2F8FA

Crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
203
Chain Sequence
b'DHIKVIFFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 28 kDa
publication title Probing the Mechanism of GSH Activation in Schistosoma haematobium Glutathione-S-transferase by Site-directed Mutagenesis and X-ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
molecule tags Transferase
total genus 65
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2f8fA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2f8fA01
4GLTA 4KE3A 4N0VA 1W89A 2VL2A 2D2ZA 3GSTA 2E2GA 4GCIA 2E2MA 3GFKA 4QL7A 2VLVA 1O81A 5DJLA 2I9HA 2X64A 12GSA 3GNJA 1O73A 2M80A 3GV1A 4NMUA 3ME8A 2VOCA 3IAM2 3QD9A 3AY8A 5D96A 4PURA 2H0IA 3TJGA 3E0UA 5F05A 4ZIJA 4G2EA 2HNLA 2DJKA 2F8AA 3TKSE 2GSTA 2LRCA 5KN0A 2I3YA 3Q74A 4YAVA 2XHFA 4O7HA 2YP6A 5ECOB 1ACVA 2H66A 2C3TA 1ML6A 3VURA 1KEBA 4MF7A 2REMA 1TU8A 1VGLA 1GUMA 2IMEA 2HSYA 3VPTA 2HYXA 1B4PA 1EEMA 4PGTA 4WKWA 1A24A 4KSOA 3GKXA 2WJUA 4WBRD 4IBPA 5IMZA 1DBYA 1GUHA 2CX4A 5J9CA 4TR3A 4AJ6A 4HQZA 2VD1A 1BX9A 1M99A 1PL1A 2RUFA 1K0OA 2WGRA 2E7PA 2HT9A 1XWAA 5A4VA 4ZXGA 3I69A 1X5CA 1FAAA 5ECHB 1XIYA 2R6KA 4GQCA 3QFBC 4G0KA 3TJJA 4ZBDA 3H8QA 1OE8A 2IMIA 4Z7XA 3LYPA 2IL3A 1KTEA 5CAXA 4IVFA 1ZGNA 5HR1A 3RHCA 1TK8B 1J9BA 3HZ8A 1GL8A 2B5XA 3GSSA 1PRXA 3LEFA 4EF0A 3EYTA 2AHEA 1NW2A 3ZFBA 3APSA 5INYA 2K8SA 1XWKA 9GSSA 3WYWA 4I2TA 2PU9C 4NXIA 4OMVA 2MMZA 1M9BA 2VCZA 4BPYA 3GTUB 1GWCA 3FW2A 1XOBA 3UEMA 4K9ZA 2HRKB 4NV2A 2IWTA 1WOUA 1X9MB 2OA7A 4ECCA 4AGSA 2H1BA 3HJOA 5FWGA 1TP9A 1MTCA 3CSJA 2LNTA 3VWUA 4V2LA 8GSSA 5AGYA 2RM6A 1SKRB 2AJQB 1XWGA 3BCKA 3QAWA 3DIEA 1SJ6A 5EPFA 1EEJA 6GSUA 5H5RA 1WRYA 2HI7A 3DVXA 5J9BA 2ZCTA 3FRCA 5G5EA 4DEJA 3FZ9A 1OC9A 1A23A 4ML1A 4MDCA 3MDKA 2GLRA 3KXOA 3LSZA 5J5NA 2HSMB 3HVVA 1GNEA 2L5OA 5CRWA 3LG6A 5KN3A 2FWEA 1AQXA 3VWWA 3ZL5A 2GGTA 2DMLA 2P5RA 4WF4A 3M3MA 3US3A 1X9WB 2CQ9A 5IO0A 5D93A 4H86A 3CXGA 4N10A 2H71A 1VF1A 1DUGA 1R4WA 2O8VB 4PNFA 2AYTA 4K0GA 2H76A 3GMFA 1K0AA 5CYYA 1K0NA 6GSWA 4KDXA 5GZZB 2VL3A 2R37A 5DALB 2LNSA 2B5EA 3GRXA 3IRAA 3G9BA 2ZNMA 2WDUA 3ERFA 2ES7A 2B1LA 1EP7A 1TXXA 5B8BA 2H6XA 4MA9A 1GSSA 3CTFA 3W6GA 1XPVA 4L0WA 5IQYA 2VCVA 1YKCA 2IIYA 2GZZA 4MF5A 2XBQA 4RI6A 3ZVJD 18GSA 1T00A 2L59A 2GT6A 4ZILA 1O8XA 1R26A 3RPNA 3IC8A 3TDGA 3QR6A 1F37A 1R7HA 2OJLA 1SKWB 3RHBA 1EV9A 4TXVA 4ZL7A 2XBIA 3ZITA 3KEBA 5D73A 3ZREA 2KUCA 5AIVA 4WXTA 2HZFA 1MDKA 5ECRB 1F9MA 5GSSA 3HKRA 5IPGA 5DALA 5J4UA 1F3AA 3U5RE 2IMDA 4X1UA 4POKA 1GULA 3EE2A 2VL9A 4HZ2A 5DQSA 3QOUA 2AAWA 3MNGA 5ELAA 3TKSC 5BMUA 1GLPA 2H70A 3HZ4A 4TXOB 3KIJA 4FIWA 1A2MA 3D21A 2GSQA 3F63A 2LQOA 1XW9A 1GNWA 1U3IA 2IFQB 1V98A 1TTZA 1XFLA 2IN3A 4IKHA 1SU9A 4FO5A 3HA9A 3QFAC 5F07A 3EC3A 4IELA 5DAKA 2HRNA 3L9VA 2R4VA 2P31A 3DVWA 1ZZYA 3WGXA 5G5FA 1B9XC 1RK4A 1EOHA 1ZOFA 2QGVA 4BA7A 3EMPA 2X8HA 3P2AA 3DXBA 1O85A 5A5KA 3GHAA 1MDIA 4F0BA 1Q98A 2KOKA 16GSA 5DCHA 4NHZA 1XZOA 4JZQA 3PINA 3GA4A 3WT2A 1TU7A 1FG4A 4K7NA 3J7Yk 2XPDA 13GSA 3GH6A 4L0UA 5EVOA 2K8VA 2DIYA 3D4MA 4MCUA 3F8UA 1O8WA 1FVKA 4IJ3A 1GP1A 5ECKB 2C0GA 1T4ZA 1DE2A 2HZEA 1O6JA 1XW6A 3HVSA 4JBBA 5D9TA 2QC7A 2DIZA 2QSIA 3C8EA 3A2VA 4Q5NA 2OACA 2YANA 4JRRA 1THXA 1OC3A 4POBA 2WZ9A 3K8NA 4IJIA 6GSSA 5ID2B 4RUVA 4V1Ap 3TKPA 4J56E 1YEPA 2YV9A 2BJXA 4TR0A 4EKZA 1YF1A 1SL2B 1ERWA 2A4VA 1FHEA 2GVPA 4MJAA 1OAZA 4FYBA 1GSQA 2CT6A 1JFUA 6GSTA 3ZMKA 1WWJA 4V2NA 4XRDA 1A2LA 2VO4A 1T8EB 1TRVA 2VCQA 1O7UA 2N5BA 4MJEA 2GDRA 2VCWA 1TI1A 3GKMA 2DBCA 2HXKA 1UN2A 4KX4A 5G1LA 3MAKA 4FYCA 2HSNB 4WR4A 1SL1B 4G19A 1T1VA 5JWOB 1HD2A 1OKTA 2H75A 3S9FA 2F9SA 3O6TA 5HFGA 2P5QA 3QAVA 4CDOA 1EWXA 4ZB6A 3PR8A 2LRNA 4O92A 3D4TA 1QQ2A 2DC5A 3UJ1A 3ZIJA 5ECMB 3TB2A 1PN9A 4X43A 5ECSA 3NIVA 1OKDA 3UAPA 3CMIA 1SYXA 3G7IA 4QQ7A 2OADA 2H1GA 2H19A 2K18A 2H6ZA 4YQVA 5CO3A 1XOAA 3W8JA 1BEDA 5KEJA 4QL9A 5G30A 2DMMA 3EMXA 3QPMA 2O89A 1JZDA 2RM5A 1SENA 3VWVA 1G6WA 4YQMA 1PKZA 5ECPB 2ZUPA 4J57E 1AUCA 4OWYA 2XC2A 1THOA 1GRXA 2FWHA 2JL4A 1QUWA 1WE0A 3GURA 2OE3A 2I81A 4GWRA 1V9WA 1LBKA 3CTGA 3U6VA 4OO4A 2ALBA 5DJMA 4V2MA 4RI7A 4K7OA 3CRUA 4L5OA 1V57A 3ZYWA 3M1GA 4E8EA 2EIRA 2YNXA 4POLA 3IK7A 1VRSD 2AV4A 1U88A 5DDLA 5AN1A 2DJJA 1MD3A 3ERWA 3GUSA 3BBYA 4TR1B 1FO5A 3UIWA 2L57A 3HDCA 4HJ2A 1WJKA 3HXSA 1K3OA 3PGTA 2ON7A 1WP0A 4F2IA 2I4AA 1XBSA 4JR6A 3D0ZA 4HS1A 2PERA 4JR4A 3P90A 5J41A 1GLQA 2M46A 4F0CA 1TJDA 3I9V2 1RW1A 1N8JA 2OE0A 4XS4B 3SBCA 2NPBA 5IPHA 3ZZXA 4RQXA 4BWQA 1YQ1A 1JZWA 4KF9A 3UOMA 2H1AA 2C1YA 3E9JB 2H01A 1B8XA 3JCML 5IMCA 20GSA 4MK3A 3PPUA 1MDJA 4Q5FA 5CRGA 3GH9A 3QMXA 5AIXA 4DSSB 3GYKA 1GH2A 1A8LA 3QAGA 2IMKA 4TR4A 5KN2A 2WCIA 5ECQB 1W4VA 5KN1A 3WGDA 19GSA 1SYRA 4D73B 3ISOA 3DRNA 1PA3A 2TIRA 3FZ4A 3QDNA 4NV5A 2FHEA 4WR5A 2LTKA 4K8MA 1TK5B 2F3MA 4HQSA 1XWBA 3ZFLA 1NM3A 5H5SA 2GTUA 4BVXB 3IAS2 3EU3A 2B3SA 2JSYA 1A2JA 1GTBA 4V1Ag 1ZYEA 3GL3A 1TRUA 2GSRA 3LORA 1ILOA 2JZSA 3F4TA 3L4NA 4MP4A 5CREA 1BQ7A 1GSFA 1TRWA 1UC7A 3C7MA 3Q6OA 4KH7A 4EE0A 3M8NA 5GAPD 1KNGA 2WULA 3ZVJA 1JHBA 1ZYQB 1XCCA 3GN3A 2R2JA 3LXZA 1A0FA 3R3EA 3F9UA 1AQWA 2DJ2A 5IM9A 2R3XA 4ACSA 1M2BA 4X0XA 3IK9A 2GT5A 1XXUA 4HEA2 1F3BA 4XIHA 4N0ZA 1I5GA 2YWNA 3GTUA 1YF0A 3UVHA 4IN0A 3G7JA 3APQA 3NOFA 1BYEA 1PMTA 2X8GA 3IA1A 2A2RA 2HRKA 2PVOC 4IGJA 5HQPA 3KH9A 2LS5A 3M0FA 1GSUA 5EY6A 1PSQA 3ZTLA 2MYGA 4TKYA 4BVYB 4K7IA 1WIKA 4I8BA 4G9HA 4EO3A 5JCGA 4LLRA 4XRAA 4DSQA 4AJ8A 2FA4A 3UBKA 4CW9A 3R2QA 2X8CA 1Q4JA 3F6FA 3V1WA 4BWSA 2QKEA 5ABRA 2WRTA 3F4SA 2MBTA 1YEXA 1A0RP 3RDWA 2JACA 5JCWA 3HJMA 2HSMA 4KCAA 1CQGA 4YH2A 4HU7A 4G10A 1GUKA 4TVEA 1TOFA 2H0HA 2IJYA 3KGKA 5AISA 2HRAA 4OO5A 3HVXA 4MLYA 3FZAA 2J23A 2VLTA 3LXTA 2P0GA 4KAEA 3FR6A 1TKDB 2GS3A 1V40A 4IP6A 5CRDA 3CSHA 3IC4A 4N30A 4BL7B 2YCDA 3GL5A 2FGXA 4L8EA 2JZRA 2CVBA 2PN8A 2LEGA 5D9XA 4IW9A 4ILFA 1JLVA 2KP1A 3ZRDA 4ISDA 3A2XA 5D9WA 2V1MA 3C1RA 4ML6A 2PGTA 2O7KA 2FNOA 1N2AA 4KNDA 1PX7A 2L4QA 2GSSA 4LA1A 1URMA 3IXRA 3TOTA 4FYUA 3ERGA 2A2SA 1M9AA 4PQ1A 1H4OA 3IR4A 3FK8A 4ZL9A 3EWLA 4DVCA 1SD9A 1SJZA 2YN1A 2JU5A 5A4WA 1UVZA 4KUNA 3DD3A 4FH8A 2KHPA 2CV4A 1TI3A 3TRXA 10GSA 5C04A 3N9JA 1QFNA 4HDEA 4I6XA 2K6VA 3GX0A 2HSHA 1QK8A 2VIMA 3EVIA 1R5AA 1YKAA 1PX6A 2E0QA 2YJ7A 2LSTA 2YJHA 2FA8A 4GTUA 2LJAA 2J9HA 2LV3A 3O3TA 11GSA 1HNBA 4NWYA 2GZPA 3I43A 2AUVA 1X5DA 1QMVA 2WS2A 1AIUA 1SKSB 2EIQA 2GZYA 2C0EA 3LFLA 3L78A 1FB0A 4OD7A 4MZWA 4ECIA 1QXHA 3TKSA 4USSA 3MWHA 3H93A 3F4RA 1GTAA 4TXOA 2ON5A 2H30A 2OE1A 2YWOA 5E4WA 1F2EA 4MZCA 2NBSA 3P8WA 4ZBAA 2IFQA 4PUFC 3FR3A 4YAPA 4GQFA 4RQRA 1GTIA 3WGEA 2VM1A 2KLXA 4LL4B 3KD0A 1YDKA 1AW9A 5JCUA 3C73A 1QGVA 4K0NA 1Z5YE 4OFTA 1OYJA 1Z3EA 5F0GA 1S3AA 2TRXA 1XWCA 2LJKA 1S3DA 2FY6A 3KP8A 1GSDA 5IO2A 2V32A 2R5GA 1K3YA 3GKNA 3D5JA 3LYKA 1NSWA 1Y25A 1PQNA 3RPPA 2C3QA 1YJ6A 1T4YA 2L5LA 3TRPA 4KW6A 2LKUA 3IBHA 3IOSA 4TW5A 3L9UA 1RQMA 2O85A 4EDZA 4MH3A 3KP9A 4EC0A 5DCGA 3DMLA 4OFMA 1XW5A 1ON4A 3BCIA 2K9FA 1M2DA 2HE3A 2C8UA 1EGOA 2FUG2 3WT1A 5A4UA 1LJRA 4F03A 2TRCP 2CVDA 2MMNA 5IOWA 1E2YA 3HY2A 1B9YC 2LJRA 2V6KA 1ERTA 1J0FA 2H0GA 5DQYA 3DKSA 2YZHA 4EVMA 1FOVA 2LRTA 4KGIA 3RBTA 1IYHA 2IPAA 5ID2A 2C0DA 5HFIA 5GSTA 1B48A 3IPZA 1EOGA 2YV7A 5IOXA 1TRSA 2C4JA 4ULXA 3ZMLA 3VLNA 1ABAA 4KB3A 2YPMA 1J08A 3GIXA 2N5FA 4ZB9A 1PD21 2V41A 1MD4A 1NHYA 4XTSA 3W8SA 5CRHA 3E3EA 5ECNB 2EIOA 4LMVA 4TN8A 1C72A 1TK0B 3F3RA 1EV4A 3FKFA 1Z6NA 3WD6A 5C00A 2G0FA 4MJBA 4MH2A 3OR5A 4JEDA 4WEYA 3H4KA 4ECJA 2N5AA 3TJFA 1ZL9A 4POMA 1Y6EA 4HU9A 4DSRA 1AAZA 3KJYA 4EDYA 2XPEA 5ECIB 4F9ZA 1OC8A 3VPQA 2M72A 5G2ZA 2VAFA 3HD5A 1DSBA 2VD0A 1BG5A 4IQ1A 1V2AA 2B6MA 3EU4A 1JZOA 1E6BA 4PQIA 3PH9A 1AQVA 1FB6A 3QCPA 4F82A 2MBSA 1M2AA 2CAIA 3DEXA 1JZRA 2HRFA 1GSEA 1KBNA 3UL3A 3GX8A 2GQKA 3IHQA 2VCTA 4HZ4A 5D8IA 7GSSA 2PMTA 1WMJA 4YQUA 2F51A 2WFCA 2VLUA 5F06A 4XS6A 2LUSA 3TJKA 1G7EA 3FEUA 1K0BA 4HJMA 5HR0A 1USBA 2HLSA 3GKKA 4JU5A 2H72A 3P7XA 4I2UA 5LD0A 3HJPA 5COHA 3CBUA 1G7OA 1T7PB 1VF4A 1MEKA 2O87A 22GSA 2I1UA 1OC9B 1OE7A 3DGQA 2BMXA 3KMNA 2H8LA 2IMFA 3H1NA 2FWFA 4KA0A 5IMAA 4TR1A 2X99A 4ID0A 5FT3A 5CNWA 4KSMA 4OFNA 2NTOA 1U6TA 3SWLA 4PUAA 3H79A 3HYPA 2FD3A 2PPTA 4WBJA 4ECBA 1EGRA 2JADA 2RLIA 3D6IA 2VUPA 3TJBA 1B4QA 3UMAA 5JWQB 2FWGA 1TDIA 5IMDA 4GF0A 2VCXA 4MPFA 1ERVA 1X5EA 4NPBA 4XS4A 4TOPA 2H6YA 3KH7A 4PX1A 5LCZA 5B8AA 4XS1A 5DVBA 2C3NA 2OKAA 2MZCA 4WF5A 2PUKC 1PL2A 3FZ5A 2PWJA 5G31A 3EINA 2HQTA 3TOUA 3KTBA 2CZ3A 3EURA 4IS0A 4DSSA 6GSXA 3RAZA 3VI5A 4KDUA 4IHUA 4D73A 5ECLB 4GSNA 3UBLA 4KCEA 2RUEA 3IE3A 3CYNA 2FLSA 1SL0B 1X0RA 2AB6A 2C80A 5ELGA 2WB9A 2UZ8A 1EP8A 1SK0A 4BVXA 1R5PA 2FCHA 4GSSA 1G6YA 3CSIA 5FHIA 1X9SB 5LNKe 3TRQA 2JZTA 2MMAA 1AXDA 4PNGA 1U3AA 2CA8A 3IDVA 4OCFA 4MMMA 1K3LA 5EL8A 4KDYA 3APOA 5IMVA 1T3BA 3BD2A 5CP1A 4CHSA 3FYGA 4MJCA 4O5RA 3UVTA 3VFIA 1K0MA 2L6CA 5B6MA 1U87A 4MF6A 3MSZA 1ERUA 4LMWA 4HI7A 3C1SA 5B6NA 4GXZA 4MZBA 1I9DA 3VK9A 1HNCA 5HR3A 2LQQA 1GSYA 5HFKA 4IQAA 1GTUA 3LJRA 3KZQA 3VWXA 4EUYA 1FVJA 1SJIA 4EL1A 1CQHA 4Q5RA 3D22A 2YWMA 1HQOA 3F6DA 3DWVA 3M9JA 5E59A 1S3CA 3KTLA 3TCOA 4G0LA 2CZ2A 4BVYA 3A5WA 5J3RA 3N5OA 2B1KA 5DAKB 4IP1A 3Q18A 5GAND 4I5QA 3ED3A 2B5YA 3TGZA 3TUEA 1BJXA 3A2WA 4I97A 4EXJA 1H75A 4P3YB 4WETA 4MPGA 2BTOT 3ZLPA 2H1DA 5HR2A 3FR9A 4K2DA 3Q19A 1WPIA 3KMOA 1Z7PA 4PXOA 2NVLA 2YOIA 2F8FA 3LWAA 3F0IA 4AJ7A 1IYIA 1VF2A 1UA5A 14GSA 1G0TA 4PQHA 2B7KA 3ZIVA 3ME7A 3F3QA 1OVNA 3CRTA 2V2GA 1EZKA 4K1FA 3DYRA 1Z6MA 1M7TA 1NHOA 2HZEB 4BL7A 1Z7RA 1AC1A 3I6AA 1ST9A 17GSA 1F6MC 2GQLA 5ENUA 4HOJA 3LGCA 1Z9HA 4G0IA 4HUAA 4L5LA 4K6XA 3C71A 4E8HA 1HNAA 1FW1A 2Z9SA 2GQMA 5DBQA 3L0HA 3TKRA 4AF2A 2EC4A 2DJ1A 1LU4A 3FY7A 3FHKA 1M0UA 1ZMAA 1YY7A 4FQUA 3A3TA 2HFDA 2CVKA 2YZUA 2KP2A 2H74A 2PBJA 4O32A 2L6DA 1K0CA 4NHWA 5D9VA 4PTSA 3VI7A 2OBKA 2OBIA 1PGTA 3J7Yb 1SK2A 4N11A 1A8YA 4XCSA 3HHVA 1JLWA 2H73A 1HYUA 3TKQA 1DE1A 4LL1B 1BAYA 2DLXA 3KCMA 4OCEA 2MMOA 5G1KA 2VL2C 1K0DA 5IIZA 3BJ5A 2L4CA 4ZB8A 1V58A 2CX3A 2DJ3A 1SK1A 4J2FA 3LQ7A 6GSVA 1XVQA 6GSYA 2JSZA 3UARA 3BOAA 3L9SA 2V6OA 5F8BA 5IMFA 5B7CA 4ZBBA 2C0FA 4GSTA 4Q5QA 3NZNA 1VF3A 4JE1A 2NDOA 2RIIA 2YWIA 5L71A 2VM2A 1XVWA 4NAXA 1YZXA 3M9KA 3KM6A 2DSAA 2DJ0A 3O76A 1SD8A 3IV4A 5JWRB 1TW9A 2PVQA 4ZL8A 4MABA 3G7YA 3HCZA 2G2QA 1PKWA 2B7JA 4TRXA 2CAQA 4GRFA 5H5QA 4XHMA 1ZCPA
