2WRTA

The 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGSTPEERARISMIEGAAMDLRMGFVRVCYNPKFEEVKGDYLKELPTTLKMWSNFLGDRHYLTGSSVSHVDFMVYEALDCIRYLAPQCLEDFPKLKEFKSRIEDLPKIKAYMESEKFIKWPLNSWIASFGGGDAAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE CLASS-MU 26 KDA ISOZYME 51
publication title The 2.5 Angstrom Structure of a Mu Class Gst from Fasciola Hepatica
rcsb
source organism Fasciola hepatica
molecule tags Transferase
total genus 70
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wrtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wrtA01
4KH7A 1J9BA 5IOWA 3KH9A 2XBQA 1W89A 5ENUA 2B6MA 3QD9A 3GRXA 1V40A 4HZ4A 1SJ6A 4EUYA 4MA9A 3GL5A 1YQ1A 1T4ZA 1ON4A 3D21A 1TI1A 2PWJA 2N5BA 1TRVA 5FT3A 3TCOA 3FYGA 2B7KA 1YEPA 3ZMLA 1TU8A 3NIVA 1K0DA 3TKSE 4KX4A 2RM6A 3VPQA 1QQ2A 5J9CA 5GSTA 4IQ1A 2I4AA 4F2IA 4HEA2 5C00A 5AISA 3N5OA 4IGJA 4AJ7A 4NPBA 2H76A 2PPTA 1ABAA 5DBQA 3EC3A 5IMCA 2IIYA 3A2WA 2AHEA 1ERWA 2OBIA 3GKMA 4J56E 1EZKA 4MJAA 2VAFA 2D2ZA 4TR1B 3CSIA 4I6XA 4P3YB 1Z5YE 1FW1A 3I9V2 4MJCA 3FW2A 2CVBA 4MCUA 5J3RA 3US3A 5G30A 5INYA 1GRXA 1K0MA 3CTGA 5ECKB 2H0HA 3FHKA 1TK0B 5IMZA 1PQNA 3LEFA 4N11A 2NPBA 1XZOA 5DJMA 3F3QA 3TJJA 4MZCA 5ID2B 1XVWA 3R2QA 1OKDA 4TOPA 4K1FA 1MD3A 5DAKB 2PERA 2WGRA 5D9XA 1JLWA 2IMIA 3F4RA 1XW6A 2GQLA 1UA5A 4I97A 1EEJA 1Z3EA 1MEKA 1ZOFA 1V2AA 1TRWA 3A2VA 1M0UA 4XS6A 4KDXA 2RUEA 4I2UA 2L5OA 4GWRA 2DJ2A 3D6IA 5L71A 4IJIA 4MK3A 4O5RA 3IK7A 1J0FA 1GUKA 1OE8A 4IKHA 3R3EA 2VLTA 5EY6A 4USSA 3IAM2 2PN8A 1AAZA 1G0TA 2HNLA 1M2BA 5CP1A 3RPNA 3CRTA 1LJRA 5ECNB 2CV4A 5CYYA 1MTCA 5F8BA 4NV5A 1G7OA 3TB2A 2LJKA 1F3BA 2H6ZA 1UC7A 4ZXGA 2VLUA 3HDCA 3HCZA 3L0HA 4BVXA 2JSZA 1FVKA 2RIIA 3LYKA 2MMOA 3MAKA 4GCIA 2K9FA 4TXVA 4TKYA 1HYUA 3KP8A 2DMMA 1EV9A 2TRXA 2P5RA 4EVMA 2HZFA 1QFNA 3EU4A 4YAPA 1V58A 2GQMA 4ECIA 4KDYA 2F9SA 4PQ1A 1PKZA 4MLYA 5D9VA 4MF7A 1JZRA 2JSYA 4MZBA 2B1LA 5GAND 3ZZXA 1H75A 1KBNA 1R4WA 4KB3A 4JR4A 2MBSA 4EL1A 1YZXA 2YJHA 1GH2A 4FIWA 3GX8A 3KMOA 2YN1A 3DMLA 1WPIA 1TKDB 3GL3A 1H4OA 2Z9SA 4TW5A 2IMKA 3LORA 1GL8A 3MNGA 5KN3A 2R3XA 2H72A 1EOGA 5DCHA 2ON5A 2L57A 2H1BA 4N30A 2TRCP 1WIKA 5AIXA 2VL2C 3DD3A 1AC1A 4HJ2A 1GWCA 4NV2A 1T4YA 3U6VA 5D96A 3FZ5A 3KM6A 1EP7A 1PSQA 2WFCA 3UOMA 2YWMA 3GTUA 1U3IA 4OFNA 3ZIJA 2LTKA 3GX0A 2FWGA 3KTBA 2I81A 3FKFA 5IO2A 2XPEA 1USBA 1R5PA 4K0GA 2P0GA 1MDKA 3TKRA 2YJ7A 2C0EA 5IIZA 1R5AA 5G1KA 1SKSB 2YV7A 1T8EB 1EEMA 3SWLA 1GSEA 2P5QA 4IS0A 2H6XA 4MMMA 3IDVA 5F07A 4G19A 4BVXB 1YJ6A 2C80A 2BJXA 3ZYWA 2HRKB 3KGKA 4ZILA 3KZQA 4LMWA 1Z7PA 2DBCA 3E3EA 1ZGNA 4OCEA 2C0GA 5CNWA 1VF4A 2C3TA 4O32A 2M80A 2V41A 4OFTA 1K3YA 3WYWA 3QDNA 1GSYA 5DQYA 16GSA 1S3AA 2VL9A 5IQYA 4MZWA 1PL1A 2H70A 4ZL8A 3FR6A 3ZFBA 1A8LA 5AGYA 4RI7A 3APOA 1KTEA 3ZIVA 3LXTA 22GSA 2MBTA 2BMXA 2VCWA 3IE3A 2BTOT 3ERFA 4K7OA 4L8EA 3K8NA 1OKTA 4GQCA 4FYBA 1WOUA 1O85A 2HRFA 1A24A 2FD3A 4G9HA 4NMUA 2HSMB 4MP4A 5DVBA 4GTUA 4KGIA 2DIZA 1V9WA 1FVJA 3C8EA 2PVOC 5LCZA 5ELAA 2EC4A 3KD0A 3UL3A 3GHAA 3IRAA 3C1SA 2WZ9A 3EINA 3VFIA 3H8QA 3ZLPA 5JWOB 3HA9A 4TR4A 2CZ3A 1K0NA 2CX3A 3DGQA 1EGRA 2X8HA 4IP1A 4MABA 2ZUPA 2VUPA 4F0CA 2MMAA 5LD0A 5COHA 1A2LA 4F0BA 1Z7RA 2P31A 2GQKA 2FA4A 3O3TA 1XIYA 1PN9A 1T1VA 4TR1A 1O73A 2HQTA 4ZBBA 2PBJA 3HJPA 5HR2A 4DSSB 4LLRA 5ECQB 3WGEA 4IN0A 1M2DA 1GSQA 4Q5RA 4WF5A 1HNAA 3GSTA 2AUVA 1NM3A 3TRPA 2V32A 3CTFA 4G0IA 1GTIA 4MF5A 5ID2A 2HFDA 4HUAA 4GF0A 3F4SA 3ZVJD 4PX1A 2OADA 4V2LA 1XWAA 5ECSA 4D73B 1GSDA 4MDCA 1ZCPA 2C0DA 5DAKA 3DRNA 5H5SA 2L4QA 2GZZA 14GSA 2ON7A 2O89A 3BD2A 1TP9A 3FR3A 2HSNB 3C7MA 4G0KA 2GSTA 1SKWB 1XCCA 4I2TA 1O8XA 1SJIA 3HXSA 2YWIA 5DALB 3GA4A 3GKKA 3VWWA 5ECLB 3LYPA 2VCVA 3Q18A 2IL3A 1DE1A 2O85A 2F8AA 2QC7A 3ERGA 5E59A 2J9HA 3EURA 3EWLA 3UVTA 4IW9A 3DXBA 2C4JA 2HZEB 1KNGA 4GQFA 4POLA 2B5XA 5GZZB 1QUWA 5IMAA 10GSA 2IFQA 5IMVA 4K2DA 3I43A 2K8VA 5JWQB 1NHOA 5IPHA 3PH9A 2DJ3A 1DE2A 4ID0A 5D9WA 4JBBA 3VLNA 4V2NA 1B9XC 1Z6NA 2REMA 3VK9A 5IMDA 4L5OA 1Z6MA 2MYGA 3W6GA 2HRAA 2GSSA 3CRUA 1B4PA 1X9MB 1BQ7A 2CQ9A 1PA3A 1WWJA 3AY8A 2B7JA 1G7EA 3VURA 1XFLA 5CRHA 1SENA 1OAZA 2HSHA 4KNDA 1URMA 1TW9A 19GSA 1M9AA 2TIRA 1GNWA 2H30A 3UAPA 