1VF1A

Cgsta1-1 in complex with glutathione
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
226
structure length
226
Chain Sequence
AKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 83
structure length 226
sequence length 226
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf1A01
3LQ7A 4MF6A 1SYRA 2IPAA 4WF5A 1BYEA 2QC7A 3LSZA 3DVWA 2VLUA 3GA4A 2OACA 1MDJA 4IP6A 5J9CA 1G6YA 2FY6A 1ZZYA 1QUWA 3W8JA 1O8XA 2MMZA 3EVIA 3VPTA 2JADA 2TIRA 1QFNA 2OE1A 1BX9A 1QK8A 1LU4A 2OKAA 1FB6A 3L78A 2RIIA 2HRNA 3IBHA 1CQHA 2VCZA 9GSSA 1GWCA 5GSTA 5CP1A 1ZL9A 5D9XA 4ZL7A 2TRCP 1OC8A 4ML1A 2C0GA 2O8VB 4P3YB 4V1Ag 2R4VA 5ABRA 4I2TA 4ML6A 4MZCA 2MBTA 2H6XA 4MH2A 4K7OA 1O6JA 5DCGA 2WDUA 2PVQA 4ECJA 3P8WA 1V9WA 3BD2A 5IMAA 3E9JB 1UN2A 4Q5QA 2HFDA 4EF0A 3ME8A 2OBKA 3DXBA 4XS1A 2K18A 2K8VA 4WR5A 1JZWA 3IK7A 4RI7A 3O6TA 1URMA 3GKNA 3FW2A 3FZ5A 2YP6A 1LBKA 1QMVA 1R5AA 2WJUA 1WRYA 1U88A 3HCZA 3TJJA 2VD1A 5JCGA 4KF9A 3E0UA 2YWMA 2DJJA 3ZMKA 3IAS2 2B1KA 4RI6A 1Z6MA 4MLYA 6GSXA 2VCXA 1XOAA 2I4AA 2C3TA 4IS0A 2IMKA 3FK8A 1W89A 3HDCA 1A2MA 1YF0A 2RUFA 5JWOB 5KN2A 2CQ9A 4K0NA 4CDOA 3F4RA 2H1AA 5DVBA 4XS6A 2A4VA 7GSSA 1XVQA 1EP8A 2H0IA 4MJEA 1OC9A 2L5OA 2KHPA 2B3SA 2YPMA 5ECIB 2IWTA 3UJ1A 5IOWA 2LS5A 2YWIA 2H71A 4F0CA 5D8IA 1U3IA 1K0BA 5ECMB 3TOUA 3OR5A 3I43A 4GWRA 1PL1A 2FGXA 3D22A 4WKWA 4TR4A 1V40A 4NV5A 3A3TA 4ID0A 3IV4A 5DAKA 2YJHA 1XWKA 5CRWA 3I69A 1OC9B 2EIOA 4HJ2A 4PUFC 1GUHA 3MWHA 4ZXGA 4FYBA 1FW1A 4ZBBA 1HYUA 1T3BA 3IAM2 4ZB8A 3CXGA 4DSRA 2OE3A 2AV4A 4K2DA 2QGVA 4MMMA 1F9MA 3KH9A 2P5QA 3CTFA 3GX0A 4O92A 4PUAA 2L57A 6GSTA 3HHVA 1K0OA 3M8NA 3GFKA 3IK9A 3FZ4A 4K7IA 1Z7RA 2LSTA 2DJ0A 3GSTA 2CZ2A 1XPVA 3LJRA 2DMMA 5KEJA 4TXOA 5DQYA 4MJAA 2GT6A 5CRHA 5C04A 2WB9A 5G1LA 2PWJA 2GQKA 5ECRB 3LORA 5IMDA 3TOTA 5IIZA 4TR1B 1IYHA 3W6GA 2GZYA 4D73A 3RHBA 3DKSA 1YEXA 4LMWA 3FYGA 5A5KA 2NBSA 1YY7A 4TOPA 1BAYA 5HR0A 5J4UA 3PPUA 2DSAA 1SJ6A 4TXOB 1WPIA 2CX3A 1TW9A 4PQHA 2R3XA 5DJMA 3TUEA 2JU5A 4FYUA 5L71A 3KIJA 1SK2A 2HZEA 1I5GA 1YF1A 2EC4A 3GIXA 2LNTA 1TRSA 4D73B 4N11A 3SWLA 1JZRA 2YV9A 2VM2A 5IPGA 5IMVA 2RM5A 2JL4A 3WGDA 3ZITA 4LLRA 4LL1B 5DBQA 2PUKC 1K3LA 5F05A 3P2AA 2HZEB 4V2NA 1PX6A 5KN0A 5E59A 1A0RP 1FO5A 3TRQA 1VF2A 1YZXA 2LJRA 5CRGA 2LV3A 2YNXA 1VF4A 4YQMA 3VI5A 4BWSA 1MEKA 3KTBA 1GH2A 3KXOA 1SJIA 1AQVA 1PD21 4BA7A 3QCPA 2G0FA 1TJDA 2J9HA 1TI1A 2NDOA 2FA8A 5E4WA 4DSQA 1B4PA 1X5DA 3PR8A 4ECIA 2N5BA 5G1KA 2L6CA 3BCIA 2TRXA 3ZFLA 1XW9A 2JZRA 5CYYA 1QGVA 4MJBA 1SENA 4G19A 1SL0B 1TK0B 2K9FA 4HU9A 4TR3A 2H73A 5ELGA 5IM9A 4HQSA 4NV2A 4QL7A 2FLSA 1OE8A 2AB6A 4XRAA 4CW9A 2J23A 1A0FA 3UVHA 1DE2A 1OKDA 3EMXA 4BVYA 2GQMA 1U87A 4PNGA 2IMFA 5ECOB 3F8UA 4KDYA 4N0VA 4IBPA 2LRTA 3ERWA 1O73A 2L4CA 16GSA 3CTGA 1PRXA 1AUCA 4FO5A 4IGJA 4O7HA 1AW9A 4HI7A 1PKWA 3ZFBA 4MCUA 4IJIA 3US3A 2IMEA 2IJYA 5ECKB 4KE3A 5ENUA 1K0MA 4BVYB 3V1WA 4JE1A 2OA7A 2F8AA 4V1Ap 2PBJA 2HT9A 4ISDA 3UIWA 2XHFA 5GSSA 1OYJA 5ELAA 5FWGA 4L8EA 3C1RA 1ZOFA 2GSQA 5G5EA 3QDNA 3J7Yb 3AY8A 3IC4A 2KP2A 3WT2A 4G10A 3WYWA 3GTUB 4IP1A 1B8XA 3R2QA 3H79A 1VGLA 1Z9HA 3DRNA 4ILFA 3E3EA 1XWCA 1GNEA 1AC1A 3IRAA 2V2GA 1NM3A 1K3OA 1YEPA 2C4JA 2DJ1A 2CVBA 3U5RE 2HSYA 2KOKA 3QR6A 4X1UA 2VO4A 3DVXA 1X9MB 3EINA 1G7OA 2HSMA 3VFIA 5INYA 2CVDA 1PA3A 1GSYA 4EDYA 3DIEA 5HQPA 2HE3A 3HVXA 1G6WA 3KTLA 4KDXA 1M2DA 1JLVA 3N9JA 3WD6A 4MP4A 3H93A 3ZIVA 4MH3A 4HOJA 2HI7A 3CSJA 1VRSD 2HSMB 4PNFA 2MMAA 3UMAA 2H0HA 2I1UA 3QFBC 1A8LA 4EDZA 2E2GA 2YOIA 3M1GA 2DLXA 1S3AA 1TDIA 3GH9A 2LTKA 1PKZA 5D9VA 3HVVA 1VF3A 1M99A 4N0ZA 2LRNA 5HR1A 3TGZA 5B7CA 1SJZA 3EMPA 3IR4A 2L4QA 2PVOC 1RK4A 2GZPA 2H01A 3C71A 2CZ3A 5A4WA 3UEMA 2VCQA 3KP9A 2FNOA 1TXXA 2PN8A 5HFKA 2H1BA 4GTUA 4EVMA 1Q98A 2X8CA 1EZKA 2WGRA 2C3QA 3P90A 2YZUA 5KN3A 2M46A 4DEJA 2QSIA 2G2QA 6GSUA 1TU8A 1XBSA 2HSNB 1GP1A 2ZNMA 3ED3A 1GTIA 1GSSA 2DIYA 4XCSA 4GRFA 1SK1A 2C0DA 4KDUA 2ON5A 4GQFA 2H6ZA 2REMA 3F6DA 1XWGA 3FZAA 1U6TA 2PU9C 4ACSA 1K0AA 1RW1A 1EEJA 1T00A 5GAND 1GTBA 2O89A 1PMTA 4BVXA 1SL2B 2GZZA 3L9UA 1ZCPA 2ES7A 4IQAA 1TRWA 3FR3A 2C0EA 3FHKA 1PX7A 2BJXA 4KNDA 1AQWA 3KEBA 4BVXB 2MBSA 3M3MA 3NOFA 3HKRA 1YKAA 1K3YA 3TCOA 3L0HA 1ZYQB 4NWYA 1MTCA 1MDIA 3D6IA 1EV4A 1FB0A 3LG6A 4ZL9A 3SBCA 5EY6A 4N10A 3F6FA 2HXKA 3Q19A 3S9FA 4BPYA 1FVKA 1AAZA 3M9KA 2L6DA 2VUPA 2CAIA 5J41A 3ZVJD 3GUSA 2ON7A 3CMIA 4PQIA 3IOSA 2LQOA 1GLQA 4OMVA 4E8HA 1R26A 2IMIA 1TOFA 4XS4A 5FHIA 1TTZA 4RUVA 1B9XC 5F0GA 2R37A 4I2UA 1GLPA 5IQYA 4IW9A 5B6MA 1T8EB 4IVFA 5A4UA 2AHEA 2VCWA 1UA5A 1EP7A 1WMJA 3QOUA 4JZQA 4LMVA 4HZ4A 3GN3A 2IFQA 2QKEA 3A2VA 2GSSA 4GLTA 1Y25A 2NVLA 1PGTA 4XS4B 4K7NA 1MD4A 4JR6A 3EWLA 4EUYA 4TR1A 4MPFA 2JZSA 5DJLA 8GSSA 3GL3A 2JZTA 3HJOA 1ZGNA 2FCHA 3L4NA 1BG5A 1AIUA 4TVEA 4USSA 5DALA 4XTSA 3KMOA 3TRPA 4FYCA 2XBQA 2IFQB 4L0WA 1SU9A 3MSZA 3QFAC 2F3MA 1MDKA 2XPDA 3APOA 1R7HA 1SD8A 1HQOA 4HUAA 4GSNA 4RQRA 1S3DA 4KSMA 2AUVA 4EE0A 1GSFA 2H8LA 1YDKA 2E2MA 5DALB 2GSTA 3MNGA 4K1FA 1DSBA 3QD9A 5JWRB 5F06A 3JCML 3D4TA 5B6NA 2CX4A 1TRUA 1GULA 1XWBA 2PERA 3RBTA 4WXTA 3F3RA 1X5CA 3KJYA 4KGIA 2YWNA 1YKCA 4O32A 2OBIA 4JRRA 4J2FA 3EU4A 4EC0A 3ZREA 1X9SB 2I3YA 4KB3A 5A4VA 5EVOA 5AISA 1KTEA 2N5FA 4G2EA 1SKSB 4KH7A 2CVKA 3KZQA 2HNLA 3EURA 2GT5A 5D73A 5G30A 1T7PB 4Q5RA 3CSIA 5IMCA 4O5RA 4MF5A 4EKZA 4OO5A 1E6BA 5ECQB 4EL1A 5GAPD 2HRKB 5AIXA 2H1DA 1B4QA 2H70A 1N2AA 3G7JA 3KD0A 2LUSA 4MJCA 3RPPA 5B8BA 1JZDA 6GSWA 2CT6A 5J5NA 1N8JA 3D4MA 1SYXA 6GSVA 5IOXA 4GXZA 1GNWA 2YWOA 3QPMA 1FOVA 1ABAA 2CA8A 4WBJA 3GNJA 3DGQA 4QQ7A 3EC3A 2YANA 2FHEA 1F6MC 2XBIA 3VK9A 2OJLA 3IPZA 4XHMA 3F4TA 4OD7A 5EL8A 5HFGA 2P0GA 4I6XA 4PTSA 2V6OA 1A24A 1XW6A 5IPHA 4FIWA 4HEA2 1QXHA 1ML6A 5IO0A 3TKSE 2OADA 2JACA 4AGSA 4N30A 5F8BA 2C3NA 2VL9A 5HFIA 3DD3A 3KCMA 3BBYA 3GYKA 2WFCA 1PQNA 3TDGA 4WETA 2B5XA 3GTUA 1GSEA 4JR4A 4AF2A 2ZUPA 4MZBA 4POKA 4L5LA 3QMXA 3NZNA 3IC8A 1F2EA 5AN1A 4KA0A 3GMFA 3ZZXA 2V1MA 3M9JA 4X0XA 3TJKA 4POBA 2LJKA 3RPNA 3FZ9A 4F0BA 4ZL8A 3HJMA 3ERFA 3L9SA 4WR4A 1FVJA 5IO2A 3HD5A 4GQCA 4KCAA 4KAEA 4J56E 1CQGA 1W4VA 2H66A 2WRTA 3VPQA 3G7IA 4Z7XA 12GSA 2HZFA 4I8BA 5H5RA 1JFUA 1C72A 3BJ5A 2FWEA 1V58A 2DJKA 1FHEA 2I9HA 2H74A 4KUNA 4QL9A 4AJ8A 3R3EA 4NPBA 1THXA 4ULXA 3VLNA 2FA4A 2GDRA 1WWJA 1XWAA 3C1SA 4GCIA 3TJGA 3TKSC 5ECPB 1T4ZA 4IHUA 3GKKA 2VIMA 4YQUA 3GHAA 5HR3A 1WIKA 1Z3EA 4TN8A 1TRVA 1SKRB 5J9BA 1QQ2A 2V32A 5D9TA 2C0FA 3ZMLA 2H1GA 2FWFA 1B48A 3CRTA 1T1VA 5ECLB 2MMNA 2YV7A 5KN1A 2M72A 2H6YA 1G0TA 3I6AA 2H19A 5AIVA 1TP9A 3C8EA 1O85A 3KH7A 2B5EA 1GSUA 1GUKA 1V98A 2X8HA 3EYTA 1OKTA 4Q5NA 5ECHB 2VCVA 2VL2C 2PPTA 3TKPA 2V41A 2EIQA 3I9V2 1EEMA 3TKQA 3TJFA 3KM6A 3HYPA 2K8SA 1OC3A 2K6VA 1ZYEA 5EPFA 4FH8A 4H86A 19GSA 1NHOA 3VI7A 4NXIA 2N5AA 5G2ZA 2P5RA 2V6KA 1T4YA 1V2AA 3GURA 2LNSA 3VWVA 2PGTA 1H4OA 1Z6NA 1WP0A 3FKFA 4AJ7A 4L5OA 3KP8A 4K0GA 2E0QA 1F37A 1A8YA 1ERUA 2KUCA 20GSA 4POLA 2XPEA 1TI3A 2AYTA 4E8EA 3ME7A 4G0KA 4JBBA 3ZIJA 3LXZA 3FY7A 3TJBA 2O7KA 4OFNA 2CV4A 3F63A 1ERTA 4TXVA 2WCIA 1X9WB 2IL3A 3CSHA 5ID2A 1GUMA 1M9AA 1NHYA 2RLIA 1V57A 2C8UA 11GSA 1VF1A 2L5LA 1BQ7A 2LKUA 2ALBA 4CHSA 2YZHA 2BTOT 2XC2A 1FAAA 5IMFA 1SKWB 13GSA 1M9BA 1NSWA 3FEUA 4EO3A 4K9ZA 3A2WA 1JHBA 4BWQA 5ID2B 4ZILA 4NHWA 5FT3A 3H4KA 5JCUA 5LCZA 1KEBA 4YH2A 2KLXA 2H0GA 5LD0A 3F4SA 3WGXA 4OCEA 1G7EA 1JLWA 4NMUA 2DMLA 1ACVA 4HZ2A 3IXRA 3UOMA 1SK0A 2IN3A 1A23A 3KMNA 1WOUA 4MPGA 1J08A 4KCEA 4TR0A 2HQTA 2F8FA 2LRCA 4LL4B 1PN9A 4HS1A 2UZ8A 3GV1A 3O76A 3C73A 1EOHA 4IN0A 2KP1A 4MA9A 4AJ6A 1U3AA 2DIZA 2NPBA 4V2LA 4K6XA 5GZZB 2B7KA 3NIVA 1TK8B 1M7TA 2ZCTA 4PGTA 4HU7A 2GLRA 1UVZA 3TB2A 1SL1B 5H5SA 3UAPA 3GX8A 2GTUA 3D0ZA 1GTUA 2IIYA 4JU5A 1KNGA 3IE3A 3GRXA 4ECCA 6GSYA 4EXJA 2RUEA 1EGRA 2AAWA 3LYPA 4ZBDA 2B1LA 2P31A 2CAQA 3BCKA 1BEDA 2X8GA 4X43A 4ZBAA 14GSA 1TK5B 3WGEA 3GSSA 2JSZA 2OE0A 2R5GA 1SD9A 1TKDB 1ST9A 3UVTA 5BMUA 4NHZA 22GSA 2DJ3A 5COHA 3H8QA 3ZYWA 3C7MA 2DC5A 4OWYA 1XZOA 3IHQA 4KW6A 3DWVA 5B8AA 3MDKA 5D96A 4WEYA 3CYNA 4GSSA 4DVCA 2BMXA 4J57E 2VLVA 4FQUA 2JSYA 4F03A 3CBUA 4IKHA 2X99A 3IDVA 2GGTA 1AXDA 1O7UA 4YAVA 1FG4A 2NTOA 2IMDA 4ZB9A 4HDEA 3DEXA 1F3BA 1WE0A 1Y6EA 5DAKB 2X64A 4XIHA 3VWXA 2EIRA 3GKMA 1ON4A 1XW5A 1RQMA 1PSQA 2PMTA 3APSA 5AGYA 2VD0A 1IYIA 2VOCA 4L0UA 5CREA 3U6VA 4YAPA 2MMOA 1O81A 1H75A 1R5PA 3GKXA 3LEFA 4WBRD 4OO4A 3A5WA 4PQ1A 3PH9A 2YJ7A 1XIYA 2B7JA 3FR9A 1GSDA 1E2YA 2VAFA 3ZTLA 3ERGA 18GSA 5HR2A 3Q6OA 4NAXA 1XVWA 4POMA 2HRFA 3G9BA 3UBLA 1B9YC 2LEGA 1OE7A 2GSRA 4Q5FA 1J9BA 3RHCA 3PGTA 2YCDA 4KX4A 3LGCA 1X0RA 2C1YA 1MD3A 4F9ZA 2VLTA 3P7XA 4I97A 4PX1A 4G0IA 5G5FA 5JWQB 1M0UA 3Q18A 2HRKA 3J7Yk 1K0DA 5C00A 5LNKe 2AJQB 1OVNA 4ECBA 1EV9A 2VM1A 4YQVA 5F07A 1BJXA 3HZ4A 4OFTA 4F2IA 3DMLA 5J3RA 4MF7A 1I9DA 3O3TA 2VCTA 3QAVA 3ZL5A 3GL5A 2A2RA 2F51A 4OCFA 1XFLA 1DUGA 5DDLA 1ILOA 1Q4JA 3N5OA 3UARA 2R2JA 2C80A 5H5QA 1F3AA 2FWHA 3QAWA 1WJKA 3Q74A 2MYGA 3HZ8A 4GF0A 2H30A 2WULA 4DSSA 2O85A 1XXUA 1HNBA 1K0NA 1O8WA 5D9WA 3HJPA 3VWUA 1Z7PA 4IQ1A 3D5JA 1DBYA 1ZMAA 4ZB6A 4BL7A 3HY2A 3ZLPA 3G7YA 1EWXA 1A2LA 2VL3A 1EGOA 3KGKA 4V2MA 4TRXA 1NW2A 4I5QA 4DSSB 3TKRA 2RM6A 3CRUA 3LXTA 2R6KA 3HXSA 4LA1A 2B6MA 4BL7B 3LWAA 4TKYA 2L59A 1S3CA 2E7PA 4TW5A 3VWWA 4ZIJA 2M80A 4HJMA 1X5EA 3LYKA 3M0FA 4F82A 1PL2A 1LJRA 1HNCA 2FWGA 2O87A 1XCCA 17GSA 3FRCA 1XOBA 4MABA 5CO3A 5CRDA 5CAXA 1JZOA 4K8MA 3PINA 4XRDA 3APQA 4MK3A 1GL8A 1M2BA 3HVSA 2H76A 5DQSA 3BOAA 2WZ9A 1K0CA 1EOGA 3LFLA 2HLSA 1KBNA 3IA1A 2FUG2 1UC7A 4PURA 1THOA 1YJ6A 3UBKA 3WT1A 4G9HA 2YN1A 4GSTA 5G31A 1Z5YE 2Z9SA 1USBA 2LJAA 2GVPA 4IJ3A 1GSQA 2FD3A 3RAZA 3VURA 4OFMA 3ISOA 3K8NA 3DYRA 1OAZA 2LQQA 3L9VA 3F0IA 4RQXA 3EU3A 4HQZA 5JCWA 2B5YA 5IMZA 3FR6A 3F3QA 2HYXA 5DCHA 2H72A 2GS3A 1R4WA 1AQXA 10GSA 1ERVA 5ECNB 3TKSA 3ZVJA 2I81A 4MZWA 3UL3A 2MZCA 3ZRDA 1TU7A 2GQLA 3HA9A 2A2SA 2DJ2A 2DBCA 2HSHA 5CNWA 4PXOA 1J0FA 1DE1A 1GTAA 1A2JA 1GRXA 4IELA 5D93A 1HNAA 6GSSA 3W8SA 5ECSA 3F9UA 4WF4A 4JEDA 1HD2A 3D21A 4G0LA 3EE2A 3H1NA 1M2AA 2H75A 3RDWA 3A2XA 1ERWA 2D2ZA 4KSOA 3TRXA 3MAKA 2F9SA 2HRAA 2VL2A 2WS2A 1YQ1A 3GH6A 4MDCA 3QAGA
