2F8FA

Crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
203
Chain Sequence
DHIKVIFFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 28 kDa
publication title Probing the Mechanism of GSH Activation in Schistosoma haematobium Glutathione-S-transferase by Site-directed Mutagenesis and X-ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
total genus 65
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2f8fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2f8fA01
3VWWA 2VCXA 1FG4A 4HS1A 5HQPA 1PL1A 1VF1A 1BG5A 2YZUA 4MPFA 2VL2A 1YF1A 5EVOA 2CVDA 4OFNA 1VF3A 6GSXA 5DQSA 5G30A 4OD7A 1R4WA 1YEPA 3UVHA 3C8EA 2LKUA 1O85A 1XBSA 3FK8A 1V98A 1GSSA 2WZ9A 4PURA 4ZXGA 2LNTA 4TR0A 4HZ2A 2F3MA 1I5GA 2PVQA 5D73A 2GZPA 4GSTA 1XWKA 6GSTA 5ECHB 4WR4A 5G31A 2IMIA 1YEXA 3BJ5A 5DAKB 5DALA 1PMTA 4DEJA 2LS5A 1BX9A 1EOHA 2CX3A 3WT2A 2O85A 4IQAA 5H5QA 2HZEB 4AJ7A 4XRDA 4GLTA 2IJYA 5CO3A 4PX1A 2HRKA 3V1WA 3A2VA 1K3LA 1WOUA 2OE3A 3CBUA 4KX4A 1THOA 5G5EA 2DJJA 3BBYA 4K9ZA 2H8LA 3IR4A 4N0ZA 2H0HA 2X8CA 1VGLA 4MJEA 4GXZA 3WYWA 5D8IA 5ECIB 1X5CA 2OE0A 3PH9A 4ZBAA 3F3RA 1MTCA 1OC8A 4JZQA 2XBQA 3TDGA 5INYA 4HOJA 4ACSA 3WT1A 2O87A 2CZ2A 4YAVA 4LLRA 3QAVA 2IMEA 2YWMA 4POBA 1RQMA 4MZCA 3HVXA 4HDEA 1GH2A 5JWRB 5ECLB 1S3DA 4PXOA 2JSYA 3HVVA 1MDIA 2GSRA 1Q4JA 3CXGA 1UC7A 2I81A 5DJMA 3BOAA 2H0IA 1Y6EA 1FOVA 2VIMA 4MLYA 2VCVA 2GSSA 1A0RP 5CAXA 2C8UA 4ML1A 1T4YA 4WKWA 2HYXA 4KAEA 1F9MA 3WGDA 2L5LA 2RUEA 2VLTA 1SJZA 1V57A 2L6CA 3QMXA 1DE1A 3GSTA 2IMFA 2A2SA 4EDYA 2JL4A 3W8SA 3ZMLA 3UOMA 1PX7A 1GL8A 2NTOA 3IK7A 3HZ8A 3C7MA 5ECOB 1XOBA 2KP2A 4K8MA 4JEDA 2E0QA 1XWCA 4PUAA 1TXXA 4XS4B 3G7IA 3F63A 3KTLA 5JCUA 1WPIA 4KF9A 3TKRA 4G9HA 2MMAA 2OBKA 4K7OA 5GAND 4GF0A 12GSA 4TKYA 1FHEA 4MZBA 2DC5A 3KGKA 4AJ8A 4F82A 3L4NA 4HJ2A 5GAPD 2M46A 1KBNA 2VD1A 1XCCA 4NV5A 4ZL8A 3EMXA 4J57E 1Z9HA 5JWQB 5AGYA 2ALBA 1G7EA 4RQRA 5KN3A 1K0BA 1OC9B 3GV1A 5ID2A 5CP1A 1WIKA 2V1MA 2YP6A 1N8JA 1TRSA 4BL7A 2X99A 3MNGA 4OCEA 3KM6A 3P90A 4IJIA 1WMJA 3GTUB 2F51A 3CSIA 2ZUPA 4G2EA 1HNCA 3TKSE 3A2WA 1AQXA 2H6ZA 2HSYA 2B3SA 3D21A 6GSVA 3C73A 4PTSA 2H1BA 4MPGA 1RW1A 3ZVJD 3F4SA 3LXZA 1E6BA 4KSMA 2WDUA 22GSA 2YN1A 2B1LA 3APSA 4YH2A 4JRRA 3CRUA 2R6KA 2P0GA 3ZMKA 5IMZA 1M0UA 5D96A 3E0UA 1ZMAA 2VO4A 1GP1A 1EEJA 3QDNA 3ZFBA 1O73A 5HR2A 3ZREA 1SK1A 4JE1A 1PA3A 2H1AA 5IMDA 1A23A 1ZGNA 1JZOA 3F4RA 1Z7RA 2R5GA 4TRXA 1GSQA 1KNGA 2CV4A 2HI7A 4MJCA 5D9VA 3NIVA 1TKDB 3QCPA 4IELA 4GTUA 4XCSA 4RUVA 3GNJA 4EF0A 6GSWA 1AC1A 4MA9A 1YKAA 1OAZA 4DSSB 5EY6A 2C3QA 2FWFA 4EUYA 3VURA 3GFKA 2HZFA 5F8BA 1HNAA 4TOPA 2PWJA 3DVWA 4NMUA 1K0NA 2FA4A 2L5OA 5A4WA 2TIRA 2FLSA 1J0FA 5FWGA 4ZB8A 4KCAA 5J9CA 3ZIVA 3ME8A 2E2MA 3M0FA 3US3A 3M9JA 3C1RA 3RDWA 1K0AA 2BTOT 3U5RE 4K0NA 1U3IA 4JBBA 3UAPA 3QR6A 1SYRA 10GSA 1M9AA 5L71A 1H4OA 3VWUA 1AW9A 1WRYA 2L59A 2VM1A 1CQGA 4HU7A 1X5EA 3A3TA 3F3QA 3PINA 3QFBC 2AYTA 3FRCA 3GHAA 2GDRA 4H86A 2GSTA 3UIWA 3F0IA 5CYYA 1EEMA 4JU5A 2RLIA 3D4TA 2KOKA 3GA4A 2J9HA 3QPMA 5ELAA 2H01A 1PX6A 5AN1A 1GWCA 1Z5YE 2C0DA 4WXTA 1IYHA 3LG6A 3J7Yb 4L8EA 1M9BA 1GLPA 3I9V2 3P7XA 1PRXA 4TR4A 3GL5A 1URMA 2H6YA 2LQOA 2H70A 2HZEA 2B5XA 2CAQA 1QQ2A 3LJRA 1ZOFA 4TR1A 4ZILA 1BYEA 4BA7A 3DIEA 1U3AA 3CSHA 3CTFA 3Q18A 2LSTA 5DCGA 4J2FA 1AQVA 5E59A 5AIVA 1G6YA 3G7YA 3ZYWA 2AHEA 1TDIA 4BPYA 4ECBA 1NM3A 1GTUA 4X43A 2OKAA 1QMVA 2XPEA 3MDKA 1GUHA 1QUWA 4D73A 2XC2A 3RPNA 2IFQA 3GX0A 1T3BA 3KD0A 5B7CA 1SJ6A 2K9FA 3F6DA 3GH6A 1Z6NA 1YJ6A 3GKMA 2VL9A 4N11A 5F06A 3EURA 1JZWA 2EIQA 3VWVA 4NAXA 3TKSA 5FHIA 2OBIA 5GZZB 2VCTA 5B6MA 1XW6A 5ECRB 2YWIA 3KH7A 3UARA 4OFTA 3SWLA 4V2NA 3WGEA 4MDCA 2DJ0A 1YDKA 2X64A 1I9DA 2R37A 3CMIA 4JR6A 4ISDA 5JCGA 2FWHA 2EIOA 1ZZYA 2OE1A 1TRUA 2MYGA 2YJHA 1TOFA 1B9XC 3M8NA 1R5AA 5ABRA 5IMCA 2H0GA 3F4TA 4MH2A 1XVQA 1NW2A 3APQA 1ERUA 2BMXA 1ACVA 1JHBA 2VLVA 3C71A 2HE3A 1XFLA 1FB6A 1Z3EA 4QL9A 2B7KA 4MMMA 2FWEA 1O8WA 1SD8A 1HD2A 2VOCA 4I2TA 4FH8A 2G2QA 2O7KA 3ZITA 4IKHA 1AUCA 1GNWA 2PN8A 1T8EB 4ECIA 4PUFC 3TOTA 3TJJA 3HHVA 3H4KA 2ES7A 4WF5A 5B8AA 1JZRA 3EC3A 3IA1A 5GSTA 1T4ZA 4JR4A 4OCFA 4POKA 5HR3A 2H76A 1GSEA 4ILFA 3DWVA 4GQCA 2YWOA 1JZDA 4TXOA 2R3XA 4FYCA 4HI7A 1FVJA 4HJMA 3VK9A 5D9XA 4IHUA 3DD3A 3HKRA 3QAWA 2X8GA 3GKNA 1X9MB 1H75A 3BCIA 1LBKA 2WB9A 2VL2C 4I2UA 4O7HA 1QFNA 3HVSA 4TVEA 2IIYA 3F6FA 2WGRA 4K0GA 5ECKB 1USBA 1OC3A 3ISOA 2VAFA 2VCZA 2C1YA 2C0GA 2LV3A 2DJ3A 2MBSA 1E2YA 3EU3A 1NHYA 3TKQA 4ECJA 4KCEA 2L4CA 2HSHA 4ML6A 1OE7A 3KJYA 1TRWA 3ME7A 3ERGA 5DQYA 2YOIA 2GSQA 3BCKA 3HJPA 1B48A 1XWBA 4ZBDA 1XPVA 1K0MA 4I5QA 1F2EA 3NZNA 2JADA 1MD3A 4DVCA 2VM2A 3LSZA 2DJ1A 4ULXA 1C72A 2V2GA 1GTIA 2PUKC 4IBPA 1PKZA 5A4VA 1YF0A 4FYBA 2E2GA 2N5BA 3LXTA 2WCIA 4RQXA 4CW9A 1VF4A 3VLNA 4KW6A 4WEYA 3RAZA 5ECMB 1TRVA 3CTGA 4BVXA 5J3RA 2C3TA 3DKSA 3GH9A 1EP8A 4L5OA 4Q5FA 4F03A 2I4AA 2H72A 1O7UA 3LGCA 4FYUA 6GSYA 1Z6MA 3UL3A 5IM9A 2V6KA 4IN0A 2VUPA 2C0EA 3HDCA 2UZ8A 3ZLPA 1TK5B 3RPPA 4HEA2 2LRNA 1XZOA 3VI5A 1A8YA 2GTUA 3Q6OA 1EV9A 3RHBA 1U87A 1HNBA 3BD2A 4XHMA 5AISA 5DALB 2MBTA 3J7Yk 2V41A 4MF7A 4IS0A 2RIIA 1KTEA 1ML6A 4XRAA 1J08A 1EZKA 5EL8A 2YJ7A 1XIYA 2RM5A 3IXRA 3KTBA 2HRKB 3W6GA 4KGIA 2HT9A 1YZXA 2IMKA 1GTBA 3PR8A 1V9WA 2R4VA 3O3TA 1OYJA 2WJUA 1G0TA 1YKCA 6GSUA 1ABAA 4KNDA 3UBLA 2HNLA 2MMOA 4P3YB 2B6MA 3G7JA 4K2DA 3TUEA 3DXBA 2QGVA 1GSFA 1TU8A 2FNOA 1Z7PA 2H1GA 4XS6A 4WETA 1AAZA 3HZ4A 4G0KA 3LORA 2KLXA 1F3AA 2PBJA 4HQSA 3HJMA 1M2BA 3G9BA 2I3YA 2KHPA 4ZB9A 1SKWB 2GQKA 5LNKe 3ERWA 3IAS2 1FB0A 4QQ7A 2ON5A 2X8HA 4OMVA 3I69A 4IJ3A 3R3EA 2HSMB 4KA0A 1LJRA 4KH7A 4NHZA 3VWXA 2H6XA 3UJ1A 1EP7A 2LRCA 3LYPA 3IHQA 2I9HA 2HRAA 4IVFA 4AGSA 3P2AA 4K6XA 3VI7A 4TW5A 4EE0A 1SJIA 3C1SA 2TRXA 19GSA 1ZL9A 2PGTA 1TTZA 2HRNA 1GRXA 3KP8A 5CRWA 1A2MA 1PN9A 5H5SA 3RBTA 2L57A 1HQOA 3GURA 3EMPA 3DGQA 2IWTA 1PSQA 3L9VA 3KXOA 2M80A 2N5FA 3ERFA 2JZRA 4ID0A 4I6XA 5DBQA 3UMAA 5J9BA 4L5LA 4Z7XA 5IOXA 1O6JA 1ERWA 4F0CA 3HJOA 4BVYA 3M9KA 3TJKA 1R5PA 4V1Ap 3IBHA 3R2QA 1AXDA 8GSSA 2FCHA 2RM6A 1FVKA 1K3OA 2D2ZA 1B4PA 2XPDA 1ST9A 5IO2A 1F37A 3GN3A 4EDZA 4K1FA 2PMTA 1QK8A 3VFIA 4NWYA 2NPBA 2Z9SA 3I43A 14GSA 3W8JA 5IPGA 1U6TA 4WBJA 2YV9A 1X5DA 3IC4A 2A2RA 3F8UA 4IGJA 4YQMA 5HFIA 4IP1A 3L0HA 3N9JA 5ID2B 3VPQA 3ED3A 3U6VA 2QSIA 1MD4A 1PD21 9GSSA 1ZYQB 4BL7B 5CREA 1GSUA 2QC7A 2GT6A 2F8AA 3FHKA 5ECSA 2DJKA 4PQHA 2JU5A 1XXUA 2YV7A 5D9TA 4HU9A 3CSJA 2LNSA 5F07A 1B8XA 3DRNA 4LL1B 3H79A 5GSSA 4EL1A 5DAKA 4E8HA 3IRAA 3EU4A 3EE2A 3EYTA 3TRPA 1ERVA 4FIWA 3DVXA 2QKEA 1A0FA 1GSYA 4J56E 4MZWA 1V58A 1SL1B 1YY7A 3L78A 2B5YA 1EOGA 3ZRDA 2LRTA 1XW9A 3ZFLA 2H19A 3E3EA 3HYPA 1X0RA 5G1LA 1JLVA 1MEKA 1TI1A 2AUVA 4OO4A 2WULA 1W4VA 2H30A 2IMDA 1ON4A 3D6IA 3HD5A 4XS1A 2GZYA 4I97A 2FWGA 3FKFA 4ZB6A 1SK0A 2TRCP 1T7PB 4NHWA 2HQTA 3TGZA 3DMLA 2HFDA 4ZBBA 1XWGA 3QOUA 1PKWA 2MMNA 5HFKA 2YZHA 4OO5A 5B8BA 1WE0A 1TK0B 4NXIA 4FQUA 3LWAA 2B7JA 2K18A 3KMNA 1ZCPA 3NOFA 3KZQA 3DYRA 4EXJA 3M3MA 11GSA 1SU9A 2OACA 3FZ9A 2HRFA 3FR6A 4MP4A 6GSSA 2CT6A 3TB2A 4Q5NA 3GMFA 4WBRD 4XIHA 4DSRA 1T00A 3MSZA 2AJQB 2DSAA 1SL0B 2PU9C 2M72A 3ZL5A 2WFCA 3QAGA 3TRXA 1ERTA 1AIUA 1WJKA 3A5WA 2R2JA 3HCZA 3KCMA 1XWAA 1K0DA 4GRFA 3GIXA 2VL3A 1R26A 4HZ4A 1N2AA 1OE8A 1Q98A 1SKSB 2DLXA 3EINA 3GL3A 4KDYA 1BJXA 2K8VA 2FHEA 2GQLA 1GULA 4MJBA 4OWYA 5J41A 4G0IA 4XTSA 4XS4A 3TRQA 1LU4A 2KUCA 4KUNA 4CHSA 2LUSA 4V1Ag 4V2MA 5KN1A 2GQMA 5CNWA 3WGXA 2FUG2 1PGTA 2I1UA 2PPTA 3GYKA 4HQZA 4KE3A 2H74A 2YANA 1B9YC 2H66A 2L4QA 3TKSC 1CQHA 7GSSA 5IMVA 2CZ3A 2OJLA 5IMFA 4PNFA 5JCWA 4G10A 2VD0A 1NSWA 1VRSD 3CYNA 4O92A 2VLUA 1ZYEA 4MK3A 4AJ6A 1TK8B 1EWXA 3FZ5A 1THXA 4TR1B 4GSSA 1GUKA 3VPTA 4WF4A 1TU7A 2GS3A 2P5QA 3P8WA 2HXKA 1M2DA 1OC9A 2EIRA 3GRXA 3HA9A 3FYGA 5G5FA 1HYUA 3FR9A 3WD6A 1KEBA 1J9BA 1UA5A 3ZIJA 1DUGA 3GTUA 4MJAA 3N5OA 4RI7A 3LQ7A 2H1DA 4EC0A 2KP1A 3FW2A 18GSA 4GSNA 4D73B 2AV4A 2IFQB 4N30A 2H73A 2JZSA 3S9FA 4KDXA 2CX4A 5H5RA 2E7PA 3KIJA 1R7HA 5BMUA 3TJGA 1B4QA 2DIZA 1BQ7A 13GSA 1IYIA 4I8BA 3FEUA 1A8LA 2WRTA 3KH9A 5EPFA 1K3YA 3FR3A 3TJFA 5G2ZA 1Y25A 2N5AA 5FT3A 3OR5A 1GSDA 2C3NA 2GLRA 3MAKA 2P5RA 2HSMA 3DEXA 2OADA 1PL2A 4N0VA 2LJKA 5DCHA 2H75A 4O32A 5F0GA 4KSOA 4N10A 2WS2A 2NDOA 3D0ZA 5G1KA 5HR0A 3GKXA 1T1VA 1SL2B 2REMA 4L0WA 4G0LA 4PQIA 4TXVA 5E4WA 2CA8A 3IDVA 4O5RA 1X9WB 1A2JA 4MF6A 2MMZA 3SBCA 3FZAA 2DIYA 5IO0A 2VCQA 4DSSA 3GX8A 5CRDA 2CVKA 4MF5A 5IOWA 2C4JA 1YQ1A 2AB6A 2OA7A 5IPHA 4EVMA 4L0UA 1F6MC 1BAYA 2K6VA 2XBIA 3TKPA 20GSA 2ON7A 1FAAA 5ECNB 1TI3A 5D9WA 2GGTA 3KP9A 2O89A 2NVLA 1AQWA 4CDOA 3CRTA 5J4UA 2L6DA 4GWRA 1FW1A 4GCIA 5IMAA 3Q74A 4TXOB 3PPUA 3ZTLA 2B5EA 4G19A 2LEGA 1OVNA 1O81A 3KMOA 4E8EA 2F9SA 1FO5A 4KB3A 2ZNMA 3QD9A 4NPBA 4RI6A 4POLA 3GUSA 1SK2A 1MDKA 4NV2A 2V6OA 1V40A 2FGXA 4ZL9A 4LMWA 1W89A 4X0XA 5COHA 4Q5QA 1EV4A 1XVWA 1OKDA 2HLSA 5KN0A 3TCOA 4PNGA 4WR5A 3L9SA 2AAWA 5AIXA 4FO5A 4BWQA 3IE3A 3ZVJA 1G7OA 3KEBA 5F05A 5A4UA 3HY2A 2XHFA 2LJAA 4LA1A 1DBYA 3H93A 3D5JA 2V32A 3AY8A 2G0FA 4IW9A 2PERA 3O76A 4USSA 1SYXA 3Q19A 4ZIJA 1GUMA 1S3CA 3O6TA 4F2IA 2ZCTA 1K0CA 5D93A 4EO3A 4LL4B 1GTAA 2FA8A 2YCDA 1K0OA 4BVXB 2PVOC 1M2AA 1GLQA 4BWSA 5LD0A 1MDJA 2DMMA 3F9UA 2FY6A 2JACA 2K8SA 2HSNB 16GSA 5DVBA 3H8QA 1RK4A 3IV4A 4YAPA 3IC8A 4ZL7A 3A2XA 2C80A 1S3AA 4ECCA 1UN2A 5C00A 3MWHA 1SD9A 1A2LA 4YQUA 4GQFA 3H1NA 5CRHA 2YNXA 5A5KA 1M7TA 2LTKA 1JFUA 1EGRA 4EKZA 1V2AA 17GSA 5J5NA 5KN2A 4V2LA 3LYKA 1QXHA 2VCWA 2CVBA 3APOA 1EGOA 5ECQB 3I6AA 2IN3A 3IOSA 2YPMA 1NHOA 3K8NA 2H71A 4MABA 1ILOA 3EVIA 5LCZA 2DBCA 3IAM2 4PGTA 3L9UA 3LFLA 1PQNA 3EWLA 4Q5RA 1XW5A 2C0FA 3FY7A 1OKTA 1GNEA 5IIZA 2IL3A 2EC4A 4LMVA 2F8FA 2BJXA 1F3BA 1M99A 2GZZA 3TOUA 3IK9A 3FZ4A 2P31A 5DDLA 3RHCA 2JSZA 1QGVA 3UVTA 2DJ2A 4KDUA 2YWNA 4PQ1A 1UVZA 2A4VA 4IP6A 2J23A 5CRGA 1TW9A 4X1UA 1SKRB 1TJDA 1XOAA 5ECPB 3LEFA 5KEJA 2JZTA 4OFMA 3E9JB 2CQ9A 1TP9A 1VF2A 1U88A 4DSQA 3UBKA 2LQQA 5B6NA 5ENUA 1SENA 4QL7A 4K7IA 4F9ZA 3ZZXA 3IPZA 5DJLA 3JCML 4TR3A 3QFAC 2CAIA 1A24A 1BEDA 2DMLA 5HR1A 1DE2A 4K7NA 4TN8A 5JWOB 1JLWA 4F0BA 2NBSA 1DSBA 3PGTA 5IQYA 3GSSA 1X9SB 5C04A 4IQ1A 4MH3A 1WP0A 4YQVA 4BVYB 2IPAA 1O8XA 1WWJA 2O8VB 3GKKA 3D4MA 5HFGA 5ELGA 4POMA 3D22A 3TJBA 4MCUA 2GVPA 2FD3A 2RUFA 3M1GA 4AF2A 1G6WA 2MZCA 3UEMA 2GT5A 4HUAA 2B1KA 2LJRA 3HXSA
