5FWGA

Tetra-(5-fluorotryptophanyl)-glutathione transferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
213
Chain Sequence
PMILGYNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TETRA-(5-FLUOROTRYPTOPHANYL)-GLUTATHIONE TRANSFERASE MU CLAS
publication title Enzymes harboring unnatural amino acids: mechanistic and structural analysis of the enhanced catalytic activity of a glutathione transferase containing 5-fluorotryptophan.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 72
structure length 213
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fwgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fwgA01
2IMKA 4GSNA 1XBSA 5D93A 2K9FA 1A24A 2C8UA 3HHVA 2DSAA 3HKRA 2HSMA 5HR3A 2HRAA 3FR9A 3OR5A 2LEGA 3FHKA 1K3YA 1RW1A 1HNCA 2NTOA 2M46A 6GSUA 2IIYA 1J0FA 3QAGA 3LXZA 1TRSA 4GSSA 4K1FA 2I81A 2VD0A 4Q5RA 4WF4A 3ERWA 4H86A 4OO5A 4XIHA 3PINA 4N0VA 4PX1A 1Z7RA 5F05A 4POBA 1ZCPA 1OKDA 1EZKA 1GSEA 5DCGA 4F0CA 2YCDA 1HD2A 1I9DA 1EV4A 2HZEB 3TRXA 2TRCP 3SBCA 3QPMA 3KMNA 3LWAA 5CO3A 4TN8A 3GKMA 4IBPA 3ZMKA 1M2BA 2OACA 5IMAA 3IAS2 1Z6MA 4BVXB 2X8HA 5ENUA 1AQWA 1JLVA 5ELGA 3A2XA 5C04A 1T1VA 4HJMA 3FEUA 3IXRA 1BAYA 4EVMA 1IYIA 1FVJA 4HDEA 2NDOA 3TDGA 4K8MA 3KP9A 18GSA 5ECMB 3KTLA 4G2EA 3TJFA 5GAND 1SL1B 4V1Ag 3VURA 4ZXGA 3GTUB 5J4UA 3NZNA 1MD4A 3LQ7A 4MF5A 4BPYA 4FH8A 1MD3A 4PURA 3IRAA 1KEBA 2MBTA 5IMDA 1HNBA 3VWWA 1GSSA 4N30A 2JZRA 2OKAA 3WGXA 2GTUA 1NW2A 3GX8A 4XHMA 1O8XA 3F9UA 3E9JB 2P0GA 3VWUA 1GSYA 1XVWA 2L59A 4CW9A 3IHQA 3LORA 3MNGA 1K0BA 3IBHA 2ON5A 2YN1A 1ERVA 2MYGA 4CHSA 1UC7A 3CTGA 5JCUA 4MP4A 3L9UA 2VL9A 4K0GA 3D4TA 3GL3A 1FW1A 3IAM2 2TRXA 3LXTA 2OBIA 2WZ9A 2I1UA 2HNLA 1X9WB 1XZOA 2MMNA 4PNGA 1GTBA 1PSQA 4NXIA 4XS1A 2JZTA 1X5CA 3TKPA 4EKZA 1WOUA 4PXOA 4E8HA 2VM1A 2LRNA 4DSRA 3TUEA 5CRGA 2PBJA 5AGYA 2H1GA 1ERTA 3F3RA 2PN8A 1PA3A 1A0FA 5ECOB 2C0FA 4AGSA 2X8CA 1OE7A 4ECIA 4G10A 2XBQA 4K2DA 1PQNA 2RUEA 2WFCA 4KH7A 5HFGA 6GSWA 1T4ZA 3NIVA 1R7HA 4X43A 4MLYA 2C3NA 1URMA 2DIYA 3I69A 2H0IA 3UEMA 3DWVA 8GSSA 2RLIA 5ECNB 4MZBA 3F8UA 1TU8A 2EIOA 3DEXA 1F37A 10GSA 1K3OA 1TRVA 4IP1A 4ZL9A 5ID2A 2KP1A 5DQYA 1GLQA 1GNWA 4IN0A 2HXKA 3WGDA 1T7PB 3O76A 4G19A 1A2LA 5J9BA 1R4WA 5DJMA 1O81A 3C1SA 2I3YA 2XPEA 4ZB6A 2HSNB 5DQSA 1WMJA 3GUSA 5GAPD 4YQMA 5IPGA 5AIXA 1T4YA 1YEXA 1YEPA 3F3QA 2I9HA 5HR0A 5F06A 5ECPB 5CAXA 1XWAA 3D21A 3C1RA 1V2AA 5B8AA 3RHCA 2B1KA 4ML1A 5J3RA 2L4CA 1M9BA 3DIEA 2WJUA 4FYCA 5DBQA 5GZZB 4KSMA 3H79A 2DMLA 3DMLA 2GS3A 3ZVJA 4OFMA 4XS4A 4IW9A 1SENA 5D9TA 5FWGA 2FUG2 3WD6A 1AUCA 1XIYA 1YF0A 2DLXA 3CRTA 2VCZA 3KJYA 5E59A 2LTKA 2PU9C 1O7UA 4HUAA 4MZCA 3IDVA 1E6BA 2A4VA 1NHYA 2H01A 2E2MA 2NVLA 2KOKA 1B9YC 4GF0A 1QMVA 3O3TA 2L4QA 2FWHA 3TJBA 4N11A 5ABRA 2IJYA 4AJ8A 3EE2A 1A0RP 1RK4A 1TU7A 3LEFA 1PX7A 4X0XA 3IPZA 2ES7A 1OC8A 2CQ9A 3QFAC 4EDYA 2JSZA 3DXBA 1XW5A 2K8SA 5DALA 1ZMAA 1THOA 4L0WA 4DSSA 1OAZA 2H74A 3GL5A 3UVHA 1T3BA 4V2MA 1DE2A 1FOVA 3HZ4A 2IFQB 3LYKA 4TXOA 4F82A 2VO4A 2GQKA 4NWYA 2H76A 1TI3A 3ZMLA 2H73A 5CRDA 1ZOFA 4LMVA 4EDZA 3A2WA 3EINA 2PERA 3N5OA 3ZL5A 5ID2B 5IO0A 2FA8A 4QL9A 12GSA 1G6WA 4RUVA 1FAAA 3UMAA 1GSQA 5EL8A 2GDRA 1JZWA 4HJ2A 2MMZA 1M2DA 2FHEA 1B8XA 2WB9A 3ZLPA 1BJXA 4OCEA 1J08A 4IVFA 2C4JA 3HJMA 2ALBA 2FY6A 2GSQA 1ZZYA 4V1Ap 3F4RA 2IMEA 2L57A 1VF1A 3WYWA 4KW6A 4GWRA 5IOXA 3CSJA 1X5DA 1QXHA 3ZITA 3HXSA 3GURA 4AJ6A 3GIXA 2R37A 3EU3A 3G7YA 4HZ4A 2X64A 1G6YA 4WR5A 4XS4B 2B5XA 4O5RA 3PH9A 1EOHA 3VI5A 1AQXA 1GLPA 1Z6NA 3HD5A 4I5QA 2PWJA 2DJ0A 3HY2A 3L4NA 2GT5A 1YDKA 3H8QA 2B5YA 2CVBA 2HI7A 3Q74A 1VF4A 2LRTA 3QMXA 3UL3A 2H70A 2E7PA 2IL3A 2CZ3A 4JR4A 1JFUA 3M1GA 5G5FA 2O89A 2GSRA 13GSA 2H0GA 1V98A 4OMVA 5JCGA 2C0GA 3M9KA 1TXXA 1SK2A 1THXA 1Q98A 5IMZA 3TB2A 5JWOB 2N5AA 3L9VA 3HCZA 2VCVA 2VAFA 4POKA 5A4UA 2PVQA 2MMAA 5DALB 2OE3A 4DSQA 2AAWA 4OWYA 2O8VB 5KN1A 4DSSB 3QAVA 5JCWA 4AF2A 2DJ2A 5CRHA 1N8JA 4TXOB 2X8GA 2B1LA 4XRDA 2JACA 2E0QA 4GQCA 4P3YB 1H4OA 2VCTA 2GZYA 1K3LA 4WF5A 4LMWA 3HZ8A 2EC4A 2BJXA 2XC2A 1BQ7A 2AYTA 1SJZA 5ECRB 2H0HA 3WT1A 1J9BA 2FLSA 4GTUA 1B9XC 3U6VA 2MMOA 2J9HA 1V57A 1EWXA 3F0IA 4J56E 3HYPA 2H1BA 3NOFA 4HU7A 1EGOA 3EYTA 3CTFA 1TK5B 4D73A 1HNAA 3GKXA 1EOGA 3KZQA 2FWFA 5AISA 1MDKA 4EL1A 3N9JA 4QQ7A 4MH2A 4MF6A 5IQYA 2CA8A 2RM5A 5IMVA 4XCSA 3LG6A 5ECHB 2R3XA 7GSSA 1DSBA 3H4KA 4TR1A 3HA9A 5HQPA 1Z5YE 1TP9A 2HQTA 3IOSA 3BCKA 2VLVA 1KTEA 4IS0A 3FY7A 3QDNA 6GSTA 3D22A 3M3MA 4KDXA 3TKSA 3I6AA 2O85A 2I4AA 2ZCTA 5ECLB 1ERWA 2MZCA 1TK8B 2OBKA 5G31A 4BL7A 5LNKe 4V2NA 2OE0A 2GVPA 4KB3A 1WE0A 1W4VA 4QL7A 2EIQA 1E2YA 5C00A 5B7CA 4PQHA 1SK1A 3RHBA 3KP8A 1UVZA 5B8BA 2YV7A 4YH2A 3C7MA 6GSVA 3KH9A 3ERGA 3UAPA 1F3AA 2FNOA 2DJJA 4KCEA 3TOUA 5JWQB 4TR4A 4J57E 1CQGA 2DJ3A 4NHZA 4USSA 1QUWA 2ZUPA 3GNJA 2JSYA 1PX6A 3MWHA 3M8NA 5H5RA 1YF1A 1EEJA 2HSMB 2C1YA 3QCPA 4FO5A 3UJ1A 4KDYA 4J2FA 2V41A 3GHAA 5COHA 2CVKA 1Z7PA 3I9V2 2PMTA 2PVOC 1WJKA 3GV1A 5J5NA 1S3CA 3G7JA 3TRPA 3L9SA 3F6FA 1V9WA 4LLRA 4ECJA 2IWTA 1LBKA 3QOUA 2CX4A 2CAQA 1BX9A 1TI1A 3W6GA 5D9VA 1F9MA 1OVNA 4D73B 1OE8A 3DVWA 1JZOA 2H6ZA 5G30A 1WPIA 1Z3EA 5KN3A 5INYA 2CT6A 4WBJA 3FZ5A 1NHOA 4TR0A 3KCMA 2CZ2A 2EIRA 1ST9A 1OC3A 3EU4A 4TR1B 2OADA 4ID0A 5IMCA 4YQUA 4KUNA 4HQZA 3HJPA 3CXGA 2YZUA 3IE3A 4K7OA 1GUKA 3VPTA 1JLWA 2IMIA 2VL3A 3GMFA 1XXUA 2WS2A 1XWCA 2LQOA 1QK8A 4MCUA 1XVQA 1I5GA 2CVDA 1XW9A 4G9HA 1PL2A 3LSZA 4L0UA 1TTZA 1SD8A 3QAWA 4KGIA 4ECCA 3UOMA 1GTIA 2M80A 1Q4JA 4RQRA 4BL7B 3ZVJD 1PD21 4MJEA 2DIZA 2YZHA 3ZIVA 3J7Yb 3FR6A 3IK7A 2NBSA 4FYBA 9GSSA 5HR2A 3PGTA 4FIWA 3TKQA 4DVCA 2C80A 5D73A 4OFNA 1U87A 2HYXA 5EPFA 2V1MA 3I43A 3RBTA 1G7EA 1K0AA 4O32A 3WT2A 1W89A 2QC7A 2VL2C 3VPQA 3ZFBA 1FG4A 2YWNA 5KN2A 20GSA 1SKWB 2CX3A 1AIUA 3KD0A 5EY6A 5CNWA 4WBRD 5KN0A 4V2LA 2FA4A 3F6DA 1QGVA 3KEBA 4XS6A 4NV2A 1USBA 3R2QA 5J41A 1Y6EA 2NPBA 2H6YA 1C72A 2H72A 1JZDA 1K0MA 3TRQA 1HYUA 3ED3A 3BBYA 4L5OA 1MEKA 2YANA 3KMOA 1GL8A 4OD7A 3FW2A 2HSHA 4KA0A 3C71A 4KF9A 3EVIA 2B7JA 4PTSA 5A4WA 5G1KA 1R5AA 4TVEA 5HFIA 2AUVA 1V40A 1U3AA 1GP1A 2P5QA 2YWOA 2XPDA 2P31A 2L6CA 4ECBA 1GUHA 2L5LA 1ZYEA 2WCIA 4NPBA 2AJQB 1M99A 3ZZXA 1GTAA 2AV4A 1PN9A 4MJBA 3W8JA 2PGTA 4IQ1A 1TJDA 1XWBA 4IJ3A 4NAXA 4PNFA 2HFDA 3KM6A 4E8EA 3GA4A 4FQUA 1YY7A 4RI7A 3HVVA 2R2JA 5ELAA 1A2MA 3G9BA 1WIKA 3TCOA 3H1NA 5F07A 1F3BA 2V6KA 4MDCA 1AQVA 5IM9A 1F2EA 2YJ7A 3Q19A 2JADA 3GH9A 1SJIA 2D2ZA 2HLSA 1K0CA 3ZTLA 4PUFC 5G2ZA 3BD2A 2R5GA 1U88A 4ZBDA 1Z9HA 4IELA 5CYYA 5EVOA 1G7OA 4Z7XA 3ZRDA 2GZZA 2FWGA 4RI6A 3TJJA 4ZIJA 1TOFA 4GSTA 4ZBAA 4PQIA 2HRNA 1YZXA 2RIIA 1ON4A 1BYEA 3WGEA 3TKSE 2YOIA 2UZ8A 4OO4A 4Q5QA 5CRWA 4FYUA 1GWCA 3IV4A 2C0EA 1T00A 3TGZA 2X99A 1VRSD 2AHEA 3V1WA 4G0LA 5G5EA 5ECQB 2FD3A 3E3EA 22GSA 1F6MC 2GSTA 4O7HA 2VLTA 5FT3A 5G1LA 2VOCA 1U6TA 2K8VA 2VL2A 5D8IA 2A2SA 2HZEA 2RUFA 1T8EB 1O85A 2N5BA 4EO3A 4KDUA 1O73A 4YAPA 3GSSA 1LJRA 3P8WA 3P2AA 1YKAA 6GSSA 2CV4A 4IHUA 4PGTA 1JHBA 2V2GA 3DGQA 1QFNA 3D4MA 2B3SA 1SJ6A 5A5KA 2E2GA 5E4WA 2XHFA 3CSIA 1GRXA 11GSA 2AB6A 1NSWA 2BMXA 2H30A 1B4PA 5HR1A 3AY8A 3PPUA 3C73A 1LU4A 1VGLA 3DD3A 1XWGA 3EC3A 4I2TA 2WGRA 17GSA 1MDIA 1ERUA 4MABA 3Q18A 4MJCA 1SL2B 2DMMA 2LSTA 5DVBA 4JBBA 4ZB9A 4ISDA 3UBKA 4MK3A 1BG5A 1A2JA 1EP8A 3ME8A 4ZILA 1TDIA 3EMXA 3LFLA 4WETA 1TKDB 2LV3A 1YJ6A 1SK0A 3TOTA 3P90A 1XPVA 2VM2A 3RPNA 4YAVA 16GSA 3UVTA 2B6MA 2Z9SA 3GYKA 1TK0B 2VLUA 1SYXA 1TRUA 3FZ9A 2GQMA 1OC9A 2F3MA 3SWLA 3S9FA 4AJ7A 2F8FA 1FB6A 4EUYA 3LJRA 2J23A 2YNXA 1GUMA 2DC5A 1EGRA 3QD9A 5CP1A 1AAZA 1ABAA 5DCHA 3BCIA 3M0FA 2JZSA 2O87A 3E0UA 4O92A 2HRKA 4EC0A 4I6XA 2VCWA 3TJGA 5A4VA 4BVYA 4IKHA 1A8LA 4POLA 4I97A 2GZPA 1TW9A 2K6VA 1XWKA 3L0HA 1Y25A 5L71A 4CDOA 4F2IA 3VK9A 4MH3A 2QSIA 3KXOA 2N5FA 2YPMA 2YJHA 3W8SA 3TKRA 2O7KA 2TIRA 5IMFA 1PKZA 2VUPA 2LJRA 3GKKA 3F4SA 4KX4A 1WP0A 2GSSA 1PKWA 3VFIA 1FB0A 1UA5A 4Q5NA 2DJ1A 3KGKA 4OFTA 1VF2A 3ME7A 3A5WA 2REMA 5DDLA 2GT6A 3ZFLA 4L8EA 4N0ZA 2H1AA 1MTCA 1M0UA 4WR4A 4ACSA 3MAKA 1S3DA 1SL0B 4BWSA 3LGCA 1GULA 4GCIA 3QR6A 2FWEA 3EMPA 3D5JA 2PPTA 1B48A 1M9AA 3FRCA 2IN3A 3EWLA 4K9ZA 4TKYA 1KNGA 3ZREA 3IC4A 4MF7A 19GSA 4BWQA 4JEDA 3UBLA 2C3TA 2GGTA 1JZRA 4I2UA 3CBUA 1PL1A 2LJAA 3MSZA 4KNDA 4K6XA 3FZAA 5ECIB 3QFBC 2WULA 5F0GA 2IPAA 4NHWA 3R3EA 4TRXA 1N2AA 2GLRA 2WRTA 1ACVA 2G0FA 3APOA 1FO5A 4NV5A 3A3TA 3IK9A 3US3A 1SYRA 1OC9B 3GN3A 1SKSB 2KUCA 4MPGA 5IOWA 1XOBA 4KAEA 4YQVA 5IO2A 4X1UA 2HRFA 2VIMA 3CYNA 2GQLA 4IQAA 2FGXA 3DVXA 4WXTA 2LQQA 4TOPA 1NM3A 1X9MB 2HRKB 4G0KA 3RAZA 4BVYB 1ZYQB 4ZL8A 5AN1A 4G0IA 1GSUA 2YV9A 4JU5A 4Q5FA 1PGTA 3JCML 4JRRA 5BMUA 4XTSA 2ON7A 4N10A 3Q6OA 4TW5A 4IP6A 2IMDA 2KLXA 4GLTA 3FR3A 2CAIA 2L6DA 4HU9A 3G7IA 3DKSA 4ILFA 1OKTA 2P5RA 3LYPA 2HZFA 4BA7A 4EE0A 4I8BA 2H19A 5F8BA 3MDKA 3UARA 4WEYA 5JWRB 4JZQA 2IFQA 5J9CA 4HOJA 3ISOA 5IPHA 2OE1A 4GRFA 3CMIA 1PMTA 2K18A 4NMUA 2OA7A 3BOAA 2KP2A 5D9XA 4PUAA 1M2AA 4DEJA 1VF3A 1XFLA 3FYGA 2XBIA 2F51A 1X9SB 2LUSA 4EF0A 2VD1A 6GSYA 1X0RA 4ZB8A 1AW9A 5D9WA 1H75A 2B7KA 2C0DA 2LKUA 2IMFA 3C8EA 3FZ4A 2PUKC 1R26A 1ZGNA 2R6KA 4RQXA 4EXJA 5KEJA 3J7Yk 4TR3A 1RQMA 1ILOA 1BEDA 14GSA 3EURA 2M72A 2YWIA 1DBYA 2QGVA 4HEA2 3UIWA 3HDCA 3CSHA 2YWMA 6GSXA 5DAKA 1O8WA 1M7TA 4JE1A 4HZ2A 3ERFA 3KH7A 5H5QA 5D96A 1SKRB 3O6TA 3ZIJA 1FHEA 2OJLA 3RPPA 4K7IA 2H71A 4GXZA 4ULXA 2MBSA 2C3QA 2ZNMA 4F0BA 5LCZA 2LJKA 3D6IA 3F4TA 5CREA 4GQFA 5HFKA 3APQA 3VI7A 5B6MA 1GNEA 5H5SA 1EP7A 2DJKA 3P7XA 2BTOT 2LNSA 1A8YA 4KE3A 2LS5A 5IIZA 3GX0A 4POMA 4HI7A 3A2VA 5ECSA 1AXDA 3HVSA 4KSOA 2DBCA 4LL1B 2H75A 1IYHA 3VWVA 4MA9A 3GH6A 2KHPA 1SD9A 2B5EA 1WRYA 2VCQA 4HS1A 1HQOA 2H66A 1K0OA 4F9ZA 1QQ2A 3CRUA 3ZYWA 3TJKA 3FK8A 1FVKA 2R4VA 3APSA 5AIVA 4ZL7A 4ZBBA 3H93A 4L5LA 1XW6A 1AC1A 1EEMA 3VLNA 3GSTA 1UN2A 2HSYA 3DRNA 3RDWA 4MJAA 1EV9A 2LRCA 1O6JA 2VCXA 5DJLA 1B4QA 3IC8A 4IGJA 1R5PA 1XCCA 2YP6A 1GSFA 1K0NA 2RM6A 3TKSC 2V32A 4WKWA 3PR8A 2F9SA 2JL4A 1S3AA 4MPFA 1MDJA 2H1DA 5FHIA 3DYRA 3HVXA 1GH2A 1GTUA 4KCAA 1K0DA 1OYJA 5GSSA 4JR6A 4TXVA 2FCHA 2JU5A 3M9JA 2LNTA 3U5RE 2H6XA 3GKNA 3GRXA 5ECKB 1XOAA 4MZWA 1V58A 4MMMA 2A2RA 4F03A 3FKFA 2WDUA 2G2QA 3KTBA 5DAKB 4OCFA 4K0NA 4BVXA 2H8LA 4XRAA 3D0ZA 3HJOA 1U3IA 1DE1A 3IR4A 4ML6A 4PQ1A 1CQHA 5B6NA 3KIJA 4IJIA 2V6OA 1YKCA 5LD0A 3GFKA 1X5EA 5GSTA 1WWJA 3IA1A 4LA1A 1KBNA 1DUGA 3K8NA 1PRXA 4K7NA 3GTUA 2QKEA 4LL4B 1GSDA 1A23A 3BJ5A 1YQ1A 1ZL9A 1SU9A 1ML6A 2F8AA 1TRWA 2HT9A 3VWXA 3F63A 4HQSA 2HE3A 1G0TA 2L5OA 3L78A
