2WRTA

The 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
b'PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGSTPEERARISMIEGAAMDLRMGFVRVCYNPKFEEVKGDYLKELPTTLKMWSNFLGDRHYLTGSSVSHVDFMVYEALDCIRYLAPQCLEDFPKLKEFKSRIEDLPKIKAYMESEKFIKWPLNSWIASFGGGDAAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE CLASS-MU 26 KDA ISOZYME 51
publication title The 2.5 Angstrom Structure of a Mu Class Gst from Fasciola Hepatica
rcsb
source organism Fasciola hepatica
molecule tags Transferase
total genus 70
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wrtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wrtA01
1B48A 1K0NA 3IAS2 2LSTA 1U87A 1TK8B 2L5OA 4ACSA 4TR1B 4X1UA 2AV4A 4I2UA 3I6AA 3KTBA 3FR9A 5B6NA 1K3LA 4J56E 4HEA2 6GSXA 1PRXA 4HZ2A 4EKZA 4Q5NA 1TKDB 4K7IA 1AW9A 2JZRA 4F9ZA 4K2DA 2BJXA 5FT3A 4MF7A 4IS0A 3IXRA 3HZ8A 2X64A 2WFCA 4JBBA 1OE7A 2IPAA 3DEXA 4BWSA 2PUKC 2PMTA 1X5EA 4ZL7A 3M0FA 5CRDA 1K0BA 2XPDA 4BL7A 5ENUA 1Q4JA 4G0IA 1Y25A 2IFQA 4NWYA 1XOAA 4N10A 5KN1A 4LLRA 3EVIA 2CAIA 1YQ1A 2TRCP 5ID2A 5J9CA 3CTGA 1X5CA 1RW1A 4ML1A 3QFBC 7GSSA 1TRSA 3E9JB 4MPFA 2L59A 2IL3A 5EL8A 3KP8A 3VK9A 2FCHA 2KOKA 3VPTA 1EV4A 3ZZXA 4IQAA 5FHIA 2RLIA 3IBHA 3WT1A 2IMFA 2MMAA 4MZBA 4Z7XA 3HVSA 1KBNA 1K0OA 3FK8A 4OO5A 1SD9A 3IRAA 1GUKA 2DBCA 1OYJA 2YCDA 1SJ6A 3LYKA 3Q19A 5DALA 2C1YA 3FW2A 1HNBA 1TP9A 1IYIA 1YEPA 2IWTA 5ABRA 2H01A 4IP6A 3TGZA 2C0EA 4DSQA 4WBJA 3M3MA 1GNEA 3DMLA 2YWNA 4WXTA 4ZB6A 3VWVA 3L0HA 1XWAA 4JR4A 3QFAC 2WDUA 3LGCA 4ZBBA 1TI1A 2GSTA 1J08A 4KE3A 5D9VA 3W8SA 5JCWA 4HJ2A 1GTAA 1A0RP 3M9JA 3QCPA 2H74A 1EGRA 2ON7A 1MEKA 5AIXA 1C72A 2MBSA 3F6DA 3KD0A 4FH8A 3N5OA 3WT2A 4DVCA 4MABA 1H75A 3HXSA 3TKQA 1T4YA 1F9MA 1I9DA 2L4CA 2V2GA 3D5JA 6GSUA 1QFNA 2VUPA 3EMXA 2UZ8A 2M46A 2K6VA 5JCUA 1DE1A 4KH7A 3GFKA 2AHEA 1OKTA 1EV9A 4TRXA 2HFDA 4GRFA 3TKSC 4MH3A 4I6XA 3DKSA 3GA4A 1AQWA 4MZCA 4GSTA 5B6MA 1WOUA 2H1BA 4J2FA 1YF0A 2KP2A 1AQXA 5F07A 2IFQB 1GULA 1TU8A 5IO0A 2YJ7A 3TUEA 4KCEA 1ERTA 2YZHA 5IM9A 5BMUA 1XWGA 1SK0A 3APOA 1A2LA 3IC8A 4V2MA 2VLVA 3MAKA 1X0RA 3TRXA 1XVWA 2H0IA 3C1SA 2GSRA 2CX4A 3GN3A 5G5EA 1DSBA 1H4OA 2H6ZA 2HSHA 2MYGA 2MMZA 4ZIJA 4ID0A 1TDIA 3GHAA 3ERFA 4QQ7A 3TRPA 2WCIA 2K18A 3A2XA 5IMZA 2B1KA 1XVQA 3NIVA 5HFGA 1X9SB 1FOVA 2DJJA 4POBA 2R3XA 4KSMA 4L0UA 3ME7A 3O6TA 2R5GA 1GSQA 3H79A 4MMMA 1X9MB 2XC2A 2HI7A 3QR6A 1B9XC 3APSA 5GZZB 1MDKA 3R3EA 2RUEA 3DGQA 3FZ9A 3LEFA 3VI7A 4OFTA 4KCAA 4L8EA 2B5EA 2FWEA 2QKEA 3H8QA 4KF9A 2QGVA 2G0FA 1ERWA 2LQQA 4XRDA 2JZTA 4AJ8A 5IOWA 5IQYA 1OC8A 3RHBA 2EIRA 3RPPA 2VM2A 1XZOA 1LU4A 1A24A 2GZYA 3CMIA 3GH6A 1QK8A 3C71A 2H76A 5CYYA 1OC9B 2OE0A 2FUG2 2E2MA 2JSYA 1URMA 2D2ZA 2JSZA 5GAPD 1XIYA 4X43A 2HZFA 9GSSA 2KUCA 3TB2A 1Z5YE 1TXXA 5D73A 3DRNA 3KH7A 3F63A 1WP0A 2C3TA 2FHEA 2GDRA 2GGTA 2OADA 2YNXA 3HD5A 1SJIA 4OCFA 3LYPA 4NV2A 1GH2A 2AYTA 3M9KA 2Z9SA 4FQUA 4ZBDA 2GLRA 1Z7PA 4CHSA 3UOMA 3TRQA 4EE0A 3TOUA 4PUFC 1G6WA 3PPUA 3OR5A 2YJHA 3ZMLA 2H66A 4IJIA 4IQ1A 5IPHA 2GSQA 3C8EA 4DEJA 1BQ7A 5G1KA 4ULXA 3RAZA 4JZQA 1M2DA 4XS6A 2KLXA 2HRKA 4K0GA 5D93A 2PN8A 1W89A 3AY8A 2V6KA 2HQTA 3VLNA 4ML6A 3JCML 2REMA 1TRWA 1XWKA 3KMOA 5CRWA 2OA7A 3TKSA 2FY6A 1SYXA 2LTKA 3GSTA 4FO5A 4I97A 1UC7A 1GNWA 4JEDA 4WKWA 3F3RA 4IVFA 6GSWA 1XBSA 5F0GA 1PL1A 4MF5A 4NPBA 1OE8A 2HSMA 2DIYA 2K8SA 2IMKA 3GRXA 1SK2A 1CQGA 2DC5A 3GTUB 2JZSA 1FO5A 2NVLA 4GSNA 2YWMA 1F6MC 2HXKA 3TJFA 2WJUA 1GTUA 1SJZA 4KUNA 1ZYEA 2GTUA 4ILFA 4MPGA 1J0FA 4EDZA 1SL2B 3I9V2 2CX3A 1EP7A 2VCXA 1T4ZA 5EY6A 4F03A 1A8LA 2GSSA 5ECIB 1M2BA 1SL0B 3TDGA 1GUHA 1M9AA 3K8NA 2H75A 1VF3A 3FRCA 3UVTA 1GSFA 2H1DA 4YQVA 4LMVA 2IIYA 4RI6A 4AJ6A 4G10A 3WGXA 3ZVJA 2C4JA 4MJBA 2R4VA 3S9FA 3FYGA 3C7MA 1N8JA 1V57A 4HQZA 1MD3A 3FZ5A 4OCEA 2DJ0A 3ISOA 3GL3A 2PGTA 4K9ZA 5H5SA 3H4KA 3MWHA 1G7OA 1XPVA 2DLXA 5DCGA 3CSJA 4IGJA 4NV5A 3GKXA 1SL1B 4PQIA 3BCIA 3RHCA 4F82A 3EU4A 2HRKB 2MMOA 2CA8A 1CQHA 3BD2A 1BYEA 1SYRA 3FR6A 1UA5A 4RUVA 4WEYA 4BVXA 3IHQA 4TXVA 4E8EA 3IV4A 3GV1A 3IK9A 3QAWA 1XW5A 1SENA 5A4UA 3G7YA 4PNGA 3A3TA 2DJ2A 4PUAA 4N0VA 1M9BA 4JRRA 2OE1A 4POLA 1WPIA 1JZDA 2BMXA 2N5BA 1TK0B 2FLSA 1K3YA 2HLSA 2HSMB 1A2MA 3LFLA 3IC4A 3TOTA 3D21A 2R6KA 2VCTA 2LUSA 4EXJA 3A2VA 2DMLA 1QQ2A 1JLVA 2WS2A 5KN0A 3VWWA 1XFLA 4MK3A 2VLUA 1JZWA 3DXBA 3VURA 2C0GA 5IMFA 4H86A 5L71A 1TRUA 5LNKe 2F9SA 2TIRA 4IN0A 4TR3A 5JWRB 3HVVA 4PQ1A 2YOIA 4GXZA 2LJRA 2LNSA 2EIOA 3VI5A 3CXGA 2I1UA 5J41A 3LWAA 4TXOA 4FIWA 3HVXA 2M72A 5DJLA 1SKSB 1WMJA 4TOPA 3KZQA 1PD21 5AISA 3A2WA 5H5RA 5ECNB 1MDJA 2I81A 2NDOA 4GLTA 4ZB9A 3ERGA 2JACA 1OAZA 3C1RA 2G2QA 2EC4A 5H5QA 1S3CA 1K3OA 5A4WA 1R7HA 1PSQA 3WYWA 1ZMAA 4CW9A 4TVEA 2V6OA 2MMNA 3LORA 3QD9A 2TRXA 2A2RA 2O8VB 1OC9A 3HJMA 2LJKA 2CQ9A 2WZ9A 5DCHA 2ON5A 2LS5A 4LL1B 3M8NA 4AF2A 4EL1A 1FAAA 3WGDA 4K7OA 1M99A 4OFNA 4G0KA 2GS3A 2HRFA 2LNTA 3KJYA 3GL5A 2VD1A 3P7XA 5A4VA 5J9BA 1GSEA 4K7NA 3L78A 3EMPA 2VO4A 4BVXB 4KX4A 2O7KA 2P5QA 3DYRA 3BOAA 5ECLB 1A23A 1BAYA 1K0MA 2PBJA 1ZZYA 2K8VA 1YJ6A 2JL4A 2L5LA 4KA0A 1B4PA 1Z3EA 1V40A 4HZ4A 4L5OA 2HRNA 2I3YA 4KDXA 2I4AA 5JWQB 5EVOA 3ERWA 3F0IA 4JR6A 1SKWB 4XCSA 1G0TA 3EE2A 2B7KA 1A0FA 1Z6MA 4PXOA 2H30A 4MJAA 5CAXA 4ZBAA 1W4VA 3ZLPA 4GQCA 1BX9A 1F3BA 1HNCA 3GKMA 4V2LA 1KNGA 3US3A 3GH9A 3NZNA 1ML6A 11GSA 3ZVJD 4JE1A 3G9BA 4MH2A 5ELGA 5HFIA 4V1Ap 5B8AA 5F06A 4TXOB 3EWLA 1T1VA 2LJAA 2ZCTA 4F2IA 4XRAA 2E0QA 2L6DA 3GMFA 1AUCA 1TU7A 3DVWA 1WRYA 1FB6A 3EU3A 1LJRA 5DAKB 2VL2A 2B5XA 5IMVA 5ECHB 4IKHA 5D9TA 1A8YA 3IK7A 3KTLA 2GQLA 3TCOA 1V2AA 3PH9A 3LQ7A 2N5AA 4GCIA 4L0WA 2VCQA 1GSYA 2I9HA 5COHA 4FYCA 3GTUA 3BJ5A 2LRTA 2OBKA 1GTIA 4WF4A 4JU5A 5JCGA 1QGVA 5DVBA 1A2JA 2C3NA 2OE3A 3KM6A 2KP1A 3ED3A 4MCUA 3TJJA 5ECQB 3UIWA 4XS4A 5E59A 4O5RA 1K0AA 2HRAA 5KEJA 4IHUA 1FVJA 1M0UA 4ECJA 2H71A 1TRVA 3FEUA 2N5FA 3Q18A 5J4UA 4LMWA 4POMA 13GSA 4GF0A 5HR0A 5LD0A 5DQSA 1NW2A 4I2TA 2F3MA 1SKRB 3O3TA 1YF1A 4EC0A 3M1GA 1EZKA 2HNLA 4WBRD 5DBQA 3ZMKA 2YANA 5G1LA 3ZFBA 1PKZA 1FW1A 4EF0A 3IPZA 4NHWA 1FB0A 4OFMA 2PERA 4TR0A 5D96A 3A5WA 4QL9A 4F0CA 3CBUA 3FHKA 1EGOA 2IJYA 4G19A 3Q74A 2E2GA 2OKAA 6GSYA 3APQA 4HUAA 4O32A 3N9JA 3C73A 3ZL5A 2OACA 2LRNA 1YDKA 2FNOA 2RM5A 2X99A 1HNAA 1FHEA 5C04A 4LL4B 1F3AA 2H72A 5INYA 2CVKA 1GP1A 4KDYA 5GSSA 2H1AA 3TJGA 4K0NA 2VLTA 1U3IA 2C3QA 3HCZA 1VF4A 4GTUA 3IA1A 3TJKA 2PVQA 5IMAA 3UMAA 2PWJA 2H0HA 4ZILA 4MDCA 2DJ1A 3ZIJA 3VWXA 3W8JA 4G0LA 3F6FA 3P90A 1V58A 3FR3A 2GZPA 3QMXA 2B7JA 1E2YA 2VCWA 2X8CA 1MTCA 5ECSA 2XBQA 3BCKA 3QPMA 4HS1A 1DE2A 2QSIA 4HU9A 1K0DA 3E0UA 1U3AA 1THXA 1M7TA 3RDWA 2DSAA 3H93A 5HR1A 1ACVA 3DVXA 4IBPA 5KN3A 4LA1A 3LXTA 3DD3A 1EOHA 4Q5FA 3NOFA 1NM3A 3KMNA 5DJMA 4G9HA 2OJLA 1QMVA 4XS4B 1YEXA 3TJBA 3QOUA 1XWCA 2OBIA 1T8EB 3D4MA 4HOJA 3CSIA 3KIJA 3KP9A 4EVMA 3HDCA 5IO2A 1G7EA 3GKNA 3GURA 4KGIA 3EURA 3TKSE 1PN9A 1HQOA 3KGKA 1U88A 3U5RE 2WB9A 2V41A 4PQHA 3MNGA 4FYUA 4F0BA 1TTZA 3F3QA 4ZXGA 1T00A 2NBSA 1I5GA 5JWOB 3ZREA 4PNFA 4BPYA 1LBKA 3PGTA 2H73A 4BVYA 1JZOA 4RQRA 2JADA 4D73A 4GSSA 1NHYA 5D9WA 2F51A 3FZ4A 4TKYA 1TJDA 5AIVA 3KEBA 3LSZA 1BEDA 2VIMA 4CDOA 4L5LA 4Q5RA 1XWBA 2BTOT 1PKWA 1MD4A 3ZFLA 1DBYA 1GSSA 4BWQA 3HJOA 4I5QA 2WGRA 2VM1A 4OWYA 4MA9A 5ECKB 1TW9A 2GT5A 2YN1A 3DIEA 1O8WA 3RBTA 2VL2C 1GRXA 3HHVA 1O85A 1V9WA 2YP6A 1GWCA 2H1GA 4WR4A 5G2ZA 4ZB8A 2H6XA 5ECOB 4NXIA 3QAGA 4HU7A 2P5RA 1OVNA 5LCZA 3UEMA 2P31A 1O73A 4V1Ag 1Y6EA 2DJKA 1XW6A 2YPMA 1Z6NA 4TN8A 1O8XA 1XW9A 2RUFA 3F9UA 5HFKA 1GTBA 4XIHA 12GSA 2FA4A 5CO3A 1U6TA 1KEBA 1K0CA 2MBTA 1E6BA 3PR8A 18GSA 2JU5A 3HKRA 1V98A 2HSNB 4NHZA 2O85A 2GVPA 2AB6A 4YAPA 1OKDA 4K1FA 4IELA 3IAM2 4FYBA 3O76A 4OD7A 4YQMA 2EIQA 3CYNA 4MP4A 2F8FA 2GQMA 4P3YB 10GSA 2C80A 4DSSB 3U6VA 1YZXA 2ZUPA 1ZGNA 2X8HA 5DAKA 3HY2A 4TW5A 1N2AA 3ZRDA 2CT6A 2IMDA 4BVYB 3L4NA 4MJCA 4D73B 1PX7A 3SBCA 19GSA 3J7Yb 2XHFA 4XHMA 2HZEA 3ZITA 3KCMA 1WIKA 1PL2A 2LKUA 4HQSA 4EDYA 1PQNA 1WWJA 1T7PB 1X5DA 2IMEA 3UBKA 3EC3A 4ZL9A 1GLPA 4GWRA 3I69A 1HYUA 4AGSA 1ZL9A 1Q98A 2RIIA 5HQPA 1EOGA 5ELAA 4K8MA 1TI3A 4O92A 1Z9HA 5ECMB 1ZOFA 1RK4A 1AC1A 4WETA 4ECIA 2RM6A 2C8UA 1HD2A 1XXUA 3BBYA 4G2EA 4ECBA 2AJQB 3MDKA 3UAPA 4BL7B 4ISDA 5DDLA 3UVHA 1BJXA 5B7CA 2XBIA 4PTSA 4YH2A 3GKKA 5J5NA 3GSSA 2H6YA 5D9XA 5ECRB 1S3DA 3IR4A 4PGTA 1VF1A 1YKAA 2H70A 2CAQA 3D0ZA 1TK5B 5ID2B 3Q6OA 3UL3A 4NAXA 3I43A 4RQXA 4IP1A 1G6YA 6GSVA 3EYTA 5DQYA 2L4QA 4BA7A 4ECCA 2WULA 1AAZA 1QUWA 3FZAA 5CNWA 4E8HA 3DWVA 5B8BA 4HDEA 5IMCA 4N11A 17GSA 2CZ2A 2VCVA 5C00A 2B1LA 5CRHA 3ZTLA 3E3EA 1EEJA 1GUMA 5F05A 2FA8A 2LQOA 14GSA 3J7Yk 2CVDA 4AJ7A 1GSDA 16GSA 1EEMA 5DALB 3F8UA 4V2NA 4MJEA 2ZNMA 3F4RA 5EPFA 5G30A 2LEGA 2CVBA 3FKFA 3HA9A 1QXHA 4O7HA 3L9SA 1M2AA 1ZCPA 3D4TA 3L9UA 4MZWA 2K9FA 2GQKA 4GQFA 1R4WA 3ME8A 4KSOA 3CTFA 1GSUA 5F8BA 2IMIA 1B9YC 1X9WB 1MDIA 4NMUA 3RPNA 2FD3A 1R5AA 4USSA 1ERVA 5KN2A 1UVZA 1GL8A 2B5YA 1USBA 2CV4A 2V1MA 2E7PA 1EP8A 2HZEB 3F4SA 1KTEA 5IPGA 5CREA 4N0ZA 2H8LA 3P8WA 5IMDA 1PGTA 1THOA 3QAVA 1O6JA 2M80A 3ZIVA 1XCCA 1JHBA 4IW9A 3VWUA 1FG4A 1R5PA 8GSSA 4QL7A 5G31A 1T3BA 3F4TA 4PX1A 4WR5A 3IOSA 3LXZA 1XOBA 1JLWA 2HSYA 5D8IA 1UN2A 4HJMA 4POKA 2V32A 2NTOA 2GT6A 3W6GA 2A2SA 2YV7A 2PPTA 4XTSA 2FWFA 3ZYWA 2XPEA 3GYKA 2VCZA 1YY7A 4OO4A 1PX6A 3MSZA 1ZYQB 3FY7A 2DJ3A 1R26A 2PU9C 1WJKA 2IN3A 2B3SA 1AXDA 2J9HA 2YWOA 2GZZA 2ES7A 2LRCA 1ILOA 5A5KA 4ZL8A 4IJ3A 2O87A 3L9VA 1O81A 4PURA 2O89A 4TR1A 2HE3A 3SWLA 2PVOC 2HT9A 5CRGA 1DUGA 4KAEA 4EO3A 2X8GA 5ECPB 3HYPA 3CRUA 1F37A 2CZ3A 6GSSA 4MLYA 3H1NA 5J3RA 1NHOA 3LJRA 4N30A 1PMTA 1F2EA 3TKPA 1VRSD 1VGLA 2DIZA 1ST9A 3HZ4A 5G5FA 1JZRA 2VL9A 4X0XA 3WGEA 2FGXA 3UBLA 3GIXA 2LV3A 2B6MA 4KDUA 3CRTA 3KH9A 3QDNA 2FWGA 2VD0A 2MZCA 2AAWA 1VF2A 3GNJA 5IOXA 1IYHA 1B8XA 2VAFA 3D6IA 2YZUA 2A4VA 3D22A 3LG6A 2ALBA 3GX0A 1S3AA 1PA3A 5HR3A 5AGYA 4XS1A 4TR4A 3PINA 4I8BA 2F8AA 20GSA 1SU9A 2J23A 1AIUA 2H0GA 2P0GA 4DSRA 2KHPA 1ERUA 1ON4A 5IIZA 1ABAA 5FWGA 2HYXA 3HJPA 2NPBA 2R37A 3IDVA 1WE0A 2L57A 2WRTA 4YAVA 4KB3A 4KW6A 1NSWA 3P2AA 3EINA 2YV9A 2H19A 1FVKA 2DMMA 1RQMA 1Z7RA 4EUYA 5CP1A 5E4WA 4J57E 4WF5A 3GUSA 2QC7A 4KNDA 3UJ1A 3UARA 2VOCA 2AUVA 1GLQA 1YKCA 5HR2A 2C0FA 3G7JA 4MF6A 4HI7A 5GSTA 2C0DA 3R2QA 3VPQA 3KXOA 4RI7A 4DSSA 1SK1A 1OC3A 1BG5A 4OMVA 1SD8A 3GX8A 3V1WA 4Q5QA 3CSHA 1TOFA 3IE3A 2VL3A 2FWHA 1AQVA 1EWXA 1JFUA 4YQUA 1O7UA 3G7IA 5AN1A 3WD6A 2R2JA 2L6CA 1J9BA 2YWIA 1B4QA 6GSTA 22GSA 4K6XA 3VFIA 3TKRA 5GAND
