5FWGA

Tetra-(5-fluorotryptophanyl)-glutathione transferase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
213
Chain Sequence
PMILGYNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TETRA-(5-FLUOROTRYPTOPHANYL)-GLUTATHIONE TRANSFERASE MU CLAS
publication title Enzymes harboring unnatural amino acids: mechanistic and structural analysis of the enhanced catalytic activity of a glutathione transferase containing 5-fluorotryptophan.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 72
structure length 213
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5fwgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5fwgA01
2VAFA 2YZUA 3KMNA 5DCHA 1T8EB 2E2MA 4TR3A 3IC4A 1Z5YE 4GSNA 1OE7A 1PRXA 3ZIVA 1S3AA 4ZL9A 4NV2A 3M9KA 1OE8A 1AW9A 3P2AA 2HSMB 3QFBC 2RIIA 3M1GA 2YZHA 4NV5A 1ABAA 2CA8A 1G6YA 1FOVA 2CAQA 1SD9A 2YP6A 4GXZA 2RUEA 2FCHA 4MPFA 1DSBA 3HVVA 3TB2A 3TKSC 4FIWA 2JADA 3GURA 1A8LA 3IA1A 5G2ZA 4EL1A 2PMTA 2GSSA 2NVLA 4G10A 1CQHA 1MD4A 3UVHA 3GX0A 4RQXA 3KP9A 5IM9A 4EO3A 3MAKA 4F03A 3CSHA 2QGVA 3IBHA 3EC3A 5CYYA 2RM6A 1OKTA 2D2ZA 3TOTA 1VF2A 2VL2C 3Q19A 2B5XA 3D21A 2GT5A 1VF3A 1C72A 1VF1A 1ZL9A 5G1LA 4PUFC 1SK0A 2HSHA 1HNBA 3EU4A 1BQ7A 3MWHA 3L4NA 5HR2A 1AQWA 4K6XA 1UC7A 1SK2A 5H5QA 5DVBA 1Y25A 3ISOA 3HJOA 19GSA 1O8XA 1ERTA 4K7OA 3IC8A 3F0IA 2C0DA 5IOXA 2DIYA 4GWRA 1NHOA 2G0FA 1PMTA 1X5EA 1HD2A 5KN3A 4NMUA 1X5DA 2FWFA 2PVOC 4RI7A 2DMMA 3HYPA 1AQXA 4IN0A 3VURA 1RQMA 4ECIA 1XOBA 2H30A 3UMAA 3ED3A 5C00A 2MBSA 5DDLA 5EY6A 3ZITA 5LCZA 5CRWA 2C3TA 2YN1A 5JCUA 2H0GA 3J7Yb 1A2LA 4ZBDA 5H5SA 3KGKA 6GSSA 1BJXA 1GSEA 2K8VA 2YWOA 3E3EA 7GSSA 2H1BA 5D9TA 4ECJA 2H0IA 1B9YC 2H76A 1A2JA 1T4YA 2H74A 5G31A 4I5QA 2H72A 5GSSA 2OE0A 3N9JA 5F05A 5D9WA 3GV1A 3L9UA 2GSTA 3FR6A 2HZEB 1KNGA 4WETA 2F9SA 1JZRA 3ZVJD 2HFDA 1GLPA 3VWUA 5CAXA 2RLIA 2L6CA 4PTSA 3GMFA 3M3MA 3L78A 1M2AA 2GQLA 1K0DA 2OA7A 1K3YA 1SENA 1PX7A 2REMA 3R2QA 5GSTA 1SKWB 1VF4A 1GSQA 5ECSA 2FWGA 1JLVA 5A4WA 3PPUA 1AQVA 2GSRA 2I4AA 3FYGA 4GQFA 1F6MC 4JR4A 3GYKA 4KNDA 1G6WA 5HQPA 4BPYA 1PSQA 2V2GA 3FZAA 3LORA 1V57A 5LD0A 1AAZA 4Q5RA 3GIXA 5HR1A 4K2DA 1YDKA 4KSMA 5IMVA 4AJ7A 3O76A 3ZREA 2H71A 3F4SA 10GSA 1ZYEA 5D8IA 4KA0A 1R5AA 2L5LA 2V1MA 3KH9A 2K8SA 2C3NA 1GP1A 4LMVA 1MDIA 4NWYA 5DQYA 4TVEA 3H4KA 2L6DA 5B6MA 1JZDA 2VL9A 3FR9A 1PX6A 2FD3A 4PQ1A 2AAWA 2AYTA 4ML1A 1KBNA 1WP0A 11GSA 2FLSA 1TK8B 1W4VA 3D4MA 5DBQA 3VLNA 3I9V2 3U5RE 2YV7A 5J5NA 3QR6A 2R6KA 4JBBA 1OC8A 3IOSA 1BX9A 2OBIA 3GA4A 4KSOA 3A3TA 1Z6NA 4IS0A 3IHQA 2HQTA 2OE3A 2CX4A 4FYUA 2ALBA 2VLTA 3SBCA 4ML6A 4OD7A 3VWVA 2PUKC 2X8HA 2NDOA 5ABRA 1K0CA 4EVMA 2OACA 4ZXGA 9GSSA 1ZMAA 3IAM2 3LWAA 2R37A 5J9BA 4D73A 5IMAA 3GUSA 1V9WA 3P8WA 2B7KA 2X8CA 4OFNA 4RUVA 3GL3A 5JCGA 2JACA 3KTLA 3M0FA 1R7HA 2GZZA 4K0NA 2M72A 3HJPA 2HSNB 4CW9A 2GLRA 4GRFA 1EP7A 3GKMA 4KCEA 1K0MA 2XPDA 3VK9A 4LA1A 3US3A 3WGXA 5AGYA 2YWIA 5AN1A 5IPGA 2B7JA 4AJ6A 2OADA 4D73B 4EE0A 4L8EA 1SJZA 1GTBA 1FW1A 3QMXA 2R3XA 3LQ7A 1XIYA 3RPPA 4HEA2 3DKSA 3IE3A 3GKNA 1NM3A 1LBKA 4AF2A 1ON4A 1U6TA 4N0VA 2HRKA 2MMOA 4PQHA 5B6NA 1CQGA 3C71A 4IW9A 4Q5QA 4DVCA 3GX8A 1DBYA 3DGQA 1TKDB 2K18A 5E59A 4E8HA 2A2SA 2C3QA 4N0ZA 3PR8A 1XVQA 1ZOFA 3APQA 3IXRA 2VO4A 1EGOA 5B8BA 1K3OA 5J41A 2VCWA 1GSDA 14GSA 4OO4A 3IRAA 4POMA 1SL1B 4KF9A 4TXOB 1XWAA 4OO5A 3IK7A 4BVXA 4I8BA 1V98A 4GQCA 1JLWA 3F9UA 2CAIA 2J23A 3TCOA 3DWVA 3HJMA 1F3BA 5F8BA 3RBTA 3CTGA 3F4RA 1GLQA 2X99A 4FYCA 1F2EA 1XZOA 1TRSA 3VWXA 3HHVA 5ECPB 3QPMA 2TRXA 3UJ1A 2R5GA 4JEDA 4OCEA 3RPNA 1OYJA 2BMXA 5CRGA 5HR3A 5DCGA 4O7HA 1OVNA 4MDCA 2G2QA 2ZUPA 4K7IA 2IMIA 5JWQB 2BTOT 3BOAA 3TRPA 16GSA 4ZIJA 2N5FA 4IGJA 3H93A 6GSYA 1GSFA 4LMWA 5IO2A 1TRVA 2HSMA 3TJBA 1V40A 3HVXA 4PUAA 3U6VA 4TN8A 2XBIA 3VI7A 2N5BA 3C1SA 2C80A 3ZRDA 3M8NA 3DRNA 4K7NA 1SD8A 3MNGA 1A23A 1UN2A 1ZGNA 3NOFA 3H79A 1THXA 2FNOA 1QQ2A 1OC9B 1XW9A 3EYTA 3HKRA 4KUNA 1BAYA 1V58A 5LNKe 2IWTA 2RM5A 3CSIA 2CT6A 2Z9SA 2AV4A 2HE3A 4RQRA 1NHYA 2DJ1A 1XWCA 5J3RA 1Q98A 2PBJA 1SKSB 4IP1A 4EXJA 2WULA 2JZSA 4MZCA 4MMMA 3TDGA 1GULA 4MLYA 4DSSB 2H66A 2GQMA 3CMIA 4EKZA 3D22A 2CV4A 3UAPA 2EIQA 2VD1A 1MTCA 2B1KA 2LRCA 4YAVA 3W8JA 3ME8A 5HR0A 3CBUA 4TOPA 4IP6A 8GSSA 3FR3A 1URMA 2XBQA 5G5EA 1PL1A 2LEGA 1ZYQB 2LJKA 3TJGA 5G5FA 1XOAA 1J08A 2K6VA 3APSA 3BCKA 6GSTA 3F6FA 3ZFBA 4GF0A 4IQAA 3M9JA 1WMJA 3O6TA 2H6ZA 1O6JA 1XWGA 1X9SB 3QAVA 3NZNA 4ILFA 1QXHA 3C8EA 5AIXA 4KW6A 4LLRA 3W8SA 4HI7A 3LSZA 4X43A 3C7MA 4POKA 2IJYA 1K0OA 1J0FA 2LS5A 3R3EA 4XS4B 2PN8A 4HU9A 5A4UA 5IOWA 4V2MA 1A2MA 5H5RA 1OAZA 3FKFA 2H75A 4J57E 2DJ0A 3TRXA 1GH2A 3LGCA 1X9MB 5CRHA 1XPVA 1H4OA 3EVIA 3ZMKA 3CRUA 4WXTA 2L4CA 5IQYA 4XRAA 2VLUA 3HD5A 2H6XA 1JZOA 2VCVA 1PGTA 3FW2A 1GTUA 1PQNA 4WF5A 4IQ1A 1NSWA 4TRXA 2FHEA 3EURA 3P90A 2AUVA 2JL4A 3APOA 2ON7A 2H6YA 1M9BA 4TR1B 1F9MA 3EU3A 2HZEA 4EDZA 1PD21 3FZ4A 5ECOB 2LV3A 4V1Ag 1T7PB 3Q18A 1PN9A 1U88A 2C0FA 1JHBA 4GTUA 1M99A 4KDUA 4I97A 5INYA 1GL8A 4F2IA 1ZZYA 4MCUA 3V1WA 4OFMA 1GUKA 4K0GA 2OJLA 5IO0A 2QC7A 4FQUA 2KP1A 3DD3A 1MEKA 4FO5A 1B8XA 5ECHB 2B6MA 3FK8A 3RHCA 4CHSA 4G0IA 4ACSA 4QL9A 1EV9A 1SYXA 1YJ6A 2HLSA 3KP8A 1TI1A 3G9BA 5G30A 4PNFA 3BBYA 3TOUA 1XW5A 2QKEA 4LL1B 1HNAA 3S9FA 5ELAA 2FWHA 2F51A 1B4QA 1K0NA 3MSZA 4V2NA 2LJAA 1YF0A 2VCQA 3GNJA 2X8GA 5DJLA 1HYUA 2GQKA 2P5RA 3DVXA 3I69A 2WB9A 1PKWA 5BMUA 3SWLA 5GAPD 5AIVA 2B3SA 2F3MA 2F8FA 4I2UA 2DIZA 3MDKA 1M9AA 3KIJA 3BCIA 1OKDA 4KB3A 2WFCA 3TKSE 2FA8A 2VLVA 3D0ZA 2VM2A 4XCSA 4ID0A 1R5PA 1TK0B 2WJUA 1DE1A 5EPFA 2WGRA 2ES7A 4EC0A 4NXIA 3ERFA 1X5CA 2E0QA 1QK8A 4Z7XA 4ZL7A 5CREA 2DLXA 1GRXA 1M7TA 4XS6A 3L0HA 1GSYA 5F06A 2VD0A 5EL8A 4FYBA 2E2GA 4BL7B 4ZBBA 3CXGA 2IFQB 4EF0A 1EOGA 2X64A 2CQ9A 4TW5A 5GZZB 2B5EA 1MD3A 1S3CA 1E2YA 2M80A 2F8AA 1J9BA 3A2WA 1G7EA 4OCFA 2NPBA 3LXZA 4YAPA 5IPHA 2MMZA 4PURA 5ID2B 4BVYB 2YJHA 1SU9A 2I3YA 1YY7A 2HRFA 3TKRA 1QUWA 4FH8A 2P5QA 2L4QA 1ERUA 5CNWA 3WT2A 4DSRA 1H75A 1YKCA 2HI7A 4ECCA 4V2LA 2EC4A 1B48A 2ON5A 3QAGA 4RI6A 4WKWA 4XIHA 2IMFA 5D73A 2WDUA 3QD9A 5KN1A 4POBA 4IKHA 3ME7A 2E7PA 4ISDA 4ZB6A 2DJJA 5D96A 3HVSA 3KH7A 1THOA 2AHEA 3TKSA 1K0AA 3GHAA 2O85A 2R2JA 5ECIB 3TJJA 1FB6A 2V32A 3GFKA 2O87A 5L71A 1UA5A 2DJ2A 4K1FA 5CRDA 1T1VA 2YNXA 1T3BA 17GSA 3ZYWA 4O92A 3GTUB 3KEBA 5HFIA 5GAND 4N10A 4HOJA 1TU8A 1BG5A 4HJ2A 2VL2A 3QAWA 3GSTA 1XCCA 2LUSA 3LG6A 3VPTA 3DVWA 3ZVJA 5FHIA 1DE2A 4ZILA 1VGLA 3EWLA 4TXOA 5ECMB 3GRXA 3F6DA 2M46A 5KN2A 2JSYA 1SKRB 2JZTA 1TDIA 4ZBAA 5DQSA 5FT3A 1F3AA 5DAKA 5IIZA 1GUMA 5HFGA 3UL3A 1IYIA 4OFTA 2I9HA 2NTOA 4ZB9A 22GSA 3DEXA 3TKPA 3VWWA 4I6XA 4HUAA 5ENUA 3HXSA 2OE1A 5CO3A 2YWMA 5DAKB 3ZLPA 3TRQA 1QGVA 1IYHA 2FGXA 3GSSA 1FHEA 3IR4A 4TR0A 4WBJA 3GL5A 3G7IA 1DUGA 1TU7A 3KTBA 5IMCA 2VCXA 4X0XA 4MP4A 1VRSD 4KE3A 1QMVA 1G7OA 4F82A 1LJRA 2V6KA 2LTKA 2TRCP 5ECQB 4K9ZA 3JCML 4XS1A 3H1NA 2L57A 1GNEA 2L59A 3EMPA 4F0BA 5J4UA 4YH2A 4MH3A 2O7KA 3KJYA 5ELGA 3A5WA 3PGTA 3RHBA 1OC9A 3KXOA 3ZFLA 4BWQA 3TGZA 1GTIA 3ERGA 4XTSA 3ERWA 2GS3A 3HY2A 1S3DA 3EMXA 3VPQA 2PWJA 4IHUA 3G7YA 3EINA 3AY8A 1E6BA 3ZTLA 2FUG2 2H01A 2P0GA 1UVZA 1A8YA 1Z6MA 3L9VA 1O85A 4DSSA 3GN3A 4O5RA 3FRCA 2MYGA 3D6IA 5ECNB 3FZ5A 3QOUA 3KMOA 1XWKA 18GSA 3Q6OA 2LSTA 1U87A 2HZFA 3DMLA 2LKUA 4MJCA 1V2AA 4F0CA 2MZCA 3K8NA 2H0HA 3UEMA 1O7UA 2L5OA 1BYEA 2PERA 4H86A 2DJKA 3BD2A 3C73A 1PA3A 4AJ8A 5DALB 4WBRD 13GSA 3I43A 1RK4A 1TRWA 3UOMA 4NHZA 4MH2A 1WRYA 3LYKA 1ACVA 4WEYA 1SJ6A 3D4TA 4MJAA 2J9HA 2P31A 4ZL8A 3BJ5A 2AJQB 3N5OA 4XS4A 1K0BA 1MDJA 2IIYA 3H8QA 2LQQA 1AC1A 3FHKA 3HDCA 2XHFA 3TKQA 3HCZA 4PX1A 3KM6A 5ECLB 3UBKA 1TW9A 2N5AA 4YQUA 1R4WA 1SL0B 2C1YA 3A2XA 3W6GA 5FWGA 5EVOA 1MDKA 1N8JA 4I2TA 2OKAA 1R26A 2LNSA 2C0GA 3LJRA 1XWBA 3HA9A 4IVFA 2DBCA 1WOUA 1HQOA 1SJIA 3RDWA 2A2RA 2LRNA 2B5YA 2DJ3A 4TR1A 5J9CA 3LXTA 1WPIA 4MZWA 1FVKA 2YWNA 2GSQA 2H1DA 3KCMA 2FY6A 2JSZA 2I1UA 2PGTA 3PH9A 2O8VB 1USBA 4MF7A 1YEXA 4MABA 4HQZA 1Z9HA 4MA9A 1RW1A 1AIUA 1TXXA 3DYRA 3A2VA 2LQOA 4PNGA 4MK3A 2YCDA 2TIRA 1TJDA 2LJRA 4F9ZA 4GSSA 4MJEA 5F0GA 2FWEA 2HRAA 3LFLA 2OBKA 5D9XA 1JFUA 1ST9A 4TKYA 3QFAC 1TTZA 2IPAA 2YANA 4KDXA 3DXBA 4JE1A 4N30A 1GWCA 5D9VA 12GSA 3TUEA 2KHPA 2H8LA 1FG4A 1EV4A 3G7JA 6GSUA 2KUCA 4KGIA 1Q4JA 4HS1A 3UIWA 1WWJA 1T00A 1AUCA 1W89A 3Q74A 5ECRB 2XC2A 2PPTA 4P3YB 3IDVA 2DC5A 1N2AA 1GTAA 2WZ9A 4QQ7A 3F4TA 1TP9A 4KH7A 5COHA 4G0KA 3F63A 1WE0A 4MJBA 3KD0A 4POLA 2R4VA 6GSXA 4NHWA 1LU4A 1ILOA 2H70A 5G1KA 2HT9A 1OC3A 2GTUA 2K9FA 2JU5A 3GH6A 1EZKA 3FZ9A 1SK1A 2NBSA 2BJXA 3UVTA 1FB0A 2V41A 2C4JA 1EP8A 3O3TA 1TRUA 4IJ3A 4ZB8A 2GZPA 2GGTA 3WD6A 1Y6EA 3ZL5A 1BEDA 3WT1A 4G9HA 4Q5NA 3HZ8A 3UBLA 4BL7A 2XPEA 2ZNMA 5DJMA 20GSA 3CYNA 4DEJA 1FVJA 1QFNA 4X1UA 5D93A 4KX4A 2IFQA 6GSWA 3EE2A 2IL3A 1YEPA 2H19A 4BA7A 3ZMLA 2VM1A 3UARA 1XFLA 4JRRA 4J2FA 1O81A 1XW6A 1GSSA 2GDRA 1SYRA 1TK5B 4TR4A 2IMDA 1XBSA 4O32A 2MBTA 4ECBA 3J7Yk 1ZCPA 3CSJA 5ID2A 4BVYA 4KDYA 4CDOA 5AISA 1HNCA 3D5JA 1NW2A 2VIMA 3PINA 4MF5A 4PGTA 2YV9A 1B9XC 4ULXA 5IMZA 1X0RA 2HXKA 4L0WA 5HFKA 3OR5A 2AB6A 4HU7A 3IPZA 3GH9A 2HRNA 5C04A 5A4VA 2RUFA 3IV4A 4YQMA 1XXUA 3I6AA 2KP2A 5IMFA 3CTFA 2H1AA 1X9WB 4V1Ap 3TJFA 1A24A 3ZIJA 4EUYA 1GSUA 2GT6A 4NAXA 2V6OA 3HZ4A 5KN0A 3CRTA 1K3LA 1ML6A 1FAAA 4BWSA 2IMEA 1A0FA 3L9SA 2YPMA 2WS2A 1EWXA 1KEBA 2VUPA 1U3AA 3GTUA 4GLTA 2C0EA 1I9DA 3LEFA 1A0RP 4KAEA 2WRTA 1WIKA 4PXOA 1Z3EA 5B8AA 4DSQA 5ECKB 1Z7PA 5F07A 3F8UA 2MMNA 1FO5A 1M2BA 2IN3A 1U3IA 2HYXA 3IK9A 4GCIA 4QL7A 4YQVA 1F37A 4N11A 1GUHA 1EEMA 2YJ7A 6GSVA 5E4WA 2LNTA 3VFIA 3IAS2 2C8UA 4L5LA 1YKAA 5JWOB 4WR5A 5CP1A 4USSA 2ZCTA 1Z7RA 4JU5A 4AGSA 1M0UA 4HJMA 1TOFA 4HDEA 4HZ2A 4IELA 3LYPA 4GSTA 1EGRA 4NPBA 1EOHA 3P7XA 3WGDA 2HSYA 4WR4A 2QSIA 4WF4A 2HNLA 2DSAA 1YF1A 2KOKA 4MZBA 4MF6A 3FEUA 2UZ8A 1B4PA 3NIVA 1YQ1A 2GZYA 2H73A 4G0LA 1T4ZA 3ZZXA 2CZ2A 1O8WA 5KEJA 4LL4B 3VI5A 4IJIA 4OMVA 1KTEA 4HQSA 3TJKA 2DMLA 1WJKA 3WGEA 1M2DA 3KZQA 4Q5FA 2IMKA 1PKZA 3F3QA 2CVBA 4E8EA 3F3RA 2VL3A 1JZWA 1XVWA 4OWYA 2FA4A 4EDYA 2HRKB 4HZ4A 4L0UA 3WYWA 3C1RA 3GKKA 1O73A 3QDNA 4G2EA 2PVQA 2B1LA 4PQIA 4G19A 3QCPA 5IMDA 4XRDA 4K8MA 2PU9C 2KLXA 4MPGA 2VCTA 1I5GA 3GKXA 2I81A 2CVDA 5JCWA 3DIEA 1AXDA 4J56E 4JZQA 1PL2A 4L5OA 2CX3A 4KCAA 2A4VA 2CVKA 2GVPA 1GNWA 2CZ3A 2EIRA 1G0TA 2LRTA 1TI3A 3E9JB 4BVXB 2WCIA 5B7CA 5A5KA 3RAZA 2H1GA 1ERWA 2O89A 3E0UA 4TXVA 1ERVA 4XHMA 1SL2B 3FY7A 1EEJA 2EIOA 2VOCA 2VCZA 4JR6A 2MMAA 2YOIA 4IBPA 1YZXA 2JZRA 5DALA 5JWRB
