1VF1A

Cgsta1-1 in complex with glutathione
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
226
structure length
226
Chain Sequence
AKPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
total genus 83
structure length 226
sequence length 226
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf1A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf1A01
5HFGA 5DQSA 4ML6A 4JZQA 2LRTA 4BWQA 4GRFA 3IA1A 4RQXA 1JZDA 1QUWA 3HCZA 1A2LA 3IK9A 4BVXA 1EOGA 2B3SA 2PPTA 2VM1A 3ZITA 4MF5A 3R3EA 2CT6A 4BL7A 2IWTA 3QCPA 1NHOA 1HNCA 1GP1A 4MZWA 2AJQB 4DSSA 5DQYA 5CRGA 5KN1A 3H4KA 2X8HA 3F3RA 4EL1A 3LJRA 1BX9A 2X99A 3A2WA 4AF2A 1X9SB 1F9MA 4BVXB 2H70A 3WYWA 4JU5A 4GQCA 1IYIA 3HKRA 3E3EA 4QL9A 1HD2A 4KH7A 2FHEA 5ECHB 4G19A 1Y25A 3ZVJA 3EINA 2FY6A 4TR0A 3HVVA 4ILFA 2ZCTA 3FKFA 4ECBA 3M1GA 3D4TA 2UZ8A 1OVNA 1EV9A 3GL3A 5GSSA 5L71A 4K6XA 1FG4A 1TJDA 4PNGA 2E7PA 4KNDA 3GV1A 2B5EA 2B7JA 1G7EA 5F06A 2WCIA 4NMUA 4ECIA 1Z7RA 5CAXA 5ECPB 2F51A 3Q6OA 5JWQB 2YZUA 2VM2A 2VO4A 4V1Ap 3TOTA 2IMDA 3IK7A 2V41A 2IL3A 3KH7A 1JHBA 1XPVA 2C80A 3G9BA 1EGOA 1ERWA 3FZ4A 4L0WA 3RAZA 4I6XA 1Z5YE 4G0KA 5ECQB 4MJEA 4N30A 5ECIB 3LFLA 3PPUA 1A24A 2N5BA 4BA7A 5ECKB 2IMIA 2WRTA 3L0HA 3DWVA 4NWYA 6GSWA 4WF5A 3VWUA 4GXZA 4JR4A 2PERA 1NW2A 5LCZA 2LNTA 3MAKA 4GWRA 2C4JA 4WEYA 1GTAA 3ZFLA 1AXDA 1QFNA 4L0UA 1GSEA 2N5AA 5EPFA 2YCDA 3IOSA 5F07A 2XPDA 4KCEA 2ES7A 2CVDA 1PRXA 3K8NA 1YZXA 2I9HA 1GTBA 4F2IA 4BVYA 8GSSA 5IOXA 3DIEA 1C72A 5GSTA 1B8XA 4WXTA 2JL4A 4QQ7A 1GH2A 2HFDA 1M2DA 3GMFA 3O3TA 1XWCA 3QAGA 1ML6A 5COHA 1GUMA 2HYXA 3ED3A 1W89A 1LU4A 3VWXA 3FK8A 5G5FA 1QMVA 3KMOA 3MNGA 5H5SA 4GQFA 3M0FA 4BVYB 1A0FA 4XRDA 5JCWA 2DBCA 3TB2A 1YQ1A 1FHEA 2F8FA 1J9BA 1W4VA 1XIYA 1T4ZA 3MWHA 4CDOA 5CREA 1YEPA 1O8XA 5CRDA 3RPNA 3IAM2 2GT6A 1TOFA 3KD0A 4O92A 3M9JA 1ERUA 2A2SA 2ZUPA 4HU9A 1TP9A 4PUAA 2OADA 1BG5A 1GWCA 4PUFC 4MH3A 3H93A 3APQA 5INYA 4XHMA 5F8BA 1M2BA 2WULA 2HSNB 1T3BA 3DYRA 2H0HA 2H30A 4TKYA 3FZ5A 4AGSA 1SU9A 2A4VA 2DMMA 4O32A 2WDUA 2GS3A 2C3QA 4ULXA 3VPTA 1SKSB 3PINA 5KN3A 2VCZA 4TXVA 1PQNA 4WR5A 3P2AA 4E8EA 4YQMA 2JADA 3LSZA 1V2AA 4LMWA 2PBJA 4OWYA 3M8NA 1QQ2A 2OACA 2LNSA 2YWNA 4KGIA 2BTOT 3KTBA 1T7PB 3ZZXA 4EUYA 2YJ7A 4J56E 3ZIVA 2YZHA 3TJKA 1K0MA 4JRRA 3TKPA 2HRNA 2FNOA 3CTFA 2MBTA 4ZL8A 2PN8A 2BMXA 4DEJA 2DJ0A 3EWLA 1LJRA 5ENUA 2VL2C 4IN0A 3A5WA 3GHAA 2CA8A 3VI7A 5ECNB 2VCXA 1S3CA 1GUKA 3FR9A 1SENA 4HQZA 3TKQA 4OFMA 1F3AA 4ACSA 5DAKA 1FW1A 1XW9A 3HA9A 3F4SA 3FZAA 5ECMB 4E8HA 1WIKA 4HS1A 18GSA 2RLIA 2C8UA 4ML1A 2IN3A 4F9ZA 5AISA 5J9BA 3APSA 4D73A 5B6NA 2XPEA 4XS1A 4JEDA 1Z3EA 4BPYA 2H6YA 2DIYA 3TRQA 3KCMA 4HOJA 3FYGA 2LV3A 1LBKA 1U3IA 3GX0A 3JCML 4YH2A 3H8QA 1XWGA 2R2JA 4IBPA 5E59A 1XOBA 5DAKB 2DJ2A 3G7IA 3GUSA 1GSYA 4N11A 3ZL5A 1V40A 4DSRA 4V2LA 2WZ9A 3DGQA 2YWIA 3ERGA 4GTUA 1R5AA 1GL8A 1TKDB 4RQRA 2YV9A 1THXA 3GH6A 4ZL9A 4Q5NA 4ZIJA 2NTOA 1G0TA 1TRWA 1TK0B 4Q5QA 3EE2A 2V2GA 2L5OA 5C04A 3RDWA 4PTSA 3GH9A 3ERFA 11GSA 4Q5FA 2P31A 4F03A 3C73A 3LORA 3N5OA 4G9HA 2O8VB 2MYGA 3MDKA 1ABAA 2L5LA 3HZ4A 3DMLA 19GSA 1THOA 4K7OA 5DCGA 4XCSA 3IAS2 4AJ6A 3ZIJA 2NBSA 1PMTA 1TU8A 2MBSA 5B6MA 1DSBA 1EP7A 3EYTA 1X9WB 1SYRA 4OMVA 4PXOA 2O7KA 3GKNA 4EDYA 2WGRA 2KLXA 2LRNA 4I5QA 3QMXA 1Z6NA 1OE8A 1XVQA 5IPGA 1PGTA 3L9SA 1F6MC 3KM6A 1V98A 3CRUA 1GLQA 2L59A 1R26A 4KCAA 3UARA 3ME8A 2D2ZA 4P3YB 4FO5A 2C0DA 2B7KA 2J23A 1NM3A 2IIYA 2YWMA 4V2NA 3DEXA 3GRXA 3UJ1A 3P90A 1YKCA 6GSYA 3QPMA 2TRXA 2HSHA 3ME7A 3PR8A 2OJLA 3QFAC 3QAVA 1ZMAA 3F4RA 2VL9A 2IMKA 1XZOA 4XRAA 5CP1A 1AC1A 3CSHA 1PL2A 4OO4A 2C3TA 3FEUA 2GVPA 2CZ3A 3ISOA 4PQ1A 1CQGA 1SD8A 4IS0A 3TCOA 4IHUA 1V9WA 1EZKA 1K0AA 3QAWA 3IXRA 4KDXA 5AIVA 3PGTA 2FD3A 2KUCA 1NHYA 2FLSA 3HJPA 1XFLA 5EL8A 2VLUA 1F37A 1XVWA 4N10A 2NPBA 2ON7A 5D8IA 1GTIA 5D9VA 4L5OA 2FUG2 5G5EA 1TRUA 2VOCA 4ZBAA 2H01A 5A5KA 2TRCP 1B4QA 2CAQA 4ID0A 2K6VA 3FRCA 3SBCA 4EC0A 4WKWA 3AY8A 3TDGA 1ACVA 2NDOA 9GSSA 4OD7A 4KW6A 2GSRA 2KOKA 5ECSA 2F3MA 1K0DA 2H71A 1KBNA 4MJAA 2LKUA 4YQUA 4WBJA 1AQVA 2GSQA 2V6OA 1T8EB 1ST9A 2CAIA 12GSA 4OFNA 3KTLA 10GSA 2K9FA 4MZBA 3F63A 2G0FA 5IIZA 1A23A 2M46A 1SJ6A 3BJ5A 2VCTA 2LRCA 4MF7A 2JSYA 3E9JB 1HYUA 2VL2A 2B6MA 3IRAA 4NHZA 1GLPA 3LWAA 2KHPA 1KNGA 5CRHA 1A8YA 2X8GA 2M80A 4KE3A 1ZL9A 4MH2A 4NHWA 4PNFA 1ZOFA 4PX1A 4RI6A 3HJMA 5D9WA 1ERTA 1TTZA 1OE7A 3ZFBA 4IGJA 1PSQA 4V2MA 1I9DA 4POKA 3E0UA 1FB0A 2TIRA 1S3AA 1TK8B 5G30A 3GA4A 2CV4A 2GQMA 5LD0A 1TRVA 3IE3A 5ECLB 1I5GA 5DCHA 2GSTA 1XWAA 5AN1A 2FWHA 1SK0A 3L9VA 2PWJA 5GAND 3EMPA 2GZYA 3ZLPA 5D73A 3WD6A 1AUCA 2O89A 4MDCA 1J0FA 4EKZA 5G2ZA 2PU9C 1PD21 3VURA 3D6IA 3UEMA 3L4NA 1U87A 1B48A 4O5RA 3IDVA 4XS6A 5A4WA 2YJHA 3GKKA 1CQHA 1OAZA 4XTSA 4GSTA 2GT5A 5DBQA 4HDEA 4KA0A 4TOPA 4K2DA 2LJRA 3TKSE 4I2UA 3F4TA 2HSMA 2FA8A 2JSZA 3DXBA 2VL3A 4NPBA 4WR4A 1TDIA 1M9AA 4FYUA 5BMUA 4HUAA 4IVFA 3GN3A 5CNWA 3KP8A 4WF4A 2XHFA 3ZYWA 2HI7A 3BCKA 3HVXA 1GSDA 4RI7A 3FR6A 2AYTA 6GSTA 2P0GA 3EU4A 4IP1A 3D5JA 4L5LA 2JZTA 5IMAA 1MD3A 1ZYQB 3UBLA 3TJGA 2HSMB 3H79A 2IMFA 4ZBDA 16GSA 3LYPA 4KX4A 4FH8A 3C7MA 4HZ2A 3BCIA 1VF2A 3F6FA 3QFBC 2VCWA 1EWXA 5H5RA 1YF0A 3FY7A 4EXJA 2HQTA 3KH9A 3TUEA 2VLTA 5AIXA 1MEKA 3OR5A 2DJKA 4MK3A 4XIHA 4HEA2 4KB3A 5ID2A 1F2EA 2C0GA 5IQYA 3D4MA 3GSSA 1SJIA 1SK1A 3A2XA 5ELAA 4TR1A 1JZWA 1XCCA 6GSVA 2DSAA 2EIOA 3GNJA 4TRXA 3HVSA 3O76A 5G1LA 4WETA 5ABRA 1V58A 1UC7A 2DIZA 2LUSA 2GGTA 1GUHA 1DUGA 5ID2B 4YAVA 4ISDA 4RUVA 4TR1B 5ECRB 1USBA 4CW9A 3KXOA 1UN2A 5F0GA 1X5EA 4TW5A 1BAYA 2C3NA 1A2JA 3I9V2 3C71A 2I81A 5DALB 1E6BA 2P5QA 1DE2A 5IO2A 1GULA 3M3MA 3HYPA 2B5YA 5HR1A 2MMNA 4OCEA 1FVKA 2L6CA 2RIIA 2EC4A 5G1KA 5IMDA 4PQHA 1QK8A 4FQUA 1O73A 4Z7XA 3W8JA 5JWOB 1GNWA 3G7JA 1U3AA 2KP2A 5D93A 3U5RE 5IMVA 2VD1A 2YOIA 5HR0A 1X5CA 2ALBA 2VUPA 3F0IA 2R3XA 4KSOA 1MTCA 3EVIA 1BJXA 1TU7A 5KN2A 3UL3A 1R5PA 3M9KA 3DRNA 5CRWA 4MJBA 3MSZA 1K0BA 2FCHA 3FR3A 1OKTA 5CO3A 2JZRA 2QKEA 1QXHA 2H74A 2QGVA 3HD5A 3I43A 4CHSA 1WRYA 2H75A 2HRKA 3CBUA 3TKSC 2RUFA 4DSQA 1RQMA 5AGYA 3IBHA 3NIVA 2FWGA 2HNLA 4IKHA 5D9XA 3HY2A 4HJ2A 2FGXA 4EVMA 1XXUA 1HNAA 4IW9A 2H1DA 1BEDA 1WOUA 2H0IA 6GSUA 2VCVA 4ZB8A 2K8SA 3DKSA 4I2TA 3D0ZA 2GQKA 2GDRA 1RW1A 3VWVA 4Q5RA 4USSA 1F3BA 5EY6A 5C00A 5HQPA 2HRKB 2DJ1A 2R4VA 5EVOA 4LL4B 2OA7A 2MZCA 5HR3A 20GSA 5DDLA 3KP9A 1GSQA 1VF1A 5J41A 3ZMKA 1XWBA 3UAPA 4K9ZA 2V6KA 2YP6A 4XS4A 2H1AA 4PURA 3UIWA 1X0RA 3BD2A 5H5QA 1Z6MA 3EU3A 3KMNA 5J5NA 1V57A 2H8LA 3SWLA 22GSA 1H75A 2N5FA 4TXOA 2AUVA 2X8CA 3VWWA 1M7TA 2H76A 2LQQA 5ECOB 1BQ7A 2V32A 5FT3A 5B8AA 4KSMA 3NOFA 4MZCA 4XS4B 2C0FA 2YWOA 5J9CA 4IQAA 3A2VA 3HJOA 1PX6A 3CRTA 1PA3A 2H73A 13GSA 3P8WA 4PGTA 4GSNA 4POBA 2LSTA 3QD9A 2LQOA 1M0UA 5J4UA 4ECCA 3CSJA 1PX7A 4KUNA 4TXOB 2GZZA 2HT9A 1B4PA 3GX8A 3C8EA 4MMMA 3IHQA 2NVLA 2Z9SA 1MDKA 2RM5A 4FYCA 2C0EA 3Q19A 2VCQA 3ZVJD 4ZILA 2WFCA 4EE0A 3GSTA 5A4UA 3US3A 1MD4A 3LGCA 4G0IA 4K1FA 2F9SA 2RUEA 4MA9A 7GSSA 1O85A 2R37A 4DVCA 3GURA 1M9BA 2CVKA 5B8BA 4NAXA 1EOHA 3D21A 1TXXA 3A3TA 1U88A 2K18A 1Q98A 5B7CA 1R7HA 1K0NA 5KEJA 3KZQA 5A4VA 1VRSD 1SJZA 1K3OA 3C1RA 4I97A 4G10A 5E4WA 3EC3A 3L78A 1B9YC 1KTEA 1GNEA 2GSSA 2R6KA 1PKZA 1YEXA 2PUKC 2WS2A 4ZXGA 2AB6A 3TJFA 5DVBA 5D9TA 3F3QA 3HDCA 1U6TA 2HZEA 2XBIA 2C1YA 2V1MA 3HHVA 3UMAA 4JR6A 1ERVA 2IPAA 1O6JA 1GSFA 5HFIA 2VLVA 3HXSA 4I8BA 4ZL7A 1EV4A 2FA4A 1E2YA 1K0CA 4N0VA 5JWRB 2B1KA 1S3DA 4NV5A 3TGZA 4JE1A 2I4AA 2E0QA 4BL7B 4IP6A 2DLXA 2HZEB 3UVTA 2ZNMA 1AAZA 3QOUA 5FWGA 1B9XC 3C1SA 1ILOA 4DSSB 2YN1A 2K8VA 2A2RA 2DMLA 4IJIA 2AHEA 3KGKA 4FIWA 3TKRA 4BWSA 2L4QA 3WGXA 3GL5A 3TJBA 2BJXA 1G7OA 2OBIA 1N8JA 1GSSA 4IJ3A 4X43A 3UOMA 4TVEA 1SL1B 1Y6EA 5JCUA 1T1VA 4WBRD 4HZ4A 3HZ8A 5J3RA 6GSSA 5HFKA 3VFIA 4X0XA 1FO5A 3I6AA 1YF1A 2H6ZA 14GSA 1RK4A 1FVJA 5JCGA 4EDZA 1SYXA 3KEBA 3FHKA 4TR3A 1MDIA 2M72A 1M2AA 1DBYA 4K0NA 2CQ9A 4K0GA 5IMZA 2FWEA 1AQXA 1OC3A 1EP8A 1KEBA 1TW9A 2VD0A 1G6WA 4OO5A 3J7Yk 4QL7A 3CYNA 4IELA 4MF6A 3ZRDA 4O7HA 5GZZB 2L4CA 4KDUA 1ZZYA 5DJMA 2CVBA 2O85A 1JLVA 1ZGNA 3BOAA 4HU7A 3TKSA 2LEGA 17GSA 3VPQA 3GYKA 1QGVA 3TOUA 5KN0A 5IMFA 1NSWA 3RPPA 3O6TA 4MABA 1AIUA 2IMEA 3NZNA 2GZPA 4KAEA 2AV4A 3WGEA 4MPFA 2YPMA 3G7YA 2LTKA 2AAWA 4J2FA 1X9MB 1JFUA 1A0RP 3TJJA 4MPGA 2G2QA 3VLNA 4ZB6A 1OC9A 3W6GA 4F0CA 3P7XA 4HI7A 1WJKA 1WMJA 2X64A 1R4WA 1EGRA 1YY7A 3DVWA 3BBYA 3GIXA 1ZYEA 1Z7PA 2HZFA 1XW6A 1M99A 3GTUA 1TK5B 1ZCPA 1G6YA 1MDJA 1HQOA 3IR4A 5IMCA 2PVOC 4MP4A 4LLRA 3IC8A 4OCFA 2HLSA 1TI1A 1YJ6A 4L8EA 2OKAA 1OYJA 5LNKe 1OC9B 4J57E 1PN9A 1SKRB 1IYHA 3CSIA 2RM6A 3GKXA 3GTUB 4EF0A 4MJCA 2H19A 3H1NA 1Q4JA 1TRSA 2CX4A 1BYEA 1FB6A 1DE1A 2PVQA 2DC5A 2IFQA 2EIRA 2XBQA 4YQVA 4OFTA 5IPHA 3IC4A 3VK9A 1XW5A 4LL1B 6GSXA 4LMVA 5DALA 2REMA 2EIQA 2HRAA 3VI5A 2MMZA 3F9UA 3WT1A 1WE0A 1O8WA 3R2QA 1VF3A 4GF0A 1T00A 1VGLA 2J9HA 3CTGA 2IFQB 1UA5A 2MMOA 4MCUA 3S9FA 3LEFA 2WB9A 3CXGA 3LXZA 2E2MA 1O7UA 2VIMA 5FHIA 3F8UA 4ZBBA 2JZSA 4NXIA 2P5RA 4V1Ag 1WP0A 2MMAA 3UVHA 4KDYA 2HE3A 1YKAA 2PMTA 1JLWA 2GTUA 1SKWB 3LG6A 3TRXA 2DJ3A 4K7NA 1SL2B 5G31A 2OE1A 3APOA 4G0LA 3PH9A 4POLA 1WPIA 4KF9A 4TR4A 4X1UA 3DD3A 2KP1A 3QR6A 1A2MA 4ZB9A 1JZOA 2H66A 1PL1A 2L6DA 3FZ9A 3FW2A 3RHBA 3U6VA 1K3YA 4HJMA 2HRFA 4AJ7A 1TI3A 2YANA 1PKWA 1FAAA 1XOAA 2QSIA 2L57A 4POMA 1FOVA 1AW9A 3F6DA 5D96A 2B1LA 3V1WA 4K7IA 3GKMA 1XBSA 3KIJA 1AQWA 1GTUA 5DJLA 3QDNA 1O81A 2E2GA 3L9UA 2OE0A 1H4OA 3ZTLA 2I3YA 2H0GA 2B5XA 4JBBA 4D73B 4MLYA 4AJ8A 3W8SA 2H72A 3UBKA 4HQSA 3GFKA 4YAPA 3ZREA 2HXKA 2YV7A 2YNXA 1OKDA 1SK2A 3ZMLA 1ON4A 5ELGA 3LYKA 4ECJA 2JACA 2JU5A 2XC2A 5GAPD 2I1UA 3I69A 4GSSA 2ON5A 1OC8A 1J08A 2OBKA 5CYYA 4IQ1A 2LJKA 4H86A 1EEMA 1K0OA 2CZ2A 2F8AA 1N2AA 2H1GA 1Z9HA 1GSUA 3RBTA 2FWFA 3WT2A 3WGDA 2GLRA 4G2EA 2LS5A 1XWKA 4F0BA 2O87A 4GCIA 2WJUA 3Q74A 4PQIA 2QC7A 2CX3A 4LA1A 2DJJA 1URMA 1VF4A 2GQLA 4F82A 2VAFA 1EEJA 3CMIA 1UVZA 4GLTA 1WWJA 3IPZA 4TN8A 3EURA 1GRXA 2PGTA 3DVXA 3LQ7A 3N9JA 3J7Yb 3D22A 3LXTA 3IV4A 2LJAA 5F05A 2H1BA 2R5GA 4EO3A 1JZRA 2H6XA 3Q18A 4K8MA 5IO0A 1T4YA 1SL0B 4N0ZA 3RHCA 5IM9A 1SD9A 5HR2A 2OE3A 1HNBA 1X5DA 1K3LA 3TRPA 4FYBA 4NV2A 3KJYA 1A8LA 1YDKA 3ERWA 5IOWA 2IJYA 2HSYA 3EMXA
