3AY8A

Glutathione s-transferase unclassified 2 from bombyx mori
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
215
structure length
215
Chain Sequence
SSLKLYHFPVSGPSRGALLAARAIGIPIQIEIVNLFKKEQLQESFLKLNPQHCVPTLDDNNFVLWESRAIACYLADKYGKDDQWYPKDLQKRAVVNQRLYFDSASLYVKIRAICFPILFLGETEIKQSLKDDLNSTLSFLNQFLEKTKWVAADHPTIADTSIYASMSSILAVGWDISSFPNIQRWIKDCLLLPGAPENEDGARTFGDAVKKNIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Crystallographic survey of active sites of an unclassified glutathione transferase from Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
total genus 81
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ay8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ay8A01
2LEGA 3OR5A 2P5QA 1QXHA 1X5EA 5C04A 1OKTA 3GNJA 4MJBA 2BMXA 2ES7A 1AQVA 1LJRA 3GKKA 2P5RA 4CDOA 1HYUA 1O85A 3CTGA 3FK8A 5EY6A 3KMOA 1Z6MA 2GQLA 5J4UA 3GSSA 1RQMA 4JE1A 3HA9A 5ECHB 1N2AA 3ZMKA 2J9HA 4G9HA 2D2ZA 4N30A 3CSIA 2NPBA 2LRCA 1SKWB 5EPFA 1YZXA 2H0HA 3CMIA 3F3QA 4ECJA 3KEBA 3DWVA 3F3RA 5HFIA 2N5FA 1GUKA 2IIYA 3ZMLA 2V1MA 2H70A 2V32A 3G7YA 2H1DA 1MEKA 4F2IA 1E2YA 1QK8A 2YOIA 1B8XA 1SENA 4NHZA 1F3AA 3R2QA 1QGVA 3O3TA 3E3EA 5D93A 2H74A 3WGXA 6GSWA 4EKZA 2IMIA 4TXOB 2R3XA 2LNSA 1ACVA 2LJKA 1WE0A 4PURA 1GNWA 2JSYA 3LEFA 2FWFA 2L6DA 2I4AA 3KTBA 1TKDB 5G5FA 1ZGNA 1MTCA 4MH2A 3D4MA 4OFNA 5J9BA 4JU5A 2VUPA 4NWYA 1NHYA 5IO0A 1NM3A 2OBIA 2B1LA 4DSSB 3D4TA 2JZSA 2R37A 2NTOA 1QUWA 4AF2A 5G1LA 5ECPB 5A5KA 3IAS2 1PQNA 3EURA 4QQ7A 3L9VA 4KB3A 1QQ2A 4KW6A 2HSHA 2IJYA 2OE0A 2YCDA 4WF4A 1VF4A 2HNLA 4NV2A 5IMFA 5H5RA 1ERTA 5A4VA 1V98A 3C1SA 2MMOA 4ZL8A 5HR3A 3APOA 3TJFA 3IRAA 4KA0A 4LMVA 4TW5A 4G0KA 4FYUA 1O7UA 2E2GA 8GSSA 4K1FA 3IXRA 3TJGA 2C3QA 4DSRA 2H0GA 4X1UA 3ZREA 3LFLA 3TKRA 5INYA 4DVCA 3W8JA 2H66A 1JLWA 4BA7A 4FYCA 4ECCA 1UC7A 4WR4A 3TJKA 2WS2A 4KNDA 5AGYA 2LTKA 4V1Ap 1K0AA 4ULXA 2YWOA 5IMDA 4ML6A 3GURA 5FWGA 2RM6A 3AY8A 1LU4A 4BVYA 2HSMB 1G6YA 1HNAA 1O8WA 1UA5A 4NPBA 1GL8A 4WEYA 2O89A 4I8BA 5B6NA 2Z9SA 2RUEA 2GTUA 1E6BA 2C80A 4K8MA 3HXSA 3HYPA 2LQQA 2GQMA 4G2EA 5G30A 1UN2A 5ECKB 1U88A 3UOMA 3RHCA 2I9HA 13GSA 1GSFA 4HEA2 1Z9HA 5ECLB 1NHOA 1XOAA 4MF5A 4OCEA 1X5CA 1R5PA 1V2AA 5J3RA 2X64A 3M3MA 3EWLA 3BOAA 2AV4A 5FHIA 5DCHA 2OBKA 1XCCA 1ZL9A 5F06A 2I3YA 3ED3A 5EVOA 3GX0A 4XCSA 4G19A 2VL9A 3LORA 4TR1B 1PL2A 1DUGA 2GSSA 1T00A 2H6XA 4MF7A 4NXIA 2GZPA 2RLIA 3LXZA 4XRAA 1A24A 4O92A 2XHFA 5DDLA 5DALB 2H76A 2MBSA 6GSXA 1YDKA 5AIVA 1J9BA 3CBUA 3TDGA 2MZCA 2TIRA 1GSSA 3APSA 1WWJA 2O8VB 3LYPA 3GSTA 2KP2A 2WFCA 2MMAA 2QKEA 3GN3A 2L5OA 1H4OA 2VLTA 2R5GA 2AAWA 1DSBA 2HRNA 2LJAA 5GAND 5D9VA 4IBPA 4CHSA 1AAZA 2K9FA 4XS4B 2HQTA 1OAZA 2H72A 2I1UA 2HE3A 2AUVA 2VCTA 2H73A 2FUG2 5GZZB 2C4JA 1WOUA 1V58A 4IP1A 1YKCA 2CZ3A 1TTZA 2M80A 2H1GA 3VPQA 3ZVJD 4JBBA 1GWCA 4I5QA 1F9MA 3L4NA 2JL4A 4RI7A 1USBA 2H19A 1KNGA 2PU9C 3BBYA 4IS0A 2PUKC 3PR8A 2IN3A 2V2GA 4WBJA 1M2AA 2FHEA 3VURA 1O6JA 2GS3A 3L9UA 2C0EA 4WF5A 4TR4A 1YF1A 2X8CA 2WCIA 1RK4A 1WP0A 4KSMA 2FWEA 3QFBC 1TI3A 3US3A 2K8VA 1X5DA 1GUMA 3TRQA 3RHBA 1OC9B 2JADA 5CREA 3P90A 3VI5A 2PBJA 4KX4A 2VLVA 2ON5A 3I43A 1Z3EA 3DYRA 1PKZA 6GSUA 1TRUA 1T7PB 2VD1A 4RUVA 3A3TA 2VCWA 5ECQB 2QGVA 4V2MA 4POMA 2IPAA 2CVKA 2KHPA 2VCXA 1FOVA 1EV4A 4BVXB 2LKUA 3QCPA 2DJ1A 1B9XC 5BMUA 3EU4A 3PGTA 1GRXA 1EEJA 2E2MA 1PA3A 4F03A 4IJ3A 5IQYA 1EGRA 2GGTA 4ZILA 3N9JA 5IO2A 3W6GA 3KM6A 1ON4A 4PQIA 2QC7A 2YV9A 3BCIA 3VLNA 4WETA 5IMCA 2GVPA 3TUEA 4MABA 5ECRB 2R6KA 4V2LA 5JCGA 3TKSC 5JWRB 1QFNA 4MCUA 2A2RA 3ZYWA 1ZCPA 1V57A 1T4YA 4L5OA 4IQ1A 5F0GA 1OE7A 1EZKA 4LL1B 3A2WA 3GV1A 2MMNA 3GUSA 9GSSA 1PX6A 5CRHA 4ZL7A 2VCZA 3O6TA 4V2NA 2H8LA 1TP9A 2LJRA 4LMWA 2H1BA 2DSAA 4PQHA 3EC3A 2MYGA 1XWGA 3J7Yb 4FO5A 5HR2A 2XBIA 5COHA 4K7NA 4MK3A 4ECIA 2F8FA 1XVQA 5LD0A 2FA4A 1K3LA 1GSYA 3DXBA 1PMTA 3FRCA 1DE1A 4WXTA 2PGTA 3ZL5A 1XWCA 4Q5RA 4POBA 2B7JA 1U3AA 2HSYA 3GTUB 1XWAA 2VM1A 1K0MA 1EP8A 3I6AA 4MH3A 3H93A 4OFTA 2HYXA 4DSSA 4ISDA 4Q5QA 4PQ1A 4EUYA 3TJJA 4KE3A 3VFIA 2AJQB 3VI7A 1VF3A 1B4PA 4HQSA 2B6MA 5IMAA 2H30A 2FNOA 2FLSA 3HDCA 5CO3A 4E8HA 4YQVA 1BQ7A 4NV5A 4PNFA 4I2UA 3M1GA 1XBSA 4HI7A 2IMFA 2OADA 3D5JA 2H1AA 2RIIA 4MJAA 4I97A 1AC1A 4JR4A 3WD6A 1HQOA 2DJ3A 1WRYA 3KP9A 3FKFA 4O32A 2VL3A 3EVIA 3MSZA 1JZDA 3VWXA 1MDKA 4ACSA 4CW9A 4MZWA 1GLPA 1GSEA 2F8AA 1B9YC 1UVZA 2EC4A 5DQSA 3FZAA 3H8QA 1Q4JA 5DAKB 1TOFA 5IPGA 3F4SA 3NIVA 1GTAA 2IL3A 3KIJA 5CRGA 4LLRA 5EL8A 5KEJA 1BX9A 2CV4A 1A2JA 1K0NA 2PVQA 1OE8A 3JCML 4KAEA 1ZMAA 2M46A 1WMJA 3K8NA 1J0FA 16GSA 5DCGA 2FWHA 2REMA 5C00A 3KCMA 1SK1A 4IP6A 2AB6A 4LL4B 3E0UA 4AJ8A 3F8UA 4BL7B 2VL2C 1PSQA 2X8HA 3IHQA 4O5RA 1O81A 3HKRA 1MDIA 1ZOFA 2MMZA 3DD3A 4GQFA 3KXOA 1Y6EA 1A2MA 4HOJA 5IPHA 3LG6A 3GH9A 4GXZA 4N0VA 1GUHA 3GL3A 3LGCA 4KCEA 1XIYA 4HZ4A 2I81A 1FHEA 2N5AA 3KD0A 3E9JB 1M7TA 5H5QA 5DJMA 2V41A 1EEMA 4N0ZA 4EL1A 2JU5A 3L0HA 1F3BA 3TRXA 3LSZA 1G7EA 3C1RA 3DVWA 1X9SB 1AIUA 5D9XA 4PUFC 1PKWA 3HJOA 1C72A 6GSTA 2R2JA 4DEJA 1EOHA 2FY6A 1OC3A 4HU7A 2WRTA 4OO5A 3M9JA 1BEDA 3P2AA 4TKYA 4GQCA 5CAXA 2ZUPA 2IMDA 1X9WB 1TK5B 4E8EA 1XZOA 4GF0A 1GH2A 2C8UA 2YZUA 2OE1A 3DVXA 2GLRA 2C1YA 1G7OA 4TR1A 5JCWA 1KTEA 3TCOA 2GZYA 2YN1A 1ILOA 2B5XA 1B4QA 4K6XA 5D9WA 1SKSB 5DALA 4MP4A 4XHMA 1ZYEA 3ERFA 5G2ZA 5ECIB 2EIQA 2IMEA 1K3OA 4AJ6A 1DE2A 5DJLA 3P7XA 2L5LA 5LCZA 2WDUA 2WULA 1AUCA 5ABRA 2PERA 6GSSA 3KH7A 2UZ8A 3HZ4A 1DBYA 1SJZA 4F82A 2TRCP 3D6IA 4I2TA 1Q98A 3DGQA 3ZITA 1VF2A 3ZTLA 2IFQB 5HFGA 3TKSA 3QR6A 2YWMA 3BCKA 2HSNB 2AYTA 4IHUA 6GSYA 4IJIA 2GDRA 1F2EA 1CQGA 1ML6A 2E0QA 3CTFA 4PTSA 4O7HA 1F37A 4XS1A 2GSTA 4ZBDA 1SK0A 4TVEA 2B7KA 4PGTA 1EGOA 4USSA 5D73A 1XW5A 4ZBBA 4OMVA 5ECNB 3Q74A 4KH7A 2EIOA 2O85A 2VIMA 2DIYA 3F6DA 2G2QA 4MF6A 1FVKA 1EV9A 3DMLA 1JZWA 2MBTA 3IC4A 2B5EA 4AGSA 4XRDA 3HVVA 1Z6NA 3QD9A 1YY7A 1A8YA 2B3SA 3EMPA 5E59A 1SD8A 1OC9A 4WBRD 2L4QA 1HNCA 1XW9A 2X99A 11GSA 1ERUA 2L6CA 4IELA 2K6VA 3PH9A 2PN8A 3C73A 1YKAA 3WGDA 5KN2A 1O73A 1BAYA 5KN0A 2LQOA 3CXGA 1YF0A 4BVXA 1VGLA 4HQZA 4JZQA 1T1VA 1AQXA 4PX1A 2HZEB 5AISA 5DQYA 1LBKA 5IM9A 2PMTA 1GSQA 3HZ8A 5JWOB 3EU3A 4ML1A 2V6OA 3FZ4A 3A2VA 4YQMA 3KH9A 4GRFA 3UBKA 1SKRB 4K0NA 3TKQA 4L0WA 1BG5A 3IBHA 5L71A 1ZZYA 4K2DA 2XPDA 1TXXA 1GTBA 3LWAA 3A5WA 3ME8A 2V6KA 3HVSA 3C71A 5D8IA 3HD5A 1SD9A 3F63A 1BJXA 2A4VA 4HJ2A 5B8BA 1JZOA 2CZ2A 2K8SA 5CRDA 2IMKA 3FR9A 1XFLA 3GIXA 1Y25A 4POKA 3ZIJA 4ZXGA 4JR6A 2WGRA 4HDEA 1RW1A 1A0FA 3IPZA 4NMUA 1JFUA 2CVBA 4QL9A 4MZBA 4K0GA 2TRXA 4OD7A 2HRKA 2OA7A 1PL1A 2VCQA 2VL2A 1SYXA 1GSDA 1T3BA 3SBCA 3DIEA 4GLTA 2XPEA 3J7Yk 5IOXA 10GSA 1FW1A 2ALBA 4MPGA 2FWGA 1PRXA 5ID2B 1WIKA 3G7IA 1GTIA 3QPMA 1URMA 2L59A 4YAVA 3P8WA 3IK7A 3ZVJA 4HJMA 2JZRA 3KGKA 1U87A 3L9SA 3G7JA 2G0FA 4JEDA 1R7HA 3HY2A 3GL5A 1OKDA 3DEXA 2RM5A 2VCVA 4EO3A 4D73B 3BJ5A 3TKSE 3ZFBA 3GMFA 1A0RP 1M9AA 2NDOA 2GSQA 3QOUA 2GZZA 2HZFA 3NOFA 1U6TA 2C0DA 2IWTA 2YANA 1FVJA 4MZCA 4GSNA 2KLXA 1R5AA 1K0CA 3FW2A 3TGZA 2HFDA 5ECMB 2VLUA 2YJHA 1AQWA 5F05A 2YPMA 4HU9A 3H1NA 2F3MA 3KJYA 3ERWA 2H6YA 2F51A 1TJDA 4TXOA 1IYHA 5LNKe 3MDKA 1SU9A 3R3EA 4ZB8A 3WT2A 5ELGA 2L4CA 5AN1A 4EXJA 2NBSA 2DJJA 1OC8A 1XOBA 1GNEA 2CQ9A 4WKWA 4KDYA 2LV3A 2ZNMA 1KBNA 3RPPA 3UMAA 2DJKA 4X0XA 2DBCA 3PPUA 4BL7A 1S3CA 1YEXA 2DLXA 4EDYA 2YZHA 3IK9A 4J56E 4ECBA 4HUAA 1ERVA 2WB9A 2HI7A 2RUFA 1YEPA 2PVOC 5ELAA 5GSSA 2LUSA 2KP1A 5DVBA 5HFKA 3UJ1A 2H6ZA 2O87A 1AW9A 4ZL9A 5IOWA 3M9KA 1HD2A 5B6MA 1XXUA 5F8BA 4RQRA 3KTLA 6GSVA 3QAGA 5CP1A 3M8NA 3KMNA 1T4ZA 3F6FA 2YWIA 2N5BA 4MDCA 2GQKA 3IOSA 3FYGA 1M2BA 14GSA 3IAM2 2JSZA 17GSA 1OYJA 4ID0A 2DJ0A 2KOKA 1FG4A 1EWXA 5GAPD 4POLA 1GTUA 4PNGA 2B1KA 5G5EA 2O7KA 5HR1A 1SJ6A 5E4WA 4IKHA 4FH8A 3WT1A 4IVFA 3TRPA 3V1WA 1WPIA 1BYEA 3IE3A 3TB2A 4XTSA 4L8EA 5H5SA 3KZQA 1TRWA 1MDJA 3RPNA 3MNGA 3FEUA 20GSA 3UAPA 1K3YA 3UIWA 1XVWA 2HSMA 2FA8A 1NW2A 5AIXA 3VK9A 1IYIA 2VO4A 2OACA 1FB6A 3GH6A 2M72A 2CVDA 4RI6A 5A4UA 1EP7A 4K7OA 4P3YB 2VAFA 2C0FA 4ZB9A 4TR0A 2LSTA 1VRSD 1SL1B 1TRSA 2IFQA 1GSUA 1EOGA 3PINA 2XBQA 4JRRA 2KUCA 1X9MB 1SYRA 4IGJA 2BJXA 3VWWA 1H75A 3UVHA 3F4TA 3U6VA 4ZBAA 1PGTA 1YJ6A 2P31A 1V40A 4BWQA 3FZ5A 2VM2A 2CAQA 4X43A 1A8LA 3RBTA 1J08A 5CRWA 1ZYQB 3C8EA 1W89A 1M99A 4FQUA 2HT9A 4LA1A 1M0UA 5HQPA 4TR3A 3HVXA 3ZFLA 3F0IA 2H01A 2NVLA 3Q18A 4KUNA 1ABAA 2E7PA 5ECOB 2CAIA 2JACA 3CSHA 12GSA 2CX4A 2HRFA 5J5NA 3W8SA 1TU7A 3HCZA 1K0OA 22GSA 4J57E 3UL3A 3H4KA 1TRVA 3UEMA 3QDNA 3TJBA 2PPTA 2AHEA 5CNWA 3LYKA 3WYWA 3A2XA 3VWVA 1TK8B 1SK2A 3IV4A 2J23A 1XW6A 1T8EB 2YNXA 1PN9A 3LJRA 2GT6A 4OFMA 1VF1A 4NAXA 2C3NA 5KN3A 1XPVA 3MWHA 1XWKA 1O8XA 4PXOA 2HZEA 2DC5A 4YQUA 2ON7A 2HXKA 4XS4A 5HR0A 4GSTA 4IN0A 2EIRA 5A4WA 3LXTA 2DJ2A 2YJ7A 1A23A 1THXA 2CT6A 5G1KA 5B8AA 3HHVA 3G9BA 3I9V2 1Z7RA 5DBQA 3GRXA 4H86A 1KEBA 4ZIJA 3ME7A 3DRNA 2H71A 1R26A 3ZZXA 19GSA 3H79A 1G0TA 3FHKA 3APQA 1GLQA 3NZNA 3HJMA 1M2DA 4EVMA 5D96A 3CRTA 1AXDA 3Q6OA 1ST9A 4MMMA 1I9DA 2X8GA 2LRNA 3ZIVA 2HLSA 1F6MC 1ERWA 7GSSA 3S9FA 1M9BA 4I6XA 4F0BA 2GSRA 3U5RE 3UARA 4HZ2A 1JHBA 2BTOT 2LRTA 1V9WA 5IMZA 4IW9A 3GKNA 3QMXA 4BWSA 3IDVA 3GKMA 4QL7A 3RDWA 3HJPA 2LS5A 2CA8A 5G31A 3F4RA 4MLYA 4BPYA 3O76A 4G0LA 5JWQB 2HRAA 1QMVA 4TOPA 2GT5A 4BVYB 3IR4A 3F9UA 4J2FA 3LQ7A 1JLVA 2R4VA 3CYNA 5ID2A 2H0IA 5ECSA 2VD0A 1R4WA 2JZTA 1Z7PA 2ZCTA 1X0RA 4RQXA 4MJCA 4KDXA 1K0BA 4N10A 3ZLPA 1GULA 1FAAA 4DSQA 4Q5NA 3GA4A 3Q19A 1N8JA 1HNBA 4PUAA 4XS6A 4D73A 3QFAC 2FCHA 4V1Ag 2DMLA 4K7IA 4AJ7A 4ILFA 3GKXA 2B5YA 3N5OA 3GX8A 2YWNA 3I69A 4MJEA 1TW9A 4G10A 4KGIA 2VOCA 3GYKA 1XWBA 3TOTA 4EC0A 2DIZA 1YQ1A 5FT3A 4YAPA 2P0GA 3IC8A 4WR5A 1JZRA 4OO4A 4L5LA 4GTUA 4F0CA 2L57A 3GHAA 3D21A 5JCUA 1FO5A 1B48A 4KSOA 4GCIA 3GFKA 1TK0B 1NSWA 3IA1A 3SWLA 4IQAA 1PD21 3QAVA 1K0DA 2FGXA 2H75A 2FD3A 4OWYA 3ZRDA 3BD2A 4MA9A 1THOA 3CRUA 4NHWA 5GSTA 2C0GA 3M0FA 3CSJA 3GTUA 1G6WA 2OE3A 1GP1A 2C3TA 4KDUA 1MD4A 1W4VA 4FYBA 2YP6A 4N11A 5B7CA 3UVTA 4F9ZA 3KP8A 4KCAA 5F07A 2LNTA 3EMXA 1CQHA 2YV7A 4FIWA 3ISOA 4ZB6A 3EYTA 4G0IA 5KN1A 4GWRA 4XIHA 3WGEA 3UBLA 4OCFA 4Q5FA 4KF9A 3TKPA 5ENUA 1S3DA 1TI1A 4EDZA 3VWUA 4MPFA 3TOUA 5IIZA 1FB0A 1OVNA 2OJLA 4HS1A 2XC2A 1TDIA 1TU8A 2CX3A 1A2LA 2QSIA 1MD3A 5IMVA 3VPTA 3MAKA 4TRXA 3FR6A 1WJKA 4TXVA 4YH2A 3FR3A 18GSA 1SJIA 3L78A 5DAKA 3D0ZA 5CYYA 1U3IA 5J9CA 3FZ9A 3ERGA 1Z5YE 1SL0B 2F9SA 3D22A 4EE0A 2WJUA 2DMMA 3C7MA 4GSSA 5D9TA 3RAZA 2OKAA 1SL2B 3EE2A 2K18A 4Z7XA 2HRKB 1S3AA 2PWJA 3FY7A 5J41A 1PX7A 3EINA 3DKSA 4L0UA 2A2SA 4TN8A 4K9ZA 4EF0A 2WZ9A 1I5GA 3QAWA