chains in the Genus database with same CATH superfamily
3LQ7A 4MF6A 1SYRA 3CQFA 2IPAA 4WF5A 1BYEA 2QC7A 4ZB7A 4W66A 3LSZA 3DVWA 2VLUA 3GA4A 2OACA 1MDJA 4IP6A 5J9CA 2R0GA 1G6YA 2FY6A 1ZZYA 1QUWA 3W8JA 1O8XA 2MMZA 3EVIA 3VPTA 2JADA 2TIRA 1QFNA 2OE1A 1BX9A 1QK8A 1LU4A 2OKAA 1XG8A 1FB6A 3L78A 2RIIA 2HRNA 3IBHA 1CQHA 1S3RA 2VCZA 9GSSA 1GWCA 5GSTA 5CP1A 1ZL9A 5D9XA 4ZL7A 3HMJG 2DKHA 2TRCP 1OC8A 4ML1A 2WVZA 2C0GA 2O8VB 4P3YB 4V1Ag 2R4VA 5ABRA 3IHGA 4I2TA 4E68A 4ML6A 4MZCA 2MBTA 2H6XA 4MH2A 4K7OA 1O6JA 5DCGA 2WDUA 2PVQA 4ECJA 3P8WA 1V9WA 2VKZG 3BD2A 5IMAA 3E9JB 4PI2C 1UN2A 4Q5QA 2HFDA 4EF0A 3ME8A 2OBKA 3DXBA 4XS1A 2K18A 2K8VA 4WR5A 1JZWA 3IK7A 4RI7A 1URMA 3O6TA 3GKNA 3FW2A 3FZ5A 2YP6A 1LBKA 1QMVA 1R5AA 2WJUA 1WRYA 1U88A 3HCZA 3TJJA 2VD1A 5JCGA 4KF9A 3E0UA 2YWMA 2DJJA 3ZMKA 3IAS2 2B1KA 4RI6A 1Z6MA 4MLYA 6GSXA 2VCXA 1XOAA 4O5QA 2O5VA 2I4AA 2C3TA 4IS0A 2IMKA 3FK8A 1W89A 3HDCA 1A2MA 1TXUA 1YF0A 2RUFA 5JWOB 4AKGA 5KN2A 2CQ9A 4K0NA 4CDOA 3F4RA 2H1AA 5DVBA 4XS6A 2A4VA 7GSSA 1XVQA 1EP8A 2H0IA 4MJEA 1OC9A 2L5OA 2KHPA 2B3SA 2YPMA 5ECIB 2IWTA 3UJ1A 5IOWA 2LS5A 2YWIA 4CY6A 2H71A 4F0CA 5D8IA 1U3IA 1K0BA 5ECMB 3TOUA 3OR5A 3I43A 4GWRA 1PL1A 2FGXA 3D22A 4WKWA 4TR4A 1V40A 4NV5A 3A3TA 4AKIA 4ID0A 3IV4A 5DAKA 2YJHA 1XWKA 5A1NA 5CRWA 3I69A 1OC9B 2EIOA 4HJ2A 4PUFC 1GUHA 3MWHA 4ZXGA 4FYBA 1FW1A 4ZBBA 1HYUA 1T3BA 3IAM2 4ZB8A 3CXGA 4DSRA 2OE3A 2AV4A 4K2DA 2QGVA 4MMMA 1F9MA 3KH9A 2P5QA 3CTFA 3GX0A 4O92A 4PUAA 5A1NB 2L57A 6GSTA 3HHVA 1K0OA 3M8NA 3GFKA 3IK9A 3FZ4A 4K7IA 1Z7RA 2LSTA 2DJ0A 3GSTA 2CZ2A 1XPVA 3LJRA 2DMMA 5KEJA 4TXOA 5DQYA 4MJAA 2GT6A 5CRHA 5C04A 2WB9A 5G1LA 2PWJA 2GQKA 5ECRB 3LORA 5IMDA 3TOTA 5IIZA 4TR1B 1IYHA 3W6GA 2GZYA 4D73A 3RHBA 3DKSA 1YEXA 4LMWA 4X4JA 3FYGA 5A5KA 2NBSA 1YY7A 4TOPA 1BAYA 5HR0A 5J4UA 3PPUA 2DSAA 1SJ6A 4TXOB 1WPIA 2CX3A 1TW9A 4PQHA 2R3XA 5DJMA 3TUEA 2JU5A 4FYUA 5L71A 3KIJA 1SK2A 2HZEA 1I5GA 4YKFA 1YF1A 3RFRC 2EC4A 1YVLA 3GIXA 2LNTA 1TRSA 4D73B 4N11A 3SWLA 1JZRA 2YV9A 2VM2A 5IPGA 5IMVA 2RM5A 2JL4A 3WGDA 3ZITA 3A5IA 4LLRA 4LL1B 5DBQA 2PUKC 1K3LA 5F05A 3P2AA 2HZEB 4V2NA 1PX6A 5KN0A 5E59A 1A0RP 1FO5A 3TRQA 1VF2A 1YZXA 2LJRA 5CRGA 2LV3A 2YNXA 1VF4A 4YQMA 3VI5A 4BWSA 1MEKA 3KTBA 1GH2A 3KXOA 2H1LA 1SJIA 1AQVA 1PD21 4BA7A 3QCPA 2G0FA 1TJDA 2J9HA 1TI1A 1N25A 2NDOA 4YKGA 2FA8A 5E4WA 4DSQA 1B4PA 1X5DA 3PR8A 4ECIA 2N5BA 5G1KA 2L6CA 3BCIA 2TRXA 4Z2TA 3ZFLA 1XW9A 2JZRA 5CYYA 1QGVA 4GDFA 4MJBA 1SENA 4G19A 1SL0B 1TK0B 2K9FA 4HU9A 4TR3A 2H73A 5ELGA 5IM9A 4HQSA 4NV2A 4QL7A 2FLSA 1OE8A 2AB6A 4XRAA 4CW9A 2J23A 1A0FA 3UVHA 1DE2A 1OKDA 3EMXA 4BVYA 2GQMA 1U87A 4PNGA 2IMFA 5ECOB 3F8UA 3MIXA 4KDYA 4N0VA 4IBPA 2LRTA 3ERWA 1O73A 2L4CA 4EIPA 16GSA 3CTGA 1PRXA 2WVXA 1AUCA 4FO5A 4IGJA 4O7HA 1AW9A 4K2XA 4HI7A 1FOHA 1PKWA 3ZFBA 4MCUA 4IJIA 3US3A 2IMEA 2IJYA 5ECKB 4KE3A 5ENUA 1K0MA 4BVYB 3V1WA 4JE1A 2OA7A 2F8AA 4V1Ap 2PBJA 2HT9A 4ISDA 3UIWA 2WVXB 2XHFA 5GSSA 1OYJA 5ELAA 5FWGA 4L8EA 3C1RA 1ZOFA 2GSQA 5G5EA 3QDNA 3J7Yb 3AY8A 3IC4A 2KP2A 3WT2A 4G10A 4CY8A 3WYWA 3GTUB 4IP1A 1B8XA 3R2QA 3H79A 3TU3B 1VGLA 1Z9HA 5J40A 3DRNA 4ILFA 3E3EA 1XWCA 1GNEA 1AC1A 3IRAA 2V2GA 1NM3A 1K3OA 2A2PA 1YEPA 2C4JA 2DJ1A 2CVBA 3U5RE 2HSYA 2KOKA 3QR6A 2EFHA 4X1UA 2VO4A 3DVXA 1X9MB 3EINA 1G7OA 2HSMA 3VFIA 5INYA 2CVDA 1PA3A 1GSYA 4EDYA 3DIEA 5HQPA 2HE3A 3HVXA 1YEWC 1G6WA 3KTLA 4KDXA 1M2DA 1JLVA 3N9JA 3WD6A 4MP4A 3H93A 3ZIVA 2QA1A 4MH3A 4HOJA 2HI7A 3CSJA 2DKIA 1VRSD 5J4VA 2HSMB 4PNFA 2MMAA 3UMAA 2H0HA 2I1UA 3QFBC 1A8LA 4EDZA 2E2GA 2YOIA 3M1GA 2DLXA 1S3AA 1TDIA 3GH9A 2LTKA 1PKZA 5D9VA 3HVVA 1VF3A 1M99A 4N0ZA 2LRNA 5HR1A 3TGZA 5B7CA 1SJZA 3EMPA 3IR4A 2L4QA 2PVOC 1RK4A 2GZPA 2H01A 1PFOA 3C71A 2CZ3A 5A4WA 2HSNA 3UEMA 2VCQA 3KP9A 2FNOA 1TXXA 2PN8A 5HFKA 2H1BA 4GTUA 4EVMA 1Q98A 2X8CA 1EZKA 2WGRA 2QA2A 2C3QA 3P90A 2YZUA 5KN3A 2M46A 4DEJA 2QSIA 2G2QA 2WW2A 1TU8A 6GSUA 1XBSA 2HSNB 1GP1A 2ZNMA 3ED3A 1GTIA 1GSSA 2DIYA 2O3EA 4XCSA 4GRFA 1SK1A 2C0DA 4KDUA 2ON5A 4GQFA 2H6ZA 2REMA 3F6DA 1XWGA 3FZAA 1U6TA 1M3JA 2PU9C 4ACSA 1K0AA 1M3IA 1RW1A 1EEJA 1T00A 5GAND 1GTBA 2O89A 1PMTA 4BVXA 1SL2B 4ICYA 2GZZA 3L9UA 1ZCPA 2ES7A 4IQAA 1TRWA 3FR3A 2C0EA 3FHKA 1PX7A 2BJXA 4KNDA 1AQWA 3KEBA 4BVXB 2MBSA 3M3MA 3NOFA 3HKRA 1YKAA 2X4AA 1SVLA 1K3YA 3TCOA 3L0HA 1ZYQB 4NWYA 1MTCA 1MDIA 3D6IA 1EV4A 1FB0A 3LG6A 4ZL9A 3SBCA 5EY6A 4N10A 3F6FA 2EFDA 2HXKA 3Q19A 3S9FA 4BPYA 1FVKA 1AAZA 3M9KA 2L6DA 2VUPA 2CAIA 5J41A 3ZVJD 3GUSA 2ON7A 3CMIA 4PQIA 3IOSA 5A5HA 2LQOA 3MYDA 1GLQA 4OMVA 4E8HA 1R26A 2IMIA 1TOFA 4XS4A 5FHIA 1TTZA 4RUVA 1B9XC 5F0GA 2R37A 4I2UA 1GLPA 5IQYA 4IW9A 5B6MA 4G01A 1T8EB 4IVFA 5A4UA 2AHEA 2VCWA 1UA5A 1EP7A 1WMJA 3QOUA 4JZQA 4LMVA 4HZ4A 5A5HB 3GN3A 2IFQA 2QKEA 3A2VA 2GSSA 4GLTA 1Y25A 2NVLA 1PGTA 4XS4B 4K7NA 1MD4A 4JR6A 3EWLA 4EUYA 4TR1A 4MPFA 4AI6A 2JZSA 5DJLA 8GSSA 3GL3A 2JZTA 3HJOA 4MNNA 1ZGNA 2FCHA 3L4NA 1BG5A 1AIUA 4TVEA 4USSA 5DALA 4XTSA 3KMOA 3TRPA 4FYCA 2XBQA 2IFQB 4L0WA 1SU9A 3MSZA 3QFAC 2F3MA 1MDKA 2XPDA 3APOA 4K5RA 1R7HA 1SD8A 1HQOA 4HUAA 4GSNA 4RQRA 1S3DA 4KSMA 2AUVA 4EE0A 2WW0A 1GSFA 2H8LA 1YDKA 2E2MA 3HVNA 5DALB 2GSTA 3MNGA 4K1FA 1DSBA 3QD9A 5JWRB 2A4HA 5F06A 3JCML 3D4TA 5B6NA 2CX4A 1TRUA 1GULA 1XWBA 2PERA 3RBTA 4WXTA 3F3RA 1X5CA 3KJYA 4KGIA 2YWNA 1S4BP 1YKCA 4O32A 2OBIA 4JRRA 4J2FA 3EU4A 4EC0A 4PI0C 3ZREA 1X9SB 2I3YA 4HSCX 1ZYPA 4KB3A 5A4VA 5EVOA 5AISA 1KTEA 2N5FA 4G2EA 1SKSB 4KH7A 2CVKA 3KZQA 2HNLA 3EURA 2GT5A 5KOWA 5D73A 5G30A 1T7PB 4Q5RA 3CSIA 2X49A 5IMCA 4O5RA 4MF5A 4EKZA 4OO5A 1E6BA 5ECQB 4EL1A 5GAPD 2HRKB 5AIXA 2H1DA 1B4QA 2H70A 1N2AA 3G7JA 3KD0A 2LUSA 4MJCA 2WW1A 3RPPA 5B8BA 5J47A 1JZDA 6GSWA 5A34A 2CT6A 5J5NA 1N8JA 3D4MA 1SYXA 5J4YA 6GSVA 5IOXA 4GXZA 1GNWA 2YWOA 3QPMA 1FOVA 1ABAA 2CA8A 4WBJA 3GNJA 3DGQA 4QQ7A 1I1IP 3EC3A 2YANA 2FHEA 1F6MC 2XBIA 3VK9A 2OJLA 3IPZA 4XHMA 3F4TA 5A34B 4OD7A 5EL8A 4A5PA 5HFGA 2P0GA 4I6XA 4PTSA 2V6OA 4K5SA 4O5UA 1A24A 2R0CA 1XW6A 1Y1UA 5IPHA 4FIWA 4HEA2 1QXHA 1ML6A 5IO0A 3TKSE 2OADA 2JACA 4AGSA 4N30A 5F8BA 2C3NA 2VL9A 5HFIA 3DD3A 3KCMA 3BBYA 3GYKA 2WFCA 1PQNA 3TDGA 4WETA 2B5XA 3GTUA 1GSEA 4JR4A 4AF2A 2ZUPA 4MZBA 4POKA 4L5LA 3QMXA 3NZNA 3IC8A 1F2EA 5AN1A 4KA0A 3GMFA 3ZZXA 2V1MA 3M9JA 4X0XA 3TJKA 4POBA 2LJKA 3RPNA 3FZ9A 4F0BA 4ZL8A 3HJMA 3ERFA 4N3ZA 3L9SA 4WR4A 1FVJA 5IO2A 3HD5A 4GQCA 4KCAA 2EFCA 4KAEA 4J56E 1CQGA 1W4VA 2H66A 2WRTA 3VPQA 3G7IA 4Z7XA 12GSA 2HZFA 4I8BA 5H5RA 1JFUA 1C72A 3BJ5A 2FWEA 1V58A 2DJKA 1FHEA 2I9HA 2H74A 4KUNA 4QL9A 4AJ8A 3R3EA 4NPBA 1THXA 4ULXA 3VLNA 2FA4A 2GDRA 1WWJA 1XWAA 3C1SA 4GCIA 3TJGA 3TKSC 5ECPB 1T4ZA 4IHUA 3GKKA 2VIMA 4YQUA 3GHAA 5HR3A 1WIKA 1Z3EA 4TN8A 1TRVA 1SKRB 5J9BA 1QQ2A 2V32A 5D9TA 2C0FA 3ZMLA 2H1GA 2FWFA 1B48A 4BIKA 3CRTA 1T1VA 5ECLB 2MMNA 2YV7A 5KN1A 2M72A 2H6YA 1G0TA 3I6AA 2H19A 5AIVA 1TP9A 3C8EA 1O85A 4FXYP 3KH7A 3CWGA 2B5EA 1GSUA 1GUKA 1V98A 2X8HA 3EYTA 1OKTA 2OT3A 4Q5NA 5ECHB 2EFEA 3EPTA 2VCVA 2VL2C 2PPTA 3TKPA 2V41A 2EIQA 3I9V2 1EEMA 3TKQA 3TJFA 3KM6A 3HYPA 2K8SA 1OC3A 2K6VA 4Z2RA 1ZYEA 5EPFA 4FH8A 4H86A 19GSA 1NHOA 3VI7A 4NXIA 2N5AA 5G2ZA 2P5RA 2V6KA 1T4YA 1V2AA 3GURA 2LNSA 3VWVA 2PGTA 1H4OA 5BRTA 1Z6NA 1WP0A 3FKFA 4AJ7A 4L5OA 3KP8A 4K0GA 2E0QA 1F37A 1A8YA 1ERUA 2KUCA 20GSA 4POLA 2XPEA 1TI3A 2AYTA 4E8EA 3ME7A 4G0KA 4JBBA 3ZIJA 3LXZA 3FY7A 3TJBA 2O7KA 4OFNA 2CV4A 3F63A 1ERTA 4TXVA 2WCIA 1X9WB 2IL3A 3CSHA 5ID2A 5KOXA 1GUMA 1M9AA 1NHYA 2RLIA 1V57A 2C8UA 11GSA 1VF1A 2L5LA 1BQ7A 2LKUA 2ALBA 4CHSA 2YZHA 2BTOT 2XC2A 1FAAA 3LW9A 5IMFA 1SKWB 13GSA 1M9BA 1NSWA 3FEUA 4EO3A 1BG1A 4K9ZA 3A2WA 1JHBA 3FMWA 4BWQA 5ID2B 4ZILA 4NHWA 5FT3A 3H4KA 5JCUA 5LCZA 1KEBA 4YH2A 2UV8G 2KLXA 2H0GA 5LD0A 3F4SA 3WGXA 4OCEA 1G7EA 1JLWA 4NMUA 2DMLA 4EIQA 1ACVA 4HZ2A 3IXRA 3UOMA 1SK0A 2IN3A 1A23A 3KMNA 1WOUA 4MPGA 1J08A 4KCEA 4TR0A 2HQTA 2F8FA 2LRCA 4LL4B 1PN9A 4HS1A 2UZ8A 3GV1A 3O76A 3C73A 1EOHA 4IN0A 2KP1A 4MA9A 4AJ6A 1U3AA 2DIZA 2NPBA 4V2LA 4K6XA 5GZZB 3RGBC 2B7KA 3NIVA 1ZYNA 1TK8B 1M7TA 2ZCTA 4PGTA 4HU7A 2GLRA 1UVZA 3TB2A 1SL1B 5H5SA 3UAPA 3GX8A 2GTUA 3D0ZA 1GTUA 2IIYA 4JU5A 1KNGA 3IE3A 3GRXA 4ECCA 6GSYA 4EXJA 2RUEA 1EGRA 2AAWA 3LYPA 4ZBDA 2B1LA 2P31A 2CAQA 3BCKA 1BEDA 2X8GA 4X43A 4ZBAA 14GSA 1TK5B 3WGEA 3GSSA 2JSZA 2OE0A 2R5GA 1SD9A 1TKDB 1ST9A 3UVTA 5BMUA 4NHZA 22GSA 2DJ3A 5COHA 3H8QA 3ZYWA 3C7MA 2DC5A 4OWYA 1XZOA 3IHQA 4KW6A 3DWVA 5B8AA 3MDKA 5D96A 4WEYA 3CYNA 4GSSA 4DVCA 2BMXA 4J57E 2VLVA 4FQUA 2JSYA 4F03A 3CBUA 4IKHA 2X99A 3IDVA 2GGTA 1AXDA 1O7UA 4YAVA 5BMUB 1FG4A 2NTOA 2IMDA 4ZB9A 4HDEA 3DEXA 1F3BA 1WE0A 1Y6EA 3CHXC 5DAKB 2X64A 4XIHA 4QMKA 3VWXA 2EIRA 3GKMA 1ON4A 1XW5A 1RQMA 1PSQA 2PMTA 3APSA 5AGYA 2VD0A 1IYIA 2VOCA 4L0UA 5CREA 3U6VA 4YAPA 2MMOA 1O81A 1H75A 1R5PA 3GKXA 3LEFA 4WBRD 4OO4A 3A5WA 4PQ1A 3PH9A 2YJ7A 2O36A 1XIYA 2B7JA 3FR9A 1GSDA 1E2YA 2VAFA 3ZTLA 3ERGA 18GSA 5HR2A 3Q6OA 4NAXA 1XVWA 4POMA 2HRFA 3G9BA 3UBLA 1B9YC 2LEGA 1OE7A 2GSRA 4Q5FA 1J9BA 3RHCA 3PGTA 2YCDA 4KX4A 3LGCA 2WVYA 1X0RA 2C1YA 1MD3A 4F9ZA 2VLTA 3P7XA 4I97A 4PX1A 4G0IA 5G5FA 5JWQB 1M0UA 3Q18A 2HRKA 3J7Yk 1K0DA 5C00A 5LNKe 2AJQB 4PHZC 1OVNA 4ECBA 1EV9A 2VM1A 1SVOA 4YQVA 5F07A 1BJXA 3HZ4A 4OFTA 4F2IA 3DMLA 5J3RA 4MF7A 1I9DA 3O3TA 2VCTA 3QAVA 3ZL5A 2WZSA 3GL5A 2A2RA 2F51A 4OCFA 1XFLA 1DUGA 5DDLA 1ILOA 1Q4JA 3N5OA 3UARA 2R2JA 2C80A 5H5QA 1F3AA 2FWHA 3QAWA 1WJKA 3Q74A 2MYGA 4Z2UA 3HZ8A 4GF0A 2H30A 2WULA 4DSSA 2O85A 1XXUA 1HNBA 1K0NA 1O8WA 5D9WA 3HJPA 3VWUA 1Z7PA 4IQ1A 3D5JA 1DBYA 1ZMAA 4ZB6A 4BL7A 3HY2A 3ZLPA 3G7YA 1EWXA 1A2LA 2VL3A 1EGOA 3KGKA 4V2MA 4TRXA 1NW2A 4I5QA 4DSSB 3TKRA 2RM6A 3CRUA 3LXTA 2R6KA 3HXSA 4LA1A 2B6MA 4BL7B 3LWAA 4TKYA 2L59A 1S3CA 2E7PA 4TW5A 3VWWA 4ZIJA 1SVMA 2M80A 4HJMA 1X5EA 1PN0A 4AKHA 3LYKA 3M0FA 4F82A 1PL2A 1LJRA 1HNCA 2FWGA 2O87A 1XCCA 17GSA 3FRCA 1XOBA 4MABA 5CO3A 5CRDA 5CAXA 1JZOA 4K8MA 3PINA 4XRDA 3APQA 4MK3A 1GL8A 1M2BA 3HVSA 2H76A 5DQSA 3BOAA 2WZ9A 1K0CA 1EOGA 3LFLA 2HLSA 1KBNA 3IA1A 2FUG2 1UC7A 4PURA 1THOA 1YJ6A 3UBKA 1BF5A 3WT1A 4G9HA 2R0PA 2YN1A 4GSTA 5G31A 1Z5YE 2Z9SA 1USBA 2LJAA 2GVPA 4IJ3A 1GSQA 2FD3A 3RAZA 3VURA 4OFMA 3ISOA 3K8NA 3DYRA 1OAZA 2LQQA 3L9VA 3F0IA 4RQXA 3EU3A 4HQZA 5JCWA 2B5YA 5IMZA 3FR6A 3F3QA 2HYXA 5DCHA 2H72A 2GS3A 1R4WA 1AQXA 10GSA 1ERVA 5ECNB 3TKSA 3ZVJA 4AKXB 2I81A 4MZWA 3UL3A 2MZCA 3ZRDA 1TU7A 2GQLA 3HA9A 2A2SA 2DJ2A 2DBCA 2HSHA 5CNWA 4PXOA 1J0FA 2WW3A 1DE1A 1GTAA 1A2JA 1GRXA 4IELA 5D93A 1HNAA 6GSSA 3W8SA 5ECSA 3F9UA 4WF4A 4JEDA 1HD2A 3D21A 4G0LA 3EE2A 3H1NA 1M2AA 2H75A 3RDWA 3A2XA 1ERWA 2D2ZA 4KSOA 3TRXA 3MAKA 2F9SA 2HRAA 2VL2A 2WS2A 1YQ1A 3GH6A 4MDCA 3QAGA