chains in the Genus database with same CATH superfamily
2EFDA 5KOWA 2IMKA 4GSNA 1XBSA 5D93A 2K9FA 1A24A 2C8UA 3HHVA 2DSAA 3HKRA 2HSMA 5HR3A 2HRAA 3FR9A 4AKIA 3OR5A 2LEGA 3FHKA 1K3YA 1RW1A 1HNCA 3A5IA 4CY8A 2NTOA 2M46A 6GSUA 2IIYA 1J0FA 3QAGA 3LXZA 5BRTA 1TRSA 4GSSA 2X4AA 4K1FA 2I81A 2VD0A 4Q5RA 4WF4A 3ERWA 4H86A 4OO5A 4XIHA 3PINA 4N0VA 4PX1A 1Z7RA 5F05A 4POBA 1ZCPA 1OKDA 1EZKA 1GSEA 5DCGA 4F0CA 2YCDA 1HD2A 1I9DA 1EV4A 2HZEB 3TRXA 4O5UA 2TRCP 3SBCA 3QPMA 3KMNA 3LWAA 5CO3A 4TN8A 3CQFA 3GKMA 4IBPA 3ZMKA 1M2BA 1YEWC 2OACA 5IMAA 3IAS2 4PHZC 4BVXB 1Z6MA 3FMWA 2X8HA 5ENUA 1AQWA 1JLVA 5ELGA 3A2XA 5C04A 1T1VA 4HJMA 5A5HA 3FEUA 3IXRA 1BAYA 4EVMA 1IYIA 1FVJA 4HDEA 2NDOA 2O3EA 2WVXB 1M3IA 4W66A 3TDGA 4K8MA 3KP9A 5J47A 18GSA 5ECMB 3KTLA 4G2EA 3TJFA 5GAND 1SL1B 4V1Ag 3VURA 4ZXGA 3GTUB 5J4UA 2A2PA 3NZNA 1MD4A 2UV8G 3LQ7A 4MF5A 4BPYA 4FH8A 1MD3A 4PURA 3IRAA 1KEBA 2MBTA 5IMDA 1HNBA 3VWWA 1GSSA 4N30A 2JZRA 2OKAA 3WGXA 2GTUA 1NW2A 3GX8A 4XHMA 4YKFA 1O8XA 3F9UA 3E9JB 2P0GA 3VWUA 1GSYA 1XVWA 2L59A 4CW9A 3IHQA 3LORA 3MNGA 1K0BA 3IBHA 2ON5A 2YN1A 1ERVA 2MYGA 4CHSA 1UC7A 3CTGA 4AKHA 1SVLA 5JCUA 4MP4A 3L9UA 2VL9A 4K0GA 3D4TA 3GL3A 1FW1A 3IAM2 2TRXA 3LXTA 2R0CA 2OBIA 2WZ9A 2I1UA 2HNLA 1X9WB 1XZOA 2MMNA 4PNGA 1GTBA 1PSQA 4NXIA 4XS1A 2JZTA 1X5CA 3TKPA 4EKZA 1WOUA 4PXOA 4E8HA 2VM1A 2LRNA 4DSRA 3MIXA 3TUEA 5CRGA 2PBJA 5AGYA 2H1GA 1ERTA 3F3RA 2PN8A 1PA3A 1A0FA 5ECOB 2C0FA 4AGSA 1TXUA 2X8CA 1OE7A 4ECIA 4G10A 2XBQA 4K2DA 1PQNA 2RUEA 2WFCA 4KH7A 1XG8A 5HFGA 6GSWA 1T4ZA 3NIVA 1R7HA 1FOHA 4X43A 4MLYA 2C3NA 1URMA 2DIYA 3I69A 2H0IA 3UEMA 3DWVA 8GSSA 2RLIA 4K5SA 5ECNB 4MZBA 3F8UA 1YVLA 1TU8A 2EIOA 3DEXA 1F37A 10GSA 1K3OA 2WVZA 2OT3A 1TRVA 4IP1A 4ZL9A 5A5HB 5ID2A 2KP1A 5DQYA 1GLQA 1GNWA 4IN0A 2HXKA 3WGDA 1T7PB 3O76A 4G19A 1A2LA 5J9BA 1R4WA 5DJMA 1O81A 3C1SA 2I3YA 2XPEA 4ZB6A 4O5QA 2HSNB 5DQSA 1WMJA 3GUSA 5GAPD 4YQMA 5IPGA 5AIXA 1T4YA 1YEXA 1YEPA 3F3QA 2I9HA 5HR0A 5F06A 5ECPB 5CAXA 4QMKA 1XWAA 3D21A 3C1RA 1V2AA 5B8AA 3RHCA 2B1KA 4ML1A 5J3RA 2L4CA 1M9BA 3DIEA 2WJUA 4FYCA 5DBQA 5GZZB 4KSMA 3H79A 2DMLA 3DMLA 2GS3A 3ZVJA 4FXYP 4OFMA 4G01A 4XS4A 4IW9A 1SENA 5D9TA 5FWGA 2FUG2 3WD6A 1AUCA 1XIYA 1YF0A 2DLXA 3CRTA 2VCZA 3KJYA 5E59A 5A34B 2LTKA 2PU9C 1O7UA 4HUAA 4MZCA 2WVYA 3IDVA 1E6BA 2A4VA 1NHYA 2H01A 2E2MA 2NVLA 2KOKA 1B9YC 4GF0A 1QMVA 3O3TA 2L4QA 2FWHA 3TJBA 4N11A 5ABRA 2IJYA 4AJ8A 3EE2A 1A0RP 1RK4A 5BMUB 1TU7A 3LEFA 1PX7A 2DKIA 4X0XA 3IPZA 2ES7A 1OC8A 2CQ9A 3QFAC 4EDYA 2JSZA 3CHXC 3DXBA 1XW5A 2K8SA 5DALA 1ZMAA 1THOA 4L0WA 4DSSA 1OAZA 2H74A 3GL5A 3UVHA 1T3BA 4V2MA 1DE2A 1FOVA 3HZ4A 2IFQB 3LYKA 4TXOA 4F82A 2VO4A 2GQKA 4NWYA 2H76A 1TI3A 3ZMLA 2H73A 5CRDA 1ZOFA 4LMVA 4EDZA 3A2WA 3EINA 2PERA 3N5OA 3ZL5A 5ID2B 5IO0A 2FA8A 4QL9A 12GSA 1G6WA 2R0GA 1FAAA 4RUVA 3UMAA 4CY6A 1GSQA 5EL8A 2GDRA 1JZWA 4HJ2A 2MMZA 1M2DA 2FHEA 1B8XA 1S4BP 2WB9A 3ZLPA 1BJXA 4ICYA 4OCEA 1J08A 4IVFA 2C4JA 3HJMA 4Z2TA 2ALBA 4EIQA 2FY6A 2GSQA 1ZZYA 4V1Ap 3F4RA 2IMEA 2L57A 1VF1A 3WYWA 4KW6A 4GWRA 5IOXA 3CSJA 1X5DA 3CWGA 1QXHA 3ZITA 3HXSA 3GURA 1PN0A 4AJ6A 3GIXA 2R37A 3EU3A 3G7YA 4HZ4A 2X64A 1G6YA 4WR5A 4XS4B 2B5XA 4O5RA 3PH9A 1EOHA 3VI5A 1AQXA 1GLPA 1Z6NA 3HD5A 4I5QA 2PWJA 2DJ0A 3HY2A 3L4NA 2GT5A 1YDKA 3H8QA 2WW1A 2B5YA 2CVBA 2HI7A 3Q74A 1VF4A 2LRTA 3QMXA 3UL3A 2H70A 2E7PA 2IL3A 2CZ3A 4JR4A 1JFUA 3M1GA 5G5FA 2O89A 2GSRA 13GSA 2H0GA 1V98A 4OMVA 5JCGA 2C0GA 3M9KA 1TXXA 1SK2A 1THXA 1Q98A 5IMZA 3TB2A 5JWOB 2N5AA 3L9VA 3LW9A 3HCZA 2VCVA 2VAFA 4POKA 5A4UA 2PVQA 2MMAA 5DALB 2OE3A 4DSQA 2AAWA 4OWYA 2O8VB 5KN1A 4DSSB 3QAVA 5JCWA 4K2XA 4AF2A 2DJ2A 5CRHA 1N8JA 4TXOB 2X8GA 4N3ZA 2B1LA 4XRDA 2JACA 2E0QA 4GQCA 4P3YB 1H4OA 2VCTA 2GZYA 1K3LA 4WF5A 4LMWA 3HZ8A 2EC4A 2BJXA 2XC2A 1BQ7A 2AYTA 1SJZA 5ECRB 2H0HA 3WT1A 1J9BA 2FLSA 4GTUA 1B9XC 3U6VA 2MMOA 2J9HA 1V57A 1EWXA 3F0IA 4J56E 3HYPA 2H1BA 3NOFA 4HU7A 1EGOA 3EYTA 3CTFA 4ZB7A 1TK5B 4D73A 1HNAA 3GKXA 3HVNA 1EOGA 3KZQA 2FWFA 5AISA 1MDKA 4EL1A 3N9JA 4QQ7A 4MH2A 4MF6A 5A1NB 5IQYA 2CA8A 2RM5A 5J40A 5IMVA 4XCSA 4GDFA 3LG6A 5ECHB 2R3XA 7GSSA 1DSBA 3H4KA 4TR1A 3HA9A 5HQPA 1Z5YE 1TP9A 2HQTA 3IOSA 3BCKA 2VLVA 1KTEA 4IS0A 3FY7A 3QDNA 6GSTA 3D22A 3M3MA 4KDXA 3TKSA 3I6AA 2O85A 2I4AA 2ZCTA 5ECLB 1ERWA 2MZCA 1TK8B 2OBKA 2O5VA 5G31A 4BL7A 5LNKe 4V2NA 2OE0A 2GVPA 4KB3A 1WE0A 1W4VA 4QL7A 2EIQA 1E2YA 5C00A 4X4JA 5B7CA 4PQHA 1SK1A 3RHBA 3KP8A 1UVZA 5B8BA 2YV7A 4YH2A 3C7MA 6GSVA 3KH9A 3ERGA 3UAPA 1F3AA 2FNOA 2DJJA 4KCEA 3TOUA 5JWQB 4TR4A 4J57E 1CQGA 2DJ3A 4NHZA 4USSA 1QUWA 2ZUPA 3GNJA 2JSYA 1PX6A 3MWHA 3M8NA 5H5RA 1YF1A 1EEJA 2HSMB 2C1YA 3QCPA 4FO5A 3UJ1A 4KDYA 4J2FA 2V41A 3GHAA 5COHA 2CVKA 1Z7PA 3I9V2 2PMTA 2PVOC 1WJKA 3GV1A 5J5NA 1S3CA 4E68A 3G7JA 3TRPA 3L9SA 3F6FA 1V9WA 4LLRA 4ECJA 2IWTA 5J4VA 1LBKA 3QOUA 2CX4A 2CAQA 1BX9A 1TI1A 3W6GA 5D9VA 1F9MA 1OVNA 4D73B 1OE8A 3DVWA 1JZOA 2H6ZA 5G30A 1WPIA 1Z3EA 5KN3A 5INYA 2CT6A 4WBJA 3FZ5A 1NHOA 3RFRC 4TR0A 3KCMA 2CZ2A 2EIRA 1ST9A 1OC3A 3EU4A 4TR1B 2OADA 4ID0A 1ZYNA 5IMCA 4YQUA 4KUNA 4HQZA 3HJPA 3CXGA 2YZUA 3IE3A 4K7OA 1GUKA 3VPTA 1JLWA 2IMIA 2VL3A 3GMFA 1XXUA 2WS2A 1XWCA 2LQOA 1QK8A 4PI0C 4MCUA 1XVQA 1I5GA 2CVDA 1XW9A 4G9HA 1PL2A 3LSZA 4L0UA 2H1LA 1TTZA 4AKGA 1SD8A 3QAWA 4KGIA 4ECCA 3UOMA 1GTIA 2M80A 1Q4JA 4RQRA 4BL7B 3ZVJD 1PD21 4MJEA 2DIZA 2YZHA 3ZIVA 3J7Yb 3FR6A 3IK7A 2A4HA 2NBSA 4FYBA 9GSSA 5HR2A 3PGTA 4FIWA 3TKQA 4DVCA 2C80A 5D73A 4OFNA 1U87A 2HYXA 5EPFA 2V1MA 1SVOA 3I43A 1SVMA 3RBTA 1G7EA 1K0AA 4O32A 3WT2A 1W89A 2EFHA 2QC7A 2VL2C 3VPQA 3ZFBA 1FG4A 2YWNA 5KN2A 20GSA 1SKWB 2CX3A 2WW0A 1AIUA 3KD0A 5EY6A 5CNWA 4WBRD 5KN0A 4V2LA 2FA4A 3F6DA 2WW3A 1QGVA 3KEBA 4XS6A 4NV2A 1USBA 3R2QA 5J41A 1Y6EA 2NPBA 2H6YA 3IHGA 1C72A 2H72A 1JZDA 1K0MA 3TRQA 1HYUA 3ED3A 3BBYA 4L5OA 1MEKA 2YANA 3KMOA 1GL8A 4OD7A 3FW2A 2HSHA 4KA0A 3C71A 4KF9A 3EVIA 2B7JA 4PTSA 3HMJG 5A4WA 5G1KA 1R5AA 4TVEA 2EFCA 5HFIA 2AUVA 1V40A 1U3AA 1GP1A 2P5QA 4YKGA 2YWOA 2XPDA 2P31A 2L6CA 4ECBA 1GUHA 1M3JA 2L5LA 1ZYEA 2WCIA 4NPBA 2AJQB 1M99A 3ZZXA 1GTAA 2AV4A 1PN9A 4MJBA 3W8JA 2PGTA 3EPTA 4IQ1A 1TJDA 1XWBA 4IJ3A 4NAXA 4PNFA 2HFDA 3KM6A 4E8EA 3GA4A 4FQUA 1YY7A 4RI7A 3HVVA 2R2JA 5ELAA 1A2MA 3G9BA 1WIKA 3TCOA 3H1NA 5F07A 1F3BA 2V6KA 4MDCA 1AQVA 5IM9A 1F2EA 3RGBC 2YJ7A 3Q19A 2DKHA 2JADA 3GH9A 1SJIA 2D2ZA 2HLSA 1K0CA 3ZTLA 4PUFC 5G2ZA 3BD2A 2R5GA 1U88A 4ZBDA 1Z9HA 4IELA 5CYYA 5EVOA 1G7OA 4Z7XA 3ZRDA 2GZZA 2FWGA 4RI6A 3TJJA 4ZIJA 1TOFA 4GSTA 4ZBAA 4PQIA 2HRNA 1YZXA 2RIIA 1ON4A 1BYEA 3WGEA 3TKSE 2YOIA 2UZ8A 4OO4A 4Q5QA 5CRWA 4FYUA 1GWCA 3IV4A 4BIKA 2C0EA 1T00A 3TGZA 2X99A 1VRSD 2AHEA 3V1WA 4G0LA 5G5EA 5ECQB 2FD3A 3E3EA 22GSA 1F6MC 2GSTA 4O7HA 2VLTA 5FT3A 5G1LA 2VOCA 1U6TA 2K8VA 2VL2A 5D8IA 2A2SA 2HZEA 2RUFA 1T8EB 1O85A 2N5BA 4EO3A 4KDUA 1O73A 4YAPA 3GSSA 1LJRA 3P8WA 3P2AA 1YKAA 6GSSA 2CV4A 4IHUA 4PGTA 1JHBA 2V2GA 3DGQA 1PFOA 1QFNA 2WW2A 3D4MA 2B3SA 1SJ6A 5A5KA 2E2GA 5E4WA 2XHFA 3CSIA 1GRXA 11GSA 2AB6A 1NSWA 2BMXA 2H30A 1B4PA 5HR1A 3AY8A 3PPUA 3C73A 1LU4A 1VGLA 2X49A 3DD3A 1XWGA 3EC3A 4I2TA 2WGRA 17GSA 1MDIA 1ERUA 4MABA 3Q18A 4MJCA 1SL2B 2DMMA 2LSTA 5DVBA 4JBBA 4ZB9A 4ISDA 3UBKA 4MK3A 2QA1A 1BG5A 1A2JA 1EP8A 3ME8A 4ZILA 1ZYPA 1TDIA 3EMXA 3LFLA 4WETA 1TKDB 2LV3A 1YJ6A 1SK0A 3TOTA 3P90A 1XPVA 2VM2A 3RPNA 4YAVA 16GSA 3UVTA 2B6MA 2Z9SA 3GYKA 1TK0B 2VLUA 1SYXA 1TRUA 3FZ9A 2GQMA 1OC9A 2F3MA 3SWLA 3S9FA 4AJ7A 2F8FA 1FB6A 4EUYA 3LJRA 2J23A 2YNXA 1GUMA 2DC5A 1EGRA 3QD9A 5CP1A 1AAZA 1ABAA 5DCHA 3BCIA 3M0FA 2JZSA 2O87A 3E0UA 1BG1A 4O92A 2HRKA 4EC0A 4I6XA 2VCWA 3TJGA 5A4VA 4BVYA 4IKHA 1A8LA 2VKZG 4POLA 4I97A 2GZPA 1TW9A 2K6VA 1XWKA 3L0HA 1Y25A 5L71A 4Z2RA 4CDOA 4F2IA 3VK9A 4MH3A 2QSIA 3KXOA 2N5FA 2YPMA 2YJHA 3W8SA 3TKRA 2EFEA 2O7KA 2TIRA 5IMFA 1PKZA 2VUPA 2LJRA 3GKKA 3F4SA 4KX4A 1WP0A 2GSSA 1PKWA 3VFIA 1FB0A 1UA5A 4Q5NA 2DJ1A 3KGKA 4OFTA 1VF2A 3ME7A 3A5WA 2REMA 5DDLA 2GT6A 3ZFLA 4L8EA 4N0ZA 2H1AA 1MTCA 5J4YA 1M0UA 4WR4A 4ACSA 3MAKA 1S3DA 1SL0B 4BWSA 3LGCA 2HSNA 1GULA 4GCIA 3QR6A 2FWEA 3EMPA 2O36A 3D5JA 2PPTA 1B48A 1M9AA 3FRCA 2IN3A 3EWLA 4K9ZA 1BF5A 4TKYA 1KNGA 3ZREA 3IC4A 1N25A 4MF7A 19GSA 4BWQA 4JEDA 3UBLA 2C3TA 2GGTA 1JZRA 4I2UA 3CBUA 1PL1A 2LJAA 3MSZA 4KNDA 4K6XA 3FZAA 5ECIB 3QFBC 2WULA 5F0GA 2WZSA 2IPAA 4NHWA 3R3EA 2R0PA 4TRXA 1N2AA 2GLRA 2WRTA 1ACVA 2G0FA 3APOA 1FO5A 4NV5A 3A3TA 3IK9A 3US3A 1SYRA 1OC9B 3GN3A 1SKSB 2KUCA 4MPGA 3TU3B 5A34A 5IOWA 1XOBA 4KAEA 4YQVA 5IO2A 4X1UA 2HRFA 2VIMA 3CYNA 2GQLA 4EIPA 2QA2A 4IQAA 2FGXA 3DVXA 4WXTA 2LQQA 4TOPA 1NM3A 1X9MB 2HRKB 4G0KA 4K5RA 3RAZA 4BVYB 1ZYQB 5KOXA 4ZL8A 5AN1A 4G0IA 1GSUA 2YV9A 4JU5A 4Q5FA 1PGTA 3JCML 4JRRA 5BMUA 4XTSA 2ON7A 4N10A 3Q6OA 4TW5A 4IP6A 2IMDA 2KLXA 4GLTA 3FR3A 2CAIA 2L6DA 4HU9A 3G7IA 3DKSA 4ILFA 1OKTA 2P5RA 1S3RA 3LYPA 2HZFA 4BA7A 4EE0A 4I8BA 2H19A 5F8BA 3MDKA 3UARA 4WEYA 5JWRB 4JZQA 2IFQA 5J9CA 4HOJA 3ISOA 5IPHA 2OE1A 1I1IP 4GRFA 3CMIA 1PMTA 2K18A 4NMUA 2OA7A 3BOAA 2KP2A 5D9XA 