chains in the Genus database with same CATH superfamily
2LEGA 3OR5A 2P5QA 1QXHA 1X5EA 5C04A 1OKTA 3GNJA 4MJBA 2BMXA 2ES7A 1YVLA 1AQVA 1LJRA 1FOHA 3GKKA 2P5RA 4CDOA 1HYUA 1O85A 3CTGA 3FK8A 5EY6A 4EIPA 3KMOA 1Z6MA 2GQLA 5J4UA 3GSSA 1RQMA 4JE1A 3HA9A 5ECHB 1N2AA 3ZMKA 2J9HA 4G9HA 2D2ZA 4N30A 3CSIA 2NPBA 2H1LA 2LRCA 1SKWB 5EPFA 1YZXA 2H0HA 3CMIA 3F3QA 4ECJA 3KEBA 3DWVA 3F3RA 5HFIA 2N5FA 1GUKA 2IIYA 3ZMLA 2V1MA 2H70A 2V32A 3G7YA 2H1DA 1MEKA 4F2IA 1E2YA 1QK8A 2YOIA 1B8XA 1SENA 4NHZA 1SVLA 1F3AA 3R2QA 1QGVA 3O3TA 3E3EA 5D93A 2H74A 3WGXA 6GSWA 4EKZA 2IMIA 4TXOB 2R3XA 2LNSA 1ACVA 2LJKA 1WE0A 4PURA 1GNWA 2JSYA 3LEFA 2FWFA 2L6DA 2I4AA 3KTBA 2DKIA 1TKDB 5G5FA 1ZGNA 4E68A 1SVOA 1MTCA 4MH2A 3D4MA 4OFNA 5J9BA 4JU5A 2VUPA 4NWYA 1NHYA 5IO0A 1NM3A 2OBIA 2B1LA 4DSSB 3D4TA 2JZSA 2R37A 2NTOA 1QUWA 4AF2A 5G1LA 5ECPB 5A5KA 3IAS2 1PQNA 3HMJG 3EURA 4QQ7A 3L9VA 4KB3A 1QQ2A 4KW6A 2HSHA 2IJYA 2OE0A 2YCDA 5J4VA 4WF4A 1VF4A 2HNLA 4NV2A 5IMFA 2WVXA 5H5RA 1ERTA 3EPTA 5A4VA 1V98A 3C1SA 2MMOA 4ZL8A 5HR3A 3APOA 3TJFA 3IRAA 3A5IA 4KA0A 4LMVA 4TW5A 4G0KA 4FYUA 1O7UA 2E2GA 8GSSA 4K1FA 3IXRA 2A4HA 3TJGA 2C3QA 4DSRA 2H0GA 4X1UA 3ZREA 3LFLA 3TKRA 3LW9A 5INYA 2O3EA 4DVCA 5A34A 2H66A 3W8JA 1JLWA 4BA7A 4FYCA 4ECCA 2QA2A 1UC7A 4WR4A 3TJKA 2WS2A 4KNDA 5AGYA 2LTKA 4V1Ap 1K0AA 4ULXA 2YWOA 5IMDA 4ML6A 3GURA 5FWGA 2RM6A 3AY8A 2X4AA 1LU4A 4BVYA 4ZB7A 2HSMB 1G6YA 1HNAA 1O8WA 2WVZA 1UA5A 4NPBA 1GL8A 4N3ZA 4WEYA 2O89A 4I8BA 5B6NA 2Z9SA 2RUEA 2GTUA 1E6BA 2C80A 4K8MA 3HXSA 3HYPA 2LQQA 2GQMA 4G2EA 5G30A 1UN2A 5ECKB 1U88A 3UOMA 3RHCA 2I9HA 13GSA 1GSFA 4HEA2 4Z2TA 1Z9HA 5ECLB 1NHOA 1XOAA 2EFDA 4MF5A 4OCEA 1X5CA 1R5PA 1V2AA 5J3RA 2X64A 4PHZC 3M3MA 3EWLA 3BOAA 2AV4A 5FHIA 5DCHA 2OBKA 1XCCA 1ZL9A 5F06A 2R0CA 1BF5A 2I3YA 3ED3A 5EVOA 3GX0A 4XCSA 4G19A 2VL9A 4GDFA 3LORA 4TR1B 1PL2A 4AI6A 1DUGA 2GSSA 1T00A 2H6XA 4MF7A 4NXIA 2GZPA 2RLIA 3LXZA 4XRAA 1A24A 4O92A 2XHFA 5DDLA 5DALB 2H76A 2MBSA 6GSXA 1YDKA 5AIVA 1J9BA 3CBUA 3TDGA 2MZCA 4AKIA 2TIRA 1GSSA 3APSA 1WWJA 2O8VB 3LYPA 1M3JA 3GSTA 2KP2A 2WFCA 2MMAA 2QKEA 3GN3A 2L5OA 1H4OA 2VLTA 2R5GA 2AAWA 1DSBA 2HRNA 2LJAA 5GAND 5D9VA 4IBPA 4CHSA 1AAZA 2K9FA 4XS4B 2HQTA 1OAZA 2H72A 2I1UA 2HE3A 2AUVA 4CY6A 2VCTA 2H73A 1PFOA 2FUG2 5GZZB 2C4JA 1WOUA 1V58A 4IP1A 1YKCA 2CZ3A 1TTZA 2M80A 2H1GA 2WZSA 3VPQA 3ZVJD 4JBBA 1GWCA 4I5QA 1F9MA 3L4NA 2JL4A 4RI7A 1USBA 2H19A 3RFRC 1KNGA 2PU9C 3BBYA 4IS0A 2PUKC 3PR8A 2IN3A 2V2GA 4WBJA 1M2AA 2FHEA 3VURA 1O6JA 2GS3A 3L9UA 2C0EA 4WF5A 4TR4A 1YF1A 2X8CA 2WCIA 1RK4A 1WP0A 4KSMA 2FWEA 3QFBC 1TI3A 3US3A 2K8VA 1X5DA 1GUMA 3TRQA 3RHBA 4YKGA 1OC9B 2JADA 5CREA 3P90A 3VI5A 2PBJA 4KX4A 2VLVA 2ON5A 3I43A 1Z3EA 3DYRA 1PKZA 6GSUA 1TRUA 1T7PB 2VD1A 4RUVA 3A3TA 2VCWA 5ECQB 2QGVA 4V2MA 4POMA 2IPAA 2CVKA 2KHPA 2VCXA 1FOVA 1EV4A 4BVXB 2LKUA 3QCPA 2DJ1A 1B9XC 5BMUA 3EU4A 3PGTA 1GRXA 1EEJA 2E2MA 1PA3A 4F03A 4IJ3A 5IQYA 1EGRA 2GGTA 4ZILA 3N9JA 5IO2A 3W6GA 3KM6A 1ON4A 4PQIA 2QC7A 2YV9A 3BCIA 3VLNA 1Y1UA 4WETA 5IMCA 2GVPA 3TUEA 4MABA 5ECRB 2R6KA 4V2LA 5JCGA 3TKSC 5JWRB 1QFNA 4MCUA 2A2RA 2R0PA 3ZYWA 4BIKA 1ZCPA 1V57A 1T4YA 4L5OA 4IQ1A 5F0GA 1OE7A 1EZKA 4LL1B 3A2WA 4O5QA 3GV1A 2MMNA 3GUSA 9GSSA 1PX6A 5CRHA 4ZL7A 2VCZA 3O6TA 4V2NA 2H8LA 1TP9A 2LJRA 4LMWA 2H1BA 2DSAA 4PQHA 3EC3A 2MYGA 1XWGA 3J7Yb 4FO5A 5HR2A 2XBIA 5COHA 4K7NA 2QA1A 4MK3A 4ECIA 2F8FA 1XVQA 5LD0A 2FA4A 1K3LA 1GSYA 3DXBA 1PMTA 3FRCA 1DE1A 4WXTA 4AKHA 2PGTA 2DKHA 3ZL5A 1XWCA 4Q5RA 4POBA 2B7JA 1U3AA 2HSYA 3GTUB 1XWAA 2VM1A 1K0MA 1EP8A 3I6AA 4MH3A 3H93A 4OFTA 2HYXA 4DSSA 4ISDA 4Q5QA 4PQ1A 4EUYA 3TJJA 4KE3A 3VFIA 2AJQB 3VI7A 1VF3A 1B4PA 4HQSA 2B6MA 5IMAA 2H30A 2FNOA 2FLSA 3HDCA 5CO3A 4E8HA 4YQVA 1BQ7A 2WW1A 4NV5A 4PNFA 4I2UA 3M1GA 2WW3A 1XBSA 4HI7A 2IMFA 2OADA 3D5JA 2H1AA 2RIIA 4MJAA 4I97A 1AC1A 4JR4A 3WD6A 1HQOA 2DJ3A 1S4BP 1WRYA 3KP9A 3FKFA 4O32A 2VL3A 3EVIA 3MSZA 1JZDA 3VWXA 1MDKA 4ACSA 4CW9A 4A5PA 4MZWA 1GLPA 1GSEA 2F8AA 1B9YC 1UVZA 2EC4A 5DQSA 3FZAA 3H8QA 1Q4JA 5DAKB 1TOFA 5IPGA 3F4SA 3NIVA 1GTAA 2IL3A 3KIJA 5CRGA 4LLRA 5EL8A 5KEJA 1BX9A 2CV4A 1A2JA 1K0NA 2PVQA 1OE8A 3JCML 4KAEA 1ZMAA 2M46A 1WMJA 3K8NA 1J0FA 4CY8A 16GSA 5DCGA 2FWHA 2REMA 5C00A 3KCMA 1SK1A 4IP6A 2AB6A 4LL4B 3E0UA 4AJ8A 3F8UA 4BL7B 2VL2C 1PSQA 2X8HA 3IHQA 4O5RA 1O81A 3HKRA 1MDIA 1ZOFA 2MMZA 3DD3A 4GQFA 3KXOA 1Y6EA 1A2MA 4HOJA 5IPHA 4Z2UA 3LG6A 3GH9A 3GL3A 4N0VA 1GUHA 4GXZA 3LGCA 1ZYNA 4KCEA 1XIYA 4HZ4A 2I81A 1FHEA 2N5AA 3KD0A 3E9JB 1M7TA 5H5QA 5DJMA 2V41A 1EEMA 4N0ZA 1BG1A 4EL1A 2JU5A 3L0HA 2X49A 1F3BA 3TRXA 3LSZA 1G7EA 3C1RA 3DVWA 1X9SB 1AIUA 5D9XA 4PUFC 1PKWA 3HJOA 1C72A 6GSTA 2R2JA 4DEJA 1EOHA 2FY6A 1OC3A 4HU7A 2EFCA 2WRTA 4OO5A 3M9JA 1BEDA 3P2AA 4TKYA 4GQCA 5CAXA 2ZUPA 2IMDA 1X9WB 1TK5B 4E8EA 1XZOA 4GF0A 1GH2A 2C8UA 2YZUA 2OE1A 3DVXA 2GLRA 2C1YA 1G7OA 4TR1A 5JCWA 2O5VA 1KTEA 3TCOA 2GZYA 2YN1A 1ILOA 2B5XA 1B4QA 4K6XA 5D9WA 1SKSB 5DALA 4MP4A 4XHMA 1ZYEA 3ERFA 5G2ZA 5ECIB 2EIQA 2IMEA 1K3OA 4AJ6A 1DE2A 5DJLA 3P7XA 2L5LA 5LCZA 2WDUA 2WULA 1AUCA 5ABRA 2PERA 6GSSA 3KH7A 2UZ8A 3HZ4A 1DBYA 1SJZA 4F82A 2TRCP 3D6IA 4I2TA 1Q98A 3DGQA 3ZITA 1VF2A 3ZTLA 2IFQB 5HFGA 3TKSA 3QR6A 2YWMA 3BCKA 2HSNB 2AYTA 4IHUA 6GSYA 4IJIA 2GDRA 1F2EA 1CQGA 1ML6A 2E0QA 3CTFA 4PTSA 4O7HA 1F37A 4XS1A 2GSTA 4ZBDA 1SK0A 4TVEA 2B7KA 2WVXB 4PGTA 1EGOA 4USSA 5D73A 4PI2C 1XW5A 4ZBBA 4OMVA 5ECNB 3Q74A 1S3RA 4KH7A 2EIOA 2O85A 2VIMA 2DIYA 3F6DA 2G2QA 4MF6A 1FVKA 4K5SA 1EV9A 3DMLA 1JZWA 2WVYA 2MBTA 3IC4A 2B5EA 4AGSA 4XRDA 3HVVA 1Z6NA 3QD9A 1YY7A 1A8YA 2B3SA 3EMPA 5E59A 1SD8A 4QMKA 1OC9A 4WBRD 2L4QA 1HNCA 1XW9A 2X99A 11GSA 1ERUA 2L6CA 4IELA 2K6VA 3IHGA 3PH9A 2PN8A 3C73A 1YKAA 3WGDA 5KN2A 1XG8A 1O73A 1BAYA 5A5HB 5KN0A 2LQOA 3CXGA 1YF0A 4BVXA 1VGLA 4HQZA 4JZQA 4FXYP 1T1VA 1AQXA 4PX1A 2HZEB 5A1NB 5AISA 1SVMA 5DQYA 1LBKA 5IM9A 2PMTA 1GSQA 3HZ8A 5JWOB 3EU3A 4ML1A 2V6OA 3FZ4A 3A2VA 4YQMA 3KH9A 4GRFA 3UBKA 1SKRB 4K0NA 3TKQA 4L0WA 1BG5A 3IBHA 5L71A 1ZZYA 4K2DA 2XPDA 1TXXA 1GTBA 3LWAA 3A5WA 3ME8A 2V6KA 3HVSA 3C71A 4PI0C 5D8IA 3HD5A 1SD9A 3F63A 1BJXA 2A4VA 4HJ2A 5B8BA 1JZOA 2CZ2A 2K8SA 5CRDA 2IMKA 3FR9A 1XFLA 3GIXA 1Y25A 4POKA 3ZIJA 4ZXGA 4JR6A 2WGRA 4HDEA 1RW1A 1A0FA 3IPZA 4NMUA 1JFUA 2CVBA 4QL9A 4MZBA 4K0GA 2TRXA 4OD7A 2HRKA 2OA7A 1PL1A 2VCQA 2VL2A 1SYXA 1GSDA 1T3BA 3SBCA 3DIEA 4GLTA 2XPEA 3J7Yk 5IOXA 10GSA 1FW1A 2ALBA 4MPGA 2FWGA 1PRXA 5ID2B 1WIKA 3G7IA 1GTIA 3QPMA 1URMA 2L59A 4YAVA 1PN0A 3P8WA 3IK7A 3ZVJA 4HJMA 2JZRA 3KGKA 1U87A 3L9SA 3G7JA 2G0FA 4JEDA 1R7HA 3HY2A 3GL5A 1OKDA 3DEXA 2RM5A 2VCVA 4EO3A 4D73B 3BJ5A 3TKSE 3ZFBA 3GMFA 1A0RP 1M9AA 2NDOA 2GSQA 3QOUA 2GZZA 2HZFA 3NOFA 1U6TA 2C0DA 2IWTA 2YANA 1FVJA 4MZCA 4GSNA 2KLXA 4K5RA 1R5AA 1K0CA 3FW2A 3TGZA 2HFDA 5ECMB 2VLUA 2YJHA 1AQWA 5F05A 1YEWC 2YPMA 4HU9A 3H1NA 2F3MA 3KJYA 3ERWA 2H6YA 2F51A 1TJDA 4TXOA 1IYHA 5LNKe 3MDKA 1SU9A 3R3EA 4ZB8A 3MYDA 3WT2A 5ELGA 2L4CA 5AN1A 4EXJA 2NBSA 2DJJA 1OC8A 1XOBA 1GNEA 2CQ9A 4WKWA 4KDYA 2LV3A 2ZNMA 3RGBC 1KBNA 3RPPA 3UMAA 2DJKA 4X0XA 2DBCA 3PPUA 4BL7A 3TU3B 1S3CA 1YEXA 2DLXA 5BMUB 4EDYA 2YZHA 3IK9A 4J56E 4ECBA 4HUAA 1ERVA 2WB9A 2HI7A 2RUFA 1YEPA 2PVOC 4EIQA 5ELAA 5GSSA 2LUSA 2KP1A 2A2PA 5DVBA 5HFKA 3UJ1A 2H6ZA 2O87A 1AW9A 4ZL9A 5IOWA 3M9KA 1HD2A 5B6MA 1XXUA 5F8BA 4RQRA 3KTLA 6GSVA 3QAGA 5CP1A 3M8NA 3KMNA 1T4ZA 3F6FA 2YWIA 2OT3A 1ZYPA 2N5BA 4MDCA 4G01A 2GQKA 3IOSA 3FYGA 1M2BA 14GSA 3IAM2 2JSZA 17GSA 1OYJA 4ID0A 2DJ0A 2KOKA 1FG4A 1EWXA 5GAPD 4POLA 1GTUA 4PNGA 2B1KA 5G5EA 2O7KA 5HR1A 1SJ6A 5E4WA 5J47A 4IKHA 4FH8A 3WT1A 4IVFA 3TRPA 3V1WA 3FMWA 1WPIA 1BYEA 3IE3A 3TB2A 4XTSA 2EFEA 4L8EA 5H5SA 3KZQA 1TRWA 1MDJA 3RPNA 3MNGA 3FEUA 3CHXC 20GSA 3UAPA 1K3YA 3UIWA 1XVWA 2HSMA 2FA8A 1NW2A 5AIXA 3VK9A 1IYIA 2VO4A 2OACA 1FB6A 3GH6A 2M72A 2CVDA 4RI6A 5A4UA 1EP7A 4K7OA 4P3YB 2VAFA 2C0FA 4ZB9A 4TR0A 4X4JA 2LSTA 2O36A 1VRSD 1SL1B 1TRSA 2IFQA 1GSUA 1EOGA 3PINA 2XBQA 4JRRA 2HSNA 2KUCA 1X9MB 1SYRA 4IGJA 2BJXA 3VWWA 1H75A 3UVHA 3F4TA 3U6VA 4ZBAA 1PGTA 1YJ6A 2P31A 1V40A 4BWQA 3FZ5A 2VM2A 2CAQA 4X43A 1A8LA 3RBTA 1J08A 5CRWA 1ZYQB 3C8EA 1W89A 1M99A 4FQUA 2HT9A 4LA1A 1M0UA 5HQPA 4TR3A 5KOWA 3HVXA 3ZFLA 3F0IA 2H01A 2NVLA 3Q18A 4KUNA 1ABAA 2E7PA 5ECOB 2CAIA 2JACA 3CSHA 12GSA 2CX4A 2HRFA 5J5NA 3W8SA 5BRTA 1TU7A 3HCZA 1K0OA 22GSA 4J57E 3UL3A 3HVNA 3H4KA 1TRVA 3UEMA 3QDNA 3TJBA 2PPTA 2AHEA 3CWGA 5CNWA 3LYKA 3WYWA 3A2XA 3VWVA 1TK8B 2WW2A 5A5HA 4W66A 1SK2A 3IV4A 2J23A 1XW6A 1T8EB 2YNXA 4K2XA 1PN9A 3LJRA 2GT6A 4OFMA 1VF1A 4NAXA 2WW0A 2C3NA 5KN3A 1XPVA 3MWHA 1XWKA 1O8XA 4PXOA 2HZEA 5A1NA 2DC5A 4YQUA 2ON7A 2HXKA 4XS4A 5HR0A 4GSTA 4IN0A 2EIRA 1I1IP 5A4WA 3LXTA 2DJ2A 2YJ7A 1A23A 1THXA 2CT6A 5G1KA 5B8AA 3HHVA 3G9BA 3I9V2 1Z7RA 5DBQA 3GRXA 4H86A 1KEBA 4ZIJA 3ME7A 3DRNA 2H71A 1R26A 3ZZXA 19GSA 3H79A 1G0TA 3FHKA 3APQA 1GLQA 3NZNA 2UV8G 3HJMA 1M2DA 4EVMA 5D96A 3CRTA 1AXDA 4HSCX 3Q6OA 1ST9A 4MMMA 1I9DA 2X8GA 