chains in the Genus database with same CATH topology
3LQ7A 4MF6A 1SYRA 2IPAA 4WF5A 1BYEA 2QC7A 4ZB7A 4W66A 3LSZA 3DVWA 2VLUA 3GA4A 2OACA 1MDJA 4IP6A 5J9CA 2R0GA 1G6YA 2FY6A 1ZZYA 1QUWA 3W8JA 1O8XA 2MMZA 3EVIA 3VPTA 2JADA 2TIRA 1QFNA 2OE1A 1BX9A 1QK8A 1LU4A 2OKAA 1FB6A 3L78A 2RIIA 2HRNA 3IBHA 1CQHA 2VCZA 9GSSA 1GWCA 5GSTA 5CP1A 1ZL9A 5D9XA 4ZL7A 3HMJG 2DKHA 2TRCP 1OC8A 4ML1A 2C0GA 2O8VB 4P3YB 4V1Ag 2R4VA 5ABRA 3IHGA 4I2TA 4E68A 4ML6A 4MZCA 2MBTA 2H6XA 4MH2A 4K7OA 1O6JA 5DCGA 2WDUA 2PVQA 4ECJA 3P8WA 1V9WA 2VKZG 3BD2A 5IMAA 3E9JB 1UN2A 4Q5QA 2HFDA 4EF0A 3ME8A 2OBKA 3DXBA 4XS1A 2K18A 2K8VA 4WR5A 1JZWA 3IK7A 4RI7A 1URMA 3O6TA 3GKNA 3FW2A 3FZ5A 2YP6A 1LBKA 1QMVA 1R5AA 2WJUA 1WRYA 1U88A 3HCZA 3TJJA 2VD1A 5JCGA 4KF9A 3E0UA 2YWMA 2DJJA 3ZMKA 3IAS2 2B1KA 4RI6A 1Z6MA 4MLYA 6GSXA 2VCXA 1XOAA 4O5QA 2O5VA 2I4AA 2C3TA 4IS0A 2IMKA 3FK8A 1W89A 3HDCA 1A2MA 1TXUA 1YF0A 2RUFA 5JWOB 4AKGA 5KN2A 2CQ9A 4K0NA 4CDOA 3F4RA 2H1AA 5DVBA 4XS6A 2A4VA 7GSSA 1XVQA 1EP8A 2H0IA 4MJEA 1OC9A 2L5OA 2KHPA 2B3SA 2YPMA 5ECIB 2IWTA 3UJ1A 5IOWA 2LS5A 2YWIA 4CY6A 2H71A 4F0CA 5D8IA 1U3IA 1K0BA 5ECMB 3TOUA 3OR5A 3I43A 4GWRA 1PL1A 2FGXA 3D22A 4WKWA 4TR4A 1V40A 4NV5A 3A3TA 4AKIA 4ID0A 3IV4A 5DAKA 2YJHA 1XWKA 5A1NA 5CRWA 3I69A 1OC9B 2EIOA 4HJ2A 4PUFC 1GUHA 3MWHA 4ZXGA 4FYBA 1FW1A 4ZBBA 1HYUA 1T3BA 3IAM2 4ZB8A 3CXGA 4DSRA 2OE3A 2AV4A 4K2DA 2QGVA 4MMMA 1F9MA 3KH9A 2P5QA 3CTFA 3GX0A 4O92A 4PUAA 5A1NB 2L57A 6GSTA 3HHVA 1K0OA 3M8NA 3GFKA 3IK9A 3FZ4A 4K7IA 1Z7RA 2LSTA 2DJ0A 3GSTA 2CZ2A 1XPVA 3LJRA 2DMMA 5KEJA 4TXOA 5DQYA 4MJAA 2GT6A 5CRHA 5C04A 2WB9A 5G1LA 2PWJA 2GQKA 5ECRB 3LORA 5IMDA 3TOTA 5IIZA 4TR1B 1IYHA 3W6GA 2GZYA 4D73A 3RHBA 3DKSA 1YEXA 4LMWA 4X4JA 3FYGA 5A5KA 2NBSA 1YY7A 4TOPA 1BAYA 5HR0A 5J4UA 3PPUA 2DSAA 1SJ6A 4TXOB 1WPIA 2CX3A 1TW9A 4PQHA 2R3XA 5DJMA 3TUEA 2JU5A 4FYUA 5L71A 3KIJA 1SK2A 2HZEA 1I5GA 4YKFA 1YF1A 2EC4A 1YVLA 3GIXA 2LNTA 1TRSA 4D73B 4N11A 3SWLA 1JZRA 2YV9A 2VM2A 5IPGA 5IMVA 2RM5A 2JL4A 3WGDA 3ZITA 3A5IA 4LLRA 4LL1B 5DBQA 2PUKC 1K3LA 5F05A 3P2AA 2HZEB 4V2NA 1PX6A 5KN0A 5E59A 1A0RP 1FO5A 3TRQA 1VF2A 1YZXA 2LJRA 5CRGA 2LV3A 2YNXA 1VF4A 4YQMA 3VI5A 4BWSA 1MEKA 3KTBA 1GH2A 3KXOA 2H1LA 1SJIA 1AQVA 1PD21 4BA7A 3QCPA 2G0FA 1TJDA 2J9HA 1TI1A 1N25A 2NDOA 4YKGA 2FA8A 5E4WA 4DSQA 1B4PA 1X5DA 3PR8A 4ECIA 2N5BA 5G1KA 2L6CA 3BCIA 2TRXA 4Z2TA 3ZFLA 1XW9A 2JZRA 5CYYA 1QGVA 4GDFA 4MJBA 1SENA 4G19A 1SL0B 1TK0B 2K9FA 4HU9A 4TR3A 2H73A 5ELGA 5IM9A 4HQSA 4NV2A 4QL7A 2FLSA 1OE8A 2AB6A 4XRAA 4CW9A 2J23A 1A0FA 3UVHA 1DE2A 1OKDA 3EMXA 4BVYA 2GQMA 1U87A 4PNGA 2IMFA 5ECOB 3F8UA 3MIXA 4KDYA 4N0VA 4IBPA 2LRTA 3ERWA 1O73A 2L4CA 4EIPA 16GSA 3CTGA 1PRXA 1AUCA 4FO5A 4IGJA 4O7HA 1AW9A 4K2XA 4HI7A 1FOHA 1PKWA 3ZFBA 4MCUA 4IJIA 3US3A 2IMEA 2IJYA 5ECKB 4KE3A 5ENUA 1K0MA 4BVYB 3V1WA 4JE1A 2OA7A 2F8AA 4V1Ap 2PBJA 2HT9A 4ISDA 3UIWA 2XHFA 5GSSA 1OYJA 5ELAA 5FWGA 4L8EA 3C1RA 1ZOFA 2GSQA 5G5EA 3QDNA 3J7Yb 3AY8A 3IC4A 2KP2A 3WT2A 4G10A 4CY8A 3WYWA 3GTUB 4IP1A 1B8XA 3R2QA 3H79A 3TU3B 1VGLA 1Z9HA 5J40A 3DRNA 4ILFA 3E3EA 1XWCA 1GNEA 1AC1A 3IRAA 2V2GA 1NM3A 1K3OA 2A2PA 1YEPA 2C4JA 2DJ1A 2CVBA 3U5RE 2HSYA 2KOKA 3QR6A 2EFHA 4X1UA 2VO4A 3DVXA 1X9MB 3EINA 1G7OA 2HSMA 3VFIA 5INYA 2CVDA 1PA3A 1GSYA 4EDYA 3DIEA 5HQPA 2HE3A 3HVXA 1G6WA 3KTLA 4KDXA 1M2DA 1JLVA 3N9JA 3WD6A 4MP4A 3H93A 3ZIVA 2QA1A 4MH3A 4HOJA 2HI7A 3CSJA 2DKIA 1VRSD 5J4VA 2HSMB 4PNFA 2MMAA 3UMAA 2H0HA 2I1UA 3QFBC 1A8LA 4EDZA 2E2GA 2YOIA 3M1GA 2DLXA 1S3AA 1TDIA 3GH9A 2LTKA 1PKZA 5D9VA 3HVVA 1VF3A 1M99A 4N0ZA 2LRNA 5HR1A 3TGZA 5B7CA 1SJZA 3EMPA 3IR4A 2L4QA 2PVOC 1RK4A 2GZPA 2H01A 3C71A 2CZ3A 5A4WA 2HSNA 3UEMA 2VCQA 3KP9A 2FNOA 1TXXA 2PN8A 5HFKA 2H1BA 4GTUA 4EVMA 1Q98A 2X8CA 1EZKA 2WGRA 2QA2A 2C3QA 3P90A 2YZUA 5KN3A 2M46A 4DEJA 2QSIA 2G2QA 6GSUA 1TU8A 1XBSA 2HSNB 1GP1A 2ZNMA 3ED3A 1GTIA 1GSSA 2DIYA 4XCSA 4GRFA 1SK1A 2C0DA 4KDUA 2ON5A 4GQFA 2H6ZA 2REMA 3F6DA 1XWGA 3FZAA 1U6TA 2PU9C 4ACSA 1K0AA 1RW1A 1EEJA 1T00A 5GAND 1GTBA 2O89A 1PMTA 4BVXA 1SL2B 4ICYA 2GZZA 3L9UA 1ZCPA 2ES7A 4IQAA 1TRWA 3FR3A 2C0EA 3FHKA 1PX7A 2BJXA 4KNDA 1AQWA 3KEBA 4BVXB 2MBSA 3M3MA 3NOFA 3HKRA 1YKAA 2X4AA 1SVLA 1K3YA 3TCOA 3L0HA 1ZYQB 4NWYA 1MTCA 1MDIA 3D6IA 1EV4A 1FB0A 3LG6A 4ZL9A 3SBCA 5EY6A 4N10A 3F6FA 2EFDA 2HXKA 3Q19A 3S9FA 4BPYA 1FVKA 1AAZA 3M9KA 2L6DA 2VUPA 2CAIA 5J41A 3ZVJD 3GUSA 2ON7A 3CMIA 4PQIA 3IOSA 5A5HA 2LQOA 3MYDA 1GLQA 4OMVA 4E8HA 1R26A 2IMIA 1TOFA 4XS4A 5FHIA 1TTZA 4RUVA 1B9XC 5F0GA 2R37A 4I2UA 1GLPA 5IQYA 4IW9A 5B6MA 4G01A 1T8EB 4IVFA 5A4UA 2AHEA 2VCWA 1UA5A 1EP7A 1WMJA 3QOUA 4JZQA 4LMVA 4HZ4A 5A5HB 3GN3A 2IFQA 2QKEA 3A2VA 2GSSA 4GLTA 1Y25A 2NVLA 1PGTA 4XS4B 4K7NA 1MD4A 4JR6A 3EWLA 4EUYA 4TR1A 4MPFA 4AI6A 2JZSA 5DJLA 8GSSA 3GL3A 2JZTA 3HJOA 4MNNA 1ZGNA 2FCHA 3L4NA 1BG5A 1AIUA 4TVEA 4USSA 5DALA 4XTSA 3KMOA 3TRPA 4FYCA 2XBQA 2IFQB 4L0WA 1SU9A 3MSZA 3QFAC 2F3MA 1MDKA 2XPDA 3APOA 4K5RA 1R7HA 1SD8A 1HQOA 4HUAA 4GSNA 4RQRA 1S3DA 4KSMA 2AUVA 4EE0A 1GSFA 2H8LA 1YDKA 2E2MA 5DALB 2GSTA 3MNGA 4K1FA 1DSBA 3QD9A 5JWRB 2A4HA 5F06A 3JCML 3D4TA 5B6NA 2CX4A 1TRUA 1GULA 1XWBA 2PERA 3RBTA 4WXTA 3F3RA 1X5CA 3KJYA 4KGIA 2YWNA 1YKCA 4O32A 2OBIA 4JRRA 4J2FA 3EU4A 4EC0A 3ZREA 1X9SB 2I3YA 1ZYPA 4KB3A 5A4VA 5EVOA 5AISA 1KTEA 2N5FA 4G2EA 1SKSB 4KH7A 2CVKA 3KZQA 2HNLA 3EURA 2GT5A 5KOWA 5D73A 5G30A 1T7PB 4Q5RA 3CSIA 2X49A 5IMCA 4O5RA 4MF5A 4EKZA 4OO5A 1E6BA 5ECQB 4EL1A 5GAPD 2HRKB 5AIXA 2H1DA 1B4QA 2H70A 1N2AA 3G7JA 3KD0A 2LUSA 4MJCA 3RPPA 5B8BA 5J47A 1JZDA 6GSWA 5A34A 2CT6A 5J5NA 1N8JA 3D4MA 1SYXA 5J4YA 6GSVA 5IOXA 4GXZA 1GNWA 2YWOA 3QPMA 1FOVA 1ABAA 2CA8A 4WBJA 3GNJA 3DGQA 4QQ7A 3EC3A 2YANA 2FHEA 1F6MC 2XBIA 3VK9A 2OJLA 3IPZA 4XHMA 3F4TA 5A34B 4OD7A 5EL8A 4A5PA 5HFGA 2P0GA 4I6XA 4PTSA 2V6OA 4K5SA 4O5UA 1A24A 2R0CA 1XW6A 1Y1UA 5IPHA 4FIWA 4HEA2 1QXHA 1ML6A 5IO0A 3TKSE 2OADA 2JACA 4AGSA 4N30A 5F8BA 2C3NA 2VL9A 5HFIA 3DD3A 3KCMA 3BBYA 3GYKA 2WFCA 1PQNA 3TDGA 4WETA 2B5XA 3GTUA 1GSEA 4JR4A 4AF2A 2ZUPA 4MZBA 4POKA 4L5LA 3QMXA 3NZNA 3IC8A 1F2EA 5AN1A 4KA0A 3GMFA 3ZZXA 2V1MA 3M9JA 4X0XA 3TJKA 4POBA 2LJKA 3RPNA 3FZ9A 4F0BA 4ZL8A 3HJMA 3ERFA 4N3ZA 3L9SA 4WR4A 1FVJA 5IO2A 3HD5A 4GQCA 4KCAA 2EFCA 4KAEA 4J56E 1CQGA 1W4VA 2H66A 2WRTA 3VPQA 3G7IA 4Z7XA 12GSA 2HZFA 4I8BA 5H5RA 1JFUA 1C72A 3BJ5A 2FWEA 1V58A 2DJKA 1FHEA 2I9HA 2H74A 4KUNA 4QL9A 4AJ8A 3R3EA 4NPBA 1THXA 4ULXA 3VLNA 2FA4A 2GDRA 1WWJA 1XWAA 3C1SA 4GCIA 3TJGA 3TKSC 5ECPB 1T4ZA 4IHUA 3GKKA 2VIMA 4YQUA 3GHAA 5HR3A 1WIKA 1Z3EA 4TN8A 1TRVA 1SKRB 5J9BA 1QQ2A 2V32A 5D9TA 2C0FA 3ZMLA 2H1GA 2FWFA 1B48A 3CRTA 1T1VA 5ECLB 2MMNA 2YV7A 5KN1A 2M72A 2H6YA 1G0TA 3I6AA 2H19A 5AIVA 1TP9A 3C8EA 1O85A 3KH7A 3CWGA 2B5EA 1GSUA 1GUKA 1V98A 2X8HA 3EYTA 1OKTA 2OT3A 4Q5NA 5ECHB 2EFEA 3EPTA 2VCVA 2VL2C 2PPTA 3TKPA 2V41A 2EIQA 3I9V2 1EEMA 3TKQA 3TJFA 3KM6A 3HYPA 2K8SA 1OC3A 2K6VA 4Z2RA 1ZYEA 5EPFA 4FH8A 4H86A 19GSA 1NHOA 3VI7A 4NXIA 2N5AA 5G2ZA 2P5RA 2V6KA 1T4YA 1V2AA 3GURA 2LNSA 3VWVA 2PGTA 1H4OA 5BRTA 1Z6NA 1WP0A 3FKFA 4AJ7A 4L5OA 3KP8A 4K0GA 2E0QA 1F37A 1A8YA 1ERUA 2KUCA 20GSA 4POLA 2XPEA 1TI3A 2AYTA 4E8EA 3ME7A 4G0KA 4JBBA 3ZIJA 3LXZA 3FY7A 3TJBA 2O7KA 4OFNA 2CV4A 3F63A 1ERTA 4TXVA 2WCIA 1X9WB 2IL3A 3CSHA 5ID2A 5KOXA 1GUMA 1M9AA 1NHYA 2RLIA 1V57A 2C8UA 11GSA 1VF1A 2L5LA 1BQ7A 2LKUA 2ALBA 4CHSA 2YZHA 2BTOT 2XC2A 1FAAA 3LW9A 5IMFA 1SKWB 13GSA 1M9BA 1NSWA 3FEUA 4EO3A 1BG1A 4K9ZA 3A2WA 1JHBA 3FMWA 4BWQA 5ID2B 4ZILA 4NHWA 5FT3A 3H4KA 5JCUA 5LCZA 1KEBA 4YH2A 2UV8G 2KLXA 2H0GA 5LD0A 3F4SA 3WGXA 4OCEA 1G7EA 1JLWA 4NMUA 2DMLA 4EIQA 1ACVA 4HZ2A 3IXRA 3UOMA 1SK0A 2IN3A 1A23A 3KMNA 1WOUA 4MPGA 1J08A 4KCEA 4TR0A 2HQTA 2F8FA 2LRCA 4LL4B 1PN9A 4HS1A 2UZ8A 3GV1A 3O76A 3C73A 1EOHA 4IN0A 2KP1A 4MA9A 4AJ6A 1U3AA 2DIZA 2NPBA 4V2LA 4K6XA 5GZZB 2B7KA 3NIVA 1ZYNA 1TK8B 1M7TA 2ZCTA 4PGTA 4HU7A 2GLRA 1UVZA 3TB2A 1SL1B 5H5SA 3UAPA 3GX8A 2GTUA 3D0ZA 1GTUA 2IIYA 4JU5A 1KNGA 3IE3A 3GRXA 4ECCA 6GSYA 4EXJA 2RUEA 1EGRA 2AAWA 3LYPA 4ZBDA 2B1LA 2P31A 2CAQA 3BCKA 1BEDA 2X8GA 4X43A 4ZBAA 14GSA 1TK5B 3WGEA 3GSSA 2JSZA 2OE0A 2R5GA 1SD9A 1TKDB 1ST9A 3UVTA 5BMUA 4NHZA 22GSA 2DJ3A 5COHA 3H8QA 3ZYWA 3C7MA 2DC5A 4OWYA 1XZOA 3IHQA 4KW6A 3DWVA 5B8AA 3MDKA 5D96A 4WEYA 3CYNA 4GSSA 4DVCA 2BMXA 4J57E 2VLVA 4FQUA 2JSYA 4F03A 3CBUA 