  1YF0 A;  2C3T A;  2BMX A;  5J9B A;  1I1I P;  3DRN A;  3CRT A;  1M3I A;  3FZ4 A;  2WVX A;  3KP8 A;  2DJK A;  3US3 A;  5JCW A;  4F9Z A;  2EC4 A;  2X49 A;  2IMK A;  2L4C A;  4G01 A;  3IK7 A;  2MZC A;  1WIK A;  1WOU A;  4KH7 A;  3DVW A;  1AQV A;  2FWG A;  3CTF A;  5EPF A;  3GST A;  4NAX A;  3APS A;  1ILO A;  4EXJ A;  3CXG A;  1YEX A;  2L57 A;  5COH A;  3EUR A;  5D9W A;  3APQ A;  2ZNM A;  3GUR A;  5H5R A;  1TRS A;  3RBT A;  2HT9 A;  3A5W A;  3PH9 A;  5B8B A;  2YWN A;  3H93 A;  2IFQ B;  4O5U A;  5D9T A;  3WYW A;  3O6T A;  2JZT A;  4FIW A;  4OO4 A;  1PX6 A;  1PMT A;  1SL1 B;  5DQS A;  1A2M A;  4XRA A;  1TI1 A;  2WCI A;  4IN0 A;  2O5V A;  4ZIJ A;  1ZYQ B;  3HVX A;  2WVX B;  2L59 A;  1ERU A;  2LEG A;  3HXS A;  2B5Y A;  1B4Q A;  2KLX A;  2JZS A;  1WRY A;  4DEJ A;  3KD0 A;  4GCI A;  2C80 A;  3CSJ A;  1K3Y A;  1A23 A;  2WB9 A;  2GSS A;  5ECH B;  5ECK B;  1Z7R A;  2HI7 A;  3UIW A;  2EIO A;  1Z6N A;  3QCP A;  5IOW A;  1CQG A;  5CRG A;  1SJ6 A;  2IJY A;  3UMA A;  1SVO A;  2GDR A;  2VUP A;  2H75 A;  5C04 A;  2OAC A;  4F03 A;  1WE0 A;  1ERT A;  1N8J A;  4MJA A;  3EYT A;  2WS2 A;  4LA1 A;  4IEL A;  4PUF C;  2D2Z A;  3IK9 A;  3G9B A;  4A5P A;  5F8B A;  2E7P A;  2GS3 A;  1PL1 A;  2X8H A;  1YQ1 A;  1RW1 A;  3TKR A;  2K8V A;  2MMO A;  2K18 A;  4OCF A;  3DIE A;  3L9V A;  5J5N A;  2LJR A;  3FEU A;  2MBT A;  3G7Y A;  4MNN A;  4PNF A;  1TRU A;  3TRX A;  2X8C A;  1M2B A;  1M99 A;  3A2W A;  1THX A;  5B8A A;  2XBI A;  2KOK A;  1V98 A;  5ECP B;  4MA9 A;  1FVJ A;  1TOF A;  2IIY A;  6GSS A;  1FHE A;  2A2P A;  4QL9 A;  1BG1 A;  2WVY A;  5G31 A;  4HU7 A;  3HJP A;  3VI7 A;  2B5X A;  5AIV A;  4K2X A;  3GFK A;  5E4W A;  1XW6 A;  3HA9 A;  4MZW A;  3TKS E;  5J9C A;  2HQT A;  4USS A;  2GSQ A;  4WBR D;  1NHY A;  1M9A A;  2H1G A;  2IWT A;  4IQA A;  3GA4 A;  2HNL A;  3GKM A;  4HQZ A;  3U6V A;  2VL3 A;  2LS5 A;  4RI7 A;  1XVQ A;  5J41 A;  3GX0 A;  1S3R A;  2FY6 A;  3GH6 A;  4NV2 A;  16GS A;  1R26 A;  1EGR A;  2QC7 A;  2HZE A;  1EV9 A;  1Z6M A;  3H1N A;  4KAE A;  1OAZ A;  4MPF A;  3VPT A;  3MSZ A;  4NHW A;  2FNO A;  2V1M A;  3L4N A;  2LV3 A;  4EIQ A;  1GLQ A;  3TJJ A;  1X5E A;  3EU4 A;  3IE3 A;  4FH8 A;  3ZRD A;  3HVV A;  3G7I A;  1V57 A;  2EFD A;  2K8S A;  2MMZ A;  1VF2 A;  2MMA A;  1GUM A;  2WUL A;  1U3A A;  4MJC A;  4BVX A;  1TP9 A;  2LNT A;  1JHB A;  3D5J A;  3HJO A;  1TDI A;  1MDK A;  3MNG A;  2OE0 A;  4EUY A;  4MP4 A;  2YZH A;  1BQ7 A;  1O85 A;  5EL8 A;  2R5G A;  4RI6 A;  4ULX A;  1F6M C;  4NPB A;  4OFN A;  3HY2 A;  3I9V 2;  3HYP A;  1ERV A;  4X4J A;  2LRT A;  5HR1 A;  1U3I A;  1R5P A;  1ZYE A;  1XOB A;  1SJZ A;  1EOH A;  19GS A;  4Z2R A;  4IQ1 A;  3GIX A;  2WFC A;  5AGY A;  2O3E A;  3TGZ A;  4Q5N A;  5CP1 A;  1VGL A;  1QFN A;  2HRK A;  1AIU A;  2CX3 A;  1G6Y A;  2XPE A;  2RM5 A;  4OO5 A;  2HRA A;  1AQX A;  4KSO A;  2I1U A;  2C3Q A;  3FHK A;  3M1G A;  3IBH A;  2OT3 A;  2L4Q A;  1GSE A;  4FO5 A;  2WZ9 A;  4GLT A;  3HJM A;  1GLP A;  4XTS A;  3IOS A;  1XWB A;  1OKT A;  2FGX A;  3IC4 A;  4TXV A;  1GWC A;  1JZO A;  2AJQ B;  3FZA A;  2NPB A;  3NIV A;  6GSV A;  5J4V A;  1H75 A;  1QK8 A;  4J2F A;  3I6A A;  5IQY A;  3GN3 A;  1FO5 A;  2A2R A;  3HHV A;  1QGV A;  3R2Q A;  4XS1 A;  2OE1 A;  2PVQ A;  5A4U A;  3TUE A;  1T1V A;  3E3E A;  2HRK B;  3TOT A;  3QOU A;  4G19 A;  1GUH A;  3KTB A;  3C8E A;  3R3E A;  3SWL A;  2A2S A;  2WGR A;  3LEF A;  2H1A A;  3TKS C;  2LNS A;  2REM A;  3IPZ A;  12GS A;  2LST A;  4LMW A;  2QSI A;  4P3Y B;  4BVY A;  1Y6E A;  4KGI A;  2RLI A;  1HD2 A;  4TKY A;  4F2I A;  4YKG A;  3TOU A;  2G2Q A;  3N9J A;  4WR4 A;  3P90 A;  3DD3 A;  4AKH A;  4KDY A;  5DVB A;  3TJF A;  5GAP D;  5GST A;  1MDJ A;  3H4K A;  3KH7 A;  3QDN A;  1TXU A;  2WW2 A;  2TIR A;  3F4T A;  4RQR A;  1GSD A;  1RQM A;  2IME A;  3CBU A;  6GST