4CDOA 1QGVA 2V6OA 5ECOB 2VL3A 3LGCA 1GNEA 2MMNA 5CAXA 4TN8A 3TOUA 4PGTA 2OACA 4KSMA 4GRFA 3OR5A 2X99A 4DVCA 1FHEA 4XS4B 2H75A 3M1GA 2HT9A 5IPGA 3IAS2 2LSTA 1JZDA 3Q74A 4XIHA 3VPTA 8GSSA 3EVIA 1S3CA 1XWKA 5D93A 4K7NA 1TK8B 1EWXA 5JWRB 2WS2A 2C0FA 4YH2A 3ED3A 1SU9A 5JCUA 2GTUA 2LRTA 4BWQA 1B8XA 2GS3A 2A2SA 4PXOA 1JZWA 2DJKA 3L9SA 5G2ZA 4POMA 4WR4A 1BG5A 4KSOA 3ISOA 1OE7A 3BOAA 1XVQA 2IMFA 2KUCA 5KN2A 1M7TA 1UN2A 2HYXA 3WT2A 4NWYA 5ECRB 2F51A 4NHWA 2B5YA 2XHFA 1XWGA 4TR0A 2E0QA 3ZRDA 2V1MA 3GNJA 3HVSA 4HU7A 2ALBA 2DIYA 4FO5A 3TOTA 3HHVA 1V57A 1Q4JA 3M0FA 2GT6A 1Y25A 1YF0A 4LMVA 4IELA 2VIMA 2EIOA 2H01A 4KA0A 2IFQB 4Z7XA 4ZL7A 4KDUA 3WT1A 1X5DA 2HRKA 2R2JA 3M9KA 2R4VA 2HSYA 2H1DA 1EOHA 2O7KA 3KXOA 3RHCA 3KEBA 5CRGA 3ZVJA 3BCIA 3IHQA 4DSRA 4V1Ag 1UVZA 4RI6A 4X43A 4IJ3A 2CAIA 1ZZYA 2HLSA 1YDKA 1THXA 1R26A 3ME8A 4EXJA 4HQSA 1RQMA 2NDOA 4HU9A 1HNCA 1SJZA 1ZYEA 3HKRA 2IJYA 3E9JB 3HYPA 4PNFA 1SL2B 4E8HA 5D8IA 4MH3A 4GSSA 1WJKA 2RUFA 1U88A 4FYCA 4K0NA 3TKSC 1OC9B 2HSMA 2C8UA 2H74A 3KJYA 4MJEA 2H0IA 3NZNA 1DBYA 3GH6A 2AV4A 4FH8A 1M9BA 3LXZA 3A5WA 6GSWA 1OC8A 2GGTA 2CVDA 1C72A 1U87A 4JR6A 1A0RP 1LBKA 2IMEA 5FHIA 2H73A 2OA7A 2VM2A 1FO5A 3BCKA 4O7HA 1BJXA 2B3SA 2KOKA 3G9BA 1FAAA 3IPZA 4HI7A 2PVQA 4YAVA 3F4TA 1PGTA 5ECMB 3F3RA 5J41A 3GSSA 5JCGA 2HXKA 2LNTA 2NVLA 4AGSA 3RBTA 4LL1B 1K0AA 1PMTA 3QAVA 2LKUA 3HD5A 4EC0A 1TDIA 3CSHA 2X8GA 2VD0A 5B7CA 2NTOA 2K18A 2X8CA 3EMXA 1GSSA 4DSSA 1TJDA 2N5AA 1R7HA 5B8AA 3M9JA 2FGXA 3WGXA 4N0VA 5KN1A 3MWHA 2GZYA 3ZL5A 5CO3A 1JHBA 5F0GA 1GP1A 1G6WA 3MDKA 2AAWA 2WJUA 5IO0A 2YWOA 1X9SB 3MSZA 1VRSD 2VOCA 3EU3A 4D73A 2WRTA 4WETA 2OJLA 4HJMA 1N2AA 2WCIA 1OYJA 1HD2A 5KN0A 1GTAA 2DMLA 5HFKA 3WGDA 5IMFA 4WR5A 2K6VA 1U6TA 4GSTA 2N5FA 2QKEA 3DKSA 2IMDA 2VM1A 5DALA 2F8FA 2VD1A 12GSA 4L0WA 2GZPA 3NOFA 2KP2A 4TR3A 4EDZA 3WD6A 2X64A 1N8JA 2CX4A 3CBUA 4QQ7A 3HY2A 2YP6A 1YKAA 4EO3A 4X1UA 2H66A 3U5RE 1T00A 1THOA 1MDIA 2HZEA 2VL2A 4ZB9A 3H1NA 2M72A 2LS5A 3QMXA 4HS1A 3JCML 4L0UA 3Q6OA 6GSUA 4TXOB 5ECPB 3HVVA 2B5EA 4K6XA 2PGTA 4Q5QA 4JRRA 3IC8A 3TJFA 4AF2A 1I9DA 5ECIB 1AW9A 1U3AA 3HVXA 1WMJA 1SD9A 6GSTA 3PR8A 4ECCA 3APSA 3CXGA 1OVNA 3TKQA 3O76A 1NHYA 2DJJA 1JLVA 1YKCA 4IQAA 1A2MA 1AIUA 1TXXA 5KEJA 2J23A 3F9UA 2CZ2A 1Z9HA 3PPUA 1XW9A 3P8WA 3HJMA 4BL7B 4FYUA 2LQOA 2LV3A 2XPDA 3L9UA 4TVEA 3FZ9A 2FUG2 4ISDA 1XXUA 1TTZA 1W4VA 5F06A 3KCMA 5ABRA 1GLPA 4NXIA 3QAWA 4PQHA 3TGZA 1AQXA 3P90A 2F3MA 1ERTA 2OBKA 3EMPA 2FY6A 5C04A 1TOFA 4K8MA 11GSA 2HRNA 2FCHA 3V1WA 2O8VB 5IM9A 4XS4A 3L78A 4OO5A 4XS1A 4BVYB 1TK5B 4HQZA 1ACVA 2YPMA 4POKA 3UBLA 2VCQA 1PRXA 2IPAA 2V6KA 4LL4B 1QXHA 4PURA 1X9WB 4ECBA 1EV4A 2E7PA 4WEYA 2CAQA 3D4TA 4PNGA 1BX9A 3VI5A 3VWXA 4Q5NA 2H1AA 3QFAC 2K8SA 1G6YA 3FY7A 1ZL9A 1ERUA 1SL1B 5DQSA 3DVWA 4XTSA 9GSSA 2MMZA 3VWVA 4JEDA 2FA8A 4Q5FA 4HDEA 4FQUA 1F37A 2JU5A 5J5NA 4N10A 4EDYA 3UARA 1E2YA 5JCWA 2GSRA 3DVXA 2VCTA 3GIXA 3H93A 4ECJA 2A4VA 2OE0A 5A4VA 1VF2A 2JL4A 4EF0A 2XBIA 3FR9A 1IYHA 3GYKA 5AN1A 2JZRA 3GURA 2DLXA 4OO4A 2VCXA 2NBSA 1CQGA 2ZNMA 4PUFC 2IN3A 4NAXA 1XW5A 3M3MA 4KW6A 3DEXA 4ML1A 1FOVA 5B8BA 2GDRA 2L5LA 13GSA 4ML6A 2LUSA 4E8EA 1PD21 1WRYA 1BAYA 2I1UA 7GSSA 4G0LA 4AJ8A 3IBHA 3J7Yk 3KTLA 2AYTA 5H5RA 4WKWA 4GLTA 3HZ8A 4X0XA 6GSXA 4V2MA 4ULXA 2HI7A 2DJ0A 2FNOA 4KAEA 1ST9A 4RQRA 4J57E 2GLRA 4MH2A 2JACA 4H86A 2H19A 1A0FA 5A4WA 4WXTA 4TRXA 1J08A 1OC9A 5LNKe 1IYIA 4L5LA 4I8BA 4DSQA 1EP8A 1KEBA 1JZOA 4XHMA 1X5EA 5B6NA 3ZTLA 2L4CA 3QCPA 3S9FA 1EGOA 4KE3A 3ZFLA 5CRDA 1GLQA 4ZB8A 1GTBA 1OC3A 2LEGA 4MPFA 4NHZA 1DSBA 3SBCA 1NSWA 2PU9C 3UIWA 2YNXA 1F2EA 1XBSA 2RM5A 3I6AA 2H6YA 2KHPA 3QR6A 1VF3A 3ZREA 4K7IA 2M46A 4K9ZA 1B9YC 2QSIA 4J2FA 3RHBA 4KF9A 3LQ7A 3BJ5A 3IK9A 3GV1A 5DJLA 5F05A 1O81A 3ZITA 5ECHB 2YZHA 5HFIA 3F63A 1A2JA 5D73A 3F6DA 1TRUA 3C1RA 3P2AA 1TU7A 3TDGA 3GKXA 3FRCA 2GT5A 2GVPA 4AJ6A 4QL9A 2OE1A 1VGLA 2WB9A 1RW1A 4BPYA 3E0UA 4PQIA 2PMTA 3LG6A 1ZYQB 4OCFA 6GSSA 3F8UA 1MDJA 3LWAA 1ILOA 3IA1A 5G5FA 3TUEA 4YQVA 3ZMKA 3PINA 1HNBA 2H71A 3LSZA 3UJ1A 3L4NA 5E4WA 1GSUA 1T7PB 3FK8A 4EE0A 1PKWA 3D5JA 5H5QA 3I69A 4ZBAA 2VO4A 5DDLA 4F82A 1GTUA 2JADA 1NW2A 2HE3A 5G5EA 5HFGA 