chains in the Genus database with same CATH superfamily
4GLTA 4KE3A 4N0VA 3HVNA 1W89A 2VL2A 2D2ZA 3GSTA 2E2GA 4GCIA 2E2MA 3GFKA 4QMKA 4QL7A 2VLVA 1O81A 5DJLA 2I9HA 2X64A 12GSA 2OT3A 3GNJA 1O73A 2M80A 3GV1A 4NMUA 3ME8A 2VOCA 3IAM2 3QD9A 3AY8A 5D96A 4PURA 2H0IA 3TJGA 3E0UA 5F05A 4ZIJA 4G2EA 2HNLA 2DJKA 2DKHA 2F8AA 3TKSE 2GSTA 2LRCA 5KN0A 2I3YA 3Q74A 4YAVA 2EFDA 2XHFA 4O7HA 2YP6A 5ECOB 1ACVA 2H66A 2C3TA 1ML6A 3VURA 1KEBA 4MF7A 2REMA 1TU8A 1VGLA 1GUMA 2IMEA 2HSYA 3VPTA 2H1LA 2HYXA 1B4PA 1EEMA 4PGTA 4WKWA 1A24A 4KSOA 3GKXA 2WJUA 4WBRD 4IBPA 5IMZA 1DBYA 1GUHA 2CX4A 5J9CA 4TR3A 4AJ6A 4HQZA 2VD1A 1BX9A 1XG8A 1M99A 1PL1A 2RUFA 1K0OA 2WGRA 2E7PA 2HT9A 1XWAA 5A4VA 4ZXGA 3I69A 1X5CA 2WW0A 1FAAA 5ECHB 1XIYA 2R6KA 4GQCA 3QFBC 4G0KA 4K2XA 3TJJA 4ZBDA 3H8QA 1OE8A 2IMIA 4Z7XA 3LYPA 2IL3A 4AKXB 1KTEA 5CAXA 4IVFA 1ZGNA 3HMJG 5HR1A 3RHCA 1TK8B 1J9BA 3HZ8A 1GL8A 2B5XA 3GSSA 1PRXA 3LEFA 4EF0A 3EYTA 2AHEA 1NW2A 1PN0A 3ZFBA 3APSA 5INYA 2K8SA 1XWKA 9GSSA 3WYWA 4I2TA 2PU9C 4NXIA 4OMVA 2MMZA 1M9BA 2VCZA 4BPYA 3GTUB 1GWCA 3FW2A 1XOBA 3UEMA 4K9ZA 2HRKB 4NV2A 2IWTA 1WOUA 1X9MB 2OA7A 4ECCA 4AGSA 2H1BA 3HJOA 5FWGA 1TP9A 1MTCA 3CSJA 2LNTA 3VWUA 4V2LA 8GSSA 4CY8A 5AGYA 2RM6A 1SKRB 2AJQB 1XWGA 3BCKA 3QAWA 3DIEA 1SJ6A 5EPFA 1EEJA 6GSUA 5H5RA 1WRYA 2HI7A 3DVXA 5J9BA 2ZCTA 3FRCA 5G5EA 4DEJA 3FZ9A 1OC9A 1A23A 4ML1A 4MDCA 3MDKA 2GLRA 3KXOA 3LSZA 5J5NA 2HSMB 3HVVA 1GNEA 1SVOA 2L5OA 5CRWA 3LG6A 5KN3A 2FWEA 1AQXA 4ZB7A 3VWWA 3ZL5A 2GGTA 2DMLA 2P5RA 4WF4A 3M3MA 3US3A 3TU3B 1X9WB 2CQ9A 5IO0A 5D93A 4H86A 3CXGA 4N10A 2H71A 1VF1A 1DUGA 1R4WA 2O8VB 4PNFA 2AYTA 4K0GA 2H76A 3GMFA 1K0AA 5CYYA 1K0NA 1S3RA 6GSWA 4KDXA 5GZZB 2VL3A 2R37A 3LW9A 5DALB 2LNSA 2B5EA 3GRXA 3IRAA 3G9BA 2ZNMA 2WDUA 3ERFA 2ES7A 2B1LA 1EP7A 1TXXA 5B8BA 2H6XA 4MA9A 1GSSA 3CTFA 3W6GA 1XPVA 4L0WA 5IQYA 2VCVA 1YKCA 2IIYA 2GZZA 4MF5A 3CHXC 2XBQA 4RI6A 3ZVJD 2VKZG 18GSA 1T00A 2L59A 2GT6A 4ZILA 1O8XA 1R26A 3RPNA 3IC8A 3TDGA 3QR6A 1F37A 1R7HA 2OJLA 1SKWB 3RHBA 1EV9A 4TXVA 4ZL7A 2XBIA 3ZITA 3KEBA 5D73A 3ZREA 2KUCA 5AIVA 4WXTA 2HZFA 1MDKA 5ECRB 4ICYA 1F9MA 5GSSA 3HKRA 5IPGA 5DALA 5J4UA 1F3AA 3U5RE 4K5SA 2IMDA 4X1UA 4POKA 1GULA 3EE2A 2VL9A 4HZ2A 5DQSA 3QOUA 2AAWA 3MNGA 5ELAA 3TKSC 5BMUA 1GLPA 2H70A 3HZ4A 4TXOB 3KIJA 4FIWA 1A2MA 3D21A 2GSQA 1ZYNA 2QA2A 3F63A 2LQOA 1XW9A 1GNWA 1U3IA 2IFQB 1V98A 1TTZA 1XFLA 2IN3A 4IKHA 1SU9A 4FO5A 3HA9A 3QFAC 5F07A 3EC3A 4IELA 5DAKA 2HRNA 3L9VA 2R4VA 2P31A 4G01A 3DVWA 1ZZYA 2A2PA 3WGXA 5G5FA 1B9XC 1RK4A 1EOHA 1ZOFA 2QGVA 4BA7A 3EMPA 2X8HA 3P2AA 3DXBA 1O85A 5A5KA 3GHAA 1MDIA 4F0BA 1Q98A 2KOKA 16GSA 5DCHA 4NHZA 1XZOA 4JZQA 3PINA 3GA4A 3WT2A 3MIXA 1TU7A 1FG4A 4K7NA 3J7Yk 2XPDA 13GSA 3GH6A 4L0UA 5EVOA 2K8VA 2DIYA 3D4MA 4MCUA 3F8UA 1O8WA 1FVKA 4IJ3A 4A5PA 1GP1A 5ECKB 2C0GA 1T4ZA 2R0CA 1DE2A 1SVLA 2HZEA 4YKGA 2EFHA 1O6JA 1XW6A 3HVSA 4JBBA 4FXYP 5D9TA 2QC7A 2DIZA 2QSIA 3C8EA 3A2VA 4Q5NA 2OACA 2YANA 4CY6A 4JRRA 1THXA 1OC3A 4POBA 2WZ9A 3K8NA 4IJIA 6GSSA 5ID2B 4RUVA 4V1Ap 3TKPA 4J56E 1YEPA 3MYDA 2YV9A 2BJXA 4TR0A 1ZYPA 4EKZA 1YF1A 1SL2B 1ERWA 2A4VA 1FHEA 2GVPA 2WZSA 4MJAA 1OAZA 4FYBA 1GSQA 2CT6A 1JFUA 6GSTA 3ZMKA 1WWJA 4V2NA 4XRDA 1A2LA 2VO4A 1T8EB 1TRVA 2VCQA 1O7UA 2N5BA 4MJEA 2GDRA 2VCWA 1TI1A 3GKMA 2DBCA 4YKFA 2HXKA 1UN2A 4KX4A 5G1LA 3MAKA 4FYCA 2HSNB 4WR4A 1SL1B 4G19A 1T1VA 5JWOB 1HD2A 1OKTA 2H75A 5A34B 3S9FA 2F9SA 3O6TA 5HFGA 2P5QA 2WVYA 3QAVA 4CDOA 1EWXA 4ZB6A 3PR8A 2LRNA 4PI0C 4O92A 3D4TA 1QQ2A 2DC5A 3UJ1A 3ZIJA 5ECMB 3TB2A 2O36A 1PN9A 4HSCX 4X43A 5ECSA 3NIVA 1OKDA 3UAPA 3FMWA 3CMIA 1SYXA 3G7IA 4QQ7A 2OADA 2H1GA 2H19A 2K18A 2H6ZA 4YQVA 5CO3A 1XOAA 3W8JA 1BEDA 5KEJA 4QL9A 5G30A 2DMMA 3EMXA 3QPMA 2O89A 1JZDA 2RM5A 1SENA 3VWVA 1G6WA 4YQMA 1PKZA 5ECPB 2ZUPA 4J57E 1AUCA 2EFCA 2XC2A 4OWYA 1THOA 1GRXA 2FWHA 2JL4A 1QUWA 1WE0A 3GURA 2OE3A 2I81A 4GWRA 1V9WA 1LBKA 3RFRC 3CTGA 3U6VA 4OO4A 2ALBA 5DJMA 4V2MA 4EIPA 3IHGA 4RI7A 4K7OA 2EFEA 3CRUA 4L5OA 1V57A 3ZYWA 3M1GA 4E8EA 2EIRA 2YNXA 4POLA 3IK7A 1VRSD 2AV4A 1U88A 5DDLA 5AN1A 2DJJA 1MD3A 3ERWA 3GUSA 3BBYA 4TR1B 1FO5A 3UIWA 2L57A 3HDCA 4HJ2A 1WJKA 3HXSA 1FOHA 4X4JA 1K3OA 4AKHA 3PGTA 2ON7A 1WP0A 4F2IA 2I4AA 1XBSA 3D0ZA 4JR6A 4HS1A 2PERA 4JR4A 3P90A 5J41A 1GLQA 2M46A 4F0CA 1TJDA 3I9V2 1RW1A 1N8JA 2OE0A 4XS4B 3SBCA 2NPBA 5IPHA 3ZZXA 4RQXA 4BWQA 1YQ1A 1JZWA 4KF9A 3UOMA 2H1AA 2C1YA 3E9JB 4AI6A 2H01A 1B8XA 3JCML 5IMCA 20GSA 4MK3A 3PPUA 1MDJA 4Q5FA 5CRGA 3GH9A 3QMXA 5AIXA 4DSSB 3GYKA 1GH2A 1A8LA 1M3JA 3QAGA 2IMKA 4TR4A 5KN2A 2WCIA 5ECQB 1W4VA 5KN1A 3WGDA 19GSA 1SYRA 4D73B 3ISOA 3DRNA 1PA3A 2TIRA 3FZ4A 3QDNA 4NV5A 2FHEA 4PI2C 4WR5A 2LTKA 4K8MA 1TK5B 2F3MA 4HQSA 1XWBA 3ZFLA 1NM3A 5H5SA 2GTUA 4BVXB 3IAS2 3EU3A 2B3SA 2JSYA 1A2JA 1GTBA 4V1Ag 1ZYEA 3GL3A 1TRUA 2GSRA 3LORA 1ILOA 2JZSA 3F4TA 3L4NA 4MP4A 5CREA 1BQ7A 1GSFA 1TRWA 1UC7A 3C7MA 3Q6OA 4KH7A 4EE0A 3M8NA 5GAPD 1KNGA 2WULA 3ZVJA 1JHBA 1ZYQB 1XCCA 3GN3A 2R2JA 3LXZA 1A0FA 3R3EA 3F9UA 1AQWA 2DJ2A 2R0GA 5IM9A 2R3XA 4ACSA 1M2BA 4X0XA 3IK9A 2GT5A 2WVXB 1XXUA 4HEA2 1F3BA 4XIHA 4N0ZA 1I5GA 1YEWC 2YWNA 3GTUA 1YF0A 3UVHA 4IN0A 3G7JA 3APQA 3NOFA 1BYEA 1PMTA 2X8GA 1SVMA 3IA1A 2A2RA 2HRKA 2PVOC 4IGJA 5HQPA 3KH9A 2LS5A 3M0FA 1GSUA 5EY6A 1PSQA 3ZTLA 2MYGA 4TKYA 4BVYB 4K7IA 1WIKA 4I8BA 4G9HA 4EO3A 5JCGA 1Y1UA 4LLRA 4XRAA 4DSQA 4AJ8A 2FA4A 3UBKA 4CW9A 3R2QA 2X8CA 1Q4JA 3F6FA 3V1WA 4BWSA 2QKEA 5ABRA 2WRTA 3F4SA 2MBTA 1YEXA 1A0RP 3RDWA 2JACA 5JCWA 3HJMA 2HSMA 4KCAA 1CQGA 4YH2A 4HU7A 4G10A 1GUKA 4TVEA 1TOFA 2H0HA 2IJYA 3KGKA 5AISA 2O3EA 2HRAA 4OO5A 3HVXA 4MLYA 3FZAA 2J23A 2VLTA 3LXTA 2P0GA 4KAEA 3FR6A 1TKDB 2GS3A 1V40A 4IP6A 5CRDA 3CSHA 3IC4A 4N30A 4BL7B 2YCDA 3GL5A 2FGXA 4L8EA 2JZRA 2CVBA 2PN8A 2DKIA 2LEGA 5D9XA 4IW9A 4ILFA 1JLVA 2KP1A 3ZRDA 4ISDA 3A2XA 5D9WA 2V1MA 3C1RA 4ML6A 2R0PA 2PGTA 2O7KA 2FNOA 1N2AA 4KNDA 1PX7A 2L4QA 2GSSA 4LA1A 1URMA 3IXRA 3TOTA 4FYUA 3ERGA 2A2SA 1M9AA 4PQ1A 1H4OA 3IR4A 3FK8A 4ZL9A 3EWLA 4DVCA 1SD9A 1SJZA 2YN1A 2JU5A 5A4WA 1UVZA 4KUNA 3DD3A 4FH8A 2KHPA 2CV4A 1TI3A 3TRXA 10GSA 5C04A 3N9JA 1QFNA 4Z2RA 5A5HB 4HDEA 4I6XA 2K6VA 3GX0A 2HSHA 1QK8A 2VIMA 3EVIA 1R5AA 1YKAA 1PX6A 2E0QA 2YJ7A 2LSTA 2YJHA 2FA8A 4GTUA 2LJAA 2J9HA 2LV3A 3O3TA 11GSA 1HNBA 4NWYA 2GZPA 3I43A 2AUVA 5J4YA 1X5DA 1QMVA 2WS2A 1AIUA 1SKSB 2EIQA 2GZYA 2C0EA 5A1NB 3LFLA 3L78A 1FB0A 4OD7A 4MZWA 4ECIA 1QXHA 3TKSA 4USSA 3MWHA 3H93A 3F4RA 1GTAA 4TXOA 1N25A 1S4BP 2ON5A 2H30A 2OE1A 2YWOA 5E4WA 1F2EA 4W66A 4MZCA 2NBSA 3P8WA 4ZBAA 2IFQA 4PUFC 3FR3A 2X4AA 4YAPA 4GDFA 4GQFA 4RQRA 1GTIA 3WGEA 2VM1A 2KLXA 4LL4B 3KD0A 1YDKA 1AW9A 5JCUA 3C73A 1QGVA 4K0NA 1Z5YE 4OFTA 1OYJA 1Z3EA 5F0GA 1S3AA 2TRXA 1XWCA 2LJKA 1S3DA 2FY6A 3KP8A 1GSDA 5IO2A 2V32A 4MNNA 2R5GA 1K3YA 3GKNA 3D5JA 3LYKA 1NSWA 1Y25A 1PQNA 3RPPA 2C3QA 1YJ6A 1T4YA 2L5LA 3TRPA 4KW6A 2LKUA 3IBHA 3IOSA 4TW5A 3L9UA 1RQMA 2O85A 4O5UA 4EDZA 4MH3A 3KP9A 4EC0A 5DCGA 3DMLA 4OFMA 1XW5A 5KOXA 1ON4A 3BCIA 2K9FA 1M2DA 2HE3A 2C8UA 1EGOA 2FUG2 3WT1A 5A4UA 1LJRA 4F03A 2TRCP 2CVDA 2MMNA 5IOWA 1E2YA 3HY2A 1B9YC 2LJRA 2V6KA 1ERTA 1J0FA 2H0GA 5DQYA 3DKSA 2YZHA 4EVMA 1FOVA 2LRTA 4KGIA 3RBTA 1IYHA 2IPAA 5ID2A 2C0DA 5HFIA 5GSTA 1B48A 3IPZA 1EOGA 2YV7A 5IOXA 1TRSA 2C4JA 4ULXA 3CWGA 3ZMLA 3VLNA 1ABAA 4KB3A 2YPMA 1J08A 3GIXA 2N5FA 4ZB9A 1PD21 2V41A 1MD4A 1NHYA 4XTSA 3W8SA 5CRHA 3E3EA 5ECNB 2EIOA 4LMVA 4TN8A 1C72A 1TK0B 3F3RA 1EV4A 5J40A 3FKFA 1Z6NA 3WD6A 5C00A 2G0FA 4MJBA 4MH2A 3OR5A 4JEDA 4WEYA 3H4KA 5BRTA 2HSNA 4ECJA 5A34A 2N5AA 3TJFA 1ZL9A 4POMA 1Y6EA 4HU9A 4DSRA 1AAZA 3KJYA 4EDYA 2XPEA 5ECIB 4F9ZA 1OC8A 3VPQA 2M72A 5G2ZA 2VAFA 3HD5A 1DSBA 2VD0A 4AKGA 1BG5A 4IQ1A 1V2AA 2B6MA 3EU4A 1JZOA 1E6BA 4PQIA 3PH9A 1AQVA 1FB6A 3QCPA 4F82A 2MBSA 1M2AA 2CAIA 1BF5A 3DEXA 1JZRA 2HRFA 1GSEA 1KBNA 4Z2TA 3UL3A 3GX8A 2GQKA 3IHQA 5KOWA 2VCTA 4HZ4A 5D8IA 7GSSA 2PMTA 1WMJA 4YQUA 2F51A 2WFCA 2VLUA 5F06A 4XS6A 2LUSA 3TJKA 1G7EA 3FEUA 1K0BA 4HJMA 5HR0A 1USBA 2HLSA 3GKKA 1BG1A 4JU5A 2H72A 3P7XA 4I2UA 5LD0A 3HJPA 5COHA 3CBUA 1G7OA 1T7PB 1VF4A 1MEKA 2O87A 22GSA 2I1UA 1OC9B 2A4HA 1OE7A 4EIQA 3DGQA 1YVLA 2BMXA 3KMNA 2WW3A 2H8LA 2IMFA 3H1NA 2FWFA 4KA0A 5IMAA 4TR1A 2X99A 4ID0A 5FT3A 5CNWA 4KSMA 4OFNA 2NTOA 1U6TA 3SWLA 4PUAA 3H79A 3HYPA 2FD3A 2PPTA 4WBJA 4ECBA 1EGRA 2JADA 2RLIA 3D6IA 2VUPA 3TJBA 1B4QA 3UMAA 5JWQB 2FWGA 1TDIA 5IMDA 4GF0A 2VCXA 4E68A 4MPFA 1ERVA 1X5EA 4NPBA 4XS4A 4TOPA 2H6YA 3KH7A 4PX1A 5LCZA 5B8AA 4XS1A 5DVBA 2C3NA 2OKAA 2MZCA 4WF5A 2PUKC 1PL2A 3FZ5A 2PWJA 5G31A 3EINA 2HQTA 3TOUA 3KTBA 2CZ3A 3EURA 4IS0A 4DSSA 6GSXA 3RAZA 3VI5A 4KDUA 4IHUA 2WW2A 4D73A 5ECLB 4GSNA 3UBLA 4KCEA 2RUEA 3IE3A 3CYNA 1M3IA 2FLSA 1SL0B 1X0RA 2AB6A 2C80A 5ELGA 2WB9A 2UZ8A 1EP8A 1SK0A 4BVXA 1R5PA 2FCHA 4GSSA 1G6YA 3CSIA 5FHIA 1X9SB 5LNKe 3TRQA 2JZTA 2MMAA 1AXDA 4PNGA 1U3AA 2CA8A 3IDVA 4OCFA 4MMMA 1K3LA 5EL8A 4KDYA 3APOA 5IMVA 1PFOA 1T3BA 3BD2A 5CP1A 4CHSA 3FYGA 4MJCA 4O5RA 3UVTA 3VFIA 1K0MA 2L6CA 5B6MA 1U87A 4MF6A 3MSZA 2WVXA 1ERUA 4LMWA 4HI7A 3C1SA 5B6NA 4GXZA 4MZBA 1I9DA 5BMUB 3VK9A 