3AY8A

Glutathione s-transferase unclassified 2 from bombyx mori
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
215
structure length
215
Chain Sequence
SSLKLYHFPVSGPSRGALLAARAIGIPIQIEIVNLFKKEQLQESFLKLNPQHCVPTLDDNNFVLWESRAIACYLADKYGKDDQWYPKDLQKRAVVNQRLYFDSASLYVKIRAICFPILFLGETEIKQSLKDDLNSTLSFLNQFLEKTKWVAADHPTIADTSIYASMSSILAVGWDISSFPNIQRWIKDCLLLPGAPENEDGARTFGDAVKKNIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Crystallographic survey of active sites of an unclassified glutathione transferase from Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 81
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3ay8A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ay8A01
4ZBAA 3SWLA 2MMNA 1NHOA 3L4NA 4X43A 5G1LA 3Q74A 10GSA 1OC3A 2HFDA 4TW5A 4Q5FA 2H6XA 3GTUB 3PGTA 4KSOA 3TOUA 5B6NA 5DQSA 2HSMB 1ACVA 1N2AA 1O8WA 3G7YA 3KD0A 1OKTA 1MDJA 1ST9A 3UEMA 3LXTA 3WYWA 4MJBA 4F82A 3FZAA 3W8JA 2BJXA 4FO5A 4MF5A 1E2YA 4YQUA 1ZGNA 2HSYA 2WFCA 4BVYA 4MABA 1LBKA 1YF1A 1UA5A 4LMWA 2YV9A 4ZL8A 1S3AA 2YZHA 1A24A 4G19A 4CHSA 1NM3A 3MDKA 2LUSA 3CYNA 3UJ1A 4FIWA 4CDOA 1TI1A 4I8BA 2R4VA 3DGQA 1Z5YE 2GT5A 2O87A 4AJ6A 1WMJA 3WD6A 4XCSA 2F8FA 3TRQA 4ML6A 2M72A 5CNWA 2R3XA 4ECJA 1F3AA 4KA0A 3IBHA 1GTBA 4LMVA 4MDCA 4MLYA 3L78A 3M0FA 1F2EA 2LV3A 5ID2A 4G0IA 3QR6A 2YJHA 4WXTA 1M0UA 1T7PB 4XIHA 3IE3A 1SL1B 6GSUA 2B1KA 4GTUA 3CTGA 3Q19A 3O6TA 4FH8A 3GA4A 3TOTA 5A4WA 1UN2A 1OC8A 5HFKA 1DBYA 5D73A 4EE0A 4MPGA 3F63A 5FT3A 2HRFA 2GTUA 4F03A 3VWVA 2H71A 2VCWA 2K9FA 1K0OA 2VCTA 4ID0A 3CSIA 4PX1A 3QFAC 4L5LA 3GHAA 3K8NA 3EMPA 1SL0B 5D8IA 2R5GA 5F07A 1SYXA 3IC4A 2VL9A 4G9HA 1NHYA 3DVWA 1EV9A 2B7KA 5EPFA 3VPTA 3MNGA 1EEJA 3PR8A 3LORA 5KEJA 4TXOB 2E7PA 4RI7A 3E3EA 3DD3A 5INYA 3HZ4A 1TI3A 1PN9A 2C3QA 4JE1A 3U6VA 17GSA 1THOA 1SKSB 3UARA 3ZFLA 4ZB6A 3BCKA 4K7IA 2R6KA 3ZZXA 1SENA 1TRSA 1TKDB 1GH2A 1A8YA 2I1UA 3GURA 3D5JA 3PH9A 3HY2A 3ZMLA 3C71A 1THXA 4AJ8A 5ECMB 2DJ2A 2QC7A 2X99A 4BL7A 4OFTA 2NDOA 1M9AA 5GSSA 2P5RA 4WR4A 1PKWA 5IO0A 5HR1A 3ZRDA 6GSTA 2VM1A 4GSSA 4XTSA 3F8UA 1EOGA 2VM2A 4G10A 1AQXA 2YWNA 3EU3A 2CAQA 2H75A 4GWRA 1H75A 2IFQA 2OACA 5ECIB 4WF5A 4XRDA 4TOPA 1YEXA 3J7Yk 4PTSA 3DRNA 5AISA 2OE0A 3TKPA 3IK9A 1OAZA 3C73A 2WS2A 13GSA 1URMA 5DALB 2KHPA 2K6VA 1Z7RA 1XW5A 4BWSA 2K8SA 4HEA2 5CRHA 3VWWA 1M7TA 4BPYA 5F0GA 5GAND 2DJ1A 3GNJA 3DEXA 1MDKA 2IIYA 5HR3A 2VCVA 4J2FA 5GSTA 1FW1A 3F3RA 2AJQB 2PPTA 4IQAA 4BWQA 4I97A 2WB9A 2KUCA 5J41A 2HXKA 1ZCPA 2HZEB 5D96A 1CQHA 2CQ9A 1DUGA 1A23A 3UL3A 3ZLPA 1YF0A 1XOAA 3FEUA 2NBSA 1LJRA 1QXHA 2H6YA 1X5CA 3ME8A 2GQMA 4BVXA 4GSNA 4G0LA 1GNEA 3A2VA 4V2MA 4PUAA 6GSYA 5B6MA 2H8LA 4FQUA 2LNSA 2IMDA 4KDUA 3NIVA 4P3YB 4JU5A 1XW9A 1ZOFA 3R2QA 1X5DA 3CXGA 1FG4A 5D9TA 4RQRA 1HQOA 2H76A 2FD3A 2L5LA 1K3LA 4ULXA 2EIQA 1GSQA 1VF1A 2VLUA 4N0VA 2HE3A 3VI5A 2P31A 3W8SA 4TR0A 4E8EA 4TR4A 4LL4B 3EE2A 4OD7A 2HSNB 3KJYA 1XW6A 4POKA 1R26A 5KN1A 3DMLA 1EV4A 5H5QA 3LFLA 3F6FA 2EC4A 5D93A 2FWGA 1PX6A 1OC9A 2O85A 3WT2A 3Q18A 3HDCA 1NSWA 4J56E 4DSQA 3HKRA 3L9SA 3RBTA 2X64A 5B8AA 1A8LA 4TKYA 2H6ZA 1K0NA 4PGTA 2YCDA 2O7KA 2RIIA 2V32A 3U5RE 3IC8A 3IXRA 1YEPA 1H4OA 4ZL7A 6GSWA 3CSHA 3A2WA 1GUKA 1XBSA 3DXBA 3GFKA 3C8EA 4EDYA 4H86A 2CVKA 4DSSB 1HYUA 4HQSA 4L0UA 2JZTA 2LJRA 4WR5A 2I81A 1ZZYA 5LCZA 3TRXA 4IQ1A 2N5AA 2DLXA 5J3RA 5ID2B 3TRPA 2DBCA 4L5OA 2JU5A 2GGTA 2DC5A 3P7XA 4Z7XA 1ERVA 1AW9A 2VO4A 4EUYA 3M3MA 4MJEA 5B8BA 1J08A 1X9MB 4N10A 4ZBDA 1GLPA 1WPIA 2HI7A 2HYXA 4ZILA 3O76A 1YJ6A 5CRWA 5JWOB 3L0HA 5HFGA 3LEFA 1GP1A 1K0CA 2DJKA 4LLRA 5KN3A 2JZSA 1BEDA 4JZQA 2A4VA 3BJ5A 3A3TA 2FWHA 1I5GA 2F51A 2WGRA 2X8HA 2OKAA 3UBKA 3HA9A 1O81A 1E6BA 4E8HA 4ZBBA 3IAM2 4MH3A 4Q5NA 2RUFA 4L8EA 4OFMA 2V6OA 3IK7A 1FHEA 4OWYA 1RQMA 1T1VA 1R4WA 1S3CA 3BBYA 5B7CA 4HOJA 2PUKC 1Z6MA 3NZNA 2OBIA 3ZVJD 2YWOA 2LTKA 4BL7B 4KB3A 3BD2A 1GSUA 1QQ2A 3DIEA 2LS5A 2WULA 2MYGA 1K0AA 5ECKB 2H66A 4POBA 3APQA 2FWEA 4GXZA 1MD3A 3KP9A 3FZ9A 3QFBC 1B4PA 3FR9A 3FYGA 2XPDA 3IOSA 2IFQB 2VCQA 2C0GA 2FLSA 2G2QA 3TJJA 1XWKA 4YQMA 2OE3A 2HQTA 2WDUA 1UVZA 3EURA 5JWRB 4TRXA 2BMXA 1X9WB 2JZRA 3HVSA 1KNGA 2B5YA 5DBQA 3PPUA 1QFNA 2VIMA 3F6DA 5LNKe 1A0RP 4TR3A 2VL2A 5ECSA 5IMCA 2CX4A 3P90A 1HNCA 3TJGA 5C04A 2FHEA 5IMFA 3HCZA 2GQLA 1BQ7A 2XHFA 3QAGA 4TXVA 1SJ6A 5G31A 3TB2A 1GWCA 1S3DA 2GSTA 4G0KA 3KIJA 3TKSC 2VCXA 4MA9A 1GSYA 4HZ4A 3N9JA 1SJIA 5H5RA 3KP8A 4JRRA 2FWFA 1X9SB 3LJRA 4BVXB 5DVBA 1HNBA 4NHWA 4I6XA 3TKQA 3KGKA 1XOBA 2C3TA 2AAWA 1YKAA 1T4YA 3RPNA 3VURA 2O89A 2CV4A 1V98A 5E4WA 3GN3A 4MJAA 2ZNMA 1TK8B 3H8QA 1JLVA 5ECHB 2L6CA 4KCAA 4POLA 3HVXA 2CZ2A 2PVOC 1YDKA 3Q6OA 3D0ZA 2HRKB 3I69A 2B3SA 4KF9A 4JR4A 4ACSA 3HVVA 2E2GA 4KGIA 4J57E 1R5AA 5EY6A 1RK4A 2LRNA 1OC9B 3A5WA 3IAS2 2J9HA 3F3QA 2B1LA 3BCIA 5IO2A 1MDIA 2WCIA 1YQ1A 1ERWA 2GZZA 3D21A 2YJ7A 4PQIA 3CMIA 5ECQB 4IGJA 5G5FA 4YAVA 1ERTA 2PBJA 2P0GA 4MMMA 1SL2B 1BYEA 3MWHA 4FYUA 5ECOB 3TJBA 1DE1A 2GQKA 1N8JA 2H19A 2RLIA 4HU9A 3GRXA 4PNGA 2XPEA 5CREA 4DEJA 2YV7A 2CA8A 2GT6A 2H1DA 4NXIA 4MP4A 11GSA 5IM9A 3F4RA 1YKCA 2DIYA 5HFIA 5F05A 1WRYA 3HD5A 1Z3EA 1WWJA 4EC0A 5JCGA 4X1UA 1PRXA 3ZL5A 2GS3A 2FNOA 5EVOA 4AJ7A 3J7Yb 3GKMA 3FY7A 3FW2A 4MK3A 2M80A 3IPZA 2C3NA 4JBBA 2QKEA 1VF3A 3TJFA 1CQGA 3G9BA 2PERA 4QQ7A 2BTOT 2VUPA 1SU9A 4EKZA 1O85A 2LQOA 3LXZA 4K9ZA 4PURA 4NV5A 2H73A 1EEMA 3GKXA 1GSSA 2KOKA 3DWVA 3KMOA 1X0RA 4IW9A 2H0HA 2DMLA 4ZB9A 1GSEA 3ERFA 2OE1A 3LSZA 1OKDA 4WBJA 1AC1A 3TCOA 3ZREA 4ISDA 1TP9A 1PSQA 1DSBA 4Q5QA 1BG5A 3M1GA 3GL5A 3WT1A 1AUCA 1B9XC 4WEYA 2YPMA 1JLWA 2MMOA 2DIZA 3TKRA 1U3AA 2ON5A 3ZFBA 5ENUA 2GVPA 1XXUA 4KH7A 5DCHA 2D2ZA 2J23A 1AQWA 2FA4A 1ML6A 4PXOA 3L9VA 2H30A 4ZXGA 1XWCA 4F0BA 3TGZA 4XS4A 4IP1A 4IELA 3LQ7A 2AV4A 4BA7A 3M9JA 3D6IA 5J9CA 2O8VB 3FK8A 1TU7A 4X0XA 4N0ZA 1WP0A 5J9BA 1YY7A 2L4CA 2E2MA 1G0TA 2HSMA 2JSZA 5G1KA 4IJ3A 4I2TA 5F06A 2V2GA 5AIVA 3AY8A 5GAPD 3FKFA 2K8VA 4DVCA 1U3IA 3ZTLA 4I2UA 3WGEA 2FY6A 12GSA 1VF4A 3V1WA 2CAIA 1T00A 4IVFA 3TDGA 4D73A 1QK8A 1UC7A 1Y6EA 4G2EA 3LYKA 4GRFA 2WZ9A 4GSTA 2A2SA 1G6YA 3HJOA 1Z6NA 4N11A 2GZYA 5CAXA 3GSTA 4HUAA 1WJKA 3F0IA 1XCCA 1TRVA 3UBLA 6GSSA 2JSYA 4IJIA 2VAFA 2C80A 3IV4A 2AUVA 2YN1A 3GX8A 4V2LA 3VWXA 4BVYB 2VD0A 1JHBA 3OR5A 5KN0A 2KP2A 1IYIA 2EIOA 3H93A 2PU9C 3UVTA 1GRXA 1X5EA 4YQVA 5D9XA 4TVEA 2L6DA 2C0FA 2DJ3A 3RPPA 4OMVA 1GULA 1JZRA 2VOCA 1XZOA 4WKWA 3VFIA 1PL1A 5DCGA 1WIKA 2V41A 2N5FA 2ZCTA 3ZIVA 1B9YC 4O32A 3APOA 1F6MC 2VL3A 3C1SA 4HU7A 1TOFA 2IN3A 1T8EB 2JL4A 2AYTA 1TU8A 3F9UA 5H5SA 4LA1A 1U87A 4LL1B 3I43A 1TJDA 4EO3A 5ELAA 8GSSA 4KUNA 2IMKA 4OO4A 5A4VA 2IMFA 3EYTA 5FHIA 3NOFA 5KN2A 4N30A 2VL2C 1MTCA 4ZB8A 4EVMA 2C0DA 4TXOA 1SK2A 3DKSA 5IMAA 3VK9A 2GSSA 5L71A 2YOIA 2OA7A 2LKUA 4GQCA 2FA8A 2QSIA 16GSA 3EVIA 1PA3A 1EZKA 3C7MA 1ERUA 2YZUA 5DAKA 1QGVA 3KH9A 2F8AA 3GMFA 2ALBA 3GH9A 3ED3A 2GLRA 2IJYA 4IHUA 2C0EA 3KXOA 4OO5A 5CO3A 3DYRA 2G0FA 2HRNA 3EMXA 4FYCA 1GL8A 1PD21 2WRTA 5J4UA 2QGVA 4V2NA 2LSTA 2LEGA 2DMMA 2YNXA 4OFNA 4Q5RA 5DDLA 1MD4A 3KTLA 1ZYEA 2E0QA 2B6MA 1PMTA 1SK0A 1Q4JA 4GQFA 1QUWA 4DSRA 4KCEA 4KDYA 1SJZA 4CW9A 1T4ZA 2MBTA 2FCHA 2H01A 6GSXA 4YAPA 1AXDA 9GSSA 5CYYA 1EOHA 2JACA 3G7IA 4EXJA 1F3BA 3A2XA 4O7HA 1R7HA 3LGCA 2CX3A 3GYKA 5IMVA 3QD9A 2LJAA 4GCIA 4MF7A 2VLTA 5JCUA 4K0GA 3HXSA 2NPBA 4L0WA 1QMVA 1G7OA 1R5PA 1KTEA 3TUEA 1G6WA 1VGLA 3M8NA 3RHBA 1GLQA 4EF0A 5HQPA 1XWBA 2H1AA 2ZUPA 5AGYA 4XS4B 4POMA 3CRTA 4XS6A 4I5QA 1B8XA 3I6AA 3P2AA 4JEDA 7GSSA 3WGDA 4NHZA 2B5XA 3FZ5A 4NWYA 3MAKA 1A2LA 1ILOA 1DE2A 2OJLA 3QAVA 3HHVA 3ZYWA 2R2JA 4HS1A 1B4QA 2LNTA 4V1Ap 3VLNA 5IQYA 1GTAA 1G7EA 5FWGA 3QPMA 6GSVA 3HJPA 5ECLB 3D4MA 1V2AA 1XWGA 3H4KA 4D73B 1FOVA 3D22A 2GDRA 5D9VA 4NAXA 1JZOA 1AAZA 2DJ0A 5IOWA 4O5RA 4IKHA 5AIXA 4MPFA 4JR6A 2V6KA 2LRTA 1NW2A 3EU4A 1KBNA 2GSQA 4NMUA 3HJMA 2B5EA 3QAWA 1J9BA 3EWLA 2H70A 4XRAA 2OADA 2TIRA 1VRSD 3TKSE 4PQHA 1M2BA 1XVWA 3ZMKA 2LJKA 5DQYA 3VI7A 4OCEA 4K8MA 4DSSA 4O92A 5IMDA 1EGRA 4TR1A 2MZCA 5G5EA 2H0GA 3H79A 4TN8A 1A2MA 2WJUA 1ZMAA 2A2RA 1C72A 5ELGA 2H1BA 2VLVA 5G2ZA 3ERWA 1GUMA 1OE7A 1EP8A 1PX7A 3O3TA 1XVQA 1GSFA 2NTOA 4WF4A 1TTZA 2AB6A 4GLTA 2XBQA 4K2DA 1BJXA 1F37A 3UIWA 4KAEA 1U88A 1JZWA 3VPQA 4ILFA 1HNAA 2OBKA 1V9WA 4HJ2A 1SKRB 1IYHA 4MZCA 5IPHA 3L9UA 2Z9SA 2UZ8A 2M46A 1ZL9A 2FGXA 2RM5A 4HQZA 3GH6A 4QL7A 3ZIJA 1W4VA 5AN1A 5ABRA 2KP1A 4KW6A 2VD1A 3LWAA 3RAZA 2B7JA 1SD9A 3TKSA 3ERGA 5LD0A 4K6XA 3UAPA 1WE0A 4ECCA 1EWXA 2H0IA 2I3YA 4KE3A 18GSA 4ML1A 3SBCA 5IOXA 2EIRA 3KZQA 2HT9A 3FRCA 3FR6A 5CP1A 1O73A 5DAKB 4GF0A 3CRUA 1TK0B 1HD2A 1T3BA 2X8GA 4F2IA 2IPAA 1GTIA 3LG6A 1EP7A 2L57A 1MEKA 1ABAA 2L4QA 3KMNA 1A0FA 1ON4A 4MZWA 1PGTA 1BAYA 4YH2A 3E9JB 3R3EA 4F0CA 1FO5A 1O6JA 2GSRA 14GSA 4FYBA 4K7OA 3PINA 1TW9A 3F4SA 3VWUA 1XWAA 1VF2A 3ZVJA 3N5OA 4IBPA 2L5OA 4PQ1A 2MMAA 4ZL9A 5IIZA 1V58A 1SK1A 20GSA 4ZIJA 3GX0A 2JADA 3ISOA 3GV1A 5A4UA 1AIUA 2H1GA 3MSZA 5HR0A 1SYRA 3KH7A 1M2DA 5DJLA 2HSHA 2I4AA 4KNDA 1K3YA 5JWQB 1GSDA 5COHA 3IR4A 3GTUA 2DSAA 5CRDA 5HR2A 1EGOA 1F9MA 2C4JA 2CT6A 4MCUA 5GZZB 2H72A 2HZFA 3US3A 1FVJA 5IMZA 5DJMA 1TDIA 5J5NA 4ECIA 3GUSA 4F9ZA 1GUHA 2PN8A 3QOUA 2LRCA 3ME7A 19GSA 1YZXA 1BX9A 3CBUA 2PGTA 2VCZA 3GIXA 4WBRD 4K7NA 3HYPA 3E0UA 1JFUA 4AGSA 1K0MA 3KCMA 3FZ4A 4MJCA 3IHQA 1K0DA 3M9KA 1JZDA 4HDEA 1M9BA 3IRAA 2HLSA 1TRWA 4ECBA 3GKNA 3RDWA 3D4TA 3LYPA 3H1NA 5A5KA 4NPBA 1USBA 1OYJA 4XHMA 3I9V2 2HRKA 3KEBA 5EL8A 2REMA 3RHCA 5BMUA 2PVQA 2HRAA 2V1MA 1XIYA 3UMAA 3GL3A 2GZPA 5CRGA 3UVHA 2C1YA 2I9HA 1O8XA 1OVNA 4USSA 2PMTA 1U6TA 5G30A 1PQNA 2YWIA 3G7JA 5D9WA 1A2JA 1TXXA 5ECNB 3EINA 4V1Ag 22GSA 2CVBA 4K0NA 4KDXA 3CTFA 1O7UA 4EDZA 1FB0A 1GTUA 2XC2A 3QDNA 1M99A 1K0BA 4TR1B 2YANA 4RI6A 3IA1A 2R37A 5C00A 2NVLA 2TRCP 3APSA 1OE8A 4AF2A 2FUG2 3EC3A 4NV2A 5E59A 3QCPA 3JCML 1RW1A 1SD8A 5F8BA 2F9SA 4PNFA 5JCWA 4XS1A 1KEBA 2CVDA 2MBSA 1Z7PA 3C1RA 1AQVA 2YWMA 1PL2A 3KM6A 3IDVA 4HJMA 3GSSA 2IL3A 4MF6A 2AHEA 1PKZA 2XBIA 2MMZA 4KSMA 1TRUA 5ECRB 1Q98A 1V40A 1WOUA 4PUFC 4EL1A 1V57A 3P8WA 5IPGA 1LU4A 2H74A 2X8CA 2TRXA 3UOMA 3ZITA 2IMIA 3WGXA 1GNWA 3S9FA 3FHKA 2N5BA 4MZBA 2DJJA 3KTBA 1XPVA 2RM6A 2LQQA 3DVXA 3GKKA 2L59A 1J0FA 1K3OA 3F4TA 1XFLA 4K1FA 1B48A 4RUVA 1M2AA 3QMXA 2F3MA 3CSJA 3TJKA 1I9DA 4IP6A 4HZ2A 4RQXA 5DALA 1Y25A 1W89A 1TK5B 2ES7A 4KX4A 4HI7A 2YP6A 2C8UA 4OCFA 3BOAA 2KLXA 1ZYQB 4WETA 1FAAA 4MH2A 1FVKA 2P5QA 2HNLA 3FR3A 4IS0A 2CZ3A 3W6GA 2PWJA 2K18A 1FB6A 1SKWB 2RUEA 2IMEA 5ECPB 4QL9A 1Z9HA 3HZ8A 2IWTA 2HZEA 4IN0A 2ON7A