4Z2UA 4PUAA 1M2AA 4DEJA 4MNNA 1VF3A 1XFLA 3FYGA 2XBIA 2F51A 1X9SB 2LUSA 4EF0A 2VD1A 6GSYA 4PI2C 1X0RA 4ZB8A 1AW9A 5D9WA 1H75A 2B7KA 2C0DA 2LKUA 2IMFA 3C8EA 3FZ4A 3MYDA 2PUKC 1R26A 1ZGNA 2R6KA 4RQXA 4EXJA 5KEJA 3J7Yk 4TR3A 1RQMA 1ILOA 1BEDA 3EURA 14GSA 2M72A 2YWIA 1DBYA 2QGVA 4HEA2 3UIWA 3HDCA 3CSHA 2YWMA 6GSXA 5DAKA 1O8WA 1M7TA 4JE1A 4HZ2A 3ERFA 3KH7A 5H5QA 5D96A 1SKRB 3O6TA 3ZIJA 1FHEA 2OJLA 3RPPA 4K7IA 2H71A 4GXZA 4ULXA 2MBSA 2C3QA 2ZNMA 4F0BA 5LCZA 2LJKA 3D6IA 3F4TA 5CREA 4GQFA 5HFKA 3APQA 3VI7A 5B6MA 1GNEA 5H5SA 1EP7A 2DJKA 3P7XA 2BTOT 2LNSA 1A8YA 4KE3A 2LS5A 5IIZA 3GX0A 4HSCX 4POMA 4HI7A 3A2VA 5ECSA 1AXDA 3HVSA 4KSOA 2DBCA 4LL1B 2H75A 1IYHA 3VWVA 4A5PA 4MA9A 3GH6A 2KHPA 1SD9A 2B5EA 1WRYA 2VCQA 4HS1A 1HQOA 2H66A 1K0OA 4F9ZA 1QQ2A 3CRUA 3ZYWA 4AI6A 3TJKA 3FK8A 1FVKA 2R4VA 3APSA 5AIVA 4ZL7A 4ZBBA 3H93A 4L5LA 1XW6A 1AC1A 1EEMA 3VLNA 3GSTA 1UN2A 2HSYA 3DRNA 3RDWA 4MJAA 1EV9A 2LRCA 1O6JA 4AKXB 2VCXA 5DJLA 1B4QA 3IC8A 4IGJA 1R5PA 1XCCA 2YP6A 1GSFA 1K0NA 2RM6A 3TKSC 2V32A 4WKWA 3PR8A 2F9SA 2JL4A 1S3AA 4MPFA 1MDJA 2H1DA 5FHIA 3DYRA 5A1NA 3HVXA 1GH2A 1GTUA 4KCAA 1K0DA 1OYJA 5GSSA 4JR6A 4TXVA 2FCHA 2JU5A 3M9JA 2LNTA 3U5RE 2H6XA 3GKNA 3GRXA 5ECKB 1XOAA 4MZWA 1V58A 4MMMA 2A2RA 4F03A 3FKFA 2WDUA 2G2QA 3KTBA 5DAKB 4OCFA 4K0NA 4BVXA 2H8LA 4XRAA 3D0ZA 3HJOA 1U3IA 1DE1A 3IR4A 4ML6A 4PQ1A 1CQHA 5B6NA 3KIJA 1Y1UA 4IJIA 2V6OA 1YKCA 5LD0A 3GFKA 1X5EA 5GSTA 1WWJA 3IA1A 2WVXA 4LA1A 1KBNA 1DUGA 3K8NA 1PRXA 4K7NA 3GTUA 2QKEA 4LL4B 1GSDA 1A23A 3BJ5A 1YQ1A 1ZL9A 1SU9A 1ML6A 2F8AA 1TRWA 2HT9A 3VWXA 3F63A 4HQSA 2HE3A 1G0TA 2L5OA 3L78A
chains in the Genus database with same CATH topology
2EFDA 5KOWA 2IMKA 4GSNA 1XBSA 5D93A 2K9FA 1A24A 2C8UA 3HHVA 2DSAA 3HKRA 2HSMA 5HR3A 2HRAA 3FR9A 4AKIA 3OR5A 2LEGA 3FHKA 1K3YA 1RW1A 1HNCA 3A5IA 4CY8A 2NTOA 2M46A 6GSUA 2IIYA 1J0FA 3QAGA 3LXZA 5BRTA 1TRSA 4GSSA 2X4AA 4K1FA 2I81A 2VD0A 4Q5RA 4WF4A 3ERWA 4H86A 4OO5A 4XIHA 3PINA 4N0VA 4PX1A 1Z7RA 5F05A 4POBA 1ZCPA 1OKDA 1EZKA 1GSEA 5DCGA 4F0CA 2YCDA 1HD2A 1I9DA 1EV4A 2HZEB 3TRXA 4O5UA 2TRCP 3SBCA 3QPMA 3KMNA 3LWAA 5CO3A 4TN8A 3GKMA 4IBPA 3ZMKA 1M2BA 2OACA 5IMAA 3IAS2 1Z6MA 4BVXB 3FMWA 2X8HA 5ENUA 1AQWA 1JLVA 5ELGA 3A2XA 5C04A 1T1VA 4HJMA 5A5HA 3FEUA 3IXRA 1BAYA 4EVMA 1IYIA 1FVJA 4HDEA 2NDOA 4W66A 3TDGA 4K8MA 3KP9A 5J47A 18GSA 5ECMB 3KTLA 4G2EA 3TJFA 5GAND 1SL1B 4V1Ag 3VURA 4ZXGA 3GTUB 5J4UA 2A2PA 3NZNA 1MD4A 2UV8G 3LQ7A 4MF5A 4BPYA 4FH8A 1MD3A 4PURA 3IRAA 1KEBA 2MBTA 5IMDA 1HNBA 3VWWA 1GSSA 4N30A 2JZRA 2OKAA 3WGXA 2GTUA 1NW2A 3GX8A 4XHMA 4YKFA 1O8XA 3F9UA 3E9JB 2P0GA 3VWUA 1GSYA 1XVWA 2L59A 4CW9A 3IHQA 3LORA 3MNGA 1K0BA 3IBHA 2ON5A 2YN1A 1ERVA 2MYGA 4CHSA 1UC7A 3CTGA 4AKHA 1SVLA 5JCUA 4MP4A 3L9UA 2VL9A 4K0GA 3D4TA 3GL3A 1FW1A 3IAM2 2TRXA 3LXTA 2R0CA 2OBIA 2WZ9A 2I1UA 2HNLA 1X9WB 1XZOA 2MMNA 4PNGA 1GTBA 1PSQA 4NXIA 4XS1A 2JZTA 1X5CA 3TKPA 4EKZA 1WOUA 4PXOA 4E8HA 2VM1A 2LRNA 4DSRA 3MIXA 3TUEA 5CRGA 2PBJA 5AGYA 2H1GA 1ERTA 3F3RA 2PN8A 1PA3A 1A0FA 5ECOB 2C0FA 4AGSA 1TXUA 2X8CA 1OE7A 4ECIA 4G10A 2XBQA 4K2DA 1PQNA 2RUEA 2WFCA 4KH7A 5HFGA 6GSWA 1T4ZA 3NIVA 1R7HA 1FOHA 4X43A 4MLYA 2C3NA 1URMA 2DIYA 3I69A 2H0IA 3UEMA 3DWVA 8GSSA 2RLIA 4K5SA 5ECNB 4MZBA 3F8UA 1YVLA 1TU8A 2EIOA 3DEXA 1F37A 10GSA 1K3OA 2OT3A 1TRVA 4IP1A 4ZL9A 5A5HB 5ID2A 2KP1A 5DQYA 1GLQA 1GNWA 4IN0A 2HXKA 3WGDA 1T7PB 3O76A 4G19A 1A2LA 5J9BA 1R4WA 5DJMA 1O81A 3C1SA 2I3YA 2XPEA 4ZB6A 4O5QA 2HSNB 5DQSA 1WMJA 3GUSA 5GAPD 4YQMA 5IPGA 5AIXA 1T4YA 1YEXA 1YEPA 3F3QA 2I9HA 5HR0A 5F06A 5ECPB 5CAXA 4QMKA 1XWAA 3D21A 3C1RA 1V2AA 5B8AA 3RHCA 2B1KA 4ML1A 5J3RA 2L4CA 1M9BA 3DIEA 2WJUA 4FYCA 5DBQA 5GZZB 4KSMA 3H79A 2DMLA 3DMLA 2GS3A 3ZVJA 4OFMA 4G01A 4XS4A 4IW9A 1SENA 5D9TA 5FWGA 2FUG2 3WD6A 1AUCA 1XIYA 1YF0A 2DLXA 3CRTA 2VCZA 3KJYA 5E59A 5A34B 2LTKA 2PU9C 1O7UA 4HUAA 4MZCA 3IDVA 1E6BA 2A4VA 1NHYA 2H01A 2E2MA 2NVLA 2KOKA 1B9YC 4GF0A 1QMVA 3O3TA 2L4QA 2FWHA 3TJBA 4N11A 5ABRA 2IJYA 4AJ8A 3EE2A 1A0RP 1RK4A 5BMUB 1TU7A 3LEFA 1PX7A 2DKIA 4X0XA 3IPZA 2ES7A 1OC8A 2CQ9A 3QFAC 4EDYA 2JSZA 3DXBA 1XW5A 2K8SA 5DALA 1ZMAA 1THOA 4L0WA 4DSSA 1OAZA 2H74A 3GL5A 3UVHA 1T3BA 4V2MA 1DE2A 1FOVA 3HZ4A 2IFQB 3LYKA 4TXOA 4F82A 2VO4A 2GQKA 4NWYA 2H76A 1TI3A 3ZMLA 2H73A 5CRDA 1ZOFA 4LMVA 4EDZA 3A2WA 3EINA 2PERA 3N5OA 3ZL5A 5ID2B 5IO0A 2FA8A 4QL9A 12GSA 1G6WA 2R0GA 1FAAA 4RUVA 3UMAA 4CY6A 1GSQA 5EL8A 2GDRA 1JZWA 4HJ2A 2MMZA 1M2DA 2FHEA 1B8XA 2WB9A 3ZLPA 1BJXA 4ICYA 4OCEA 1J08A 4IVFA 2C4JA 3HJMA 4Z2TA 2ALBA 4EIQA 2FY6A 2GSQA 1ZZYA 4V1Ap 3F4RA 2IMEA 2L57A 1VF1A 3WYWA 4KW6A 4GWRA 5IOXA 3CSJA 1X5DA 3CWGA 1QXHA 3ZITA 3HXSA 3GURA 1PN0A 4AJ6A 3GIXA 2R37A 3EU3A 3G7YA 4HZ4A 2X64A 1G6YA 4WR5A 4XS4B 2B5XA 4O5RA 3PH9A 1EOHA 3VI5A 1AQXA 1GLPA 1Z6NA 3HD5A 4I5QA 2PWJA 2DJ0A 3HY2A 3L4NA 2GT5A 1YDKA 3H8QA 2B5YA 2CVBA 2HI7A 3Q74A 1VF4A 2LRTA 3QMXA 3UL3A 2H70A 2E7PA 2IL3A 2CZ3A 4JR4A 1JFUA 3M1GA 5G5FA 2O89A 2GSRA 13GSA 2H0GA 1V98A 4OMVA 5JCGA 2C0GA 3M9KA 1TXXA 1SK2A 1THXA 1Q98A 5IMZA 3TB2A 5JWOB 2N5AA 3L9VA 3LW9A 3HCZA 2VCVA 2VAFA 4POKA 5A4UA 2PVQA 2MMAA 5DALB 2OE3A 4DSQA 2AAWA 4OWYA 2O8VB 5KN1A 4DSSB 3QAVA 5JCWA 4K2XA 4AF2A 2DJ2A 5CRHA 1N8JA 4TXOB 2X8GA 4N3ZA 2B1LA 4XRDA 2JACA 2E0QA 4GQCA 4P3YB 1H4OA 2VCTA 2GZYA 1K3LA 4WF5A 4LMWA 3HZ8A 2EC4A 2BJXA 2XC2A 1BQ7A 2AYTA 1SJZA 5ECRB 2H0HA 3WT1A 1J9BA 2FLSA 4GTUA 1B9XC 3U6VA 2MMOA 2J9HA 1V57A 1EWXA 3F0IA 4J56E 3HYPA 2H1BA 3NOFA 4HU7A 1EGOA 3EYTA 3CTFA 4ZB7A 1TK5B 4D73A 1HNAA 3GKXA 1EOGA 3KZQA 2FWFA 5AISA 1MDKA 4EL1A 3N9JA 4QQ7A 4MH2A 4MF6A 5A1NB 5IQYA 2CA8A 2RM5A 5J40A 5IMVA 4XCSA 4GDFA 3LG6A 5ECHB 2R3XA 7GSSA 1DSBA 3H4KA 4TR1A 3HA9A 5HQPA 1Z5YE 1TP9A 2HQTA 3IOSA 3BCKA 2VLVA 1KTEA 4IS0A 3FY7A 3QDNA 6GSTA 3D22A 3M3MA 4KDXA 3TKSA 3I6AA 2O85A 2I4AA 2ZCTA 5ECLB 1ERWA 2MZCA 1TK8B 2OBKA 2O5VA 5G31A 4BL7A 5LNKe 4V2NA 2OE0A 2GVPA 4KB3A 1WE0A 1W4VA 4QL7A 2EIQA 1E2YA 5C00A 4X4JA 5B7CA 4PQHA 1SK1A 3RHBA 3KP8A 1UVZA 5B8BA 2YV7A 4YH2A 3C7MA 6GSVA 3KH9A 3ERGA 3UAPA 1F3AA 2FNOA 2DJJA 4KCEA 3TOUA 5JWQB 4TR4A 4J57E 1CQGA 2DJ3A 4NHZA 4USSA 1QUWA 2ZUPA 3GNJA 2JSYA 1PX6A 3MWHA 3M8NA 5H5RA 1YF1A 1EEJA 2HSMB 2C1YA 3QCPA 4FO5A 3UJ1A 4KDYA 4J2FA 2V41A 3GHAA 5COHA 2CVKA 1Z7PA 3I9V2 2PMTA 2PVOC 1WJKA 3GV1A 5J5NA 1S3CA 4E68A 3G7JA 3TRPA 3L9SA 3F6FA 1V9WA 4LLRA 4ECJA 2IWTA 5J4VA 1LBKA 3QOUA 2CX4A 2CAQA 1BX9A 1TI1A 3W6GA 5D9VA 1F9MA 1OVNA 4D73B 1OE8A 3DVWA 1JZOA 2H6ZA 5G30A 1WPIA 1Z3EA 5KN3A 5INYA 2CT6A 4WBJA 3FZ5A 1NHOA 4TR0A 3KCMA 2CZ2A 2EIRA 1ST9A 1OC3A 3EU4A 4TR1B 2OADA 4ID0A 1ZYNA 5IMCA 4YQUA 4KUNA 4HQZA 3HJPA 3CXGA 2YZUA 3IE3A 4K7OA 1GUKA 3VPTA 1JLWA 2IMIA 2VL3A 3GMFA 1XXUA 2WS2A 1XWCA 2LQOA 1QK8A 4MCUA 1XVQA 1I5GA 2CVDA 1XW9A 4G9HA 1PL2A 3LSZA 4L0UA 2H1LA 1TTZA 4AKGA 1SD8A 3QAWA 4KGIA 4ECCA 3UOMA 1GTIA 2M80A 1Q4JA 4RQRA 4BL7B 3ZVJD 1PD21 4MJEA 2DIZA 2YZHA 3ZIVA 3J7Yb 3FR6A 3IK7A 2A4HA 2NBSA 4FYBA 9GSSA 5HR2A 3PGTA 4FIWA 3TKQA 4DVCA 2C80A 5D73A 4OFNA 1U87A 2HYXA 5EPFA 2V1MA 1SVOA 3I43A 1SVMA 3RBTA 1G7EA 1K0AA 4O32A 3WT2A 1W89A 2EFHA 2QC7A 2VL2C 3VPQA 3ZFBA 1FG4A 2YWNA 5KN2A 20GSA 1SKWB 2CX3A 1AIUA 3KD0A 5EY6A 5CNWA 4WBRD 5KN0A 4V2LA 2FA4A 3F6DA 1QGVA 3KEBA 4XS6A 4NV2A 1USBA 3R2QA 5J41A 1Y6EA 2NPBA 2H6YA 3IHGA 1C72A 2H72A 1JZDA 1K0MA 3TRQA 1HYUA 3ED3A 3BBYA 4L5OA 1MEKA 2YANA 3KMOA 1GL8A 4OD7A 3FW2A 2HSHA 4KA0A 3C71A 4KF9A 3EVIA 2B7JA 4PTSA 3HMJG 5A4WA 5G1KA 1R5AA 4TVEA 2EFCA 5HFIA 2AUVA 1V40A 1U3AA 1GP1A 2P5QA 4YKGA 2YWOA 2XPDA 2P31A 2L6CA 4ECBA 1GUHA 2L5LA 1ZYEA 2WCIA 4NPBA 2AJQB 1M99A 3ZZXA 1GTAA 2AV4A 1PN9A 4MJBA 3W8JA 2PGTA 3EPTA 4IQ1A 1TJDA 1XWBA 4IJ3A 4NAXA 4PNFA 2HFDA 3KM6A 4E8EA 3GA4A 4FQUA 1YY7A 4RI7A 3HVVA 2R2JA 5ELAA 1A2MA 3G9BA 1WIKA 3TCOA 3H1NA 5F07A 1F3BA 2V6KA 4MDCA 1AQVA 5IM9A 1F2EA 2YJ7A 3Q19A 2DKHA 2JADA 3GH9A 1SJIA 2D2ZA 2HLSA 1K0CA 3ZTLA 4PUFC 5G2ZA 3BD2A 2R5GA 1U88A 4ZBDA 1Z9HA 4IELA 5CYYA 5EVOA 1G7OA 4Z7XA 3ZRDA 2GZZA 2FWGA 4RI6A 3TJJA 4ZIJA 1TOFA 4GSTA 4ZBAA 4PQIA 2HRNA 1YZXA 2RIIA 1ON4A 1BYEA 3WGEA 3TKSE 2YOIA 2UZ8A 4OO4A 4Q5QA 5CRWA 4FYUA 1GWCA 3IV4A 2C0EA 1T00A 3TGZA 2X99A 1VRSD 2AHEA 3V1WA 4G0LA 5G5EA 5ECQB 2FD3A 3E3EA 22GSA 1F6MC 2GSTA 4O7HA 2VLTA 5FT3A 5G1LA 2VOCA 1U6TA 2K8VA 2VL2A 5D8IA 2A2SA 2HZEA 2RUFA 1T8EB 1O85A 2N5BA 4EO3A 4KDUA 1O73A 4YAPA 3GSSA 1LJRA 3P8WA 3P2AA 1YKAA 6GSSA 2CV4A 4IHUA 4PGTA 1JHBA 2V2GA 3DGQA 1QFNA 3D4MA 2B3SA 1SJ6A 5A5KA 2E2GA 5E4WA 2XHFA 3CSIA 1GRXA 11GSA 2AB6A 1NSWA 2BMXA 2H30A 1B4PA 5HR1A 3AY8A 3PPUA 3C73A 1LU4A 1VGLA 2X49A 3DD3A 1XWGA 3EC3A 4I2TA 2WGRA 17GSA 1MDIA 1ERUA 4MABA 3Q18A 4MJCA 1SL2B 2DMMA 2LSTA 5DVBA 4JBBA 4ZB9A 4ISDA 3UBKA 4MK3A 2QA1A 1BG5A 1A2JA 1EP8A 3ME8A 4ZILA 1ZYPA 1TDIA 3EMXA 3LFLA 4WETA 1TKDB 2LV3A 1YJ6A 1SK0A 3TOTA 3P90A 1XPVA 2VM2A 3RPNA 4YAVA 16GSA 3UVTA 2B6MA 2Z9SA 3GYKA 1TK0B 2VLUA 1SYXA 1TRUA 3FZ9A 2GQMA 1OC9A 2F3MA 3SWLA 3S9FA 4AJ7A 2F8FA 1FB6A 4EUYA 3LJRA 2J23A 2YNXA 1GUMA 2DC5A 1EGRA 3QD9A 5CP1A 1AAZA 1ABAA 5DCHA 3BCIA 3M0FA 2JZSA 2O87A 3E0UA 1BG1A 4O92A 2HRKA 4EC0A 4I6XA 2VCWA 3TJGA 5A4VA 4BVYA 4IKHA 1A8LA 2VKZG 4POLA 4I97A 2GZPA 1TW9A 2K6VA 1XWKA 3L0HA 1Y25A 5L71A 4Z2RA 4CDOA 4F2IA 3VK9A 4MH3A 2QSIA 3KXOA 2N5FA 2YPMA 2YJHA 3W8SA 3TKRA 2EFEA 2O7KA 2TIRA 5IMFA 1PKZA 2VUPA 2LJRA 3GKKA 3F4SA 4KX4A 1WP0A 2GSSA 1PKWA 3VFIA 1FB0A 1UA5A 4Q5NA 2DJ1A 3KGKA 4OFTA 1VF2A 3ME7A 3A5WA 2REMA 5DDLA 2GT6A 3ZFLA 4L8EA 4N0ZA 2H1AA 1MTCA 5J4YA 1M0UA 4WR4A 4ACSA 3MAKA 1S3DA 1SL0B 4BWSA 3LGCA 2HSNA 1GULA 4GCIA 3QR6A 2FWEA 3EMPA 3D5JA 2PPTA 1B48A 1M9AA 3FRCA 2IN3A 3EWLA 4K9ZA 1BF5A 4TKYA 1KNGA 3ZREA 3IC4A 1N25A 4MF7A 19GSA 4BWQA 4JEDA 3UBLA 2C3TA 2GGTA 1JZRA 4I2UA 3CBUA 1PL1A 2LJAA 3MSZA 4KNDA 4K6XA 3FZAA 