4IKHA 2X99A 3IDVA 2GGTA 1AXDA 1O7UA 4YAVA 5BMUB 1FG4A 2NTOA 2IMDA 4ZB9A 4HDEA 3DEXA 1F3BA 1WE0A 1Y6EA 5DAKB 2X64A 4XIHA 4QMKA 3VWXA 2EIRA 3GKMA 1ON4A 1XW5A 1RQMA 1PSQA 2PMTA 3APSA 5AGYA 2VD0A 1IYIA 2VOCA 4L0UA 5CREA 3U6VA 4YAPA 2MMOA 1O81A 1H75A 1R5PA 3GKXA 3LEFA 4WBRD 4OO4A 3A5WA 4PQ1A 3PH9A 2YJ7A 1XIYA 2B7JA 3FR9A 1GSDA 1E2YA 2VAFA 3ZTLA 3ERGA 18GSA 5HR2A 3Q6OA 4NAXA 1XVWA 4POMA 2HRFA 3G9BA 3UBLA 1B9YC 2LEGA 1OE7A 2GSRA 4Q5FA 1J9BA 3RHCA 3PGTA 2YCDA 4KX4A 3LGCA 1X0RA 2C1YA 1MD3A 4F9ZA 2VLTA 3P7XA 4I97A 4PX1A 4G0IA 5G5FA 5JWQB 1M0UA 3Q18A 2HRKA 3J7Yk 1K0DA 5C00A 5LNKe 2AJQB 1OVNA 4ECBA 1EV9A 2VM1A 1SVOA 4YQVA 5F07A 1BJXA 3HZ4A 4OFTA 4F2IA 3DMLA 5J3RA 4MF7A 1I9DA 3O3TA 2VCTA 3QAVA 3ZL5A 3GL5A 2A2RA 2F51A 4OCFA 1XFLA 1DUGA 5DDLA 1ILOA 1Q4JA 3N5OA 3UARA 2R2JA 2C80A 5H5QA 1F3AA 2FWHA 3QAWA 1WJKA 3Q74A 2MYGA 4Z2UA 3HZ8A 4GF0A 2H30A 2WULA 4DSSA 2O85A 1XXUA 1HNBA 1K0NA 1O8WA 5D9WA 3HJPA 3VWUA 1Z7PA 4IQ1A 3D5JA 1DBYA 1ZMAA 4ZB6A 4BL7A 3HY2A 3ZLPA 3G7YA 1EWXA 1A2LA 2VL3A 1EGOA 3KGKA 4V2MA 4TRXA 1NW2A 4I5QA 4DSSB 3TKRA 2RM6A 3CRUA 3LXTA 2R6KA 3HXSA 4LA1A 2B6MA 4BL7B 3LWAA 4TKYA 2L59A 1S3CA 2E7PA 4TW5A 3VWWA 4ZIJA 1SVMA 2M80A 4HJMA 1X5EA 1PN0A 4AKHA 3LYKA 3M0FA 4F82A 1PL2A 1LJRA 1HNCA 2FWGA 2O87A 1XCCA 17GSA 3FRCA 1XOBA 4MABA 5CO3A 5CRDA 5CAXA 1JZOA 4K8MA 3PINA 4XRDA 3APQA 4MK3A 1GL8A 1M2BA 3HVSA 2H76A 5DQSA 3BOAA 2WZ9A 1K0CA 1EOGA 3LFLA 2HLSA 1KBNA 3IA1A 2FUG2 1UC7A 4PURA 1THOA 1YJ6A 3UBKA 1BF5A 3WT1A 4G9HA 2R0PA 2YN1A 4GSTA 5G31A 1Z5YE 2Z9SA 1USBA 2LJAA 2GVPA 4IJ3A 1GSQA 2FD3A 3RAZA 3VURA 4OFMA 3ISOA 3K8NA 3DYRA 1OAZA 2LQQA 3L9VA 3F0IA 4RQXA 3EU3A 4HQZA 5JCWA 2B5YA 5IMZA 3FR6A 3F3QA 2HYXA 5DCHA 2H72A 2GS3A 1R4WA 1AQXA 10GSA 1ERVA 5ECNB 3TKSA 3ZVJA 4AKXB 2I81A 4MZWA 3UL3A 2MZCA 3ZRDA 1TU7A 2GQLA 3HA9A 2A2SA 2DJ2A 2DBCA 2HSHA 5CNWA 4PXOA 1J0FA 1DE1A 1GTAA 1A2JA 1GRXA 4IELA 5D93A 1HNAA 6GSSA 3W8SA 5ECSA 3F9UA 4WF4A 4JEDA 1HD2A 3D21A 4G0LA 3EE2A 3H1NA 1M2AA 2H75A 3RDWA 3A2XA 1ERWA 2D2ZA 4KSOA 3TRXA 3MAKA 2F9SA 2HRAA 2VL2A 2WS2A 1YQ1A 3GH6A 4MDCA 3QAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ7 A;  4MF6 A;  1SYR A;  2IPA A;  4WF5 A;  1BYE A;  2QC7 A;  3LSZ A;  3DVW A;  2VLU A;  3GA4 A;  2OAC A;  1MDJ A;  4IP6 A;  5J9C A;  1G6Y A;  2FY6 A;  1ZZY A;  1QUW A;  3W8J A;  1O8X A;  2MMZ A;  3EVI A;  3VPT A;  2JAD A;  2TIR A;  1QFN A;  2OE1 A;  1BX9 A;  1QK8 A;  1LU4 A;  2OKA A;  1FB6 A;  3L78 A;  2RII A;  2HRN A;  3IBH A;  1CQH A;  2VCZ A;  9GSS A;  1GWC A;  5GST A;  5CP1 A;  1ZL9 A;  5D9X A;  4ZL7 A;  2TRC P;  1OC8 A;  4ML1 A;  2C0G A;  2O8V B;  4P3Y B;  4V1A g;  2R4V A;  5ABR A;  4I2T A;  4ML6 A;  4MZC A;  2MBT A;  2H6X A;  4MH2 A;  4K7O A;  1O6J A;  5DCG A;  2WDU A;  2PVQ A;  4ECJ A;  3P8W A;  1V9W A;  3BD2 A;  5IMA A;  3E9J B;  1UN2 A;  4Q5Q A;  2HFD A;  4EF0 A;  3ME8 A;  2OBK A;  3DXB A;  4XS1 A;  2K18 A;  2K8V A;  4WR5 A;  1JZW A;  3IK7 A;  4RI7 A;  3O6T A;  1URM A;  3GKN A;  3FW2 A;  3FZ5 A;  2YP6 A;  1LBK A;  1QMV A;  1R5A A;  2WJU A;  1WRY A;  1U88 A;  3HCZ A;  3TJJ A;  2VD1 A;  5JCG A;  4KF9 A;  3E0U A;  2YWM A;  2DJJ A;  3ZMK A;  3IAS 2;  2B1K A;  4RI6 A;  1Z6M A;  4MLY A;  6GSX A;  2VCX A;  1XOA A;  2I4A A;  2C3T A;  4IS0 A;  2IMK A;  3FK8 A;  1W89 A;  3HDC A;  1A2M A;  1YF0 A;  2RUF A;  5JWO B;  5KN2 A;  2CQ9 A;  4K0N A;  4CDO A;  3F4R A;  2H1A A;  5DVB A;  4XS6 A;  2A4V A;  7GSS A;  1XVQ A;  1EP8 A;  2H0I A;  4MJE A;  1OC9 A;  2L5O A;  2KHP A;  2B3S A;  2YPM A;  5ECI B;  2IWT A;  3UJ1 A;  5IOW A;  2LS5 A;  2YWI A;  2H71 A;  4F0C A;  5D8I A;  1U3I A;  1K0B A;  5ECM B;  3TOU A;  3OR5 A;  3I43 A;  4GWR A;  1PL1 A;  2FGX A;  3D22 A;  4WKW A;  4TR4 A;  1V40 A;  4NV5 A;  3A3T A;  4ID0 A;  3IV4 A;  5DAK A;  2YJH A;  1XWK A;  5CRW A;  3I69 A;  1OC9 B;  2EIO A;  4HJ2 A;  4PUF C;  1GUH A;  3MWH A;  4ZXG A;  4FYB A;  1FW1 A;  4ZBB A;  1HYU A;  1T3B A;  3IAM 2;  4ZB8 A;  3CXG A;  4DSR A;  2OE3 A;  2AV4 A;  4K2D A;  2QGV A;  4MMM A;  1F9M A;  3KH9 A;  2P5Q A;  3CTF A;  3GX0 A;  4O92 A;  4PUA A;  2L57 A;  6GST A;  3HHV A;  1K0O A;  3M8N A;  3GFK A;  3IK9 A;  3FZ4 A;  4K7I A;  1Z7R A;  2LST A;  2DJ0 A;  3GST A;  2CZ2 A;  1XPV A;  3LJR A;  2DMM A;  5KEJ A;  4TXO A;  5DQY A;  4MJA A;  2GT6 A;  5CRH A;  5C04 A;  2WB9 A;  5G1L A;  2PWJ A;  2GQK A;  5ECR B;  3LOR A;  5IMD A;  3TOT A;  5IIZ A;  4TR1 B;  1IYH A;  3W6G A;  2GZY A;  4D73 A;  3RHB A;  3DKS A;  1YEX A;  4LMW A;  3FYG A;  5A5K A;  2NBS A;  1YY7 A;  4TOP A;  1BAY A;  5HR0 A;  5J4U A;  3PPU A;  2DSA A;  1SJ6 A;  4TXO B;  1WPI A;  2CX3 A;  1TW9 A;  4PQH A;  2R3X A;  5DJM A;  3TUE A;  2JU5 A;  4FYU A;  5L71 A;  3KIJ A;  1SK2 A;  2HZE A;  1I5G A;  1YF1 A;  2EC4 A;  3GIX A;  2LNT A;  1TRS A;  4D73 B;  4N11 A;  3SWL A;  1JZR A;  2YV9 A;  2VM2 A;  5IPG A;  5IMV A;  2RM5 A;  2JL4 A;  3WGD A;  3ZIT A;  4LLR A;  4LL1 B;  5DBQ A;  2PUK C;  1K3L A;  5F05 A;  3P2A A;  2HZE B;  4V2N A;  1PX6 A;  5KN0 A;  5E59 A;  1A0R P;  1FO5 A;  3TRQ A;  1VF2 A;  1YZX A;  2LJR A;  5CRG A;  2LV3 A;  2YNX A;  1VF4 A;  4YQM A;  3VI5 A;  4BWS A;  1MEK A;  3KTB A;  1GH2 A;  3KXO A;  1SJI A;  1AQV A;  1PD2 1;  4BA7 A;  3QCP A;  2G0F A;  1TJD A;  2J9H A;  1TI1 A;  2NDO A;  2FA8 A;  5E4W A;  4DSQ A;  1B4P A;  1X5D A;  3PR8 A;  4ECI A;  2N5B A;  5G1K A;  2L6C A;  3BCI A;  2TRX A;  3ZFL A;  1XW9 A;  2JZR A;  5CYY A;  1QGV A;  4MJB A;  1SEN A;  4G19 A;  1SL0 B;  1TK0 B;  2K9F A;  4HU9 A;  4TR3 A;  2H73 A;  5ELG A;  5IM9 A;  4HQS A;  4NV2 A;  4QL7 A;  2FLS A;  1OE8 A;  2AB6 A;  4XRA A;  4CW9 A;  2J23 A;  1A0F A;  3UVH A;  1DE2 A;  1OKD A;  3EMX A;  4BVY A;  2GQM A;  1U87 A;  4PNG A;  2IMF A;  5ECO B;  3F8U A;  4KDY A;  4N0V A;  4IBP A;  2LRT A;  3ERW A;  1O73 A;  2L4C A;  16GS A;  3CTG A;  1PRX A;  1AUC A;  4FO5 A;  4IGJ A;  4O7H A;  1AW9 A;  4HI7 A;  1PKW A;  3ZFB A;  4MCU A;  4IJI A;  3US3 A;  2IME A;  2IJY A;  5ECK B;  4KE3 A;  5ENU A;  1K0M A;  4BVY B;  3V1W A;  4JE1 A;  2OA7 A;  2F8A A;  4V1A p;  2PBJ A;  2HT9 A;  4ISD A;  3UIW A;  2XHF A;  5GSS A;  1OYJ A;  5ELA A;  5FWG A;  4L8E A;  3C1R A;  1ZOF A;  2GSQ A;  5G5E A;  3QDN A;  3J7Y b;  3AY8 A;  3IC4 A;  2KP2 A;  3WT2 A;  4G10 A;  3WYW A;  3GTU B;  4IP1 A;  1B8X A;  3R2Q A;  3H79 A;  1VGL A;  1Z9H A;  3DRN A;  4ILF A;  3E3E A;  1XWC A;  1GNE A;  1AC1 A;  3IRA A;  2V2G A;  1NM3 A;  1K3O A;  1YEP A;  2C4J A;  2DJ1 A;  2CVB A;  3U5R E;  2HSY A;  2KOK A;  3QR6 A;  4X1U A;  2VO4 A;  3DVX A;  1X9M B;  3EIN A;  1G7O A;  2HSM A;  3VFI A;  5INY A;  2CVD A;  1PA3 A;  1GSY A;  4EDY A;  3DIE A;  5HQP A;  2HE3 A;  3HVX A;  1G6W A;  3KTL A;  4KDX A;  1M2D A;  1JLV A;  3N9J A;  3WD6 A;  4MP4 A;  3H93 A;  3ZIV A;  4MH3 A;  4HOJ A;  2HI7 A;  3CSJ A;  1VRS D;  2HSM B;  4PNF A;  2MMA A;  3UMA A;  2H0H A;  2I1U A;  3QFB C;  1A8L A;  4EDZ A;  2E2G A;  2YOI A;  3M1G A;  2DLX A;  1S3A A;  1TDI A;  3GH9 A;  2LTK A;  1PKZ A;  5D9V A;  3HVV A;  1VF3 A;  1M99 A;  4N0Z A;  2LRN A;  5HR1 A;  3TGZ A;  5B7C A;  1SJZ A;  3EMP A;  3IR4 A;  2L4Q A;  2PVO C;  1RK4 A;  2GZP A;  2H01 A;  3C71 A;  2CZ3 A;  5A4W A;  3UEM A;  2VCQ A;  3KP9 A;  2FNO A;  1TXX A;  2PN8 A;  5HFK A;  2H1B A;  4GTU A;  4EVM A;  1Q98 A;  2X8C A;  1EZK A;  2WGR A;  2C3Q A;  3P90 A;  2YZU A;  5KN3 A;  2M46 A;  4DEJ A;  2QSI A;  2G2Q A;  6GSU A;  1TU8 A;  1XBS A;  2HSN B;  1GP1 A;  2ZNM A;  3ED3 A;  1GTI A;  1GSS A;  2DIY A;  4XCS A;  4GRF A;  1SK1 A;  2C0D A;  4KDU A;  2ON5 A;  4GQF A;  2H6Z A;  2REM A;  3F6D A;  1XWG A;  3FZA A;  1U6T A;  2PU9 C;  4ACS A;  1K0A A;  1RW1 A;  1EEJ A;  1T00 A;  5GAN D;  1GTB A;  2O89 A;  1PMT A;  4BVX A;  1SL2 B;  2GZZ A;  3L9U A;  1ZCP A;  2ES7 A;  4IQA A;  1TRW A;  3FR3 A;  2C0E A;  3FHK A;  1PX7 A;  2BJX A;  4KND A;  1AQW A;  3KEB A;  4BVX B;  2MBS A;  3M3M A;  3NOF A;  3HKR A;  1YKA A;  1K3Y A;  3TCO A;  3L0H A;  1ZYQ B;  4NWY A;  1MTC A;  1MDI A;  3D6I A;  1EV4 A;  1FB0 A;  3LG6 A;  4ZL9 A;  3SBC A;  5EY6 A;  4N10 A;  3F6F A;  2HXK A;  3Q19 A;  3S9F A;  4BPY A;  1FVK A;  1AAZ A;  3M9K A;  2L6D A;  2VUP A;  2CAI A;  5J41 A;  3ZVJ D;  3GUS A;  2ON7 A;  3CMI A;  4PQI A;  3IOS A;  2LQO A;  1GLQ A;  4OMV A;  4E8H A;  1R26 A;  2IMI A;  1TOF A;  4XS4 A;  5FHI A;  1TTZ A;  4RUV A;  1B9X C;  5F0G A;  2R37 A;  4I2U A;  1GLP A;  5IQY A;  4IW9 A;  5B6M A;  1T8E B;  4IVF A;  5A4U A;  2AHE A;  2VCW A;  1UA5 A;  1EP7 A;  1WMJ A;  3QOU A;  4JZQ A;  4LMV A;  4HZ4 A;  3GN3 A;  2IFQ A;  2QKE A;  3A2V A;  2GSS A;  4GLT A;  1Y25 A;  2NVL A;  1PGT A;  4XS4 B;  4K7N A;  1MD4 A;  4JR6 A;  3EWL A;  4EUY A;  4TR1 A;  4MPF A;  2JZS A;  5DJL A;  8GSS A;  3GL3 A;  2JZT A;  3HJO A;  1ZGN A;  2FCH A;  3L4N A;  1BG5 A;  1AIU A;  4TVE A;  4USS A;  5DAL A;  4XTS A;  3KMO A;  3TRP A;  4FYC A;  2XBQ A;  2IFQ B;  4L0W A;  1SU9 A;  3MSZ A;  3QFA C;  2F3M A;  1MDK A;  2XPD A;  3APO A;  1R7H A;  1SD8 A;  1HQO A;  4HUA A;  4GSN A;  4RQR A;  1S3D A;  4KSM A;  2AUV A;  4EE0 A;  1GSF A;  2H8L A;  1YDK A;  2E2M A;  5DAL B;  2GST A;  3MNG A;  4K1F A;  1DSB A;  3QD9 A;  5JWR B;  5F06 A;  3JCM L;  3D4T A;  5B6N A;  2CX4 A;  1TRU A;  1GUL A;  1XWB A;  2PER A;  3RBT A;  4WXT A;  3F3R A;  1X5C A;  3KJY A;  4KGI A;  2YWN A;  1YKC A;  4O32 A;  2OBI A;  4JRR A;  4J2F A;  3EU4 A;  4EC0 A;  3ZRE A;  1X9S B;  2I3Y A;  4KB3 A;  5A4V A;  5EVO A;  5AIS A;  1KTE A;  2N5F A;  4G2E A;  1SKS B;  4KH7 A;  2CVK A;  3KZQ A;  2HNL A;  3EUR A;  2GT5 A;  5D73 A;  5G30 A;  1T7P B;  4Q5R A;  3CSI A;  5IMC A;  4O5R A;  4MF5 A;  4EKZ A;  