chains in the Genus database with same CATH superfamily
3VWWA 2VCXA 1FG4A 4HS1A 5HQPA 1PL1A 3LW9A 1VF1A 1BG5A 2YZUA 4MPFA 2VL2A 1YF1A 5EVOA 2CVDA 4OFNA 1VF3A 6GSXA 5DQSA 5G30A 4OD7A 1R4WA 1YEPA 3UVHA 3C8EA 2LKUA 1O85A 1XBSA 3FK8A 1V98A 1GSSA 2WZ9A 4PURA 4ZXGA 2LNTA 4TR0A 4HZ2A 2F3MA 1I5GA 2PVQA 5D73A 2GZPA 4GSTA 1XWKA 6GSTA 5ECHB 4WR4A 5G31A 3CQFA 2IMIA 1YEXA 3BJ5A 3EPTA 5DAKB 5DALA 1PMTA 2X4AA 4DEJA 2LS5A 1BX9A 1EOHA 2CX3A 3WT2A 2O85A 4IQAA 5H5QA 2HZEB 4AJ7A 4XRDA 4GLTA 2IJYA 2H1LA 4PX1A 5CO3A 2HRKA 3V1WA 3A2VA 1K3LA 1WOUA 2OE3A 3CBUA 4KX4A 1THOA 5G5EA 2DJJA 3BBYA 4K9ZA 2H8LA 3IR4A 4N0ZA 2H0HA 2X8CA 1VGLA 4MJEA 4GXZA 3WYWA 5D8IA 5ECIB 1X5CA 2OE0A 3PH9A 4ZBAA 3F3RA 1MTCA 1OC8A 4JZQA 2XBQA 3TDGA 5INYA 4HOJA 4ACSA 3WT1A 2O87A 2CZ2A 4YAVA 4LLRA 3QAVA 2IMEA 2YWMA 4POBA 1RQMA 4MZCA 3HVXA 4CY8A 4HDEA 1GH2A 5JWRB 5ECLB 1S3DA 1PN0A 4PXOA 2JSYA 3HVVA 1MDIA 2GSRA 1Q4JA 3CXGA 1UC7A 2I81A 5DJMA 3BOAA 2H0IA 1Y6EA 1FOVA 2VIMA 4MLYA 2VCVA 2GSSA 1A0RP 5CAXA 2C8UA 4ML1A 1T4YA 4WKWA 4G01A 2HYXA 4KAEA 1F9MA 3WGDA 2L5LA 2RUEA 2VLTA 1SJZA 1V57A 2L6CA 3QMXA 1DE1A 3GSTA 2IMFA 2A2SA 4EDYA 2JL4A 3W8SA 3ZMLA 3UOMA 1PX7A 1GL8A 2NTOA 3IK7A 3HZ8A 3C7MA 5ECOB 1XOBA 2KP2A 4K8MA 4JEDA 2E0QA 2EFEA 1XWCA 4PUAA 1TXXA 4XS4B 3G7IA 3F63A 3KTLA 5JCUA 1WPIA 4KF9A 3TKRA 4G9HA 2MMAA 2OBKA 4K7OA 5GAND 4GF0A 12GSA 4TKYA 1FHEA 4MZBA 2DC5A 3KGKA 4AJ8A 4F82A 3L4NA 4HJ2A 4AKHA 5GAPD 1SVLA 2M46A 1KBNA 2VD1A 2WW0A 1XCCA 4NV5A 4ZL8A 3EMXA 3CHXC 4J57E 1Z9HA 5JWQB 5AGYA 2ALBA 5KOWA 1G7EA 4RQRA 5KN3A 1K0BA 1OC9B 3GV1A 5ID2A 5CP1A 1WIKA 2V1MA 2YP6A 1N8JA 1TRSA 4BL7A 2X99A 3MNGA 1SVMA 4OCEA 3KM6A 4EIQA 5KOXA 3P90A 4MNNA 4IJIA 1WMJA 3GTUB 2F51A 3CSIA 2ZUPA 4G2EA 1HNCA 3TKSE 3A2WA 1AQXA 2H6ZA 2HSYA 2B3SA 3D21A 6GSVA 4K5RA 3C73A 4PTSA 2H1BA 4MPGA 1RW1A 3ZVJD 3F4SA 3LXZA 1E6BA 4KSMA 2WDUA 22GSA 2YN1A 2B1LA 3APSA 4YH2A 4JRRA 3CRUA 2R6KA 2P0GA 3ZMKA 5IMZA 1M0UA 5D96A 3E0UA 1ZMAA 2VO4A 1GP1A 1EEJA 3QDNA 3ZFBA 1O73A 5HR2A 3ZREA 1SK1A 4JE1A 1PA3A 2H1AA 5IMDA 1A23A 1ZGNA 2O5VA 1JZOA 3F4RA 1Z7RA 2R5GA 4TRXA 1GSQA 1KNGA 2CV4A 2HI7A 4MJCA 5D9VA 3NIVA 1TKDB 3QCPA 4IELA 4GTUA 4XCSA 4RUVA 3GNJA 5J4VA 4EF0A 6GSWA 1AC1A 4MA9A 1YKAA 1OAZA 4W66A 4DSSB 5EY6A 3MIXA 3IHGA 2C3QA 1M3IA 2FWFA 4EUYA 3VURA 3GFKA 2HZFA 5F8BA 1HNAA 4TOPA 2PWJA 3DVWA 4NMUA 1K0NA 2FA4A 2L5OA 5A4WA 2TIRA 2FLSA 1J0FA 5FWGA 4ZB8A 4KCAA 5J9CA 3ZIVA 3ME8A 2E2MA 3M0FA 4AKGA 3US3A 3M9JA 3C1RA 3RDWA 1K0AA 2BTOT 3U5RE 4K0NA 1U3IA 4JBBA 3UAPA 3QR6A 1SYRA 10GSA 1M9AA 5L71A 1H4OA 3VWUA 2VKZG 1AW9A 1WRYA 2L59A 2VM1A 1CQGA 4HU7A 1X5EA 3A3TA 3F3QA 3PINA 3QFBC 2AYTA 3FRCA 3GHAA 2GDRA 4H86A 4PHZC 2GSTA 3UIWA 3F0IA 5CYYA 1EEMA 4JU5A 2RLIA 3D4TA 2WW1A 2KOKA 3GA4A 5J4YA 2J9HA 3QPMA 5ELAA 2H01A 1PX6A 4E68A 5AN1A 1GWCA 1Z5YE 2C0DA 4WXTA 1IYHA 3LG6A 3J7Yb 4L8EA 4BIKA 1M9BA 1GLPA 3I9V2 3P7XA 1PRXA 4TR4A 5A5HA 3GL5A 1URMA 2H6YA 3FMWA 2LQOA 2H70A 2HZEA 2B5XA 2CAQA 1QQ2A 3LJRA 1ZOFA 4TR1A 4ZILA 1BYEA 3HVNA 4BA7A 3DIEA 1U3AA 3CSHA 3CTFA 3Q18A 2LSTA 5DCGA 4J2FA 1AQVA 5E59A 5AIVA 1G6YA 3G7YA 3ZYWA 2AHEA 1TDIA 4BPYA 4ECBA 1NM3A 1GTUA 4X43A 2OKAA 1QMVA 2XPEA 3MDKA 1GUHA 1QUWA 4D73A 2XC2A 3RPNA 2IFQA 3GX0A 1T3BA 3KD0A 5B7CA 1SJ6A 2K9FA 3F6DA 3GH6A 1Z6NA 4PI0C 1YJ6A 3GKMA 2VL9A 4N11A 5F06A 3EURA 1JZWA 3TU3B 2EIQA 3VWVA 4NAXA 3TKSA 5FHIA 2OBIA 5GZZB 2VCTA 5B6MA 1XW6A 5ECRB 2YWIA 3KH7A 3UARA 4OFTA 3SWLA 4V2NA 3WGEA 4MDCA 2DJ0A 1YDKA 2X64A 1I9DA 2R37A 3CMIA 4JR6A 4ISDA 5JCGA 2FWHA 2EIOA 1ZZYA 2OE1A 1TRUA 2MYGA 2YJHA 1TOFA 1B9XC 4ZB7A 3M8NA 1R5AA 5ABRA 4N3ZA 5IMCA 2H0GA 3F4TA 4MH2A 1XVQA 1NW2A 3APQA 1ERUA 2BMXA 1ACVA 1JHBA 2VLVA 3C71A 2HE3A 1XFLA 1FB6A 1Z3EA 4QL9A 2B7KA 4MMMA 2FWEA 2EFCA 1O8WA 1SD8A 1HD2A 2VOCA 4I2TA 4FH8A 2WVZA 2G2QA 2O7KA 3ZITA 4IKHA 1AUCA 1GNWA 2PN8A 1T8EB 4ECIA 4PUFC 3TOTA 3TJJA 3HHVA 3H4KA 2ES7A 4WF5A 5B8AA 1JZRA 3EC3A 3IA1A 4GDFA 5GSTA 1T4ZA 4JR4A 4OCFA 4POKA 5HR3A 5J47A 2H76A 1GSEA 4ILFA 2QA2A 3DWVA 4GQCA 2YWOA 1JZDA 4TXOA 2R3XA 4FYCA 4HI7A 1FVJA 4HJMA 3VK9A 5D9XA 4IHUA 3DD3A 3HKRA 3QAWA 2X8GA 3GKNA 1X9MB 1H75A 3BCIA 1S3RA 1LBKA 1PFOA 2WB9A 2VL2C 4I2UA 4O7HA 1QFNA 3HVSA 4TVEA 2IIYA 3F6FA 2WGRA 4K0GA 5ECKB 1USBA 1OC3A 3ISOA 2VAFA 2VCZA 2C1YA 2C0GA 2LV3A 2DJ3A 2MBSA 5A34A 1E2YA 3EU3A 1NHYA 3TKQA 4ECJA 4KCEA 2L4CA 2HSHA 4ML6A 1OE7A 3KJYA 1TRWA 3ME7A 2WW3A 3ERGA 5DQYA 2YOIA 2GSQA 3BCKA 3HJPA 1B48A 1XWBA 4ZBDA 1XPVA 2O36A 1K0MA 4I5QA 1F2EA 3NZNA 2JADA 1MD3A 4DVCA 2VM2A 3LSZA 2DJ1A 1M3JA 4ULXA 1C72A 2V2GA 1GTIA 2PUKC 4IBPA 1PKZA 5A4VA 1YF0A 4FYBA 2E2GA 2N5BA 3LXTA 2WCIA 4RQXA 4CW9A 1VF4A 3VLNA 4KW6A 4WEYA 3RAZA 5ECMB 1TRVA 3CTGA 4BVXA 5J3RA 2C3TA 3DKSA 3GH9A 1EP8A 4L5OA 4Q5FA 4F03A 2I4AA 2H72A 1O7UA 3LGCA 4FYUA 6GSYA 1Z6MA 3UL3A 5IM9A 2V6KA 2WZSA 4IN0A 1ZYPA 2VUPA 2C0EA 3HDCA 2UZ8A 4Z2TA 2HSNA 3ZLPA 1TK5B 3RPPA 4HEA2 2LRNA 1XZOA 3VI5A 1A8YA 2GTUA 3Q6OA 1EV9A 4K2XA 3RHBA 1U87A 1HNBA 3BD2A 4XHMA 5AISA 5DALB 2MBTA 3J7Yk 2V41A 3A5IA 4MF7A 4IS0A 2RIIA 1KTEA 1ML6A 4XRAA 1J08A 1EZKA 5EL8A 2YJ7A 1XIYA 2RM5A 3IXRA 3KTBA 2HRKB 3W6GA 4KGIA 2HT9A 1YZXA 2IMKA 1GTBA 3PR8A 1V9WA 2R4VA 3O3TA 1OYJA 2WJUA 1G0TA 1YKCA 6GSUA 1ABAA 3RGBC 4KNDA 3UBLA 2HNLA 2MMOA 4P3YB 2B6MA 3G7JA 4K2DA 3TUEA 3DXBA 2QGVA 1GSFA 1YVLA 1TU8A 2FNOA 1Z7PA 2H1GA 4XS6A 4WETA 1AAZA 4FXYP 3HZ4A 4G0KA 5BMUB 3LORA 2KLXA 1F3AA 2PBJA 4HQSA 3HJMA 1M2BA 4A5PA 3G9BA 2I3YA 2KHPA 4ZB9A 1SKWB 2GQKA 5LNKe 3ERWA 3IAS2 4YKFA 4EIPA 1FB0A 4QQ7A 2ON5A 4QMKA 2X8HA 4OMVA 3I69A 4IJ3A 3R3EA 2HSMB 4KA0A 1LJRA 4KH7A 4NHZA 3VWXA 2H6XA 3HMJG 3UJ1A 1EP7A 2LRCA 3LYPA 3IHQA 2I9HA 2HRAA 4IVFA 4AGSA 3P2AA 4K6XA 3VI7A 4TW5A 4EE0A 1SJIA 3C1SA 2TRXA 19GSA 1ZL9A 2PGTA 1TTZA 2HRNA 1GRXA 5A1NA 3KP8A 1A2MA 1PN9A 5CRWA 5H5SA 3RBTA 2L57A 1HQOA 3GURA 3EMPA 2DKIA 3DGQA 2IWTA 1PSQA 3L9VA 3KXOA 2M80A 2N5FA 3ERFA 2JZRA 4ID0A 4I6XA 5DBQA 3UMAA 5J9BA 4L5LA 4Z7XA 5IOXA 1O6JA 2WVXA 1ERWA 4F0CA 3HJOA 4BVYA 3M9KA 3TJKA 1R5PA 4V1Ap 3IBHA 3R2QA 1AXDA 8GSSA 2FCHA 2RM6A 1FVKA 1K3OA 2D2ZA 1B4PA 2XPDA 2EFDA 1ST9A 5IO2A 1F37A 3GN3A 4EDZA 4K1FA 2PMTA 1QK8A 3VFIA 4NWYA 2NPBA 1N25A 2Z9SA 3I43A 14GSA 3W8JA 5IPGA 1U6TA 4WBJA 2YV9A 1X5DA 3IC4A 2A2RA 5BRTA 3F8UA 4IGJA 4YQMA 5HFIA 4IP1A 3L0HA 3N9JA 5ID2B 3VPQA 3ED3A 3U6VA 2QSIA 1MD4A 1PD21 9GSSA 1ZYQB 4BL7B 5CREA 1GSUA 2QC7A 2GT6A 2F8AA 3FHKA 5ECSA 2DKHA 2DJKA 2R0PA 4PQHA 2JU5A 1XXUA 2YV7A 5D9TA 4HU9A 3CSJA 2LNSA 1FOHA 5F07A 1B8XA 3DRNA 4LL1B 4Z2RA 3H79A 5GSSA 4EL1A 2EFHA 5DAKA 4E8HA 3IRAA 3EU4A 3EE2A 3EYTA 3TRPA 1ERVA 4FIWA 3DVXA 2QKEA 1A0FA 1GSYA 4J56E 4MZWA 1V58A 1SL1B 1YY7A 3L78A 2B5YA 1EOGA 3ZRDA 2LRTA 1XW9A 3ZFLA 2H19A 3E3EA 3HYPA 1X0RA 5G1LA 1JLVA 1MEKA 4K5SA 1TI1A 2AUVA 4OO4A 2WULA 1W4VA 2H30A 2IMDA 1ON4A 3D6IA 3HD5A 4XS1A 2GZYA 4I97A 2FWGA 3FKFA 4ZB6A 1SK0A 2TRCP 1T7PB 4NHWA 2HQTA 3TGZA 3DMLA 2HFDA 4ZBBA 1XWGA 4O5QA 3QOUA 1PKWA 2MMNA 5HFKA 2YZHA 4PI2C 4OO5A 5B8BA 1WE0A 1TK0B 4NXIA 4FQUA 3LWAA 2B7JA 2K18A 3KMNA 1ZCPA 3NOFA 3KZQA 3DYRA 4EXJA 3M3MA 2R0GA 11GSA 1SU9A 2OACA 3FZ9A 2HRFA 4AKIA 3FR6A 4MP4A 6GSSA 2CT6A 3TB2A 4Q5NA 3GMFA 4WBRD 1S4BP 4XIHA 4DSRA 1T00A 3MSZA 2AJQB 2DSAA 1SL0B 2PU9C 2M72A 3ZL5A 2WFCA 3QAGA 3TRXA 1ERTA 1AIUA 1WJKA 3A5WA 2R2JA 3HCZA 3KCMA 1XWAA 1K0DA 4GRFA 3GIXA 2VL3A 1R26A 4HZ4A 1N2AA 1OE8A 1Q98A 1SKSB 2DLXA 3EINA 3GL3A 4KDYA 1TXUA 1BJXA 2K8VA 2FHEA 2GQLA 1GULA 4MJBA 4OWYA 5J41A 4G0IA 4XTSA 4XS4A 3TRQA 1LU4A 2KUCA 4KUNA 4CHSA 2LUSA 4V1Ag 4V2MA 5KN1A 2GQMA 5CNWA 3WGXA 2FUG2 1PGTA 2I1UA 2PPTA 3GYKA 4HQZA 4KE3A 2H74A 2YANA 4O5UA 1B9YC 4AI6A 2H66A 2L4QA 3TKSC 1CQHA 7GSSA 5IMVA 2CZ3A 2OJLA 5IMFA 4PNFA 5JCWA 4G10A 2VD0A 1NSWA 1VRSD 3CYNA 4O92A 2VLUA 1ZYEA 4MK3A 5A5HB 4AJ6A 1TK8B 1EWXA 3FZ5A 1THXA 4TR1B 4GSSA 1GUKA 3VPTA 5J40A 1SVOA 4WF4A 1TU7A 2GS3A 2P5QA 3P8WA 2HXKA 1M2DA 1OC9A 2EIRA 3GRXA 3HA9A 3FYGA 5G5FA 1HYUA 3FR9A 3WD6A 1KEBA 1J9BA 1UA5A 3ZIJA 1DUGA 3GTUA 4MJAA 3N5OA 4RI7A 3LQ7A 2H1DA 4EC0A 2KP1A 3FW2A 18GSA 4GSNA 4D73B 2AV4A 2IFQB 4N30A 2H73A 2JZSA 3S9FA 4KDXA 2CX4A 5H5RA 2E7PA 3KIJA 1R7HA 5BMUA 3TJGA 1B4QA 2DIZA 2A4HA 1BQ7A 13GSA 1IYIA 4I8BA 3FEUA 4X4JA 1A8LA 2WRTA 3KH9A 4Z2UA 5EPFA 1K3YA 3FR3A 3TJFA 5G2ZA 1Y25A 2N5AA 5FT3A 3OR5A 1GSDA 2C3NA 2GLRA 3MAKA 2P5RA 2HSMA 3DEXA 2OADA 1PL2A 4N0VA 2LJKA 5DCHA 2H75A 4O32A 5F0GA 4KSOA 4N10A 2WS2A 2NDOA 3D0ZA 5G1KA 5HR0A 3GKXA 1T1VA 1SL2B 4AKXB 2REMA 4L0WA 4G0LA 4PQIA 4TXVA 5E4WA 2CA8A 3IDVA 4O5RA 1X9WB 1A2JA 4MF6A 2MMZA 3SBCA 3CWGA 3FZAA 2DIYA 5IO0A 2VCQA 4DSSA 3GX8A 5CRDA 2A2PA 2CVKA 4MF5A 5IOWA 2C4JA 1YQ1A 2AB6A 2OA7A 5IPHA 4EVMA 4L0UA 1F6MC 1BAYA 2K6VA 2XBIA 3TKPA 20GSA 2ON7A 1FAAA 5ECNB 2X49A 1TI3A 5D9WA 2GGTA 3KP9A 2O89A 2NVLA 1AQWA 2QA1A 4CDOA 3CRTA 5J4UA 2L6DA 4GWRA 1FW1A 4GCIA 5IMAA 3Q74A 4TXOB 3PPUA 3ZTLA 2B5EA 4G19A 2LEGA 1OVNA 1I1IP 4YKGA 1O81A 3KMOA 4E8EA 2F9SA 1FO5A 4KB3A 2ZNMA 3QD9A 4NPBA 4RI6A 4POLA 3GUSA 1SK2A 1MDKA 4NV2A 2V6OA 1V40A 2FGXA 4ZL9A 4LMWA 1ZYNA 1W89A 4X0XA 5COHA 5A34B 4Q5QA 4HSCX 1EV4A 1XVWA 3RFRC 1OKDA 2HLSA 5KN0A 4CY6A 3TCOA 4PNGA 4WR5A 3L9SA 