A;  2LTK A;  2OBI A;  4YQU A;  2JAD A;  2EIQ A;  2I81 A;  5JWO B;  2WW3 A;  4RUV A;  5IMV A;  1OE7 A;  1WPI A;  4HZ2 A;  2VLV A;  3JCM L;  2GVP A;  3W8S A;  4MAB A;  4Q5Q A;  3FYG A;  3TRQ A;  1M9B A;  4Q5F A;  2CVK A;  4TXO A;  4IJ3 A;  3LG6 A;  4BVY B;  2H76 A;  2KUC A;  4IKH A;  3WGE A;  3DML A;  1B9Y C;  3O76 A;  2O36 A;  3BCI A;  3E9J B;  5B6M A;  2DJ2 A;  2V6O A;  2V32 A;  2G0F A;  7GSS A;  2OE3 A;  4WET A;  5HR0 A;  3A3T A;  2HRN A;  2CAQ A;  3VUR A;  3C71 A;  2Z9S A;  1BJX A;  1ZYP A;  4K5S A;  3GUS A;  4AGS A;  4N10 A;  5DBQ A;  3Q74 A;  4ZXG A;  3TB2 A;  3QAW A;  3MIX A;  2F51 A;  4KE3 A;  3EWL A;  1M2D A;  2VCT A;  14GS A;  1MD4 A;  1GSQ A;  4K9Z A;  4PQ1 A;  1DBY A;  5CRW A;  2FWH A;  3I43 A;  5D8I A;  3QFA C;  2DC5 A;  3NOF A;  4MH2 A;  1A0R P;  4I8B A;  3A2V A;  5DAK A;  2DLX A;  4CW9 A;  2VO4 A;  2XC2 A;  4TXO B;  5G30 A;  5JCG A;  1T7P B;  3BOA A;  4V2L A;  4O7H A;  1K0M A;  1GSU A;  2O87 A;  2VLU A;  3VWV A;  1K3L A;  5IPH A;  1HYU A;  3KM6 A;  4RQX A;  3KIJ A;  4O5Q A;  3QR6 A;  2WW1 A;  3ZL5 A;  2J9H A;  2N5A A;  1FOH A;  3L9S A;  2M46 A;  3F0I A;  1A2J A;  1UC7 A;  4IW9 A;  2O85 A;  4TOP A;  3PR8 A;  1FG4 A;  2VL9 A;  2E0Q A;  2DKH A;  2UV8 G;  4POM A;  2LQO A;  2K9F A;  4OCE A;  4PUA A;  3F4S A;  3FR3 A;  5IO0 A;  4ZBD A;  5CRH A;  4XCS A;  2H6X A;  1Z7P A;  2GT5 A;  3RPN A;  1GTI A;  1OC9 A;  5LNK e;  3MYD A;  4ILF A;  5AIS A;  2VD1 A;  3F8U A;  4K7I A;  4FYU A;  3TU3 B;  5ECL B;  5DAK B;  3ZMK A;  5CNW A;  1KNG A;  4MCU A;  5ECO B;  4KX4 A;  5CRE A;  3WGX A;  2H6Y A;  2YJH A;  4JR4 A;  2GZP A;  4Z2T A;  1ABA A;  4F0B A;  3P8W A;  4MF6 A;  2X4A A;  5E59 A;  1WJK A;  4CHS A;  1PD2 1;  2AHE A;  4F82 A;  5JWQ B;  3D4T A;  3M9K A;  2GT6 A;  1XW9 A;  3UOM A;  1SD8 A;  4ML6 A;  1K3O A;  1SVM A;  4K0N A;  4N30 A;  3ZTL A;  1T3B A;  4G10 A;  5LCZ A;  4PUR A;  4XS6 A;  5DAL B;  2VCZ A;  2B7K A;  2PWJ A;  2HSM A;  2V6K A;  4ZB6 A;  3WT2 A;  3RDW A;  2KP2 A;  2VCX A;  3UAR A;  2LJK A;  4AJ8 A;  1HNC A;  5D93 A;  3KJY A;  3FKF A;  4NWY A;  2J23 A;  3F6D A;  2C8U A;  2HFD A;  3F3R A;  1XVW A;  2VCW A;  2JZR A;  2YWM A;  4HEA 2;  5ABR A;  2VCQ A;  4I2U A;  3ZLP A;  3KEB A;  2A4V A;  2GGT A;  1BF5 A;  3N5O A;  2LJA A;  4PI0 C;  1X5C A;  1EGO A;  4HSC X;  3ZFB A;  3KXO A;  3FMW A;  4BWS A;  2HE3 A;  1GRX A;  3HMJ G;  3ZRE A;  1A8Y A;  3ZZX A;  1S3A A;  2VL2 C;  20GS A;  2R37 A;  3FK8 A;  1M2A A;  1SKR B;  1GUK A;  9GSS A;  2BTO T;  2O89 A;  4L0U A;  4TW5 A;  4XRD A;  1XFL A;  5HR2 A;  2F3M A;  1PQN A;  5IPG A;  2HSM B;  1U6T A;  2V41 A;  3F4R A;  1TU7 A;  1JFU A;  5G5F A;  3ZIJ A;  2NVL A;  1JLV A;  3CMI A;  4ECC A;  2ZUP A;  3D21 A;  1QQ2 A;  2CV4 A;  3ZIT A;  1M7T A;  5JCU A;  4X1U A;  3D4M A;  2YWO A;  11GS A;  4ZL8 A;  3LJR A;  2E2G A;  1YY7 A;  5CRD A;  2CAI A;  2OA7 A;  5KOW A;  2P31 A;  1X9W B;  4CY6 A;  2YAN A;  1M3J A;  3VPQ A;  4L5O A;  2EFC A;  3M3M A;  5INY A;  2PN8 A;  2YCD A;  2DJ0 A;  2YPM A;  4PTS A;  2B6M A;  4K1F A;  1OVN A;  3MWH A;  2FHE A;  2R6K A;  1C72 A;  2QKE A;  3DVX A;  1X0R A;  1KEB A;  4BL7 A;  2MYG A;  3C1R A;  2NDO A;  4K6X A;  1G7O A;  3F6F A;  3DEX A;  3D6I A;  1G0T A;  4AKI A;  2M72 A;  3HVS A;  3UBL A;  3QFB C;  1EV4 A;  1X9M B;  3GKN A;  5KEJ A;  2CZ3 A;  3HZ4 A;  1TK8 B;  4XIH A;  4G2E A;  2R2J A;  4I6X A;  3ERF A;  4L5L A;  3RPP A;  6GSX A;  3C7M A;  1ZYN A;  3GKX A;  2IMI A;  5F07 A;  2DML A;  4ISD A;  1GSS A;  4K5R A;  1R7H A;  4Q5R A;  2VL2 A;  4PXO A;  1X9S B;  2DSA A;  3VLN A;  3QAG A;  4GWR A;  3GV1 A;  2QA1 A;  3F3Q A;  1GSY A;  1O6J A;  4XHM A;  4BL7 B;  2IMD A;  3Q18 A;  3IR4 A;  2I3Y A;  3HDC A;  1EOG A;  5CO3 A;  3ERW A;  4D73 A;  2JSY A;  3DKS A;  1XCC A;  4OFT A;  4IGJ A;  4IS0 A;  5D73 A;  1E6B A;  1ML6 A;  4TRX A;  