chains in the Genus database with same CATH superfamily
1B48A 1K0NA 3IAS2 2LSTA 1U87A 1TK8B 2L5OA 4ACSA 4TR1B 4X1UA 2AV4A 4I2UA 3I6AA 3KTBA 3FR9A 5B6NA 1K3LA 4J56E 4HEA2 6GSXA 1PRXA 4HZ2A 4EKZA 4Q5NA 1TKDB 4K7IA 1AW9A 2JZRA 4F9ZA 2X4AA 4K2DA 2BJXA 5FT3A 4MF7A 4IS0A 3IXRA 5A34A 3HZ8A 2X64A 2WFCA 4JBBA 1OE7A 2IPAA 3DEXA 4BWSA 2PUKC 2PMTA 1X5EA 4ZL7A 3M0FA 5CRDA 1K0BA 2XPDA 4BL7A 5ENUA 1Q4JA 4G0IA 1Y25A 2IFQA 4NWYA 1XOAA 4N10A 5KN1A 4LLRA 3EVIA 2CAIA 5J40A 1YQ1A 2TRCP 5ID2A 5J9CA 3MYDA 3CTGA 1X5CA 1RW1A 4ML1A 3QFBC 7GSSA 1TRSA 3E9JB 4MPFA 2L59A 2IL3A 3CQFA 5EL8A 3KP8A 3VK9A 2FCHA 2KOKA 3VPTA 1EV4A 3RFRC 3ZZXA 4IQAA 5FHIA 2RLIA 3IBHA 3WT1A 2IMFA 2MMAA 4MZBA 4AKXB 4X4JA 2R0GA 4Z7XA 3HVSA 1KBNA 1K0OA 3FK8A 4OO5A 1SD9A 3IRAA 1GUKA 2DBCA 1OYJA 2YCDA 1SJ6A 3LYKA 3Q19A 5DALA 2C1YA 3FW2A 1HNBA 1TP9A 1IYIA 1YEPA 2IWTA 5ABRA 2H01A 4IP6A 3TGZA 2O3EA 2C0EA 4DSQA 4WBJA 1TXUA 3M3MA 1GNEA 3DMLA 2YWNA 4WXTA 4PI2C 4ZB6A 3VWVA 3L0HA 1XWAA 4JR4A 3QFAC 2WDUA 3LGCA 4ZBBA 1TI1A 2GSTA 1J08A 4KE3A 5D9VA 3W8SA 4AKIA 5JCWA 4HJ2A 1GTAA 1A0RP 3M9JA 3QCPA 2H74A 1EGRA 2ON7A 1MEKA 5AIXA 1C72A 2MBSA 3F6DA 3KD0A 4FH8A 3N5OA 3WT2A 4DVCA 4MABA 1H75A 3HXSA 3TKQA 1T4YA 1F9MA 1I9DA 2L4CA 2V2GA 3D5JA 6GSUA 1QFNA 2VUPA 3EMXA 2UZ8A 2M46A 2K6VA 5JCUA 1DE1A 4KH7A 3GFKA 2AHEA 1OKTA 1EV9A 4TRXA 2HFDA 4GRFA 5A34B 3TKSC 4MH3A 4I6XA 3DKSA 3GA4A 1AQWA 4MZCA 4GSTA 4AI6A 5B6MA 1WOUA 2H1BA 4J2FA 1YF0A 2KP2A 2WW3A 1AQXA 5F07A 2IFQB 1GULA 1TU8A 5IO0A 2YJ7A 3TUEA 4KCEA 1ERTA 2YZHA 5IM9A 5BMUA 4MNNA 1XWGA 1SK0A 3APOA 1A2LA 3IC8A 4V2MA 2VLVA 3MAKA 1X0RA 3TRXA 1XVWA 2H0IA 3C1SA 2GSRA 2CX4A 3GN3A 5G5EA 4PHZC 1DSBA 1H4OA 2H6ZA 2HSHA 2MYGA 2MMZA 4ZIJA 4ID0A 1TDIA 3GHAA 3ERFA 4QQ7A 3TRPA 2WCIA 2K18A 3A2XA 5IMZA 2B1KA 1XVQA 3NIVA 5HFGA 1X9SB 1FOVA 2DJJA 3RGBC 4POBA 4EIQA 2R3XA 4KSMA 4L0UA 2OT3A 3ME7A 3O6TA 2R5GA 1GSQA 3H79A 4MMMA 1X9MB 2XC2A 2HI7A 4K5SA 3QR6A 1B9XC 3APSA 5GZZB 1MDKA 3R3EA 2RUEA 3DGQA 3FZ9A 3LEFA 3VI7A 4OFTA 4KCAA 4L8EA 2B5EA 2FWEA 1YVLA 2QKEA 3H8QA 4KF9A 2QGVA 2G0FA 1ERWA 2LQQA 4XRDA 2JZTA 4AJ8A 5IOWA 5IQYA 1OC8A 3RHBA 2EIRA 3RPPA 2VM2A 1XZOA 1LU4A 1A24A 2GZYA 3CMIA 3GH6A 1QK8A 3C71A 2H76A 5CYYA 1OC9B 2OE0A 2FUG2 2WW0A 2E2MA 2JSYA 1URMA 2D2ZA 2JSZA 5GAPD 1XIYA 4X43A 2HZFA 9GSSA 2R0CA 2KUCA 3TB2A 1Z5YE 4ZB7A 1TXXA 5D73A 3DRNA 3KH7A 3F63A 1WP0A 2C3TA 2FHEA 2GDRA 2GGTA 2OADA 2YNXA 3HD5A 1SJIA 4OCFA 3LYPA 4NV2A 1GH2A 2AYTA 3M9KA 2Z9SA 4FQUA 4ZBDA 2GLRA 1Z7PA 4CHSA 3UOMA 3TRQA 4EE0A 3TOUA 4PUFC 1G6WA 3PPUA 3OR5A 2YJHA 3ZMLA 2H66A 4IJIA 4IQ1A 5IPHA 2GSQA 3C8EA 4DEJA 1BQ7A 5G1KA 4ULXA 2O5VA 5J4VA 3RAZA 3A5IA 4JZQA 1M2DA 4XS6A 2KLXA 2HRKA 4K0GA 5D93A 2PN8A 1W89A 1PN0A 3AY8A 2V6KA 2HQTA 3VLNA 4ML6A 3JCML 2REMA 1TRWA 1XWKA 3KMOA 5CRWA 2OA7A 3TKSA 2FY6A 1SYXA 2LTKA 3GSTA 4FO5A 4I97A 1UC7A 1GNWA 4JEDA 4WKWA 3F3RA 4IVFA 6GSWA 1XBSA 5F0GA 1PL1A 4MF5A 4NPBA 1OE8A 2HSMA 2DIYA 2K8SA 2IMKA 3GRXA 1SK2A 1CQGA 2DC5A 3GTUB 2JZSA 1FO5A 2NVLA 4GSNA 2YWMA 1F6MC 2HXKA 2WVXA 3TJFA 2WJUA 1GTUA 1SJZA 4KUNA 1ZYEA 2GTUA 4ILFA 4MPGA 1J0FA 4EDZA 1SL2B 3I9V2 2CX3A 1EP7A 2VCXA 1T4ZA 5EY6A 4F03A 2O36A 1A8LA 2GSSA 5ECIB 1M2BA 3CHXC 1SL0B 3TDGA 1GUHA 1M9AA 3K8NA 2H75A 1VF3A 3FRCA 3UVTA 1ZYPA 1GSFA 2EFDA 2H1DA 4YQVA 4LMVA 2IIYA 4RI6A 4AJ6A 4G10A 3WGXA 3ZVJA 2C4JA 4MJBA 2UV8G 2R4VA 3S9FA 3FYGA 4Z2UA 3C7MA 1N8JA 1V57A 4HQZA 1MD3A 3FZ5A 4OCEA 2DJ0A 3ISOA 3GL3A 2PGTA 4K9ZA 5H5SA 3H4KA 3MWHA 1FOHA 1G7OA 1XPVA 2DLXA 5DCGA 1YEWC 3CSJA 4IGJA 5J4YA 4NV5A 3GKXA 1SL1B 4PQIA 3BCIA 3RHCA 4F82A 3EU4A 2HRKB 2MMOA 2CA8A 1CQHA 3BD2A 1BYEA 1SYRA 3FR6A 1UA5A 4RUVA 4WEYA 4BVXA 3IHQA 4TXVA 4E8EA 4PI0C 3IV4A 3GV1A 3IK9A 3QAWA 1XW5A 1SENA 5A4UA 3G7YA 4N3ZA 4PNGA 3A3TA 2DJ2A 4PUAA 4N0VA 1M9BA 4JRRA 2OE1A 4POLA 1WPIA 1JZDA 2BMXA 2N5BA 1TK0B 2FLSA 1K3YA 2HLSA 2HSMB 1A2MA 3LFLA 3IC4A 3TOTA 2WVZA 3D21A 2R6KA 2VCTA 2LUSA 4EXJA 3A2VA 2DMLA 1QQ2A 1JLVA 2WS2A 5KN0A 3VWWA 1XFLA 4MK3A 2VLUA 1JZWA 3DXBA 3VURA 2WVXB 2C0GA 5IMFA 4H86A 5L71A 1TRUA 5LNKe 2F9SA 2TIRA 4IN0A 4TR3A 5JWRB 3HVVA 4PQ1A 2YOIA 4GXZA 2LJRA 2LNSA 2EIOA 3VI5A 3CXGA 2I1UA 5J41A 3LWAA 4TXOA 4FIWA 3HVXA 2M72A 5DJLA 1SKSB 1WMJA 4TOPA 3KZQA 1PD21 5AISA 3A2WA 5H5RA 5ECNB 1MDJA 2I81A 2NDOA 4GLTA 4ZB9A 3ERGA 2JACA 1OAZA 3C1RA 2G2QA 2EC4A 5H5QA 3EPTA 1S3CA 1K3OA 5A4WA 1R7HA 1PSQA 3WYWA 1ZMAA 4CW9A 4TVEA 2V6OA 2MMNA 3LORA 3QD9A 2TRXA 2A2RA 2O8VB 1OC9A 3HJMA 2LJKA 2CQ9A 2WZ9A 5DCHA 2ON5A 2LS5A 4LL1B 3M8NA 4AF2A 4EL1A 1FAAA 3WGDA 4K7OA 1M99A 4OFNA 2WVYA 4G0KA 2GS3A 2HRFA 2LNTA 3KJYA 3GL5A 2VD1A 3P7XA 5A4VA 5J9BA 1GSEA 1N25A 3L78A 4K7NA 3EMPA 2VO4A 4BVXB 4KX4A 2O7KA 2P5QA 3DYRA 3BOAA 5ECLB 1A23A 1BAYA 1K0MA 2PBJA 2WW1A 1ZZYA 2K8VA 1YJ6A 2JL4A 2L5LA 4KA0A 1B4PA 1Z3EA 1V40A 4HZ4A 4L5OA 2HRNA 2I3YA 4KDXA 2I4AA 5JWQB 5EVOA 3ERWA 3F0IA 4JR6A 1SKWB 4XCSA 1G0TA 3EE2A 2B7KA 1A0FA 1Z6MA 5KOWA 4PXOA 2H30A 4MJAA 5CAXA 4ZBAA 1W4VA 3ZLPA 4GQCA 1BX9A 1F3BA 1HNCA 3GKMA 4V2LA 1KNGA 3US3A 3GH9A 3NZNA 1ML6A 11GSA 3ZVJD 3IHGA 4JE1A 3G9BA 4MH2A 5ELGA 5HFIA 4V1Ap 2EFHA 5B8AA 5F06A 4TXOB 3EWLA 1T1VA 2LJAA 2A2PA 2ZCTA 4F2IA 4XRAA 2E0QA 2L6DA 3GMFA 1AUCA 1TU7A 3DVWA 1WRYA 1FB6A 3EU3A 1LJRA 5DAKB 2VL2A 2B5XA 5IMVA 5BRTA 5ECHB 4IKHA 5D9TA 1A8YA 3IK7A 3KTLA 2GQLA 3TCOA 1V2AA 3PH9A 3LQ7A 2N5AA 4GCIA 4L0WA 2VCQA 1GSYA 2I9HA 5COHA 4FYCA 3GTUA 3BJ5A 2LRTA 2OBKA 1GTIA 4WF4A 2H1LA 4JU5A 5JCGA 1QGVA 5DVBA 1A2JA 2C3NA 4W66A 2OE3A 3KM6A 2KP1A 3ED3A 4MCUA 3TJJA 5ECQB 3UIWA 4XS4A 5A1NB 5E59A 4O5RA 1K0AA 2HRAA 5KEJA 4IHUA 1FVJA 1M0UA 4ECJA 2H71A 1TRVA 3FEUA 2N5FA 3Q18A 5J4UA 4LMWA 4POMA 13GSA 4GF0A 5HR0A 5LD0A 5DQSA 1NW2A 4I2TA 2F3MA 1SKRB 3O3TA 1YF1A 4EC0A 3M1GA 1EZKA 2HNLA 4WBRD 4CY8A 5DBQA 3ZMKA 2YANA 5G1LA 3ZFBA 1PKZA 1FW1A 4EF0A 3IPZA 4NHWA 1FB0A 4OFMA 2PERA 4TR0A 5D96A 5J47A 2X49A 3A5WA 4QL9A 4F0CA 3CBUA 4GDFA 3FHKA 1EGOA 2IJYA 4G19A 3Q74A 2E2GA 2OKAA 6GSYA 3APQA 4HUAA 4O32A 3N9JA 3C73A 3ZL5A 2OACA 1ZYNA 2LRNA 1YDKA 2FNOA 2RM5A 2X99A 1HNAA 1FHEA 3LW9A 5C04A 4LL4B 4A5PA 1F3AA 2H72A 5INYA 2CVKA 1GP1A 4KDYA 5GSSA 1S4BP 2H1AA 3TJGA 4K0NA 2VLTA 1U3IA 2C3QA 3HCZA 1VF4A 4GTUA 3IA1A 3TJKA 2PVQA 5IMAA 3UMAA 2PWJA 2R0PA 2H0HA 2EFCA 4ZILA 4MDCA 2DJ1A 3ZIJA 3VWXA 3W8JA 4G0LA 3HMJG 1SVOA 3F6FA 3P90A 1V58A 3FR3A 2GZPA 3QMXA 2B7JA 1E2YA 2VCWA 2X8CA 1MTCA 5ECSA 2XBQA 3BCKA 3QPMA 4HS1A 1DE2A 2QSIA 4HU9A 1K0DA 3E0UA 1U3AA 1THXA 1M7TA 3RDWA 2DSAA 3H93A 5HR1A 1ACVA 3DVXA 4IBPA 5KN3A 4LA1A 3LXTA 3DD3A 1EOHA 4Q5FA 3NOFA 1NM3A 1BG1A 3KMNA 5DJMA 2HSNA 4G9HA 2OJLA 1QMVA 4XS4B 1YEXA 3TJBA 3QOUA 1XWCA 2OBIA 1T8EB 3D4MA 4HOJA 3CSIA 3KIJA 3KP9A 4EVMA 3HDCA 5IO2A 1G7EA 3GKNA 2DKIA 4O5QA 3GURA 4KGIA 3EURA 3TKSE 1PN9A 2A4HA 1HQOA 3KGKA 1U88A 3U5RE 2WB9A 2V41A 4PQHA 3MNGA 4FYUA 4F0BA 1TTZA 3F3QA 4ZXGA 1T00A 2NBSA 1I5GA 5JWOB 3ZREA 4PNFA 4BPYA 4YKGA 1LBKA 3PGTA 2H73A 4BVYA 1JZOA 4RQRA 2JADA 5A5HB 4D73A 4GSSA 1NHYA 5D9WA 2F51A 3FZ4A 4TKYA 4E68A 1TJDA 5AIVA 3KEBA 3LSZA 1BEDA 2VIMA 4CDOA 4L5LA 4Q5RA 1XWBA 2BTOT 1PKWA 1MD4A 2EFEA 3ZFLA 1DBYA 1GSSA 4BWQA 3HJOA 4I5QA 2WGRA 2VM1A 4OWYA 4MA9A 5ECKB 1TW9A 2GT5A 2YN1A 3DIEA 1BF5A 1O8WA 3RBTA 2VL2C 1GRXA 3HHVA 1O85A 1V9WA 2YP6A 1GWCA 2H1GA 2VKZG 4WR4A 5G2ZA 4ZB8A 2H6XA 5ECOB 4NXIA 5KOXA 3QAGA 4HU7A 2P5RA 4AKGA 1OVNA 5LCZA 3UEMA 2P31A 1O73A 4V1Ag 1Y6EA 2DJKA 1XW6A 2YPMA 1Z6NA 4TN8A 1O8XA 1XW9A 2RUFA 3F9UA 3CWGA 5HFKA 1XG8A 1GTBA 4XIHA 12GSA 4FXYP 2FA4A 5CO3A 1U6TA 1KEBA 1K0CA 2MBTA 1E6BA 3PR8A 18GSA 2JU5A 3HKRA 1I1IP 1V98A 2HSNB 4NHZA 2O85A 2GVPA 2AB6A 4YAPA 4AKHA 1OKDA 4K1FA 4IELA 3IAM2 4FYBA 3O76A 4OD7A 4YQMA 2EIQA 1M3IA 3CYNA 4MP4A 2F8FA 2GQMA 4P3YB 10GSA 2C80A 4DSSB 3U6VA 1YZXA 2ZUPA 1ZGNA 2X8HA 5DAKA 3HY2A 4TW5A 1N2AA 1S3RA 3ZRDA 2CT6A 2IMDA 4BVYB 3L4NA 4MJCA 2DKHA 4D73B 1PX7A 3TU3B 3SBCA 3MIXA 19GSA 3J7Yb 2XHFA 4XHMA 2HZEA 3ZITA 3KCMA 1WIKA 1PL2A 2LKUA 4HQSA 4EDYA 1PQNA 4K5RA 1WWJA 1T7PB 1X5DA 2IMEA 3UBKA 2QA2A 3EC3A 4ZL9A 1GLPA 4GWRA 3I69A 5A1NA 1HYUA 4AGSA 1ZL9A 4ICYA 1Q98A 2RIIA 5HQPA 1EOGA 5ELAA 4K8MA 4O5UA 1TI3A 4O92A 1Z9HA 5ECMB 1Y1UA 1ZOFA 1RK4A 1AC1A 4WETA 4ECIA 2RM6A 2C8UA 1HD2A 1XXUA 3BBYA 4G2EA 4Z2TA 4ECBA 2AJQB 3MDKA 3UAPA 4BL7B 4ISDA 5DDLA 3UVHA 1BJXA 5B7CA 2XBIA 4PTSA 4YH2A 3GKKA 5J5NA 3GSSA 2H6YA 5D9XA 4HSCX 5ECRB 1S3DA 3IR4A 4PGTA 1VF1A 1YKAA 2H70A 2CAQA 3D0ZA 1TK5B 5ID2B 3Q6OA 3UL3A 4NAXA 3I43A 4RQXA 4IP1A 1G6YA 6GSVA 3EYTA 5DQYA 2L4QA 4BA7A 4ECCA 2WULA 1AAZA 4YKFA 1QUWA 3FZAA 5CNWA 4E8HA 3DWVA 5B8BA 4HDEA 5IMCA 4N11A 17GSA 2CZ2A 2VCVA 5C00A 2B1LA 5CRHA 3ZTLA 3E3EA 1EEJA 1GUMA 5F05A 2FA8A 2LQOA 14GSA 3J7Yk 2CVDA 4AJ7A 1GSDA 16GSA 1EEMA 5DALB 3F8UA 4V2NA 4MJEA 2ZNMA 3F4RA 5EPFA 5G30A 2LEGA 2CVBA 3FKFA 3HA9A 1QXHA 4O7HA 3L9SA 1M2AA 1ZCPA 3D4TA 3L9UA 4MZWA 2K9FA 2GQKA 4GQFA 1R4WA 1PFOA 3ME8A 4KSOA 3CTFA 1GSUA 5F8BA 2IMIA 1B9YC 1X9WB 1MDIA 4NMUA 3RPNA 2FD3A 1R5AA 4USSA 1ERVA 5KN2A 1UVZA 1GL8A 2B5YA 1USBA 2CV4A 2V1MA 2E7PA 1EP8A 2HZEB 3F4SA 1KTEA 5IPGA 5CREA 4N0ZA 2H8LA 3P8WA 5IMDA 1PGTA 1THOA 3FMWA 3QAVA 1O6JA 2M80A 3ZIVA 1XCCA 1JHBA 4IW9A 3VWUA 1FG4A 1R5PA 8GSSA 4QL7A 2WW2A 5G31A 1T3BA 3HVNA 3F4TA 4PX1A 4WR5A 3IOSA 3LXZA 1XOBA 1JLWA 2HSYA 5D8IA 1UN2A 4HJMA 4POKA 2V32A 2NTOA 2GT6A 3W6GA 2A2SA 2YV7A 2PPTA 4XTSA 2QA1A 2FWFA 3ZYWA 2XPEA 3GYKA 2VCZA 1YY7A 4OO4A 1PX6A 3MSZA 1ZYQB 3FY7A 2DJ3A 2WZSA 5A5HA 1R26A 2PU9C 5BMUB 1WJKA 4CY6A 2IN3A 4EIPA 2B3SA 1AXDA 2J9HA 2YWOA 2GZZA 2ES7A 2LRCA 1ILOA 5A5KA 4ZL8A 4IJ3A 2O87A 3L9VA 1O81A 4PURA 2O89A 4TR1A 2HE3A 1SVMA 3SWLA 2PVOC 2HT9A 5CRGA 1DUGA 4KAEA 4EO3A 2X8GA 5ECPB 3HYPA 3CRUA 1F37A 2CZ3A 6GSSA 4MLYA 3H1NA 5J3RA 1NHOA 3LJRA 4N30A 1PMTA 1F2EA 3TKPA 1VRSD 1VGLA 2DIZA 1ST9A 3HZ4A 5G5FA 1JZRA 2VL9A 4QMKA 4X0XA 3WGEA 2FGXA 3UBLA 3GIXA 1SVLA 2LV3A 2B6MA 4KDUA 3CRTA 3KH9A 3QDNA 2FWGA 2VD0A 2MZCA 2AAWA 1VF2A 3GNJA 5IOXA 1IYHA 1B8XA 2VAFA 3D6IA 2YZUA 4BIKA 2A4VA 3D22A 3LG6A 2ALBA 3GX0A 1S3AA 4G01A 1PA3A 5HR3A 5AGYA 4XS1A 4TR4A 3PINA 4I8BA 2F8AA 20GSA 1SU9A 2J23A 1AIUA 2H0GA 2P0GA 4DSRA 2KHPA 1ERUA 1ON4A 5IIZA 1ABAA 5FWGA 2HYXA 3HJPA 2NPBA 2R37A 3IDVA 1WE0A 2L57A 2WRTA 4YAVA 4KB3A 4KW6A 1NSWA 3P2AA 3EINA 2YV9A 2H19A 1FVKA 2DMMA 1RQMA 1Z7RA 4EUYA 5CP1A 5E4WA 4J57E 4WF5A 3GUSA 2QC7A 4KNDA 3UJ1A 3UARA 2VOCA 2AUVA 1GLQA 1YKCA 5HR2A 2C0FA 3G7JA 4MF6A 4HI7A 5GSTA 2C0DA 3R2QA 4K2XA 3VPQA 3KXOA 4RI7A 4DSSA 1SK1A 1OC3A 1BG5A 4OMVA 1SD8A 3GX8A 3V1WA 4Q5QA 3CSHA 1TOFA 3IE3A 1M3JA 2VL3A 2FWHA 1AQVA 1EWXA 1JFUA 4YQUA 1O7UA 3G7IA 5AN1A 3WD6A 2R2JA 2L6CA 1J9BA 2YWIA 1B4QA 6GSTA 22GSA 4K6XA 3VFIA 3TKRA 4Z2RA 5GAND
chains in the Genus database with same CATH topology
1B48A 1K0NA 3IAS2 2LSTA 1U87A 1TK8B 2L5OA 4ACSA 4TR1B 4X1UA 2AV4A 4I2UA 3I6AA 3KTBA 3FR9A 5B6NA 1K3LA 4J56E 4HEA2 6GSXA 1PRXA 4HZ2A 4EKZA 4Q5NA 1TKDB 4K7IA 1AW9A 2JZRA 4F9ZA 2X4AA 4K2DA 2BJXA 5FT3A 4MF7A 4IS0A 3IXRA 5A34A 3HZ8A 2X64A 2WFCA 4JBBA 1OE7A 2IPAA 3DEXA 4BWSA 2PUKC 2PMTA 1X5EA 4ZL7A 3M0FA 5CRDA 1K0BA 2XPDA 4BL7A 5ENUA 1Q4JA 4G0IA 1Y25A 2IFQA 4NWYA 1XOAA 4N10A 5KN1A 4LLRA 3EVIA 2CAIA 5J40A 1YQ1A 2TRCP 5ID2A 5J9CA 3MYDA 3CTGA 1X5CA 1RW1A 4ML1A 3QFBC 7GSSA 1TRSA 3E9JB 4MPFA 2L59A 2IL3A 5EL8A 3KP8A 3VK9A 2FCHA 2KOKA 3VPTA 1EV4A 3ZZXA 4IQAA 5FHIA 2RLIA 3IBHA 3WT1A 2IMFA 2MMAA 4MZBA 4AKXB 4X4JA 2R0GA 4Z7XA 3HVSA 1KBNA 1K0OA 3FK8A 4OO5A 1SD9A 3IRAA 1GUKA 2DBCA 1OYJA 2YCDA 1SJ6A 3LYKA 3Q19A 5DALA 2C1YA 3FW2A 1HNBA 1TP9A 1IYIA 1YEPA 2IWTA 5ABRA 2H01A 4IP6A 3TGZA 2C0EA 4DSQA 4WBJA 1TXUA 3M3MA 1GNEA 3DMLA 2YWNA 4WXTA 4ZB6A 3VWVA 3L0HA 1XWAA 4JR4A 3QFAC 2WDUA 3LGCA 4ZBBA 1TI1A 2GSTA 1J08A 4KE3A 5D9VA 3W8SA 4AKIA 5JCWA 4HJ2A 1GTAA 1A0RP 3M9JA 3QCPA 2H74A 1EGRA 2ON7A 1MEKA 5AIXA 1C72A 2MBSA 3F6DA 3KD0A 4FH8A 3N5OA 3WT2A 4DVCA 4MABA 1H75A 3HXSA 3TKQA 1T4YA 1F9MA 1I9DA 2L4CA 2V2GA 3D5JA 6GSUA 1QFNA 2VUPA 3EMXA 2UZ8A 2M46A 2K6VA 5JCUA 1DE1A 4KH7A 3GFKA 2AHEA 1OKTA 1EV9A 4TRXA 2HFDA 4GRFA 5A34B 3TKSC 4MH3A 4I6XA 3DKSA 3GA4A 1AQWA 4MZCA 4GSTA 4AI6A 5B6MA 1WOUA 2H1BA 4J2FA 1YF0A 2KP2A 1AQXA 5F07A 2IFQB 1GULA 1TU8A 5IO0A 2YJ7A 3TUEA 4KCEA 1ERTA 2YZHA 5IM9A 5BMUA 4MNNA 1XWGA 1SK0A 3APOA 1A2LA 3IC8A 4V2MA 2VLVA 3MAKA 1X0RA 3TRXA 1XVWA 2H0IA 3C1SA 2GSRA 2CX4A 3GN3A 5G5EA 1DSBA 1H4OA 2H6ZA 2HSHA 2MYGA 2MMZA 4ZIJA 4ID0A 1TDIA 3GHAA 3ERFA 4QQ7A 3TRPA 2WCIA 2K18A 3A2XA 5IMZA 2B1KA 1XVQA 3NIVA 5HFGA 1X9SB 1FOVA 2DJJA 4POBA 4EIQA 2R3XA 4KSMA 4L0UA 2OT3A 3ME7A 3O6TA 2R5GA 1GSQA 3H79A 4MMMA 1X9MB 2XC2A 2HI7A 4K5SA 3QR6A 1B9XC 3APSA 5GZZB 1MDKA 3R3EA 2RUEA 3DGQA 3FZ9A 3LEFA 3VI7A 4OFTA 4KCAA 4L8EA 2B5EA 2FWEA 1YVLA 2QKEA 3H8QA 4KF9A 2QGVA 2G0FA 1ERWA 2LQQA 4XRDA 2JZTA 4AJ8A 5IOWA 5IQYA 1OC8A 3RHBA 2EIRA 3RPPA 2VM2A 1XZOA 1LU4A 1A24A 2GZYA 3CMIA 3GH6A 1QK8A 3C71A 2H76A 5CYYA 1OC9B 2OE0A 2FUG2 2E2MA 2JSYA 1URMA 2D2ZA 2JSZA 5GAPD 1XIYA 4X43A 2HZFA 9GSSA 2R0CA 2KUCA 3TB2A 1Z5YE 4ZB7A 1TXXA 5D73A 3DRNA 3KH7A 3F63A 1WP0A 2C3TA 2FHEA 2GDRA 2GGTA 2OADA 2YNXA 3HD5A 1SJIA 4OCFA 3LYPA 4NV2A 1GH2A 2AYTA 3M9KA 2Z9SA 4FQUA 4ZBDA 2GLRA 1Z7PA 4CHSA 3UOMA 3TRQA 4EE0A 3TOUA 4PUFC 1G6WA 3PPUA 3OR5A 2YJHA 3ZMLA 2H66A 4IJIA 4IQ1A 5IPHA 2GSQA 3C8EA 4DEJA 1BQ7A 5G1KA 4ULXA 2O5VA 5J4VA 3RAZA 3A5IA 4JZQA 1M2DA 4XS6A 2KLXA 2HRKA 4K0GA 5D93A 2PN8A 1W89A 1PN0A 3AY8A 2V6KA 2HQTA 3VLNA 4ML6A 3JCML 2REMA 1TRWA 1XWKA 3KMOA 5CRWA 2OA7A 3TKSA 2FY6A 1SYXA 2LTKA 3GSTA 4FO5A 4I97A 1UC7A 1GNWA 4JEDA 4WKWA 3F3RA 4IVFA 6GSWA 1XBSA 5F0GA 1PL1A 4MF5A 4NPBA 1OE8A 2HSMA 2DIYA 2K8SA 2IMKA 3GRXA 1SK2A 1CQGA 2DC5A 3GTUB 2JZSA 1FO5A 2NVLA 4GSNA 2YWMA 1F6MC 2HXKA 3TJFA 2WJUA 1GTUA 1SJZA 4KUNA 1ZYEA 2GTUA 4ILFA 4MPGA 1J0FA 4EDZA 1SL2B 3I9V2 2CX3A 1EP7A 2VCXA 1T4ZA 5EY6A 4F03A 1A8LA 2GSSA 5ECIB 1M2BA 1SL0B 3TDGA 1GUHA 1M9AA 3K8NA 2H75A 1VF3A 3FRCA 3UVTA 1ZYPA 1GSFA 2EFDA 2H1DA 4YQVA 4LMVA 2IIYA 4RI6A 4AJ6A 4G10A 3WGXA 3ZVJA 2C4JA 4MJBA 2UV8G 2R4VA 3S9FA 3FYGA 4Z2UA 3C7MA 1N8JA 1V57A 4HQZA 1MD3A 3FZ5A 4OCEA 2DJ0A 3ISOA 3GL3A 2PGTA 4K9ZA 5H5SA 3H4KA 3MWHA 1FOHA 1G7OA 1XPVA 2DLXA 5DCGA 3CSJA 4IGJA 5J4YA 4NV5A 3GKXA 1SL1B 4PQIA 3BCIA 3RHCA 4F82A 3EU4A 2HRKB 2MMOA 2CA8A 1CQHA 3BD2A 1BYEA 1SYRA 3FR6A 1UA5A 4RUVA 4WEYA 4BVXA 3IHQA 4TXVA 4E8EA 3IV4A 3GV1A 3IK9A 3QAWA 1XW5A 1SENA 5A4UA 3G7YA 4N3ZA 4PNGA 3A3TA 2DJ2A 4PUAA 4N0VA 1M9BA 4JRRA 2OE1A 4POLA 1WPIA 1JZDA 2BMXA 2N5BA 1TK0B 2FLSA 1K3YA 2HLSA 2HSMB 1A2MA 3LFLA 3IC4A 3TOTA 3D21A 2R6KA 2VCTA 2LUSA 4EXJA 3A2VA 2DMLA 1QQ2A 1JLVA 2WS2A 5KN0A 3VWWA 1XFLA 4MK3A 2VLUA 1JZWA 3DXBA 3VURA 2C0GA 5IMFA 4H86A 5L71A 1TRUA 5LNKe 2F9SA 2TIRA 4IN0A 4TR3A 5JWRB 3HVVA 4PQ1A 2YOIA 4GXZA 2LJRA 2LNSA 2EIOA 3VI5A 3CXGA 2I1UA 5J41A 3LWAA 4TXOA 4FIWA 3HVXA 2M72A 5DJLA 1SKSB 1WMJA 4TOPA 3KZQA 1PD21 5AISA 3A2WA 5H5RA 5ECNB 1MDJA 2I81A 2NDOA 4GLTA 4ZB9A 3ERGA 2JACA 1OAZA 3C1RA 2G2QA 2EC4A 5H5QA 3EPTA 1S3CA 1K3OA 5A4WA 1R7HA 1PSQA 3WYWA 1ZMAA 4CW9A 4TVEA 2V6OA 2MMNA 3LORA 3QD9A 2TRXA 2A2RA 2O8VB 1OC9A 3HJMA 2LJKA 2CQ9A 2WZ9A 5DCHA 2ON5A 2LS5A 4LL1B 3M8NA 4AF2A 4EL1A 1FAAA 3WGDA 4K7OA 1M99A 4OFNA 4G0KA 2GS3A 2HRFA 2LNTA 3KJYA 3GL5A 2VD1A 3P7XA 5A4VA 5J9BA 1GSEA 1N25A 3L78A 4K7NA 3EMPA 2VO4A 4BVXB 4KX4A 2O7KA 2P5QA 3DYRA 3BOAA 5ECLB 1A23A 1BAYA 1K0MA 2PBJA 1ZZYA 2K8VA 1YJ6A 2JL4A 2L5LA 4KA0A 1B4PA 1Z3EA 1V40A 4HZ4A 4L5OA 2HRNA 2I3YA 4KDXA 2I4AA 5JWQB 5EVOA 3ERWA 3F0IA 4JR6A 1SKWB 4XCSA 1G0TA 3EE2A 2B7KA 1A0FA 1Z6MA 5KOWA 4PXOA 2H30A 4MJAA 5CAXA 4ZBAA 1W4VA 3ZLPA 4GQCA 1BX9A 1F3BA 1HNCA 3GKMA 4V2LA 1KNGA 3US3A 3GH9A 3NZNA 1ML6A 11GSA 3ZVJD 3IHGA 4JE1A 3G9BA 4MH2A 5ELGA 5HFIA 4V1Ap 2EFHA 5B8AA 5F06A 4TXOB 3EWLA 1T1VA 2LJAA 2A2PA 2ZCTA 4F2IA 4XRAA 2E0QA 2L6DA 3GMFA 1AUCA 1TU7A 3DVWA 1WRYA 1FB6A 3EU3A 1LJRA 5DAKB 2VL2A 2B5XA 5IMVA 5BRTA 5ECHB 4IKHA 5D9TA 1A8YA 3IK7A 3KTLA 2GQLA 3TCOA 1V2AA 3PH9A 3LQ7A 2N5AA 4GCIA 4L0WA 2VCQA 1GSYA 2I9HA 5COHA 4FYCA 3GTUA 3BJ5A 2LRTA 2OBKA 1GTIA 4WF4A 2H1LA 4JU5A 5JCGA 1QGVA 5DVBA 1A2JA 2C3NA 4W66A 2OE3A 3KM6A 2KP1A 3ED3A 4MCUA 3TJJA 5ECQB 3UIWA 4XS4A 5A1NB 5E59A 4O5RA 1K0AA 2HRAA 5KEJA 4IHUA 1FVJA 1M0UA 4ECJA 2H71A 1TRVA 3FEUA 2N5FA 3Q18A 5J4UA 4LMWA 4POMA 13GSA 4GF0A 5HR0A 5LD0A 5DQSA 1NW2A 4I2TA 2F3MA 1SKRB 3O3TA 1YF1A 4EC0A 3M1GA 1EZKA 2HNLA 4WBRD 4CY8A 5DBQA 3ZMKA 2YANA 5G1LA 3ZFBA 1PKZA 1FW1A 4EF0A 3IPZA 4NHWA 1FB0A 4OFMA 2PERA 4TR0A 5D96A 5J47A 2X49A 3A5WA 4QL9A 4F0CA 3CBUA 4GDFA 3FHKA 1EGOA 2IJYA 4G19A 3Q74A 2E2GA 2OKAA 6GSYA 3APQA 4HUAA 4O32A 3N9JA 3C73A 3ZL5A 2OACA 1ZYNA 2LRNA 1YDKA 2FNOA 2RM5A 2X99A 1HNAA 1FHEA 3LW9A 5C04A 4LL4B 4A5PA 1F3AA 2H72A 5INYA 2CVKA 1GP1A 4KDYA 5GSSA 2H1AA 3TJGA 4K0NA 2VLTA 1U3IA 2C3QA 3HCZA 1VF4A 4GTUA 3IA1A 3TJKA 2PVQA 5IMAA 3UMAA 2PWJA 2R0PA 2H0HA 2EFCA 4ZILA 4MDCA 2DJ1A 3ZIJA 3VWXA 3W8JA 4G0LA 3HMJG 1SVOA 3F6FA 3P90A 1V58A 3FR3A 2GZPA 3QMXA 2B7JA 1E2YA 2VCWA 2X8CA 1MTCA 5ECSA 2XBQA 3BCKA 3QPMA 4HS1A 1DE2A 2QSIA 4HU9A 1K0DA 3E0UA 1U3AA 1THXA 1M7TA 3RDWA 2DSAA 3H93A 5HR1A 1ACVA 3DVXA 4IBPA 5KN3A 4LA1A 3LXTA 3DD3A 1EOHA 4Q5FA 3NOFA 1NM3A 1BG1A 3KMNA 5DJMA 2HSNA 4G9HA 2OJLA 1QMVA 4XS4B 1YEXA 3TJBA 3QOUA 1XWCA 2OBIA 1T8EB 3D4MA 4HOJA 3CSIA 3KIJA 3KP9A 4EVMA 3HDCA 5IO2A 1G7EA 3GKNA 2DKIA 4O5QA 3GURA 4KGIA 3EURA 3TKSE 1PN9A 2A4HA 1HQOA 3KGKA 1U88A 3U5RE 2WB9A 2V41A 4PQHA 3MNGA 4FYUA 4F0BA 1TTZA 3F3QA 4ZXGA 1T00A 2NBSA 1I5GA 5JWOB 3ZREA 4PNFA 4BPYA 4YKGA 1LBKA 3PGTA 2H73A 4BVYA 1JZOA 4RQRA 2JADA 5A5HB 4D73A 4GSSA 1NHYA 5D9WA 2F51A 3FZ4A 4TKYA 4E68A 1TJDA 5AIVA 3KEBA 3LSZA 1BEDA 2VIMA 4CDOA 4L5LA 4Q5RA 1XWBA 2BTOT 1PKWA 1MD4A 2EFEA 3ZFLA 1DBYA 1GSSA 4BWQA 3HJOA 4I5QA 2WGRA 2VM1A 4OWYA 4MA9A 5ECKB 1TW9A 2GT5A 2YN1A 3DIEA 1BF5A 1O8WA 3RBTA 2VL2C 1GRXA 3HHVA 1O85A 1V9WA 2YP6A 1GWCA 2H1GA 2VKZG 4WR4A 5G2ZA 4ZB8A 2H6XA 5ECOB 4NXIA 5KOXA 3QAGA 4HU7A 2P5RA 4AKGA 1OVNA 5LCZA 3UEMA 2P31A 1O73A 4V1Ag 1Y6EA 2DJKA 1XW6A 2YPMA 1Z6NA 4TN8A 1O8XA 1XW9A 2RUFA 3F9UA 3CWGA 5HFKA 1GTBA 4XIHA 12GSA 2FA4A 5CO3A 1U6TA 1KEBA 1K0CA 2MBTA 1E6BA 3PR8A 18GSA 2JU5A 3HKRA 1V98A 2HSNB 4NHZA 2O85A 2GVPA 2AB6A 4YAPA 4AKHA 1OKDA 4K1FA 4IELA 3IAM2 4FYBA 3O76A 4OD7A 4YQMA 2EIQA 3CYNA 4MP4A 2F8FA 2GQMA 4P3YB 10GSA 2C80A 4DSSB 3U6VA 1YZXA 2ZUPA 1ZGNA 2X8HA 5DAKA 3HY2A 4TW5A 1N2AA 3ZRDA 2CT6A 2IMDA 4BVYB 3L4NA 4MJCA 2DKHA 4D73B 1PX7A 3TU3B 3SBCA 3MIXA 19GSA 3J7Yb 2XHFA 4XHMA 2HZEA 3ZITA 3KCMA 1WIKA 1PL2A 2LKUA 4HQSA 4EDYA 1PQNA 4K5RA 1WWJA 1T7PB 1X5DA 2IMEA 3UBKA 2QA2A 3EC3A 4ZL9A 1GLPA 4GWRA 3I69A 5A1NA 1HYUA 4AGSA 1ZL9A 4ICYA 1Q98A 2RIIA 5HQPA 1EOGA 5ELAA 4K8MA 4O5UA 1TI3A 4O92A 1Z9HA 5ECMB 1Y1UA 1ZOFA 1RK4A 1AC1A 4WETA 4ECIA 2RM6A 2C8UA 1HD2A 1XXUA 3BBYA 4G2EA 4Z2TA 4ECBA 2AJQB 3MDKA 3UAPA 4BL7B 4ISDA 5DDLA 3UVHA 1BJXA 5B7CA 