2AAWA 5AIXA 4FO5A 4BWQA 3IE3A 3ZVJA 1G7OA 3KEBA 5F05A 5A4UA 3HY2A 2XHFA 2LJAA 4LA1A 1DBYA 3H93A 3D5JA 2V32A 3AY8A 2G0FA 4IW9A 2PERA 3O76A 4USSA 1SYXA 3Q19A 4ZIJA 3MYDA 1GUMA 1S3CA 3O6TA 4F2IA 2ZCTA 1K0CA 1Y1UA 5D93A 4EO3A 4LL4B 1GTAA 2FA8A 2YCDA 1K0OA 4BVXB 2PVOC 1M2AA 1GLQA 4BWSA 1XG8A 5LD0A 2O3EA 1MDJA 2DMMA 3F9UA 2FY6A 2JACA 2K8SA 2HSNB 1BG1A 16GSA 5DVBA 3H8QA 1RK4A 3IV4A 4YAPA 3IC8A 4ZL7A 3A2XA 2C80A 1S3AA 4ECCA 1UN2A 5C00A 3MWHA 1SD9A 1A2LA 4YQUA 4GQFA 3H1NA 5CRHA 2YNXA 5A5KA 1M7TA 2OT3A 2LTKA 1JFUA 1EGRA 4EKZA 1V2AA 17GSA 5J5NA 5KN2A 4V2LA 3LYKA 1QXHA 2VCWA 2CVBA 3APOA 1EGOA 5ECQB 3I6AA 2IN3A 3IOSA 2YPMA 1NHOA 3K8NA 2H71A 4MABA 1ILOA 3EVIA 5LCZA 2DBCA 3IAM2 4PGTA 3L9UA 3LFLA 1PQNA 3EWLA 4Q5RA 1XW5A 2C0FA 1BF5A 3FY7A 1OKTA 1GNEA 5IIZA 2IL3A 2EC4A 4LMVA 2F8FA 2BJXA 1F3BA 1M99A 2GZZA 3TOUA 3IK9A 3FZ4A 2P31A 5DDLA 3RHCA 2JSZA 1QGVA 2R0CA 3UVTA 2DJ2A 4KDUA 2YWNA 4PQ1A 1UVZA 2A4VA 4IP6A 2J23A 5CRGA 1TW9A 4X1UA 1YEWC 1SKRB 1TJDA 1XOAA 5ECPB 3LEFA 5KEJA 2JZTA 4OFMA 3E9JB 2CQ9A 1TP9A 1VF2A 1U88A 4DSQA 3UBKA 2LQQA 5B6NA 5ENUA 1SENA 4QL7A 4K7IA 2WW2A 4F9ZA 3ZZXA 5A1NB 3IPZA 5DJLA 3JCML 4TR3A 3QFAC 2UV8G 2CAIA 1A24A 1BEDA 2DMLA 5HR1A 1DE2A 4K7NA 4TN8A 5JWOB 1JLWA 4F0BA 2NBSA 1DSBA 3PGTA 5IQYA 3GSSA 2WVXB 1X9SB 5C04A 4IQ1A 4ICYA 4MH3A 1WP0A 4YQVA 4BVYB 2IPAA 1O8XA 1WWJA 2O8VB 3GKKA 3D4MA 5HFGA 5ELGA 4POMA 3D22A 3TJBA 4MCUA 2GVPA 2FD3A 2RUFA 3M1GA 2WVYA 4AF2A 1G6WA 2MZCA 3UEMA 2GT5A 4HUAA 2B1KA 2LJRA 3HXSA
chains in the Genus database with same CATH topology
3VWWA 2VCXA 1FG4A 4HS1A 5HQPA 1PL1A 3LW9A 1VF1A 1BG5A 2YZUA 4MPFA 2VL2A 1YF1A 5EVOA 2CVDA 4OFNA 1VF3A 6GSXA 5DQSA 5G30A 4OD7A 1R4WA 1YEPA 3UVHA 3C8EA 2LKUA 1O85A 1XBSA 3FK8A 1V98A 1GSSA 2WZ9A 4PURA 4ZXGA 2LNTA 4TR0A 4HZ2A 2F3MA 1I5GA 2PVQA 5D73A 2GZPA 4GSTA 1XWKA 6GSTA 5ECHB 4WR4A 5G31A 2IMIA 1YEXA 3BJ5A 3EPTA 5DAKB 5DALA 1PMTA 2X4AA 4DEJA 2LS5A 1BX9A 1EOHA 2CX3A 3WT2A 2O85A 4IQAA 5H5QA 2HZEB 4AJ7A 4XRDA 4GLTA 2IJYA 2H1LA 4PX1A 5CO3A 2HRKA 3V1WA 3A2VA 1K3LA 1WOUA 2OE3A 3CBUA 4KX4A 1THOA 5G5EA 2DJJA 3BBYA 4K9ZA 2H8LA 3IR4A 4N0ZA 2H0HA 2X8CA 1VGLA 4MJEA 4GXZA 3WYWA 5D8IA 5ECIB 1X5CA 2OE0A 3PH9A 4ZBAA 3F3RA 1MTCA 1OC8A 4JZQA 2XBQA 3TDGA 5INYA 4HOJA 4ACSA 3WT1A 2O87A 2CZ2A 4YAVA 4LLRA 3QAVA 2IMEA 2YWMA 4POBA 1RQMA 4MZCA 3HVXA 4CY8A 4HDEA 1GH2A 5JWRB 5ECLB 1S3DA 1PN0A 4PXOA 2JSYA 3HVVA 1MDIA 2GSRA 1Q4JA 3CXGA 1UC7A 2I81A 5DJMA 3BOAA 2H0IA 1Y6EA 1FOVA 2VIMA 4MLYA 2VCVA 2GSSA 1A0RP 5CAXA 2C8UA 4ML1A 1T4YA 4WKWA 4G01A 2HYXA 4KAEA 1F9MA 3WGDA 2L5LA 2RUEA 2VLTA 1SJZA 1V57A 2L6CA 3QMXA 1DE1A 3GSTA 2IMFA 2A2SA 4EDYA 2JL4A 3W8SA 3ZMLA 3UOMA 1PX7A 1GL8A 2NTOA 3IK7A 3HZ8A 3C7MA 5ECOB 1XOBA 2KP2A 4K8MA 4JEDA 2E0QA 2EFEA 1XWCA 4PUAA 1TXXA 4XS4B 3G7IA 3F63A 3KTLA 5JCUA 1WPIA 4KF9A 3TKRA 4G9HA 2MMAA 2OBKA 4K7OA 5GAND 4GF0A 12GSA 4TKYA 1FHEA 4MZBA 2DC5A 3KGKA 4AJ8A 4F82A 3L4NA 4HJ2A 4AKHA 5GAPD 1SVLA 2M46A 1KBNA 2VD1A 1XCCA 4NV5A 4ZL8A 3EMXA 4J57E 1Z9HA 5JWQB 5AGYA 2ALBA 5KOWA 1G7EA 4RQRA 5KN3A 1K0BA 1OC9B 3GV1A 5ID2A 5CP1A 1WIKA 2V1MA 2YP6A 1N8JA 1TRSA 4BL7A 2X99A 3MNGA 1SVMA 4OCEA 3KM6A 4EIQA 5KOXA 3P90A 4MNNA 4IJIA 1WMJA 3GTUB 2F51A 3CSIA 2ZUPA 4G2EA 1HNCA 3TKSE 3A2WA 1AQXA 2H6ZA 2HSYA 2B3SA 3D21A 6GSVA 4K5RA 3C73A 4PTSA 2H1BA 4MPGA 1RW1A 3ZVJD 3F4SA 3LXZA 1E6BA 4KSMA 2WDUA 22GSA 2YN1A 2B1LA 3APSA 4YH2A 4JRRA 3CRUA 2R6KA 2P0GA 3ZMKA 5IMZA 1M0UA 5D96A 3E0UA 1ZMAA 2VO4A 1GP1A 1EEJA 3QDNA 3ZFBA 1O73A 5HR2A 3ZREA 1SK1A 4JE1A 1PA3A 2H1AA 5IMDA 1A23A 1ZGNA 2O5VA 1JZOA 3F4RA 1Z7RA 2R5GA 4TRXA 1GSQA 1KNGA 2CV4A 2HI7A 4MJCA 5D9VA 3NIVA 1TKDB 3QCPA 4IELA 4GTUA 4XCSA 4RUVA 3GNJA 5J4VA 4EF0A 6GSWA 1AC1A 4MA9A 1YKAA 1OAZA 4W66A 4DSSB 3MIXA 5EY6A 3IHGA 2C3QA 2FWFA 4EUYA 3VURA 3GFKA 2HZFA 5F8BA 1HNAA 4TOPA 2PWJA 3DVWA 4NMUA 1K0NA 2FA4A 2L5OA 5A4WA 2TIRA 2FLSA 1J0FA 5FWGA 4ZB8A 4KCAA 5J9CA 3ZIVA 3ME8A 2E2MA 3M0FA 4AKGA 3US3A 3M9JA 3C1RA 3RDWA 1K0AA 2BTOT 3U5RE 4K0NA 1U3IA 4JBBA 3UAPA 3QR6A 1SYRA 10GSA 1M9AA 5L71A 1H4OA 3VWUA 2VKZG 1AW9A 1WRYA 2L59A 2VM1A 1CQGA 4HU7A 1X5EA 3A3TA 3F3QA 3PINA 3QFBC 2AYTA 3FRCA 3GHAA 2GDRA 4H86A 2GSTA 3UIWA 3F0IA 5CYYA 1EEMA 4JU5A 2RLIA 3D4TA 2KOKA 3GA4A 5J4YA 2J9HA 3QPMA 5ELAA 2H01A 1PX6A 4E68A 5AN1A 1GWCA 1Z5YE 2C0DA 4WXTA 1IYHA 3LG6A 3J7Yb 4L8EA 1M9BA 1GLPA 3I9V2 3P7XA 1PRXA 4TR4A 5A5HA 3GL5A 1URMA 2H6YA 3FMWA 2LQOA 2H70A 2HZEA 2B5XA 2CAQA 1QQ2A 3LJRA 1ZOFA 4TR1A 4ZILA 1BYEA 4BA7A 3DIEA 1U3AA 3CSHA 3CTFA 3Q18A 2LSTA 5DCGA 4J2FA 1AQVA 5E59A 5AIVA 1G6YA 3G7YA 3ZYWA 2AHEA 1TDIA 4BPYA 4ECBA 1NM3A 1GTUA 4X43A 2OKAA 1QMVA 2XPEA 3MDKA 1GUHA 1QUWA 4D73A 2XC2A 3RPNA 2IFQA 3GX0A 1T3BA 3KD0A 5B7CA 1SJ6A 2K9FA 3F6DA 3GH6A 1Z6NA 1YJ6A 3GKMA 2VL9A 4N11A 5F06A 3EURA 1JZWA 3TU3B 2EIQA 3VWVA 4NAXA 3TKSA 5FHIA 2OBIA 5GZZB 2VCTA 5B6MA 1XW6A 5ECRB 2YWIA 3KH7A 3UARA 4OFTA 3SWLA 4V2NA 3WGEA 4MDCA 2DJ0A 1YDKA 2X64A 1I9DA 2R37A 3CMIA 4JR6A 4ISDA 5JCGA 2FWHA 2EIOA 1ZZYA 2OE1A 1TRUA 2MYGA 2YJHA 1TOFA 1B9XC 4ZB7A 3M8NA 1R5AA 5ABRA 4N3ZA 5IMCA 2H0GA 3F4TA 4MH2A 1XVQA 1NW2A 3APQA 1ERUA 2BMXA 1ACVA 1JHBA 2VLVA 3C71A 2HE3A 1XFLA 1FB6A 1Z3EA 4QL9A 2B7KA 4MMMA 2FWEA 2EFCA 1O8WA 1SD8A 1HD2A 2VOCA 4I2TA 4FH8A 2G2QA 2O7KA 3ZITA 4IKHA 1AUCA 1GNWA 2PN8A 1T8EB 4ECIA 4PUFC 3TOTA 3TJJA 3HHVA 3H4KA 2ES7A 4WF5A 5B8AA 1JZRA 3EC3A 3IA1A 4GDFA 5GSTA 1T4ZA 4JR4A 4OCFA 4POKA 5HR3A 5J47A 2H76A 1GSEA 4ILFA 2QA2A 3DWVA 4GQCA 2YWOA 1JZDA 4TXOA 2R3XA 4FYCA 4HI7A 1FVJA 4HJMA 3VK9A 5D9XA 4IHUA 3DD3A 3HKRA 3QAWA 2X8GA 3GKNA 1X9MB 1H75A 3BCIA 1LBKA 2WB9A 2VL2C 4I2UA 4O7HA 1QFNA 3HVSA 4TVEA 2IIYA 3F6FA 2WGRA 4K0GA 5ECKB 1USBA 1OC3A 3ISOA 2VAFA 2VCZA 2C1YA 2C0GA 2LV3A 2DJ3A 2MBSA 5A34A 1E2YA 3EU3A 1NHYA 3TKQA 4ECJA 4KCEA 2L4CA 2HSHA 4ML6A 1OE7A 3KJYA 1TRWA 3ME7A 3ERGA 5DQYA 2YOIA 2GSQA 3BCKA 3HJPA 1B48A 1XWBA 4ZBDA 1XPVA 1K0MA 4I5QA 1F2EA 3NZNA 2JADA 1MD3A 4DVCA 2VM2A 3LSZA 2DJ1A 4ULXA 1C72A 2V2GA 1GTIA 2PUKC 4IBPA 1PKZA 5A4VA 1YF0A 4FYBA 2E2GA 2N5BA 3LXTA 2WCIA 4RQXA 4CW9A 1VF4A 3VLNA 4KW6A 4WEYA 3RAZA 5ECMB 1TRVA 3CTGA 4BVXA 5J3RA 2C3TA 3DKSA 3GH9A 1EP8A 4L5OA 4Q5FA 4F03A 2I4AA 2H72A 1O7UA 3LGCA 4FYUA 6GSYA 1Z6MA 3UL3A 5IM9A 2V6KA 4IN0A 1ZYPA 2VUPA 2C0EA 3HDCA 2UZ8A 4Z2TA 2HSNA 3ZLPA 1TK5B 3RPPA 4HEA2 2LRNA 1XZOA 3VI5A 1A8YA 2GTUA 3Q6OA 1EV9A 4K2XA 3RHBA 1U87A 1HNBA 3BD2A 4XHMA 5AISA 5DALB 2MBTA 3J7Yk 2V41A 3A5IA 4MF7A 4IS0A 2RIIA 1KTEA 1ML6A 4XRAA 1J08A 1EZKA 5EL8A 2YJ7A 1XIYA 2RM5A 3IXRA 3KTBA 2HRKB 3W6GA 4KGIA 2HT9A 1YZXA 2IMKA 1GTBA 3PR8A 1V9WA 2R4VA 3O3TA 1OYJA 2WJUA 1G0TA 1YKCA 6GSUA 1ABAA 4KNDA 3UBLA 2HNLA 2MMOA 4P3YB 2B6MA 3G7JA 4K2DA 3TUEA 3DXBA 2QGVA 1GSFA 1YVLA 1TU8A 2FNOA 1Z7PA 2H1GA 4XS6A 4WETA 1AAZA 3HZ4A 4G0KA 5BMUB 3LORA 2KLXA 1F3AA 2PBJA 4HQSA 3HJMA 1M2BA 4A5PA 3G9BA 2I3YA 2KHPA 4ZB9A 1SKWB 2GQKA 5LNKe 3ERWA 3IAS2 4YKFA 4EIPA 1FB0A 4QQ7A 2ON5A 4QMKA 2X8HA 4OMVA 3I69A 4IJ3A 3R3EA 2HSMB 4KA0A 1LJRA 4KH7A 4NHZA 3VWXA 2H6XA 3HMJG 3UJ1A 1EP7A 2LRCA 3LYPA 3IHQA 2I9HA 2HRAA 4IVFA 4AGSA 3P2AA 4K6XA 3VI7A 4TW5A 4EE0A 1SJIA 3C1SA 2TRXA 19GSA 1ZL9A 2PGTA 1TTZA 2HRNA 1GRXA 5A1NA 3KP8A 1A2MA 1PN9A 5CRWA 5H5SA 3RBTA 2L57A 1HQOA 3GURA 3EMPA 2DKIA 3DGQA 2IWTA 1PSQA 3L9VA 3KXOA 2M80A 2N5FA 3ERFA 2JZRA 4ID0A 4I6XA 5DBQA 3UMAA 5J9BA 4L5LA 4Z7XA 5IOXA 1O6JA 1ERWA 4F0CA 3HJOA 4BVYA 3M9KA 3TJKA 1R5PA 4V1Ap 3IBHA 3R2QA 1AXDA 8GSSA 2FCHA 2RM6A 1FVKA 1K3OA 2D2ZA 1B4PA 2XPDA 2EFDA 1ST9A 5IO2A 1F37A 3GN3A 4EDZA 4K1FA 2PMTA 1QK8A 3VFIA 4NWYA 2NPBA 1N25A 2Z9SA 3I43A 14GSA 3W8JA 5IPGA 1U6TA 4WBJA 2YV9A 1X5DA 3IC4A 2A2RA 5BRTA 3F8UA 4IGJA 4YQMA 5HFIA 4IP1A 3L0HA 3N9JA 5ID2B 3VPQA 3ED3A 3U6VA 2QSIA 1MD4A 1PD21 9GSSA 1ZYQB 4BL7B 5CREA 1GSUA 2QC7A 2GT6A 2F8AA 3FHKA 5ECSA 2DKHA 2DJKA 2R0PA 4PQHA 2JU5A 1XXUA 2YV7A 5D9TA 4HU9A 3CSJA 2LNSA 1FOHA 5F07A 1B8XA 3DRNA 4LL1B 4Z2RA 3H79A 5GSSA 4EL1A 2EFHA 5DAKA 4E8HA 3IRAA 3EU4A 3EE2A 3EYTA 3TRPA 1ERVA 4FIWA 3DVXA 2QKEA 1A0FA 1GSYA 4J56E 4MZWA 1V58A 1SL1B 1YY7A 3L78A 2B5YA 1EOGA 3ZRDA 2LRTA 1XW9A 3ZFLA 2H19A 3E3EA 3HYPA 1X0RA 5G1LA 1JLVA 1MEKA 4K5SA 1TI1A 2AUVA 4OO4A 2WULA 1W4VA 2H30A 2IMDA 1ON4A 3D6IA 3HD5A 4XS1A 2GZYA 4I97A 2FWGA 3FKFA 4ZB6A 1SK0A 2TRCP 1T7PB 4NHWA 2HQTA 3TGZA 3DMLA 2HFDA 4ZBBA 1XWGA 4O5QA 3QOUA 1PKWA 2MMNA 5HFKA 2YZHA 4OO5A 5B8BA 1WE0A 1TK0B 4NXIA 4FQUA 3LWAA 2B7JA 2K18A 3KMNA 1ZCPA 3NOFA 3KZQA 3DYRA 4EXJA 3M3MA 2R0GA 11GSA 1SU9A 2OACA 3FZ9A 2HRFA 4AKIA 3FR6A 4MP4A 6GSSA 2CT6A 3TB2A 4Q5NA 3GMFA 4WBRD 4XIHA 4DSRA 1T00A 3MSZA 2AJQB 2DSAA 1SL0B 2PU9C 2M72A 3ZL5A 2WFCA 3QAGA 3TRXA 1ERTA 1AIUA 1WJKA 3A5WA 2R2JA 3HCZA 3KCMA 1XWAA 1K0DA 4GRFA 3GIXA 2VL3A 1R26A 4HZ4A 1N2AA 1OE8A 1Q98A 1SKSB 2DLXA 3EINA 3GL3A 4KDYA 1TXUA 1BJXA 2K8VA 2FHEA 2GQLA 1GULA 4MJBA 4OWYA 5J41A 4G0IA 4XTSA 4XS4A 3TRQA 1LU4A 2KUCA 4KUNA 4CHSA 2LUSA 4V1Ag 4V2MA 5KN1A 2GQMA 5CNWA 3WGXA 2FUG2 1PGTA 2I1UA 2PPTA 3GYKA 4HQZA 4KE3A 2H74A 2YANA 4O5UA 1B9YC 4AI6A 2H66A 2L4QA 3TKSC 1CQHA 7GSSA 5IMVA 2CZ3A 2OJLA 5IMFA 4PNFA 5JCWA 4G10A 2VD0A 1NSWA 1VRSD 3CYNA 4O92A 2VLUA 1ZYEA 4MK3A 5A5HB 4AJ6A 1TK8B 1EWXA 3FZ5A 1THXA 4TR1B 4GSSA 1GUKA 3VPTA 5J40A 1SVOA 4WF4A 1TU7A 2GS3A 2P5QA 3P8WA 2HXKA 1M2DA 1OC9A 2EIRA 3GRXA 3HA9A 3FYGA 5G5FA 1HYUA 3FR9A 3WD6A 1KEBA 1J9BA 1UA5A 3ZIJA 1DUGA 3GTUA 4MJAA 3N5OA 4RI7A 3LQ7A 2H1DA 4EC0A 2KP1A 3FW2A 18GSA 4GSNA 4D73B 2AV4A 2IFQB 4N30A 2H73A 2JZSA 3S9FA 4KDXA 2CX4A 5H5RA 2E7PA 3KIJA 1R7HA 5BMUA 3TJGA 1B4QA 2DIZA 2A4HA 1BQ7A 13GSA 1IYIA 4I8BA 3FEUA 4X4JA 1A8LA 2WRTA 3KH9A 4Z2UA 5EPFA 1K3YA 3FR3A 3TJFA 5G2ZA 1Y25A 2N5AA 5FT3A 3OR5A 1GSDA 2C3NA 2GLRA 3MAKA 2P5RA 2HSMA 3DEXA 2OADA 1PL2A 4N0VA 2LJKA 5DCHA 