chains in the Genus database with same CATH superfamily
4ZBAA 3SWLA 2MMNA 1NHOA 3L4NA 4X43A 5G1LA 3Q74A 10GSA 1OC3A 2HFDA 4TW5A 4Q5FA 2H6XA 3GTUB 3PGTA 4KSOA 2WVXB 3TOUA 5B6NA 5DQSA 2HSMB 1ACVA 1N2AA 1O8WA 3G7YA 3KD0A 1OKTA 1MDJA 4AI6A 4AKGA 1ST9A 3UEMA 1Y1UA 3LXTA 4K5SA 3WYWA 4MJBA 4F82A 3FZAA 3W8JA 2BJXA 4FO5A 4MF5A 3CQFA 1E2YA 4YQUA 1ZGNA 2HSYA 2WZSA 2WFCA 4BVYA 4MABA 1LBKA 1YF1A 1UA5A 4LMWA 2YV9A 4ZL8A 1S3AA 2YZHA 1A24A 4G19A 4CHSA 1NM3A 3MDKA 2LUSA 4ICYA 2QA2A 3CYNA 3UJ1A 4FIWA 4CDOA 1TI1A 4I8BA 2R4VA 3DGQA 1Z5YE 2GT5A 2O87A 4AJ6A 1WMJA 3WD6A 4XCSA 2F8FA 3TRQA 4ML6A 2M72A 5CNWA 2R3XA 4ECJA 1F3AA 4GDFA 4KA0A 3IBHA 1GTBA 4LMVA 4MDCA 4MLYA 3L78A 3M0FA 1F2EA 2LV3A 5ID2A 4G0IA 3QR6A 1YEWC 2YJHA 4WXTA 1M0UA 2A4HA 1T7PB 4XIHA 3IE3A 1SL1B 6GSUA 2B1KA 4GTUA 3CTGA 3Q19A 3O6TA 4FH8A 3GA4A 3TOTA 5A4WA 1UN2A 1OC8A 5HFKA 1DBYA 5D73A 4EE0A 4MPGA 3F63A 5FT3A 2HRFA 2GTUA 4F03A 3VWVA 2H71A 2VCWA 2K9FA 1K0OA 2VCTA 4ID0A 3CSIA 4PX1A 3QFAC 4L5LA 3GHAA 3K8NA 3EMPA 1SL0B 5D8IA 2R5GA 5F07A 1SYXA 3IC4A 2VL9A 4G9HA 1NHYA 5A5HB 3DVWA 1EV9A 2B7KA 5EPFA 3VPTA 3MNGA 1EEJA 3PR8A 3LORA 5KEJA 4TXOB 2E7PA 4RI7A 3E3EA 3DD3A 5INYA 3HZ4A 1TI3A 1PN9A 2C3QA 4JE1A 3U6VA 17GSA 1THOA 1SKSB 3UARA 3ZFLA 4ZB6A 3BCKA 4K7IA 2R6KA 3ZZXA 1SENA 1TRSA 1TKDB 1GH2A 1A8YA 2I1UA 3GURA 3D5JA 3PH9A 3HY2A 3ZMLA 3C71A 1THXA 4AJ8A 5ECMB 2DJ2A 2QC7A 2X99A 4BL7A 4OFTA 2NDOA 1M9AA 5GSSA 2P5RA 4WR4A 1PKWA 5IO0A 5HR1A 3ZRDA 6GSTA 2VM1A 4GSSA 4XTSA 3F8UA 1EOGA 2VM2A 4G10A 1AQXA 2YWNA 3EU3A 2CAQA 2H75A 2VKZG 4GWRA 1H75A 2IFQA 2OACA 5ECIB 4WF5A 4XRDA 4TOPA 1YEXA 3J7Yk 4PTSA 3DRNA 5AISA 2OE0A 3TKPA 3IK9A 1OAZA 3C73A 2WS2A 13GSA 1URMA 4Z2TA 5DALB 2KHPA 2K6VA 1Z7RA 1XW5A 4BWSA 3TU3B 2K8SA 4HEA2 5CRHA 3MIXA 3VWWA 5A34B 1M7TA 4BPYA 5F0GA 5GAND 2DJ1A 3GNJA 3DEXA 1MDKA 2IIYA 5HR3A 2VCVA 4J2FA 5GSTA 1FW1A 3F3RA 2AJQB 2PPTA 4IQAA 4BWQA 4I97A 2WB9A 2KUCA 5J41A 5A1NA 2HXKA 1ZCPA 2HZEB 5D96A 1CQHA 2CQ9A 1DUGA 1A23A 3UL3A 3ZLPA 1YF0A 1XOAA 3FEUA 2NBSA 1LJRA 1QXHA 2H6YA 1X5CA 3ME8A 2GQMA 4BVXA 4GSNA 4G0LA 1GNEA 3A2VA 4V2MA 4PUAA 6GSYA 5B6MA 2H8LA 4FQUA 2LNSA 2IMDA 4KDUA 3NIVA 4P3YB 4JU5A 1XW9A 1ZOFA 3R2QA 1X5DA 3CXGA 1FG4A 5D9TA 4RQRA 1HQOA 2H76A 2FD3A 2L5LA 1K3LA 4ULXA 2EIQA 1GSQA 1VF1A 2VLUA 4N0VA 2HE3A 3LW9A 3VI5A 2P31A 3W8SA 4TR0A 4E8EA 4TR4A 4LL4B 3EE2A 4OD7A 2HSNB 3KJYA 1XW6A 4POKA 5KOXA 1R26A 5KN1A 3DMLA 1EV4A 5H5QA 3LFLA 3F6FA 2EC4A 5D93A 2FWGA 1PX6A 1OC9A 2O85A 3WT2A 3Q18A 3HDCA 1NSWA 4J56E 4DSQA 3HKRA 3L9SA 3RBTA 2X64A 5B8AA 1A8LA 4TKYA 2H6ZA 1K0NA 4PGTA 2YCDA 2O7KA 2RIIA 2V32A 4PI2C 3U5RE 2WW2A 3IC8A 3IXRA 1YEPA 1H4OA 4ZL7A 6GSWA 3CSHA 3A2WA 1GUKA 4ZB7A 1XBSA 3DXBA 3GFKA 3C8EA 4EDYA 4H86A 2CVKA 4DSSB 1HYUA 4HQSA 4L0UA 2JZTA 2LJRA 4WR5A 2WW1A 2I81A 2H1LA 1ZZYA 5LCZA 3TRXA 4IQ1A 2N5AA 2DLXA 5J3RA 5ID2B 3TRPA 2DBCA 4L5OA 2JU5A 2GGTA 2DC5A 3P7XA 4Z7XA 1ERVA 1AW9A 2VO4A 4EUYA 3M3MA 4MJEA 5B8BA 1J08A 1X9MB 4N10A 4ZBDA 1GLPA 1WPIA 2HI7A 2HYXA 4ZILA 2R0PA 3O76A 1YJ6A 5CRWA 5JWOB 3L0HA 5HFGA 3LEFA 1PFOA 1GP1A 1K0CA 2DJKA 4LLRA 5KN3A 2JZSA 1BEDA 4JZQA 2A4VA 3BJ5A 3A3TA 2FWHA 1I5GA 2F51A 2WGRA 2X8HA 2OKAA 3UBKA 3HA9A 1O81A 2EFHA 1E6BA 4E8HA 4ZBBA 3IAM2 4MH3A 4Q5NA 2RUFA 4L8EA 4OFMA 2V6OA 3IK7A 1FHEA 4OWYA 4HSCX 1RQMA 1T1VA 1R4WA 1S3CA 3BBYA 5B7CA 4HOJA 2PUKC 1Z6MA 3NZNA 2OBIA 3ZVJD 2X49A 2YWOA 2LTKA 4BL7B 4KB3A 3IHGA 3BD2A 1GSUA 1QQ2A 3DIEA 2LS5A 2WULA 2MYGA 1K0AA 5ECKB 2H66A 1SVOA 4POBA 3APQA 2FWEA 4GXZA 1MD3A 3KP9A 3FZ9A 3QFBC 1B4PA 2UV8G 3FR9A 3FYGA 2XPDA 3IOSA 2IFQB 2VCQA 2C0GA 3HVNA 2FLSA 2G2QA 3TJJA 1XWKA 4YQMA 2OE3A 2HQTA 2WDUA 1UVZA 3EURA 5JWRB 4TRXA 2BMXA 1X9WB 2JZRA 2R0GA 3HVSA 1KNGA 2B5YA 5DBQA 3PPUA 1QFNA 2VIMA 3F6DA 5LNKe 1A0RP 4TR3A 2VL2A 5ECSA 5IMCA 2CX4A 3P90A 4W66A 1HNCA 4EIQA 3TJGA 5C04A 2FHEA 5IMFA 3HCZA 2GQLA 1BQ7A 2XHFA 3QAGA 4TXVA 1SJ6A 1N25A 5G31A 3TB2A 1GWCA 5A1NB 1S3DA 2GSTA 4G0KA 3KIJA 3TKSC 2VCXA 4MA9A 1GSYA 4HZ4A 3N9JA 4A5PA 1SJIA 5H5RA 3KP8A 4JRRA 2FWFA 1X9SB 3LJRA 4BVXB 5DVBA 1HNBA 4BIKA 4NHWA 4I6XA 3TKQA 3KGKA 1XOBA 2C3TA 2AAWA 1YKAA 1T4YA 3RPNA 3VURA 4FXYP 2O89A 2CV4A 1V98A 5E4WA 3GN3A 4MJAA 2ZNMA 1TK8B 3H8QA 1JLVA 5ECHB 2L6CA 4KCAA 4POLA 3HVXA 2CZ2A 2PVOC 1YDKA 3Q6OA 3D0ZA 3CWGA 2HRKB 3I69A 1YVLA 2B3SA 4KF9A 5BMUB 4JR4A 4ACSA 3HVVA 2E2GA 4KGIA 4J57E 1R5AA 5EY6A 1RK4A 2LRNA 1OC9B 3A5IA 3A5WA 3IAS2 2J9HA 3F3QA 2B1LA 3BCIA 5IO2A 1MDIA 1ZYNA 2WCIA 1YQ1A 1ERWA 2GZZA 3D21A 4MNNA 3RFRC 2YJ7A 4PQIA 3CMIA 5ECQB 4IGJA 1PN0A 5G5FA 4YAVA 1ERTA 2PBJA 2P0GA 4MMMA 1SL2B 1BYEA 3MWHA 4FYUA 1S4BP 5ECOB 3TJBA 1DE1A 2GQKA 1N8JA 2H19A 2RLIA 1ZYPA 4HU9A 3GRXA 4PNGA 2XPEA 5CREA 4DEJA 2YV7A 2CA8A 2GT6A 2H1DA 4NXIA 4MP4A 11GSA 5IM9A 3F4RA 1YKCA 2DIYA 5HFIA 5F05A 1WRYA 3HD5A 1Z3EA 1WWJA 4EC0A 5JCGA 4X1UA 1PRXA 3ZL5A 2GS3A 2FNOA 5EVOA 5BRTA 4AJ7A 3J7Yb 3GKMA 3FY7A 3FW2A 4MK3A 2M80A 3IPZA 2C3NA 4JBBA 2QKEA 1VF3A 3TJFA 1CQGA 3G9BA 2PERA 4YKGA 4QQ7A 2BTOT 2VUPA 1SU9A 4EKZA 1O85A 2LQOA 3LXZA 4K9ZA 4PURA 4NV5A 2H73A 1EEMA 3GKXA 1BF5A 2A2PA 1GSSA 2KOKA 3DWVA 3KMOA 1X0RA 4IW9A 2H0HA 2DMLA 4ZB9A 1GSEA 3ERFA 2OE1A 3LSZA 1OKDA 4WBJA 1AC1A 3TCOA 3ZREA 4ISDA 1TP9A 1PSQA 1DSBA 4Q5QA 1BG5A 3M1GA 3GL5A 3WT1A 1AUCA 1B9XC 4WEYA 2YPMA 1JLWA 2MMOA 2DIZA 3TKRA 1U3AA 2ON5A 3ZFBA 5ENUA 2GVPA 1XXUA 4KH7A 5DCHA 2D2ZA 2J23A 1AQWA 3EPTA 2FA4A 1ML6A 4PXOA 3L9VA 2H30A 4ZXGA 1XWCA 4F0BA 3TGZA 4XS4A 4IP1A 4IELA 3LQ7A 2AV4A 4BA7A 3M9JA 3D6IA 5J9CA 2O8VB 3FK8A 1TU7A 4X0XA 4N0ZA 1WP0A 5J9BA 1YY7A 2L4CA 2E2MA 1G0TA 2EFEA 2HSMA 2R0CA 2JSZA 5G1KA 4IJ3A 4I2TA 5F06A 2V2GA 5AIVA 3AY8A 5GAPD 3FKFA 2K8VA 4DVCA 1U3IA 3ZTLA 4I2UA 3WGEA 2FY6A 12GSA 1VF4A 1FOHA 3V1WA 2CAIA 1T00A 4IVFA 3TDGA 4D73A 1QK8A 1UC7A 1Y6EA 4G2EA 4CY6A 3LYKA 4GRFA 2WZ9A 4GSTA 2A2SA 1G6YA 3HJOA 1Z6NA 4N11A 2GZYA 5CAXA 3GSTA 4HUAA 1WJKA 3F0IA 5J4YA 1XCCA 1TRVA 3UBLA 6GSSA 2JSYA 4IJIA 2VAFA 2C80A 3IV4A 2AUVA 2YN1A 3GX8A 4V2LA 3VWXA 4BVYB 2VD0A 1JHBA 1TXUA 3OR5A 5KN0A 2KP2A 1IYIA 2EIOA 3H93A 2PU9C 3UVTA 1GRXA 1X5EA 4YQVA 5D9XA 4O5UA 4TVEA 2L6DA 2C0FA 2DJ3A 3RPPA 4OMVA 1XG8A 1GULA 1JZRA 2VOCA 1XZOA 4WKWA 3VFIA 1PL1A 5DCGA 1WIKA 2V41A 2N5FA 2ZCTA 3ZIVA 1B9YC 4O32A 3APOA 1F6MC 2VL3A 3C1SA 4HU7A 1TOFA 2IN3A 1T8EB 2JL4A 2AYTA 1TU8A 3F9UA 5H5SA 4LA1A 1U87A 4LL1B 3I43A 1TJDA 4EO3A 5ELAA 8GSSA 4KUNA 2IMKA 4OO4A 5A4VA 2IMFA 3EYTA 5J4VA 3HMJG 5FHIA 3NOFA 5KN2A 2DKHA 4N30A 2VL2C 1MTCA 4ZB8A 4EVMA 2C0DA 4TXOA 1SK2A 3DKSA 4O5QA 5IMAA 3VK9A 2GSSA 5L71A 2YOIA 2OA7A 2EFCA 2LKUA 4GQCA 2FA8A 2QSIA 16GSA 3EVIA 1PA3A 1EZKA 3C7MA 1ERUA 2YZUA 5DAKA 1QGVA 3KH9A 2F8AA 3GMFA 2ALBA 3GH9A 3ED3A 2GLRA 2IJYA 4IHUA 2C0EA 3KXOA 4OO5A 4PHZC 5CO3A 3DYRA 2G0FA 2HRNA 3EMXA 4FYCA 1GL8A 1PD21 2WRTA 2WW0A 5J4UA 2QGVA 4V2NA 2X4AA 2LSTA 2LEGA 2DMMA 2YNXA 4OFNA 4Q5RA 5DDLA 1MD4A 3KTLA 1ZYEA 2E0QA 2B6MA 1PMTA 1SK0A 1Q4JA 4GQFA 1QUWA 2O5VA 4DSRA 4KCEA 4KDYA 1SJZA 4CW9A 1T4ZA 2MBTA 2FCHA 2H01A 6GSXA 4YAPA 1AXDA 5J40A 9GSSA 5CYYA 1EOHA 2JACA 2O3EA 4AKIA 3G7IA 5A34A 4EXJA 1F3BA 3A2XA 4O7HA 1R7HA 4X4JA 3LGCA 2CX3A 3GYKA 5IMVA 3RGBC 3QD9A 2EFDA 2LJAA 4GCIA 4MF7A 2VLTA 5JCUA 4K0GA 3HXSA 2NPBA 4L0WA 1QMVA 1G7OA 4K2XA 3CHXC 1R5PA 1KTEA 3TUEA 1G6WA 1VGLA 3M8NA 3RHBA 1GLQA 1SVMA 4EF0A 5HQPA 1XWBA 2H1AA 2ZUPA 5AGYA 4XS4B 4POMA 3CRTA 4XS6A 4I5QA 1B8XA 3I6AA 3P2AA 4JEDA 4Z2RA 7GSSA 3WGDA 4NHZA 2B5XA 3FZ5A 4NWYA 3MAKA 1A2LA 1ILOA 1DE2A 2OJLA 3QAVA 3HHVA 3ZYWA 2R2JA 2OT3A 4HS1A 1B4QA 2LNTA 4V1Ap 3VLNA 5IQYA 1GTAA 1G7EA 5FWGA 3QPMA 6GSVA 2HSNA 3HJPA 5ECLB 3D4MA 1V2AA 1XWGA 3H4KA 4D73B 1FOVA 3D22A 2GDRA 5D9VA 4NAXA 1JZOA 1AAZA 2DJ0A 5IOWA 4K5RA 4O5RA 4IKHA 5AIXA 4MPFA 4JR6A 2V6KA 2LRTA 1NW2A 4EIPA 3EU4A 1KBNA 2GSQA 4NMUA 3HJMA 2B5EA 3QAWA 1J9BA 3EWLA 2H70A 4XRAA 2OADA 2TIRA 1VRSD 3TKSE 4PQHA 1M2BA 1XVWA 3ZMKA 2LJKA 5DQYA 3VI7A 4OCEA 4K8MA 4DSSA 4O92A 5IMDA 1EGRA 4TR1A 2MZCA 5G5EA 2H0GA 3H79A 4TN8A 1A2MA 2WJUA 1ZMAA 2A2RA 1C72A 5ELGA 2H1BA 2VLVA 5G2ZA 2O36A 3ERWA 1GUMA 1OE7A 1EP8A 1PX7A 3O3TA 1XVQA 1GSFA 2NTOA 4WF4A 1TTZA 2AB6A 4GLTA 2XBQA 4K2DA 1BJXA 1F37A 3UIWA 4KAEA 1U88A 1JZWA 3VPQA 4ILFA 1HNAA 2OBKA 1V9WA 4HJ2A 1SKRB 1IYHA 4MZCA 5IPHA 3L9UA 2Z9SA 2UZ8A 2M46A 1ZL9A 2FGXA 2RM5A 4HQZA 3GH6A 4QL7A 3ZIJA 1W4VA 5AN1A 5ABRA 2KP1A 4KW6A 2VD1A 3LWAA 3RAZA 2B7JA 1SD9A 3TKSA 3ERGA 5LD0A 4K6XA 3UAPA 1WE0A 4ECCA 1EWXA 2H0IA 2I3YA 4KE3A 18GSA 4ML1A 3SBCA 5IOXA 2EIRA 3MYDA 3KZQA 2HT9A 3FRCA 3FR6A 5CP1A 1O73A 5DAKB 4GF0A 3CRUA 1TK0B 1HD2A 1T3BA 2X8GA 4F2IA 2IPAA 1GTIA 3LG6A 1EP7A 2L57A 1MEKA 1ABAA 2L4QA 3KMNA 1A0FA 1ON4A 4MZWA 1PGTA 1BAYA 4YH2A 4AKXB 3E9JB 3R3EA 4F0CA 1FO5A 1O6JA 2WVYA 2GSRA 14GSA 5KOWA 4FYBA 4K7OA 3PINA 1TW9A 3F4SA 3VWUA 1XWAA 1VF2A 3ZVJA 1S3RA 3N5OA 4IBPA 2L5OA 4PQ1A 2MMAA 4ZL9A 5IIZA 1V58A 1SK1A 20GSA 4ZIJA 3GX0A 2JADA 3ISOA 3GV1A 5A4UA 1AIUA 2H1GA 3MSZA 5HR0A 1SYRA 3KH7A 1M2DA 5DJLA 2HSHA 2I4AA 4KNDA 1K3YA 