chains in the Genus database with same CATH superfamily
5HFGA 5DQSA 4ML6A 1SVOA 4JZQA 1XG8A 2LRTA 4BWQA 4GRFA 3IA1A 4RQXA 1JZDA 1QUWA 3HCZA 1A2LA 3IK9A 4BVXA 1EOGA 2B3SA 2PPTA 2VM1A 3ZITA 4MF5A 3R3EA 2CT6A 4BL7A 2IWTA 3QCPA 4GDFA 1NHOA 1HNCA 1GP1A 4MZWA 2AJQB 4DSSA 5DQYA 5CRGA 5KN1A 3H4KA 2X8HA 3F3RA 4EL1A 3LJRA 1BX9A 2X99A 3A2WA 4AF2A 1X9SB 1F9MA 4BVXB 2H70A 3WYWA 4JU5A 4GQCA 1IYIA 3HKRA 3E3EA 3MYDA 4QL9A 3TU3B 1HD2A 4KH7A 2FHEA 5ECHB 4G19A 1Y25A 3ZVJA 4Z2RA 3EINA 2FY6A 4TR0A 3HVVA 4ILFA 2ZCTA 3FKFA 4ECBA 3M1GA 3D4TA 2UZ8A 1OVNA 1EV9A 3GL3A 5GSSA 5L71A 4K6XA 1FG4A 1TJDA 4PNGA 2E7PA 4KNDA 3GV1A 2B5EA 2B7JA 1G7EA 4CY6A 5F06A 2WCIA 4NMUA 4ECIA 1Z7RA 5CAXA 5ECPB 2F51A 3Q6OA 5JWQB 5KOWA 2YZUA 2VM2A 2VO4A 4V1Ap 3TOTA 2IMDA 3IK7A 2V41A 2IL3A 3KH7A 1JHBA 1XPVA 2C80A 3G9BA 1EGOA 1ERWA 3FZ4A 4L0WA 3RAZA 4I6XA 1Z5YE 4G0KA 5ECQB 4MJEA 4N30A 5ECIB 3LFLA 3PPUA 1A24A 2N5BA 4BA7A 5ECKB 2IMIA 2WRTA 3L0HA 3DWVA 4NWYA 6GSWA 4WF5A 3VWUA 4GXZA 1ZYPA 4JR4A 2PERA 1NW2A 5LCZA 2LNTA 3MAKA 4GWRA 2C4JA 4WEYA 1GTAA 3ZFLA 2VKZG 1AXDA 1QFNA 4L0UA 1GSEA 2N5AA 5EPFA 2YCDA 1M3IA 3IOSA 5F07A 2XPDA 4KCEA 2ES7A 2CVDA 1PRXA 3K8NA 1YZXA 2I9HA 1GTBA 4F2IA 4BVYA 8GSSA 5IOXA 3DIEA 2X4AA 1C72A 5GSTA 1B8XA 4WXTA 2JL4A 4QQ7A 1GH2A 2HFDA 1M2DA 3GMFA 3O3TA 1XWCA 3QAGA 1ML6A 5COHA 3HMJG 4PI2C 1GUMA 2HYXA 3ED3A 1W89A 4Z2UA 1LU4A 3VWXA 3FK8A 5G5FA 1QMVA 3KMOA 3MNGA 5H5SA 4GQFA 3M0FA 4BVYB 1A0FA 4XRDA 5JCWA 2DBCA 3TB2A 1YQ1A 1FHEA 2F8FA 4E68A 1J9BA 1W4VA 1XIYA 1T4ZA 3MWHA 4CDOA 5A34B 2WW3A 5CREA 1YEPA 1O8XA 5CRDA 3RPNA 3IAM2 2GT6A 1TOFA 3KD0A 4O92A 3M9JA 1ERUA 2A2SA 4YKFA 2ZUPA 4HU9A 1TP9A 4PUAA 2OADA 5BMUB 1BG5A 1GWCA 4PUFC 4MH3A 3H93A 3APQA 5INYA 4XHMA 5F8BA 1M2BA 2WULA 2HSNB 1T3BA 3DYRA 2H0HA 2H30A 4TKYA 3FZ5A 4AGSA 1SU9A 2A4VA 2DMMA 4O32A 2WDUA 2GS3A 2C3QA 4ULXA 3VPTA 1SKSB 3PINA 5KN3A 2VCZA 4TXVA 1PQNA 4WR5A 3P2AA 4E8EA 4YQMA 2JADA 3LSZA 1V2AA 4LMWA 2PBJA 4OWYA 3M8NA 1QQ2A 2OACA 2LNSA 2YWNA 4AKHA 4KGIA 2BTOT 3KTBA 1T7PB 3ZZXA 4EUYA 2YJ7A 4J56E 3ZIVA 2YZHA 3TJKA 1K0MA 4JRRA 3TKPA 2HRNA 2FNOA 3CTFA 2MBTA 4ZL8A 2PN8A 2BMXA 4DEJA 2DJ0A 3EWLA 1LJRA 5ENUA 2VL2C 4IN0A 3A5WA 2EFDA 3GHAA 2CA8A 3VI7A 5ECNB 2VCXA 1S3CA 1GUKA 3FR9A 1SENA 4HQZA 3TKQA 4OFMA 1F3AA 4ACSA 5DAKA 1FW1A 1XW9A 3HA9A 3F4SA 3FZAA 5ECMB 4E8HA 1WIKA 2RLIA 18GSA 4HS1A 2C8UA 4ML1A 2IN3A 4F9ZA 5AISA 5J9BA 3APSA 4D73A 5B6NA 4A5PA 2XPEA 4XS1A 4JEDA 1Z3EA 4BPYA 2H6YA 2DIYA 3TRQA 3KCMA 4HOJA 3FYGA 2LV3A 1LBKA 1U3IA 3GX0A 3JCML 4YH2A 3H8QA 1XWGA 2R2JA 4IBPA 5E59A 1XOBA 5DAKB 2DJ2A 3G7IA 3GUSA 1GSYA 4N11A 3ZL5A 1V40A 4DSRA 4V2LA 2WZ9A 3DGQA 2YWIA 3ERGA 4GTUA 1R5AA 1GL8A 1TKDB 4RQRA 2YV9A 1THXA 3GH6A 4ZL9A 4Q5NA 4ZIJA 2NTOA 4PHZC 1G0TA 1TRWA 3CHXC 1TK0B 4Q5QA 3EE2A 2V2GA 2L5OA 2WZSA 5C04A 3RDWA 4PTSA 4X4JA 3GH9A 3ERFA 11GSA 4Q5FA 2P31A 4F03A 3C73A 3LORA 3CWGA 3N5OA 4G9HA 2O8VB 2MYGA 3MDKA 1ABAA 2L5LA 3HZ4A 3DMLA 19GSA 1THOA 4K7OA 5DCGA 4XCSA 3IAS2 4AJ6A 4G01A 3ZIJA 2NBSA 1PMTA 1TU8A 2MBSA 5B6MA 1DSBA 1EP7A 3EYTA 1X9WB 1SYRA 4OMVA 4PXOA 2O7KA 3GKNA 4EDYA 2WGRA 2KLXA 2LRNA 4I5QA 3QMXA 1Z6NA 1OE8A 1XVQA 5IPGA 1PGTA 3L9SA 1F6MC 3KM6A 1V98A 3CRUA 1GLQA 2L59A 1R26A 4KCAA 1SVLA 3UARA 3ME8A 2D2ZA 4P3YB 4FO5A 2C0DA 2B7KA 2J23A 1NM3A 2IIYA 2YWMA 4K5SA 3DEXA 4V2NA 3GRXA 3UJ1A 3P90A 1YKCA 6GSYA 3QPMA 2TRXA 2HSHA 3ME7A 3PR8A 2OJLA 3QFAC 3QAVA 1ZMAA 3F4RA 2VL9A 2IMKA 1XZOA 4XRAA 5CP1A 2O3EA 1AC1A 3CSHA 1PL2A 4OO4A 2C3TA 3FEUA 2GVPA 2CZ3A 3ISOA 4PQ1A 1CQGA 1SD8A 4IS0A 3TCOA 4IHUA 1V9WA 1EZKA 1K0AA 3QAWA 3IXRA 4KDXA 5AIVA 3PGTA 2FD3A 2KUCA 1NHYA 2FLSA 3HJPA 1XFLA 5EL8A 2VLUA 4W66A 1F37A 1XVWA 4N10A 2NPBA 2ON7A 5D8IA 1GTIA 5D9VA 1BF5A 4L5OA 2FUG2 5G5EA 1TRUA 2VOCA 4ZBAA 2WVZA 2H01A 5A5KA 2TRCP 1B4QA 2CAQA 4ID0A 1I1IP 2K6VA 3FRCA 3SBCA 4EC0A 4WKWA 3AY8A 3TDGA 1ACVA 2NDOA 9GSSA 4OD7A 4KW6A 4AI6A 2GSRA 2KOKA 5ECSA 2F3MA 1K0DA 5KOXA 2H71A 1KBNA 4MJAA 2LKUA 4YQUA 4WBJA 1AQVA 2GSQA 2V6OA 1T8EB 1ST9A 2CAIA 12GSA 4OFNA 3KTLA 10GSA 2K9FA 4MZBA 3F63A 2G0FA 5IIZA 1A23A 2M46A 1SJ6A 3BJ5A 2VCTA 2LRCA 4MF7A 2JSYA 3E9JB 1HYUA 2VL2A 2B6MA 3IRAA 4NHZA 1GLPA 3LWAA 1BG1A 2KHPA 1KNGA 5CRHA 1A8YA 2X8GA 2M80A 4KE3A 1ZL9A 4MH2A 4NHWA 4PNFA 1ZOFA 4PX1A 4RI6A 3HJMA 5D9WA 1ERTA 1TTZA 1OE7A 3ZFBA 4IGJA 1PSQA 4V2MA 1I9DA 4POKA 3E0UA 1FB0A 2TIRA 1S3AA 1TK8B 5G30A 3GA4A 2CV4A 2GQMA 5LD0A 1TRVA 3IE3A 5ECLB 1I5GA 5DCHA 2GSTA 1XWAA 5AN1A 2FWHA 1SK0A 3L9VA 2PWJA 5GAND 3EMPA 2GZYA 3ZLPA 5D73A 3WD6A 1AUCA 2O89A 4MDCA 1J0FA 4EKZA 5G2ZA 2PU9C 1PD21 3VURA 3D6IA 3UEMA 3L4NA 1U87A 1B48A 4O5RA 3IDVA 4XS6A 5A4WA 2YJHA 3GKKA 1CQHA 1OAZA 4XTSA 4HSCX 2DKIA 4GSTA 2GT5A 5DBQA 4HDEA 4KA0A 4TOPA 4K2DA 2LJRA 3TKSE 5A34A 4I2UA 3F4TA 5BRTA 2HSMA 2FA8A 2JSZA 3DXBA 2VL3A 4NPBA 4WR4A 1TDIA 1M9AA 4FYUA 5BMUA 4HUAA 4FXYP 4IVFA 3GN3A 5CNWA 3KP8A 4WF4A 2XHFA 3ZYWA 2HI7A 3BCKA 3HVXA 1GSDA 5A1NB 4RI7A 3FR6A 2HSNA 2AYTA 6GSTA 2P0GA 3EU4A 4IP1A 3EPTA 3D5JA 4L5LA 2JZTA 5IMAA 2OT3A 1MD3A 1ZYQB 3UBLA 3TJGA 2HSMB 3H79A 2IMFA 4ZBDA 16GSA 3LYPA 4KX4A 4FH8A 3C7MA 4HZ2A 3BCIA 1VF2A 3F6FA 3QFBC 2VCWA 1EWXA 5H5RA 1YF0A 3FY7A 4EXJA 2HQTA 3KH9A 2X49A 3TUEA 2VLTA 5AIXA 3RGBC 1MEKA 3OR5A 2DJKA 4MK3A 4XIHA 3CQFA 4HEA2 4KB3A 5ID2A 1F2EA 2C0GA 5IQYA 3D4MA 3GSSA 1SJIA 1SK1A 3A2XA 5ELAA 4TR1A 1JZWA 1XCCA 6GSVA 2DSAA 1TXUA 2EIOA 3GNJA 4TRXA 3HVSA 5A5HA 3O76A 5G1LA 4WETA 5ABRA 1V58A 1UC7A 2DIZA 2LUSA 2GGTA 1GUHA 1DUGA 5ID2B 4YAVA 4ISDA 4RUVA 4TR1B 5ECRB 1USBA 4CW9A 2WW1A 3RFRC 3KXOA 1UN2A 5F0GA 1X5EA 5A5HB 4TW5A 1BAYA 2C3NA 1A2JA 3I9V2 3C71A 2I81A 5DALB 1E6BA 2P5QA 1DE2A 2O5VA 5IO2A 1GULA 3M3MA 3HYPA 2B5YA 5HR1A 2MMNA 4OCEA 1FVKA 2L6CA 2RIIA 2EC4A 5J4VA 5G1KA 5IMDA 4PQHA 1QK8A 4CY8A 4FQUA 3LW9A 1O73A 4Z7XA 3W8JA 5JWOB 1GNWA 3G7JA 1U3AA 2KP2A 5D93A 1PFOA 3U5RE 5IMVA 2VD1A 2YOIA 5HR0A 1X5CA 2ALBA 2VUPA 4PI0C 3F0IA 2R3XA 4KSOA 1MTCA 3EVIA 1BJXA 1TU7A 5KN2A 3UL3A 1R5PA 3M9KA 3DRNA 5CRWA 4MJBA 3MSZA 1K0BA 2FCHA 3FR3A 1OKTA 3FMWA 5CO3A 2JZRA 2QKEA 2UV8G 1QXHA 2H74A 2QGVA 3HD5A 3I43A 4CHSA 1WRYA 2H75A 2HRKA 3CBUA 3TKSC 2RUFA 4DSQA 1RQMA 5AGYA 3IBHA 3NIVA 2FWGA 2HNLA 4IKHA 5D9XA 3HY2A 4HJ2A 2FGXA 4EVMA 1XXUA 1HNAA 4IW9A 2H1DA 1BEDA 1WOUA 2H0IA 6GSUA 2VCVA 4ZB8A 2K8SA 3DKSA 4I2TA 3D0ZA 2GQKA 2GDRA 1RW1A 4EIPA 3VWVA 4Q5RA 4USSA 1F3BA 5EY6A 5C00A 5HQPA 2HRKB 2DJ1A 2R4VA 5EVOA 4LL4B 2OA7A 2MZCA 5HR3A 20GSA 5DDLA 3KP9A 1GSQA 1VF1A 5J41A 3ZMKA 1XWBA 3UAPA 4K9ZA 2V6KA 2YP6A 4XS4A 2H1AA 4PURA 3UIWA 1X0RA 3BD2A 5H5QA 1Z6MA 3EU3A 3KMNA 1M3JA 5J5NA 1V57A 2H8LA 1Y1UA 3SWLA 22GSA 1H75A 2N5FA 4TXOA 2AUVA 2X8CA 3VWWA 1M7TA 2H76A 2EFEA 2LQQA 5ECOB 1BQ7A 2V32A 5FT3A 5B8AA 4KSMA 3NOFA 4MZCA 4XS4B 2C0FA 2YWOA 5J9CA 4IQAA 3A2VA 3HJOA 1PX6A 3CRTA 1PA3A 2H73A 13GSA 3P8WA 4PGTA 4GSNA 4POBA 2LSTA 3QD9A 2LQOA 1M0UA 5J4UA 4ECCA 3CSJA 1PX7A 4KUNA 4TXOB 2GZZA 2HT9A 1B4PA 3GX8A 3C8EA 4MMMA 3IHQA 2NVLA 2Z9SA 1MDKA 2RM5A 4FYCA 2C0EA 2R0CA 3Q19A 2VCQA 3ZVJD 1S3RA 4ZILA 2WFCA 4EE0A 3GSTA 5A4UA 3US3A 1MD4A 3LGCA 4G0IA 2R0PA 4K1FA 2F9SA 2RUEA 2QA1A 4MA9A 7GSSA 1O85A 2R37A 4DVCA 3GURA 1M9BA 2CVKA 5B8BA 4NAXA 1EOHA 3D21A 1TXXA 3A3TA 1U88A 2K18A 1Q98A 5B7CA 1R7HA 1K0NA 5KEJA 3KZQA 5A4VA 1VRSD 1SJZA 1K3OA 3C1RA 4I97A 4N3ZA 4G10A 5E4WA 1N25A 3EC3A 3L78A 1B9YC 1KTEA 1GNEA 2GSSA 2WW2A 2R6KA 1FOHA 1PKZA 2WVXA 1YEXA 2PUKC 2WS2A 4ZXGA 2AB6A 3TJFA 5DVBA 5D9TA 3F3QA 3HDCA 2XBIA 1U6TA 2HZEA 2C1YA 2V1MA 3HHVA 3UMAA 4JR6A 1ERVA 4Z2TA 2IPAA 1O6JA 1GSFA 5HFIA 2VLVA 3HXSA 4I8BA 4ZL7A 1EV4A 2FA4A 1E2YA 1K0CA 2WVXB 4N0VA 5JWRB 2B1KA 1S3DA 4NV5A 3TGZA 4JE1A 2I4AA 2E0QA 4BL7B 4IP6A 2DLXA 2HZEB 3UVTA 1YVLA 2ZNMA 1AAZA 3QOUA 4MNNA 5FWGA 1B9XC 3C1SA 1ILOA 4DSSB 2YN1A 2K8VA 2A2RA 2DMLA 4IJIA 2AHEA 3KGKA 4FIWA 3TKRA 2R0GA 4BWSA 2L4QA 3WGXA 3GL5A 3TJBA 2BJXA 1G7OA 2OBIA 1N8JA 1GSSA 4IJ3A 4X43A 3UOMA 4TVEA 1SL1B 1Y6EA 5JCUA 2EFCA 1T1VA 4WBRD 3A5IA 4HZ4A 3HZ8A 5J3RA 6GSSA 5HFKA 3VFIA 4X0XA 1FO5A 3I6AA 1YF1A 2H6ZA 14GSA 1RK4A 3HVNA 1FVJA 5JCGA 4EDZA 1SYXA 3KEBA 3FHKA 4TR3A 1MDIA 2M72A 1M2AA 1DBYA 4K0NA 2CQ9A 4K0GA 5IMZA 2FWEA 1AQXA 1OC3A 1EP8A 1KEBA 1TW9A 2VD0A 1G6WA 4OO5A 3J7Yk 4QL7A 3CYNA 4IELA 4MF6A 3ZRDA 4O7HA 5GZZB 2L4CA 4KDUA 1ZZYA 5DJMA 2CVBA 2A2PA 2O85A 1JLVA 1ZGNA 3BOAA 4HU7A 3MIXA 3TKSA 2LEGA 17GSA 3VPQA 3GYKA 1QGVA 3TOUA 5KN0A 5A1NA 5IMFA 1NSWA 3RPPA 3O6TA 4MABA 1AIUA 2IMEA 3NZNA 2GZPA 4KAEA 2AV4A 3WGEA 4MPFA 2YPMA 3G7YA 2LTKA 2AAWA 4J2FA 4ZB7A 1X9MB 1JFUA 1A0RP 3TJJA 4MPGA 2G2QA 3VLNA 2WVYA 4ZB6A 1OC9A 3W6GA 4F0CA 3P7XA 4HI7A 1WJKA 1WMJA 2X64A 1R4WA 1EGRA 1YY7A 3DVWA 4QMKA 3BBYA 3GIXA 4ICYA 1ZYEA 1Z7PA 2HZFA 1XW6A 1M99A 2O36A 3GTUA 1TK5B 1ZCPA 1G6YA 1MDJA 1HQOA 3IR4A 5IMCA 2PVOC 4MP4A 4LLRA 3IC8A 4OCFA 2HLSA 1TI1A 1YJ6A 4L8EA 2OKAA 1OYJA 5LNKe 1OC9B 4J57E 4AKIA 1PN9A 2H1LA 1SKRB 1IYHA 3CSIA 2RM6A 3GKXA 3GTUB 4EF0A 4MJCA 2H19A 3H1NA 1Q4JA 1TRSA 2CX4A 1BYEA 1FB6A 1DE1A 2PVQA 2DC5A 2IFQA 2EIRA 2XBQA 4YQVA 4OFTA 5IPHA 3IC4A 5J4YA 3VK9A 1XW5A 4LL1B 6GSXA 4LMVA 5DALA 2REMA 2EIQA 2HRAA 3VI5A 4K5RA 2MMZA 3F9UA 4O5QA 3WT1A 1WE0A 1O8WA 3R2QA 1VF3A 4GF0A 1T00A 1VGLA 2J9HA 3CTGA 2IFQB 1UA5A 2MMOA 4MCUA 3S9FA 3LEFA 2WB9A 3CXGA 3LXZA 1ZYNA 2E2MA 1O7UA 2VIMA 5FHIA 3F8UA 4ZBBA 2JZSA 4NXIA 2P5RA 4V1Ag 1WP0A 2MMAA 3UVHA 1SVMA 4KDYA 2HE3A 1PN0A 1YKAA 2PMTA 1JLWA 2GTUA 1SKWB 3LG6A 3TRXA 2DJ3A 4K7NA 1SL2B 4EIQA 5G31A 2OE1A 3APOA 4G0LA 3PH9A 4POLA 1WPIA 4AKGA 4KF9A 4O5UA 4TR4A 4X1UA 3DD3A 2KP1A 3QR6A 1A2MA 4ZB9A 1JZOA 2H66A 1PL1A 2L6DA 3FZ9A 3FW2A 3RHBA 3U6VA 1K3YA 4HJMA 2HRFA 4BIKA 3IHGA 4AJ7A 1TI3A 2YANA 1PKWA 1FAAA 1XOAA 2QSIA 2L57A 4POMA 1FOVA 1AW9A 3F6DA 5D96A 2B1LA 3V1WA 4K7IA 3GKMA 1XBSA 3KIJA 1AQWA 1GTUA 5DJLA 3QDNA 1O81A 2E2GA 3L9UA 2OE0A 1H4OA 3ZTLA 4AKXB 2I3YA 2H0GA 2B5XA 4JBBA 1YEWC 4D73B 4MLYA 4AJ8A 3W8SA 2H72A 3UBKA 4HQSA 3GFKA 4YAPA 3ZREA 2HXKA 2YV7A 2YNXA 1OKDA 1SK2A 3ZMLA 1ON4A 5ELGA 3LYKA 4ECJA 2JACA 4YKGA 2JU5A 2XC2A 5GAPD 2I1UA 3I69A 4K2XA 4GSSA 2ON5A 1OC8A 1J08A 2OBKA 5CYYA 2DKHA 4IQ1A 2LJKA 4H86A 1EEMA 1K0OA 2CZ2A 2F8AA 1N2AA 2H1GA 1Z9HA 1GSUA 2EFHA 3RBTA 2FWFA 3WT2A 3WGDA 2GLRA 4G2EA 2LS5A 1XWKA 4F0BA 2O87A 4GCIA 2WJUA 3Q74A 4PQIA 2QC7A 2CX3A 4LA1A 2DJJA 5J40A 1URMA 1VF4A 2GQLA 4F82A 2VAFA 1EEJA 3CMIA 1UVZA 4GLTA 1WWJA 3IPZA 4TN8A 3EURA 1GRXA 2PGTA 3DVXA 3LQ7A 3N9JA 3J7Yb 3D22A 3LXTA 2QA2A 3IV4A 2LJAA 5F05A 2H1BA 2R5GA 4EO3A 1JZRA 2H6XA 3Q18A 4K8MA 2A4HA 5IO0A 1T4YA 1SL0B 4N0ZA 3RHCA 5IM9A 1SD9A 5HR2A 2OE3A 1HNBA 1X5DA 5J47A 1K3LA 3TRPA 4FYBA 4NV2A 3KJYA 1A8LA 2WW0A 1S4BP 1YDKA 3ERWA 5IOWA 2IJYA 2HSYA 3EMXA