2H75A 4O32A 5F0GA 4KSOA 4N10A 2WS2A 2NDOA 3D0ZA 5G1KA 5HR0A 3GKXA 1T1VA 1SL2B 4AKXB 2REMA 4L0WA 4G0LA 4PQIA 4TXVA 5E4WA 2CA8A 3IDVA 4O5RA 1X9WB 1A2JA 4MF6A 2MMZA 3SBCA 3CWGA 3FZAA 2DIYA 5IO0A 2VCQA 4DSSA 3GX8A 5CRDA 2A2PA 2CVKA 4MF5A 5IOWA 2C4JA 1YQ1A 2AB6A 2OA7A 5IPHA 4EVMA 4L0UA 1F6MC 1BAYA 2K6VA 2XBIA 3TKPA 20GSA 2ON7A 1FAAA 5ECNB 2X49A 1TI3A 5D9WA 2GGTA 3KP9A 2O89A 2NVLA 1AQWA 2QA1A 4CDOA 3CRTA 5J4UA 2L6DA 4GWRA 1FW1A 4GCIA 5IMAA 3Q74A 4TXOB 3PPUA 3ZTLA 2B5EA 4G19A 2LEGA 1OVNA 4YKGA 1O81A 3KMOA 4E8EA 2F9SA 1FO5A 4KB3A 2ZNMA 3QD9A 4NPBA 4RI6A 4POLA 3GUSA 1SK2A 1MDKA 4NV2A 2V6OA 1V40A 2FGXA 4ZL9A 4LMWA 1ZYNA 1W89A 4X0XA 5COHA 5A34B 4Q5QA 1EV4A 1XVWA 1OKDA 2HLSA 5KN0A 4CY6A 3TCOA 4PNGA 4WR5A 3L9SA 2AAWA 5AIXA 4FO5A 4BWQA 3IE3A 3ZVJA 1G7OA 3KEBA 5F05A 5A4UA 3HY2A 2XHFA 2LJAA 4LA1A 1DBYA 3H93A 3D5JA 2V32A 3AY8A 2G0FA 4IW9A 2PERA 3O76A 4USSA 1SYXA 3Q19A 4ZIJA 3MYDA 1GUMA 1S3CA 3O6TA 4F2IA 2ZCTA 1K0CA 1Y1UA 5D93A 4EO3A 4LL4B 1GTAA 2FA8A 2YCDA 1K0OA 4BVXB 2PVOC 1M2AA 1GLQA 4BWSA 5LD0A 1MDJA 2DMMA 3F9UA 2FY6A 2JACA 2K8SA 2HSNB 1BG1A 16GSA 5DVBA 3H8QA 1RK4A 3IV4A 4YAPA 3IC8A 4ZL7A 3A2XA 2C80A 1S3AA 4ECCA 1UN2A 5C00A 3MWHA 1SD9A 1A2LA 4YQUA 4GQFA 3H1NA 5CRHA 2YNXA 5A5KA 1M7TA 2OT3A 2LTKA 1JFUA 1EGRA 4EKZA 1V2AA 17GSA 5J5NA 5KN2A 4V2LA 3LYKA 1QXHA 2VCWA 2CVBA 3APOA 1EGOA 5ECQB 3I6AA 2IN3A 3IOSA 2YPMA 1NHOA 3K8NA 2H71A 4MABA 1ILOA 3EVIA 5LCZA 2DBCA 3IAM2 4PGTA 3L9UA 3LFLA 1PQNA 3EWLA 4Q5RA 1XW5A 2C0FA 1BF5A 3FY7A 1OKTA 1GNEA 5IIZA 2IL3A 2EC4A 4LMVA 2F8FA 2BJXA 1F3BA 1M99A 2GZZA 3TOUA 3IK9A 3FZ4A 2P31A 5DDLA 3RHCA 2JSZA 1QGVA 2R0CA 3UVTA 2DJ2A 4KDUA 2YWNA 4PQ1A 1UVZA 2A4VA 4IP6A 2J23A 5CRGA 1TW9A 4X1UA 1SKRB 1TJDA 1XOAA 5ECPB 3LEFA 5KEJA 2JZTA 4OFMA 3E9JB 2CQ9A 1TP9A 1VF2A 1U88A 4DSQA 3UBKA 2LQQA 5B6NA 5ENUA 1SENA 4QL7A 4K7IA 4F9ZA 3ZZXA 5A1NB 3IPZA 5DJLA 3JCML 4TR3A 3QFAC 2UV8G 2CAIA 1A24A 1BEDA 2DMLA 5HR1A 1DE2A 4K7NA 4TN8A 5JWOB 1JLWA 4F0BA 2NBSA 1DSBA 3PGTA 5IQYA 3GSSA 1X9SB 5C04A 4IQ1A 4ICYA 4MH3A 1WP0A 4YQVA 4BVYB 2IPAA 1O8XA 1WWJA 2O8VB 3GKKA 3D4MA 5HFGA 5ELGA 4POMA 3D22A 3TJBA 4MCUA 2GVPA 2FD3A 2RUFA 3M1GA 4AF2A 1G6WA 2MZCA 3UEMA 2GT5A 4HUAA 2B1KA 2LJRA 3HXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWW A;  2VCX A;  1FG4 A;  4HS1 A;  5HQP A;  1PL1 A;  1VF1 A;  1BG5 A;  2YZU A;  4MPF A;  2VL2 A;  1YF1 A;  5EVO A;  2CVD A;  4OFN A;  1VF3 A;  6GSX A;  5DQS A;  5G30 A;  4OD7 A;  1R4W A;  1YEP A;  3UVH A;  3C8E A;  2LKU A;  1O85 A;  1XBS A;  3FK8 A;  1V98 A;  1GSS A;  2WZ9 A;  4PUR A;  4ZXG A;  2LNT A;  4TR0 A;  4HZ2 A;  2F3M A;  1I5G A;  2PVQ A;  5D73 A;  2GZP A;  4GST A;  1XWK A;  6GST A;  5ECH B;  4WR4 A;  5G31 A;  2IMI A;  1YEX A;  3BJ5 A;  5DAK B;  5DAL A;  1PMT A;  4DEJ A;  2LS5 A;  1BX9 A;  1EOH A;  2CX3 A;  3WT2 A;  2O85 A;  4IQA A;  5H5Q A;  2HZE B;  4AJ7 A;  4XRD A;  4GLT A;  2IJY A;  5CO3 A;  4PX1 A;  2HRK A;  3V1W A;  3A2V A;  1K3L A;  1WOU A;  2OE3 A;  3CBU A;  4KX4 A;  1THO A;  5G5E A;  2DJJ A;  3BBY A;  4K9Z A;  2H8L A;  3IR4 A;  4N0Z A;  2H0H A;  2X8C A;  1VGL A;  4MJE A;  4GXZ A;  3WYW A;  5D8I A;  5ECI B;  1X5C A;  2OE0 A;  3PH9 A;  4ZBA A;  3F3R A;  1MTC A;  1OC8 A;  4JZQ A;  2XBQ A;  3TDG A;  5INY A;  4HOJ A;  4ACS A;  3WT1 A;  2O87 A;  2CZ2 A;  4YAV A;  4LLR A;  3QAV A;  2IME A;  2YWM A;  4POB A;  1RQM A;  4MZC A;  3HVX A;  4HDE A;  1GH2 A;  5JWR B;  5ECL B;  1S3D A;  4PXO A;  2JSY A;  3HVV A;  1MDI A;  2GSR A;  1Q4J A;  3CXG A;  1UC7 A;  2I81 A;  5DJM A;  3BOA A;  2H0I A;  1Y6E A;  1FOV A;  2VIM A;  4MLY A;  2VCV A;  2GSS A;  1A0R P;  5CAX A;  2C8U A;  4ML1 A;  1T4Y A;  4WKW A;  2HYX A;  4KAE A;  1F9M A;  3WGD A;  2L5L A;  2RUE A;  2VLT A;  1SJZ A;  1V57 A;  2L6C A;  3QMX A;  1DE1 A;  3GST A;  2IMF A;  2A2S A;  4EDY A;  2JL4 A;  3W8S A;  3ZML A;  3UOM A;  1PX7 A;  1GL8 A;  2NTO A;  3IK7 A;  3HZ8 A;  3C7M A;  5ECO B;  1XOB A;  2KP2 A;  4K8M A;  4JED A;  2E0Q A;  1XWC A;  4PUA A;  1TXX A;  4XS4 B;  3G7I A;  3F63 A;  3KTL A;  5JCU A;  1WPI A;  4KF9 A;  3TKR A;  4G9H A;  2MMA A;  2OBK A;  4K7O A;  5GAN D;  4GF0 A;  12GS A;  4TKY A;  1FHE A;  4MZB A;  2DC5 A;  3KGK A;  4AJ8 A;  4F82 A;  3L4N A;  4HJ2 A;  5GAP D;  2M46 A;  1KBN A;  2VD1 A;  1XCC A;  4NV5 A;  4ZL8 A;  3EMX A;  4J57 E;  1Z9H A;  5JWQ B;  5AGY A;  2ALB A;  1G7E A;  4RQR A;  5KN3 A;  1K0B A;  1OC9 B;  3GV1 A;  5ID2 A;  5CP1 A;  1WIK A;  2V1M A;  2YP6 A;  1N8J A;  1TRS A;  4BL7 A;  2X99 A;  3MNG A;  4OCE A;  3KM6 A;  3P90 A;  4IJI A;  1WMJ A;  3GTU B;  2F51 A;  3CSI A;  2ZUP A;  4G2E A;  1HNC A;  3TKS E;  3A2W A;  1AQX A;  2H6Z A;  2HSY A;  2B3S A;  3D21 A;  6GSV A;  3C73 A;  4PTS A;  2H1B A;  4MPG A;  1RW1 A;  3ZVJ D;  3F4S A;  3LXZ A;  1E6B A;  4KSM A;  2WDU A;  22GS A;  2YN1 A;  2B1L A;  3APS A;  4YH2 A;  4JRR A;  3CRU A;  2R6K A;  2P0G A;  3ZMK A;  5IMZ A;  1M0U A;  5D96 A;  3E0U A;  1ZMA A;  2VO4 A;  1GP1 A;  1EEJ A;  3QDN A;  3ZFB A;  1O73 A;  5HR2 A;  3ZRE A;  1SK1 A;  4JE1 A;  1PA3 A;  2H1A A;  5IMD A;  1A23 A;  1ZGN A;  1JZO A;  3F4R A;  1Z7R A;  2R5G A;  4TRX A;  1GSQ A;  1KNG A;  2CV4 A;  2HI7 A;  4MJC A;  5D9V A;  3NIV A;  1TKD B;  3QCP A;  4IEL A;  4GTU A;  4XCS A;  4RUV A;  3GNJ A;  4EF0 A;  6GSW A;  1AC1 A;  4MA9 A;  1YKA A;  1OAZ A;  4DSS B;  5EY6 A;  2C3Q A;  2FWF A;  4EUY A;  3VUR A;  3GFK A;  2HZF A;  5F8B A;  1HNA A;  4TOP A;  2PWJ A;  3DVW A;  4NMU A;  1K0N A;  2FA4 A;  2L5O A;  5A4W A;  2TIR A;  2FLS A;  1J0F A;  5FWG A;  4ZB8 A;  4KCA A;  5J9C A;  3ZIV A;  3ME8 A;  2E2M A;  3M0F A;  3US3 A;  3M9J A;  3C1R A;  3RDW A;  1K0A A;  2BTO T;  3U5R E;  4K0N A;  1U3I A;  4JBB A;  3UAP A;  3QR6 A;  1SYR A;  10GS A;  1M9A A;  5L71 A;  1H4O A;  3VWU A;  1AW9 A;  1WRY A;  2L59 A;  2VM1 A;  1CQG A;  4HU7 A;  1X5E A;  3A3T A;  3F3Q A;  3PIN A;  3QFB C;  2AYT A;  3FRC A;  3GHA A;  2GDR A;  4H86 A;  2GST A;  3UIW A;  3F0I A;  5CYY A;  1EEM A;  4JU5 A;  2RLI A;  3D4T A;  2KOK A;  3GA4 A;  2J9H A;  3QPM A;  5ELA A;  2H01 A;  1PX6 A;  5AN1 A;  1GWC A;  1Z5Y E;  2C0D A;  4WXT A;  1IYH A;  3LG6 A;  3J7Y b;  4L8E A;  1M9B A;  1GLP A;  3I9V 2;  3P7X A;  1PRX A;  4TR4 A;  3GL5 A;  1URM A;  2H6Y A;  2LQO A;  2H70 A;  2HZE A;  2B5X A;  2CAQ A;  1QQ2 A;  3LJR A;  1ZOF A;  4TR1 A;  4ZIL A;  1BYE A;  4BA7 A;  3DIE A;  1U3A A;  3CSH A;  3CTF A;  3Q18 A;  2LST A;  5DCG A;  4J2F A;  1AQV A;  5E59 A;  5AIV A;  1G6Y A;  3G7Y A;  3ZYW A;  2AHE A;  1TDI A;  4BPY A;  4ECB A;  1NM3 A;  1GTU A;  4X43 A;  2OKA A;  1QMV A;  2XPE A;  3MDK A;  1GUH A;  1QUW A;  4D73 A;  2XC2 A;  3RPN A;  2IFQ A;  3GX0 A;  1T3B A;  3KD0 A;  5B7C A;  1SJ6 A;  2K9F A;  3F6D A;  3GH6 A;  1Z6N A;  1YJ6 A;  3GKM A;  2VL9 A;  4N11 A;  5F06 A;  3EUR A;  1JZW A;  2EIQ A;  3VWV A;  4NAX A;  3TKS A;  5FHI A;  2OBI A;  5GZZ B;  2VCT A;  5B6M A;  1XW6 A;  5ECR B;  2YWI A;  3KH7 A;  3UAR A;  4OFT A;  3SWL A;  4V2N A;  3WGE A;  4MDC A;  2DJ0 A;  1YDK A;  2X64 A;  1I9D A;  2R37 A;  3CMI A;  4JR6 A;  4ISD A;  5JCG A;  2FWH A;  2EIO A;  1ZZY A;  2OE1 A;  1TRU A;  2MYG A;  2YJH A;  1TOF A;  1B9X C;  3M8N A;  1R5A A;  5ABR A;  5IMC A;  2H0G A;  3F4T A;  4MH2 A;  1XVQ A;  1NW2 A;  3APQ A;  1ERU A;  2BMX A;  1ACV A;  1JHB A;  2VLV A;  3C71 A;  2HE3 A;  1XFL A;  1FB6 A;  1Z3E A;  4QL9 A;  2B7K A;  4MMM A;  2FWE A;  1O8W A;  1SD8 A;  1HD2 A;  2VOC A;  4I2T A;  4FH8 A;  2G2Q A;  2O7K A;  3ZIT A;  4IKH A;  1AUC A;  1GNW A;  2PN8 A;  1T8E B;  4ECI A;  4PUF C;  3TOT A;  3TJJ A;  3HHV A;  3H4K A;  2ES7 A;  4WF5 A;  5B8A A;  1JZR A;  3EC3 A;  3IA1 A;  5GST A;  1T4Z A;  4JR4 A;  4OCF A;  4POK A;  5HR3 A;  2H76 A;  1GSE A;  4ILF A;  3DWV A;  4GQC A;  2YWO A;  1JZD A;  4TXO A;  2R3X A;  4FYC A;  4HI7 A;  1FVJ A;  4HJM A;  3VK9 A;  5D9X A;  4IHU A;  3DD3 A;  3HKR A;  3QAW A;  2X8G A;  3GKN A;  1X9M B;  1H75 A;  3BCI A;  1LBK A;  2WB9 A;  2VL2 C;  4I2U A;  4O7H A;  1QFN A;  3HVS A;  4TVE A;  2IIY A;  3F6F A;  2WGR A;  4K0G A;  5ECK B;  1USB A;  1OC3 A;  3ISO A;  2VAF A;  2VCZ A;  2C1Y A;  2C0G A;  2LV3 A;  2DJ3 A;  2MBS A;  1E2Y A;  3EU3 A;  1NHY A;  3TKQ A;  4ECJ A;  4KCE A;  2L4C A;  2HSH A;  4ML6 A;  1OE7 A;  3KJY A;  1TRW A;  3ME7 A;  3ERG A;  5DQY A;  2YOI A;  2GSQ A;  3BCK A;  3HJP A;  1B48 A;  1XWB A;  4ZBD A;  1XPV A;  1K0M A;  4I5Q A;  1F2E A;  3NZN A;  2JAD A;  1MD3 A;  4DVC A;  2VM2 A;  3LSZ A;  2DJ1 A;  4ULX A;  1C72 A;  2V2G A;  1GTI A;  2PUK C;  4IBP A;  1PKZ A;  5A4V A;  1YF0 A;  4FYB A;  2E2G A;  2N5B A;  3LXT A;  2WCI A;  4RQX A;  4CW9 A;  1VF4 A;  3VLN A;  4KW6 A;  4WEY A;  3RAZ A;  5ECM B;  1TRV A;  3CTG A;  4BVX A;  5J3R A;  2C3T A;  3DKS A;  3GH9 A;  1EP8 A;  4L5O A;  4Q5F A;  4F03 A;  2I4A A;  2H72 A;  1O7U A;  3LGC A;  4FYU A;  6GSY A;  1Z6M A;  3UL3 A;  5IM9 A;  2V6K A;  4IN0 A;  2VUP A;  2C0E A;  3HDC A;  2UZ8 A;  3ZLP A;  1TK5 B;  3RPP A;  4HEA 2;  2LRN A;  1XZO A;  3VI5 A;  1A8Y A;  2GTU A;  3Q6O A;  1EV9 A;  3RHB A;  1U87 A;  1HNB A;  3BD2 A;  4XHM A;  5AIS A;  5DAL B;  2MBT A;  3J7Y k;  2V41 A;  4MF7 A;  4IS0 A;  2RII A;  1KTE A;  1ML6 A;  4XRA A;  1J08 A;  1EZK A;  5EL8 A;  2YJ7 A;  1XIY A;  2RM5 A;  3IXR A;  3KTB A;  2HRK B;  3W6G A;  4KGI A;  2HT9 A;  1YZX A;  2IMK A;  1GTB A;  3PR8 A;  1V9W A;  2R4V A;  3O3T A;  1OYJ A;  2WJU A;  1G0T A;  1YKC A;  6GSU A;  1ABA A;  4KND A;  3UBL A;  2HNL A;  2MMO A;  4P3Y B;  2B6M A;  3G7J A;  4K2D A;  3TUE A;  3DXB A;  2QGV A;  1GSF A;  1TU8 A;  2FNO A;  1Z7P A;  2H1G A;  4XS6 A;  4WET A;  1AAZ A;  3HZ4 A;  4G0K A;  3LOR A;  2KLX A;  1F3A A;  2PBJ A;  4HQS A;  3HJM A;  1M2B A;  3G9B A;  2I3Y A;  2KHP A;  4ZB9 A;  1SKW B;  2GQK A;  5LNK e;  3ERW A;  3IAS 2;  1FB0 A;  4QQ7 A;  2ON5 A;  2X8H A;  4OMV A;  3I69 A;  4IJ3 A;  3R3E A;  2HSM B;  4KA0 A;  1LJR A;  4KH7 A;  4NHZ A;  3VWX A;  2H6X A;  3UJ1 A;  1EP7 A;  2LRC A;  3LYP A;  3IHQ A;  2I9H A;  2HRA A;  4IVF A;  4AGS A;  3P2A A;  4K6X A;  3VI7 A;  4TW5 A;  4EE0 A;  1SJI A;  3C1S A;  2TRX A;  19GS A;  1ZL9 A;  2PGT A;  1TTZ A;  2HRN A;  1GRX A;  3KP8 A;  5CRW A;  1A2M A;  1PN9 A;  5H5S A;  3RBT A;  2L57 A;  1HQO A;  3GUR A;  3EMP A;  3DGQ A;  2IWT A;  1PSQ A;  3L9V A;  3KXO A;  2M80 A;  2N5F A;  3ERF A;  2JZR A;  4ID0 A;  4I6X A;  5DBQ A;  3UMA A;  5J9B A;  4L5L A;  4Z7X A;  5IOX A;  1O6J A;  1ERW A;  4F0C A;  3HJO A;  4BVY A;  3M9K A;  3TJK A;  1R5P A;  4V1A p;  3IBH A;  3R2Q A;  1AXD A;  8GSS A;  2FCH A;  2RM6 A;  1FVK A;  1K3O A;  2D2Z A;  1B4P A;  2XPD A;  1ST9 A;  5IO2 A;  1F37 A;  3GN3 A;  4EDZ A;  4K1F A;  2PMT A;  1QK8 A;  3VFI A;  4NWY A;  2NPB A;  2Z9S A;  3I43 A;  14GS A;  3W8J A;  5IPG A;  1U6T A;  4WBJ A;  2YV9 A;  1X5D A;  3IC4 A;  2A2R A;  3F8U A;  4IGJ A;  4YQM A;  5HFI A;  4IP1 A;  3L0H A;  3N9J A;  5ID2 B;  3VPQ A;  3ED3 A;  3U6V A;  2QSI A;  1MD4 A;  1PD2 1;  9GSS A;  1ZYQ B;  4BL7 B;  5CRE A;  1GSU A;  2QC7 A;  2GT6 A;  2F8A A;  3FHK A;  5ECS A;  2DJK A;  4PQH A;  2JU5 A;  1XXU A;  2YV7 A;  5D9T A;  4HU9 A;  3CSJ A;  2LNS A;  5F07 A;  1B8X A;  3DRN A;  4LL1 B;  3H79 A;  5GSS A;  4EL1 A;  5DAK A;  4E8H A;  3IRA A;  3EU4 A;  3EE2 A;  3EYT A;  3TRP A;  1ERV A;  4FIW A;  3DVX A;  2QKE A;  1A0F A;  1GSY A;  4J56 E;  4MZW A;  1V58 A;  1SL1 B;  1YY7 A;  3L78 A;  2B5Y A;  1EOG A;  3ZRD A;  2LRT A;  1XW9 A;  3ZFL A;  2H19 A;  3E3E A;  3HYP A;  1X0R A;  5G1L A;  1JLV A;  1MEK A;  1TI1 A;  2AUV A;  4OO4 A;  2WUL A;  1W4V A;  2H30 A;  2IMD A;  1ON4 A;  3D6I A;  3HD5 A;  4XS1 A;  2GZY A;  4I97 A;  2FWG A;  3FKF A;  4ZB6 A;  1SK0 A;  2TRC P;  1T7P B;  4NHW A;  2HQT A;  3TGZ A;  3DML A;  2HFD A;  4ZBB A;  1XWG A;  3QOU A;  1PKW A;  2MMN A;  5HFK A;  2YZH A;  4OO5 A;  5B8B A;  1WE0 A;  1TK0 B;  4NXI A;  4FQU A;  3LWA A;  2B7J A;  2K18 A;  3KMN A;  1ZCP A;  3NOF A;  3KZQ A;  3DYR A;  4EXJ A;  3M3M A;  11GS A;  1SU9 A;  2OAC A;  3FZ9 A;  2HRF A;  3FR6 A;  4MP4 A;  6GSS A;  2CT6 A;  3TB2 A;  4Q5N A;  3GMF A;  4WBR D;  4XIH A;  4DSR A;  1T00 A;  3MSZ A;  2AJQ B;  2DSA A;  1SL0 B;  2PU9 C;  2M72 A;  3ZL5 A;  2WFC A;  3QAG A;  3TRX A;  1ERT A;  1AIU A;  1WJK A;  3A5W A;  2R2J A;  3HCZ A;  3KCM A;  1XWA A;  1K0D A;  4GRF A;  3GIX A;  2VL3 A;  1R26 A;  4HZ4 A;  1N2A A;  1OE8 A;  1Q98 A;  1SKS B;  2DLX A;  3EIN A;  3GL3 A;  4KDY A;  1BJX A;  2K8V A;  2FHE A;  2GQL A;  1GUL A;  4MJB A;  4OWY A;  5J41 A;  4G0I A;  4XTS A;  4XS4 A;  3TRQ A;  1LU4 A;  2KUC A;  4KUN A;  4CHS A;  2LUS A;  4V1A g;  4V2M A;  5KN1 A;  2GQM A;  5CNW A;  3WGX A;  2FUG 2;  1PGT A;  2I1U A;  2PPT A;  3GYK A;  4HQZ A;  4KE3 A;  2H74 A;  2YAN A;  1B9Y C;  2H66 A;  2L4Q A;  3TKS C;  1CQH A;  7GSS A;  5IMV A;  2CZ3 A;  2OJL A;  5IMF A;  4PNF A;  5JCW A;  4G10 A;  2VD0 A;  1NSW A;  1VRS D;  3CYN A;  4O92 A;  2VLU A;  1ZYE A;  4MK3 A;  4AJ6 A;  1TK8 B;  1EWX A;  3FZ5 A;  1THX A;  4TR1 B;  4GSS A;  1GUK A;  3VPT A;  4WF4 A;  1TU7 A;  2GS3 A;  2P5Q A;  3P8W A;  2HXK A;  1M2D A;  1OC9 A;  2EIR A;  3GRX A;  3HA9 A;  3FYG A;  5G5F A;  1HYU A;  3FR9 A;  3WD6 A;  1KEB A;  1J9B A;  1UA5 A;  3ZIJ A;  1DUG A;  3GTU A;  4MJA A;  3N5O A;  4RI7 A;  3LQ7 A;  2H1D A;  4EC0 A;  2KP1 A;  3FW2 A;  18GS A;  4GSN A;  4D73 B;  2AV4 A;  2IFQ B;  4N30 A;  2H73 A;  2JZS A;  3S9F A;  4KDX A;  2CX4 A;  5H5R A;  2E7P A;  3KIJ A;  1R7H A;  5BMU A;  3TJG A;  1B4Q A;  2DIZ A;  1BQ7 A;  13GS A;  1IYI A;  4I8B A;  3FEU A;  1A8L A;  2WRT A;  3KH9 A;  5EPF A;  1K3Y A;  3FR3 A;  3TJF A;  5G2Z A;  1Y25 A;  2N5A A;  5FT3 A;  3OR5 A;  1GSD A;  2C3N A;  2GLR A;  3MAK A;  2P5R A;  2HSM A;  3DEX A;  2OAD A;  1PL2 A;  4N0V A;  2LJK A;  5DCH A;  2H75 A;  4O32 A;  5F0G A;  4KSO A;  4N10 A;  2WS2 A;  2NDO A;  3D0Z A;  5G1K A;  5HR0 A;  3GKX A;  1T1V A;  1SL2 B;  2REM A;  4L0W A;  4G0L A;  4PQI A;  4TXV A;  5E4W A;  2CA8 A;  3IDV A;  4O5R A;  1X9W B;  1A2J A;  4MF6 A;  2MMZ A;  3SBC A;  3FZA A;  2DIY A;  5IO0 A;  2VCQ A;  4DSS A;  3GX8 A;  5CRD A;  2CVK A;  4MF5 A;  5IOW A;  2C4J A;  1YQ1 A;  2AB6 A;  2OA7 A;  5IPH A;  4EVM A;  4L0U A;  1F6M C;  1BAY A;  2K6V A;  2XBI A;  3TKP A;  20GS A;  2ON7 A;  1FAA A;  5ECN B;  1TI3 A;  5D9W A;  2GGT A;  3KP9 A;  2O89 A;  2NVL A;  1AQW A;  4CDO A;  3CRT A;  5J4U A;  2L6D A;  4GWR A;  1FW1 A;  4GCI A;  5IMA A;  3Q74 A;  4TXO B;  3PPU A;  3ZTL A;  2B5E A;  4G19 A;  2LEG A;  1OVN A;  1O81 A;  3KMO A;  4E8E A;  2F9S A;  1FO5 A;  4KB3 A;  2ZNM A;  3QD9 A;  4NPB A;  4RI6 A;  4POL A;  3GUS A;  1SK2 A;  1MDK A;  4NV2 A;  2V6O A;  1V40 A;  2FGX A;  4ZL9 A;  4LMW A;  1W89 A;  4X0X A;  5COH A;  4Q5Q A;  1EV4 A;  1XVW A;  1OKD A;  2HLS A;  5KN0 A;  3TCO A;  4PNG A;  4WR5 A;  3L9S A;  2AAW A;  5AIX A;  4FO5 A;  4BWQ A;  3IE3 A;  3ZVJ A;  1G7O A;  3KEB A;  5F05 A;  5A4U A;  3HY2 A;  2XHF A;  2LJA A;  4LA1 A;  1DBY A;  3H93 A;  3D5J A;  2V32 A;  3AY8 A;  2G0F A;  4IW9 A;  2PER A;  3O76 A;  4USS A;  1SYX A;  3Q19 A;  4ZIJ A;  1GUM A;  1S3C A;  3O6T A;  4F2I A;  2ZCT A;  1K0C A;  5D93 A;  4EO3 A;  4LL4 B;  1GTA A;  2FA8 A;  2YCD A;  1K0O A;  4BVX B;  2PVO C;  1M2A A;  1GLQ A;  4BWS A;  5LD0 A;  1MDJ A;  2DMM A;  3F9U A;  2FY6 A;  2JAC A;  2K8S A;  2HSN B;  16GS A;  5DVB A;  3H8Q A;  1RK4 A;  3IV4 A;  4YAP A;  3IC8 A;  4ZL7 A;  3A2X A;  2C80 A;  1S3A A;  4ECC A;  1UN2 A;  5C00 A;  3MWH A;  1SD9 A;  1A2L A;  4YQU A;  4GQF A;  3H1N A;  5CRH A;  2YNX A;  5A5K A;  1M7T A;  2LTK A;  1JFU A;  1EGR A;  4EKZ A;  1V2A A;  17GS A;  5J5N A;  5KN2 A;  4V2L A;  3LYK A;  1QXH A;  2VCW A;  2CVB A;  3APO A;  1EGO A;  5ECQ B;  3I6A A;  2IN3 A;  3IOS A;  2YPM A;  1NHO A;  3K8N A;  2H71 A;  4MAB A;  1ILO A;  3EVI A;  5LCZ A;  2DBC A;  3IAM 2;  4PGT A;  3L9U A;  3LFL A;  1PQN A;  3EWL A;  4Q5R A;  1XW5 A;  2C0F A;  3FY7 A;  1OKT A;  1GNE A;  5IIZ A;  2IL3 A;  2EC4 A;  4LMV A;  2F8F A;  2BJX A;  1F3B A;  1M99 A;  2GZZ A;  3TOU A;  3IK9 A;  3FZ4 A;  2P31 A;  5DDL A;  3RHC A;  2JSZ A;  1QGV A;  3UVT A;  2DJ2 A;  4KDU A;  2YWN A;  4PQ1 A;  1UVZ A;  2A4V A;  4IP6 A;  2J23 A;  5CRG A;  1TW9 A;  4X1U A;  1SKR B;  1TJD A;  1XOA A;  5ECP B;  3LEF A;  5KEJ A;  2JZT A;  4OFM A;  3E9J B;  2CQ9 A;  1TP9 A;  1VF2 A;  1U88 A;  4DSQ A;  3UBK A;  2LQQ A;  5B6N A;  5ENU A;  1SEN A;  4QL7 A;  4K7I A;  4F9Z A;  3ZZX A;  3IPZ A;  5DJL A;  3JCM L;  4TR3 A;  3QFA C;  2CAI A;  1A24 A;  1BED A;  2DML A;  5HR1 A;  1DE2 A;  4K7N A;  4TN8 A;  5JWO B;  1JLW A;  4F0B A;  2NBS A;  1DSB A;  3PGT A;  5IQY A;  3GSS A;  1X9S B;  5C04 A;  4IQ1 A;  4MH3 A;  1WP0 A;  4YQV A;  4BVY B;  2IPA A;  1O8X A;  1WWJ A;  2O8V B;  3GKK A;  3D4M A;  5HFG A;  5ELG A;  4POM A;  3D22 A;  3TJB A;  4MCU A;  2GVP A;  2FD3 A;  2RUF A;  3M1G A;  4AF2 A;  1G6W A;  2MZC A;  3UEM A;  2GT5 A;  4HUA A;  2B1K A;  2LJR A;  3HXS A; 
#chains in the Genus database with same CATH topology
 3VWW A;  2VCX A;  1FG4 A;  4HS1 A;  5HQP A;  1PL1 A;  3LW9 A;  1VF1 A;  1BG5 A;  2YZU A;  4MPF A;  2VL2 A;  1YF1 A;  5EVO A;  2CVD A;  4OFN A;  1VF3 A;  6GSX A;  5DQS A;  5G30 A;  4OD7 A;  1R4W A;  1YEP A;  3UVH A;  3C8E A;  2LKU A;  1O85 A;  1XBS A;  3FK8 A;  1V98 A;  1GSS A;  2WZ9 A;  4PUR A;  4ZXG A;  2LNT A;  4TR0 A;  4HZ2 A;  2F3M A;  1I5G A;  2PVQ A;  5D73 A;  2GZP A;  4GST A;  1XWK A;  6GST A;  5ECH B;  4WR4 A;  5G31 A;  3CQF A;  2IMI A;  1YEX A;  3BJ5 A;  3EPT A;  5DAK B;  5DAL A;  1PMT A;  2X4A A;  4DEJ A;  2LS5 A;  1BX9 A;  1EOH A;  2CX3 A;  3WT2 A;  2O85 A;  4IQA A;  5H5Q A;  2HZE B;  4AJ7 A;  4XRD A;  4GLT A;  2IJY A;  2H1L A;  4PX1 A;  5CO3 A;  2HRK A;  3V1W A;  3A2V A;  1K3L A;  1WOU A;  2OE3 A;  3CBU A;  4KX4 A;  1THO A;  5G5E A;  2DJJ A;  3BBY A;  4K9Z A;  2H8L A;  3IR4 A;  4N0Z A;  2H0H A;  2X8C A;  1VGL A;  4MJE A;  4GXZ A;  3WYW A;  5D8I A;  5ECI B;  1X5C A;  2OE0 A;  3PH9 A;  4ZBA A;  3F3R A;  1MTC A;  1OC8 A;  4JZQ A;  2XBQ A;  3TDG A;  5INY A;  4HOJ A;  4ACS A;  3WT1 A;  2O87 A;  2CZ2 A;  4YAV A;  4LLR A;  3QAV A;  2IME A;  2YWM A;  4POB A;  1RQM A;  4MZC A;  3HVX A;  4CY8 A;  4HDE A;  1GH2 A;  5JWR B;  5ECL B;  1S3D A;  1PN0 A;  4PXO A;  2JSY A;  3HVV A;  1MDI A;  2GSR A;  1Q4J A;  3CXG A;  1UC7 A;  2I81 A;  5DJM A;  3BOA A;  2H0I A;  1Y6E A;  1FOV A;  2VIM A;  4MLY A;  2VCV A;  2GSS A;  1A0R P;  5CAX A;  2C8U A;  4ML1 A;  1T4Y A;  4WKW A;  4G01 A;  2HYX A;  4KAE A;  1F9M A;  3WGD A;  2L5L A;  2RUE A;  2VLT A;  1SJZ A;  1V57 A;  2L6C A;  3QMX A;  1DE1 A;  3GST A;  2IMF A;  2A2S A;  4EDY A;  2JL4 A;  3W8S A;  3ZML A;  3UOM A;  1PX7 A;  1GL8 A;  2NTO A;  3IK7 A;  3HZ8 A;  3C7M A;  5ECO B;  1XOB A;  2KP2 A;  4K8M A;  4JED A;  2E0Q A;  2EFE A;  1XWC A;  4PUA A;  1TXX A;  4XS4 B;  3G7I A;  3F63 A;  3KTL A;  5JCU A;  1WPI A;  4KF9 A;  3TKR A;  4G9H A;  2MMA A;  2OBK A;  4K7O A;  5GAN D;  4GF0 A;  12GS A;  4TKY A;  1FHE A;  4MZB A;  2DC5 A;  3KGK A;  4AJ8 A;  4F82 A;  3L4N A;  4HJ2 A;  4AKH A;  5GAP D;  1SVL A;  2M46 A;  1KBN A;  2VD1 A;  2WW0 A;  1XCC A;  4NV5 A;  4ZL8 A;  3EMX A;  3CHX C;  4J57 E;  1Z9H A;  5JWQ B;  5AGY A;  2ALB A;  5KOW A;  1G7E A;  4RQR A;  5KN3 A;  1K0B A;  1OC9 B;  3GV1 A;  5ID2 A;  5CP1 A;  1WIK A;  2V1M A;  2YP6 A;  1N8J A;  1TRS A;  4BL7 A;  