5JWQB 1GSDA 5COHA 3IR4A 3GTUA 2DSAA 5CRDA 5HR2A 1EGOA 1F9MA 2C4JA 2WVXA 2CT6A 4MCUA 5GZZB 2H72A 2HZFA 3US3A 1FVJA 1M3IA 5IMZA 5DJMA 1TDIA 5J5NA 4ECIA 3GUSA 4F9ZA 1GUHA 2PN8A 3QOUA 2LRCA 3ME7A 19GSA 1YZXA 1BX9A 3CBUA 2PGTA 2VCZA 3GIXA 4WBRD 4K7NA 3HYPA 3E0UA 1JFUA 4AGSA 1K0MA 3KCMA 3FZ4A 5J47A 4MJCA 1SVLA 3IHQA 1K0DA 3M9KA 1JZDA 4HDEA 1M9BA 3IRAA 2HLSA 1TRWA 4ECBA 3GKNA 3RDWA 3D4TA 3LYPA 3H1NA 5A5KA 4Z2UA 4PI0C 4NPBA 1USBA 1OYJA 4XHMA 3I9V2 2HRKA 1M3JA 3KEBA 5EL8A 2REMA 3RHCA 5BMUA 2PVQA 2HRAA 2V1MA 1XIYA 4AKHA 3UMAA 3GL3A 2GZPA 5CRGA 3UVHA 2C1YA 2I9HA 1O8XA 1OVNA 4CY8A 4USSA 2PMTA 1U6TA 5G30A 1PQNA 2YWIA 3G7JA 5D9WA 1BG1A 1A2JA 1TXXA 5ECNB 3EINA 4V1Ag 22GSA 2CVBA 4K0NA 4KDXA 3CTFA 1O7UA 4YKFA 4EDZA 2DKIA 1FB0A 1GTUA 2XC2A 3QDNA 1M99A 1K0BA 4TR1B 2YANA 4RI6A 3IA1A 2R37A 5C00A 2NVLA 2TRCP 3APSA 1OE8A 4AF2A 2FUG2 4N3ZA 3EC3A 4NV2A 5E59A 3QCPA 3JCML 1RW1A 1SD8A 5F8BA 2F9SA 4PNFA 5A5HA 5JCWA 4XS1A 1KEBA 2CVDA 2MBSA 1Z7PA 3C1RA 1AQVA 2YWMA 1PL2A 3KM6A 3IDVA 4HJMA 3GSSA 4G01A 2IL3A 4MF6A 2AHEA 1PKZA 2XBIA 2MMZA 1I1IP 4KSMA 1TRUA 5ECRB 1Q98A 1V40A 1WOUA 4PUFC 4EL1A 1V57A 3P8WA 5IPGA 1LU4A 2H74A 2X8CA 2TRXA 3UOMA 3ZITA 3FMWA 2IMIA 3WGXA 1GNWA 3S9FA 3FHKA 2N5BA 4MZBA 2DJJA 3KTBA 1XPVA 2RM6A 2LQQA 3DVXA 3GKKA 2L59A 1J0FA 2QA1A 1K3OA 3F4TA 1XFLA 4K1FA 1B48A 4RUVA 1M2AA 3QMXA 2F3MA 3CSJA 3TJKA 1I9DA 4IP6A 4HZ2A 4RQXA 5DALA 1Y25A 1W89A 1TK5B 2ES7A 4KX4A 4HI7A 2YP6A 4E68A 2C8UA 4OCFA 3BOAA 2KLXA 1ZYQB 4WETA 1FAAA 4MH2A 2WW3A 1FVKA 2P5QA 2HNLA 3FR3A 4IS0A 2CZ3A 3W6GA 2PWJA 2K18A 1FB6A 1SKWB 2RUEA 2IMEA 5ECPB 4QL9A 1Z9HA 3HZ8A 2IWTA 4QMKA 2HZEA 2WVZA 4IN0A 2ON7A
chains in the Genus database with same CATH topology
4ZBAA 3SWLA 2MMNA 1NHOA 3L4NA 4X43A 5G1LA 3Q74A 10GSA 1OC3A 2HFDA 4TW5A 4Q5FA 2H6XA 3GTUB 3PGTA 4KSOA 3TOUA 5B6NA 5DQSA 2HSMB 1ACVA 1N2AA 1O8WA 3G7YA 3KD0A 1OKTA 1MDJA 4AI6A 4AKGA 1ST9A 3UEMA 1Y1UA 3LXTA 4K5SA 3WYWA 4MJBA 4F82A 3FZAA 3W8JA 2BJXA 4FO5A 4MF5A 1E2YA 4YQUA 1ZGNA 2HSYA 2WFCA 4BVYA 4MABA 1LBKA 1YF1A 1UA5A 4LMWA 2YV9A 4ZL8A 1S3AA 2YZHA 1A24A 4G19A 4CHSA 1NM3A 3MDKA 2LUSA 4ICYA 2QA2A 3CYNA 3UJ1A 4FIWA 4CDOA 1TI1A 4I8BA 2R4VA 3DGQA 1Z5YE 2GT5A 2O87A 4AJ6A 1WMJA 3WD6A 4XCSA 2F8FA 3TRQA 4ML6A 2M72A 5CNWA 2R3XA 4ECJA 1F3AA 4GDFA 4KA0A 3IBHA 1GTBA 4LMVA 4MDCA 4MLYA 3L78A 3M0FA 1F2EA 2LV3A 5ID2A 4G0IA 3QR6A 2YJHA 4WXTA 1M0UA 2A4HA 1T7PB 4XIHA 3IE3A 1SL1B 6GSUA 2B1KA 4GTUA 3CTGA 3Q19A 3O6TA 4FH8A 3GA4A 3TOTA 5A4WA 1UN2A 1OC8A 5HFKA 1DBYA 5D73A 4EE0A 4MPGA 3F63A 5FT3A 2HRFA 2GTUA 4F03A 3VWVA 2H71A 2VCWA 2K9FA 1K0OA 2VCTA 4ID0A 3CSIA 4PX1A 3QFAC 4L5LA 3GHAA 3K8NA 3EMPA 1SL0B 5D8IA 2R5GA 5F07A 1SYXA 3IC4A 2VL9A 4G9HA 1NHYA 5A5HB 3DVWA 1EV9A 2B7KA 5EPFA 3VPTA 3MNGA 1EEJA 3PR8A 3LORA 5KEJA 4TXOB 2E7PA 4RI7A 3E3EA 3DD3A 5INYA 3HZ4A 1TI3A 1PN9A 2C3QA 4JE1A 3U6VA 17GSA 1THOA 1SKSB 3UARA 3ZFLA 4ZB6A 3BCKA 4K7IA 2R6KA 3ZZXA 1SENA 1TRSA 1TKDB 1GH2A 1A8YA 2I1UA 3GURA 3D5JA 3PH9A 3HY2A 3ZMLA 3C71A 1THXA 4AJ8A 5ECMB 2DJ2A 2QC7A 2X99A 4BL7A 4OFTA 2NDOA 1M9AA 5GSSA 2P5RA 4WR4A 1PKWA 5IO0A 5HR1A 3ZRDA 6GSTA 2VM1A 4GSSA 4XTSA 3F8UA 1EOGA 2VM2A 4G10A 1AQXA 2YWNA 3EU3A 2CAQA 2H75A 2VKZG 4GWRA 1H75A 2IFQA 2OACA 5ECIB 4WF5A 4XRDA 4TOPA 1YEXA 3J7Yk 4PTSA 3DRNA 5AISA 2OE0A 3TKPA 3IK9A 1OAZA 3C73A 2WS2A 13GSA 1URMA 4Z2TA 5DALB 2KHPA 2K6VA 1Z7RA 1XW5A 4BWSA 3TU3B 2K8SA 4HEA2 5CRHA 3MIXA 3VWWA 5A34B 1M7TA 4BPYA 5F0GA 5GAND 2DJ1A 3GNJA 3DEXA 1MDKA 2IIYA 5HR3A 2VCVA 4J2FA 5GSTA 1FW1A 3F3RA 2AJQB 2PPTA 4IQAA 4BWQA 4I97A 2WB9A 2KUCA 5J41A 5A1NA 2HXKA 1ZCPA 2HZEB 5D96A 1CQHA 2CQ9A 1DUGA 1A23A 3UL3A 3ZLPA 1YF0A 1XOAA 3FEUA 2NBSA 1LJRA 1QXHA 2H6YA 1X5CA 3ME8A 2GQMA 4BVXA 4GSNA 4G0LA 1GNEA 3A2VA 4V2MA 4PUAA 6GSYA 5B6MA 2H8LA 4FQUA 2LNSA 2IMDA 4KDUA 3NIVA 4P3YB 4JU5A 1XW9A 1ZOFA 3R2QA 1X5DA 3CXGA 1FG4A 5D9TA 4RQRA 1HQOA 2H76A 2FD3A 2L5LA 1K3LA 4ULXA 2EIQA 1GSQA 1VF1A 2VLUA 4N0VA 2HE3A 3LW9A 3VI5A 2P31A 3W8SA 4TR0A 4E8EA 4TR4A 4LL4B 3EE2A 4OD7A 2HSNB 3KJYA 1XW6A 4POKA 5KOXA 1R26A 5KN1A 3DMLA 1EV4A 5H5QA 3LFLA 3F6FA 2EC4A 5D93A 2FWGA 1PX6A 1OC9A 2O85A 3WT2A 3Q18A 3HDCA 1NSWA 4J56E 4DSQA 3HKRA 3L9SA 3RBTA 2X64A 5B8AA 1A8LA 4TKYA 2H6ZA 1K0NA 4PGTA 2YCDA 2O7KA 2RIIA 2V32A 3U5RE 3IC8A 3IXRA 1YEPA 1H4OA 4ZL7A 6GSWA 3CSHA 3A2WA 1GUKA 4ZB7A 1XBSA 3DXBA 3GFKA 3C8EA 4EDYA 4H86A 2CVKA 4DSSB 1HYUA 4HQSA 4L0UA 2JZTA 2LJRA 4WR5A 2I81A 2H1LA 1ZZYA 5LCZA 3TRXA 4IQ1A 2N5AA 2DLXA 5J3RA 5ID2B 3TRPA 2DBCA 4L5OA 2JU5A 2GGTA 2DC5A 3P7XA 4Z7XA 1ERVA 1AW9A 2VO4A 4EUYA 3M3MA 4MJEA 5B8BA 1J08A 1X9MB 4N10A 4ZBDA 1GLPA 1WPIA 2HI7A 2HYXA 4ZILA 2R0PA 3O76A 1YJ6A 5CRWA 5JWOB 3L0HA 5HFGA 3LEFA 1GP1A 1K0CA 2DJKA 4LLRA 5KN3A 2JZSA 1BEDA 4JZQA 2A4VA 3BJ5A 3A3TA 2FWHA 1I5GA 2F51A 2WGRA 2X8HA 2OKAA 3UBKA 3HA9A 1O81A 2EFHA 1E6BA 4E8HA 4ZBBA 3IAM2 4MH3A 4Q5NA 2RUFA 4L8EA 4OFMA 2V6OA 3IK7A 1FHEA 4OWYA 1RQMA 1T1VA 1R4WA 1S3CA 3BBYA 5B7CA 4HOJA 2PUKC 1Z6MA 3NZNA 2OBIA 3ZVJD 2X49A 2YWOA 2LTKA 4BL7B 4KB3A 3IHGA 3BD2A 1GSUA 1QQ2A 3DIEA 2LS5A 2WULA 2MYGA 1K0AA 5ECKB 2H66A 1SVOA 4POBA 3APQA 2FWEA 4GXZA 1MD3A 3KP9A 3FZ9A 3QFBC 1B4PA 2UV8G 3FR9A 3FYGA 2XPDA 3IOSA 2IFQB 2VCQA 2C0GA 2FLSA 2G2QA 3TJJA 1XWKA 4YQMA 2OE3A 2HQTA 2WDUA 1UVZA 3EURA 5JWRB 4TRXA 2BMXA 1X9WB 2JZRA 2R0GA 3HVSA 1KNGA 2B5YA 5DBQA 3PPUA 1QFNA 2VIMA 3F6DA 5LNKe 1A0RP 4TR3A 2VL2A 5ECSA 5IMCA 2CX4A 3P90A 4W66A 1HNCA 4EIQA 3TJGA 5C04A 2FHEA 5IMFA 3HCZA 2GQLA 1BQ7A 2XHFA 3QAGA 4TXVA 1SJ6A 1N25A 5G31A 3TB2A 1GWCA 5A1NB 1S3DA 2GSTA 4G0KA 3KIJA 3TKSC 2VCXA 4MA9A 1GSYA 4HZ4A 3N9JA 4A5PA 1SJIA 5H5RA 3KP8A 4JRRA 2FWFA 1X9SB 3LJRA 4BVXB 5DVBA 1HNBA 4NHWA 4I6XA 3TKQA 3KGKA 1XOBA 2C3TA 2AAWA 1YKAA 1T4YA 3RPNA 3VURA 2O89A 2CV4A 1V98A 5E4WA 3GN3A 4MJAA 2ZNMA 1TK8B 3H8QA 1JLVA 5ECHB 2L6CA 4KCAA 4POLA 3HVXA 2CZ2A 2PVOC 1YDKA 3Q6OA 3D0ZA 3CWGA 2HRKB 3I69A 1YVLA 2B3SA 4KF9A 5BMUB 4JR4A 4ACSA 3HVVA 2E2GA 4KGIA 4J57E 1R5AA 5EY6A 1RK4A 2LRNA 1OC9B 3A5IA 3A5WA 3IAS2 2J9HA 3F3QA 2B1LA 3BCIA 5IO2A 1MDIA 1ZYNA 2WCIA 1YQ1A 1ERWA 2GZZA 3D21A 4MNNA 2YJ7A 4PQIA 3CMIA 5ECQB 4IGJA 1PN0A 5G5FA 4YAVA 1ERTA 2PBJA 2P0GA 4MMMA 1SL2B 1BYEA 3MWHA 4FYUA 5ECOB 3TJBA 1DE1A 2GQKA 1N8JA 2H19A 2RLIA 1ZYPA 4HU9A 3GRXA 4PNGA 2XPEA 5CREA 4DEJA 2YV7A 2CA8A 2GT6A 2H1DA 4NXIA 4MP4A 11GSA 5IM9A 3F4RA 1YKCA 2DIYA 5HFIA 5F05A 1WRYA 3HD5A 1Z3EA 1WWJA 4EC0A 5JCGA 4X1UA 1PRXA 3ZL5A 2GS3A 2FNOA 5EVOA 5BRTA 4AJ7A 3J7Yb 3GKMA 3FY7A 3FW2A 4MK3A 2M80A 3IPZA 2C3NA 4JBBA 2QKEA 1VF3A 3TJFA 1CQGA 3G9BA 2PERA 4YKGA 4QQ7A 2BTOT 2VUPA 1SU9A 4EKZA 1O85A 2LQOA 3LXZA 4K9ZA 4PURA 4NV5A 2H73A 1EEMA 3GKXA 1BF5A 2A2PA 1GSSA 2KOKA 3DWVA 3KMOA 1X0RA 4IW9A 2H0HA 2DMLA 4ZB9A 1GSEA 3ERFA 2OE1A 3LSZA 1OKDA 4WBJA 1AC1A 3TCOA 3ZREA 4ISDA 1TP9A 1PSQA 1DSBA 4Q5QA 1BG5A 3M1GA 3GL5A 3WT1A 1AUCA 1B9XC 4WEYA 2YPMA 1JLWA 2MMOA 2DIZA 3TKRA 1U3AA 2ON5A 3ZFBA 5ENUA 2GVPA 1XXUA 4KH7A 5DCHA 2D2ZA 2J23A 1AQWA 3EPTA 2FA4A 1ML6A 4PXOA 3L9VA 2H30A 4ZXGA 1XWCA 4F0BA 3TGZA 4XS4A 4IP1A 4IELA 3LQ7A 2AV4A 4BA7A 3M9JA 3D6IA 5J9CA 2O8VB 3FK8A 1TU7A 4X0XA 4N0ZA 1WP0A 5J9BA 1YY7A 2L4CA 2E2MA 1G0TA 2EFEA 2HSMA 2R0CA 2JSZA 5G1KA 4IJ3A 4I2TA 5F06A 2V2GA 5AIVA 3AY8A 5GAPD 3FKFA 2K8VA 4DVCA 1U3IA 3ZTLA 4I2UA 3WGEA 2FY6A 12GSA 1VF4A 1FOHA 3V1WA 2CAIA 1T00A 4IVFA 3TDGA 4D73A 1QK8A 1UC7A 1Y6EA 4G2EA 4CY6A 3LYKA 4GRFA 2WZ9A 4GSTA 2A2SA 1G6YA 3HJOA 1Z6NA 4N11A 2GZYA 5CAXA 3GSTA 4HUAA 1WJKA 3F0IA 5J4YA 1XCCA 1TRVA 3UBLA 6GSSA 2JSYA 4IJIA 2VAFA 2C80A 3IV4A 2AUVA 2YN1A 3GX8A 4V2LA 3VWXA 4BVYB 2VD0A 1JHBA 1TXUA 3OR5A 5KN0A 2KP2A 1IYIA 2EIOA 3H93A 2PU9C 3UVTA 1GRXA 1X5EA 4YQVA 5D9XA 4O5UA 4TVEA 2L6DA 2C0FA 2DJ3A 3RPPA 4OMVA 1GULA 1JZRA 2VOCA 1XZOA 4WKWA 3VFIA 1PL1A 5DCGA 1WIKA 2V41A 2N5FA 2ZCTA 3ZIVA 1B9YC 4O32A 3APOA 1F6MC 2VL3A 3C1SA 4HU7A 1TOFA 2IN3A 1T8EB 2JL4A 2AYTA 1TU8A 3F9UA 5H5SA 4LA1A 1U87A 4LL1B 3I43A 1TJDA 4EO3A 5ELAA 8GSSA 4KUNA 2IMKA 4OO4A 5A4VA 2IMFA 3EYTA 5J4VA 3HMJG 5FHIA 3NOFA 5KN2A 2DKHA 4N30A 2VL2C 1MTCA 4ZB8A 4EVMA 2C0DA 4TXOA 1SK2A 3DKSA 4O5QA 5IMAA 3VK9A 2GSSA 5L71A 2YOIA 2OA7A 2EFCA 2LKUA 4GQCA 2FA8A 2QSIA 16GSA 3EVIA 1PA3A 1EZKA 3C7MA 1ERUA 2YZUA 5DAKA 1QGVA 3KH9A 2F8AA 3GMFA 2ALBA 3GH9A 3ED3A 2GLRA 2IJYA 4IHUA 2C0EA 3KXOA 4OO5A 5CO3A 3DYRA 2G0FA 2HRNA 3EMXA 4FYCA 1GL8A 1PD21 2WRTA 5J4UA 2QGVA 4V2NA 2X4AA 2LSTA 2LEGA 2DMMA 2YNXA 4OFNA 4Q5RA 5DDLA 1MD4A 3KTLA 1ZYEA 2E0QA 2B6MA 1PMTA 1SK0A 1Q4JA 4GQFA 1QUWA 2O5VA 4DSRA 4KCEA 4KDYA 1SJZA 4CW9A 1T4ZA 2MBTA 2FCHA 2H01A 6GSXA 4YAPA 1AXDA 5J40A 9GSSA 5CYYA 1EOHA 2JACA 4AKIA 3G7IA 5A34A 4EXJA 1F3BA 3A2XA 4O7HA 1R7HA 4X4JA 3LGCA 2CX3A 3GYKA 5IMVA 3QD9A 2EFDA 2LJAA 4GCIA 4MF7A 2VLTA 5JCUA 4K0GA 3HXSA 2NPBA 4L0WA 1QMVA 1G7OA 4K2XA 1R5PA 1KTEA 3TUEA 1G6WA 1VGLA 3M8NA 3RHBA 1GLQA 1SVMA 4EF0A 5HQPA 1XWBA 2H1AA 2ZUPA 5AGYA 4XS4B 4POMA 3CRTA 4XS6A 4I5QA 1B8XA 3I6AA 3P2AA 4JEDA 4Z2RA 7GSSA 3WGDA 4NHZA 2B5XA 3FZ5A 4NWYA 3MAKA 1A2LA 1ILOA 1DE2A 2OJLA 3QAVA 3HHVA 3ZYWA 2R2JA 2OT3A 4HS1A 1B4QA 2LNTA 4V1Ap 3VLNA 5IQYA 1GTAA 1G7EA 5FWGA 3QPMA 6GSVA 2HSNA 3HJPA 5ECLB 3D4MA 1V2AA 1XWGA 3H4KA 4D73B 1FOVA 3D22A 2GDRA 5D9VA 4NAXA 1JZOA 1AAZA 2DJ0A 5IOWA 4K5RA 4O5RA 4IKHA 5AIXA 4MPFA 4JR6A 2V6KA 2LRTA 1NW2A 4EIPA 3EU4A 1KBNA 2GSQA 4NMUA 3HJMA 2B5EA 3QAWA 1J9BA 3EWLA 2H70A 4XRAA 2OADA 2TIRA 1VRSD 3TKSE 4PQHA 1M2BA 1XVWA 3ZMKA 2LJKA 5DQYA 3VI7A 4OCEA 4K8MA 4DSSA 4O92A 5IMDA 1EGRA 4TR1A 2MZCA 5G5EA 2H0GA 3H79A 4TN8A 1A2MA 2WJUA 1ZMAA 2A2RA 1C72A 5ELGA 2H1BA 2VLVA 5G2ZA 3ERWA 1GUMA 1OE7A 1EP8A 1PX7A 3O3TA 1XVQA 1GSFA 2NTOA 4WF4A 1TTZA 2AB6A 4GLTA 2XBQA 4K2DA 1BJXA 1F37A 3UIWA 4KAEA 1U88A 1JZWA 3VPQA 4ILFA 1HNAA 2OBKA 1V9WA 4HJ2A 1SKRB 1IYHA 