1XPVA 2LJRA 20GSA 2FWEA 2LRCA 2OE3A 3KMNA 4RUVA 3C71A 4IHUA 3GH9A 2IWTA 1M2AA 1AUCA 2AJQB 3RPPA 4G10A 3P7XA 3QOUA 2E2MA 2I9HA 5GSSA 2RLIA 2YWNA 4JE1A 1GULA 1SKRB 3A3TA 3J7Yb 1AXDA 4TXOA 3D4MA 2A2RA 2GSQA 4KUNA 3DIEA 6GSVA 1ERVA 1XOBA 2FWFA 1ML6A 2FWHA 4GSNA 1SK2A 3W8JA 1K0CA 4HOJA 1ZMAA 3CYNA 4BL7A 5EL8A 1F9MA 3DWVA 4KCAA 1MD4A 5B6MA 2UZ8A 3F6FA 2H0GA 1O6JA 2PUKC 4PTSA 1VF1A 3G7IA 3IOSA 1B4QA 5AIVA 3EYTA 4WF4A 3D0ZA 4GXZA 3QPMA 1TRSA 1F3AA 3PGTA 2YOIA 1FB0A 2YCDA 4IP6A 5GAPD 4ZBDA 2L6DA 4XRAA 5CRWA 5A5KA 3UBKA 3GMFA 2OKAA 2YZUA 1YEXA 3VWUA 2EIQA 6GSYA 2EIRA 1SK0A 4BVYA 5G1LA 3RDWA 5CREA 3H79A 3HZ4A 5EPFA 3TJKA 4DEJA 2R5GA 2XC2A 1LU4A 4XCSA 1SL0B 3G7JA 1M99A 1V98A 2VLVA 3L9VA 1XOAA 3TRXA 2LRNA 5G31A 2G2QA 2DC5A 3TKSA 1SYXA 2C3NA 4OD7A 3GKNA 3RAZA 2L6CA 4OWYA 5J4UA 4MJBA 2E2GA 1YY7A 3TRQA 4YQMA 1BYEA 1JFUA 4ZIJA 2KP1A 2R37A 1DUGA 2ES7A 3TJGA 1O7UA 4POBA 1SD8A 1PL2A 2LQQA 2I3YA 3F0IA 3Q19A 1PX6A 5DCGA 4KCEA 2CA8A 3N9JA 3KP9A 1PX7A 3DYRA 1K3OA 3HJOA 1I5GA 2KLXA 1K3LA 4G2EA 4N0ZA 3FZ4A 3O6TA 2FLSA 2G0FA 2CT6A 3APQA 3W8SA 1HQOA 3A2XA 3GFKA 3D22A 5HR0A 4JZQA 5EVOA 3ERWA 5J9BA 5A4UA 3KIJA 4BA7A 4CW9A 2C3QA 3UEMA 3VI7A 3M8NA 3LJRA 4I5QA 1AQVA 3CMIA 1CQHA 1Q98A 5ELGA 4YQUA 5BMUA 4OFMA 4WBJA 5IOXA 2WDUA 5HR1A 2O87A 3H4KA 4IBPA 3UVHA 4ZL9A 2JZSA 5D9TA 4OMVA 18GSA 3KH7A 1GUMA 1RK4A 2CVKA 1A23A 1QMVA 3IV4A 2AB6A 5HQPA 4HZ2A 1SYRA 1AQWA 2DJ1A 3FEUA 1T3BA 4ILFA 1TI3A 4ZB6A 5HR3A 4CHSA 4EKZA 3LFLA 2WULA 3IXRA 2MZCA 4F03A 3ME7A 3FZAA 1FG4A 2L59A 1SK1A 4WBRD 4JU5A 1X0RA 4BWSA 4MF6A 2V2GA 3GTUB 1O8WA 2YV9A 2LJAA 3GUSA 4V1Ap 3BBYA 1E6BA 1XWBA 1XWCA 3IR4A 1F6MC 1K0OA 3TJBA 1QK8A 3QFBC 1FB6A 3UMAA 2JZTA 1BEDA 4RQXA 2LNSA 3IC4A 1A8YA 17GSA 4IVFA 4QL7A 3TKPA 2YANA 1S3DA 4F9ZA 2VCZA 4MPGA 3G7YA 2R6KA 3CSJA 3QAGA 4LA1A 1WP0A 5FWGA 2H8LA 4XRDA 3EE2A 1GUHA 2ZCTA 3C73A 1K0BA 4ACSA 3GN3A 1WE0A 1GSFA 4PUAA 1X5CA 1YF1A 1B48A 1Y6EA 2B1KA 2C1YA 2QGVA 2DSAA 2H1GA 2FHEA 4O92A
chains in the Genus database with same CATH superfamily
4KH7A 1J9BA 5IOWA 3KH9A 2XBQA 4Z2UA 1W89A 5ENUA 2B6MA 3QD9A 3GRXA 1V40A 4HZ4A 1SJ6A 4EUYA 2WW1A 4MA9A 3GL5A 1YQ1A 1T4ZA 1ON4A 3D21A 1S3RA 1TI1A 2PWJA 2N5BA 1TRVA 5FT3A 3TCOA 3FYGA 2B7KA 5J4YA 1YEPA 5BMUB 3ZMLA 1TU8A 3NIVA 1K0DA 3TKSE 4KX4A 2RM6A 3VPQA 1QQ2A 5J9CA 5GSTA 4IQ1A 2I4AA 4O5QA 4F2IA 4HEA2 5C00A 5AISA 3N5OA 1M3IA 4IGJA 4AJ7A 4NPBA 2H76A 5A1NA 2PPTA 1ABAA 5DBQA 3EC3A 5IMCA 2IIYA 3A2WA 4X4JA 2AHEA 1ERWA 2OBIA 4G01A 3GKMA 1EZKA 4ZB7A 4J56E 2VAFA 4MJAA 2D2ZA 4TR1B 3CSIA 4I6XA 4P3YB 4PI2C 1Z5YE 1FW1A 3I9V2 4MJCA 3FW2A 2CVBA 4MCUA 5J3RA 3US3A 5G30A 4A5PA 5INYA 1GRXA 1K0MA 3CTGA 5ECKB 3RGBC 2H0HA 3FHKA 1TK0B 4YKFA 5IMZA 5A5HA 1PQNA 3LEFA 4N11A 2NPBA 1XZOA 5DJMA 3F3QA 3TJJA 4MZCA 1PFOA 5ID2B 2WZSA 1XVWA 2A2PA 3R2QA 1OKDA 4TOPA 4K1FA 1MD3A 3CQFA 5DAKB 2PERA 2WGRA 2DKHA 5D9XA 1JLWA 2IMIA 3F4RA 1XW6A 2GQLA 1UA5A 4I97A 1EEJA 1Z3EA 1MEKA 1ZOFA 1V2AA 1TRWA 3A2VA 1M0UA 4XS6A 4KDXA 2RUEA 4I2UA 4ICYA 1YEWC 3TU3B 2L5OA 4GWRA 2DJ2A 3D6IA 5L71A 4IJIA 4MK3A 2DKIA 4O5RA 3IK7A 1J0FA 1GUKA 1OE8A 4IKHA 3R3EA 2VLTA 1I1IP 5EY6A 4USSA 3IAM2 2PN8A 1AAZA 1G0TA 2HNLA 1M2BA 5CP1A 3RPNA 3CRTA 1LJRA 5ECNB 2CV4A 5CYYA 1MTCA 5F8BA 4NV5A 1G7OA 3TB2A 2LJKA 1F3BA 2H6ZA 1UC7A 4ZXGA 3HDCA 2VLUA 3HCZA 3L0HA 4BVXA 2JSZA 1FVKA 2RIIA 3LYKA 2MMOA 3MAKA 4GCIA 2H1LA 2K9FA 4TXVA 4TKYA 1HYUA 3KP8A 2DMMA 1EV9A 2TRXA 2P5RA 4EVMA 2HZFA 1QFNA 3EU4A 4YAPA 1Y1UA 1V58A 2GQMA 4ECIA 4KDYA 2F9SA 4PQ1A 1PKZA 4MLYA 5D9VA 4MF7A 1JZRA 2JSYA 4MZBA 2B1LA 5GAND 3ZZXA 1H75A 1KBNA 2VKZG 1R4WA 4KB3A 4JR4A 2MBSA 4EL1A 1YZXA 2YJHA 1GH2A 4FIWA 3GX8A 3KMOA 2YN1A 3DMLA 1WPIA 4K5SA 1TKDB 3GL3A 1H4OA 2Z9SA 4TW5A 2IMKA 3LORA 1GL8A 3MNGA 5KN3A 2R3XA 2H72A 1EOGA 5DCHA 2ON5A 2L57A 2H1BA 2WW2A 4N30A 2TRCP 1WIKA 5AIXA 2VL2C 3DD3A 1AC1A 4HJ2A 1GWCA 4NV2A 1T4YA 3U6VA 5D96A 3FZ5A 3KM6A 1EP7A 1PSQA 2WFCA 3UOMA 2R0GA 2YWMA 3GTUA 1U3IA 4OFNA 3LW9A 3ZIJA 2LTKA 3GX0A 2FWGA 3KTBA 2I81A 3FKFA 5IO2A 2WW3A 2XPEA 1USBA 2EFDA 1R5PA 4K0GA 2P0GA 1MDKA 3TKRA 2YJ7A 2C0EA 5IIZA 1R5AA 5G1KA 1SKSB 2YV7A 3RFRC 1T8EB 1EEMA 3SWLA 1GSEA 2P5QA 4IS0A 2H6XA 2R0CA 4MMMA 