5ECIB 3QFBC 2WULA 5F0GA 2IPAA 4NHWA 3R3EA 2R0PA 4TRXA 1N2AA 2GLRA 2WRTA 1ACVA 2G0FA 3APOA 1FO5A 4NV5A 3A3TA 3IK9A 3US3A 1SYRA 1OC9B 3GN3A 1SKSB 2KUCA 4MPGA 3TU3B 5A34A 5IOWA 1XOBA 4KAEA 4YQVA 5IO2A 4X1UA 2HRFA 2VIMA 3CYNA 2GQLA 4EIPA 2QA2A 4IQAA 2FGXA 3DVXA 4WXTA 2LQQA 4TOPA 1NM3A 1X9MB 2HRKB 4G0KA 4K5RA 3RAZA 4BVYB 1ZYQB 5KOXA 4ZL8A 5AN1A 4G0IA 1GSUA 2YV9A 4JU5A 4Q5FA 1PGTA 3JCML 4JRRA 5BMUA 4XTSA 2ON7A 4N10A 3Q6OA 4TW5A 4IP6A 2IMDA 2KLXA 4GLTA 3FR3A 2CAIA 2L6DA 4HU9A 3G7IA 3DKSA 4ILFA 1OKTA 2P5RA 3LYPA 2HZFA 4BA7A 4EE0A 4I8BA 2H19A 5F8BA 3MDKA 3UARA 4WEYA 5JWRB 4JZQA 2IFQA 5J9CA 4HOJA 3ISOA 5IPHA 2OE1A 4GRFA 3CMIA 1PMTA 2K18A 4NMUA 2OA7A 3BOAA 2KP2A 5D9XA 4Z2UA 4PUAA 1M2AA 4DEJA 4MNNA 1VF3A 1XFLA 3FYGA 2XBIA 2F51A 1X9SB 2LUSA 4EF0A 2VD1A 6GSYA 1X0RA 4ZB8A 1AW9A 5D9WA 1H75A 2B7KA 2C0DA 2LKUA 2IMFA 3C8EA 3FZ4A 3MYDA 2PUKC 1R26A 1ZGNA 2R6KA 4RQXA 4EXJA 5KEJA 3J7Yk 4TR3A 1RQMA 1ILOA 1BEDA 14GSA 3EURA 2M72A 2YWIA 1DBYA 2QGVA 4HEA2 3UIWA 3HDCA 3CSHA 2YWMA 6GSXA 5DAKA 1O8WA 1M7TA 4JE1A 4HZ2A 3ERFA 3KH7A 5H5QA 5D96A 1SKRB 3O6TA 3ZIJA 1FHEA 2OJLA 3RPPA 4K7IA 2H71A 4GXZA 4ULXA 2MBSA 2C3QA 2ZNMA 4F0BA 5LCZA 2LJKA 3D6IA 3F4TA 5CREA 4GQFA 5HFKA 3APQA 3VI7A 5B6MA 1GNEA 5H5SA 1EP7A 2DJKA 3P7XA 2BTOT 2LNSA 1A8YA 4KE3A 2LS5A 5IIZA 3GX0A 4POMA 4HI7A 3A2VA 5ECSA 1AXDA 3HVSA 4KSOA 2DBCA 4LL1B 2H75A 1IYHA 3VWVA 4A5PA 4MA9A 3GH6A 2KHPA 1SD9A 2B5EA 1WRYA 2VCQA 4HS1A 1HQOA 2H66A 1K0OA 4F9ZA 1QQ2A 3CRUA 3ZYWA 4AI6A 3TJKA 3FK8A 1FVKA 2R4VA 3APSA 5AIVA 4ZL7A 4ZBBA 3H93A 4L5LA 1XW6A 1AC1A 1EEMA 3VLNA 3GSTA 1UN2A 2HSYA 3DRNA 3RDWA 4MJAA 1EV9A 2LRCA 1O6JA 4AKXB 2VCXA 5DJLA 1B4QA 3IC8A 4IGJA 1R5PA 1XCCA 2YP6A 1GSFA 1K0NA 2RM6A 3TKSC 2V32A 4WKWA 3PR8A 2F9SA 2JL4A 1S3AA 4MPFA 1MDJA 2H1DA 5FHIA 3DYRA 5A1NA 3HVXA 1GH2A 1GTUA 4KCAA 1K0DA 1OYJA 5GSSA 4JR6A 4TXVA 2FCHA 2JU5A 3M9JA 2LNTA 3U5RE 2H6XA 3GKNA 3GRXA 5ECKB 1XOAA 4MZWA 1V58A 4MMMA 2A2RA 4F03A 3FKFA 2WDUA 2G2QA 3KTBA 5DAKB 4OCFA 4K0NA 4BVXA 2H8LA 4XRAA 3D0ZA 3HJOA 1U3IA 1DE1A 3IR4A 4ML6A 4PQ1A 1CQHA 5B6NA 3KIJA 1Y1UA 4IJIA 2V6OA 1YKCA 5LD0A 3GFKA 1X5EA 5GSTA 1WWJA 3IA1A 4LA1A 1KBNA 1DUGA 3K8NA 1PRXA 4K7NA 3GTUA 2QKEA 4LL4B 1GSDA 1A23A 3BJ5A 1YQ1A 1ZL9A 1SU9A 1ML6A 2F8AA 1TRWA 2HT9A 3VWXA 3F63A 4HQSA 2HE3A 1G0TA 2L5OA 3L78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMK A;  4GSN A;  1XBS A;  5D93 A;  2K9F A;  1A24 A;  2C8U A;  3HHV A;  2DSA A;  3HKR A;  2HSM A;  5HR3 A;  2HRA A;  3FR9 A;  3OR5 A;  2LEG A;  3FHK A;  1K3Y A;  1RW1 A;  1HNC A;  2NTO A;  2M46 A;  6GSU A;  2IIY A;  1J0F A;  3QAG A;  3LXZ A;  1TRS A;  4GSS A;  4K1F A;  2I81 A;  2VD0 A;  4Q5R A;  4WF4 A;  3ERW A;  4H86 A;  4OO5 A;  4XIH A;  3PIN A;  4N0V A;  4PX1 A;  1Z7R A;  5F05 A;  4POB A;  1ZCP A;  1OKD A;  1EZK A;  1GSE A;  5DCG A;  4F0C A;  2YCD A;  1HD2 A;  1I9D A;  1EV4 A;  2HZE B;  3TRX A;  2TRC P;  3SBC A;  3QPM A;  3KMN A;  3LWA A;  5CO3 A;  4TN8 A;  3GKM A;  4IBP A;  3ZMK A;  1M2B A;  2OAC A;  5IMA A;  3IAS 2;  1Z6M A;  4BVX B;  2X8H A;  5ENU A;  1AQW A;  1JLV A;  5ELG A;  3A2X A;  5C04 A;  1T1V A;  4HJM A;  3FEU A;  3IXR A;  1BAY A;  4EVM A;  1IYI A;  1FVJ A;  4HDE A;  2NDO A;  3TDG A;  4K8M A;  3KP9 A;  18GS A;  5ECM B;  3KTL A;  4G2E A;  3TJF A;  5GAN D;  1SL1 B;  4V1A g;  3VUR A;  4ZXG A;  3GTU B;  5J4U A;  3NZN A;  1MD4 A;  3LQ7 A;  4MF5 A;  4BPY A;  4FH8 A;  1MD3 A;  4PUR A;  3IRA A;  1KEB A;  2MBT A;  5IMD A;  1HNB A;  3VWW A;  1GSS A;  4N30 A;  2JZR A;  2OKA A;  3WGX A;  2GTU A;  1NW2 A;  3GX8 A;  4XHM A;  1O8X A;  3F9U A;  3E9J B;  2P0G A;  3VWU A;  1GSY A;  1XVW A;  2L59 A;  4CW9 A;  3IHQ A;  3LOR A;  3MNG A;  1K0B A;  3IBH A;  2ON5 A;  2YN1 A;  1ERV A;  2MYG A;  4CHS A;  1UC7 A;  3CTG A;  5JCU A;  4MP4 A;  3L9U A;  2VL9 A;  4K0G A;  3D4T A;  3GL3 A;  1FW1 A;  3IAM 2;  2TRX A;  3LXT A;  2OBI A;  2WZ9 A;  2I1U A;  2HNL A;  1X9W B;  1XZO A;  2MMN A;  4PNG A;  1GTB A;  1PSQ A;  4NXI A;  4XS1 A;  2JZT A;  1X5C A;  3TKP A;  4EKZ A;  1WOU A;  4PXO A;  4E8H A;  2VM1 A;  2LRN A;  4DSR A;  3TUE A;  5CRG A;  2PBJ A;  5AGY A;  2H1G A;  1ERT A;  3F3R A;  2PN8 A;  1PA3 A;  1A0F A;  5ECO B;  2C0F A;  4AGS A;  2X8C A;  1OE7 A;  4ECI A;  4G10 A;  2XBQ A;  4K2D A;  1PQN A;  2RUE A;  2WFC A;  4KH7 A;  5HFG A;  6GSW A;  1T4Z A;  3NIV A;  1R7H A;  4X43 A;  4MLY A;  2C3N A;  1URM A;  2DIY A;  3I69 A;  2H0I A;  3UEM A;  3DWV A;  8GSS A;  2RLI A;  5ECN B;  4MZB A;  3F8U A;  1TU8 A;  2EIO A;  3DEX A;  1F37 A;  10GS A;  1K3O A;  1TRV A;  4IP1 A;  4ZL9 A;  5ID2 A;  2KP1 A;  5DQY A;  1GLQ A;  1GNW A;  4IN0 A;  2HXK A;  3WGD A;  1T7P B;  3O76 A;  4G19 A;  1A2L A;  5J9B A;  1R4W A;  5DJM A;  1O81 A;  3C1S A;  2I3Y A;  2XPE A;  4ZB6 A;  2HSN B;  5DQS A;  1WMJ A;  3GUS A;  5GAP D;  4YQM A;  5IPG A;  5AIX A;  1T4Y A;  1YEX A;  1YEP A;  3F3Q A;  2I9H A;  5HR0 A;  5F06 A;  5ECP B;  5CAX A;  1XWA A;  3D21 A;  3C1R A;  1V2A A;  5B8A A;  3RHC A;  2B1K A;  4ML1 A;  5J3R A;  2L4C A;  1M9B A;  3DIE A;  2WJU A;  4FYC A;  5DBQ A;  5GZZ B;  4KSM A;  3H79 A;  2DML A;  3DML A;  2GS3 A;  3ZVJ A;  4OFM A;  4XS4 A;  4IW9 A;  1SEN A;  5D9T A;  5FWG A;  2FUG 2;  3WD6 A;  1AUC A;  1XIY A;  1YF0 A;  2DLX A;  3CRT A;  2VCZ A;  3KJY A;  5E59 A;  2LTK A;  2PU9 C;  1O7U A;  4HUA A;  4MZC A;  3IDV A;  1E6B A;  2A4V A;  1NHY A;  2H01 A;  2E2M A;  2NVL A;  2KOK A;  1B9Y C;  4GF0 A;  1QMV A;  3O3T A;  2L4Q A;  2FWH A;  3TJB A;  4N11 A;  5ABR A;  2IJY A;  4AJ8 A;  3EE2 A;  1A0R P;  1RK4 A;  1TU7 A;  3LEF A;  1PX7 A;  4X0X A;  3IPZ A;  2ES7 A;  1OC8 A;  2CQ9 A;  3QFA C;  4EDY A;  2JSZ A;  3DXB A;  1XW5 A;  2K8S A;  5DAL A;  1ZMA A;  1THO A;  4L0W A;  4DSS A;  1OAZ A;  2H74 A;  3GL5 A;  3UVH A;  1T3B A;  4V2M A;  1DE2 A;  1FOV A;  3HZ4 A;  2IFQ B;  3LYK A;  4TXO A;  4F82 A;  2VO4 A;  2GQK A;  4NWY A;  2H76 A;  1TI3 A;  3ZML A;  2H73 A;  5CRD A;  1ZOF A;  4LMV A;  4EDZ A;  3A2W A;  3EIN A;  2PER A;  3N5O A;  3ZL5 A;  5ID2 B;  5IO0 A;  2FA8 A;  4QL9 A;  12GS A;  1G6W A;  4RUV A;  1FAA A;  3UMA A;  1GSQ A;  5EL8 A;  2GDR A;  1JZW A;  4HJ2 A;  2MMZ A;  1M2D A;  2FHE A;  1B8X A;  2WB9 A;  3ZLP A;  1BJX A;  4OCE A;  1J08 A;  4IVF A;  2C4J A;  3HJM A;  2ALB A;  2FY6 A;  2GSQ A;  1ZZY A;  4V1A p;  3F4R A;  2IME A;  2L57 A;  1VF1 A;  3WYW A;  4KW6 A;  4GWR A;  5IOX A;  3CSJ A;  1X5D A;  1QXH A;  3ZIT A;  3HXS A;  3GUR A;  4AJ6 A;  3GIX A;  2R37 A;  3EU3 A;  3G7Y A;  4HZ4 A;  2X64 A;  1G6Y A;  4WR5 A;  4XS4 B;  2B5X A;  4O5R A;  3PH9 A;  1EOH A;  3VI5 A;  1AQX A;  1GLP A;  1Z6N A;  3HD5 A;  4I5Q A;  2PWJ A;  2DJ0 A;  3HY2 A;  3L4N A;  2GT5 A;  1YDK A;  3H8Q A;  2B5Y A;  2CVB A;  2HI7 A;  3Q74 A;  1VF4 A;  2LRT A;  3QMX A;  3UL3 A;  2H70 A;  2E7P A;  2IL3 A;  2CZ3 A;  4JR4 A;  1JFU A;  3M1G A;  5G5F A;  2O89 A;  2GSR A;  13GS A;  2H0G A;  1V98 A;  4OMV A;  5JCG A;  2C0G A;  3M9K A;  1TXX A;  1SK2 A;  1THX A;  1Q98 A;  5IMZ A;  3TB2 A;  5JWO B;  2N5A A;  3L9V A;  3HCZ A;  2VCV A;  2VAF A;  4POK A;  5A4U A;  2PVQ A;  2MMA A;  5DAL B;  2OE3 A;  4DSQ A;  2AAW A;  4OWY A;  2O8V B;  5KN1 A;  4DSS B;  3QAV A;  5JCW A;  4AF2 A;  2DJ2 A;  5CRH A;  1N8J A;  4TXO B;  2X8G A;  2B1L A;  4XRD A;  2JAC A;  2E0Q A;  4GQC A;  4P3Y B;  1H4O A;  2VCT A;  2GZY A;  1K3L A;  4WF5 A;  4LMW A;  3HZ8 A;  2EC4 A;  2BJX A;  2XC2 A;  1BQ7 A;  2AYT A;  1SJZ A;  5ECR B;  2H0H A;  3WT1 A;  1J9B A;  2FLS A;  4GTU A;  1B9X C;  3U6V A;  2MMO A;  2J9H A;  1V57 A;  1EWX A;  3F0I A;  4J56 E;  3HYP A;  2H1B A;  3NOF A;  4HU7 A;  1EGO A;  3EYT A;  3CTF A;  1TK5 B;  4D73 A;  1HNA A;  3GKX A;  1EOG A;  3KZQ A;  2FWF A;  5AIS A;  1MDK A;  4EL1 A;  3N9J A;  4QQ7 A;  4MH2 A;  4MF6 A;  5IQY A;  2CA8 A;  2RM5 A;  5IMV A;  4XCS A;  3LG6 A;  5ECH B;  2R3X A;  7GSS A;  1DSB A;  3H4K A;  4TR1 A;  3HA9 A;  5HQP A;  1Z5Y E;  1TP9 A;  2HQT A;  3IOS A;  3BCK A;  2VLV A;  1KTE A;  4IS0 A;  3FY7 A;  3QDN A;  6GST A;  3D22 A;  3M3M A;  4KDX A;  3TKS A;  3I6A A;  2O85 A;  2I4A A;  2ZCT A;  5ECL B;  1ERW A;  2MZC A;  1TK8 B;  2OBK A;  5G31 A;  4BL7 A;  5LNK e;  4V2N A;  2OE0 A;  2GVP A;  4KB3 A;  1WE0 A;  1W4V A;  4QL7 A;  2EIQ A;  1E2Y A;  5C00 A;  5B7C A;  4PQH A;  1SK1 A;  3RHB A;  3KP8 A;  1UVZ A;  5B8B A;  2YV7 A;  4YH2 A;  3C7M A;  6GSV A;  3KH9 A;  3ERG A;  3UAP A;  1F3A A;  2FNO A;  2DJJ A;  4KCE A;  3TOU A;  5JWQ B;  4TR4 A;  4J57 E;  1CQG A;  2DJ3 A;  4NHZ A;  4USS A;  1QUW A;  2ZUP A;  3GNJ A;  2JSY A;  1PX6 A;  3MWH A;  3M8N A;  5H5R A;  1YF1 A;  1EEJ A;  2HSM B;  2C1Y A;  3QCP A;  4FO5 A;  3UJ1 A;  4KDY A;  4J2F A;  2V41 A;  3GHA A;  5COH A;  2CVK A;  1Z7P A;  3I9V 2;  2PMT A;  2PVO C;  1WJK A;  3GV1 A;  5J5N A;  1S3C A;  3G7J A;  3TRP A;  3L9S A;  3F6F A;  1V9W A;  4LLR A;  4ECJ A;  2IWT A;  1LBK A;  3QOU A;  2CX4 A;  2CAQ A;  1BX9 A;  1TI1 A;  3W6G A;  5D9V A;  1F9M A;  1OVN A;  4D73 B;  1OE8 A;  3DVW A;  1JZO A;  2H6Z A;  5G30 A;  1WPI A;  1Z3E A;  5KN3 A;  5INY A;  2CT6 A;  4WBJ A;  3FZ5 A;  1NHO A;  4TR0 A;  3KCM A;  2CZ2 A;  2EIR A;  1ST9 A;  1OC3 A;  3EU4 A;  4TR1 B;  2OAD A;  4ID0 A;  5IMC A;  4YQU A;  4KUN A;  4HQZ A;  3HJP A;  3CXG A;  2YZU A;  3IE3 A;  4K7O A;  1GUK A;  3VPT A;  1JLW A;  2IMI A;  2VL3 A;  3GMF A;  1XXU A;  2WS2 A;  1XWC A;  2LQO A;  1QK8 A;  4MCU A;  1XVQ A;  1I5G A;  2CVD A;  1XW9 A;  4G9H A;  1PL2 A;  3LSZ A;  4L0U A;  1TTZ A;  1SD8 A;  3QAW A;  4KGI A;  4ECC A;  3UOM A;  1GTI A;  2M80 A;  1Q4J A;  4RQR A;  4BL7 B;  3ZVJ D;  1PD2 1;  4MJE A;  2DIZ A;  2YZH A;  3ZIV A;  3J7Y b;  3FR6 A;  3IK7 A;  2NBS A;  4FYB A;  9GSS