chains in the Genus database with same CATH superfamily
2VAFA 2YZUA 3KMNA 5DCHA 1T8EB 5A5HB 2E2MA 4TR3A 3IC4A 1Z5YE 4GSNA 1OE7A 4AI6A 1PRXA 3ZIVA 4PI2C 1S3AA 4ZL9A 4O5UA 4NV2A 3M9KA 1OE8A 1AW9A 3P2AA 2HSMB 3QFBC 2RIIA 3M1GA 2YZHA 4NV5A 1ABAA 2CA8A 1G6YA 1FOVA 2CAQA 1SD9A 2YP6A 4GXZA 2RUEA 2FCHA 4MPFA 1DSBA 3HVVA 3TB2A 3TKSC 4FIWA 2JADA 3GURA 1A8LA 3IA1A 5G2ZA 4FXYP 4EL1A 2PMTA 2GSSA 2NVLA 4G10A 1CQHA 1MD4A 3UVHA 3GX0A 4RQXA 3KP9A 5IM9A 4EO3A 3MAKA 4F03A 3CSHA 2QGVA 3IBHA 3EC3A 5CYYA 2RM6A 1OKTA 2D2ZA 3TOTA 1VF2A 2VL2C 3Q19A 2B5XA 3D21A 5A1NB 2GT5A 1VF3A 2QA2A 1C72A 1VF1A 1ZL9A 5G1LA 4PUFC 4CY6A 1SK0A 2HSHA 1HNBA 3EU4A 1BQ7A 3MWHA 3L4NA 5HR2A 1AQWA 4K6XA 1UC7A 1SK2A 5H5QA 5DVBA 1Y25A 1BF5A 3ISOA 3HJOA 19GSA 1O8XA 3MYDA 1ERTA 4K7OA 3IC8A 3F0IA 2C0DA 2WW0A 5IOXA 2R0CA 2DIYA 4GWRA 1NHOA 2G0FA 1PMTA 1X5EA 1HD2A 5KN3A 4NMUA 1X5DA 2FWFA 2PVOC 4RI7A 1M3JA 2DMMA 3HYPA 1AQXA 2WVXA 4IN0A 3VURA 1RQMA 4ECIA 1XOBA 2H30A 3UMAA 3ED3A 5C00A 2MBSA 5DDLA 5EY6A 1YEWC 3ZITA 5LCZA 5CRWA 2C3TA 2YN1A 5JCUA 2H0GA 3J7Yb 1A2LA 4ZBDA 5H5SA 3KGKA 6GSSA 1BJXA 1GSEA 2K8VA 2YWOA 3E3EA 7GSSA 2H1BA 5D9TA 4ECJA 2H0IA 1B9YC 2H76A 1A2JA 1T4YA 2H74A 5G31A 4I5QA 2H72A 5GSSA 2OE0A 3N9JA 5F05A 5D9WA 3GV1A 3L9UA 2GSTA 3FR6A 1ZYNA 2HZEB 1KNGA 4WETA 2F9SA 1JZRA 3ZVJD 2HFDA 1GLPA 3VWUA 5CAXA 2RLIA 2L6CA 4PTSA 3GMFA 3M3MA 3L78A 1M2AA 2GQLA 1K0DA 2OA7A 4O5QA 1K3YA 1SENA 1PX7A 2REMA 3R2QA 5GSTA 1SKWB 1VF4A 1GSQA 5ECSA 2FWGA 1JLVA 5A4WA 3PPUA 1AQVA 2GSRA 2I4AA 3FYGA 4GDFA 4GQFA 1F6MC 4JR4A 3GYKA 4KNDA 1G6WA 5HQPA 4BPYA 1PSQA 2V2GA 3FZAA 3LORA 1V57A 5LD0A 1AAZA 4Q5RA 3GIXA 5HR1A 4K2DA 1YDKA 4KSMA 5IMVA 4W66A 4AJ7A 3O76A 3ZREA 2H71A 3F4SA 10GSA 1ZYEA 5D8IA 4KA0A 2WVYA 1R5AA 2L5LA 2V1MA 5BMUB 3KH9A 2K8SA 2C3NA 4AKIA 1GP1A 4LMVA 1MDIA 4NWYA 5DQYA 4TVEA 3H4KA 2L6DA 5B6MA 1JZDA 2VL9A 3FR9A 3IHGA 1PX6A 2FD3A 4PQ1A 2AAWA 2AYTA 4ML1A 1KBNA 1WP0A 11GSA 2UV8G 2FLSA 1TK8B 1W4VA 3D4MA 5DBQA 3VLNA 3I9V2 3U5RE 2YV7A 5J5NA 3QR6A 4EIQA 2R6KA 4JBBA 1OC8A 3IOSA 1BX9A 2OBIA 3GA4A 4KSOA 3A3TA 1Z6NA 4IS0A 3IHQA 2HQTA 2OE3A 2CX4A 4FYUA 2ALBA 2VLTA 3SBCA 4ML6A 4OD7A 3VWVA 2PUKC 2X8HA 2NDOA 5ABRA 1K0CA 4EVMA 2OACA 4ZXGA 9GSSA 1ZMAA 3IAM2 3LWAA 2R37A 5J9BA 4D73A 5IMAA 3GUSA 1V9WA 3P8WA 2B7KA 4E68A 2X8CA 4OFNA 4RUVA 3GL3A 5JCGA 2JACA 3KTLA 3M0FA 1R7HA 2O36A 2GZZA 4K0NA 2M72A 3HJPA 2HSNB 4CW9A 2GLRA 4GRFA 1EP7A 3GKMA 4KCEA 1K0MA 2XPDA 3VK9A 4LA1A 3US3A 3WGXA 4BIKA 5AGYA 2YWIA 5AN1A 5IPGA 2B7JA 4AJ6A 2OADA 4D73B 4EE0A 4L8EA 1SJZA 1GTBA 1FW1A 3QMXA 2R3XA 3LQ7A 1XIYA 3RPPA 4HEA2 3DKSA 3IE3A 3GKNA 1NM3A 1LBKA 4AF2A 1ON4A 1U6TA 4N0VA 2HRKA 2MMOA 4PQHA 5B6NA 1CQGA 3C71A 4IW9A 5J40A 4Q5QA 4DVCA 3GX8A 1DBYA 3DGQA 1TKDB 2K18A 5E59A 4K5SA 4E8HA 2A2SA 2C3QA 2R0GA 4N0ZA 3PR8A 1XVQA 1ZOFA 4HSCX 4PHZC 3APQA 3IXRA 2VO4A 1EGOA 5B8BA 1K3OA 5J41A 2VCWA 1GSDA 14GSA 4OO4A 3IRAA 4POMA 1SL1B 4KF9A 4TXOB 1XWAA 4OO5A 3IK7A 4BVXA 4I8BA 1V98A 4GQCA 1JLWA 3F9UA 2CAIA 2J23A 3TCOA 3DWVA 3HJMA 1F3BA 5F8BA 3RBTA 3CTGA 3F4RA 1GLQA 2X99A 4FYCA 1F2EA 1XZOA 1TRSA 3VWXA 3HHVA 5ECPB 3QPMA 2TRXA 3UJ1A 2R5GA 4JEDA 4OCEA 3RPNA 1OYJA 2EFDA 2BMXA 2X49A 2WVZA 5CRGA 5HR3A 5DCGA 4O7HA 5A5HA 1OVNA 4MDCA 2G2QA 2ZUPA 4K7IA 2IMIA 5JWQB 2BTOT 3BOAA 3TRPA 16GSA 4ZIJA 2N5FA 4IGJA 3H93A 6GSYA 1GSFA 4LMWA 5IO2A 1TRVA 2HSMA 3TJBA 1V40A 3HVXA 4PUAA 3U6VA 4TN8A 2XBIA 3VI7A 2N5BA 3C1SA 2C80A 3ZRDA 3M8NA 3DRNA 4K7NA 1SD8A 1SVLA 3MNGA 1A23A 1UN2A 1ZGNA 3NOFA 3H79A 1THXA 2FNOA 1QQ2A 1OC9B 1XW9A 3EYTA 3HKRA 4KUNA 1BAYA 1V58A 5LNKe 2IWTA 2RM5A 3CSIA 2CT6A 2Z9SA 2AV4A 2HE3A 2EFEA 4RQRA 1NHYA 2DJ1A 1XWCA 5J3RA 1Q98A 2PBJA 1SKSB 4IP1A 4EXJA 2WULA 2JZSA 4MZCA 4MMMA 3TDGA 1GULA 4MLYA 4DSSB 2H66A 5A1NA 2GQMA 3CMIA 1N25A 4EKZA 3D22A 2CV4A 3UAPA 2EIQA 2VD1A 1MTCA 2B1KA 2LRCA 4YAVA 3W8JA 3ME8A 3HVNA 5HR0A 3CBUA 4TOPA 4IP6A 8GSSA 3FR3A 1URMA 2XBQA 5G5EA 1PL1A 2LEGA 1ZYQB 2LJKA 3TJGA 5G5FA 1XOAA 1J08A 2K6VA 3APSA 3BCKA 6GSTA 3F6FA 3ZFBA 4GF0A 4IQAA 3M9JA 1WMJA 3O6TA 2H6ZA 1O6JA 1XWGA 1X9SB 4CY8A 3QAVA 3NZNA 4ILFA 1QXHA 3C8EA 5AIXA 4KW6A 4LLRA 4AKGA 3W8SA 4HI7A 3LSZA 4X43A 3C7MA 4POKA 2IJYA 1K0OA 1J0FA 2EFCA 2LS5A 3R3EA 4XS4B 2PN8A 4HU9A 5A4UA 5IOWA 4V2MA 1A2MA 5H5RA 1OAZA 3FKFA 2H75A 4J57E 2DJ0A 3TRXA 2WW1A 1GH2A 3LGCA 1X9MB 5CRHA 1XPVA 1H4OA 3EVIA 5KOWA 3ZMKA 3CRUA 4WXTA 2L4CA 5IQYA 4XRAA 2VLUA 3HD5A 2H6XA 1JZOA 2VCVA 1PGTA 3FW2A 1GTUA 2DKHA 1PQNA 4WF5A 4IQ1A 1NSWA 4TRXA 2FHEA 3EURA 3P90A 2AUVA 2JL4A 3APOA 2ON7A 2H6YA 1M9BA 4TR1B 1TXUA 1F9MA 3EU3A 2HZEA 4EDZA 1PD21 3FZ4A 5ECOB 2LV3A 4V1Ag 1T7PB 3Q18A 1PN9A 1U88A 2C0FA 3TU3B 1JHBA 4GTUA 1M99A 4KDUA 4I97A 5INYA 1GL8A 4AKHA 4F2IA 1ZZYA 4MCUA 3V1WA 4OFMA 1GUKA 4K0GA 2OJLA 5IO0A 2QC7A 4FQUA 2KP1A 3DD3A 1MEKA 4FO5A 1B8XA 5ECHB 2B6MA 3FK8A 3RHCA 4CHSA 4G0IA 4ACSA 4QL9A 1EV9A 1SYXA 1YJ6A 2HLSA 3KP8A 1TI1A 3G9BA 5G30A 4PNFA 3BBYA 3TOUA 1XW5A 2QKEA 4LL1B 1HNAA 3S9FA 4X4JA 5ELAA 2FWHA 2F51A 1B4QA 1K0NA 3MSZA 4V2NA 2LJAA 1YF0A 2VCQA 3GNJA 2X8GA 5DJLA 1HYUA 2GQKA 2P5RA 3DVXA 3I69A 2WW3A 2WB9A 1PKWA 5BMUA 3SWLA 5GAPD 5AIVA 2B3SA 2F3MA 2F8FA 4I2UA 2DIZA 3MDKA 1M9AA 3BCIA 3KIJA 2DKIA 4PI0C 1OKDA 4KB3A 2WFCA 3TKSE 2FA8A 2VLVA 3D0ZA 2VM2A 4XCSA 4ID0A 1R5PA 1TK0B 3FMWA 2WJUA 1DE1A 5EPFA 2WGRA 2ES7A 4EC0A 4NXIA 3ERFA 1X5CA 2O5VA 2E0QA 1QK8A 4Z7XA 4ZL7A 5CREA 2DLXA 1GRXA 1M7TA 4XS6A 3L0HA 1GSYA 5F06A 2VD0A 5EL8A 4FYBA 2E2GA 4BL7B 4ZBBA 3CXGA 3RGBC 2IFQB 4EF0A 1EOGA 2X64A 2CQ9A 4TW5A 5GZZB 2B5EA 1MD3A 1S3CA 3MIXA 1E2YA 2M80A 2F8AA 1J9BA 3A2WA 1G7EA 4OCFA 2NPBA 3LXZA 4YAPA 5IPHA 2MMZA 4PURA 5ID2B 4BVYB 2VKZG 2YJHA 1SU9A 2I3YA 1YY7A 2HRFA 3TKRA 1QUWA 4FH8A 2P5QA 2L4QA 1ERUA 5CNWA 1I1IP 3WT2A 4DSRA 1H75A 3EPTA 1YKCA 2HI7A 4ECCA 4V2LA 2EC4A 1B48A 5KOXA 2ON5A 2HSNA 3QAGA 4RI6A 4WKWA 4XIHA 2IMFA 5D73A 2WDUA 3QD9A 5KN1A 4POBA 4IKHA 3ME7A 2E7PA 4ISDA 4ZB6A 2DJJA 5D96A 3HVSA 3KH7A 1THOA 2AHEA 3TKSA 1K0AA 3GHAA 2O85A 2R2JA 5ECIB 3TJJA 1BG1A 1FB6A 2V32A 3GFKA 2O87A 5L71A 1UA5A 4N3ZA 2DJ2A 4K1FA 5CRDA 1T1VA 2YNXA 1T3BA 17GSA 3ZYWA 4Z2RA 4O92A 3GTUB 3KEBA 5HFIA 5GAND 4N10A 4HOJA 1TU8A 1BG5A 4HJ2A 2VL2A 3QAWA 3GSTA 1XCCA 3A5IA 2LUSA 3LG6A 3VPTA 3DVWA 3ZVJA 5FHIA 1DE2A 4ZILA 1VGLA 3EWLA 4TXOA 5ECMB 3GRXA 3F6DA 2M46A 4YKFA 5KN2A 2JSYA 1SKRB 5J4YA 2JZTA 1TDIA 4ZBAA 5DQSA 5FT3A 4K5RA 1F3AA 5DAKA 5IIZA 1GUMA 5HFGA 3UL3A 1IYIA 4OFTA 2I9HA 2NTOA 4ZB9A 22GSA 3LW9A 3HMJG 3DEXA 3TKPA 2A4HA 3VWWA 4I6XA 4HUAA 5ENUA 1S4BP 4ZB7A 3HXSA 2OE1A 5CO3A 2YWMA 5DAKB 3ZLPA 3TRQA 1QGVA 1IYHA 2FGXA 3GSSA 1FHEA 3IR4A 4TR0A 4WBJA 3GL5A 3G7IA 1DUGA 1TU7A 3KTBA 5IMCA 2VCXA 4X0XA 2WZSA 4MP4A 1VRSD 4KE3A 1QMVA 1G7OA 4F82A 1LJRA 2V6KA 2LTKA 2TRCP 5BRTA 5ECQB 4K9ZA 2WW2A 3JCML 4XS1A 3H1NA 2L57A 4MNNA 1GNEA 2L59A 3EMPA 4F0BA 5J4UA 4YH2A 4MH3A 2O7KA 3KJYA 5ELGA 3A5WA 3PGTA 3RHBA 1OC9A 3KXOA 3ZFLA 4BWQA 3TGZA 1GTIA 5A34B 3ERGA 4XTSA 3ERWA 2GS3A 3HY2A 1S3DA 3EMXA 3VPQA 2PWJA 4IHUA 3G7YA 3EINA 3AY8A 1E6BA 3ZTLA 2FUG2 2H01A 2P0GA 1UVZA 4K2XA 1A8YA 1Z6MA 3L9VA 1O85A 4DSSA 3GN3A 4O5RA 3FRCA 2MYGA 3D6IA 5ECNB 3FZ5A 3QOUA 3KMOA 1XWKA 18GSA 2OT3A 3CWGA 3Q6OA 2LSTA 4Z2TA 1U87A 2HZFA 3DMLA 2LKUA 4MJCA 1V2AA 4F0CA 2MZCA 3K8NA 2H0HA 3UEMA 1O7UA 2L5OA 1BYEA 2PERA 4H86A 2DJKA 3BD2A 3C73A 1PA3A 1YVLA 4AJ8A 5DALB 4WBRD 13GSA 3I43A 1RK4A 1TRWA 3UOMA 4NHZA 4MH2A 1WRYA 3LYKA 1ACVA 4WEYA 1SJ6A 3D4TA 4MJAA 2J9HA 2P31A 4ZL8A 3BJ5A 2AJQB 3N5OA 4XS4A 1K0BA 1MDJA 2IIYA 3H8QA 2LQQA 1AC1A 3FHKA 3HDCA 2XHFA 3TKQA 3HCZA 4PX1A 3KM6A 5ECLB 3UBKA 1TW9A 2N5AA 4YQUA 1R4WA 1SL0B 2C1YA 3A2XA 3W6GA 5FWGA 5EVOA 1MDKA 1N8JA 4I2TA 2OKAA 1R26A 2LNSA 2C0GA 1Y1UA 3LJRA 1XWBA 3HA9A 4IVFA 2DBCA 1WOUA 2R0PA 1HQOA 1M3IA 1SJIA 3RDWA 2A2RA 4QMKA 2LRNA 2B5YA 2DJ3A 4TR1A 5J9CA 3LXTA 4EIPA 1WPIA 1PFOA 4MZWA 1FVKA 2YWNA 4ICYA 5J47A 2GSQA 2H1DA 3KCMA 2FY6A 2JSZA 2I1UA 2PGTA 3PH9A 2O8VB 1USBA 4MF7A 1YEXA 4MABA 4HQZA 1Z9HA 4MA9A 1RW1A 1AIUA 1TXXA 3DYRA 1PN0A 1ZYPA 3A2VA 2LQOA 4PNGA 4MK3A 2YCDA 2TIRA 1TJDA 2LJRA 4F9ZA 4GSSA 4MJEA 5F0GA 2FWEA 2HRAA 3LFLA 2OBKA 5D9XA 1JFUA 1ST9A 4TKYA 3QFAC 1TTZA 2IPAA 2YANA 4KDXA 3DXBA 4JE1A 4N30A 1GWCA 5D9VA 2WVXB 12GSA 3TUEA 2KHPA 2H8LA 4Z2UA 1FG4A 1EV4A 3G7JA 6GSUA 2KUCA 4KGIA 1Q4JA 4HS1A 3UIWA 1WWJA 1T00A 1AUCA 1W89A 3Q74A 5ECRB 2XC2A 2PPTA 4P3YB 3IDVA 2DC5A 1N2AA 1GTAA 2WZ9A 4QQ7A 3F4TA 1TP9A 4KH7A 5COHA 4G0KA 3F63A 1WE0A 4MJBA 3KD0A 4POLA 2R4VA 6GSXA 4NHWA 1LU4A 1ILOA 2H70A 5G1KA 2HT9A 1OC3A 2GTUA 2K9FA 2JU5A 4G01A 3GH6A 1EZKA 3FZ9A 1SK1A 2NBSA 2BJXA 3UVTA 1FB0A 2V41A 2C4JA 1EP8A 3O3TA 1TRUA 4IJ3A 4ZB8A 2GZPA 2GGTA 3WD6A 1Y6EA 3ZL5A 1BEDA 3WT1A 4G9HA 4Q5NA 3HZ8A 3UBLA 4BL7A 2XPEA 2ZNMA 5DJMA 20GSA 3CYNA 4DEJA 1FVJA 1QFNA 4X1UA 5D93A 4KX4A 2IFQA 6GSWA 3EE2A 2IL3A 1YEPA 2H19A 4BA7A 3ZMLA 2VM1A 3UARA 1XFLA 4JRRA 4J2FA 4A5PA 1O81A 1SVOA 1XW6A 1GSSA 2GDRA 2H1LA 1SYRA 1TK5B 4TR4A 2IMDA 1XBSA 4O32A 2MBTA 4ECBA 3J7Yk 1ZCPA 3CSJA 5ID2A 4BVYA 