2KHP A;  1UVZ A;  2WVZ A;  4PQH A;  3FW2 A;  4MH3 A;  2RUF A;  1TRV A;  1BAY A;  4GF0 A;  4ZB7 A;  2R4V A;  4PI2 C;  4MDC A;  3LFL A;  3IAS 2;  1PA3 A;  5DCG A;  5J47 A;  4FXY P;  2B1L A;  1IYI A;  2QA2 A;  1FAA A;  3HKR A;  1EP8 A;  3KGK A;  1XWK A;  3GNJ A;  5HFG A;  1ZL9 A;  5KN1 A;  5FWG A;  4E8E A;  3L9U A;  4Z2U A;  3W8J A;  2HZE B;  4EC0 A;  4OFM A;  4N3Z A;  4D73 B;  4WF4 A;  1PGT A;  3F9U A;  2FA8 A;  2H0G A;  3PGT A;  3Q19 A;  1W89 A;  4BIK A;  3IV4 A;  3VWW A;  1JZR A;  5J4Y A;  4ZL9 A;  2LKU A;  4L0W A;  2HSH A;  3HZ8 A;  5ECQ B;  4MJB A;  1SJI A;  2H73 A;  2H0H A;  2TRX A;  1K0B A;  3QAV A;  2L5L A;  1URM A;  4OD7 A;  2V2G A;  3CRU A;  4BVX B;  3TJB A;  2AUV A;  2MBS A;  1FVK A;  2E2M A;  2EIR A;  4KCE A;  3ZYW A;  3EIN A;  1ERW A;  2TRC P;  1W4V A;  4EIP A;  4N0Z A;  1AW9 A;  4DVC A;  5IM9 A;  1ZZY A;  5IMC A;  1SK0 A;  2BJX A;  1GL8 A;  1OC3 A;  2FCH A;  4IJI A;  2R0P A;  5H5S A;  4KSM A;  3CQF A;  2CQ9 A;  3IC8 A;  3TRP A;  1K0N A;  1U88 A;  1OKD A;  1YEW C;  2AYT A;  2GST A;  2YZU A;  1G6W A;  2WZS A;  1DE2 A;  4MJE A;  1TKD B;  3DWV A;  3A5I A;  3VWU A;  5ENU A;  1Q98 A;  4E68 A;  4O32 A;  4KW6 A;  2OKA A;  1VF1 A;  2H1D A;  1HNA A;  3QPM A;  5D9V A;  2F8A A;  2I4A A;  1DE1 A;  1V2A A;  2PUK C;  3QMX A;  2C0E A;  1V58 A;  4V1A g;  4X43 A;  5H5Q A;  1UA5 A;  1WMJ A;  5KOX A;  3KMN A;  2N5B A;  1SKW B;  3F63 A;  3IRA A;  4HJ2 A;  1XPV A;  3FR6 A;  2CVB A;  1GSF A;  3LQ7 A;  1YF1 A;  1XWG A;  4ECB A;  17GS A;  5LD0 A;  4LLR A;  2VCV A;  5FHI A;  5HQP A;  2LUS A;  2FUG 2;  1FOV A;  4O5R A;  2L6C A;  4NXI A;  3C1S A;  4DSQ A;  4POB A;  2IN3 A;  1K0C A;  1MTC A;  3A2X A;  1BED A;  1MD3 A;  2PER A;  3FZ9 A;  2AB6 A;  5A5K A;  2AAW A;  3GMF A;  3P2A A;  3GRX A;  4KA0 A;  1PKZ A;  2OJL A;  3NZN A;  3AY8 A;  5J40 A;  1LJR A;  3UJ1 A;  4KND A;  1SK2 A;  5ECM B;  4MK3 A;  4N0V A;  3ME7 A;  1YEP A;  3KCM A;  2HXK A;  1N2A A;  5IMZ A;  4HI7 A;  3UVH A;  2YWI A;  3FRC A;  5HFI A;  1Z5Y E;  4J56 E;  2B3S A;  4TR1 A;  1GNW A;  2HRF A;  1ON4 A;  4AKG A;  1A8L A;  2NTO A;  2ON5 A;  2C0G A;  4K0G A;  4PQI A;  2P0G A;  3RAZ A;  2YV7 A;  4G0I A;  2PVO C;  4IVF A;  4ACS A;  1TU8 A;  22GS A;  4JZQ A;  2HYX A;  4GXZ A;  4IHU A;  2JAC A;  2YN1 A;  4DSS A;  4WEY A;  1AC1 A;  1PKW A;  2JSZ A;  2P5Q A;  4ZBB A;  4BA7 A;  1J0F A;  1N25 A;  1GTA A;  1V9W A;  2DIY A;  3L78 A;  4YAV A;  4JRR A;  2EFH A;  1MEK A;  2C0F A;  1PFO A;  3TJG A;  5CAX A;  4TR1 B;  5HR3 A;  1CQH A;  4MZB A;  1F9M A;  5GSS A;  2C0D A;  4L8E A;  5A5H A;  2B5E A;  4KB3 A;  5BRT A;  4HS1 A;  2NBS A;  1LBK A;  2ALB A;  5B7C A;  5IIZ A;  3UL3 A;  3SBC A;  1U87 A;  1A24 A;  1K0A A;  3J7Y b;  4YQM A;  3ZVJ D;  1THO A;  1H4O A;  1NM3 A;  4EKZ A;  4DSS B;  1G7E A;  1B4P A;  4POK A;  3V1W A;  3RHC A;  1JZD A;  4ZB9 A;  1EWX A;  1VRS D;  5ELG A;  1Y1U A;  2DKI A;  5BMU A;  1QUW A;  4V2N A;  3HVN A;  1SKS B;  4WKW A;  1PN9 A;  2AV4 A;  1AUC A;  3VFI A;  5EY6 A;  1YKA A;  2B1K A;  5ECI B;  4ML1 A;  2FWF A;  3KP9 A;  4AKX B;  3MAK A;  3CSI A;  4EDY A;  4KDX A;  2VKZ G;  3FZ5 A;  5EVO A;  3VI5 A;  1T4Z A;  4N11 A;  3IHG A;  5A5H B;  4YKF A;  3EMX A;  3K8N A;  2H1L A;  1PL2 A;  5L71 A;  2H1B A;  5D96 A;  2EFE A;  2VOC A;  1PN0 A;  1BX9 A;  3HD5 A;  3DGQ A;  3CYN A;  1XW5 A;  3EVI A;  3Q6O A;  2OBK A;  1OC9 B;  1FB0 A;  1SEN A;  3S9F A;  2R0G A;  2M80 A;  4GSN A;  4MPG A;  4H86 A;  3TKP A;  4XS4 A;  2VM1 A;  2L5O A;  5BMU B;  4PX1 A;  1SYX A;  3ZIV A;  2HSN A;  2GSR A;  2H8L A;  4V2M A;  2VIM A;  1YKC A;  1TXX A;  1T00 A;  3LWA A;  4TR4 A;  3PPU A;  3M9J A;  3KZQ A;  5IOX A;  1YVL A;  1XWA A;  2I9H A;  4O92 A;  4JED A;  2H71 A;  1S3C A;  5DJM A;  6GSU A;  2RM6 A;  1A2L A;  2GZY A;  4KF9 A;  2CVD A;  4TR3 A;  3VWX A;  4KCA A;  2PU9 C;  