A;  5HR2 A;  3PGT A;  4FIW A;  3TKQ A;  4DVC A;  2C80 A;  5D73 A;  4OFN A;  1U87 A;  2HYX A;  5EPF A;  2V1M A;  3I43 A;  3RBT A;  1G7E A;  1K0A A;  4O32 A;  3WT2 A;  1W89 A;  2QC7 A;  2VL2 C;  3VPQ A;  3ZFB A;  1FG4 A;  2YWN A;  5KN2 A;  20GS A;  1SKW B;  2CX3 A;  1AIU A;  3KD0 A;  5EY6 A;  5CNW A;  4WBR D;  5KN0 A;  4V2L A;  2FA4 A;  3F6D A;  1QGV A;  3KEB A;  4XS6 A;  4NV2 A;  1USB A;  3R2Q A;  5J41 A;  1Y6E A;  2NPB A;  2H6Y A;  1C72 A;  2H72 A;  1JZD A;  1K0M A;  3TRQ A;  1HYU A;  3ED3 A;  3BBY A;  4L5O A;  1MEK A;  2YAN A;  3KMO A;  1GL8 A;  4OD7 A;  3FW2 A;  2HSH A;  4KA0 A;  3C71 A;  4KF9 A;  3EVI A;  2B7J A;  4PTS A;  5A4W A;  5G1K A;  1R5A A;  4TVE A;  5HFI A;  2AUV A;  1V40 A;  1U3A A;  1GP1 A;  2P5Q A;  2YWO A;  2XPD A;  2P31 A;  2L6C A;  4ECB A;  1GUH A;  2L5L A;  1ZYE A;  2WCI A;  4NPB A;  2AJQ B;  1M99 A;  3ZZX A;  1GTA A;  2AV4 A;  1PN9 A;  4MJB A;  3W8J A;  2PGT A;  4IQ1 A;  1TJD A;  1XWB A;  4IJ3 A;  4NAX A;  4PNF A;  2HFD A;  3KM6 A;  4E8E A;  3GA4 A;  4FQU A;  1YY7 A;  4RI7 A;  3HVV A;  2R2J A;  5ELA A;  1A2M A;  3G9B A;  1WIK A;  3TCO A;  3H1N A;  5F07 A;  1F3B A;  2V6K A;  4MDC A;  1AQV A;  5IM9 A;  1F2E A;  2YJ7 A;  3Q19 A;  2JAD A;  3GH9 A;  1SJI A;  2D2Z A;  2HLS A;  1K0C A;  3ZTL A;  4PUF C;  5G2Z A;  3BD2 A;  2R5G A;  1U88 A;  4ZBD A;  1Z9H A;  4IEL A;  5CYY A;  5EVO A;  1G7O A;  4Z7X A;  3ZRD A;  2GZZ A;  2FWG A;  4RI6 A;  3TJJ A;  4ZIJ A;  1TOF A;  4GST A;  4ZBA A;  4PQI A;  2HRN A;  1YZX A;  2RII A;  1ON4 A;  1BYE A;  3WGE A;  3TKS E;  2YOI A;  2UZ8 A;  4OO4 A;  4Q5Q A;  5CRW A;  4FYU A;  1GWC A;  3IV4 A;  2C0E A;  1T00 A;  3TGZ A;  2X99 A;  1VRS D;  2AHE A;  3V1W A;  4G0L A;  5G5E A;  5ECQ B;  2FD3 A;  3E3E A;  22GS A;  1F6M C;  2GST A;  4O7H A;  2VLT A;  5FT3 A;  5G1L A;  2VOC A;  1U6T A;  2K8V A;  2VL2 A;  5D8I A;  2A2S A;  2HZE A;  2RUF A;  1T8E B;  1O85 A;  2N5B A;  4EO3 A;  4KDU A;  1O73 A;  4YAP A;  3GSS A;  1LJR A;  3P8W A;  3P2A A;  1YKA A;  6GSS A;  2CV4 A;  4IHU A;  4PGT A;  1JHB A;  2V2G A;  3DGQ A;  1QFN A;  3D4M A;  2B3S A;  1SJ6 A;  5A5K A;  2E2G A;  5E4W A;  2XHF A;  3CSI A;  1GRX A;  11GS A;  2AB6 A;  1NSW A;  2BMX A;  2H30 A;  1B4P A;  5HR1 A;  3AY8 A;  3PPU A;  3C73 A;  1LU4 A;  1VGL A;  3DD3 A;  1XWG A;  3EC3 A;  4I2T A;  2WGR A;  17GS A;  1MDI A;  1ERU A;  4MAB A;  3Q18 A;  4MJC A;  1SL2 B;  2DMM A;  2LST A;  5DVB A;  4JBB A;  4ZB9 A;  4ISD A;  3UBK A;  4MK3 A;  1BG5 A;  1A2J A;  1EP8 A;  3ME8 A;  4ZIL A;  1TDI A;  3EMX A;  3LFL A;  4WET A;  1TKD B;  2LV3 A;  1YJ6 A;  1SK0 A;  3TOT A;  3P90 A;  1XPV A;  2VM2 A;  3RPN A;  4YAV A;  16GS A;  3UVT A;  2B6M A;  2Z9S A;  3GYK A;  1TK0 B;  2VLU A;  1SYX A;  1TRU A;  3FZ9 A;  2GQM A;  1OC9 A;  2F3M A;  3SWL A;  3S9F A;  4AJ7 A;  2F8F A;  1FB6 A;  4EUY A;  3LJR A;  2J23 A;  2YNX A;  1GUM A;  2DC5 A;  1EGR A;  3QD9 A;  5CP1 A;  1AAZ A;  1ABA A;  5DCH A;  3BCI A;  3M0F A;  2JZS A;  2O87 A;  3E0U A;  4O92 A;  2HRK A;  4EC0 A;  4I6X A;  2VCW A;  3TJG A;  5A4V A;  4BVY A;  4IKH A;  1A8L A;  4POL A;  4I97 A;  2GZP A;  1TW9 A;  2K6V A;  1XWK A;  3L0H A;  1Y25 A;  5L71 A;  4CDO A;  4F2I A;  3VK9 A;  4MH3 A;  2QSI A;  3KXO A;  2N5F A;  2YPM A;  2YJH A;  3W8S A;  3TKR A;  2O7K A;  2TIR A;  5IMF A;  1PKZ A;  2VUP A;  2LJR A;  3GKK A;  3F4S A;  4KX4 A;  1WP0 A;  2GSS A;  1PKW A;  3VFI A;  1FB0 A;  1UA5 A;  4Q5N A;  2DJ1 A;  3KGK A;  4OFT A;  1VF2 A;  3ME7 A;  3A5W A;  2REM A;  5DDL A;  2GT6 A;  3ZFL A;  4L8E A;  4N0Z A;  2H1A A;  1MTC A;  1M0U A;  4WR4 A;  4ACS A;  3MAK A;  1S3D A;  1SL0 B;  4BWS A;  3LGC A;  1GUL A;  4GCI A;  3QR6 A;  2FWE A;  3EMP A;  3D5J A;  2PPT A;  1B48 A;  1M9A A;  3FRC A;  2IN3 A;  3EWL A;  4K9Z A;  4TKY A;  1KNG A;  3ZRE A;  3IC4 A;  4MF7 A;  19GS A;  4BWQ A;  4JED A;  3UBL A;  2C3T A;  2GGT A;  1JZR A;  4I2U A;  3CBU A;  1PL1 A;  2LJA A;  3MSZ A;  4KND A;  4K6X A;  3FZA A;  5ECI B;  3QFB C;  2WUL A;  5F0G A;  2IPA A;  4NHW A;  3R3E A;  4TRX A;  1N2A A;  2GLR A;  2WRT A;  1ACV A;  2G0F A;  3APO A;  1FO5 A;  4NV5 A;  3A3T A;  3IK9 A;  3US3 A;  1SYR A;  1OC9 B;  3GN3 A;  1SKS B;  2KUC A;  4MPG A;  5IOW A;  1XOB A;  4KAE A;  4YQV A;  5IO2 A;  4X1U A;  2HRF A;  2VIM A;  3CYN A;  2GQL A;  4IQA A;  2FGX A;  3DVX A;  4WXT A;  2LQQ A;  4TOP A;  1NM3 A;  1X9M B;  2HRK B;  4G0K A;  3RAZ A;  4BVY B;  1ZYQ B;  4ZL8 A;  5AN1 A;  4G0I A;  1GSU A;  2YV9 A;  4JU5 A;  4Q5F A;  1PGT A;  3JCM L;  4JRR A;  5BMU A;  4XTS A;  2ON7 A;  4N10 A;  3Q6O A;  4TW5 A;  4IP6 A;  2IMD A;  2KLX A;  4GLT A;  3FR3 A;  2CAI A;  2L6D A;  4HU9 A;  3G7I A;  3DKS A;  4ILF A;  1OKT A;  2P5R A;  3LYP A;  2HZF A;  4BA7 A;  4EE0 A;  4I8B A;  2H19 A;  5F8B A;  3MDK A;  3UAR A;  4WEY A;  5JWR B;  4JZQ A;  2IFQ A;  5J9C A;  4HOJ A;  3ISO A;  5IPH A;  2OE1 A;  4GRF A;  3CMI A;  1PMT A;  2K18 A;  4NMU A;  2OA7 A;  3BOA A;  2KP2 A;  5D9X A;  4PUA A;  1M2A A;  4DEJ A;  1VF3 A;  1XFL A;  3FYG A;  2XBI A;  2F51 A;  1X9S B;  2LUS A;  4EF0 A;  2VD1 A;  6GSY A;  1X0R A;  4ZB8 A;  1AW9 A;  5D9W A;  1H75 A;  2B7K A;  2C0D A;  2LKU A;  2IMF A;  3C8E A;  3FZ4 A;  2PUK C;  1R26 A;  1ZGN A;  2R6K A;  4RQX A;  4EXJ A;  5KEJ A;  3J7Y k;  4TR3 A;  1RQM A;  1ILO A;  1BED A;  14GS A;  3EUR A;  2M72 A;  2YWI A;  1DBY A;  2QGV A;  4HEA 2;  3UIW A;  3HDC A;  3CSH A;  2YWM A;  6GSX A;  5DAK A;  1O8W A;  1M7T A;  4JE1 A;  4HZ2 A;  3ERF A;  3KH7 A;  5H5Q A;  5D96 A;  1SKR B;  3O6T A;  3ZIJ A;  1FHE A;  2OJL A;  3RPP A;  4K7I A;  2H71 A;  4GXZ A;  4ULX A;  2MBS A;  2C3Q A;  2ZNM A;  4F0B A;  5LCZ A;  2LJK A;  3D6I A;  3F4T A;  5CRE A;  4GQF A;  5HFK A;  3APQ A;  3VI7 A;  5B6M A;  1GNE A;  5H5S A;  1EP7 A;  2DJK A;  3P7X A;  2BTO T;  2LNS A;  1A8Y A;  4KE3 A;  2LS5 A;  5IIZ A;  3GX0 A;  4POM A;  4HI7 A;  3A2V A;  5ECS A;  1AXD A;  3HVS A;  4KSO A;  2DBC A;  4LL1 B;  2H75 A;  1IYH A;  3VWV A;  4MA9 A;  3GH6 A;  2KHP A;  1SD9 A;  2B5E A;  1WRY A;  2VCQ A;  4HS1 A;  1HQO A;  2H66 A;  1K0O A;  4F9Z A;  1QQ2 A;  3CRU A;  3ZYW A;  3TJK A;  3FK8 A;  1FVK A;  2R4V A;  3APS A;  5AIV A;  4ZL7 A;  4ZBB A;  3H93 A;  4L5L A;  1XW6 A;  1AC1 A;  1EEM A;  3VLN A;  3GST A;  1UN2 A;  2HSY A;  3DRN A;  3RDW A;  4MJA A;  1EV9 A;  2LRC A;  1O6J A;  2VCX A;  5DJL A;  1B4Q A;  3IC8 A;  4IGJ A;  1R5P A;  1XCC A;  2YP6 A;  1GSF A;  1K0N A;  2RM6 A;  3TKS C;  2V32 A;  4WKW A;  3PR8 A;  2F9S A;  2JL4 A;  1S3A A;  4MPF A;  1MDJ A;  2H1D A;  5FHI A;  3DYR A;  3HVX A;  1GH2 A;  1GTU A;  4KCA A;  1K0D A;  1OYJ A;  5GSS A;  4JR6 A;  4TXV A;  2FCH A;  2JU5 A;  3M9J A;  2LNT A;  3U5R E;  2H6X A;  3GKN A;  3GRX A;  5ECK B;  1XOA A;  4MZW A;  1V58 A;  4MMM A;  2A2R A;  4F03 A;  3FKF A;  2WDU A;  2G2Q A;  3KTB A;  5DAK B;  4OCF A;  4K0N A;  4BVX A;  2H8L A;  4XRA A;  3D0Z A;  3HJO A;  1U3I A;  1DE1 A;  3IR4 A;  4ML6 A;  4PQ1 A;  1CQH A;  5B6N A;  3KIJ A;  4IJI A;  2V6O A;  1YKC A;  5LD0 A;  3GFK A;  1X5E A;  5GST A;  1WWJ A;  3IA1 A;  4LA1 A;  1KBN A;  1DUG A;  3K8N A;  1PRX A;  4K7N A;  3GTU A;  2QKE A;  4LL4 B;  1GSD A;  1A23 A;  3BJ5 A;  1YQ1 A;  1ZL9 A;  1SU9 A;  1ML6 A;  2F8A A;  1TRW A;  2HT9 A;  3VWX A;  3F63 A;  4HQS A;  2HE3 A;  1G0T A;  2L5O A;  3L78 A; 
#chains in the Genus database with same CATH topology
 2EFD A;  5KOW A;  2IMK A;  4GSN A;  1XBS A;  5D93 A;  2K9F A;  1A24 A;  2C8U A;  3HHV A;  2DSA A;  3HKR A;  2HSM A;  5HR3 A;  2HRA A;  3FR9 A;  4AKI A;  3OR5 A;  2LEG A;  3FHK A;  1K3Y A;  1RW1 A;  1HNC A;  3A5I A;  4CY8 A;  2NTO A;  2M46 A;  6GSU A;  2IIY A;  1J0F A;  3QAG A;  3LXZ A;  5BRT A;  1TRS A;  4GSS A;  2X4A A;  4K1F A;  2I81 A;  2VD0 A;  4Q5R A;  4WF4 A;  3ERW A;  4H86 A;  4OO5 A;  4XIH A;  3PIN A;  4N0V A;  4PX1 A;  1Z7R A;  5F05 A;  4POB A;  1ZCP A;  1OKD A;  1EZK A;  1GSE A;  5DCG A;  4F0C A;  2YCD A;  1HD2 A;  1I9D A;  1EV4 A;  2HZE B;  3TRX A;  4O5U A;  2TRC P;  3SBC A;  3QPM A;  3KMN A;  3LWA A;  5CO3 A;  4TN8 A;  3CQF A;  3GKM A;  4IBP A;  3ZMK A;  1M2B A;  1YEW C;  2OAC A;  5IMA A;  3IAS 2;  4PHZ C;  4BVX B;  1Z6M A;  3FMW A;  2X8H A;  5ENU A;  1AQW A;  1JLV A;  5ELG A;  3A2X A;  5C04 A;  1T1V A;  4HJM A;  5A5H A;  3FEU A;  3IXR A;  1BAY A;  4EVM A;  1IYI A;  1FVJ A;  4HDE A;  2NDO A;  2O3E A;  2WVX B;  1M3I A;  4W66 A;  3TDG A;  4K8M A;  3KP9 A;  5J47 A;  18GS A;  5ECM B;  3KTL A;  4G2E A;  3TJF A;  5GAN D;  1SL1 B;  4V1A g;  3VUR A;  4ZXG A;  3GTU B;  5J4U A;  2A2P A;  3NZN A;  1MD4 A;  2UV8 G;  3LQ7 A;  4MF5 A;  4BPY A;  4FH8 A;  1MD3 A;  4PUR A;  3IRA A;  1KEB A;  2MBT A;  5IMD A;  1HNB A;  3VWW A;  1GSS A;  4N30 A;  2JZR A;  2OKA A;  3WGX A;  2GTU A;  1NW2 A;  3GX8 A;  4XHM A;  4YKF A;  1O8X A;  3F9U A;  3E9J B;  2P0G A;  3VWU A;  1GSY A;  1XVW A;  2L59 A;  4CW9 A;  3IHQ A;  3LOR A;  3MNG A;  1K0B A;  3IBH A;  2ON5 A;  2YN1 A;  1ERV A;  2MYG A;  4CHS A;  1UC7 A;  3CTG A;  4AKH A;  1SVL A;  5JCU A;  4MP4 A;  3L9U A;  2VL9 A;  4K0G A;  3D4T A;  3GL3 A;  1FW1 A;  3IAM 2;  2TRX A;  3LXT A;  2R0C A;  2OBI A;  2WZ9 A;  2I1U A;  2HNL A;  1X9W B;  1XZO A;  2MMN A;  4PNG A;  1GTB A;  1PSQ A;  4NXI A;  4XS1 A;  2JZT A;  1X5C A;  3TKP A;  4EKZ A;  1WOU A;  4PXO A;  4E8H A;  2VM1 A;  2LRN A;  4DSR A;  3MIX A;  3TUE A;  5CRG A;  2PBJ A;  5AGY A;  2H1G A;  1ERT A;  3F3R A;  2PN8 A;  1PA3 A;  1A0F A;  5ECO B;  2C0F A;  4AGS A;  1TXU A;  2X8C A;  1OE7 A;  4ECI A;  4G10 A;  2XBQ A;  4K2D A;  1PQN A;  2RUE A;  2WFC A;  4KH7 A;  1XG8 A;  5HFG A;  6GSW A;  1T4Z A;  3NIV A;  1R7H A;  1FOH A;  4X43 A;  4MLY A;  2C3N A;  1URM