2LRNA 3ZIVA 2HLSA 1F6MC 1ERWA 7GSSA 3S9FA 1M9BA 4I6XA 4Z2RA 1TXUA 4F0BA 2GSRA 3U5RE 3UARA 4AKGA 4HZ2A 1JHBA 2BTOT 2LRTA 1V9WA 5IMZA 4IW9A 3GKNA 5A34B 3QMXA 4BWSA 3IDVA 3GKMA 4QL7A 3RDWA 3HJPA 2LS5A 2CA8A 5G31A 3F4RA 4MLYA 4BPYA 3O76A 4G0LA 5JWQB 2HRAA 1QMVA 4TOPA 2GT5A 4MNNA 4BVYB 3IR4A 3F9UA 4J2FA 3LQ7A 1JLVA 2R4VA 3CYNA 5ID2A 2H0IA 5ECSA 2VD0A 1R4WA 2JZTA 1Z7PA 2ZCTA 3MIXA 1X0RA 4ICYA 4RQXA 4MJCA 4KDXA 1K0BA 4N10A 3ZLPA 1GULA 1FAAA 4DSQA 4Q5NA 1N25A 3GA4A 3Q19A 1N8JA 1HNBA 4PUAA 4XS6A 4D73A 3QFAC 2FCHA 4V1Ag 2DMLA 4K7IA 4AJ7A 4ILFA 3GKXA 2B5YA 3N5OA 3GX8A 2YWNA 3I69A 4MJEA 1TW9A 4G10A 4KGIA 2VOCA 3GYKA 1XWBA 3TOTA 4EC0A 2DIZA 1YQ1A 4AKXB 5FT3A 4YAPA 2P0GA 3IC8A 4WR5A 1JZRA 4OO4A 4L5LA 4GTUA 4F0CA 2L57A 3GHAA 3D21A 5JCUA 1FO5A 1B48A 5J40A 4KSOA 4GCIA 3GFKA 1TK0B 1NSWA 3IA1A 3SWLA 4YKFA 4IQAA 1PD21 2EFHA 3QAVA 1K0DA 2FGXA 2H75A 2FD3A 4OWYA 3ZRDA 3BD2A 4MA9A 1THOA 3CRUA 4NHWA 5GSTA 2C0GA 3CSJA 3M0FA 3GTUA 1G6WA 2OE3A 1GP1A 2C3TA 4KDUA 1MD4A 1W4VA 2R0GA 4FYBA 2YP6A 4N11A 5B7CA 3UVTA 4F9ZA 3KP8A 4KCAA 5F07A 2LNTA 3EMXA 1CQHA 2YV7A 4FIWA 3ISOA 4ZB6A 3EYTA 3CQFA 4G0IA 5KN1A 4GWRA 4XIHA 3WGEA 3UBLA 4OCFA 4Q5FA 4KF9A 3TKPA 5ENUA 1S3DA 1TI1A 4EDZA 3VWUA 4MPFA 3TOUA 5IIZA 1FB0A 1OVNA 2OJLA 4HS1A 2XC2A 1TDIA 1TU8A 2CX3A 1A2LA 2QSIA 1MD3A 5IMVA 3VPTA 3MAKA 4TRXA 3FR6A 1WJKA 4TXVA 4YH2A 3FR3A 18GSA 1SJIA 3L78A 5DAKA 2VKZG 3D0ZA 1M3IA 5CYYA 1U3IA 5J9CA 3FZ9A 3ERGA 1Z5YE 1SL0B 2F9SA 3D22A 4EE0A 2WJUA 2DMMA 5J4YA 3C7MA 4GSSA 5D9TA 3RAZA 2OKAA 1SL2B 3EE2A 2K18A 4Z7XA 2HRKB 1S3AA 2PWJA 3FY7A 5J41A 1PX7A 3EINA 4O5UA 3DKSA 4L0UA 2A2SA 5KOXA 4TN8A 4K9ZA 4EF0A 2WZ9A 1I5GA 3QAWA
chains in the Genus database with same CATH topology
2LEGA 3OR5A 2P5QA 1QXHA 1X5EA 5C04A 1OKTA 3GNJA 4MJBA 2BMXA 2ES7A 1YVLA 1AQVA 1LJRA 1FOHA 3GKKA 2P5RA 4CDOA 1HYUA 1O85A 3CTGA 3FK8A 5EY6A 4EIPA 3KMOA 1Z6MA 2GQLA 5J4UA 3GSSA 1RQMA 4JE1A 3HA9A 5ECHB 1N2AA 3ZMKA 2J9HA 4G9HA 2D2ZA 4N30A 3CSIA 2NPBA 2H1LA 2LRCA 1SKWB 5EPFA 1YZXA 2H0HA 3CMIA 3F3QA 4ECJA 3KEBA 3DWVA 3F3RA 5HFIA 2N5FA 1GUKA 2IIYA 3ZMLA 2V1MA 2H70A 2V32A 3G7YA 2H1DA 1MEKA 4F2IA 1E2YA 1QK8A 2YOIA 1B8XA 1SENA 4NHZA 1SVLA 1F3AA 3R2QA 1QGVA 3O3TA 3E3EA 5D93A 2H74A 3WGXA 6GSWA 4EKZA 2IMIA 4TXOB 2R3XA 2LNSA 1ACVA 2LJKA 1WE0A 4PURA 1GNWA 2JSYA 3LEFA 2FWFA 2L6DA 2I4AA 3KTBA 2DKIA 1TKDB 5G5FA 1ZGNA 4E68A 1SVOA 1MTCA 4MH2A 3D4MA 4OFNA 5J9BA 4JU5A 2VUPA 4NWYA 1NHYA 5IO0A 1NM3A 2OBIA 2B1LA 4DSSB 3D4TA 2JZSA 2R37A 2NTOA 1QUWA 4AF2A 5G1LA 5ECPB 5A5KA 3IAS2 1PQNA 3HMJG 3EURA 4QQ7A 3L9VA 4KB3A 1QQ2A 4KW6A 2HSHA 2IJYA 2OE0A 2YCDA 5J4VA 4WF4A 1VF4A 2HNLA 4NV2A 5IMFA 5H5RA 1ERTA 3EPTA 5A4VA 1V98A 3C1SA 2MMOA 4ZL8A 5HR3A 3APOA 3TJFA 3IRAA 3A5IA 4KA0A 4LMVA 4TW5A 4G0KA 4FYUA 1O7UA 2E2GA 8GSSA 4K1FA 3IXRA 2A4HA 3TJGA 2C3QA 4DSRA 2H0GA 4X1UA 3ZREA 3LFLA 3TKRA 3LW9A 5INYA 4DVCA 5A34A 2H66A 3W8JA 1JLWA 4BA7A 4FYCA 4ECCA 2QA2A 1UC7A 4WR4A 3TJKA 2WS2A 4KNDA 5AGYA 2LTKA 4V1Ap 1K0AA 4ULXA 2YWOA 5IMDA 4ML6A 3GURA 5FWGA 2RM6A 3AY8A 2X4AA 1LU4A 4BVYA 4ZB7A 2HSMB 1G6YA 1HNAA 1O8WA 1UA5A 4NPBA 1GL8A 4N3ZA 4WEYA 2O89A 4I8BA 5B6NA 2Z9SA 2RUEA 2GTUA 1E6BA 2C80A 4K8MA 3HXSA 3HYPA 2LQQA 2GQMA 4G2EA 5G30A 1UN2A 5ECKB 1U88A 3UOMA 3RHCA 2I9HA 13GSA 1GSFA 4HEA2 4Z2TA 1Z9HA 5ECLB 1NHOA 1XOAA 2EFDA 4MF5A 4OCEA 1X5CA 1R5PA 1V2AA 5J3RA 2X64A 3M3MA 3EWLA 3BOAA 2AV4A 5FHIA 5DCHA 2OBKA 1XCCA 1ZL9A 5F06A 2R0CA 1BF5A 2I3YA 3ED3A 5EVOA 3GX0A 4XCSA 4G19A 2VL9A 4GDFA 3LORA 4TR1B 1PL2A 4AI6A 1DUGA 2GSSA 1T00A 2H6XA 4MF7A 4NXIA 2GZPA 2RLIA 3LXZA 4XRAA 1A24A 4O92A 2XHFA 5DDLA 5DALB 2H76A 2MBSA 6GSXA 1YDKA 5AIVA 1J9BA 3CBUA 3TDGA 2MZCA 4AKIA 2TIRA 1GSSA 3APSA 1WWJA 2O8VB 3LYPA 3GSTA 2KP2A 2WFCA 2MMAA 2QKEA 3GN3A 2L5OA 1H4OA 2VLTA 2R5GA 2AAWA 1DSBA 2HRNA 2LJAA 5GAND 5D9VA 4IBPA 4CHSA 1AAZA 2K9FA 4XS4B 2HQTA 1OAZA 2H72A 2I1UA 2HE3A 2AUVA 4CY6A 2VCTA 2H73A 2FUG2 5GZZB 2C4JA 1WOUA 1V58A 4IP1A 1YKCA 2CZ3A 1TTZA 2M80A 2H1GA 3VPQA 3ZVJD 4JBBA 1GWCA 4I5QA 1F9MA 3L4NA 2JL4A 4RI7A 1USBA 2H19A 1KNGA 2PU9C 3BBYA 4IS0A 2PUKC 3PR8A 2IN3A 2V2GA 4WBJA 1M2AA 2FHEA 3VURA 1O6JA 2GS3A 3L9UA 2C0EA 4WF5A 4TR4A 1YF1A 2X8CA 2WCIA 1RK4A 1WP0A 4KSMA 2FWEA 3QFBC 1TI3A 3US3A 2K8VA 1X5DA 1GUMA 3TRQA 3RHBA 4YKGA 1OC9B 2JADA 5CREA 3P90A 3VI5A 2PBJA 4KX4A 2VLVA 2ON5A 3I43A 1Z3EA 3DYRA 1PKZA 6GSUA 1TRUA 1T7PB 2VD1A 4RUVA 3A3TA 2VCWA 5ECQB 2QGVA 4V2MA 4POMA 2IPAA 2CVKA 2KHPA 2VCXA 1FOVA 1EV4A 4BVXB 2LKUA 3QCPA 2DJ1A 1B9XC 5BMUA 3EU4A 3PGTA 1GRXA 1EEJA 2E2MA 1PA3A 4F03A 4IJ3A 5IQYA 1EGRA 2GGTA 4ZILA 3N9JA 5IO2A 3W6GA 3KM6A 1ON4A 4PQIA 2QC7A 2YV9A 3BCIA 3VLNA 1Y1UA 4WETA 5IMCA 2GVPA 3TUEA 4MABA 5ECRB 2R6KA 4V2LA 5JCGA 3TKSC 5JWRB 1QFNA 4MCUA 2A2RA 2R0PA 3ZYWA 1ZCPA 1V57A 1T4YA 4L5OA 4IQ1A 5F0GA 1OE7A 1EZKA 4LL1B 3A2WA 4O5QA 3GV1A 2MMNA 3GUSA 9GSSA 1PX6A 5CRHA 4ZL7A 2VCZA 3O6TA 4V2NA 2H8LA 1TP9A 2LJRA 4LMWA 2H1BA 2DSAA 4PQHA 3EC3A 2MYGA 1XWGA 3J7Yb 4FO5A 5HR2A 2XBIA 5COHA 4K7NA 2QA1A 4MK3A 4ECIA 2F8FA 1XVQA 5LD0A 2FA4A 1K3LA 1GSYA 3DXBA 1PMTA 3FRCA 1DE1A 4WXTA 4AKHA 2PGTA 2DKHA 3ZL5A 1XWCA 4Q5RA 4POBA 2B7JA 1U3AA 2HSYA 3GTUB 1XWAA 2VM1A 1K0MA 1EP8A 3I6AA 4MH3A 3H93A 4OFTA 2HYXA 4DSSA 4ISDA 4Q5QA 4PQ1A 4EUYA 3TJJA 4KE3A 3VFIA 2AJQB 3VI7A 1VF3A 1B4PA 4HQSA 2B6MA 5IMAA 2H30A 2FNOA 2FLSA 3HDCA 5CO3A 4E8HA 4YQVA 1BQ7A 4NV5A 4PNFA 4I2UA 3M1GA 1XBSA 4HI7A 2IMFA 2OADA 3D5JA 2H1AA 2RIIA 4MJAA 4I97A 1AC1A 4JR4A 3WD6A 1HQOA 2DJ3A 1WRYA 3KP9A 3FKFA 4O32A 2VL3A 3EVIA 3MSZA 1JZDA 3VWXA 1MDKA 4ACSA 4CW9A 4A5PA 4MZWA 1GLPA 1GSEA 2F8AA 1B9YC 1UVZA 2EC4A 5DQSA 3FZAA 3H8QA 1Q4JA 5DAKB 1TOFA 5IPGA 3F4SA 3NIVA 1GTAA 2IL3A 3KIJA 5CRGA 4LLRA 5EL8A 5KEJA 1BX9A 2CV4A 1A2JA 1K0NA 2PVQA 1OE8A 3JCML 4KAEA 1ZMAA 2M46A 1WMJA 3K8NA 1J0FA 4CY8A 16GSA 5DCGA 2FWHA 2REMA 5C00A 3KCMA 1SK1A 4IP6A 2AB6A 4LL4B 3E0UA 4AJ8A 3F8UA 4BL7B 2VL2C 1PSQA 2X8HA 3IHQA 4O5RA 1O81A 3HKRA 1MDIA 1ZOFA 2MMZA 3DD3A 4GQFA 3KXOA 1Y6EA 1A2MA 4HOJA 5IPHA 4Z2UA 3LG6A 3GH9A 3GL3A 4N0VA 1GUHA 4GXZA 3LGCA 1ZYNA 4KCEA 1XIYA 4HZ4A 2I81A 1FHEA 2N5AA 3KD0A 3E9JB 1M7TA 5H5QA 5DJMA 2V41A 1EEMA 4N0ZA 1BG1A 4EL1A 2JU5A 3L0HA 2X49A 1F3BA 3TRXA 3LSZA 1G7EA 3C1RA 3DVWA 1X9SB 1AIUA 5D9XA 4PUFC 1PKWA 3HJOA 1C72A 6GSTA 2R2JA 4DEJA 1EOHA 2FY6A 1OC3A 4HU7A 2EFCA 2WRTA 4OO5A 3M9JA 1BEDA 3P2AA 4TKYA 4GQCA 5CAXA 2ZUPA 2IMDA 1X9WB 1TK5B 4E8EA 1XZOA 4GF0A 1GH2A 2C8UA 2YZUA 2OE1A 3DVXA 2GLRA 2C1YA 1G7OA 4TR1A 5JCWA 2O5VA 1KTEA 3TCOA 2GZYA 2YN1A 1ILOA 2B5XA 1B4QA 4K6XA 5D9WA 1SKSB 5DALA 4MP4A 4XHMA 1ZYEA 3ERFA 5G2ZA 5ECIB 2EIQA 2IMEA 1K3OA 4AJ6A 1DE2A 5DJLA 3P7XA 2L5LA 5LCZA 2WDUA 2WULA 1AUCA 5ABRA 2PERA 6GSSA 3KH7A 2UZ8A 3HZ4A 1DBYA 1SJZA 4F82A 2TRCP 3D6IA 4I2TA 1Q98A 3DGQA 3ZITA 1VF2A 3ZTLA 2IFQB 5HFGA 3TKSA 3QR6A 2YWMA 3BCKA 2HSNB 2AYTA 4IHUA 6GSYA 4IJIA 2GDRA 1F2EA 1CQGA 1ML6A 2E0QA 3CTFA 4PTSA 4O7HA 1F37A 4XS1A 2GSTA 4ZBDA 1SK0A 4TVEA 2B7KA 4PGTA 1EGOA 4USSA 5D73A 1XW5A 4ZBBA 4OMVA 5ECNB 3Q74A 4KH7A 2EIOA 2O85A 2VIMA 2DIYA 3F6DA 2G2QA 4MF6A 1FVKA 4K5SA 1EV9A 3DMLA 1JZWA 2MBTA 3IC4A 2B5EA 4AGSA 4XRDA 3HVVA 1Z6NA 3QD9A 1YY7A 1A8YA 2B3SA 3EMPA 5E59A 1SD8A 4QMKA 1OC9A 4WBRD 2L4QA 1HNCA 1XW9A 2X99A 11GSA 1ERUA 2L6CA 4IELA 2K6VA 3IHGA 3PH9A 2PN8A 3C73A 1YKAA 3WGDA 5KN2A 1O73A 1BAYA 5A5HB 5KN0A 2LQOA 3CXGA 1YF0A 4BVXA 1VGLA 4HQZA 4JZQA 1T1VA 1AQXA 4PX1A 2HZEB 5A1NB 5AISA 1SVMA 5DQYA 1LBKA 5IM9A 2PMTA 1GSQA 3HZ8A 5JWOB 3EU3A 4ML1A 2V6OA 3FZ4A 3A2VA 4YQMA 3KH9A 4GRFA 3UBKA 1SKRB 4K0NA 3TKQA 4L0WA 1BG5A 3IBHA 5L71A 1ZZYA 4K2DA 2XPDA 1TXXA 1GTBA 3LWAA 3A5WA 3ME8A 2V6KA 3HVSA 3C71A 5D8IA 3HD5A 1SD9A 3F63A 1BJXA 2A4VA 4HJ2A 5B8BA 1JZOA 2CZ2A 2K8SA 5CRDA 2IMKA 3FR9A 1XFLA 3GIXA 1Y25A 4POKA 3ZIJA 4ZXGA 4JR6A 2WGRA 4HDEA 1RW1A 1A0FA 3IPZA 4NMUA 1JFUA 2CVBA 4QL9A 4MZBA 4K0GA 2TRXA 4OD7A 2HRKA 2OA7A 1PL1A 2VCQA 2VL2A 1SYXA 1GSDA 1T3BA 3SBCA 3DIEA 4GLTA 2XPEA 3J7Yk 5IOXA 10GSA 1FW1A 2ALBA 4MPGA 2FWGA 1PRXA 5ID2B 1WIKA 3G7IA 1GTIA 3QPMA 1URMA 2L59A 4YAVA 1PN0A 3P8WA 3IK7A 3ZVJA 4HJMA 2JZRA 3KGKA 1U87A 3L9SA 3G7JA 2G0FA 4JEDA 1R7HA 3HY2A 3GL5A 1OKDA 3DEXA 2RM5A 2VCVA 4EO3A 4D73B 3BJ5A 3TKSE 3ZFBA 3GMFA 1A0RP 1M9AA 2NDOA 2GSQA 3QOUA 2GZZA 2HZFA 3NOFA 1U6TA 2C0DA 2IWTA 2YANA 1FVJA 4MZCA 4GSNA 2KLXA 4K5RA 1R5AA 1K0CA 3FW2A 3TGZA 2HFDA 5ECMB 2VLUA 2YJHA 1AQWA 5F05A 2YPMA 4HU9A 3H1NA 2F3MA 3KJYA 3ERWA 2H6YA 2F51A 1TJDA 4TXOA 1IYHA 5LNKe 3MDKA 1SU9A 3R3EA 4ZB8A 3MYDA 3WT2A 5ELGA 2L4CA 5AN1A 4EXJA 2NBSA 2DJJA 1OC8A 1XOBA 1GNEA 2CQ9A 4WKWA 4KDYA 2LV3A 2ZNMA 1KBNA 3RPPA 3UMAA 2DJKA 4X0XA 2DBCA 3PPUA 4BL7A 3TU3B 1S3CA 1YEXA 2DLXA 5BMUB 4EDYA 2YZHA 3IK9A 4J56E 4ECBA 4HUAA 1ERVA 2WB9A 2HI7A 2RUFA 1YEPA 2PVOC 4EIQA 5ELAA 5GSSA 2LUSA 2KP1A 2A2PA 5DVBA 5HFKA 3UJ1A 2H6ZA 2O87A 1AW9A 4ZL9A 5IOWA 3M9KA 1HD2A 5B6MA 1XXUA 5F8BA 4RQRA 3KTLA 6GSVA 3QAGA 5CP1A 3M8NA 3KMNA 1T4ZA 3F6FA 2YWIA 2OT3A 1ZYPA 2N5BA 4MDCA 4G01A 2GQKA 3IOSA 3FYGA 1M2BA 14GSA 3IAM2 2JSZA 17GSA 1OYJA 4ID0A 2DJ0A 2KOKA 1FG4A 1EWXA 5GAPD 4POLA 1GTUA 4PNGA 2B1KA 5G5EA 2O7KA 5HR1A 1SJ6A 5E4WA 5J47A 4IKHA 4FH8A 3WT1A 4IVFA 3TRPA 3V1WA 3FMWA 1WPIA 1BYEA 3IE3A 3TB2A 4XTSA 2EFEA 4L8EA 5H5SA 3KZQA 1TRWA 1MDJA 3RPNA 3MNGA 3FEUA 20GSA 3UAPA 1K3YA 3UIWA 1XVWA 2HSMA 2FA8A 1NW2A 5AIXA 3VK9A 1IYIA 2VO4A 2OACA 1FB6A 3GH6A 2M72A 2CVDA 4RI6A 5A4UA 1EP7A 4K7OA 4P3YB 2VAFA 2C0FA 4ZB9A 4TR0A 4X4JA 2LSTA 1VRSD 1SL1B 1TRSA 2IFQA 1GSUA 1EOGA 3PINA 2XBQA 4JRRA 2HSNA 2KUCA 1X9MB 1SYRA 4IGJA 2BJXA 3VWWA 1H75A 3UVHA 3F4TA 3U6VA 4ZBAA 1PGTA 1YJ6A 2P31A 1V40A 4BWQA 3FZ5A 2VM2A 2CAQA 4X43A 1A8LA 3RBTA 1J08A 5CRWA 1ZYQB 3C8EA 1W89A 1M99A 4FQUA 2HT9A 4LA1A 1M0UA 5HQPA 4TR3A 5KOWA 3HVXA 3ZFLA 3F0IA 2H01A 2NVLA 