4OO5 A;  1E6B A;  5ECQ B;  4EL1 A;  5GAP D;  2HRK B;  5AIX A;  2H1D A;  1B4Q A;  2H70 A;  1N2A A;  3G7J A;  3KD0 A;  2LUS A;  4MJC A;  3RPP A;  5B8B A;  1JZD A;  6GSW A;  2CT6 A;  5J5N A;  1N8J A;  3D4M A;  1SYX A;  6GSV A;  5IOX A;  4GXZ A;  1GNW A;  2YWO A;  3QPM A;  1FOV A;  1ABA A;  2CA8 A;  4WBJ A;  3GNJ A;  3DGQ A;  4QQ7 A;  3EC3 A;  2YAN A;  2FHE A;  1F6M C;  2XBI A;  3VK9 A;  2OJL A;  3IPZ A;  4XHM A;  3F4T A;  4OD7 A;  5EL8 A;  5HFG A;  2P0G A;  4I6X A;  4PTS A;  2V6O A;  1A24 A;  1XW6 A;  5IPH A;  4FIW A;  4HEA 2;  1QXH A;  1ML6 A;  5IO0 A;  3TKS E;  2OAD A;  2JAC A;  4AGS A;  4N30 A;  5F8B A;  2C3N A;  2VL9 A;  5HFI A;  3DD3 A;  3KCM A;  3BBY A;  3GYK A;  2WFC A;  1PQN A;  3TDG A;  4WET A;  2B5X A;  3GTU A;  1GSE A;  4JR4 A;  4AF2 A;  2ZUP A;  4MZB A;  4POK A;  4L5L A;  3QMX A;  3NZN A;  3IC8 A;  1F2E A;  5AN1 A;  4KA0 A;  3GMF A;  3ZZX A;  2V1M A;  3M9J A;  4X0X A;  3TJK A;  4POB A;  2LJK A;  3RPN A;  3FZ9 A;  4F0B A;  4ZL8 A;  3HJM A;  3ERF A;  3L9S A;  4WR4 A;  1FVJ A;  5IO2 A;  3HD5 A;  4GQC A;  4KCA A;  4KAE A;  4J56 E;  1CQG A;  1W4V A;  2H66 A;  2WRT A;  3VPQ A;  3G7I A;  4Z7X A;  12GS A;  2HZF A;  4I8B A;  5H5R A;  1JFU A;  1C72 A;  3BJ5 A;  2FWE A;  1V58 A;  2DJK A;  1FHE A;  2I9H A;  2H74 A;  4KUN A;  4QL9 A;  4AJ8 A;  3R3E A;  4NPB A;  1THX A;  4ULX A;  3VLN A;  2FA4 A;  2GDR A;  1WWJ A;  1XWA A;  3C1S A;  4GCI A;  3TJG A;  3TKS C;  5ECP B;  1T4Z A;  4IHU A;  3GKK A;  2VIM A;  4YQU A;  3GHA A;  5HR3 A;  1WIK A;  1Z3E A;  4TN8 A;  1TRV A;  1SKR B;  5J9B A;  1QQ2 A;  2V32 A;  5D9T A;  2C0F A;  3ZML A;  2H1G A;  2FWF A;  1B48 A;  3CRT A;  1T1V A;  5ECL B;  2MMN A;  2YV7 A;  5KN1 A;  2M72 A;  2H6Y A;  1G0T A;  3I6A A;  2H19 A;  5AIV A;  1TP9 A;  3C8E A;  1O85 A;  3KH7 A;  2B5E A;  1GSU A;  1GUK A;  1V98 A;  2X8H A;  3EYT A;  1OKT A;  4Q5N A;  5ECH B;  2VCV A;  2VL2 C;  2PPT A;  3TKP A;  2V41 A;  2EIQ A;  3I9V 2;  1EEM A;  3TKQ A;  3TJF A;  3KM6 A;  3HYP A;  2K8S A;  1OC3 A;  2K6V A;  1ZYE A;  5EPF A;  4FH8 A;  4H86 A;  19GS A;  1NHO A;  3VI7 A;  4NXI A;  2N5A A;  5G2Z A;  2P5R A;  2V6K A;  1T4Y A;  1V2A A;  3GUR A;  2LNS A;  3VWV A;  2PGT A;  1H4O A;  1Z6N A;  1WP0 A;  3FKF A;  4AJ7 A;  4L5O A;  3KP8 A;  4K0G A;  2E0Q A;  1F37 A;  1A8Y A;  1ERU A;  2KUC A;  20GS A;  4POL A;  2XPE A;  1TI3 A;  2AYT A;  4E8E A;  3ME7 A;  4G0K A;  4JBB A;  3ZIJ A;  3LXZ A;  3FY7 A;  3TJB A;  2O7K A;  4OFN A;  2CV4 A;  3F63 A;  1ERT A;  4TXV A;  2WCI A;  1X9W B;  2IL3 A;  3CSH A;  5ID2 A;  1GUM A;  1M9A A;  1NHY A;  2RLI A;  1V57 A;  2C8U A;  11GS A;  1VF1 A;  2L5L A;  1BQ7 A;  2LKU A;  2ALB A;  4CHS A;  2YZH A;  2BTO T;  2XC2 A;  1FAA A;  5IMF A;  1SKW B;  13GS A;  1M9B A;  1NSW A;  3FEU A;  4EO3 A;  4K9Z A;  3A2W A;  1JHB A;  4BWQ A;  5ID2 B;  4ZIL A;  4NHW A;  5FT3 A;  3H4K A;  5JCU A;  5LCZ A;  1KEB A;  4YH2 A;  2KLX A;  2H0G A;  5LD0 A;  3F4S A;  3WGX A;  4OCE A;  1G7E A;  1JLW A;  4NMU A;  2DML A;  1ACV A;  4HZ2 A;  3IXR A;  3UOM A;  1SK0 A;  2IN3 A;  1A23 A;  3KMN A;  1WOU A;  4MPG A;  1J08 A;  4KCE A;  4TR0 A;  2HQT A;  2F8F A;  2LRC A;  4LL4 B;  1PN9 A;  4HS1 A;  2UZ8 A;  3GV1 A;  3O76 A;  3C73 A;  1EOH A;  4IN0 A;  2KP1 A;  4MA9 A;  4AJ6 A;  1U3A A;  2DIZ A;  2NPB A;  4V2L A;  4K6X A;  5GZZ B;  2B7K A;  3NIV A;  1TK8 B;  1M7T A;  2ZCT A;  4PGT A;  4HU7 A;  2GLR A;  1UVZ A;  3TB2 A;  1SL1 B;  5H5S A;  3UAP A;  3GX8 A;  2GTU A;  3D0Z A;  1GTU A;  2IIY A;  4JU5 A;  1KNG A;  3IE3 A;  3GRX A;  4ECC A;  6GSY A;  4EXJ A;  2RUE A;  1EGR A;  2AAW A;  3LYP A;  4ZBD A;  2B1L A;  2P31 A;  2CAQ A;  3BCK A;  1BED A;  2X8G A;  4X43 A;  4ZBA A;  14GS A;  1TK5 B;  3WGE A;  3GSS A;  2JSZ A;  2OE0 A;  2R5G A;  1SD9 A;  1TKD B;  1ST9 A;  3UVT A;  5BMU A;  4NHZ A;  22GS A;  2DJ3 A;  5COH A;  3H8Q A;  3ZYW A;  3C7M A;  2DC5 A;  4OWY A;  1XZO A;  3IHQ A;  4KW6 A;  3DWV A;  5B8A A;  3MDK A;  5D96 A;  4WEY A;  3CYN A;  4GSS A;  4DVC A;  2BMX A;  4J57 E;  2VLV A;  4FQU A;  2JSY A;  4F03 A;  3CBU A;  4IKH A;  2X99 A;  3IDV A;  2GGT A;  1AXD A;  1O7U A;  4YAV A;  1FG4 A;  2NTO A;  2IMD A;  4ZB9 A;  4HDE A;  3DEX A;  1F3B A;  1WE0 A;  1Y6E A;  5DAK B;  2X64 A;  4XIH A;  3VWX A;  2EIR A;  3GKM A;  1ON4 A;  1XW5 A;  1RQM A;  1PSQ A;  2PMT A;  3APS A;  5AGY A;  2VD0 A;  1IYI A;  2VOC A;  4L0U A;  5CRE A;  3U6V A;  4YAP A;  2MMO A;  1O81 A;  1H75 A;  1R5P A;  3GKX A;  3LEF A;  4WBR D;  4OO4 A;  3A5W A;  4PQ1 A;  3PH9 A;  2YJ7 A;  1XIY A;  2B7J A;  3FR9 A;  1GSD A;  1E2Y A;  2VAF A;  3ZTL A;  3ERG A;  18GS A;  5HR2 A;  3Q6O A;  4NAX A;  1XVW A;  4POM A;  2HRF A;  3G9B A;  3UBL A;  1B9Y C;  2LEG A;  1OE7 A;  2GSR A;  4Q5F A;  1J9B A;  3RHC A;  3PGT A;  2YCD A;  4KX4 A;  3LGC A;  1X0R A;  2C1Y A;  1MD3 A;  4F9Z A;  2VLT A;  3P7X A;  4I97 A;  4PX1 A;  4G0I A;  5G5F A;  5JWQ B;  1M0U A;  3Q18 A;  2HRK A;  3J7Y k;  1K0D A;  5C00 A;  5LNK e;  2AJQ B;  1OVN A;  4ECB A;  1EV9 A;  2VM1 A;  4YQV A;  5F07 A;  1BJX A;  3HZ4 A;  4OFT A;  4F2I A;  3DML A;  5J3R A;  4MF7 A;  1I9D A;  3O3T A;  2VCT A;  3QAV A;  3ZL5 A;  3GL5 A;  2A2R A;  2F51 A;  4OCF A;  1XFL A;  1DUG A;  5DDL A;  1ILO A;  1Q4J A;  3N5O A;  3UAR A;  2R2J A;  2C80 A;  5H5Q A;  1F3A A;  2FWH A;  3QAW A;  1WJK A;  3Q74 A;  2MYG A;  3HZ8 A;  4GF0 A;  2H30 A;  2WUL A;  4DSS A;  2O85 A;  1XXU A;  1HNB A;  1K0N A;  1O8W A;  5D9W A;  3HJP A;  3VWU A;  1Z7P A;  4IQ1 A;  3D5J A;  1DBY A;  1ZMA A;  4ZB6 A;  4BL7 A;  3HY2 A;  3ZLP A;  3G7Y A;  1EWX A;  1A2L A;  2VL3 A;  1EGO A;  3KGK A;  4V2M A;  4TRX A;  1NW2 A;  4I5Q A;  4DSS B;  3TKR A;  2RM6 A;  3CRU A;  3LXT A;  2R6K A;  3HXS A;  4LA1 A;  2B6M A;  4BL7 B;  3LWA A;  4TKY A;  2L59 A;  1S3C A;  2E7P A;  4TW5 A;  3VWW A;  4ZIJ A;  2M80 A;  4HJM A;  1X5E A;  3LYK A;  3M0F A;  4F82 A;  1PL2 A;  1LJR A;  1HNC A;  2FWG A;  2O87 A;  1XCC A;  17GS A;  3FRC A;  1XOB A;  4MAB A;  5CO3 A;  5CRD A;  5CAX A;  1JZO A;  4K8M A;  3PIN A;  4XRD A;  3APQ A;  4MK3 A;  1GL8 A;  1M2B A;  3HVS A;  2H76 A;  5DQS A;  3BOA A;  2WZ9 A;  1K0C A;  1EOG A;  3LFL A;  2HLS A;  1KBN A;  3IA1 A;  2FUG 2;  1UC7 A;  4PUR A;  1THO A;  1YJ6 A;  3UBK A;  3WT1 A;  4G9H A;  2YN1 A;  4GST A;  5G31 A;  1Z5Y E;  2Z9S A;  1USB A;  2LJA A;  2GVP A;  4IJ3 A;  1GSQ A;  2FD3 A;  3RAZ A;  3VUR A;  4OFM A;  3ISO A;  3K8N A;  3DYR A;  1OAZ A;  2LQQ A;  3L9V A;  3F0I A;  4RQX A;  3EU3 A;  4HQZ A;  5JCW A;  2B5Y A;  5IMZ A;  3FR6 A;  3F3Q A;  2HYX A;  5DCH A;  2H72 A;  2GS3 A;  1R4W A;  1AQX A;  10GS A;  1ERV A;  5ECN B;  3TKS A;  3ZVJ A;  2I81 A;  4MZW A;  3UL3 A;  2MZC A;  3ZRD A;  1TU7 A;  2GQL A;  3HA9 A;  2A2S A;  2DJ2 A;  2DBC A;  2HSH A;  5CNW A;  4PXO A;  1J0F A;  1DE1 A;  1GTA A;  1A2J A;  1GRX A;  4IEL A;  5D93 A;  1HNA A;  6GSS A;  3W8S A;  5ECS A;  3F9U A;  4WF4 A;  4JED A;  1HD2 A;  3D21 A;  4G0L A;  3EE2 A;  3H1N A;  1M2A A;  2H75 A;  3RDW A;  3A2X A;  1ERW A;  2D2Z A;  4KSO A;  3TRX A;  3MAK A;  2F9S A;  2HRA A;  2VL2 A;  2WS2 A;  1YQ1 A;  3GH6 A;  4MDC A;  3QAG A; 
#chains in the Genus database with same CATH topology
 3LQ7 A;  4MF6 A;  1SYR A;  3CQF A;  2IPA A;  4WF5 A;  1BYE A;  2QC7 A;  4ZB7 A;  4W66 A;  3LSZ A;  3DVW A;  2VLU A;  3GA4 A;  2OAC A;  1MDJ A;  4IP6 A;  5J9C A;  2R0G A;  1G6Y A;  2FY6 A;  1ZZY A;  1QUW A;  3W8J A;  1O8X A;  2MMZ A;  3EVI A;  3VPT A;  2JAD A;  2TIR A;  1QFN A;  2OE1 A;  1BX9 A;  1QK8 A;  1LU4 A;  2OKA A;  1XG8 A;  1FB6 A;  3L78 A;  2RII A;  2HRN A;  3IBH A;  1CQH A;  1S3R A;  2VCZ A;  9GSS A;  1GWC A;  5GST A;  5CP1 A;  1ZL9 A;  5D9X A;  4ZL7 A;  3HMJ G;  2DKH A;  2TRC P;  1OC8 A;  4ML1 A;  2WVZ A;  2C0G A;  2O8V B;  4P3Y B;  4V1A g;  2R4V A;  5ABR A;  3IHG A;  4I2T A;  4E68 A;  4ML6 A;  4MZC A;  2MBT A;  2H6X A;  4MH2 A;  4K7O A;  1O6J A;  5DCG A;  2WDU A;  2PVQ A;  4ECJ A;  3P8W A;  1V9W A;  2VKZ G;  3BD2 A;  5IMA A;  3E9J B;  4PI2 C;  1UN2 A;  4Q5Q A;  2HFD A;  4EF0 A;  3ME8 A;  2OBK A;  3DXB A;  4XS1 A;  2K18 A;  2K8V A;  4WR5 A;  1JZW A;  3IK7 A;  4RI7 A;  1URM A;  3O6T A;  3GKN A;  3FW2 A;  3FZ5 A;  2YP6 A;  1LBK A;  1QMV A;  1R5A A;  2WJU A;  1WRY A;  1U88 A;  3HCZ A;  3TJJ A;  2VD1 A;  5JCG A;  4KF9 A;  3E0U A;  2YWM A;  2DJJ A;  3ZMK A;  3IAS 2;  2B1K A;  4RI6 A;  1Z6M A;  4MLY A;  6GSX A;  2VCX A;  1XOA A;  4O5Q A;  2O5V A;  2I4A A;  2C3T A;  4IS0 A;  2IMK A;  3FK8 A;  1W89 A;  3HDC A;  1A2M A;  1TXU A;  1YF0 A;  2RUF A;  5JWO B;  4AKG A;  5KN2 A;  2CQ9 A;  4K0N A;  4CDO A;  3F4R A;  2H1A A;  5DVB A;  4XS6 A;  2A4V A;  7GSS A;  1XVQ A;  1EP8 A;  2H0I A;  4MJE A;  1OC9 A;  2L5O A;  2KHP A;  2B3S A;  2YPM A;  5ECI B;  2IWT A;  3UJ1 A;  5IOW A;  2LS5 A;  2YWI A;  4CY6 A;  2H71 A;  4F0C A;  5D8I A;  1U3I A;  1K0B A;  5ECM B;  3TOU A;  3OR5 A;  3I43 A;  4GWR A;  1PL1 A;  2FGX A;  3D22 A;  4WKW A;  4TR4 A;  1V40 A;  4NV5 A;  3A3T A;  4AKI A;  4ID0 A;  3IV4 A;  5DAK A;  2YJH A;  1XWK A;  5A1N A;  5CRW A;  3I69 A;  1OC9 B;  2EIO A;  4HJ2 A;  4PUF C;  1GUH A;  3MWH A;  4ZXG A;  4FYB A;  1FW1 A;  4ZBB A;  1HYU A;  1T3B A;  3IAM 2;  4ZB8 A;  3CXG A;  4DSR A;  2OE3 A;  2AV4 A;  4K2D A;  2QGV A;  4MMM A;  1F9M A;  3KH9 A;  2P5Q A;  3CTF A;  3GX0 A;  4O92 A;  4PUA A;  5A1N B;  2L57 A;  6GST A;  3HHV A;  1K0O A;  3M8N A;  3GFK A;  3IK9 A;  3FZ4 A;  4K7I A;  1Z7R A;  2LST A;  2DJ0 A;  3GST A;  2CZ2 A;  1XPV A;  3LJR A;  2DMM A;  5KEJ A;  4TXO A;  5DQY A;  4MJA A;  2GT6 A;  5CRH A;  5C04 A;  2WB9 A;  5G1L A;  2PWJ A;  2GQK A;  5ECR B;  3LOR