2XBIA 4PTSA 4YH2A 3GKKA 5J5NA 3GSSA 2H6YA 5D9XA 5ECRB 1S3DA 3IR4A 4PGTA 1VF1A 1YKAA 2H70A 2CAQA 3D0ZA 1TK5B 5ID2B 3Q6OA 3UL3A 4NAXA 3I43A 4RQXA 4IP1A 1G6YA 6GSVA 3EYTA 5DQYA 2L4QA 4BA7A 4ECCA 2WULA 1AAZA 4YKFA 1QUWA 3FZAA 5CNWA 4E8HA 3DWVA 5B8BA 4HDEA 5IMCA 4N11A 17GSA 2CZ2A 2VCVA 5C00A 2B1LA 5CRHA 3ZTLA 3E3EA 1EEJA 1GUMA 5F05A 2FA8A 2LQOA 14GSA 3J7Yk 2CVDA 4AJ7A 1GSDA 16GSA 1EEMA 5DALB 3F8UA 4V2NA 4MJEA 2ZNMA 3F4RA 5EPFA 5G30A 2LEGA 2CVBA 3FKFA 3HA9A 1QXHA 4O7HA 3L9SA 1M2AA 1ZCPA 3D4TA 3L9UA 4MZWA 2K9FA 2GQKA 4GQFA 1R4WA 3ME8A 4KSOA 3CTFA 1GSUA 5F8BA 2IMIA 1B9YC 1X9WB 1MDIA 4NMUA 3RPNA 2FD3A 1R5AA 4USSA 1ERVA 5KN2A 1UVZA 1GL8A 2B5YA 1USBA 2CV4A 2V1MA 2E7PA 1EP8A 2HZEB 3F4SA 1KTEA 5IPGA 5CREA 4N0ZA 2H8LA 3P8WA 5IMDA 1PGTA 1THOA 3FMWA 3QAVA 1O6JA 2M80A 3ZIVA 1XCCA 1JHBA 4IW9A 3VWUA 1FG4A 1R5PA 8GSSA 4QL7A 5G31A 1T3BA 3F4TA 4PX1A 4WR5A 3IOSA 3LXZA 1XOBA 1JLWA 2HSYA 5D8IA 1UN2A 4HJMA 4POKA 2V32A 2NTOA 2GT6A 3W6GA 2A2SA 2YV7A 2PPTA 4XTSA 2QA1A 2FWFA 3ZYWA 2XPEA 3GYKA 2VCZA 1YY7A 4OO4A 1PX6A 3MSZA 1ZYQB 3FY7A 2DJ3A 5A5HA 1R26A 2PU9C 5BMUB 1WJKA 4CY6A 2IN3A 4EIPA 2B3SA 1AXDA 2J9HA 2YWOA 2GZZA 2ES7A 2LRCA 1ILOA 5A5KA 4ZL8A 4IJ3A 2O87A 3L9VA 1O81A 4PURA 2O89A 4TR1A 2HE3A 1SVMA 3SWLA 2PVOC 2HT9A 5CRGA 1DUGA 4KAEA 4EO3A 2X8GA 5ECPB 3HYPA 3CRUA 1F37A 2CZ3A 6GSSA 4MLYA 3H1NA 5J3RA 1NHOA 3LJRA 4N30A 1PMTA 1F2EA 3TKPA 1VRSD 1VGLA 2DIZA 1ST9A 3HZ4A 5G5FA 1JZRA 2VL9A 4QMKA 4X0XA 3WGEA 2FGXA 3UBLA 3GIXA 1SVLA 2LV3A 2B6MA 4KDUA 3CRTA 3KH9A 3QDNA 2FWGA 2VD0A 2MZCA 2AAWA 1VF2A 3GNJA 5IOXA 1IYHA 1B8XA 2VAFA 3D6IA 2YZUA 2A4VA 3D22A 3LG6A 2ALBA 3GX0A 1S3AA 4G01A 1PA3A 5HR3A 5AGYA 4XS1A 4TR4A 3PINA 4I8BA 2F8AA 20GSA 1SU9A 2J23A 1AIUA 2H0GA 2P0GA 4DSRA 2KHPA 1ERUA 1ON4A 5IIZA 1ABAA 5FWGA 2HYXA 3HJPA 2NPBA 2R37A 3IDVA 1WE0A 2L57A 2WRTA 4YAVA 4KB3A 4KW6A 1NSWA 3P2AA 3EINA 2YV9A 2H19A 1FVKA 2DMMA 1RQMA 1Z7RA 4EUYA 5CP1A 5E4WA 4J57E 4WF5A 3GUSA 2QC7A 4KNDA 3UJ1A 3UARA 2VOCA 2AUVA 1GLQA 1YKCA 5HR2A 2C0FA 3G7JA 4MF6A 4HI7A 5GSTA 2C0DA 3R2QA 4K2XA 3VPQA 3KXOA 4RI7A 4DSSA 1SK1A 1OC3A 1BG5A 4OMVA 1SD8A 3GX8A 3V1WA 4Q5QA 3CSHA 1TOFA 3IE3A 2VL3A 2FWHA 1AQVA 1EWXA 1JFUA 4YQUA 1O7UA 3G7IA 5AN1A 3WD6A 2R2JA 2L6CA 1J9BA 2YWIA 1B4QA 6GSTA 22GSA 4K6XA 3VFIA 3TKRA 4Z2RA 5GAND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B48 A;  1K0N A;  3IAS 2;  2LST A;  1U87 A;  1TK8 B;  2L5O A;  4ACS A;  4TR1 B;  4X1U A;  2AV4 A;  4I2U A;  3I6A A;  3KTB A;  3FR9 A;  5B6N A;  1K3L A;  4J56 E;  4HEA 2;  6GSX A;  1PRX A;  4HZ2 A;  4EKZ A;  4Q5N A;  1TKD B;  4K7I A;  1AW9 A;  2JZR A;  4F9Z A;  4K2D A;  2BJX A;  5FT3 A;  4MF7 A;  4IS0 A;  3IXR A;  3HZ8 A;  2X64 A;  2WFC A;  4JBB A;  1OE7 A;  2IPA A;  3DEX A;  4BWS A;  2PUK C;  2PMT A;  1X5E A;  4ZL7 A;  3M0F A;  5CRD A;  1K0B A;  2XPD A;  4BL7 A;  5ENU A;  1Q4J A;  4G0I A;  1Y25 A;  2IFQ A;  4NWY A;  1XOA A;  4N10 A;  5KN1 A;  4LLR A;  3EVI A;  2CAI A;  1YQ1 A;  2TRC P;  5ID2 A;  5J9C A;  3CTG A;  1X5C A;  1RW1 A;  4ML1 A;  3QFB C;  7GSS A;  1TRS A;  3E9J B;  4MPF A;  2L59 A;  2IL3 A;  5EL8 A;  3KP8 A;  3VK9 A;  2FCH A;  2KOK A;  3VPT A;  1EV4 A;  3ZZX A;  4IQA A;  5FHI A;  2RLI A;  3IBH A;  3WT1 A;  2IMF A;  2MMA A;  4MZB A;  4Z7X A;  3HVS A;  1KBN A;  1K0O A;  3FK8 A;  4OO5 A;  1SD9 A;  3IRA A;  1GUK A;  2DBC A;  1OYJ A;  2YCD A;  1SJ6 A;  3LYK A;  3Q19 A;  5DAL A;  2C1Y A;  3FW2 A;  1HNB A;  1TP9 A;  1IYI A;  1YEP A;  2IWT A;  5ABR A;  2H01 A;  4IP6 A;  3TGZ A;  2C0E A;  4DSQ A;  4WBJ A;  3M3M A;  1GNE A;  3DML A;  2YWN A;  4WXT A;  4ZB6 A;  3VWV A;  3L0H A;  1XWA A;  4JR4 A;  3QFA C;  2WDU A;  3LGC A;  4ZBB A;  1TI1 A;  2GST A;  1J08 A;  4KE3 A;  5D9V A;  3W8S A;  5JCW A;  4HJ2 A;  1GTA A;  1A0R P;  3M9J A;  3QCP A;  2H74 A;  1EGR A;  2ON7 A;  1MEK A;  5AIX A;  1C72 A;  2MBS A;  3F6D A;  3KD0 A;  4FH8 A;  3N5O A;  3WT2 A;  4DVC A;  4MAB A;  1H75 A;  3HXS A;  3TKQ A;  1T4Y A;  1F9M A;  1I9D A;  2L4C A;  2V2G A;  3D5J A;  6GSU A;  1QFN A;  2VUP A;  3EMX A;  2UZ8 A;  2M46 A;  2K6V A;  5JCU A;  1DE1 A;  4KH7 A;  3GFK A;  2AHE A;  1OKT A;  1EV9 A;  4TRX A;  2HFD A;  4GRF A;  3TKS C;  4MH3 A;  4I6X A;  3DKS A;  3GA4 A;  1AQW A;  4MZC A;  4GST A;  5B6M A;  1WOU A;  2H1B A;  4J2F A;  1YF0 A;  2KP2 A;  1AQX A;  5F07 A;  2IFQ B;  1GUL A;  1TU8 A;  5IO0 A;  2YJ7 A;  3TUE A;  4KCE A;  1ERT A;  2YZH A;  5IM9 A;  5BMU A;  1XWG A;  1SK0 A;  3APO A;  1A2L A;  3IC8 A;  4V2M A;  2VLV A;  3MAK A;  1X0R A;  3TRX A;  1XVW A;  2H0I A;  3C1S A;  2GSR A;  2CX4 A;  3GN3 A;  5G5E A;  1DSB A;  1H4O A;  2H6Z A;  2HSH A;  2MYG A;  2MMZ A;  4ZIJ A;  4ID0 A;  1TDI A;  3GHA A;  3ERF A;  4QQ7 A;  3TRP A;  2WCI A;  2K18 A;  3A2X A;  5IMZ A;  2B1K A;  1XVQ A;  3NIV A;  5HFG A;  1X9S B;  1FOV A;  2DJJ A;  4POB A;  2R3X A;  4KSM A;  4L0U A;  3ME7 A;  3O6T A;  2R5G A;  1GSQ A;  3H79 A;  4MMM A;  1X9M B;  2XC2 A;  2HI7 A;  3QR6 A;  1B9X C;  3APS A;  5GZZ B;  1MDK A;  3R3E A;  2RUE A;  3DGQ A;  3FZ9 A;  3LEF A;  3VI7 A;  4OFT A;  4KCA A;  4L8E A;  2B5E A;  2FWE A;  2QKE A;  3H8Q A;  4KF9 A;  2QGV A;  2G0F A;  1ERW A;  2LQQ A;  4XRD A;  2JZT A;  4AJ8 A;  5IOW A;  5IQY A;  1OC8 A;  3RHB A;  2EIR A;  3RPP A;  2VM2 A;  1XZO A;  1LU4 A;  1A24 A;  2GZY A;  3CMI A;  3GH6 A;  1QK8 A;  3C71 A;  2H76 A;  5CYY A;  1OC9 B;  2OE0 A;  2FUG 2;  2E2M A;  2JSY A;  1URM A;  2D2Z A;  2JSZ A;  5GAP D;  1XIY A;  4X43 A;  2HZF A;  9GSS A;  2KUC A;  3TB2 A;  1Z5Y E;  1TXX A;  5D73 A;  3DRN A;  3KH7 A;  3F63 A;  1WP0 A;  2C3T A;  2FHE A;  2GDR A;  2GGT A;  2OAD A;  2YNX A;  3HD5 A;  1SJI A;  4OCF A;  3LYP A;  4NV2 A;  1GH2 A;  2AYT A;  3M9K A;  2Z9S A;  4FQU A;  4ZBD A;  2GLR A;  1Z7P A;  4CHS A;  3UOM A;  3TRQ A;  4EE0 A;  3TOU A;  4PUF C;  1G6W A;  3PPU A;  3OR5 A;  2YJH A;  3ZML A;  2H66 A;  4IJI A;  4IQ1 A;  5IPH A;  2GSQ A;  3C8E A;  4DEJ A;  1BQ7 A;  5G1K A;  4ULX A;  3RAZ A;  4JZQ A;  1M2D A;  4XS6 A;  2KLX A;  2HRK A;  4K0G A;  5D93 A;  2PN8 A;  1W89 A;  3AY8 A;  2V6K A;  2HQT A;  3VLN A;  4ML6 A;  3JCM L;  2REM A;  1TRW A;  1XWK A;  3KMO A;  5CRW A;  2OA7 A;  3TKS A;  2FY6 A;  1SYX A;  2LTK A;  3GST A;  4FO5 A;  4I97 A;  1UC7 A;  1GNW A;  4JED A;  4WKW A;  3F3R A;  4IVF A;  6GSW A;  1XBS A;  5F0G A;  1PL1 A;  4MF5 A;  4NPB A;  1OE8 A;  2HSM A;  2DIY A;  2K8S A;  2IMK A;  3GRX A;  1SK2 A;  1CQG A;  2DC5 A;  3GTU B;  2JZS A;  1FO5 A;  2NVL A;  4GSN A;  2YWM A;  1F6M C;  2HXK A;  3TJF A;  2WJU A;  1GTU A;  1SJZ A;  4KUN A;  1ZYE A;  2GTU A;  4ILF A;  4MPG A;  1J0F A;  4EDZ A;  1SL2 B;  3I9V 2;  2CX3 A;  1EP7 A;  2VCX A;  1T4Z A;  5EY6 A;  4F03 A;  1A8L A;  2GSS A;  5ECI B;  1M2B A;  1SL0 B;  3TDG A;  1GUH A;  1M9A A;  3K8N A;  2H75 A;  1VF3 A;  3FRC A;  3UVT A;  1GSF A;  2H1D A;  4YQV A;  4LMV A;  2IIY A;  4RI6 A;  4AJ6 A;  4G10 A;  3WGX A;  3ZVJ A;  2C4J A;  4MJB A;  2R4V A;  3S9F A;  3FYG A;  3C7M A;  1N8J A;  1V57 A;  4HQZ A;  1MD3 A;  3FZ5 A;  4OCE A;  2DJ0 A;  3ISO A;  3GL3 A;  2PGT A;  4K9Z A;  5H5S A;  3H4K A;  3MWH A;  1G7O A;  1XPV A;  2DLX A;  5DCG A;  3CSJ A;  4IGJ A;  4NV5 A;  3GKX A;  1SL1 B;  4PQI A;  3BCI A;  3RHC A;  4F82 A;  3EU4 A;  2HRK B;  2MMO A;  2CA8 A;  1CQH A;  3BD2 A;  1BYE A;  1SYR A;  3FR6 A;  1UA5 A;  4RUV A;  4WEY A;  4BVX A;  3IHQ A;  4TXV A;  4E8E A;  3IV4 A;  3GV1 A;  3IK9 A;  3QAW A;  1XW5 A;  1SEN A;  5A4U A;  3G7Y A;  4PNG A;  3A3T A;  2DJ2 A;  4PUA A;  4N0V A;  1M9B A;  4JRR A;  2OE1 A;  4POL A;  1WPI A;  1JZD A;  2BMX A;  2N5B A;  1TK0 B;  2FLS A;  1K3Y A;  2HLS A;  2HSM B;  1A2M A;  3LFL A;  3IC4 A;  3TOT A;  3D21 A;  2R6K A;  2VCT A;  2LUS A;  4EXJ A;  3A2V A;  2DML A;  1QQ2 A;  1JLV A;  2WS2 A;  5KN0 A;  3VWW A;  1XFL A;  4MK3 A;  2VLU A;  1JZW A;  3DXB A;  3VUR A;  2C0G A;  5IMF A;  4H86 A;  5L71 A;  1TRU A;  5LNK e;  2F9S A;  2TIR A;  4IN0 A;  4TR3 A;  5JWR B;  3HVV A;  4PQ1 A;  2YOI A;  4GXZ A;  2LJR A;  2LNS A;  2EIO A;  3VI5 A;  3CXG A;  2I1U A;  5J41 A;  3LWA A;  4TXO A;  4FIW A;  3HVX A;  2M72 A;  5DJL A;  1SKS B;  1WMJ A;  4TOP A;  3KZQ A;  1PD2 1;  5AIS A;  3A2W A;  5H5R A;  5ECN B;  1MDJ A;  2I81 A;  2NDO A;  4GLT A;  4ZB9 A;  3ERG A;  2JAC A;  1OAZ A;  3C1R A;  2G2Q A;  2EC4 A;  5H5Q A;  1S3C A;  1K3O A;  5A4W A;  1R7H A;  1PSQ A;  3WYW A;  1ZMA A;  4CW9 A;  4TVE A;  2V6O A;  2MMN A;  3LOR A;  3QD9 A;  2TRX A;  2A2R A;  2O8V B;  1OC9 A;  3HJM A;  2LJK A;  2CQ9 A;  2WZ9 A;  5DCH A;  2ON5 A;  2LS5 A;  4LL1 B;  3M8N A;  4AF2 A;  4EL1 A;  1FAA A;  3WGD A;  4K7O A;  1M99 A;  4OFN A;  4G0K A;  2GS3 A;  2HRF A;  2LNT A;  3KJY A;  3GL5 A;  2VD1 A;  3P7X A;  5A4V A;  5J9B A;  1GSE A;  4K7N A;  3L78 A;  3EMP A;  2VO4 A;  4BVX B;  4KX4 A;  2O7K A;  2P5Q A;  3DYR A;  3BOA A;  5ECL B;  1A23 A;  1BAY A;  1K0M A;  2PBJ A;  1ZZY A;  2K8V A;  1YJ6 A;  2JL4 A;  2L5L A;  4KA0 A;  1B4P A;  1Z3E A;  1V40 A;  4HZ4 A;  4L5O A;  2HRN A;  2I3Y A;  4KDX A;  2I4A A;  5JWQ B;  5EVO A;  3ERW A;  3F0I A;  4JR6 A;  1SKW B;  4XCS A;  1G0T A;  3EE2 A;  2B7K A;  1A0F A;  1Z6M A;  4PXO A;  2H30 A;  4MJA A;  5CAX A;  4ZBA A;  1W4V A;  3ZLP A;  4GQC A;  1BX9 A;  1F3B A;  1HNC A;  3GKM A;  4V2L A;  1KNG A;  3US3 A;  3GH9 A;  3NZN A;  1ML6 A;  11GS A;  3ZVJ D;  4JE1 A;  3G9B A;  4MH2 A;  5ELG A;  5HFI A;  4V1A p;  5B8A A;  5F06 A;  4TXO B;  3EWL A;  1T1V A;  2LJA A;  2ZCT A;  4F2I A;  4XRA A;  2E0Q A;  2L6D A;  3GMF A;  1AUC A;  1TU7 A;  3DVW A;  1WRY A;  1FB6 A;  3EU3 A;  1LJR A;  5DAK B;  2VL2 A;  2B5X A;  5IMV A;  5ECH B;  4IKH A;  5D9T A;  1A8Y A;  3IK7 A;  3KTL A;  2GQL A;  