3IDVA 5F07A 4G19A 4BVXB 1YJ6A 2C80A 2BJXA 3ZYWA 2HRKB 3KGKA 4ZILA 3A5IA 3KZQA 4LMWA 1Z7PA 2DBCA 3E3EA 3MYDA 1ZGNA 4OCEA 2C0GA 5A34A 5CNWA 1VF4A 2C3TA 4O32A 5J4VA 2M80A 2V41A 4OFTA 1K3YA 3WYWA 3QDNA 1GSYA 5DQYA 16GSA 1S3AA 2VL9A 5IQYA 4MZWA 1PL1A 2H70A 4ZL8A 3FR6A 3ZFBA 4FXYP 1A8LA 5AGYA 4RI7A 3APOA 1KTEA 3ZIVA 3LXTA 22GSA 2MBTA 2BMXA 2VCWA 3IE3A 2BTOT 3ERFA 4K7OA 4L8EA 3K8NA 1OKTA 4GQCA 4FYBA 4E68A 1WOUA 1O85A 2HRFA 1A24A 2FD3A 4G9HA 4NMUA 2HSMB 4MP4A 5DVBA 4GTUA 4KGIA 2DIZA 1V9WA 1FVJA 3C8EA 2PVOC 5LCZA 5ELAA 2EC4A 3KD0A 3UL3A 3GHAA 3IRAA 3C1SA 2WZ9A 3EINA 3VFIA 3H8QA 3ZLPA 5JWOB 3HA9A 4TR4A 2CZ3A 1K0NA 2CX3A 3DGQA 1EGRA 2X8HA 4IP1A 4MABA 2ZUPA 2VUPA 4F0CA 2MMAA 5LD0A 5COHA 1A2LA 4F0BA 1Z7RA 2P31A 2GQKA 2X49A 2FA4A 3O3TA 1XIYA 1PN9A 1T1VA 4TR1A 4AKXB 1O73A 2HQTA 4ZBBA 2PBJA 3HJPA 5HR2A 4DSSB 4LLRA 5ECQB 3WGEA 4IN0A 1M2DA 1GSQA 4Q5RA 4WF5A 1HNAA 3GSTA 2AUVA 1NM3A 3TRPA 2V32A 3CTFA 4G0IA 1GTIA 4MF5A 2QA1A 5ID2A 2HFDA 4HUAA 4GF0A 3F4SA 3ZVJD 4PX1A 2OADA 4V2LA 1XWAA 5ECSA 1SVOA 4D73B 1GSDA 4MDCA 1ZCPA 2C0DA 5DAKA 3DRNA 3EPTA 5H5SA 2L4QA 2GZZA 14GSA 2ON7A 2O89A 3BD2A 1TP9A 5J47A 3FR3A 2HSNB 3C7MA 4G0KA 2GSTA 2WVZA 1SKWB 1XCCA 4I2TA 1O8XA 1SJIA 3HXSA 2YWIA 5DALB 3GA4A 1S4BP 3GKKA 3VWWA 5ECLB 3LYPA 2VCVA 3Q18A 2IL3A 1DE1A 2O85A 2F8AA 2QC7A 3ERGA 5E59A 2J9HA 3EURA 3EWLA 3UVTA 4IW9A 3DXBA 2C4JA 2HZEB 1KNGA 4GQFA 4POLA 2B5XA 5GZZB 1QUWA 5IMAA 10GSA 2IFQA 5IMVA 4K2DA 3I43A 2K8VA 5JWQB 1NHOA 5IPHA 3PH9A 2DJ3A 1DE2A 4ID0A 5D9WA 4JBBA 3VLNA 3CWGA 4V2NA 1B9XC 1Z6NA 2REMA 3VK9A 5IMDA 4L5OA 1Z6MA 2MYGA 3W6GA 2HRAA 2GSSA 3CRUA 1B4PA 1X9MB 1BQ7A 2CQ9A 1PA3A 1WWJA 2OT3A 3AY8A 2B7JA 1G7EA 3VURA 1XFLA 5CRHA 1SENA 1OAZA 2HSHA 4KNDA 1URMA 1TW9A 19GSA 1M9AA 2TIRA 1GNWA 2H30A 3UAPA 4CDOA 1QGVA 2V6OA 5ECOB 2VL3A 3LGCA 1GNEA 2MMNA 5CAXA 4TN8A 3TOUA 4PGTA 2OACA 4KSMA 4GRFA 3OR5A 2X99A 4DVCA 1FHEA 4XS4B 4K2XA 2H75A 3M1GA 2HT9A 5IPGA 3IAS2 2LSTA 1JZDA 3Q74A 4XIHA 3VPTA 8GSSA 3EVIA 1S3CA 1XWKA 5D93A 4K7NA 4Z2TA 1TK8B 1EWXA 3HMJG 5JWRB 2WS2A 2C0FA 4YH2A 3ED3A 1SU9A 5JCUA 2GTUA 2LRTA 4BWQA 1B8XA 2GS3A 2A2SA 4PXOA 1JZWA 2DJKA 2EFCA 3L9SA 5G2ZA 4POMA 4WR4A 1BG5A 1N25A 4KSOA 3ISOA 1OE7A 3BOAA 1XVQA 2IMFA 2KUCA 5KN2A 1M7TA 1UN2A 2HYXA 3WT2A 4NWYA 5ECRB 2F51A 4NHWA 2B5YA 2XHFA 1XWGA 4TR0A 2E0QA 3ZRDA 2V1MA 3GNJA 3HVSA 4HU7A 2ALBA 2DIYA 4FO5A 3TOTA 3HHVA 1V57A 1Q4JA 3M0FA 2GT6A 1Y25A 1YF0A 4LMVA 4IELA 2VIMA 2EIOA 2H01A 4KA0A 2IFQB 4Z7XA 4ZL7A 4KDUA 3WT1A 1X5DA 2HRKA 2R2JA 3M9KA 2R4VA 1PN0A 2HSYA 2H1DA 1EOHA 2O7KA 3KXOA 3RHCA 3KEBA 5CRGA 3ZVJA 3BCIA 3IHQA 4DSRA 4V1Ag 1UVZA 4RI6A 4X43A 4IJ3A 2CAIA 1ZZYA 2HLSA 1YDKA 1THXA 1R26A 3ME8A 4EXJA 4HQSA 1RQMA 2NDOA 4HU9A 1HNCA 1SJZA 1ZYEA 3HKRA 2IJYA 3E9JB 3HYPA 4PNFA 1SL2B 4E8HA 5D8IA 4MH3A 4GSSA 1WJKA 2RUFA 1U88A 4FYCA 4K0NA 3TKSC 1OC9B 2HSMA 2C8UA 2H74A 3KJYA 4MJEA 2H0IA 3NZNA 1DBYA 4YKGA 3GH6A 2AV4A 4FH8A 1M9BA 1FOHA 3LXZA 3A5WA 6GSWA 1OC8A 2GGTA 2CVDA 1C72A 1U87A 4JR6A 5KOXA 1A0RP 1LBKA 2IMEA 5FHIA 2H73A 2OA7A 2VM2A 1FO5A 3BCKA 4O7HA 1BJXA 2B3SA 2KOKA 3G9BA 1FAAA 3IPZA 4HI7A 2PVQA 4YAVA 3F4TA 1PGTA 2O36A 3F3RA 5ECMB 3GSSA 5J41A 5JCGA 2HXKA 2LNTA 4QMKA 2NVLA 4AGSA 3RBTA 4LL1B 1K0AA 1PMTA 1YVLA 1SVMA 3QAVA 2LKUA 3HD5A 4EC0A 1TDIA 3CSHA 2X8GA 2VD0A 5B7CA 2NTOA 2K18A 2X8CA 3EMXA 1GSSA 4DSSA 1TJDA 2N5AA 1R7HA 1M3JA 5B8AA 3M9JA 2FGXA 3WGXA 4N0VA 5KN1A 3MWHA 2GZYA 3ZL5A 5CO3A 1JHBA 5F0GA 1GP1A 1G6WA 3MDKA 2AAWA 2WJUA 5IO0A 2YWOA 5BRTA 1X9SB 3MSZA 1VRSD 2VOCA 3EU3A 4D73A 2WRTA 4WETA 2OJLA 4HJMA 1N2AA 2QA2A 2WCIA 1OYJA 1HD2A 5KN0A 5KOWA 1GTAA 2DMLA 5HFKA 1BG1A 3WGDA 5IMFA 4WR5A 2HSNA 2K6VA 1U6TA 4GSTA 2N5FA 2QKEA 3DKSA 2IMDA 2VM1A 5DALA 2F8FA 2VD1A 12GSA 4L0WA 2GZPA 3NOFA 2KP2A 4TR3A 4EDZA 3WD6A 2X64A 1N8JA 2CX4A 3CBUA 4EIPA 4QQ7A 3HY2A 2YP6A 1YKAA 4EO3A 4X1UA 2H66A 3U5RE 1T00A 1THOA 1MDIA 2HZEA 2VL2A 4ZB9A 3H1NA 2M72A 2LS5A 3QMXA 4HS1A 3JCML 4L0UA 3Q6OA 6GSUA 4TXOB 5ECPB 3HVVA 2B5EA 4K6XA 2PGTA 4Q5QA 4JRRA 3IC8A 3TJFA 4AF2A 1I9DA 5ECIB 1AW9A 1U3AA 3HVXA 1WMJA 1SD9A 6GSTA 3PR8A 4ECCA 3APSA 3CXGA 1OVNA 3TKQA 3O76A 1NHYA 2DJJA 1JLVA 1YKCA 4IQAA 1A2MA 1AIUA 1TXXA 