chains in the Genus database with same CATH topology
5HFGA 5DQSA 4ML6A 1SVOA 4JZQA 2LRTA 4BWQA 4GRFA 3IA1A 4RQXA 1JZDA 1QUWA 3HCZA 1A2LA 3IK9A 4BVXA 1EOGA 2B3SA 2PPTA 2VM1A 3ZITA 4MF5A 3R3EA 2CT6A 4BL7A 2IWTA 3QCPA 4GDFA 1NHOA 1HNCA 1GP1A 4MZWA 2AJQB 4DSSA 5DQYA 5CRGA 5KN1A 3H4KA 2X8HA 3F3RA 4EL1A 3LJRA 1BX9A 2X99A 3A2WA 4AF2A 1X9SB 1F9MA 4BVXB 2H70A 3WYWA 4JU5A 4GQCA 1IYIA 3HKRA 3E3EA 3MYDA 4QL9A 3TU3B 1HD2A 4KH7A 2FHEA 5ECHB 4G19A 1Y25A 3ZVJA 4Z2RA 3EINA 2FY6A 4TR0A 3HVVA 4ILFA 2ZCTA 3FKFA 4ECBA 3M1GA 3D4TA 2UZ8A 1OVNA 1EV9A 3GL3A 5GSSA 5L71A 4K6XA 1FG4A 1TJDA 4PNGA 2E7PA 4KNDA 3GV1A 2B5EA 2B7JA 1G7EA 4CY6A 5F06A 2WCIA 4NMUA 4ECIA 1Z7RA 5CAXA 5ECPB 2F51A 3Q6OA 5JWQB 5KOWA 2YZUA 2VM2A 2VO4A 4V1Ap 3TOTA 2IMDA 3IK7A 2V41A 2IL3A 3KH7A 1JHBA 1XPVA 2C80A 3G9BA 1EGOA 1ERWA 3FZ4A 4L0WA 3RAZA 4I6XA 1Z5YE 4G0KA 5ECQB 4MJEA 4N30A 5ECIB 3LFLA 3PPUA 1A24A 2N5BA 4BA7A 5ECKB 2IMIA 2WRTA 3L0HA 3DWVA 4NWYA 6GSWA 4WF5A 3VWUA 4GXZA 1ZYPA 4JR4A 2PERA 1NW2A 5LCZA 2LNTA 3MAKA 4GWRA 2C4JA 4WEYA 1GTAA 3ZFLA 2VKZG 1AXDA 1QFNA 4L0UA 1GSEA 2N5AA 5EPFA 2YCDA 3IOSA 5F07A 2XPDA 4KCEA 2ES7A 2CVDA 1PRXA 3K8NA 1YZXA 2I9HA 1GTBA 4F2IA 4BVYA 8GSSA 5IOXA 3DIEA 2X4AA 1C72A 5GSTA 1B8XA 4WXTA 2JL4A 4QQ7A 1GH2A 2HFDA 1M2DA 3GMFA 3O3TA 1XWCA 3QAGA 1ML6A 5COHA 3HMJG 1GUMA 2HYXA 3ED3A 1W89A 4Z2UA 1LU4A 3VWXA 3FK8A 5G5FA 1QMVA 3KMOA 3MNGA 5H5SA 4GQFA 3M0FA 4BVYB 1A0FA 4XRDA 5JCWA 2DBCA 3TB2A 1YQ1A 1FHEA 2F8FA 4E68A 1J9BA 1W4VA 1XIYA 1T4ZA 3MWHA 4CDOA 5A34B 5CREA 1YEPA 1O8XA 5CRDA 3RPNA 3IAM2 2GT6A 1TOFA 3KD0A 4O92A 3M9JA 1ERUA 2A2SA 4YKFA 2ZUPA 4HU9A 1TP9A 4PUAA 2OADA 5BMUB 1BG5A 1GWCA 4PUFC 4MH3A 3H93A 3APQA 5INYA 4XHMA 5F8BA 1M2BA 2WULA 2HSNB 1T3BA 3DYRA 2H0HA 2H30A 4TKYA 3FZ5A 4AGSA 1SU9A 2A4VA 2DMMA 4O32A 2WDUA 2GS3A 2C3QA 4ULXA 3VPTA 1SKSB 3PINA 5KN3A 2VCZA 4TXVA 1PQNA 4WR5A 3P2AA 4E8EA 4YQMA 2JADA 3LSZA 1V2AA 4LMWA 2PBJA 4OWYA 3M8NA 1QQ2A 2OACA 2LNSA 2YWNA 4AKHA 4KGIA 2BTOT 3KTBA 1T7PB 3ZZXA 4EUYA 2YJ7A 4J56E 3ZIVA 2YZHA 3TJKA 1K0MA 4JRRA 3TKPA 2HRNA 2FNOA 3CTFA 2MBTA 4ZL8A 2PN8A 2BMXA 4DEJA 2DJ0A 3EWLA 1LJRA 5ENUA 2VL2C 4IN0A 3A5WA 2EFDA 3GHAA 2CA8A 3VI7A 5ECNB 2VCXA 1S3CA 1GUKA 3FR9A 1SENA 4HQZA 3TKQA 4OFMA 1F3AA 4ACSA 5DAKA 1FW1A 1XW9A 3HA9A 3F4SA 3FZAA 5ECMB 4E8HA 1WIKA 2RLIA 18GSA 4HS1A 2C8UA 4ML1A 2IN3A 4F9ZA 5AISA 5J9BA 3APSA 4D73A 5B6NA 4A5PA 2XPEA 4XS1A 4JEDA 1Z3EA 4BPYA 2H6YA 2DIYA 3TRQA 3KCMA 4HOJA 3FYGA 2LV3A 1LBKA 1U3IA 3GX0A 3JCML 4YH2A 3H8QA 1XWGA 2R2JA 4IBPA 5E59A 1XOBA 5DAKB 2DJ2A 3G7IA 3GUSA 1GSYA 4N11A 3ZL5A 1V40A 4DSRA 4V2LA 2WZ9A 3DGQA 2YWIA 3ERGA 4GTUA 1R5AA 1GL8A 1TKDB 4RQRA 2YV9A 1THXA 3GH6A 4ZL9A 4Q5NA 4ZIJA 2NTOA 1G0TA 1TRWA 1TK0B 4Q5QA 3EE2A 2V2GA 2L5OA 5C04A 3RDWA 4PTSA 4X4JA 3GH9A 3ERFA 11GSA 4Q5FA 2P31A 4F03A 3C73A 3LORA 3CWGA 3N5OA 4G9HA 2O8VB 2MYGA 3MDKA 1ABAA 2L5LA 3HZ4A 3DMLA 19GSA 1THOA 4K7OA 5DCGA 4XCSA 3IAS2 4AJ6A 4G01A 3ZIJA 2NBSA 1PMTA 1TU8A 2MBSA 5B6MA 1DSBA 1EP7A 3EYTA 1X9WB 1SYRA 4OMVA 4PXOA 2O7KA 3GKNA 4EDYA 2WGRA 2KLXA 2LRNA 4I5QA 3QMXA 1Z6NA 1OE8A 1XVQA 5IPGA 1PGTA 3L9SA 1F6MC 3KM6A 1V98A 3CRUA 1GLQA 2L59A 1R26A 4KCAA 1SVLA 3UARA 3ME8A 2D2ZA 4P3YB 4FO5A 2C0DA 2B7KA 2J23A 1NM3A 2IIYA 2YWMA 4K5SA 3DEXA 4V2NA 3GRXA 3UJ1A 3P90A 1YKCA 6GSYA 3QPMA 2TRXA 2HSHA 3ME7A 3PR8A 2OJLA 3QFAC 3QAVA 1ZMAA 3F4RA 2VL9A 2IMKA 1XZOA 4XRAA 5CP1A 1AC1A 3CSHA 1PL2A 4OO4A 2C3TA 3FEUA 2GVPA 2CZ3A 3ISOA 4PQ1A 1CQGA 1SD8A 4IS0A 3TCOA 4IHUA 1V9WA 1EZKA 1K0AA 3QAWA 3IXRA 4KDXA 5AIVA 3PGTA 2FD3A 2KUCA 1NHYA 2FLSA 3HJPA 1XFLA 5EL8A 2VLUA 4W66A 1F37A 1XVWA 4N10A 2NPBA 2ON7A 5D8IA 1GTIA 5D9VA 1BF5A 4L5OA 2FUG2 5G5EA 1TRUA 2VOCA 4ZBAA 2H01A 5A5KA 2TRCP 1B4QA 2CAQA 4ID0A 2K6VA 3FRCA 3SBCA 4EC0A 4WKWA 3AY8A 3TDGA 1ACVA 2NDOA 9GSSA 4OD7A 4KW6A 4AI6A 2GSRA 2KOKA 5ECSA 2F3MA 1K0DA 5KOXA 2H71A 1KBNA 4MJAA 2LKUA 4YQUA 4WBJA 1AQVA 2GSQA 2V6OA 1T8EB 1ST9A 2CAIA 12GSA 4OFNA 3KTLA 10GSA 2K9FA 4MZBA 3F63A 2G0FA 5IIZA 1A23A 2M46A 1SJ6A 3BJ5A 2VCTA 2LRCA 4MF7A 2JSYA 3E9JB 1HYUA 2VL2A 2B6MA 3IRAA 4NHZA 1GLPA 3LWAA 1BG1A 2KHPA 1KNGA 5CRHA 1A8YA 2X8GA 2M80A 4KE3A 1ZL9A 4MH2A 4NHWA 4PNFA 1ZOFA 4PX1A 4RI6A 3HJMA 5D9WA 1ERTA 1TTZA 1OE7A 3ZFBA 4IGJA 1PSQA 4V2MA 1I9DA 4POKA 3E0UA 1FB0A 2TIRA 1S3AA 1TK8B 5G30A 3GA4A 2CV4A 2GQMA 5LD0A 1TRVA 3IE3A 5ECLB 1I5GA 5DCHA 2GSTA 1XWAA 5AN1A 2FWHA 1SK0A 3L9VA 2PWJA 5GAND 3EMPA 2GZYA 3ZLPA 5D73A 3WD6A 1AUCA 2O89A 4MDCA 1J0FA 4EKZA 5G2ZA 2PU9C 1PD21 3VURA 3D6IA 3UEMA 3L4NA 1U87A 1B48A 4O5RA 3IDVA 4XS6A 5A4WA 2YJHA 3GKKA 1CQHA 1OAZA 4XTSA 2DKIA 4GSTA 2GT5A 5DBQA 4HDEA 4KA0A 4TOPA 4K2DA 2LJRA 3TKSE 5A34A 4I2UA 3F4TA 5BRTA 2HSMA 2FA8A 2JSZA 3DXBA 2VL3A 4NPBA 4WR4A 1TDIA 1M9AA 4FYUA 5BMUA 4HUAA 4IVFA 3GN3A 5CNWA 3KP8A 4WF4A 2XHFA 3ZYWA 2HI7A 3BCKA 3HVXA 1GSDA 5A1NB 4RI7A 3FR6A 2HSNA 2AYTA 6GSTA 2P0GA 3EU4A 4IP1A 3EPTA 3D5JA 4L5LA 2JZTA 5IMAA 2OT3A 1MD3A 1ZYQB 3UBLA 3TJGA 2HSMB 3H79A 2IMFA 4ZBDA 16GSA 3LYPA 4KX4A 4FH8A 3C7MA 4HZ2A 3BCIA 1VF2A 3F6FA 3QFBC 2VCWA 1EWXA 5H5RA 1YF0A 3FY7A 4EXJA 2HQTA 3KH9A 2X49A 3TUEA 2VLTA 5AIXA 1MEKA 3OR5A 2DJKA 4MK3A 4XIHA 4HEA2 4KB3A 5ID2A 1F2EA 2C0GA 5IQYA 3D4MA 3GSSA 1SJIA 1SK1A 3A2XA 5ELAA 4TR1A 1JZWA 1XCCA 6GSVA 2DSAA 1TXUA 2EIOA 3GNJA 4TRXA 3HVSA 5A5HA 3O76A 5G1LA 4WETA 5ABRA 1V58A 1UC7A 2DIZA 2LUSA 2GGTA 1GUHA 1DUGA 5ID2B 4YAVA 4ISDA 4RUVA 4TR1B 5ECRB 1USBA 4CW9A 3KXOA 1UN2A 5F0GA 1X5EA 5A5HB 4TW5A 1BAYA 2C3NA 1A2JA 3I9V2 3C71A 2I81A 5DALB 1E6BA 2P5QA 1DE2A 2O5VA 5IO2A 1GULA 3M3MA 3HYPA 2B5YA 5HR1A 2MMNA 4OCEA 1FVKA 2L6CA 2RIIA 2EC4A 5J4VA 5G1KA 5IMDA 4PQHA 1QK8A 4CY8A 4FQUA 3LW9A 1O73A 4Z7XA 3W8JA 5JWOB 1GNWA 3G7JA 1U3AA 2KP2A 5D93A 3U5RE 5IMVA 2VD1A 2YOIA 5HR0A 1X5CA 2ALBA 2VUPA 3F0IA 2R3XA 4KSOA 1MTCA 3EVIA 1BJXA 1TU7A 5KN2A 3UL3A 1R5PA 3M9KA 3DRNA 5CRWA 4MJBA 3MSZA 1K0BA 2FCHA 3FR3A 1OKTA 3FMWA 5CO3A 2JZRA 2QKEA 2UV8G 1QXHA 2H74A 2QGVA 3HD5A 3I43A 4CHSA 1WRYA 2H75A 2HRKA 3CBUA 3TKSC 2RUFA 4DSQA 1RQMA 5AGYA 3IBHA 3NIVA 2FWGA 2HNLA 4IKHA 5D9XA 3HY2A 4HJ2A 2FGXA 4EVMA 1XXUA 1HNAA 4IW9A 2H1DA 1BEDA 1WOUA 2H0IA 6GSUA 2VCVA 4ZB8A 2K8SA 3DKSA 4I2TA 3D0ZA 2GQKA 2GDRA 1RW1A 4EIPA 3VWVA 4Q5RA 4USSA 1F3BA 5EY6A 5C00A 5HQPA 2HRKB 2DJ1A 2R4VA 5EVOA 4LL4B 2OA7A 2MZCA 5HR3A 20GSA 5DDLA 3KP9A 1GSQA 1VF1A 5J41A 3ZMKA 1XWBA 3UAPA 4K9ZA 2V6KA 2YP6A 4XS4A 2H1AA 4PURA 3UIWA 1X0RA 3BD2A 5H5QA 1Z6MA 3EU3A 3KMNA 5J5NA 1V57A 2H8LA 1Y1UA 3SWLA 22GSA 1H75A 2N5FA 4TXOA 2AUVA 2X8CA 3VWWA 1M7TA 2H76A 2EFEA 2LQQA 5ECOB 1BQ7A 2V32A 5FT3A 5B8AA 4KSMA 3NOFA 4MZCA 4XS4B 2C0FA 2YWOA 5J9CA 4IQAA 3A2VA 3HJOA 1PX6A 3CRTA 1PA3A 2H73A 13GSA 3P8WA 4PGTA 4GSNA 4POBA 2LSTA 3QD9A 2LQOA 1M0UA 5J4UA 4ECCA 3CSJA 1PX7A 4KUNA 4TXOB 2GZZA 2HT9A 1B4PA 3GX8A 3C8EA 4MMMA 3IHQA 2NVLA 2Z9SA 1MDKA 2RM5A 4FYCA 2C0EA 2R0CA 3Q19A 2VCQA 3ZVJD 4ZILA 2WFCA 4EE0A 3GSTA 5A4UA 3US3A 1MD4A 3LGCA 4G0IA 2R0PA 4K1FA 2F9SA 2RUEA 2QA1A 4MA9A 7GSSA 1O85A 2R37A 4DVCA 3GURA 1M9BA 2CVKA 5B8BA 4NAXA 1EOHA 3D21A 1TXXA 3A3TA 1U88A 2K18A 1Q98A 5B7CA 1R7HA 1K0NA 5KEJA 3KZQA 5A4VA 1VRSD 1SJZA 1K3OA 3C1RA 4I97A 4N3ZA 4G10A 5E4WA 1N25A 3EC3A 3L78A 1B9YC 1KTEA 1GNEA 2GSSA 2R6KA 1FOHA 1PKZA 1YEXA 2PUKC 2WS2A 4ZXGA 2AB6A 3TJFA 5DVBA 5D9TA 3F3QA 3HDCA 2XBIA 1U6TA 2HZEA 2C1YA 2V1MA 3HHVA 3UMAA 4JR6A 1ERVA 4Z2TA 2IPAA 1O6JA 1GSFA 5HFIA 2VLVA 3HXSA 4I8BA 4ZL7A 1EV4A 2FA4A 1E2YA 1K0CA 4N0VA 5JWRB 2B1KA 1S3DA 4NV5A 3TGZA 4JE1A 2I4AA 2E0QA 4BL7B 4IP6A 2DLXA 2HZEB 3UVTA 1YVLA 2ZNMA 1AAZA 3QOUA 4MNNA 5FWGA 1B9XC 3C1SA 1ILOA 4DSSB 2YN1A 2K8VA 2A2RA 2DMLA 4IJIA 2AHEA 3KGKA 4FIWA 3TKRA 2R0GA 4BWSA 2L4QA 3WGXA 3GL5A 3TJBA 2BJXA 1G7OA 2OBIA 1N8JA 1GSSA 4IJ3A 4X43A 3UOMA 4TVEA 1SL1B 1Y6EA 5JCUA 2EFCA 1T1VA 4WBRD 3A5IA 4HZ4A 3HZ8A 5J3RA 6GSSA 5HFKA 3VFIA 4X0XA 1FO5A 3I6AA 1YF1A 2H6ZA 14GSA 1RK4A 1FVJA 5JCGA 4EDZA 1SYXA 3KEBA 3FHKA 4TR3A 1MDIA 2M72A 1M2AA 1DBYA 4K0NA 2CQ9A 4K0GA 5IMZA 2FWEA 1AQXA 1OC3A 1EP8A 1KEBA 1TW9A 2VD0A 1G6WA 4OO5A 3J7Yk 4QL7A 3CYNA 4IELA 4MF6A 3ZRDA 4O7HA 5GZZB 2L4CA 4KDUA 1ZZYA 5DJMA 2CVBA 2A2PA 2O85A 1JLVA 1ZGNA 3BOAA 4HU7A 3MIXA 3TKSA 2LEGA 17GSA 3VPQA 3GYKA 1QGVA 3TOUA 5KN0A 5A1NA 5IMFA 1NSWA 3RPPA 3O6TA 4MABA 1AIUA 2IMEA 3NZNA 2GZPA 4KAEA 2AV4A 