1HNCA 5HR3A 2LQQA 1GSYA 5HFKA 4IQAA 1GTUA 5J4VA 3LJRA 3KZQA 3VWXA 2O5VA 4EUYA 1FVJA 1SJIA 4EL1A 1CQHA 4Q5RA 3D22A 2YWMA 1HQOA 3F6DA 3DWVA 3M9JA 5E59A 1S3CA 3KTLA 3TCOA 4G0LA 2CZ2A 2UV8G 4BVYA 3A5WA 5J3RA 3N5OA 2B1KA 5DAKB 4IP1A 3Q18A 5GAND 4I5QA 3ED3A 2B5YA 3TGZA 3TUEA 1BJXA 3A2WA 4I97A 4Z2UA 4EXJA 1H75A 4P3YB 4WETA 4MPGA 2BTOT 3ZLPA 2H1DA 5HR2A 2WVZA 3FR9A 3Q19A 1WPIA 4K2DA 3KMOA 1Z7PA 4PXOA 2NVLA 2YOIA 2F8FA 3LWAA 3F0IA 4O5QA 4AJ7A 1IYIA 1VF2A 1UA5A 14GSA 1G0TA 4PQHA 2B7KA 3ZIVA 3ME7A 3F3QA 4AKIA 1OVNA 3CRTA 5J47A 2X49A 2V2GA 1EZKA 4K1FA 3DYRA 1Z6MA 1M7TA 2WW1A 1NHOA 4N3ZA 2HZEB 4BL7A 1Z7RA 1AC1A 3I6AA 1ST9A 17GSA 1F6MC 2GQLA 5ENUA 4HOJA 3LGCA 1Z9HA 4G0IA 4HUAA 4L5LA 4K6XA 3C71A 4E8HA 1HNAA 1FW1A 2Z9SA 2GQMA 5DBQA 3L0HA 3TKRA 4K5RA 4AF2A 2EC4A 2DJ1A 1LU4A 3FY7A 3FHKA 1M0UA 1ZMAA 1YY7A 4FQUA 3A3TA 2HFDA 2CVKA 2YZUA 2KP2A 2H74A 2PBJA 4O32A 2L6DA 1K0CA 4NHWA 5D9VA 3CQFA 4PTSA 3VI7A 2OBKA 2OBIA 1PGTA 3J7Yb 2QA1A 1SK2A 4N11A 1A8YA 4XCSA 3HHVA 1JLWA 2H73A 1HYUA 3TKQA 1DE1A 4LL1B 1BAYA 2DLXA 3KCMA 5A5HA 4OCEA 2MMOA 5G1KA 2VL2C 4BIKA 1K0DA 5IIZA 3BJ5A 3A5IA 2L4CA 4ZB8A 1V58A 4PHZC 2CX3A 2DJ3A 1SK1A 4J2FA 1XVQA 3LQ7A 6GSVA 1I1IP 6GSYA 2JSZA 3UARA 3BOAA 1TXUA 3EPTA 3L9SA 2V6OA 5F8BA 5IMFA 5B7CA 4ZBBA 5A1NA 2C0FA 4GSTA 4Q5QA 3NZNA 1VF3A 4JE1A 2NDOA 2RIIA 2YWIA 5L71A 2VM2A 1XVWA 4NAXA 1YZXA 3M9KA 3RGBC 3KM6A 2DSAA 2DJ0A 3O76A 1SD8A 3IV4A 5JWRB 1TW9A 2PVQA 4ZL8A 4MABA 3G7YA 3HCZA 2G2QA 1PKWA 2B7JA 4TRXA 2CAQA 4GRFA 5H5QA 4XHMA 1ZCPA
chains in the Genus database with same CATH topology
4GLTA 4KE3A 4N0VA 1W89A 2VL2A 2D2ZA 3GSTA 2E2GA 4GCIA 2E2MA 3GFKA 4QMKA 4QL7A 2VLVA 1O81A 5DJLA 2I9HA 2X64A 12GSA 2OT3A 3GNJA 1O73A 2M80A 3GV1A 4NMUA 3ME8A 2VOCA 3IAM2 3QD9A 3AY8A 5D96A 4PURA 2H0IA 3TJGA 3E0UA 5F05A 4ZIJA 4G2EA 2HNLA 2DJKA 2DKHA 2F8AA 3TKSE 2GSTA 2LRCA 5KN0A 2I3YA 3Q74A 4YAVA 2EFDA 2XHFA 4O7HA 2YP6A 5ECOB 1ACVA 2H66A 2C3TA 1ML6A 3VURA 1KEBA 4MF7A 2REMA 1TU8A 1VGLA 1GUMA 2IMEA 2HSYA 3VPTA 2H1LA 2HYXA 1B4PA 1EEMA 4PGTA 4WKWA 1A24A 4KSOA 3GKXA 2WJUA 4WBRD 4IBPA 5IMZA 1DBYA 1GUHA 2CX4A 5J9CA 4TR3A 4AJ6A 4HQZA 2VD1A 1BX9A 1M99A 1PL1A 2RUFA 1K0OA 2WGRA 2E7PA 2HT9A 1XWAA 5A4VA 4ZXGA 3I69A 1X5CA 1FAAA 5ECHB 1XIYA 2R6KA 4GQCA 3QFBC 4G0KA 4K2XA 3TJJA 4ZBDA 3H8QA 1OE8A 2IMIA 4Z7XA 3LYPA 2IL3A 4AKXB 1KTEA 5CAXA 4IVFA 1ZGNA 3HMJG 5HR1A 3RHCA 1TK8B 1J9BA 3HZ8A 1GL8A 2B5XA 3GSSA 1PRXA 3LEFA 4EF0A 3EYTA 2AHEA 1NW2A 1PN0A 3ZFBA 3APSA 5INYA 2K8SA 1XWKA 9GSSA 3WYWA 4I2TA 2PU9C 4NXIA 4OMVA 2MMZA 1M9BA 2VCZA 4BPYA 3GTUB 1GWCA 3FW2A 1XOBA 3UEMA 4K9ZA 2HRKB 4NV2A 2IWTA 1WOUA 1X9MB 2OA7A 4ECCA 4AGSA 2H1BA 3HJOA 5FWGA 1TP9A 1MTCA 3CSJA 2LNTA 3VWUA 4V2LA 8GSSA 4CY8A 5AGYA 2RM6A 1SKRB 2AJQB 1XWGA 3BCKA 3QAWA 3DIEA 1SJ6A 5EPFA 1EEJA 6GSUA 5H5RA 1WRYA 2HI7A 3DVXA 5J9BA 2ZCTA 3FRCA 5G5EA 4DEJA 3FZ9A 1OC9A 1A23A 4ML1A 4MDCA 3MDKA 2GLRA 3KXOA 3LSZA 5J5NA 2HSMB 3HVVA 1GNEA 1SVOA 2L5OA 5CRWA 3LG6A 5KN3A 2FWEA 1AQXA 4ZB7A 3VWWA 3ZL5A 2GGTA 2DMLA 2P5RA 4WF4A 3M3MA 3US3A 3TU3B 1X9WB 2CQ9A 5IO0A 5D93A 4H86A 3CXGA 4N10A 2H71A 1VF1A 1DUGA 1R4WA 2O8VB 4PNFA 2AYTA 4K0GA 2H76A 3GMFA 1K0AA 5CYYA 1K0NA 6GSWA 4KDXA 5GZZB 2VL3A 2R37A 3LW9A 5DALB 2LNSA 2B5EA 3GRXA 3IRAA 3G9BA 2ZNMA 2WDUA 3ERFA 2ES7A 2B1LA 1EP7A 1TXXA 5B8BA 2H6XA 4MA9A 1GSSA 3CTFA 3W6GA 1XPVA 4L0WA 5IQYA 2VCVA 1YKCA 2IIYA 2GZZA 4MF5A 2XBQA 4RI6A 3ZVJD 2VKZG 18GSA 1T00A 2L59A 2GT6A 4ZILA 1O8XA 1R26A 3RPNA 3IC8A 3TDGA 3QR6A 1F37A 1R7HA 2OJLA 1SKWB 3RHBA 1EV9A 4TXVA 4ZL7A 2XBIA 3ZITA 3KEBA 5D73A 3ZREA 2KUCA 5AIVA 4WXTA 2HZFA 1MDKA 5ECRB 4ICYA 1F9MA 5GSSA 3HKRA 5IPGA 5DALA 5J4UA 1F3AA 3U5RE 4K5SA 2IMDA 4X1UA 4POKA 1GULA 3EE2A 2VL9A 4HZ2A 5DQSA 3QOUA 2AAWA 3MNGA 5ELAA 3TKSC 5BMUA 1GLPA 2H70A 3HZ4A 4TXOB 3KIJA 4FIWA 1A2MA 3D21A 2GSQA 1ZYNA 2QA2A 3F63A 2LQOA 1XW9A 1GNWA 1U3IA 2IFQB 1V98A 1TTZA 1XFLA 2IN3A 4IKHA 1SU9A 4FO5A 3HA9A 3QFAC 5F07A 3EC3A 4IELA 5DAKA 2HRNA 3L9VA 2R4VA 2P31A 4G01A 3DVWA 1ZZYA 2A2PA 3WGXA 5G5FA 1B9XC 1RK4A 1EOHA 1ZOFA 2QGVA 4BA7A 3EMPA 2X8HA 3P2AA 3DXBA 1O85A 5A5KA 3GHAA 1MDIA 4F0BA 1Q98A 2KOKA 16GSA 5DCHA 4NHZA 1XZOA 4JZQA 3PINA 3GA4A 3WT2A 3MIXA 1TU7A 1FG4A 4K7NA 3J7Yk 2XPDA 13GSA 3GH6A 4L0UA 5EVOA 2K8VA 2DIYA 3D4MA 4MCUA 3F8UA 1O8WA 1FVKA 4IJ3A 4A5PA 1GP1A 5ECKB 2C0GA 1T4ZA 2R0CA 1DE2A 1SVLA 2HZEA 4YKGA 2EFHA 1O6JA 1XW6A 3HVSA 4JBBA 5D9TA 2QC7A 2DIZA 2QSIA 3C8EA 3A2VA 4Q5NA 2OACA 2YANA 4CY6A 4JRRA 1THXA 1OC3A 4POBA 2WZ9A 3K8NA 4IJIA 6GSSA 5ID2B 4RUVA 4V1Ap 3TKPA 4J56E 1YEPA 3MYDA 2YV9A 2BJXA 4TR0A 1ZYPA 4EKZA 1YF1A 1SL2B 1ERWA 2A4VA 1FHEA 2GVPA 4MJAA 1OAZA 4FYBA 1GSQA 2CT6A 1JFUA 6GSTA 3ZMKA 1WWJA 4V2NA 4XRDA 1A2LA 2VO4A 1T8EB 1TRVA 2VCQA 1O7UA 2N5BA 4MJEA 2GDRA 2VCWA 1TI1A 3GKMA 2DBCA 4YKFA 2HXKA 1UN2A 4KX4A 5G1LA 3MAKA 4FYCA 2HSNB 4WR4A 1SL1B 4G19A 1T1VA 5JWOB 1HD2A 1OKTA 2H75A 5A34B 3S9FA 2F9SA 3O6TA 5HFGA 2P5QA 3QAVA 4CDOA 1EWXA 4ZB6A 3PR8A 2LRNA 4O92A 3D4TA 1QQ2A 2DC5A 3UJ1A 3ZIJA 5ECMB 3TB2A 1PN9A 4X43A 5ECSA 3NIVA 1OKDA 3UAPA 3FMWA 3CMIA 1SYXA 3G7IA 4QQ7A 2OADA 2H1GA 2H19A 2K18A 2H6ZA 4YQVA 5CO3A 1XOAA 3W8JA 1BEDA 5KEJA 4QL9A 5G30A 2DMMA 3EMXA 3QPMA 2O89A 1JZDA 2RM5A 1SENA 3VWVA 1G6WA 4YQMA 1PKZA 5ECPB 2ZUPA 4J57E 1AUCA 2EFCA 2XC2A 4OWYA 1THOA 1GRXA 2FWHA 2JL4A 1QUWA 1WE0A 3GURA 2OE3A 2I81A 4GWRA 1V9WA 1LBKA 3CTGA 3U6VA 4OO4A 2ALBA 5DJMA 4V2MA 4EIPA 3IHGA 4RI7A 4K7OA 2EFEA 3CRUA 4L5OA 1V57A 3ZYWA 3M1GA 4E8EA 2EIRA 2YNXA 4POLA 3IK7A 1VRSD 2AV4A 1U88A 5DDLA 5AN1A 2DJJA 1MD3A 3ERWA 3GUSA 3BBYA 4TR1B 1FO5A 3UIWA 2L57A 3HDCA 4HJ2A 1WJKA 3HXSA 1FOHA 4X4JA 1K3OA 4AKHA 3PGTA 2ON7A 1WP0A 4F2IA 2I4AA 1XBSA 3D0ZA 4JR6A 4HS1A 2PERA 4JR4A 3P90A 5J41A 1GLQA 2M46A 4F0CA 1TJDA 3I9V2 1RW1A 1N8JA 2OE0A 4XS4B 3SBCA 2NPBA 5IPHA 3ZZXA 4RQXA 4BWQA 1YQ1A 1JZWA 4KF9A 3UOMA 2H1AA 2C1YA 3E9JB 4AI6A 2H01A 1B8XA 3JCML 5IMCA 20GSA 4MK3A 3PPUA 1MDJA 4Q5FA 5CRGA 3GH9A 3QMXA 5AIXA 4DSSB 3GYKA 1GH2A 1A8LA 3QAGA 2IMKA 4TR4A 5KN2A 2WCIA 5ECQB 1W4VA 5KN1A 3WGDA 19GSA 1SYRA 4D73B 3ISOA 3DRNA 1PA3A 2TIRA 3FZ4A 3QDNA 4NV5A 2FHEA 4WR5A 2LTKA 4K8MA 1TK5B 2F3MA 4HQSA 1XWBA 3ZFLA 1NM3A 5H5SA 2GTUA 4BVXB 3IAS2 3EU3A 2B3SA 2JSYA 1A2JA 1GTBA 4V1Ag 1ZYEA 3GL3A 1TRUA 2GSRA 3LORA 1ILOA 2JZSA 3F4TA 3L4NA 4MP4A 5CREA 1BQ7A 1GSFA 1TRWA 1UC7A 3C7MA 3Q6OA 4KH7A 4EE0A 3M8NA 5GAPD 1KNGA 2WULA 3ZVJA 1JHBA 1ZYQB 1XCCA 3GN3A 2R2JA 3LXZA 1A0FA 3R3EA 3F9UA 1AQWA 2DJ2A 2R0GA 5IM9A 2R3XA 4ACSA 1M2BA 4X0XA 3IK9A 2GT5A 1XXUA 4HEA2 1F3BA 4XIHA 4N0ZA 1I5GA 2YWNA 3GTUA 1YF0A 3UVHA 4IN0A 3G7JA 3APQA 3NOFA 1BYEA 1PMTA 2X8GA 1SVMA 3IA1A 2A2RA 2HRKA 2PVOC 4IGJA 5HQPA 3KH9A 2LS5A 3M0FA 1GSUA 5EY6A 1PSQA 3ZTLA 2MYGA 4TKYA 4BVYB 4K7IA 1WIKA 4I8BA 4G9HA 4EO3A 5JCGA 1Y1UA 4LLRA 4XRAA 4DSQA 4AJ8A 2FA4A 3UBKA 4CW9A 3R2QA 2X8CA 1Q4JA 3F6FA 3V1WA 4BWSA 2QKEA 5ABRA 2WRTA 3F4SA 2MBTA 1YEXA 1A0RP 3RDWA 2JACA 5JCWA 3HJMA 2HSMA 4KCAA 1CQGA 4YH2A 4HU7A 4G10A 1GUKA 4TVEA 1TOFA 2H0HA 2IJYA 3KGKA 5AISA 2HRAA 4OO5A 3HVXA 4MLYA 3FZAA 2J23A 2VLTA 3LXTA 2P0GA 4KAEA 3FR6A 1TKDB 2GS3A 1V40A 4IP6A 5CRDA 3CSHA 3IC4A 4N30A 4BL7B 2YCDA 3GL5A 2FGXA 4L8EA 2JZRA 2CVBA 2PN8A 2DKIA 2LEGA 5D9XA 4IW9A 4ILFA 1JLVA 2KP1A 3ZRDA 4ISDA 3A2XA 5D9WA 2V1MA 3C1RA 4ML6A 2R0PA 2PGTA 2O7KA 2FNOA 1N2AA 4KNDA 1PX7A 2L4QA 2GSSA 4LA1A 1URMA 3IXRA 3TOTA 4FYUA 3ERGA 2A2SA 1M9AA 4PQ1A 1H4OA 3IR4A 3FK8A 4ZL9A 3EWLA 4DVCA 1SD9A 1SJZA 2YN1A 2JU5A 5A4WA 1UVZA 4KUNA 3DD3A 4FH8A 2KHPA 2CV4A 1TI3A 3TRXA 10GSA 5C04A 3N9JA 1QFNA 4Z2RA 5A5HB 4HDEA 4I6XA 2K6VA 3GX0A 2HSHA 1QK8A 2VIMA 3EVIA 1R5AA 1YKAA 1PX6A 2E0QA 2YJ7A 2LSTA 2YJHA 2FA8A 4GTUA 2LJAA 2J9HA 2LV3A 3O3TA 11GSA 1HNBA 4NWYA 2GZPA 3I43A 2AUVA 5J4YA 1X5DA 1QMVA 2WS2A 1AIUA 1SKSB 2EIQA 2GZYA 2C0EA 5A1NB 3LFLA 3L78A 1FB0A 4OD7A 4MZWA 4ECIA 1QXHA 3TKSA 4USSA 3MWHA 3H93A 3F4RA 1GTAA 4TXOA 1N25A 2ON5A 2H30A 2OE1A 2YWOA 5E4WA 1F2EA 4W66A 4MZCA 2NBSA 3P8WA 4ZBAA 2IFQA 4PUFC 3FR3A 2X4AA 4YAPA 4GDFA 4GQFA 4RQRA 1GTIA 3WGEA 2VM1A 2KLXA 4LL4B 3KD0A 1YDKA 1AW9A 5JCUA 3C73A 1QGVA 4K0NA 1Z5YE 4OFTA 1OYJA 1Z3EA 5F0GA 1S3AA 2TRXA 1XWCA 2LJKA 1S3DA 2FY6A 3KP8A 1GSDA 5IO2A 2V32A 4MNNA 2R5GA 1K3YA 3GKNA 3D5JA 3LYKA 1NSWA 1Y25A 1PQNA 3RPPA 2C3QA 1YJ6A 1T4YA 2L5LA 3TRPA 4KW6A 2LKUA 3IBHA 3IOSA 4TW5A 3L9UA 1RQMA 2O85A 4O5UA 4EDZA 4MH3A 3KP9A 4EC0A 5DCGA 3DMLA 4OFMA 1XW5A 5KOXA 1ON4A 3BCIA 2K9FA 1M2DA 2HE3A 2C8UA 1EGOA 2FUG2 3WT1A 5A4UA 1LJRA 4F03A 2TRCP 2CVDA 2MMNA 5IOWA 1E2YA 3HY2A 1B9YC 2LJRA 2V6KA 1ERTA 1J0FA 2H0GA 5DQYA 3DKSA 2YZHA 4EVMA 1FOVA 2LRTA 4KGIA 3RBTA 1IYHA 2IPAA 5ID2A 2C0DA 5HFIA 5GSTA 1B48A 3IPZA 1EOGA 2YV7A 5IOXA 1TRSA 2C4JA 4ULXA 3CWGA 3ZMLA 3VLNA 1ABAA 4KB3A 2YPMA 1J08A 3GIXA 2N5FA 4ZB9A 1PD21 2V41A 1MD4A 1NHYA 4XTSA 3W8SA 5CRHA 3E3EA 5ECNB 2EIOA 4LMVA 4TN8A 1C72A 1TK0B 3F3RA 1EV4A 5J40A 3FKFA 1Z6NA 3WD6A 5C00A 2G0FA 4MJBA 4MH2A 3OR5A 4JEDA 4WEYA 3H4KA 5BRTA 2HSNA 4ECJA 5A34A 2N5AA 3TJFA 1ZL9A 4POMA 1Y6EA 4HU9A 4DSRA 1AAZA 3KJYA 4EDYA 2XPEA 5ECIB 4F9ZA 1OC8A 3VPQA 2M72A 5G2ZA 2VAFA 3HD5A 1DSBA 2VD0A 4AKGA 1BG5A 4IQ1A 1V2AA 2B6MA 3EU4A 1JZOA 1E6BA 4PQIA 3PH9A 1AQVA 1FB6A 3QCPA 4F82A 2MBSA 1M2AA 2CAIA 1BF5A 3DEXA 1JZRA 2HRFA 1GSEA 1KBNA 4Z2TA 3UL3A 3GX8A 2GQKA 3IHQA 5KOWA 2VCTA 4HZ4A 5D8IA 7GSSA 2PMTA 1WMJA 4YQUA 2F51A 2WFCA 2VLUA 5F06A 4XS6A 2LUSA 3TJKA 1G7EA 3FEUA 1K0BA 4HJMA 5HR0A 1USBA 2HLSA 3GKKA 1BG1A 4JU5A 2H72A 3P7XA 4I2UA 5LD0A 3HJPA 5COHA 3CBUA 1G7OA 1T7PB 1VF4A 1MEKA 2O87A 22GSA 2I1UA 1OC9B 2A4HA 1OE7A 4EIQA 3DGQA 1YVLA 2BMXA 3KMNA 2H8LA 2IMFA 3H1NA 2FWFA 4KA0A 5IMAA 4TR1A 2X99A 4ID0A 5FT3A 5CNWA 4KSMA 4OFNA 2NTOA 1U6TA 3SWLA 4PUAA 3H79A 3HYPA 2FD3A 2PPTA 4WBJA 