A;  5IMD A;  3TOT A;  5IIZ A;  4TR1 B;  1IYH A;  3W6G A;  2GZY A;  4D73 A;  3RHB A;  3DKS A;  1YEX A;  4LMW A;  4X4J A;  3FYG A;  5A5K A;  2NBS A;  1YY7 A;  4TOP A;  1BAY A;  5HR0 A;  5J4U A;  3PPU A;  2DSA A;  1SJ6 A;  4TXO B;  1WPI A;  2CX3 A;  1TW9 A;  4PQH A;  2R3X A;  5DJM A;  3TUE A;  2JU5 A;  4FYU A;  5L71 A;  3KIJ A;  1SK2 A;  2HZE A;  1I5G A;  4YKF A;  1YF1 A;  3RFR C;  2EC4 A;  1YVL A;  3GIX A;  2LNT A;  1TRS A;  4D73 B;  4N11 A;  3SWL A;  1JZR A;  2YV9 A;  2VM2 A;  5IPG A;  5IMV A;  2RM5 A;  2JL4 A;  3WGD A;  3ZIT A;  3A5I A;  4LLR A;  4LL1 B;  5DBQ A;  2PUK C;  1K3L A;  5F05 A;  3P2A A;  2HZE B;  4V2N A;  1PX6 A;  5KN0 A;  5E59 A;  1A0R P;  1FO5 A;  3TRQ A;  1VF2 A;  1YZX A;  2LJR A;  5CRG A;  2LV3 A;  2YNX A;  1VF4 A;  4YQM A;  3VI5 A;  4BWS A;  1MEK A;  3KTB A;  1GH2 A;  3KXO A;  2H1L A;  1SJI A;  1AQV A;  1PD2 1;  4BA7 A;  3QCP A;  2G0F A;  1TJD A;  2J9H A;  1TI1 A;  1N25 A;  2NDO A;  4YKG A;  2FA8 A;  5E4W A;  4DSQ A;  1B4P A;  1X5D A;  3PR8 A;  4ECI A;  2N5B A;  5G1K A;  2L6C A;  3BCI A;  2TRX A;  4Z2T A;  3ZFL A;  1XW9 A;  2JZR A;  5CYY A;  1QGV A;  4GDF A;  4MJB A;  1SEN A;  4G19 A;  1SL0 B;  1TK0 B;  2K9F A;  4HU9 A;  4TR3 A;  2H73 A;  5ELG A;  5IM9 A;  4HQS A;  4NV2 A;  4QL7 A;  2FLS A;  1OE8 A;  2AB6 A;  4XRA A;  4CW9 A;  2J23 A;  1A0F A;  3UVH A;  1DE2 A;  1OKD A;  3EMX A;  4BVY A;  2GQM A;  1U87 A;  4PNG A;  2IMF A;  5ECO B;  3F8U A;  3MIX A;  4KDY A;  4N0V A;  4IBP A;  2LRT A;  3ERW A;  1O73 A;  2L4C A;  4EIP A;  16GS A;  3CTG A;  1PRX A;  2WVX A;  1AUC A;  4FO5 A;  4IGJ A;  4O7H A;  1AW9 A;  4K2X A;  4HI7 A;  1FOH A;  1PKW A;  3ZFB A;  4MCU A;  4IJI A;  3US3 A;  2IME A;  2IJY A;  5ECK B;  4KE3 A;  5ENU A;  1K0M A;  4BVY B;  3V1W A;  4JE1 A;  2OA7 A;  2F8A A;  4V1A p;  2PBJ A;  2HT9 A;  4ISD A;  3UIW A;  2WVX B;  2XHF A;  5GSS A;  1OYJ A;  5ELA A;  5FWG A;  4L8E A;  3C1R A;  1ZOF A;  2GSQ A;  5G5E A;  3QDN A;  3J7Y b;  3AY8 A;  3IC4 A;  2KP2 A;  3WT2 A;  4G10 A;  4CY8 A;  3WYW A;  3GTU B;  4IP1 A;  1B8X A;  3R2Q A;  3H79 A;  3TU3 B;  1VGL A;  1Z9H A;  5J40 A;  3DRN A;  4ILF A;  3E3E A;  1XWC A;  1GNE A;  1AC1 A;  3IRA A;  2V2G A;  1NM3 A;  1K3O A;  2A2P A;  1YEP A;  2C4J A;  2DJ1 A;  2CVB A;  3U5R E;  2HSY A;  2KOK A;  3QR6 A;  2EFH A;  4X1U A;  2VO4 A;  3DVX A;  1X9M B;  3EIN A;  1G7O A;  2HSM A;  3VFI A;  5INY A;  2CVD A;  1PA3 A;  1GSY A;  4EDY A;  3DIE A;  5HQP A;  2HE3 A;  3HVX A;  1YEW C;  1G6W A;  3KTL A;  4KDX A;  1M2D A;  1JLV A;  3N9J A;  3WD6 A;  4MP4 A;  3H93 A;  3ZIV A;  2QA1 A;  4MH3 A;  4HOJ A;  2HI7 A;  3CSJ A;  2DKI A;  1VRS D;  5J4V A;  2HSM B;  4PNF A;  2MMA A;  3UMA A;  2H0H A;  2I1U A;  3QFB C;  1A8L A;  4EDZ A;  2E2G A;  2YOI A;  3M1G A;  2DLX A;  1S3A A;  1TDI A;  3GH9 A;  2LTK A;  1PKZ A;  5D9V A;  3HVV A;  1VF3 A;  1M99 A;  4N0Z A;  2LRN A;  5HR1 A;  3TGZ A;  5B7C A;  1SJZ A;  3EMP A;  3IR4 A;  2L4Q A;  2PVO C;  1RK4 A;  2GZP A;  2H01 A;  1PFO A;  3C71 A;  2CZ3 A;  5A4W A;  2HSN A;  3UEM A;  2VCQ A;  3KP9 A;  2FNO A;  1TXX A;  2PN8 A;  5HFK A;  2H1B A;  4GTU A;  4EVM A;  1Q98 A;  2X8C A;  1EZK A;  2WGR A;  2QA2 A;  2C3Q A;  3P90 A;  2YZU A;  5KN3 A;  2M46 A;  4DEJ A;  2QSI A;  2G2Q A;  2WW2 A;  1TU8 A;  6GSU A;  1XBS A;  2HSN B;  1GP1 A;  2ZNM A;  3ED3 A;  1GTI A;  1GSS A;  2DIY A;  2O3E A;  4XCS A;  4GRF A;  1SK1 A;  2C0D A;  4KDU A;  2ON5 A;  4GQF A;  2H6Z A;  2REM A;  3F6D A;  1XWG A;  3FZA A;  1U6T A;  1M3J A;  2PU9 C;  4ACS A;  1K0A A;  1M3I A;  1RW1 A;  1EEJ A;  1T00 A;  5GAN D;  1GTB A;  2O89 A;  1PMT A;  4BVX A;  1SL2 B;  4ICY A;  2GZZ A;  3L9U A;  1ZCP A;  2ES7 A;  4IQA A;  1TRW A;  3FR3 A;  2C0E A;  3FHK A;  1PX7 A;  2BJX A;  4KND A;  1AQW A;  3KEB A;  4BVX B;  2MBS A;  3M3M A;  3NOF A;  3HKR A;  1YKA A;  2X4A A;  1SVL A;  1K3Y A;  3TCO A;  3L0H A;  1ZYQ B;  4NWY A;  1MTC A;  1MDI A;  3D6I A;  1EV4 A;  1FB0 A;  3LG6 A;  4ZL9 A;  3SBC A;  5EY6 A;  4N10 A;  3F6F A;  2EFD A;  2HXK A;  3Q19 A;  3S9F A;  4BPY A;  1FVK A;  1AAZ A;  3M9K A;  2L6D A;  2VUP A;  2CAI A;  5J41 A;  3ZVJ D;  3GUS A;  2ON7 A;  3CMI A;  4PQI A;  3IOS A;  5A5H A;  2LQO A;  3MYD A;  1GLQ A;  4OMV A;  4E8H A;  1R26 A;  2IMI A;  1TOF A;  4XS4 A;  5FHI A;  1TTZ A;  4RUV A;  1B9X C;  5F0G A;  2R37 A;  4I2U A;  1GLP A;  5IQY A;  4IW9 A;  5B6M A;  4G01 A;  1T8E B;  4IVF A;  5A4U A;  2AHE A;  2VCW A;  1UA5 A;  1EP7 A;  1WMJ A;  3QOU A;  4JZQ A;  4LMV A;  4HZ4 A;  5A5H B;  3GN3 A;  2IFQ A;  2QKE A;  3A2V A;  2GSS A;  4GLT A;  1Y25 A;  2NVL A;  1PGT A;  4XS4 B;  4K7N A;  1MD4 A;  4JR6 A;  3EWL A;  4EUY A;  4TR1 A;  4MPF A;  4AI6 A;  2JZS A;  5DJL A;  8GSS A;  3GL3 A;  2JZT A;  3HJO A;  4MNN A;  1ZGN A;  2FCH A;  3L4N A;  1BG5 A;  1AIU A;  4TVE A;  4USS A;  5DAL A;  4XTS A;  3KMO A;  3TRP A;  4FYC A;  2XBQ A;  2IFQ B;  4L0W A;  1SU9 A;  3MSZ A;  3QFA C;  2F3M A;  1MDK A;  2XPD A;  3APO A;  4K5R A;  1R7H A;  1SD8 A;  1HQO A;  4HUA A;  4GSN A;  4RQR A;  1S3D A;  4KSM A;  2AUV A;  4EE0 A;  2WW0 A;  1GSF A;  2H8L A;  1YDK A;  2E2M A;  3HVN A;  5DAL B;  2GST A;  3MNG A;  4K1F A;  1DSB A;  3QD9 A;  5JWR B;  2A4H A;  5F06 A;  3JCM L;  3D4T A;  5B6N A;  2CX4 A;  1TRU A;  1GUL A;  1XWB A;  2PER A;  3RBT A;  4WXT A;  3F3R A;  1X5C A;  3KJY A;  4KGI A;  2YWN A;  1S4B P;  1YKC A;  4O32 A;  2OBI A;  4JRR A;  4J2F A;  3EU4 A;  4EC0 A;  4PI0 C;  3ZRE A;  1X9S B;  2I3Y A;  4HSC X;  1ZYP A;  4KB3 A;  5A4V A;  5EVO A;  5AIS A;  1KTE A;  2N5F A;  4G2E A;  1SKS B;  4KH7 A;  2CVK A;  3KZQ A;  2HNL A;  3EUR A;  2GT5 A;  5KOW A;  5D73 A;  5G30 A;  1T7P B;  4Q5R A;  3CSI A;  2X49 A;  5IMC A;  4O5R A;  4MF5 A;  4EKZ A;  4OO5 A;  1E6B A;  5ECQ B;  4EL1 A;  5GAP D;  2HRK B;  5AIX A;  2H1D A;  1B4Q A;  2H70 A;  1N2A A;  3G7J A;  3KD0 A;  2LUS A;  4MJC A;  2WW1 A;  3RPP A;  5B8B A;  5J47 A;  1JZD A;  6GSW A;  5A34 A;  2CT6 A;  5J5N A;  1N8J A;  3D4M A;  1SYX A;  5J4Y A;  6GSV A;  5IOX A;  4GXZ A;  1GNW A;  2YWO A;  3QPM A;  1FOV A;  1ABA A;  2CA8 A;  4WBJ A;  3GNJ A;  3DGQ A;  4QQ7 A;  1I1I P;  3EC3 A;  2YAN A;  2FHE A;  1F6M C;  2XBI A;  3VK9 A;  2OJL A;  3IPZ A;  4XHM A;  3F4T A;  5A34 B;  4OD7 A;  5EL8 A;  4A5P A;  5HFG A;  2P0G A;  4I6X A;  4PTS A;  2V6O A;  4K5S A;  4O5U A;  1A24 A;  2R0C A;  1XW6 A;  1Y1U A;  5IPH A;  4FIW A;  4HEA 2;  1QXH A;  1ML6 A;  5IO0 A;  3TKS E;  2OAD A;  2JAC A;  4AGS A;  4N30 A;  5F8B A;  2C3N A;  2VL9 A;  5HFI A;  3DD3 A;  3KCM A;  3BBY A;  3GYK A;  2WFC A;  1PQN A;  3TDG A;  4WET A;  2B5X A;  3GTU A;  1GSE A;  4JR4 A;  4AF2 A;  2ZUP A;  4MZB A;  4POK A;  4L5L A;  3QMX A;  3NZN A;  3IC8 A;  1F2E A;  5AN1 A;  4KA0 A;  3GMF A;  3ZZX A;  2V1M A;  3M9J A;  4X0X A;  3TJK A;  4POB A;  2LJK A;  3RPN A;  3FZ9 A;  4F0B A;  4ZL8 A;  3HJM A;  3ERF A;  4N3Z A;  3L9S A;  4WR4 A;  1FVJ A;  5IO2 A;  3HD5 A;  4GQC A;  4KCA A;  2EFC A;  4KAE A;  4J56 E;  1CQG A;  1W4V A;  2H66 A;  2WRT A;  3VPQ A;  3G7I A;  4Z7X A;  12GS A;  2HZF A;  4I8B A;  5H5R A;  1JFU A;  1C72 A;  3BJ5 A;  2FWE A;  1V58 A;  2DJK A;  1FHE A;  2I9H A;  2H74 A;  4KUN A;  4QL9 A;  4AJ8 A;  3R3E A;  4NPB A;  1THX A;  4ULX A;  3VLN A;  2FA4 A;  2GDR A;  1WWJ A;  1XWA A;  3C1S A;  4GCI A;  3TJG A;  3TKS C;  5ECP B;  1T4Z A;  4IHU A;  3GKK A;  2VIM A;  4YQU A;  3GHA A;  5HR3 A;  1WIK A;  1Z3E A;  4TN8 A;  1TRV A;  1SKR B;  5J9B A;  1QQ2 A;  2V32 A;  5D9T A;  2C0F A;  3ZML A;  2H1G A;  2FWF A;  1B48 A;  4BIK A;  3CRT A;  1T1V A;  5ECL B;  2MMN A;  2YV7 A;  5KN1 A;  2M72 A;  2H6Y A;  1G0T A;  3I6A A;  2H19 A;  5AIV A;  1TP9 A;  3C8E A;  1O85 A;  4FXY P;  3KH7 A;  3CWG A;  2B5E A;  1GSU A;  1GUK A;  1V98 A;  2X8H A;  3EYT A;  1OKT A;  2OT3 A;  4Q5N A;  5ECH B;  2EFE A;  3EPT A;  2VCV A;  2VL2 C;  2PPT A;  3TKP A;  2V41 A;  2EIQ A;  3I9V 2;  1EEM A;  3TKQ A;  3TJF A;  3KM6 A;  3HYP A;  2K8S A;  1OC3 A;  2K6V A;  4Z2R A;  1ZYE A;  5EPF A;  4FH8 A;  4H86 A;  19GS A;  1NHO A;  3VI7 A;  4NXI A;  2N5A A;  5G2Z A;  2P5R A;  2V6K A;  1T4Y A;  1V2A A;  3GUR A;  2LNS A;  3VWV A;  2PGT A;  1H4O A;  5BRT A;  1Z6N A;  1WP0 A;  3FKF A;  4AJ7 A;  4L5O A;  3KP8 A;  4K0G A;  2E0Q A;  1F37 A;  1A8Y A;  1ERU A;  2KUC A;  20GS A;  4POL A;  2XPE A;  1TI3 A;  2AYT A;  4E8E A;  3ME7 A;  4G0K A;  4JBB A;  3ZIJ A;  3LXZ A;  3FY7 A;  3TJB A;  2O7K A;  4OFN A;  2CV4 A;  3F63 A;  1ERT A;  4TXV A;  2WCI A;  1X9W B;  2IL3 A;  3CSH A;  5ID2 A;  5KOX A;  1GUM A;  1M9A A;  1NHY A;  2RLI A;  1V57 A;  2C8U A;  11GS A;  1VF1 A;  2L5L A;  1BQ7 A;  2LKU A;  2ALB A;  4CHS A;  2YZH A;  2BTO T;  2XC2 A;  1FAA A;  3LW9 A;  5IMF A;  1SKW B;  13GS A;  1M9B A;  1NSW A;  3FEU A;  4EO3 A;  1BG1 A;  4K9Z A;  3A2W A;  1JHB A;  3FMW A;  4BWQ A;  5ID2 B;  4ZIL A;  4NHW A;  5FT3 A;  3H4K A;  5JCU A;  5LCZ A;  1KEB A;  4YH2 A;  2UV8 G;  2KLX A;  2H0G A;  5LD0 A;  3F4S A;  3WGX A;  4OCE A;  1G7E A;  1JLW A;  4NMU A;  2DML A;  4EIQ A;  1ACV A;  4HZ2 A;  3IXR A;  3UOM A;  1SK0 A;  2IN3 A;  1A23 A;  3KMN A;  1WOU A;  4MPG A;  1J08 A;  4KCE A;  4TR0 A;  2HQT A;  2F8F A;  2LRC A;  4LL4 B;  1PN9 A;  4HS1 A;  2UZ8 A;  3GV1 A;  3O76 A;  3C73 A;  1EOH A;  4IN0 A;  2KP1 A;  4MA9 A;  4AJ6 A;  1U3A A;  2DIZ A;  2NPB A;  4V2L A;  4K6X A;  5GZZ B;  3RGB C;  2B7K A;  3NIV A;  1ZYN A;  1TK8 B;  1M7T A;  2ZCT A;  4PGT A;  4HU7 A;  2GLR A;  1UVZ A;  3TB2 A;  1SL1 B;  5H5S A;  3UAP A;  3GX8 A;  2GTU A;  3D0Z A;  1GTU A;  2IIY A;  4JU5 A;  1KNG A;  3IE3 A;  3GRX A;  4ECC A;  6GSY A;  4EXJ A;  2RUE A;  1EGR