4KDYA 4CDOA 5AISA 1HNCA 3D5JA 1NW2A 2VIMA 3PINA 4MF5A 4PGTA 2YV9A 1B9XC 4ULXA 5IMZA 1X0RA 2HXKA 4L0WA 5HFKA 3OR5A 2AB6A 4HU7A 3IPZA 3GH9A 2HRNA 5C04A 5A4VA 2RUFA 3IV4A 4YQMA 1XXUA 3I6AA 2KP2A 5IMFA 3CTFA 2H1AA 1X9WB 4V1Ap 3TJFA 1A24A 3ZIJA 4EUYA 1GSUA 2GT6A 4NAXA 2V6OA 3HZ4A 5KN0A 3CRTA 4AKXB 1K3LA 1ML6A 1FAAA 2EFHA 4BWSA 2IMEA 1A0FA 3L9SA 2YPMA 1SVMA 2WS2A 1EWXA 1KEBA 2VUPA 1U3AA 3GTUA 2O3EA 4GLTA 2C0EA 1I9DA 3LEFA 2X4AA 5J4VA 1A0RP 4KAEA 2WRTA 1WIKA 4PXOA 1Z3EA 5B8AA 4DSQA 5ECKB 1Z7PA 5F07A 3F8UA 2MMNA 4YKGA 1FO5A 1M2BA 2IN3A 1U3IA 2HYXA 3IK9A 4GCIA 4QL7A 4YQVA 1F37A 2A2PA 4N11A 1GUHA 1EEMA 2YJ7A 6GSVA 5E4WA 2LNTA 3VFIA 3IAS2 2C8UA 4L5LA 1YKAA 5JWOB 4WR5A 5CP1A 4USSA 2ZCTA 1Z7RA 4JU5A 4AGSA 1M0UA 4HJMA 1TOFA 4HDEA 4HZ2A 4IELA 3LYPA 4GSTA 1EGRA 4NPBA 2QA1A 1EOHA 3P7XA 3WGDA 2HSYA 4WR4A 2QSIA 4WF4A 2HNLA 2DSAA 1YF1A 2KOKA 4MZBA 4MF6A 3FEUA 2UZ8A 1S3RA 1B4PA 3NIVA 1YQ1A 2GZYA 2H73A 4G0LA 1T4ZA 3ZZXA 2CZ2A 1O8WA 1XG8A 5KEJA 4LL4B 3VI5A 4IJIA 4OMVA 1KTEA 4HQSA 3TJKA 2DMLA 1WJKA 3WGEA 1M2DA 3KZQA 4Q5FA 2IMKA 1PKZA 3F3QA 2CVBA 4E8EA 3F3RA 2VL3A 1JZWA 5A34A 1XVWA 4OWYA 2FA4A 4EDYA 2HRKB 4HZ4A 4L0UA 3WYWA 3C1RA 3GKKA 1O73A 3QDNA 4G2EA 2PVQA 2B1LA 4PQIA 4G19A 3QCPA 5IMDA 4XRDA 4K8MA 2PU9C 2KLXA 4MPGA 2VCTA 3RFRC 1I5GA 3GKXA 2I81A 2CVDA 5JCWA 3DIEA 1AXDA 1FOHA 4J56E 4JZQA 1PL2A 4L5OA 2CX3A 4KCAA 2A4VA 2CVKA 2GVPA 1GNWA 2CZ3A 2EIRA 1G0TA 3CQFA 2LRTA 1TI3A 3E9JB 4BVXB 2WCIA 5B7CA 5A5KA 3RAZA 2H1GA 1ERWA 2O89A 3E0UA 3CHXC 4TXVA 1ERVA 4XHMA 1SL2B 3FY7A 1EEJA 2EIOA 2VOCA 2VCZA 4JR6A 2MMAA 2YOIA 4IBPA 1YZXA 2JZRA 5DALA 5JWRB
chains in the Genus database with same CATH topology
2VAFA 2YZUA 3KMNA 5DCHA 1T8EB 5A5HB 2E2MA 4TR3A 3IC4A 1Z5YE 4GSNA 1OE7A 4AI6A 1PRXA 3ZIVA 1S3AA 4ZL9A 4O5UA 4NV2A 3M9KA 1OE8A 1AW9A 3P2AA 2HSMB 3QFBC 2RIIA 3M1GA 2YZHA 4NV5A 1ABAA 2CA8A 1G6YA 1FOVA 2CAQA 1SD9A 2YP6A 4GXZA 2RUEA 2FCHA 4MPFA 1DSBA 3HVVA 3TB2A 3TKSC 4FIWA 2JADA 3GURA 1A8LA 3IA1A 5G2ZA 4EL1A 2PMTA 2GSSA 2NVLA 4G10A 1CQHA 1MD4A 3UVHA 3GX0A 4RQXA 3KP9A 5IM9A 4EO3A 3MAKA 4F03A 3CSHA 2QGVA 3IBHA 3EC3A 5CYYA 2RM6A 1OKTA 2D2ZA 3TOTA 1VF2A 2VL2C 3Q19A 2B5XA 3D21A 5A1NB 2GT5A 1VF3A 2QA2A 1C72A 1VF1A 1ZL9A 5G1LA 4PUFC 4CY6A 1SK0A 2HSHA 1HNBA 3EU4A 1BQ7A 3MWHA 3L4NA 5HR2A 1AQWA 4K6XA 1UC7A 1SK2A 5H5QA 5DVBA 1Y25A 1BF5A 3ISOA 3HJOA 19GSA 1O8XA 3MYDA 1ERTA 4K7OA 3IC8A 3F0IA 2C0DA 5IOXA 2R0CA 2DIYA 4GWRA 1NHOA 2G0FA 1PMTA 1X5EA 1HD2A 5KN3A 4NMUA 1X5DA 2FWFA 2PVOC 4RI7A 2DMMA 3HYPA 1AQXA 4IN0A 3VURA 1RQMA 4ECIA 1XOBA 2H30A 3UMAA 3ED3A 5C00A 2MBSA 5DDLA 5EY6A 3ZITA 5LCZA 5CRWA 2C3TA 2YN1A 5JCUA 2H0GA 3J7Yb 1A2LA 4ZBDA 5H5SA 3KGKA 6GSSA 1BJXA 1GSEA 2K8VA 2YWOA 3E3EA 7GSSA 2H1BA 5D9TA 4ECJA 2H0IA 1B9YC 2H76A 1A2JA 1T4YA 2H74A 5G31A 4I5QA 2H72A 5GSSA 2OE0A 3N9JA 5F05A 5D9WA 3GV1A 3L9UA 2GSTA 3FR6A 1ZYNA 2HZEB 1KNGA 4WETA 2F9SA 1JZRA 3ZVJD 2HFDA 1GLPA 3VWUA 5CAXA 2RLIA 2L6CA 4PTSA 3GMFA 3M3MA 3L78A 1M2AA 2GQLA 1K0DA 2OA7A 4O5QA 1K3YA 1SENA 1PX7A 2REMA 3R2QA 5GSTA 1SKWB 1VF4A 1GSQA 5ECSA 2FWGA 1JLVA 5A4WA 3PPUA 1AQVA 2GSRA 2I4AA 3FYGA 4GDFA 4GQFA 1F6MC 4JR4A 3GYKA 4KNDA 1G6WA 5HQPA 4BPYA 1PSQA 2V2GA 3FZAA 3LORA 1V57A 5LD0A 1AAZA 4Q5RA 3GIXA 5HR1A 4K2DA 1YDKA 4KSMA 5IMVA 4W66A 4AJ7A 3O76A 3ZREA 2H71A 3F4SA 10GSA 1ZYEA 5D8IA 4KA0A 1R5AA 2L5LA 2V1MA 5BMUB 3KH9A 2K8SA 2C3NA 4AKIA 1GP1A 4LMVA 1MDIA 4NWYA 5DQYA 4TVEA 3H4KA 2L6DA 5B6MA 1JZDA 2VL9A 3FR9A 3IHGA 1PX6A 2FD3A 4PQ1A 2AAWA 2AYTA 4ML1A 1KBNA 1WP0A 11GSA 2UV8G 2FLSA 1TK8B 1W4VA 3D4MA 5DBQA 3VLNA 3I9V2 3U5RE 2YV7A 5J5NA 3QR6A 4EIQA 2R6KA 4JBBA 1OC8A 3IOSA 1BX9A 2OBIA 3GA4A 4KSOA 3A3TA 1Z6NA 4IS0A 3IHQA 2HQTA 2OE3A 2CX4A 4FYUA 2ALBA 2VLTA 3SBCA 4ML6A 4OD7A 3VWVA 2PUKC 2X8HA 2NDOA 5ABRA 1K0CA 4EVMA 2OACA 4ZXGA 9GSSA 1ZMAA 3IAM2 3LWAA 2R37A 5J9BA 4D73A 5IMAA 3GUSA 1V9WA 3P8WA 2B7KA 4E68A 2X8CA 4OFNA 4RUVA 3GL3A 5JCGA 2JACA 3KTLA 3M0FA 1R7HA 2GZZA 4K0NA 2M72A 3HJPA 2HSNB 4CW9A 2GLRA 4GRFA 1EP7A 3GKMA 4KCEA 1K0MA 2XPDA 3VK9A 4LA1A 3US3A 3WGXA 5AGYA 2YWIA 5AN1A 5IPGA 2B7JA 4AJ6A 2OADA 4D73B 4EE0A 4L8EA 1SJZA 1GTBA 1FW1A 3QMXA 2R3XA 3LQ7A 1XIYA 3RPPA 4HEA2 3DKSA 3IE3A 3GKNA 1NM3A 1LBKA 4AF2A 1ON4A 1U6TA 4N0VA 2HRKA 2MMOA 4PQHA 5B6NA 1CQGA 3C71A 4IW9A 5J40A 4Q5QA 4DVCA 3GX8A 1DBYA 3DGQA 1TKDB 2K18A 5E59A 4K5SA 4E8HA 2A2SA 2C3QA 2R0GA 4N0ZA 3PR8A 1XVQA 1ZOFA 3APQA 3IXRA 2VO4A 1EGOA 5B8BA 1K3OA 5J41A 2VCWA 1GSDA 14GSA 4OO4A 3IRAA 4POMA 1SL1B 4KF9A 4TXOB 1XWAA 4OO5A 3IK7A 4BVXA 4I8BA 1V98A 4GQCA 1JLWA 3F9UA 2CAIA 2J23A 3TCOA 3DWVA 3HJMA 1F3BA 5F8BA 3RBTA 3CTGA 3F4RA 1GLQA 2X99A 4FYCA 1F2EA 1XZOA 1TRSA 3VWXA 3HHVA 5ECPB 3QPMA 2TRXA 3UJ1A 2R5GA 4JEDA 4OCEA 3RPNA 1OYJA 2EFDA 2BMXA 2X49A 5CRGA 5HR3A 5DCGA 4O7HA 5A5HA 1OVNA 4MDCA 2G2QA 2ZUPA 4K7IA 2IMIA 5JWQB 2BTOT 3BOAA 3TRPA 16GSA 4ZIJA 2N5FA 4IGJA 3H93A 6GSYA 1GSFA 4LMWA 5IO2A 1TRVA 2HSMA 3TJBA 1V40A 3HVXA 4PUAA 3U6VA 4TN8A 2XBIA 3VI7A 2N5BA 3C1SA 2C80A 3ZRDA 3M8NA 3DRNA 4K7NA 1SD8A 1SVLA 3MNGA 1A23A 1UN2A 1ZGNA 3NOFA 3H79A 1THXA 2FNOA 1QQ2A 1OC9B 1XW9A 3EYTA 3HKRA 4KUNA 1BAYA 1V58A 5LNKe 2IWTA 2RM5A 3CSIA 2CT6A 2Z9SA 2AV4A 2HE3A 2EFEA 4RQRA 1NHYA 2DJ1A 1XWCA 5J3RA 1Q98A 2PBJA 1SKSB 4IP1A 4EXJA 2WULA 2JZSA 4MZCA 4MMMA 3TDGA 1GULA 4MLYA 4DSSB 2H66A 5A1NA 2GQMA 3CMIA 1N25A 4EKZA 3D22A 2CV4A 3UAPA 2EIQA 2VD1A 1MTCA 2B1KA 2LRCA 4YAVA 3W8JA 3ME8A 5HR0A 3CBUA 4TOPA 4IP6A 8GSSA 3FR3A 1URMA 2XBQA 5G5EA 1PL1A 2LEGA 1ZYQB 2LJKA 3TJGA 5G5FA 1XOAA 1J08A 2K6VA 3APSA 3BCKA 6GSTA 3F6FA 3ZFBA 4GF0A 4IQAA 3M9JA 1WMJA 3O6TA 2H6ZA 1O6JA 1XWGA 1X9SB 4CY8A 3QAVA 3NZNA 4ILFA 1QXHA 3C8EA 5AIXA 4KW6A 4LLRA 4AKGA 3W8SA 4HI7A 3LSZA 4X43A 3C7MA 4POKA 2IJYA 1K0OA 1J0FA 2EFCA 2LS5A 3R3EA 4XS4B 2PN8A 4HU9A 5A4UA 5IOWA 4V2MA 1A2MA 5H5RA 1OAZA 3FKFA 2H75A 4J57E 2DJ0A 3TRXA 1GH2A 3LGCA 1X9MB 5CRHA 1XPVA 1H4OA 3EVIA 5KOWA 3ZMKA 3CRUA 4WXTA 2L4CA 5IQYA 4XRAA 2VLUA 3HD5A 2H6XA 1JZOA 2VCVA 1PGTA 3FW2A 1GTUA 2DKHA 1PQNA 4WF5A 4IQ1A 1NSWA 4TRXA 2FHEA 3EURA 3P90A 2AUVA 2JL4A 3APOA 2ON7A 2H6YA 1M9BA 4TR1B 1TXUA 1F9MA 3EU3A 2HZEA 4EDZA 1PD21 3FZ4A 5ECOB 2LV3A 4V1Ag 1T7PB 3Q18A 1PN9A 1U88A 2C0FA 3TU3B 1JHBA 4GTUA 1M99A 4KDUA 4I97A 5INYA 1GL8A 4AKHA 4F2IA 1ZZYA 4MCUA 3V1WA 4OFMA 1GUKA 4K0GA 2OJLA 5IO0A 2QC7A 4FQUA 2KP1A 3DD3A 1MEKA 4FO5A 1B8XA 5ECHB 2B6MA 3FK8A 3RHCA 4CHSA 4G0IA 4ACSA 4QL9A 1EV9A 1SYXA 1YJ6A 2HLSA 3KP8A 1TI1A 3G9BA 5G30A 4PNFA 3BBYA 3TOUA 1XW5A 2QKEA 4LL1B 1HNAA 3S9FA 4X4JA 5ELAA 2FWHA 2F51A 1B4QA 1K0NA 3MSZA 4V2NA 2LJAA 1YF0A 2VCQA 3GNJA 2X8GA 5DJLA 1HYUA 2GQKA 2P5RA 3DVXA 3I69A 2WB9A 1PKWA 5BMUA 3SWLA 5GAPD 5AIVA 2B3SA 2F3MA 2F8FA 4I2UA 2DIZA 3MDKA 1M9AA 3KIJA 3BCIA 2DKIA 1OKDA 4KB3A 2WFCA 3TKSE 2FA8A 2VLVA 3D0ZA 2VM2A 4XCSA 4ID0A 1R5PA 1TK0B 3FMWA 2WJUA 1DE1A 5EPFA 2WGRA 2ES7A 4EC0A 4NXIA 3ERFA 1X5CA 2O5VA 2E0QA 1QK8A 4Z7XA 4ZL7A 5CREA 2DLXA 1GRXA 1M7TA 4XS6A 3L0HA 1GSYA 5F06A 2VD0A 5EL8A 4FYBA 2E2GA 4BL7B 4ZBBA 3CXGA 2IFQB 4EF0A 1EOGA 2X64A 2CQ9A 4TW5A 5GZZB 2B5EA 1MD3A 1S3CA 3MIXA 1E2YA 2M80A 2F8AA 1J9BA 3A2WA 1G7EA 4OCFA 2NPBA 3LXZA 4YAPA 5IPHA 2MMZA 4PURA 5ID2B 4BVYB 2VKZG 2YJHA 1SU9A 2I3YA 1YY7A 2HRFA 3TKRA 1QUWA 4FH8A 2P5QA 2L4QA 1ERUA 5CNWA 3WT2A 4DSRA 1H75A 3EPTA 1YKCA 2HI7A 4ECCA 4V2LA 2EC4A 1B48A 5KOXA 2ON5A 2HSNA 3QAGA 4RI6A 4WKWA 4XIHA 2IMFA 5D73A 2WDUA 3QD9A 5KN1A 4POBA 4IKHA 3ME7A 2E7PA 4ISDA 4ZB6A 2DJJA 5D96A 3HVSA 3KH7A 1THOA 2AHEA 3TKSA 1K0AA 3GHAA 2O85A 2R2JA 5ECIB 3TJJA 1BG1A 1FB6A 2V32A 3GFKA 2O87A 5L71A 1UA5A 4N3ZA 2DJ2A 4K1FA 5CRDA 1T1VA 2YNXA 1T3BA 17GSA 3ZYWA 4Z2RA 4O92A 3GTUB 3KEBA 5HFIA 5GAND 4N10A 4HOJA 1TU8A 1BG5A 4HJ2A 2VL2A 3QAWA 3GSTA 1XCCA 3A5IA 2LUSA 3LG6A 3VPTA 3DVWA 3ZVJA 5FHIA 1DE2A 4ZILA 1VGLA 3EWLA 4TXOA 5ECMB 3GRXA 3F6DA 2M46A 4YKFA 5KN2A 2JSYA 1SKRB 5J4YA 2JZTA 1TDIA 4ZBAA 5DQSA 5FT3A 4K5RA 1F3AA 5DAKA 5IIZA 1GUMA 5HFGA 3UL3A 1IYIA 4OFTA 2I9HA 2NTOA 4ZB9A 22GSA 3LW9A 3HMJG 3DEXA 3TKPA 2A4HA 3VWWA 4I6XA 4HUAA 5ENUA 4ZB7A 3HXSA 2OE1A 5CO3A 2YWMA 5DAKB 3ZLPA 3TRQA 1QGVA 1IYHA 2FGXA 3GSSA 1FHEA 3IR4A 4TR0A 4WBJA 3GL5A 3G7IA 1DUGA 1TU7A 3KTBA 5IMCA 2VCXA 4X0XA 4MP4A 1VRSD 4KE3A 1QMVA 1G7OA 4F82A 1LJRA 2V6KA 2LTKA 2TRCP 5BRTA 5ECQB 4K9ZA 3JCML 4XS1A 3H1NA 2L57A 4MNNA 1GNEA 2L59A 3EMPA 4F0BA 5J4UA 4YH2A 4MH3A 2O7KA 3KJYA 5ELGA 3A5WA 3PGTA 3RHBA 1OC9A 3KXOA 3ZFLA 4BWQA 3TGZA 1GTIA 5A34B 3ERGA 4XTSA 3ERWA 2GS3A 3HY2A 1S3DA 3EMXA 3VPQA 2PWJA 4IHUA 3G7YA 3EINA 3AY8A 1E6BA 3ZTLA 2FUG2 2H01A 2P0GA 1UVZA 4K2XA 1A8YA 1Z6MA 3L9VA 1O85A 4DSSA 3GN3A 4O5RA 3FRCA 2MYGA 3D6IA 5ECNB 3FZ5A 3QOUA 3KMOA 1XWKA 18GSA 2OT3A 3CWGA 3Q6OA 2LSTA 4Z2TA 1U87A 2HZFA 3DMLA 2LKUA 4MJCA 1V2AA 4F0CA 2MZCA 3K8NA 2H0HA 3UEMA 1O7UA 2L5OA 1BYEA 2PERA 4H86A 2DJKA 3BD2A 3C73A 1PA3A 1YVLA 4AJ8A 5DALB 4WBRD 13GSA 3I43A 1RK4A 1TRWA 3UOMA 4NHZA 4MH2A 1WRYA 3LYKA 1ACVA 4WEYA 1SJ6A 3D4TA 4MJAA 2J9HA 2P31A 4ZL8A 3BJ5A 2AJQB 3N5OA 4XS4A 1K0BA 1MDJA 2IIYA 3H8QA 2LQQA 1AC1A 3FHKA 3HDCA 2XHFA 3TKQA 3HCZA 4PX1A 3KM6A 5ECLB 3UBKA 1TW9A 2N5AA 4YQUA 1R4WA 1SL0B 2C1YA 3A2XA 3W6GA 5FWGA 5EVOA 1MDKA 1N8JA 4I2TA 2OKAA 1R26A 2LNSA 2C0GA 1Y1UA 3LJRA 1XWBA 3HA9A 4IVFA 2DBCA 1WOUA 2R0PA 1HQOA 1SJIA 3RDWA 2A2RA 4QMKA 2LRNA 2B5YA 2DJ3A 4TR1A 5J9CA 3LXTA 4EIPA 1WPIA 4MZWA 1FVKA 2YWNA 4ICYA 5J47A 2GSQA 2H1DA 3KCMA 2FY6A 2JSZA 2I1UA 2PGTA 3PH9A 2O8VB 1USBA 4MF7A 1YEXA 4MABA 4HQZA 1Z9HA 4MA9A 1RW1A 1AIUA 1TXXA 3DYRA 1PN0A 1ZYPA 3A2VA 2LQOA 4PNGA 4MK3A 2YCDA 2TIRA 1TJDA 2LJRA 4F9ZA 4GSSA 4MJEA 5F0GA 2FWEA 2HRAA 3LFLA 2OBKA 5D9XA 1JFUA 1ST9A 4TKYA 3QFAC 1TTZA 2IPAA 2YANA 4KDXA 3DXBA 4JE1A 4N30A 1GWCA 5D9VA 12GSA 3TUEA 2KHPA 2H8LA 4Z2UA 1FG4A 1EV4A 3G7JA 