3Q18A 4KUNA 1ABAA 2E7PA 5ECOB 2CAIA 2JACA 3CSHA 12GSA 2CX4A 2HRFA 5J5NA 3W8SA 5BRTA 1TU7A 3HCZA 1K0OA 22GSA 4J57E 3UL3A 3H4KA 1TRVA 3UEMA 3QDNA 3TJBA 2PPTA 2AHEA 3CWGA 5CNWA 3LYKA 3WYWA 3A2XA 3VWVA 1TK8B 5A5HA 4W66A 1SK2A 3IV4A 2J23A 1XW6A 1T8EB 2YNXA 4K2XA 1PN9A 3LJRA 2GT6A 4OFMA 1VF1A 4NAXA 2C3NA 5KN3A 1XPVA 3MWHA 1XWKA 1O8XA 4PXOA 2HZEA 5A1NA 2DC5A 4YQUA 2ON7A 2HXKA 4XS4A 5HR0A 4GSTA 4IN0A 2EIRA 5A4WA 3LXTA 2DJ2A 2YJ7A 1A23A 1THXA 2CT6A 5G1KA 5B8AA 3HHVA 3G9BA 3I9V2 1Z7RA 5DBQA 3GRXA 4H86A 1KEBA 4ZIJA 3ME7A 3DRNA 2H71A 1R26A 3ZZXA 19GSA 3H79A 1G0TA 3FHKA 3APQA 1GLQA 3NZNA 2UV8G 3HJMA 1M2DA 4EVMA 5D96A 3CRTA 1AXDA 3Q6OA 1ST9A 4MMMA 1I9DA 2X8GA 2LRNA 3ZIVA 2HLSA 1F6MC 1ERWA 7GSSA 3S9FA 1M9BA 4I6XA 4Z2RA 1TXUA 4F0BA 2GSRA 3U5RE 3UARA 4AKGA 4HZ2A 1JHBA 2BTOT 2LRTA 1V9WA 5IMZA 4IW9A 3GKNA 5A34B 3QMXA 4BWSA 3IDVA 3GKMA 4QL7A 3RDWA 3HJPA 2LS5A 2CA8A 5G31A 3F4RA 4MLYA 4BPYA 3O76A 4G0LA 5JWQB 2HRAA 1QMVA 4TOPA 2GT5A 4MNNA 4BVYB 3IR4A 3F9UA 4J2FA 3LQ7A 1JLVA 2R4VA 3CYNA 5ID2A 2H0IA 5ECSA 2VD0A 1R4WA 2JZTA 1Z7PA 2ZCTA 3MIXA 1X0RA 4ICYA 4RQXA 4MJCA 4KDXA 1K0BA 4N10A 3ZLPA 1GULA 1FAAA 4DSQA 4Q5NA 1N25A 3GA4A 3Q19A 1N8JA 1HNBA 4PUAA 4XS6A 4D73A 3QFAC 2FCHA 4V1Ag 2DMLA 4K7IA 4AJ7A 4ILFA 3GKXA 2B5YA 3N5OA 3GX8A 2YWNA 3I69A 4MJEA 1TW9A 4G10A 4KGIA 2VOCA 3GYKA 1XWBA 3TOTA 4EC0A 2DIZA 1YQ1A 4AKXB 5FT3A 4YAPA 2P0GA 3IC8A 4WR5A 1JZRA 4OO4A 4L5LA 4GTUA 4F0CA 2L57A 3GHAA 3D21A 5JCUA 1FO5A 1B48A 5J40A 4KSOA 4GCIA 3GFKA 1TK0B 1NSWA 3IA1A 3SWLA 4YKFA 4IQAA 1PD21 2EFHA 3QAVA 1K0DA 2FGXA 2H75A 2FD3A 4OWYA 3ZRDA 3BD2A 4MA9A 1THOA 3CRUA 4NHWA 5GSTA 2C0GA 3M0FA 3CSJA 3GTUA 1G6WA 2OE3A 1GP1A 2C3TA 4KDUA 1MD4A 1W4VA 2R0GA 4FYBA 2YP6A 4N11A 5B7CA 3UVTA 4F9ZA 3KP8A 4KCAA 5F07A 2LNTA 3EMXA 1CQHA 2YV7A 4FIWA 3ISOA 4ZB6A 3EYTA 4G0IA 5KN1A 4GWRA 4XIHA 3WGEA 3UBLA 4OCFA 4Q5FA 4KF9A 3TKPA 5ENUA 1S3DA 1TI1A 4EDZA 3VWUA 4MPFA 3TOUA 5IIZA 1FB0A 1OVNA 2OJLA 4HS1A 2XC2A 1TDIA 1TU8A 2CX3A 1A2LA 2QSIA 1MD3A 5IMVA 3VPTA 3MAKA 4TRXA 3FR6A 1WJKA 4TXVA 4YH2A 3FR3A 18GSA 1SJIA 3L78A 5DAKA 2VKZG 3D0ZA 5CYYA 1U3IA 5J9CA 3FZ9A 3ERGA 1Z5YE 1SL0B 2F9SA 3D22A 4EE0A 2WJUA 2DMMA 5J4YA 3C7MA 4GSSA 5D9TA 3RAZA 2OKAA 1SL2B 3EE2A 2K18A 4Z7XA 2HRKB 1S3AA 2PWJA 3FY7A 5J41A 1PX7A 3EINA 4O5UA 3DKSA 4L0UA 2A2SA 5KOXA 4TN8A 4K9ZA 4EF0A 2WZ9A 1I5GA 3QAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEG A;  3OR5 A;  2P5Q A;  1QXH A;  1X5E A;  5C04 A;  1OKT A;  3GNJ A;  4MJB A;  2BMX A;  2ES7 A;  1AQV A;  1LJR A;  3GKK A;  2P5R A;  4CDO A;  1HYU A;  1O85 A;  3CTG A;  3FK8 A;  5EY6 A;  3KMO A;  1Z6M A;  2GQL A;  5J4U A;  3GSS A;  1RQM A;  4JE1 A;  3HA9 A;  5ECH B;  1N2A A;  3ZMK A;  2J9H A;  4G9H A;  2D2Z A;  4N30 A;  3CSI A;  2NPB A;  2LRC A;  1SKW B;  5EPF A;  1YZX A;  2H0H A;  3CMI A;  3F3Q A;  4ECJ A;  3KEB A;  3DWV A;  3F3R A;  5HFI A;  2N5F A;  1GUK A;  2IIY A;  3ZML A;  2V1M A;  2H70 A;  2V32 A;  3G7Y A;  2H1D A;  1MEK A;  4F2I A;  1E2Y A;  1QK8 A;  2YOI A;  1B8X A;  1SEN A;  4NHZ A;  1F3A A;  3R2Q A;  1QGV A;  3O3T A;  3E3E A;  5D93 A;  2H74 A;  3WGX A;  6GSW A;  4EKZ A;  2IMI A;  4TXO B;  2R3X A;  2LNS A;  1ACV A;  2LJK A;  1WE0 A;  4PUR A;  1GNW A;  2JSY A;  3LEF A;  2FWF A;  2L6D A;  2I4A A;  3KTB A;  1TKD B;  5G5F A;  1ZGN A;  1MTC A;  4MH2 A;  3D4M A;  4OFN A;  5J9B A;  4JU5 A;  2VUP A;  4NWY A;  1NHY A;  5IO0 A;  1NM3 A;  2OBI A;  2B1L A;  4DSS B;  3D4T A;  2JZS A;  2R37 A;  2NTO A;  1QUW A;  4AF2 A;  5G1L A;  5ECP B;  5A5K A;  3IAS 2;  1PQN A;  3EUR A;  4QQ7 A;  3L9V A;  4KB3 A;  1QQ2 A;  4KW6 A;  2HSH A;  2IJY A;  2OE0 A;  2YCD A;  4WF4 A;  1VF4 A;  2HNL A;  4NV2 A;  5IMF A;  5H5R A;  1ERT A;  5A4V A;  1V98 A;  3C1S A;  2MMO A;  4ZL8 A;  5HR3 A;  3APO A;  3TJF A;  3IRA A;  4KA0 A;  4LMV A;  4TW5 A;  4G0K A;  4FYU A;  1O7U A;  2E2G A;  8GSS A;  4K1F A;  3IXR A;  3TJG A;  2C3Q A;  4DSR A;  2H0G A;  4X1U A;  3ZRE A;  3LFL A;  3TKR A;  5INY A;  4DVC A;  3W8J A;  2H66 A;  1JLW A;  4BA7 A;  4FYC A;  4ECC A;  1UC7 A;  4WR4 A;  3TJK A;  2WS2 A;  4KND A;  5AGY A;  2LTK A;  4V1A p;  1K0A A;  4ULX A;  2YWO A;  5IMD A;  4ML6 A;  3GUR A;  5FWG A;  2RM6 A;  3AY8 A;  1LU4 A;  4BVY A;  2HSM B;  1G6Y A;  1HNA A;  1O8W A;  1UA5 A;  4NPB A;  1GL8 A;  4WEY A;  2O89 A;  4I8B A;  5B6N A;  2Z9S A;  2RUE A;  2GTU A;  1E6B A;  2C80 A;  4K8M A;  3HXS A;  3HYP A;  2LQQ A;  2GQM A;  4G2E A;  5G30 A;  1UN2 A;  5ECK B;  1U88 A;  3UOM A;  3RHC A;  2I9H A;  13GS A;  1GSF A;  4HEA 2;  1Z9H A;  5ECL B;  1NHO A;  1XOA A;  4MF5 A;  4OCE A;  1X5C A;  1R5P A;  1V2A A;  5J3R A;  2X64 A;  3M3M A;  3EWL A;  3BOA A;  2AV4 A;  5FHI A;  5DCH A;  2OBK A;  1XCC A;  1ZL9 A;  5F06 A;  2I3Y A;  3ED3 A;  5EVO A;  3GX0 A;  4XCS A;  4G19 A;  2VL9 A;  3LOR A;  4TR1 B;  1PL2 A;  1DUG A;  2GSS A;  1T00 A;  2H6X A;  4MF7 A;  4NXI A;  2GZP A;  2RLI A;  3LXZ A;  4XRA A;  1A24 A;  4O92 A;  2XHF A;  5DDL A;  5DAL B;  2H76 A;  2MBS A;  6GSX A;  1YDK A;  5AIV A;  1J9B A;  3CBU A;  3TDG A;  2MZC A;  2TIR A;  1GSS A;  3APS A;  1WWJ A;  2O8V B;  3LYP A;  3GST A;  2KP2 A;  2WFC A;  2MMA A;  2QKE A;  3GN3 A;  2L5O A;  1H4O A;  2VLT A;  2R5G A;  2AAW A;  1DSB A;  2HRN A;  2LJA A;  5GAN D;  5D9V A;  4IBP A;  4CHS A;  1AAZ A;  2K9F A;  4XS4 B;  2HQT A;  1OAZ A;  2H72 A;  2I1U A;  2HE3 A;  2AUV A;  2VCT A;  2H73 A;  2FUG 2;  5GZZ B;  2C4J A;  1WOU A;  1V58 A;  4IP1 A;  1YKC A;  2CZ3 A;  1TTZ A;  2M80 A;  2H1G A;  3VPQ A;  3ZVJ D;  4JBB A;  1GWC A;  4I5Q A;  1F9M A;  3L4N A;  2JL4 A;  4RI7 A;  1USB A;  2H19 A;  1KNG A;  2PU9 C;  3BBY A;  4IS0 A;  2PUK C;  3PR8 A;  2IN3 A;  2V2G A;  4WBJ A;  1M2A A;  2FHE A;  3VUR A;  1O6J A;  2GS3 A;  3L9U A;  2C0E A;  4WF5 A;  4TR4 A;  1YF1 A;  2X8C A;  2WCI A;  1RK4 A;  1WP0 A;  4KSM A;  2FWE A;  3QFB C;  1TI3 A;  3US3 A;  2K8V A;  1X5D A;  1GUM A;  3TRQ A;  3RHB A;  1OC9 B;  2JAD A;  5CRE A;  3P90 A;  3VI5 A;  2PBJ A;  4KX4 A;  2VLV A;  2ON5 A;  3I43 A;  1Z3E A;  3DYR A;  1PKZ A;  6GSU A;  1TRU A;  1T7P B;  2VD1 A;  4RUV A;  3A3T A;  2VCW A;  5ECQ B;  2QGV A;  4V2M A;  4POM A;  2IPA A;  2CVK A;  2KHP A;  2VCX A;  1FOV A;  1EV4 A;  4BVX B;  2LKU A;  3QCP A;  2DJ1 A;  1B9X C;  5BMU A;  3EU4 A;  3PGT A;  1GRX A;  1EEJ A;  2E2M A;  1PA3 A;  4F03 A;  4IJ3 A;  5IQY A;  1EGR A;  2GGT A;  4ZIL A;  3N9J A;  5IO2 A;  3W6G A;  3KM6 A;  1ON4 A;  4PQI A;  2QC7 A;  2YV9 A;  3BCI A;  3VLN A;  4WET A;  5IMC A;  2GVP A;  3TUE A;  4MAB A;  5ECR B;  2R6K A;  4V2L A;  5JCG A;  3TKS C;  5JWR B;  1QFN A;  4MCU A;  2A2R A;  3ZYW A;  1ZCP A;  1V57 A;  1T4Y A;  4L5O A;  4IQ1 A;  5F0G A;  1OE7 A;  1EZK A;  4LL1 B;  3A2W A;  3GV1 A;  2MMN A;  3GUS A;  9GSS A;  1PX6 A;  5CRH A;  4ZL7 A;  2VCZ A;  3O6T A;  4V2N A;  2H8L A;  1TP9 A;  2LJR A;  4LMW A;  2H1B A;  2DSA A;  4PQH A;  3EC3 A;  2MYG A;  1XWG A;  3J7Y b;  4FO5 A;  5HR2 A;  2XBI A;  5COH A;  4K7N A;  4MK3 A;  4ECI A;  2F8F A;  1XVQ A;  5LD0 A;  2FA4 A;  1K3L A;  1GSY A;  3DXB A;  1PMT A;  3FRC A;  1DE1 A;  4WXT A;  2PGT A;  3ZL5 A;  1XWC A;  4Q5R A;  4POB A;  2B7J A;  1U3A A;  2HSY A;  3GTU B;  1XWA A;  2VM1 A;  1K0M A;  1EP8 A;  3I6A A;  4MH3 A;  3H93 A;  4OFT A;  2HYX A;  4DSS A;  4ISD A;  4Q5Q A;  4PQ1 A;  4EUY A;  3TJJ A;  4KE3 A;  3VFI A;  2AJQ B;  3VI7 A;  1VF3 A;  1B4P A;  4HQS A;  2B6M A;  5IMA A;  2H30 A;  2FNO A;  2FLS A;  3HDC A;  5CO3 A;  4E8H A;  4YQV A;  1BQ7 A;  4NV5 A;  4PNF A;  4I2U A;  3M1G A;  1XBS A;  4HI7 A;  2IMF A;  2OAD A;  3D5J A;  2H1A A;  2RII A;  4MJA A;  4I97 A;  1AC1 A;  4JR4 A;  3WD6 A;  1HQO A;  2DJ3 A;  1WRY A;  3KP9 A;  3FKF A;  4O32 A;  2VL3 A;  3EVI A;  3MSZ A;  1JZD A;  3VWX A;  1MDK A;  4ACS A;  4CW9 A;  4MZW A;  1GLP A;  1GSE A;  2F8A A;  1B9Y C;  1UVZ A;  2EC4 A;  5DQS A;  3FZA A;  3H8Q A;  1Q4J A;  5DAK B;  1TOF A;  5IPG A;  3F4S A;  3NIV A;  1GTA A;  2IL3 A;  3KIJ A;  5CRG A;  4LLR A;  5EL8 A;  5KEJ A;  1BX9 A;  2CV4 A;  1A2J A;  1K0N A;  2PVQ A;  1OE8 A;  3JCM L;  4KAE A;  1ZMA A;  2M46 A;  1WMJ A;  3K8N A;  1J0F A;  16GS A;  5DCG A;  2FWH A;  2REM A;  5C00 A;  3KCM A;  1SK1 A;  4IP6 A;  2AB6 A;  4LL4 B;  3E0U A;  4AJ8 A;  3F8U A;  4BL7 B;  2VL2 C;  1PSQ A;  2X8H A;  3IHQ A;  4O5R A;  1O81 A;  3HKR A;  1MDI A;  1ZOF A;  2MMZ A;  3DD3 A;  4GQF A;  3KXO A;  1Y6E A;  1A2M A;  4HOJ A;  5IPH A;  3LG6 A;  3GH9 A;  4GXZ A;  4N0V A;  1GUH A;  3GL3 A;  3LGC A;  4KCE A;  1XIY A;  4HZ4 A;  2I81 A;  1FHE A;  2N5A A;  3KD0 A;  3E9J B;  1M7T A;  5H5Q A;  5DJM A;  2V41 A;  1EEM A;  4N0Z A;  4EL1 A;  2JU5 A;  3L0H A;  1F3B A;  3TRX A;  3LSZ A;  1G7E A;  3C1R A;  3DVW A;  1X9S B;  1AIU A;  5D9X A;  4PUF C;  1PKW A;  3HJO A;  1C72 A;  6GST A;  2R2J A;  4DEJ A;  1EOH A;  2FY6 A;  1OC3 A;  4HU7 A;  2WRT A;  4OO5 A;  3M9J A;  1BED A;  3P2A A;  4TKY A;  4GQC A;  5CAX A;  2ZUP A;  2IMD A;  1X9W B;  1TK5 B;  4E8E A;  1XZO A;  4GF0 A;  1GH2 A;  2C8U A;  2YZU A;  2OE1 A;  3DVX A;  2GLR A;  2C1Y A;  1G7O A;  4TR1 A;  5JCW A;  1KTE A;  3TCO A;  2GZY A;  2YN1 A;  1ILO A;  2B5X A;  1B4Q A;  4K6X A;  5D9W A;  1SKS B;  5DAL A;  4MP4 A;  4XHM A;  1ZYE A;  3ERF A;  5G2Z A;  5ECI B;  2EIQ A;  2IME A;  1K3O A;  4AJ6 A;  1DE2 A;  5DJL A;  3P7X A;  2L5L A;  5LCZ A;  2WDU A;  2WUL A;  1AUC A;  5ABR A;  2PER A;  6GSS A;  3KH7 A;  2UZ8 A;  3HZ4 A;  1DBY A;  1SJZ A;  4F82 A;  2TRC P;  3D6I A;  4I2T A;  1Q98 A;  3DGQ A;  3ZIT A;  1VF2 A;  3ZTL A;  2IFQ B;  5HFG A;  3TKS A;  3QR6 A;  2YWM A;  3BCK A;  2HSN B;  2AYT A;  4IHU A;  6GSY A;  4IJI A;  2GDR A;  1F2E A;  1CQG A;  1ML6 A;  2E0Q A;  3CTF A;  4PTS