5KEJA 2J23A 3F9UA 2CZ2A 1Z9HA 3PPUA 1XW9A 3P8WA 3HJMA 4BL7B 4FYUA 2LQOA 2LV3A 2XPDA 3L9UA 4TVEA 3FZ9A 2FUG2 4ISDA 1XXUA 1TTZA 3IHGA 1W4VA 5F06A 3KCMA 5ABRA 1GLPA 1BF5A 2X4AA 4NXIA 3QAWA 4PQHA 3TGZA 1AQXA 3P90A 2F3MA 1ERTA 2OBKA 3EMPA 2FY6A 5C04A 1TOFA 4K8MA 11GSA 2HRNA 2FCHA 4BIKA 3V1WA 2O8VB 5IM9A 4XS4A 3L78A 4OO5A 4XS1A 4BVYB 1TK5B 4HQZA 1ACVA 2YPMA 4POKA 3UBLA 2VCQA 1PRXA 1ZYNA 2IPAA 2V6KA 4LL4B 1QXHA 4PURA 1X9WB 4ECBA 1EV4A 2E7PA 4WEYA 2CAQA 3D4TA 4PNGA 1BX9A 3VI5A 3VWXA 4Q5NA 2H1AA 3QFAC 2K8SA 1G6YA 3FY7A 1ZL9A 1ERUA 1SL1B 5DQSA 3DVWA 4XTSA 9GSSA 2MMZA 3VWVA 4JEDA 2FA8A 4Q5FA 4HDEA 4FQUA 1F37A 2JU5A 5J5NA 4N10A 4EDYA 3UARA 1E2YA 5JCWA 2GSRA 3DVXA 2VCTA 3GIXA 3H93A 4ECJA 2A4VA 2OE0A 5A4VA 1VF2A 2JL4A 4EF0A 2XBIA 3FR9A 1IYHA 3GYKA 5AN1A 2JZRA 3GURA 2DLXA 4OO4A 2VCXA 2NBSA 1CQGA 2ZNMA 4PUFC 2IN3A 4NAXA 1XW5A 3M3MA 4KW6A 3DEXA 4ML1A 1FOVA 5B8BA 2GDRA 2L5LA 13GSA 4ML6A 2LUSA 4E8EA 2WVYA 1PD21 4K5RA 1WRYA 1BAYA 4AKHA 2I1UA 7GSSA 4G0LA 4AJ8A 3IBHA 3J7Yk 3KTLA 2AYTA 5H5RA 4WKWA 4GLTA 3HZ8A 4X0XA 4AI6A 6GSXA 4V2MA 4ULXA 2HI7A 2DJ0A 2FNOA 4KAEA 1ST9A 4RQRA 4AKIA 4J57E 2GLRA 2WVXB 4MH2A 2JACA 4H86A 2H19A 1A0FA 5A4WA 3FMWA 4WXTA 4TRXA 1J08A 1OC9A 2EFHA 5LNKe 1IYIA 4L5LA 2R0PA 4I8BA 4DSQA 4GDFA 1EP8A 1KEBA 4Z2RA 1JZOA 4XHMA 1X5EA 5B6NA 3ZTLA 2L4CA 3QCPA 3S9FA 1EGOA 4KE3A 3HVNA 3ZFLA 5CRDA 1GLQA 4ZB8A 2WW0A 1GTBA 1OC3A 2LEGA 4MPFA 4NHZA 1DSBA 3SBCA 4HSCX 4O5UA 1NSWA 2PU9C 3UIWA 2YNXA 1F2EA 1XBSA 2RM5A 3I6AA 2H6YA 2KHPA 3QR6A 1VF3A 3CHXC 3ZREA 4K7IA 2M46A 4K9ZA 1B9YC 2QSIA 4J2FA 3RHBA 4KF9A 3LQ7A 3BJ5A 3IK9A 3GV1A 5DJLA 5F05A 1O81A 3ZITA 5ECHB 2YZHA 5HFIA 3F63A 1A2JA 5D73A 3F6DA 1TRUA 3C1RA 3P2AA 1TU7A 3TDGA 4W66A 3GKXA 3FRCA 2GT5A 4AKGA 2GVPA 4AJ6A 4QL9A 2OE1A 1VGLA 2WB9A 1RW1A 4BPYA 1ZYPA 3E0UA 4PQIA 2PMTA 3LG6A 1ZYQB 4OCFA 6GSSA 3F8UA 4PHZC 1MDJA 3LWAA 1ILOA 3IA1A 5G5FA 3TUEA 4YQVA 3ZMKA 3PINA 1HNBA 2H71A 3LSZA 3UJ1A 3L4NA 5E4WA 1GSUA 1T7PB 3FK8A 4EE0A 1PKWA 3D5JA 3MIXA 5H5QA 3I69A 4ZBAA 2VO4A 5DDLA 4F82A 1GTUA 2JADA 1NW2A 2HE3A 5G5EA 5HFGA 1SVLA 1XPVA 2LJRA 20GSA 2FWEA 2LRCA 2OE3A 3KMNA 4RUVA 3C71A 4IHUA 3GH9A 2IWTA 1M2AA 1AUCA 2AJQB 3RPPA 4G10A 3P7XA 3QOUA 2E2MA 2I9HA 5GSSA 2RLIA 2YWNA 5A1NB 4JE1A 1GULA 1SKRB 3A3TA 3J7Yb 1AXDA 4TXOA 3D4MA 2A2RA 2GSQA 4KUNA 3DIEA 6GSVA 1ERVA 1XOBA 2FWFA 1ML6A 2FWHA 4GSNA 2A4HA 1SK2A 3W8JA 1K0CA 5A5HB 4HOJA 1ZMAA 3CYNA 4BL7A 5EL8A 1F9MA 3DWVA 4KCAA 1MD4A 5B6MA 2UZ8A 3F6FA 2H0GA 1O6JA 2PUKC 4PTSA 1VF1A 3G7IA 3IOSA 1B4QA 5AIVA 3EYTA 4WF4A 3D0ZA 4GXZA 3QPMA 1TRSA 1F3AA 3PGTA 2YOIA 1FB0A 2YCDA 4IP6A 5GAPD 4ZBDA 2L6DA 4XRAA 5CRWA 5A5KA 3UBKA 3GMFA 2OKAA 2YZUA 1YEXA 3VWUA 2EIQA 6GSYA 2EIRA 1SK0A 4BVYA 5G1LA 3RDWA 5CREA 3H79A 3HZ4A 5EPFA 3TJKA 4DEJA 2R5GA 2XC2A 1LU4A 4XCSA 1SL0B 3G7JA 1M99A 1V98A 2VLVA 3L9VA 1XOAA 3TRXA 2LRNA 4PI0C 5G31A 2G2QA 2DC5A 3TKSA 1SYXA 2C3NA 4OD7A 3GKNA 3RAZA 2L6CA 4OWYA 5J4UA 4MJBA 2E2GA 1YY7A 3TRQA 4YQMA 1BYEA 1JFUA 4ZIJA 2KP1A 2R37A 1DUGA 2ES7A 3TJGA 1O7UA 4POBA 1SD8A 1PL2A 2LQQA 2I3YA 3F0IA 3Q19A 1PX6A 5DCGA 4KCEA 2CA8A 3N9JA 3KP9A 1PX7A 3DYRA 1K3OA 3HJOA 1I5GA 2KLXA 1K3LA 4G2EA 4N0ZA 3FZ4A 2FLSA 3O6TA 2G0FA 2CT6A 3APQA 3W8SA 1HQOA 4EIQA 3A2XA 3GFKA 3D22A 5HR0A 4JZQA 5EVOA 3ERWA 5J9BA 5A4UA 2O3EA 4N3ZA 3KIJA 4BA7A 4CW9A 2C3QA 3UEMA 3VI7A 3M8NA 3LJRA 4I5QA 1AQVA 3CMIA 1CQHA 1Q98A 5ELGA 4YQUA 5BMUA 4OFMA 4WBJA 5IOXA 2WDUA 5HR1A 2O87A 3H4KA 4IBPA 3UVHA 4ZL9A 2UV8G 2JZSA 5D9TA 4OMVA 2WVXA 18GSA 3KH7A 1GUMA 1RK4A 2CVKA 1A23A 1QMVA 3IV4A 2AB6A 5HQPA 4HZ2A 1SYRA 1AQWA 2DJ1A 3FEUA 1T3BA 4ILFA 1TI3A 4ZB6A 5HR3A 4CHSA 4EKZA 3LFLA 2WULA 3IXRA 2MZCA 4CY8A 4F03A 3ME7A 3FZAA 4MNNA 1FG4A 2L59A 1SK1A 4WBRD 4JU5A 1X0RA 4BWSA 4MF6A 2V2GA 3GTUB 1O8WA 2YV9A 2LJAA 3GUSA 4V1Ap 3BBYA 1E6BA 1XWBA 1XWCA 3IR4A 1F6MC 1K0OA 3TJBA 1QK8A 3QFBC 1FB6A 2EFEA 3UMAA 2JZTA 1BEDA 4RQXA 2LNSA 3IC4A 4CY6A 1A8YA 17GSA 4IVFA 4QL7A 3TKPA 2YANA 1S3DA 4F9ZA 2VCZA 4MPGA 3G7YA 2R6KA 3CSJA 3QAGA 4LA1A 5A34B 5J40A 1WP0A 2O5VA 5FWGA 2H8LA 1TXUA 4XRDA 3EE2A 1GUHA 2ZCTA 3C73A 1K0BA 4ACSA 3GN3A 1WE0A 1GSFA 4PUAA 1X5CA 1XG8A 1YF1A 2B1KA 1B48A 1Y6EA 2C1YA 2QGVA 2DSAA 2H1GA 2FHEA 4O92A