6GSUA 2KUCA 4KGIA 1Q4JA 4HS1A 3UIWA 1WWJA 1T00A 1AUCA 1W89A 3Q74A 5ECRB 2XC2A 2PPTA 4P3YB 3IDVA 2DC5A 1N2AA 1GTAA 2WZ9A 4QQ7A 3F4TA 1TP9A 4KH7A 5COHA 4G0KA 3F63A 1WE0A 4MJBA 3KD0A 4POLA 2R4VA 6GSXA 4NHWA 1LU4A 1ILOA 2H70A 5G1KA 2HT9A 1OC3A 2GTUA 2K9FA 2JU5A 4G01A 3GH6A 1EZKA 3FZ9A 1SK1A 2NBSA 2BJXA 3UVTA 1FB0A 2V41A 2C4JA 1EP8A 3O3TA 1TRUA 4IJ3A 4ZB8A 2GZPA 2GGTA 3WD6A 1Y6EA 3ZL5A 1BEDA 3WT1A 4G9HA 4Q5NA 3HZ8A 3UBLA 4BL7A 2XPEA 2ZNMA 5DJMA 20GSA 3CYNA 4DEJA 1FVJA 1QFNA 4X1UA 5D93A 4KX4A 2IFQA 6GSWA 3EE2A 2IL3A 1YEPA 2H19A 4BA7A 3ZMLA 2VM1A 3UARA 1XFLA 4JRRA 4J2FA 4A5PA 1O81A 1SVOA 1XW6A 1GSSA 2GDRA 2H1LA 1SYRA 1TK5B 4TR4A 2IMDA 1XBSA 4O32A 2MBTA 4ECBA 3J7Yk 1ZCPA 3CSJA 5ID2A 4BVYA 4KDYA 4CDOA 5AISA 1HNCA 3D5JA 1NW2A 2VIMA 3PINA 4MF5A 4PGTA 2YV9A 1B9XC 4ULXA 5IMZA 1X0RA 2HXKA 4L0WA 5HFKA 3OR5A 2AB6A 4HU7A 3IPZA 3GH9A 2HRNA 5C04A 5A4VA 2RUFA 3IV4A 4YQMA 1XXUA 3I6AA 2KP2A 5IMFA 3CTFA 2H1AA 1X9WB 4V1Ap 3TJFA 1A24A 3ZIJA 4EUYA 1GSUA 2GT6A 4NAXA 2V6OA 3HZ4A 5KN0A 3CRTA 4AKXB 1K3LA 1ML6A 1FAAA 2EFHA 4BWSA 2IMEA 1A0FA 3L9SA 2YPMA 1SVMA 2WS2A 1EWXA 1KEBA 2VUPA 1U3AA 3GTUA 4GLTA 2C0EA 1I9DA 3LEFA 2X4AA 5J4VA 1A0RP 4KAEA 2WRTA 1WIKA 4PXOA 1Z3EA 5B8AA 4DSQA 5ECKB 1Z7PA 5F07A 3F8UA 2MMNA 4YKGA 1FO5A 1M2BA 2IN3A 1U3IA 2HYXA 3IK9A 4GCIA 4QL7A 4YQVA 1F37A 2A2PA 4N11A 1GUHA 1EEMA 2YJ7A 6GSVA 5E4WA 2LNTA 3VFIA 3IAS2 2C8UA 4L5LA 1YKAA 5JWOB 4WR5A 5CP1A 4USSA 2ZCTA 1Z7RA 4JU5A 4AGSA 1M0UA 4HJMA 1TOFA 4HDEA 4HZ2A 4IELA 3LYPA 4GSTA 1EGRA 4NPBA 2QA1A 1EOHA 3P7XA 3WGDA 2HSYA 4WR4A 2QSIA 4WF4A 2HNLA 2DSAA 1YF1A 2KOKA 4MZBA 4MF6A 3FEUA 2UZ8A 1B4PA 3NIVA 1YQ1A 2GZYA 2H73A 4G0LA 1T4ZA 3ZZXA 2CZ2A 1O8WA 5KEJA 4LL4B 3VI5A 4IJIA 4OMVA 1KTEA 4HQSA 3TJKA 2DMLA 1WJKA 3WGEA 1M2DA 3KZQA 4Q5FA 2IMKA 1PKZA 3F3QA 2CVBA 4E8EA 3F3RA 2VL3A 1JZWA 5A34A 1XVWA 4OWYA 2FA4A 4EDYA 2HRKB 4HZ4A 4L0UA 3WYWA 3C1RA 3GKKA 1O73A 3QDNA 4G2EA 2PVQA 2B1LA 4PQIA 4G19A 3QCPA 5IMDA 4XRDA 4K8MA 2PU9C 2KLXA 4MPGA 2VCTA 1I5GA 3GKXA 2I81A 2CVDA 5JCWA 3DIEA 1AXDA 1FOHA 4J56E 4JZQA 1PL2A 4L5OA 2CX3A 4KCAA 2A4VA 2CVKA 2GVPA 1GNWA 2CZ3A 2EIRA 1G0TA 2LRTA 1TI3A 3E9JB 4BVXB 2WCIA 5B7CA 5A5KA 3RAZA 2H1GA 1ERWA 2O89A 3E0UA 4TXVA 1ERVA 4XHMA 1SL2B 3FY7A 1EEJA 2EIOA 2VOCA 2VCZA 4JR6A 2MMAA 2YOIA 4IBPA 1YZXA 2JZRA 5DALA 5JWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VAF A;  2YZU A;  3KMN A;  5DCH A;  1T8E B;  2E2M A;  4TR3 A;  3IC4 A;  1Z5Y E;  4GSN A;  1OE7 A;  1PRX A;  3ZIV A;  1S3A A;  4ZL9 A;  4NV2 A;  3M9K A;  1OE8 A;  1AW9 A;  3P2A A;  2HSM B;  3QFB C;  2RII A;  3M1G A;  2YZH A;  4NV5 A;  1ABA A;  2CA8 A;  1G6Y A;  1FOV A;  2CAQ A;  1SD9 A;  2YP6 A;  4GXZ A;  2RUE A;  2FCH A;  4MPF A;  1DSB A;  3HVV A;  3TB2 A;  3TKS C;  4FIW A;  2JAD A;  3GUR A;  1A8L A;  3IA1 A;  5G2Z A;  4EL1 A;  2PMT A;  2GSS A;  2NVL A;  4G10 A;  1CQH A;  1MD4 A;  3UVH A;  3GX0 A;  4RQX A;  3KP9 A;  5IM9 A;  4EO3 A;  3MAK A;  4F03 A;  3CSH A;  2QGV A;  3IBH A;  3EC3 A;  5CYY A;  2RM6 A;  1OKT A;  2D2Z A;  3TOT A;  1VF2 A;  2VL2 C;  3Q19 A;  2B5X A;  3D21 A;  2GT5 A;  1VF3 A;  1C72 A;  1VF1 A;  1ZL9 A;  5G1L A;  4PUF C;  1SK0 A;  2HSH A;  1HNB A;  3EU4 A;  1BQ7 A;  3MWH A;  3L4N A;  5HR2 A;  1AQW A;  4K6X A;  1UC7 A;  1SK2 A;  5H5Q A;  5DVB A;  1Y25 A;  3ISO A;  3HJO A;  19GS A;  1O8X A;  1ERT A;  4K7O A;  3IC8 A;  3F0I A;  2C0D A;  5IOX A;  2DIY A;  4GWR A;  1NHO A;  2G0F A;  1PMT A;  1X5E A;  1HD2 A;  5KN3 A;  4NMU A;  1X5D A;  2FWF A;  2PVO C;  4RI7 A;  2DMM A;  3HYP A;  1AQX A;  4IN0 A;  3VUR A;  1RQM A;  4ECI A;  1XOB A;  2H30 A;  3UMA A;  3ED3 A;  5C00 A;  2MBS A;  5DDL A;  5EY6 A;  3ZIT A;  5LCZ A;  5CRW A;  2C3T A;  2YN1 A;  5JCU A;  2H0G A;  3J7Y b;  1A2L A;  4ZBD A;  5H5S A;  3KGK A;  6GSS A;  1BJX A;  1GSE A;  2K8V A;  2YWO A;  3E3E A;  7GSS A;  2H1B A;  5D9T A;  4ECJ A;  2H0I A;  1B9Y C;  2H76 A;  1A2J A;  1T4Y A;  2H74 A;  5G31 A;  4I5Q A;  2H72 A;  5GSS A;  2OE0 A;  3N9J A;  5F05 A;  5D9W A;  3GV1 A;  3L9U A;  2GST A;  3FR6 A;  2HZE B;  1KNG A;  4WET A;  2F9S A;  1JZR A;  3ZVJ D;  2HFD A;  1GLP A;  3VWU A;  5CAX A;  2RLI A;  2L6C A;  4PTS A;  3GMF A;  3M3M A;  3L78 A;  1M2A A;  2GQL A;  1K0D A;  2OA7 A;  1K3Y A;  1SEN A;  1PX7 A;  2REM A;  3R2Q A;  5GST A;  1SKW B;  1VF4 A;  1GSQ A;  5ECS A;  2FWG A;  1JLV A;  5A4W A;  3PPU A;  1AQV A;  2GSR A;  2I4A A;  3FYG A;  4GQF A;  1F6M C;  4JR4 A;  3GYK A;  4KND A;  1G6W A;  5HQP A;  4BPY A;  1PSQ A;  2V2G A;  3FZA A;  3LOR A;  1V57 A;  5LD0 A;  1AAZ A;  4Q5R A;  3GIX A;  5HR1 A;  4K2D A;  1YDK A;  4KSM A;  5IMV A;  4AJ7 A;  3O76 A;  3ZRE A;  2H71 A;  3F4S A;  10GS A;  1ZYE A;  5D8I A;  4KA0 A;  1R5A A;  2L5L A;  2V1M A;  3KH9 A;  2K8S A;  2C3N A;  1GP1 A;  4LMV A;  1MDI A;  4NWY A;  5DQY A;  4TVE A;  3H4K A;  2L6D A;  5B6M A;  1JZD A;  2VL9 A;  3FR9 A;  1PX6 A;  2FD3 A;  4PQ1 A;  2AAW A;  2AYT A;  4ML1 A;  1KBN A;  1WP0 A;  11GS A;  2FLS A;  1TK8 B;  1W4V A;  3D4M A;  5DBQ A;  3VLN A;  3I9V 2;  3U5R E;  2YV7 A;  5J5N A;  3QR6 A;  2R6K A;  4JBB A;  1OC8 A;  3IOS A;  1BX9 A;  2OBI A;  3GA4 A;  4KSO A;  3A3T A;  1Z6N A;  4IS0 A;  3IHQ A;  2HQT A;  2OE3 A;  2CX4 A;  4FYU A;  2ALB A;  2VLT A;  3SBC A;  4ML6 A;  4OD7 A;  3VWV A;  2PUK C;  2X8H A;  2NDO A;  5ABR A;  1K0C A;  4EVM A;  2OAC A;  4ZXG A;  9GSS A;  1ZMA A;  3IAM 2;  3LWA A;  2R37 A;  5J9B A;  4D73 A;  5IMA A;  3GUS A;  1V9W A;  3P8W A;  2B7K A;  2X8C A;  4OFN A;  4RUV A;  3GL3 A;  5JCG A;  2JAC A;  3KTL A;  3M0F A;  1R7H A;  2GZZ A;  4K0N A;  2M72 A;  3HJP A;  2HSN B;  4CW9 A;  2GLR A;  4GRF A;  1EP7 A;  3GKM A;  4KCE A;  1K0M A;  2XPD A;  3VK9 A;  4LA1 A;  3US3 A;  3WGX A;  5AGY A;  2YWI A;  5AN1 A;  5IPG A;  2B7J A;  4AJ6 A;  2OAD A;  4D73 B;  4EE0 A;  4L8E A;  1SJZ A;  1GTB A;  1FW1 A;  3QMX A;  2R3X A;  3LQ7 A;  1XIY A;  3RPP A;  4HEA 2;  3DKS A;  3IE3 A;  3GKN A;  1NM3 A;  1LBK A;  4AF2 A;  1ON4 A;  1U6T A;  4N0V A;  2HRK A;  2MMO A;  4PQH A;  5B6N A;  1CQG A;  3C71 A;  4IW9 A;  4Q5Q A;  4DVC A;  3GX8 A;  1DBY A;  3DGQ A;  1TKD B;  2K18 A;  5E59 A;  4E8H A;  2A2S A;  2C3Q A;  4N0Z A;  3PR8 A;  1XVQ A;  1ZOF A;  3APQ A;  3IXR A;  2VO4 A;  1EGO A;  5B8B A;  1K3O A;  5J41 A;  2VCW A;  1GSD A;  14GS A;  4OO4 A;  3IRA A;  4POM A;  1SL1 B;  4KF9 A;  4TXO B;  1XWA A;  4OO5 A;  3IK7 A;  4BVX A;  4I8B A;  1V98 A;  4GQC A;  1JLW A;  3F9U A;  2CAI A;  2J23 A;  3TCO A;  3DWV A;  3HJM A;  1F3B A;  5F8B A;  3RBT A;  3CTG A;  3F4R A;  1GLQ A;  2X99 A;  4FYC A;  1F2E A;  1XZO A;  1TRS A;  3VWX A;  3HHV A;  5ECP B;  3QPM A;  2TRX A;  3UJ1 A;  2R5G A;  4JED A;  4OCE A;  3RPN A;  1OYJ A;  2BMX A;  5CRG A;  5HR3 A;  5DCG A;  4O7H A;  1OVN A;  4MDC A;  2G2Q A;  2ZUP A;  4K7I A;  2IMI A;  5JWQ B;  2BTO T;  3BOA A;  3TRP A;  16GS A;  4ZIJ A;  2N5F A;  4IGJ A;  3H93 A;  6GSY A;  1GSF A;  4LMW A;  5IO2 A;  1TRV A;  2HSM A;  3TJB A;  1V40 A;  3HVX A;  4PUA A;  3U6V A;  4TN8 A;  2XBI A;  3VI7 A;  2N5B A;  3C1S A;  2C80 A;  3ZRD A;  3M8N A;  3DRN A;  4K7N A;  1SD8 A;  3MNG A;  1A23 A;  1UN2 A;  1ZGN A;  3NOF A;  3H79 A;  1THX A;  2FNO A;  1QQ2 A;  1OC9 B;  1XW9 A;  3EYT A;  3HKR A;  4KUN A;  1BAY A;  1V58 A;  5LNK e;  2IWT A;  2RM5 A;  3CSI A;  2CT6 A;  2Z9S A;  2AV4 A;  2HE3 A;  4RQR A;  1NHY A;  2DJ1 A;  1XWC A;  5J3R A;  1Q98 A;  2PBJ A;  1SKS B;  4IP1 A;  4EXJ A;  2WUL A;  2JZS A;  4MZC A;  4MMM A;  3TDG A;  1GUL A;  4MLY A;  4DSS B;  2H66 A;  2GQM A;  3CMI A;  4EKZ A;  3D22 A;  2CV4 A;  3UAP A;  2EIQ A;  2VD1 A;  1MTC A;  2B1K A;  2LRC A;  4YAV A;  3W8J A;  3ME8 A;  5HR0 A;  3CBU A;  4TOP A;  4IP6 A;  8GSS A;  3FR3 A;  1URM A;  2XBQ A;  5G5E A;  1PL1 A;  2LEG A;  1ZYQ B;  2LJK A;  3TJG A;  5G5F A;  1XOA A;  1J08 A;  2K6V A;  3APS A;  3BCK A;  6GST A;  3F6F A;  3ZFB A;  4GF0 A;  4IQA A;  3M9J A;  1WMJ A;  3O6T A;  2H6Z A;  1O6J A;  1XWG A;  1X9S B;  3QAV A;  3NZN A;  4ILF A;  1QXH A;  3C8E A;  5AIX A;  4KW6 A;  4LLR A;  3W8S A;  4HI7 A;  3LSZ A;  4X43 A;  3C7M A;  4POK A;  2IJY A;  1K0O A;  1J0F A;  2LS5 A;  3R3E A;  4XS4 B;  2PN8 A;  4HU9 A;  5A4U A;  5IOW A;  4V2M A;  1A2M A;  5H5R A;  1OAZ A;  3FKF A;  2H75 A;  4J57 E;  2DJ0 A;  3TRX A;  1GH2 A;  3LGC A;  1X9M B;  5CRH A;  1XPV A;  1H4O A;  3EVI A;  3ZMK A;  3CRU A;  4WXT A;  2L4C A;  5IQY A;  4XRA A;  2VLU A;  3HD5 A;  2H6X A;  1JZO A;  2VCV A;  1PGT A;  3FW2 A;  1GTU A;  1PQN A;  4WF5 A;  4IQ1 A;  1NSW A;  4TRX A;  2FHE A;  3EUR A;  3P90 A;  2AUV A;  2JL4 A;  3APO A;  2ON7 A;  2H6Y A;  1M9B A;  4TR1 B;  1F9M A;  3EU3 A;  2HZE A;  4EDZ A;  1PD2 1;  3FZ4 A;  5ECO B;  2LV3 A;  4V1A g;  1T7P B;  3Q18 A;  1PN9 A;  1U88 A;  2C0F A;  1JHB A;  4GTU A;  1M99 A;  4KDU A;  4I97 A;  5INY A;  1GL8 A;  4F2I A;  1ZZY A;  4MCU A;  3V1W A;  4OFM A;  1GUK A;  4K0G A;  2OJL A;  5IO0 A;  2QC7 A;  4FQU A;  2KP1 A;  3DD3 A;  1MEK A;  4FO5 A;  1B8X A;  5ECH B;  2B6M A;  3FK8 A;  3RHC A;  4CHS A;  4G0I A;  4ACS A;  4QL9 A;  1EV9 A;  1SYX A;  1YJ6 A;  2HLS A;  3KP8 A;  1TI1 A;  3G9B A;  5G30 A;  4PNF A;  3BBY A;  3TOU A;  1XW5 A;  2QKE A;  4LL1 B;  1HNA A;  3S9F A;  5ELA A;  2FWH A;  2F51 A;  1B4Q A;  1K0N A;  3MSZ A;  4V2N A;  2LJA A;  1YF0 A;  2VCQ A;  3GNJ A;  2X8G A;  5DJL A;  1HYU A;  2GQK A;  2P5R A;  3DVX A;  3I69 A;  2WB9 A;  1PKW A;  5BMU A;  3SWL A;  5GAP D;  5AIV A;  2B3S A;  2F3M A;  2F8F A;  4I2U A;  2DIZ A;  3MDK A;  1M9A A;  3KIJ A;  3BCI A;  1OKD A;  4KB3 A;  2WFC A;  3TKS E;  2FA8 A;  2VLV A;  3D0Z A;  2VM2 A;  4XCS A;  4ID0 A;  1R5P A;  1TK0 B;  2WJU A;  1DE1 A;  5EPF A;  2WGR A;  2ES7 A;  4EC0 A;  4NXI A;  3ERF A;  1X5C A;  2E0Q A;  1QK8 A;  4Z7X A;  4ZL7 A;  5CRE A;  2DLX A;  1GRX A;  1M7T A;  4XS6 A;  3L0H A;  1GSY A;  5F06 A;  2VD0 A;  5EL8 A;  4FYB A;  2E2G A;  4BL7 B;  4ZBB A;  3CXG A;  2IFQ B;  4EF0 A;  1EOG A;  2X64 A;  2CQ9 A;  4TW5 A;  5GZZ B;  2B5E A;  1MD3 A;  1S3C A;  1E2Y A;  2M80 A;  2F8A A;  1J9B A;  3A2W A;  1G7E A;  4OCF A;  2NPB A;  3LXZ A;  4YAP A;  5IPH A;  2MMZ A;  4PUR A;  5ID2 B;  4BVY B;  2YJH A;  1SU9 A;  2I3Y A;  1YY7 A;  2HRF A;  3TKR A;  1QUW A;  4FH8 A;  2P5Q A;  2L4Q A;  1ERU A;  5CNW A;  3WT2 A;  4DSR A;  1H75 A;  1YKC A;  2HI7 A;  4ECC A;  4V2L A;  2EC4 A;  1B48 A;  2ON5 A;  3QAG A;  4RI6 A;  4WKW A;  4XIH A;  2IMF A;  5D73 A;  2WDU A;  3QD9 A;  5KN1 A;  4POB A;  4IKH A;  3ME7 A;  2E7P A;  4ISD A;  4ZB6 A;  2DJJ A;  5D96 A;  3HVS A;  3KH7 A;  1THO A;  2AHE A;  3TKS A;  1K0A A;  3GHA A;  2O85 A;  2R2J A;  5ECI B;  3TJJ A;  1FB6 A;  2V32 A;  3GFK A;  2O87 A;  5L71 A;  1UA5 A;  2DJ2 A;  4K1F A;  5CRD A;  1T1V A;  2YNX A;  1T3B A;  17GS A;  3ZYW A;  4O92 A;  3GTU B;  3KEB A;  5HFI A;  5GAN D;  4N10 A;  4HOJ A;  1TU8 A;  1BG5 A;  4HJ2 A;  2VL2 A;  3QAW A;  3GST A;  1XCC A;  2LUS A;  3LG6 A;  3VPT A;  3DVW A;  3ZVJ A;  5FHI A;  1DE2 A;  4ZIL A;  1VGL A;  3EWL A;  4TXO A;  5ECM B;  3GRX A;  3F6D A;  2M46 A;  5KN2 A;  2JSY A;  1SKR B;  2JZT A;  1TDI A;  4ZBA A;  5DQS A;  5FT3 A;  1F3A A;  5DAK A;  5IIZ A;  1GUM A;  5HFG A;  3UL3 A;  1IYI A;  4OFT A;  2I9H A;  2NTO A;  4ZB9 A;  22GS A;  3DEX A;  3TKP A;  3VWW A;  4I6X A;  4HUA A;  5ENU A;  3HXS A;  2OE1 A;  5CO3 A;  2YWM A;  5DAK B;  3ZLP A;  3TRQ A;  1QGV A;  1IYH A;  2FGX A;  3GSS A;  1FHE A;  3IR4 A;  4TR0 A;  4WBJ A;  3GL5 A;  3G7I A;  1DUG A;  1TU7 A;  3KTB A;  5IMC A;  2VCX A;  4X0X A;  4MP4 A;  1VRS D;  4KE3 A;  1QMV A;  1G7O A;  4F82 A;  1LJR A;  2V6K A;  2LTK A;  2TRC P;  5ECQ B;  4K9Z A;  3JCM L;  4XS1 A;  3H1N A;  2L57 A;  1GNE A;  2L59 A;  3EMP A;  4F0B A;  5J4U A;  4YH2 A;  4MH3 A;  2O7K A;  3KJY A;  5ELG A;  3A5W A;  3PGT A;  3RHB A;  1OC9 A;  3KXO A;  3ZFL A;  4BWQ A;  3TGZ A;  1GTI A;  3ERG A;  4XTS A;  3ERW A;  2GS3 A;  3HY2 A;  1S3D A;  3EMX A;  3VPQ A;  2PWJ A;  4IHU A;  3G7Y A;  3EIN A;  3AY8 A;  1E6B A;  3ZTL A;  2FUG 2;  2H01 A;  2P0G A;  1UVZ A;  1A8Y A;  1Z6M A;  3L9V A;  1O85 A;  4DSS A;  3GN3 A;  4O5R A;  3FRC A;  2MYG A;  3D6I A;  5ECN B;  3FZ5 A;  3QOU A;  3KMO A;  1XWK A;  18GS A;  3Q6O A;  2LST A;  1U87 A;  2HZF A;  3DML A;  2LKU A;  4MJC A;  1V2A A;  4F0C A;  2MZC A;  3K8N A;  2H0H A;  3UEM A;  1O7U A;  2L5O A;  1BYE A;  2PER A;  4H86 A;  2DJK A;  3BD2 A;  3C73 A;  1PA3 A;  4AJ8 A;  5DAL B;  4WBR D;  13GS A;  3I43 A;  1RK4 A;  1TRW A;  3UOM A;  4NHZ A;  4MH2 A;  1WRY A;  3LYK A;  1ACV A;  4WEY A;  1SJ6 A;  3D4T A;  4MJA A;  2J9H A;  2P31 A;  4ZL8 A;  3BJ5 A;  2AJQ B;  3N5O A;  4XS4 A;  1K0B A;  1MDJ A;  2IIY A;  3H8Q A;  2LQQ A;  1AC1 A;  3FHK A;  3HDC A;  2XHF A;  3TKQ A;  3HCZ A;  4PX1 A;  3KM6 A;  5ECL B;  3UBK A;  1TW9 A;  2N5A A;  4YQU A;  1R4W A;  1SL0 B;  2C1Y A;  3A2X A;  3W6G A;  5FWG A;  5EVO A;  1MDK A;  1N8J A;  4I2T A;  2OKA A;  1R26 A;  2LNS A;  2C0G A;  3LJR A;  1XWB A;  3HA9 A;  4IVF A;  2DBC A;  1WOU A;  1HQO A;  1SJI A;  3RDW A;  2A2R A;  2LRN A;  2B5Y A;  2DJ3 A;  4TR1 A;  5J9C A;  3LXT A;  1WPI A;  4MZW A;  1FVK A;  2YWN A;  2GSQ A;  2H1D A;  3KCM A;  2FY6 A;  2JSZ A;  2I1U A;  2PGT A;  3PH9 A;  2O8V B;  1USB A;  4MF7 A;  1YEX A;  4MAB A;  4HQZ A;  1Z9H A;  4MA9 A;  1RW1 A;  1AIU A;  1TXX A;  3DYR A;  3A2V A;  2LQO A;  4PNG A;  4MK3 A;  2YCD A;  2TIR A;  1TJD A;  2LJR A;  4F9Z A;  4GSS A;  4MJE A;  5F0G A;  2FWE A;  2HRA A;  3LFL A;  2OBK A;  5D9X A;  1JFU A;  1ST9 A;  4TKY A;  3QFA C;  1TTZ A;  2IPA A;  2YAN A;  4KDX A;  3DXB A;  4JE1 A;  4N30 A;  1GWC A;  5D9V A;  12GS A;  3TUE A;  2KHP A;  2H8L A;  1FG4 A;  1EV4 A;  3G7J A;  6GSU A;  2KUC A;  4KGI A;  1Q4J A;  4HS1 A;  3UIW A;  1WWJ A;  1T00 A;  1AUC A;  1W89 A;  3Q74 A;  5ECR B;  2XC2 A;  2PPT A;  4P3Y B;  3IDV A;  2DC5 A;  1N2A A;  1GTA A;  2WZ9 A;  4QQ7 A;  3F4T A;  1TP9 A;  4KH7 A;  5COH A;  4G0K A;  3F63 A;  1WE0 A;  4MJB A;  3KD0 A;  4POL A;  2R4V A;  6GSX A;  4NHW A;  1LU4 A;  1ILO A;  2H70 A;  5G1K A;  2HT9 A;  1OC3 A;  2GTU A;  2K9F A;  2JU5 A;  3GH6 A;  1EZK A;  3FZ9 A;  1SK1 A;  2NBS A;  2BJX A;  3UVT A;  1FB0 A;  2V41 A;  2C4J A;  1EP8 A;  3O3T A;  1TRU A;  4IJ3 A;  4ZB8 A;  2GZP A;  2GGT A;  3WD6 A;  1Y6E A;  3ZL5 A;  1BED A;  3WT1 A;  4G9H A;  4Q5N A;  3HZ8 A;  3UBL A;  4BL7 A;  2XPE A;  2ZNM A;  5DJM A;  20GS A;  3CYN A;  4DEJ A;  1FVJ A;  1QFN A;  4X1U A;  5D93 A;  4KX4 A;  2IFQ A;  6GSW A;  3EE2 A;  2IL3 A;  1YEP A;  2H19 A;  4BA7 A;  3ZML A;  2VM1 A;  3UAR A;  1XFL A;  4JRR A;  4J2F A;  1O81 A;  1XW6 A;  1GSS A;  2GDR A;  1SYR A;  1TK5 B;  4TR4 A;  2IMD A;  1XBS A;  4O32 A;  2MBT A;  4ECB A;  3J7Y k;  1ZCP A;  3CSJ A;  5ID2 A;  4BVY A;  4KDY A;  4CDO A;  5AIS A;  1HNC A;  3D5J A;  1NW2 A;  2VIM A;  3PIN A;  4MF5 A;  4PGT A;  2YV9 A;  1B9X C;  4ULX A;  5IMZ A;  1X0R A;  2HXK A;  4L0W A;  5HFK A;  3OR5 A;  2AB6 A;  4HU7 A;  3IPZ A;  3GH9 A;  2HRN A;  5C04 A;  5A4V A;  2RUF A;  3IV4 A;  4YQM A;  1XXU A;  3I6A A;  2KP2 A;  5IMF A;  3CTF A;  2H1A A;  1X9W B;  4V1A p;  3TJF A;  1A24 A;  3ZIJ A;  4EUY A;  1GSU A;  2GT6 A;  4NAX A;  2V6O A;  3HZ4 A;  5KN0 A;  3CRT A;  1K3L A;  1ML6 A;  1FAA A;  4BWS A;  2IME A;  1A0F A;  3L9S A;  2YPM A;  2WS2 A;  1EWX A;  1KEB A;  2VUP A;  1U3A A;  3GTU A;  4GLT A;  2C0E A;  1I9D A;  3LEF A;  1A0R P;  4KAE A;  2WRT A;  1WIK A;  4PXO A;  1Z3E A;  5B8A A;  4DSQ A;  5ECK B;  1Z7P A;  5F07 A;  3F8U A;  2MMN A;  1FO5 A;  1M2B A;  2IN3 A;  1U3I A;  2HYX A;  3IK9 A;  4GCI A;  4QL7 A;  4YQV A;  1F37 A;  4N11 A;  1GUH A;  1EEM A;  2YJ7 A;  6GSV A;  5E4W A;  2LNT A;  3VFI A;  3IAS 2;  2C8U A;  4L5L A;  1YKA A;  5JWO B;  4WR5 A;  5CP1 A;  4USS A;  2ZCT A;  1Z7R A;  4JU5 A;  4AGS A;  1M0U A;  4HJM A;  1TOF A;  4HDE A;  4HZ2 A;  4IEL A;  3LYP A;  4GST A;  1EGR A;  4NPB A;  1EOH A;  3P7X A;  3WGD A;  2HSY A;  4WR4 A;  2QSI A;  4WF4 A;  2HNL A;  2DSA A;  1YF1 A;  2KOK A;  4MZB A;  4MF6 A;  3FEU A;  2UZ8 A;  1B4P A;  3NIV A;  1YQ1 A;  2GZY A;  2H73 A;  4G0L A;  1T4Z A;  3ZZX A;  2CZ2 A;  1O8W A;  5KEJ A;  4LL4 B;  3VI5 A;  4IJI A;  4OMV A;  1KTE A;  4HQS A;  3TJK A;  2DML A;  1WJK A;  3WGE A;  1M2D A;  3KZQ A;  4Q5F A;  2IMK A;  1PKZ A;  3F3Q A;  2CVB A;  4E8E A;  3F3R A;  2VL3 A;  1JZW A;  1XVW A;  4OWY A;  2FA4 A;  4EDY A;  2HRK B;  4HZ4 A;  4L0U A;  3WYW A;  3C1R A;  3GKK A;  1O73 A;  3QDN A;  4G2E A;  2PVQ A;  2B1L A;  4PQI A;  4G19 A;  3QCP A;  5IMD A;  4XRD A;  4K8M A;  2PU9 C;  2KLX A;  4MPG A;  2VCT A;  1I5G A;  3GKX A;  2I81 A;  2CVD A;  5JCW A;  3DIE A;  1AXD A;  4J56 E;  4JZQ A;  1PL2 A;  4L5O A;  2CX3 A;  4KCA A;  2A4V A;  2CVK A;  2GVP A;  1GNW A;  2CZ3 A;  2EIR A;  1G0T A;  2LRT A;  1TI3 A;  3E9J B;  4BVX B;  2WCI A;  5B7C A;  5A5K A;  3RAZ A;  2H1G A;  1ERW A;  2O89 A;  3E0U A;  4TXV A;  1ERV A;  4XHM A;  1SL2 B;  3FY7 A;  1EEJ A;  2EIO A;  2VOC A;  2VCZ A;  4JR6 A;  2MMA A;  2YOI A;  4IBP A;  1YZX A;  2JZR A;  5DAL A;  5JWR B; 
#chains in the Genus database with same CATH topology
 2VAF A;  2YZU A;  3KMN A;  5DCH A;  1T8E B;  5A5H B;  2E2M A;  4TR3 A;  3IC4 A;  1Z5Y E;  4GSN A;  1OE7 A;  4AI6 A;  1PRX A;  3ZIV A;  4PI2 C;  1S3A A;  4ZL9 A;  4O5U A;  4NV2 A;  3M9K A;  1OE8 A;  1AW9 A;  3P2A A;  2HSM B;  3QFB C;  2RII A;  3M1G A;  2YZH A;  4NV5 A;  1ABA A;  2CA8 A;  1G6Y A;  1FOV A;  2CAQ A;  1SD9 A;  2YP6 A;  4GXZ A;  2RUE A;  2FCH A;  4MPF A;  1DSB A;  3HVV A;  3TB2 A;  3TKS C;  4FIW A;  2JAD A;  3GUR A;  1A8L A;  3IA1 A;  5G2Z A;  4FXY P;  4EL1 A;  2PMT A;  2GSS A;  2NVL A;  4G10 A;  1CQH A;  1MD4 A;  3UVH A;  3GX0 A;  4RQX A;  3KP9 A;  5IM9 A;  4EO3 A;  3MAK A;  4F03 A;  3CSH A;  2QGV A;  3IBH A;  3EC3 A;  5CYY A;  2RM6 A;  1OKT A;  2D2Z A;  3TOT A;  1VF2 A;  2VL2 C;  3Q19 A;  2B5X A;  3D21 A;  5A1N B;  2GT5 A;  1VF3 A;  2QA2 A;  1C72 A;  1VF1 A;  1ZL9 A;  5G1L A;  4PUF C;  4CY6 A;  1SK0 A;  2HSH A;  1HNB A;  3EU4 A;  1BQ7 A;  3MWH A;  3L4N A;  5HR2 A;  1AQW A;  4K6X A;  1UC7 A;  1SK2 A;  5H5Q A;  5DVB A;  1Y25 A;  1BF5 A;  3ISO A;  3HJO A;  19GS A;  1O8X A;  3MYD A;  1ERT A;  4K7O A;  3IC8 A;  3F0I A;  2C0D A;  2WW0 A;  5IOX A;  2R0C A;  2DIY A;  4GWR A;  1NHO A;  2G0F A;  1PMT A;  1X5E A;  1HD2 A;  5KN3 A;  4NMU A;  1X5D A;  2FWF A;  2PVO C;  4RI7 A;  1M3J A;  2DMM A;  3HYP A;  1AQX A;  2WVX A;  4IN0 A;  3VUR A;  1RQM A;  4ECI A;  1XOB A;  2H30 A;  3UMA A;  3ED3 A;  5C00 A;  2MBS A;  5DDL A;  5EY6 A;  1YEW C;  3ZIT A;  5LCZ A;  5CRW A;  2C3T A;  2YN1 A;  5JCU A;  2H0G A;  3J7Y b;  1A2L A;  4ZBD A;  5H5S A;  3KGK A;  6GSS A;  1BJX A;  1GSE A;  2K8V A;  2YWO A;  3E3E A;  7GSS A;  2H1B A;  5D9T A;  4ECJ A;  2H0I A;  1B9Y C;  2H76 A;  1A2J A;  1T4Y A;  2H74 A;  5G31 A;  4I5Q A;  2H72 A;  5GSS A;  2OE0 A;  3N9J A;  5F05 A;  5D9W A;  3GV1 A;  3L9U A;  2GST A;  3FR6 A;  1ZYN A;  2HZE B;  1KNG A;  4WET A;  2F9S A;  1JZR A;  3ZVJ D;  2HFD A;  1GLP A;  3VWU A;  5CAX A;  2RLI A;  2L6C A;  4PTS A;  3GMF A;  3M3M A;  3L78 A;  1M2A A;  2GQL A;  1K0D A;  2OA7 A;  4O5Q A;  1K3Y A;  1SEN A;  1PX7 A;  2REM A;  3R2Q A;  5GST A;  1SKW B;  1VF4 A;  1GSQ A;  5ECS A;  2FWG A;  1JLV A;  5A4W A;  3PPU A;  1AQV A;  2GSR A;  2I4A A;  3FYG A;  4GDF A;  4GQF A;  1F6M C;  4JR4 A;  3GYK A;  4KND A;  1G6W A;  5HQP A;  4BPY A;  1PSQ A;  2V2G A;  3FZA A;  3LOR A;  1V57 A;  5LD0 A;  1AAZ A;  4Q5R A;  3GIX A;  5HR1 A;  4K2D A;  1YDK A;  4KSM A;  5IMV A;  4W66 A;  4AJ7 A;  3O76 A;  3ZRE A;  2H71 A;  3F4S A;  10GS A;  1ZYE A;  5D8I A;  4KA0 A;  2WVY A;  1R5A A;  2L5L A;  2V1M A;  5BMU B;  3KH9 A;  2K8S A;  2C3N A;  4AKI A;  1GP1 A;  4LMV A;  1MDI A;  4NWY A;  5DQY A;  4TVE A;  3H4K A;  2L6D A;  5B6M A;  1JZD A;  2VL9 A;  3FR9 A;  3IHG A;  1PX6 A;  2FD3 A;  4PQ1 A;  2AAW A;  2AYT A;  4ML1 A;  1KBN A;  1WP0 A;  11GS A;  2UV8 G;  2FLS A;  1TK8 B;  1W4V A;  3D4M A;  5DBQ A;  3VLN A;  3I9V 2;  3U5R E;  2YV7 A;  5J5N A;  3QR6 A;  4EIQ A;  2R6K A;  4JBB A;  1OC8 A;  3IOS A;  1BX9 A;  2OBI A;  3GA4 A;  4KSO A;  3A3T A;  1Z6N A;  4IS0 A;  3IHQ A;  2HQT A;  2OE3 A;  2CX4 A;  4FYU A;  2ALB A;  2VLT A;  3SBC A;  4ML6 A;  4OD7 A;  3VWV A;  2PUK C;  2X8H A;  2NDO A;  5ABR A;  1K0C A;  4EVM A;  2OAC A;  4ZXG A;  9GSS A;  1ZMA A;  3IAM 2;  3LWA A;  2R37 A;  5J9B A;  4D73 A;  5IMA A;  3GUS A;  1V9W A;  3P8W A;  2B7K A;  4E68 A;  2X8C A;  4OFN A;  4RUV A;  3GL3 A;  5JCG A;  2JAC A;  3KTL A;  3M0F A;  1R7H A;  2O36 A;  2GZZ A;  4K0N A;  2M72 A;  3HJP A;  2HSN B;  4CW9 A;  2GLR A;  4GRF A;  1EP7 A;  3GKM A;  4KCE A;  1K0M A;  2XPD A;  3VK9 A;  4LA1 A;  3US3 A;  3WGX A;  4BIK A;  5AGY A;  2YWI A;  5AN1 A;  5IPG A;  2B7J A;  4AJ6 A;  2OAD A;  4D73 B;  4EE0 A;  4L8E A;  1SJZ A;  1GTB A;  1FW1 A;  3QMX A;  2R3X A;  3LQ7 A;  1XIY A;  3RPP A;  4HEA 2;  3DKS A;  3IE3 A;  3GKN A;  1NM3 A;  1LBK A;  4AF2 A;  1ON4 A;  1U6T A;  4N0V A;  2HRK A;  2MMO A;  4PQH A;  5B6N A;  1CQG A;  3C71 A;  4IW9 A;  5J40 A;  4Q5Q A;  4DVC A;  3GX8 A;  1DBY A;  3DGQ A;  1TKD B;  2K18 A;  5E59 A;  4K5S A;  4E8H A;  2A2S A;  2C3Q A;  2R0G A;  4N0Z A;  3PR8 A;  1XVQ A;  1ZOF A;  4HSC X;  4PHZ C;  3APQ A;  3IXR A;  2VO4 A;  1EGO A;  5B8B A;  1K3O A;  5J41 A;  2VCW A;  1GSD A;  14GS A;  4OO4 A;  3IRA A;  4POM A;  1SL1 B;  4KF9 A;  4TXO B;  1XWA A;  4OO5 A;  3IK7 A;  4BVX A;  4I8B A;  1V98 A;  4GQC A;  1JLW A;  3F9U A;  2CAI A;  2J23 A;  3TCO A;  3DWV A;  3HJM A;  1F3B A;  5F8B A;  3RBT A;  3CTG A;  3F4R A;  1GLQ A;  2X99 A;  4FYC A;  1F2E A;  1XZO A;  1TRS A;  3VWX A;  3HHV A;  5ECP B;  3QPM A;  2TRX A;  3UJ1 A;  2R5G A;  4JED A;  4OCE A;  3RPN A;  1OYJ A;  2EFD A;  2BMX A;  2X49 A;  2WVZ A;  5CRG A;  5HR3 A;  5DCG A;  4O7H A;  5A5H A;  1OVN A;  4MDC A;  2G2Q A;  2ZUP A;  4K7I A;  2IMI A;  5JWQ B;  2BTO T;  3BOA A;  3TRP A;  16GS A;  4ZIJ A;  2N5F A;  4IGJ A;  3H93 A;  6GSY A;  1GSF A;  4LMW A;  5IO2 A;  1TRV A;  2HSM A;  3TJB A;  1V40 A;  3HVX A;  4PUA A;  3U6V A;  4TN8 A;  2XBI A;  3VI7 A;  2N5B A;  3C1S A;  2C80 A;  3ZRD A;  3M8N A;  3DRN A;  4K7N A;  1SD8 A;  1SVL A;  3MNG A;  1A23 A;  1UN2 A;  1ZGN A;  3NOF A;  3H79 A;  1THX A;  2FNO A;  1QQ2 A;  1OC9 B;  1XW9 A;  3EYT A;  3HKR A;  4KUN A;  1BAY A;  1V58 A;  5LNK e;  2IWT A;  2RM5 A;  3CSI A;  2CT6 A;  2Z9S A;  2AV4 A;  2HE3 A;  2EFE A;  4RQR A;  1NHY A;  2DJ1 A;  1XWC A;  5J3R A;  1Q98 A;  2PBJ A;  1SKS B;  4IP1 A;  4EXJ A;  2WUL A;  2JZS A;  4MZC A;  4MMM A;  3TDG A;  1GUL A;  4MLY A;  4DSS B;  2H66 A;  5A1N A;  2GQM A;  3CMI A;  1N25 A;  4EKZ A;  3D22 A;  2CV4 A;  3UAP A;  2EIQ A;  2VD1 A;  1MTC A;  2B1K A;  2LRC A;  4YAV A;  3W8J A;  3ME8 A;  3HVN A;  5HR0 A;  3CBU A;  4TOP A;  4IP6 A;  8GSS A;  3FR3 A;  1URM A;  2XBQ A;  5G5E A;  1PL1 A;  2LEG A;  1ZYQ B;  2LJK A;  3TJG A;  5G5F A;  1XOA A;  1J08 A;  2K6V A;  3APS A;  3BCK A;  6GST A;  3F6F A;  3ZFB A;  4GF0 A;  4IQA A;  3M9J A;  1WMJ A;  3O6T A;  2H6Z A;  1O6J A;  1XWG A;  1X9S B;  4CY8 A;  3QAV A;  3NZN A;  4ILF A;  1QXH A;  3C8E A;  5AIX A;  4KW6 A;  4LLR A;  4AKG A;  3W8S A;  4HI7 A;  3LSZ A;  4X43 A;  3C7M A;  4POK A;  2IJY A;  1K0O A;  1J0F A;  2EFC A;  2LS5 A;  3R3E A;  4XS4 B;  2PN8 A;  4HU9 A;  5A4U A;  5IOW A;  4V2M A;  1A2M A;  5H5R A;  1OAZ A;  3FKF A;  2H75 A;  4J57 E;  2DJ0 A;  3TRX A;  2WW1 A;  1GH2 A;  3LGC A;  1X9M B;  5CRH A;  1XPV A;  1H4O A;  3EVI A;  5KOW A;  3ZMK A;  3CRU A;  4WXT A;  2L4C A;  5IQY A;  4XRA A;  2VLU A;  3HD5 A;  2H6X A;  1JZO A;  2VCV A;  1PGT A;  3FW2 A;  1GTU A;  2DKH A;  1PQN A;  4WF5 A;  4IQ1 A;  1NSW A;  4TRX A;  2FHE A;  3EUR A;  3P90 A;  2AUV A;  2JL4 A;  3APO A;  2ON7 A;  2H6Y A;  1M9B A;  4TR1 B;  1TXU A;  1F9M A;  3EU3 A;  2HZE A;  4EDZ A;  1PD2 1;  3FZ4 A;  5ECO B;  2LV3 A;  4V1A g;  1T7P B;  3Q18 A;  1PN9 A;  1U88 A;  2C0F A;  3TU3 B;  1JHB A;  4GTU A;  1M99 A;  4KDU A;  4I97 A;  5INY A;  1GL8 A;  4AKH A;  4F2I A;  1ZZY A;  4MCU A;  3V1W A;  4OFM A;  1GUK A;  4K0G A;  2OJL A;  5IO0 A;  2QC7 A;  4FQU A;  2KP1 A;  3DD3 A;  1MEK A;  4FO5 A;  1B8X A;  5ECH B;  2B6M A;  3FK8 A;  3RHC A;  4CHS A;  4G0I A;  4ACS A;  4QL9 A;  1EV9 A;  1SYX A;  1YJ6 A;  2HLS A;  3KP8 A;  1TI1 A;  3G9B A;  5G30 A;  4PNF A;  3BBY A;  3TOU A;  1XW5 A;  2QKE A;  4LL1 B;  1HNA A;  3S9F A;  4X4J A;  5ELA A;  2FWH A;  2F51 A;  1B4Q A;  1K0N A;  3MSZ A;  4V2N A;  2LJA A;  1YF0 A;  2VCQ A;  3GNJ A;  2X8G A;  5DJL A;  1HYU A;  2GQK A;  2P5R A;  3DVX A;  3I69 A;  2WW3 A;  2WB9 A;  1PKW A;  5BMU A;  3SWL A;  5GAP D;  5AIV A;  2B3S A;  2F3M A;  2F8F A;  4I2U A;  2DIZ A;  3MDK A;  1M9A A;  3BCI A;  3KIJ A;  2DKI A;  4PI0 C;  1OKD A;  4KB3 A;  2WFC A;  3TKS E;  2FA8 A;  2VLV A;  3D0Z A;  2VM2 A;  4XCS A;  4ID0 A;  1R5P A;  1TK0 B;  3FMW A;  2WJU A;  1DE1 A;  5EPF A;  2WGR A;  2ES7 A;  4EC0 A;  4NXI A;  3ERF A;  1X5C A;  2O5V A;  2E0Q A;  1QK8 A;  4Z7X A;  4ZL7 A;  5CRE A;  2DLX A;  1GRX A;  1M7T A;  4XS6 A;  3L0H A;  1GSY A;  5F06 A;  2VD0 A;  5EL8 A;  4FYB A;  2E2G A;  4BL7 B;  4ZBB A;  3CXG A;  3RGB C;  2IFQ B;  4EF0 A;  1EOG A;  2X64 A;  2CQ9 A;  4TW5 A;  5GZZ B;  2B5E A;  1MD3 A;  1S3C A;  3MIX A;  1E2Y A;  2M80 A;  2F8A A;  1J9B A;  3A2W A;  1G7E A;  4OCF A;  2NPB A;  3LXZ A;  4YAP A;  5IPH A;  2MMZ A;  4PUR A;  5ID2 B;  4BVY B;  2VKZ G;  2YJH A;  1SU9 A;  2I3Y A;  1YY7 A;  2HRF A;  3TKR A;  1QUW A;  4FH8 A;  2P5Q A;  2L4Q A;  1ERU A;  5CNW A;  1I1I P;  3WT2 A;  4DSR A;  1H75 A;  3EPT A;  1YKC A;  2HI7 A;  4ECC A;  4V2L A;  2EC4 A;  1B48 A;  5KOX A;  2ON5 A;  2HSN A;  3QAG A;  4RI6 A;  4WKW A;  4XIH A;  2IMF A;  5D73 A;  2WDU A;  3QD9 A;  5KN1 A;  4POB A;  4IKH A;  3ME7 A;  2E7P A;  4ISD A;  4ZB6 A;  2DJJ A;  5D96 A;  3HVS A;  3KH7 A;  1THO A;  2AHE A;  3TKS A;  1K0A A;  3GHA A;  2O85 A;  2R2J A;  5ECI B;  3TJJ A;  1BG1 A;  1FB6 A;  2V32 A;  3GFK A;  2O87 A;  5L71 A;  1UA5 A;  4N3Z A;  2DJ2 A;  4K1F A;  5CRD A;  1T1V A;  2YNX A;  1T3B A;  17GS A;  3ZYW A;  4Z2R A;  4O92 A;  3GTU B;  3KEB A;  5HFI A;  5GAN D;  4N10 A;  4HOJ A;  1TU8 A;  1BG5 A;  4HJ2 A;  2VL2 A;  3QAW A;  3GST A;  1XCC A;  3A5I A;  2LUS A;  3LG6 A;  3VPT A;  3DVW A;  3ZVJ A;  5FHI A;  1DE2 A;  4ZIL A;  1VGL A;  3EWL A;  4TXO A;  5ECM B;  3GRX A;  3F6D A;  2M46 A;  4YKF A;  5KN2 A;  2JSY A;  1SKR B;  5J4Y A;  2JZT A;  1TDI A;  4ZBA A;  5DQS A;  5FT3 A;  4K5R A;  1F3A A;  5DAK A;  5IIZ A;  1GUM A;  5HFG A;  3UL3 A;  1IYI A;  4OFT A;  2I9H A;  2NTO A;  4ZB9 A;  22GS A;  3LW9 A;  3HMJ G;  3DEX A;  3TKP A;  2A4H A;  3VWW A;  4I6X A;  4HUA A;  5ENU A;  1S4B P;  4ZB7 A;  3HXS A;  2OE1 A;  5CO3 A;  2YWM A;  5DAK B;  3ZLP A;  3TRQ A;  1QGV A;  1IYH A;  2FGX A;  3GSS A;  1FHE A;  3IR4 A;  4TR0 A;  4WBJ A;  3GL5 A;  3G7I A;  1DUG A;  1TU7 A;  3KTB A;  5IMC A;  2VCX A;  4X0X A;  2WZS A;  4MP4 A;  1VRS D;  4KE3 A;  1QMV A;  1G7O A;  4F82 A;  1LJR A;  2V6K A;  2LTK A;  2TRC P;  5BRT A;  5ECQ B;  4K9Z A;  2WW2 A;  3JCM L;  4XS1 A;  3H1N A;  2L57 A;  4MNN A;  1GNE A;  2L59 A;  3EMP A;  4F0B A;  5J4U A;  4YH2 A;  4MH3 A;  2O7K A;  3KJY A;  5ELG A;  3A5W A;  3PGT A;  3RHB A;  1OC9 A;  3KXO A;  3ZFL A;  4BWQ A;  3TGZ A;  1GTI A;  5A34 B;  3ERG A;  4XTS A;  3ERW A;  2GS3 A;  3HY2 A;  1S3D A;  3EMX A;  3VPQ A;  2PWJ A;  4IHU A;  3G7Y A;  3EIN A;  3AY8 A;  1E6B A;  3ZTL A;  2FUG 2;  2H01 A;  2P0G A;  1UVZ A;  4K2X A;  1A8Y A;  1Z6M A;  3L9V A;  1O85 A;  4DSS A;  3GN3 A;  4O5R A;  3FRC A;  2MYG A;  3D6I A;  5ECN B;  3FZ5 A;  3QOU A;  3KMO A;  1XWK A;  18GS A;  2OT3 A;  3CWG A;  3Q6O A;  2LST A;  4Z2T A;  1U87 A;  2HZF A;  3DML A;  2LKU A;  4MJC A;  1V2A A;  4F0C A;  2MZC A;  3K8N A;  2H0H A;  3UEM A;  1O7U A;  2L5O A;  1BYE A;  2PER A;  4H86 A;  2DJK A;  3BD2 A;  3C73 A;  1PA3 A;  1YVL A;  4AJ8 A;  5DAL B;  4WBR D;  13GS A;  3I43 A;  1RK4 A;  1TRW A;  3UOM A;  4NHZ A;  4MH2 A;  1WRY A;  3LYK A;  1ACV A;  4WEY A;  1SJ6 A;  3D4T A;  4MJA A;  2J9H A;  2P31 A;  4ZL8 A;  3BJ5 A;  2AJQ B;  3N5O A;  4XS4 A;  1K0B A;  1MDJ A;  2IIY A;  3H8Q A;  2LQQ A;  1AC1 A;  3FHK A;  3HDC A;  2XHF A;  3TKQ A;  3HCZ A;  4PX1 A;  3KM6 A;  5ECL B;  3UBK A;  1TW9 A;  2N5A A;  4YQU A;  1R4W A;  1SL0 B;  2C1Y A;  3A2X A;  3W6G A;  5FWG A;  5EVO A;  1MDK A;  1N8J A;  4I2T A;  2OKA A;  1R26 A;  2LNS A;  2C0G A;  1Y1U A;  3LJR A;  1XWB A;  3HA9 A;  4IVF A;  2DBC A;  1WOU A;  2R0P A;  1HQO A;  1M3I A;  1SJI A;  3RDW A;  2A2R A;  4QMK A;  2LRN A;  2B5Y A;  2DJ3 A;  4TR1 A;  5J9C A;  3LXT A;  4EIP A;  1WPI A;  1PFO A;  4MZW A;  1FVK A;  2YWN A;  4ICY A;  5J47 A;  2GSQ A;  2H1D A;  3KCM A;  2FY6 A;  2JSZ A;  2I1U A;  2PGT A;  3PH9 A;  2O8V B;  1USB A;  4MF7 A;  1YEX A;  4MAB A;  4HQZ A;  1Z9H A;  4MA9 A;  1RW1 A;  1AIU A;  1TXX A;  3DYR A;  1PN0 A;  1ZYP A;  3A2V A;  2LQO A;  4PNG A;  4MK3 A;  2YCD A;  2TIR A;  1TJD A;  2LJR A;  4F9Z A;  4GSS A;  4MJE A;  5F0G A;  2FWE A;  2HRA A;  3LFL