A;  4O7H A;  1F37 A;  4XS1 A;  2GST A;  4ZBD A;  1SK0 A;  4TVE A;  2B7K A;  4PGT A;  1EGO A;  4USS A;  5D73 A;  1XW5 A;  4ZBB A;  4OMV A;  5ECN B;  3Q74 A;  4KH7 A;  2EIO A;  2O85 A;  2VIM A;  2DIY A;  3F6D A;  2G2Q A;  4MF6 A;  1FVK A;  1EV9 A;  3DML A;  1JZW A;  2MBT A;  3IC4 A;  2B5E A;  4AGS A;  4XRD A;  3HVV A;  1Z6N A;  3QD9 A;  1YY7 A;  1A8Y A;  2B3S A;  3EMP A;  5E59 A;  1SD8 A;  1OC9 A;  4WBR D;  2L4Q A;  1HNC A;  1XW9 A;  2X99 A;  11GS A;  1ERU A;  2L6C A;  4IEL A;  2K6V A;  3PH9 A;  2PN8 A;  3C73 A;  1YKA A;  3WGD A;  5KN2 A;  1O73 A;  1BAY A;  5KN0 A;  2LQO A;  3CXG A;  1YF0 A;  4BVX A;  1VGL A;  4HQZ A;  4JZQ A;  1T1V A;  1AQX A;  4PX1 A;  2HZE B;  5AIS A;  5DQY A;  1LBK A;  5IM9 A;  2PMT A;  1GSQ A;  3HZ8 A;  5JWO B;  3EU3 A;  4ML1 A;  2V6O A;  3FZ4 A;  3A2V A;  4YQM A;  3KH9 A;  4GRF A;  3UBK A;  1SKR B;  4K0N A;  3TKQ A;  4L0W A;  1BG5 A;  3IBH A;  5L71 A;  1ZZY A;  4K2D A;  2XPD A;  1TXX A;  1GTB A;  3LWA A;  3A5W A;  3ME8 A;  2V6K A;  3HVS A;  3C71 A;  5D8I A;  3HD5 A;  1SD9 A;  3F63 A;  1BJX A;  2A4V A;  4HJ2 A;  5B8B A;  1JZO A;  2CZ2 A;  2K8S A;  5CRD A;  2IMK A;  3FR9 A;  1XFL A;  3GIX A;  1Y25 A;  4POK A;  3ZIJ A;  4ZXG A;  4JR6 A;  2WGR A;  4HDE A;  1RW1 A;  1A0F A;  3IPZ A;  4NMU A;  1JFU A;  2CVB A;  4QL9 A;  4MZB A;  4K0G A;  2TRX A;  4OD7 A;  2HRK A;  2OA7 A;  1PL1 A;  2VCQ A;  2VL2 A;  1SYX A;  1GSD A;  1T3B A;  3SBC A;  3DIE A;  4GLT A;  2XPE A;  3J7Y k;  5IOX A;  10GS A;  1FW1 A;  2ALB A;  4MPG A;  2FWG A;  1PRX A;  5ID2 B;  1WIK A;  3G7I A;  1GTI A;  3QPM A;  1URM A;  2L59 A;  4YAV A;  3P8W A;  3IK7 A;  3ZVJ A;  4HJM A;  2JZR A;  3KGK A;  1U87 A;  3L9S A;  3G7J A;  2G0F A;  4JED A;  1R7H A;  3HY2 A;  3GL5 A;  1OKD A;  3DEX A;  2RM5 A;  2VCV A;  4EO3 A;  4D73 B;  3BJ5 A;  3TKS E;  3ZFB A;  3GMF A;  1A0R P;  1M9A A;  2NDO A;  2GSQ A;  3QOU A;  2GZZ A;  2HZF A;  3NOF A;  1U6T A;  2C0D A;  2IWT A;  2YAN A;  1FVJ A;  4MZC A;  4GSN A;  2KLX A;  1R5A A;  1K0C A;  3FW2 A;  3TGZ A;  2HFD A;  5ECM B;  2VLU A;  2YJH A;  1AQW A;  5F05 A;  2YPM A;  4HU9 A;  3H1N A;  2F3M A;  3KJY A;  3ERW A;  2H6Y A;  2F51 A;  1TJD A;  4TXO A;  1IYH A;  5LNK e;  3MDK A;  1SU9 A;  3R3E A;  4ZB8 A;  3WT2 A;  5ELG A;  2L4C A;  5AN1 A;  4EXJ A;  2NBS A;  2DJJ A;  1OC8 A;  1XOB A;  1GNE A;  2CQ9 A;  4WKW A;  4KDY A;  2LV3 A;  2ZNM A;  1KBN A;  3RPP A;  3UMA A;  2DJK A;  4X0X A;  2DBC A;  3PPU A;  4BL7 A;  1S3C A;  1YEX A;  2DLX A;  4EDY A;  2YZH A;  3IK9 A;  4J56 E;  4ECB A;  4HUA A;  1ERV A;  2WB9 A;  2HI7 A;  2RUF A;  1YEP A;  2PVO C;  5ELA A;  5GSS A;  2LUS A;  2KP1 A;  5DVB A;  5HFK A;  3UJ1 A;  2H6Z A;  2O87 A;  1AW9 A;  4ZL9 A;  5IOW A;  3M9K A;  1HD2 A;  5B6M A;  1XXU A;  5F8B A;  4RQR A;  3KTL A;  6GSV A;  3QAG A;  5CP1 A;  3M8N A;  3KMN A;  1T4Z A;  3F6F A;  2YWI A;  2N5B A;  4MDC A;  2GQK A;  3IOS A;  3FYG A;  1M2B A;  14GS A;  3IAM 2;  2JSZ A;  17GS A;  1OYJ A;  4ID0 A;  2DJ0 A;  2KOK A;  1FG4 A;  1EWX A;  5GAP D;  4POL A;  1GTU A;  4PNG A;  2B1K A;  5G5E A;  2O7K A;  5HR1 A;  1SJ6 A;  5E4W A;  4IKH A;  4FH8 A;  3WT1 A;  4IVF A;  3TRP A;  3V1W A;  1WPI A;  1BYE A;  3IE3 A;  3TB2 A;  4XTS A;  4L8E A;  5H5S A;  3KZQ A;  1TRW A;  1MDJ A;  3RPN A;  3MNG A;  3FEU A;  20GS A;  3UAP A;  1K3Y A;  3UIW A;  1XVW A;  2HSM A;  2FA8 A;  1NW2 A;  5AIX A;  3VK9 A;  1IYI A;  2VO4 A;  2OAC A;  1FB6 A;  3GH6 A;  2M72 A;  2CVD A;  4RI6 A;  5A4U A;  1EP7 A;  4K7O A;  4P3Y B;  2VAF A;  2C0F A;  4ZB9 A;  4TR0 A;  2LST A;  1VRS D;  1SL1 B;  1TRS A;  2IFQ A;  1GSU A;  1EOG A;  3PIN A;  2XBQ A;  4JRR A;  2KUC A;  1X9M B;  1SYR A;  4IGJ A;  2BJX A;  3VWW A;  1H75 A;  3UVH A;  3F4T A;  3U6V A;  4ZBA A;  1PGT A;  1YJ6 A;  2P31 A;  1V40 A;  4BWQ A;  3FZ5 A;  2VM2 A;  2CAQ A;  4X43 A;  1A8L A;  3RBT A;  1J08 A;  5CRW A;  1ZYQ B;  3C8E A;  1W89 A;  1M99 A;  4FQU A;  2HT9 A;  4LA1 A;  1M0U A;  5HQP A;  4TR3 A;  3HVX A;  3ZFL A;  3F0I A;  2H01 A;  2NVL A;  3Q18 A;  4KUN A;  1ABA A;  2E7P A;  5ECO B;  2CAI A;  2JAC A;  3CSH A;  12GS A;  2CX4 A;  2HRF A;  5J5N A;  3W8S A;  1TU7 A;  3HCZ A;  1K0O A;  22GS A;  4J57 E;  3UL3 A;  3H4K A;  1TRV A;  3UEM A;  3QDN A;  3TJB A;  2PPT A;  2AHE A;  5CNW A;  3LYK A;  3WYW A;  3A2X A;  3VWV A;  1TK8 B;  1SK2 A;  3IV4 A;  2J23 A;  1XW6 A;  1T8E B;  2YNX A;  1PN9 A;  3LJR A;  2GT6 A;  4OFM A;  1VF1 A;  4NAX A;  2C3N A;  5KN3 A;  1XPV A;  3MWH A;  1XWK A;  1O8X A;  4PXO A;  2HZE A;  2DC5 A;  4YQU A;  2ON7 A;  2HXK A;  4XS4 A;  5HR0 A;  4GST A;  4IN0 A;  2EIR A;  5A4W A;  3LXT A;  2DJ2 A;  2YJ7 A;  1A23 A;  1THX A;  2CT6 A;  5G1K A;  5B8A A;  3HHV A;  3G9B A;  3I9V 2;  1Z7R A;  5DBQ A;  3GRX A;  4H86 A;  1KEB A;  4ZIJ A;  3ME7 A;  3DRN A;  2H71 A;  1R26 A;  3ZZX A;  19GS A;  3H79 A;  1G0T A;  3FHK A;  3APQ A;  1GLQ A;  3NZN A;  3HJM A;  1M2D A;  4EVM A;  5D96 A;  3CRT A;  1AXD A;  3Q6O A;  1ST9 A;  4MMM A;  1I9D A;  2X8G A;  2LRN A;  3ZIV A;  2HLS A;  1F6M C;  1ERW A;  7GSS A;  3S9F A;  1M9B A;  4I6X A;  4F0B A;  2GSR A;  3U5R E;  3UAR A;  4HZ2 A;  1JHB A;  2BTO T;  2LRT A;  1V9W A;  5IMZ A;  4IW9 A;  3GKN A;  3QMX A;  4BWS A;  3IDV A;  3GKM A;  4QL7 A;  3RDW A;  3HJP A;  2LS5 A;  2CA8 A;  5G31 A;  3F4R A;  4MLY A;  4BPY A;  3O76 A;  4G0L A;  5JWQ B;  2HRA A;  1QMV A;  4TOP A;  2GT5 A;  4BVY B;  3IR4 A;  3F9U A;  4J2F A;  3LQ7 A;  1JLV A;  2R4V A;  3CYN A;  5ID2 A;  2H0I A;  5ECS A;  2VD0 A;  1R4W A;  2JZT A;  1Z7P A;  2ZCT A;  1X0R A;  4RQX A;  4MJC A;  4KDX A;  1K0B A;  4N10 A;  3ZLP A;  1GUL A;  1FAA A;  4DSQ A;  4Q5N A;  3GA4 A;  3Q19 A;  1N8J A;  1HNB A;  4PUA A;  4XS6 A;  4D73 A;  3QFA C;  2FCH A;  4V1A g;  2DML A;  4K7I A;  4AJ7 A;  4ILF A;  3GKX A;  2B5Y A;  3N5O A;  3GX8 A;  2YWN A;  3I69 A;  4MJE A;  1TW9 A;  4G10 A;  4KGI A;  2VOC A;  3GYK A;  1XWB A;  3TOT A;  4EC0 A;  2DIZ A;  1YQ1 A;  5FT3 A;  4YAP A;  2P0G A;  3IC8 A;  4WR5 A;  1JZR A;  4OO4 A;  4L5L A;  4GTU A;  4F0C A;  2L57 A;  3GHA A;  3D21 A;  5JCU A;  1FO5 A;  1B48 A;  4KSO A;  4GCI A;  3GFK A;  1TK0 B;  1NSW A;  3IA1 A;  3SWL A;  4IQA A;  1PD2 1;  3QAV A;  1K0D A;  2FGX A;  2H75 A;  2FD3 A;  4OWY A;  3ZRD A;  3BD2 A;  4MA9 A;  1THO A;  3CRU A;  4NHW A;  5GST A;  2C0G A;  3M0F A;  3CSJ A;  3GTU A;  1G6W A;  2OE3 A;  1GP1 A;  2C3T A;  4KDU A;  1MD4 A;  1W4V A;  4FYB A;  2YP6 A;  4N11 A;  5B7C A;  3UVT A;  4F9Z A;  3KP8 A;  4KCA A;  5F07 A;  2LNT A;  3EMX A;  1CQH A;  2YV7 A;  4FIW A;  3ISO A;  4ZB6 A;  3EYT A;  4G0I A;  5KN1 A;  4GWR A;  4XIH A;  3WGE A;  3UBL A;  4OCF A;  4Q5F A;  4KF9 A;  3TKP A;  5ENU A;  1S3D A;  1TI1 A;  4EDZ A;  3VWU A;  4MPF A;  3TOU A;  5IIZ A;  1FB0 A;  1OVN A;  2OJL A;  4HS1 A;  2XC2 A;  1TDI A;  1TU8 A;  2CX3 A;  1A2L A;  2QSI A;  1MD3 A;  5IMV A;  3VPT A;  3MAK A;  4TRX A;  3FR6 A;  1WJK A;  4TXV A;  4YH2 A;  3FR3 A;  18GS A;  1SJI A;  3L78 A;  5DAK A;  3D0Z A;  5CYY A;  1U3I A;  5J9C A;  3FZ9 A;  3ERG A;  1Z5Y E;  1SL0 B;  2F9S A;  3D22 A;  4EE0 A;  2WJU A;  2DMM A;  3C7M A;  4GSS A;  5D9T A;  3RAZ A;  2OKA A;  1SL2 B;  3EE2 A;  2K18 A;  4Z7X A;  2HRK B;  1S3A A;  2PWJ A;  3FY7 A;  5J41 A;  1PX7 A;  3EIN A;  3DKS A;  4L0U A;  2A2S A;  4TN8 A;  4K9Z A;  4EF0 A;  2WZ9 A;  1I5G A;  3QAW A; 
#chains in the Genus database with same CATH topology
 2LEG A;  3OR5 A;  2P5Q A;  1QXH A;  1X5E A;  5C04 A;  1OKT A;  3GNJ A;  4MJB A;  2BMX A;  2ES7 A;  1YVL A;  1AQV A;  1LJR A;  1FOH A;  3GKK A;  2P5R A;  4CDO A;  1HYU A;  1O85 A;  3CTG A;  3FK8 A;  5EY6 A;  4EIP A;  3KMO A;  1Z6M A;  2GQL A;  5J4U A;  3GSS A;  1RQM A;  4JE1 A;  3HA9 A;  5ECH B;  1N2A A;  3ZMK A;  2J9H A;  4G9H A;  2D2Z A;  4N30 A;  3CSI A;  2NPB A;  2H1L A;  2LRC A;  1SKW B;  5EPF A;  1YZX A;  2H0H A;  3CMI A;  3F3Q A;  4ECJ A;  3KEB A;  3DWV A;  3F3R A;  5HFI A;  2N5F A;  1GUK A;  2IIY A;  3ZML A;  2V1M A;  2H70 A;  2V32 A;  3G7Y A;  2H1D A;  1MEK A;  4F2I A;  1E2Y A;  1QK8 A;  2YOI A;  1B8X A;  1SEN A;  4NHZ A;  1SVL A;  1F3A A;  3R2Q A;  1QGV A;  3O3T A;  3E3E A;  5D93 A;  2H74 A;  3WGX A;  6GSW A;  4EKZ A;  2IMI A;  4TXO B;  2R3X A;  2LNS A;  1ACV A;  2LJK A;  1WE0 A;  4PUR A;  1GNW A;  2JSY A;  3LEF A;  2FWF A;  2L6D A;  2I4A A;  3KTB A;  2DKI A;  1TKD B;  5G5F A;  1ZGN A;  4E68 A;  1SVO A;  1MTC A;  4MH2 A;  3D4M A;  4OFN A;  5J9B A;  4JU5 A;  2VUP A;  4NWY A;  1NHY A;  5IO0 A;  1NM3 A;  2OBI A;  2B1L A;  4DSS B;  3D4T A;  2JZS A;  2R37 A;  2NTO A;  1QUW A;  4AF2 A;  5G1L A;  5ECP B;  5A5K A;  3IAS 2;  1PQN A;  3HMJ G;  3EUR A;  4QQ7 A;  3L9V A;  4KB3 A;  1QQ2 A;  4KW6 A;  2HSH A;  2IJY A;  2OE0 A;  2YCD A;  5J4V A;  4WF4 A;  1VF4 A;  2HNL A;  4NV2 A;  5IMF A;  2WVX A;  5H5R A;  1ERT A;  3EPT A;  5A4V A;  1V98 A;  3C1S A;  2MMO A;  4ZL8 A;  5HR3 A;  3APO A;  3TJF A;  3IRA A;  3A5I A;  4KA0 A;  4LMV A;  4TW5 A;  4G0K A;  4FYU A;  1O7U A;  2E2G A;  8GSS A;  4K1F A;  3IXR A;  2A4H A;  3TJG A;  2C3Q A;  4DSR A;  2H0G A;  4X1U A;  3ZRE A;  3LFL A;  3TKR A;  3LW9 A;  5INY A;  2O3E A;  4DVC A;  5A34 A;  2H66 A;  3W8J A;  1JLW A;  4BA7 A;  4FYC A;  4ECC A;  2QA2 A;  1UC7 A;  4WR4 A;  3TJK A;  2WS2 A;  4KND A;  5AGY A;  2LTK A;  4V1A p;  1K0A A;  4ULX A;  2YWO A;  5IMD A;  4ML6 A;  3GUR A;  5FWG A;  2RM6 A;  3AY8 A;  2X4A A;  1LU4 A;  4BVY A;  4ZB7 A;  2HSM B;  1G6Y A;  1HNA A;  1O8W A;  2WVZ A;  1UA5 A;  4NPB A;  1GL8 A;  4N3Z A;  4WEY A;  2O89 A;  4I8B A;  5B6N A;  2Z9S A;  2RUE A;  2GTU A;  1E6B A;  2C80 A;  4K8M A;  3HXS A;  3HYP A;  2LQQ A;  2GQM A;  4G2E A;  5G30 A;  1UN2 A;  5ECK B;  