3WGEA 4MPFA 2YPMA 3G7YA 2LTKA 2AAWA 4J2FA 4ZB7A 1X9MB 1JFUA 1A0RP 3TJJA 4MPGA 2G2QA 3VLNA 4ZB6A 1OC9A 3W6GA 4F0CA 3P7XA 4HI7A 1WJKA 1WMJA 2X64A 1R4WA 1EGRA 1YY7A 3DVWA 4QMKA 3BBYA 3GIXA 4ICYA 1ZYEA 1Z7PA 2HZFA 1XW6A 1M99A 3GTUA 1TK5B 1ZCPA 1G6YA 1MDJA 1HQOA 3IR4A 5IMCA 2PVOC 4MP4A 4LLRA 3IC8A 4OCFA 2HLSA 1TI1A 1YJ6A 4L8EA 2OKAA 1OYJA 5LNKe 1OC9B 4J57E 4AKIA 1PN9A 2H1LA 1SKRB 1IYHA 3CSIA 2RM6A 3GKXA 3GTUB 4EF0A 4MJCA 2H19A 3H1NA 1Q4JA 1TRSA 2CX4A 1BYEA 1FB6A 1DE1A 2PVQA 2DC5A 2IFQA 2EIRA 2XBQA 4YQVA 4OFTA 5IPHA 3IC4A 5J4YA 3VK9A 1XW5A 4LL1B 6GSXA 4LMVA 5DALA 2REMA 2EIQA 2HRAA 3VI5A 4K5RA 2MMZA 3F9UA 4O5QA 3WT1A 1WE0A 1O8WA 3R2QA 1VF3A 4GF0A 1T00A 1VGLA 2J9HA 3CTGA 2IFQB 1UA5A 2MMOA 4MCUA 3S9FA 3LEFA 2WB9A 3CXGA 3LXZA 1ZYNA 2E2MA 1O7UA 2VIMA 5FHIA 3F8UA 4ZBBA 2JZSA 4NXIA 2P5RA 4V1Ag 1WP0A 2MMAA 3UVHA 1SVMA 4KDYA 2HE3A 1PN0A 1YKAA 2PMTA 1JLWA 2GTUA 1SKWB 3LG6A 3TRXA 2DJ3A 4K7NA 1SL2B 4EIQA 5G31A 2OE1A 3APOA 4G0LA 3PH9A 4POLA 1WPIA 4AKGA 4KF9A 4O5UA 4TR4A 4X1UA 3DD3A 2KP1A 3QR6A 1A2MA 4ZB9A 1JZOA 2H66A 1PL1A 2L6DA 3FZ9A 3FW2A 3RHBA 3U6VA 1K3YA 4HJMA 2HRFA 3IHGA 4AJ7A 1TI3A 2YANA 1PKWA 1FAAA 1XOAA 2QSIA 2L57A 4POMA 1FOVA 1AW9A 3F6DA 5D96A 2B1LA 3V1WA 4K7IA 3GKMA 1XBSA 3KIJA 1AQWA 1GTUA 5DJLA 3QDNA 1O81A 2E2GA 3L9UA 2OE0A 1H4OA 3ZTLA 4AKXB 2I3YA 2H0GA 2B5XA 4JBBA 4D73B 4MLYA 4AJ8A 3W8SA 2H72A 3UBKA 4HQSA 3GFKA 4YAPA 3ZREA 2HXKA 2YV7A 2YNXA 1OKDA 1SK2A 3ZMLA 1ON4A 5ELGA 3LYKA 4ECJA 2JACA 4YKGA 2JU5A 2XC2A 5GAPD 2I1UA 3I69A 4K2XA 4GSSA 2ON5A 1OC8A 1J08A 2OBKA 5CYYA 2DKHA 4IQ1A 2LJKA 4H86A 1EEMA 1K0OA 2CZ2A 2F8AA 1N2AA 2H1GA 1Z9HA 1GSUA 2EFHA 3RBTA 2FWFA 3WT2A 3WGDA 2GLRA 4G2EA 2LS5A 1XWKA 4F0BA 2O87A 4GCIA 2WJUA 3Q74A 4PQIA 2QC7A 2CX3A 4LA1A 2DJJA 5J40A 1URMA 1VF4A 2GQLA 4F82A 2VAFA 1EEJA 3CMIA 1UVZA 4GLTA 1WWJA 3IPZA 4TN8A 3EURA 1GRXA 2PGTA 3DVXA 3LQ7A 3N9JA 3J7Yb 3D22A 3LXTA 2QA2A 3IV4A 2LJAA 5F05A 2H1BA 2R5GA 4EO3A 1JZRA 2H6XA 3Q18A 4K8MA 2A4HA 5IO0A 1T4YA 1SL0B 4N0ZA 3RHCA 5IM9A 1SD9A 5HR2A 2OE3A 1HNBA 1X5DA 5J47A 1K3LA 3TRPA 4FYBA 4NV2A 3KJYA 1A8LA 1YDKA 3ERWA 5IOWA 2IJYA 2HSYA 3EMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFG A;  5DQS A;  4ML6 A;  4JZQ A;  2LRT A;  4BWQ A;  4GRF A;  3IA1 A;  4RQX A;  1JZD A;  1QUW A;  3HCZ A;  1A2L A;  3IK9 A;  4BVX A;  1EOG A;  2B3S A;  2PPT A;  2VM1 A;  3ZIT A;  4MF5 A;  3R3E A;  2CT6 A;  4BL7 A;  2IWT A;  3QCP A;  1NHO A;  1HNC A;  1GP1 A;  4MZW A;  2AJQ B;  4DSS A;  5DQY A;  5CRG A;  5KN1 A;  3H4K A;  2X8H A;  3F3R A;  4EL1 A;  3LJR A;  1BX9 A;  2X99 A;  3A2W A;  4AF2 A;  1X9S B;  1F9M A;  4BVX B;  2H70 A;  3WYW A;  4JU5 A;  4GQC A;  1IYI A;  3HKR A;  3E3E A;  4QL9 A;  1HD2 A;  4KH7 A;  2FHE A;  5ECH B;  4G19 A;  1Y25 A;  3ZVJ A;  3EIN A;  2FY6 A;  4TR0 A;  3HVV A;  4ILF A;  2ZCT A;  3FKF A;  4ECB A;  3M1G A;  3D4T A;  2UZ8 A;  1OVN A;  1EV9 A;  3GL3 A;  5GSS A;  5L71 A;  4K6X A;  1FG4 A;  1TJD A;  4PNG A;  2E7P A;  4KND A;  3GV1 A;  2B5E A;  2B7J A;  1G7E A;  5F06 A;  2WCI A;  4NMU A;  4ECI A;  1Z7R A;  5CAX A;  5ECP B;  2F51 A;  3Q6O A;  5JWQ B;  2YZU A;  2VM2 A;  2VO4 A;  4V1A p;  3TOT A;  2IMD A;  3IK7 A;  2V41 A;  2IL3 A;  3KH7 A;  1JHB A;  1XPV A;  2C80 A;  3G9B A;  1EGO A;  1ERW A;  3FZ4 A;  4L0W A;  3RAZ A;  4I6X A;  1Z5Y E;  4G0K A;  5ECQ B;  4MJE A;  4N30 A;  5ECI B;  3LFL A;  3PPU A;  1A24 A;  2N5B A;  4BA7 A;  5ECK B;  2IMI A;  2WRT A;  3L0H A;  3DWV A;  4NWY A;  6GSW A;  4WF5 A;  3VWU A;  4GXZ A;  4JR4 A;  2PER A;  1NW2 A;  5LCZ A;  2LNT A;  3MAK A;  4GWR A;  2C4J A;  4WEY A;  1GTA A;  3ZFL A;  1AXD A;  1QFN A;  4L0U A;  1GSE A;  2N5A A;  5EPF A;  2YCD A;  3IOS A;  5F07 A;  2XPD A;  4KCE A;  2ES7 A;  2CVD A;  1PRX A;  3K8N A;  1YZX A;  2I9H A;  1GTB A;  4F2I A;  4BVY A;  8GSS A;  5IOX A;  3DIE A;  1C72 A;  5GST A;  1B8X A;  4WXT A;  2JL4 A;  4QQ7 A;  1GH2 A;  2HFD A;  1M2D A;  3GMF A;  3O3T A;  1XWC A;  3QAG A;  1ML6 A;  5COH A;  1GUM A;  2HYX A;  3ED3 A;  1W89 A;  1LU4 A;  3VWX A;  3FK8 A;  5G5F A;  1QMV A;  3KMO A;  3MNG A;  5H5S A;  4GQF A;  3M0F A;  4BVY B;  1A0F A;  4XRD A;  5JCW A;  2DBC A;  3TB2 A;  1YQ1 A;  1FHE A;  2F8F A;  1J9B A;  1W4V A;  1XIY A;  1T4Z A;  3MWH A;  4CDO A;  5CRE A;  1YEP A;  1O8X A;  5CRD A;  3RPN A;  3IAM 2;  2GT6 A;  1TOF A;  3KD0 A;  4O92 A;  3M9J A;  1ERU A;  2A2S A;  2ZUP A;  4HU9 A;  1TP9 A;  4PUA A;  2OAD A;  1BG5 A;  1GWC A;  4PUF C;  4MH3 A;  3H93 A;  3APQ A;  5INY A;  4XHM A;  5F8B A;  1M2B A;  2WUL A;  2HSN B;  1T3B A;  3DYR A;  2H0H A;  2H30 A;  4TKY A;  3FZ5 A;  4AGS A;  1SU9 A;  2A4V A;  2DMM A;  4O32 A;  2WDU A;  2GS3 A;  2C3Q A;  4ULX A;  3VPT A;  1SKS B;  3PIN A;  5KN3 A;  2VCZ A;  4TXV A;  1PQN A;  4WR5 A;  3P2A A;  4E8E A;  4YQM A;  2JAD A;  3LSZ A;  1V2A A;  4LMW A;  2PBJ A;  4OWY A;  3M8N A;  1QQ2 A;  2OAC A;  2LNS A;  2YWN A;  4KGI A;  2BTO T;  3KTB A;  1T7P B;  3ZZX A;  4EUY A;  2YJ7 A;  4J56 E;  3ZIV A;  2YZH A;  3TJK A;  1K0M A;  4JRR A;  3TKP A;  2HRN A;  2FNO A;  3CTF A;  2MBT A;  4ZL8 A;  2PN8 A;  2BMX A;  4DEJ A;  2DJ0 A;  3EWL A;  1LJR A;  5ENU A;  2VL2 C;  4IN0 A;  3A5W A;  3GHA A;  2CA8 A;  3VI7 A;  5ECN B;  2VCX A;  1S3C A;  1GUK A;  3FR9 A;  1SEN A;  4HQZ A;  3TKQ A;  4OFM A;  1F3A A;  4ACS A;  5DAK A;  1FW1 A;  1XW9 A;  3HA9 A;  3F4S A;  3FZA A;  5ECM B;  4E8H A;  1WIK A;  4HS1 A;  18GS A;  2RLI A;  2C8U A;  4ML1 A;  2IN3 A;  4F9Z A;  5AIS A;  5J9B A;  3APS A;  4D73 A;  5B6N A;  2XPE A;  4XS1 A;  4JED A;  1Z3E A;  4BPY A;  2H6Y A;  2DIY A;  3TRQ A;  3KCM A;  4HOJ A;  3FYG A;  2LV3 A;  1LBK A;  1U3I A;  3GX0 A;  3JCM L;  4YH2 A;  3H8Q A;  1XWG A;  2R2J A;  4IBP A;  5E59 A;  1XOB A;  5DAK B;  2DJ2 A;  3G7I A;  3GUS A;  1GSY A;  4N11 A;  3ZL5 A;  1V40 A;  4DSR A;  4V2L A;  2WZ9 A;  3DGQ A;  2YWI A;  3ERG A;  4GTU A;  1R5A A;  1GL8 A;  1TKD B;  4RQR A;  2YV9 A;  1THX A;  3GH6 A;  4ZL9 A;  4Q5N A;  4ZIJ A;  2NTO A;  1G0T A;  1TRW A;  1TK0 B;  4Q5Q A;  3EE2 A;  2V2G A;  2L5O A;  5C04 A;  3RDW A;  4PTS A;  3GH9 A;  3ERF A;  11GS A;  4Q5F A;  2P31 A;  4F03 A;  3C73 A;  3LOR A;  3N5O A;  4G9H A;  2O8V B;  2MYG A;  3MDK A;  1ABA A;  2L5L A;  3HZ4 A;  3DML A;  19GS A;  1THO A;  4K7O A;  5DCG A;  4XCS A;  3IAS 2;  4AJ6 A;  3ZIJ A;  2NBS A;  1PMT A;  1TU8 A;  2MBS A;  5B6M A;  1DSB A;  1EP7 A;  3EYT A;  1X9W B;  1SYR A;  4OMV A;  4PXO A;  2O7K A;  3GKN A;  4EDY A;  2WGR A;  2KLX A;  2LRN A;  4I5Q A;  3QMX A;  1Z6N A;  1OE8 A;  1XVQ A;  5IPG A;  1PGT A;  3L9S A;  1F6M C;  3KM6 A;  1V98 A;  3CRU A;  1GLQ A;  2L59 A;  1R26 A;  4KCA A;  3UAR A;  3ME8 A;  2D2Z A;  4P3Y B;  4FO5 A;  2C0D A;  2B7K A;  2J23 A;  1NM3 A;  2IIY A;  2YWM A;  4V2N A;  3DEX A;  3GRX A;  3UJ1 A;  3P90 A;  1YKC A;  6GSY A;  3QPM A;  2TRX A;  2HSH A;  3ME7 A;  3PR8 A;  2OJL A;  3QFA C;  3QAV A;  1ZMA A;  3F4R A;  2VL9 A;  2IMK A;  1XZO A;  4XRA A;  5CP1 A;  1AC1 A;  3CSH A;  1PL2 A;  4OO4 A;  2C3T A;  3FEU A;  2GVP A;  2CZ3 A;  3ISO A;  4PQ1 A;  1CQG A;  1SD8 A;  4IS0 A;  3TCO A;  4IHU A;  1V9W A;  1EZK A;  1K0A A;  3QAW A;  3IXR A;  4KDX A;  5AIV A;  3PGT A;  2FD3 A;  2KUC A;  1NHY A;  2FLS A;  3HJP A;  1XFL A;  5EL8 A;  2VLU A;  1F37 A;  1XVW A;  4N10 A;  2NPB A;  2ON7 A;  5D8I A;  1GTI A;  5D9V A;  4L5O A;  2FUG 2;  5G5E A;  1TRU A;  2VOC A;  4ZBA A;  2H01 A;  5A5K A;  2TRC P;  1B4Q A;  2CAQ A;  4ID0 A;  2K6V A;  3FRC A;  3SBC A;  4EC0 A;  4WKW A;  3AY8 A;  3TDG A;  1ACV A;  2NDO A;  9GSS A;  4OD7 A;  4KW6 A;  2GSR A;  2KOK A;  5ECS A;  2F3M A;  1K0D A;  2H71 A;  1KBN A;  4MJA A;  2LKU A;  4YQU A;  4WBJ A;  1AQV A;  2GSQ A;  2V6O A;  1T8E B;  1ST9 A;  2CAI A;  12GS A;  4OFN A;  3KTL A;  10GS A;  2K9F A;  4MZB A;  3F63 A;  2G0F A;  5IIZ A;  1A23 A;  2M46 A;  1SJ6 A;  3BJ5 A;  2VCT A;  2LRC A;  4MF7 A;  2JSY A;  3E9J B;  1HYU A;  2VL2 A;  2B6M A;  3IRA A;  4NHZ A;  1GLP A;  3LWA A;  2KHP A;  1KNG A;  5CRH A;  1A8Y A;  2X8G A;  2M80 A;  4KE3 A;  1ZL9 A;  4MH2 A;  4NHW A;  4PNF A;  1ZOF A;  4PX1 A;  4RI6 A;  3HJM A;  5D9W A;  1ERT A;  1TTZ A;  1OE7 A;  3ZFB A;  4IGJ A;  1PSQ A;  4V2M A;  1I9D A;  4POK A;  3E0U A;  1FB0 A;  2TIR A;  1S3A A;  1TK8 B;  5G30 A;  3GA4 A;  2CV4 A;  2GQM A;  5LD0 A;  1TRV A;  3IE3 A;  5ECL B;  1I5G A;  5DCH A;  2GST A;  1XWA A;  5AN1 A;  2FWH A;  1SK0 A;  3L9V A;  2PWJ A;  5GAN D;  3EMP A;  2GZY A;  3ZLP A;  5D73 A;  3WD6 A;  1AUC A;  2O89 A;  4MDC A;  1J0F A;  4EKZ A;  5G2Z A;  2PU9 C;  1PD2 1;  3VUR A;  3D6I A;  3UEM A;  3L4N A;  1U87 A;  1B48 A;  4O5R A;  3IDV A;  4XS6 A;  5A4W A;  2YJH A;  3GKK A;  1CQH A;  1OAZ A;  4XTS A;  4GST A;  2GT5 A;  5DBQ A;  4HDE A;  4KA0 A;  4TOP A;  4K2D A;  2LJR A;  3TKS E;  4I2U A;  3F4T A;  2HSM A;  2FA8 A;  2JSZ A;  3DXB A;  2VL3 A;  4NPB A;  4WR4 A;  1TDI A;  1M9A A;  4FYU A;  5BMU A;  4HUA A;  4IVF A;  3GN3 A;  5CNW A;  3KP8 A;  4WF4 A;  2XHF A;  3ZYW A;  2HI7 A;  3BCK A;  3HVX A;  1GSD A;  4RI7 A;  3FR6 A;  2AYT A;  6GST A;  2P0G A;  3EU4 A;  4IP1 A;  3D5J A;  4L5L A;  2JZT A;  5IMA A;  1MD3 A;  1ZYQ B;  3UBL A;  3TJG A;  2HSM B;  3H79 A;  2IMF A;  4ZBD A;  16GS A;  3LYP A;  4KX4 A;  4FH8 A;  3C7M A;  4HZ2 A;  3BCI A;  1VF2 A;  3F6F A;  3QFB C;  2VCW A;  1EWX A;  5H5R A;  1YF0 A;  3FY7 A;  4EXJ A;  2HQT A;  3KH9 A;  3TUE A;  2VLT A;  5AIX A;  1MEK A;  3OR5 A;  2DJK A;  4MK3 A;  4XIH A;  4HEA 2;  4KB3 A;  5ID2 A;  1F2E A;  2C0G A;  5IQY A;  3D4M A;  3GSS A;  1SJI A;  1SK1 A;  3A2X A;  5ELA A;  4TR1 A;  1JZW A;  1XCC A;  6GSV A;  2DSA A;  2EIO A;  3GNJ A;  4TRX A;  