chains in the Genus database with same CATH topology
4KH7A 1J9BA 5IOWA 3KH9A 2XBQA 4Z2UA 1W89A 5ENUA 2B6MA 3QD9A 3GRXA 1V40A 4HZ4A 1SJ6A 4EUYA 4MA9A 3GL5A 1YQ1A 1T4ZA 1ON4A 3D21A 1TI1A 2PWJA 2N5BA 1TRVA 5FT3A 3TCOA 3FYGA 2B7KA 5J4YA 1YEPA 5BMUB 3ZMLA 1TU8A 3NIVA 1K0DA 3TKSE 4KX4A 2RM6A 3VPQA 1QQ2A 5J9CA 5GSTA 4IQ1A 2I4AA 4O5QA 4F2IA 4HEA2 5C00A 5AISA 3N5OA 4IGJA 4AJ7A 4NPBA 2H76A 5A1NA 2PPTA 1ABAA 5DBQA 3EC3A 5IMCA 2IIYA 3A2WA 4X4JA 2AHEA 1ERWA 2OBIA 4G01A 3GKMA 1EZKA 4ZB7A 4J56E 2VAFA 4MJAA 2D2ZA 4TR1B 3CSIA 4I6XA 4P3YB 1Z5YE 1FW1A 3I9V2 4MJCA 3FW2A 2CVBA 4MCUA 5J3RA 3US3A 5G30A 4A5PA 5INYA 1GRXA 1K0MA 3CTGA 5ECKB 2H0HA 3FHKA 1TK0B 4YKFA 5IMZA 5A5HA 1PQNA 3LEFA 4N11A 2NPBA 1XZOA 5DJMA 3F3QA 3TJJA 4MZCA 5ID2B 1XVWA 2A2PA 3R2QA 1OKDA 4TOPA 4K1FA 1MD3A 5DAKB 2PERA 2WGRA 2DKHA 5D9XA 1JLWA 2IMIA 3F4RA 1XW6A 2GQLA 1UA5A 4I97A 1EEJA 1Z3EA 1MEKA 1ZOFA 1V2AA 1TRWA 3A2VA 1M0UA 4XS6A 4KDXA 2RUEA 4I2UA 4ICYA 3TU3B 2L5OA 4GWRA 2DJ2A 3D6IA 5L71A 4IJIA 4MK3A 2DKIA 4O5RA 3IK7A 1J0FA 1GUKA 1OE8A 4IKHA 3R3EA 2VLTA 5EY6A 4USSA 3IAM2 2PN8A 1AAZA 1G0TA 2HNLA 1M2BA 5CP1A 3RPNA 3CRTA 1LJRA 5ECNB 2CV4A 5CYYA 1MTCA 5F8BA 4NV5A 1G7OA 3TB2A 2LJKA 1F3BA 2H6ZA 1UC7A 4ZXGA 3HDCA 2VLUA 3HCZA 3L0HA 4BVXA 2JSZA 1FVKA 2RIIA 3LYKA 2MMOA 3MAKA 4GCIA 2H1LA 2K9FA 4TXVA 4TKYA 1HYUA 3KP8A 2DMMA 1EV9A 2TRXA 2P5RA 4EVMA 2HZFA 1QFNA 3EU4A 4YAPA 1Y1UA 1V58A 2GQMA 4ECIA 4KDYA 2F9SA 4PQ1A 1PKZA 4MLYA 5D9VA 4MF7A 1JZRA 2JSYA 4MZBA 2B1LA 5GAND 3ZZXA 1H75A 1KBNA 2VKZG 1R4WA 4KB3A 4JR4A 2MBSA 4EL1A 1YZXA 2YJHA 1GH2A 4FIWA 3GX8A 3KMOA 2YN1A 3DMLA 1WPIA 4K5SA 1TKDB 3GL3A 1H4OA 2Z9SA 4TW5A 2IMKA 3LORA 1GL8A 3MNGA 5KN3A 2R3XA 2H72A 1EOGA 5DCHA 2ON5A 2L57A 2H1BA 4N30A 2TRCP 1WIKA 5AIXA 2VL2C 3DD3A 1AC1A 4HJ2A 1GWCA 4NV2A 1T4YA 3U6VA 5D96A 3FZ5A 3KM6A 1EP7A 1PSQA 2WFCA 3UOMA 2R0GA 2YWMA 3GTUA 1U3IA 4OFNA 3LW9A 3ZIJA 2LTKA 3GX0A 2FWGA 3KTBA 2I81A 3FKFA 5IO2A 2XPEA 1USBA 2EFDA 1R5PA 4K0GA 2P0GA 1MDKA 3TKRA 2YJ7A 2C0EA 5IIZA 1R5AA 5G1KA 1SKSB 2YV7A 1T8EB 1EEMA 3SWLA 1GSEA 2P5QA 4IS0A 2H6XA 2R0CA 4MMMA 3IDVA 5F07A 4G19A 4BVXB 1YJ6A 2C80A 2BJXA 3ZYWA 2HRKB 3KGKA 4ZILA 3A5IA 3KZQA 4LMWA 1Z7PA 2DBCA 3E3EA 3MYDA 1ZGNA 4OCEA 2C0GA 5A34A 5CNWA 1VF4A 2C3TA 4O32A 5J4VA 2M80A 2V41A 4OFTA 1K3YA 3WYWA 3QDNA 1GSYA 5DQYA 16GSA 1S3AA 2VL9A 5IQYA 4MZWA 1PL1A 2H70A 4ZL8A 3FR6A 3ZFBA 1A8LA 5AGYA 4RI7A 3APOA 1KTEA 3ZIVA 3LXTA 22GSA 2MBTA 2BMXA 2VCWA 3IE3A 2BTOT 3ERFA 4K7OA 4L8EA 3K8NA 1OKTA 4GQCA 4FYBA 4E68A 1WOUA 1O85A 2HRFA 1A24A 2FD3A 4G9HA 4NMUA 2HSMB 4MP4A 5DVBA 4GTUA 4KGIA 2DIZA 1V9WA 1FVJA 3C8EA 2PVOC 5LCZA 5ELAA 2EC4A 3KD0A 3UL3A 3GHAA 3IRAA 3C1SA 2WZ9A 3EINA 3VFIA 3H8QA 3ZLPA 5JWOB 3HA9A 4TR4A 2CZ3A 1K0NA 2CX3A 3DGQA 1EGRA 2X8HA 4IP1A 4MABA 2ZUPA 2VUPA 4F0CA 2MMAA 5LD0A 5COHA 1A2LA 4F0BA 1Z7RA 2P31A 2GQKA 2X49A 2FA4A 3O3TA 1XIYA 1PN9A 1T1VA 4TR1A 4AKXB 1O73A 2HQTA 4ZBBA 2PBJA 3HJPA 5HR2A 4DSSB 4LLRA 5ECQB 3WGEA 4IN0A 1M2DA 1GSQA 4Q5RA 4WF5A 1HNAA 3GSTA 2AUVA 1NM3A 3TRPA 2V32A 3CTFA 4G0IA 1GTIA 4MF5A 2QA1A 5ID2A 2HFDA 4HUAA 4GF0A 3F4SA 3ZVJD 4PX1A 2OADA 4V2LA 1XWAA 5ECSA 1SVOA 4D73B 1GSDA 4MDCA 1ZCPA 2C0DA 5DAKA 3DRNA 3EPTA 5H5SA 2L4QA 2GZZA 14GSA 2ON7A 2O89A 3BD2A 1TP9A 5J47A 3FR3A 2HSNB 3C7MA 4G0KA 2GSTA 1SKWB 1XCCA 4I2TA 1O8XA 1SJIA 3HXSA 2YWIA 5DALB 3GA4A 3GKKA 3VWWA 5ECLB 3LYPA 2VCVA 3Q18A 2IL3A 1DE1A 2O85A 2F8AA 2QC7A 3ERGA 5E59A 2J9HA 3EURA 3EWLA 3UVTA 4IW9A 3DXBA 2C4JA 2HZEB 1KNGA 4GQFA 4POLA 2B5XA 5GZZB 1QUWA 5IMAA 10GSA 2IFQA 5IMVA 4K2DA 3I43A 2K8VA 5JWQB 1NHOA 5IPHA 3PH9A 2DJ3A 1DE2A 4ID0A 5D9WA 4JBBA 3VLNA 3CWGA 4V2NA 1B9XC 1Z6NA 2REMA 3VK9A 5IMDA 4L5OA 1Z6MA 2MYGA 3W6GA 2HRAA 2GSSA 3CRUA 1B4PA 1X9MB 1BQ7A 2CQ9A 1PA3A 1WWJA 2OT3A 3AY8A 2B7JA 1G7EA 3VURA 1XFLA 5CRHA 1SENA 1OAZA 2HSHA 4KNDA 1URMA 1TW9A 19GSA 1M9AA 2TIRA 1GNWA 2H30A 3UAPA 4CDOA 1QGVA 2V6OA 5ECOB 2VL3A 3LGCA 1GNEA 2MMNA 5CAXA 4TN8A 3TOUA 4PGTA 2OACA 4KSMA 4GRFA 3OR5A 2X99A 4DVCA 1FHEA 4XS4B 4K2XA 2H75A 3M1GA 2HT9A 5IPGA 3IAS2 2LSTA 1JZDA 3Q74A 4XIHA 3VPTA 8GSSA 3EVIA 1S3CA 1XWKA 5D93A 4K7NA 4Z2TA 1TK8B 1EWXA 3HMJG 5JWRB 2WS2A 2C0FA 4YH2A 