4I97 A;  1F3B A;  4K8M A;  1Y25 A;  4MZC A;  2A4H A;  2DIZ A;  4HUA A;  3GKK A;  2H30 A;  4XS4 B;  3VK9 A;  2GZZ A;  4JU5 A;  3TJK A;  3WGD A;  1Z3E A;  1ST9 A;  2IL3 A;  1T8E B;  2HSN B;  3FY7 A;  1SL0 B;  2IPA A;  5D9X A;  1XBS A;  2IMF A;  2VAF A;  5IMA A;  5J4U A;  4PGT A;  4EO3 A;  3GHA A;  4OMV A;  3UBK A;  1SK1 A;  3M0F A;  3I69 A;  4CDO A;  1O7U A;  2K6V A;  1EP7 A;  2FLS A;  3BJ5 A;  3E0U A;  3GH9 A;  1R4W A;  5A4V A;  3C73 A;  3H79 A;  2C4J A;  3U5R E;  1AXD A;  2YNX A;  3P7X A;  1GTU A;  2XHF A;  4G0L A;  1O81 A;  3FR9 A;  3D22 A;  2VD0 A;  1J08 A;  3PIN A;  3WD6 A;  4GQC A;  1A0F A;  1ZCP A;  4ZBA A;  1HNB A;  4G9H A;  4E8H A;  2OAD A;  1V40 A;  5DJL A;  4PNG A;  3LYP A;  3QD9 A;  4ECJ A;  3IA1 A;  4POL A;  5DQY A;  3G7J A;  5F0G A;  2HLS A;  2H72 A;  2PMT A;  2R3X A;  4FQU A;  4WF5 A;  1TW9 A;  1SYR A;  2DJ3 A;  5IMD A;  2FWE A;  4JBB A;  4HOJ A;  4YH2 A;  5IO2 A;  2RUE A;  1F3A A;  4HU9 A;  5G1K A;  5FT3 A;  2JU5 A;  2HSY A;  3LSZ A;  3LXT A;  4EL1 A;  2XPD A;  1GNE A;  1Q4J A;  1O8X A;  2KP1 A;  4K7O A;  4JE1 A;  1NSW A;  2ES7 A;  1NW2 A;  2XBQ A;  5CYY A;  5B6N A;  2GLR A;  4QMK A;  3CSH A;  1M0U A;  4MMM A;  3DXB A;  3GL5 A;  1KBN A;  2GQL A;  4WR5 A;  1B9X C;  3GSS A;  3ZFL A;  1TI3 A;  3KTL A;  5GAN D;  6GSW A;  4KDU A;  4HDE A;  2O8V B;  4WXT A;  4YAP A;  2H70 A;  4NV5 A;  4FYB A;  4MF7 A;  1WWJ A;  4IBP A;  4HZ4 A;  4I2T A;  3WT1 A;  2ZCT A;  3LXZ A;  6GSY A;  2O7K A;  2F9S A;  2H66 A;  3GYK A;  2LRN A;  4GDF A;  4EE0 A;  1PRX A;  3D0Z A;  1JLW A;  5DCH A;  1T4Y A;  1J9B A;  5AN1 A;  1AAZ A;  1S3D A;  1HQO A;  4JR6 A;  2LRC A;  1UN2 A;  4EVM A;  3ED3 A;  3J7Y k;  4IP6 A;  2FA4 A;  3LGC A;  1BYE A;  4I5Q A;  2HZF A;  2B7J A;  4HQS A;  2ON7 A;  4G0K A;  4ZB8 A;  1ACV A;  1EEM A;  3ZML A;  3EC3 A;  1IYH A;  5ECN B;  3IAM 2;  1FB6 A;  3ME8 A;  3TKQ A;  1NHO A;  3BD2 A;  5ECR B;  3RHB A;  3APO A;  13GS A;  5IMF A;  5J3R A;  1EZK A;  2F8F A;  2CT6 A;  1TK0 B;  2PPT A;  3ISO A;  2H74 A;  5DDL A;  3H8Q A;  3KH9 A;  2WW0 A;  5KN2 A;  4QL7 A;  5KN3 A;  1R5A A;  3GTU A;  1DSB A;  2P5R A;  3LW9 A;  3OR5 A;  2R0C A;  2X8G A;  1O8W A;  1OYJ A;  2GQK A;  1SL2 B;  2WRT A;  2CZ2 A;  1OC8 A;  2QGV A;  4AI6 A;  1ZOF A;  2X64 A;  1YZX A;  1VF3 A;  1F2E A;  3MDK A;  1GP1 A;  10GS A;  2PGT A;  1XZO A;  3UVT A;  3M8N A;  4KUN A;  1QXH A;  4GRF A;  2DJJ A;  1S4B P;  3GL3 A;  4BWQ A;  3UAP A;  5A34 A;  4IP1 A;  1O73 A;  2YOI A;  2H01 A;  4AJ6 A;  5ECS A;  4LL4 B;  2WDU A;  2X99 A;  1XOA A;  1GUL A;  1WP0 A;  4BPY A;  5A1N A;  1F37 A;  1K0O A;  1XWC A;  2YV9 A;  1YDK A;  3IDV A;  2RII A;  3EMP A;  2C3N A;  5KN0 A;  1K0D A;  3GTU B;  3DYR A;  2DBC A;  1USB A;  1E2Y A;  3RGB C;  3CHX C;  3BBY A;  3EPT A;  1GTB A;  1YJ6 A;  1DUG A;  3HCZ A;  2DJ1 A;  2N5F A;  5ID2 A;  4V1A p;  1B8X A;  2VM2 A;  2L6D A;  2H0I A;  4TR0 A;  1BG5 A;  3IHQ A;  4EF0 A;  2GTU A;  8GSS A;  3L0H A;  3EE2 A;  3LOR A;  4MLY A;  5G2Z A;  3TCO A;  5C00 A;  3W6G A;  5A4W A;  1B48 A;  5HFK A;  5G5E A;  3CWG A;  1TTZ A;  1SVL A;  4Z7X A;  5A34 B;  2C1Y A;  2WJU A;  1Z9H A;  4WBJ A;  3ZVJ A;  2JL4 A;  2H19 A;  1I5G A;  2FD3 A;  5A1N B;  3LYK A;  4ECI A;  4QQ7 A;  5F06 A;  3TDG A;  18GS A;  3RFR C;  4ZIL A;  4FYC A;  4K7N A;  5GZZ B;  2YJ7 A;  4AF2 A;  4K2D A;  4GST A;  4TVE A;  1MDI A;  4F0C A;  4W66 A;  3GX8 A;  1XXU A;  5ID2 B;  1OE8 A;  4ICY A;  3EU3 A;  4LMV A;  4J57 E;  4AJ7 A;  4MF5 A;  1TJD A;  3UEM A;  3TKS A;  5JWR B;  2UZ8 A;  2GQM A;  4GTU A;  4ID0 A;  1LU4 A;  4GSS A;  4HJM A;  4NMU A;  4DSR A;  1QMV A;  1JZW A;  4NHZ A;  4EDZ A;  4OWY A;  4LL1 B;  4CY8 A;  3KMO A;  1ZGN A;  3IXR A;  4YQV A;  1VF4 A;  1I9D A; 
#chains in the Genus database with same CATH homology