4MZCA 5IPHA 3L9UA 2Z9SA 2UZ8A 2M46A 1ZL9A 2FGXA 2RM5A 4HQZA 3GH6A 4QL7A 3ZIJA 1W4VA 5AN1A 5ABRA 2KP1A 4KW6A 2VD1A 3LWAA 3RAZA 2B7JA 1SD9A 3TKSA 3ERGA 5LD0A 4K6XA 3UAPA 1WE0A 4ECCA 1EWXA 2H0IA 2I3YA 4KE3A 18GSA 4ML1A 3SBCA 5IOXA 2EIRA 3MYDA 3KZQA 2HT9A 3FRCA 3FR6A 5CP1A 1O73A 5DAKB 4GF0A 3CRUA 1TK0B 1HD2A 1T3BA 2X8GA 4F2IA 2IPAA 1GTIA 3LG6A 1EP7A 2L57A 1MEKA 1ABAA 2L4QA 3KMNA 1A0FA 1ON4A 4MZWA 1PGTA 1BAYA 4YH2A 4AKXB 3E9JB 3R3EA 4F0CA 1FO5A 1O6JA 2GSRA 14GSA 5KOWA 4FYBA 4K7OA 3PINA 1TW9A 3F4SA 3VWUA 1XWAA 1VF2A 3ZVJA 3N5OA 4IBPA 2L5OA 4PQ1A 2MMAA 4ZL9A 5IIZA 1V58A 1SK1A 20GSA 4ZIJA 3GX0A 2JADA 3ISOA 3GV1A 5A4UA 1AIUA 2H1GA 3MSZA 5HR0A 1SYRA 3KH7A 1M2DA 5DJLA 2HSHA 2I4AA 4KNDA 1K3YA 5JWQB 1GSDA 5COHA 3IR4A 3GTUA 2DSAA 5CRDA 5HR2A 1EGOA 1F9MA 2C4JA 2CT6A 4MCUA 5GZZB 2H72A 2HZFA 3US3A 1FVJA 5IMZA 5DJMA 1TDIA 5J5NA 4ECIA 3GUSA 4F9ZA 1GUHA 2PN8A 3QOUA 2LRCA 3ME7A 19GSA 1YZXA 1BX9A 3CBUA 2PGTA 2VCZA 3GIXA 4WBRD 4K7NA 3HYPA 3E0UA 1JFUA 4AGSA 1K0MA 3KCMA 3FZ4A 5J47A 4MJCA 1SVLA 3IHQA 1K0DA 3M9KA 1JZDA 4HDEA 1M9BA 3IRAA 2HLSA 1TRWA 4ECBA 3GKNA 3RDWA 3D4TA 3LYPA 3H1NA 5A5KA 4Z2UA 4NPBA 1USBA 1OYJA 4XHMA 3I9V2 2HRKA 3KEBA 5EL8A 2REMA 3RHCA 5BMUA 2PVQA 2HRAA 2V1MA 1XIYA 4AKHA 3UMAA 3GL3A 2GZPA 5CRGA 3UVHA 2C1YA 2I9HA 1O8XA 1OVNA 4CY8A 4USSA 2PMTA 1U6TA 5G30A 1PQNA 2YWIA 3G7JA 5D9WA 1BG1A 1A2JA 1TXXA 5ECNB 3EINA 4V1Ag 22GSA 2CVBA 4K0NA 4KDXA 3CTFA 1O7UA 4YKFA 4EDZA 2DKIA 1FB0A 1GTUA 2XC2A 3QDNA 1M99A 1K0BA 4TR1B 2YANA 4RI6A 3IA1A 2R37A 5C00A 2NVLA 2TRCP 3APSA 1OE8A 4AF2A 2FUG2 4N3ZA 3EC3A 4NV2A 5E59A 3QCPA 3JCML 1RW1A 1SD8A 5F8BA 2F9SA 4PNFA 5A5HA 5JCWA 4XS1A 1KEBA 2CVDA 2MBSA 1Z7PA 3C1RA 1AQVA 2YWMA 1PL2A 3KM6A 3IDVA 4HJMA 3GSSA 4G01A 2IL3A 4MF6A 2AHEA 1PKZA 2XBIA 2MMZA 4KSMA 1TRUA 5ECRB 1Q98A 1V40A 1WOUA 4PUFC 4EL1A 1V57A 3P8WA 5IPGA 1LU4A 2H74A 2X8CA 2TRXA 3UOMA 3ZITA 3FMWA 2IMIA 3WGXA 1GNWA 3S9FA 3FHKA 2N5BA 4MZBA 2DJJA 3KTBA 1XPVA 2RM6A 2LQQA 3DVXA 3GKKA 2L59A 1J0FA 2QA1A 1K3OA 3F4TA 1XFLA 4K1FA 1B48A 4RUVA 1M2AA 3QMXA 2F3MA 3CSJA 3TJKA 1I9DA 4IP6A 4HZ2A 4RQXA 5DALA 1Y25A 1W89A 1TK5B 2ES7A 4KX4A 4HI7A 2YP6A 4E68A 2C8UA 4OCFA 3BOAA 2KLXA 1ZYQB 4WETA 1FAAA 4MH2A 1FVKA 2P5QA 2HNLA 3FR3A 4IS0A 2CZ3A 3W6GA 2PWJA 2K18A 1FB6A 1SKWB 2RUEA 2IMEA 5ECPB 4QL9A 1Z9HA 3HZ8A 2IWTA 4QMKA 2HZEA 4IN0A 2ON7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBA A;  3SWL A;  2MMN A;  1NHO A;  3L4N A;  4X43 A;  5G1L A;  3Q74 A;  10GS A;  1OC3 A;  2HFD A;  4TW5 A;  4Q5F A;  2H6X A;  3GTU B;  3PGT A;  4KSO A;  3TOU A;  5B6N A;  5DQS A;  2HSM B;  1ACV A;  1N2A A;  1O8W A;  3G7Y A;  3KD0 A;  1OKT A;  1MDJ A;  1ST9 A;  3UEM A;  3LXT A;  3WYW A;  4MJB A;  4F82 A;  3FZA A;  3W8J A;  2BJX A;  4FO5 A;  4MF5 A;  1E2Y A;  4YQU A;  1ZGN A;  2HSY A;  2WFC A;  4BVY A;  4MAB A;  1LBK A;  1YF1 A;  1UA5 A;  4LMW A;  2YV9 A;  4ZL8 A;  1S3A A;  2YZH A;  1A24 A;  4G19 A;  4CHS A;  1NM3 A;  3MDK A;  2LUS A;  3CYN A;  3UJ1 A;  4FIW A;  4CDO A;  1TI1 A;  4I8B A;  2R4V A;  3DGQ A;  1Z5Y E;  2GT5 A;  2O87 A;  4AJ6 A;  1WMJ A;  3WD6 A;  4XCS A;  2F8F A;  3TRQ A;  4ML6 A;  2M72 A;  5CNW A;  2R3X A;  4ECJ A;  1F3A A;  4KA0 A;  3IBH A;  1GTB A;  4LMV A;  4MDC A;  4MLY A;  3L78 A;  3M0F A;  1F2E A;  2LV3 A;  5ID2 A;  4G0I A;  3QR6 A;  2YJH A;  4WXT A;  1M0U A;  1T7P B;  4XIH A;  3IE3 A;  1SL1 B;  6GSU A;  2B1K A;  4GTU A;  3CTG A;  3Q19 A;  3O6T A;  4FH8 A;  3GA4 A;  3TOT A;  5A4W A;  1UN2 A;  1OC8 A;  5HFK A;  1DBY A;  5D73 A;  4EE0 A;  4MPG A;  3F63 A;  5FT3 A;  2HRF A;  2GTU A;  4F03 A;  3VWV A;  2H71 A;  2VCW A;  2K9F A;  1K0O A;  2VCT A;  4ID0 A;  3CSI A;  4PX1 A;  3QFA C;  4L5L A;  3GHA A;  3K8N A;  3EMP A;  1SL0 B;  5D8I A;  2R5G A;  5F07 A;  1SYX A;  3IC4 A;  2VL9 A;  4G9H A;  1NHY A;  3DVW A;  1EV9 A;  2B7K A;  5EPF A;  3VPT A;  3MNG A;  1EEJ A;  3PR8 A;  3LOR A;  5KEJ A;  4TXO B;  2E7P A;  4RI7 A;  3E3E A;  3DD3 A;  5INY A;  3HZ4 A;  1TI3 A;  1PN9 A;  2C3Q A;  4JE1 A;  3U6V A;  17GS A;  1THO A;  1SKS B;  3UAR A;  3ZFL A;  4ZB6 A;  3BCK A;  4K7I A;  2R6K A;  3ZZX A;  1SEN A;  1TRS A;  1TKD B;  1GH2 A;  1A8Y A;  2I1U A;  3GUR A;  3D5J A;  3PH9 A;  3HY2 A;  3ZML A;  3C71 A;  1THX A;  4AJ8 A;  5ECM B;  2DJ2 A;  2QC7 A;  2X99 A;  4BL7 A;  4OFT A;  2NDO A;  1M9A A;  5GSS A;  2P5R A;  4WR4 A;  1PKW A;  5IO0 A;  5HR1 A;  3ZRD A;  6GST A;  2VM1 A;  4GSS A;  4XTS A;  3F8U A;  1EOG A;  2VM2 A;  4G10 A;  1AQX A;  2YWN A;  3EU3 A;  2CAQ A;  2H75 A;  4GWR A;  1H75 A;  2IFQ A;  2OAC A;  5ECI B;  4WF5 A;  4XRD A;  4TOP A;  1YEX A;  3J7Y k;  4PTS A;  3DRN A;  5AIS A;  2OE0 A;  3TKP A;  3IK9 A;  1OAZ A;  3C73 A;  2WS2 A;  13GS A;  1URM A;  5DAL B;  2KHP A;  2K6V A;  1Z7R A;  1XW5 A;  4BWS A;  2K8S A;  4HEA 2;  5CRH A;  3VWW A;  1M7T A;  4BPY A;  5F0G A;  5GAN D;  2DJ1 A;  3GNJ A;  3DEX A;  1MDK A;  2IIY A;  5HR3 A;  2VCV A;  4J2F A;  5GST A;  1FW1 A;  3F3R A;  2AJQ B;  2PPT A;  4IQA A;  4BWQ A;  4I97 A;  2WB9 A;  2KUC A;  5J41 A;  2HXK A;  1ZCP A;  2HZE B;  5D96 A;  1CQH A;  2CQ9 A;  1DUG A;  1A23 A;  3UL3 A;  3ZLP A;  1YF0 A;  1XOA A;  3FEU A;  2NBS A;  1LJR A;  1QXH A;  2H6Y A;  1X5C A;  3ME8 A;  2GQM A;  4BVX A;  4GSN A;  4G0L A;  1GNE A;  3A2V A;  4V2M A;  4PUA A;  6GSY A;  5B6M A;  2H8L A;  4FQU A;  2LNS A;  2IMD A;  4KDU A;  3NIV A;  4P3Y B;  4JU5 A;  1XW9 A;  1ZOF A;  3R2Q A;  1X5D A;  3CXG A;  1FG4 A;  5D9T A;  4RQR A;  1HQO A;  2H76 A;  2FD3 A;  2L5L A;  1K3L A;  4ULX A;  2EIQ A;  1GSQ A;  1VF1 A;  2VLU A;  4N0V A;  2HE3 A;  3VI5 A;  2P31 A;  3W8S A;  4TR0 A;  4E8E A;  4TR4 A;  4LL4 B;  3EE2 A;  4OD7 A;  2HSN B;  3KJY A;  1XW6 A;  4POK A;  1R26 A;  5KN1 A;  3DML A;  1EV4 A;  5H5Q A;  3LFL A;  3F6F A;  2EC4 A;  5D93 A;  2FWG A;  1PX6 A;  1OC9 A;  2O85 A;  3WT2 A;  3Q18 A;  3HDC A;  1NSW A;  4J56 E;  4DSQ A;  3HKR A;  3L9S A;  3RBT A;  2X64 A;  5B8A A;  1A8L A;  4TKY A;  2H6Z A;  1K0N A;  4PGT A;  2YCD A;  2O7K A;  2RII A;  2V32 A;  3U5R E;  3IC8 A;  3IXR A;  1YEP A;  1H4O A;  4ZL7 A;  6GSW A;  3CSH A;  3A2W A;  1GUK A;  1XBS A;  3DXB A;  3GFK A;  3C8E A;  4EDY A;  4H86 A;  2CVK A;  4DSS B;  1HYU A;  4HQS A;  4L0U A;  2JZT A;  2LJR A;  4WR5 A;  2I81 A;  1ZZY A;  5LCZ A;  3TRX A;  4IQ1 A;  2N5A A;  2DLX A;  5J3R A;  5ID2 B;  3TRP A;  2DBC A;  4L5O A;  2JU5 A;  2GGT A;  2DC5 A;  3P7X A;  4Z7X A;  1ERV A;  1AW9 A;  2VO4 A;  4EUY A;  3M3M A;  4MJE A;  5B8B A;  1J08 A;  1X9M B;  4N10 A;  4ZBD A;  1GLP A;  1WPI A;  2HI7 A;  2HYX A;  4ZIL A;  3O76 A;  1YJ6 A;  5CRW A;  5JWO B;  3L0H A;  5HFG A;  3LEF A;  1GP1 A;  1K0C A;  2DJK A;  4LLR A;  5KN3 A;  2JZS A;  1BED A;  4JZQ A;  2A4V A;  3BJ5 A;  3A3T A;  2FWH A;  1I5G A;  2F51 A;  2WGR A;  2X8H A;  2OKA A;  3UBK A;  3HA9 A;  1O81 A;  1E6B A;  4E8H A;  4ZBB A;  3IAM 2;  4MH3 A;  4Q5N A;  2RUF A;  4L8E A;  4OFM A;  2V6O A;  3IK7 A;  1FHE A;  4OWY A;  1RQM A;  1T1V A;  1R4W A;  1S3C A;  3BBY A;  5B7C A;  4HOJ A;  2PUK C;  1Z6M A;  3NZN A;  2OBI A;  3ZVJ D;  2YWO A;  2LTK A;  4BL7 B;  4KB3 A;  3BD2 A;  1GSU A;  1QQ2 A;  3DIE A;  2LS5 A;  2WUL A;  2MYG A;  1K0A A;  5ECK B;  2H66 A;  4POB A;  3APQ A;  2FWE A;  4GXZ A;  1MD3 A;  3KP9 A;  3FZ9 A;  3QFB C;  1B4P A;  3FR9 A;  3FYG A;  2XPD A;  3IOS A;  2IFQ B;  2VCQ A;  2C0G A;  2FLS A;  2G2Q A;  3TJJ A;  1XWK A;  4YQM A;  2OE3 A;  2HQT A;  2WDU A;  1UVZ A;  3EUR A;  5JWR B;  4TRX A;  2BMX A;  1X9W B;  2JZR A;  3HVS A;  1KNG A;  2B5Y A;  5DBQ A;  3PPU A;  1QFN A;  2VIM A;  3F6D A;  5LNK e;  1A0R P;  4TR3 A;  2VL2 A;  5ECS A;  5IMC A;  2CX4 A;  3P90 A;  1HNC A;  3TJG A;  5C04 A;  2FHE A;  5IMF A;  3HCZ A;  2GQL A;  1BQ7 A;  2XHF A;  3QAG A;  4TXV A;  1SJ6 A;  5G31 A;  3TB2 A;  1GWC A;  1S3D A;  2GST A;  4G0K A;  3KIJ A;  3TKS C;  2VCX A;  4MA9 A;  1GSY A;  4HZ4 A;  3N9J A;  1SJI A;  5H5R A;  3KP8 A;  4JRR A;  2FWF A;  1X9S B;  3LJR A;  4BVX B;  5DVB A;  1HNB A;  4NHW A;  4I6X A;  3TKQ A;  3KGK A;  1XOB A;  2C3T A;  2AAW A;  1YKA A;  1T4Y A;  3RPN A;  3VUR A;  2O89 A;  2CV4 A;  1V98 A;  5E4W A;  3GN3 A;  4MJA A;  2ZNM A;  1TK8 B;  3H8Q A;  1JLV A;  5ECH B;  2L6C A;  4KCA A;  4POL A;  3HVX A;  2CZ2 A;  2PVO C;  1YDK A;  3Q6O A;  3D0Z A;  2HRK B;  3I69 A;  2B3S A;  4KF9 A;  4JR4 A;  4ACS A;  3HVV A;  2E2G A;  4KGI A;  4J57 E;  1R5A A;  5EY6 A;  1RK4 A;  2LRN A;  1OC9 B;  3A5W A;  3IAS 2;  2J9H A;  3F3Q A;  2B1L A;  3BCI A;  5IO2 A;  1MDI A;  2WCI A;  1YQ1 A;  1ERW A;  2GZZ A;  3D21 A;  2YJ7 A;  4PQI A;  3CMI A;  5ECQ B;  4IGJ A;  5G5F A;  4YAV A;  1ERT A;  2PBJ A;  2P0G A;  4MMM A;  1SL2 B;  1BYE A;  3MWH A;  4FYU A;  5ECO B;  3TJB A;  1DE1 A;  2GQK A;  1N8J A;  2H19 A;  2RLI A;  4HU9 A;  3GRX A;  4PNG A;  2XPE A;  5CRE A;  4DEJ A;  2YV7 A;  2CA8 A;  2GT6 A;  2H1D A;  4NXI A;  4MP4 A;  11GS A;  5IM9 A;  3F4R A;  1YKC A;  2DIY A;  5HFI A;  5F05 A;  1WRY A;  3HD5 A;  1Z3E A;  1WWJ A;  4EC0 A;  5JCG A;  4X1U A;  1PRX A;  3ZL5 A;  2GS3 A;  2FNO A;  5EVO A;  4AJ7 A;  3J7Y b;  3GKM A;  3FY7 A;  3FW2 A;  4MK3 A;  2M80 A;  3IPZ A;  2C3N A;  4JBB A;  2QKE A;  1VF3 A;  3TJF A;  1CQG A;  3G9B A;  2PER A;  4QQ7 A;  2BTO T;  2VUP A;  1SU9 A;  4EKZ A;  1O85 A;  2LQO A;  3LXZ A;  4K9Z A;  4PUR A;  4NV5 A;  2H73 A;  1EEM A;  3GKX A;  1GSS A;  2KOK A;  3DWV A;  3KMO A;  1X0R A;  4IW9 A;  2H0H A;  2DML A;  4ZB9 A;  1GSE A;  3ERF A;  2OE1 A;  3LSZ A;  1OKD A;  4WBJ A;  1AC1 A;  3TCO A;  3ZRE A;  4ISD A;  1TP9 A;  1PSQ A;  1DSB A;  4Q5Q A;  1BG5 A;  3M1G A;  3GL5 A;  3WT1 A;  1AUC A;  1B9X C;  4WEY A;  2YPM A;  1JLW A;  2MMO A;  2DIZ A;  3TKR A;  1U3A A;  2ON5 A;  3ZFB A;  5ENU A;  2GVP A;  1XXU A;  4KH7 A;  5DCH A;  2D2Z A;  2J23 A;  1AQW A;  2FA4 A;  1ML6 A;  4PXO A;  3L9V A;  2H30 A;  4ZXG A;  1XWC A;  4F0B A;  3TGZ A;  4XS4 A;  4IP1 A;  4IEL A;  3LQ7 A;  2AV4 A;  4BA7 A;  3M9J A;  3D6I A;  5J9C A;  2O8V B;  3FK8 A;  1TU7 A;  4X0X A;  4N0Z A;  1WP0 A;  5J9B A;  1YY7 A;  2L4C A;  2E2M A;  1G0T A;  2HSM A;  2JSZ A;  5G1K A;  4IJ3 A;  4I2T A;  5F06 A;  2V2G A;  5AIV A;  3AY8 A;  5GAP D;  3FKF A;  2K8V A;  4DVC A;  1U3I A;  3ZTL A;  4I2U A;  3WGE A;  2FY6 A;  12GS A;  1VF4 A;  3V1W A;  2CAI A;  1T00 A;  4IVF A;  3TDG A;  4D73 A;  1QK8 A;  1UC7 A;  1Y6E A;  4G2E A;  3LYK A;  4GRF A;  2WZ9 A;  4GST A;  2A2S A;  1G6Y A;  3HJO A;  1Z6N A;  4N11 A;  2GZY A;  5CAX A;  3GST A;  4HUA A;  1WJK A;  3F0I A;  1XCC A;  1TRV A;  3UBL A;  6GSS A;  2JSY A;  4IJI A;  2VAF A;  2C80 A;  3IV4 A;  2AUV A;  2YN1 A;  3GX8 A;  4V2L A;  3VWX A;  4BVY B;  2VD0 A;  1JHB A;  3OR5 A;  5KN0 A;  2KP2 A;  1IYI A;  2EIO A;  3H93 A;  2PU9 C;  3UVT A;  1GRX A;  1X5E A;  4YQV A;  5D9X A;  4TVE A;  2L6D A;  2C0F A;  2DJ3 A;  3RPP A;  4OMV A;  1GUL A;  1JZR A;  2VOC A;  1XZO A;  4WKW A;  3VFI A;  1PL1 A;  5DCG A;  1WIK A;  2V41 A;  2N5F A;  2ZCT A;  3ZIV A;  1B9Y C;  4O32 A;  3APO A;  1F6M C;  2VL3 A;  3C1S A;  4HU7 A;  1TOF A;  2IN3 A;  1T8E B;  2JL4 A;  2AYT A;  1TU8 A;  3F9U A;  5H5S A;  4LA1 A;  1U87 A;  4LL1 B;  3I43 A;  1TJD A;  4EO3 A;  5ELA A;  8GSS A;  4KUN A;  2IMK A;  4OO4 A;  5A4V A;  2IMF A;  3EYT A;  5FHI A;  3NOF A;  5KN2 A;  4N30 A;  2VL2 C;  1MTC A;  4ZB8 A;  4EVM A;  2C0D A;  4TXO A;  1SK2 A;  3DKS A;  5IMA A;  3VK9 A;  2GSS A;  5L71 A;  2YOI A;  2OA7 A;  2LKU A;  4GQC A;  2FA8 A;  2QSI A;  16GS A;  3EVI A;  1PA3 A;  1EZK A;  3C7M A;  1ERU A;  2YZU A;  5DAK A;  1QGV A;  3KH9 A;  2F8A A;  3GMF A;  2ALB A;  3GH9 A;  3ED3 A;  2GLR A;  2IJY A;  4IHU A;  2C0E A;  3KXO A;  4OO5 A;  5CO3 A;  3DYR A;  2G0F A;  2HRN A;  3EMX A;  4FYC A;  1GL8 A;  1PD2 1;  2WRT A;  5J4U A;  2QGV A;  4V2N A;  2LST A;  2LEG A;  2DMM A;  2YNX A;  4OFN A;  4Q5R A;  5DDL A;  1MD4 A;  3KTL A;  1ZYE A;  2E0Q A;  2B6M A;  1PMT A;  1SK0 A;  1Q4J A;  4GQF A;  1QUW A;  4DSR A;  4KCE A;  4KDY A;  1SJZ A;  4CW9 A;  1T4Z A;  2MBT A;  2FCH A;  2H01 A;  6GSX A;  4YAP A;  1AXD A;  9GSS A;  5CYY A;  1EOH A;  2JAC A;  3G7I A;  4EXJ A;  1F3B A;  3A2X A;  4O7H A;  1R7H A;  3LGC A;  2CX3 A;  3GYK A;  5IMV A;  3QD9 A;  2LJA A;  4GCI A;  4MF7 A;  2VLT A;  5JCU A;  4K0G A;  3HXS A;  2NPB A;  4L0W A;  1QMV A;  1G7O A;  1R5P A;  1KTE A;  3TUE A;  1G6W A;  1VGL A;  3M8N A;  3RHB A;  1GLQ A;  4EF0 A;  5HQP A;  1XWB A;  2H1A A;  2ZUP A;  5AGY A;  4XS4 B;  4POM A;  3CRT A;  4XS6 A;  4I5Q A;  1B8X A;  3I6A A;  3P2A A;  4JED A;  7GSS A;  3WGD A;  4NHZ A;  2B5X A;  3FZ5 A;  4NWY A;  3MAK A;  1A2L A;  1ILO A;  1DE2 A;  2OJL A;  3QAV A;  3HHV A;  3ZYW A;  2R2J A;  4HS1 A;  1B4Q A;  2LNT A;  4V1A p;  3VLN A;  5IQY A;  1GTA A;  1G7E A;  5FWG A;  3QPM A;  6GSV A;  3HJP A;  5ECL B;  3D4M A;  1V2A A;  1XWG A;  3H4K A;  4D73 B;  1FOV A;  3D22 A;  2GDR A;  5D9V A;  4NAX A;  1JZO A;  1AAZ A;  2DJ0 A;  5IOW A;  4O5R A;  4IKH A;  5AIX A;  4MPF A;  4JR6 A;  2V6K A;  2LRT A;  1NW2 A;  3EU4 A;  1KBN A;  2GSQ A;  4NMU A;  3HJM A;  2B5E A;  3QAW A;  1J9B A;  3EWL A;  2H70 A;  4XRA A;  2OAD A;  2TIR A;  1VRS D;  3TKS E;  4PQH A;  1M2B A;  1XVW A;  3ZMK A;  2LJK A;  5DQY A;  3VI7 A;  4OCE A;  4K8M A;  4DSS A;  4O92 A;  5IMD A;  1EGR A;  4TR1 A;  2MZC A;  5G5E A;  2H0G A;  3H79 A;  4TN8 A;  1A2M A;  2WJU A;  1ZMA A;  2A2R A;  1C72 A;  5ELG A;  2H1B A;  2VLV A;  5G2Z A;  3ERW A;  1GUM A;  1OE7 A;  1EP8 A;  1PX7 A;  3O3T A;  1XVQ A;  1GSF A;  2NTO A;  4WF4 A;  1TTZ A;  2AB6 A;  4GLT A;  2XBQ A;  4K2D A;  1BJX A;  1F37 A;  3UIW A;  4KAE A;  1U88 A;  1JZW A;  3VPQ A;  4ILF A;  1HNA A;  2OBK A;  1V9W A;  4HJ2 A;  1SKR B;  1IYH A;  4MZC A;  5IPH A;  3L9U A;  2Z9S A;  2UZ8 A;  2M46 A;  1ZL9 A;  2FGX A;  2RM5 A;  4HQZ A;  3GH6 A;  4QL7 A;  3ZIJ A;  1W4V A;  5AN1 A;  5ABR A;  2KP1 A;  4KW6 A;  2VD1 A;  3LWA A;  3RAZ A;  2B7J A;  1SD9 A;  3TKS A;  3ERG A;  5LD0 A;  4K6X A;  3UAP A;  1WE0 A;  4ECC A;  1EWX A;  2H0I A;  2I3Y A;  4KE3 A;  18GS A;  4ML1 A;  3SBC A;  5IOX A;  2EIR A;  3KZQ A;  2HT9 A;  3FRC A;  3FR6 A;  5CP1 A;  1O73 A;  5DAK B;  4GF0 A;  3CRU A;  1TK0 B;  1HD2 A;  1T3B A;  2X8G A;  4F2I A;  2IPA A;  1GTI A;  3LG6 A;  1EP7 A;  2L57 A;  1MEK A;  1ABA A;  2L4Q A;  3KMN A;  1A0F A;  1ON4 A;  4MZW A;  1PGT A;  1BAY A;  4YH2 A;  3E9J B;  3R3E A;  4F0C A;  1FO5 A;  1O6J A;  2GSR A;  14GS A;  4FYB A;  4K7O A;  3PIN A;  1TW9 A;  3F4S A;  3VWU A;  1XWA A;  1VF2 A;  3ZVJ A;  3N5O A;  4IBP A;  2L5O A;  4PQ1 A;  2MMA A;  4ZL9 A;  5IIZ A;  1V58 A;  1SK1 A;  20GS A;  4ZIJ A;  3GX0 A;  2JAD A;  3ISO A;  3GV1 A;  5A4U A;  1AIU A;  2H1G A;  3MSZ A;  5HR0 A;  1SYR A;  3KH7 A;  1M2D A;  5DJL A;  2HSH A;  2I4A A;  4KND A;  1K3Y A;  5JWQ B;  1GSD A;  5COH A;  3IR4 A;  3GTU A;  2DSA A;  5CRD A;  5HR2 A;  1EGO A;  1F9M A;  2C4J A;  2CT6 A;  4MCU A;  5GZZ B;  2H72 A;  2HZF A;  3US3 A;  1FVJ A;  5IMZ A;  5DJM A;  1TDI A;  5J5N A;  4ECI A;  3GUS A;  4F9Z A;  1GUH A;  2PN8 A;  3QOU A;  2LRC A;  3ME7 A;  19GS A;  1YZX A;  1BX9 A;  3CBU A;  2PGT A;  2VCZ A;  3GIX A;  4WBR D;  4K7N A;  3HYP A;  3E0U A;  1JFU A;  4AGS A;  1K0M A;  3KCM A;  3FZ4 A;  4MJC A;  3IHQ A;  1K0D A;  3M9K A;  1JZD A;  4HDE A;  1M9B A;  3IRA A;  2HLS A;  1TRW A;  4ECB A;  3GKN A;  3RDW A;  3D4T A;  3LYP A;  3H1N A;  5A5K A;  4NPB A;  1USB A;  1OYJ A;  4XHM A;  3I9V 2;  2HRK A;  3KEB A;  5EL8 A;  2REM A;  3RHC A;  5BMU A;  2PVQ A;  2HRA A;  2V1M A;  1XIY A;  3UMA A;  3GL3 A;  2GZP A;  5CRG A;  3UVH A;  2C1Y A;  2I9H A;  1O8X A;  1OVN A;  4USS A;  2PMT A;  1U6T A;  5G30 A;  1PQN A;  2YWI A;  3G7J A;  5D9W A;  1A2J A;  1TXX A;  5ECN B;  3EIN A;  4V1A g;  22GS A;  2CVB A;  4K0N A;  4KDX A;  3CTF A;  1O7U A;  4EDZ A;  1FB0 A;  1GTU A;  2XC2 A;  3QDN A;  1M99 A;  1K0B A;  4TR1 B;  2YAN A;  4RI6 A;  3IA1 A;  2R37 A;  5C00 A;  2NVL A;  2TRC P;  3APS A;  1OE8 A;  4AF2 A;  2FUG 2;  3EC3 A;  4NV2 A;  5E59 A;  3QCP A;  3JCM L;  1RW1 A;  1SD8 A;  5F8B A;  2F9S A;  4PNF A;  5JCW A;  4XS1 A;  1KEB A;  2CVD A;  2MBS A;  1Z7P A;  3C1R A;  1AQV A;  2YWM A;  1PL2 A;  3KM6 A;  3IDV A;  4HJM A;  3GSS A;  2IL3 A;  4MF6 A;  2AHE A;  1PKZ A;  2XBI A;  2MMZ A;  4KSM A;  1TRU A;  5ECR B;  1Q98 A;  1V40 A;  1WOU A;  4PUF C;  4EL1 A;  1V57 A;  3P8W A;  5IPG A;  1LU4 A;  2H74 A;  2X8C A;  2TRX A;  3UOM A;  3ZIT A;  2IMI A;  3WGX A;  1GNW A;  3S9F A;  3FHK A;  2N5B A;  4MZB A;  2DJJ A;  3KTB A;  1XPV A;  2RM6 A;  2LQQ A;  3DVX A;  3GKK A;  2L59 A;  1J0F A;  1K3O A;  3F4T A;  1XFL A;  4K1F A;  1B48 A;  4RUV A;  1M2A A;  3QMX A;  2F3M A;  3CSJ A;  3TJK A;  1I9D A;  4IP6 A;  4HZ2 A;  4RQX A;  5DAL A;  1Y25 A;  1W89 A;  1TK5 B;  2ES7 A;  4KX4 A;  4HI7 A;  2YP6 A;  2C8U A;  4OCF A;  3BOA A;  2KLX A;  1ZYQ B;  4WET A;  1FAA A;  4MH2 A;  1FVK A;  2P5Q A;  2HNL A;  3FR3 A;  4IS0 A;  2CZ3 A;  3W6G A;  2PWJ A;  2K18 A;  1FB6 A;  1SKW B;  2RUE A;  2IME A;  5ECP B;  4QL9 A;  1Z9H A;  3HZ8 A;  2IWT A;  2HZE A;  4IN0 A;  2ON7 A; 
#chains in the Genus database with same CATH topology
 4ZBA A;  3SWL A;  2MMN A;  1NHO A;  3L4N A;  4X43 A;  5G1L A;  3Q74 A;  10GS A;  1OC3 A;  2HFD A;  4TW5 A;  4Q5F A;  2H6X A;  3GTU B;  3PGT A;  4KSO A;  2WVX B;  3TOU A;  5B6N A;  5DQS A;  2HSM B;  1ACV A;  1N2A A;  1O8W A;  3G7Y A;  3KD0 A;  1OKT A;  1MDJ A;  4AI6 A;  4AKG A;  1ST9 A;  3UEM A;  1Y1U A;  3LXT A;  4K5S A;  3WYW A;  4MJB A;  4F82 A;  3FZA A;  3W8J A;  2BJX A;  4FO5 A;  4MF5 A;  3CQF A;  1E2Y A;  4YQU A;  1ZGN A;  2HSY A;  2WZS A;  2WFC A;  4BVY A;  4MAB A;  1LBK A;  1YF1 A;  1UA5 A;  4LMW A;  2YV9 A;  4ZL8 A;  1S3A A;  2YZH A;  1A24 A;  4G19 A;  4CHS A;  1NM3 A;  3MDK A;  2LUS A;  4ICY A;  2QA2 A;  3CYN A;  3UJ1 A;  4FIW A;  4CDO A;  1TI1 A;  4I8B A;  2R4V A;  3DGQ A;  1Z5Y E;  2GT5 A;  2O87 A;  4AJ6 A;  1WMJ A;  3WD6 A;  4XCS A;  2F8F A;  3TRQ A;  4ML6 A;  2M72 A;  5CNW A;  2R3X A;  4ECJ A;  1F3A A;  4GDF A;  4KA0 A;  3IBH A;  1GTB A;  4LMV A;  4MDC A;  4MLY A;  3L78 A;  3M0F A;  1F2E A;  2LV3 A;  5ID2 A;  4G0I A;  3QR6 A;  1YEW C;  2YJH A;  4WXT A;  1M0U A;  2A4H A;  1T7P B;  4XIH A;  3IE3 A;  1SL1 B;  6GSU A;  2B1K A;  4GTU A;  3CTG A;  3Q19 A;  3O6T A;  4FH8 A;  3GA4 A;  3TOT A;  5A4W A;  1UN2 A;  1OC8 A;  5HFK A;  1DBY A;  5D73 A;  4EE0 A;  4MPG A;  3F63 A;  5FT3 A;  2HRF A;  2GTU A;  4F03 A;  3VWV A;  2H71 A;  2VCW A;  2K9F A;  1K0O A;  2VCT A;  4ID0 A;  3CSI A;  4PX1 A;  3QFA C;  4L5L A;  3GHA A;  3K8N A;  3EMP A;  1SL0 B;  5D8I A;  2R5G A;  5F07 A;  1SYX A;  3IC4 A;  2VL9 A;  4G9H A;  1NHY A;  5A5H B;  3DVW A;  1EV9 A;  2B7K A;  5EPF A;  3VPT A;  3MNG A;  1EEJ A;  3PR8 A;  3LOR A;  5KEJ A;  4TXO B;  2E7P A;  4RI7 A;  3E3E A;  3DD3 A;  5INY A;  3HZ4 A;  1TI3 A;  1PN9 A;  2C3Q A;  4JE1 A;  3U6V A;  17GS A;  1THO A;  1SKS B;  3UAR A;  3ZFL A;  4ZB6 A;  3BCK A;  4K7I A;  2R6K A;  3ZZX A;  1SEN A;  1TRS A;  1TKD B;  1GH2 A;  1A8Y A;  2I1U A;  3GUR A;  3D5J A;  3PH9 A;  3HY2 A;  3ZML A;  3C71 A;  1THX A;  4AJ8 A;  5ECM B;  2DJ2 A;  2QC7 A;  2X99 A;  4BL7 A;  4OFT A;  2NDO A;  1M9A A;  5GSS A;  2P5R A;  4WR4 A;  1PKW A;  5IO0 A;  5HR1 A;  3ZRD A;  6GST A;  2VM1 A;  4GSS A;  4XTS A;  3F8U A;  1EOG A;  2VM2 A;  4G10 A;  1AQX A;  2YWN A;  3EU3 A;  2CAQ A;  2H75 A;  2VKZ G;  4GWR A;  1H75 A;  2IFQ A;  2OAC A;  5ECI B;  4WF5 A;  4XRD A;  4TOP A;  1YEX A;  3J7Y k;  4PTS A;  3DRN A;  5AIS A;  2OE0 A;  3TKP A;  3IK9 A;  1OAZ A;  3C73 A;  2WS2 A;  13GS A;  1URM A;  4Z2T A;  5DAL B;  2KHP A;  2K6V A;  1Z7R A;  1XW5 A;  4BWS A;  3TU3 B;  2K8S A;  4HEA 2;  5CRH A;  3MIX A;  3VWW A;  5A34 B;  1M7T A;  4BPY A;  5F0G A;  5GAN D;  2DJ1 A;  3GNJ A;  3DEX A;  1MDK A;  2IIY A;  5HR3 A;  2VCV A;  4J2F A;  5GST A;  1FW1 A;  3F3R A;  2AJQ B;  2PPT A;  4IQA A;  4BWQ A;  4I97 A;  2WB9 A;  2KUC A;  5J41 A;  5A1N A;  2HXK A;  1ZCP A;  2HZE B;  5D96 A;  1CQH A;  2CQ9 A;  1DUG A;  1A23 A;  3UL3 A;  3ZLP A;  1YF0 A;  1XOA A;  3FEU A;  2NBS A;  1LJR A;  1QXH A;  2H6Y A;  1X5C A;  3ME8 A;  2GQM A;  4BVX A;  4GSN A;  4G0L A;  1GNE A;  3A2V A;  4V2M A;  4PUA A;  6GSY A;  5B6M A;  2H8L A;  4FQU A;  2LNS A;  2IMD A;  4KDU A;  3NIV A;  4P3Y B;  4JU5 A;  1XW9 A;  1ZOF A;  3R2Q A;  1X5D A;  3CXG A;  1FG4 A;  5D9T A;  4RQR A;  1HQO A;  2H76 A;  2FD3 A;  2L5L A;  1K3L A;  4ULX A;  2EIQ A;  1GSQ A;  1VF1 A;  2VLU A;  4N0V A;  2HE3 A;  3LW9 A;  3VI5 A;  2P31 A;  3W8S A;  4TR0 A;  4E8E A;  4TR4 A;  4LL4 B;  3EE2 A;  4OD7 A;  2HSN B;  3KJY A;  1XW6 A;  4POK A;  5KOX A;  1R26 A;  5KN1 A;  3DML A;  1EV4 A;  5H5Q A;  3LFL A;  3F6F A;  2EC4 A;  5D93 A;  2FWG A;  1PX6 A;  1OC9 A;  2O85 A;  3WT2 A;  3Q18 A;  3HDC A;  1NSW A;  4J56 E;  4DSQ A;  3HKR A;  3L9S A;  3RBT A;  2X64 A;  5B8A A;  1A8L A;  4TKY A;  2H6Z A;  1K0N A;  4PGT A;  2YCD A;  2O7K A;  2RII A;  2V32 A;  4PI2 C;  3U5R E;  2WW2 A;  3IC8 A;  3IXR A;  1YEP A;  1H4O A;  4ZL7 A;  6GSW A;  3CSH A;  3A2W A;  1GUK A;  4ZB7 A;  1XBS A;  3DXB A;  3GFK A;  3C8E A;  4EDY A;  4H86 A;  2CVK A;  4DSS B;  1HYU A;  4HQS A;  4L0U A;  2JZT A;  2LJR A;  4WR5 A;  2WW1 A;  2I81 A;  2H1L A;  1ZZY A;  5LCZ A;  3TRX A;  4IQ1 A;  2N5A A;  2DLX A;  5J3R A;  5ID2 B;  3TRP A;  2DBC A;  4L5O A;  2JU5 A;  2GGT A;  2DC5 A;  3P7X A;  4Z7X A;  1ERV A;  1AW9 A;  2VO4 A;  4EUY A;  3M3M A;  4MJE A;  5B8B A;  1J08 A;  1X9M B;  4N10 A;  4ZBD A;  1GLP A;  1WPI A;  2HI7 A;  2HYX A;  4ZIL A;  2R0P A;  3O76 A;  1YJ6 A;  5CRW A;  5JWO B;  3L0H A;  5HFG A;  3LEF A;  1PFO A;  1GP1 A;  1K0C A;  2DJK A;  4LLR A;  5KN3 A;  2JZS A;  1BED A;  4JZQ A;  2A4V A;  3BJ5 A;  3A3T A;  2FWH A;  1I5G A;  2F51 A;  2WGR A;  2X8H A;  2OKA A;  3UBK A;  3HA9 A;  1O81 A;  2EFH A;  1E6B A;  4E8H A;  4ZBB A;  3IAM 2;  4MH3 A;  4Q5N A;  2RUF A;  4L8E A;  4OFM A;  2V6O A;  3IK7 A;  1FHE A;  4OWY A;  4HSC X;  1RQM A;  1T1V A;  1R4W A;  1S3C A;  3BBY A;  5B7C A;  4HOJ A;  2PUK C;  1Z6M A;  3NZN A;  2OBI A;  3ZVJ D;  2X49 A;  2YWO A;  2LTK A;  4BL7 B;  4KB3 A;  3IHG A;  3BD2 A;  1GSU A;  1QQ2 A;  3DIE A;  2LS5 A;  2WUL A;  2MYG A;  1K0A A;  5ECK B;  2H66 A;  1SVO A;  4POB A;  3APQ A;  2FWE A;  4GXZ A;  1MD3 A;  3KP9 A;  3FZ9 A;  3QFB C;  1B4P A;  2UV8 G;  3FR9 A;  3FYG A;  2XPD A;  3IOS A;  2IFQ B;  2VCQ A;  2C0G A;  3HVN A;  2FLS A;  2G2Q A;  3TJJ A;  1XWK A;  4YQM A;  2OE3 A;  2HQT A;  2WDU A;  1UVZ A;  3EUR A;  5JWR B;  4TRX A;  2BMX A;  1X9W B;  2JZR A;  2R0G A;  3HVS A;  1KNG A;  2B5Y A;  5DBQ A;  3PPU A;  1QFN A;  2VIM A;  3F6D A;  5LNK e;  1A0R P;  4TR3 A;  2VL2 A;  5ECS A;  5IMC A;  2CX4 A;  3P90 A;  4W66 A;  1HNC A;  4EIQ A;  3TJG A;  5C04 A;  2FHE A;  5IMF A;  3HCZ A;  2GQL A;  1BQ7 A;  2XHF A;  3QAG A;  4TXV A;  1SJ6 A;  1N25 A;  5G31 A;  3TB2 A;  1GWC A;  5A1N B;  1S3D A;  2GST A;  4G0K A;  3KIJ A;  3TKS C;  2VCX A;  4MA9 A;  1GSY A;  4HZ4 A;  3N9J A;  4A5P A;  1SJI A;  5H5R A;  3KP8 A;  4JRR A;  2FWF A;  1X9S B;  3LJR A;  4BVX B;  5DVB A;  1HNB A;  4BIK A;  4NHW A;  4I6X A;  3TKQ A;  3KGK A;  1XOB A;  2C3T A;  2AAW A;  1YKA A;  1T4Y A;  3RPN A;  3VUR A;  4FXY P;  2O89 A;  2CV4 A;  1V98 A;  5E4W A;  3GN3 A;  4MJA A;  2ZNM A;  1TK8 B;  3H8Q A;  1JLV A;  5ECH B;  2L6C A;  4KCA A;  4POL A;  3HVX A;  2CZ2 A;  2PVO C;  1YDK A;  3Q6O A;  3D0Z A;  3CWG A;  2HRK B;  3I69 A;  1YVL A;  2B3S A;  4KF9 A;  5BMU B;  4JR4 A;  4ACS A;  3HVV A;  2E2G A;  4KGI A;  4J57 E;  1R5A A;  5EY6 A;  1RK4 A;  2LRN A;  1OC9 B;  3A5I A;  3A5W A;  3IAS 2;  2J9H A;  3F3Q A;  2B1L A;  3BCI A;  5IO2 A;  1MDI A;  1ZYN A;  2WCI A;  1YQ1 A;  1ERW A;  2GZZ A;  3D21 A;  4MNN A;  3RFR C;  2YJ7 A;  4PQI A;  3CMI A;  5ECQ B;  4IGJ A;  1PN0 A;  5G5F A;  4YAV A;  1ERT A;  2PBJ A;  2P0G A;  4MMM A;  1SL2 B;  1BYE A;  3MWH A;  4FYU A;  1S4B P;  5ECO B;  3TJB A;  1DE1 A;  2GQK A;  1N8J A;  2H19 A;  2RLI A;  1ZYP A;  4HU9 A;  3GRX A;  4PNG A;  2XPE A;  5CRE A;  4DEJ A;  2YV7 A;  2CA8 A;  2GT6 A;  2H1D A;  4NXI A;  4MP4 A;  11GS A;  5IM9 A;  3F4R A;  1YKC A;  2DIY A;  5HFI A;  5F05 A;  1WRY A;  3HD5 A;  1Z3E A;  1WWJ A;  4EC0 A;  5JCG A;  4X1U A;  1PRX A;  3ZL5 A;  2GS3 A;  2FNO A;  5EVO A;  5BRT A;  4AJ7 A;  3J7Y b;  3GKM A;  3FY7 A;  3FW2 A;  4MK3 A;  2M80 A;  3IPZ A;  2C3N A;  4JBB A;  2QKE A;  1VF3 A;  3TJF A;  1CQG A;  3G9B A;  2PER A;  4YKG A;  4QQ7 A;  2BTO T;  2VUP A;  1SU9 A;  4EKZ A;  1O85 A;  2LQO A;  3LXZ A;  4K9Z A;  4PUR A;  4NV5 A;  2H73 A;  1EEM A;  3GKX A;  1BF5 A;  2A2P A;  1GSS A;  2KOK A;  3DWV A;  3KMO A;  1X0R A;  4IW9 A;  2H0H A;  2DML A;  4ZB9 A;  1GSE A;  3ERF A;  2OE1 A;  3LSZ A;  1OKD A;  4WBJ A;  1AC1 A;  3TCO A;  3ZRE A;  4ISD A;  1TP9 A;  1PSQ A;  1DSB A;  4Q5Q A;  1BG5 A;  3M1G A;  3GL5 A;  3WT1 A;  1AUC A;  1B9X C;  4WEY A;  2YPM A;  1JLW A;  2MMO A;  2DIZ A;  3TKR A;  1U3A A;  2ON5 A;  3ZFB A;  5ENU A;  2GVP A;  1XXU A;  4KH7 A;  5DCH A;  2D2Z A;  2J23 A;  1AQW A;  3EPT A;  2FA4 A;  1ML6 A;  4PXO A;  3L9V A;  2H30 A;  4ZXG A;  1XWC A;  4F0B A;  3TGZ A;  4XS4 A;  4IP1 A;  4IEL A;  3LQ7 A;  2AV4 A;  4BA7 A;  3M9J A;  3D6I A;  5J9C A;  2O8V B;  3FK8 A;  1TU7 A;  4X0X A;  4N0Z A;  1WP0 A;  5J9B A;  1YY7 A;  2L4C A;  2E2M A;  1G0T A;  2EFE A;  2HSM A;  2R0C A;  2JSZ A;  5G1K A;  4IJ3 A;  4I2T A;  5F06 A;  2V2G A;  5AIV A;  3AY8 A;  5GAP D;  3FKF A;  2K8V A;  4DVC A;  1U3I A;  3ZTL A;  4I2U A;  3WGE A;  2FY6 A;  12GS A;  1VF4 A;  1FOH A;  3V1W A;  2CAI A;  1T00 A;  4IVF A;  3TDG A;  4D73 A;  1QK8 A;  1UC7 A;  1Y6E A;  4G2E A;  4CY6 A;  3LYK A;  4GRF A;  2WZ9 A;  4GST A;  2A2S A;  1G6Y A;  3HJO A;  1Z6N A;  4N11 A;  2GZY A;  5CAX A;  3GST A;  4HUA A;  1WJK A;  3F0I A;  5J4Y A;  1XCC A;  1TRV A;  3UBL A;  6GSS A;  2JSY A;  4IJI A;  2VAF A;  2C80 A;  3IV4 A;  2AUV A;  2YN1 A;  3GX8 A;  4V2L A;  3VWX A;  4BVY B;  2VD0 A;  1JHB A;  1TXU A;  3OR5 A;  5KN0 A;  2KP2 A;  1IYI A;  2EIO A;  3H93 A;  2PU9 C;  3UVT A;  1GRX A;  1X5E A;  4YQV A;  5D9X A;  4O5U A;  4TVE A;  2L6D A;  2C0F A;  2DJ3 A;  3RPP A;  4OMV A;  1XG8 A;  1GUL A;  1JZR A;  2VOC A;  1XZO A;  4WKW A;  3VFI A;  1PL1 A;  5DCG A;  1WIK A;  2V41 A;  2N5F A;  2ZCT A;  3ZIV A;  1B9Y C;  4O32 A;  3APO A;  1F6M C;  2VL3 A;  3C1S A;  4HU7 A;  1TOF A;  2IN3 A;  1T8E B;  2JL4 A;  2AYT A;  1TU8 A;  3F9U A;  5H5S A;  4LA1 A;  1U87 A;  4LL1 B;  3I43 A;  1TJD A;  4EO3 A;  5ELA A;  8GSS A;  4KUN A;  2IMK A;  4OO4 A;  5A4V A;  2IMF A;  3EYT A;  5J4V A;  3HMJ G;  5FHI A;  3NOF A;  5KN2 A;  2DKH A;  4N30 A;  2VL2 C;  1MTC A;  4ZB8 A;  4EVM A;  2C0D A;  4TXO A;  1SK2 A;  3DKS A;  4O5Q A;  5IMA A;  3VK9 A;  2GSS A;  5L71 A;  2YOI A;  2OA7 A;  2EFC A;  2LKU A;  4GQC A;  2FA8 A;  2QSI A;  16GS A;  3EVI A;  1PA3 A;  1EZK A;  3C7M A;  1ERU A;  2YZU A;  5DAK A;  1QGV A;  3KH9 A;  2F8A A;  3GMF A;  2ALB A;  3GH9 A;  3ED3 A;  2GLR A;  2IJY A;  4IHU A;  2C0E A;  3KXO A;  4OO5 A;  4PHZ C;  5CO3 A;  3DYR A;  2G0F A;  2HRN A;  3EMX A;  4FYC A;  1GL8 A;  1PD2 1;  2WRT A;  2WW0 A;  5J4U A;  2QGV A;  4V2N A;  2X4A A;  2LST A;  2LEG A;  2DMM A;  2YNX A;  4OFN A;  4Q5R A;  5DDL A;  1MD4 A;  3KTL A;  1ZYE A;  2E0Q A;  2B6M A;  1PMT A;  1SK0 A;  1Q4J A;  4GQF A;  1QUW A;  2O5V A;  4DSR A;  4KCE A;  4KDY A;  1SJZ A;  4CW9 A;  1T4Z A;  2MBT A;  2FCH A;  2H01 A;  6GSX A;  4YAP A;  1AXD A;  5J40 A;  9GSS A;  5CYY A;  1EOH A;  2JAC A;  2O3E A;  4AKI A;  3G7I A;  5A34 A;  4EXJ A;  1F3B A;  3A2X A;  4O7H A;  1R7H A;  4X4J A;  3LGC A;  2CX3 A;  3GYK A;  5IMV A;  3RGB C;  3QD9 A;  2EFD A;  2LJA A;  4GCI A;  4MF7 A;  2VLT A;  5JCU A;  4K0G A;  3HXS A;  2NPB A;  4L0W A;  1QMV A;  1G7O A;  4K2X A;  3CHX C;  1R5P A;  1KTE A;  3TUE A;  1G6W A;  1VGL A;  3M8N A;  3RHB A;  1GLQ A;  1SVM A;  4EF0 A;  5HQP A;  1XWB A;  2H1A A;  2ZUP A;  5AGY A;  4XS4 B;  4POM A;  3CRT A;  4XS6 A;  4I5Q A;  1B8X A;  3I6A A;  3P2A A;  4JED A;  4Z2R A;  7GSS A;  3WGD A;  4NHZ A;  2B5X A;  3FZ5 A;  4NWY A;  3MAK A;  1A2L A;  1ILO A;  1DE2 A;  2OJL A;  3QAV A;  3HHV A;  3ZYW A;  2R2J A;  2OT3 A;  4HS1 A;  1B4Q A;  2LNT A;  4V1A p;  3VLN A;  5IQY A;  1GTA A;  1G7E A;  5FWG A;  3QPM A;  6GSV A;  2HSN A;  3HJP A;  5ECL B;  3D4M A;  1V2A A;  1XWG A;  3H4K A;  4D73 B;  1FOV A;  3D22 A;  2GDR A;  5D9V A;  4NAX A;  1JZO A;  1AAZ A;  2DJ0 A;  5IOW A;  4K5R A;  4O5R A;  4IKH A;  5AIX A;  4MPF A;  4JR6 A;  2V6K A;  2LRT A;  1NW2 A;  4EIP A;  3EU4 A;  1KBN A;  2GSQ A;  4NMU A;  3HJM A;  2B5E A;  3QAW A;  1J9B A;  3EWL A;  2H70 A;  4XRA A;  2OAD A;  2TIR A;  1VRS D;  3TKS E;  4PQH A;  1M2B A;  1XVW A;  3ZMK A;  2LJK A;  5DQY A;  3VI7 A;  4OCE A;  4K8M A;  4DSS A;  4O92 A;  5IMD A;  1EGR A;  4TR1 A;  2MZC A;  5G5E A;  2H0G A;  3H79 A;  4TN8 A;  1A2M A;  2WJU A;  1ZMA A;  2A2R A;  1C72 A;  5ELG A;  2H1B A;  2VLV A;  5G2Z A;  2O36 A;  3ERW A;  1GUM A;  1OE7 A;  1EP8 A;  1PX7 A;  3O3T A;  1XVQ A;  1GSF A;  2NTO A;  4WF4 A;  1TTZ A;  2AB6 