2X99 A;  3MNG A;  1SVM A;  4OCE A;  3KM6 A;  4EIQ A;  5KOX A;  3P90 A;  4MNN A;  4IJI A;  1WMJ A;  3GTU B;  2F51 A;  3CSI A;  2ZUP A;  4G2E A;  1HNC A;  3TKS E;  3A2W A;  1AQX A;  2H6Z A;  2HSY A;  2B3S A;  3D21 A;  6GSV A;  4K5R A;  3C73 A;  4PTS A;  2H1B A;  4MPG A;  1RW1 A;  3ZVJ D;  3F4S A;  3LXZ A;  1E6B A;  4KSM A;  2WDU A;  22GS A;  2YN1 A;  2B1L A;  3APS A;  4YH2 A;  4JRR A;  3CRU A;  2R6K A;  2P0G A;  3ZMK A;  5IMZ A;  1M0U A;  5D96 A;  3E0U A;  1ZMA A;  2VO4 A;  1GP1 A;  1EEJ A;  3QDN A;  3ZFB A;  1O73 A;  5HR2 A;  3ZRE A;  1SK1 A;  4JE1 A;  1PA3 A;  2H1A A;  5IMD A;  1A23 A;  1ZGN A;  2O5V A;  1JZO A;  3F4R A;  1Z7R A;  2R5G A;  4TRX A;  1GSQ A;  1KNG A;  2CV4 A;  2HI7 A;  4MJC A;  5D9V A;  3NIV A;  1TKD B;  3QCP A;  4IEL A;  4GTU A;  4XCS A;  4RUV A;  3GNJ A;  5J4V A;  4EF0 A;  6GSW A;  1AC1 A;  4MA9 A;  1YKA A;  1OAZ A;  4W66 A;  4DSS B;  5EY6 A;  3MIX A;  3IHG A;  2C3Q A;  1M3I A;  2FWF A;  4EUY A;  3VUR A;  3GFK A;  2HZF A;  5F8B A;  1HNA A;  4TOP A;  2PWJ A;  3DVW A;  4NMU A;  1K0N A;  2FA4 A;  2L5O A;  5A4W A;  2TIR A;  2FLS A;  1J0F A;  5FWG A;  4ZB8 A;  4KCA A;  5J9C A;  3ZIV A;  3ME8 A;  2E2M A;  3M0F A;  4AKG A;  3US3 A;  3M9J A;  3C1R A;  3RDW A;  1K0A A;  2BTO T;  3U5R E;  4K0N A;  1U3I A;  4JBB A;  3UAP A;  3QR6 A;  1SYR A;  10GS A;  1M9A A;  5L71 A;  1H4O A;  3VWU A;  2VKZ G;  1AW9 A;  1WRY A;  2L59 A;  2VM1 A;  1CQG A;  4HU7 A;  1X5E A;  3A3T A;  3F3Q A;  3PIN A;  3QFB C;  2AYT A;  3FRC A;  3GHA A;  2GDR A;  4H86 A;  4PHZ C;  2GST A;  3UIW A;  3F0I A;  5CYY A;  1EEM A;  4JU5 A;  2RLI A;  3D4T A;  2WW1 A;  2KOK A;  3GA4 A;  5J4Y A;  2J9H A;  3QPM A;  5ELA A;  2H01 A;  1PX6 A;  4E68 A;  5AN1 A;  1GWC A;  1Z5Y E;  2C0D A;  4WXT A;  1IYH A;  3LG6 A;  3J7Y b;  4L8E A;  4BIK A;  1M9B A;  1GLP A;  3I9V 2;  3P7X A;  1PRX A;  4TR4 A;  5A5H A;  3GL5 A;  1URM A;  2H6Y A;  3FMW A;  2LQO A;  2H70 A;  2HZE A;  2B5X A;  2CAQ A;  1QQ2 A;  3LJR A;  1ZOF A;  4TR1 A;  4ZIL A;  1BYE A;  3HVN A;  4BA7 A;  3DIE A;  1U3A A;  3CSH A;  3CTF A;  3Q18 A;  2LST A;  5DCG A;  4J2F A;  1AQV A;  5E59 A;  5AIV A;  1G6Y A;  3G7Y A;  3ZYW A;  2AHE A;  1TDI A;  4BPY A;  4ECB A;  1NM3 A;  1GTU A;  4X43 A;  2OKA A;  1QMV A;  2XPE A;  3MDK A;  1GUH A;  1QUW A;  4D73 A;  2XC2 A;  3RPN A;  2IFQ A;  3GX0 A;  1T3B A;  3KD0 A;  5B7C A;  1SJ6 A;  2K9F A;  3F6D A;  3GH6 A;  1Z6N A;  4PI0 C;  1YJ6 A;  3GKM A;  2VL9 A;  4N11 A;  5F06 A;  3EUR A;  1JZW A;  3TU3 B;  2EIQ A;  3VWV A;  4NAX A;  3TKS A;  5FHI A;  2OBI A;  5GZZ B;  2VCT A;  5B6M A;  1XW6 A;  5ECR B;  2YWI A;  3KH7 A;  3UAR A;  4OFT A;  3SWL A;  4V2N A;  3WGE A;  4MDC A;  2DJ0 A;  1YDK A;  2X64 A;  1I9D A;  2R37 A;  3CMI A;  4JR6 A;  4ISD A;  5JCG A;  2FWH A;  2EIO A;  1ZZY A;  2OE1 A;  1TRU A;  2MYG A;  2YJH A;  1TOF A;  1B9X C;  4ZB7 A;  3M8N A;  1R5A A;  5ABR A;  4N3Z A;  5IMC A;  2H0G A;  3F4T A;  4MH2 A;  1XVQ A;  1NW2 A;  3APQ A;  1ERU A;  2BMX A;  1ACV A;  1JHB A;  2VLV A;  3C71 A;  2HE3 A;  1XFL A;  1FB6 A;  1Z3E A;  4QL9 A;  2B7K A;  4MMM A;  2FWE A;  2EFC A;  1O8W A;  1SD8 A;  1HD2 A;  2VOC A;  4I2T A;  4FH8 A;  2WVZ A;  2G2Q A;  2O7K A;  3ZIT A;  4IKH A;  1AUC A;  1GNW A;  2PN8 A;  1T8E B;  4ECI A;  4PUF C;  3TOT A;  3TJJ A;  3HHV A;  3H4K A;  2ES7 A;  4WF5 A;  5B8A A;  1JZR A;  3EC3 A;  3IA1 A;  4GDF A;  5GST A;  1T4Z A;  4JR4 A;  4OCF A;  4POK A;  5HR3 A;  5J47 A;  2H76 A;  1GSE A;  4ILF A;  2QA2 A;  3DWV A;  4GQC A;  2YWO A;  1JZD A;  4TXO A;  2R3X A;  4FYC A;  4HI7 A;  1FVJ A;  4HJM A;  3VK9 A;  5D9X A;  4IHU A;  3DD3 A;  3HKR A;  3QAW A;  2X8G A;  3GKN A;  1X9M B;  1H75 A;  3BCI A;  1S3R A;  1LBK A;  1PFO A;  2WB9 A;  2VL2 C;  4I2U A;  4O7H A;  1QFN A;  3HVS A;  4TVE A;  2IIY A;  3F6F A;  2WGR A;  4K0G A;  5ECK B;  1USB A;  1OC3 A;  3ISO A;  2VAF A;  2VCZ A;  2C1Y A;  2C0G A;  2LV3 A;  2DJ3 A;  2MBS A;  5A34 A;  1E2Y A;  3EU3 A;  1NHY A;  3TKQ A;  4ECJ A;  4KCE A;  2L4C A;  2HSH A;  4ML6 A;  1OE7 A;  3KJY A;  1TRW A;  3ME7 A;  2WW3 A;  3ERG A;  5DQY A;  2YOI A;  2GSQ A;  3BCK A;  3HJP A;  1B48 A;  1XWB A;  4ZBD A;  1XPV A;  2O36 A;  1K0M A;  4I5Q A;  1F2E A;  3NZN A;  2JAD A;  1MD3 A;  4DVC A;  2VM2 A;  3LSZ A;  2DJ1 A;  1M3J A;  4ULX A;  1C72 A;  2V2G A;  1GTI A;  2PUK C;  4IBP A;  1PKZ A;  5A4V A;  1YF0 A;  4FYB A;  2E2G A;  2N5B A;  3LXT A;  2WCI A;  4RQX A;  4CW9 A;  1VF4 A;  3VLN A;  4KW6 A;  4WEY A;  3RAZ A;  5ECM B;  1TRV A;  3CTG A;  4BVX A;  5J3R A;  2C3T A;  3DKS A;  3GH9 A;  1EP8 A;  4L5O A;  4Q5F A;  4F03 A;  2I4A A;  2H72 A;  1O7U A;  3LGC A;  4FYU A;  6GSY A;  1Z6M A;  3UL3 A;  5IM9 A;  2V6K A;  2WZS A;  4IN0 A;  1ZYP A;  2VUP A;  2C0E A;  3HDC A;  2UZ8 A;  4Z2T A;  2HSN A;  3ZLP A;  1TK5 B;  3RPP A;  4HEA 2;  2LRN A;  1XZO A;  3VI5 A;  1A8Y A;  2GTU A;  3Q6O A;  1EV9 A;  4K2X A;  3RHB A;  1U87 A;  1HNB A;  3BD2 A;  4XHM A;  5AIS A;  5DAL B;  2MBT A;  3J7Y k;  2V41 A;  3A5I A;  4MF7 A;  4IS0 A;  2RII A;  1KTE A;  1ML6 A;  4XRA A;  1J08 A;  1EZK A;  5EL8 A;  2YJ7 A;  1XIY A;  2RM5 A;  3IXR A;  3KTB A;  2HRK B;  3W6G A;  4KGI A;  2HT9 A;  1YZX A;  2IMK A;  1GTB A;  3PR8 A;  1V9W A;  2R4V A;  3O3T A;  1OYJ A;  2WJU A;  1G0T A;  1YKC A;  6GSU A;  1ABA A;  3RGB C;  4KND A;  3UBL A;  2HNL A;  2MMO A;  4P3Y B;  2B6M A;  3G7J A;  4K2D A;  3TUE A;  3DXB A;  2QGV A;  1GSF A;  1YVL A;  1TU8 A;  2FNO A;  1Z7P A;  2H1G A;  4XS6 A;  4WET A;  1AAZ A;  4FXY P;  3HZ4 A;  4G0K A;  5BMU B;  3LOR A;  2KLX A;  1F3A A;  2PBJ A;  4HQS A;  3HJM A;  1M2B A;  4A5P A;  3G9B A;  2I3Y A;  2KHP A;  4ZB9 A;  1SKW B;  2GQK A;  5LNK e;  3ERW A;  3IAS 2;  4YKF A;  4EIP A;  1FB0 A;  4QQ7 A;  2ON5 A;  4QMK A;  2X8H A;  4OMV A;  3I69 A;  4IJ3 A;  3R3E A;  2HSM B;  4KA0 A;  1LJR A;  4KH7 A;  4NHZ A;  3VWX A;  2H6X A;  3HMJ G;  3UJ1 A;  1EP7 A;  2LRC A;  3LYP A;  3IHQ A;  2I9H A;  2HRA A;  4IVF A;  4AGS A;  3P2A A;  4K6X A;  3VI7 A;  4TW5 A;  4EE0 A;  1SJI A;  3C1S A;  2TRX A;  19GS A;  1ZL9 A;  2PGT A;  1TTZ A;  2HRN A;  1GRX A;  5A1N A;  3KP8 A;  1A2M A;  1PN9 A;  5CRW A;  5H5S A;  3RBT A;  2L57 A;  1HQO A;  3GUR A;  3EMP A;  2DKI A;  3DGQ A;  2IWT A;  1PSQ A;  3L9V A;  3KXO A;  2M80 A;  2N5F A;  3ERF A;  2JZR A;  4ID0 A;  4I6X A;  5DBQ A;  3UMA A;  5J9B A;  4L5L A;  4Z7X A;  5IOX A;  1O6J A;  2WVX A;  1ERW A;  4F0C A;  3HJO A;  4BVY A;  3M9K A;  3TJK A;  1R5P A;  4V1A p;  3IBH A;  3R2Q A;  1AXD A;  8GSS A;  2FCH A;  2RM6 A;  1FVK A;  1K3O A;  2D2Z A;  1B4P A;  2XPD A;  2EFD A;  1ST9 A;  5IO2 A;  1F37 A;  3GN3 A;  4EDZ A;  4K1F A;  2PMT A;  1QK8 A;  3VFI A;  4NWY A;  2NPB A;  1N25 A;  2Z9S A;  3I43 A;  14GS A;  3W8J A;  5IPG A;  1U6T A;  4WBJ A;  2YV9 A;  1X5D A;  3IC4 A;  2A2R A;  5BRT A;  3F8U A;  4IGJ A;  4YQM A;  5HFI A;  4IP1 A;  3L0H A;  3N9J A;  5ID2 B;  3VPQ A;  3ED3 A;  3U6V A;  2QSI A;  1MD4 A;  1PD2 1;  9GSS A;  1ZYQ B;  4BL7 B;  5CRE A;  1GSU A;  2QC7 A;  2GT6 A;  2F8A A;  3FHK A;  5ECS A;  2DKH A;  2DJK A;  2R0P A;  4PQH A;  2JU5 A;  1XXU A;  2YV7 A;  5D9T A;  4HU9 A;  3CSJ A;  2LNS A;  1FOH A;  5F07 A;  1B8X A;  3DRN A;  4LL1 B;  4Z2R A;  3H79 A;  5GSS A;  4EL1 A;  2EFH A;  5DAK A;  4E8H A;  3IRA A;  3EU4 A;  3EE2 A;  3EYT A;  3TRP A;  1ERV A;  4FIW A;  3DVX A;  2QKE A;  1A0F A;  1GSY A;  4J56 E;  4MZW A;  1V58 A;  1SL1 B;  1YY7 A;  3L78 A;  2B5Y A;  1EOG A;  3ZRD A;  2LRT A;  1XW9 A;  3ZFL A;  2H19 A;  3E3E A;  3HYP A;  1X0R A;  5G1L A;  1JLV A;  1MEK A;  4K5S A;  1TI1 A;  2AUV A;  4OO4 A;  2WUL A;  1W4V A;  2H30 A;  2IMD A;  1ON4 A;  3D6I A;  3HD5 A;  4XS1 A;  2GZY A;  4I97 A;  2FWG A;  3FKF A;  4ZB6 A;  1SK0 A;  2TRC P;  1T7P B;  4NHW A;  2HQT A;  3TGZ A;  3DML A;  2HFD A;  4ZBB A;  1XWG A;  4O5Q A;  3QOU A;  1PKW A;  2MMN A;  5HFK A;  2YZH A;  4PI2 C;  4OO5 A;  5B8B A;  1WE0 A;  1TK0 B;  4NXI A;  4FQU A;  3LWA A;  2B7J A;  2K18 A;  3KMN A;  1ZCP A;  3NOF A;  3KZQ A;  3DYR A;  4EXJ A;  3M3M A;  2R0G A;  11GS A;  1SU9 A;  2OAC A;  3FZ9 A;  2HRF A;  4AKI A;  3FR6 A;  4MP4 A;  6GSS A;  2CT6 A;  3TB2 A;  4Q5N A;  3GMF A;  4WBR D;  1S4B P;  4XIH A;  4DSR A;  1T00 A;  3MSZ A;  2AJQ B;  2DSA A;  1SL0 B;  2PU9 C;  2M72 A;  3ZL5 A;  2WFC A;  3QAG A;  3TRX A;  1ERT A;  1AIU A;  1WJK A;  3A5W A;  2R2J A;  3HCZ A;  3KCM A;  1XWA A;  1K0D A;  4GRF A;  3GIX A;  2VL3 A;  1R26 A;  4HZ4 A;  1N2A A;  1OE8 A;  1Q98 A;  1SKS B;  2DLX A;  3EIN A;  3GL3 A;  4KDY A;  1TXU A;  1BJX A;  2K8V A;  2FHE A;  2GQL A;  1GUL A;  4MJB A;  4OWY A;  5J41 A;  4G0I A;  4XTS A;  4XS4 A;  3TRQ A;  1LU4 A;  2KUC A;  4KUN A;  4CHS A;  2LUS A;  4V1A g;  4V2M A;  5KN1 A;  2GQM A;  5CNW A;  3WGX A;  2FUG 2;  1PGT A;  2I1U A;  2PPT A;  3GYK A;  4HQZ A;  4KE3 A;  2H74 A;  2YAN A;  4O5U A;  1B9Y C;  4AI6 A;  2H66 A;  2L4Q A;  3TKS C;  1CQH A;  7GSS A;  5IMV A;  2CZ3 A;  2OJL A;  5IMF A;  4PNF A;  5JCW A;  4G10 A;  2VD0 A;  1NSW A;  1VRS D;  3CYN A;  4O92 A;  2VLU A;  1ZYE A;  4MK3 A;  5A5H B;  4AJ6 A;  1TK8 B;  1EWX A;  3FZ5 A;  1THX A;  4TR1 B;  4GSS A;  1GUK A;  3VPT A;  5J40 A;  1SVO A;  4WF4 A;  1TU7 A;  2GS3 A;  2P5Q A;  3P8W A;  2HXK A;  1M2D A;  1OC9 A;  2EIR A;  3GRX A;  3HA9 A;  3FYG A;  5G5F A;  1HYU A;  3FR9 A;  3WD6 A;  1KEB A;  1J9B A;  1UA5 A;  3ZIJ A;  1DUG A;  3GTU A;  4MJA A;  3N5O A;  4RI7 A;  3LQ7 A;  2H1D A;  4EC0 A;  2KP1 A;  3FW2 A;  18GS A;  4GSN A;  4D73 B;  2AV4 A;  2IFQ B;  4N30 A;  2H73 A;  2JZS A;  3S9F A;  4KDX A;  2CX4 A;  5H5R A;  2E7P A;  3KIJ A;  1R7H A;  5BMU A;  3TJG A;  1B4Q A;  