1U88 A;  3UOM A;  3RHC A;  2I9H A;  13GS A;  1GSF A;  4HEA 2;  4Z2T A;  1Z9H A;  5ECL B;  1NHO A;  1XOA A;  2EFD A;  4MF5 A;  4OCE A;  1X5C A;  1R5P A;  1V2A A;  5J3R A;  2X64 A;  4PHZ C;  3M3M A;  3EWL A;  3BOA A;  2AV4 A;  5FHI A;  5DCH A;  2OBK A;  1XCC A;  1ZL9 A;  5F06 A;  2R0C A;  1BF5 A;  2I3Y A;  3ED3 A;  5EVO A;  3GX0 A;  4XCS A;  4G19 A;  2VL9 A;  4GDF A;  3LOR A;  4TR1 B;  1PL2 A;  4AI6 A;  1DUG A;  2GSS A;  1T00 A;  2H6X A;  4MF7 A;  4NXI A;  2GZP A;  2RLI A;  3LXZ A;  4XRA A;  1A24 A;  4O92 A;  2XHF A;  5DDL A;  5DAL B;  2H76 A;  2MBS A;  6GSX A;  1YDK A;  5AIV A;  1J9B A;  3CBU A;  3TDG A;  2MZC A;  4AKI A;  2TIR A;  1GSS A;  3APS A;  1WWJ A;  2O8V B;  3LYP A;  1M3J A;  3GST A;  2KP2 A;  2WFC A;  2MMA A;  2QKE A;  3GN3 A;  2L5O A;  1H4O A;  2VLT A;  2R5G A;  2AAW A;  1DSB A;  2HRN A;  2LJA A;  5GAN D;  5D9V A;  4IBP A;  4CHS A;  1AAZ A;  2K9F A;  4XS4 B;  2HQT A;  1OAZ A;  2H72 A;  2I1U A;  2HE3 A;  2AUV A;  4CY6 A;  2VCT A;  2H73 A;  1PFO A;  2FUG 2;  5GZZ B;  2C4J A;  1WOU A;  1V58 A;  4IP1 A;  1YKC A;  2CZ3 A;  1TTZ A;  2M80 A;  2H1G A;  2WZS A;  3VPQ A;  3ZVJ D;  4JBB A;  1GWC A;  4I5Q A;  1F9M A;  3L4N A;  2JL4 A;  4RI7 A;  1USB A;  2H19 A;  3RFR C;  1KNG A;  2PU9 C;  3BBY A;  4IS0 A;  2PUK C;  3PR8 A;  2IN3 A;  2V2G A;  4WBJ A;  1M2A A;  2FHE A;  3VUR A;  1O6J A;  2GS3 A;  3L9U A;  2C0E A;  4WF5 A;  4TR4 A;  1YF1 A;  2X8C A;  2WCI A;  1RK4 A;  1WP0 A;  4KSM A;  2FWE A;  3QFB C;  1TI3 A;  3US3 A;  2K8V A;  1X5D A;  1GUM A;  3TRQ A;  3RHB A;  4YKG A;  1OC9 B;  2JAD A;  5CRE A;  3P90 A;  3VI5 A;  2PBJ A;  4KX4 A;  2VLV A;  2ON5 A;  3I43 A;  1Z3E A;  3DYR A;  1PKZ A;  6GSU A;  1TRU A;  1T7P B;  2VD1 A;  4RUV A;  3A3T A;  2VCW A;  5ECQ B;  2QGV A;  4V2M A;  4POM A;  2IPA A;  2CVK A;  2KHP A;  2VCX A;  1FOV A;  1EV4 A;  4BVX B;  2LKU A;  3QCP A;  2DJ1 A;  1B9X C;  5BMU A;  3EU4 A;  3PGT A;  1GRX A;  1EEJ A;  2E2M A;  1PA3 A;  4F03 A;  4IJ3 A;  5IQY A;  1EGR A;  2GGT A;  4ZIL A;  3N9J A;  5IO2 A;  3W6G A;  3KM6 A;  1ON4 A;  4PQI A;  2QC7 A;  2YV9 A;  3BCI A;  3VLN A;  1Y1U A;  4WET A;  5IMC A;  2GVP A;  3TUE A;  4MAB A;  5ECR B;  2R6K A;  4V2L A;  5JCG A;  3TKS C;  5JWR B;  1QFN A;  4MCU A;  2A2R A;  2R0P A;  3ZYW A;  4BIK A;  1ZCP A;  1V57 A;  1T4Y A;  4L5O A;  4IQ1 A;  5F0G A;  1OE7 A;  1EZK A;  4LL1 B;  3A2W A;  4O5Q A;  3GV1 A;  2MMN A;  3GUS A;  9GSS A;  1PX6 A;  5CRH A;  4ZL7 A;  2VCZ A;  3O6T A;  4V2N A;  2H8L A;  1TP9 A;  2LJR A;  4LMW A;  2H1B A;  2DSA A;  4PQH A;  3EC3 A;  2MYG A;  1XWG A;  3J7Y b;  4FO5 A;  5HR2 A;  2XBI A;  5COH A;  4K7N A;  2QA1 A;  4MK3 A;  4ECI A;  2F8F A;  1XVQ A;  5LD0 A;  2FA4 A;  1K3L A;  1GSY A;  3DXB A;  1PMT A;  3FRC A;  1DE1 A;  4WXT A;  4AKH A;  2PGT A;  2DKH A;  3ZL5 A;  1XWC A;  4Q5R A;  4POB A;  2B7J A;  1U3A A;  2HSY A;  3GTU B;  1XWA A;  2VM1 A;  1K0M A;  1EP8 A;  3I6A A;  4MH3 A;  3H93 A;  4OFT A;  2HYX A;  4DSS A;  4ISD A;  4Q5Q A;  4PQ1 A;  4EUY A;  3TJJ A;  4KE3 A;  3VFI A;  2AJQ B;  3VI7 A;  1VF3 A;  1B4P A;  4HQS A;  2B6M A;  5IMA A;  2H30 A;  2FNO A;  2FLS A;  3HDC A;  5CO3 A;  4E8H A;  4YQV A;  1BQ7 A;  2WW1 A;  4NV5 A;  4PNF A;  4I2U A;  3M1G A;  2WW3 A;  1XBS A;  4HI7 A;  2IMF A;  2OAD A;  3D5J A;  2H1A A;  2RII A;  4MJA A;  4I97 A;  1AC1 A;  4JR4 A;  3WD6 A;  1HQO A;  2DJ3 A;  1S4B P;  1WRY A;  3KP9 A;  3FKF A;  4O32 A;  2VL3 A;  3EVI A;  3MSZ A;  1JZD A;  3VWX A;  1MDK A;  4ACS A;  4CW9 A;  4A5P A;  4MZW A;  1GLP A;  1GSE A;  2F8A A;  1B9Y C;  1UVZ A;  2EC4 A;  5DQS A;  3FZA A;  3H8Q A;  1Q4J A;  5DAK B;  1TOF A;  5IPG A;  3F4S A;  3NIV A;  1GTA A;  2IL3 A;  3KIJ A;  5CRG A;  4LLR A;  5EL8 A;  5KEJ A;  1BX9 A;  2CV4 A;  1A2J A;  1K0N A;  2PVQ A;  1OE8 A;  3JCM L;  4KAE A;  1ZMA A;  2M46 A;  1WMJ A;  3K8N A;  1J0F A;  4CY8 A;  16GS A;  5DCG A;  2FWH A;  2REM A;  5C00 A;  3KCM A;  1SK1 A;  4IP6 A;  2AB6 A;  4LL4 B;  3E0U A;  4AJ8 A;  3F8U A;  4BL7 B;  2VL2 C;  1PSQ A;  2X8H A;  3IHQ A;  4O5R A;  1O81 A;  3HKR A;  1MDI A;  1ZOF A;  2MMZ A;  3DD3 A;  4GQF A;  3KXO A;  1Y6E A;  1A2M A;  4HOJ A;  5IPH A;  4Z2U A;  3LG6 A;  3GH9 A;  3GL3 A;  4N0V A;  1GUH A;  4GXZ A;  3LGC A;  1ZYN A;  4KCE A;  1XIY A;  4HZ4 A;  2I81 A;  1FHE A;  2N5A A;  3KD0 A;  3E9J B;  1M7T A;  5H5Q A;  5DJM A;  2V41 A;  1EEM A;  4N0Z A;  1BG1 A;  4EL1 A;  2JU5 A;  3L0H A;  2X49 A;  1F3B A;  3TRX A;  3LSZ A;  1G7E A;  3C1R A;  3DVW A;  1X9S B;  1AIU A;  5D9X A;  4PUF C;  1PKW A;  3HJO A;  1C72 A;  6GST A;  2R2J A;  4DEJ A;  1EOH A;  2FY6 A;  1OC3 A;  4HU7 A;  2EFC A;  2WRT A;  4OO5 A;  3M9J A;  1BED A;  3P2A A;  4TKY A;  4GQC A;  5CAX A;  2ZUP A;  2IMD A;  1X9W B;  1TK5 B;  4E8E A;  1XZO A;  4GF0 A;  1GH2 A;  2C8U A;  2YZU A;  2OE1 A;  3DVX A;  2GLR A;  2C1Y A;  1G7O A;  4TR1 A;  5JCW A;  2O5V A;  1KTE A;  3TCO A;  2GZY A;  2YN1 A;  1ILO A;  2B5X A;  1B4Q A;  4K6X A;  5D9W A;  1SKS B;  5DAL A;  4MP4 A;  4XHM A;  1ZYE A;  3ERF A;  5G2Z A;  5ECI B;  2EIQ A;  2IME A;  1K3O A;  4AJ6 A;  1DE2 A;  5DJL A;  3P7X A;  2L5L A;  5LCZ A;  2WDU A;  2WUL A;  1AUC A;  5ABR A;  2PER A;  6GSS A;  3KH7 A;  2UZ8 A;  3HZ4 A;  1DBY A;  1SJZ A;  4F82 A;  2TRC P;  3D6I A;  4I2T A;  1Q98 A;  3DGQ A;  3ZIT A;  1VF2 A;  3ZTL A;  2IFQ B;  5HFG A;  3TKS A;  3QR6 A;  2YWM A;  3BCK A;  2HSN B;  2AYT A;  4IHU A;  6GSY A;  4IJI A;  2GDR A;  1F2E A;  1CQG A;  1ML6 A;  2E0Q A;  3CTF A;  4PTS A;  4O7H A;  1F37 A;  4XS1 A;  2GST A;  4ZBD A;  1SK0 A;  4TVE A;  2B7K A;  2WVX B;  4PGT A;  1EGO A;  4USS A;  5D73 A;  4PI2 C;  1XW5 A;  4ZBB A;  4OMV A;  5ECN B;  3Q74 A;  1S3R A;  4KH7 A;  2EIO A;  2O85 A;  2VIM A;  2DIY A;  3F6D A;  2G2Q A;  4MF6 A;  1FVK A;  4K5S A;  1EV9 A;  3DML A;  1JZW A;  2WVY A;  2MBT A;  3IC4 A;  2B5E A;  4AGS A;  4XRD A;  3HVV A;  1Z6N A;  3QD9 A;  1YY7 A;  1A8Y A;  2B3S A;  3EMP A;  5E59 A;  1SD8 A;  4QMK A;  1OC9 A;  4WBR D;  2L4Q A;  1HNC A;  1XW9 A;  2X99 A;  11GS A;  1ERU A;  2L6C A;  4IEL A;  2K6V A;  3IHG A;  3PH9 A;  2PN8 A;  3C73 A;  1YKA A;  3WGD A;  5KN2 A;  1XG8 A;  1O73 A;  1BAY A;  5A5H B;  5KN0 A;  2LQO A;  3CXG A;  1YF0 A;  4BVX A;  1VGL A;  4HQZ A;  4JZQ A;  4FXY P;  1T1V A;  1AQX A;  4PX1 A;  2HZE B;  5A1N B;  5AIS A;  1SVM A;  5DQY A;  1LBK A;  5IM9 A;  2PMT A;  1GSQ A;  3HZ8 A;  5JWO B;  3EU3 A;  4ML1 A;  2V6O A;  3FZ4 A;  3A2V A;  4YQM A;  3KH9 A;  4GRF A;  3UBK A;  1SKR B;  4K0N A;  3TKQ A;  4L0W A;  1BG5 A;  3IBH A;  5L71 A;  1ZZY A;  4K2D A;  2XPD A;  1TXX A;  1GTB A;  3LWA A;  3A5W A;  3ME8 A;  2V6K A;  3HVS A;  3C71 A;  4PI0 C;  5D8I A;  3HD5 A;  1SD9 A;  3F63 A;  1BJX A;  2A4V A;  4HJ2 A;  5B8B A;  1JZO A;  2CZ2 A;  2K8S A;  5CRD A;  2IMK A;  3FR9 A;  1XFL A;  3GIX A;  1Y25 A;  4POK A;  3ZIJ A;  4ZXG A;  4JR6 A;  2WGR A;  4HDE A;  1RW1 A;  1A0F A;  3IPZ A;  4NMU A;  1JFU A;  2CVB A;  4QL9 A;  4MZB A;  4K0G A;  2TRX A;  4OD7 A;  2HRK A;  2OA7 A;  1PL1 A;  2VCQ A;  2VL2 A;  1SYX A;  1GSD A;  1T3B A;  3SBC A;  3DIE A;  4GLT A;  2XPE A;  3J7Y k;  5IOX A;  10GS A;  1FW1 A;  2ALB A;  4MPG A;  2FWG A;  1PRX A;  5ID2 B;  1WIK A;  3G7I A;  1GTI A;  3QPM A;  1URM A;  2L59 A;  4YAV A;  1PN0 A;  3P8W A;  3IK7 A;  3ZVJ A;  4HJM A;  2JZR A;  3KGK A;  1U87 A;  3L9S A;  3G7J A;  2G0F A;  4JED A;  1R7H A;  3HY2 A;  3GL5 A;  1OKD A;  3DEX A;  2RM5 A;  2VCV A;  4EO3 A;  4D73 B;  3BJ5 A;  3TKS E;  3ZFB A;  3GMF A;  1A0R P;  1M9A A;  2NDO A;  2GSQ A;  3QOU A;  2GZZ A;  2HZF A;  3NOF A;  1U6T A;  2C0D A;  2IWT A;  2YAN A;  1FVJ A;  4MZC A;  4GSN A;  2KLX A;  4K5R A;  1R5A A;  1K0C A;  3FW2 A;  3TGZ A;  2HFD A;  5ECM B;  2VLU A;  2YJH A;  1AQW A;  5F05 A;  1YEW C;  2YPM A;  4HU9 A;  3H1N A;  2F3M A;  3KJY A;  3ERW A;  2H6Y A;  2F51 A;  1TJD A;  4TXO A;  1IYH A;  5LNK e;  3MDK A;  1SU9 A;  3R3E A;  4ZB8 A;  3MYD A;  3WT2 A;  5ELG A;  2L4C A;  5AN1 A;  4EXJ A;  2NBS A;  2DJJ A;  1OC8 A;  1XOB A;  1GNE A;  2CQ9 A;  4WKW A;  4KDY A;  2LV3 A;  2ZNM A;  3RGB C;  1KBN A;  3RPP A;  3UMA A;  2DJK A;  4X0X A;  2DBC A;  3PPU A;  4BL7 A;  3TU3 B;  1S3C A;  1YEX A;  2DLX A;  5BMU B;  4EDY A;  2YZH A;  3IK9 A;  4J56 E;  4ECB A;  4HUA A;  1ERV A;  2WB9 A;  2HI7 A;  2RUF A;  1YEP A;  2PVO C;  4EIQ A;  5ELA A;  5GSS A;  2LUS A;  2KP1 A;  2A2P A;  5DVB A;  5HFK A;  3UJ1 A;  2H6Z A;  2O87 A;  1AW9 A;  4ZL9 A;  5IOW A;  3M9K A;  1HD2 A;  5B6M A;  1XXU A;  5F8B A;  4RQR A;  3KTL A;  6GSV A;  3QAG A;  5CP1 A;  3M8N A;  3KMN A;  1T4Z A;  3F6F A;  2YWI A;  2OT3 A;  1ZYP A;  2N5B A;  4MDC A;  4G01 A;  2GQK A;  3IOS A;  3FYG A;  1M2B A;  14GS A;  3IAM 2;  2JSZ A;  17GS A;  1OYJ A;  4ID0 A;  2DJ0 A;  2KOK A;  1FG4 A;  1EWX A;  5GAP D;  4POL A;  1GTU A;  4PNG A;  2B1K A;  5G5E A;  2O7K A;  5HR1 A;  1SJ6 A;  5E4W A;  5J47 A;  4IKH A;  4FH8 A;  3WT1 A;  4IVF A;  3TRP A;  3V1W A;  3FMW A;  1WPI A;  1BYE A;  3IE3 A;  3TB2 A;  4XTS A;  2EFE A;  4L8E A;  5H5S A;  3KZQ A;  1TRW A;  1MDJ A;  3RPN A;  3MNG A;  3FEU A;  3CHX C;  20GS A;  3UAP A;  1K3Y A;  3UIW A;  1XVW A;  2HSM A;  2FA8 A;  1NW2 A;  5AIX A;  3VK9 A;  1IYI A;  2VO4 A;  2OAC A;  1FB6 A;  3GH6 A;  2M72 A;  2CVD A;  4RI6 A;  5A4U A;  1EP7 A;  4K7O A;  4P3Y B;  2VAF A;  2C0F A;  4ZB9 A;  4TR0 A;  4X4J A;  2LST A;  2O36 A;  1VRS D;  1SL1 B;  1TRS A;  2IFQ A;  1GSU A;  1EOG A;  3PIN A;  2XBQ A;  4JRR A;  2HSN A;  2KUC A;  1X9M B;  1SYR A;  4IGJ A;  2BJX A;  3VWW A;  1H75 A;  3UVH A;  3F4T A;  3U6V A;  4ZBA A;  1PGT A;  1YJ6 A;  2P31 A;  1V40 A;  4BWQ A;  3FZ5 A;  2VM2 A;  2CAQ A;  4X43 A;  1A8L A;  