3TCO A;  1V2A A;  3PH9 A;  3LQ7 A;  2N5A A;  4GCI A;  4L0W A;  2VCQ A;  1GSY A;  2I9H A;  5COH A;  4FYC A;  3GTU A;  3BJ5 A;  2LRT A;  2OBK A;  1GTI A;  4WF4 A;  4JU5 A;  5JCG A;  1QGV A;  5DVB A;  1A2J A;  2C3N A;  2OE3 A;  3KM6 A;  2KP1 A;  3ED3 A;  4MCU A;  3TJJ A;  5ECQ B;  3UIW A;  4XS4 A;  5E59 A;  4O5R A;  1K0A A;  2HRA A;  5KEJ A;  4IHU A;  1FVJ A;  1M0U A;  4ECJ A;  2H71 A;  1TRV A;  3FEU A;  2N5F A;  3Q18 A;  5J4U A;  4LMW A;  4POM A;  13GS A;  4GF0 A;  5HR0 A;  5LD0 A;  5DQS A;  1NW2 A;  4I2T A;  2F3M A;  1SKR B;  3O3T A;  1YF1 A;  4EC0 A;  3M1G A;  1EZK A;  2HNL A;  4WBR D;  5DBQ A;  3ZMK A;  2YAN A;  5G1L A;  3ZFB A;  1PKZ A;  1FW1 A;  4EF0 A;  3IPZ A;  4NHW A;  1FB0 A;  4OFM A;  2PER A;  4TR0 A;  5D96 A;  3A5W A;  4QL9 A;  4F0C A;  3CBU A;  3FHK A;  1EGO A;  2IJY A;  4G19 A;  3Q74 A;  2E2G A;  2OKA A;  6GSY A;  3APQ A;  4HUA A;  4O32 A;  3N9J A;  3C73 A;  3ZL5 A;  2OAC A;  2LRN A;  1YDK A;  2FNO A;  2RM5 A;  2X99 A;  1HNA A;  1FHE A;  5C04 A;  4LL4 B;  1F3A A;  2H72 A;  5INY A;  2CVK A;  1GP1 A;  4KDY A;  5GSS A;  2H1A A;  3TJG A;  4K0N A;  2VLT A;  1U3I A;  2C3Q A;  3HCZ A;  1VF4 A;  4GTU A;  3IA1 A;  3TJK A;  2PVQ A;  5IMA A;  3UMA A;  2PWJ A;  2H0H A;  4ZIL A;  4MDC A;  2DJ1 A;  3ZIJ A;  3VWX A;  3W8J A;  4G0L A;  3F6F A;  3P90 A;  1V58 A;  3FR3 A;  2GZP A;  3QMX A;  2B7J A;  1E2Y A;  2VCW A;  2X8C A;  1MTC A;  5ECS A;  2XBQ A;  3BCK A;  3QPM A;  4HS1 A;  1DE2 A;  2QSI A;  4HU9 A;  1K0D A;  3E0U A;  1U3A A;  1THX A;  1M7T A;  3RDW A;  2DSA A;  3H93 A;  5HR1 A;  1ACV A;  3DVX A;  4IBP A;  5KN3 A;  4LA1 A;  3LXT A;  3DD3 A;  1EOH A;  4Q5F A;  3NOF A;  1NM3 A;  3KMN A;  5DJM A;  4G9H A;  2OJL A;  1QMV A;  4XS4 B;  1YEX A;  3TJB A;  3QOU A;  1XWC A;  2OBI A;  1T8E B;  3D4M A;  4HOJ A;  3CSI A;  3KIJ A;  3KP9 A;  4EVM A;  3HDC A;  5IO2 A;  1G7E A;  3GKN A;  3GUR A;  4KGI A;  3EUR A;  3TKS E;  1PN9 A;  1HQO A;  3KGK A;  1U88 A;  3U5R E;  2WB9 A;  2V41 A;  4PQH A;  3MNG A;  4FYU A;  4F0B A;  1TTZ A;  3F3Q A;  4ZXG A;  1T00 A;  2NBS A;  1I5G A;  5JWO B;  3ZRE A;  4PNF A;  4BPY A;  1LBK A;  3PGT A;  2H73 A;  4BVY A;  1JZO A;  4RQR A;  2JAD A;  4D73 A;  4GSS A;  1NHY A;  5D9W A;  2F51 A;  3FZ4 A;  4TKY A;  1TJD A;  5AIV A;  3KEB A;  3LSZ A;  1BED A;  2VIM A;  4CDO A;  4L5L A;  4Q5R A;  1XWB A;  2BTO T;  1PKW A;  1MD4 A;  3ZFL A;  1DBY A;  1GSS A;  4BWQ A;  3HJO A;  4I5Q A;  2WGR A;  2VM1 A;  4OWY A;  4MA9 A;  5ECK B;  1TW9 A;  2GT5 A;  2YN1 A;  3DIE A;  1O8W A;  3RBT A;  2VL2 C;  1GRX A;  3HHV A;  1O85 A;  1V9W A;  2YP6 A;  1GWC A;  2H1G A;  4WR4 A;  5G2Z A;  4ZB8 A;  2H6X A;  5ECO B;  4NXI A;  3QAG A;  4HU7 A;  2P5R A;  1OVN A;  5LCZ A;  3UEM A;  2P31 A;  1O73 A;  4V1A g;  1Y6E A;  2DJK A;  1XW6 A;  2YPM A;  1Z6N A;  4TN8 A;  1O8X A;  1XW9 A;  2RUF A;  3F9U A;  5HFK A;  1GTB A;  4XIH A;  12GS A;  2FA4 A;  5CO3 A;  1U6T A;  1KEB A;  1K0C A;  2MBT A;  1E6B A;  3PR8 A;  18GS A;  2JU5 A;  3HKR A;  1V98 A;  2HSN B;  4NHZ A;  2O85 A;  2GVP A;  2AB6 A;  4YAP A;  1OKD A;  4K1F A;  4IEL A;  3IAM 2;  4FYB A;  3O76 A;  4OD7 A;  4YQM A;  2EIQ A;  3CYN A;  4MP4 A;  2F8F A;  2GQM A;  4P3Y B;  10GS A;  2C80 A;  4DSS B;  3U6V A;  1YZX A;  2ZUP A;  1ZGN A;  2X8H A;  5DAK A;  3HY2 A;  4TW5 A;  1N2A A;  3ZRD A;  2CT6 A;  2IMD A;  4BVY B;  3L4N A;  4MJC A;  4D73 B;  1PX7 A;  3SBC A;  19GS A;  3J7Y b;  2XHF A;  4XHM A;  2HZE A;  3ZIT A;  3KCM A;  1WIK A;  1PL2 A;  2LKU A;  4HQS A;  4EDY A;  1PQN A;  1WWJ A;  1T7P B;  1X5D A;  2IME A;  3UBK A;  3EC3 A;  4ZL9 A;  1GLP A;  4GWR A;  3I69 A;  1HYU A;  4AGS A;  1ZL9 A;  1Q98 A;  2RII A;  5HQP A;  1EOG A;  5ELA A;  4K8M A;  1TI3 A;  4O92 A;  1Z9H A;  5ECM B;  1ZOF A;  1RK4 A;  1AC1 A;  4WET A;  4ECI A;  2RM6 A;  2C8U A;  1HD2 A;  1XXU A;  3BBY A;  4G2E A;  4ECB A;  2AJQ B;  3MDK A;  3UAP A;  4BL7 B;  4ISD A;  5DDL A;  3UVH A;  1BJX A;  5B7C A;  2XBI A;  4PTS A;  4YH2 A;  3GKK A;  5J5N A;  3GSS A;  2H6Y A;  5D9X A;  5ECR B;  1S3D A;  3IR4 A;  4PGT A;  1VF1 A;  1YKA A;  2H70 A;  2CAQ A;  3D0Z A;  1TK5 B;  5ID2 B;  3Q6O A;  3UL3 A;  4NAX A;  3I43 A;  4RQX A;  4IP1 A;  1G6Y A;  6GSV A;  3EYT A;  5DQY A;  2L4Q A;  4BA7 A;  4ECC A;  2WUL A;  1AAZ A;  1QUW A;  3FZA A;  5CNW A;  4E8H A;  3DWV A;  5B8B A;  4HDE A;  5IMC A;  4N11 A;  17GS A;  2CZ2 A;  2VCV A;  5C00 A;  2B1L A;  5CRH A;  3ZTL A;  3E3E A;  1EEJ A;  1GUM A;  5F05 A;  2FA8 A;  2LQO A;  14GS A;  3J7Y k;  2CVD A;  4AJ7 A;  1GSD A;  16GS A;  1EEM A;  5DAL B;  3F8U A;  4V2N A;  4MJE A;  2ZNM A;  3F4R A;  5EPF A;  5G30 A;  2LEG A;  2CVB A;  3FKF A;  3HA9 A;  1QXH A;  4O7H A;  3L9S A;  1M2A A;  1ZCP A;  3D4T A;  3L9U A;  4MZW A;  2K9F A;  2GQK A;  4GQF A;  1R4W A;  3ME8 A;  4KSO A;  3CTF A;  1GSU A;  5F8B A;  2IMI A;  1B9Y C;  1X9W B;  1MDI A;  4NMU A;  3RPN A;  2FD3 A;  1R5A A;  4USS A;  1ERV A;  5KN2 A;  1UVZ A;  1GL8 A;  2B5Y A;  1USB A;  2CV4 A;  2V1M A;  2E7P A;  1EP8 A;  2HZE B;  3F4S A;  1KTE A;  5IPG A;  5CRE A;  4N0Z A;  2H8L A;  3P8W A;  5IMD A;  1PGT A;  1THO A;  3QAV A;  1O6J A;  2M80 A;  3ZIV A;  1XCC A;  1JHB A;  4IW9 A;  3VWU A;  1FG4 A;  1R5P A;  8GSS A;  4QL7 A;  5G31 A;  1T3B A;  3F4T A;  4PX1 A;  4WR5 A;  3IOS A;  3LXZ A;  1XOB A;  1JLW A;  2HSY A;  5D8I A;  1UN2 A;  4HJM A;  4POK A;  2V32 A;  2NTO A;  2GT6 A;  3W6G A;  2A2S A;  2YV7 A;  2PPT A;  4XTS A;  2FWF A;  3ZYW A;  2XPE A;  3GYK A;  2VCZ A;  1YY7 A;  4OO4 A;  1PX6 A;  3MSZ A;  1ZYQ B;  3FY7 A;  2DJ3 A;  1R26 A;  2PU9 C;  1WJK A;  2IN3 A;  2B3S A;  1AXD A;  2J9H A;  2YWO A;  2GZZ A;  2ES7 A;  2LRC A;  1ILO A;  5A5K A;  4ZL8 A;  4IJ3 A;  2O87 A;  3L9V A;  1O81 A;  4PUR A;  2O89 A;  4TR1 A;  2HE3 A;  3SWL A;  2PVO C;  2HT9 A;  5CRG A;  1DUG A;  4KAE A;  4EO3 A;  2X8G A;  5ECP B;  3HYP A;  3CRU A;  1F37 A;  2CZ3 A;  6GSS A;  4MLY A;  3H1N A;  5J3R A;  1NHO A;  3LJR A;  4N30 A;  1PMT A;  1F2E A;  3TKP A;  1VRS D;  1VGL A;  2DIZ A;  1ST9 A;  3HZ4 A;  5G5F A;  1JZR A;  2VL9 A;  4X0X A;  3WGE A;  2FGX A;  3UBL A;  3GIX A;  2LV3 A;  2B6M A;  4KDU A;  3CRT A;  3KH9 A;  3QDN A;  2FWG A;  2VD0 A;  2MZC A;  2AAW A;  1VF2 A;  3GNJ A;  5IOX A;  1IYH A;  1B8X A;  2VAF A;  3D6I A;  2YZU A;  2A4V A;  3D22 A;  3LG6 A;  2ALB A;  3GX0 A;  1S3A A;  1PA3 A;  5HR3 A;  5AGY A;  4XS1 A;  4TR4 A;  3PIN A;  4I8B A;  2F8A A;  20GS A;  1SU9 A;  2J23 A;  1AIU A;  2H0G A;  2P0G A;  4DSR A;  2KHP A;  1ERU A;  1ON4 A;  5IIZ A;  1ABA A;  5FWG A;  2HYX A;  3HJP A;  2NPB A;  2R37 A;  3IDV A;  1WE0 A;  2L57 A;  2WRT A;  4YAV A;  4KB3 A;  4KW6 A;  1NSW A;  3P2A A;  3EIN A;  2YV9 A;  2H19 A;  1FVK A;  2DMM A;  1RQM A;  1Z7R A;  4EUY A;  5CP1 A;  5E4W A;  4J57 E;  4WF5 A;  3GUS A;  2QC7 A;  4KND A;  3UJ1 A;  3UAR A;  2VOC A;  2AUV A;  1GLQ A;  1YKC A;  5HR2 A;  2C0F A;  3G7J A;  4MF6 A;  4HI7 A;  5GST A;  2C0D A;  3R2Q A;  3VPQ A;  3KXO A;  4RI7 A;  4DSS A;  1SK1 A;  1OC3 A;  1BG5 A;  4OMV A;  1SD8 A;  3GX8 A;  3V1W A;  4Q5Q A;  3CSH A;  1TOF A;  3IE3 A;  2VL3 A;  2FWH A;  1AQV A;  1EWX A;  1JFU A;  4YQU A;  1O7U A;  3G7I A;  5AN1 A;  3WD6 A;  2R2J A;  2L6C A;  1J9B A;  2YWI A;  1B4Q A;  6GST A;  22GS A;  4K6X A;  3VFI A;  3TKR A;  5GAN D; 
#chains in the Genus database with same CATH topology
 1B48 A;  1K0N A;  3IAS 2;  2LST A;  1U87 A;  1TK8 B;  2L5O A;  4ACS A;  4TR1 B;  4X1U A;  2AV4 A;  4I2U A;  3I6A A;  3KTB A;  3FR9 A;  5B6N A;  1K3L A;  4J56 E;  4HEA 2;  6GSX A;  1PRX A;  4HZ2 A;  4EKZ A;  4Q5N A;  1TKD B;  4K7I A;  1AW9 A;  2JZR A;  4F9Z A;  2X4A A;  4K2D A;  2BJX A;  5FT3 A;  4MF7 A;  4IS0 A;  3IXR A;  5A34 A;  3HZ8 A;  2X64 A;  2WFC A;  4JBB A;  1OE7 A;  2IPA A;  3DEX A;  4BWS A;  2PUK C;  2PMT A;  1X5E A;  4ZL7 A;  3M0F A;  5CRD A;  1K0B A;  2XPD A;  4BL7 A;  5ENU A;  1Q4J A;  4G0I A;  1Y25 A;  2IFQ A;  4NWY A;  1XOA A;  4N10 A;  5KN1 A;  4LLR A;  3EVI A;  2CAI A;  5J40 A;  1YQ1 A;  2TRC P;  5ID2 A;  5J9C A;  3MYD A;  3CTG A;  1X5C A;  1RW1 A;  4ML1 A;  3QFB C;  7GSS A;  1TRS A;  3E9J B;  4MPF A;  2L59 A;  2IL3 A;  3CQF A;  5EL8 A;  3KP8 A;  3VK9 A;  2FCH A;  2KOK A;  3VPT A;  1EV4 A;  3RFR C;  3ZZX A;  4IQA A;  5FHI A;  2RLI A;  3IBH A;  3WT1 A;  2IMF A;  2MMA A;  4MZB A;  4AKX B;  4X4J A;  2R0G A;  4Z7X A;  3HVS A;  1KBN A;  1K0O A;  3FK8 A;  4OO5 A;  1SD9 A;  3IRA A;  1GUK A;  2DBC A;  1OYJ A;  2YCD A;  1SJ6 A;  3LYK A;  3Q19 A;  5DAL A;  2C1Y A;  3FW2 A;  1HNB A;  1TP9 A;  1IYI A;  1YEP A;  2IWT A;  5ABR A;  2H01 A;  4IP6 A;  3TGZ A;  2O3E A;  2C0E A;  4DSQ A;  4WBJ A;  1TXU A;  3M3M A;  1GNE A;  3DML A;  2YWN A;  4WXT A;  4PI2 C;  4ZB6 A;  3VWV A;  3L0H A;  1XWA A;  4JR4 A;  3QFA C;  2WDU A;  3LGC A;  4ZBB A;  1TI1 A;  2GST A;  1J08 A;  4KE3 A;  5D9V A;  3W8S A;  4AKI A;  5JCW A;  4HJ2 A;  1GTA A;  1A0R P;  3M9J A;  3QCP A;  2H74 A;  1EGR A;  2ON7 A;  1MEK A;  5AIX A;  1C72 A;  2MBS A;  3F6D A;  3KD0 A;  4FH8 A;  3N5O A;  3WT2 A;  4DVC A;  4MAB A;  1H75 A;  3HXS A;  3TKQ A;  1T4Y A;  1F9M A;  1I9D A;  2L4C A;  2V2G A;  3D5J A;  6GSU A;  1QFN A;  2VUP A;  3EMX A;  2UZ8 A;  2M46 A;  2K6V A;  5JCU A;  1DE1 A;  4KH7 A;  3GFK A;  2AHE A;  1OKT A;  1EV9 A;  4TRX A;  2HFD A;  4GRF A;  5A34 B;  3TKS C;  4MH3 A;  4I6X A;  3DKS A;  3GA4 A;  1AQW A;  4MZC A;  4GST A;  4AI6 A;  5B6M A;  1WOU A;  2H1B A;  4J2F A;  1YF0 A;  2KP2 A;  2WW3 A;  1AQX A;  5F07 A;  2IFQ B;  1GUL A;  1TU8 A;  5IO0 A;  2YJ7 A;  3TUE A;  4KCE A;  1ERT A;  2YZH A;  5IM9 A;  5BMU A;  4MNN A;  1XWG A;  1SK0 A;  3APO A;  1A2L A;  3IC8 A;  4V2M A;  