A;  4GLT A;  2XBQ A;  4K2D A;  1BJX A;  1F37 A;  3UIW A;  4KAE A;  1U88 A;  1JZW A;  3VPQ A;  4ILF A;  1HNA A;  2OBK A;  1V9W A;  4HJ2 A;  1SKR B;  1IYH A;  4MZC A;  5IPH A;  3L9U A;  2Z9S A;  2UZ8 A;  2M46 A;  1ZL9 A;  2FGX A;  2RM5 A;  4HQZ A;  3GH6 A;  4QL7 A;  3ZIJ A;  1W4V A;  5AN1 A;  5ABR A;  2KP1 A;  4KW6 A;  2VD1 A;  3LWA A;  3RAZ A;  2B7J A;  1SD9 A;  3TKS A;  3ERG A;  5LD0 A;  4K6X A;  3UAP A;  1WE0 A;  4ECC A;  1EWX A;  2H0I A;  2I3Y A;  4KE3 A;  18GS A;  4ML1 A;  3SBC A;  5IOX A;  2EIR A;  3MYD A;  3KZQ A;  2HT9 A;  3FRC A;  3FR6 A;  5CP1 A;  1O73 A;  5DAK B;  4GF0 A;  3CRU A;  1TK0 B;  1HD2 A;  1T3B A;  2X8G A;  4F2I A;  2IPA A;  1GTI A;  3LG6 A;  1EP7 A;  2L57 A;  1MEK A;  1ABA A;  2L4Q A;  3KMN A;  1A0F A;  1ON4 A;  4MZW A;  1PGT A;  1BAY A;  4YH2 A;  4AKX B;  3E9J B;  3R3E A;  4F0C A;  1FO5 A;  1O6J A;  2WVY A;  2GSR A;  14GS A;  5KOW A;  4FYB A;  4K7O A;  3PIN A;  1TW9 A;  3F4S A;  3VWU A;  1XWA A;  1VF2 A;  3ZVJ A;  1S3R A;  3N5O A;  4IBP A;  2L5O A;  4PQ1 A;  2MMA A;  4ZL9 A;  5IIZ A;  1V58 A;  1SK1 A;  20GS A;  4ZIJ A;  3GX0 A;  2JAD A;  3ISO A;  3GV1 A;  5A4U A;  1AIU A;  2H1G A;  3MSZ A;  5HR0 A;  1SYR A;  3KH7 A;  1M2D A;  5DJL A;  2HSH A;  2I4A A;  4KND A;  1K3Y A;  5JWQ B;  1GSD A;  5COH A;  3IR4 A;  3GTU A;  2DSA A;  5CRD A;  5HR2 A;  1EGO A;  1F9M A;  2C4J A;  2WVX A;  2CT6 A;  4MCU A;  5GZZ B;  2H72 A;  2HZF A;  3US3 A;  1FVJ A;  1M3I A;  5IMZ A;  5DJM A;  1TDI A;  5J5N A;  4ECI A;  3GUS A;  4F9Z A;  1GUH A;  2PN8 A;  3QOU A;  2LRC A;  3ME7 A;  19GS A;  1YZX A;  1BX9 A;  3CBU A;  2PGT A;  2VCZ A;  3GIX A;  4WBR D;  4K7N A;  3HYP A;  3E0U A;  1JFU A;  4AGS A;  1K0M A;  3KCM A;  3FZ4 A;  5J47 A;  4MJC A;  1SVL A;  3IHQ A;  1K0D A;  3M9K A;  1JZD A;  4HDE A;  1M9B A;  3IRA A;  2HLS A;  1TRW A;  4ECB A;  3GKN A;  3RDW A;  3D4T A;  3LYP A;  3H1N A;  5A5K A;  4Z2U A;  4PI0 C;  4NPB A;  1USB A;  1OYJ A;  4XHM A;  3I9V 2;  2HRK A;  1M3J A;  3KEB A;  5EL8 A;  2REM A;  3RHC A;  5BMU A;  2PVQ A;  2HRA A;  2V1M A;  1XIY A;  4AKH A;  3UMA A;  3GL3 A;  2GZP A;  5CRG A;  3UVH A;  2C1Y A;  2I9H A;  1O8X A;  1OVN A;  4CY8 A;  4USS A;  2PMT A;  1U6T A;  5G30 A;  1PQN A;  2YWI A;  3G7J A;  5D9W A;  1BG1 A;  1A2J A;  1TXX A;  5ECN B;  3EIN A;  4V1A g;  22GS A;  2CVB A;  4K0N A;  4KDX A;  3CTF A;  1O7U A;  4YKF A;  4EDZ A;  2DKI A;  1FB0 A;  1GTU A;  2XC2 A;  3QDN A;  1M99 A;  1K0B A;  4TR1 B;  2YAN A;  4RI6 A;  3IA1 A;  2R37 A;  5C00 A;  2NVL A;  2TRC P;  3APS A;  1OE8 A;  4AF2 A;  2FUG 2;  4N3Z A;  3EC3 A;  4NV2 A;  5E59 A;  3QCP A;  3JCM L;  1RW1 A;  1SD8 A;  5F8B A;  2F9S A;  4PNF A;  5A5H A;  5JCW A;  4XS1 A;  1KEB A;  2CVD A;  2MBS A;  1Z7P A;  3C1R A;  1AQV A;  2YWM A;  1PL2 A;  3KM6 A;  3IDV A;  4HJM A;  3GSS A;  4G01 A;  2IL3 A;  4MF6 A;  2AHE A;  1PKZ A;  2XBI A;  2MMZ A;  1I1I P;  4KSM A;  1TRU A;  5ECR B;  1Q98 A;  1V40 A;  1WOU A;  4PUF C;  4EL1 A;  1V57 A;  3P8W A;  5IPG A;  1LU4 A;  2H74 A;  2X8C A;  2TRX A;  3UOM A;  3ZIT A;  3FMW A;  2IMI A;  3WGX A;  1GNW A;  3S9F A;  3FHK A;  2N5B A;  4MZB A;  2DJJ A;  3KTB A;  1XPV A;  2RM6 A;  2LQQ A;  3DVX A;  3GKK A;  2L59 A;  1J0F A;  2QA1 A;  1K3O A;  3F4T A;  1XFL A;  4K1F A;  1B48 A;  4RUV A;  1M2A A;  3QMX A;  2F3M A;  3CSJ A;  3TJK A;  1I9D A;  4IP6 A;  4HZ2 A;  4RQX A;  5DAL A;  1Y25 A;  1W89 A;  1TK5 B;  2ES7 A;  4KX4 A;  4HI7 A;  2YP6 A;  4E68 A;  2C8U A;  4OCF A;  3BOA A;  2KLX A;  1ZYQ B;  4WET A;  1FAA A;  4MH2 A;  2WW3 A;  1FVK A;  2P5Q A;  2HNL A;  3FR3 A;  4IS0 A;  2CZ3 A;  3W6G A;  2PWJ A;  2K18 A;  1FB6 A;  1SKW B;  2RUE A;  2IME A;  5ECP B;  4QL9 A;  1Z9H A;  3HZ8 A;  2IWT A;  4QMK A;  2HZE A;  2WVZ A;  4IN0 A;  2ON7 A; 
#chains in the Genus database with same CATH homology
 4ZBA A;  3SWL A;  2MMN A;  1NHO A;  3L4N A;  4X43 A;  5G1L A;  3Q74 A;  10GS A;  1OC3 A;  2HFD A;  4TW5 A;  4Q5F A;  2H6X A;  3GTU B;  3PGT A;  4KSO A;  3TOU A;  5B6N A;  5DQS A;  2HSM B;  1ACV A;  1N2A A;  1O8W A;  3G7Y A;  3KD0 A;  1OKT A;  1MDJ A;  4AI6 A;  4AKG A;  1ST9 A;  3UEM A;  1Y1U A;  3LXT A;  4K5S A;  3WYW A;  4MJB A;  4F82 A;  3FZA A;  3W8J A;  2BJX A;  4FO5 A;  4MF5 A;  1E2Y A;  4YQU A;  1ZGN A;  2HSY A;  2WFC A;  4BVY A;  4MAB A;  1LBK A;  1YF1 A;  1UA5 A;  4LMW A;  2YV9 A;  4ZL8 A;  1S3A A;  2YZH A;  1A24 A;  4G19 A;  4CHS A;  1NM3 A;  3MDK A;  2LUS A;  4ICY A;  2QA2 A;  3CYN A;  3UJ1 A;  4FIW A;  4CDO A;  1TI1 A;  4I8B A;  2R4V A;  3DGQ A;  1Z5Y E;  2GT5 A;  2O87 A;  4AJ6 A;  1WMJ A;  3WD6 A;  4XCS A;  2F8F A;  3TRQ A;  4ML6 A;  2M72 A;  5CNW A;  2R3X A;  4ECJ A;  1F3A A;  4GDF A;  4KA0 A;  3IBH A;  1GTB A;  4LMV A;  4MDC A;  4MLY A;  3L78 A;  3M0F A;  1F2E A;  2LV3 A;  5ID2 A;  4G0I A;  3QR6 A;  2YJH A;  4WXT A;  1M0U A;  2A4H A;  1T7P B;  4XIH A;  3IE3 A;  1SL1 B;  6GSU A;  2B1K A;  4GTU A;  3CTG A;  3Q19 A;  3O6T A;  4FH8 A;  3GA4 A;  3TOT A;  5A4W A;  1UN2 A;  1OC8 A;  5HFK A;  1DBY A;  5D73 A;  4EE0 A;  4MPG A;  3F63 A;  5FT3 A;  2HRF A;  2GTU A;  4F03 A;  3VWV A;  2H71 A;  2VCW A;  2K9F A;  1K0O A;  2VCT A;  4ID0 A;  3CSI A;  4PX1 A;  3QFA C;  4L5L A;  3GHA A;  3K8N A;  3EMP A;  1SL0 B;  5D8I A;  2R5G A;  5F07 A;  1SYX A;  3IC4 A;  2VL9 A;  4G9H A;  1NHY A;  5A5H B;  3DVW A;  1EV9 A;  2B7K A;  5EPF A;  3VPT A;  3MNG A;  1EEJ A;  3PR8 A;  3LOR A;  5KEJ A;  4TXO B;  2E7P A;  4RI7 A;  3E3E A;  3DD3 A;  5INY A;  3HZ4 A;  1TI3 A;  1PN9 A;  2C3Q A;  4JE1 A;  3U6V A;  17GS A;  1THO A;  1SKS B;  3UAR A;  3ZFL A;  4ZB6 A;  3BCK A;  4K7I A;  2R6K A;  3ZZX A;  1SEN A;  1TRS A;  1TKD B;  1GH2 A;  1A8Y A;  2I1U A;  3GUR A;  3D5J A;  3PH9 A;  3HY2 A;  3ZML A;  3C71 A;  1THX A;  4AJ8 A;  5ECM B;  2DJ2 A;  2QC7 A;  2X99 A;  4BL7 A;  4OFT A;  2NDO A;  1M9A A;  5GSS A;  2P5R A;  4WR4 A;  1PKW A;  5IO0 A;  5HR1 A;  3ZRD A;  6GST A;  2VM1 A;  4GSS A;  4XTS A;  3F8U A;  1EOG A;  2VM2 A;  4G10 A;  1AQX A;  2YWN A;  3EU3 A;  2CAQ A;  2H75 A;  2VKZ G;  4GWR A;  1H75 A;  2IFQ A;  2OAC A;  5ECI B;  4WF5 A;  4XRD A;  4TOP A;  1YEX A;  3J7Y k;  4PTS A;  3DRN A;  5AIS A;  2OE0 A;  3TKP A;  3IK9 A;  1OAZ A;  3C73 A;  2WS2 A;  13GS A;  1URM A;  4Z2T A;  5DAL B;  2KHP A;  2K6V A;  1Z7R A;  1XW5 A;  4BWS A;  3TU3 B;  2K8S A;  4HEA 2;  5CRH A;  3MIX A;  3VWW A;  5A34 B;  1M7T A;  4BPY A;  5F0G A;  5GAN D;  2DJ1 A;  3GNJ A;  3DEX A;  1MDK A;  2IIY A;  5HR3 A;  2VCV A;  4J2F A;  5GST A;  1FW1 A;  3F3R A;  2AJQ B;  2PPT A;  4IQA A;  4BWQ A;  4I97 A;  2WB9 A;  2KUC A;  5J41 A;  5A1N A;  2HXK A;  1ZCP A;  2HZE B;  5D96 A;  1CQH A;  2CQ9 A;  1DUG A;  1A23 A;  3UL3 A;  3ZLP A;  1YF0 A;  1XOA A;  3FEU A;  2NBS A;  1LJR A;  1QXH A;  2H6Y A;  1X5C A;  3ME8 A;  2GQM A;  4BVX A;  4GSN A;  4G0L A;  1GNE A;  3A2V A;  4V2M A;  4PUA A;  6GSY A;  5B6M A;  2H8L A;  4FQU A;  2LNS A;  2IMD A;  4KDU A;  3NIV A;  4P3Y B;  4JU5 A;  1XW9 A;  1ZOF A;  3R2Q A;  1X5D A;  3CXG A;  1FG4 A;  5D9T A;  4RQR A;  1HQO A;  2H76 A;  2FD3 A;  2L5L A;  1K3L A;  4ULX A;  2EIQ A;  1GSQ A;  1VF1 A;  2VLU A;  4N0V A;  2HE3 A;  3LW9 A;  3VI5 A;  2P31 A;  3W8S A;  4TR0 A;  4E8E A;  4TR4 A;  4LL4 B;  3EE2 A;  4OD7 A;  2HSN B;  3KJY A;  1XW6 A;  4POK A;  5KOX A;  1R26 A;  5KN1 A;  3DML A;  1EV4 A;  5H5Q A;  3LFL A;  3F6F A;  2EC4 A;  5D93 A;  2FWG A;  1PX6 A;  1OC9 A;  2O85 A;  3WT2 A;  3Q18 A;  3HDC A;  1NSW A;  4J56 E;  4DSQ A;  3HKR A;  3L9S A;  3RBT A;  2X64 A;  5B8A A;  1A8L A;  4TKY A;  2H6Z A;  1K0N A;  4PGT A;  2YCD A;  2O7K A;  2RII A;  2V32 A;  3U5R E;  3IC8 A;  3IXR A;  1YEP A;  1H4O A;  4ZL7 A;  6GSW A;  3CSH A;  3A2W A;  1GUK A;  4ZB7 A;  1XBS A;  3DXB A;  3GFK A;  3C8E A;  4EDY A;  4H86 A;  2CVK A;  4DSS B;  1HYU A;  4HQS A;  4L0U A;  2JZT A;  2LJR A;  4WR5 A;  2I81 A;  2H1L A;  1ZZY A;  5LCZ A;  3TRX A;  4IQ1 A;  2N5A A;  2DLX A;  5J3R A;  5ID2 B;  3TRP A;  2DBC A;  4L5O A;  2JU5 A;  2GGT A;  2DC5 A;  3P7X A;  4Z7X A;  1ERV A;  1AW9 A;  2VO4 A;  4EUY A;  3M3M A;  4MJE A;  5B8B A;  1J08 A;  1X9M B;  4N10 A;  4ZBD A;  1GLP A;  1WPI A;  2HI7 A;  2HYX A;  4ZIL A;  2R0P A;  3O76 A;  1YJ6 A;  5CRW A;  5JWO B;  3L0H A;  5HFG A;  3LEF A;  1GP1 A;  1K0C A;  2DJK A;  4LLR A;  5KN3 A;  2JZS A;  1BED A;  4JZQ A;  2A4V A;  3BJ5 A;  3A3T A;  2FWH A;  1I5G A;  2F51 A;  2WGR A;  2X8H A;  2OKA A;  3UBK A;  3HA9 A;  1O81 A;  2EFH A;  1E6B A;  4E8H A;  4ZBB A;  3IAM 2;  4MH3 A;  4Q5N A;  2RUF A;  4L8E A;  4OFM A;  2V6O A;  3IK7 A;  1FHE A;  4OWY A;  1RQM A;  1T1V A;  1R4W A;  1S3C A;  3BBY A;  5B7C A;  4HOJ A;  2PUK C;  1Z6M A;  3NZN A;  2OBI A;  3ZVJ D;  2X49 A;  2YWO A;  2LTK A;  4BL7 B;  4KB3 A;  3IHG A;  3BD2 A;  1GSU A;  1QQ2 A;  3DIE A;  2LS5 A;  2WUL A;  2MYG A;  1K0A A;  5ECK B;  2H66 A;  1SVO A;  4POB A;  3APQ A;  2FWE A;  4GXZ A;  1MD3 A;  3KP9 A;  3FZ9 A;  3QFB C;  1B4P A;  2UV8 G;  3FR9 A;  3FYG A;  2XPD A;  3IOS A;  2IFQ B;  2VCQ A;  2C0G A;  2FLS A;  2G2Q A;  3TJJ A;  1XWK A;  4YQM A;  2OE3 A;  2HQT A;  2WDU A;  1UVZ A;  3EUR A;  5JWR B;  4TRX A;  2BMX A;  1X9W B;  2JZR A;  2R0G A;  3HVS A;  1KNG A;  2B5Y A;  5DBQ A;  3PPU A;  1QFN A;  2VIM A;  3F6D A;  5LNK e;  1A0R P;  4TR3 A;  2VL2 A;  5ECS A;  5IMC A;  2CX4 A;  3P90 A;  4W66 A;  1HNC A;  4EIQ A;  3TJG A;  5C04 A;  2FHE A;  5IMF A;  3HCZ A;  2GQL A;  1BQ7 A;  2XHF A;  3QAG A;  4TXV A;  1SJ6 A;  1N25 A;  5G31 A;  3TB2 A;  1GWC A;  5A1N B;  1S3D A;  2GST A;  4G0K A;  3KIJ A;  3TKS C;  2VCX A;  4MA9 A;  1GSY A;  4HZ4 A;  3N9J A;  4A5P A;  1SJI A;  5H5R A;  3KP8 A;  4JRR A;  2FWF A;  1X9S