4ECBA 1EGRA 2JADA 2RLIA 3D6IA 2VUPA 3TJBA 1B4QA 3UMAA 5JWQB 2FWGA 1TDIA 5IMDA 4GF0A 2VCXA 4E68A 4MPFA 1ERVA 1X5EA 4NPBA 4XS4A 4TOPA 2H6YA 3KH7A 4PX1A 5LCZA 5B8AA 4XS1A 5DVBA 2C3NA 2OKAA 2MZCA 4WF5A 2PUKC 1PL2A 3FZ5A 2PWJA 5G31A 3EINA 2HQTA 3TOUA 3KTBA 2CZ3A 3EURA 4IS0A 4DSSA 6GSXA 3RAZA 3VI5A 4KDUA 4IHUA 4D73A 5ECLB 4GSNA 3UBLA 4KCEA 2RUEA 3IE3A 3CYNA 2FLSA 1SL0B 1X0RA 2AB6A 2C80A 5ELGA 2WB9A 2UZ8A 1EP8A 1SK0A 4BVXA 1R5PA 2FCHA 4GSSA 1G6YA 3CSIA 5FHIA 1X9SB 5LNKe 3TRQA 2JZTA 2MMAA 1AXDA 4PNGA 1U3AA 2CA8A 3IDVA 4OCFA 4MMMA 1K3LA 5EL8A 4KDYA 3APOA 5IMVA 1T3BA 3BD2A 5CP1A 4CHSA 3FYGA 4MJCA 4O5RA 3UVTA 3VFIA 1K0MA 2L6CA 5B6MA 1U87A 4MF6A 3MSZA 1ERUA 4LMWA 4HI7A 3C1SA 5B6NA 4GXZA 4MZBA 1I9DA 5BMUB 3VK9A 1HNCA 5HR3A 2LQQA 1GSYA 5HFKA 4IQAA 1GTUA 5J4VA 3LJRA 3KZQA 3VWXA 2O5VA 4EUYA 1FVJA 1SJIA 4EL1A 1CQHA 4Q5RA 3D22A 2YWMA 1HQOA 3F6DA 3DWVA 3M9JA 5E59A 1S3CA 3KTLA 3TCOA 4G0LA 2CZ2A 2UV8G 4BVYA 3A5WA 5J3RA 3N5OA 2B1KA 5DAKB 4IP1A 3Q18A 5GAND 4I5QA 3ED3A 2B5YA 3TGZA 3TUEA 1BJXA 3A2WA 4I97A 4Z2UA 4EXJA 1H75A 4P3YB 4WETA 4MPGA 2BTOT 3ZLPA 2H1DA 5HR2A 3FR9A 3Q19A 1WPIA 4K2DA 3KMOA 1Z7PA 4PXOA 2NVLA 2YOIA 2F8FA 3LWAA 3F0IA 4O5QA 4AJ7A 1IYIA 1VF2A 1UA5A 14GSA 1G0TA 4PQHA 2B7KA 3ZIVA 3ME7A 3F3QA 4AKIA 1OVNA 3CRTA 5J47A 2X49A 2V2GA 1EZKA 4K1FA 3DYRA 1Z6MA 1M7TA 1NHOA 4N3ZA 2HZEB 4BL7A 1Z7RA 1AC1A 3I6AA 1ST9A 17GSA 1F6MC 2GQLA 5ENUA 4HOJA 3LGCA 1Z9HA 4G0IA 4HUAA 4L5LA 4K6XA 3C71A 4E8HA 1HNAA 1FW1A 2Z9SA 2GQMA 5DBQA 3L0HA 3TKRA 4K5RA 4AF2A 2EC4A 2DJ1A 1LU4A 3FY7A 3FHKA 1M0UA 1ZMAA 1YY7A 4FQUA 3A3TA 2HFDA 2CVKA 2YZUA 2KP2A 2H74A 2PBJA 4O32A 2L6DA 1K0CA 4NHWA 5D9VA 4PTSA 3VI7A 2OBKA 2OBIA 1PGTA 3J7Yb 2QA1A 1SK2A 4N11A 1A8YA 4XCSA 3HHVA 1JLWA 2H73A 1HYUA 3TKQA 1DE1A 4LL1B 1BAYA 2DLXA 3KCMA 5A5HA 4OCEA 2MMOA 5G1KA 2VL2C 1K0DA 5IIZA 3BJ5A 3A5IA 2L4CA 4ZB8A 1V58A 2CX3A 2DJ3A 1SK1A 4J2FA 1XVQA 3LQ7A 6GSVA 6GSYA 2JSZA 3UARA 3BOAA 1TXUA 3EPTA 3L9SA 2V6OA 5F8BA 5IMFA 5B7CA 4ZBBA 5A1NA 2C0FA 4GSTA 4Q5QA 3NZNA 1VF3A 4JE1A 2NDOA 2RIIA 2YWIA 5L71A 2VM2A 1XVWA 4NAXA 1YZXA 3M9KA 3KM6A 2DSAA 2DJ0A 3O76A 1SD8A 3IV4A 5JWRB 1TW9A 2PVQA 4ZL8A 4MABA 3G7YA 3HCZA 2G2QA 1PKWA 2B7JA 4TRXA 2CAQA 4GRFA 5H5QA 4XHMA 1ZCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLT A;  4KE3 A;  4N0V A;  1W89 A;  2VL2 A;  2D2Z A;  3GST A;  2E2G A;  4GCI A;  2E2M A;  3GFK A;  4QL7 A;  2VLV A;  1O81 A;  5DJL A;  2I9H A;  2X64 A;  12GS A;  3GNJ A;  1O73 A;  2M80 A;  3GV1 A;  4NMU A;  3ME8 A;  2VOC A;  3IAM 2;  3QD9 A;  3AY8 A;  5D96 A;  4PUR A;  2H0I A;  3TJG A;  3E0U A;  5F05 A;  4ZIJ A;  4G2E A;  2HNL A;  2DJK A;  2F8A A;  3TKS E;  2GST A;  2LRC A;  5KN0 A;  2I3Y A;  3Q74 A;  4YAV A;  2XHF A;  4O7H A;  2YP6 A;  5ECO B;  1ACV A;  2H66 A;  2C3T A;  1ML6 A;  3VUR A;  1KEB A;  4MF7 A;  2REM A;  1TU8 A;  1VGL A;  1GUM A;  2IME A;  2HSY A;  3VPT A;  2HYX A;  1B4P A;  1EEM A;  4PGT A;  4WKW A;  1A24 A;  4KSO A;  3GKX A;  2WJU A;  4WBR D;  4IBP A;  5IMZ A;  1DBY A;  1GUH A;  2CX4 A;  5J9C A;  4TR3 A;  4AJ6 A;  4HQZ A;  2VD1 A;  1BX9 A;  1M99 A;  1PL1 A;  2RUF A;  1K0O A;  2WGR A;  2E7P A;  2HT9 A;  1XWA A;  5A4V A;  4ZXG A;  3I69 A;  1X5C A;  1FAA A;  5ECH B;  1XIY A;  2R6K A;  4GQC A;  3QFB C;  4G0K A;  3TJJ A;  4ZBD A;  3H8Q A;  1OE8 A;  2IMI A;  4Z7X A;  3LYP A;  2IL3 A;  1KTE A;  5CAX A;  4IVF A;  1ZGN A;  5HR1 A;  3RHC A;  1TK8 B;  1J9B A;  3HZ8 A;  1GL8 A;  2B5X A;  3GSS A;  1PRX A;  3LEF A;  4EF0 A;  3EYT A;  2AHE A;  1NW2 A;  3ZFB A;  3APS A;  5INY A;  2K8S A;  1XWK A;  9GSS A;  3WYW A;  4I2T A;  2PU9 C;  4NXI A;  4OMV A;  2MMZ A;  1M9B A;  2VCZ A;  4BPY A;  3GTU B;  1GWC A;  3FW2 A;  1XOB A;  3UEM A;  4K9Z A;  2HRK B;  4NV2 A;  2IWT A;  1WOU A;  1X9M B;  2OA7 A;  4ECC A;  4AGS A;  2H1B A;  3HJO A;  5FWG A;  1TP9 A;  1MTC A;  3CSJ A;  2LNT A;  3VWU A;  4V2L A;  8GSS A;  5AGY A;  2RM6 A;  1SKR B;  2AJQ B;  1XWG A;  3BCK A;  3QAW A;  3DIE A;  1SJ6 A;  5EPF A;  1EEJ A;  6GSU A;  5H5R A;  1WRY A;  2HI7 A;  3DVX A;  5J9B A;  2ZCT A;  3FRC A;  5G5E A;  4DEJ A;  3FZ9 A;  1OC9 A;  1A23 A;  4ML1 A;  4MDC A;  3MDK A;  2GLR A;  3KXO A;  3LSZ A;  5J5N A;  2HSM B;  3HVV A;  1GNE A;  2L5O A;  5CRW A;  3LG6 A;  5KN3 A;  2FWE A;  1AQX A;  3VWW A;  3ZL5 A;  2GGT A;  2DML A;  2P5R A;  4WF4 A;  3M3M A;  3US3 A;  1X9W B;  2CQ9 A;  5IO0 A;  5D93 A;  4H86 A;  3CXG A;  4N10 A;  2H71 A;  1VF1 A;  1DUG A;  1R4W A;  2O8V B;  4PNF A;  2AYT A;  4K0G A;  2H76 A;  3GMF A;  1K0A A;  5CYY A;  1K0N A;  6GSW A;  4KDX A;  5GZZ B;  2VL3 A;  2R37 A;  5DAL B;  2LNS A;  2B5E A;  3GRX A;  3IRA A;  3G9B A;  2ZNM A;  2WDU A;  3ERF A;  2ES7 A;  2B1L A;  1EP7 A;  1TXX A;  5B8B A;  2H6X A;  4MA9 A;  1GSS A;  3CTF A;  3W6G A;  1XPV A;  4L0W A;  5IQY A;  2VCV A;  1YKC A;  2IIY A;  2GZZ A;  4MF5 A;  2XBQ A;  4RI6 A;  3ZVJ D;  18GS A;  1T00 A;  2L59 A;  2GT6 A;  4ZIL A;  1O8X A;  1R26 A;  3RPN A;  3IC8 A;  3TDG A;  3QR6 A;  1F37 A;  1R7H A;  2OJL A;  1SKW B;  3RHB A;  1EV9 A;  4TXV A;  4ZL7 A;  2XBI A;  3ZIT A;  3KEB A;  5D73 A;  3ZRE A;  2KUC A;  5AIV A;  4WXT A;  2HZF A;  1MDK A;  5ECR B;  1F9M A;  5GSS A;  3HKR A;  5IPG A;  5DAL A;  5J4U A;  1F3A A;  3U5R E;  2IMD A;  4X1U A;  4POK A;  1GUL A;  3EE2 A;  2VL9 A;  4HZ2 A;  5DQS A;  3QOU A;  2AAW A;  3MNG A;  5ELA A;  3TKS C;  5BMU A;  1GLP A;  2H70 A;  3HZ4 A;  4TXO B;  3KIJ A;  4FIW A;  1A2M A;  3D21 A;  2GSQ A;  3F63 A;  2LQO A;  1XW9 A;  1GNW A;  1U3I A;  2IFQ B;  1V98 A;  1TTZ A;  1XFL A;  2IN3 A;  4IKH A;  1SU9 A;  4FO5 A;  3HA9 A;  3QFA C;  5F07 A;  3EC3 A;  4IEL A;  5DAK A;  2HRN A;  3L9V A;  2R4V A;  2P31 A;  3DVW A;  1ZZY A;  3WGX A;  5G5F A;  1B9X C;  1RK4 A;  1EOH A;  1ZOF A;  2QGV A;  4BA7 A;  3EMP A;  2X8H A;  3P2A A;  3DXB A;  1O85 A;  5A5K A;  3GHA A;  1MDI A;  4F0B A;  1Q98 A;  2KOK A;  16GS A;  5DCH A;  4NHZ A;  1XZO A;  4JZQ A;  3PIN A;  3GA4 A;  3WT2 A;  1TU7 A;  1FG4 A;  4K7N A;  3J7Y k;  2XPD A;  13GS A;  3GH6 A;  4L0U A;  5EVO A;  2K8V A;  2DIY A;  3D4M A;  4MCU A;  3F8U A;  1O8W A;  1FVK A;  4IJ3 A;  1GP1 A;  5ECK B;  2C0G A;  1T4Z A;  1DE2 A;  2HZE A;  1O6J A;  1XW6 A;  3HVS A;  4JBB A;  5D9T A;  2QC7 A;  2DIZ A;  2QSI A;  3C8E A;  3A2V A;  4Q5N A;  2OAC A;  2YAN A;  4JRR A;  1THX A;  1OC3 A;  4POB A;  2WZ9 A;  3K8N A;  4IJI A;  6GSS A;  5ID2 B;  4RUV A;  4V1A p;  3TKP A;  4J56 E;  1YEP A;  2YV9 A;  2BJX A;  4TR0 A;  4EKZ A;  1YF1 A;  1SL2 B;  1ERW A;  2A4V A;  1FHE A;  2GVP A;  4MJA A;  1OAZ A;  4FYB A;  1GSQ A;  2CT6 A;  1JFU A;  6GST A;  3ZMK A;  1WWJ A;  4V2N A;  4XRD A;  1A2L A;  2VO4 A;  1T8E B;  1TRV A;  2VCQ A;  1O7U A;  2N5B A;  4MJE A;  2GDR A;  2VCW A;  1TI1 A;  3GKM A;  2DBC A;  2HXK A;  1UN2 A;  4KX4 A;  5G1L A;  3MAK A;  4FYC A;  2HSN B;  4WR4 A;  1SL1 B;  4G19 A;  1T1V A;  5JWO B;  1HD2 A;  1OKT A;  2H75 A;  3S9F A;  2F9S A;  3O6T A;  5HFG A;  2P5Q A;  3QAV A;  4CDO A;  1EWX A;  4ZB6 A;  3PR8 A;  2LRN A;  4O92 A;  3D4T A;  1QQ2 A;  2DC5 A;  3UJ1 A;  3ZIJ A;  5ECM B;  3TB2 A;  1PN9 A;  4X43 A;  5ECS A;  3NIV A;  1OKD A;  3UAP A;  3CMI A;  1SYX A;  3G7I A;  4QQ7 A;  2OAD A;  2H1G A;  2H19 A;  2K18 A;  2H6Z A;  4YQV A;  5CO3 A;  1XOA A;  3W8J A;  1BED A;  5KEJ A;  4QL9 A;  5G30 A;  2DMM A;  3EMX A;  3QPM A;  2O89 A;  1JZD A;  2RM5 A;  1SEN A;  3VWV A;  1G6W A;  4YQM A;  1PKZ A;  5ECP B;  2ZUP A;  4J57 E;  1AUC A;  4OWY A;  2XC2 A;  1THO A;  1GRX A;  2FWH A;  2JL4 A;  1QUW A;  1WE0 A;  3GUR A;  2OE3 A;  2I81 A;  4GWR A;  1V9W A;  1LBK A;  3CTG A;  3U6V A;  4OO4 A;  2ALB A;  5DJM A;  4V2M A;  4RI7 A;  4K7O A;  3CRU A;  4L5O A;  1V57 A;  3ZYW A;  3M1G A;  4E8E A;  2EIR A;  2YNX A;  4POL A;  3IK7 A;  1VRS D;  2AV4 A;  1U88 A;  5DDL A;  5AN1 A;  2DJJ A;  1MD3 A;  3ERW A;  3GUS A;  3BBY A;  4TR1 B;  1FO5 A;  3UIW A;  2L57 A;  3HDC A;  4HJ2 A;  1WJK A;  3HXS A;  1K3O A;  3PGT A;  2ON7 A;  1WP0 A;  4F2I A;  2I4A A;  1XBS A;  4JR6 A;  3D0Z A;  4HS1 A;  2PER A;  4JR4 A;  3P90 A;  5J41 A;  1GLQ A;  2M46 A;  4F0C A;  1TJD A;  3I9V 2;  1RW1 A;  1N8J A;  2OE0 A;  4XS4 B;  3SBC A;  2NPB A;  5IPH A;  3ZZX A;  4RQX A;  4BWQ A;  1YQ1 A;  1JZW A;  4KF9 A;  3UOM A;  2H1A A;  2C1Y A;  3E9J B;  2H01 A;  1B8X A;  3JCM L;  5IMC A;  20GS A;  4MK3 A;  3PPU A;  1MDJ A;  4Q5F A;  5CRG A;  3GH9 A;  3QMX A;  5AIX A;  4DSS B;  3GYK A;  1GH2 A;  1A8L A;  3QAG A;  2IMK A;  4TR4 A;  5KN2 A;  2WCI A;  5ECQ B;  1W4V A;  5KN1 A;  3WGD A;  19GS A;  1SYR A;  4D73 B;  3ISO A;  3DRN A;  1PA3 A;  2TIR A;  3FZ4 A;  3QDN A;  4NV5 A;  2FHE A;  4WR5 A;  2LTK A;  4K8M A;  1TK5 B;  2F3M A;  4HQS A;  1XWB A;  3ZFL A;  1NM3 A;  5H5S A;  2GTU A;  4BVX B;  3IAS 2;  3EU3 A;  2B3S A;  2JSY A;  1A2J A;  1GTB A;  4V1A g;  1ZYE A;  3GL3 A;  1TRU A;  2GSR A;  3LOR A;  1ILO A;  2JZS A;  3F4T A;  3L4N A;  4MP4 A;  5CRE A;  1BQ7 A;  1GSF A;  1TRW A;  1UC7 A;  3C7M A;  3Q6O A;  4KH7 A;  4EE0 A;  3M8N A;  5GAP D;  1KNG A;  2WUL A;  3ZVJ A;  1JHB A;  1ZYQ B;  1XCC A;  3GN3 A;  2R2J A;  3LXZ A;  1A0F A;  3R3E A;  3F9U A;  1AQW A;  2DJ2 A;  5IM9 A;  2R3X A;  4ACS A;  1M2B A;  4X0X A;  3IK9 A;  2GT5 A;  1XXU A;  4HEA 2;  1F3B A;  4XIH A;  4N0Z A;  1I5G A;  2YWN A;  3GTU A;  1YF0 A;  3UVH A;  4IN0 A;  3G7J A;  3APQ A;  3NOF A;  1BYE A;  1PMT A;  2X8G A;  3IA1 A;  2A2R A;  2HRK A;  2PVO C;  4IGJ A;  5HQP A;  3KH9 A;  2LS5 A;  3M0F A;  1GSU A;  5EY6 A;  1PSQ A;  3ZTL A;  2MYG A;  4TKY A;  4BVY B;  4K7I A;  1WIK A;  4I8B A;  4G9H A;  4EO3 A;  5JCG A;  4LLR A;  4XRA A;  4DSQ A;  4AJ8 A;  2FA4 A;  3UBK A;  4CW9 A;  