3ED3A 1SU9A 5JCUA 2GTUA 2LRTA 4BWQA 1B8XA 2GS3A 2A2SA 4PXOA 1JZWA 2DJKA 2EFCA 3L9SA 5G2ZA 4POMA 4WR4A 1BG5A 1N25A 4KSOA 3ISOA 1OE7A 3BOAA 1XVQA 2IMFA 2KUCA 5KN2A 1M7TA 1UN2A 2HYXA 3WT2A 4NWYA 5ECRB 2F51A 4NHWA 2B5YA 2XHFA 1XWGA 4TR0A 2E0QA 3ZRDA 2V1MA 3GNJA 3HVSA 4HU7A 2ALBA 2DIYA 4FO5A 3TOTA 3HHVA 1V57A 1Q4JA 3M0FA 2GT6A 1Y25A 1YF0A 4LMVA 4IELA 2VIMA 2EIOA 2H01A 4KA0A 2IFQB 4Z7XA 4ZL7A 4KDUA 3WT1A 1X5DA 2HRKA 2R2JA 3M9KA 2R4VA 1PN0A 2HSYA 2H1DA 1EOHA 2O7KA 3KXOA 3RHCA 3KEBA 5CRGA 3ZVJA 3BCIA 3IHQA 4DSRA 4V1Ag 1UVZA 4RI6A 4X43A 4IJ3A 2CAIA 1ZZYA 2HLSA 1YDKA 1THXA 1R26A 3ME8A 4EXJA 4HQSA 1RQMA 2NDOA 4HU9A 1HNCA 1SJZA 1ZYEA 3HKRA 2IJYA 3E9JB 3HYPA 4PNFA 1SL2B 4E8HA 5D8IA 4MH3A 4GSSA 1WJKA 2RUFA 1U88A 4FYCA 4K0NA 3TKSC 1OC9B 2HSMA 2C8UA 2H74A 3KJYA 4MJEA 2H0IA 3NZNA 1DBYA 4YKGA 3GH6A 2AV4A 4FH8A 1M9BA 1FOHA 3LXZA 3A5WA 6GSWA 1OC8A 2GGTA 2CVDA 1C72A 1U87A 4JR6A 5KOXA 1A0RP 1LBKA 2IMEA 5FHIA 2H73A 2OA7A 2VM2A 1FO5A 3BCKA 4O7HA 1BJXA 2B3SA 2KOKA 3G9BA 1FAAA 3IPZA 4HI7A 2PVQA 4YAVA 3F4TA 1PGTA 5ECMB 3F3RA 5J41A 3GSSA 5JCGA 2HXKA 2LNTA 4QMKA 2NVLA 4AGSA 3RBTA 4LL1B 1K0AA 1PMTA 1YVLA 1SVMA 3QAVA 2LKUA 3HD5A 4EC0A 1TDIA 3CSHA 2X8GA 2VD0A 5B7CA 2NTOA 2K18A 2X8CA 3EMXA 1GSSA 4DSSA 1TJDA 2N5AA 1R7HA 5B8AA 3M9JA 2FGXA 3WGXA 4N0VA 5KN1A 3MWHA 2GZYA 3ZL5A 5CO3A 1JHBA 5F0GA 1GP1A 1G6WA 3MDKA 2AAWA 2WJUA 5IO0A 2YWOA 5BRTA 1X9SB 3MSZA 1VRSD 2VOCA 3EU3A 4D73A 2WRTA 4WETA 2OJLA 4HJMA 1N2AA 2QA2A 2WCIA 1OYJA 1HD2A 5KN0A 5KOWA 1GTAA 2DMLA 5HFKA 1BG1A 3WGDA 5IMFA 4WR5A 2HSNA 2K6VA 1U6TA 4GSTA 2N5FA 2QKEA 3DKSA 2IMDA 2VM1A 5DALA 2F8FA 2VD1A 12GSA 4L0WA 2GZPA 3NOFA 2KP2A 4TR3A 4EDZA 3WD6A 2X64A 1N8JA 2CX4A 3CBUA 4EIPA 4QQ7A 3HY2A 2YP6A 1YKAA 4EO3A 4X1UA 2H66A 3U5RE 1T00A 1THOA 1MDIA 2HZEA 2VL2A 4ZB9A 3H1NA 2M72A 2LS5A 3QMXA 4HS1A 3JCML 4L0UA 3Q6OA 6GSUA 4TXOB 5ECPB 3HVVA 2B5EA 4K6XA 2PGTA 4Q5QA 4JRRA 3IC8A 3TJFA 4AF2A 1I9DA 5ECIB 1AW9A 1U3AA 3HVXA 1WMJA 1SD9A 6GSTA 3PR8A 4ECCA 3APSA 3CXGA 1OVNA 3TKQA 3O76A 1NHYA 2DJJA 1JLVA 1YKCA 4IQAA 1A2MA 1AIUA 1TXXA 5KEJA 2J23A 3F9UA 2CZ2A 1Z9HA 3PPUA 1XW9A 3P8WA 3HJMA 4BL7B 4FYUA 2LQOA 2LV3A 2XPDA 3L9UA 4TVEA 3FZ9A 2FUG2 4ISDA 1XXUA 1TTZA 3IHGA 1W4VA 5F06A 3KCMA 5ABRA 1GLPA 1BF5A 2X4AA 4NXIA 3QAWA 4PQHA 3TGZA 1AQXA 3P90A 2F3MA 1ERTA 2OBKA 3EMPA 2FY6A 5C04A 1TOFA 4K8MA 11GSA 2HRNA 2FCHA 3V1WA 2O8VB 5IM9A 4XS4A 3L78A 4OO5A 4XS1A 4BVYB 1TK5B 4HQZA 1ACVA 2YPMA 4POKA 3UBLA 2VCQA 1PRXA 1ZYNA 2IPAA 2V6KA 4LL4B 1QXHA 4PURA 1X9WB 4ECBA 1EV4A 2E7PA 4WEYA 2CAQA 3D4TA 4PNGA 1BX9A 3VI5A 3VWXA 4Q5NA 2H1AA 3QFAC 2K8SA 1G6YA 3FY7A 1ZL9A 1ERUA 1SL1B 5DQSA 3DVWA 4XTSA 9GSSA 2MMZA 3VWVA 4JEDA 2FA8A 4Q5FA 4HDEA 4FQUA 1F37A 2JU5A 5J5NA 4N10A 4EDYA 3UARA 1E2YA 5JCWA 2GSRA 3DVXA 2VCTA 3GIXA 3H93A 4ECJA 2A4VA 2OE0A 5A4VA 1VF2A 2JL4A 4EF0A 2XBIA 3FR9A 1IYHA 3GYKA 5AN1A 2JZRA 3GURA 2DLXA 4OO4A 2VCXA 2NBSA 1CQGA 2ZNMA 4PUFC 2IN3A 4NAXA 1XW5A 3M3MA 4KW6A 3DEXA 4ML1A 1FOVA 5B8BA 2GDRA 2L5LA 13GSA 4ML6A 2LUSA 4E8EA 1PD21 4K5RA 1WRYA 1BAYA 4AKHA 2I1UA 7GSSA 4G0LA 4AJ8A 3IBHA 3J7Yk 3KTLA 2AYTA 5H5RA 4WKWA 4GLTA 3HZ8A 4X0XA 4AI6A 6GSXA 4V2MA 4ULXA 2HI7A 2DJ0A 2FNOA 4KAEA 1ST9A 4RQRA 4AKIA 4J57E 2GLRA 4MH2A 2JACA 4H86A 2H19A 1A0FA 5A4WA 3FMWA 4WXTA 4TRXA 1J08A 1OC9A 2EFHA 5LNKe 1IYIA 4L5LA 2R0PA 4I8BA 4DSQA 4GDFA 1EP8A 1KEBA 4Z2RA 1JZOA 4XHMA 1X5EA 5B6NA 3ZTLA 2L4CA 3QCPA 3S9FA 1EGOA 4KE3A 3ZFLA 5CRDA 1GLQA 4ZB8A 1GTBA 1OC3A 2LEGA 4MPFA 4NHZA 1DSBA 3SBCA 4O5UA 1NSWA 2PU9C 3UIWA 2YNXA 1F2EA 1XBSA 2RM5A 3I6AA 2H6YA 2KHPA 3QR6A 1VF3A 3ZREA 4K7IA 2M46A 4K9ZA 1B9YC 2QSIA 4J2FA 3RHBA 4KF9A 3LQ7A 3BJ5A 3IK9A 3GV1A 5DJLA 5F05A 1O81A 3ZITA 5ECHB 2YZHA 5HFIA 3F63A 1A2JA 5D73A 3F6DA 1TRUA 3C1RA 3P2AA 1TU7A 3TDGA 4W66A 3GKXA 3FRCA 2GT5A 4AKGA 2GVPA 4AJ6A 4QL9A 2OE1A 1VGLA 2WB9A 1RW1A 4BPYA 1ZYPA 3E0UA 4PQIA 2PMTA 3LG6A 1ZYQB 4OCFA 6GSSA 3F8UA 1MDJA 3LWAA 1ILOA 3IA1A 5G5FA 3TUEA 4YQVA 3ZMKA 3PINA 1HNBA 2H71A 3LSZA 3UJ1A 3L4NA 5E4WA 1GSUA 1T7PB 3FK8A 4EE0A 1PKWA 3D5JA 3MIXA 5H5QA 3I69A 4ZBAA 2VO4A 5DDLA 4F82A 1GTUA 2JADA 1NW2A 2HE3A 5G5EA 5HFGA 1SVLA 1XPVA 2LJRA 20GSA 2FWEA 2LRCA 2OE3A 3KMNA 4RUVA 