 1TK5 B;  3ERG A;  2CA8 A;  1FW1 A;  1AQW A;  2VLT A;  1XIY A;  5F05 A;  1SD9 A;  2YP6 A;  2PBJ A;  2MMN A;  4TN8 A;  2DMM A;  1ZMA A;  2IFQ A;  4GQF A;  3O3T A;  5ELA A;  3BCK A;  2H6Z A;  2LQQ A;  1RK4 A;  5DAL A;  1X5D A;  1GH2 A;  4ZL7 A;  1PX7 A;  1PSQ A;  1TRW A;  2CX4 A;  1KTE A;  1EEJ A;  1SU9 A;  4X0X A;  3CTG A;  5G1L A;  5AIX A;  1YF0 A;  2C3T A;  2BMX A;  5J9B A;  3DRN A;  3CRT A;  3FZ4 A;  3KP8 A;  2DJK A;  3US3 A;  5JCW A;  4F9Z A;  2EC4 A;  2X49 A;  2IMK A;  2L4C A;  4G01 A;  3IK7 A;  2MZC A;  1WIK A;  1WOU A;  4KH7 A;  3DVW A;  1AQV A;  2FWG A;  3CTF A;  5EPF A;  3GST A;  4NAX A;  3APS A;  1ILO A;  4EXJ A;  3CXG A;  1YEX A;  2L57 A;  5COH A;  3EUR A;  5D9W A;  3APQ A;  2ZNM A;  3GUR A;  5H5R A;  1TRS A;  3RBT A;  2HT9 A;  3A5W A;  3PH9 A;  5B8B A;  2YWN A;  3H93 A;  2IFQ B;  4O5U A;  5D9T A;  3WYW A;  3O6T A;  2JZT A;  4FIW A;  4OO4 A;  1PX6 A;  1PMT A;  1SL1 B;  5DQS A;  1A2M A;  4XRA A;  1TI1 A;  2WCI A;  4IN0 A;  2O5V A;  4ZIJ A;  1ZYQ B;  3HVX A;  2L59 A;  1ERU A;  2LEG A;  3HXS A;  2B5Y A;  1B4Q A;  2KLX A;  2JZS A;  1WRY A;  4DEJ A;  3KD0 A;  4GCI A;  2C80 A;  3CSJ A;  1K3Y A;  1A23 A;  2WB9 A;  2GSS A;  5ECH B;  5ECK B;  1Z7R A;  2HI7 A;  3UIW A;  2EIO A;  1Z6N A;  3QCP A;  5IOW A;  1CQG A;  5CRG A;  1SJ6 A;  2IJY A;  3UMA A;  1SVO A;  2GDR A;  2VUP A;  2H75 A;  5C04 A;  2OAC A;  4F03 A;  1WE0 A;  1ERT A;  1N8J A;  4MJA A;  3EYT A;  2WS2 A;  4LA1 A;  4IEL A;  4PUF C;  2D2Z A;  3IK9 A;  3G9B A;  4A5P A;  5F8B A;  2E7P A;  2GS3 A;  1PL1 A;  2X8H A;  1YQ1 A;  1RW1 A;  3TKR A;  2K8V A;  2MMO A;  2K18 A;  4OCF A;  3DIE A;  3L9V A;  5J5N A;  2LJR A;  3FEU A;  2MBT A;  3G7Y A;  4MNN A;  4PNF A;  1TRU A;  3TRX A;  2X8C A;  1M2B A;  1M99 A;  3A2W A;  1THX A;  5B8A A;  2XBI A;  2KOK A;  1V98 A;  5ECP B;  4MA9 A;  1FVJ A;  1TOF A;  2IIY A;  6GSS A;  1FHE A;  2A2P A;  4QL9 A;  1BG1 A;  5G31 A;  4HU7 A;  3HJP A;  3VI7 A;  2B5X A;  5AIV A;  4K2X A;  3GFK A;  5E4W A;  1XW6 A;  3HA9 A;  4MZW A;  3TKS E;  5J9C A;  2HQT A;  4USS A;  2GSQ A;  4WBR D;  1NHY A;  1M9A A;  2H1G A;  2IWT A;  4IQA A;  3GA4 A;  2HNL A;  3GKM A;  4HQZ A;  3U6V A;  2VL3 A;  2LS5 A;  4RI7 A;  1XVQ A;  5J41 A;  3GX0 A;  2FY6 A;  3GH6 A;  4NV2 A;  16GS A;  1R26 A;  1EGR A;  2QC7 A;  2HZE A;  1EV9 A;  1Z6M A;  3H1N A;  4KAE A;  1OAZ A;  4MPF A;  3VPT A;  3MSZ A;  4NHW A;  2FNO A;  2V1M A;  3L4N A;  2LV3 A;  4EIQ A;  1GLQ A;  3TJJ A;  1X5E A;  3EU4 A;  3IE3 A;  4FH8 A;  3ZRD A;  3HVV A;  3G7I A;  1V57 A;  2EFD A;  2K8S A;  2MMZ A;  1VF2 A;  2MMA A;  1GUM A;  2WUL A;  1U3A A;  4MJC A;  4BVX A;  1TP9 A;  2LNT A;  1JHB A;  3D5J A;  3HJO A;  1TDI A;  1MDK A;  3MNG A;  2OE0 A;  4EUY A;  4MP4 A;  2YZH A;  1BQ7 A;  1O85 A;  5EL8 A;  2R5G A;  4RI6 A;  4ULX A;  1F6M C;  4NPB A;  4OFN A;  3HY2 A;  3I9V 2;  3HYP A;  1ERV A;  4X4J A;  2LRT A;  5HR1 A;  1U3I A;  1R5P A;  1ZYE A;  1XOB A;  1SJZ A;  1EOH A;  19GS A;  4Z2R A;  4IQ1 A;  3GIX A;  2WFC A;  5AGY A;  3TGZ A;  4Q5N A;  5CP1 A;  1VGL A;  1QFN A;  2HRK A;  1AIU A;  2CX3 A;  1G6Y A;  2XPE A;  2RM5 A;  4OO5 A;  2HRA A;  1AQX A;  4KSO A;  2I1U A;  2C3Q A;  3FHK A;  3M1G A;  3IBH A;  2OT3 A;  2L4Q A;  1GSE A;  4FO5 A;  2WZ9 A;  4GLT A;  3HJM A;  1GLP A;  4XTS A;  3IOS A;  1XWB A;  1OKT A;  2FGX A;  3IC4 A;  4TXV A;  1GWC A;  1JZO A;  2AJQ B;  3FZA A;  2NPB A;  3NIV A;  6GSV A;  5J4V A;  1H75 A;  1QK8 A;  4J2F A;  3I6A A;  5IQY A;  3GN3 A;  1FO5 A;  2A2R A;  3HHV A;  1QGV A;  3R2Q A;  4XS1 A;  2OE1 A;  2PVQ A;  5A4U A;  3TUE A;  1T1V A;  3E3E A;  2HRK B;  3TOT A;  3QOU A;  4G19 A;  1GUH A;  3KTB A;  3C8E A;  3R3E A;  3SWL A;  2A2S A;  2WGR A;  3LEF A;  2H1A A;  3TKS C;  2LNS A;  2REM A;  3IPZ A;  12GS A;  2LST A;  4LMW A;  2QSI A;  4P3Y B;  4BVY A;  1Y6E A;  4KGI A;  2RLI A;  1HD2 A;  4TKY A;  4F2I A;  