3HVS A;  3O76 A;  5G1L A;  4WET A;  5ABR A;  1V58 A;  1UC7 A;  2DIZ A;  2LUS A;  2GGT A;  1GUH A;  1DUG A;  5ID2 B;  4YAV A;  4ISD A;  4RUV A;  4TR1 B;  5ECR B;  1USB A;  4CW9 A;  3KXO A;  1UN2 A;  5F0G A;  1X5E A;  4TW5 A;  1BAY A;  2C3N A;  1A2J A;  3I9V 2;  3C71 A;  2I81 A;  5DAL B;  1E6B A;  2P5Q A;  1DE2 A;  5IO2 A;  1GUL A;  3M3M A;  3HYP A;  2B5Y A;  5HR1 A;  2MMN A;  4OCE A;  1FVK A;  2L6C A;  2RII A;  2EC4 A;  5G1K A;  5IMD A;  4PQH A;  1QK8 A;  4FQU A;  1O73 A;  4Z7X A;  3W8J A;  5JWO B;  1GNW A;  3G7J A;  1U3A A;  2KP2 A;  5D93 A;  3U5R E;  5IMV A;  2VD1 A;  2YOI A;  5HR0 A;  1X5C A;  2ALB A;  2VUP A;  3F0I A;  2R3X A;  4KSO A;  1MTC A;  3EVI A;  1BJX A;  1TU7 A;  5KN2 A;  3UL3 A;  1R5P A;  3M9K A;  3DRN A;  5CRW A;  4MJB A;  3MSZ A;  1K0B A;  2FCH A;  3FR3 A;  1OKT A;  5CO3 A;  2JZR A;  2QKE A;  1QXH A;  2H74 A;  2QGV A;  3HD5 A;  3I43 A;  4CHS A;  1WRY A;  2H75 A;  2HRK A;  3CBU A;  3TKS C;  2RUF A;  4DSQ A;  1RQM A;  5AGY A;  3IBH A;  3NIV A;  2FWG A;  2HNL A;  4IKH A;  5D9X A;  3HY2 A;  4HJ2 A;  2FGX A;  4EVM A;  1XXU A;  1HNA A;  4IW9 A;  2H1D A;  1BED A;  1WOU A;  2H0I A;  6GSU A;  2VCV A;  4ZB8 A;  2K8S A;  3DKS A;  4I2T A;  3D0Z A;  2GQK A;  2GDR A;  1RW1 A;  3VWV A;  4Q5R A;  4USS A;  1F3B A;  5EY6 A;  5C00 A;  5HQP A;  2HRK B;  2DJ1 A;  2R4V A;  5EVO A;  4LL4 B;  2OA7 A;  2MZC A;  5HR3 A;  20GS A;  5DDL A;  3KP9 A;  1GSQ A;  1VF1 A;  5J41 A;  3ZMK A;  1XWB A;  3UAP A;  4K9Z A;  2V6K A;  2YP6 A;  4XS4 A;  2H1A A;  4PUR A;  3UIW A;  1X0R A;  3BD2 A;  5H5Q A;  1Z6M A;  3EU3 A;  3KMN A;  5J5N A;  1V57 A;  2H8L A;  3SWL A;  22GS A;  1H75 A;  2N5F A;  4TXO A;  2AUV A;  2X8C A;  3VWW A;  1M7T A;  2H76 A;  2LQQ A;  5ECO B;  1BQ7 A;  2V32 A;  5FT3 A;  5B8A A;  4KSM A;  3NOF A;  4MZC A;  4XS4 B;  2C0F A;  2YWO A;  5J9C A;  4IQA A;  3A2V A;  3HJO A;  1PX6 A;  3CRT A;  1PA3 A;  2H73 A;  13GS A;  3P8W A;  4PGT A;  4GSN A;  4POB A;  2LST A;  3QD9 A;  2LQO A;  1M0U A;  5J4U A;  4ECC A;  3CSJ A;  1PX7 A;  4KUN A;  4TXO B;  2GZZ A;  2HT9 A;  1B4P A;  3GX8 A;  3C8E A;  4MMM A;  3IHQ A;  2NVL A;  2Z9S A;  1MDK A;  2RM5 A;  4FYC A;  2C0E A;  3Q19 A;  2VCQ A;  3ZVJ D;  4ZIL A;  2WFC A;  4EE0 A;  3GST A;  5A4U A;  3US3 A;  1MD4 A;  3LGC A;  4G0I A;  4K1F A;  2F9S A;  2RUE A;  4MA9 A;  7GSS A;  1O85 A;  2R37 A;  4DVC A;  3GUR A;  1M9B A;  2CVK A;  5B8B A;  4NAX A;  1EOH A;  3D21 A;  1TXX A;  3A3T A;  1U88 A;  2K18 A;  1Q98 A;  5B7C A;  1R7H A;  1K0N A;  5KEJ A;  3KZQ A;  5A4V A;  1VRS D;  1SJZ A;  1K3O A;  3C1R A;  4I97 A;  4G10 A;  5E4W A;  3EC3 A;  3L78 A;  1B9Y C;  1KTE A;  1GNE A;  2GSS A;  2R6K A;  1PKZ A;  1YEX A;  2PUK C;  2WS2 A;  4ZXG A;  2AB6 A;  3TJF A;  5DVB A;  5D9T A;  3F3Q A;  3HDC A;  1U6T A;  2HZE A;  2XBI A;  2C1Y A;  2V1M A;  3HHV A;  3UMA A;  4JR6 A;  1ERV A;  2IPA A;  1O6J A;  1GSF A;  5HFI A;  2VLV A;  3HXS A;  4I8B A;  4ZL7 A;  1EV4 A;  2FA4 A;  1E2Y A;  1K0C A;  4N0V A;  5JWR B;  2B1K A;  1S3D A;  4NV5 A;  3TGZ A;  4JE1 A;  2I4A A;  2E0Q A;  4BL7 B;  4IP6 A;  2DLX A;  2HZE B;  3UVT A;  2ZNM A;  1AAZ A;  3QOU A;  5FWG A;  1B9X C;  3C1S A;  1ILO A;  4DSS B;  2YN1 A;  2K8V A;  2A2R A;  2DML A;  4IJI A;  2AHE A;  3KGK A;  4FIW A;  3TKR A;  4BWS A;  2L4Q A;  3WGX A;  3GL5 A;  3TJB A;  2BJX A;  1G7O A;  2OBI A;  1N8J A;  1GSS A;  4IJ3 A;  4X43 A;  3UOM A;  4TVE A;  1SL1 B;  1Y6E A;  5JCU A;  1T1V A;  4WBR D;  4HZ4 A;  3HZ8 A;  5J3R A;  6GSS A;  5HFK A;  3VFI A;  4X0X A;  1FO5 A;  3I6A A;  1YF1 A;  2H6Z A;  14GS A;  1RK4 A;  1FVJ A;  5JCG A;  4EDZ A;  1SYX A;  3KEB A;  3FHK A;  4TR3 A;  1MDI A;  2M72 A;  1M2A A;  1DBY A;  4K0N A;  2CQ9 A;  4K0G A;  5IMZ A;  2FWE A;  1AQX A;  1OC3 A;  1EP8 A;  1KEB A;  1TW9 A;  2VD0 A;  1G6W A;  4OO5 A;  3J7Y k;  4QL7 A;  3CYN A;  4IEL A;  4MF6 A;  3ZRD A;  4O7H A;  5GZZ B;  2L4C A;  4KDU A;  1ZZY A;  5DJM A;  2CVB A;  2O85 A;  1JLV A;  1ZGN A;  3BOA A;  4HU7 A;  3TKS A;  2LEG A;  17GS A;  3VPQ A;  3GYK A;  1QGV A;  3TOU A;  5KN0 A;  5IMF A;  1NSW A;  3RPP A;  3O6T A;  4MAB A;  1AIU A;  2IME A;  3NZN A;  2GZP A;  4KAE A;  2AV4 A;  3WGE A;  4MPF A;  2YPM A;  3G7Y A;  2LTK A;  2AAW A;  4J2F A;  1X9M B;  1JFU A;  1A0R P;  3TJJ A;  4MPG A;  2G2Q A;  3VLN A;  4ZB6 A;  1OC9 A;  3W6G A;  4F0C A;  3P7X A;  4HI7 A;  1WJK A;  1WMJ A;  2X64 A;  1R4W A;  1EGR A;  1YY7 A;  3DVW A;  3BBY A;  3GIX A;  1ZYE A;  1Z7P A;  2HZF A;  1XW6 A;  1M99 A;  3GTU A;  1TK5 B;  1ZCP A;  1G6Y A;  1MDJ A;  1HQO A;  3IR4 A;  5IMC A;  2PVO C;  4MP4 A;  4LLR A;  3IC8 A;  4OCF A;  2HLS A;  1TI1 A;  1YJ6 A;  4L8E A;  2OKA A;  1OYJ A;  5LNK e;  1OC9 B;  4J57 E;  1PN9 A;  1SKR B;  1IYH A;  3CSI A;  2RM6 A;  3GKX A;  3GTU B;  4EF0 A;  4MJC A;  2H19 A;  3H1N A;  1Q4J A;  1TRS A;  2CX4 A;  1BYE A;  1FB6 A;  1DE1 A;  2PVQ A;  2DC5 A;  2IFQ A;  2EIR A;  2XBQ A;  4YQV A;  4OFT A;  5IPH A;  3IC4 A;  3VK9 A;  1XW5 A;  4LL1 B;  6GSX A;  4LMV A;  5DAL A;  2REM A;  2EIQ A;  2HRA A;  3VI5 A;  2MMZ A;  3F9U A;  3WT1 A;  1WE0 A;  1O8W A;  3R2Q A;  1VF3 A;  4GF0 A;  1T00 A;  1VGL A;  2J9H A;  3CTG A;  2IFQ B;  1UA5 A;  2MMO A;  4MCU A;  3S9F A;  3LEF A;  2WB9 A;  3CXG A;  3LXZ A;  2E2M A;  1O7U A;  2VIM A;  5FHI A;  3F8U A;  4ZBB A;  2JZS A;  4NXI A;  2P5R A;  4V1A g;  1WP0 A;  2MMA A;  3UVH A;  4KDY A;  2HE3 A;  1YKA A;  2PMT A;  1JLW A;  2GTU A;  1SKW B;  3LG6 A;  3TRX A;  2DJ3 A;  4K7N A;  1SL2 B;  5G31 A;  2OE1 A;  3APO A;  4G0L A;  3PH9 A;  4POL A;  1WPI A;  4KF9 A;  4TR4 A;  4X1U A;  3DD3 A;  2KP1 A;  3QR6 A;  1A2M A;  4ZB9 A;  1JZO A;  2H66 A;  1PL1 A;  2L6D A;  3FZ9 A;  3FW2 A;  3RHB A;  3U6V A;  1K3Y A;  4HJM A;  2HRF A;  4AJ7 A;  1TI3 A;  2YAN A;  1PKW A;  1FAA A;  1XOA A;  2QSI A;  2L57 A;  4POM A;  1FOV A;  1AW9 A;  3F6D A;  5D96 A;  2B1L A;  3V1W A;  4K7I A;  3GKM A;  1XBS A;  3KIJ A;  1AQW A;  1GTU A;  5DJL A;  3QDN A;  1O81 A;  2E2G A;  3L9U A;  2OE0 A;  1H4O A;  3ZTL A;  2I3Y A;  2H0G A;  2B5X A;  4JBB A;  4D73 B;  4MLY A;  4AJ8 A;  3W8S A;  2H72 A;  3UBK A;  4HQS A;  3GFK A;  4YAP A;  3ZRE A;  2HXK A;  2YV7 A;  2YNX A;  1OKD A;  1SK2 A;  3ZML A;  1ON4 A;  5ELG A;  3LYK A;  4ECJ A;  2JAC A;  2JU5 A;  2XC2 A;  5GAP D;  2I1U A;  3I69 A;  4GSS A;  2ON5 A;  1OC8 A;  1J08 A;  2OBK A;  5CYY A;  4IQ1 A;  2LJK A;  4H86 A;  1EEM A;  1K0O A;  2CZ2 A;  2F8A A;  1N2A A;  2H1G A;  1Z9H A;  1GSU A;  3RBT A;  2FWF A;  3WT2 A;  3WGD A;  2GLR A;  4G2E A;  2LS5 A;  1XWK A;  4F0B A;  2O87 A;  4GCI A;  2WJU A;  3Q74 A;  4PQI A;  2QC7 A;  2CX3 A;  4LA1 A;  2DJJ A;  1URM A;  1VF4 A;  2GQL A;  4F82 A;  2VAF A;  1EEJ A;  3CMI A;  1UVZ A;  4GLT A;  1WWJ A;  3IPZ A;  4TN8 A;  3EUR A;  1GRX A;  2PGT A;  3DVX A;  3LQ7 A;  3N9J A;  3J7Y b;  3D22 A;  3LXT A;  3IV4 A;  2LJA A;  5F05 A;  2H1B A;  2R5G A;  4EO3 A;  1JZR A;  2H6X A;  3Q18 A;  4K8M A;  5IO0 A;  1T4Y A;  1SL0 B;  4N0Z A;  3RHC A;  5IM9 A;  1SD9 A;  5HR2 A;  2OE3 A;  1HNB A;  1X5D A;  1K3L A;  3TRP A;  4FYB A;  4NV2 A;  3KJY A;  1A8L A;  1YDK A;  3ERW A;  5IOW A;  2IJY A;  2HSY A;  3EMX A; 
#chains in the Genus database with same CATH topology
 5HFG A;  5DQS A;  4ML6 A;  1SVO A;  4JZQ A;  1XG8 A;  2LRT A;  4BWQ A;  4GRF A;  3IA1 A;  4RQX A;  1JZD A;  1QUW A;  3HCZ A;  1A2L A;  3IK9 A;  4BVX A;  1EOG A;  2B3S A;  2PPT A;  2VM1 A;  3ZIT A;  4MF5 A;  3R3E A;  2CT6 A;  4BL7 A;  2IWT A;  3QCP A;  4GDF A;  1NHO A;  1HNC A;  1GP1 A;  4MZW A;  2AJQ B;  4DSS A;  5DQY A;  5CRG A;  5KN1 A;  3H4K A;  2X8H A;  3F3R A;  4EL1 A;  3LJR A;  1BX9 A;  2X99 A;  3A2W A;  4AF2 A;  1X9S B;  1F9M A;  4BVX B;  2H70 A;  3WYW A;  4JU5 A;  4GQC A;  1IYI A;  3HKR A;  3E3E A;  3MYD A;  4QL9 A;  3TU3 B;  1HD2 A;  4KH7 A;  2FHE A;  5ECH B;  4G19 A;  1Y25 A;  3ZVJ A;  4Z2R A;  3EIN A;  2FY6 A;  4TR0 A;  3HVV A;  4ILF A;  2ZCT A;  3FKF A;  4ECB A;  3M1G A;  3D4T A;  2UZ8 A;  1OVN A;  1EV9 A;  3GL3 A;  5GSS A;  5L71 A;  4K6X A;  1FG4 A;  1TJD A;  4PNG A;  2E7P A;  4KND A;  3GV1 A;  2B5E A;  2B7J A;  1G7E A;  4CY6 A;  5F06 A;  2WCI A;  4NMU A;  4ECI A;  1Z7R A;  5CAX A;  5ECP B;  2F51 A;  3Q6O A;  5JWQ B;  5KOW A;  2YZU A;  2VM2 A;  2VO4 A;  4V1A p;  3TOT A;  2IMD A;  3IK7 A;  2V41 A;  2IL3 A;  3KH7 A;  1JHB A;  1XPV A;  2C80 A;  3G9B A;  1EGO A;  1ERW A;  3FZ4 A;  4L0W A;  3RAZ A;  4I6X A;  1Z5Y E;  4G0K A;  5ECQ B;  4MJE A;  4N30 A;  5ECI B;  3LFL A;  3PPU A;  1A24 A;  2N5B A;  4BA7 A;  5ECK B;  2IMI A;  2WRT A;  3L0H A;  3DWV A;  4NWY A;  6GSW A;  4WF5 A;  3VWU A;  4GXZ A;  1ZYP A;  4JR4 A;  2PER A;  1NW2 A;  5LCZ A;  2LNT A;  3MAK A;  4GWR A;  2C4J A;  4WEY A;  1GTA A;  3ZFL A;  2VKZ G;  1AXD A;  1QFN A;  4L0U A;  1GSE A;  2N5A A;  5EPF A;  2YCD A;  1M3I A;  3IOS A;  5F07 A;  2XPD A;  4KCE A;  2ES7 A;  2CVD A;  1PRX A;  3K8N A;  1YZX A;  2I9H A;  1GTB A;  4F2I A;  4BVY A;  8GSS A;  5IOX A;  3DIE A;  2X4A A;  1C72 A;  5GST A;  1B8X A;  4WXT A;  2JL4 A;  4QQ7 A;  1GH2 A;  2HFD A;  1M2D A;  3GMF A;  3O3T A;  1XWC A;  3QAG A;  1ML6 A;  5COH A;  3HMJ G;  4PI2 C;  1GUM A;  2HYX A;  3ED3 A;  1W89 A;  4Z2U A;  1LU4 A;  3VWX A;  3FK8 A;  5G5F A;  1QMV A;  3KMO A;  3MNG A;  5H5S A;  4GQF A;  3M0F A;  4BVY B;  1A0F A;  4XRD A;  5JCW A;  2DBC A;  3TB2 A;  1YQ1 A;  1FHE A;  2F8F A;  4E68 A;  1J9B A;  1W4V A;  1XIY A;  1T4Z A;  3MWH A;  4CDO A;  5A34 B;  2WW3 A;  5CRE A;  1YEP A;  1O8X A;  5CRD A;  3RPN A;  3IAM 2;  2GT6 A;  1TOF A;  3KD0 A;  4O92 A;  3M9J A;  1ERU A;  2A2S A;  4YKF A;  2ZUP A;  4HU9 A;  1TP9 