A;  2OBK A;  5D9X A;  1JFU A;  1ST9 A;  4TKY A;  3QFA C;  1TTZ A;  2IPA A;  2YAN A;  4KDX A;  3DXB A;  4JE1 A;  4N30 A;  1GWC A;  5D9V A;  2WVX B;  12GS A;  3TUE A;  2KHP A;  2H8L A;  4Z2U A;  1FG4 A;  1EV4 A;  3G7J A;  6GSU A;  2KUC A;  4KGI A;  1Q4J A;  4HS1 A;  3UIW A;  1WWJ A;  1T00 A;  1AUC A;  1W89 A;  3Q74 A;  5ECR B;  2XC2 A;  2PPT A;  4P3Y B;  3IDV A;  2DC5 A;  1N2A A;  1GTA A;  2WZ9 A;  4QQ7 A;  3F4T A;  1TP9 A;  4KH7 A;  5COH A;  4G0K A;  3F63 A;  1WE0 A;  4MJB A;  3KD0 A;  4POL A;  2R4V A;  6GSX A;  4NHW A;  1LU4 A;  1ILO A;  2H70 A;  5G1K A;  2HT9 A;  1OC3 A;  2GTU A;  2K9F A;  2JU5 A;  4G01 A;  3GH6 A;  1EZK A;  3FZ9 A;  1SK1 A;  2NBS A;  2BJX A;  3UVT A;  1FB0 A;  2V41 A;  2C4J A;  1EP8 A;  3O3T A;  1TRU A;  4IJ3 A;  4ZB8 A;  2GZP A;  2GGT A;  3WD6 A;  1Y6E A;  3ZL5 A;  1BED A;  3WT1 A;  4G9H A;  4Q5N A;  3HZ8 A;  3UBL A;  4BL7 A;  2XPE A;  2ZNM A;  5DJM A;  20GS A;  3CYN A;  4DEJ A;  1FVJ A;  1QFN A;  4X1U A;  5D93 A;  4KX4 A;  2IFQ A;  6GSW A;  3EE2 A;  2IL3 A;  1YEP A;  2H19 A;  4BA7 A;  3ZML A;  2VM1 A;  3UAR A;  1XFL A;  4JRR A;  4J2F A;  4A5P A;  1O81 A;  1SVO A;  1XW6 A;  1GSS A;  2GDR A;  2H1L A;  1SYR A;  1TK5 B;  4TR4 A;  2IMD A;  1XBS A;  4O32 A;  2MBT A;  4ECB A;  3J7Y k;  1ZCP A;  3CSJ A;  5ID2 A;  4BVY A;  4KDY A;  4CDO A;  5AIS A;  1HNC A;  3D5J A;  1NW2 A;  2VIM A;  3PIN A;  4MF5 A;  4PGT A;  2YV9 A;  1B9X C;  4ULX A;  5IMZ A;  1X0R A;  2HXK A;  4L0W A;  5HFK A;  3OR5 A;  2AB6 A;  4HU7 A;  3IPZ A;  3GH9 A;  2HRN A;  5C04 A;  5A4V A;  2RUF A;  3IV4 A;  4YQM A;  1XXU A;  3I6A A;  2KP2 A;  5IMF A;  3CTF A;  2H1A A;  1X9W B;  4V1A p;  3TJF A;  1A24 A;  3ZIJ A;  4EUY A;  1GSU A;  2GT6 A;  4NAX A;  2V6O A;  3HZ4 A;  5KN0 A;  3CRT A;  4AKX B;  1K3L A;  1ML6 A;  1FAA A;  2EFH A;  4BWS A;  2IME A;  1A0F A;  3L9S A;  2YPM A;  1SVM A;  2WS2 A;  1EWX A;  1KEB A;  2VUP A;  1U3A A;  3GTU A;  2O3E A;  4GLT A;  2C0E A;  1I9D A;  3LEF A;  2X4A A;  5J4V A;  1A0R P;  4KAE A;  2WRT A;  1WIK A;  4PXO A;  1Z3E A;  5B8A A;  4DSQ A;  5ECK B;  1Z7P A;  5F07 A;  3F8U A;  2MMN A;  4YKG A;  1FO5 A;  1M2B A;  2IN3 A;  1U3I A;  2HYX A;  3IK9 A;  4GCI A;  4QL7 A;  4YQV A;  1F37 A;  2A2P A;  4N11 A;  1GUH A;  1EEM A;  2YJ7 A;  6GSV A;  5E4W A;  2LNT A;  3VFI A;  3IAS 2;  2C8U A;  4L5L A;  1YKA A;  5JWO B;  4WR5 A;  5CP1 A;  4USS A;  2ZCT A;  1Z7R A;  4JU5 A;  4AGS A;  1M0U A;  4HJM A;  1TOF A;  4HDE A;  4HZ2 A;  4IEL A;  3LYP A;  4GST A;  1EGR A;  4NPB A;  2QA1 A;  1EOH A;  3P7X A;  3WGD A;  2HSY A;  4WR4 A;  2QSI A;  4WF4 A;  2HNL A;  2DSA A;  1YF1 A;  2KOK A;  4MZB A;  4MF6 A;  3FEU A;  2UZ8 A;  1S3R A;  1B4P A;  3NIV A;  1YQ1 A;  2GZY A;  2H73 A;  4G0L A;  1T4Z A;  3ZZX A;  2CZ2 A;  1O8W A;  1XG8 A;  5KEJ A;  4LL4 B;  3VI5 A;  4IJI A;  4OMV A;  1KTE A;  4HQS A;  3TJK A;  2DML A;  1WJK A;  3WGE A;  1M2D A;  3KZQ A;  4Q5F A;  2IMK A;  1PKZ A;  3F3Q A;  2CVB A;  4E8E A;  3F3R A;  2VL3 A;  1JZW A;  5A34 A;  1XVW A;  4OWY A;  2FA4 A;  4EDY A;  2HRK B;  4HZ4 A;  4L0U A;  3WYW A;  3C1R A;  3GKK A;  1O73 A;  3QDN A;  4G2E A;  2PVQ A;  2B1L A;  4PQI A;  4G19 A;  3QCP A;  5IMD A;  4XRD A;  4K8M A;  2PU9 C;  2KLX A;  4MPG A;  2VCT A;  3RFR C;  1I5G A;  3GKX A;  2I81 A;  2CVD A;  5JCW A;  3DIE A;  1AXD A;  1FOH A;  4J56 E;  4JZQ A;  1PL2 A;  4L5O A;  2CX3 A;  4KCA A;  2A4V A;  2CVK A;  2GVP A;  1GNW A;  2CZ3 A;  2EIR A;  1G0T A;  3CQF A;  2LRT A;  1TI3 A;  3E9J B;  4BVX B;  2WCI A;  5B7C A;  5A5K A;  3RAZ A;  2H1G A;  1ERW A;  2O89 A;  3E0U A;  3CHX C;  4TXV A;  1ERV A;  4XHM A;  1SL2 B;  3FY7 A;  1EEJ A;  2EIO A;  2VOC A;  2VCZ A;  4JR6 A;  2MMA A;  2YOI A;  4IBP A;  1YZX A;  2JZR A;  5DAL A;  5JWR B; 
#chains in the Genus database with same CATH homology
 2VAF A;  2YZU A;  3KMN A;  5DCH A;  1T8E B;  5A5H B;  2E2M A;  4TR3 A;  3IC4 A;  1Z5Y E;  4GSN A;  1OE7 A;  4AI6 A;  1PRX A;  3ZIV A;  1S3A A;  4ZL9 A;  4O5U A;  4NV2 A;  3M9K A;  1OE8 A;  1AW9 A;  3P2A A;  2HSM B;  3QFB C;  2RII A;  3M1G A;  2YZH A;  4NV5 A;  1ABA A;  2CA8 A;  1G6Y A;  1FOV A;  2CAQ A;  1SD9 A;  2YP6 A;  4GXZ A;  2RUE A;  2FCH A;  4MPF A;  1DSB A;  3HVV A;  3TB2 A;  3TKS C;  4FIW A;  2JAD A;  3GUR A;  1A8L A;  3IA1 A;  5G2Z A;  4EL1 A;  2PMT A;  2GSS A;  2NVL A;  4G10 A;  1CQH A;  1MD4 A;  3UVH A;  3GX0 A;  4RQX A;  3KP9 A;  5IM9 A;  4EO3 A;  3MAK A;  4F03 A;  3CSH A;  2QGV A;  3IBH A;  3EC3 A;  5CYY A;  2RM6 A;  1OKT A;  2D2Z A;  3TOT A;  1VF2 A;  2VL2 C;  3Q19 A;  2B5X A;  3D21 A;  5A1N B;  2GT5 A;  1VF3 A;  2QA2 A;  1C72 A;  1VF1 A;  1ZL9 A;  5G1L A;  4PUF C;  4CY6 A;  1SK0 A;  2HSH A;  1HNB A;  3EU4 A;  1BQ7 A;  3MWH A;  3L4N A;  5HR2 A;  1AQW A;  4K6X A;  1UC7 A;  1SK2 A;  5H5Q A;  5DVB A;  1Y25 A;  1BF5 A;  3ISO A;  3HJO A;  19GS A;  1O8X A;  3MYD A;  1ERT A;  4K7O A;  3IC8 A;  3F0I A;  2C0D A;  5IOX A;  2R0C A;  2DIY A;  4GWR A;  1NHO A;  2G0F A;  1PMT A;  1X5E A;  1HD2 A;  5KN3 A;  4NMU A;  1X5D A;  2FWF A;  2PVO C;  4RI7 A;  2DMM A;  3HYP A;  1AQX A;  4IN0 A;  3VUR A;  1RQM A;  4ECI A;  1XOB A;  2H30 A;  3UMA A;  3ED3 A;  5C00 A;  2MBS A;  5DDL A;  5EY6 A;  3ZIT A;  5LCZ A;  5CRW A;  2C3T A;  2YN1 A;  5JCU A;  2H0G A;  3J7Y b;  1A2L A;  4ZBD A;  5H5S A;  3KGK A;  6GSS A;  1BJX A;  1GSE A;  2K8V A;  2YWO A;  3E3E A;  7GSS A;  2H1B A;  5D9T A;  4ECJ A;  2H0I A;  1B9Y C;  2H76 A;  1A2J A;  1T4Y A;  2H74 A;  5G31 A;  4I5Q A;  2H72 A;  5GSS A;  2OE0 A;  3N9J A;  5F05 A;  5D9W A;  3GV1 A;  3L9U A;  2GST A;  3FR6 A;  1ZYN A;  2HZE B;  1KNG A;  4WET A;  2F9S A;  1JZR A;  3ZVJ D;  2HFD A;  1GLP A;  3VWU A;  5CAX A;  2RLI A;  2L6C A;  4PTS A;  3GMF A;  3M3M A;  3L78 A;  1M2A A;  2GQL A;  1K0D A;  2OA7 A;  4O5Q A;  1K3Y A;  1SEN A;  1PX7 A;  2REM A;  3R2Q A;  5GST A;  1SKW B;  1VF4 A;  1GSQ A;  5ECS A;  2FWG A;  1JLV A;  5A4W A;  3PPU A;  1AQV A;  2GSR A;  2I4A A;  3FYG A;  4GDF A;  4GQF A;  1F6M C;  4JR4 A;  3GYK A;  4KND A;  1G6W A;  5HQP A;  4BPY A;  1PSQ A;  2V2G A;  3FZA A;  3LOR A;  1V57 A;  5LD0 A;  1AAZ A;  4Q5R A;  3GIX A;  5HR1 A;  4K2D A;  1YDK A;  4KSM A;  5IMV A;  4W66 A;  4AJ7 A;  3O76 A;  3ZRE A;  2H71 A;  3F4S A;  10GS A;  1ZYE A;  5D8I A;  4KA0 A;  1R5A A;  2L5L A;  2V1M A;  5BMU B;  3KH9 A;  2K8S A;  2C3N A;  4AKI A;  1GP1 A;  4LMV A;  1MDI A;  4NWY A;  5DQY A;  4TVE A;  3H4K A;  2L6D A;  5B6M A;  1JZD A;  2VL9 A;  3FR9 A;  3IHG A;  1PX6 A;  2FD3 A;  4PQ1 A;  2AAW A;  2AYT A;  4ML1 A;  1KBN A;  1WP0 A;  11GS A;  2UV8 G;  2FLS A;  1TK8 B;  1W4V A;  3D4M A;  5DBQ A;  3VLN A;  3I9V 2;  3U5R E;  2YV7 A;  5J5N A;  3QR6 A;  4EIQ A;  2R6K A;  4JBB A;  1OC8 A;  3IOS A;  1BX9 A;  2OBI A;  3GA4 A;  4KSO A;  3A3T A;  1Z6N A;  4IS0 A;  3IHQ A;  2HQT A;  2OE3 A;  2CX4 A;  4FYU A;  2ALB A;  2VLT A;  3SBC A;  4ML6 A;  4OD7 A;  3VWV A;  2PUK C;  2X8H A;  2NDO A;  5ABR A;  1K0C A;  4EVM A;  2OAC A;  4ZXG A;  9GSS A;  1ZMA A;  3IAM 2;  3LWA A;  2R37 A;  5J9B A;  4D73 A;  5IMA A;  3GUS A;  1V9W A;  3P8W A;  2B7K A;  4E68 A;  2X8C A;  4OFN A;  4RUV A;  3GL3 A;  5JCG A;  2JAC A;  3KTL A;  3M0F A;  1R7H A;  2GZZ A;  4K0N A;  2M72 A;  3HJP A;  2HSN B;  4CW9 A;  2GLR A;  4GRF A;  1EP7 A;  3GKM A;  4KCE A;  1K0M A;  2XPD A;  3VK9 A;  4LA1 A;  3US3 A;  3WGX A;  5AGY A;  2YWI A;  5AN1 A;  5IPG A;  2B7J A;  4AJ6 A;  2OAD A;  4D73 B;  4EE0 A;  4L8E A;  1SJZ A;  1GTB A;  1FW1 A;  3QMX A;  2R3X A;  3LQ7 A;  1XIY A;  3RPP A;  4HEA 2;  3DKS A;  3IE3 A;  3GKN A;  1NM3 A;  1LBK A;  4AF2 A;  1ON4 A;  1U6T A;  4N0V A;  2HRK A;  2MMO A;  4PQH A;  5B6N A;  1CQG A;  3C71 A;  4IW9 A;  5J40 A;  4Q5Q A;  4DVC A;  3GX8 A;  1DBY A;  3DGQ A;  1TKD B;  2K18 A;  5E59 A;  4K5S A;  4E8H A;  2A2S A;  2C3Q A;  2R0G A;  4N0Z A;  3PR8 A;  1XVQ A;  1ZOF A;  3APQ A;  3IXR A;  2VO4 A;  1EGO A;  5B8B A;  1K3O A;  5J41 A;  2VCW A;  1GSD A;  14GS A;  4OO4 A;  3IRA A;  4POM A;  1SL1 B;  4KF9 A;  4TXO B;  1XWA A;  4OO5 A;  3IK7 A;  4BVX A;  4I8B A;  1V98 A;  4GQC A;  1JLW A;  3F9U A;  2CAI A;  2J23 A;  3TCO A;  3DWV A;  3HJM A;  1F3B A;  5F8B A;  3RBT A;  3CTG A;  3F4R A;  1GLQ A;  2X99 A;  4FYC A;  1F2E A;  1XZO A;  1TRS A;  3VWX A;  3HHV A;  5ECP B;  3QPM A;  2TRX A;  3UJ1 A;  2R5G A;  4JED A;  4OCE A;  3RPN A;  1OYJ A;  2EFD A;  2BMX A;  2X49 A;  5CRG A;  5HR3 A;  5DCG A;  4O7H A;  5A5H A;  1OVN A;  4MDC A;  2G2Q A;  2ZUP A;  4K7I A;  2IMI A;  5JWQ B;  2BTO T;  3BOA A;  3TRP A;  16GS A;  4ZIJ A;  2N5F A;  4IGJ A;  3H93 A;  6GSY A;  1GSF A;  4LMW A;  5IO2 A;  1TRV A;  2HSM A;  3TJB A;  1V40 A;  3HVX A;  4PUA A;  3U6V A;  4TN8 A;  2XBI A;  3VI7 A;  2N5B A;  3C1S A;  2C80 A;  3ZRD A;  3M8N A;  3DRN A;  4K7N A;  1SD8 A;  1SVL A;  3MNG A;  1A23 A;  1UN2 A;  1ZGN A;  3NOF A;  3H79 A;  1THX A;  2FNO A;  1QQ2 A;  1OC9 B;  1XW9 A;  3EYT A;  3HKR A;  4KUN A;  1BAY A;  1V58 A;  5LNK e;  2IWT A;  2RM5 A;  3CSI A;  2CT6 A;  2Z9S A;  2AV4 A;  2HE3 A;  2EFE A;  4RQR A;  1NHY A;  2DJ1 A;  1XWC A;  5J3R A;  1Q98 A;  2PBJ A;  1SKS B;  4IP1 A;  4EXJ A;  2WUL A;  2JZS A;  4MZC A;  4MMM A;  3TDG A;  1GUL A;  4MLY A;  4DSS B;  2H66 A;  5A1N A;  2GQM A;  3CMI A;  1N25 A;  4EKZ A;  3D22 A;  2CV4 A;  3UAP A;  2EIQ A;  2VD1 A;  1MTC A;  2B1K A;  2LRC A;  4YAV A;  3W8J A;  3ME8 A;  5HR0 A;  3CBU A;  4TOP A;  4IP6 A;  8GSS A;  3FR3 A;  1URM A;  2XBQ A;  5G5E A;  1PL1 A;  2LEG A;  1ZYQ B;  2LJK A;  3TJG A;  5G5F A;  1XOA A;  1J08 A;  2K6V A;  3APS A;  3BCK A;  6GST A;  3F6F A;  3ZFB A;  4GF0 A;  4IQA A;  3M9J A;  1WMJ A;  3O6T A;  2H6Z A;  1O6J A;  