A;  2DIY A;  3I69 A;  2H0I A;  3UEM A;  3DWV A;  8GSS A;  2RLI A;  4K5S A;  5ECN B;  4MZB A;  3F8U A;  1YVL A;  1TU8 A;  2EIO A;  3DEX A;  1F37 A;  10GS A;  1K3O A;  2WVZ A;  2OT3 A;  1TRV A;  4IP1 A;  4ZL9 A;  5A5H B;  5ID2 A;  2KP1 A;  5DQY A;  1GLQ A;  1GNW A;  4IN0 A;  2HXK A;  3WGD A;  1T7P B;  3O76 A;  4G19 A;  1A2L A;  5J9B A;  1R4W A;  5DJM A;  1O81 A;  3C1S A;  2I3Y A;  2XPE A;  4ZB6 A;  4O5Q A;  2HSN B;  5DQS A;  1WMJ A;  3GUS A;  5GAP D;  4YQM A;  5IPG A;  5AIX A;  1T4Y A;  1YEX A;  1YEP A;  3F3Q A;  2I9H A;  5HR0 A;  5F06 A;  5ECP B;  5CAX A;  4QMK A;  1XWA A;  3D21 A;  3C1R A;  1V2A A;  5B8A A;  3RHC A;  2B1K A;  4ML1 A;  5J3R A;  2L4C A;  1M9B A;  3DIE A;  2WJU A;  4FYC A;  5DBQ A;  5GZZ B;  4KSM A;  3H79 A;  2DML A;  3DML A;  2GS3 A;  3ZVJ A;  4FXY P;  4OFM A;  4G01 A;  4XS4 A;  4IW9 A;  1SEN A;  5D9T A;  5FWG A;  2FUG 2;  3WD6 A;  1AUC A;  1XIY A;  1YF0 A;  2DLX A;  3CRT A;  2VCZ A;  3KJY A;  5E59 A;  5A34 B;  2LTK A;  2PU9 C;  1O7U A;  4HUA A;  4MZC A;  2WVY A;  3IDV A;  1E6B A;  2A4V A;  1NHY A;  2H01 A;  2E2M A;  2NVL A;  2KOK A;  1B9Y C;  4GF0 A;  1QMV A;  3O3T A;  2L4Q A;  2FWH A;  3TJB A;  4N11 A;  5ABR A;  2IJY A;  4AJ8 A;  3EE2 A;  1A0R P;  1RK4 A;  5BMU B;  1TU7 A;  3LEF A;  1PX7 A;  2DKI A;  4X0X A;  3IPZ A;  2ES7 A;  1OC8 A;  2CQ9 A;  3QFA C;  4EDY A;  2JSZ A;  3CHX C;  3DXB A;  1XW5 A;  2K8S A;  5DAL A;  1ZMA A;  1THO A;  4L0W A;  4DSS A;  1OAZ A;  2H74 A;  3GL5 A;  3UVH A;  1T3B A;  4V2M A;  1DE2 A;  1FOV A;  3HZ4 A;  2IFQ B;  3LYK A;  4TXO A;  4F82 A;  2VO4 A;  2GQK A;  4NWY A;  2H76 A;  1TI3 A;  3ZML A;  2H73 A;  5CRD A;  1ZOF A;  4LMV A;  4EDZ A;  3A2W A;  3EIN A;  2PER A;  3N5O A;  3ZL5 A;  5ID2 B;  5IO0 A;  2FA8 A;  4QL9 A;  12GS A;  1G6W A;  2R0G A;  1FAA A;  4RUV A;  3UMA A;  4CY6 A;  1GSQ A;  5EL8 A;  2GDR A;  1JZW A;  4HJ2 A;  2MMZ A;  1M2D A;  2FHE A;  1B8X A;  1S4B P;  2WB9 A;  3ZLP A;  1BJX A;  4ICY A;  4OCE A;  1J08 A;  4IVF A;  2C4J A;  3HJM A;  4Z2T A;  2ALB A;  4EIQ A;  2FY6 A;  2GSQ A;  1ZZY A;  4V1A p;  3F4R A;  2IME A;  2L57 A;  1VF1 A;  3WYW A;  4KW6 A;  4GWR A;  5IOX A;  3CSJ A;  1X5D A;  3CWG A;  1QXH A;  3ZIT A;  3HXS A;  3GUR A;  1PN0 A;  4AJ6 A;  3GIX A;  2R37 A;  3EU3 A;  3G7Y A;  4HZ4 A;  2X64 A;  1G6Y A;  4WR5 A;  4XS4 B;  2B5X A;  4O5R A;  3PH9 A;  1EOH A;  3VI5 A;  1AQX A;  1GLP A;  1Z6N A;  3HD5 A;  4I5Q A;  2PWJ A;  2DJ0 A;  3HY2 A;  3L4N A;  2GT5 A;  1YDK A;  3H8Q A;  2WW1 A;  2B5Y A;  2CVB A;  2HI7 A;  3Q74 A;  1VF4 A;  2LRT A;  3QMX A;  3UL3 A;  2H70 A;  2E7P A;  2IL3 A;  2CZ3 A;  4JR4 A;  1JFU A;  3M1G A;  5G5F A;  2O89 A;  2GSR A;  13GS A;  2H0G A;  1V98 A;  4OMV A;  5JCG A;  2C0G A;  3M9K A;  1TXX A;  1SK2 A;  1THX A;  1Q98 A;  5IMZ A;  3TB2 A;  5JWO B;  2N5A A;  3L9V A;  3LW9 A;  3HCZ A;  2VCV A;  2VAF A;  4POK A;  5A4U A;  2PVQ A;  2MMA A;  5DAL B;  2OE3 A;  4DSQ A;  2AAW A;  4OWY A;  2O8V B;  5KN1 A;  4DSS B;  3QAV A;  5JCW A;  4K2X A;  4AF2 A;  2DJ2 A;  5CRH A;  1N8J A;  4TXO B;  2X8G A;  4N3Z A;  2B1L A;  4XRD A;  2JAC A;  2E0Q A;  4GQC A;  4P3Y B;  1H4O A;  2VCT A;  2GZY A;  1K3L A;  4WF5 A;  4LMW A;  3HZ8 A;  2EC4 A;  2BJX A;  2XC2 A;  1BQ7 A;  2AYT A;  1SJZ A;  5ECR B;  2H0H A;  3WT1 A;  1J9B A;  2FLS A;  4GTU A;  1B9X C;  3U6V A;  2MMO A;  2J9H A;  1V57 A;  1EWX A;  3F0I A;  4J56 E;  3HYP A;  2H1B A;  3NOF A;  4HU7 A;  1EGO A;  3EYT A;  3CTF A;  4ZB7 A;  1TK5 B;  4D73 A;  1HNA A;  3GKX A;  3HVN A;  1EOG A;  3KZQ A;  2FWF A;  5AIS A;  1MDK A;  4EL1 A;  3N9J A;  4QQ7 A;  4MH2 A;  4MF6 A;  5A1N B;  5IQY A;  2CA8 A;  2RM5 A;  5J40 A;  5IMV A;  4XCS A;  4GDF A;  3LG6 A;  5ECH B;  2R3X A;  7GSS A;  1DSB A;  3H4K A;  4TR1 A;  3HA9 A;  5HQP A;  1Z5Y E;  1TP9 A;  2HQT A;  3IOS A;  3BCK A;  2VLV A;  1KTE A;  4IS0 A;  3FY7 A;  3QDN A;  6GST A;  3D22 A;  3M3M A;  4KDX A;  3TKS A;  3I6A A;  2O85 A;  2I4A A;  2ZCT A;  5ECL B;  1ERW A;  2MZC A;  1TK8 B;  2OBK A;  2O5V A;  5G31 A;  4BL7 A;  5LNK e;  4V2N A;  2OE0 A;  2GVP A;  4KB3 A;  1WE0 A;  1W4V A;  4QL7 A;  2EIQ A;  1E2Y A;  5C00 A;  4X4J A;  5B7C A;  4PQH A;  1SK1 A;  3RHB A;  3KP8 A;  1UVZ A;  5B8B A;  2YV7 A;  4YH2 A;  3C7M A;  6GSV A;  3KH9 A;  3ERG A;  3UAP A;  1F3A A;  2FNO A;  2DJJ A;  4KCE A;  3TOU A;  5JWQ B;  4TR4 A;  4J57 E;  1CQG A;  2DJ3 A;  4NHZ A;  4USS A;  1QUW A;  2ZUP A;  3GNJ A;  2JSY A;  1PX6 A;  3MWH A;  3M8N A;  5H5R A;  1YF1 A;  1EEJ A;  2HSM B;  2C1Y A;  3QCP A;  4FO5 A;  3UJ1 A;  4KDY A;  4J2F A;  2V41 A;  3GHA A;  5COH A;  2CVK A;  1Z7P A;  3I9V 2;  2PMT A;  2PVO C;  1WJK A;  3GV1 A;  5J5N A;  1S3C A;  4E68 A;  3G7J A;  3TRP A;  3L9S A;  3F6F A;  1V9W A;  4LLR A;  4ECJ A;  2IWT A;  5J4V A;  1LBK A;  3QOU A;  2CX4 A;  2CAQ A;  1BX9 A;  1TI1 A;  3W6G A;  5D9V A;  1F9M A;  1OVN A;  4D73 B;  1OE8 A;  3DVW A;  1JZO A;  2H6Z A;  5G30 A;  1WPI A;  1Z3E A;  5KN3 A;  5INY A;  2CT6 A;  4WBJ A;  3FZ5 A;  1NHO A;  3RFR C;  4TR0 A;  3KCM A;  2CZ2 A;  2EIR A;  1ST9 A;  1OC3 A;  3EU4 A;  4TR1 B;  2OAD A;  4ID0 A;  1ZYN A;  5IMC A;  4YQU A;  4KUN A;  4HQZ A;  3HJP A;  3CXG A;  2YZU A;  3IE3 A;  4K7O A;  1GUK A;  3VPT A;  1JLW A;  2IMI A;  2VL3 A;  3GMF A;  1XXU A;  2WS2 A;  1XWC A;  2LQO A;  1QK8 A;  4PI0 C;  4MCU A;  1XVQ A;  1I5G A;  2CVD A;  1XW9 A;  4G9H A;  1PL2 A;  3LSZ A;  4L0U A;  2H1L A;  1TTZ A;  4AKG A;  1SD8 A;  3QAW A;  4KGI A;  4ECC A;  3UOM A;  1GTI A;  2M80 A;  1Q4J A;  4RQR A;  4BL7 B;  3ZVJ D;  1PD2 1;  4MJE A;  2DIZ A;  2YZH A;  3ZIV A;  3J7Y b;  3FR6 A;  3IK7 A;  2A4H A;  2NBS A;  4FYB A;  9GSS A;  5HR2 A;  3PGT A;  4FIW A;  3TKQ A;  4DVC A;  2C80 A;  5D73 A;  4OFN A;  1U87 A;  2HYX A;  5EPF A;  2V1M A;  1SVO A;  3I43 A;  1SVM A;  3RBT A;  1G7E A;  1K0A A;  4O32 A;  3WT2 A;  1W89 A;  2EFH A;  2QC7 A;  2VL2 C;  3VPQ A;  3ZFB A;  1FG4 A;  2YWN A;  5KN2 A;  20GS A;  1SKW B;  2CX3 A;  2WW0 A;  1AIU A;  3KD0 A;  5EY6 A;  5CNW A;  4WBR D;  5KN0 A;  4V2L A;  2FA4 A;  3F6D A;  2WW3 A;  1QGV A;  3KEB A;  4XS6 A;  4NV2 A;  1USB A;  3R2Q A;  5J41 A;  1Y6E A;  2NPB A;  2H6Y A;  3IHG A;  1C72 A;  2H72 A;  1JZD A;  1K0M A;  3TRQ A;  1HYU A;  3ED3 A;  3BBY A;  4L5O A;  1MEK A;  2YAN A;  3KMO A;  1GL8 A;  4OD7 A;  3FW2 A;  2HSH A;  4KA0 A;  3C71 A;  4KF9 A;  3EVI A;  2B7J A;  4PTS A;  3HMJ G;  5A4W A;  5G1K A;  1R5A A;  4TVE A;  2EFC A;  5HFI A;  2AUV A;  1V40 A;  1U3A A;  1GP1 A;  2P5Q A;  4YKG A;  2YWO A;  2XPD A;  2P31 A;  2L6C A;  4ECB A;  1GUH A;  1M3J A;  2L5L A;  1ZYE A;  2WCI A;  4NPB A;  2AJQ B;  1M99 A;  3ZZX A;  1GTA A;  2AV4 A;  1PN9 A;  4MJB A;  3W8J A;  2PGT A;  3EPT A;  4IQ1 A;  1TJD A;  1XWB A;  4IJ3 A;  4NAX A;  4PNF A;  2HFD A;  3KM6 A;  4E8E A;  3GA4 A;  4FQU A;  1YY7 A;  4RI7 A;  3HVV A;  2R2J A;  5ELA A;  1A2M A;  3G9B A;  1WIK A;  3TCO A;  3H1N A;  5F07 A;  1F3B A;  2V6K A;  4MDC A;  1AQV A;  5IM9 A;  1F2E A;  3RGB C;  2YJ7 A;  3Q19 A;  2DKH A;  2JAD A;  3GH9 A;  1SJI A;  2D2Z A;  2HLS A;  1K0C A;  3ZTL A;  4PUF C;  5G2Z A;  3BD2 A;  2R5G A;  1U88 A;  4ZBD A;  1Z9H A;  4IEL A;  5CYY A;  5EVO A;  1G7O A;  4Z7X A;  3ZRD A;  2GZZ A;  2FWG A;  4RI6 A;  3TJJ A;  4ZIJ A;  1TOF A;  4GST A;  4ZBA A;  4PQI A;  2HRN A;  1YZX A;  2RII A;  1ON4 A;  1BYE A;  3WGE A;  3TKS E;  2YOI A;  2UZ8 A;  4OO4 A;  4Q5Q A;  5CRW A;  4FYU A;  1GWC A;  3IV4 A;  4BIK A;  2C0E A;  1T00 A;  3TGZ A;  2X99 A;  1VRS D;  2AHE A;  3V1W A;  4G0L A;  5G5E A;  5ECQ B;  2FD3 A;  3E3E A;  22GS A;  1F6M C;  2GST A;  4O7H A;  2VLT A;  5FT3 A;  5G1L A;  2VOC A;  1U6T A;  2K8V A;  2VL2 A;  5D8I A;  2A2S A;  2HZE A;  2RUF A;  1T8E B;  1O85 A;  2N5B A;  4EO3 A;  4KDU A;  1O73 A;  4YAP A;  3GSS A;  1LJR A;  3P8W A;  3P2A A;  1YKA A;  6GSS A;  2CV4 A;  4IHU A;  4PGT A;  1JHB A;  2V2G A;  3DGQ A;  1PFO A;  1QFN A;  2WW2 A;  3D4M A;  2B3S A;  1SJ6 A;  5A5K A;  2E2G A;  5E4W A;  2XHF A;  3CSI A;  1GRX A;  11GS A;  2AB6 A;  1NSW A;  2BMX A;  2H30 A;  1B4P A;  5HR1 A;  3AY8 A;  3PPU A;  3C73 A;  1LU4 A;  1VGL A;  2X49 A;  3DD3 A;  1XWG A;  3EC3 A;  4I2T A;  2WGR A;  17GS A;  1MDI A;  1ERU A;  4MAB A;  3Q18 A;  4MJC A;  1SL2 B;  2DMM A;  2LST A;  5DVB A;  4JBB A;  4ZB9 A;  4ISD A;  3UBK A;  4MK3 A;  2QA1 A;  1BG5 A;  1A2J A;  1EP8 A;  3ME8 A;  4ZIL A;  1ZYP A;  1TDI A;  3EMX A;  3LFL A;  4WET A;  1TKD B;  2LV3 A;  1YJ6 A;  1SK0 A;  3TOT A;  3P90 A;  1XPV A;  2VM2 A;  3RPN A;  4YAV A;  16GS A;  3UVT A;  2B6M A;  2Z9S A;  3GYK A;  1TK0 B;  2VLU A;  1SYX A;  1TRU A;  3FZ9 A;  2GQM A;  1OC9 A;  2F3M A;  3SWL A;  3S9F A;  4AJ7 A;  2F8F A;  1FB6 A;  4EUY A;  3LJR A;  2J23 A;  2YNX A;  1GUM A;  2DC5 A;  1EGR A;  3QD9 A;  5CP1 A;  1AAZ A;  1ABA A;  5DCH A;  3BCI A;  3M0F A;  2JZS A;  2O87 A;  3E0U A;  1BG1 A;  4O92 A;  2HRK A;  4EC0 A;  4I6X A;  2VCW A;  3TJG A;  5A4V A;  4BVY A;  4IKH A;  1A8L A;  2VKZ G;  4POL A;  4I97 A;  2GZP A;  1TW9 A;  2K6V A;  1XWK A;  3L0H A;  1Y25 A;  5L71 A;  4Z2R A;  4CDO A;  4F2I A;  3VK9 A;  4MH3 A;  2QSI A;  3KXO A;  2N5F A;  2YPM A;  2YJH A;  3W8S A;  3TKR A;  2EFE A;  2O7K A;  2TIR A;  5IMF A;  1PKZ A;  2VUP A;  2LJR A;  3GKK A;  3F4S A;  4KX4 A;  1WP0 A;  2GSS A;  1PKW A;  3VFI A;  1FB0 A;  1UA5 A;  4Q5N A;  2DJ1 A;  3KGK A;  4OFT A;  1VF2 A;  3ME7 A;  3A5W A;  2REM A;  5DDL A;  2GT6 A;  3ZFL A;  4L8E A;  4N0Z A;  2H1A A;  1MTC A;  5J4Y A;  1M0U A;  4WR4 A;  4ACS A;  3MAK A;  1S3D A;  1SL0 B;  4BWS A;  3LGC A;  2HSN A;  1GUL A;  4GCI A;  3QR6 A;  2FWE A;  3EMP A;  2O36 A;  3D5J A;  2PPT A;  1B48 A;  1M9A A;  3FRC A;  