A;  4PUA A;  2OAD A;  5BMU B;  1BG5 A;  1GWC A;  4PUF C;  4MH3 A;  3H93 A;  3APQ A;  5INY A;  4XHM A;  5F8B A;  1M2B A;  2WUL A;  2HSN B;  1T3B A;  3DYR A;  2H0H A;  2H30 A;  4TKY A;  3FZ5 A;  4AGS A;  1SU9 A;  2A4V A;  2DMM A;  4O32 A;  2WDU A;  2GS3 A;  2C3Q A;  4ULX A;  3VPT A;  1SKS B;  3PIN A;  5KN3 A;  2VCZ A;  4TXV A;  1PQN A;  4WR5 A;  3P2A A;  4E8E A;  4YQM A;  2JAD A;  3LSZ A;  1V2A A;  4LMW A;  2PBJ A;  4OWY A;  3M8N A;  1QQ2 A;  2OAC A;  2LNS A;  2YWN A;  4AKH A;  4KGI A;  2BTO T;  3KTB A;  1T7P B;  3ZZX A;  4EUY A;  2YJ7 A;  4J56 E;  3ZIV A;  2YZH A;  3TJK A;  1K0M A;  4JRR A;  3TKP A;  2HRN A;  2FNO A;  3CTF A;  2MBT A;  4ZL8 A;  2PN8 A;  2BMX A;  4DEJ A;  2DJ0 A;  3EWL A;  1LJR A;  5ENU A;  2VL2 C;  4IN0 A;  3A5W A;  2EFD A;  3GHA A;  2CA8 A;  3VI7 A;  5ECN B;  2VCX A;  1S3C A;  1GUK A;  3FR9 A;  1SEN A;  4HQZ A;  3TKQ A;  4OFM A;  1F3A A;  4ACS A;  5DAK A;  1FW1 A;  1XW9 A;  3HA9 A;  3F4S A;  3FZA A;  5ECM B;  4E8H A;  1WIK A;  2RLI A;  18GS A;  4HS1 A;  2C8U A;  4ML1 A;  2IN3 A;  4F9Z A;  5AIS A;  5J9B A;  3APS A;  4D73 A;  5B6N A;  4A5P A;  2XPE A;  4XS1 A;  4JED A;  1Z3E A;  4BPY A;  2H6Y A;  2DIY A;  3TRQ A;  3KCM A;  4HOJ A;  3FYG A;  2LV3 A;  1LBK A;  1U3I A;  3GX0 A;  3JCM L;  4YH2 A;  3H8Q A;  1XWG A;  2R2J A;  4IBP A;  5E59 A;  1XOB A;  5DAK B;  2DJ2 A;  3G7I A;  3GUS A;  1GSY A;  4N11 A;  3ZL5 A;  1V40 A;  4DSR A;  4V2L A;  2WZ9 A;  3DGQ A;  2YWI A;  3ERG A;  4GTU A;  1R5A A;  1GL8 A;  1TKD B;  4RQR A;  2YV9 A;  1THX A;  3GH6 A;  4ZL9 A;  4Q5N A;  4ZIJ A;  2NTO A;  4PHZ C;  1G0T A;  1TRW A;  3CHX C;  1TK0 B;  4Q5Q A;  3EE2 A;  2V2G A;  2L5O A;  2WZS A;  5C04 A;  3RDW A;  4PTS A;  4X4J A;  3GH9 A;  3ERF A;  11GS A;  4Q5F A;  2P31 A;  4F03 A;  3C73 A;  3LOR A;  3CWG A;  3N5O A;  4G9H A;  2O8V B;  2MYG A;  3MDK A;  1ABA A;  2L5L A;  3HZ4 A;  3DML A;  19GS A;  1THO A;  4K7O A;  5DCG A;  4XCS A;  3IAS 2;  4AJ6 A;  4G01 A;  3ZIJ A;  2NBS A;  1PMT A;  1TU8 A;  2MBS A;  5B6M A;  1DSB A;  1EP7 A;  3EYT A;  1X9W B;  1SYR A;  4OMV A;  4PXO A;  2O7K A;  3GKN A;  4EDY A;  2WGR A;  2KLX A;  2LRN A;  4I5Q A;  3QMX A;  1Z6N A;  1OE8 A;  1XVQ A;  5IPG A;  1PGT A;  3L9S A;  1F6M C;  3KM6 A;  1V98 A;  3CRU A;  1GLQ A;  2L59 A;  1R26 A;  4KCA A;  1SVL A;  3UAR A;  3ME8 A;  2D2Z A;  4P3Y B;  4FO5 A;  2C0D A;  2B7K A;  2J23 A;  1NM3 A;  2IIY A;  2YWM A;  4K5S A;  3DEX A;  4V2N A;  3GRX A;  3UJ1 A;  3P90 A;  1YKC A;  6GSY A;  3QPM A;  2TRX A;  2HSH A;  3ME7 A;  3PR8 A;  2OJL A;  3QFA C;  3QAV A;  1ZMA A;  3F4R A;  2VL9 A;  2IMK A;  1XZO A;  4XRA A;  5CP1 A;  2O3E A;  1AC1 A;  3CSH A;  1PL2 A;  4OO4 A;  2C3T A;  3FEU A;  2GVP A;  2CZ3 A;  3ISO A;  4PQ1 A;  1CQG A;  1SD8 A;  4IS0 A;  3TCO A;  4IHU A;  1V9W A;  1EZK A;  1K0A A;  3QAW A;  3IXR A;  4KDX A;  5AIV A;  3PGT A;  2FD3 A;  2KUC A;  1NHY A;  2FLS A;  3HJP A;  1XFL A;  5EL8 A;  2VLU A;  4W66 A;  1F37 A;  1XVW A;  4N10 A;  2NPB A;  2ON7 A;  5D8I A;  1GTI A;  5D9V A;  1BF5 A;  4L5O A;  2FUG 2;  5G5E A;  1TRU A;  2VOC A;  4ZBA A;  2WVZ A;  2H01 A;  5A5K A;  2TRC P;  1B4Q A;  2CAQ A;  4ID0 A;  1I1I P;  2K6V A;  3FRC A;  3SBC A;  4EC0 A;  4WKW A;  3AY8 A;  3TDG A;  1ACV A;  2NDO A;  9GSS A;  4OD7 A;  4KW6 A;  4AI6 A;  2GSR A;  2KOK A;  5ECS A;  2F3M A;  1K0D A;  5KOX A;  2H71 A;  1KBN A;  4MJA A;  2LKU A;  4YQU A;  4WBJ A;  1AQV A;  2GSQ A;  2V6O A;  1T8E B;  1ST9 A;  2CAI A;  12GS A;  4OFN A;  3KTL A;  10GS A;  2K9F A;  4MZB A;  3F63 A;  2G0F A;  5IIZ A;  1A23 A;  2M46 A;  1SJ6 A;  3BJ5 A;  2VCT A;  2LRC A;  4MF7 A;  2JSY A;  3E9J B;  1HYU A;  2VL2 A;  2B6M A;  3IRA A;  4NHZ A;  1GLP A;  3LWA A;  1BG1 A;  2KHP A;  1KNG A;  5CRH A;  1A8Y A;  2X8G A;  2M80 A;  4KE3 A;  1ZL9 A;  4MH2 A;  4NHW A;  4PNF A;  1ZOF A;  4PX1 A;  4RI6 A;  3HJM A;  5D9W A;  1ERT A;  1TTZ A;  1OE7 A;  3ZFB A;  4IGJ A;  1PSQ A;  4V2M A;  1I9D A;  4POK A;  3E0U A;  1FB0 A;  2TIR A;  1S3A A;  1TK8 B;  5G30 A;  3GA4 A;  2CV4 A;  2GQM A;  5LD0 A;  1TRV A;  3IE3 A;  5ECL B;  1I5G A;  5DCH A;  2GST A;  1XWA A;  5AN1 A;  2FWH A;  1SK0 A;  3L9V A;  2PWJ A;  5GAN D;  3EMP A;  2GZY A;  3ZLP A;  5D73 A;  3WD6 A;  1AUC A;  2O89 A;  4MDC A;  1J0F A;  4EKZ A;  5G2Z A;  2PU9 C;  1PD2 1;  3VUR A;  3D6I A;  3UEM A;  3L4N A;  1U87 A;  1B48 A;  4O5R A;  3IDV A;  4XS6 A;  5A4W A;  2YJH A;  3GKK A;  1CQH A;  1OAZ A;  4XTS A;  4HSC X;  2DKI A;  4GST A;  2GT5 A;  5DBQ A;  4HDE A;  4KA0 A;  4TOP A;  4K2D A;  2LJR A;  3TKS E;  5A34 A;  4I2U A;  3F4T A;  5BRT A;  2HSM A;  2FA8 A;  2JSZ A;  3DXB A;  2VL3 A;  4NPB A;  4WR4 A;  1TDI A;  1M9A A;  4FYU A;  5BMU A;  4HUA A;  4FXY P;  4IVF A;  3GN3 A;  5CNW A;  3KP8 A;  4WF4 A;  2XHF A;  3ZYW A;  2HI7 A;  3BCK A;  3HVX A;  1GSD A;  5A1N B;  4RI7 A;  3FR6 A;  2HSN A;  2AYT A;  6GST A;  2P0G A;  3EU4 A;  4IP1 A;  3EPT A;  3D5J A;  4L5L A;  2JZT A;  5IMA A;  2OT3 A;  1MD3 A;  1ZYQ B;  3UBL A;  3TJG A;  2HSM B;  3H79 A;  2IMF A;  4ZBD A;  16GS A;  3LYP A;  4KX4 A;  4FH8 A;  3C7M A;  4HZ2 A;  3BCI A;  1VF2 A;  3F6F A;  3QFB C;  2VCW A;  1EWX A;  5H5R A;  1YF0 A;  3FY7 A;  4EXJ A;  2HQT A;  3KH9 A;  2X49 A;  3TUE A;  2VLT A;  5AIX A;  3RGB C;  1MEK A;  3OR5 A;  2DJK A;  4MK3 A;  4XIH A;  3CQF A;  4HEA 2;  4KB3 A;  5ID2 A;  1F2E A;  2C0G A;  5IQY A;  3D4M A;  3GSS A;  1SJI A;  1SK1 A;  3A2X A;  5ELA A;  4TR1 A;  1JZW A;  1XCC A;  6GSV A;  2DSA A;  1TXU A;  2EIO A;  3GNJ A;  4TRX A;  3HVS A;  5A5H A;  3O76 A;  5G1L A;  4WET A;  5ABR A;  1V58 A;  1UC7 A;  2DIZ A;  2LUS A;  2GGT A;  1GUH A;  1DUG A;  5ID2 B;  4YAV A;  4ISD A;  4RUV A;  4TR1 B;  5ECR B;  1USB A;  4CW9 A;  2WW1 A;  3RFR C;  3KXO A;  1UN2 A;  5F0G A;  1X5E A;  5A5H B;  4TW5 A;  1BAY A;  2C3N A;  1A2J A;  3I9V 2;  3C71 A;  2I81 A;  5DAL B;  1E6B A;  2P5Q A;  1DE2 A;  2O5V A;  5IO2 A;  1GUL A;  3M3M A;  3HYP A;  2B5Y A;  5HR1 A;  2MMN A;  4OCE A;  1FVK A;  2L6C A;  2RII A;  2EC4 A;  5J4V A;  5G1K A;  5IMD A;  4PQH A;  1QK8 A;  4CY8 A;  4FQU A;  3LW9 A;  1O73 A;  4Z7X A;  3W8J A;  5JWO B;  1GNW A;  3G7J A;  1U3A A;  2KP2 A;  5D93 A;  1PFO A;  3U5R E;  5IMV A;  2VD1 A;  2YOI A;  5HR0 A;  1X5C A;  2ALB A;  2VUP A;  4PI0 C;  3F0I A;  2R3X A;  4KSO A;  1MTC A;  3EVI A;  1BJX A;  1TU7 A;  5KN2 A;  3UL3 A;  1R5P A;  3M9K A;  3DRN A;  5CRW A;  4MJB A;  3MSZ A;  1K0B A;  2FCH A;  3FR3 A;  1OKT A;  3FMW A;  5CO3 A;  2JZR A;  2QKE A;  2UV8 G;  1QXH A;  2H74 A;  2QGV A;  3HD5 A;  3I43 A;  4CHS A;  1WRY A;  2H75 A;  2HRK A;  3CBU A;  3TKS C;  2RUF A;  4DSQ A;  1RQM A;  5AGY A;  3IBH A;  3NIV A;  2FWG A;  2HNL A;  4IKH A;  5D9X A;  3HY2 A;  4HJ2 A;  2FGX A;  4EVM A;  1XXU A;  1HNA A;  4IW9 A;  2H1D A;  1BED A;  1WOU A;  2H0I A;  6GSU A;  2VCV A;  4ZB8 A;  2K8S A;  3DKS A;  4I2T A;  3D0Z A;  2GQK A;  2GDR A;  1RW1 A;  4EIP A;  3VWV A;  4Q5R A;  4USS A;  1F3B A;  5EY6 A;  5C00 A;  5HQP A;  2HRK B;  2DJ1 A;  2R4V A;  5EVO A;  4LL4 B;  2OA7 A;  2MZC A;  5HR3 A;  20GS A;  5DDL A;  3KP9 A;  1GSQ A;  1VF1 A;  5J41 A;  3ZMK A;  1XWB A;  3UAP A;  4K9Z A;  2V6K A;  2YP6 A;  4XS4 A;  2H1A A;  4PUR A;  3UIW A;  1X0R A;  3BD2 A;  5H5Q A;  1Z6M A;  3EU3 A;  3KMN A;  1M3J A;  5J5N A;  1V57 A;  2H8L A;  1Y1U A;  3SWL A;  22GS A;  1H75 A;  2N5F A;  4TXO A;  2AUV A;  2X8C A;  3VWW A;  1M7T A;  2H76 A;  2EFE A;  2LQQ A;  5ECO B;  1BQ7 A;  2V32 A;  5FT3 A;  5B8A A;  4KSM A;  3NOF A;  4MZC A;  4XS4 B;  2C0F A;  2YWO A;  5J9C A;  4IQA A;  3A2V A;  3HJO A;  1PX6 A;  3CRT A;  1PA3 A;  2H73 A;  13GS A;  3P8W A;  4PGT A;  4GSN A;  4POB A;  2LST A;  3QD9 A;  2LQO A;  1M0U A;  5J4U A;  4ECC A;  3CSJ A;  1PX7 A;  4KUN A;  4TXO B;  2GZZ A;  2HT9 A;  1B4P A;  3GX8 A;  3C8E A;  4MMM A;  3IHQ A;  2NVL A;  2Z9S A;  1MDK A;  2RM5 A;  4FYC A;  2C0E A;  2R0C A;  3Q19 A;  2VCQ A;  3ZVJ D;  1S3R A;  4ZIL A;  2WFC A;  4EE0 A;  3GST A;  5A4U A;  3US3 A;  1MD4 A;  3LGC A;  4G0I A;  2R0P A;  4K1F A;  2F9S A;  2RUE A;  2QA1 A;  4MA9 A;  7GSS A;  1O85 A;  2R37 A;  4DVC A;  3GUR A;  1M9B A;  2CVK A;  5B8B A;  4NAX A;  1EOH A;  3D21 A;  1TXX A;  3A3T A;  1U88 A;  2K18 A;  1Q98 A;  5B7C A;  1R7H A;  1K0N A;  5KEJ A;  3KZQ A;  5A4V A;  1VRS D;  1SJZ A;  1K3O A;  3C1R A;  4I97 A;  4N3Z A;  4G10 A;  5E4W A;  1N25 A;  3EC3 A;  3L78 A;  1B9Y C;  1KTE A;  1GNE A;  2GSS A;  2WW2 A;  2R6K A;  1FOH A;  1PKZ A;  2WVX A;  1YEX A;  2PUK C;  2WS2 A;  4ZXG A;  2AB6 A;  3TJF A;  5DVB A;  5D9T A;  3F3Q A;  3HDC A;  2XBI A;  1U6T A;  2HZE A;  2C1Y A;  2V1M A;  3HHV A;  3UMA A;  4JR6 A;  1ERV A;  4Z2T A;  2IPA A;  1O6J A;  1GSF A;  5HFI A;  2VLV A;  3HXS A;  4I8B A;  4ZL7 A;  1EV4 A;  2FA4 A;  1E2Y A;  1K0C A;  2WVX B;  4N0V A;  5JWR B;  2B1K A;  1S3D A;  4NV5 A;  3TGZ A;  4JE1 A;  2I4A A;  2E0Q A;  4BL7 B;  4IP6 A;  2DLX A;  2HZE B;  3UVT A;  1YVL A;  2ZNM A;  1AAZ A;  3QOU A;  4MNN A;  5FWG A;  1B9X C;  3C1S A;  1ILO A;  4DSS B;  2YN1 A;  2K8V A;  2A2R A;  2DML A;  4IJI A;  2AHE A;  3KGK A;  4FIW A;  3TKR A;  2R0G A;  4BWS A;  2L4Q A;  3WGX A;  3GL5 A;  3TJB A;  2BJX A;  1G7O A;  2OBI A;  1N8J A;  1GSS A;  4IJ3 A;  4X43 A;  3UOM A;  4TVE A;  1SL1 B;  1Y6E A;  5JCU A;  2EFC A;  1T1V A;  4WBR D;  3A5I A;  4HZ4 A;  3HZ8 A;  5J3R A;  6GSS A;  5HFK A;  3VFI A;  4X0X A;  1FO5 A;  3I6A A;  1YF1 A;  2H6Z A;  14GS A;  1RK4 A;  3HVN A;  1FVJ A;  5JCG A;  4EDZ A;  1SYX A;  3KEB A;  3FHK A;  4TR3 A;  1MDI A;  2M72 A;  1M2A A;  1DBY A;  4K0N A;  2CQ9 A;  4K0G A;  5IMZ A;  2FWE A;  1AQX A;  1OC3 A;  1EP8 