3RBT A;  1J08 A;  5CRW A;  1ZYQ B;  3C8E A;  1W89 A;  1M99 A;  4FQU A;  2HT9 A;  4LA1 A;  1M0U A;  5HQP A;  4TR3 A;  5KOW A;  3HVX A;  3ZFL A;  3F0I A;  2H01 A;  2NVL A;  3Q18 A;  4KUN A;  1ABA A;  2E7P A;  5ECO B;  2CAI A;  2JAC A;  3CSH A;  12GS A;  2CX4 A;  2HRF A;  5J5N A;  3W8S A;  5BRT A;  1TU7 A;  3HCZ A;  1K0O A;  22GS A;  4J57 E;  3UL3 A;  3HVN A;  3H4K A;  1TRV A;  3UEM A;  3QDN A;  3TJB A;  2PPT A;  2AHE A;  3CWG A;  5CNW A;  3LYK A;  3WYW A;  3A2X A;  3VWV A;  1TK8 B;  2WW2 A;  5A5H A;  4W66 A;  1SK2 A;  3IV4 A;  2J23 A;  1XW6 A;  1T8E B;  2YNX A;  4K2X A;  1PN9 A;  3LJR A;  2GT6 A;  4OFM A;  1VF1 A;  4NAX A;  2WW0 A;  2C3N A;  5KN3 A;  1XPV A;  3MWH A;  1XWK A;  1O8X A;  4PXO A;  2HZE A;  5A1N A;  2DC5 A;  4YQU A;  2ON7 A;  2HXK A;  4XS4 A;  5HR0 A;  4GST A;  4IN0 A;  2EIR A;  1I1I P;  5A4W A;  3LXT A;  2DJ2 A;  2YJ7 A;  1A23 A;  1THX A;  2CT6 A;  5G1K A;  5B8A A;  3HHV A;  3G9B A;  3I9V 2;  1Z7R A;  5DBQ A;  3GRX A;  4H86 A;  1KEB A;  4ZIJ A;  3ME7 A;  3DRN A;  2H71 A;  1R26 A;  3ZZX A;  19GS A;  3H79 A;  1G0T A;  3FHK A;  3APQ A;  1GLQ A;  3NZN A;  2UV8 G;  3HJM A;  1M2D A;  4EVM A;  5D96 A;  3CRT A;  1AXD A;  4HSC X;  3Q6O A;  1ST9 A;  4MMM A;  1I9D A;  2X8G A;  2LRN A;  3ZIV A;  2HLS A;  1F6M C;  1ERW A;  7GSS A;  3S9F A;  1M9B A;  4I6X A;  4Z2R A;  1TXU A;  4F0B A;  2GSR A;  3U5R E;  3UAR A;  4AKG A;  4HZ2 A;  1JHB A;  2BTO T;  2LRT A;  1V9W A;  5IMZ A;  4IW9 A;  3GKN A;  5A34 B;  3QMX A;  4BWS A;  3IDV A;  3GKM A;  4QL7 A;  3RDW A;  3HJP A;  2LS5 A;  2CA8 A;  5G31 A;  3F4R A;  4MLY A;  4BPY A;  3O76 A;  4G0L A;  5JWQ B;  2HRA A;  1QMV A;  4TOP A;  2GT5 A;  4MNN A;  4BVY B;  3IR4 A;  3F9U A;  4J2F A;  3LQ7 A;  1JLV A;  2R4V A;  3CYN A;  5ID2 A;  2H0I A;  5ECS A;  2VD0 A;  1R4W A;  2JZT A;  1Z7P A;  2ZCT A;  3MIX A;  1X0R A;  4ICY A;  4RQX A;  4MJC A;  4KDX A;  1K0B A;  4N10 A;  3ZLP A;  1GUL A;  1FAA A;  4DSQ A;  4Q5N A;  1N25 A;  3GA4 A;  3Q19 A;  1N8J A;  1HNB A;  4PUA A;  4XS6 A;  4D73 A;  3QFA C;  2FCH A;  4V1A g;  2DML A;  4K7I A;  4AJ7 A;  4ILF A;  3GKX A;  2B5Y A;  3N5O A;  3GX8 A;  2YWN A;  3I69 A;  4MJE A;  1TW9 A;  4G10 A;  4KGI A;  2VOC A;  3GYK A;  1XWB A;  3TOT A;  4EC0 A;  2DIZ A;  1YQ1 A;  4AKX B;  5FT3 A;  4YAP A;  2P0G A;  3IC8 A;  4WR5 A;  1JZR A;  4OO4 A;  4L5L A;  4GTU A;  4F0C A;  2L57 A;  3GHA A;  3D21 A;  5JCU A;  1FO5 A;  1B48 A;  5J40 A;  4KSO A;  4GCI A;  3GFK A;  1TK0 B;  1NSW A;  3IA1 A;  3SWL A;  4YKF A;  4IQA A;  1PD2 1;  2EFH A;  3QAV A;  1K0D A;  2FGX A;  2H75 A;  2FD3 A;  4OWY A;  3ZRD A;  3BD2 A;  4MA9 A;  1THO A;  3CRU A;  4NHW A;  5GST A;  2C0G A;  3CSJ A;  3M0F A;  3GTU A;  1G6W A;  2OE3 A;  1GP1 A;  2C3T A;  4KDU A;  1MD4 A;  1W4V A;  2R0G A;  4FYB A;  2YP6 A;  4N11 A;  5B7C A;  3UVT A;  4F9Z A;  3KP8 A;  4KCA A;  5F07 A;  2LNT A;  3EMX A;  1CQH A;  2YV7 A;  4FIW A;  3ISO A;  4ZB6 A;  3EYT A;  3CQF A;  4G0I A;  5KN1 A;  4GWR A;  4XIH A;  3WGE A;  3UBL A;  4OCF A;  4Q5F A;  4KF9 A;  3TKP A;  5ENU A;  1S3D A;  1TI1 A;  4EDZ A;  3VWU A;  4MPF A;  3TOU A;  5IIZ A;  1FB0 A;  1OVN A;  2OJL A;  4HS1 A;  2XC2 A;  1TDI A;  1TU8 A;  2CX3 A;  1A2L A;  2QSI A;  1MD3 A;  5IMV A;  3VPT A;  3MAK A;  4TRX A;  3FR6 A;  1WJK A;  4TXV A;  4YH2 A;  3FR3 A;  18GS A;  1SJI A;  3L78 A;  5DAK A;  2VKZ G;  3D0Z A;  1M3I A;  5CYY A;  1U3I A;  5J9C A;  3FZ9 A;  3ERG A;  1Z5Y E;  1SL0 B;  2F9S A;  3D22 A;  4EE0 A;  2WJU A;  2DMM A;  5J4Y A;  3C7M A;  4GSS A;  5D9T A;  3RAZ A;  2OKA A;  1SL2 B;  3EE2 A;  2K18 A;  4Z7X A;  2HRK B;  1S3A A;  2PWJ A;  3FY7 A;  5J41 A;  1PX7 A;  3EIN A;  4O5U A;  3DKS A;  4L0U A;  2A2S A;  5KOX A;  4TN8 A;  4K9Z A;  4EF0 A;  2WZ9 A;  1I5G A;  3QAW A; 
#chains in the Genus database with same CATH homology
 2LEG A;  3OR5 A;  2P5Q A;  1QXH A;  1X5E A;  5C04 A;  1OKT A;  3GNJ A;  4MJB A;  2BMX A;  2ES7 A;  1YVL A;  1AQV A;  1LJR A;  1FOH A;  3GKK A;  2P5R A;  4CDO A;  1HYU A;  1O85 A;  3CTG A;  3FK8 A;  5EY6 A;  4EIP A;  3KMO A;  1Z6M A;  2GQL A;  5J4U A;  3GSS A;  1RQM A;  4JE1 A;  3HA9 A;  5ECH B;  1N2A A;  3ZMK A;  2J9H A;  4G9H A;  2D2Z A;  4N30 A;  3CSI A;  2NPB A;  2H1L A;  2LRC A;  1SKW B;  5EPF A;  1YZX A;  2H0H A;  3CMI A;  3F3Q A;  4ECJ A;  3KEB A;  3DWV A;  3F3R A;  5HFI A;  2N5F A;  1GUK A;  2IIY A;  3ZML A;  2V1M A;  2H70 A;  2V32 A;  3G7Y A;  2H1D A;  1MEK A;  4F2I A;  1E2Y A;  1QK8 A;  2YOI A;  1B8X A;  1SEN A;  4NHZ A;  1SVL A;  1F3A A;  3R2Q A;  1QGV A;  3O3T A;  3E3E A;  5D93 A;  2H74 A;  3WGX A;  6GSW A;  4EKZ A;  2IMI A;  4TXO B;  2R3X A;  2LNS A;  1ACV A;  2LJK A;  1WE0 A;  4PUR A;  1GNW A;  2JSY A;  3LEF A;  2FWF A;  2L6D A;  2I4A A;  3KTB A;  2DKI A;  1TKD B;  5G5F A;  1ZGN A;  4E68 A;  1SVO A;  1MTC A;  4MH2 A;  3D4M A;  4OFN A;  5J9B A;  4JU5 A;  2VUP A;  4NWY A;  1NHY A;  5IO0 A;  1NM3 A;  2OBI A;  2B1L A;  4DSS B;  3D4T A;  2JZS A;  2R37 A;  2NTO A;  1QUW A;  4AF2 A;  5G1L A;  5ECP B;  5A5K A;  3IAS 2;  1PQN A;  3HMJ G;  3EUR A;  4QQ7 A;  3L9V A;  4KB3 A;  1QQ2 A;  4KW6 A;  2HSH A;  2IJY A;  2OE0 A;  2YCD A;  5J4V A;  4WF4 A;  1VF4 A;  2HNL A;  4NV2 A;  5IMF A;  5H5R A;  1ERT A;  3EPT A;  5A4V A;  1V98 A;  3C1S A;  2MMO A;  4ZL8 A;  5HR3 A;  3APO A;  3TJF A;  3IRA A;  3A5I A;  4KA0 A;  4LMV A;  4TW5 A;  4G0K A;  4FYU A;  1O7U A;  2E2G A;  8GSS A;  4K1F A;  3IXR A;  2A4H A;  3TJG A;  2C3Q A;  4DSR A;  2H0G A;  4X1U A;  3ZRE A;  3LFL A;  3TKR A;  3LW9 A;  5INY A;  4DVC A;  5A34 A;  2H66 A;  3W8J A;  1JLW A;  4BA7 A;  4FYC A;  4ECC A;  2QA2 A;  1UC7 A;  4WR4 A;  3TJK A;  2WS2 A;  4KND A;  5AGY A;  2LTK A;  4V1A p;  1K0A A;  4ULX A;  2YWO A;  5IMD A;  4ML6 A;  3GUR A;  5FWG A;  2RM6 A;  3AY8 A;  2X4A A;  1LU4 A;  4BVY A;  4ZB7 A;  2HSM B;  1G6Y A;  1HNA A;  1O8W A;  1UA5 A;  4NPB A;  1GL8 A;  4N3Z A;  4WEY A;  2O89 A;  4I8B A;  5B6N A;  2Z9S A;  2RUE A;  2GTU A;  1E6B A;  2C80 A;  4K8M A;  3HXS A;  3HYP A;  2LQQ A;  2GQM A;  4G2E A;  5G30 A;  1UN2 A;  5ECK B;  1U88 A;  3UOM A;  3RHC A;  2I9H A;  13GS A;  1GSF A;  4HEA 2;  4Z2T A;  1Z9H A;  5ECL B;  1NHO A;  1XOA A;  2EFD A;  4MF5 A;  4OCE A;  1X5C A;  1R5P A;  1V2A A;  5J3R A;  2X64 A;  3M3M A;  3EWL A;  3BOA A;  2AV4 A;  5FHI A;  5DCH A;  2OBK A;  1XCC A;  1ZL9 A;  5F06 A;  2R0C A;  1BF5 A;  2I3Y A;  3ED3 A;  5EVO A;  3GX0 A;  4XCS A;  4G19 A;  2VL9 A;  4GDF A;  3LOR A;  4TR1 B;  1PL2 A;  4AI6 A;  1DUG A;  2GSS A;  1T00 A;  2H6X A;  4MF7 A;  4NXI A;  2GZP A;  2RLI A;  3LXZ A;  4XRA A;  1A24 A;  4O92 A;  2XHF A;  5DDL A;  5DAL B;  2H76 A;  2MBS A;  6GSX A;  1YDK A;  5AIV A;  1J9B A;  3CBU A;  3TDG A;  2MZC A;  4AKI A;  2TIR A;  1GSS A;  3APS A;  1WWJ A;  2O8V B;  3LYP A;  3GST A;  2KP2 A;  2WFC A;  2MMA A;  2QKE A;  3GN3 A;  2L5O A;  1H4O A;  2VLT A;  2R5G A;  2AAW A;  1DSB A;  2HRN A;  2LJA A;  5GAN D;  5D9V A;  4IBP A;  4CHS A;  1AAZ A;  2K9F A;  4XS4 B;  2HQT A;  1OAZ A;  2H72 A;  2I1U A;  2HE3 A;  2AUV A;  4CY6 A;  2VCT A;  2H73 A;  2FUG 2;  5GZZ B;  2C4J A;  1WOU A;  1V58 A;  4IP1 A;  1YKC A;  2CZ3 A;  1TTZ A;  2M80 A;  2H1G A;  3VPQ A;  3ZVJ D;  4JBB A;  1GWC A;  4I5Q A;  1F9M A;  3L4N A;  2JL4 A;  4RI7 A;  1USB A;  2H19 A;  1KNG A;  2PU9 C;  3BBY A;  4IS0 A;  2PUK C;  3PR8 A;  2IN3 A;  2V2G A;  4WBJ A;  1M2A A;  2FHE A;  3VUR A;  1O6J A;  2GS3 A;  3L9U A;  2C0E A;  4WF5 A;  4TR4 A;  1YF1 A;  2X8C A;  2WCI A;  1RK4 A;  1WP0 A;  4KSM A;  2FWE A;  3QFB C;  1TI3 A;  3US3 A;  2K8V A;  1X5D A;  1GUM A;  3TRQ A;  3RHB A;  4YKG A;  1OC9 B;  2JAD A;  5CRE A;  3P90 A;  3VI5 A;  2PBJ A;  4KX4 A;  2VLV A;  2ON5 A;  3I43 A;  1Z3E A;  3DYR A;  1PKZ A;  6GSU A;  1TRU A;  1T7P B;  2VD1 A;  4RUV A;  3A3T A;  2VCW A;  5ECQ B;  2QGV A;  4V2M A;  4POM A;  2IPA A;  2CVK A;  2KHP A;  2VCX A;  1FOV A;  1EV4 A;  4BVX B;  2LKU A;  3QCP A;  2DJ1 A;  1B9X C;  5BMU A;  3EU4 A;  3PGT A;  1GRX A;  1EEJ A;  2E2M A;  1PA3 A;  4F03 A;  4IJ3 A;  5IQY A;  1EGR A;  2GGT A;  4ZIL A;  3N9J A;  5IO2 A;  3W6G A;  3KM6 A;  1ON4 A;  4PQI A;  2QC7 A;  2YV9 A;  3BCI A;  3VLN A;  1Y1U A;  4WET A;  5IMC A;  2GVP A;  3TUE A;  4MAB A;  5ECR B;  2R6K A;  4V2L A;  5JCG A;  3TKS C;  5JWR B;  1QFN A;  4MCU A;  2A2R A;  2R0P A;  3ZYW A;  1ZCP A;  1V57 A;  1T4Y A;  4L5O A;  4IQ1 A;  5F0G A;  1OE7 A;  1EZK A;  4LL1 B;  3A2W A;  4O5Q A;  3GV1 A;  2MMN A;  3GUS A;  9GSS A;  1PX6 A;  5CRH A;  4ZL7 A;  2VCZ A;  3O6T A;  4V2N A;  2H8L A;  1TP9 A;  2LJR A;  4LMW A;  2H1B A;  2DSA A;  4PQH A;  3EC3 A;  2MYG A;  1XWG A;  3J7Y b;  4FO5 A;  5HR2 A;  2XBI A;  5COH A;  4K7N A;  2QA1 A;  4MK3 A;  4ECI A;  2F8F A;  1XVQ A;  5LD0 A;  2FA4 A;  1K3L A;  1GSY A;  3DXB A;  1PMT A;  3FRC A;  1DE1 A;  4WXT A;  4AKH A;  2PGT A;  2DKH A;  3ZL5 A;  1XWC A;  4Q5R A;  4POB A;  2B7J A;  1U3A A;  2HSY A;  3GTU B;  1XWA A;  2VM1 A;  1K0M A;  1EP8 A;  3I6A A;  4MH3 A;  3H93 A;  4OFT A;  2HYX A;  4DSS A;  4ISD A;  4Q5Q A;  4PQ1 A;  4EUY A;  3TJJ A;  4KE3 A;  3VFI A;  2AJQ B;  3VI7 A;  1VF3 A;  1B4P A;  4HQS A;  2B6M A;  5IMA A;  2H30 A;  2FNO A;  2FLS A;  3HDC A;  5CO3 A;  4E8H A;  4YQV A;  1BQ7 A;  4NV5 A;  4PNF A;  4I2U A;  3M1G A;  1XBS A;  4HI7 A;  2IMF A;  2OAD A;  3D5J A;  2H1A A;  2RII A;  4MJA A;  4I97 A;  1AC1 A;  4JR4 A;  3WD6 A;  1HQO A;  2DJ3 A;  1WRY A;  3KP9 A;  3FKF A;  4O32 A;  2VL3 A;  3EVI A;  3MSZ A;  1JZD A;  3VWX A;  1MDK A;  4ACS A;  4CW9 A;  4A5P A;  4MZW A;  1GLP A;  1GSE A;  2F8A A;  1B9Y C;  1UVZ A;  2EC4 A;  5DQS A;  3FZA A;  3H8Q A;  1Q4J A;  5DAK B;  1TOF A;  5IPG A;  3F4S