1XWG A;  1X9S B;  4CY8 A;  3QAV A;  3NZN A;  4ILF A;  1QXH A;  3C8E A;  5AIX A;  4KW6 A;  4LLR A;  4AKG A;  3W8S A;  4HI7 A;  3LSZ A;  4X43 A;  3C7M A;  4POK A;  2IJY A;  1K0O A;  1J0F A;  2EFC A;  2LS5 A;  3R3E A;  4XS4 B;  2PN8 A;  4HU9 A;  5A4U A;  5IOW A;  4V2M A;  1A2M A;  5H5R A;  1OAZ A;  3FKF A;  2H75 A;  4J57 E;  2DJ0 A;  3TRX A;  1GH2 A;  3LGC A;  1X9M B;  5CRH A;  1XPV A;  1H4O A;  3EVI A;  5KOW A;  3ZMK A;  3CRU A;  4WXT A;  2L4C A;  5IQY A;  4XRA A;  2VLU A;  3HD5 A;  2H6X A;  1JZO A;  2VCV A;  1PGT A;  3FW2 A;  1GTU A;  2DKH A;  1PQN A;  4WF5 A;  4IQ1 A;  1NSW A;  4TRX A;  2FHE A;  3EUR A;  3P90 A;  2AUV A;  2JL4 A;  3APO A;  2ON7 A;  2H6Y A;  1M9B A;  4TR1 B;  1TXU A;  1F9M A;  3EU3 A;  2HZE A;  4EDZ A;  1PD2 1;  3FZ4 A;  5ECO B;  2LV3 A;  4V1A g;  1T7P B;  3Q18 A;  1PN9 A;  1U88 A;  2C0F A;  3TU3 B;  1JHB A;  4GTU A;  1M99 A;  4KDU A;  4I97 A;  5INY A;  1GL8 A;  4AKH A;  4F2I A;  1ZZY A;  4MCU A;  3V1W A;  4OFM A;  1GUK A;  4K0G A;  2OJL A;  5IO0 A;  2QC7 A;  4FQU A;  2KP1 A;  3DD3 A;  1MEK A;  4FO5 A;  1B8X A;  5ECH B;  2B6M A;  3FK8 A;  3RHC A;  4CHS A;  4G0I A;  4ACS A;  4QL9 A;  1EV9 A;  1SYX A;  1YJ6 A;  2HLS A;  3KP8 A;  1TI1 A;  3G9B A;  5G30 A;  4PNF A;  3BBY A;  3TOU A;  1XW5 A;  2QKE A;  4LL1 B;  1HNA A;  3S9F A;  4X4J A;  5ELA A;  2FWH A;  2F51 A;  1B4Q A;  1K0N A;  3MSZ A;  4V2N A;  2LJA A;  1YF0 A;  2VCQ A;  3GNJ A;  2X8G A;  5DJL A;  1HYU A;  2GQK A;  2P5R A;  3DVX A;  3I69 A;  2WB9 A;  1PKW A;  5BMU A;  3SWL A;  5GAP D;  5AIV A;  2B3S A;  2F3M A;  2F8F A;  4I2U A;  2DIZ A;  3MDK A;  1M9A A;  3KIJ A;  3BCI A;  2DKI A;  1OKD A;  4KB3 A;  2WFC A;  3TKS E;  2FA8 A;  2VLV A;  3D0Z A;  2VM2 A;  4XCS A;  4ID0 A;  1R5P A;  1TK0 B;  3FMW A;  2WJU A;  1DE1 A;  5EPF A;  2WGR A;  2ES7 A;  4EC0 A;  4NXI A;  3ERF A;  1X5C A;  2O5V A;  2E0Q A;  1QK8 A;  4Z7X A;  4ZL7 A;  5CRE A;  2DLX A;  1GRX A;  1M7T A;  4XS6 A;  3L0H A;  1GSY A;  5F06 A;  2VD0 A;  5EL8 A;  4FYB A;  2E2G A;  4BL7 B;  4ZBB A;  3CXG A;  2IFQ B;  4EF0 A;  1EOG A;  2X64 A;  2CQ9 A;  4TW5 A;  5GZZ B;  2B5E A;  1MD3 A;  1S3C A;  3MIX A;  1E2Y A;  2M80 A;  2F8A A;  1J9B A;  3A2W A;  1G7E A;  4OCF A;  2NPB A;  3LXZ A;  4YAP A;  5IPH A;  2MMZ A;  4PUR A;  5ID2 B;  4BVY B;  2VKZ G;  2YJH A;  1SU9 A;  2I3Y A;  1YY7 A;  2HRF A;  3TKR A;  1QUW A;  4FH8 A;  2P5Q A;  2L4Q A;  1ERU A;  5CNW A;  3WT2 A;  4DSR A;  1H75 A;  3EPT A;  1YKC A;  2HI7 A;  4ECC A;  4V2L A;  2EC4 A;  1B48 A;  5KOX A;  2ON5 A;  2HSN A;  3QAG A;  4RI6 A;  4WKW A;  4XIH A;  2IMF A;  5D73 A;  2WDU A;  3QD9 A;  5KN1 A;  4POB A;  4IKH A;  3ME7 A;  2E7P A;  4ISD A;  4ZB6 A;  2DJJ A;  5D96 A;  3HVS A;  3KH7 A;  1THO A;  2AHE A;  3TKS A;  1K0A A;  3GHA A;  2O85 A;  2R2J A;  5ECI B;  3TJJ A;  1BG1 A;  1FB6 A;  2V32 A;  3GFK A;  2O87 A;  5L71 A;  1UA5 A;  4N3Z A;  2DJ2 A;  4K1F A;  5CRD A;  1T1V A;  2YNX A;  1T3B A;  17GS A;  3ZYW A;  4Z2R A;  4O92 A;  3GTU B;  3KEB A;  5HFI A;  5GAN D;  4N10 A;  4HOJ A;  1TU8 A;  1BG5 A;  4HJ2 A;  2VL2 A;  3QAW A;  3GST A;  1XCC A;  3A5I A;  2LUS A;  3LG6 A;  3VPT A;  3DVW A;  3ZVJ A;  5FHI A;  1DE2 A;  4ZIL A;  1VGL A;  3EWL A;  4TXO A;  5ECM B;  3GRX A;  3F6D A;  2M46 A;  4YKF A;  5KN2 A;  2JSY A;  1SKR B;  5J4Y A;  2JZT A;  1TDI A;  4ZBA A;  5DQS A;  5FT3 A;  4K5R A;  1F3A A;  5DAK A;  5IIZ A;  1GUM A;  5HFG A;  3UL3 A;  1IYI A;  4OFT A;  2I9H A;  2NTO A;  4ZB9 A;  22GS A;  3LW9 A;  3HMJ G;  3DEX A;  3TKP A;  2A4H A;  3VWW A;  4I6X A;  4HUA A;  5ENU A;  4ZB7 A;  3HXS A;  2OE1 A;  5CO3 A;  2YWM A;  5DAK B;  3ZLP A;  3TRQ A;  1QGV A;  1IYH A;  2FGX A;  3GSS A;  1FHE A;  3IR4 A;  4TR0 A;  4WBJ A;  3GL5 A;  3G7I A;  1DUG A;  1TU7 A;  3KTB A;  5IMC A;  2VCX A;  4X0X A;  4MP4 A;  1VRS D;  4KE3 A;  1QMV A;  1G7O A;  4F82 A;  1LJR A;  2V6K A;  2LTK A;  2TRC P;  5BRT A;  5ECQ B;  4K9Z A;  3JCM L;  4XS1 A;  3H1N A;  2L57 A;  4MNN A;  1GNE A;  2L59 A;  3EMP A;  4F0B A;  5J4U A;  4YH2 A;  4MH3 A;  2O7K A;  3KJY A;  5ELG A;  3A5W A;  3PGT A;  3RHB A;  1OC9 A;  3KXO A;  3ZFL A;  4BWQ A;  3TGZ A;  1GTI A;  5A34 B;  3ERG A;  4XTS A;  3ERW A;  2GS3 A;  3HY2 A;  1S3D A;  3EMX A;  3VPQ A;  2PWJ A;  4IHU A;  3G7Y A;  3EIN A;  3AY8 A;  1E6B A;  3ZTL A;  2FUG 2;  2H01 A;  2P0G A;  1UVZ A;  4K2X A;  1A8Y A;  1Z6M A;  3L9V A;  1O85 A;  4DSS A;  3GN3 A;  4O5R A;  3FRC A;  2MYG A;  3D6I A;  5ECN B;  3FZ5 A;  3QOU A;  3KMO A;  1XWK A;  18GS A;  2OT3 A;  3CWG A;  3Q6O A;  2LST A;  4Z2T A;  1U87 A;  2HZF A;  3DML A;  2LKU A;  4MJC A;  1V2A A;  4F0C A;  2MZC A;  3K8N A;  2H0H A;  3UEM A;  1O7U A;  2L5O A;  1BYE A;  2PER A;  4H86 A;  2DJK A;  3BD2 A;  3C73 A;  1PA3 A;  1YVL A;  4AJ8 A;  5DAL B;  4WBR D;  13GS A;  3I43 A;  1RK4 A;  1TRW A;  3UOM A;  4NHZ A;  4MH2 A;  1WRY A;  3LYK A;  1ACV A;  4WEY A;  1SJ6 A;  3D4T A;  4MJA A;  2J9H A;  2P31 A;  4ZL8 A;  3BJ5 A;  2AJQ B;  3N5O A;  4XS4 A;  1K0B A;  1MDJ A;  2IIY A;  3H8Q A;  2LQQ A;  1AC1 A;  3FHK A;  3HDC A;  2XHF A;  3TKQ A;  3HCZ A;  4PX1 A;  3KM6 A;  5ECL B;  3UBK A;  1TW9 A;  2N5A A;  4YQU A;  1R4W A;  1SL0 B;  2C1Y A;  3A2X A;  3W6G A;  5FWG A;  5EVO A;  1MDK A;  1N8J A;  4I2T A;  2OKA A;  1R26 A;  2LNS A;  2C0G A;  1Y1U A;  3LJR A;  1XWB A;  3HA9 A;  4IVF A;  2DBC A;  1WOU A;  2R0P A;  1HQO A;  1SJI A;  3RDW A;  2A2R A;  4QMK A;  2LRN A;  2B5Y A;  2DJ3 A;  4TR1 A;  5J9C A;  3LXT A;  4EIP A;  1WPI A;  4MZW A;  1FVK A;  2YWN A;  4ICY A;  5J47 A;  2GSQ A;  2H1D A;  3KCM A;  2FY6 A;  2JSZ A;  2I1U A;  2PGT A;  3PH9 A;  2O8V B;  1USB A;  4MF7 A;  1YEX A;  4MAB A;  4HQZ A;  1Z9H A;  4MA9 A;  1RW1 A;  1AIU A;  1TXX A;  3DYR A;  1PN0 A;  1ZYP A;  3A2V A;  2LQO A;  4PNG A;  4MK3 A;  2YCD A;  2TIR A;  1TJD A;  2LJR A;  4F9Z A;  4GSS A;  4MJE A;  5F0G A;  2FWE A;  2HRA A;  3LFL A;  2OBK A;  5D9X A;  1JFU A;  1ST9 A;  4TKY A;  3QFA C;  1TTZ A;  2IPA A;  2YAN A;  4KDX A;  3DXB A;  4JE1 A;  4N30 A;  1GWC A;  5D9V A;  12GS A;  3TUE A;  2KHP A;  2H8L A;  4Z2U A;  1FG4 A;  1EV4 A;  3G7J A;  6GSU A;  2KUC A;  4KGI A;  1Q4J A;  4HS1 A;  3UIW A;  1WWJ A;  1T00 A;  1AUC A;  1W89 A;  3Q74 A;  5ECR B;  2XC2 A;  2PPT A;  4P3Y B;  3IDV A;  2DC5 A;  1N2A A;  1GTA A;  2WZ9 A;  4QQ7 A;  3F4T A;  1TP9 A;  4KH7 A;  5COH A;  4G0K A;  3F63 A;  1WE0 A;  4MJB A;  3KD0 A;  4POL A;  2R4V A;  6GSX A;  4NHW A;  1LU4 A;  1ILO A;  2H70 A;  5G1K A;  2HT9 A;  1OC3 A;  2GTU A;  2K9F A;  2JU5 A;  4G01 A;  3GH6 A;  1EZK A;  3FZ9 A;  1SK1 A;  2NBS A;  2BJX A;  3UVT A;  1FB0 A;  2V41 A;  2C4J A;  1EP8 A;  3O3T A;  1TRU A;  4IJ3 A;  4ZB8 A;  2GZP A;  2GGT A;  3WD6 A;  1Y6E A;  3ZL5 A;  1BED A;  3WT1 A;  4G9H A;  4Q5N A;  3HZ8 A;  3UBL A;  4BL7 A;  2XPE A;  2ZNM A;  5DJM A;  20GS A;  3CYN A;  4DEJ A;  1FVJ A;  1QFN A;  4X1U A;  5D93 A;  4KX4 A;  2IFQ A;  6GSW A;  3EE2 A;  2IL3 A;  1YEP A;  2H19 A;  4BA7 A;  3ZML A;  2VM1 A;  3UAR A;  1XFL A;  4JRR A;  4J2F A;  4A5P A;  1O81 A;  1SVO A;  1XW6 A;  1GSS A;  2GDR A;  2H1L A;  1SYR A;  1TK5 B;  4TR4 A;  2IMD A;  1XBS A;  4O32 A;  2MBT A;  4ECB A;  3J7Y k;  1ZCP A;  3CSJ A;  5ID2 A;  4BVY A;  4KDY A;  4CDO A;  5AIS A;  1HNC A;  3D5J A;  1NW2 A;  2VIM A;  3PIN A;  4MF5 A;  4PGT A;  2YV9 A;  1B9X C;  4ULX A;  5IMZ A;  1X0R A;  2HXK A;  4L0W A;  5HFK A;  3OR5 A;  2AB6 A;  4HU7 A;  3IPZ A;  3GH9 A;  2HRN A;  5C04 A;  5A4V A;  2RUF A;  3IV4 A;  4YQM A;  1XXU A;  3I6A A;  2KP2 A;  5IMF A;  3CTF A;  2H1A A;  1X9W B;  4V1A p;  3TJF A;  1A24 A;  3ZIJ A;  4EUY A;  1GSU A;  2GT6 A;  4NAX A;  2V6O A;  3HZ4 A;  5KN0 A;  3CRT A;  4AKX B;  1K3L A;  1ML6 A;  1FAA A;  2EFH A;  4BWS A;  2IME A;  1A0F A;  3L9S A;  2YPM A;  1SVM A;  2WS2 A;  1EWX A;  1KEB A;  2VUP A;  1U3A A;  3GTU A;  4GLT A;  2C0E A;  1I9D A;  3LEF A;  2X4A A;  5J4V A;  1A0R P;  4KAE A;  2WRT A;  1WIK A;  4PXO A;  1Z3E A;  5B8A A;  4DSQ A;  5ECK B;  1Z7P A;  5F07 A;  3F8U A;  2MMN A;  4YKG A;  1FO5 A;  1M2B A;  2IN3 A;  1U3I A;  2HYX A;  3IK9 A;  4GCI A;  4QL7 A;  4YQV A;  1F37 A;  2A2P A;  4N11 A;  1GUH A;  1EEM A;  2YJ7 A;  6GSV A;  5E4W A;  2LNT A;  3VFI A;  3IAS 2;  2C8U A;  4L5L A;  1YKA A;  5JWO B;  4WR5 A;  5CP1 A;  4USS A;  2ZCT A;  1Z7R A;  4JU5 A;  4AGS A;  1M0U A;  4HJM A;  1TOF A;  4HDE A;  4HZ2 A;  4IEL A;  3LYP A;  4GST A;  1EGR A;  4NPB A;  2QA1 A;  1EOH A;  3P7X A;  3WGD A;  2HSY A;  4WR4 A;  2QSI A;  4WF4 A;  2HNL A;  2DSA A;  1YF1 A;  2KOK A;  4MZB A;  4MF6 A;  3FEU A;  2UZ8 A;  1B4P A;  3NIV A;  1YQ1 A;  2GZY A;  2H73 A;  4G0L A;  1T4Z A;  3ZZX A;  2CZ2 A;  1O8W A;  5KEJ A;  4LL4 B;  3VI5 A;  4IJI A;  4OMV A;  1KTE A;  4HQS A;  3TJK A;  2DML A;  1WJK A;  3WGE A;  1M2D A;  3KZQ A;  4Q5F A;  2IMK A;  1PKZ A;  3F3Q A;  2CVB A;  4E8E A;  3F3R A;  2VL3 A;  1JZW A;  5A34 A;  1XVW A;  4OWY A;  2FA4 A;  4EDY A;  2HRK B;  4HZ4 A;  4L0U A;  3WYW A;  3C1R A;  3GKK A;  1O73 A;  3QDN A;  4G2E A;  2PVQ A;  2B1L A;  4PQI A;  4G19 A;  3QCP A;  5IMD A;  4XRD A;  4K8M A;  2PU9 C;  2KLX A;  4MPG A;  2VCT A;  1I5G A;  3GKX A;  2I81 A;  2CVD A;  5JCW A;  3DIE A;  1AXD A;  1FOH A;  4J56 E;  4JZQ A;  1PL2 A;  4L5O A;  2CX3 A;  4KCA A;  2A4V A;  2CVK A;  2GVP A;  1GNW A;  2CZ3 A;  2EIR A;  1G0T A;  2LRT A;  1TI3 A;  3E9J B;  4BVX B;  2WCI A;  5B7C A;  5A5K A;  3RAZ A;  2H1G A;  1ERW A;  2O89 A;  3E0U A;  4TXV A;  1ERV A;  4XHM A;  1SL2 B;  3FY7 A;  1EEJ A;  2EIO A;  2VOC A;  2VCZ A;  4JR6 A;  2MMA A;  2YOI A;  4IBP A;  1YZX A;  2JZR A;  5DAL A;  5JWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...