3R2Q A;  2X8C A;  1Q4J A;  3F6F A;  3V1W A;  4BWS A;  2QKE A;  5ABR A;  2WRT A;  3F4S A;  2MBT A;  1YEX A;  1A0R P;  3RDW A;  2JAC A;  5JCW A;  3HJM A;  2HSM A;  4KCA A;  1CQG A;  4YH2 A;  4HU7 A;  4G10 A;  1GUK A;  4TVE A;  1TOF A;  2H0H A;  2IJY A;  3KGK A;  5AIS A;  2HRA A;  4OO5 A;  3HVX A;  4MLY A;  3FZA A;  2J23 A;  2VLT A;  3LXT A;  2P0G A;  4KAE A;  3FR6 A;  1TKD B;  2GS3 A;  1V40 A;  4IP6 A;  5CRD A;  3CSH A;  3IC4 A;  4N30 A;  4BL7 B;  2YCD A;  3GL5 A;  2FGX A;  4L8E A;  2JZR A;  2CVB A;  2PN8 A;  2LEG A;  5D9X A;  4IW9 A;  4ILF A;  1JLV A;  2KP1 A;  3ZRD A;  4ISD A;  3A2X A;  5D9W A;  2V1M A;  3C1R A;  4ML6 A;  2PGT A;  2O7K A;  2FNO A;  1N2A A;  4KND A;  1PX7 A;  2L4Q A;  2GSS A;  4LA1 A;  1URM A;  3IXR A;  3TOT A;  4FYU A;  3ERG A;  2A2S A;  1M9A A;  4PQ1 A;  1H4O A;  3IR4 A;  3FK8 A;  4ZL9 A;  3EWL A;  4DVC A;  1SD9 A;  1SJZ A;  2YN1 A;  2JU5 A;  5A4W A;  1UVZ A;  4KUN A;  3DD3 A;  4FH8 A;  2KHP A;  2CV4 A;  1TI3 A;  3TRX A;  10GS A;  5C04 A;  3N9J A;  1QFN A;  4HDE A;  4I6X A;  2K6V A;  3GX0 A;  2HSH A;  1QK8 A;  2VIM A;  3EVI A;  1R5A A;  1YKA A;  1PX6 A;  2E0Q A;  2YJ7 A;  2LST A;  2YJH A;  2FA8 A;  4GTU A;  2LJA A;  2J9H A;  2LV3 A;  3O3T A;  11GS A;  1HNB A;  4NWY A;  2GZP A;  3I43 A;  2AUV A;  1X5D A;  1QMV A;  2WS2 A;  1AIU A;  1SKS B;  2EIQ A;  2GZY A;  2C0E A;  3LFL A;  3L78 A;  1FB0 A;  4OD7 A;  4MZW A;  4ECI A;  1QXH A;  3TKS A;  4USS A;  3MWH A;  3H93 A;  3F4R A;  1GTA A;  4TXO A;  2ON5 A;  2H30 A;  2OE1 A;  2YWO A;  5E4W A;  1F2E A;  4MZC A;  2NBS A;  3P8W A;  4ZBA A;  2IFQ A;  4PUF C;  3FR3 A;  4YAP A;  4GQF A;  4RQR A;  1GTI A;  3WGE A;  2VM1 A;  2KLX A;  4LL4 B;  3KD0 A;  1YDK A;  1AW9 A;  5JCU A;  3C73 A;  1QGV A;  4K0N A;  1Z5Y E;  4OFT A;  1OYJ A;  1Z3E A;  5F0G A;  1S3A A;  2TRX A;  1XWC A;  2LJK A;  1S3D A;  2FY6 A;  3KP8 A;  1GSD A;  5IO2 A;  2V32 A;  2R5G A;  1K3Y A;  3GKN A;  3D5J A;  3LYK A;  1NSW A;  1Y25 A;  1PQN A;  3RPP A;  2C3Q A;  1YJ6 A;  1T4Y A;  2L5L A;  3TRP A;  4KW6 A;  2LKU A;  3IBH A;  3IOS A;  4TW5 A;  3L9U A;  1RQM A;  2O85 A;  4EDZ A;  4MH3 A;  3KP9 A;  4EC0 A;  5DCG A;  3DML A;  4OFM A;  1XW5 A;  1ON4 A;  3BCI A;  2K9F A;  1M2D A;  2HE3 A;  2C8U A;  1EGO A;  2FUG 2;  3WT1 A;  5A4U A;  1LJR A;  4F03 A;  2TRC P;  2CVD A;  2MMN A;  5IOW A;  1E2Y A;  3HY2 A;  1B9Y C;  2LJR A;  2V6K A;  1ERT A;  1J0F A;  2H0G A;  5DQY A;  3DKS A;  2YZH A;  4EVM A;  1FOV A;  2LRT A;  4KGI A;  3RBT A;  1IYH A;  2IPA A;  5ID2 A;  2C0D A;  5HFI A;  5GST A;  1B48 A;  3IPZ A;  1EOG A;  2YV7 A;  5IOX A;  1TRS A;  2C4J A;  4ULX A;  3ZML A;  3VLN A;  1ABA A;  4KB3 A;  2YPM A;  1J08 A;  3GIX A;  2N5F A;  4ZB9 A;  1PD2 1;  2V41 A;  1MD4 A;  1NHY A;  4XTS A;  3W8S A;  5CRH A;  3E3E A;  5ECN B;  2EIO A;  4LMV A;  4TN8 A;  1C72 A;  1TK0 B;  3F3R A;  1EV4 A;  3FKF A;  1Z6N A;  3WD6 A;  5C00 A;  2G0F A;  4MJB A;  4MH2 A;  3OR5 A;  4JED A;  4WEY A;  3H4K A;  4ECJ A;  2N5A A;  3TJF A;  1ZL9 A;  4POM A;  1Y6E A;  4HU9 A;  4DSR A;  1AAZ A;  3KJY A;  4EDY A;  2XPE A;  5ECI B;  4F9Z A;  1OC8 A;  3VPQ A;  2M72 A;  5G2Z A;  2VAF A;  3HD5 A;  1DSB A;  2VD0 A;  1BG5 A;  4IQ1 A;  1V2A A;  2B6M A;  3EU4 A;  1JZO A;  1E6B A;  4PQI A;  3PH9 A;  1AQV A;  1FB6 A;  3QCP A;  4F82 A;  2MBS A;  1M2A A;  2CAI A;  3DEX A;  1JZR A;  2HRF A;  1GSE A;  1KBN A;  3UL3 A;  3GX8 A;  2GQK A;  3IHQ A;  2VCT A;  4HZ4 A;  5D8I A;  7GSS A;  2PMT A;  1WMJ A;  4YQU A;  2F51 A;  2WFC A;  2VLU A;  5F06 A;  4XS6 A;  2LUS A;  3TJK A;  1G7E A;  3FEU A;  1K0B A;  4HJM A;  5HR0 A;  1USB A;  2HLS A;  3GKK A;  4JU5 A;  2H72 A;  3P7X A;  4I2U A;  5LD0 A;  3HJP A;  5COH A;  3CBU A;  1G7O A;  1T7P B;  1VF4 A;  1MEK A;  2O87 A;  22GS A;  2I1U A;  1OC9 B;  1OE7 A;  3DGQ A;  2BMX A;  3KMN A;  2H8L A;  2IMF A;  3H1N A;  2FWF A;  4KA0 A;  5IMA A;  4TR1 A;  2X99 A;  4ID0 A;  5FT3 A;  5CNW A;  4KSM A;  4OFN A;  2NTO A;  1U6T A;  3SWL A;  4PUA A;  3H79 A;  3HYP A;  2FD3 A;  2PPT A;  4WBJ A;  4ECB A;  1EGR A;  2JAD A;  2RLI A;  3D6I A;  2VUP A;  3TJB A;  1B4Q A;  3UMA A;  5JWQ B;  2FWG A;  1TDI A;  5IMD A;  4GF0 A;  2VCX A;  4MPF A;  1ERV A;  1X5E A;  4NPB A;  4XS4 A;  4TOP A;  2H6Y A;  3KH7 A;  4PX1 A;  5LCZ A;  5B8A A;  4XS1 A;  5DVB A;  2C3N A;  2OKA A;  2MZC A;  4WF5 A;  2PUK C;  1PL2 A;  3FZ5 A;  2PWJ A;  5G31 A;  3EIN A;  2HQT A;  3TOU A;  3KTB A;  2CZ3 A;  3EUR A;  4IS0 A;  4DSS A;  6GSX A;  3RAZ A;  3VI5 A;  4KDU A;  4IHU A;  4D73 A;  5ECL B;  4GSN A;  3UBL A;  4KCE A;  2RUE A;  3IE3 A;  3CYN A;  2FLS A;  1SL0 B;  1X0R A;  2AB6 A;  2C80 A;  5ELG A;  2WB9 A;  2UZ8 A;  1EP8 A;  1SK0 A;  4BVX A;  1R5P A;  2FCH A;  4GSS A;  1G6Y A;  3CSI A;  5FHI A;  1X9S B;  5LNK e;  3TRQ A;  2JZT A;  2MMA A;  1AXD A;  4PNG A;  1U3A A;  2CA8 A;  3IDV A;  4OCF A;  4MMM A;  1K3L A;  5EL8 A;  4KDY A;  3APO A;  5IMV A;  1T3B A;  3BD2 A;  5CP1 A;  4CHS A;  3FYG A;  4MJC A;  4O5R A;  3UVT A;  3VFI A;  1K0M A;  2L6C A;  5B6M A;  1U87 A;  4MF6 A;  3MSZ A;  1ERU A;  4LMW A;  4HI7 A;  3C1S A;  5B6N A;  4GXZ A;  4MZB A;  1I9D A;  3VK9 A;  1HNC A;  5HR3 A;  2LQQ A;  1GSY A;  5HFK A;  4IQA A;  1GTU A;  3LJR A;  3KZQ A;  3VWX A;  4EUY A;  1FVJ A;  1SJI A;  4EL1 A;  1CQH A;  4Q5R A;  3D22 A;  2YWM A;  1HQO A;  3F6D A;  3DWV A;  3M9J A;  5E59 A;  1S3C A;  3KTL A;  3TCO A;  4G0L A;  2CZ2 A;  4BVY A;  3A5W A;  5J3R A;  3N5O A;  2B1K A;  5DAK B;  4IP1 A;  3Q18 A;  5GAN D;  4I5Q A;  3ED3 A;  2B5Y A;  3TGZ A;  3TUE A;  1BJX A;  3A2W A;  4I97 A;  4EXJ A;  1H75 A;  4P3Y B;  4WET A;  4MPG A;  2BTO T;  3ZLP A;  2H1D A;  5HR2 A;  3FR9 A;  4K2D A;  3Q19 A;  1WPI A;  3KMO A;  1Z7P A;  4PXO A;  2NVL A;  2YOI A;  2F8F A;  3LWA A;  3F0I A;  4AJ7 A;  1IYI A;  1VF2 A;  1UA5 A;  14GS A;  1G0T A;  4PQH A;  2B7K A;  3ZIV A;  3ME7 A;  3F3Q A;  1OVN A;  3CRT A;  2V2G A;  1EZK A;  4K1F A;  3DYR A;  1Z6M A;  1M7T A;  1NHO A;  2HZE B;  4BL7 A;  1Z7R A;  1AC1 A;  3I6A A;  1ST9 A;  17GS A;  1F6M C;  2GQL A;  5ENU A;  4HOJ A;  3LGC A;  1Z9H A;  4G0I A;  4HUA A;  4L5L A;  4K6X A;  3C71 A;  4E8H A;  1HNA A;  1FW1 A;  2Z9S A;  2GQM A;  5DBQ A;  3L0H A;  3TKR A;  4AF2 A;  2EC4 A;  2DJ1 A;  1LU4 A;  3FY7 A;  3FHK A;  1M0U A;  1ZMA A;  1YY7 A;  4FQU A;  3A3T A;  2HFD A;  2CVK A;  2YZU A;  2KP2 A;  2H74 A;  2PBJ A;  4O32 A;  2L6D A;  1K0C A;  4NHW A;  5D9V A;  4PTS A;  3VI7 A;  2OBK A;  2OBI A;  1PGT A;  3J7Y b;  1SK2 A;  4N11 A;  1A8Y A;  4XCS A;  3HHV A;  1JLW A;  2H73 A;  1HYU A;  3TKQ A;  1DE1 A;  4LL1 B;  1BAY A;  2DLX A;  3KCM A;  4OCE A;  2MMO A;  5G1K A;  2VL2 C;  1K0D A;  5IIZ A;  3BJ5 A;  2L4C A;  4ZB8 A;  1V58 A;  2CX3 A;  2DJ3 A;  1SK1 A;  4J2F A;  3LQ7 A;  6GSV A;  1XVQ A;  6GSY A;  2JSZ A;  3UAR A;  3BOA A;  3L9S A;  2V6O A;  5F8B A;  5IMF A;  5B7C A;  4ZBB A;  2C0F A;  4GST A;  4Q5Q A;  3NZN A;  1VF3 A;  4JE1 A;  2NDO A;  2RII A;  2YWI A;  5L71 A;  2VM2 A;  1XVW A;  4NAX A;  1YZX A;  3M9K A;  3KM6 A;  2DSA A;  2DJ0 A;  3O76 A;  1SD8 A;  3IV4 A;  5JWR B;  1TW9 A;  2PVQ A;  4ZL8 A;  4MAB A;  3G7Y A;  3HCZ A;  2G2Q A;  1PKW A;  2B7J A;  4TRX A;  2CAQ A;  4GRF A;  5H5Q A;  4XHM A;  1ZCP A; 
#chains in the Genus database with same CATH topology
 4GLT A;  4KE3 A;  4N0V A;  3HVN A;  1W89 A;  2VL2 A;  2D2Z A;  3GST A;  2E2G A;  4GCI A;  2E2M A;  3GFK A;  4QMK A;  4QL7 A;  2VLV A;  1O81 A;  5DJL A;  2I9H A;  2X64 A;  12GS A;  2OT3 A;  3GNJ A;  1O73 A;  2M80 A;  3GV1 A;  4NMU A;  3ME8 A;  2VOC A;  3IAM 2;  3QD9 A;  3AY8 A;  5D96 A;  4PUR A;  2H0I A;  3TJG A;  3E0U A;  5F05 A;  4ZIJ A;  4G2E A;  2HNL A;  2DJK A;  2DKH A;  2F8A A;  3TKS E;  2GST A;  2LRC A;  5KN0 A;  2I3Y A;  3Q74 A;  4YAV A;  2EFD A;  2XHF A;  4O7H A;  2YP6 A;  5ECO B;  1ACV A;  2H66 A;  2C3T A;  1ML6 A;  3VUR A;  1KEB A;  4MF7 A;  2REM A;  1TU8 A;  1VGL A;  1GUM A;  2IME A;  2HSY A;  3VPT A;  2H1L A;  2HYX A;  1B4P A;  1EEM A;  4PGT A;  4WKW A;  1A24 A;  4KSO A;  3GKX A;  2WJU A;  4WBR D;  4IBP A;  5IMZ A;  1DBY A;  1GUH A;  2CX4 A;  5J9C A;  4TR3 A;  4AJ6 A;  4HQZ A;  2VD1 A;  1BX9 A;  1XG8 A;  1M99 A;  1PL1 A;  2RUF A;  1K0O A;  2WGR A;  2E7P A;  2HT9 A;  1XWA A;  5A4V A;  4ZXG A;  3I69 A;  1X5C A;  2WW0 A;  1FAA A;  5ECH B;  1XIY A;  2R6K A;  4GQC A;  3QFB C;  4G0K A;  4K2X A;  3TJJ A;  4ZBD A;  3H8Q A;  1OE8 A;  2IMI A;  4Z7X A;  3LYP A;  2IL3 A;  4AKX B;  1KTE A;  5CAX A;  4IVF A;  1ZGN A;  3HMJ G;  5HR1 A;  3RHC A;  1TK8 B;  1J9B A;  3HZ8 A;  1GL8 A;  2B5X A;  3GSS A;  1PRX A;  3LEF A;  4EF0 A;  3EYT A;  2AHE A;  1NW2 A;  1PN0 A;  3ZFB A;  3APS A;  5INY A;  2K8S A;  1XWK A;  9GSS A;  3WYW A;  4I2T A;  2PU9 C;  4NXI A;  4OMV A;  2MMZ A;  1M9B A;  2VCZ A;  4BPY A;  3GTU B;  1GWC A;  3FW2 A;  1XOB A;  3UEM A;  4K9Z A;  2HRK B;  4NV2 A;  2IWT A;  1WOU A;  1X9M B;  2OA7 A;  4ECC A;  4AGS A;  2H1B A;  3HJO A;  5FWG A;  1TP9 A;  1MTC A;  3CSJ A;  2LNT A;  3VWU A;  4V2L A;  8GSS A;  4CY8 A;  5AGY A;  2RM6 A;  1SKR B;  2AJQ B;  1XWG A;  3BCK A;  3QAW A;  3DIE A;  1SJ6 A;  5EPF A;  1EEJ A;  6GSU A;  5H5R A;  1WRY A;  2HI7 A;  3DVX A;  5J9B A;  2ZCT A;  3FRC A;  5G5E A;  4DEJ A;  3FZ9 A;  1OC9 A;  1A23 A;  4ML1 A;  4MDC A;  3MDK A;  2GLR A;  3KXO A;  3LSZ A;  5J5N A;  2HSM B;  3HVV A;  1GNE A;  1SVO A;  2L5O A;  5CRW A;  3LG6 A;  5KN3 A;  2FWE A;  1AQX A;  4ZB7 A;  3VWW A;  3ZL5 A;  2GGT A;  2DML A;  2P5R A;  4WF4 A;  3M3M A;  3US3 A;  3TU3 B;  1X9W B;  2CQ9 A;  5IO0 A;  5D93 A;  4H86 A;  3CXG A;  4N10 A;  2H71 A;  1VF1 A;  1DUG A;  1R4W A;  2O8V B;  4PNF