2VLV A;  3MAK A;  1X0R A;  3TRX A;  1XVW A;  2H0I A;  3C1S A;  2GSR A;  2CX4 A;  3GN3 A;  5G5E A;  4PHZ C;  1DSB A;  1H4O A;  2H6Z A;  2HSH A;  2MYG A;  2MMZ A;  4ZIJ A;  4ID0 A;  1TDI A;  3GHA A;  3ERF A;  4QQ7 A;  3TRP A;  2WCI A;  2K18 A;  3A2X A;  5IMZ A;  2B1K A;  1XVQ A;  3NIV A;  5HFG A;  1X9S B;  1FOV A;  2DJJ A;  3RGB C;  4POB A;  4EIQ A;  2R3X A;  4KSM A;  4L0U A;  2OT3 A;  3ME7 A;  3O6T A;  2R5G A;  1GSQ A;  3H79 A;  4MMM A;  1X9M B;  2XC2 A;  2HI7 A;  4K5S A;  3QR6 A;  1B9X C;  3APS A;  5GZZ B;  1MDK A;  3R3E A;  2RUE A;  3DGQ A;  3FZ9 A;  3LEF A;  3VI7 A;  4OFT A;  4KCA A;  4L8E A;  2B5E A;  2FWE A;  1YVL A;  2QKE A;  3H8Q A;  4KF9 A;  2QGV A;  2G0F A;  1ERW A;  2LQQ A;  4XRD A;  2JZT A;  4AJ8 A;  5IOW A;  5IQY A;  1OC8 A;  3RHB A;  2EIR A;  3RPP A;  2VM2 A;  1XZO A;  1LU4 A;  1A24 A;  2GZY A;  3CMI A;  3GH6 A;  1QK8 A;  3C71 A;  2H76 A;  5CYY A;  1OC9 B;  2OE0 A;  2FUG 2;  2WW0 A;  2E2M A;  2JSY A;  1URM A;  2D2Z A;  2JSZ A;  5GAP D;  1XIY A;  4X43 A;  2HZF A;  9GSS A;  2R0C A;  2KUC A;  3TB2 A;  1Z5Y E;  4ZB7 A;  1TXX A;  5D73 A;  3DRN A;  3KH7 A;  3F63 A;  1WP0 A;  2C3T A;  2FHE A;  2GDR A;  2GGT A;  2OAD A;  2YNX A;  3HD5 A;  1SJI A;  4OCF A;  3LYP A;  4NV2 A;  1GH2 A;  2AYT A;  3M9K A;  2Z9S A;  4FQU A;  4ZBD A;  2GLR A;  1Z7P A;  4CHS A;  3UOM A;  3TRQ A;  4EE0 A;  3TOU A;  4PUF C;  1G6W A;  3PPU A;  3OR5 A;  2YJH A;  3ZML A;  2H66 A;  4IJI A;  4IQ1 A;  5IPH A;  2GSQ A;  3C8E A;  4DEJ A;  1BQ7 A;  5G1K A;  4ULX A;  2O5V A;  5J4V A;  3RAZ A;  3A5I A;  4JZQ A;  1M2D A;  4XS6 A;  2KLX A;  2HRK A;  4K0G A;  5D93 A;  2PN8 A;  1W89 A;  1PN0 A;  3AY8 A;  2V6K A;  2HQT A;  3VLN A;  4ML6 A;  3JCM L;  2REM A;  1TRW A;  1XWK A;  3KMO A;  5CRW A;  2OA7 A;  3TKS A;  2FY6 A;  1SYX A;  2LTK A;  3GST A;  4FO5 A;  4I97 A;  1UC7 A;  1GNW A;  4JED A;  4WKW A;  3F3R A;  4IVF A;  6GSW A;  1XBS A;  5F0G A;  1PL1 A;  4MF5 A;  4NPB A;  1OE8 A;  2HSM A;  2DIY A;  2K8S A;  2IMK A;  3GRX A;  1SK2 A;  1CQG A;  2DC5 A;  3GTU B;  2JZS A;  1FO5 A;  2NVL A;  4GSN A;  2YWM A;  1F6M C;  2HXK A;  2WVX A;  3TJF A;  2WJU A;  1GTU A;  1SJZ A;  4KUN A;  1ZYE A;  2GTU A;  4ILF A;  4MPG A;  1J0F A;  4EDZ A;  1SL2 B;  3I9V 2;  2CX3 A;  1EP7 A;  2VCX A;  1T4Z A;  5EY6 A;  4F03 A;  2O36 A;  1A8L A;  2GSS A;  5ECI B;  1M2B A;  3CHX C;  1SL0 B;  3TDG A;  1GUH A;  1M9A A;  3K8N A;  2H75 A;  1VF3 A;  3FRC A;  3UVT A;  1ZYP A;  1GSF A;  2EFD A;  2H1D A;  4YQV A;  4LMV A;  2IIY A;  4RI6 A;  4AJ6 A;  4G10 A;  3WGX A;  3ZVJ A;  2C4J A;  4MJB A;  2UV8 G;  2R4V A;  3S9F A;  3FYG A;  4Z2U A;  3C7M A;  1N8J A;  1V57 A;  4HQZ A;  1MD3 A;  3FZ5 A;  4OCE A;  2DJ0 A;  3ISO A;  3GL3 A;  2PGT A;  4K9Z A;  5H5S A;  3H4K A;  3MWH A;  1FOH A;  1G7O A;  1XPV A;  2DLX A;  5DCG A;  1YEW C;  3CSJ A;  4IGJ A;  5J4Y A;  4NV5 A;  3GKX A;  1SL1 B;  4PQI A;  3BCI A;  3RHC A;  4F82 A;  3EU4 A;  2HRK B;  2MMO A;  2CA8 A;  1CQH A;  3BD2 A;  1BYE A;  1SYR A;  3FR6 A;  1UA5 A;  4RUV A;  4WEY A;  4BVX A;  3IHQ A;  4TXV A;  4E8E A;  4PI0 C;  3IV4 A;  3GV1 A;  3IK9 A;  3QAW A;  1XW5 A;  1SEN A;  5A4U A;  3G7Y A;  4N3Z A;  4PNG A;  3A3T A;  2DJ2 A;  4PUA A;  4N0V A;  1M9B A;  4JRR A;  2OE1 A;  4POL A;  1WPI A;  1JZD A;  2BMX A;  2N5B A;  1TK0 B;  2FLS A;  1K3Y A;  2HLS A;  2HSM B;  1A2M A;  3LFL A;  3IC4 A;  3TOT A;  2WVZ A;  3D21 A;  2R6K A;  2VCT A;  2LUS A;  4EXJ A;  3A2V A;  2DML A;  1QQ2 A;  1JLV A;  2WS2 A;  5KN0 A;  3VWW A;  1XFL A;  4MK3 A;  2VLU A;  1JZW A;  3DXB A;  3VUR A;  2WVX B;  2C0G A;  5IMF A;  4H86 A;  5L71 A;  1TRU A;  5LNK e;  2F9S A;  2TIR A;  4IN0 A;  4TR3 A;  5JWR B;  3HVV A;  4PQ1 A;  2YOI A;  4GXZ A;  2LJR A;  2LNS A;  2EIO A;  3VI5 A;  3CXG A;  2I1U A;  5J41 A;  3LWA A;  4TXO A;  4FIW A;  3HVX A;  2M72 A;  5DJL A;  1SKS B;  1WMJ A;  4TOP A;  3KZQ A;  1PD2 1;  5AIS A;  3A2W A;  5H5R A;  5ECN B;  1MDJ A;  2I81 A;  2NDO A;  4GLT A;  4ZB9 A;  3ERG A;  2JAC A;  1OAZ A;  3C1R A;  2G2Q A;  2EC4 A;  5H5Q A;  3EPT A;  1S3C A;  1K3O A;  5A4W A;  1R7H A;  1PSQ A;  3WYW A;  1ZMA A;  4CW9 A;  4TVE A;  2V6O A;  2MMN A;  3LOR A;  3QD9 A;  2TRX A;  2A2R A;  2O8V B;  1OC9 A;  3HJM A;  2LJK A;  2CQ9 A;  2WZ9 A;  5DCH A;  2ON5 A;  2LS5 A;  4LL1 B;  3M8N A;  4AF2 A;  4EL1 A;  1FAA A;  3WGD A;  4K7O A;  1M99 A;  4OFN A;  2WVY A;  4G0K A;  2GS3 A;  2HRF A;  2LNT A;  3KJY A;  3GL5 A;  2VD1 A;  3P7X A;  5A4V A;  5J9B A;  1GSE A;  1N25 A;  3L78 A;  4K7N A;  3EMP A;  2VO4 A;  4BVX B;  4KX4 A;  2O7K A;  2P5Q A;  3DYR A;  3BOA A;  5ECL B;  1A23 A;  1BAY A;  1K0M A;  2PBJ A;  2WW1 A;  1ZZY A;  2K8V A;  1YJ6 A;  2JL4 A;  2L5L A;  4KA0 A;  1B4P A;  1Z3E A;  1V40 A;  4HZ4 A;  4L5O A;  2HRN A;  2I3Y A;  4KDX A;  2I4A A;  5JWQ B;  5EVO A;  3ERW A;  3F0I A;  4JR6 A;  1SKW B;  4XCS A;  1G0T A;  3EE2 A;  2B7K A;  1A0F A;  1Z6M A;  5KOW A;  4PXO A;  2H30 A;  4MJA A;  5CAX A;  4ZBA A;  1W4V A;  3ZLP A;  4GQC A;  1BX9 A;  1F3B A;  1HNC A;  3GKM A;  4V2L A;  1KNG A;  3US3 A;  3GH9 A;  3NZN A;  1ML6 A;  11GS A;  3ZVJ D;  3IHG A;  4JE1 A;  3G9B A;  4MH2 A;  5ELG A;  5HFI A;  4V1A p;  2EFH A;  5B8A A;  5F06 A;  4TXO B;  3EWL A;  1T1V A;  2LJA A;  2A2P A;  2ZCT A;  4F2I A;  4XRA A;  2E0Q A;  2L6D A;  3GMF A;  1AUC A;  1TU7 A;  3DVW A;  1WRY A;  1FB6 A;  3EU3 A;  1LJR A;  5DAK B;  2VL2 A;  2B5X A;  5IMV A;  5BRT A;  5ECH B;  4IKH A;  5D9T A;  1A8Y A;  3IK7 A;  3KTL A;  2GQL A;  3TCO A;  1V2A A;  3PH9 A;  3LQ7 A;  2N5A A;  4GCI A;  4L0W A;  2VCQ A;  1GSY A;  2I9H A;  5COH A;  4FYC A;  3GTU A;  3BJ5 A;  2LRT A;  2OBK A;  1GTI A;  4WF4 A;  2H1L A;  4JU5 A;  5JCG A;  1QGV A;  5DVB A;  1A2J A;  2C3N A;  4W66 A;  2OE3 A;  3KM6 A;  2KP1 A;  3ED3 A;  4MCU A;  3TJJ A;  5ECQ B;  3UIW A;  4XS4 A;  5A1N B;  5E59 A;  4O5R A;  1K0A A;  2HRA A;  5KEJ A;  4IHU A;  1FVJ A;  1M0U A;  4ECJ A;  2H71 A;  1TRV A;  3FEU A;  2N5F A;  3Q18 A;  5J4U A;  4LMW A;  4POM A;  13GS A;  4GF0 A;  5HR0 A;  5LD0 A;  5DQS A;  1NW2 A;  4I2T A;  2F3M A;  1SKR B;  3O3T A;  1YF1 A;  4EC0 A;  3M1G A;  1EZK A;  2HNL A;  4WBR D;  4CY8 A;  5DBQ A;  3ZMK A;  2YAN A;  5G1L A;  3ZFB A;  1PKZ A;  1FW1 A;  4EF0 A;  3IPZ A;  4NHW A;  1FB0 A;  4OFM A;  2PER A;  4TR0 A;  5D96 A;  5J47 A;  2X49 A;  3A5W A;  4QL9 A;  4F0C A;  3CBU A;  4GDF A;  3FHK A;  1EGO A;  2IJY A;  4G19 A;  3Q74 A;  2E2G A;  2OKA A;  6GSY A;  3APQ A;  4HUA A;  4O32 A;  3N9J A;  3C73 A;  3ZL5 A;  2OAC A;  1ZYN A;  2LRN A;  1YDK A;  2FNO A;  2RM5 A;  2X99 A;  1HNA A;  1FHE A;  3LW9 A;  5C04 A;  4LL4 B;  4A5P A;  1F3A A;  2H72 A;  5INY A;  2CVK A;  1GP1 A;  4KDY A;  5GSS A;  1S4B P;  2H1A A;  3TJG A;  4K0N A;  2VLT A;  1U3I A;  2C3Q A;  3HCZ A;  1VF4 A;  4GTU A;  3IA1 A;  3TJK A;  2PVQ A;  5IMA A;  3UMA A;  2PWJ A;  2R0P A;  2H0H A;  2EFC A;  4ZIL A;  4MDC A;  2DJ1 A;  3ZIJ A;  3VWX A;  3W8J A;  4G0L A;  3HMJ G;  1SVO A;  3F6F A;  3P90 A;  1V58 A;  3FR3 A;  2GZP A;  3QMX A;  2B7J A;  1E2Y A;  2VCW A;  2X8C A;  1MTC A;  5ECS A;  2XBQ A;  3BCK A;  3QPM A;  4HS1 A;  1DE2 A;  2QSI A;  4HU9 A;  1K0D A;  3E0U A;  1U3A A;  1THX A;  1M7T A;  3RDW A;  2DSA A;  3H93 A;  5HR1 A;  1ACV A;  3DVX A;  4IBP A;  5KN3 A;  4LA1 A;  3LXT A;  3DD3 A;  1EOH A;  4Q5F A;  3NOF A;  1NM3 A;  1BG1 A;  3KMN A;  5DJM A;  2HSN A;  4G9H A;  2OJL A;  1QMV A;  4XS4 B;  1YEX A;  3TJB A;  3QOU A;  1XWC A;  2OBI A;  1T8E B;  3D4M A;  4HOJ A;  3CSI A;  3KIJ A;  3KP9 A;  4EVM A;  3HDC A;  5IO2 A;  1G7E A;  3GKN A;  2DKI A;  4O5Q A;  3GUR A;  4KGI A;  3EUR A;  3TKS E;  1PN9 A;  2A4H A;  1HQO A;  3KGK A;  1U88 A;  3U5R E;  2WB9 A;  2V41 A;  4PQH A;  3MNG A;  4FYU A;  4F0B A;  1TTZ A;  3F3Q A;  4ZXG A;  1T00 A;  2NBS A;  1I5G A;  5JWO B;  3ZRE A;  4PNF A;  4BPY A;  4YKG A;  1LBK A;  3PGT A;  2H73 A;  4BVY A;  1JZO A;  4RQR A;  2JAD A;  5A5H B;  4D73 A;  4GSS A;  1NHY A;  5D9W A;  2F51 A;  3FZ4 A;  4TKY A;  4E68 A;  1TJD A;  5AIV A;  3KEB A;  3LSZ A;  1BED A;  2VIM A;  4CDO A;  4L5L A;  4Q5R A;  1XWB A;  2BTO T;  1PKW A;  1MD4 A;  2EFE A;  3ZFL A;  1DBY A;  1GSS A;  4BWQ A;  3HJO A;  4I5Q A;  2WGR A;  2VM1 A;  4OWY A;  4MA9 A;  5ECK B;  1TW9 A;  2GT5 A;  2YN1 A;  3DIE A;  1BF5 A;  1O8W A;  3RBT A;  2VL2 C;  1GRX A;  3HHV A;  1O85 A;  1V9W A;  2YP6 A;  1GWC A;  2H1G A;  2VKZ G;  4WR4 A;  5G2Z A;  4ZB8 A;  2H6X A;  5ECO B;  4NXI A;  5KOX A;  3QAG A;  4HU7 A;  2P5R A;  4AKG A;  1OVN A;  5LCZ A;  3UEM A;  2P31 A;  1O73 A;  4V1A g;  1Y6E A;  2DJK A;  1XW6 A;  2YPM A;  1Z6N A;  4TN8 A;  1O8X A;  1XW9 A;  2RUF A;  3F9U A;  3CWG A;  5HFK A;  1XG8 A;  1GTB A;  4XIH A;  12GS A;  4FXY P;  2FA4 A;  5CO3 A;  1U6T A;  1KEB A;  1K0C A;  2MBT A;  1E6B A;  3PR8 A;  18GS A;  2JU5 A;  3HKR A;  1I1I P;  1V98 A;  2HSN B;  4NHZ A;  2O85 A;  2GVP A;  2AB6 A;  4YAP A;  4AKH A;  1OKD A;  4K1F A;  4IEL A;  3IAM 2;  4FYB A;  3O76 A;  4OD7 A;  4YQM A;  2EIQ A;  1M3I A;  3CYN A;  4MP4 A;  2F8F A;  2GQM A;  4P3Y B;  10GS A;  2C80 A;  4DSS B;  3U6V A;  1YZX A;  2ZUP A;  1ZGN A;  2X8H A;  5DAK A;  3HY2 A;  4TW5 A;  1N2A A;  1S3R A;  3ZRD A;  2CT6 A;  2IMD A;  4BVY B;  3L4N A;  4MJC A;  2DKH A;  4D73 B;  1PX7 A;  3TU3 B;  3SBC A;  3MIX A;  19GS A;  3J7Y b;  2XHF A;  4XHM A;  2HZE A;  3ZIT A;  3KCM A;  1WIK A;  1PL2 A;  2LKU A;  4HQS A;  4EDY A;  1PQN A;  4K5R A;  1WWJ A;  1T7P B;  1X5D A;  2IME A;  3UBK A;  2QA2 A;  3EC3 A;  4ZL9 A;  1GLP A;  4GWR A;  3I69 A;  5A1N A;  1HYU A;  4AGS A;  1ZL9 A;  4ICY A;  1Q98 A;  2RII A;  5HQP A;  1EOG A;  5ELA A;  4K8M A;  4O5U A;  1TI3 A;  4O92 