2DIZ A;  2A4H A;  1BQ7 A;  13GS A;  1IYI A;  4I8B A;  3FEU A;  4X4J A;  1A8L A;  2WRT A;  3KH9 A;  4Z2U A;  5EPF A;  1K3Y A;  3FR3 A;  3TJF A;  5G2Z A;  1Y25 A;  2N5A A;  5FT3 A;  3OR5 A;  1GSD A;  2C3N A;  2GLR A;  3MAK A;  2P5R A;  2HSM A;  3DEX A;  2OAD A;  1PL2 A;  4N0V A;  2LJK A;  5DCH A;  2H75 A;  4O32 A;  5F0G A;  4KSO A;  4N10 A;  2WS2 A;  2NDO A;  3D0Z A;  5G1K A;  5HR0 A;  3GKX A;  1T1V A;  1SL2 B;  4AKX B;  2REM A;  4L0W A;  4G0L A;  4PQI A;  4TXV A;  5E4W A;  2CA8 A;  3IDV A;  4O5R A;  1X9W B;  1A2J A;  4MF6 A;  2MMZ A;  3SBC A;  3CWG A;  3FZA A;  2DIY A;  5IO0 A;  2VCQ A;  4DSS A;  3GX8 A;  5CRD A;  2A2P A;  2CVK A;  4MF5 A;  5IOW A;  2C4J A;  1YQ1 A;  2AB6 A;  2OA7 A;  5IPH A;  4EVM A;  4L0U A;  1F6M C;  1BAY A;  2K6V A;  2XBI A;  3TKP A;  20GS A;  2ON7 A;  1FAA A;  5ECN B;  2X49 A;  1TI3 A;  5D9W A;  2GGT A;  3KP9 A;  2O89 A;  2NVL A;  1AQW A;  2QA1 A;  4CDO A;  3CRT A;  5J4U A;  2L6D A;  4GWR A;  1FW1 A;  4GCI A;  5IMA A;  3Q74 A;  4TXO B;  3PPU A;  3ZTL A;  2B5E A;  4G19 A;  2LEG A;  1OVN A;  1I1I P;  4YKG A;  1O81 A;  3KMO A;  4E8E A;  2F9S A;  1FO5 A;  4KB3 A;  2ZNM A;  3QD9 A;  4NPB A;  4RI6 A;  4POL A;  3GUS A;  1SK2 A;  1MDK A;  4NV2 A;  2V6O A;  1V40 A;  2FGX A;  4ZL9 A;  4LMW A;  1ZYN A;  1W89 A;  4X0X A;  5COH A;  5A34 B;  4Q5Q A;  4HSC X;  1EV4 A;  1XVW A;  3RFR C;  1OKD A;  2HLS A;  5KN0 A;  4CY6 A;  3TCO A;  4PNG A;  4WR5 A;  3L9S A;  2AAW A;  5AIX A;  4FO5 A;  4BWQ A;  3IE3 A;  3ZVJ A;  1G7O A;  3KEB A;  5F05 A;  5A4U A;  3HY2 A;  2XHF A;  2LJA A;  4LA1 A;  1DBY A;  3H93 A;  3D5J A;  2V32 A;  3AY8 A;  2G0F A;  4IW9 A;  2PER A;  3O76 A;  4USS A;  1SYX A;  3Q19 A;  4ZIJ A;  3MYD A;  1GUM A;  1S3C A;  3O6T A;  4F2I A;  2ZCT A;  1K0C A;  1Y1U A;  5D93 A;  4EO3 A;  4LL4 B;  1GTA A;  2FA8 A;  2YCD A;  1K0O A;  4BVX B;  2PVO C;  1M2A A;  1GLQ A;  4BWS A;  1XG8 A;  5LD0 A;  2O3E A;  1MDJ A;  2DMM A;  3F9U A;  2FY6 A;  2JAC A;  2K8S A;  2HSN B;  1BG1 A;  16GS A;  5DVB A;  3H8Q A;  1RK4 A;  3IV4 A;  4YAP A;  3IC8 A;  4ZL7 A;  3A2X A;  2C80 A;  1S3A A;  4ECC A;  1UN2 A;  5C00 A;  3MWH A;  1SD9 A;  1A2L A;  4YQU A;  4GQF A;  3H1N A;  5CRH A;  2YNX A;  5A5K A;  1M7T A;  2OT3 A;  2LTK A;  1JFU A;  1EGR A;  4EKZ A;  1V2A A;  17GS A;  5J5N A;  5KN2 A;  4V2L A;  3LYK A;  1QXH A;  2VCW A;  2CVB A;  3APO A;  1EGO A;  5ECQ B;  3I6A A;  2IN3 A;  3IOS A;  2YPM A;  1NHO A;  3K8N A;  2H71 A;  4MAB A;  1ILO A;  3EVI A;  5LCZ A;  2DBC A;  3IAM 2;  4PGT A;  3L9U A;  3LFL A;  1PQN A;  3EWL A;  4Q5R A;  1XW5 A;  2C0F A;  1BF5 A;  3FY7 A;  1OKT A;  1GNE A;  5IIZ A;  2IL3 A;  2EC4 A;  4LMV A;  2F8F A;  2BJX A;  1F3B A;  1M99 A;  2GZZ A;  3TOU A;  3IK9 A;  3FZ4 A;  2P31 A;  5DDL A;  3RHC A;  2JSZ A;  1QGV A;  2R0C A;  3UVT A;  2DJ2 A;  4KDU A;  2YWN A;  4PQ1 A;  1UVZ A;  2A4V A;  4IP6 A;  2J23 A;  5CRG A;  1TW9 A;  4X1U A;  1YEW C;  1SKR B;  1TJD A;  1XOA A;  5ECP B;  3LEF A;  5KEJ A;  2JZT A;  4OFM A;  3E9J B;  2CQ9 A;  1TP9 A;  1VF2 A;  1U88 A;  4DSQ A;  3UBK A;  2LQQ A;  5B6N A;  5ENU A;  1SEN A;  4QL7 A;  4K7I A;  2WW2 A;  4F9Z A;  3ZZX A;  5A1N B;  3IPZ A;  5DJL A;  3JCM L;  4TR3 A;  3QFA C;  2UV8 G;  2CAI A;  1A24 A;  1BED A;  2DML A;  5HR1 A;  1DE2 A;  4K7N A;  4TN8 A;  5JWO B;  1JLW A;  4F0B A;  2NBS A;  1DSB A;  3PGT A;  5IQY A;  3GSS A;  2WVX B;  1X9S B;  5C04 A;  4IQ1 A;  4ICY A;  4MH3 A;  1WP0 A;  4YQV A;  4BVY B;  2IPA A;  1O8X A;  1WWJ A;  2O8V B;  3GKK A;  3D4M A;  5HFG A;  5ELG A;  4POM A;  3D22 A;  3TJB A;  4MCU A;  2GVP A;  2FD3 A;  2RUF A;  3M1G A;  2WVY A;  4AF2 A;  1G6W A;  2MZC A;  3UEM A;  2GT5 A;  4HUA A;  2B1K A;  2LJR A;  3HXS A; 
#chains in the Genus database with same CATH homology
 3VWW A;  2VCX A;  1FG4 A;  4HS1 A;  5HQP A;  1PL1 A;  3LW9 A;  1VF1 A;  1BG5 A;  2YZU A;  4MPF A;  2VL2 A;  1YF1 A;  5EVO A;  2CVD A;  4OFN A;  1VF3 A;  6GSX A;  5DQS A;  5G30 A;  4OD7 A;  1R4W A;  1YEP A;  3UVH A;  3C8E A;  2LKU A;  1O85 A;  1XBS A;  3FK8 A;  1V98 A;  1GSS A;  2WZ9 A;  4PUR A;  4ZXG A;  2LNT A;  4TR0 A;  4HZ2 A;  2F3M A;  1I5G A;  2PVQ A;  5D73 A;  2GZP A;  4GST A;  1XWK A;  6GST A;  5ECH B;  4WR4 A;  5G31 A;  2IMI A;  1YEX A;  3BJ5 A;  3EPT A;  5DAK B;  5DAL A;  1PMT A;  2X4A A;  4DEJ A;  2LS5 A;  1BX9 A;  1EOH A;  2CX3 A;  3WT2 A;  2O85 A;  4IQA A;  5H5Q A;  2HZE B;  4AJ7 A;  4XRD A;  4GLT A;  2IJY A;  2H1L A;  4PX1 A;  5CO3 A;  2HRK A;  3V1W A;  3A2V A;  1K3L A;  1WOU A;  2OE3 A;  3CBU A;  4KX4 A;  1THO A;  5G5E A;  2DJJ A;  3BBY A;  4K9Z A;  2H8L A;  3IR4 A;  4N0Z A;  2H0H A;  2X8C A;  1VGL A;  4MJE A;  4GXZ A;  3WYW A;  5D8I A;  5ECI B;  1X5C A;  2OE0 A;  3PH9 A;  4ZBA A;  3F3R A;  1MTC A;  1OC8 A;  4JZQ A;  2XBQ A;  3TDG A;  5INY A;  4HOJ A;  4ACS A;  3WT1 A;  2O87 A;  2CZ2 A;  4YAV A;  4LLR A;  3QAV A;  2IME A;  2YWM A;  4POB A;  1RQM A;  4MZC A;  3HVX A;  4CY8 A;  4HDE A;  1GH2 A;  5JWR B;  5ECL B;  1S3D A;  1PN0 A;  4PXO A;  2JSY A;  3HVV A;  1MDI A;  2GSR A;  1Q4J A;  3CXG A;  1UC7 A;  2I81 A;  5DJM A;  3BOA A;  2H0I A;  1Y6E A;  1FOV A;  2VIM A;  4MLY A;  2VCV A;  2GSS A;  1A0R P;  5CAX A;  2C8U A;  4ML1 A;  1T4Y A;  4WKW A;  4G01 A;  2HYX A;  4KAE A;  1F9M A;  3WGD A;  2L5L A;  2RUE A;  2VLT A;  1SJZ A;  1V57 A;  2L6C A;  3QMX A;  1DE1 A;  3GST A;  2IMF A;  2A2S A;  4EDY A;  2JL4 A;  3W8S A;  3ZML A;  3UOM A;  1PX7 A;  1GL8 A;  2NTO A;  3IK7 A;  3HZ8 A;  3C7M A;  5ECO B;  1XOB A;  2KP2 A;  4K8M A;  4JED A;  2E0Q A;  2EFE A;  1XWC A;  4PUA A;  1TXX A;  4XS4 B;  3G7I A;  3F63 A;  3KTL A;  5JCU A;  1WPI A;  4KF9 A;  3TKR A;  4G9H A;  2MMA A;  2OBK A;  4K7O A;  5GAN D;  4GF0 A;  12GS A;  4TKY A;  1FHE A;  4MZB A;  2DC5 A;  3KGK A;  4AJ8 A;  4F82 A;  3L4N A;  4HJ2 A;  4AKH A;  5GAP D;  1SVL A;  2M46 A;  1KBN A;  2VD1 A;  1XCC A;  4NV5 A;  4ZL8 A;  3EMX A;  4J57 E;  1Z9H A;  5JWQ B;  5AGY A;  2ALB A;  5KOW A;  1G7E A;  4RQR A;  5KN3 A;  1K0B A;  1OC9 B;  3GV1 A;  5ID2 A;  5CP1 A;  1WIK A;  2V1M A;  2YP6 A;  1N8J A;  1TRS A;  4BL7 A;  2X99 A;  3MNG A;  1SVM A;  4OCE A;  3KM6 A;  4EIQ A;  5KOX A;  3P90 A;  4MNN A;  4IJI A;  1WMJ A;  3GTU B;  2F51 A;  3CSI A;  2ZUP A;  4G2E A;  1HNC A;  3TKS E;  3A2W A;  1AQX A;  2H6Z A;  2HSY A;  2B3S A;  3D21 A;  6GSV A;  4K5R A;  3C73 A;  4PTS A;  2H1B A;  4MPG A;  1RW1 A;  3ZVJ D;  3F4S A;  3LXZ A;  1E6B A;  4KSM A;  2WDU A;  22GS A;  2YN1 A;  2B1L A;  3APS A;  4YH2 A;  4JRR A;  3CRU A;  2R6K A;  2P0G A;  3ZMK A;  5IMZ A;  1M0U A;  5D96 A;  3E0U A;  1ZMA A;  2VO4 A;  1GP1 A;  1EEJ A;  3QDN A;  3ZFB A;  1O73 A;  5HR2 A;  3ZRE A;  1SK1 A;  4JE1 A;  1PA3 A;  2H1A A;  5IMD A;  1A23 A;  1ZGN A;  2O5V A;  1JZO A;  3F4R A;  1Z7R A;  2R5G A;  4TRX A;  1GSQ A;  1KNG A;  2CV4 A;  2HI7 A;  4MJC A;  5D9V A;  3NIV A;  1TKD B;  3QCP A;  4IEL A;  4GTU A;  4XCS A;  4RUV A;  3GNJ A;  5J4V A;  4EF0 A;  6GSW A;  1AC1 A;  4MA9 A;  1YKA A;  1OAZ A;  4W66 A;  4DSS B;  3MIX A;  5EY6 A;  3IHG A;  2C3Q A;  2FWF A;  4EUY A;  3VUR A;  3GFK A;  2HZF A;  5F8B A;  1HNA A;  4TOP A;  2PWJ A;  3DVW A;  4NMU A;  1K0N A;  2FA4 A;  2L5O A;  5A4W A;  2TIR A;  2FLS A;  1J0F A;  5FWG A;  4ZB8 A;  4KCA A;  5J9C A;  3ZIV A;  3ME8 A;  2E2M A;  3M0F A;  4AKG A;  3US3 A;  3M9J A;  3C1R A;  3RDW A;  1K0A A;  2BTO T;  3U5R E;  4K0N A;  1U3I A;  4JBB A;  3UAP A;  3QR6 A;  1SYR A;  10GS A;  1M9A A;  5L71 A;  1H4O A;  3VWU A;  2VKZ G;  1AW9 A;  1WRY A;  2L59 A;  2VM1 A;  1CQG A;  4HU7 A;  1X5E A;  3A3T A;  3F3Q A;  3PIN A;  3QFB C;  2AYT A;  3FRC A;  3GHA A;  2GDR A;  4H86 A;  2GST A;  3UIW A;  3F0I A;  5CYY A;  1EEM A;  4JU5 A;  2RLI A;  3D4T A;  2KOK A;  3GA4 A;  5J4Y A;  2J9H A;  3QPM A;  5ELA A;  2H01 A;  1PX6 A;  4E68 A;  5AN1 A;  1GWC A;  1Z5Y E;  2C0D A;  4WXT A;  1IYH A;  3LG6 A;  3J7Y b;  4L8E A;  1M9B A;  1GLP A;  3I9V 2;  3P7X A;  1PRX A;  4TR4 A;  5A5H A;  3GL5 A;  1URM A;  2H6Y A;  3FMW A;  2LQO A;  2H70 A;  2HZE A;  2B5X A;  2CAQ A;  1QQ2 A;  3LJR A;  1ZOF A;  4TR1 A;  4ZIL A;  1BYE A;  4BA7 A;  3DIE A;  1U3A A;  3CSH A;  3CTF A;  3Q18 A;  2LST A;  5DCG A;  4J2F A;  1AQV A;  5E59 A;  5AIV A;  1G6Y A;  3G7Y A;  3ZYW A;  2AHE A;  1TDI A;  4BPY A;  4ECB A;  1NM3 A;  1GTU A;  4X43 A;  2OKA A;  1QMV A;  2XPE A;  3MDK A;  1GUH A;  1QUW A;  4D73 A;  2XC2 A;  3RPN A;  2IFQ A;  3GX0 A;  1T3B A;  3KD0 A;  5B7C A;  1SJ6 A;  2K9F A;  3F6D A;  3GH6 A;  1Z6N A;  1YJ6 A;  3GKM A;  2VL9 A;  4N11 A;  5F06 A;  3EUR A;  1JZW A;  3TU3 B;  2EIQ A;  3VWV A;  4NAX A;  3TKS A;  5FHI A;  2OBI A;  5GZZ B;  2VCT A;  5B6M A;  1XW6 A;  5ECR B;  2YWI A;  3KH7 A;  3UAR A;  4OFT A;  3SWL A;  4V2N A;  3WGE A;  4MDC A;  2DJ0 A;  1YDK A;  2X64 A;  1I9D A;  2R37 A;  3CMI A;  4JR6 A;  4ISD A;  5JCG A;  2FWH A;  2EIO A;  1ZZY A;  2OE1 A;  1TRU A;  2MYG A;  2YJH A;  1TOF A;  1B9X C;  4ZB7 A;  3M8N A;  1R5A A;  5ABR A;  4N3Z A;  5IMC A;  2H0G A;  3F4T A;  4MH2 A;  1XVQ A;  1NW2 A;  3APQ A;  1ERU A;  2BMX A;  1ACV A;  1JHB A;  2VLV A;  3C71 A;  2HE3 A;  1XFL A;  1FB6 A;  1Z3E A;  4QL9 A;  2B7K A;  4MMM A;  2FWE A;  2EFC A;  1O8W A;  1SD8 A;  1HD2 A;  2VOC A;  4I2T A;  4FH8 A;  2G2Q A;  2O7K A;  3ZIT A;  4IKH A;  1AUC A;  1GNW A;  2PN8 A;  1T8E B;  4ECI A;  4PUF C;  3TOT A;  3TJJ A;  3HHV A;  3H4K A;  2ES7 A;  4WF5 A;  5B8A A;  1JZR A;  3EC3 A;  3IA1 A;  4GDF A;  5GST A;  1T4Z A;  4JR4 A;  4OCF A;  4POK A;  5HR3 A;  5J47 A;  2H76 A;  1GSE A;  4ILF A;  2QA2 A;  3DWV A;  4GQC A;  2YWO A;  1JZD A;  4TXO A;  2R3X A;  4FYC A;  4HI7 A;  