A;  2AYT A;  4K0G A;  2H76 A;  3GMF A;  1K0A A;  5CYY A;  1K0N A;  1S3R A;  6GSW A;  4KDX A;  5GZZ B;  2VL3 A;  2R37 A;  3LW9 A;  5DAL B;  2LNS A;  2B5E A;  3GRX A;  3IRA A;  3G9B A;  2ZNM A;  2WDU A;  3ERF A;  2ES7 A;  2B1L A;  1EP7 A;  1TXX A;  5B8B A;  2H6X A;  4MA9 A;  1GSS A;  3CTF A;  3W6G A;  1XPV A;  4L0W A;  5IQY A;  2VCV A;  1YKC A;  2IIY A;  2GZZ A;  4MF5 A;  3CHX C;  2XBQ A;  4RI6 A;  3ZVJ D;  2VKZ G;  18GS A;  1T00 A;  2L59 A;  2GT6 A;  4ZIL A;  1O8X A;  1R26 A;  3RPN A;  3IC8 A;  3TDG A;  3QR6 A;  1F37 A;  1R7H A;  2OJL A;  1SKW B;  3RHB A;  1EV9 A;  4TXV A;  4ZL7 A;  2XBI A;  3ZIT A;  3KEB A;  5D73 A;  3ZRE A;  2KUC A;  5AIV A;  4WXT A;  2HZF A;  1MDK A;  5ECR B;  4ICY A;  1F9M A;  5GSS A;  3HKR A;  5IPG A;  5DAL A;  5J4U A;  1F3A A;  3U5R E;  4K5S A;  2IMD A;  4X1U A;  4POK A;  1GUL A;  3EE2 A;  2VL9 A;  4HZ2 A;  5DQS A;  3QOU A;  2AAW A;  3MNG A;  5ELA A;  3TKS C;  5BMU A;  1GLP A;  2H70 A;  3HZ4 A;  4TXO B;  3KIJ A;  4FIW A;  1A2M A;  3D21 A;  2GSQ A;  1ZYN A;  2QA2 A;  3F63 A;  2LQO A;  1XW9 A;  1GNW A;  1U3I A;  2IFQ B;  1V98 A;  1TTZ A;  1XFL A;  2IN3 A;  4IKH A;  1SU9 A;  4FO5 A;  3HA9 A;  3QFA C;  5F07 A;  3EC3 A;  4IEL A;  5DAK A;  2HRN A;  3L9V A;  2R4V A;  2P31 A;  4G01 A;  3DVW A;  1ZZY A;  2A2P A;  3WGX A;  5G5F A;  1B9X C;  1RK4 A;  1EOH A;  1ZOF A;  2QGV A;  4BA7 A;  3EMP A;  2X8H A;  3P2A A;  3DXB A;  1O85 A;  5A5K A;  3GHA A;  1MDI A;  4F0B A;  1Q98 A;  2KOK A;  16GS A;  5DCH A;  4NHZ A;  1XZO A;  4JZQ A;  3PIN A;  3GA4 A;  3WT2 A;  3MIX A;  1TU7 A;  1FG4 A;  4K7N A;  3J7Y k;  2XPD A;  13GS A;  3GH6 A;  4L0U A;  5EVO A;  2K8V A;  2DIY A;  3D4M A;  4MCU A;  3F8U A;  1O8W A;  1FVK A;  4IJ3 A;  4A5P A;  1GP1 A;  5ECK B;  2C0G A;  1T4Z A;  2R0C A;  1DE2 A;  1SVL A;  2HZE A;  4YKG A;  2EFH A;  1O6J A;  1XW6 A;  3HVS A;  4JBB A;  4FXY P;  5D9T A;  2QC7 A;  2DIZ A;  2QSI A;  3C8E A;  3A2V A;  4Q5N A;  2OAC A;  2YAN A;  4CY6 A;  4JRR A;  1THX A;  1OC3 A;  4POB A;  2WZ9 A;  3K8N A;  4IJI A;  6GSS A;  5ID2 B;  4RUV A;  4V1A p;  3TKP A;  4J56 E;  1YEP A;  3MYD A;  2YV9 A;  2BJX A;  4TR0 A;  1ZYP A;  4EKZ A;  1YF1 A;  1SL2 B;  1ERW A;  2A4V A;  1FHE A;  2GVP A;  2WZS A;  4MJA A;  1OAZ A;  4FYB A;  1GSQ A;  2CT6 A;  1JFU A;  6GST A;  3ZMK A;  1WWJ A;  4V2N A;  4XRD A;  1A2L A;  2VO4 A;  1T8E B;  1TRV A;  2VCQ A;  1O7U A;  2N5B A;  4MJE A;  2GDR A;  2VCW A;  1TI1 A;  3GKM A;  2DBC A;  4YKF A;  2HXK A;  1UN2 A;  4KX4 A;  5G1L A;  3MAK A;  4FYC A;  2HSN B;  4WR4 A;  1SL1 B;  4G19 A;  1T1V A;  5JWO B;  1HD2 A;  1OKT A;  2H75 A;  5A34 B;  3S9F A;  2F9S A;  3O6T A;  5HFG A;  2P5Q A;  2WVY A;  3QAV A;  4CDO A;  1EWX A;  4ZB6 A;  3PR8 A;  2LRN A;  4PI0 C;  4O92 A;  3D4T A;  1QQ2 A;  2DC5 A;  3UJ1 A;  3ZIJ A;  5ECM B;  3TB2 A;  2O36 A;  1PN9 A;  4HSC X;  4X43 A;  5ECS A;  3NIV A;  1OKD A;  3UAP A;  3FMW A;  3CMI A;  1SYX A;  3G7I A;  4QQ7 A;  2OAD A;  2H1G A;  2H19 A;  2K18 A;  2H6Z A;  4YQV A;  5CO3 A;  1XOA A;  3W8J A;  1BED A;  5KEJ A;  4QL9 A;  5G30 A;  2DMM A;  3EMX A;  3QPM A;  2O89 A;  1JZD A;  2RM5 A;  1SEN A;  3VWV A;  1G6W A;  4YQM A;  1PKZ A;  5ECP B;  2ZUP A;  4J57 E;  1AUC A;  2EFC A;  2XC2 A;  4OWY A;  1THO A;  1GRX A;  2FWH A;  2JL4 A;  1QUW A;  1WE0 A;  3GUR A;  2OE3 A;  2I81 A;  4GWR A;  1V9W A;  1LBK A;  3RFR C;  3CTG A;  3U6V A;  4OO4 A;  2ALB A;  5DJM A;  4V2M A;  4EIP A;  3IHG A;  4RI7 A;  4K7O A;  2EFE A;  3CRU A;  4L5O A;  1V57 A;  3ZYW A;  3M1G A;  4E8E A;  2EIR A;  2YNX A;  4POL A;  3IK7 A;  1VRS D;  2AV4 A;  1U88 A;  5DDL A;  5AN1 A;  2DJJ A;  1MD3 A;  3ERW A;  3GUS A;  3BBY A;  4TR1 B;  1FO5 A;  3UIW A;  2L57 A;  3HDC A;  4HJ2 A;  1WJK A;  3HXS A;  1FOH A;  4X4J A;  1K3O A;  4AKH A;  3PGT A;  2ON7 A;  1WP0 A;  4F2I A;  2I4A A;  1XBS A;  3D0Z A;  4JR6 A;  4HS1 A;  2PER A;  4JR4 A;  3P90 A;  5J41 A;  1GLQ A;  2M46 A;  4F0C A;  1TJD A;  3I9V 2;  1RW1 A;  1N8J A;  2OE0 A;  4XS4 B;  3SBC A;  2NPB A;  5IPH A;  3ZZX A;  4RQX A;  4BWQ A;  1YQ1 A;  1JZW A;  4KF9 A;  3UOM A;  2H1A A;  2C1Y A;  3E9J B;  4AI6 A;  2H01 A;  1B8X A;  3JCM L;  5IMC A;  20GS A;  4MK3 A;  3PPU A;  1MDJ A;  4Q5F A;  5CRG A;  3GH9 A;  3QMX A;  5AIX A;  4DSS B;  3GYK A;  1GH2 A;  1A8L A;  1M3J A;  3QAG A;  2IMK A;  4TR4 A;  5KN2 A;  2WCI A;  5ECQ B;  1W4V A;  5KN1 A;  3WGD A;  19GS A;  1SYR A;  4D73 B;  3ISO A;  3DRN A;  1PA3 A;  2TIR A;  3FZ4 A;  3QDN A;  4NV5 A;  2FHE A;  4PI2 C;  4WR5 A;  2LTK A;  4K8M A;  1TK5 B;  2F3M A;  4HQS A;  1XWB A;  3ZFL A;  1NM3 A;  5H5S A;  2GTU A;  4BVX B;  3IAS 2;  3EU3 A;  2B3S A;  2JSY A;  1A2J A;  1GTB A;  4V1A g;  1ZYE A;  3GL3 A;  1TRU A;  2GSR A;  3LOR A;  1ILO A;  2JZS A;  3F4T A;  3L4N A;  4MP4 A;  5CRE A;  1BQ7 A;  1GSF A;  1TRW A;  1UC7 A;  3C7M A;  3Q6O A;  4KH7 A;  4EE0 A;  3M8N A;  5GAP D;  1KNG A;  2WUL A;  3ZVJ A;  1JHB A;  1ZYQ B;  1XCC A;  3GN3 A;  2R2J A;  3LXZ A;  1A0F A;  3R3E A;  3F9U A;  1AQW A;  2DJ2 A;  2R0G A;  5IM9 A;  2R3X A;  4ACS A;  1M2B A;  4X0X A;  3IK9 A;  2GT5 A;  2WVX B;  1XXU A;  4HEA 2;  1F3B A;  4XIH A;  4N0Z A;  1I5G A;  1YEW C;  2YWN A;  3GTU A;  1YF0 A;  3UVH A;  4IN0 A;  3G7J A;  3APQ A;  3NOF A;  1BYE A;  1PMT A;  2X8G A;  1SVM A;  3IA1 A;  2A2R A;  2HRK A;  2PVO C;  4IGJ A;  5HQP A;  3KH9 A;  2LS5 A;  3M0F A;  1GSU A;  5EY6 A;  1PSQ A;  3ZTL A;  2MYG A;  4TKY A;  4BVY B;  4K7I A;  1WIK A;  4I8B A;  4G9H A;  4EO3 A;  5JCG A;  1Y1U A;  4LLR A;  4XRA A;  4DSQ A;  4AJ8 A;  2FA4 A;  3UBK A;  4CW9 A;  3R2Q A;  2X8C A;  1Q4J A;  3F6F A;  3V1W A;  4BWS A;  2QKE A;  5ABR A;  2WRT A;  3F4S A;  2MBT A;  1YEX A;  1A0R P;  3RDW A;  2JAC A;  5JCW A;  3HJM A;  2HSM A;  4KCA A;  1CQG A;  4YH2 A;  4HU7 A;  4G10 A;  1GUK A;  4TVE A;  1TOF A;  2H0H A;  2IJY A;  3KGK A;  5AIS A;  2O3E A;  2HRA A;  4OO5 A;  3HVX A;  4MLY A;  3FZA A;  2J23 A;  2VLT A;  3LXT A;  2P0G A;  4KAE A;  3FR6 A;  1TKD B;  2GS3 A;  1V40 A;  4IP6 A;  5CRD A;  3CSH A;  3IC4 A;  4N30 A;  4BL7 B;  2YCD A;  3GL5 A;  2FGX A;  4L8E A;  2JZR A;  2CVB A;  2PN8 A;  2DKI A;  2LEG A;  5D9X A;  4IW9 A;  4ILF A;  1JLV A;  2KP1 A;  3ZRD A;  4ISD A;  3A2X A;  5D9W A;  2V1M A;  3C1R A;  4ML6 A;  2R0P A;  2PGT A;  2O7K A;  2FNO A;  1N2A A;  4KND A;  1PX7 A;  2L4Q A;  2GSS A;  4LA1 A;  1URM A;  3IXR A;  3TOT A;  4FYU A;  3ERG A;  2A2S A;  1M9A A;  4PQ1 A;  1H4O A;  3IR4 A;  3FK8 A;  4ZL9 A;  3EWL A;  4DVC A;  1SD9 A;  1SJZ A;  2YN1 A;  2JU5 A;  5A4W A;  1UVZ A;  4KUN A;  3DD3 A;  4FH8 A;  2KHP A;  2CV4 A;  1TI3 A;  3TRX A;  10GS A;  5C04 A;  3N9J A;  1QFN A;  4Z2R A;  5A5H B;  4HDE A;  4I6X A;  2K6V A;  3GX0 A;  2HSH A;  1QK8 A;  2VIM A;  3EVI A;  1R5A A;  1YKA A;  1PX6 A;  2E0Q A;  2YJ7 A;  2LST A;  2YJH A;  2FA8 A;  4GTU A;  2LJA A;  2J9H A;  2LV3 A;  3O3T A;  11GS A;  1HNB A;  4NWY A;  2GZP A;  3I43 A;  2AUV A;  5J4Y A;  1X5D A;  1QMV A;  2WS2 A;  1AIU A;  1SKS B;  2EIQ A;  2GZY A;  2C0E A;  5A1N B;  3LFL A;  3L78 A;  1FB0 A;  4OD7 A;  4MZW A;  4ECI A;  1QXH A;  3TKS A;  4USS A;  3MWH A;  3H93 A;  3F4R A;  1GTA A;  4TXO A;  1N25 A;  1S4B P;  2ON5 A;  2H30 A;  2OE1 A;  2YWO A;  5E4W A;  1F2E A;  4W66 A;  4MZC A;  2NBS A;  3P8W A;  4ZBA A;  2IFQ A;  4PUF C;  3FR3 A;  2X4A A;  4YAP A;  4GDF A;  4GQF A;  4RQR A;  1GTI A;  3WGE A;  2VM1 A;  2KLX A;  4LL4 B;  3KD0 A;  1YDK A;  1AW9 A;  5JCU A;  3C73 A;  1QGV A;  4K0N A;  1Z5Y E;  4OFT A;  1OYJ A;  1Z3E A;  5F0G A;  1S3A A;  2TRX A;  1XWC A;  2LJK A;  1S3D A;  2FY6 A;  3KP8 A;  1GSD A;  5IO2 A;  2V32 A;  4MNN A;  2R5G A;  1K3Y A;  3GKN A;  3D5J A;  3LYK A;  1NSW A;  1Y25 A;  1PQN A;  3RPP A;  2C3Q A;  1YJ6 A;  1T4Y A;  2L5L A;  3TRP A;  4KW6 A;  2LKU A;  3IBH A;  3IOS A;  4TW5 A;  3L9U A;  1RQM A;  2O85 A;  4O5U A;  4EDZ A;  4MH3 A;  3KP9 A;  4EC0 A;  5DCG A;  3DML A;  4OFM A;  1XW5 A;  5KOX A;  1ON4 A;  3BCI A;  2K9F A;  1M2D A;  2HE3 A;  2C8U A;  1EGO A;  2FUG 2;  3WT1 A;  5A4U A;  1LJR A;  4F03 A;  2TRC P;  2CVD A;  2MMN A;  5IOW A;  1E2Y A;  3HY2 A;  1B9Y C;  2LJR A;  2V6K A;  1ERT A;  1J0F A;  2H0G A;  5DQY A;  3DKS A;  2YZH A;  4EVM A;  1FOV A;  2LRT A;  4KGI A;  3RBT A;  1IYH A;  2IPA A;  5ID2 A;  2C0D A;  5HFI A;  5GST A;  1B48 A;  3IPZ A;  1EOG A;  2YV7 A;  5IOX A;  1TRS A;  2C4J A;  4ULX A;  3CWG A;  3ZML A;  3VLN A;  1ABA A;  4KB3 A;  2YPM A;  1J08 A;  3GIX A;  2N5F A;  4ZB9 A;  1PD2 1;  2V41 A;  1MD4 A;  1NHY A;  4XTS A;  3W8S A;  5CRH A;  3E3E A;  5ECN B;  2EIO A;  4LMV A;  4TN8 A;  1C72 A;  1TK0 B;  3F3R A;  1EV4 A;  5J40 A;  3FKF A;  1Z6N A;  3WD6 A;  5C00 A;  2G0F A;  4MJB A;  4MH2 A;  3OR5 A;  4JED A;  4WEY A;  3H4K A;  5BRT A;  2HSN A;  4ECJ A;  5A34 A;  2N5A A;  3TJF A;  1ZL9 A;  4POM A;  1Y6E A;  4HU9 A;  4DSR A;  1AAZ A;  3KJY A;  4EDY A;  2XPE A;  5ECI B;  4F9Z A;  1OC8 A;  3VPQ A;  2M72 A;  5G2Z A;  2VAF A;  3HD5 A;  1DSB A;  2VD0 A;  4AKG A;  1BG5 A;  4IQ1 A;  1V2A A;  2B6M A;  3EU4 A;  1JZO A;  1E6B A;  4PQI A;  3PH9 A;  1AQV A;  1FB6 A;  3QCP A;  4F82 A;  2MBS A;  1M2A A;  2CAI A;  1BF5 A;  3DEX A;  1JZR A;  2HRF A;  1GSE A;  1KBN A;  4Z2T A;  3UL3 A;  3GX8 A;  2GQK A;  3IHQ A;  5KOW A;  2VCT A;  4HZ4 A;  5D8I A;  7GSS A;  2PMT A;  1WMJ A;  4YQU A;  2F51 A;  2WFC A;  2VLU A;  5F06 A;  4XS6 A;  2LUS A;  3TJK A;  1G7E A;  3FEU A;  1K0B A;  4HJM A;  5HR0 A;  1USB A;  2HLS A;  3GKK A;  1BG1 A;  4JU5 A;  2H72 A;  3P7X A;  4I2U A;  5LD0 A;  3HJP A;  5COH A;  3CBU A;  1G7O A;  1T7P B;  1VF4 A;  1MEK A;  2O87 A;  22GS A;  2I1U A;  1OC9 B;  2A4H A;  