A;  1Z9H A;  5ECM B;  1Y1U A;  1ZOF A;  1RK4 A;  1AC1 A;  4WET A;  4ECI A;  2RM6 A;  2C8U A;  1HD2 A;  1XXU A;  3BBY A;  4G2E A;  4Z2T A;  4ECB A;  2AJQ B;  3MDK A;  3UAP A;  4BL7 B;  4ISD A;  5DDL A;  3UVH A;  1BJX A;  5B7C A;  2XBI A;  4PTS A;  4YH2 A;  3GKK A;  5J5N A;  3GSS A;  2H6Y A;  5D9X A;  4HSC X;  5ECR B;  1S3D A;  3IR4 A;  4PGT A;  1VF1 A;  1YKA A;  2H70 A;  2CAQ A;  3D0Z A;  1TK5 B;  5ID2 B;  3Q6O A;  3UL3 A;  4NAX A;  3I43 A;  4RQX A;  4IP1 A;  1G6Y A;  6GSV A;  3EYT A;  5DQY A;  2L4Q A;  4BA7 A;  4ECC A;  2WUL A;  1AAZ A;  4YKF A;  1QUW A;  3FZA A;  5CNW A;  4E8H A;  3DWV A;  5B8B A;  4HDE A;  5IMC A;  4N11 A;  17GS A;  2CZ2 A;  2VCV A;  5C00 A;  2B1L A;  5CRH A;  3ZTL A;  3E3E A;  1EEJ A;  1GUM A;  5F05 A;  2FA8 A;  2LQO A;  14GS A;  3J7Y k;  2CVD A;  4AJ7 A;  1GSD A;  16GS A;  1EEM A;  5DAL B;  3F8U A;  4V2N A;  4MJE A;  2ZNM A;  3F4R A;  5EPF A;  5G30 A;  2LEG A;  2CVB A;  3FKF A;  3HA9 A;  1QXH A;  4O7H A;  3L9S A;  1M2A A;  1ZCP A;  3D4T A;  3L9U A;  4MZW A;  2K9F A;  2GQK A;  4GQF A;  1R4W A;  1PFO A;  3ME8 A;  4KSO A;  3CTF A;  1GSU A;  5F8B A;  2IMI A;  1B9Y C;  1X9W B;  1MDI A;  4NMU A;  3RPN A;  2FD3 A;  1R5A A;  4USS A;  1ERV A;  5KN2 A;  1UVZ A;  1GL8 A;  2B5Y A;  1USB A;  2CV4 A;  2V1M A;  2E7P A;  1EP8 A;  2HZE B;  3F4S A;  1KTE A;  5IPG A;  5CRE A;  4N0Z A;  2H8L A;  3P8W A;  5IMD A;  1PGT A;  1THO A;  3FMW A;  3QAV A;  1O6J A;  2M80 A;  3ZIV A;  1XCC A;  1JHB A;  4IW9 A;  3VWU A;  1FG4 A;  1R5P A;  8GSS A;  4QL7 A;  2WW2 A;  5G31 A;  1T3B A;  3HVN A;  3F4T A;  4PX1 A;  4WR5 A;  3IOS A;  3LXZ A;  1XOB A;  1JLW A;  2HSY A;  5D8I A;  1UN2 A;  4HJM A;  4POK A;  2V32 A;  2NTO A;  2GT6 A;  3W6G A;  2A2S A;  2YV7 A;  2PPT A;  4XTS A;  2QA1 A;  2FWF A;  3ZYW A;  2XPE A;  3GYK A;  2VCZ A;  1YY7 A;  4OO4 A;  1PX6 A;  3MSZ A;  1ZYQ B;  3FY7 A;  2DJ3 A;  2WZS A;  5A5H A;  1R26 A;  2PU9 C;  5BMU B;  1WJK A;  4CY6 A;  2IN3 A;  4EIP A;  2B3S A;  1AXD A;  2J9H A;  2YWO A;  2GZZ A;  2ES7 A;  2LRC A;  1ILO A;  5A5K A;  4ZL8 A;  4IJ3 A;  2O87 A;  3L9V A;  1O81 A;  4PUR A;  2O89 A;  4TR1 A;  2HE3 A;  1SVM A;  3SWL A;  2PVO C;  2HT9 A;  5CRG A;  1DUG A;  4KAE A;  4EO3 A;  2X8G A;  5ECP B;  3HYP A;  3CRU A;  1F37 A;  2CZ3 A;  6GSS A;  4MLY A;  3H1N A;  5J3R A;  1NHO A;  3LJR A;  4N30 A;  1PMT A;  1F2E A;  3TKP A;  1VRS D;  1VGL A;  2DIZ A;  1ST9 A;  3HZ4 A;  5G5F A;  1JZR A;  2VL9 A;  4QMK A;  4X0X A;  3WGE A;  2FGX A;  3UBL A;  3GIX A;  1SVL A;  2LV3 A;  2B6M A;  4KDU A;  3CRT A;  3KH9 A;  3QDN A;  2FWG A;  2VD0 A;  2MZC A;  2AAW A;  1VF2 A;  3GNJ A;  5IOX A;  1IYH A;  1B8X A;  2VAF A;  3D6I A;  2YZU A;  4BIK A;  2A4V A;  3D22 A;  3LG6 A;  2ALB A;  3GX0 A;  1S3A A;  4G01 A;  1PA3 A;  5HR3 A;  5AGY A;  4XS1 A;  4TR4 A;  3PIN A;  4I8B A;  2F8A A;  20GS A;  1SU9 A;  2J23 A;  1AIU A;  2H0G A;  2P0G A;  4DSR A;  2KHP A;  1ERU A;  1ON4 A;  5IIZ A;  1ABA A;  5FWG A;  2HYX A;  3HJP A;  2NPB A;  2R37 A;  3IDV A;  1WE0 A;  2L57 A;  2WRT A;  4YAV A;  4KB3 A;  4KW6 A;  1NSW A;  3P2A A;  3EIN A;  2YV9 A;  2H19 A;  1FVK A;  2DMM A;  1RQM A;  1Z7R A;  4EUY A;  5CP1 A;  5E4W A;  4J57 E;  4WF5 A;  3GUS A;  2QC7 A;  4KND A;  3UJ1 A;  3UAR A;  2VOC A;  2AUV A;  1GLQ A;  1YKC A;  5HR2 A;  2C0F A;  3G7J A;  4MF6 A;  4HI7 A;  5GST A;  2C0D A;  3R2Q A;  4K2X A;  3VPQ A;  3KXO A;  4RI7 A;  4DSS A;  1SK1 A;  1OC3 A;  1BG5 A;  4OMV A;  1SD8 A;  3GX8 A;  3V1W A;  4Q5Q A;  3CSH A;  1TOF A;  3IE3 A;  1M3J A;  2VL3 A;  2FWH A;  1AQV A;  1EWX A;  1JFU A;  4YQU A;  1O7U A;  3G7I A;  5AN1 A;  3WD6 A;  2R2J A;  2L6C A;  1J9B A;  2YWI A;  1B4Q A;  6GST A;  22GS A;  4K6X A;  3VFI A;  3TKR A;  4Z2R A;  5GAN D; 
#chains in the Genus database with same CATH homology
 1B48 A;  1K0N A;  3IAS 2;  2LST A;  1U87 A;  1TK8 B;  2L5O A;  4ACS A;  4TR1 B;  4X1U A;  2AV4 A;  4I2U A;  3I6A A;  3KTB A;  3FR9 A;  5B6N A;  1K3L A;  4J56 E;  4HEA 2;  6GSX A;  1PRX A;  4HZ2 A;  4EKZ A;  4Q5N A;  1TKD B;  4K7I A;  1AW9 A;  2JZR A;  4F9Z A;  2X4A A;  4K2D A;  2BJX A;  5FT3 A;  4MF7 A;  4IS0 A;  3IXR A;  5A34 A;  3HZ8 A;  2X64 A;  2WFC A;  4JBB A;  1OE7 A;  2IPA A;  3DEX A;  4BWS A;  2PUK C;  2PMT A;  1X5E A;  4ZL7 A;  3M0F A;  5CRD A;  1K0B A;  2XPD A;  4BL7 A;  5ENU A;  1Q4J A;  4G0I A;  1Y25 A;  2IFQ A;  4NWY A;  1XOA A;  4N10 A;  5KN1 A;  4LLR A;  3EVI A;  2CAI A;  5J40 A;  1YQ1 A;  2TRC P;  5ID2 A;  5J9C A;  3MYD A;  3CTG A;  1X5C A;  1RW1 A;  4ML1 A;  3QFB C;  7GSS A;  1TRS A;  3E9J B;  4MPF A;  2L59 A;  2IL3 A;  5EL8 A;  3KP8 A;  3VK9 A;  2FCH A;  2KOK A;  3VPT A;  1EV4 A;  3ZZX A;  4IQA A;  5FHI A;  2RLI A;  3IBH A;  3WT1 A;  2IMF A;  2MMA A;  4MZB A;  4AKX B;  4X4J A;  2R0G A;  4Z7X A;  3HVS A;  1KBN A;  1K0O A;  3FK8 A;  4OO5 A;  1SD9 A;  3IRA A;  1GUK A;  2DBC A;  1OYJ A;  2YCD A;  1SJ6 A;  3LYK A;  3Q19 A;  5DAL A;  2C1Y A;  3FW2 A;  1HNB A;  1TP9 A;  1IYI A;  1YEP A;  2IWT A;  5ABR A;  2H01 A;  4IP6 A;  3TGZ A;  2C0E A;  4DSQ A;  4WBJ A;  1TXU A;  3M3M A;  1GNE A;  3DML A;  2YWN A;  4WXT A;  4ZB6 A;  3VWV A;  3L0H A;  1XWA A;  4JR4 A;  3QFA C;  2WDU A;  3LGC A;  4ZBB A;  1TI1 A;  2GST A;  1J08 A;  4KE3 A;  5D9V A;  3W8S A;  4AKI A;  5JCW A;  4HJ2 A;  1GTA A;  1A0R P;  3M9J A;  3QCP A;  2H74 A;  1EGR A;  2ON7 A;  1MEK A;  5AIX A;  1C72 A;  2MBS A;  3F6D A;  3KD0 A;  4FH8 A;  3N5O A;  3WT2 A;  4DVC A;  4MAB A;  1H75 A;  3HXS A;  3TKQ A;  1T4Y A;  1F9M A;  1I9D A;  2L4C A;  2V2G A;  3D5J A;  6GSU A;  1QFN A;  2VUP A;  3EMX A;  2UZ8 A;  2M46 A;  2K6V A;  5JCU A;  1DE1 A;  4KH7 A;  3GFK A;  2AHE A;  1OKT A;  1EV9 A;  4TRX A;  2HFD A;  4GRF A;  5A34 B;  3TKS C;  4MH3 A;  4I6X A;  3DKS A;  3GA4 A;  1AQW A;  4MZC A;  4GST A;  4AI6 A;  5B6M A;  1WOU A;  2H1B A;  4J2F A;  1YF0 A;  2KP2 A;  1AQX A;  5F07 A;  2IFQ B;  1GUL A;  1TU8 A;  5IO0 A;  2YJ7 A;  3TUE A;  4KCE A;  1ERT A;  2YZH A;  5IM9 A;  5BMU A;  4MNN A;  1XWG A;  1SK0 A;  3APO A;  1A2L A;  3IC8 A;  4V2M A;  2VLV A;  3MAK A;  1X0R A;  3TRX A;  1XVW A;  2H0I A;  3C1S A;  2GSR A;  2CX4 A;  3GN3 A;  5G5E A;  1DSB A;  1H4O A;  2H6Z A;  2HSH A;  2MYG A;  2MMZ A;  4ZIJ A;  4ID0 A;  1TDI A;  3GHA A;  3ERF A;  4QQ7 A;  3TRP A;  2WCI A;  2K18 A;  3A2X A;  5IMZ A;  2B1K A;  1XVQ A;  3NIV A;  5HFG A;  1X9S B;  1FOV A;  2DJJ A;  4POB A;  4EIQ A;  2R3X A;  4KSM A;  4L0U A;  2OT3 A;  3ME7 A;  3O6T A;  2R5G A;  1GSQ A;  3H79 A;  4MMM A;  1X9M B;  2XC2 A;  2HI7 A;  4K5S A;  3QR6 A;  1B9X C;  3APS A;  5GZZ B;  1MDK A;  3R3E A;  2RUE A;  3DGQ A;  3FZ9 A;  3LEF A;  3VI7 A;  4OFT A;  4KCA A;  4L8E A;  2B5E A;  2FWE A;  1YVL A;  2QKE A;  3H8Q A;  4KF9 A;  2QGV A;  2G0F A;  1ERW A;  2LQQ A;  4XRD A;  2JZT A;  4AJ8 A;  5IOW A;  5IQY A;  1OC8 A;  3RHB A;  2EIR A;  3RPP A;  2VM2 A;  1XZO A;  1LU4 A;  1A24 A;  2GZY A;  3CMI A;  3GH6 A;  1QK8 A;  3C71 A;  2H76 A;  5CYY A;  1OC9 B;  2OE0 A;  2FUG 2;  2E2M A;  2JSY A;  1URM A;  2D2Z A;  2JSZ A;  5GAP D;  1XIY A;  4X43 A;  2HZF A;  9GSS A;  2R0C A;  2KUC A;  3TB2 A;  1Z5Y E;  4ZB7 A;  1TXX A;  5D73 A;  3DRN A;  3KH7 A;  3F63 A;  1WP0 A;  2C3T A;  2FHE A;  2GDR A;  2GGT A;  2OAD A;  2YNX A;  3HD5 A;  1SJI A;  4OCF A;  3LYP A;  4NV2 A;  1GH2 A;  2AYT A;  3M9K A;  2Z9S A;  4FQU A;  4ZBD A;  2GLR A;  1Z7P A;  4CHS A;  3UOM A;  3TRQ A;  4EE0 A;  3TOU A;  4PUF C;  1G6W A;  3PPU A;  3OR5 A;  2YJH A;  3ZML A;  2H66 A;  4IJI A;  4IQ1 A;  5IPH A;  2GSQ A;  3C8E A;  4DEJ A;  1BQ7 A;  5G1K A;  4ULX A;  2O5V A;  5J4V A;  3RAZ A;  3A5I A;  4JZQ A;  1M2D A;  4XS6 A;  2KLX A;  2HRK A;  4K0G A;  5D93 A;  2PN8 A;  1W89 A;  1PN0 A;  3AY8 A;  2V6K A;  2HQT A;  3VLN A;  4ML6 A;  3JCM L;  2REM A;  1TRW A;  1XWK A;  3KMO A;  5CRW A;  2OA7 A;  3TKS A;  2FY6 A;  1SYX A;  2LTK A;  3GST A;  4FO5 A;  4I97 A;  1UC7 A;  1GNW A;  4JED A;  4WKW A;  3F3R A;  4IVF A;  6GSW A;  1XBS A;  5F0G A;  1PL1 A;  4MF5 A;  4NPB A;  1OE8 A;  2HSM A;  2DIY A;  2K8S A;  2IMK A;  3GRX A;  1SK2 A;  1CQG A;  2DC5 A;  3GTU B;  2JZS A;  1FO5 A;  2NVL A;  4GSN A;  2YWM A;  1F6M C;  2HXK A;  3TJF A;  2WJU A;  1GTU A;  1SJZ A;  4KUN A;  1ZYE A;  2GTU A;  4ILF A;  4MPG A;  1J0F A;  4EDZ A;  1SL2 B;  3I9V 2;  2CX3 A;  1EP7 A;  2VCX A;  1T4Z A;  5EY6 A;  4F03 A;  1A8L A;  2GSS A;  5ECI B;  1M2B A;  1SL0 B;  3TDG A;  1GUH A;  1M9A A;  3K8N A;  2H75 A;  1VF3 A;  3FRC A;  3UVT A;  1ZYP A;  1GSF A;  2EFD A;  2H1D A;  4YQV A;  4LMV A;  2IIY A;  4RI6 A;  4AJ6 A;  4G10 A;  3WGX A;  3ZVJ A;  2C4J A;  4MJB A;  2UV8 G;  2R4V A;  3S9F A;  3FYG A;  4Z2U A;  3C7M A;  1N8J A;  1V57 A;  4HQZ A;  1MD3 A;  3FZ5 A;  4OCE A;  2DJ0 A;  3ISO A;  3GL3 A;  2PGT A;  4K9Z A;  5H5S A;  3H4K A;  3MWH A;  1FOH A;  1G7O A;  1XPV A;  2DLX A;  5DCG A;  3CSJ A;  4IGJ A;  5J4Y A;  4NV5 A;  3GKX A;  1SL1 B;  4PQI A;  3BCI A;  3RHC A;  4F82 A;  3EU4 A;  2HRK B;  2MMO A;  2CA8 A;  1CQH A;  3BD2 A;  1BYE A;  1SYR A;  3FR6 A;  1UA5 A;  4RUV A;  4WEY A;  4BVX A;  3IHQ A;  4TXV A;  4E8E A;  3IV4 A;  3GV1 A;  3IK9 A;  3QAW A;  1XW5 A;  1SEN A;  5A4U A;  3G7Y A;  4N3Z A;  4PNG A;  3A3T A;  2DJ2 A;  4PUA A;  4N0V A;  1M9B A;  4JRR A;  2OE1 A;  4POL A;  1WPI A;  1JZD A;  2BMX A;  2N5B A;  1TK0 B;  2FLS A;  1K3Y A;  2HLS A;  2HSM B;  1A2M A;  3LFL A;  3IC4 A;  3TOT A;  3D21 A;  2R6K A;  2VCT A;  2LUS A;  4EXJ A;  3A2V A;  2DML A;  1QQ2 A;  1JLV A;  2WS2 A;  5KN0 A;  3VWW A;  1XFL A;  4MK3 A;  2VLU A;  1JZW A;  3DXB A;  3VUR A;  2C0G A;  5IMF A;  4H86 A;  5L71 A;  1TRU A;  5LNK e;  2F9S A;  2TIR A;  4IN0 