2IN3 A;  3EWL A;  4K9Z A;  1BF5 A;  4TKY A;  1KNG A;  3ZRE A;  3IC4 A;  1N25 A;  4MF7 A;  19GS A;  4BWQ A;  4JED A;  3UBL A;  2C3T A;  2GGT A;  1JZR A;  4I2U A;  3CBU A;  1PL1 A;  2LJA A;  3MSZ A;  4KND A;  4K6X A;  3FZA A;  5ECI B;  3QFB C;  2WUL A;  5F0G A;  2WZS A;  2IPA A;  4NHW A;  3R3E A;  2R0P A;  4TRX A;  1N2A A;  2GLR A;  2WRT A;  1ACV A;  2G0F A;  3APO A;  1FO5 A;  4NV5 A;  3A3T A;  3IK9 A;  3US3 A;  1SYR A;  1OC9 B;  3GN3 A;  1SKS B;  2KUC A;  4MPG A;  3TU3 B;  5A34 A;  5IOW A;  1XOB A;  4KAE A;  4YQV A;  5IO2 A;  4X1U A;  2HRF A;  2VIM A;  3CYN A;  2GQL A;  4EIP A;  2QA2 A;  4IQA A;  2FGX A;  3DVX A;  4WXT A;  2LQQ A;  4TOP A;  1NM3 A;  1X9M B;  2HRK B;  4G0K A;  4K5R A;  3RAZ A;  4BVY B;  1ZYQ B;  5KOX A;  4ZL8 A;  5AN1 A;  4G0I A;  1GSU A;  2YV9 A;  4JU5 A;  4Q5F A;  1PGT A;  3JCM L;  4JRR A;  5BMU A;  4XTS A;  2ON7 A;  4N10 A;  3Q6O A;  4TW5 A;  4IP6 A;  2IMD A;  2KLX A;  4GLT A;  3FR3 A;  2CAI A;  2L6D A;  4HU9 A;  3G7I A;  3DKS A;  4ILF A;  1OKT A;  2P5R A;  1S3R A;  3LYP A;  2HZF A;  4BA7 A;  4EE0 A;  4I8B A;  2H19 A;  5F8B A;  3MDK A;  3UAR A;  4WEY A;  5JWR B;  4JZQ A;  2IFQ A;  5J9C A;  4HOJ A;  3ISO A;  5IPH A;  2OE1 A;  1I1I P;  4GRF A;  3CMI A;  1PMT A;  2K18 A;  4NMU A;  2OA7 A;  3BOA A;  2KP2 A;  5D9X A;  4Z2U A;  4PUA A;  1M2A A;  4DEJ A;  4MNN A;  1VF3 A;  1XFL A;  3FYG A;  2XBI A;  2F51 A;  1X9S B;  2LUS A;  4EF0 A;  2VD1 A;  6GSY A;  4PI2 C;  1X0R A;  4ZB8 A;  1AW9 A;  5D9W A;  1H75 A;  2B7K A;  2C0D A;  2LKU A;  2IMF A;  3C8E A;  3FZ4 A;  3MYD A;  2PUK C;  1R26 A;  1ZGN A;  2R6K A;  4RQX A;  4EXJ A;  5KEJ A;  3J7Y k;  4TR3 A;  1RQM A;  1ILO A;  1BED A;  3EUR A;  14GS A;  2M72 A;  2YWI A;  1DBY A;  2QGV A;  4HEA 2;  3UIW A;  3HDC A;  3CSH A;  2YWM A;  6GSX A;  5DAK A;  1O8W A;  1M7T A;  4JE1 A;  4HZ2 A;  3ERF A;  3KH7 A;  5H5Q A;  5D96 A;  1SKR B;  3O6T A;  3ZIJ A;  1FHE A;  2OJL A;  3RPP A;  4K7I A;  2H71 A;  4GXZ A;  4ULX A;  2MBS A;  2C3Q A;  2ZNM A;  4F0B A;  5LCZ A;  2LJK A;  3D6I A;  3F4T A;  5CRE A;  4GQF A;  5HFK A;  3APQ A;  3VI7 A;  5B6M A;  1GNE A;  5H5S A;  1EP7 A;  2DJK A;  3P7X A;  2BTO T;  2LNS A;  1A8Y A;  4KE3 A;  2LS5 A;  5IIZ A;  3GX0 A;  4HSC X;  4POM A;  4HI7 A;  3A2V A;  5ECS A;  1AXD A;  3HVS A;  4KSO A;  2DBC A;  4LL1 B;  2H75 A;  1IYH A;  3VWV A;  4A5P A;  4MA9 A;  3GH6 A;  2KHP A;  1SD9 A;  2B5E A;  1WRY A;  2VCQ A;  4HS1 A;  1HQO A;  2H66 A;  1K0O A;  4F9Z A;  1QQ2 A;  3CRU A;  3ZYW A;  4AI6 A;  3TJK A;  3FK8 A;  1FVK A;  2R4V A;  3APS A;  5AIV A;  4ZL7 A;  4ZBB A;  3H93 A;  4L5L A;  1XW6 A;  1AC1 A;  1EEM A;  3VLN A;  3GST A;  1UN2 A;  2HSY A;  3DRN A;  3RDW A;  4MJA A;  1EV9 A;  2LRC A;  1O6J A;  4AKX B;  2VCX A;  5DJL A;  1B4Q A;  3IC8 A;  4IGJ A;  1R5P A;  1XCC A;  2YP6 A;  1GSF A;  1K0N A;  2RM6 A;  3TKS C;  2V32 A;  4WKW A;  3PR8 A;  2F9S A;  2JL4 A;  1S3A A;  4MPF A;  1MDJ A;  2H1D A;  5FHI A;  3DYR A;  5A1N A;  3HVX A;  1GH2 A;  1GTU A;  4KCA A;  1K0D A;  1OYJ A;  5GSS A;  4JR6 A;  4TXV A;  2FCH A;  2JU5 A;  3M9J A;  2LNT A;  3U5R E;  2H6X A;  3GKN A;  3GRX A;  5ECK B;  1XOA A;  4MZW A;  1V58 A;  4MMM A;  2A2R A;  4F03 A;  3FKF A;  2WDU A;  2G2Q A;  3KTB A;  5DAK B;  4OCF A;  4K0N A;  4BVX A;  2H8L A;  4XRA A;  3D0Z A;  3HJO A;  1U3I A;  1DE1 A;  3IR4 A;  4ML6 A;  4PQ1 A;  1CQH A;  5B6N A;  3KIJ A;  1Y1U A;  4IJI A;  2V6O A;  1YKC A;  5LD0 A;  3GFK A;  1X5E A;  5GST A;  1WWJ A;  3IA1 A;  2WVX A;  4LA1 A;  1KBN A;  1DUG A;  3K8N A;  1PRX A;  4K7N A;  3GTU A;  2QKE A;  4LL4 B;  1GSD A;  1A23 A;  3BJ5 A;  1YQ1 A;  1ZL9 A;  1SU9 A;  1ML6 A;  2F8A A;  1TRW A;  2HT9 A;  3VWX A;  3F63 A;  4HQS A;  2HE3 A;  1G0T A;  2L5O A;  3L78 A; 
#chains in the Genus database with same CATH homology
 2EFD A;  5KOW A;  2IMK A;  4GSN A;  1XBS A;  5D93 A;  2K9F A;  1A24 A;  2C8U A;  3HHV A;  2DSA A;  3HKR A;  2HSM A;  5HR3 A;  2HRA A;  3FR9 A;  4AKI A;  3OR5 A;  2LEG A;  3FHK A;  1K3Y A;  1RW1 A;  1HNC A;  3A5I A;  4CY8 A;  2NTO A;  2M46 A;  6GSU A;  2IIY A;  1J0F A;  3QAG A;  3LXZ A;  5BRT A;  1TRS A;  4GSS A;  2X4A A;  4K1F A;  2I81 A;  2VD0 A;  4Q5R A;  4WF4 A;  3ERW A;  4H86 A;  4OO5 A;  4XIH A;  3PIN A;  4N0V A;  4PX1 A;  1Z7R A;  5F05 A;  4POB A;  1ZCP A;  1OKD A;  1EZK A;  1GSE A;  5DCG A;  4F0C A;  2YCD A;  1HD2 A;  1I9D A;  1EV4 A;  2HZE B;  3TRX A;  4O5U A;  2TRC P;  3SBC A;  3QPM A;  3KMN A;  3LWA A;  5CO3 A;  4TN8 A;  3GKM A;  4IBP A;  3ZMK A;  1M2B A;  2OAC A;  5IMA A;  3IAS 2;  1Z6M A;  4BVX B;  3FMW A;  2X8H A;  5ENU A;  1AQW A;  1JLV A;  5ELG A;  3A2X A;  5C04 A;  1T1V A;  4HJM A;  5A5H A;  3FEU A;  3IXR A;  1BAY A;  4EVM A;  1IYI A;  1FVJ A;  4HDE A;  2NDO A;  4W66 A;  3TDG A;  4K8M A;  3KP9 A;  5J47 A;  18GS A;  5ECM B;  3KTL A;  4G2E A;  3TJF A;  5GAN D;  1SL1 B;  4V1A g;  3VUR A;  4ZXG A;  3GTU B;  5J4U A;  2A2P A;  3NZN A;  1MD4 A;  2UV8 G;  3LQ7 A;  4MF5 A;  4BPY A;  4FH8 A;  1MD3 A;  4PUR A;  3IRA A;  1KEB A;  2MBT A;  5IMD A;  1HNB A;  3VWW A;  1GSS A;  4N30 A;  2JZR A;  2OKA A;  3WGX A;  2GTU A;  1NW2 A;  3GX8 A;  4XHM A;  4YKF A;  1O8X A;  3F9U A;  3E9J B;  2P0G A;  3VWU A;  1GSY A;  1XVW A;  2L59 A;  4CW9 A;  3IHQ A;  3LOR A;  3MNG A;  1K0B A;  3IBH A;  2ON5 A;  2YN1 A;  1ERV A;  2MYG A;  4CHS A;  1UC7 A;  3CTG A;  4AKH A;  1SVL A;  5JCU A;  4MP4 A;  3L9U A;  2VL9 A;  4K0G A;  3D4T A;  3GL3 A;  1FW1 A;  3IAM 2;  2TRX A;  3LXT A;  2R0C A;  2OBI A;  2WZ9 A;  2I1U A;  2HNL A;  1X9W B;  1XZO A;  2MMN A;  4PNG A;  1GTB A;  1PSQ A;  4NXI A;  4XS1 A;  2JZT A;  1X5C A;  3TKP A;  4EKZ A;  1WOU A;  4PXO A;  4E8H A;  2VM1 A;  2LRN A;  4DSR A;  3MIX A;  3TUE A;  5CRG A;  2PBJ A;  5AGY A;  2H1G A;  1ERT A;  3F3R A;  2PN8 A;  1PA3 A;  1A0F A;  5ECO B;  2C0F A;  4AGS A;  1TXU A;  2X8C A;  1OE7 A;  4ECI A;  4G10 A;  2XBQ A;  4K2D A;  1PQN A;  2RUE A;  2WFC A;  4KH7 A;  5HFG A;  6GSW A;  1T4Z A;  3NIV A;  1R7H A;  1FOH A;  4X43 A;  4MLY A;  2C3N A;  1URM A;  2DIY A;  3I69 A;  2H0I A;  3UEM A;  3DWV A;  8GSS A;  2RLI A;  4K5S A;  5ECN B;  4MZB A;  3F8U A;  1YVL A;  1TU8 A;  2EIO A;  3DEX A;  1F37 A;  10GS A;  1K3O A;  2OT3 A;  1TRV A;  4IP1 A;  4ZL9 A;  5A5H B;  5ID2 A;  2KP1 A;  5DQY A;  1GLQ A;  1GNW A;  4IN0 A;  2HXK A;  3WGD A;  1T7P B;  3O76 A;  4G19 A;  1A2L A;  5J9B A;  1R4W A;  5DJM A;  1O81 A;  3C1S A;  2I3Y A;  2XPE A;  4ZB6 A;  4O5Q A;  2HSN B;  5DQS A;  1WMJ A;  3GUS A;  5GAP D;  4YQM A;  5IPG A;  5AIX A;  1T4Y A;  1YEX A;  1YEP A;  3F3Q A;  2I9H A;  5HR0 A;  5F06 A;  5ECP B;  5CAX A;  4QMK A;  1XWA A;  3D21 A;  3C1R A;  1V2A A;  5B8A A;  3RHC A;  2B1K A;  4ML1 A;  5J3R A;  2L4C A;  1M9B A;  3DIE A;  2WJU A;  4FYC A;  5DBQ A;  5GZZ B;  4KSM A;  3H79 A;  2DML A;  3DML A;  2GS3 A;  3ZVJ A;  4OFM A;  4G01 A;  4XS4 A;  4IW9 A;  1SEN A;  5D9T A;  5FWG A;  2FUG 2;  3WD6 A;  1AUC A;  1XIY A;  1YF0 A;  2DLX A;  3CRT A;  2VCZ A;  3KJY A;  5E59 A;  5A34 B;  2LTK A;  2PU9 C;  1O7U A;  4HUA A;  4MZC A;  3IDV A;  1E6B A;  2A4V A;  1NHY A;  2H01 A;  2E2M A;  2NVL A;  2KOK A;  1B9Y C;  4GF0 A;  1QMV A;  3O3T A;  2L4Q A;  2FWH A;  3TJB A;  4N11 A;  5ABR A;  2IJY A;  4AJ8 A;  3EE2 A;  1A0R P;  1RK4 A;  5BMU B;  1TU7 A;  3LEF A;  1PX7 A;  2DKI A;  4X0X A;  3IPZ A;  2ES7 A;  1OC8 A;  2CQ9 A;  3QFA C;  4EDY A;  2JSZ A;  3DXB A;  1XW5 A;  2K8S A;  5DAL A;  1ZMA A;  1THO A;  4L0W A;  4DSS A;  1OAZ A;  2H74 A;  3GL5 A;  3UVH A;  1T3B A;  4V2M A;  1DE2 A;  1FOV A;  3HZ4 A;  2IFQ B;  3LYK A;  4TXO A;  4F82 A;  2VO4 A;  2GQK A;  4NWY A;  2H76 A;  1TI3 A;  3ZML A;  2H73 A;  5CRD A;  1ZOF A;  4LMV A;  4EDZ A;  3A2W A;  3EIN A;  2PER A;  3N5O A;  3ZL5 A;  5ID2 B;  5IO0 A;  2FA8 A;  4QL9 A;  12GS A;  1G6W A;  2R0G A;  1FAA A;  4RUV A;  3UMA A;  4CY6 A;  1GSQ A;  5EL8 A;  2GDR A;  1JZW A;  4HJ2 A;  2MMZ A;  1M2D A;  2FHE A;  1B8X A;  2WB9 A;  3ZLP A;  1BJX A;  4ICY A;  4OCE A;  1J08 A;  4IVF A;  2C4J A;  3HJM A;  4Z2T A;  2ALB A;  4EIQ A;  2FY6 A;  2GSQ A;  1ZZY A;  4V1A p;  3F4R A;  2IME A;  2L57 A;  1VF1 A;  3WYW A;  4KW6 A;  4GWR A;  5IOX A;  3CSJ A;  1X5D A;  3CWG A;  1QXH A;  3ZIT A;  3HXS A;  3GUR A;  1PN0 A;  4AJ6 A;  3GIX A;  2R37 A;  3EU3 A;  3G7Y A;  4HZ4 A;  2X64 A;  1G6Y A;  4WR5 A;  4XS4 B;  2B5X A;  4O5R A;  3PH9 A;  1EOH A;  3VI5 A;  1AQX A;  1GLP A;  1Z6N A;  3HD5 A;  4I5Q A;  2PWJ A;  2DJ0 A;  3HY2 A;  3L4N A;  2GT5 A;  1YDK A;  3H8Q A;  2B5Y A;  2CVB A;  2HI7 A;  3Q74 A;  1VF4 A;  2LRT A;  3QMX A;  3UL3 A;  2H70 A;  2E7P A;  2IL3 A;  2CZ3 A;  4JR4 A;  1JFU A;  3M1G A;  5G5F A;  2O89 A;  2GSR A;  13GS A;  2H0G A;  1V98 A;  4OMV A;  5JCG A;  2C0G A;  3M9K A;  1TXX A;  1SK2 A;  1THX A;  1Q98 A;  5IMZ A;  3TB2 A;  5JWO B;  2N5A A;  3L9V A;  3LW9 A;  3HCZ A;  2VCV A;  2VAF A;  4POK A;  5A4U A;  2PVQ A;  2MMA A;  5DAL B;  2OE3 A;  4DSQ A;  2AAW A;  4OWY A;  2O8V B;  5KN1 A;  4DSS B;  3QAV A;  5JCW A;  4K2X A;  4AF2 A;  2DJ2 A;  5CRH A;  1N8J A;  4TXO B;  2X8G A;  4N3Z A;  2B1L A;  4XRD A;  2JAC A;  2E0Q A;  4GQC A;  4P3Y B;  1H4O A;  2VCT A;  2GZY A;  1K3L A;  4WF5 A;  4LMW A;  3HZ8 A;  2EC4 A;  2BJX A;  2XC2 A;  1BQ7 A;  2AYT A;  1SJZ A;  5ECR B;  2H0H A;  3WT1 A;  1J9B A;  2FLS A;  4GTU A;  1B9X C;  3U6V A;  2MMO A;  2J9H A;  1V57 A;  1EWX A;  3F0I A;  4J56 E;  3HYP A;  2H1B A;  3NOF A;  4HU7 A;  1EGO A;  3EYT A;  3CTF A;  4ZB7 A;  1TK5 B;  4D73 A;  1HNA A;  3GKX A;  1EOG A;  3KZQ A;  2FWF A;  5AIS A;  1MDK A;  4EL1 A;  3N9J A;  4QQ7 A;  4MH2 A;  4MF6 A;  5A1N B;  5IQY A;  2CA8 A;  2RM5 A;  