1OE7 A;  4EIQ A;  3DGQ A;  1YVL A;  2BMX A;  3KMN A;  2WW3 A;  2H8L A;  2IMF A;  3H1N A;  2FWF A;  4KA0 A;  5IMA A;  4TR1 A;  2X99 A;  4ID0 A;  5FT3 A;  5CNW A;  4KSM A;  4OFN A;  2NTO A;  1U6T A;  3SWL A;  4PUA A;  3H79 A;  3HYP A;  2FD3 A;  2PPT A;  4WBJ A;  4ECB A;  1EGR A;  2JAD A;  2RLI A;  3D6I A;  2VUP A;  3TJB A;  1B4Q A;  3UMA A;  5JWQ B;  2FWG A;  1TDI A;  5IMD A;  4GF0 A;  2VCX A;  4E68 A;  4MPF A;  1ERV A;  1X5E A;  4NPB A;  4XS4 A;  4TOP A;  2H6Y A;  3KH7 A;  4PX1 A;  5LCZ A;  5B8A A;  4XS1 A;  5DVB A;  2C3N A;  2OKA A;  2MZC A;  4WF5 A;  2PUK C;  1PL2 A;  3FZ5 A;  2PWJ A;  5G31 A;  3EIN A;  2HQT A;  3TOU A;  3KTB A;  2CZ3 A;  3EUR A;  4IS0 A;  4DSS A;  6GSX A;  3RAZ A;  3VI5 A;  4KDU A;  4IHU A;  2WW2 A;  4D73 A;  5ECL B;  4GSN A;  3UBL A;  4KCE A;  2RUE A;  3IE3 A;  3CYN A;  1M3I A;  2FLS A;  1SL0 B;  1X0R A;  2AB6 A;  2C80 A;  5ELG A;  2WB9 A;  2UZ8 A;  1EP8 A;  1SK0 A;  4BVX A;  1R5P A;  2FCH A;  4GSS A;  1G6Y A;  3CSI A;  5FHI A;  1X9S B;  5LNK e;  3TRQ A;  2JZT A;  2MMA A;  1AXD A;  4PNG A;  1U3A A;  2CA8 A;  3IDV A;  4OCF A;  4MMM A;  1K3L A;  5EL8 A;  4KDY A;  3APO A;  5IMV A;  1PFO A;  1T3B A;  3BD2 A;  5CP1 A;  4CHS A;  3FYG A;  4MJC A;  4O5R A;  3UVT A;  3VFI A;  1K0M A;  2L6C A;  5B6M A;  1U87 A;  4MF6 A;  3MSZ A;  2WVX A;  1ERU A;  4LMW A;  4HI7 A;  3C1S A;  5B6N A;  4GXZ A;  4MZB A;  1I9D A;  5BMU B;  3VK9 A;  1HNC A;  5HR3 A;  2LQQ A;  1GSY A;  5HFK A;  4IQA A;  1GTU A;  5J4V A;  3LJR A;  3KZQ A;  3VWX A;  2O5V A;  4EUY A;  1FVJ A;  1SJI A;  4EL1 A;  1CQH A;  4Q5R A;  3D22 A;  2YWM A;  1HQO A;  3F6D A;  3DWV A;  3M9J A;  5E59 A;  1S3C A;  3KTL A;  3TCO A;  4G0L A;  2CZ2 A;  2UV8 G;  4BVY A;  3A5W A;  5J3R A;  3N5O A;  2B1K A;  5DAK B;  4IP1 A;  3Q18 A;  5GAN D;  4I5Q A;  3ED3 A;  2B5Y A;  3TGZ A;  3TUE A;  1BJX A;  3A2W A;  4I97 A;  4Z2U A;  4EXJ A;  1H75 A;  4P3Y B;  4WET A;  4MPG A;  2BTO T;  3ZLP A;  2H1D A;  5HR2 A;  2WVZ A;  3FR9 A;  3Q19 A;  1WPI A;  4K2D A;  3KMO A;  1Z7P A;  4PXO A;  2NVL A;  2YOI A;  2F8F A;  3LWA A;  3F0I A;  4O5Q A;  4AJ7 A;  1IYI A;  1VF2 A;  1UA5 A;  14GS A;  1G0T A;  4PQH A;  2B7K A;  3ZIV A;  3ME7 A;  3F3Q A;  4AKI A;  1OVN A;  3CRT A;  5J47 A;  2X49 A;  2V2G A;  1EZK A;  4K1F A;  3DYR A;  1Z6M A;  1M7T A;  2WW1 A;  1NHO A;  4N3Z A;  2HZE B;  4BL7 A;  1Z7R A;  1AC1 A;  3I6A A;  1ST9 A;  17GS A;  1F6M C;  2GQL A;  5ENU A;  4HOJ A;  3LGC A;  1Z9H A;  4G0I A;  4HUA A;  4L5L A;  4K6X A;  3C71 A;  4E8H A;  1HNA A;  1FW1 A;  2Z9S A;  2GQM A;  5DBQ A;  3L0H A;  3TKR A;  4K5R A;  4AF2 A;  2EC4 A;  2DJ1 A;  1LU4 A;  3FY7 A;  3FHK A;  1M0U A;  1ZMA A;  1YY7 A;  4FQU A;  3A3T A;  2HFD A;  2CVK A;  2YZU A;  2KP2 A;  2H74 A;  2PBJ A;  4O32 A;  2L6D A;  1K0C A;  4NHW A;  5D9V A;  3CQF A;  4PTS A;  3VI7 A;  2OBK A;  2OBI A;  1PGT A;  3J7Y b;  2QA1 A;  1SK2 A;  4N11 A;  1A8Y A;  4XCS A;  3HHV A;  1JLW A;  2H73 A;  1HYU A;  3TKQ A;  1DE1 A;  4LL1 B;  1BAY A;  2DLX A;  3KCM A;  5A5H A;  4OCE A;  2MMO A;  5G1K A;  2VL2 C;  4BIK A;  1K0D A;  5IIZ A;  3BJ5 A;  3A5I A;  2L4C A;  4ZB8 A;  1V58 A;  4PHZ C;  2CX3 A;  2DJ3 A;  1SK1 A;  4J2F A;  1XVQ A;  3LQ7 A;  6GSV A;  1I1I P;  6GSY A;  2JSZ A;  3UAR A;  3BOA A;  1TXU A;  3EPT A;  3L9S A;  2V6O A;  5F8B A;  5IMF A;  5B7C A;  4ZBB A;  5A1N A;  2C0F A;  4GST A;  4Q5Q A;  3NZN A;  1VF3 A;  4JE1 A;  2NDO A;  2RII A;  2YWI A;  5L71 A;  2VM2 A;  1XVW A;  4NAX A;  1YZX A;  3M9K A;  3RGB C;  3KM6 A;  2DSA A;  2DJ0 A;  3O76 A;  1SD8 A;  3IV4 A;  5JWR B;  1TW9 A;  2PVQ A;  4ZL8 A;  4MAB A;  3G7Y A;  3HCZ A;  2G2Q A;  1PKW A;  2B7J A;  4TRX A;  2CAQ A;  4GRF A;  5H5Q A;  4XHM A;  1ZCP A; 
#chains in the Genus database with same CATH homology
 4GLT A;  4KE3 A;  4N0V A;  1W89 A;  2VL2 A;  2D2Z A;  3GST A;  2E2G A;  4GCI A;  2E2M A;  3GFK A;  4QMK A;  4QL7 A;  2VLV A;  1O81 A;  5DJL A;  2I9H A;  2X64 A;  12GS A;  2OT3 A;  3GNJ A;  1O73 A;  2M80 A;  3GV1 A;  4NMU A;  3ME8 A;  2VOC A;  3IAM 2;  3QD9 A;  3AY8 A;  5D96 A;  4PUR A;  2H0I A;  3TJG A;  3E0U A;  5F05 A;  4ZIJ A;  4G2E A;  2HNL A;  2DJK A;  2DKH A;  2F8A A;  3TKS E;  2GST A;  2LRC A;  5KN0 A;  2I3Y A;  3Q74 A;  4YAV A;  2EFD A;  2XHF A;  4O7H A;  2YP6 A;  5ECO B;  1ACV A;  2H66 A;  2C3T A;  1ML6 A;  3VUR A;  1KEB A;  4MF7 A;  2REM A;  1TU8 A;  1VGL A;  1GUM A;  2IME A;  2HSY A;  3VPT A;  2H1L A;  2HYX A;  1B4P A;  1EEM A;  4PGT A;  4WKW A;  1A24 A;  4KSO A;  3GKX A;  2WJU A;  4WBR D;  4IBP A;  5IMZ A;  1DBY A;  1GUH A;  2CX4 A;  5J9C A;  4TR3 A;  4AJ6 A;  4HQZ A;  2VD1 A;  1BX9 A;  1M99 A;  1PL1 A;  2RUF A;  1K0O A;  2WGR A;  2E7P A;  2HT9 A;  1XWA A;  5A4V A;  4ZXG A;  3I69 A;  1X5C A;  1FAA A;  5ECH B;  1XIY A;  2R6K A;  4GQC A;  3QFB C;  4G0K A;  4K2X A;  3TJJ A;  4ZBD A;  3H8Q A;  1OE8 A;  2IMI A;  4Z7X A;  3LYP A;  2IL3 A;  4AKX B;  1KTE A;  5CAX A;  4IVF A;  1ZGN A;  3HMJ G;  5HR1 A;  3RHC A;  1TK8 B;  1J9B A;  3HZ8 A;  1GL8 A;  2B5X A;  3GSS A;  1PRX A;  3LEF A;  4EF0 A;  3EYT A;  2AHE A;  1NW2 A;  1PN0 A;  3ZFB A;  3APS A;  5INY A;  2K8S A;  1XWK A;  9GSS A;  3WYW A;  4I2T A;  2PU9 C;  4NXI A;  4OMV A;  2MMZ A;  1M9B A;  2VCZ A;  4BPY A;  3GTU B;  1GWC A;  3FW2 A;  1XOB A;  3UEM A;  4K9Z A;  2HRK B;  4NV2 A;  2IWT A;  1WOU A;  1X9M B;  2OA7 A;  4ECC A;  4AGS A;  2H1B A;  3HJO A;  5FWG A;  1TP9 A;  1MTC A;  3CSJ A;  2LNT A;  3VWU A;  4V2L A;  8GSS A;  4CY8 A;  5AGY A;  2RM6 A;  1SKR B;  2AJQ B;  1XWG A;  3BCK A;  3QAW A;  3DIE A;  1SJ6 A;  5EPF A;  1EEJ A;  6GSU A;  5H5R A;  1WRY A;  2HI7 A;  3DVX A;  5J9B A;  2ZCT A;  3FRC A;  5G5E A;  4DEJ A;  3FZ9 A;  1OC9 A;  1A23 A;  4ML1 A;  4MDC A;  3MDK A;  2GLR A;  3KXO A;  3LSZ A;  5J5N A;  2HSM B;  3HVV A;  1GNE A;  1SVO A;  2L5O A;  5CRW A;  3LG6 A;  5KN3 A;  2FWE A;  1AQX A;  4ZB7 A;  3VWW A;  3ZL5 A;  2GGT A;  2DML A;  2P5R A;  4WF4 A;  3M3M A;  3US3 A;  3TU3 B;  1X9W B;  2CQ9 A;  5IO0 A;  5D93 A;  4H86 A;  3CXG A;  4N10 A;  2H71 A;  1VF1 A;  1DUG A;  1R4W A;  2O8V B;  4PNF A;  2AYT A;  4K0G A;  2H76 A;  3GMF A;  1K0A A;  5CYY A;  1K0N A;  6GSW A;  4KDX A;  5GZZ B;  2VL3 A;  2R37 A;  3LW9 A;  5DAL B;  2LNS A;  2B5E A;  3GRX A;  3IRA A;  3G9B A;  2ZNM A;  2WDU A;  3ERF A;  2ES7 A;  2B1L A;  1EP7 A;  1TXX A;  5B8B A;  2H6X A;  4MA9 A;  1GSS A;  3CTF A;  3W6G A;  1XPV A;  4L0W A;  5IQY A;  2VCV A;  1YKC A;  2IIY A;  2GZZ A;  4MF5 A;  2XBQ A;  4RI6 A;  3ZVJ D;  2VKZ G;  18GS A;  1T00 A;  2L59 A;  2GT6 A;  4ZIL A;  1O8X A;  1R26 A;  3RPN A;  3IC8 A;  3TDG A;  3QR6 A;  1F37 A;  1R7H A;  2OJL A;  1SKW B;  3RHB A;  1EV9 A;  4TXV A;  4ZL7 A;  2XBI A;  3ZIT A;  3KEB A;  5D73 A;  3ZRE A;  2KUC A;  5AIV A;  4WXT A;  2HZF A;  1MDK A;  5ECR B;  4ICY A;  1F9M A;  5GSS A;  3HKR A;  5IPG A;  5DAL A;  5J4U A;  1F3A A;  3U5R E;  4K5S A;  2IMD A;  4X1U A;  4POK A;  1GUL A;  3EE2 A;  2VL9 A;  4HZ2 A;  5DQS A;  3QOU A;  2AAW A;  3MNG A;  5ELA A;  3TKS C;  5BMU A;  1GLP A;  2H70 A;  3HZ4 A;  4TXO B;  3KIJ A;  4FIW A;  1A2M A;  3D21 A;  2GSQ A;  1ZYN A;  2QA2 A;  3F63 A;  2LQO A;  1XW9 A;  1GNW A;  1U3I A;  2IFQ B;  1V98 A;  1TTZ A;  1XFL A;  2IN3 A;  4IKH A;  1SU9 A;  4FO5 A;  3HA9 A;  3QFA C;  5F07 A;  3EC3 A;  4IEL A;  5DAK A;  2HRN A;  3L9V A;  2R4V A;  2P31 A;  4G01 A;  3DVW A;  1ZZY A;  2A2P A;  3WGX A;  5G5F A;  1B9X C;  1RK4 A;  1EOH A;  1ZOF A;  2QGV A;  4BA7 A;  3EMP A;  2X8H A;  3P2A A;  3DXB A;  1O85 A;  5A5K A;  3GHA A;  1MDI A;  4F0B A;  1Q98 A;  2KOK A;  16GS A;  5DCH A;  4NHZ A;  1XZO A;  4JZQ A;  3PIN A;  3GA4 A;  3WT2 A;  3MIX A;  1TU7 A;  1FG4 A;  4K7N A;  3J7Y k;  2XPD A;  13GS A;  3GH6 A;  4L0U A;  5EVO A;  2K8V A;  2DIY A;  3D4M A;  4MCU A;  3F8U A;  1O8W A;  1FVK A;  4IJ3 A;  4A5P A;  1GP1 A;  5ECK B;  2C0G A;  1T4Z A;  2R0C A;  1DE2 A;  1SVL A;  2HZE A;  4YKG A;  2EFH A;  1O6J A;  1XW6 A;  3HVS A;  4JBB A;  5D9T A;  2QC7 A;  2DIZ A;  2QSI A;  3C8E A;  3A2V A;  4Q5N A;  2OAC A;  2YAN A;  4CY6 A;  4JRR A;  1THX A;  1OC3 A;  4POB A;  2WZ9 A;  3K8N A;  4IJI A;  6GSS A;  5ID2 B;  4RUV A;  4V1A p;  3TKP A;  4J56 E;  1YEP A;  3MYD A;  2YV9 A;  2BJX A;  4TR0 A;  1ZYP A;  4EKZ A;  1YF1 A;  1SL2 B;  1ERW A;  2A4V A;  1FHE A;  2GVP A;  4MJA A;  1OAZ A;  4FYB A;  1GSQ A;  2CT6 A;  1JFU A;  6GST A;  3ZMK A;  1WWJ A;  4V2N A;  4XRD A;  1A2L A;  2VO4 A;  1T8E B;  1TRV A;  2VCQ A;  1O7U A;  2N5B A;  4MJE A;  2GDR A;  2VCW A;  1TI1 A;  3GKM A;  2DBC A;  4YKF A;  2HXK A;  1UN2 A;  4KX4 A;  5G1L A;  3MAK A;  4FYC A;  2HSN B;  4WR4 A;  1SL1 B;  4G19 A;  1T1V A;  5JWO B;  1HD2 A;  1OKT A;  2H75 A;  5A34 B;  3S9F A;  2F9S A;  3O6T A;  5HFG A;  2P5Q A;  3QAV A;  4CDO A;  1EWX A;  4ZB6 A;  3PR8 A;  2LRN A;  4O92 A;  3D4T A;  1QQ2 A;  2DC5 A;  3UJ1 A;  3ZIJ A;  5ECM B;  3TB2 A;  1PN9 A;  4X43 A;  5ECS A;  3NIV A;  1OKD A;  3UAP A;  3FMW A;  3CMI A;  1SYX A;  3G7I A;  4QQ7 A;  2OAD A;  2H1G A;  2H19 A;  2K18 A;  2H6Z A;  4YQV A;  5CO3 A;  1XOA A;  3W8J A;  1BED A;  5KEJ A;  4QL9 A;  5G30 A;  2DMM A;  3EMX A;  3QPM A;  2O89 A;  1JZD A;  2RM5 A;  1SEN A;  3VWV A;  1G6W A;  4YQM A;  1PKZ A;  5ECP B;  2ZUP A;  4J57 E;  1AUC A;  2EFC A;  2XC2 A;  4OWY A;  1THO A;  1GRX A;  2FWH A;  2JL4 A;  1QUW A;  1WE0 A;  3GUR A;  2OE3 A;  2I81 A;  4GWR A;  1V9W A;  1LBK A;  3CTG A;  3U6V A;  4OO4 A;  2ALB A;  5DJM A;  4V2M A;  4EIP A;  3IHG A;  4RI7 A;  4K7O A;  2EFE A;  3CRU A;  4L5O A;  1V57 A;  3ZYW A;  3M1G A;  4E8E A;  2EIR A;  2YNX A;  4POL A;  3IK7 A;  1VRS D;  2AV4 A;  1U88 A;  