4YKG A;  3TOU A;  2G2Q A;  3N9J A;  4WR4 A;  3P90 A;  3DD3 A;  4AKH A;  4KDY A;  5DVB A;  3TJF A;  5GAP D;  5GST A;  1MDJ A;  3H4K A;  3KH7 A;  3QDN A;  1TXU A;  2TIR A;  3F4T A;  4RQR A;  1GSD A;  1RQM A;  2IME A;  3CBU A;  6GST A;  2LTK A;  2OBI A;  4YQU A;  2JAD A;  2EIQ A;  2I81 A;  5JWO B;  4RUV A;  5IMV A;  1OE7 A;  1WPI A;  4HZ2 A;  2VLV A;  3JCM L;  2GVP A;  3W8S A;  4MAB A;  4Q5Q A;  3FYG A;  3TRQ A;  1M9B A;  4Q5F A;  2CVK A;  4TXO A;  4IJ3 A;  3LG6 A;  4BVY B;  2H76 A;  2KUC A;  4IKH A;  3WGE A;  3DML A;  1B9Y C;  3O76 A;  3BCI A;  3E9J B;  5B6M A;  2DJ2 A;  2V6O A;  2V32 A;  2G0F A;  7GSS A;  2OE3 A;  4WET A;  5HR0 A;  3A3T A;  2HRN A;  2CAQ A;  3VUR A;  3C71 A;  2Z9S A;  1BJX A;  1ZYP A;  4K5S A;  3GUS A;  4AGS A;  4N10 A;  5DBQ A;  3Q74 A;  4ZXG A;  3TB2 A;  3QAW A;  3MIX A;  2F51 A;  4KE3 A;  3EWL A;  1M2D A;  2VCT A;  14GS A;  1MD4 A;  1GSQ A;  4K9Z A;  4PQ1 A;  1DBY A;  5CRW A;  2FWH A;  3I43 A;  5D8I A;  3QFA C;  2DC5 A;  3NOF A;  4MH2 A;  1A0R P;  4I8B A;  3A2V A;  5DAK A;  2DLX A;  4CW9 A;  2VO4 A;  2XC2 A;  4TXO B;  5G30 A;  5JCG A;  1T7P B;  3BOA A;  4V2L A;  4O7H A;  1K0M A;  1GSU A;  2O87 A;  2VLU A;  3VWV A;  1K3L A;  5IPH A;  1HYU A;  3KM6 A;  4RQX A;  3KIJ A;  4O5Q A;  3QR6 A;  3ZL5 A;  2J9H A;  2N5A A;  1FOH A;  3L9S A;  2M46 A;  3F0I A;  1A2J A;  1UC7 A;  4IW9 A;  2O85 A;  4TOP A;  3PR8 A;  1FG4 A;  2VL9 A;  2E0Q A;  2DKH A;  2UV8 G;  4POM A;  2LQO A;  2K9F A;  4OCE A;  4PUA A;  3F4S A;  3FR3 A;  5IO0 A;  4ZBD A;  5CRH A;  4XCS A;  2H6X A;  1Z7P A;  2GT5 A;  3RPN A;  1GTI A;  1OC9 A;  5LNK e;  3MYD A;  4ILF A;  5AIS A;  2VD1 A;  3F8U A;  4K7I A;  4FYU A;  3TU3 B;  5ECL B;  5DAK B;  3ZMK A;  5CNW A;  1KNG A;  4MCU A;  5ECO B;  4KX4 A;  5CRE A;  3WGX A;  2H6Y A;  2YJH A;  4JR4 A;  2GZP A;  4Z2T A;  1ABA A;  4F0B A;  3P8W A;  4MF6 A;  2X4A A;  5E59 A;  1WJK A;  4CHS A;  1PD2 1;  2AHE A;  4F82 A;  5JWQ B;  3D4T A;  3M9K A;  2GT6 A;  1XW9 A;  3UOM A;  1SD8 A;  4ML6 A;  1K3O A;  1SVM A;  4K0N A;  4N30 A;  3ZTL A;  1T3B A;  4G10 A;  5LCZ A;  4PUR A;  4XS6 A;  5DAL B;  2VCZ A;  2B7K A;  2PWJ A;  2HSM A;  2V6K A;  4ZB6 A;  3WT2 A;  3RDW A;  2KP2 A;  2VCX A;  3UAR A;  2LJK A;  4AJ8 A;  1HNC A;  5D93 A;  3KJY A;  3FKF A;  4NWY A;  2J23 A;  3F6D A;  2C8U A;  2HFD A;  3F3R A;  1XVW A;  2VCW A;  2JZR A;  2YWM A;  4HEA 2;  5ABR A;  2VCQ A;  4I2U A;  3ZLP A;  3KEB A;  2A4V A;  2GGT A;  1BF5 A;  3N5O A;  2LJA A;  1EGO A;  1X5C A;  3ZFB A;  3KXO A;  3FMW A;  4BWS A;  2HE3 A;  1GRX A;  3HMJ G;  3ZRE A;  1A8Y A;  3ZZX A;  1S3A A;  2VL2 C;  20GS A;  2R37 A;  3FK8 A;  1M2A A;  1SKR B;  1GUK A;  9GSS A;  2BTO T;  2O89 A;  4L0U A;  4TW5 A;  4XRD A;  1XFL A;  5HR2 A;  2F3M A;  1PQN A;  5IPG A;  2HSM B;  1U6T A;  2V41 A;  3F4R A;  1TU7 A;  1JFU A;  5G5F A;  3ZIJ A;  2NVL A;  1JLV A;  3CMI A;  4ECC A;  2ZUP A;  3D21 A;  1QQ2 A;  2CV4 A;  3ZIT A;  1M7T A;  5JCU A;  4X1U A;  3D4M A;  2YWO A;  11GS A;  4ZL8 A;  3LJR A;  2E2G A;  1YY7 A;  5CRD A;  2CAI A;  2OA7 A;  5KOW A;  2P31 A;  1X9W B;  4CY6 A;  2YAN A;  3VPQ A;  4L5O A;  2EFC A;  3M3M A;  5INY A;  2PN8 A;  2YCD A;  2DJ0 A;  2YPM A;  4PTS A;  2B6M A;  4K1F A;  1OVN A;  3MWH A;  2FHE A;  2R6K A;  1C72 A;  2QKE A;  3DVX A;  1X0R A;  1KEB A;  4BL7 A;  2MYG A;  3C1R A;  2NDO A;  4K6X A;  1G7O A;  3F6F A;  3DEX A;  3D6I A;  1G0T A;  4AKI A;  2M72 A;  3HVS A;  3UBL A;  3QFB C;  1EV4 A;  1X9M B;  3GKN A;  5KEJ A;  2CZ3 A;  3HZ4 A;  1TK8 B;  4XIH A;  4G2E A;  2R2J A;  4I6X A;  3ERF A;  4L5L A;  3RPP A;  6GSX A;  3C7M A;  1ZYN A;  3GKX A;  2IMI A;  5F07 A;  2DML A;  4ISD A;  1GSS A;  4K5R A;  1R7H A;  4Q5R A;  2VL2 A;  4PXO A;  1X9S B;  2DSA A;  3VLN A;  3QAG A;  4GWR A;  3GV1 A;  2QA1 A;  3F3Q A;  1GSY A;  1O6J A;  4XHM A;  4BL7 B;  