A;  3NIV A;  1GTA A;  2IL3 A;  3KIJ A;  5CRG A;  4LLR A;  5EL8 A;  5KEJ A;  1BX9 A;  2CV4 A;  1A2J A;  1K0N A;  2PVQ A;  1OE8 A;  3JCM L;  4KAE A;  1ZMA A;  2M46 A;  1WMJ A;  3K8N A;  1J0F A;  4CY8 A;  16GS A;  5DCG A;  2FWH A;  2REM A;  5C00 A;  3KCM A;  1SK1 A;  4IP6 A;  2AB6 A;  4LL4 B;  3E0U A;  4AJ8 A;  3F8U A;  4BL7 B;  2VL2 C;  1PSQ A;  2X8H A;  3IHQ A;  4O5R A;  1O81 A;  3HKR A;  1MDI A;  1ZOF A;  2MMZ A;  3DD3 A;  4GQF A;  3KXO A;  1Y6E A;  1A2M A;  4HOJ A;  5IPH A;  4Z2U A;  3LG6 A;  3GH9 A;  3GL3 A;  4N0V A;  1GUH A;  4GXZ A;  3LGC A;  1ZYN A;  4KCE A;  1XIY A;  4HZ4 A;  2I81 A;  1FHE A;  2N5A A;  3KD0 A;  3E9J B;  1M7T A;  5H5Q A;  5DJM A;  2V41 A;  1EEM A;  4N0Z A;  1BG1 A;  4EL1 A;  2JU5 A;  3L0H A;  2X49 A;  1F3B A;  3TRX A;  3LSZ A;  1G7E A;  3C1R A;  3DVW A;  1X9S B;  1AIU A;  5D9X A;  4PUF C;  1PKW A;  3HJO A;  1C72 A;  6GST A;  2R2J A;  4DEJ A;  1EOH A;  2FY6 A;  1OC3 A;  4HU7 A;  2EFC A;  2WRT A;  4OO5 A;  3M9J A;  1BED A;  3P2A A;  4TKY A;  4GQC A;  5CAX A;  2ZUP A;  2IMD A;  1X9W B;  1TK5 B;  4E8E A;  1XZO A;  4GF0 A;  1GH2 A;  2C8U A;  2YZU A;  2OE1 A;  3DVX A;  2GLR A;  2C1Y A;  1G7O A;  4TR1 A;  5JCW A;  2O5V A;  1KTE A;  3TCO A;  2GZY A;  2YN1 A;  1ILO A;  2B5X A;  1B4Q A;  4K6X A;  5D9W A;  1SKS B;  5DAL A;  4MP4 A;  4XHM A;  1ZYE A;  3ERF A;  5G2Z A;  5ECI B;  2EIQ A;  2IME A;  1K3O A;  4AJ6 A;  1DE2 A;  5DJL A;  3P7X A;  2L5L A;  5LCZ A;  2WDU A;  2WUL A;  1AUC A;  5ABR A;  2PER A;  6GSS A;  3KH7 A;  2UZ8 A;  3HZ4 A;  1DBY A;  1SJZ A;  4F82 A;  2TRC P;  3D6I A;  4I2T A;  1Q98 A;  3DGQ A;  3ZIT A;  1VF2 A;  3ZTL A;  2IFQ B;  5HFG A;  3TKS A;  3QR6 A;  2YWM A;  3BCK A;  2HSN B;  2AYT A;  4IHU A;  6GSY A;  4IJI A;  2GDR A;  1F2E A;  1CQG A;  1ML6 A;  2E0Q A;  3CTF A;  4PTS A;  4O7H A;  1F37 A;  4XS1 A;  2GST A;  4ZBD A;  1SK0 A;  4TVE A;  2B7K A;  4PGT A;  1EGO A;  4USS A;  5D73 A;  1XW5 A;  4ZBB A;  4OMV A;  5ECN B;  3Q74 A;  4KH7 A;  2EIO A;  2O85 A;  2VIM A;  2DIY A;  3F6D A;  2G2Q A;  4MF6 A;  1FVK A;  4K5S A;  1EV9 A;  3DML A;  1JZW A;  2MBT A;  3IC4 A;  2B5E A;  4AGS A;  4XRD A;  3HVV A;  1Z6N A;  3QD9 A;  1YY7 A;  1A8Y A;  2B3S A;  3EMP A;  5E59 A;  1SD8 A;  4QMK A;  1OC9 A;  4WBR D;  2L4Q A;  1HNC A;  1XW9 A;  2X99 A;  11GS A;  1ERU A;  2L6C A;  4IEL A;  2K6V A;  3IHG A;  3PH9 A;  2PN8 A;  3C73 A;  1YKA A;  3WGD A;  5KN2 A;  1O73 A;  1BAY A;  5A5H B;  5KN0 A;  2LQO A;  3CXG A;  1YF0 A;  4BVX A;  1VGL A;  4HQZ A;  4JZQ A;  1T1V A;  1AQX A;  4PX1 A;  2HZE B;  5A1N B;  5AIS A;  1SVM A;  5DQY A;  1LBK A;  5IM9 A;  2PMT A;  1GSQ A;  3HZ8 A;  5JWO B;  3EU3 A;  4ML1 A;  2V6O A;  3FZ4 A;  3A2V A;  4YQM A;  3KH9 A;  4GRF A;  3UBK A;  1SKR B;  4K0N A;  3TKQ A;  4L0W A;  1BG5 A;  3IBH A;  5L71 A;  1ZZY A;  4K2D A;  2XPD A;  1TXX A;  1GTB A;  3LWA A;  3A5W A;  3ME8 A;  2V6K A;  3HVS A;  3C71 A;  5D8I A;  3HD5 A;  1SD9 A;  3F63 A;  1BJX A;  2A4V A;  4HJ2 A;  5B8B A;  1JZO A;  2CZ2 A;  2K8S A;  5CRD A;  2IMK A;  3FR9 A;  1XFL A;  3GIX A;  1Y25 A;  4POK A;  3ZIJ A;  4ZXG A;  4JR6 A;  2WGR A;  4HDE A;  1RW1 A;  1A0F A;  3IPZ A;  4NMU A;  1JFU A;  2CVB A;  4QL9 A;  4MZB A;  4K0G A;  2TRX A;  4OD7 A;  2HRK A;  2OA7 A;  1PL1 A;  2VCQ A;  2VL2 A;  1SYX A;  1GSD A;  1T3B A;  3SBC A;  3DIE A;  4GLT A;  2XPE A;  3J7Y k;  5IOX A;  10GS A;  1FW1 A;  2ALB A;  4MPG A;  2FWG A;  1PRX A;  5ID2 B;  1WIK A;  3G7I A;  1GTI A;  3QPM A;  1URM A;  2L59 A;  4YAV A;  1PN0 A;  3P8W A;  3IK7 A;  3ZVJ A;  4HJM A;  2JZR A;  3KGK A;  1U87 A;  3L9S A;  3G7J A;  2G0F A;  4JED A;  1R7H A;  3HY2 A;  3GL5 A;  1OKD A;  3DEX A;  2RM5 A;  2VCV A;  4EO3 A;  4D73 B;  3BJ5 A;  3TKS E;  3ZFB A;  3GMF A;  1A0R P;  1M9A A;  2NDO A;  2GSQ A;  3QOU A;  2GZZ A;  2HZF A;  3NOF A;  1U6T A;  2C0D A;  2IWT A;  2YAN A;  1FVJ A;  4MZC A;  4GSN A;  2KLX A;  4K5R A;  1R5A A;  1K0C A;  3FW2 A;  3TGZ A;  2HFD A;  5ECM B;  2VLU A;  2YJH A;  1AQW A;  5F05 A;  2YPM A;  4HU9 A;  3H1N A;  2F3M A;  3KJY A;  3ERW A;  2H6Y A;  2F51 A;  1TJD A;  4TXO A;  1IYH A;  5LNK e;  3MDK A;  1SU9 A;  3R3E A;  4ZB8 A;  3MYD A;  3WT2 A;  5ELG A;  2L4C A;  5AN1 A;  4EXJ A;  2NBS A;  2DJJ A;  1OC8 A;  1XOB A;  1GNE A;  2CQ9 A;  4WKW A;  4KDY A;  2LV3 A;  2ZNM A;  1KBN A;  3RPP A;  3UMA A;  2DJK A;  4X0X A;  2DBC A;  3PPU A;  4BL7 A;  3TU3 B;  1S3C A;  1YEX A;  2DLX A;  5BMU B;  4EDY A;  2YZH A;  3IK9 A;  4J56 E;  4ECB A;  4HUA A;  1ERV A;  2WB9 A;  2HI7 A;  2RUF A;  1YEP A;  2PVO C;  4EIQ A;  5ELA A;  5GSS A;  2LUS A;  2KP1 A;  2A2P A;  5DVB A;  5HFK A;  3UJ1 A;  2H6Z A;  2O87 A;  1AW9 A;  4ZL9 A;  5IOW A;  3M9K A;  1HD2 A;  5B6M A;  1XXU A;  5F8B A;  4RQR A;  3KTL A;  6GSV A;  3QAG A;  5CP1 A;  3M8N A;  3KMN A;  1T4Z A;  3F6F A;  2YWI A;  2OT3 A;  1ZYP A;  2N5B A;  4MDC A;  4G01 A;  2GQK A;  3IOS A;  3FYG A;  1M2B A;  14GS A;  3IAM 2;  2JSZ A;  17GS A;  1OYJ A;  4ID0 A;  2DJ0 A;  2KOK A;  1FG4 A;  1EWX A;  5GAP D;  4POL A;  1GTU A;  4PNG A;  2B1K A;  5G5E A;  2O7K A;  5HR1 A;  1SJ6 A;  5E4W A;  5J47 A;  4IKH A;  4FH8 A;  3WT1 A;  4IVF A;  3TRP A;  3V1W A;  3FMW A;  1WPI A;  1BYE A;  3IE3 A;  3TB2 A;  4XTS A;  2EFE A;  4L8E A;  5H5S A;  3KZQ A;  1TRW A;  1MDJ A;  3RPN A;  3MNG A;  3FEU A;  20GS A;  3UAP A;  1K3Y A;  3UIW A;  1XVW A;  2HSM A;  2FA8 A;  1NW2 A;  5AIX A;  3VK9 A;  1IYI A;  2VO4 A;  2OAC A;  1FB6 A;  3GH6 A;  2M72 A;  2CVD A;  4RI6 A;  5A4U A;  1EP7 A;  4K7O A;  4P3Y B;  2VAF A;  2C0F A;  4ZB9 A;  4TR0 A;  4X4J A;  2LST A;  1VRS D;  1SL1 B;  1TRS A;  2IFQ A;  1GSU A;  1EOG A;  3PIN A;  2XBQ A;  4JRR A;  2HSN A;  2KUC A;  1X9M B;  1SYR A;  4IGJ A;  2BJX A;  3VWW A;  1H75 A;  3UVH A;  3F4T A;  3U6V A;  4ZBA A;  1PGT A;  1YJ6 A;  2P31 A;  1V40 A;  4BWQ A;  3FZ5 A;  2VM2 A;  2CAQ A;  4X43 A;  1A8L A;  3RBT A;  1J08 A;  5CRW A;  1ZYQ B;  3C8E A;  1W89 A;  1M99 A;  4FQU A;  2HT9 A;  4LA1 A;  1M0U A;  5HQP A;  4TR3 A;  5KOW A;  3HVX A;  3ZFL A;  3F0I A;  2H01 A;  2NVL A;  3Q18 A;  4KUN A;  1ABA A;  2E7P A;  5ECO B;  2CAI A;  2JAC A;  3CSH A;  12GS A;  2CX4 A;  2HRF A;  5J5N A;  3W8S A;  5BRT A;  1TU7 A;  3HCZ A;  1K0O A;  22GS A;  4J57 E;  3UL3 A;  3H4K A;  1TRV A;  3UEM A;  3QDN A;  3TJB A;  2PPT A;  2AHE A;  3CWG A;  5CNW A;  3LYK A;  3WYW A;  3A2X A;  3VWV A;  1TK8 B;  5A5H A;  4W66 A;  1SK2 A;  3IV4 A;  2J23 A;  1XW6 A;  1T8E B;  2YNX A;  4K2X A;  1PN9 A;  3LJR A;  2GT6 A;  4OFM A;  1VF1 A;  4NAX A;  2C3N A;  5KN3 A;  1XPV A;  3MWH A;  1XWK A;  1O8X A;  4PXO A;  2HZE A;  5A1N A;  2DC5 A;  4YQU A;  2ON7 A;  2HXK A;  4XS4 A;  5HR0 A;  4GST A;  4IN0 A;  2EIR A;  5A4W A;  3LXT A;  2DJ2 A;  2YJ7 A;  1A23 A;  1THX A;  2CT6 A;  5G1K A;  5B8A A;  3HHV A;  3G9B A;  3I9V 2;  1Z7R A;  5DBQ A;  3GRX A;  4H86 A;  1KEB A;  4ZIJ A;  3ME7 A;  3DRN A;  2H71 A;  1R26 A;  3ZZX A;  19GS A;  3H79 A;  1G0T A;  3FHK A;  3APQ A;  1GLQ A;  3NZN A;  2UV8 G;  3HJM A;  1M2D A;  4EVM A;  5D96 A;  3CRT A;  1AXD A;  3Q6O A;  1ST9 A;  4MMM A;  1I9D A;  2X8G A;  2LRN A;  3ZIV A;  2HLS A;  1F6M C;  1ERW A;  7GSS A;  3S9F A;  1M9B A;  4I6X A;  4Z2R A;  1TXU A;  4F0B A;  2GSR A;  3U5R E;  3UAR A;  4AKG A;  4HZ2 A;  1JHB A;  2BTO T;  2LRT A;  1V9W A;  5IMZ A;  4IW9 A;  3GKN A;  5A34 B;  3QMX A;  4BWS A;  3IDV A;  3GKM A;  4QL7 A;  3RDW A;  3HJP A;  2LS5 A;  2CA8 A;  5G31 A;  3F4R A;  4MLY A;  4BPY A;  3O76 A;  4G0L A;  5JWQ B;  2HRA A;  1QMV A;  4TOP A;  2GT5 A;  4MNN A;  4BVY B;  3IR4 A;  3F9U A;  4J2F A;  3LQ7 A;  1JLV A;  2R4V A;  3CYN A;  5ID2 A;  2H0I A;  5ECS A;  2VD0 A;  1R4W A;  2JZT A;  1Z7P A;  2ZCT A;  3MIX A;  1X0R A;  4ICY A;  4RQX A;  4MJC A;  4KDX A;  1K0B A;  4N10 A;  3ZLP A;  1GUL A;  1FAA A;  4DSQ A;  4Q5N A;  1N25 A;  3GA4 A;  3Q19 A;  1N8J A;  1HNB A;  4PUA A;  4XS6 A;  4D73 A;  3QFA C;  2FCH A;  4V1A g;  2DML A;  4K7I A;  4AJ7 A;  4ILF A;  3GKX A;  2B5Y A;  3N5O A;  3GX8 A;  2YWN A;  3I69 A;  4MJE A;  1TW9 A;  4G10 A;  4KGI A;  2VOC A;  3GYK A;  1XWB A;  3TOT A;  4EC0 A;  2DIZ A;  1YQ1 A;  4AKX B;  5FT3 A;  4YAP A;  2P0G A;  3IC8 A;  4WR5 A;  1JZR A;  4OO4 A;  4L5L A;  4GTU A;  4F0C A;  2L57 A;  3GHA A;  3D21 A;  5JCU A;  1FO5 A;  1B48 A;  5J40 A;  4KSO A;  4GCI A;  3GFK A;  1TK0 B;  1NSW A;  3IA1 A;  3SWL A;  4YKF A;  4IQA A;  1PD2 1;  2EFH A;  3QAV A;  1K0D A;  2FGX A;  2H75 A;  2FD3 A;  4OWY A;  3ZRD A;  3BD2 A;  4MA9 A;  1THO A;  3CRU A;  4NHW A;  5GST A;  2C0G A;  3M0F A;  3CSJ A;  3GTU A;  1G6W A;  2OE3 A;  1GP1 A;  2C3T A;  4KDU A;  1MD4 A;  1W4V A;  2R0G A;  4FYB A;  2YP6 A;  4N11 A;  5B7C A;  3UVT A;  4F9Z A;  3KP8 A;  4KCA A;  5F07 A;  2LNT A;  3EMX A;  1CQH A;  2YV7 A;  4FIW A;  3ISO A;  4ZB6 A;  3EYT A;  4G0I A;  5KN1 A;  4GWR A;  4XIH A;  3WGE A;  3UBL A;  4OCF A;  4Q5F A;  4KF9 A;  3TKP A;  5ENU A;  1S3D A;  1TI1 A;  4EDZ A;  3VWU A;  4MPF A;  3TOU A;  5IIZ A;  1FB0 A;  1OVN A;  2OJL A;  4HS1 A;  2XC2 A;  1TDI A;  1TU8 A;  2CX3 A;  1A2L A;  2QSI A;  1MD3 A;  5IMV A;  3VPT A;  3MAK A;  4TRX A;  3FR6 A;  1WJK A;  4TXV A;  4YH2 A;  3FR3 A;  18GS A;  1SJI A;  3L78 A;  5DAK A;  2VKZ G;  3D0Z A;  5CYY A;  1U3I A;  5J9C A;  3FZ9 A;  3ERG A;  1Z5Y E;  1SL0 B;  2F9S A;  3D22 A;  4EE0 A;  2WJU A;  2DMM A;  5J4Y A;  3C7M A;  4GSS A;  5D9T A;  3RAZ A;  2OKA A;  1SL2 B;  3EE2 A;  2K18 A;  4Z7X A;  2HRK B;  1S3A A;  2PWJ A;  3FY7 A;  5J41 A;  1PX7 A;  3EIN A;  4O5U A;  3DKS A;  4L0U A;  2A2S A;  5KOX A;  4TN8 A;  4K9Z A;  4EF0 A;  2WZ9 A;  1I5G A;  3QAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...