5DDL A;  5AN1 A;  2DJJ A;  1MD3 A;  3ERW A;  3GUS A;  3BBY A;  4TR1 B;  1FO5 A;  3UIW A;  2L57 A;  3HDC A;  4HJ2 A;  1WJK A;  3HXS A;  1FOH A;  4X4J A;  1K3O A;  4AKH A;  3PGT A;  2ON7 A;  1WP0 A;  4F2I A;  2I4A A;  1XBS A;  3D0Z A;  4JR6 A;  4HS1 A;  2PER A;  4JR4 A;  3P90 A;  5J41 A;  1GLQ A;  2M46 A;  4F0C A;  1TJD A;  3I9V 2;  1RW1 A;  1N8J A;  2OE0 A;  4XS4 B;  3SBC A;  2NPB A;  5IPH A;  3ZZX A;  4RQX A;  4BWQ A;  1YQ1 A;  1JZW A;  4KF9 A;  3UOM A;  2H1A A;  2C1Y A;  3E9J B;  4AI6 A;  2H01 A;  1B8X A;  3JCM L;  5IMC A;  20GS A;  4MK3 A;  3PPU A;  1MDJ A;  4Q5F A;  5CRG A;  3GH9 A;  3QMX A;  5AIX A;  4DSS B;  3GYK A;  1GH2 A;  1A8L A;  3QAG A;  2IMK A;  4TR4 A;  5KN2 A;  2WCI A;  5ECQ B;  1W4V A;  5KN1 A;  3WGD A;  19GS A;  1SYR A;  4D73 B;  3ISO A;  3DRN A;  1PA3 A;  2TIR A;  3FZ4 A;  3QDN A;  4NV5 A;  2FHE A;  4WR5 A;  2LTK A;  4K8M A;  1TK5 B;  2F3M A;  4HQS A;  1XWB A;  3ZFL A;  1NM3 A;  5H5S A;  2GTU A;  4BVX B;  3IAS 2;  3EU3 A;  2B3S A;  2JSY A;  1A2J A;  1GTB A;  4V1A g;  1ZYE A;  3GL3 A;  1TRU A;  2GSR A;  3LOR A;  1ILO A;  2JZS A;  3F4T A;  3L4N A;  4MP4 A;  5CRE A;  1BQ7 A;  1GSF A;  1TRW A;  1UC7 A;  3C7M A;  3Q6O A;  4KH7 A;  4EE0 A;  3M8N A;  5GAP D;  1KNG A;  2WUL A;  3ZVJ A;  1JHB A;  1ZYQ B;  1XCC A;  3GN3 A;  2R2J A;  3LXZ A;  1A0F A;  3R3E A;  3F9U A;  1AQW A;  2DJ2 A;  2R0G A;  5IM9 A;  2R3X A;  4ACS A;  1M2B A;  4X0X A;  3IK9 A;  2GT5 A;  1XXU A;  4HEA 2;  1F3B A;  4XIH A;  4N0Z A;  1I5G A;  2YWN A;  3GTU A;  1YF0 A;  3UVH A;  4IN0 A;  3G7J A;  3APQ A;  3NOF A;  1BYE A;  1PMT A;  2X8G A;  1SVM A;  3IA1 A;  2A2R A;  2HRK A;  2PVO C;  4IGJ A;  5HQP A;  3KH9 A;  2LS5 A;  3M0F A;  1GSU A;  5EY6 A;  1PSQ A;  3ZTL A;  2MYG A;  4TKY A;  4BVY B;  4K7I A;  1WIK A;  4I8B A;  4G9H A;  4EO3 A;  5JCG A;  1Y1U A;  4LLR A;  4XRA A;  4DSQ A;  4AJ8 A;  2FA4 A;  3UBK A;  4CW9 A;  3R2Q A;  2X8C A;  1Q4J A;  3F6F A;  3V1W A;  4BWS A;  2QKE A;  5ABR A;  2WRT A;  3F4S A;  2MBT A;  1YEX A;  1A0R P;  3RDW A;  2JAC A;  5JCW A;  3HJM A;  2HSM A;  4KCA A;  1CQG A;  4YH2 A;  4HU7 A;  4G10 A;  1GUK A;  4TVE A;  1TOF A;  2H0H A;  2IJY A;  3KGK A;  5AIS A;  2HRA A;  4OO5 A;  3HVX A;  4MLY A;  3FZA A;  2J23 A;  2VLT A;  3LXT A;  2P0G A;  4KAE A;  3FR6 A;  1TKD B;  2GS3 A;  1V40 A;  4IP6 A;  5CRD A;  3CSH A;  3IC4 A;  4N30 A;  4BL7 B;  2YCD A;  3GL5 A;  2FGX A;  4L8E A;  2JZR A;  2CVB A;  2PN8 A;  2DKI A;  2LEG A;  5D9X A;  4IW9 A;  4ILF A;  1JLV A;  2KP1 A;  3ZRD A;  4ISD A;  3A2X A;  5D9W A;  2V1M A;  3C1R A;  4ML6 A;  2R0P A;  2PGT A;  2O7K A;  2FNO A;  1N2A A;  4KND A;  1PX7 A;  2L4Q A;  2GSS A;  4LA1 A;  1URM A;  3IXR A;  3TOT A;  4FYU A;  3ERG A;  2A2S A;  1M9A A;  4PQ1 A;  1H4O A;  3IR4 A;  3FK8 A;  4ZL9 A;  3EWL A;  4DVC A;  1SD9 A;  1SJZ A;  2YN1 A;  2JU5 A;  5A4W A;  1UVZ A;  4KUN A;  3DD3 A;  4FH8 A;  2KHP A;  2CV4 A;  1TI3 A;  3TRX A;  10GS A;  5C04 A;  3N9J A;  1QFN A;  4Z2R A;  5A5H B;  4HDE A;  4I6X A;  2K6V A;  3GX0 A;  2HSH A;  1QK8 A;  2VIM A;  3EVI A;  1R5A A;  1YKA A;  1PX6 A;  2E0Q A;  2YJ7 A;  2LST A;  2YJH A;  2FA8 A;  4GTU A;  2LJA A;  2J9H A;  2LV3 A;  3O3T A;  11GS A;  1HNB A;  4NWY A;  2GZP A;  3I43 A;  2AUV A;  5J4Y A;  1X5D A;  1QMV A;  2WS2 A;  1AIU A;  1SKS B;  2EIQ A;  2GZY A;  2C0E A;  5A1N B;  3LFL A;  3L78 A;  1FB0 A;  4OD7 A;  4MZW A;  4ECI A;  1QXH A;  3TKS A;  4USS A;  3MWH A;  3H93 A;  3F4R A;  1GTA A;  4TXO A;  1N25 A;  2ON5 A;  2H30 A;  2OE1 A;  2YWO A;  5E4W A;  1F2E A;  4W66 A;  4MZC A;  2NBS A;  3P8W A;  4ZBA A;  2IFQ A;  4PUF C;  3FR3 A;  2X4A A;  4YAP A;  4GDF A;  4GQF A;  4RQR A;  1GTI A;  3WGE A;  2VM1 A;  2KLX A;  4LL4 B;  3KD0 A;  1YDK A;  1AW9 A;  5JCU A;  3C73 A;  1QGV A;  4K0N A;  1Z5Y E;  4OFT A;  1OYJ A;  1Z3E A;  5F0G A;  1S3A A;  2TRX A;  1XWC A;  2LJK A;  1S3D A;  2FY6 A;  3KP8 A;  1GSD A;  5IO2 A;  2V32 A;  4MNN A;  2R5G A;  1K3Y A;  3GKN A;  3D5J A;  3LYK A;  1NSW A;  1Y25 A;  1PQN A;  3RPP A;  2C3Q A;  1YJ6 A;  1T4Y A;  2L5L A;  3TRP A;  4KW6 A;  2LKU A;  3IBH A;  3IOS A;  4TW5 A;  3L9U A;  1RQM A;  2O85 A;  4O5U A;  4EDZ A;  4MH3 A;  3KP9 A;  4EC0 A;  5DCG A;  3DML A;  4OFM A;  1XW5 A;  5KOX A;  1ON4 A;  3BCI A;  2K9F A;  1M2D A;  2HE3 A;  2C8U A;  1EGO A;  2FUG 2;  3WT1 A;  5A4U A;  1LJR A;  4F03 A;  2TRC P;  2CVD A;  2MMN A;  5IOW A;  1E2Y A;  3HY2 A;  1B9Y C;  2LJR A;  2V6K A;  1ERT A;  1J0F A;  2H0G A;  5DQY A;  3DKS A;  2YZH A;  4EVM A;  1FOV A;  2LRT A;  4KGI A;  3RBT A;  1IYH A;  2IPA A;  5ID2 A;  2C0D A;  5HFI A;  5GST A;  1B48 A;  3IPZ A;  1EOG A;  2YV7 A;  5IOX A;  1TRS A;  2C4J A;  4ULX A;  3CWG A;  3ZML A;  3VLN A;  1ABA A;  4KB3 A;  2YPM A;  1J08 A;  3GIX A;  2N5F A;  4ZB9 A;  1PD2 1;  2V41 A;  1MD4 A;  1NHY A;  4XTS A;  3W8S A;  5CRH A;  3E3E A;  5ECN B;  2EIO A;  4LMV A;  4TN8 A;  1C72 A;  1TK0 B;  3F3R A;  1EV4 A;  5J40 A;  3FKF A;  1Z6N A;  3WD6 A;  5C00 A;  2G0F A;  4MJB A;  4MH2 A;  3OR5 A;  4JED A;  4WEY A;  3H4K A;  5BRT A;  2HSN A;  4ECJ A;  5A34 A;  2N5A A;  3TJF A;  1ZL9 A;  4POM A;  1Y6E A;  4HU9 A;  4DSR A;  1AAZ A;  3KJY A;  4EDY A;  2XPE A;  5ECI B;  4F9Z A;  1OC8 A;  3VPQ A;  2M72 A;  5G2Z A;  2VAF A;  3HD5 A;  1DSB A;  2VD0 A;  4AKG A;  1BG5 A;  4IQ1 A;  1V2A A;  2B6M A;  3EU4 A;  1JZO A;  1E6B A;  4PQI A;  3PH9 A;  1AQV A;  1FB6 A;  3QCP A;  4F82 A;  2MBS A;  1M2A A;  2CAI A;  1BF5 A;  3DEX A;  1JZR A;  2HRF A;  1GSE A;  1KBN A;  4Z2T A;  3UL3 A;  3GX8 A;  2GQK A;  3IHQ A;  5KOW A;  2VCT A;  4HZ4 A;  5D8I A;  7GSS A;  2PMT A;  1WMJ A;  4YQU A;  2F51 A;  2WFC A;  2VLU A;  5F06 A;  4XS6 A;  2LUS A;  3TJK A;  1G7E A;  3FEU A;  1K0B A;  4HJM A;  5HR0 A;  1USB A;  2HLS A;  3GKK A;  1BG1 A;  4JU5 A;  2H72 A;  3P7X A;  4I2U A;  5LD0 A;  3HJP A;  5COH A;  3CBU A;  1G7O A;  1T7P B;  1VF4 A;  1MEK A;  2O87 A;  22GS A;  2I1U A;  1OC9 B;  2A4H A;  1OE7 A;  4EIQ A;  3DGQ A;  1YVL A;  2BMX A;  3KMN A;  2H8L A;  2IMF A;  3H1N A;  2FWF A;  4KA0 A;  5IMA A;  4TR1 A;  2X99 A;  4ID0 A;  5FT3 A;  5CNW A;  4KSM A;  4OFN A;  2NTO A;  1U6T A;  3SWL A;  4PUA A;  3H79 A;  3HYP A;  2FD3 A;  2PPT A;  4WBJ A;  4ECB A;  1EGR A;  2JAD A;  2RLI A;  3D6I A;  2VUP A;  3TJB A;  1B4Q A;  3UMA A;  5JWQ B;  2FWG A;  1TDI A;  5IMD A;  4GF0 A;  2VCX A;  4E68 A;  4MPF A;  1ERV A;  1X5E A;  4NPB A;  4XS4 A;  4TOP A;  2H6Y A;  3KH7 A;  4PX1 A;  5LCZ A;  5B8A A;  4XS1 A;  5DVB A;  2C3N A;  2OKA A;  2MZC A;  4WF5 A;  2PUK C;  1PL2 A;  3FZ5 A;  2PWJ A;  5G31 A;  3EIN A;  2HQT A;  3TOU A;  3KTB A;  2CZ3 A;  3EUR A;  4IS0 A;  4DSS A;  6GSX A;  3RAZ A;  3VI5 A;  4KDU A;  4IHU A;  4D73 A;  5ECL B;  4GSN A;  3UBL A;  4KCE A;  2RUE A;  3IE3 A;  3CYN A;  2FLS A;  1SL0 B;  1X0R A;  2AB6 A;  2C80 A;  5ELG A;  2WB9 A;  2UZ8 A;  1EP8 A;  1SK0 A;  4BVX A;  1R5P A;  2FCH A;  4GSS A;  1G6Y A;  3CSI A;  5FHI A;  1X9S B;  5LNK e;  3TRQ A;  2JZT A;  2MMA A;  1AXD A;  4PNG A;  1U3A A;  2CA8 A;  3IDV A;  4OCF A;  4MMM A;  1K3L A;  5EL8 A;  4KDY A;  3APO A;  5IMV A;  1T3B A;  3BD2 A;  5CP1 A;  4CHS A;  3FYG A;  4MJC A;  4O5R A;  3UVT A;  3VFI A;  1K0M A;  2L6C A;  5B6M A;  1U87 A;  4MF6 A;  3MSZ A;  1ERU A;  4LMW A;  4HI7 A;  3C1S A;  5B6N A;  4GXZ A;  4MZB A;  1I9D A;  5BMU B;  3VK9 A;  1HNC A;  5HR3 A;  2LQQ A;  1GSY A;  5HFK A;  4IQA A;  1GTU A;  5J4V A;  3LJR A;  3KZQ A;  3VWX A;  2O5V A;  4EUY A;  1FVJ A;  1SJI A;  4EL1 A;  1CQH A;  4Q5R A;  3D22 A;  2YWM A;  1HQO A;  3F6D A;  3DWV A;  3M9J A;  5E59 A;  1S3C A;  3KTL A;  3TCO A;  4G0L A;  2CZ2 A;  2UV8 G;  4BVY A;  3A5W A;  5J3R A;  3N5O A;  2B1K A;  5DAK B;  4IP1 A;  3Q18 A;  5GAN D;  4I5Q A;  3ED3 A;  2B5Y A;  3TGZ A;  3TUE A;  1BJX A;  3A2W A;  4I97 A;  4Z2U A;  4EXJ A;  1H75 A;  4P3Y B;  4WET A;  4MPG A;  2BTO T;  3ZLP A;  2H1D A;  5HR2 A;  3FR9 A;  3Q19 A;  1WPI A;  4K2D A;  3KMO A;  1Z7P A;  4PXO A;  2NVL A;  2YOI A;  2F8F A;  3LWA A;  3F0I A;  4O5Q A;  4AJ7 A;  1IYI A;  1VF2 A;  1UA5 A;  14GS A;  1G0T A;  4PQH A;  2B7K A;  3ZIV A;  3ME7 A;  3F3Q A;  4AKI A;  1OVN A;  3CRT A;  5J47 A;  2X49 A;  2V2G A;  1EZK A;  4K1F A;  3DYR A;  1Z6M A;  1M7T A;  1NHO A;  4N3Z A;  2HZE B;  4BL7 A;  1Z7R A;  1AC1 A;  3I6A A;  1ST9 A;  17GS A;  1F6M C;  2GQL A;  5ENU A;  4HOJ A;  3LGC A;  1Z9H A;  4G0I A;  4HUA A;  4L5L A;  4K6X A;  3C71 A;  4E8H A;  1HNA A;  1FW1 A;  2Z9S A;  2GQM A;  5DBQ A;  3L0H A;  3TKR A;  4K5R A;  4AF2 A;  2EC4 A;  2DJ1 A;  1LU4 A;  3FY7 A;  3FHK A;  1M0U A;  1ZMA A;  1YY7 A;  4FQU A;  3A3T A;  2HFD A;  2CVK A;  2YZU A;  2KP2 A;  2H74 A;  2PBJ A;  4O32 A;  2L6D A;  1K0C A;  4NHW A;  5D9V A;  4PTS A;  3VI7 A;  2OBK A;  2OBI A;  1PGT A;  3J7Y b;  2QA1 A;  1SK2 A;  4N11 A;  1A8Y A;  4XCS A;  3HHV A;  1JLW A;  2H73 A;  1HYU A;  3TKQ A;  1DE1 A;  4LL1 B;  1BAY A;  2DLX A;  3KCM A;  5A5H A;  4OCE A;  2MMO A;  5G1K A;  2VL2 C;  1K0D A;  5IIZ A;  3BJ5 A;  3A5I A;  2L4C A;  4ZB8 A;  1V58 A;  2CX3 A;  2DJ3 A;  1SK1 A;  4J2F A;  1XVQ A;  3LQ7 A;  6GSV A;  6GSY A;  2JSZ A;  3UAR A;  3BOA A;  1TXU A;  3EPT A;  3L9S A;  2V6O A;  5F8B A;  5IMF A;  5B7C A;  4ZBB A;  5A1N A;  2C0F A;  4GST A;  4Q5Q A;  3NZN A;  1VF3 A;  4JE1 A;  2NDO A;  2RII A;  2YWI A;  5L71 A;  2VM2 A;  1XVW A;  4NAX A;  1YZX A;  3M9K A;  3KM6 A;  2DSA A;  2DJ0 A;  3O76 A;  1SD8 A;  3IV4 A;  5JWR B;  1TW9 A;  2PVQ A;  4ZL8 A;  4MAB A;  3G7Y A;  3HCZ A;  2G2Q A;  1PKW A;  2B7J A;  4TRX A;  2CAQ A;  4GRF A;  5H5Q A;  4XHM A;  1ZCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...