2IMD A;  3Q18 A;  3IR4 A;  2I3Y A;  3HDC A;  1EOG A;  5CO3 A;  3ERW A;  4D73 A;  2JSY A;  3DKS A;  1XCC A;  4OFT A;  4IGJ A;  4IS0 A;  5D73 A;  1E6B A;  1ML6 A;  4TRX A;  2KHP A;  1UVZ A;  4PQH A;  3FW2 A;  4MH3 A;  2RUF A;  1TRV A;  1BAY A;  4GF0 A;  4ZB7 A;  2R4V A;  4MDC A;  3LFL A;  3IAS 2;  1PA3 A;  5DCG A;  5J47 A;  2B1L A;  1IYI A;  2QA2 A;  1FAA A;  3HKR A;  1EP8 A;  3KGK A;  1XWK A;  3GNJ A;  5HFG A;  1ZL9 A;  5KN1 A;  5FWG A;  4E8E A;  3L9U A;  4Z2U A;  3W8J A;  2HZE B;  4EC0 A;  4OFM A;  4N3Z A;  4D73 B;  4WF4 A;  1PGT A;  3F9U A;  2FA8 A;  2H0G A;  3PGT A;  3Q19 A;  1W89 A;  3IV4 A;  3VWW A;  1JZR A;  5J4Y A;  4ZL9 A;  2LKU A;  4L0W A;  2HSH A;  3HZ8 A;  5ECQ B;  4MJB A;  1SJI A;  2H73 A;  2H0H A;  2TRX A;  1K0B A;  3QAV A;  2L5L A;  1URM A;  4OD7 A;  2V2G A;  3CRU A;  4BVX B;  3TJB A;  2AUV A;  2MBS A;  1FVK A;  2E2M A;  2EIR A;  4KCE A;  3ZYW A;  3EIN A;  1ERW A;  2TRC P;  1W4V A;  4EIP A;  4N0Z A;  1AW9 A;  4DVC A;  5IM9 A;  1ZZY A;  5IMC A;  1SK0 A;  2BJX A;  1GL8 A;  1OC3 A;  2FCH A;  4IJI A;  2R0P A;  5H5S A;  4KSM A;  2CQ9 A;  3IC8 A;  3TRP A;  1K0N A;  1U88 A;  1OKD A;  2AYT A;  2GST A;  2YZU A;  1G6W A;  1DE2 A;  4MJE A;  1TKD B;  3DWV A;  3A5I A;  3VWU A;  5ENU A;  1Q98 A;  4E68 A;  4O32 A;  4KW6 A;  2OKA A;  1VF1 A;  2H1D A;  1HNA A;  3QPM A;  5D9V A;  2F8A A;  2I4A A;  1DE1 A;  1V2A A;  2PUK C;  3QMX A;  2C0E A;  1V58 A;  4V1A g;  4X43 A;  5H5Q A;  1UA5 A;  1WMJ A;  5KOX A;  3KMN A;  2N5B A;  1SKW B;  3F63 A;  3IRA A;  4HJ2 A;  1XPV A;  3FR6 A;  2CVB A;  1GSF A;  3LQ7 A;  1YF1 A;  1XWG A;  4ECB A;  17GS A;  5LD0 A;  4LLR A;  2VCV A;  5FHI A;  5HQP A;  2LUS A;  2FUG 2;  1FOV A;  4O5R A;  2L6C A;  4NXI A;  3C1S A;  4DSQ A;  4POB A;  2IN3 A;  1K0C A;  1MTC A;  3A2X A;  1BED A;  1MD3 A;  2PER A;  3FZ9 A;  2AB6 A;  5A5K A;  2AAW A;  3GMF A;  3P2A A;  3GRX A;  4KA0 A;  1PKZ A;  2OJL A;  3NZN A;  3AY8 A;  5J40 A;  1LJR A;  3UJ1 A;  4KND A;  1SK2 A;  5ECM B;  4MK3 A;  4N0V A;  3ME7 A;  1YEP A;  3KCM A;  2HXK A;  1N2A A;  5IMZ A;  4HI7 A;  3UVH A;  2YWI A;  3FRC A;  5HFI A;  1Z5Y E;  4J56 E;  2B3S A;  4TR1 A;  1GNW A;  2HRF A;  1ON4 A;  4AKG A;  1A8L A;  2NTO A;  2ON5 A;  2C0G A;  4K0G A;  4PQI A;  2P0G A;  3RAZ A;  2YV7 A;  4G0I A;  2PVO C;  4IVF A;  4ACS A;  1TU8 A;  22GS A;  4JZQ A;  2HYX A;  4GXZ A;  4IHU A;  2JAC A;  2YN1 A;  4DSS A;  4WEY A;  1AC1 A;  1PKW A;  2JSZ A;  2P5Q A;  4ZBB A;  4BA7 A;  1J0F A;  1N25 A;  1GTA A;  1V9W A;  2DIY A;  3L78 A;  4YAV A;  4JRR A;  2EFH A;  1MEK A;  2C0F A;  3TJG A;  5CAX A;  4TR1 B;  5HR3 A;  1CQH A;  4MZB A;  1F9M A;  5GSS A;  2C0D A;  4L8E A;  5A5H A;  2B5E A;  4KB3 A;  5BRT A;  4HS1 A;  2NBS A;  1LBK A;  2ALB A;  5B7C A;  5IIZ A;  3UL3 A;  3SBC A;  1U87 A;  1A24 A;  1K0A A;  3J7Y b;  4YQM A;  3ZVJ D;  1THO A;  1H4O A;  1NM3 A;  4EKZ A;  4DSS B;  1G7E A;  1B4P A;  4POK A;  3V1W A;  3RHC A;  1JZD A;  4ZB9 A;  1EWX A;  1VRS D;  5ELG A;  1Y1U A;  2DKI A;  5BMU A;  1QUW A;  4V2N A;  1SKS B;  4WKW A;  1PN9 A;  2AV4 A;  1AUC A;  3VFI A;  5EY6 A;  1YKA A;  2B1K A;  5ECI B;  4ML1 A;  2FWF A;  3KP9 A;  4AKX B;  3MAK A;  3CSI A;  4EDY A;  4KDX A;  2VKZ G;  3FZ5 A;  5EVO A;  3VI5 A;  1T4Z A;  4N11 A;  3IHG A;  5A5H B;  4YKF A;  3EMX A;  3K8N A;  2H1L A;  1PL2 A;  5L71 A;  2H1B A;  5D96 A;  2EFE A;  2VOC A;  1PN0 A;  1BX9 A;  3HD5 A;  3DGQ A;  3CYN A;  1XW5 A;  3EVI A;  3Q6O A;  2OBK A;  1OC9 B;  1FB0 A;  1SEN A;  3S9F A;  2R0G A;  2M80 A;  4GSN A;  4MPG A;  4H86 A;  3TKP A;  4XS4 A;  2VM1 A;  2L5O A;  5BMU B;  4PX1 A;  1SYX A;  3ZIV A;  2HSN A;  2GSR A;  2H8L A;  4V2M A;  2VIM A;  1YKC A;  1TXX A;  1T00 A;  3LWA A;  4TR4 A;  3PPU A;  3M9J A;  3KZQ A;  5IOX A;  1YVL A;  1XWA A;  2I9H A;  4O92 A;  4JED A;  2H71 A;  1S3C A;  5DJM