5J40 A;  5IMV A;  4XCS A;  4GDF A;  3LG6 A;  5ECH B;  2R3X A;  7GSS A;  1DSB A;  3H4K A;  4TR1 A;  3HA9 A;  5HQP A;  1Z5Y E;  1TP9 A;  2HQT A;  3IOS A;  3BCK A;  2VLV A;  1KTE A;  4IS0 A;  3FY7 A;  3QDN A;  6GST A;  3D22 A;  3M3M A;  4KDX A;  3TKS A;  3I6A A;  2O85 A;  2I4A A;  2ZCT A;  5ECL B;  1ERW A;  2MZC A;  1TK8 B;  2OBK A;  2O5V A;  5G31 A;  4BL7 A;  5LNK e;  4V2N A;  2OE0 A;  2GVP A;  4KB3 A;  1WE0 A;  1W4V A;  4QL7 A;  2EIQ A;  1E2Y A;  5C00 A;  4X4J A;  5B7C A;  4PQH A;  1SK1 A;  3RHB A;  3KP8 A;  1UVZ A;  5B8B A;  2YV7 A;  4YH2 A;  3C7M A;  6GSV A;  3KH9 A;  3ERG A;  3UAP A;  1F3A A;  2FNO A;  2DJJ A;  4KCE A;  3TOU A;  5JWQ B;  4TR4 A;  4J57 E;  1CQG A;  2DJ3 A;  4NHZ A;  4USS A;  1QUW A;  2ZUP A;  3GNJ A;  2JSY A;  1PX6 A;  3MWH A;  3M8N A;  5H5R A;  1YF1 A;  1EEJ A;  2HSM B;  2C1Y A;  3QCP A;  4FO5 A;  3UJ1 A;  4KDY A;  4J2F A;  2V41 A;  3GHA A;  5COH A;  2CVK A;  1Z7P A;  3I9V 2;  2PMT A;  2PVO C;  1WJK A;  3GV1 A;  5J5N A;  1S3C A;  4E68 A;  3G7J A;  3TRP A;  3L9S A;  3F6F A;  1V9W A;  4LLR A;  4ECJ A;  2IWT A;  5J4V A;  1LBK A;  3QOU A;  2CX4 A;  2CAQ A;  1BX9 A;  1TI1 A;  3W6G A;  5D9V A;  1F9M A;  1OVN A;  4D73 B;  1OE8 A;  3DVW A;  1JZO A;  2H6Z A;  5G30 A;  1WPI A;  1Z3E A;  5KN3 A;  5INY A;  2CT6 A;  4WBJ A;  3FZ5 A;  1NHO A;  4TR0 A;  3KCM A;  2CZ2 A;  2EIR A;  1ST9 A;  1OC3 A;  3EU4 A;  4TR1 B;  2OAD A;  4ID0 A;  1ZYN A;  5IMC A;  4YQU A;  4KUN A;  4HQZ A;  3HJP A;  3CXG A;  2YZU A;  3IE3 A;  4K7O A;  1GUK A;  3VPT A;  1JLW A;  2IMI A;  2VL3 A;  3GMF A;  1XXU A;  2WS2 A;  1XWC A;  2LQO A;  1QK8 A;  4MCU A;  1XVQ A;  1I5G A;  2CVD A;  1XW9 A;  4G9H A;  1PL2 A;  3LSZ A;  4L0U A;  2H1L A;  1TTZ A;  4AKG A;  1SD8 A;  3QAW A;  4KGI A;  4ECC A;  3UOM A;  1GTI A;  2M80 A;  1Q4J A;  4RQR A;  4BL7 B;  3ZVJ D;  1PD2 1;  4MJE A;  2DIZ A;  2YZH A;  3ZIV A;  3J7Y b;  3FR6 A;  3IK7 A;  2A4H A;  2NBS A;  4FYB A;  9GSS A;  5HR2 A;  3PGT A;  4FIW A;  3TKQ A;  4DVC A;  2C80 A;  5D73 A;  4OFN A;  1U87 A;  2HYX A;  5EPF A;  2V1M A;  1SVO A;  3I43 A;  1SVM A;  3RBT A;  1G7E A;  1K0A A;  4O32 A;  3WT2 A;  1W89 A;  2EFH A;  2QC7 A;  2VL2 C;  3VPQ A;  3ZFB A;  1FG4 A;  2YWN A;  5KN2 A;  20GS A;  1SKW B;  2CX3 A;  1AIU A;  3KD0 A;  5EY6 A;  5CNW A;  4WBR D;  5KN0 A;  4V2L A;  2FA4 A;  3F6D A;  1QGV A;  3KEB A;  4XS6 A;  4NV2 A;  1USB A;  3R2Q A;  5J41 A;  1Y6E A;  2NPB A;  2H6Y A;  3IHG A;  1C72 A;  2H72 A;  1JZD A;  1K0M A;  3TRQ A;  1HYU A;  3ED3 A;  3BBY A;  4L5O A;  1MEK A;  2YAN A;  3KMO A;  1GL8 A;  4OD7 A;  3FW2 A;  2HSH A;  4KA0 A;  3C71 A;  4KF9 A;  3EVI A;  2B7J A;  4PTS A;  3HMJ G;  5A4W A;  5G1K A;  1R5A A;  4TVE A;  2EFC A;  5HFI A;  2AUV A;  1V40 A;  1U3A A;  1GP1 A;  2P5Q A;  4YKG A;  2YWO A;  2XPD A;  2P31 A;  2L6C A;  4ECB A;  1GUH A;  2L5L A;  1ZYE A;  2WCI A;  4NPB A;  2AJQ B;  1M99 A;  3ZZX A;  1GTA A;  2AV4 A;  1PN9 A;  4MJB A;  3W8J A;  2PGT A;  3EPT A;  4IQ1 A;  1TJD A;  1XWB A;  4IJ3 A;  4NAX A;  4PNF A;  2HFD A;  3KM6 A;  4E8E A;  3GA4 A;  4FQU A;  1YY7 A;  4RI7 A;  3HVV A;  2R2J A;  5ELA A;  1A2M A;  3G9B A;  1WIK A;  3TCO A;  3H1N A;  5F07 A;  1F3B A;  2V6K A;  4MDC A;  1AQV A;  5IM9 A;  1F2E A;  2YJ7 A;  3Q19 A;  2DKH A;  2JAD A;  3GH9 A;  1SJI A;  2D2Z A;  2HLS A;  1K0C A;  3ZTL A;  4PUF C;  5G2Z A;  3BD2 A;  2R5G A;  1U88 A;  4ZBD A;  1Z9H A;  4IEL A;  5CYY A;  5EVO A;  1G7O A;  4Z7X A;  3ZRD A;  2GZZ A;  2FWG A;  4RI6 A;  3TJJ A;  4ZIJ A;  1TOF A;  4GST A;  4ZBA A;  4PQI A;  2HRN A;  1YZX A;  2RII A;  1ON4 A;  1BYE A;  3WGE A;  3TKS E;  2YOI A;  2UZ8 A;  4OO4 A;  4Q5Q A;  5CRW A;  4FYU A;  1GWC A;  3IV4 A;  2C0E A;  1T00 A;  3TGZ A;  2X99 A;  1VRS D;  2AHE A;  3V1W A;  4G0L A;  5G5E A;  5ECQ B;  2FD3 A;  3E3E A;  22GS A;  1F6M C;  2GST A;  4O7H A;  2VLT A;  5FT3 A;  5G1L A;  2VOC A;  1U6T A;  2K8V A;  2VL2 A;  5D8I A;  2A2S A;  2HZE A;  2RUF A;  1T8E B;  1O85 A;  2N5B A;  4EO3 A;  4KDU A;  1O73 A;  4YAP A;  3GSS A;  1LJR A;  3P8W A;  3P2A A;  1YKA A;  6GSS A;  2CV4 A;  4IHU A;  4PGT A;  1JHB A;  2V2G A;  3DGQ A;  1QFN A;  3D4M A;  2B3S A;  1SJ6 A;  5A5K A;  2E2G A;  5E4W A;  2XHF A;  3CSI A;  1GRX A;  11GS A;  2AB6 A;  1NSW A;  2BMX A;  2H30 A;  1B4P A;  5HR1 A;  3AY8 A;  3PPU A;  3C73 A;  1LU4 A;  1VGL A;  2X49 A;  3DD3 A;  1XWG A;  3EC3 A;  4I2T A;  2WGR A;  17GS A;  1MDI A;  1ERU A;  4MAB A;  3Q18 A;  4MJC A;  1SL2 B;  2DMM A;  2LST A;  5DVB A;  4JBB A;  4ZB9 A;  4ISD A;  3UBK A;  4MK3 A;  2QA1 A;  1BG5 A;  1A2J A;  1EP8 A;  3ME8 A;  4ZIL A;  1ZYP A;  1TDI A;  3EMX A;  3LFL A;  4WET A;  1TKD B;  2LV3 A;  1YJ6 A;  1SK0 A;  3TOT A;  3P90 A;  1XPV A;  2VM2 A;  3RPN A;  4YAV A;  16GS A;  3UVT A;  2B6M A;  2Z9S A;  3GYK A;  1TK0 B;  2VLU A;  1SYX A;  1TRU A;  3FZ9 A;  2GQM A;  1OC9 A;  2F3M A;  3SWL A;  3S9F A;  4AJ7 A;  2F8F A;  1FB6 A;  4EUY A;  3LJR A;  2J23 A;  2YNX A;  1GUM A;  2DC5 A;  1EGR A;  3QD9 A;  5CP1 A;  1AAZ A;  1ABA A;  5DCH A;  3BCI A;  3M0F A;  2JZS A;  2O87 A;  3E0U A;  1BG1 A;  4O92 A;  2HRK A;  4EC0 A;  4I6X A;  2VCW A;  3TJG A;  5A4V A;  4BVY A;  4IKH A;  1A8L A;  2VKZ G;  4POL A;  4I97 A;  2GZP A;  1TW9 A;  2K6V A;  1XWK A;  3L0H A;  1Y25 A;  5L71 A;  4Z2R A;  4CDO A;  4F2I A;  3VK9 A;  4MH3 A;  2QSI A;  3KXO A;  2N5F A;  2YPM A;  2YJH A;  3W8S A;  3TKR A;  2EFE A;  2O7K A;  2TIR A;  5IMF A;  1PKZ A;  2VUP A;  2LJR A;  3GKK A;  3F4S A;  4KX4 A;  1WP0 A;  2GSS A;  1PKW A;  3VFI A;  1FB0 A;  1UA5 A;  4Q5N A;  2DJ1 A;  3KGK A;  4OFT A;  1VF2 A;  3ME7 A;  3A5W A;  2REM A;  5DDL A;  2GT6 A;  3ZFL A;  4L8E A;  4N0Z A;  2H1A A;  1MTC A;  5J4Y A;  1M0U A;  4WR4 A;  4ACS A;  3MAK A;  1S3D A;  1SL0 B;  4BWS A;  3LGC A;  2HSN A;  1GUL A;  4GCI A;  3QR6 A;  2FWE A;  3EMP A;  3D5J A;  2PPT A;  1B48 A;  1M9A A;  3FRC A;  2IN3 A;  3EWL A;  4K9Z A;  1BF5 A;  4TKY A;  1KNG A;  3ZRE A;  3IC4 A;  1N25 A;  4MF7 A;  19GS A;  4BWQ A;  4JED A;  3UBL A;  2C3T A;  2GGT A;  1JZR A;  4I2U A;  3CBU A;  1PL1 A;  2LJA A;  3MSZ A;  4KND A;  4K6X A;  3FZA A;  5ECI B;  3QFB C;  2WUL A;  5F0G A;  2IPA A;  4NHW A;  3R3E A;  2R0P A;  4TRX A;  1N2A A;  2GLR A;  2WRT A;  1ACV A;  2G0F A;  3APO A;  1FO5 A;  4NV5 A;  3A3T A;  3IK9 A;  3US3 A;  1SYR A;  1OC9 B;  3GN3 A;  1SKS B;  2KUC A;  4MPG A;  3TU3 B;  5A34 A;  5IOW A;  1XOB A;  4KAE A;  4YQV A;  5IO2 A;  4X1U A;  2HRF A;  2VIM A;  3CYN A;  2GQL A;  4EIP A;  2QA2 A;  4IQA A;  2FGX A;  3DVX A;  4WXT A;  2LQQ A;  4TOP A;  1NM3 A;  1X9M B;  2HRK B;  4G0K A;  4K5R A;  3RAZ A;  4BVY B;  1ZYQ B;  5KOX A;  4ZL8 A;  5AN1 A;  4G0I A;  1GSU A;  2YV9 A;  4JU5 A;  4Q5F A;  1PGT A;  3JCM L;  4JRR A;  5BMU A;  4XTS A;  2ON7 A;  4N10 A;  3Q6O A;  4TW5 A;  4IP6 A;  2IMD A;  2KLX A;  4GLT A;  3FR3 A;  2CAI A;  2L6D A;  4HU9 A;  3G7I A;  3DKS A;  4ILF A;  1OKT A;  2P5R A;  3LYP A;  2HZF A;  4BA7 A;  4EE0 A;  4I8B A;  2H19 A;  5F8B A;  3MDK A;  3UAR A;  4WEY A;  5JWR B;  4JZQ A;  2IFQ A;  5J9C A;  4HOJ A;  3ISO A;  5IPH A;  2OE1 A;  4GRF A;  3CMI A;  1PMT A;  2K18 A;  4NMU A;  2OA7 A;  3BOA A;  2KP2 A;  5D9X A;  4Z2U A;  4PUA A;  1M2A A;  4DEJ A;  4MNN A;  1VF3 A;  1XFL A;  3FYG A;  2XBI A;  2F51 A;  1X9S B;  2LUS A;  4EF0 A;  2VD1 A;  6GSY A;  1X0R A;  4ZB8 A;  1AW9 A;  5D9W A;  1H75 A;  2B7K A;  2C0D A;  2LKU A;  2IMF A;  3C8E A;  3FZ4 A;  3MYD A;  2PUK C;  1R26 A;  1ZGN A;  2R6K A;  4RQX A;  4EXJ A;  5KEJ A;  3J7Y k;  4TR3 A;  1RQM A;  1ILO A;  1BED A;  14GS A;  3EUR A;  2M72 A;  2YWI A;  1DBY A;  2QGV A;  4HEA 2;  3UIW A;  3HDC A;  3CSH A;  2YWM A;  6GSX A;  5DAK A;  1O8W A;  1M7T A;  4JE1 A;  4HZ2 A;  3ERF A;  3KH7 A;  5H5Q A;  5D96 A;  1SKR B;  3O6T A;  3ZIJ A;  1FHE A;  2OJL A;  3RPP A;  4K7I A;  2H71 A;  4GXZ A;  4ULX A;  2MBS A;  2C3Q A;  2ZNM A;  4F0B A;  5LCZ A;  2LJK A;  3D6I A;  3F4T A;  5CRE A;  4GQF A;  5HFK A;  3APQ A;  3VI7 A;  5B6M A;  1GNE A;  5H5S A;  1EP7 A;  2DJK A;  3P7X A;  2BTO T;  2LNS A;  1A8Y A;  4KE3 A;  2LS5 A;  5IIZ A;  3GX0 A;  4POM A;  4HI7 A;  3A2V A;  5ECS A;  1AXD A;  3HVS A;  4KSO A;  2DBC A;  4LL1 B;  2H75 A;  1IYH A;  3VWV A;  4A5P A;  4MA9 A;  3GH6 A;  2KHP A;  1SD9 A;  2B5E A;  1WRY A;  2VCQ A;  4HS1 A;  1HQO A;  2H66 A;  1K0O A;  4F9Z A;  1QQ2 A;  3CRU A;  3ZYW A;  4AI6 A;  3TJK A;  3FK8 A;  1FVK A;  2R4V A;  3APS A;  5AIV A;  4ZL7 A;  4ZBB A;  3H93 A;  4L5L A;  1XW6 A;  1AC1 A;  1EEM A;  3VLN A;  3GST A;  1UN2 A;  2HSY A;  3DRN A;  3RDW A;  4MJA A;  1EV9 A;  2LRC A;  1O6J A;  4AKX B;  2VCX A;  5DJL A;  1B4Q A;  3IC8 A;  4IGJ A;  1R5P A;  1XCC A;  2YP6 A;  1GSF A;  1K0N A;  2RM6 A;  3TKS C;  2V32 A;  4WKW A;  3PR8 A;  2F9S A;  2JL4 A;  1S3A A;  4MPF A;  1MDJ A;  2H1D A;  5FHI A;  3DYR A;  5A1N A;  3HVX A;  1GH2 A;  1GTU A;  4KCA A;  1K0D A;  1OYJ A;  5GSS A;  4JR6 A;  4TXV A;  2FCH A;  2JU5 A;  3M9J A;  2LNT A;  3U5R E;  2H6X A;  3GKN A;  3GRX A;  5ECK B;  1XOA A;  4MZW A;  1V58 A;  4MMM A;  2A2R A;  4F03 A;  3FKF A;  2WDU A;  2G2Q A;  3KTB A;  5DAK B;  4OCF A;  4K0N A;  4BVX A;  2H8L A;  4XRA A;  3D0Z A;  3HJO A;  1U3I A;  1DE1 A;  3IR4 A;  4ML6 A;  4PQ1 A;  1CQH A;  5B6N A;  3KIJ A;  1Y1U A;  4IJI A;  2V6O A;  1YKC A;  5LD0 A;  3GFK A;  1X5E A;  5GST A;  1WWJ A;  3IA1 A;  4LA1 A;  1KBN A;  1DUG A;  3K8N A;  1PRX A;  4K7N A;  3GTU A;  2QKE A;  4LL4 B;  1GSD A;  1A23 A;  3BJ5 A;  1YQ1 A;  1ZL9 A;  1SU9 A;  1ML6 A;  2F8A A;  1TRW A;  2HT9 A;  3VWX A;  3F63 A;  4HQS A;  2HE3 A;  1G0T A;  2L5O A;  3L78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...