A;  2AAW A;  3LYP A;  4ZBD A;  2B1L A;  2P31 A;  2CAQ A;  3BCK A;  1BED A;  2X8G A;  4X43 A;  4ZBA A;  14GS A;  1TK5 B;  3WGE A;  3GSS A;  2JSZ A;  2OE0 A;  2R5G A;  1SD9 A;  1TKD B;  1ST9 A;  3UVT A;  5BMU A;  4NHZ A;  22GS A;  2DJ3 A;  5COH A;  3H8Q A;  3ZYW A;  3C7M A;  2DC5 A;  4OWY A;  1XZO A;  3IHQ A;  4KW6 A;  3DWV A;  5B8A A;  3MDK A;  5D96 A;  4WEY A;  3CYN A;  4GSS A;  4DVC A;  2BMX A;  4J57 E;  2VLV A;  4FQU A;  2JSY A;  4F03 A;  3CBU A;  4IKH A;  2X99 A;  3IDV A;  2GGT A;  1AXD A;  1O7U A;  4YAV A;  5BMU B;  1FG4 A;  2NTO A;  2IMD A;  4ZB9 A;  4HDE A;  3DEX A;  1F3B A;  1WE0 A;  1Y6E A;  3CHX C;  5DAK B;  2X64 A;  4XIH A;  4QMK A;  3VWX A;  2EIR A;  3GKM A;  1ON4 A;  1XW5 A;  1RQM A;  1PSQ A;  2PMT A;  3APS A;  5AGY A;  2VD0 A;  1IYI A;  2VOC A;  4L0U A;  5CRE A;  3U6V A;  4YAP A;  2MMO A;  1O81 A;  1H75 A;  1R5P A;  3GKX A;  3LEF A;  4WBR D;  4OO4 A;  3A5W A;  4PQ1 A;  3PH9 A;  2YJ7 A;  2O36 A;  1XIY A;  2B7J A;  3FR9 A;  1GSD A;  1E2Y A;  2VAF A;  3ZTL A;  3ERG A;  18GS A;  5HR2 A;  3Q6O A;  4NAX A;  1XVW A;  4POM A;  2HRF A;  3G9B A;  3UBL A;  1B9Y C;  2LEG A;  1OE7 A;  2GSR A;  4Q5F A;  1J9B A;  3RHC A;  3PGT A;  2YCD A;  4KX4 A;  3LGC A;  2WVY A;  1X0R A;  2C1Y A;  1MD3 A;  4F9Z A;  2VLT A;  3P7X A;  4I97 A;  4PX1 A;  4G0I A;  5G5F A;  5JWQ B;  1M0U A;  3Q18 A;  2HRK A;  3J7Y k;  1K0D A;  5C00 A;  5LNK e;  2AJQ B;  4PHZ C;  1OVN A;  4ECB A;  1EV9 A;  2VM1 A;  1SVO A;  4YQV A;  5F07 A;  1BJX A;  3HZ4 A;  4OFT A;  4F2I A;  3DML A;  5J3R A;  4MF7 A;  1I9D A;  3O3T A;  2VCT A;  3QAV A;  3ZL5 A;  2WZS A;  3GL5 A;  2A2R A;  2F51 A;  4OCF A;  1XFL A;  1DUG A;  5DDL A;  1ILO A;  1Q4J A;  3N5O A;  3UAR A;  2R2J A;  2C80 A;  5H5Q A;  1F3A A;  2FWH A;  3QAW A;  1WJK A;  3Q74 A;  2MYG A;  4Z2U A;  3HZ8 A;  4GF0 A;  2H30 A;  2WUL A;  4DSS A;  2O85 A;  1XXU A;  1HNB A;  1K0N A;  1O8W A;  5D9W A;  3HJP A;  3VWU A;  1Z7P A;  4IQ1 A;  3D5J A;  1DBY A;  1ZMA A;  4ZB6 A;  4BL7 A;  3HY2 A;  3ZLP A;  3G7Y A;  1EWX A;  1A2L A;  2VL3 A;  1EGO A;  3KGK A;  4V2M A;  4TRX A;  1NW2 A;  4I5Q A;  4DSS B;  3TKR A;  2RM6 A;  3CRU A;  3LXT A;  2R6K A;  3HXS A;  4LA1 A;  2B6M A;  4BL7 B;  3LWA A;  4TKY A;  2L59 A;  1S3C A;  2E7P A;  4TW5 A;  3VWW A;  4ZIJ A;  1SVM A;  2M80 A;  4HJM A;  1X5E A;  1PN0 A;  4AKH A;  3LYK A;  3M0F A;  4F82 A;  1PL2 A;  1LJR A;  1HNC A;  2FWG A;  2O87 A;  1XCC A;  17GS A;  3FRC A;  1XOB A;  4MAB A;  5CO3 A;  5CRD A;  5CAX A;  1JZO A;  4K8M A;  3PIN A;  4XRD A;  3APQ A;  4MK3 A;  1GL8 A;  1M2B A;  3HVS A;  2H76 A;  5DQS A;  3BOA A;  2WZ9 A;  1K0C A;  1EOG A;  3LFL A;  2HLS A;  1KBN A;  3IA1 A;  2FUG 2;  1UC7 A;  4PUR A;  1THO A;  1YJ6 A;  3UBK A;  1BF5 A;  3WT1 A;  4G9H A;  2R0P A;  2YN1 A;  4GST A;  5G31 A;  1Z5Y E;  2Z9S A;  1USB A;  2LJA A;  2GVP A;  4IJ3 A;  1GSQ A;  2FD3 A;  3RAZ A;  3VUR A;  4OFM A;  3ISO A;  3K8N A;  3DYR A;  1OAZ A;  2LQQ A;  3L9V A;  3F0I A;  4RQX A;  3EU3 A;  4HQZ A;  5JCW A;  2B5Y A;  5IMZ A;  3FR6 A;  3F3Q A;  2HYX A;  5DCH A;  2H72 A;  2GS3 A;  1R4W A;  1AQX A;  10GS A;  1ERV A;  5ECN B;  3TKS A;  3ZVJ A;  4AKX B;  2I81 A;  4MZW A;  3UL3 A;  2MZC A;  3ZRD A;  1TU7 A;  2GQL A;  3HA9 A;  2A2S A;  2DJ2 A;  2DBC A;  2HSH A;  5CNW A;  4PXO A;  1J0F A;  2WW3 A;  1DE1 A;  1GTA A;  1A2J A;  1GRX A;  4IEL A;  5D93 A;  1HNA A;  6GSS A;  3W8S A;  5ECS A;  3F9U A;  4WF4 A;  4JED A;  1HD2 A;  3D21 A;  4G0L A;  3EE2 A;  3H1N A;  1M2A A;  2H75 A;  3RDW A;  3A2X A;  1ERW A;  2D2Z A;  4KSO A;  3TRX A;  3MAK A;  2F9S A;  2HRA A;  2VL2 A;  2WS2 A;  1YQ1 A;  3GH6 A;  4MDC A;  3QAG A; 
#chains in the Genus database with same CATH homology
 3LQ7 A;  4MF6 A;  1SYR A;  2IPA A;  4WF5 A;  1BYE A;  2QC7 A;  4ZB7 A;  4W66 A;  3LSZ A;  3DVW A;  2VLU A;  3GA4 A;  2OAC A;  1MDJ A;  4IP6 A;  5J9C A;  2R0G A;  1G6Y A;  2FY6 A;  1ZZY A;  1QUW A;  3W8J A;  1O8X A;  2MMZ A;  3EVI A;  3VPT A;  2JAD A;  2TIR A;  1QFN A;  2OE1 A;  1BX9 A;  1QK8 A;  1LU4 A;  2OKA A;  1FB6 A;  3L78 A;  2RII A;  2HRN A;  3IBH A;  1CQH A;  2VCZ A;  9GSS A;  1GWC A;  5GST A;  5CP1 A;  1ZL9 A;  5D9X A;  4ZL7 A;  3HMJ G;  2DKH A;  2TRC P;  1OC8 A;  4ML1 A;  2C0G A;  2O8V B;  4P3Y B;  4V1A g;  2R4V A;  5ABR A;  3IHG A;  4I2T A;  4E68 A;  4ML6 A;  4MZC A;  2MBT A;  2H6X A;  4MH2 A;  4K7O A;  1O6J A;  5DCG A;  2WDU A;  2PVQ A;  4ECJ A;  3P8W A;  1V9W A;  2VKZ G;  3BD2 A;  5IMA A;  3E9J B;  1UN2 A;  4Q5Q A;  2HFD A;  4EF0 A;  3ME8 A;  2OBK A;  3DXB A;  4XS1 A;  2K18 A;  2K8V A;  4WR5 A;  1JZW A;  3IK7 A;  4RI7 A;  1URM A;  3O6T A;  3GKN A;  3FW2 A;  3FZ5 A;  2YP6 A;  1LBK A;  1QMV A;  1R5A A;  2WJU A;  1WRY A;  1U88 A;  3HCZ A;  3TJJ A;  2VD1 A;  5JCG A;  4KF9 A;  3E0U A;  2YWM A;  2DJJ A;  3ZMK A;  3IAS 2;  2B1K A;  4RI6 A;  1Z6M A;  4MLY A;  6GSX A;  2VCX A;  1XOA A;  4O5Q A;  2O5V A;  2I4A A;  2C3T A;  4IS0 A;  2IMK A;  3FK8 A;  1W89 A;  3HDC A;  1A2M A;  1TXU A;  1YF0 A;  2RUF A;  5JWO B;  4AKG A;  5KN2 A;  2CQ9 A;  4K0N A;  4CDO A;  3F4R A;  2H1A A;  5DVB A;  4XS6 A;  2A4V A;  7GSS A;  1XVQ A;  1EP8 A;  2H0I A;  4MJE A;  1OC9 A;  2L5O A;  2KHP A;  2B3S A;  2YPM A;  5ECI B;  2IWT A;  3UJ1 A;  5IOW A;  2LS5 A;  2YWI A;  4CY6 A;  2H71 A;  4F0C A;  5D8I A;  1U3I A;  1K0B A;  5ECM B;  3TOU A;  3OR5 A;  3I43 A;  4GWR A;  1PL1 A;  2FGX A;  3D22 A;  4WKW A;  4TR4 A;  1V40 A;  4NV5 A;  3A3T A;  4AKI A;  4ID0 A;  3IV4 A;  5DAK A;  2YJH A;  1XWK A;  5A1N A;  5CRW A;  3I69 A;  1OC9 B;  2EIO A;  4HJ2 A;  4PUF C;  1GUH A;  3MWH A;  4ZXG A;  4FYB A;  1FW1 A;  4ZBB A;  1HYU A;  1T3B A;  3IAM 2;  4ZB8 A;  3CXG A;  4DSR A;  2OE3 A;  2AV4 A;  4K2D A;  2QGV A;  4MMM A;  1F9M A;  3KH9 A;  2P5Q A;  3CTF A;  3GX0 A;  4O92 A;  4PUA A;  5A1N B;  2L57 A;  6GST A;  3HHV A;  1K0O A;  3M8N A;  3GFK A;  3IK9 A;  3FZ4 A;  4K7I A;  1Z7R A;  2LST A;  2DJ0 A;  3GST A;  2CZ2 A;  1XPV A;  3LJR A;  2DMM A;  5KEJ A;  4TXO A;  5DQY A;  4MJA A;  2GT6 A;  5CRH A;  5C04 A;  2WB9 A;  5G1L A;  2PWJ A;  2GQK A;  5ECR B;  3LOR A;  5IMD A;  3TOT A;  5IIZ A;  4TR1 B;  1IYH A;  3W6G A;  2GZY A;  4D73 A;  3RHB A;  3DKS A;  1YEX A;  4LMW A;  4X4J A;  3FYG A;  5A5K A;  2NBS A;  1YY7 A;  4TOP A;  1BAY A;  5HR0 A;  5J4U A;  3PPU A;  2DSA A;  1SJ6 A;  4TXO B;  1WPI A;  2CX3 A;  1TW9 A;  4PQH A;  2R3X A;  5DJM A;  3TUE A;  2JU5 A;  4FYU A;  5L71 A;  3KIJ A;  1SK2 A;  2HZE A;  1I5G A;  4YKF A;  1YF1 A;  2EC4 A;  1YVL A;  3GIX A;  2LNT A;  1TRS A;  4D73 B;  4N11 A;  3SWL A;  1JZR A;  2YV9 A;  2VM2 A;  5IPG A;  5IMV A;  2RM5 A;  2JL4 A;  3WGD A;  3ZIT A;  3A5I A;  4LLR A;  4LL1 B;  5DBQ A;  2PUK C;  1K3L A;  5F05 A;  3P2A A;  2HZE B;  4V2N A;  1PX6 A;  5KN0 A;  5E59 A;  1A0R P;  1FO5 A;  3TRQ A;  1VF2 A;  1YZX A;  2LJR A;  5CRG A;  2LV3 A;  2YNX A;  1VF4 A;  4YQM A;  3VI5 A;  4BWS A;  1MEK A;  3KTB A;  1GH2 A;  3KXO A;  2H1L A;  1SJI A;  1AQV A;  1PD2 1;  4BA7 A;  3QCP A;  2G0F A;  1TJD A;  2J9H A;  1TI1 A;  1N25 A;  2NDO A;  4YKG A;  2FA8 A;  5E4W A;  4DSQ A;  1B4P A;  1X5D A;  3PR8 A;  4ECI A;  2N5B A;  5G1K A;  2L6C A;  3BCI A;  2TRX A;  4Z2T A;  3ZFL A;  1XW9 A;  2JZR A;  5CYY A;  1QGV A;  4GDF A;  4MJB A;  1SEN A;  4G19 A;  1SL0 B;  1TK0 B;  2K9F A;  4HU9 A;  4TR3 A;  2H73 A;  5ELG A;  5IM9 A;  4HQS A;  4NV2 A;  4QL7 A;  2FLS A;  1OE8 A;  2AB6 A;  4XRA A;  4CW9 A;  2J23 A;  1A0F A;  3UVH A;  1DE2 A;  1OKD A;  3EMX A;  4BVY A;  2GQM A;  1U87 A;  4PNG A;  2IMF A;  5ECO B;  3F8U A;  3MIX A;  4KDY A;  4N0V A;  4IBP A;  2LRT A;  3ERW A;  1O73 A;  2L4C A;  4EIP A;  16GS A;  3CTG A;  1PRX A;  1AUC A;  4FO5 A;  4IGJ A;  4O7H A;  1AW9 A;  4K2X A;  4HI7 A;  1FOH A;  1PKW A;  3ZFB A;  4MCU A;  4IJI A;  3US3 A;  2IME A;  2IJY A;  5ECK B;  4KE3 A;  5ENU A;  1K0M A;  4BVY B;  3V1W A;  4JE1 A;  2OA7 A;  2F8A A;  4V1A p;  2PBJ A;  2HT9 A;  4ISD A;  3UIW A;  2XHF A;  5GSS A;  1OYJ A;  5ELA A;  5FWG A;  4L8E A;  3C1R A;  1ZOF A;  2GSQ A;  5G5E A;  3QDN A;  3J7Y b;  3AY8 A;  3IC4 A;  2KP2 A;  3WT2 A;  4G10 A;  4CY8 A;  3WYW A;  3GTU B;  4IP1 A;  1B8X A;  3R2Q A;  3H79 A;  3TU3 B;  1VGL A;  1Z9H A;  5J40 A;  3DRN A;  4ILF A;  3E3E A;  1XWC A;  1GNE A;  1AC1 A;  3IRA A;  2V2G A;  1NM3 A;  1K3O A;  2A2P A;  1YEP A;  2C4J A;  2DJ1 A;  2CVB A;  3U5R E;  2HSY A;  2KOK A;  3QR6 A;  2EFH A;  4X1U A;  2VO4 A;  3DVX A;  1X9M B;  3EIN A;  1G7O A;  2HSM A;  3VFI A;  5INY A;  2CVD A;  1PA3 A;  1GSY A;  4EDY A;  3DIE A;  5HQP A;  2HE3 A;  3HVX A;  1G6W A;  3KTL A;  4KDX A;  1M2D A;  1JLV A;  3N9J A;  3WD6 A;  4MP4 A;  3H93 A;  3ZIV A;  2QA1 A;  4MH3 A;  4HOJ A;  2HI7 A;  3CSJ A;  2DKI A;  1VRS D;  5J4V A;  2HSM B;  4PNF A;  2MMA A;  3UMA A;  2H0H A;  2I1U A;  3QFB C;  1A8L A;  4EDZ A;  2E2G A;  2YOI A;  3M1G A;  2DLX A;  1S3A A;  1TDI A;  3GH9 A;  2LTK A;  1PKZ A;  5D9V A;  3HVV A;  1VF3 A;  1M99 A;  4N0Z A;  2LRN A;  5HR1 A;  3TGZ A;  5B7C A;  1SJZ A;  3EMP A;  3IR4 A;  2L4Q A;  2PVO C;  1RK4 A;  2GZP A;  2H01 A;  3C71 A;  2CZ3 A;  5A4W A;  2HSN A;  3UEM A;  2VCQ A;  3KP9 A;  2FNO A;  1TXX A;  2PN8 A;  5HFK A;  2H1B A;  4GTU A;  4EVM A;  1Q98 A;  2X8C A;  1EZK A;  2WGR A;  2QA2 A;  2C3Q A;  3P90 A;  2YZU A;  5KN3 A;  2M46 A;  4DEJ A;  2QSI A;  2G2Q A;  6GSU A;  1TU8 A;  1XBS A;  2HSN B;  1GP1 A;  2ZNM A;  3ED3 A;  1GTI A;  1GSS A;  2DIY A;  4XCS A;  4GRF A;  1SK1 A;  2C0D A;  4KDU A;  2ON5 A;  4GQF A;  2H6Z A;  2REM A;  3F6D A;  1XWG A;  3FZA A;  1U6T A;  2PU9 C;  4ACS A;  1K0A A;  1RW1 A;  1EEJ A;  