A;  6GSU A;  2RM6 A;  1A2L A;  2GZY A;  4KF9 A;  2CVD A;  4TR3 A;  3VWX A;  4KCA A;  2PU9 C;  4I97 A;  1F3B A;  4K8M A;  1Y25 A;  4MZC A;  2A4H A;  2DIZ A;  4HUA A;  3GKK A;  2H30 A;  4XS4 B;  3VK9 A;  2GZZ A;  4JU5 A;  3TJK A;  3WGD A;  1Z3E A;  1ST9 A;  2IL3 A;  1T8E B;  2HSN B;  3FY7 A;  1SL0 B;  2IPA A;  5D9X A;  1XBS A;  2IMF A;  2VAF A;  5IMA A;  5J4U A;  4PGT A;  4EO3 A;  3GHA A;  4OMV A;  3UBK A;  1SK1 A;  3M0F A;  3I69 A;  4CDO A;  1O7U A;  2K6V A;  1EP7 A;  2FLS A;  3BJ5 A;  3E0U A;  3GH9 A;  1R4W A;  5A4V A;  3C73 A;  3H79 A;  2C4J A;  3U5R E;  1AXD A;  2YNX A;  3P7X A;  1GTU A;  2XHF A;  4G0L A;  1O81 A;  3FR9 A;  3D22 A;  2VD0 A;  1J08 A;  3PIN A;  3WD6 A;  4GQC A;  1A0F A;  1ZCP A;  4ZBA A;  1HNB A;  4G9H A;  4E8H A;  2OAD A;  1V40 A;  5DJL A;  4PNG A;  3LYP A;  3QD9 A;  4ECJ A;  3IA1 A;  4POL A;  5DQY A;  3G7J A;  5F0G A;  2HLS A;  2H72 A;  2PMT A;  2R3X A;  4FQU A;  4WF5 A;  1TW9 A;  1SYR A;  2DJ3 A;  5IMD A;  2FWE A;  4JBB A;  4HOJ A;  4YH2 A;  5IO2 A;  2RUE A;  1F3A A;  4HU9 A;  5G1K A;  5FT3 A;  2JU5 A;  2HSY A;  3LSZ A;  3LXT A;  4EL1 A;  2XPD A;  1GNE A;  1Q4J A;  1O8X A;  2KP1 A;  4K7O A;  4JE1 A;  1NSW A;  2ES7 A;  1NW2 A;  2XBQ A;  5CYY A;  5B6N A;  2GLR A;  4QMK A;  3CSH A;  1M0U A;  4MMM A;  3DXB A;  3GL5 A;  1KBN A;  2GQL A;  4WR5 A;  1B9X C;  3GSS A;  3ZFL A;  1TI3 A;  3KTL A;  5GAN D;  6GSW A;  4KDU A;  4HDE A;  2O8V B;  4WXT A;  4YAP A;  2H70 A;  4NV5 A;  4FYB A;  4MF7 A;  1WWJ A;  4IBP A;  4HZ4 A;  4I2T A;  3WT1 A;  2ZCT A;  3LXZ A;  6GSY A;  2O7K A;  2F9S A;  2H66 A;  3GYK A;  2LRN A;  4GDF A;  4EE0 A;  1PRX A;  3D0Z A;  1JLW A;  5DCH A;  1T4Y A;  1J9B A;  5AN1 A;  1AAZ A;  1S3D A;  1HQO A;  4JR6 A;  2LRC A;  1UN2 A;  4EVM A;  3ED3 A;  3J7Y k;  4IP6 A;  2FA4 A;  3LGC A;  1BYE A;  4I5Q A;  2HZF A;  2B7J A;  4HQS A;  2ON7 A;  4G0K A;  4ZB8 A;  1ACV A;  1EEM A;  3ZML A;  3EC3 A;  1IYH A;  5ECN B;  3IAM 2;  1FB6 A;  3ME8 A;  3TKQ A;  1NHO A;  3BD2 A;  5ECR B;  3RHB A;  3APO A;  13GS A;  5IMF A;  5J3R A;  1EZK A;  2F8F A;  2CT6 A;  1TK0 B;  2PPT A;  3ISO A;  2H74 A;  5DDL A;  3H8Q A;  3KH9 A;  5KN2 A;  4QL7 A;  5KN3 A;  1R5A A;  3GTU A;  1DSB A;  2P5R A;  3LW9 A;  3OR5 A;  2R0C A;  2X8G A;  1O8W A;  1OYJ A;  2GQK A;  1SL2 B;  2WRT A;  2CZ2 A;  1OC8 A;  2QGV A;  4AI6 A;  1ZOF A;  2X64 A;  1YZX A;  1VF3 A;  1F2E A;  3MDK A;  1GP1 A;  10GS A;  2PGT A;  1XZO A;  3UVT A;  3M8N A;  4KUN A;  1QXH A;  4GRF A;  2DJJ A;  3GL3 A;  4BWQ A;  3UAP A;  5A34 A;  4IP1 A;  1O73 A;  2YOI A;  2H01 A;  4AJ6 A;  5ECS A;  4LL4 B;  2WDU A;  2X99 A;  1XOA A;  1GUL A;  1WP0 A;  4BPY A;  5A1N A;  1F37 A;  1K0O A;  1XWC A;  2YV9 A;  1YDK A;  3IDV A;  2RII A;  3EMP A;  2C3N A;  5KN0 A;  1K0D A;  3GTU B;  3DYR A;  2DBC A;  1USB A;  1E2Y A;  3BBY A;  3EPT A;  1GTB A;  1YJ6 A;  1DUG A;  3HCZ A;  2DJ1 A;  2N5F A;  5ID2 A;  4V1A p;  1B8X A;  2VM2 A;  2L6D A;  2H0I A;  4TR0 A;  1BG5 A;  3IHQ A;  4EF0 A;  2GTU A;  8GSS A;  3L0H A;  3EE2 A;  3LOR A;  4MLY A;  5G2Z A;  3TCO A;  5C00 A;  3W6G A;  5A4W A;  1B48 A;  5HFK A;  5G5E A;  3CWG A;  1TTZ A;  1SVL A;  4Z7X A;  5A34 B;  2C1Y A;  2WJU A;  1Z9H A;  4WBJ A;  3ZVJ A;  2JL4 A;  2H19 A;  1I5G A;  2FD3 A;  5A1N B;  3LYK A;  4ECI A;  4QQ7 A;  5F06 A;  3TDG A;  18GS A;  4ZIL A;  4FYC A;  4K7N A;  5GZZ B;  2YJ7 A;  4AF2 A;  4K2D A;  4GST A;  4TVE A;  1MDI A;  4F0C A;  4W66 A;  3GX8 A;  1XXU A;  5ID2 B;  1OE8 A;  4ICY A;  3EU3 A;  4LMV A;  4J57 E;  4AJ7 A;  4MF5 A;  1TJD A;  3UEM A;  3TKS A;  5JWR B;  2UZ8 A;  2GQM A;  4GTU A;  4ID0 A;  1LU4 A;  4GSS A;  4HJM A;  4NMU A;  4DSR A;  1QMV A;  1JZW A;  4NHZ A;  4EDZ A;  4OWY A;  4LL1 B;  4CY8 A;  3KMO A;  1ZGN A;  3IXR A;  4YQV A;  1VF4 A;  1I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...