1FVJ A;  4HJM A;  3VK9 A;  5D9X A;  4IHU A;  3DD3 A;  3HKR A;  3QAW A;  2X8G A;  3GKN A;  1X9M B;  1H75 A;  3BCI A;  1LBK A;  2WB9 A;  2VL2 C;  4I2U A;  4O7H A;  1QFN A;  3HVS A;  4TVE A;  2IIY A;  3F6F A;  2WGR A;  4K0G A;  5ECK B;  1USB A;  1OC3 A;  3ISO A;  2VAF A;  2VCZ A;  2C1Y A;  2C0G A;  2LV3 A;  2DJ3 A;  2MBS A;  5A34 A;  1E2Y A;  3EU3 A;  1NHY A;  3TKQ A;  4ECJ A;  4KCE A;  2L4C A;  2HSH A;  4ML6 A;  1OE7 A;  3KJY A;  1TRW A;  3ME7 A;  3ERG A;  5DQY A;  2YOI A;  2GSQ A;  3BCK A;  3HJP A;  1B48 A;  1XWB A;  4ZBD A;  1XPV A;  1K0M A;  4I5Q A;  1F2E A;  3NZN A;  2JAD A;  1MD3 A;  4DVC A;  2VM2 A;  3LSZ A;  2DJ1 A;  4ULX A;  1C72 A;  2V2G A;  1GTI A;  2PUK C;  4IBP A;  1PKZ A;  5A4V A;  1YF0 A;  4FYB A;  2E2G A;  2N5B A;  3LXT A;  2WCI A;  4RQX A;  4CW9 A;  1VF4 A;  3VLN A;  4KW6 A;  4WEY A;  3RAZ A;  5ECM B;  1TRV A;  3CTG A;  4BVX A;  5J3R A;  2C3T A;  3DKS A;  3GH9 A;  1EP8 A;  4L5O A;  4Q5F A;  4F03 A;  2I4A A;  2H72 A;  1O7U A;  3LGC A;  4FYU A;  6GSY A;  1Z6M A;  3UL3 A;  5IM9 A;  2V6K A;  4IN0 A;  1ZYP A;  2VUP A;  2C0E A;  3HDC A;  2UZ8 A;  4Z2T A;  2HSN A;  3ZLP A;  1TK5 B;  3RPP A;  4HEA 2;  2LRN A;  1XZO A;  3VI5 A;  1A8Y A;  2GTU A;  3Q6O A;  1EV9 A;  4K2X A;  3RHB A;  1U87 A;  1HNB A;  3BD2 A;  4XHM A;  5AIS A;  5DAL B;  2MBT A;  3J7Y k;  2V41 A;  3A5I A;  4MF7 A;  4IS0 A;  2RII A;  1KTE A;  1ML6 A;  4XRA A;  1J08 A;  1EZK A;  5EL8 A;  2YJ7 A;  1XIY A;  2RM5 A;  3IXR A;  3KTB A;  2HRK B;  3W6G A;  4KGI A;  2HT9 A;  1YZX A;  2IMK A;  1GTB A;  3PR8 A;  1V9W A;  2R4V A;  3O3T A;  1OYJ A;  2WJU A;  1G0T A;  1YKC A;  6GSU A;  1ABA A;  4KND A;  3UBL A;  2HNL A;  2MMO A;  4P3Y B;  2B6M A;  3G7J A;  4K2D A;  3TUE A;  3DXB A;  2QGV A;  1GSF A;  1YVL A;  1TU8 A;  2FNO A;  1Z7P A;  2H1G A;  4XS6 A;  4WET A;  1AAZ A;  3HZ4 A;  4G0K A;  5BMU B;  3LOR A;  2KLX A;  1F3A A;  2PBJ A;  4HQS A;  3HJM A;  1M2B A;  4A5P A;  3G9B A;  2I3Y A;  2KHP A;  4ZB9 A;  1SKW B;  2GQK A;  5LNK e;  3ERW A;  3IAS 2;  4YKF A;  4EIP A;  1FB0 A;  4QQ7 A;  2ON5 A;  4QMK A;  2X8H A;  4OMV A;  3I69 A;  4IJ3 A;  3R3E A;  2HSM B;  4KA0 A;  1LJR A;  4KH7 A;  4NHZ A;  3VWX A;  2H6X A;  3HMJ G;  3UJ1 A;  1EP7 A;  2LRC A;  3LYP A;  3IHQ A;  2I9H A;  2HRA A;  4IVF A;  4AGS A;  3P2A A;  4K6X A;  3VI7 A;  4TW5 A;  4EE0 A;  1SJI A;  3C1S A;  2TRX A;  19GS A;  1ZL9 A;  2PGT A;  1TTZ A;  2HRN A;  1GRX A;  5A1N A;  3KP8 A;  1A2M A;  1PN9 A;  5CRW A;  5H5S A;  3RBT A;  2L57 A;  1HQO A;  3GUR A;  3EMP A;  2DKI A;  3DGQ A;  2IWT A;  1PSQ A;  3L9V A;  3KXO A;  2M80 A;  2N5F A;  3ERF A;  2JZR A;  4ID0 A;  4I6X A;  5DBQ A;  3UMA A;  5J9B A;  4L5L A;  4Z7X A;  5IOX A;  1O6J A;  1ERW A;  4F0C A;  3HJO A;  4BVY A;  3M9K A;  3TJK A;  1R5P A;  4V1A p;  3IBH A;  3R2Q A;  1AXD A;  8GSS A;  2FCH A;  2RM6 A;  1FVK A;  1K3O A;  2D2Z A;  1B4P A;  2XPD A;  2EFD A;  1ST9 A;  5IO2 A;  1F37 A;  3GN3 A;  4EDZ A;  4K1F A;  2PMT A;  1QK8 A;  3VFI A;  4NWY A;  2NPB A;  1N25 A;  2Z9S A;  3I43 A;  14GS A;  3W8J A;  5IPG A;  1U6T A;  4WBJ A;  2YV9 A;  1X5D A;  3IC4 A;  2A2R A;  5BRT A;  3F8U A;  4IGJ A;  4YQM A;  5HFI A;  4IP1 A;  3L0H A;  3N9J A;  5ID2 B;  3VPQ A;  3ED3 A;  3U6V A;  2QSI A;  1MD4 A;  1PD2 1;  9GSS A;  1ZYQ B;  4BL7 B;  5CRE A;  1GSU A;  2QC7 A;  2GT6 A;  2F8A A;  3FHK A;  5ECS A;  2DKH A;  2DJK A;  2R0P A;  4PQH A;  2JU5 A;  1XXU A;  2YV7 A;  5D9T A;  4HU9 A;  3CSJ A;  2LNS A;  1FOH A;  5F07 A;  1B8X A;  3DRN A;  4LL1 B;  4Z2R A;  3H79 A;  5GSS A;  4EL1 A;  2EFH A;  5DAK A;  4E8H A;  3IRA A;  3EU4 A;  3EE2 A;  3EYT A;  3TRP A;  1ERV A;  4FIW A;  3DVX A;  2QKE A;  1A0F A;  1GSY A;  4J56 E;  4MZW A;  1V58 A;  1SL1 B;  1YY7 A;  3L78 A;  2B5Y A;  1EOG A;  3ZRD A;  2LRT A;  1XW9 A;  3ZFL A;  2H19 A;  3E3E A;  3HYP A;  1X0R A;  5G1L A;  1JLV A;  1MEK A;  4K5S A;  1TI1 A;  2AUV A;  4OO4 A;  2WUL A;  1W4V A;  2H30 A;  2IMD A;  1ON4 A;  3D6I A;  3HD5 A;  4XS1 A;  2GZY A;  4I97 A;  2FWG A;  3FKF A;  4ZB6 A;  1SK0 A;  2TRC P;  1T7P B;  4NHW A;  2HQT A;  3TGZ A;  3DML A;  2HFD A;  4ZBB A;  1XWG A;  4O5Q A;  3QOU A;  1PKW A;  2MMN A;  5HFK A;  2YZH A;  4OO5 A;  5B8B A;  1WE0 A;  1TK0 B;  4NXI A;  4FQU A;  3LWA A;  2B7J A;  2K18 A;  3KMN A;  1ZCP A;  3NOF A;  3KZQ A;  3DYR A;  4EXJ A;  3M3M A;  2R0G A;  11GS A;  1SU9 A;  2OAC A;  3FZ9 A;  2HRF A;  4AKI A;  3FR6 A;  4MP4 A;  6GSS A;  2CT6 A;  3TB2 A;  4Q5N A;  3GMF A;  4WBR D;  4XIH A;  4DSR A;  1T00 A;  3MSZ A;  2AJQ B;  2DSA A;  1SL0 B;  2PU9 C;  2M72 A;  3ZL5 A;  2WFC A;  3QAG A;  3TRX A;  1ERT A;  1AIU A;  1WJK A;  3A5W A;  2R2J A;  3HCZ A;  3KCM A;  1XWA A;  1K0D A;  4GRF A;  3GIX A;  2VL3 A;  1R26 A;  4HZ4 A;  1N2A A;  1OE8 A;  1Q98 A;  1SKS B;  2DLX A;  3EIN A;  3GL3 A;  4KDY A;  1TXU A;  1BJX A;  2K8V A;  2FHE A;  2GQL A;  1GUL A;  4MJB A;  4OWY A;  5J41 A;  4G0I A;  4XTS A;  4XS4 A;  3TRQ A;  1LU4 A;  2KUC A;  4KUN A;  4CHS A;  2LUS A;  4V1A g;  4V2M A;  5KN1 A;  2GQM A;  5CNW A;  3WGX A;  2FUG 2;  1PGT A;  2I1U A;  2PPT A;  3GYK A;  4HQZ A;  4KE3 A;  2H74 A;  2YAN A;  4O5U A;  1B9Y C;  4AI6 A;  2H66 A;  2L4Q A;  3TKS C;  1CQH A;  7GSS A;  5IMV A;  2CZ3 A;  2OJL A;  5IMF A;  4PNF A;  5JCW A;  4G10 A;  2VD0 A;  1NSW A;  1VRS D;  3CYN A;  4O92 A;  2VLU A;  1ZYE A;  4MK3 A;  5A5H B;  4AJ6 A;  1TK8 B;  1EWX A;  3FZ5 A;  1THX A;  4TR1 B;  4GSS A;  1GUK A;  3VPT A;  5J40 A;  1SVO A;  4WF4 A;  1TU7 A;  2GS3 A;  2P5Q A;  3P8W A;  2HXK A;  1M2D A;  1OC9 A;  2EIR A;  3GRX A;  3HA9 A;  3FYG A;  5G5F A;  1HYU A;  3FR9 A;  3WD6 A;  1KEB A;  1J9B A;  1UA5 A;  3ZIJ A;  1DUG A;  3GTU A;  4MJA A;  3N5O A;  4RI7 A;  3LQ7 A;  2H1D A;  4EC0 A;  2KP1 A;  3FW2 A;  18GS A;  4GSN A;  4D73 B;  2AV4 A;  2IFQ B;  4N30 A;  2H73 A;  2JZS A;  3S9F A;  4KDX A;  2CX4 A;  5H5R A;  2E7P A;  3KIJ A;  1R7H A;  5BMU A;  3TJG A;  1B4Q A;  2DIZ A;  2A4H A;  1BQ7 A;  13GS A;  1IYI A;  4I8B A;  3FEU A;  4X4J A;  1A8L A;  2WRT A;  3KH9 A;  4Z2U A;  5EPF A;  1K3Y A;  3FR3 A;  3TJF A;  5G2Z A;  1Y25 A;  2N5A A;  5FT3 A;  3OR5 A;  1GSD A;  2C3N A;  2GLR A;  3MAK A;  2P5R A;  2HSM A;  3DEX A;  2OAD A;  1PL2 A;  4N0V A;  2LJK A;  5DCH A;  2H75 A;  4O32 A;  5F0G A;  4KSO A;  4N10 A;  2WS2 A;  2NDO A;  3D0Z A;  5G1K A;  5HR0 A;  3GKX A;  1T1V A;  1SL2 B;  4AKX B;  2REM A;  4L0W A;  4G0L A;  4PQI A;  4TXV A;  5E4W A;  2CA8 A;  3IDV A;  4O5R A;  1X9W B;  1A2J A;  4MF6 A;  2MMZ A;  3SBC A;  3CWG A;  3FZA A;  2DIY A;  5IO0 A;  2VCQ A;  4DSS A;  3GX8 A;  5CRD A;  2A2P A;  2CVK A;  4MF5 A;  5IOW A;  2C4J A;  1YQ1 A;  2AB6 A;  2OA7 A;  5IPH A;  4EVM A;  4L0U A;  1F6M C;  1BAY A;  2K6V A;  2XBI A;  3TKP A;  20GS A;  2ON7 A;  1FAA A;  5ECN B;  2X49 A;  1TI3 A;  5D9W A;  2GGT A;  3KP9 A;  2O89 A;  2NVL A;  1AQW A;  2QA1 A;  4CDO A;  3CRT A;  5J4U A;  2L6D A;  4GWR A;  1FW1 A;  4GCI A;  5IMA A;  3Q74 A;  4TXO B;  3PPU A;  3ZTL A;  2B5E A;  4G19 A;  2LEG A;  1OVN A;  4YKG A;  1O81 A;  3KMO A;  4E8E A;  2F9S A;  1FO5 A;  4KB3 A;  2ZNM A;  3QD9 A;  4NPB A;  4RI6 A;  4POL A;  3GUS A;  1SK2 A;  1MDK A;  4NV2 A;  2V6O A;  1V40 A;  2FGX A;  4ZL9 A;  4LMW A;  1ZYN A;  1W89 A;  4X0X A;  5COH A;  5A34 B;  4Q5Q A;  1EV4 A;  1XVW A;  1OKD A;  2HLS A;  5KN0 A;  4CY6 A;  3TCO A;  4PNG A;  4WR5 A;  3L9S A;  2AAW A;  5AIX A;  4FO5 A;  4BWQ A;  3IE3 A;  3ZVJ A;  1G7O A;  3KEB A;  5F05 A;  5A4U A;  3HY2 A;  2XHF A;  2LJA A;  4LA1 A;  1DBY A;  3H93 A;  3D5J A;  2V32 A;  3AY8 A;  2G0F A;  4IW9 A;  2PER A;  3O76 A;  4USS A;  1SYX A;  3Q19 A;  4ZIJ A;  3MYD A;  1GUM A;  1S3C A;  3O6T A;  4F2I A;  2ZCT A;  1K0C A;  1Y1U A;  5D93 A;  4EO3 A;  4LL4 B;  1GTA A;  2FA8 A;  2YCD A;  1K0O A;  4BVX B;  2PVO C;  1M2A A;  1GLQ A;  4BWS A;  5LD0 A;  1MDJ A;  2DMM A;  3F9U A;  2FY6 A;  2JAC A;  2K8S A;  2HSN B;  1BG1 A;  16GS A;  5DVB A;  3H8Q A;  1RK4 A;  3IV4 A;  4YAP A;  3IC8 A;  4ZL7 A;  3A2X A;  2C80 A;  1S3A A;  4ECC A;  1UN2 A;  5C00 A;  3MWH A;  1SD9 A;  1A2L A;  4YQU A;  4GQF A;  3H1N A;  5CRH A;  2YNX A;  5A5K A;  1M7T A;  2OT3 A;  2LTK A;  1JFU A;  1EGR A;  4EKZ A;  1V2A A;  17GS A;  5J5N A;  5KN2 A;  4V2L A;  3LYK A;  1QXH A;  2VCW A;  2CVB A;  3APO A;  1EGO A;  5ECQ B;  3I6A A;  2IN3 A;  3IOS A;  2YPM A;  1NHO A;  3K8N A;  2H71 A;  4MAB A;  1ILO A;  3EVI A;  5LCZ A;  2DBC A;  3IAM 2;  4PGT A;  3L9U A;  3LFL A;  1PQN A;  3EWL A;  4Q5R A;  1XW5 A;  2C0F A;  1BF5 A;  3FY7 A;  1OKT A;  1GNE A;  5IIZ A;  2IL3 A;  2EC4 A;  4LMV A;  2F8F A;  2BJX A;  1F3B A;  1M99 A;  2GZZ A;  3TOU A;  3IK9 A;  3FZ4 A;  2P31 A;  5DDL A;  3RHC A;  2JSZ A;  1QGV A;  2R0C A;  3UVT A;  2DJ2 A;  4KDU A;  2YWN A;  4PQ1 A;  1UVZ A;  2A4V A;  4IP6 A;  2J23 A;  5CRG A;  1TW9 A;  4X1U A;  1SKR B;  1TJD A;  1XOA A;  5ECP B;  3LEF A;  5KEJ A;  2JZT A;  4OFM A;  3E9J B;  2CQ9 A;  1TP9 A;  1VF2 A;  1U88 A;  4DSQ A;  3UBK A;  2LQQ A;  5B6N A;  5ENU A;  1SEN A;  4QL7 A;  4K7I A;  4F9Z A;  3ZZX A;  5A1N B;  3IPZ A;  5DJL A;  3JCM L;  4TR3 A;  3QFA C;  2UV8 G;  2CAI A;  1A24 A;  1BED A;  2DML A;  5HR1 A;  1DE2 A;  4K7N A;  4TN8 A;  5JWO B;  1JLW A;  4F0B A;  2NBS A;  1DSB A;  3PGT A;  5IQY A;  3GSS A;  1X9S B;  5C04 A;  4IQ1 A;  4ICY A;  4MH3 A;  1WP0 A;  4YQV A;  4BVY B;  2IPA A;  1O8X A;  1WWJ A;  2O8V B;  3GKK A;  3D4M A;  5HFG A;  5ELG A;  4POM A;  3D22 A;  3TJB A;  4MCU A;  2GVP A;  2FD3 A;  2RUF A;  3M1G A;  4AF2 A;  1G6W A;  2MZC A;  3UEM A;  2GT5 A;  4HUA A;  2B1K A;  2LJR A;  3HXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...