A;  1KEB A;  1TW9 A;  2VD0 A;  1G6W A;  4OO5 A;  3J7Y k;  4QL7 A;  3CYN A;  4IEL A;  4MF6 A;  3ZRD A;  4O7H A;  5GZZ B;  2L4C A;  4KDU A;  1ZZY A;  5DJM A;  2CVB A;  2A2P A;  2O85 A;  1JLV A;  1ZGN A;  3BOA A;  4HU7 A;  3MIX A;  3TKS A;  2LEG A;  17GS A;  3VPQ A;  3GYK A;  1QGV A;  3TOU A;  5KN0 A;  5A1N A;  5IMF A;  1NSW A;  3RPP A;  3O6T A;  4MAB A;  1AIU A;  2IME A;  3NZN A;  2GZP A;  4KAE A;  2AV4 A;  3WGE A;  4MPF A;  2YPM A;  3G7Y A;  2LTK A;  2AAW A;  4J2F A;  4ZB7 A;  1X9M B;  1JFU A;  1A0R P;  3TJJ A;  4MPG A;  2G2Q A;  3VLN A;  2WVY A;  4ZB6 A;  1OC9 A;  3W6G A;  4F0C A;  3P7X A;  4HI7 A;  1WJK A;  1WMJ A;  2X64 A;  1R4W A;  1EGR A;  1YY7 A;  3DVW A;  4QMK A;  3BBY A;  3GIX A;  4ICY A;  1ZYE A;  1Z7P A;  2HZF A;  1XW6 A;  1M99 A;  2O36 A;  3GTU A;  1TK5 B;  1ZCP A;  1G6Y A;  1MDJ A;  1HQO A;  3IR4 A;  5IMC A;  2PVO C;  4MP4 A;  4LLR A;  3IC8 A;  4OCF A;  2HLS A;  1TI1 A;  1YJ6 A;  4L8E A;  2OKA A;  1OYJ A;  5LNK e;  1OC9 B;  4J57 E;  4AKI A;  1PN9 A;  2H1L A;  1SKR B;  1IYH A;  3CSI A;  2RM6 A;  3GKX A;  3GTU B;  4EF0 A;  4MJC A;  2H19 A;  3H1N A;  1Q4J A;  1TRS A;  2CX4 A;  1BYE A;  1FB6 A;  1DE1 A;  2PVQ A;  2DC5 A;  2IFQ A;  2EIR A;  2XBQ A;  4YQV A;  4OFT A;  5IPH A;  3IC4 A;  5J4Y A;  3VK9 A;  1XW5 A;  4LL1 B;  6GSX A;  4LMV A;  5DAL A;  2REM A;  2EIQ A;  2HRA A;  3VI5 A;  4K5R A;  2MMZ A;  3F9U A;  4O5Q A;  3WT1 A;  1WE0 A;  1O8W A;  3R2Q A;  1VF3 A;  4GF0 A;  1T00 A;  1VGL A;  2J9H A;  3CTG A;  2IFQ B;  1UA5 A;  2MMO A;  4MCU A;  3S9F A;  3LEF A;  2WB9 A;  3CXG A;  3LXZ A;  1ZYN A;  2E2M A;  1O7U A;  2VIM A;  5FHI A;  3F8U A;  4ZBB A;  2JZS A;  4NXI A;  2P5R A;  4V1A g;  1WP0 A;  2MMA A;  3UVH A;  1SVM A;  4KDY A;  2HE3 A;  1PN0 A;  1YKA A;  2PMT A;  1JLW A;  2GTU A;  1SKW B;  3LG6 A;  3TRX A;  2DJ3 A;  4K7N A;  1SL2 B;  4EIQ A;  5G31 A;  2OE1 A;  3APO A;  4G0L A;  3PH9 A;  4POL A;  1WPI A;  4AKG A;  4KF9 A;  4O5U A;  4TR4 A;  4X1U A;  3DD3 A;  2KP1 A;  3QR6 A;  1A2M A;  4ZB9 A;  1JZO A;  2H66 A;  1PL1 A;  2L6D A;  3FZ9 A;  3FW2 A;  3RHB A;  3U6V A;  1K3Y A;  4HJM A;  2HRF A;  4BIK A;  3IHG A;  4AJ7 A;  1TI3 A;  2YAN A;  1PKW A;  1FAA A;  1XOA A;  2QSI A;  2L57 A;  4POM A;  1FOV A;  1AW9 A;  3F6D A;  5D96 A;  2B1L A;  3V1W A;  4K7I A;  3GKM A;  1XBS A;  3KIJ A;  1AQW A;  1GTU A;  5DJL A;  3QDN A;  1O81 A;  2E2G A;  3L9U A;  2OE0 A;  1H4O A;  3ZTL A;  4AKX B;  2I3Y A;  2H0G A;  2B5X A;  4JBB A;  1YEW C;  4D73 B;  4MLY A;  4AJ8 A;  3W8S A;  2H72 A;  3UBK A;  4HQS A;  3GFK A;  4YAP A;  3ZRE A;  2HXK A;  2YV7 A;  2YNX A;  1OKD A;  1SK2 A;  3ZML A;  1ON4 A;  5ELG A;  3LYK A;  4ECJ A;  2JAC A;  4YKG A;  2JU5 A;  2XC2 A;  5GAP D;  2I1U A;  3I69 A;  4K2X A;  4GSS A;  2ON5 A;  1OC8 A;  1J08 A;  2OBK A;  5CYY A;  2DKH A;  4IQ1 A;  2LJK A;  4H86 A;  1EEM A;  1K0O A;  2CZ2 A;  2F8A A;  1N2A A;  2H1G A;  1Z9H A;  1GSU A;  2EFH A;  3RBT A;  2FWF A;  3WT2 A;  3WGD A;  2GLR A;  4G2E A;  2LS5 A;  1XWK A;  4F0B A;  2O87 A;  4GCI A;  2WJU A;  3Q74 A;  4PQI A;  2QC7 A;  2CX3 A;  4LA1 A;  2DJJ A;  5J40 A;  1URM A;  1VF4 A;  2GQL A;  4F82 A;  2VAF A;  1EEJ A;  3CMI A;  1UVZ A;  4GLT A;  1WWJ A;  3IPZ A;  4TN8 A;  3EUR A;  1GRX A;  2PGT A;  3DVX A;  3LQ7 A;  3N9J A;  3J7Y b;  3D22 A;  3LXT A;  2QA2 A;  3IV4 A;  2LJA A;  5F05 A;  2H1B A;  2R5G A;  4EO3 A;  1JZR A;  2H6X A;  3Q18 A;  4K8M A;  2A4H A;  5IO0 A;  1T4Y A;  1SL0 B;  4N0Z A;  3RHC A;  5IM9 A;  1SD9 A;  5HR2 A;  2OE3 A;  1HNB A;  1X5D A;  5J47 A;  1K3L A;  3TRP A;  4FYB A;  4NV2 A;  3KJY A;  1A8L A;  2WW0 A;  1S4B P;  1YDK A;  3ERW A;  5IOW A;  2IJY A;  2HSY A;  3EMX A; 
#chains in the Genus database with same CATH homology
 5HFG A;  5DQS A;  4ML6 A;  1SVO A;  4JZQ A;  2LRT A;  4BWQ A;  4GRF A;  3IA1 A;  4RQX A;  1JZD A;  1QUW A;  3HCZ A;  1A2L A;  3IK9 A;  4BVX A;  1EOG A;  2B3S A;  2PPT A;  2VM1 A;  3ZIT A;  4MF5 A;  3R3E A;  2CT6 A;  4BL7 A;  2IWT A;  3QCP A;  4GDF A;  1NHO A;  1HNC A;  1GP1 A;  4MZW A;  2AJQ B;  4DSS A;  5DQY A;  5CRG A;  5KN1 A;  3H4K A;  2X8H A;  3F3R A;  4EL1 A;  3LJR A;  1BX9 A;  2X99 A;  3A2W A;  4AF2 A;  1X9S B;  1F9M A;  4BVX B;  2H70 A;  3WYW A;  4JU5 A;  4GQC A;  1IYI A;  3HKR A;  3E3E A;  3MYD A;  4QL9 A;  3TU3 B;  1HD2 A;  4KH7 A;  2FHE A;  5ECH B;  4G19 A;  1Y25 A;  3ZVJ A;  4Z2R A;  3EIN A;  2FY6 A;  4TR0 A;  3HVV A;  4ILF A;  2ZCT A;  3FKF A;  4ECB A;  3M1G A;  3D4T A;  2UZ8 A;  1OVN A;  1EV9 A;  3GL3 A;  5GSS A;  5L71 A;  4K6X A;  1FG4 A;  1TJD A;  4PNG A;  2E7P A;  4KND A;  3GV1 A;  2B5E A;  2B7J A;  1G7E A;  4CY6 A;  5F06 A;  2WCI A;  4NMU A;  4ECI A;  1Z7R A;  5CAX A;  5ECP B;  2F51 A;  3Q6O A;  5JWQ B;  5KOW A;  2YZU A;  2VM2 A;  2VO4 A;  4V1A p;  3TOT A;  2IMD A;  3IK7 A;  2V41 A;  2IL3 A;  3KH7 A;  1JHB A;  1XPV A;  2C80 A;  3G9B A;  1EGO A;  1ERW A;  3FZ4 A;  4L0W A;  3RAZ A;  4I6X A;  1Z5Y E;  4G0K A;  5ECQ B;  4MJE A;  4N30 A;  5ECI B;  3LFL A;  3PPU A;  1A24 A;  2N5B A;  4BA7 A;  5ECK B;  2IMI A;  2WRT A;  3L0H A;  3DWV A;  4NWY A;  6GSW A;  4WF5 A;  3VWU A;  4GXZ A;  1ZYP A;  4JR4 A;  2PER A;  1NW2 A;  5LCZ A;  2LNT A;  3MAK A;  4GWR A;  2C4J A;  4WEY A;  1GTA A;  3ZFL A;  2VKZ G;  1AXD A;  1QFN A;  4L0U A;  1GSE A;  2N5A A;  5EPF A;  2YCD A;  3IOS A;  5F07 A;  2XPD A;  4KCE A;  2ES7 A;  2CVD A;  1PRX A;  3K8N A;  1YZX A;  2I9H A;  1GTB A;  4F2I A;  4BVY A;  8GSS A;  5IOX A;  3DIE A;  2X4A A;  1C72 A;  5GST A;  1B8X A;  4WXT A;  2JL4 A;  4QQ7 A;  1GH2 A;  2HFD A;  1M2D A;  3GMF A;  3O3T A;  1XWC A;  3QAG A;  1ML6 A;  5COH A;  3HMJ G;  1GUM A;  2HYX A;  3ED3 A;  1W89 A;  4Z2U A;  1LU4 A;  3VWX A;  3FK8 A;  5G5F A;  1QMV A;  3KMO A;  3MNG A;  5H5S A;  4GQF A;  3M0F A;  4BVY B;  1A0F A;  4XRD A;  5JCW A;  2DBC A;  3TB2 A;  1YQ1 A;  1FHE A;  2F8F A;  4E68 A;  1J9B A;  1W4V A;  1XIY A;  1T4Z A;  3MWH A;  4CDO A;  5A34 B;  5CRE A;  1YEP A;  1O8X A;  5CRD A;  3RPN A;  3IAM 2;  2GT6 A;  1TOF A;  3KD0 A;  4O92 A;  3M9J A;  1ERU A;  2A2S A;  4YKF A;  2ZUP A;  4HU9 A;  1TP9 A;  4PUA A;  2OAD A;  5BMU B;  1BG5 A;  1GWC A;  4PUF C;  4MH3 A;  3H93 A;  3APQ A;  5INY A;  4XHM A;  5F8B A;  1M2B A;  2WUL A;  2HSN B;  1T3B A;  3DYR A;  2H0H A;  2H30 A;  4TKY A;  3FZ5 A;  4AGS A;  1SU9 A;  2A4V A;  2DMM A;  4O32 A;  2WDU A;  2GS3 A;  2C3Q A;  4ULX A;  3VPT A;  1SKS B;  3PIN A;  5KN3 A;  2VCZ A;  4TXV A;  1PQN A;  4WR5 A;  3P2A A;  4E8E A;  4YQM A;  2JAD A;  3LSZ A;  1V2A A;  4LMW A;  2PBJ A;  4OWY A;  3M8N A;  1QQ2 A;  2OAC A;  2LNS A;  2YWN A;  4AKH A;  4KGI A;  2BTO T;  3KTB A;  1T7P B;  3ZZX A;  4EUY A;  2YJ7 A;  4J56 E;  3ZIV A;  2YZH A;  3TJK A;  1K0M A;  4JRR A;  3TKP A;  2HRN A;  2FNO A;  3CTF A;  2MBT A;  4ZL8 A;  2PN8 A;  2BMX A;  4DEJ A;  2DJ0 A;  3EWL A;  1LJR A;  5ENU A;  2VL2 C;  4IN0 A;  3A5W A;  2EFD A;  3GHA A;  2CA8 A;  3VI7 A;  5ECN B;  2VCX A;  1S3C A;  1GUK A;  3FR9 A;  1SEN A;  4HQZ A;  3TKQ A;  4OFM A;  1F3A A;  4ACS A;  5DAK A;  1FW1 A;  1XW9 A;  3HA9 A;  3F4S A;  3FZA A;  5ECM B;  4E8H A;  1WIK A;  2RLI A;  18GS A;  4HS1 A;  2C8U A;  4ML1 A;  2IN3 A;  4F9Z A;  5AIS A;  5J9B A;  3APS A;  4D73 A;  5B6N A;  4A5P A;  2XPE A;  4XS1 A;  4JED A;  1Z3E A;  4BPY A;  2H6Y A;  2DIY A;  3TRQ A;  3KCM A;  4HOJ A;  3FYG A;  2LV3 A;  1LBK A;  1U3I A;  3GX0 A;  3JCM L;  4YH2 A;  3H8Q A;  1XWG A;  2R2J A;  4IBP A;  5E59 A;  1XOB A;  5DAK B;  2DJ2 A;  3G7I A;  3GUS A;  1GSY A;  4N11 A;  3ZL5 A;  1V40 A;  4DSR A;  4V2L A;  2WZ9 A;  3DGQ A;  2YWI A;  3ERG A;  4GTU A;  1R5A A;  1GL8 A;  1TKD B;  4RQR A;  2YV9 A;  1THX A;  3GH6 A;  4ZL9 A;  4Q5N A;  4ZIJ A;  2NTO A;  1G0T A;  1TRW A;  1TK0 B;  4Q5Q A;  3EE2 A;  2V2G A;  2L5O A;  5C04 A;  3RDW A;  4PTS A;  4X4J A;  3GH9 A;  3ERF A;  11GS A;  4Q5F A;  2P31 A;  4F03 A;  3C73 A;  3LOR A;  3CWG A;  3N5O A;  4G9H A;  2O8V B;  2MYG A;  3MDK A;  1ABA A;  2L5L A;  3HZ4 A;  3DML A;  19GS A;  1THO A;  4K7O A;  5DCG A;  4XCS A;  3IAS 2;  4AJ6 A;  4G01 A;  3ZIJ A;  2NBS A;  1PMT A;  1TU8 A;  2MBS A;  5B6M A;  1DSB A;  1EP7 A;  3EYT A;  1X9W B;  1SYR A;  4OMV A;  4PXO A;  2O7K A;  3GKN A;  4EDY A;  2WGR A;  2KLX A;  2LRN A;  4I5Q A;  3QMX A;  1Z6N A;  1OE8 A;  1XVQ A;  5IPG A;  1PGT A;  3L9S A;  1F6M C;  3KM6 A;  1V98 A;  3CRU A;  1GLQ A;  2L59 A;  1R26 A;  4KCA A;  1SVL A;  3UAR A;  3ME8 A;  2D2Z A;  4P3Y B;  4FO5 A;  2C0D A;  2B7K A;  2J23 A;  1NM3 A;  2IIY A;  2YWM A;  4K5S A;  3DEX A;  4V2N A;  3GRX A;  3UJ1 A;  3P90 A;  1YKC A;  6GSY A;  3QPM A;  2TRX A;  2HSH A;  3ME7 A;  3PR8 A;  2OJL A;  3QFA C;  3QAV A;  1ZMA A;  3F4R A;  2VL9 A;  2IMK A;  1XZO A;  4XRA A;  5CP1 A;  1AC1 A;  3CSH A;  1PL2 A;  4OO4 A;  2C3T A;  3FEU A;  2GVP A;  2CZ3 A;  3ISO A;  4PQ1 A;  1CQG A;  1SD8 A;  4IS0 A;  3TCO A;  4IHU A;  1V9W A;  1EZK A;  1K0A A;  3QAW A;  3IXR A;  4KDX A;  5AIV A;  3PGT A;  2FD3 A;  2KUC A;  1NHY A;  2FLS A;  3HJP A;  1XFL A;  5EL8 A;  2VLU A;  4W66 A;  1F37 A;  1XVW A;  4N10 A;  2NPB A;  2ON7 A;  5D8I A;  1GTI A;  5D9V A;  1BF5 A;  4L5O A;  2FUG 2;  5G5E A;  1TRU A;  2VOC A;  4ZBA A;  2H01 A;  5A5K A;  2TRC P;  1B4Q A;  2CAQ A;  4ID0 A;  2K6V A;  3FRC A;  3SBC A;  4EC0 A;  4WKW A;  3AY8 A;  3TDG A;  1ACV A;  2NDO A;  9GSS A;  4OD7 A;  4KW6 A;  4AI6 A;  2GSR A;  2KOK A;  5ECS A;  2F3M A;  1K0D A;  5KOX A;  2H71 A;  1KBN A;  4MJA A;  2LKU A;  4YQU A;  4WBJ A;  1AQV A;  2GSQ A;  2V6O A;  1T8E B;  1ST9 A;  2CAI A;  12GS A;  4OFN A;  3KTL A;  10GS A;  2K9F A;  4MZB A;  3F63 A;  2G0F A;  