A;  4TR3 A;  5JWR B;  3HVV A;  4PQ1 A;  2YOI A;  4GXZ A;  2LJR A;  2LNS A;  2EIO A;  3VI5 A;  3CXG A;  2I1U A;  5J41 A;  3LWA A;  4TXO A;  4FIW A;  3HVX A;  2M72 A;  5DJL A;  1SKS B;  1WMJ A;  4TOP A;  3KZQ A;  1PD2 1;  5AIS A;  3A2W A;  5H5R A;  5ECN B;  1MDJ A;  2I81 A;  2NDO A;  4GLT A;  4ZB9 A;  3ERG A;  2JAC A;  1OAZ A;  3C1R A;  2G2Q A;  2EC4 A;  5H5Q A;  3EPT A;  1S3C A;  1K3O A;  5A4W A;  1R7H A;  1PSQ A;  3WYW A;  1ZMA A;  4CW9 A;  4TVE A;  2V6O A;  2MMN A;  3LOR A;  3QD9 A;  2TRX A;  2A2R A;  2O8V B;  1OC9 A;  3HJM A;  2LJK A;  2CQ9 A;  2WZ9 A;  5DCH A;  2ON5 A;  2LS5 A;  4LL1 B;  3M8N A;  4AF2 A;  4EL1 A;  1FAA A;  3WGD A;  4K7O A;  1M99 A;  4OFN A;  4G0K A;  2GS3 A;  2HRF A;  2LNT A;  3KJY A;  3GL5 A;  2VD1 A;  3P7X A;  5A4V A;  5J9B A;  1GSE A;  1N25 A;  3L78 A;  4K7N A;  3EMP A;  2VO4 A;  4BVX B;  4KX4 A;  2O7K A;  2P5Q A;  3DYR A;  3BOA A;  5ECL B;  1A23 A;  1BAY A;  1K0M A;  2PBJ A;  1ZZY A;  2K8V A;  1YJ6 A;  2JL4 A;  2L5L A;  4KA0 A;  1B4P A;  1Z3E A;  1V40 A;  4HZ4 A;  4L5O A;  2HRN A;  2I3Y A;  4KDX A;  2I4A A;  5JWQ B;  5EVO A;  3ERW A;  3F0I A;  4JR6 A;  1SKW B;  4XCS A;  1G0T A;  3EE2 A;  2B7K A;  1A0F A;  1Z6M A;  5KOW A;  4PXO A;  2H30 A;  4MJA A;  5CAX A;  4ZBA A;  1W4V A;  3ZLP A;  4GQC A;  1BX9 A;  1F3B A;  1HNC A;  3GKM A;  4V2L A;  1KNG A;  3US3 A;  3GH9 A;  3NZN A;  1ML6 A;  11GS A;  3ZVJ D;  3IHG A;  4JE1 A;  3G9B A;  4MH2 A;  5ELG A;  5HFI A;  4V1A p;  2EFH A;  5B8A A;  5F06 A;  4TXO B;  3EWL A;  1T1V A;  2LJA A;  2A2P A;  2ZCT A;  4F2I A;  4XRA A;  2E0Q A;  2L6D A;  3GMF A;  1AUC A;  1TU7 A;  3DVW A;  1WRY A;  1FB6 A;  3EU3 A;  1LJR A;  5DAK B;  2VL2 A;  2B5X A;  5IMV A;  5BRT A;  5ECH B;  4IKH A;  5D9T A;  1A8Y A;  3IK7 A;  3KTL A;  2GQL A;  3TCO A;  1V2A A;  3PH9 A;  3LQ7 A;  2N5A A;  4GCI A;  4L0W A;  2VCQ A;  1GSY A;  2I9H A;  5COH A;  4FYC A;  3GTU A;  3BJ5 A;  2LRT A;  2OBK A;  1GTI A;  4WF4 A;  2H1L A;  4JU5 A;  5JCG A;  1QGV A;  5DVB A;  1A2J A;  2C3N A;  4W66 A;  2OE3 A;  3KM6 A;  2KP1 A;  3ED3 A;  4MCU A;  3TJJ A;  5ECQ B;  3UIW A;  4XS4 A;  5A1N B;  5E59 A;  4O5R A;  1K0A A;  2HRA A;  5KEJ A;  4IHU A;  1FVJ A;  1M0U A;  4ECJ A;  2H71 A;  1TRV A;  3FEU A;  2N5F A;  3Q18 A;  5J4U A;  4LMW A;  4POM A;  13GS A;  4GF0 A;  5HR0 A;  5LD0 A;  5DQS A;  1NW2 A;  4I2T A;  2F3M A;  1SKR B;  3O3T A;  1YF1 A;  4EC0 A;  3M1G A;  1EZK A;  2HNL A;  4WBR D;  4CY8 A;  5DBQ A;  3ZMK A;  2YAN A;  5G1L A;  3ZFB A;  1PKZ A;  1FW1 A;  4EF0 A;  3IPZ A;  4NHW A;  1FB0 A;  4OFM A;  2PER A;  4TR0 A;  5D96 A;  5J47 A;  2X49 A;  3A5W A;  4QL9 A;  4F0C A;  3CBU A;  4GDF A;  3FHK A;  1EGO A;  2IJY A;  4G19 A;  3Q74 A;  2E2G A;  2OKA A;  6GSY A;  3APQ A;  4HUA A;  4O32 A;  3N9J A;  3C73 A;  3ZL5 A;  2OAC A;  1ZYN A;  2LRN A;  1YDK A;  2FNO A;  2RM5 A;  2X99 A;  1HNA A;  1FHE A;  3LW9 A;  5C04 A;  4LL4 B;  4A5P A;  1F3A A;  2H72 A;  5INY A;  2CVK A;  1GP1 A;  4KDY A;  5GSS A;  2H1A A;  3TJG A;  4K0N A;  2VLT A;  1U3I A;  2C3Q A;  3HCZ A;  1VF4 A;  4GTU A;  3IA1 A;  3TJK A;  2PVQ A;  5IMA A;  3UMA A;  2PWJ A;  2R0P A;  2H0H A;  2EFC A;  4ZIL A;  4MDC A;  2DJ1 A;  3ZIJ A;  3VWX A;  3W8J A;  4G0L A;  3HMJ G;  1SVO A;  3F6F A;  3P90 A;  1V58 A;  3FR3 A;  2GZP A;  3QMX A;  2B7J A;  1E2Y A;  2VCW A;  2X8C A;  1MTC A;  5ECS A;  2XBQ A;  3BCK A;  3QPM A;  4HS1 A;  1DE2 A;  2QSI A;  4HU9 A;  1K0D A;  3E0U A;  1U3A A;  1THX A;  1M7T A;  3RDW A;  2DSA A;  3H93 A;  5HR1 A;  1ACV A;  3DVX A;  4IBP A;  5KN3 A;  4LA1 A;  3LXT A;  3DD3 A;  1EOH A;  4Q5F A;  3NOF A;  1NM3 A;  1BG1 A;  3KMN A;  5DJM A;  2HSN A;  4G9H A;  2OJL A;  1QMV A;  4XS4 B;  1YEX A;  3TJB A;  3QOU A;  1XWC A;  2OBI A;  1T8E B;  3D4M A;  4HOJ A;  3CSI A;  3KIJ A;  3KP9 A;  4EVM A;  3HDC A;  5IO2 A;  1G7E A;  3GKN A;  2DKI A;  4O5Q A;  3GUR A;  4KGI A;  3EUR A;  3TKS E;  1PN9 A;  2A4H A;  1HQO A;  3KGK A;  1U88 A;  3U5R E;  2WB9 A;  2V41 A;  4PQH A;  3MNG A;  4FYU A;  4F0B A;  1TTZ A;  3F3Q A;  4ZXG A;  1T00 A;  2NBS A;  1I5G A;  5JWO B;  3ZRE A;  4PNF A;  4BPY A;  4YKG A;  1LBK A;  3PGT A;  2H73 A;  4BVY A;  1JZO A;  4RQR A;  2JAD A;  5A5H B;  4D73 A;  4GSS A;  1NHY A;  5D9W A;  2F51 A;  3FZ4 A;  4TKY A;  4E68 A;  1TJD A;  5AIV A;  3KEB A;  3LSZ A;  1BED A;  2VIM A;  4CDO A;  4L5L A;  4Q5R A;  1XWB A;  2BTO T;  1PKW A;  1MD4 A;  2EFE A;  3ZFL A;  1DBY A;  1GSS A;  4BWQ A;  3HJO A;  4I5Q A;  2WGR A;  2VM1 A;  4OWY A;  4MA9 A;  5ECK B;  1TW9 A;  2GT5 A;  2YN1 A;  3DIE A;  1BF5 A;  1O8W A;  3RBT A;  2VL2 C;  1GRX A;  3HHV A;  1O85 A;  1V9W A;  2YP6 A;  1GWC A;  2H1G A;  2VKZ G;  4WR4 A;  5G2Z A;  4ZB8 A;  2H6X A;  5ECO B;  4NXI A;  5KOX A;  3QAG A;  4HU7 A;  2P5R A;  4AKG A;  1OVN A;  5LCZ A;  3UEM A;  2P31 A;  1O73 A;  4V1A g;  1Y6E A;  2DJK A;  1XW6 A;  2YPM A;  1Z6N A;  4TN8 A;  1O8X A;  1XW9 A;  2RUF A;  3F9U A;  3CWG A;  5HFK A;  1GTB A;  4XIH A;  12GS A;  2FA4 A;  5CO3 A;  1U6T A;  1KEB A;  1K0C A;  2MBT A;  1E6B A;  3PR8 A;  18GS A;  2JU5 A;  3HKR A;  1V98 A;  2HSN B;  4NHZ A;  2O85 A;  2GVP A;  2AB6 A;  4YAP A;  4AKH A;  1OKD A;  4K1F A;  4IEL A;  3IAM 2;  4FYB A;  3O76 A;  4OD7 A;  4YQM A;  2EIQ A;  3CYN A;  4MP4 A;  2F8F A;  2GQM A;  4P3Y B;  10GS A;  2C80 A;  4DSS B;  3U6V A;  1YZX A;  2ZUP A;  1ZGN A;  2X8H A;  5DAK A;  3HY2 A;  4TW5 A;  1N2A A;  3ZRD A;  2CT6 A;  2IMD A;  4BVY B;  3L4N A;  4MJC A;  2DKH A;  4D73 B;  1PX7 A;  3TU3 B;  3SBC A;  3MIX A;  19GS A;  3J7Y b;  2XHF A;  4XHM A;  2HZE A;  3ZIT A;  3KCM A;  1WIK A;  1PL2 A;  2LKU A;  4HQS A;  4EDY A;  1PQN A;  4K5R A;  1WWJ A;  1T7P B;  1X5D A;  2IME A;  3UBK A;  2QA2 A;  3EC3 A;  4ZL9 A;  1GLP A;  4GWR A;  3I69 A;  5A1N A;  1HYU A;  4AGS A;  1ZL9 A;  4ICY A;  1Q98 A;  2RII A;  5HQP A;  1EOG A;  5ELA A;  4K8M A;  4O5U A;  1TI3 A;  4O92 A;  1Z9H A;  5ECM B;  1Y1U A;  1ZOF A;  1RK4 A;  1AC1 A;  4WET A;  4ECI A;  2RM6 A;  2C8U A;  1HD2 A;  1XXU A;  3BBY A;  4G2E A;  4Z2T A;  4ECB A;  2AJQ B;  3MDK A;  3UAP A;  4BL7 B;  4ISD A;  5DDL A;  3UVH A;  1BJX A;  5B7C A;  2XBI A;  4PTS A;  4YH2 A;  3GKK A;  5J5N A;  3GSS A;  2H6Y A;  5D9X A;  5ECR B;  1S3D A;  3IR4 A;  4PGT A;  1VF1 A;  1YKA A;  2H70 A;  2CAQ A;  3D0Z A;  1TK5 B;  5ID2 B;  3Q6O A;  3UL3 A;  4NAX A;  3I43 A;  4RQX A;  4IP1 A;  1G6Y A;  6GSV A;  3EYT A;  5DQY A;  2L4Q A;  4BA7 A;  4ECC A;  2WUL A;  1AAZ A;  4YKF A;  1QUW A;  3FZA A;  5CNW A;  4E8H A;  3DWV A;  5B8B A;  4HDE A;  5IMC A;  4N11 A;  17GS A;  2CZ2 A;  2VCV A;  5C00 A;  2B1L A;  5CRH A;  3ZTL A;  3E3E A;  1EEJ A;  1GUM A;  5F05 A;  2FA8 A;  2LQO A;  14GS A;  3J7Y k;  2CVD A;  4AJ7 A;  1GSD A;  16GS A;  1EEM A;  5DAL B;  3F8U A;  4V2N A;  4MJE A;  2ZNM A;  3F4R A;  5EPF A;  5G30 A;  2LEG A;  2CVB A;  3FKF A;  3HA9 A;  1QXH A;  4O7H A;  3L9S A;  1M2A A;  1ZCP A;  3D4T A;  3L9U A;  4MZW A;  2K9F A;  2GQK A;  4GQF A;  1R4W A;  3ME8 A;  4KSO A;  3CTF A;  1GSU A;  5F8B A;  2IMI A;  1B9Y C;  1X9W B;  1MDI A;  4NMU A;  3RPN A;  2FD3 A;  1R5A A;  4USS A;  1ERV A;  5KN2 A;  1UVZ A;  1GL8 A;  2B5Y A;  1USB A;  2CV4 A;  2V1M A;  2E7P A;  1EP8 A;  2HZE B;  3F4S A;  1KTE A;  5IPG A;  5CRE A;  4N0Z A;  2H8L A;  3P8W A;  5IMD A;  1PGT A;  1THO A;  3FMW A;  3QAV A;  1O6J A;  2M80 A;  3ZIV A;  1XCC A;  1JHB A;  4IW9 A;  3VWU A;  1FG4 A;  1R5P A;  8GSS A;  4QL7 A;  5G31 A;  1T3B A;  3F4T A;  4PX1 A;  4WR5 A;  3IOS A;  3LXZ A;  1XOB A;  1JLW A;  2HSY A;  5D8I A;  1UN2 A;  4HJM A;  4POK A;  2V32 A;  2NTO A;  2GT6 A;  3W6G A;  2A2S A;  2YV7 A;  2PPT A;  4XTS A;  2QA1 A;  2FWF A;  3ZYW A;  2XPE A;  3GYK A;  2VCZ A;  1YY7 A;  4OO4 A;  1PX6 A;  3MSZ A;  1ZYQ B;  3FY7 A;  2DJ3 A;  5A5H A;  1R26 A;  2PU9 C;  5BMU B;  1WJK A;  4CY6 A;  2IN3 A;  4EIP A;  2B3S A;  1AXD A;  2J9H A;  2YWO A;  2GZZ A;  2ES7 A;  2LRC A;  1ILO A;  5A5K A;  4ZL8 A;  4IJ3 A;  2O87 A;  3L9V A;  1O81 A;  4PUR A;  2O89 A;  4TR1 A;  2HE3 A;  1SVM A;  3SWL A;  2PVO C;  2HT9 A;  5CRG A;  1DUG A;  4KAE A;  4EO3 A;  2X8G A;  5ECP B;  3HYP A;  3CRU A;  1F37 A;  2CZ3 A;  6GSS A;  4MLY A;  3H1N A;  5J3R A;  1NHO A;  3LJR A;  4N30 A;  1PMT A;  1F2E A;  3TKP A;  1VRS D;  1VGL A;  2DIZ A;  1ST9 A;  3HZ4 A;  5G5F A;  1JZR A;  2VL9 A;  4QMK A;  4X0X A;  3WGE A;  2FGX A;  3UBL A;  3GIX A;  1SVL A;  2LV3 A;  2B6M A;  4KDU A;  3CRT A;  3KH9 A;  3QDN A;  2FWG A;  2VD0 A;  2MZC A;  2AAW A;  1VF2 A;  3GNJ A;  5IOX A;  1IYH A;  1B8X A;  2VAF A;  3D6I A;  2YZU A;  2A4V A;  3D22 A;  3LG6 A;  2ALB A;  3GX0 A;  1S3A A;  4G01 A;  1PA3 A;  5HR3 A;  5AGY A;  4XS1 A;  4TR4 A;  3PIN A;  4I8B A;  2F8A A;  20GS A;  1SU9 A;  2J23 A;  1AIU A;  2H0G A;  2P0G A;  4DSR A;  2KHP A;  1ERU A;  1ON4 A;  5IIZ A;  1ABA A;  5FWG A;  2HYX A;  3HJP A;  2NPB A;  2R37 A;  3IDV A;  1WE0 A;  2L57 A;  2WRT A;  4YAV A;  4KB3 A;  4KW6 A;  1NSW A;  3P2A A;  3EIN A;  2YV9 A;  2H19 A;  1FVK A;  2DMM A;  1RQM A;  1Z7R A;  4EUY A;  5CP1 A;  5E4W A;  4J57 E;  4WF5 A;  3GUS A;  2QC7 A;  4KND A;  3UJ1 A;  3UAR A;  2VOC A;  2AUV A;  1GLQ A;  1YKC A;  5HR2 A;  2C0F A;  3G7J A;  4MF6 A;  4HI7 A;  5GST A;  2C0D A;  3R2Q A;  4K2X A;  3VPQ A;  3KXO A;  4RI7 A;  4DSS A;  1SK1 A;  1OC3 A;  1BG5 A;  4OMV A;  1SD8 A;  3GX8 A;  3V1W A;  4Q5Q A;  3CSH A;  1TOF A;  3IE3 A;  2VL3 A;  2FWH A;  1AQV A;  1EWX A;  1JFU A;  4YQU A;  1O7U A;  3G7I A;  5AN1 A;  3WD6 A;  2R2J A;  2L6C A;  1J9B A;  2YWI A;  1B4Q A;  6GST A;  22GS A;  4K6X A;  3VFI A;  3TKR A;  4Z2R A;  5GAN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...