B;  3LJR A;  4BVX B;  5DVB A;  1HNB A;  4NHW A;  4I6X A;  3TKQ A;  3KGK A;  1XOB A;  2C3T A;  2AAW A;  1YKA A;  1T4Y A;  3RPN A;  3VUR A;  2O89 A;  2CV4 A;  1V98 A;  5E4W A;  3GN3 A;  4MJA A;  2ZNM A;  1TK8 B;  3H8Q A;  1JLV A;  5ECH B;  2L6C A;  4KCA A;  4POL A;  3HVX A;  2CZ2 A;  2PVO C;  1YDK A;  3Q6O A;  3D0Z A;  3CWG A;  2HRK B;  3I69 A;  1YVL A;  2B3S A;  4KF9 A;  5BMU B;  4JR4 A;  4ACS A;  3HVV A;  2E2G A;  4KGI A;  4J57 E;  1R5A A;  5EY6 A;  1RK4 A;  2LRN A;  1OC9 B;  3A5I A;  3A5W A;  3IAS 2;  2J9H A;  3F3Q A;  2B1L A;  3BCI A;  5IO2 A;  1MDI A;  1ZYN A;  2WCI A;  1YQ1 A;  1ERW A;  2GZZ A;  3D21 A;  4MNN A;  2YJ7 A;  4PQI A;  3CMI A;  5ECQ B;  4IGJ A;  1PN0 A;  5G5F A;  4YAV A;  1ERT A;  2PBJ A;  2P0G A;  4MMM A;  1SL2 B;  1BYE A;  3MWH A;  4FYU A;  5ECO B;  3TJB A;  1DE1 A;  2GQK A;  1N8J A;  2H19 A;  2RLI A;  1ZYP A;  4HU9 A;  3GRX A;  4PNG A;  2XPE A;  5CRE A;  4DEJ A;  2YV7 A;  2CA8 A;  2GT6 A;  2H1D A;  4NXI A;  4MP4 A;  11GS A;  5IM9 A;  3F4R A;  1YKC A;  2DIY A;  5HFI A;  5F05 A;  1WRY A;  3HD5 A;  1Z3E A;  1WWJ A;  4EC0 A;  5JCG A;  4X1U A;  1PRX A;  3ZL5 A;  2GS3 A;  2FNO A;  5EVO A;  5BRT A;  4AJ7 A;  3J7Y b;  3GKM A;  3FY7 A;  3FW2 A;  4MK3 A;  2M80 A;  3IPZ A;  2C3N A;  4JBB A;  2QKE A;  1VF3 A;  3TJF A;  1CQG A;  3G9B A;  2PER A;  4YKG A;  4QQ7 A;  2BTO T;  2VUP A;  1SU9 A;  4EKZ A;  1O85 A;  2LQO A;  3LXZ A;  4K9Z A;  4PUR A;  4NV5 A;  2H73 A;  1EEM A;  3GKX A;  1BF5 A;  2A2P A;  1GSS A;  2KOK A;  3DWV A;  3KMO A;  1X0R A;  4IW9 A;  2H0H A;  2DML A;  4ZB9 A;  1GSE A;  3ERF A;  2OE1 A;  3LSZ A;  1OKD A;  4WBJ A;  1AC1 A;  3TCO A;  3ZRE A;  4ISD A;  1TP9 A;  1PSQ A;  1DSB A;  4Q5Q A;  1BG5 A;  3M1G A;  3GL5 A;  3WT1 A;  1AUC A;  1B9X C;  4WEY A;  2YPM A;  1JLW A;  2MMO A;  2DIZ A;  3TKR A;  1U3A A;  2ON5 A;  3ZFB A;  5ENU A;  2GVP A;  1XXU A;  4KH7 A;  5DCH A;  2D2Z A;  2J23 A;  1AQW A;  3EPT A;  2FA4 A;  1ML6 A;  4PXO A;  3L9V A;  2H30 A;  4ZXG A;  1XWC A;  4F0B A;  3TGZ A;  4XS4 A;  4IP1 A;  4IEL A;  3LQ7 A;  2AV4 A;  4BA7 A;  3M9J A;  3D6I A;  5J9C A;  2O8V B;  3FK8 A;  1TU7 A;  4X0X A;  4N0Z A;  1WP0 A;  5J9B A;  1YY7 A;  2L4C A;  2E2M A;  1G0T A;  2EFE A;  2HSM A;  2R0C A;  2JSZ A;  5G1K A;  4IJ3 A;  4I2T A;  5F06 A;  2V2G A;  5AIV A;  3AY8 A;  5GAP D;  3FKF A;  2K8V A;  4DVC A;  1U3I A;  3ZTL A;  4I2U A;  3WGE A;  2FY6 A;  12GS A;  1VF4 A;  1FOH A;  3V1W A;  2CAI A;  1T00 A;  4IVF A;  3TDG A;  4D73 A;  1QK8 A;  1UC7 A;  1Y6E A;  4G2E A;  4CY6 A;  3LYK A;  4GRF A;  2WZ9 A;  4GST A;  2A2S A;  1G6Y A;  3HJO A;  1Z6N A;  4N11 A;  2GZY A;  5CAX A;  3GST A;  4HUA A;  1WJK A;  3F0I A;  5J4Y A;  1XCC A;  1TRV A;  3UBL A;  6GSS A;  2JSY A;  4IJI A;  2VAF A;  2C80 A;  3IV4 A;  2AUV A;  2YN1 A;  3GX8 A;  4V2L A;  3VWX A;  4BVY B;  2VD0 A;  1JHB A;  1TXU A;  3OR5 A;  5KN0 A;  2KP2 A;  1IYI A;  2EIO A;  3H93 A;  2PU9 C;  3UVT A;  1GRX A;  1X5E A;  4YQV A;  5D9X A;  4O5U A;  4TVE A;  2L6D A;  2C0F A;  2DJ3 A;  3RPP A;  4OMV A;  1GUL A;  1JZR A;  2VOC A;  1XZO A;  4WKW A;  3VFI A;  1PL1 A;  5DCG A;  1WIK A;  2V41 A;  2N5F A;  2ZCT A;  3ZIV A;  1B9Y C;  4O32 A;  3APO A;  1F6M C;  2VL3 A;  3C1S A;  4HU7 A;  1TOF A;  2IN3 A;  1T8E B;  2JL4 A;  2AYT A;  1TU8 A;  3F9U A;  5H5S A;  4LA1 A;  1U87 A;  4LL1 B;  3I43 A;  1TJD A;  4EO3 A;  5ELA A;  8GSS A;  4KUN A;  2IMK A;  4OO4 A;  5A4V A;  2IMF A;  3EYT A;  5J4V A;  3HMJ G;  5FHI A;  3NOF A;  5KN2 A;  2DKH A;  4N30 A;  2VL2 C;  1MTC A;  4ZB8 A;  4EVM A;  2C0D A;  4TXO A;  1SK2 A;  3DKS A;  4O5Q A;  5IMA A;  3VK9 A;  2GSS A;  5L71 A;  2YOI A;  2OA7 A;  2EFC A;  2LKU A;  4GQC A;  2FA8 A;  2QSI A;  16GS A;  3EVI A;  1PA3 A;  1EZK A;  3C7M A;  1ERU A;  2YZU A;  5DAK A;  1QGV A;  3KH9 A;  2F8A A;  3GMF A;  2ALB A;  3GH9 A;  3ED3 A;  2GLR A;  2IJY A;  4IHU A;  2C0E A;  3KXO A;  4OO5 A;  5CO3 A;  3DYR A;  2G0F A;  2HRN A;  3EMX A;  4FYC A;  1GL8 A;  1PD2 1;  2WRT A;  5J4U A;  2QGV A;  4V2N A;  2X4A A;  2LST A;  2LEG A;  2DMM A;  2YNX A;  4OFN A;  4Q5R A;  5DDL A;  1MD4 A;  3KTL A;  1ZYE A;  2E0Q A;  2B6M A;  1PMT A;  1SK0 A;  1Q4J A;  4GQF A;  1QUW A;  2O5V A;  4DSR A;  4KCE A;  4KDY A;  1SJZ A;  4CW9 A;  1T4Z A;  2MBT A;  2FCH A;  2H01 A;  6GSX A;  4YAP A;  1AXD A;  5J40 A;  9GSS A;  5CYY A;  1EOH A;  2JAC A;  4AKI A;  3G7I A;  5A34 A;  4EXJ A;  1F3B A;  3A2X A;  4O7H A;  1R7H A;  4X4J A;  3LGC A;  2CX3 A;  3GYK A;  5IMV A;  3QD9 A;  2EFD A;  2LJA A;  4GCI A;  4MF7 A;  2VLT A;  5JCU A;  4K0G A;  3HXS A;  2NPB A;  4L0W A;  1QMV A;  1G7O A;  4K2X A;  1R5P A;  1KTE A;  3TUE A;  1G6W A;  1VGL A;  3M8N A;  3RHB A;  1GLQ A;  1SVM A;  4EF0 A;  5HQP A;  1XWB A;  2H1A A;  2ZUP A;  5AGY A;  4XS4 B;  4POM A;  3CRT A;  4XS6 A;  4I5Q A;  1B8X A;  3I6A A;  3P2A A;  4JED A;  4Z2R A;  7GSS A;  3WGD A;  4NHZ A;  2B5X A;  3FZ5 A;  4NWY A;  3MAK A;  1A2L A;  1ILO A;  1DE2 A;  2OJL A;  3QAV A;  3HHV A;  3ZYW A;  2R2J A;  2OT3 A;  4HS1 A;  1B4Q A;  2LNT A;  4V1A p;  3VLN A;  5IQY A;  1GTA A;  1G7E A;  5FWG A;  3QPM A;  6GSV A;  2HSN A;  3HJP A;  5ECL B;  3D4M A;  1V2A A;  1XWG A;  3H4K A;  4D73 B;  1FOV A;  3D22 A;  2GDR A;  5D9V A;  4NAX A;  1JZO A;  1AAZ A;  2DJ0 A;  5IOW A;  4K5R A;  4O5R A;  4IKH A;  5AIX A;  4MPF A;  4JR6 A;  2V6K A;  2LRT A;  1NW2 A;  4EIP A;  3EU4 A;  1KBN A;  2GSQ A;  4NMU A;  3HJM A;  2B5E A;  3QAW A;  1J9B A;  3EWL A;  2H70 A;  4XRA A;  2OAD A;  2TIR A;  1VRS D;  3TKS E;  4PQH A;  1M2B A;  1XVW A;  3ZMK A;  2LJK A;  5DQY A;  3VI7 A;  4OCE A;  4K8M A;  4DSS A;  4O92 A;  5IMD A;  1EGR A;  4TR1 A;  2MZC A;  5G5E A;  2H0G A;  3H79 A;  4TN8 A;  1A2M A;  2WJU A;  1ZMA A;  2A2R A;  1C72 A;  5ELG A;  2H1B A;  2VLV A;  5G2Z A;  3ERW A;  1GUM A;  1OE7 A;  1EP8 A;  1PX7 A;  3O3T A;  1XVQ A;  1GSF A;  2NTO A;  4WF4 A;  1TTZ A;  2AB6 A;  4GLT A;  2XBQ A;  4K2D A;  1BJX A;  1F37 A;  3UIW A;  4KAE A;  1U88 A;  1JZW A;  3VPQ A;  4ILF A;  1HNA A;  2OBK A;  1V9W A;  4HJ2 A;  1SKR B;  1IYH A;  4MZC A;  5IPH A;  3L9U A;  2Z9S A;  2UZ8 A;  2M46 A;  1ZL9 A;  2FGX A;  2RM5 A;  4HQZ A;  3GH6 A;  4QL7 A;  3ZIJ A;  1W4V A;  5AN1 A;  5ABR A;  2KP1 A;  4KW6 A;  2VD1 A;  3LWA A;  3RAZ A;  2B7J A;  1SD9 A;  3TKS A;  3ERG A;  5LD0 A;  4K6X A;  3UAP A;  1WE0 A;  4ECC A;  1EWX A;  2H0I A;  2I3Y A;  4KE3 A;  18GS A;  4ML1 A;  3SBC A;  5IOX A;  2EIR A;  3MYD A;  3KZQ A;  2HT9 A;  3FRC A;  3FR6 A;  5CP1 A;  1O73 A;  5DAK B;  4GF0 A;  3CRU A;  1TK0 B;  1HD2 A;  1T3B A;  2X8G A;  4F2I A;  2IPA A;  1GTI A;  3LG6 A;  1EP7 A;  2L57 A;  1MEK A;  1ABA A;  2L4Q A;  3KMN A;  1A0F A;  1ON4 A;  4MZW A;  1PGT A;  1BAY A;  4YH2 A;  4AKX B;  3E9J B;  3R3E A;  4F0C A;  1FO5 A;  1O6J A;  2GSR A;  14GS A;  5KOW A;  4FYB A;  4K7O A;  3PIN A;  1TW9 A;  3F4S A;  3VWU A;  1XWA A;  1VF2 A;  3ZVJ A;  3N5O A;  4IBP A;  2L5O A;  4PQ1 A;  2MMA A;  4ZL9 A;  5IIZ A;  1V58 A;  1SK1 A;  20GS A;  4ZIJ A;  3GX0 A;  2JAD A;  3ISO A;  3GV1 A;  5A4U A;  1AIU A;  2H1G A;  3MSZ A;  5HR0 A;  1SYR A;  3KH7 A;  1M2D A;  5DJL A;  2HSH A;  2I4A A;  4KND A;  1K3Y A;  5JWQ B;  1GSD A;  5COH A;  3IR4 A;  3GTU A;  2DSA A;  5CRD A;  5HR2 A;  1EGO A;  1F9M A;  2C4J A;  2CT6 A;  4MCU A;  5GZZ B;  2H72 A;  2HZF A;  3US3 A;  1FVJ A;  5IMZ A;  5DJM A;  1TDI A;  5J5N A;  4ECI A;  3GUS A;  4F9Z A;  1GUH A;  2PN8 A;  3QOU A;  2LRC A;  3ME7 A;  19GS A;  1YZX A;  1BX9 A;  3CBU A;  2PGT A;  2VCZ A;  3GIX A;  4WBR D;  4K7N A;  3HYP A;  3E0U A;  1JFU A;  4AGS A;  1K0M A;  3KCM A;  3FZ4 A;  5J47 A;  4MJC A;  1SVL A;  3IHQ A;  1K0D A;  3M9K A;  1JZD A;  4HDE A;  1M9B A;  3IRA A;  2HLS A;  1TRW A;  4ECB A;  3GKN A;  3RDW A;  3D4T A;  3LYP A;  3H1N A;  5A5K A;  4Z2U A;  4NPB A;  1USB A;  1OYJ A;  4XHM A;  3I9V 2;  2HRK A;  3KEB A;  5EL8 A;  2REM A;  3RHC A;  5BMU A;  2PVQ A;  2HRA A;  2V1M A;  1XIY A;  4AKH A;  3UMA A;  3GL3 A;  2GZP A;  5CRG A;  3UVH A;  2C1Y A;  2I9H A;  1O8X A;  1OVN A;  4CY8 A;  4USS A;  2PMT A;  1U6T A;  5G30 A;  1PQN A;  2YWI A;  3G7J A;  5D9W A;  1BG1 A;  1A2J A;  1TXX A;  5ECN B;  3EIN A;  4V1A g;  22GS A;  2CVB A;  4K0N A;  4KDX A;  3CTF A;  1O7U A;  4YKF A;  4EDZ A;  2DKI A;  1FB0 A;  1GTU A;  2XC2 A;  3QDN A;  1M99 A;  1K0B A;  4TR1 B;  2YAN A;  4RI6 A;  3IA1 A;  2R37 A;  5C00 A;  2NVL A;  2TRC P;  3APS A;  1OE8 A;  4AF2 A;  2FUG 2;  4N3Z A;  3EC3 A;  4NV2 A;  5E59 A;  3QCP A;  3JCM L;  1RW1 A;  1SD8 A;  5F8B A;  2F9S A;  4PNF A;  5A5H A;  5JCW A;  4XS1 A;  1KEB A;  2CVD A;  2MBS A;  1Z7P A;  3C1R A;  1AQV A;  2YWM A;  1PL2 A;  3KM6 A;  3IDV A;  4HJM A;  3GSS A;  4G01 A;  2IL3 A;  4MF6 A;  2AHE A;  1PKZ A;  2XBI A;  2MMZ A;  4KSM A;  1TRU A;  5ECR B;  1Q98 A;  1V40 A;  1WOU A;  4PUF C;  4EL1 A;  1V57 A;  3P8W A;  5IPG A;  1LU4 A;  2H74 A;  2X8C A;  2TRX A;  3UOM A;  3ZIT A;  3FMW A;  2IMI A;  3WGX A;  1GNW A;  3S9F A;  3FHK A;  2N5B A;  4MZB A;  2DJJ A;  3KTB A;  1XPV A;  2RM6 A;  2LQQ A;  3DVX A;  3GKK A;  2L59 A;  1J0F A;  2QA1 A;  1K3O A;  3F4T A;  1XFL A;  4K1F A;  1B48 A;  4RUV A;  1M2A A;  3QMX A;  2F3M A;  3CSJ A;  3TJK A;  1I9D A;  4IP6 A;  4HZ2 A;  4RQX A;  5DAL A;  1Y25 A;  1W89 A;  1TK5 B;  2ES7 A;  4KX4 A;  4HI7 A;  2YP6 A;  4E68 A;  2C8U A;  4OCF A;  3BOA A;  2KLX A;  1ZYQ B;  4WET A;  1FAA A;  4MH2 A;  1FVK A;  2P5Q A;  2HNL A;  3FR3 A;  4IS0 A;  2CZ3 A;  3W6G A;  2PWJ A;  2K18 A;  1FB6 A;  1SKW B;  2RUE A;  2IME A;  5ECP B;  4QL9 A;  1Z9H A;  3HZ8 A;  2IWT A;  4QMK A;  2HZE A;  4IN0 A;  2ON7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...