5IIZ A;  1A23 A;  2M46 A;  1SJ6 A;  3BJ5 A;  2VCT A;  2LRC A;  4MF7 A;  2JSY A;  3E9J B;  1HYU A;  2VL2 A;  2B6M A;  3IRA A;  4NHZ A;  1GLP A;  3LWA A;  1BG1 A;  2KHP A;  1KNG A;  5CRH A;  1A8Y A;  2X8G A;  2M80 A;  4KE3 A;  1ZL9 A;  4MH2 A;  4NHW A;  4PNF A;  1ZOF A;  4PX1 A;  4RI6 A;  3HJM A;  5D9W A;  1ERT A;  1TTZ A;  1OE7 A;  3ZFB A;  4IGJ A;  1PSQ A;  4V2M A;  1I9D A;  4POK A;  3E0U A;  1FB0 A;  2TIR A;  1S3A A;  1TK8 B;  5G30 A;  3GA4 A;  2CV4 A;  2GQM A;  5LD0 A;  1TRV A;  3IE3 A;  5ECL B;  1I5G A;  5DCH A;  2GST A;  1XWA A;  5AN1 A;  2FWH A;  1SK0 A;  3L9V A;  2PWJ A;  5GAN D;  3EMP A;  2GZY A;  3ZLP A;  5D73 A;  3WD6 A;  1AUC A;  2O89 A;  4MDC A;  1J0F A;  4EKZ A;  5G2Z A;  2PU9 C;  1PD2 1;  3VUR A;  3D6I A;  3UEM A;  3L4N A;  1U87 A;  1B48 A;  4O5R A;  3IDV A;  4XS6 A;  5A4W A;  2YJH A;  3GKK A;  1CQH A;  1OAZ A;  4XTS A;  2DKI A;  4GST A;  2GT5 A;  5DBQ A;  4HDE A;  4KA0 A;  4TOP A;  4K2D A;  2LJR A;  3TKS E;  5A34 A;  4I2U A;  3F4T A;  5BRT A;  2HSM A;  2FA8 A;  2JSZ A;  3DXB A;  2VL3 A;  4NPB A;  4WR4 A;  1TDI A;  1M9A A;  4FYU A;  5BMU A;  4HUA A;  4IVF A;  3GN3 A;  5CNW A;  3KP8 A;  4WF4 A;  2XHF A;  3ZYW A;  2HI7 A;  3BCK A;  3HVX A;  1GSD A;  5A1N B;  4RI7 A;  3FR6 A;  2HSN A;  2AYT A;  6GST A;  2P0G A;  3EU4 A;  4IP1 A;  3EPT A;  3D5J A;  4L5L A;  2JZT A;  5IMA A;  2OT3 A;  1MD3 A;  1ZYQ B;  3UBL A;  3TJG A;  2HSM B;  3H79 A;  2IMF A;  4ZBD A;  16GS A;  3LYP A;  4KX4 A;  4FH8 A;  3C7M A;  4HZ2 A;  3BCI A;  1VF2 A;  3F6F A;  3QFB C;  2VCW A;  1EWX A;  5H5R A;  1YF0 A;  3FY7 A;  4EXJ A;  2HQT A;  3KH9 A;  2X49 A;  3TUE A;  2VLT A;  5AIX A;  1MEK A;  3OR5 A;  2DJK A;  4MK3 A;  4XIH A;  4HEA 2;  4KB3 A;  5ID2 A;  1F2E A;  2C0G A;  5IQY A;  3D4M A;  3GSS A;  1SJI A;  1SK1 A;  3A2X A;  5ELA A;  4TR1 A;  1JZW A;  1XCC A;  6GSV A;  2DSA A;  1TXU A;  2EIO A;  3GNJ A;  4TRX A;  3HVS A;  5A5H A;  3O76 A;  5G1L A;  4WET A;  5ABR A;  1V58 A;  1UC7 A;  2DIZ A;  2LUS A;  2GGT A;  1GUH A;  1DUG A;  5ID2 B;  4YAV A;  4ISD A;  4RUV A;  4TR1 B;  5ECR B;  1USB A;  4CW9 A;  3KXO A;  1UN2 A;  5F0G A;  1X5E A;  5A5H B;  4TW5 A;  1BAY A;  2C3N A;  1A2J A;  3I9V 2;  3C71 A;  2I81 A;  5DAL B;  1E6B A;  2P5Q A;  1DE2 A;  2O5V A;  5IO2 A;  1GUL A;  3M3M A;  3HYP A;  2B5Y A;  5HR1 A;  2MMN A;  4OCE A;  1FVK A;  2L6C A;  2RII A;  2EC4 A;  5J4V A;  5G1K A;  5IMD A;  4PQH A;  1QK8 A;  4CY8 A;  4FQU A;  3LW9 A;  1O73 A;  4Z7X A;  3W8J A;  5JWO B;  1GNW A;  3G7J A;  1U3A A;  2KP2 A;  5D93 A;  3U5R E;  5IMV A;  2VD1 A;  2YOI A;  5HR0 A;  1X5C A;  2ALB A;  2VUP A;  3F0I A;  2R3X A;  4KSO A;  1MTC A;  3EVI A;  1BJX A;  1TU7 A;  5KN2 A;  3UL3 A;  1R5P A;  3M9K A;  3DRN A;  5CRW A;  4MJB A;  3MSZ A;  1K0B A;  2FCH A;  3FR3 A;  1OKT A;  3FMW A;  5CO3 A;  2JZR A;  2QKE A;  2UV8 G;  1QXH A;  2H74 A;  2QGV A;  3HD5 A;  3I43 A;  4CHS A;  1WRY A;  2H75 A;  2HRK A;  3CBU A;  3TKS C;  2RUF A;  4DSQ A;  1RQM A;  5AGY A;  3IBH A;  3NIV A;  2FWG A;  2HNL A;  4IKH A;  5D9X A;  3HY2 A;  4HJ2 A;  2FGX A;  4EVM A;  1XXU A;  1HNA A;  4IW9 A;  2H1D A;  1BED A;  1WOU A;  2H0I A;  6GSU A;  2VCV A;  4ZB8 A;  2K8S A;  3DKS A;  4I2T A;  3D0Z A;  2GQK A;  2GDR A;  1RW1 A;  4EIP A;  3VWV A;  4Q5R A;  4USS A;  1F3B A;  5EY6 A;  5C00 A;  5HQP A;  2HRK B;  2DJ1 A;  2R4V A;  5EVO A;  4LL4 B;  2OA7 A;  2MZC A;  5HR3 A;  20GS A;  5DDL A;  3KP9 A;  1GSQ A;  1VF1 A;  5J41 A;  3ZMK A;  1XWB A;  3UAP A;  4K9Z A;  2V6K A;  2YP6 A;  4XS4 A;  2H1A A;  4PUR A;  3UIW A;  1X0R A;  3BD2 A;  5H5Q A;  1Z6M A;  3EU3 A;  3KMN A;  5J5N A;  1V57 A;  2H8L A;  1Y1U A;  3SWL A;  22GS A;  1H75 A;  2N5F A;  4TXO A;  2AUV A;  2X8C A;  3VWW A;  1M7T A;  2H76 A;  2EFE A;  2LQQ A;  5ECO B;  1BQ7 A;  2V32 A;  5FT3 A;  5B8A A;  4KSM A;  3NOF A;  4MZC A;  4XS4 B;  2C0F A;  2YWO A;  5J9C A;  4IQA A;  3A2V A;  3HJO A;  1PX6 A;  3CRT A;  1PA3 A;  2H73 A;  13GS A;  3P8W A;  4PGT A;  4GSN A;  4POB A;  2LST A;  3QD9 A;  2LQO A;  1M0U A;  5J4U A;  4ECC A;  3CSJ A;  1PX7 A;  4KUN A;  4TXO B;  2GZZ A;  2HT9 A;  1B4P A;  3GX8 A;  3C8E A;  4MMM A;  3IHQ A;  2NVL A;  2Z9S A;  1MDK A;  2RM5 A;  4FYC A;  2C0E A;  2R0C A;  3Q19 A;  2VCQ A;  3ZVJ D;  4ZIL A;  2WFC A;  4EE0 A;  3GST A;  5A4U A;  3US3 A;  1MD4 A;  3LGC A;  4G0I A;  2R0P A;  4K1F A;  2F9S A;  2RUE A;  2QA1 A;  4MA9 A;  7GSS A;  1O85 A;  2R37 A;  4DVC A;  3GUR A;  1M9B A;  2CVK A;  5B8B A;  4NAX A;  1EOH A;  3D21 A;  1TXX A;  3A3T A;  1U88 A;  2K18 A;  1Q98 A;  5B7C A;  1R7H A;  1K0N A;  5KEJ A;  3KZQ A;  5A4V A;  1VRS D;  1SJZ A;  1K3O A;  3C1R A;  4I97 A;  4N3Z A;  4G10 A;  5E4W A;  1N25 A;  3EC3 A;  3L78 A;  1B9Y C;  1KTE A;  1GNE A;  2GSS A;  2R6K A;  1FOH A;  1PKZ A;  1YEX A;  2PUK C;  2WS2 A;  4ZXG A;  2AB6 A;  3TJF A;  5DVB A;  5D9T A;  3F3Q A;  3HDC A;  2XBI A;  1U6T A;  2HZE A;  2C1Y A;  2V1M A;  3HHV A;  3UMA A;  4JR6 A;  1ERV A;  4Z2T A;  2IPA A;  1O6J A;  1GSF A;  5HFI A;  2VLV A;  3HXS A;  4I8B A;  4ZL7 A;  1EV4 A;  2FA4 A;  1E2Y A;  1K0C A;  4N0V A;  5JWR B;  2B1K A;  1S3D A;  4NV5 A;  3TGZ A;  4JE1 A;  2I4A A;  2E0Q A;  4BL7 B;  4IP6 A;  2DLX A;  2HZE B;  3UVT A;  1YVL A;  2ZNM A;  1AAZ A;  3QOU A;  4MNN A;  5FWG A;  1B9X C;  3C1S A;  1ILO A;  4DSS B;  2YN1 A;  2K8V A;  2A2R A;  2DML A;  4IJI A;  2AHE A;  3KGK A;  4FIW A;  3TKR A;  2R0G A;  4BWS A;  2L4Q A;  3WGX A;  3GL5 A;  3TJB A;  2BJX A;  1G7O A;  2OBI A;  1N8J A;  1GSS A;  4IJ3 A;  4X43 A;  3UOM A;  4TVE A;  1SL1 B;  1Y6E A;  5JCU A;  2EFC A;  1T1V A;  4WBR D;  3A5I A;  4HZ4 A;  3HZ8 A;  5J3R A;  6GSS A;  5HFK A;  3VFI A;  4X0X A;  1FO5 A;  3I6A A;  1YF1 A;  2H6Z A;  14GS A;  1RK4 A;  1FVJ A;  5JCG A;  4EDZ A;  1SYX A;  3KEB A;  3FHK A;  4TR3 A;  1MDI A;  2M72 A;  1M2A A;  1DBY A;  4K0N A;  2CQ9 A;  4K0G A;  5IMZ A;  2FWE A;  1AQX A;  1OC3 A;  1EP8 A;  1KEB A;  1TW9 A;  2VD0 A;  1G6W A;  4OO5 A;  3J7Y k;  4QL7 A;  3CYN A;  4IEL A;  4MF6 A;  3ZRD A;  4O7H A;  5GZZ B;  2L4C A;  4KDU A;  1ZZY A;  5DJM A;  2CVB A;  2A2P A;  2O85 A;  1JLV A;  1ZGN A;  3BOA A;  4HU7 A;  3MIX A;  3TKS A;  2LEG A;  17GS A;  3VPQ A;  3GYK A;  1QGV A;  3TOU A;  5KN0 A;  5A1N A;  5IMF A;  1NSW A;  3RPP A;  3O6T A;  4MAB A;  1AIU A;  2IME A;  3NZN A;  2GZP A;  4KAE A;  2AV4 A;  3WGE A;  4MPF A;  2YPM A;  3G7Y A;  2LTK A;  2AAW A;  4J2F A;  4ZB7 A;  1X9M B;  1JFU A;  1A0R P;  3TJJ A;  4MPG A;  2G2Q A;  3VLN A;  4ZB6 A;  1OC9 A;  3W6G A;  4F0C A;  3P7X A;  4HI7 A;  1WJK A;  1WMJ A;  2X64 A;  1R4W A;  1EGR A;  1YY7 A;  3DVW A;  4QMK A;  3BBY A;  3GIX A;  4ICY A;  1ZYE A;  1Z7P A;  2HZF A;  1XW6 A;  1M99 A;  3GTU A;  1TK5 B;  1ZCP A;  1G6Y A;  1MDJ A;  1HQO A;  3IR4 A;  5IMC A;  2PVO C;  4MP4 A;  4LLR A;  3IC8 A;  4OCF A;  2HLS A;  1TI1 A;  1YJ6 A;  4L8E A;  2OKA A;  1OYJ A;  5LNK e;  1OC9 B;  4J57 E;  4AKI A;  1PN9 A;  2H1L A;  1SKR B;  1IYH A;  3CSI A;  2RM6 A;  3GKX A;  3GTU B;  4EF0 A;  4MJC A;  2H19 A;  3H1N A;  1Q4J A;  1TRS A;  2CX4 A;  1BYE A;  1FB6 A;  1DE1 A;  2PVQ A;  2DC5 A;  2IFQ A;  2EIR A;  2XBQ A;  4YQV A;  4OFT A;  5IPH A;  3IC4 A;  5J4Y A;  3VK9 A;  1XW5 A;  4LL1 B;  6GSX A;  4LMV A;  5DAL A;  2REM A;  2EIQ A;  2HRA A;  3VI5 A;  4K5R A;  2MMZ A;  3F9U A;  4O5Q A;  3WT1 A;  1WE0 A;  1O8W A;  3R2Q A;  1VF3 A;  4GF0 A;  1T00 A;  1VGL A;  2J9H A;  3CTG A;  2IFQ B;  1UA5 A;  2MMO A;  4MCU A;  3S9F A;  3LEF A;  2WB9 A;  3CXG A;  3LXZ A;  1ZYN A;  2E2M A;  1O7U A;  2VIM A;  5FHI A;  3F8U A;  4ZBB A;  2JZS A;  4NXI A;  2P5R A;  4V1A g;  1WP0 A;  2MMA A;  3UVH A;  1SVM A;  4KDY A;  2HE3 A;  1PN0 A;  1YKA A;  2PMT A;  1JLW A;  2GTU A;  1SKW B;  3LG6 A;  3TRX A;  2DJ3 A;  4K7N A;  1SL2 B;  4EIQ A;  5G31 A;  2OE1 A;  3APO A;  4G0L A;  3PH9 A;  4POL A;  1WPI A;  4AKG A;  4KF9 A;  4O5U A;  4TR4 A;  4X1U A;  3DD3 A;  2KP1 A;  3QR6 A;  1A2M A;  4ZB9 A;  1JZO A;  2H66 A;  1PL1 A;  2L6D A;  3FZ9 A;  3FW2 A;  3RHB A;  3U6V A;  1K3Y A;  4HJM A;  2HRF A;  3IHG A;  4AJ7 A;  1TI3 A;  2YAN A;  1PKW A;  1FAA A;  1XOA A;  2QSI A;  2L57 A;  4POM A;  1FOV A;  1AW9 A;  3F6D A;  5D96 A;  2B1L A;  3V1W A;  4K7I A;  3GKM A;  1XBS A;  3KIJ A;  1AQW A;  1GTU A;  5DJL A;  3QDN A;  1O81 A;  2E2G A;  3L9U A;  2OE0 A;  1H4O A;  3ZTL A;  4AKX B;  2I3Y A;  2H0G A;  2B5X A;  4JBB A;  4D73 B;  4MLY A;  4AJ8 A;  3W8S A;  2H72 A;  3UBK A;  4HQS A;  3GFK A;  4YAP A;  3ZRE A;  2HXK A;  2YV7 A;  2YNX A;  1OKD A;  1SK2 A;  3ZML A;  1ON4 A;  5ELG A;  3LYK A;  4ECJ A;  2JAC A;  4YKG A;  2JU5 A;  2XC2 A;  5GAP D;  2I1U A;  3I69 A;  4K2X A;  4GSS A;  2ON5 A;  1OC8 A;  1J08 A;  2OBK A;  5CYY A;  2DKH A;  4IQ1 A;  2LJK A;  4H86 A;  1EEM A;  1K0O A;  2CZ2 A;  2F8A A;  1N2A A;  2H1G A;  1Z9H A;  1GSU A;  2EFH A;  3RBT A;  2FWF A;  3WT2 A;  3WGD A;  2GLR A;  4G2E A;  2LS5 A;  1XWK A;  4F0B A;  2O87 A;  4GCI A;  2WJU A;  3Q74 A;  4PQI A;  2QC7 A;  2CX3 A;  4LA1 A;  2DJJ A;  5J40 A;  1URM A;  1VF4 A;  2GQL A;  4F82 A;  2VAF A;  1EEJ A;  3CMI A;  1UVZ A;  4GLT A;  1WWJ A;  3IPZ A;  4TN8 A;  3EUR A;  1GRX A;  2PGT A;  3DVX A;  3LQ7 A;  3N9J A;  3J7Y b;  3D22 A;  3LXT A;  2QA2 A;  3IV4 A;  2LJA A;  5F05 A;  2H1B A;  2R5G A;  4EO3 A;  1JZR A;  2H6X A;  3Q18 A;  4K8M A;  2A4H A;  5IO0 A;  1T4Y A;  1SL0 B;  4N0Z A;  3RHC A;  5IM9 A;  1SD9 A;  5HR2 A;  2OE3 A;  1HNB A;  1X5D A;  5J47 A;  1K3L A;  3TRP A;  4FYB A;  4NV2 A;  3KJY A;  1A8L A;  1YDK A;  3ERW A;  5IOW A;  2IJY A;  2HSY A;  3EMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...