1T00 A;  5GAN D;  1GTB A;  2O89 A;  1PMT A;  4BVX A;  1SL2 B;  4ICY A;  2GZZ A;  3L9U A;  1ZCP A;  2ES7 A;  4IQA A;  1TRW A;  3FR3 A;  2C0E A;  3FHK A;  1PX7 A;  2BJX A;  4KND A;  1AQW A;  3KEB A;  4BVX B;  2MBS A;  3M3M A;  3NOF A;  3HKR A;  1YKA A;  2X4A A;  1SVL A;  1K3Y A;  3TCO A;  3L0H A;  1ZYQ B;  4NWY A;  1MTC A;  1MDI A;  3D6I A;  1EV4 A;  1FB0 A;  3LG6 A;  4ZL9 A;  3SBC A;  5EY6 A;  4N10 A;  3F6F A;  2EFD A;  2HXK A;  3Q19 A;  3S9F A;  4BPY A;  1FVK A;  1AAZ A;  3M9K A;  2L6D A;  2VUP A;  2CAI A;  5J41 A;  3ZVJ D;  3GUS A;  2ON7 A;  3CMI A;  4PQI A;  3IOS A;  5A5H A;  2LQO A;  3MYD A;  1GLQ A;  4OMV A;  4E8H A;  1R26 A;  2IMI A;  1TOF A;  4XS4 A;  5FHI A;  1TTZ A;  4RUV A;  1B9X C;  5F0G A;  2R37 A;  4I2U A;  1GLP A;  5IQY A;  4IW9 A;  5B6M A;  4G01 A;  1T8E B;  4IVF A;  5A4U A;  2AHE A;  2VCW A;  1UA5 A;  1EP7 A;  1WMJ A;  3QOU A;  4JZQ A;  4LMV A;  4HZ4 A;  5A5H B;  3GN3 A;  2IFQ A;  2QKE A;  3A2V A;  2GSS A;  4GLT A;  1Y25 A;  2NVL A;  1PGT A;  4XS4 B;  4K7N A;  1MD4 A;  4JR6 A;  3EWL A;  4EUY A;  4TR1 A;  4MPF A;  4AI6 A;  2JZS A;  5DJL A;  8GSS A;  3GL3 A;  2JZT A;  3HJO A;  4MNN A;  1ZGN A;  2FCH A;  3L4N A;  1BG5 A;  1AIU A;  4TVE A;  4USS A;  5DAL A;  4XTS A;  3KMO A;  3TRP A;  4FYC A;  2XBQ A;  2IFQ B;  4L0W A;  1SU9 A;  3MSZ A;  3QFA C;  2F3M A;  1MDK A;  2XPD A;  3APO A;  4K5R A;  1R7H A;  1SD8 A;  1HQO A;  4HUA A;  4GSN A;  4RQR A;  1S3D A;  4KSM A;  2AUV A;  4EE0 A;  1GSF A;  2H8L A;  1YDK A;  2E2M A;  5DAL B;  2GST A;  3MNG A;  4K1F A;  1DSB A;  3QD9 A;  5JWR B;  2A4H A;  5F06 A;  3JCM L;  3D4T A;  5B6N A;  2CX4 A;  1TRU A;  1GUL A;  1XWB A;  2PER A;  3RBT A;  4WXT A;  3F3R A;  1X5C A;  3KJY A;  4KGI A;  2YWN A;  1YKC A;  4O32 A;  2OBI A;  4JRR A;  4J2F A;  3EU4 A;  4EC0 A;  3ZRE A;  1X9S B;  2I3Y A;  1ZYP A;  4KB3 A;  5A4V A;  5EVO A;  5AIS A;  1KTE A;  2N5F A;  4G2E A;  1SKS B;  4KH7 A;  2CVK A;  3KZQ A;  2HNL A;  3EUR A;  2GT5 A;  5KOW A;  5D73 A;  5G30 A;  1T7P B;  4Q5R A;  3CSI A;  2X49 A;  5IMC A;  4O5R A;  4MF5 A;  4EKZ A;  4OO5 A;  1E6B A;  5ECQ B;  4EL1 A;  5GAP D;  2HRK B;  5AIX A;  2H1D A;  1B4Q A;  2H70 A;  1N2A A;  3G7J A;  3KD0 A;  2LUS A;  4MJC A;  3RPP A;  5B8B A;  5J47 A;  1JZD A;  6GSW A;  5A34 A;  2CT6 A;  5J5N A;  1N8J A;  3D4M A;  1SYX A;  5J4Y A;  6GSV A;  5IOX A;  4GXZ A;  1GNW A;  2YWO A;  3QPM A;  1FOV A;  1ABA A;  2CA8 A;  4WBJ A;  3GNJ A;  3DGQ A;  4QQ7 A;  3EC3 A;  2YAN A;  2FHE A;  1F6M C;  2XBI A;  3VK9 A;  2OJL A;  3IPZ A;  4XHM A;  3F4T A;  5A34 B;  4OD7 A;  5EL8 A;  4A5P A;  5HFG A;  2P0G A;  4I6X A;  4PTS A;  2V6O A;  4K5S A;  4O5U A;  1A24 A;  2R0C A;  1XW6 A;  1Y1U A;  5IPH A;  4FIW A;  4HEA 2;  1QXH A;  1ML6 A;  5IO0 A;  3TKS E;  2OAD A;  2JAC A;  4AGS A;  4N30 A;  5F8B A;  2C3N A;  2VL9 A;  5HFI A;  3DD3 A;  3KCM A;  3BBY A;  3GYK A;  2WFC A;  1PQN A;  3TDG A;  4WET A;  2B5X A;  3GTU A;  1GSE A;  4JR4 A;  4AF2 A;  2ZUP A;  4MZB A;  4POK A;  4L5L A;  3QMX A;  3NZN A;  3IC8 A;  1F2E A;  5AN1 A;  4KA0 A;  3GMF A;  3ZZX A;  2V1M A;  3M9J A;  4X0X A;  3TJK A;  4POB A;  2LJK A;  3RPN A;  3FZ9 A;  4F0B A;  4ZL8 A;  3HJM A;  3ERF A;  4N3Z A;  3L9S A;  4WR4 A;  1FVJ A;  5IO2 A;  3HD5 A;  4GQC A;  4KCA A;  2EFC A;  4KAE A;  4J56 E;  1CQG A;  1W4V A;  2H66 A;  2WRT A;  3VPQ A;  3G7I A;  4Z7X A;  12GS A;  2HZF A;  4I8B A;  5H5R A;  1JFU A;  1C72 A;  3BJ5 A;  2FWE A;  1V58 A;  2DJK A;  1FHE A;  2I9H A;  2H74 A;  4KUN A;  4QL9 A;  4AJ8 A;  3R3E A;  4NPB A;  1THX A;  4ULX A;  3VLN A;  2FA4 A;  2GDR A;  1WWJ A;  1XWA A;  3C1S A;  4GCI A;  3TJG A;  3TKS C;  5ECP B;  1T4Z A;  4IHU A;  3GKK A;  2VIM A;  4YQU A;  3GHA A;  5HR3 A;  1WIK A;  1Z3E A;  4TN8 A;  1TRV A;  1SKR B;  5J9B A;  1QQ2 A;  2V32 A;  5D9T A;  2C0F A;  3ZML A;  2H1G A;  2FWF A;  1B48 A;  3CRT A;  1T1V A;  5ECL B;  2MMN A;  2YV7 A;  5KN1 A;  2M72 A;  2H6Y A;  1G0T A;  3I6A A;  2H19 A;  5AIV A;  1TP9 A;  3C8E A;  1O85 A;  3KH7 A;  3CWG A;  2B5E A;  1GSU A;  1GUK A;  1V98 A;  2X8H A;  3EYT A;  1OKT A;  2OT3 A;  4Q5N A;  5ECH B;  2EFE A;  3EPT A;  2VCV A;  2VL2 C;  2PPT A;  3TKP A;  2V41 A;  2EIQ A;  3I9V 2;  1EEM A;  3TKQ A;  3TJF A;  3KM6 A;  3HYP A;  2K8S A;  1OC3 A;  2K6V A;  4Z2R A;  1ZYE A;  5EPF A;  4FH8 A;  4H86 A;  19GS A;  1NHO A;  3VI7 A;  4NXI A;  2N5A A;  5G2Z A;  2P5R A;  2V6K A;  1T4Y A;  1V2A A;  3GUR A;  2LNS A;  3VWV A;  2PGT A;  1H4O A;  5BRT A;  1Z6N A;  1WP0 A;  3FKF A;  4AJ7 A;  4L5O A;  3KP8 A;  4K0G A;  2E0Q A;  1F37 A;  1A8Y A;  1ERU A;  2KUC A;  20GS A;  4POL A;  2XPE A;  1TI3 A;  2AYT A;  4E8E A;  3ME7 A;  4G0K A;  4JBB A;  3ZIJ A;  3LXZ A;  3FY7 A;  3TJB A;  2O7K A;  4OFN A;  2CV4 A;  3F63 A;  1ERT A;  4TXV A;  2WCI A;  1X9W B;  2IL3 A;  3CSH A;  5ID2 A;  5KOX A;  1GUM A;  1M9A A;  1NHY A;  2RLI A;  1V57 A;  2C8U A;  11GS A;  1VF1 A;  2L5L A;  1BQ7 A;  2LKU A;  2ALB A;  4CHS A;  2YZH A;  2BTO T;  2XC2 A;  1FAA A;  3LW9 A;  5IMF A;  1SKW B;  13GS A;  1M9B A;  1NSW A;  3FEU A;  4EO3 A;  1BG1 A;  4K9Z A;  3A2W A;  1JHB A;  3FMW A;  4BWQ A;  5ID2 B;  4ZIL A;  4NHW A;  5FT3 A;  3H4K A;  5JCU A;  5LCZ A;  1KEB A;  4YH2 A;  2UV8 G;  2KLX A;  2H0G A;  5LD0 A;  3F4S A;  3WGX A;  4OCE A;  1G7E A;  1JLW A;  4NMU A;  2DML A;  4EIQ A;  1ACV A;  4HZ2 A;  3IXR A;  3UOM A;  1SK0 A;  2IN3 A;  1A23 A;  3KMN A;  1WOU A;  4MPG A;  1J08 A;  4KCE A;  4TR0 A;  2HQT A;  2F8F A;  2LRC A;  4LL4 B;  1PN9 A;  4HS1 A;  2UZ8 A;  3GV1 A;  3O76 A;  3C73 A;  1EOH A;  4IN0 A;  2KP1 A;  4MA9 A;  4AJ6 A;  1U3A A;  2DIZ A;  2NPB A;  4V2L A;  4K6X A;  5GZZ B;  2B7K A;  3NIV A;  1ZYN A;  1TK8 B;  1M7T A;  2ZCT A;  4PGT A;  4HU7 A;  2GLR A;  1UVZ A;  3TB2 A;  1SL1 B;  5H5S A;  3UAP A;  3GX8 A;  2GTU A;  3D0Z A;  1GTU A;  2IIY A;  4JU5 A;  1KNG A;  3IE3 A;  3GRX A;  4ECC A;  6GSY A;  4EXJ A;  2RUE A;  1EGR A;  2AAW A;  3LYP A;  4ZBD A;  2B1L A;  2P31 A;  2CAQ A;  3BCK A;  1BED A;  2X8G A;  4X43 A;  4ZBA A;  14GS A;  1TK5 B;  3WGE A;  3GSS A;  2JSZ A;  2OE0 A;  2R5G A;  1SD9 A;  1TKD B;  1ST9 A;  3UVT A;  5BMU A;  4NHZ A;  22GS A;  2DJ3 A;  5COH A;  3H8Q A;  3ZYW A;  3C7M A;  2DC5 A;  4OWY A;  1XZO A;  3IHQ A;  4KW6 A;  3DWV A;  5B8A A;  3MDK A;  5D96 A;  4WEY A;  3CYN A;  4GSS A;  4DVC A;  2BMX A;  4J57 E;  2VLV A;  4FQU A;  2JSY A;  4F03 A;  3CBU A;  4IKH A;  2X99 A;  3IDV A;  2GGT A;  1AXD A;  1O7U A;  4YAV A;  5BMU B;  1FG4 A;  2NTO A;  2IMD A;  4ZB9 A;  4HDE A;  3DEX A;  1F3B A;  1WE0 A;  1Y6E A;  5DAK B;  2X64 A;  4XIH A;  4QMK A;  3VWX A;  2EIR A;  3GKM A;  1ON4 A;  1XW5 A;  1RQM A;  1PSQ A;  2PMT A;  3APS A;  5AGY A;  2VD0 A;  1IYI A;  2VOC A;  4L0U A;  5CRE A;  3U6V A;  4YAP A;  2MMO A;  1O81 A;  1H75 A;  1R5P A;  3GKX A;  3LEF A;  4WBR D;  4OO4 A;  3A5W A;  4PQ1 A;  3PH9 A;  2YJ7 A;  1XIY A;  2B7J A;  3FR9 A;  1GSD A;  1E2Y A;  2VAF A;  3ZTL A;  3ERG A;  18GS A;  5HR2 A;  3Q6O A;  4NAX A;  1XVW A;  4POM A;  2HRF A;  3G9B A;  3UBL A;  1B9Y C;  2LEG A;  1OE7 A;  2GSR A;  4Q5F A;  1J9B A;  3RHC A;  3PGT A;  2YCD A;  4KX4 A;  3LGC A;  1X0R A;  2C1Y A;  1MD3 A;  4F9Z A;  2VLT A;  3P7X A;  4I97 A;  4PX1 A;  4G0I A;  5G5F A;  5JWQ B;  1M0U A;  3Q18 A;  2HRK A;  3J7Y k;  1K0D A;  5C00 A;  5LNK e;  2AJQ B;  1OVN A;  4ECB A;  1EV9 A;  2VM1 A;  1SVO A;  4YQV A;  5F07 A;  1BJX A;  3HZ4 A;  4OFT A;  4F2I A;  3DML A;  5J3R A;  4MF7 A;  1I9D A;  3O3T A;  2VCT A;  3QAV A;  3ZL5 A;  3GL5 A;  2A2R A;  2F51 A;  4OCF A;  1XFL A;  1DUG A;  5DDL A;  1ILO A;  1Q4J A;  3N5O A;  3UAR A;  2R2J A;  2C80 A;  5H5Q A;  1F3A A;  2FWH A;  3QAW A;  1WJK A;  3Q74 A;  2MYG A;  4Z2U A;  3HZ8 A;  4GF0 A;  2H30 A;  2WUL A;  4DSS A;  2O85 A;  1XXU A;  1HNB A;  1K0N A;  1O8W A;  5D9W A;  3HJP A;  3VWU A;  1Z7P A;  4IQ1 A;  3D5J A;  1DBY A;  1ZMA A;  4ZB6 A;  4BL7 A;  3HY2 A;  3ZLP A;  3G7Y A;  1EWX A;  1A2L A;  2VL3 A;  1EGO A;  3KGK A;  4V2M A;  4TRX A;  1NW2 A;  4I5Q A;  4DSS B;  3TKR A;  2RM6 A;  3CRU A;  3LXT A;  2R6K A;  3HXS A;  4LA1 A;  2B6M A;  4BL7 B;  3LWA A;  4TKY A;  2L59 A;  1S3C A;  2E7P A;  4TW5 A;  3VWW A;  4ZIJ A;  1SVM A;  2M80 A;  4HJM A;  1X5E A;  1PN0 A;  4AKH A;  3LYK A;  3M0F A;  4F82 A;  1PL2 A;  1LJR A;  1HNC A;  2FWG A;  2O87 A;  1XCC A;  17GS A;  3FRC A;  1XOB A;  4MAB A;  5CO3 A;  5CRD A;  5CAX A;  1JZO A;  4K8M A;  3PIN A;  4XRD A;  3APQ A;  4MK3 A;  1GL8 A;  1M2B A;  3HVS A;  2H76 A;  5DQS A;  3BOA A;  2WZ9 A;  1K0C A;  1EOG A;  3LFL A;  2HLS A;  1KBN A;  3IA1 A;  2FUG 2;  1UC7 A;  4PUR A;  1THO A;  1YJ6 A;  3UBK A;  1BF5 A;  3WT1 A;  4G9H A;  2R0P A;  2YN1 A;  4GST A;  5G31 A;  1Z5Y E;  2Z9S A;  1USB A;  2LJA A;  2GVP A;  4IJ3 A;  1GSQ A;  2FD3 A;  3RAZ A;  3VUR A;  4OFM A;  3ISO A;  3K8N A;  3DYR A;  1OAZ A;  2LQQ A;  3L9V A;  3F0I A;  4RQX A;  3EU3 A;  4HQZ A;  5JCW A;  2B5Y A;  5IMZ A;  3FR6 A;  3F3Q A;  2HYX A;  5DCH A;  2H72 A;  2GS3 A;  1R4W A;  1AQX A;  10GS A;  1ERV A;  5ECN B;  3TKS A;  3ZVJ A;  4AKX B;  2I81 A;  4MZW A;  3UL3 A;  2MZC A;  3ZRD A;  1TU7 A;  2GQL A;  3HA9 A;  2A2S A;  2DJ2 A;  2DBC A;  2HSH A;  5CNW A;  4PXO A;  1J0F A;  1DE1 A;  1GTA A;  1A2J A;  1GRX A;  4IEL A;  5D93 A;  1HNA A;  6GSS A;  3W8S A;  5ECS A;  3F9U A;  4WF4 A;  4JED A;  1HD2 A;  3D21 A;  4G0L A;  3EE2 A;  3H1N A;  1M2A A;  2H75 A;  3RDW A;  3A2X A;  1ERW A;  2D2Z A;  4KSO A;  3TRX A;  3MAK A;  2F9S A;  2HRA A;  2VL2 A;  2WS2 A;  1YQ1 A;  3GH6 A;  4MDC A;  3QAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...