3C71A 4IHUA 3GH9A 2IWTA 1M2AA 1AUCA 2AJQB 3RPPA 4G10A 3P7XA 3QOUA 2E2MA 2I9HA 5GSSA 2RLIA 2YWNA 5A1NB 4JE1A 1GULA 1SKRB 3A3TA 3J7Yb 1AXDA 4TXOA 3D4MA 2A2RA 2GSQA 4KUNA 3DIEA 6GSVA 1ERVA 1XOBA 2FWFA 1ML6A 2FWHA 4GSNA 2A4HA 1SK2A 3W8JA 1K0CA 5A5HB 4HOJA 1ZMAA 3CYNA 4BL7A 5EL8A 1F9MA 3DWVA 4KCAA 1MD4A 5B6MA 2UZ8A 3F6FA 2H0GA 1O6JA 2PUKC 4PTSA 1VF1A 3G7IA 3IOSA 1B4QA 5AIVA 3EYTA 4WF4A 3D0ZA 4GXZA 3QPMA 1TRSA 1F3AA 3PGTA 2YOIA 1FB0A 2YCDA 4IP6A 5GAPD 4ZBDA 2L6DA 4XRAA 5CRWA 5A5KA 3UBKA 3GMFA 2OKAA 2YZUA 1YEXA 3VWUA 2EIQA 6GSYA 2EIRA 1SK0A 4BVYA 5G1LA 3RDWA 5CREA 3H79A 3HZ4A 5EPFA 3TJKA 4DEJA 2R5GA 2XC2A 1LU4A 4XCSA 1SL0B 3G7JA 1M99A 1V98A 2VLVA 3L9VA 1XOAA 3TRXA 2LRNA 5G31A 2G2QA 2DC5A 3TKSA 1SYXA 2C3NA 4OD7A 3GKNA 3RAZA 2L6CA 4OWYA 5J4UA 4MJBA 2E2GA 1YY7A 3TRQA 4YQMA 1BYEA 1JFUA 4ZIJA 2KP1A 2R37A 1DUGA 2ES7A 3TJGA 1O7UA 4POBA 1SD8A 1PL2A 2LQQA 2I3YA 3F0IA 3Q19A 1PX6A 5DCGA 4KCEA 2CA8A 3N9JA 3KP9A 1PX7A 3DYRA 1K3OA 3HJOA 1I5GA 2KLXA 1K3LA 4G2EA 4N0ZA 3FZ4A 2FLSA 3O6TA 2G0FA 2CT6A 3APQA 3W8SA 1HQOA 4EIQA 3A2XA 3GFKA 3D22A 5HR0A 4JZQA 5EVOA 3ERWA 5J9BA 5A4UA 4N3ZA 3KIJA 4BA7A 4CW9A 2C3QA 3UEMA 3VI7A 3M8NA 3LJRA 4I5QA 1AQVA 3CMIA 1CQHA 1Q98A 5ELGA 4YQUA 5BMUA 4OFMA 4WBJA 5IOXA 2WDUA 5HR1A 2O87A 3H4KA 4IBPA 3UVHA 4ZL9A 2UV8G 2JZSA 5D9TA 4OMVA 18GSA 3KH7A 1GUMA 1RK4A 2CVKA 1A23A 1QMVA 3IV4A 2AB6A 5HQPA 4HZ2A 1SYRA 1AQWA 2DJ1A 3FEUA 1T3BA 4ILFA 1TI3A 4ZB6A 5HR3A 4CHSA 4EKZA 3LFLA 2WULA 3IXRA 2MZCA 4CY8A 4F03A 3ME7A 3FZAA 4MNNA 1FG4A 2L59A 1SK1A 4WBRD 4JU5A 1X0RA 4BWSA 4MF6A 2V2GA 3GTUB 1O8WA 2YV9A 2LJAA 3GUSA 4V1Ap 3BBYA 1E6BA 1XWBA 1XWCA 3IR4A 1F6MC 1K0OA 3TJBA 1QK8A 3QFBC 1FB6A 2EFEA 3UMAA 2JZTA 1BEDA 4RQXA 2LNSA 3IC4A 4CY6A 1A8YA 17GSA 4IVFA 4QL7A 3TKPA 2YANA 1S3DA 4F9ZA 2VCZA 4MPGA 3G7YA 2R6KA 3CSJA 3QAGA 4LA1A 5A34B 5J40A 1WP0A 2O5VA 5FWGA 2H8LA 1TXUA 4XRDA 3EE2A 1GUHA 2ZCTA 3C73A 1K0BA 4ACSA 3GN3A 1WE0A 1GSFA 4PUAA 1X5CA 1YF1A 1B48A 1Y6EA 2B1KA 2C1YA 2QGVA 2DSAA 2H1GA 2FHEA 4O92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KH7 A;  1J9B A;  5IOW A;  3KH9 A;  2XBQ A;  1W89 A;  5ENU A;  2B6M A;  3QD9 A;  3GRX A;  1V40 A;  4HZ4 A;  1SJ6 A;  4EUY A;  4MA9 A;  3GL5 A;  1YQ1 A;  1T4Z A;  1ON4 A;  3D21 A;  1TI1 A;  2PWJ A;  2N5B A;  1TRV A;  5FT3 A;  3TCO A;  3FYG A;  2B7K A;  1YEP A;  3ZML A;  1TU8 A;  3NIV A;  1K0D A;  3TKS E;  4KX4 A;  2RM6 A;  3VPQ A;  1QQ2 A;  5J9C A;  5GST A;  4IQ1 A;  2I4A A;  4F2I A;  4HEA 2;  5C00 A;  5AIS A;  3N5O A;  4IGJ A;  4AJ7 A;  4NPB A;  2H76 A;  2PPT A;  1ABA A;  5DBQ A;  3EC3 A;  5IMC A;  2IIY A;  3A2W A;  2AHE A;  1ERW A;  2OBI A;  3GKM A;  4J56 E;  1EZK A;  4MJA A;  2VAF A;  2D2Z A;  4TR1 B;  3CSI A;  4I6X A;  4P3Y B;  1Z5Y E;  1FW1 A;  3I9V 2;  4MJC A;  3FW2 A;  2CVB A;  4MCU A;  5J3R A;  3US3 A;  5G30 A;  5INY A;  1GRX A;  1K0M A;  3CTG A;  5ECK B;  2H0H A;  3FHK A;  1TK0 B;  5IMZ A;  1PQN A;  3LEF A;  4N11 A;  2NPB A;  1XZO A;  5DJM A;  3F3Q A;  3TJJ A;  4MZC A;  5ID2 B;  1XVW A;  3R2Q A;  1OKD A;  4TOP A;  4K1F A;  1MD3 A;  5DAK B;  2PER A;  2WGR A;  5D9X A;  1JLW A;  2IMI A;  3F4R A;  1XW6 A;  2GQL A;  1UA5 A;  4I97 A;  1EEJ A;  1Z3E A;  1MEK A;  1ZOF A;  1V2A A;  1TRW A;  3A2V A;  1M0U A;  4XS6 A;  4KDX A;  2RUE A;  4I2U A;  2L5O A;  4GWR A;  2DJ2 A;  3D6I A;  5L71 A;  4IJI A;  4MK3 A;  4O5R A;  3IK7 A;  1J0F A;  1GUK A;  1OE8 A;  4IKH A;  3R3E A;  2VLT A;  5EY6 A;  4USS A;  3IAM 2;  2PN8 A;  1AAZ A;  1G0T A;  2HNL A;  1M2B A;  5CP1 A;  3RPN A;  3CRT A;  1LJR A;  5ECN B;  2CV4 A;  5CYY A;  1MTC A;  5F8B A;  4NV5 A;  1G7O A;  3TB2 A;  2LJK A;  1F3B A;  2H6Z A;  1UC7 A;  4ZXG A;  2VLU A;  3HDC A;  3HCZ A;  3L0H A;  4BVX A;  2JSZ A;  1FVK A;  2RII A;  3LYK A;  2MMO A;  3MAK A;  4GCI A;  2K9F A;  4TXV A;  4TKY A;  1HYU A;  3KP8 A;  2DMM A;  1EV9 A;  2TRX A;  2P5R A;  4EVM A;  2HZF A;  1QFN A;  3EU4 A;  4YAP A;  1V58 A;  2GQM A;  4ECI A;  4KDY A;  2F9S A;  4PQ1 A;  1PKZ A;  4MLY A;  5D9V A;  4MF7 A;  1JZR A;  2JSY A;  4MZB A;  2B1L A;  5GAN D;  3ZZX A;  1H75 A;  1KBN A;  1R4W A;  4KB3 A;  4JR4 A;  2MBS A;  4EL1 A;  1YZX A;  2YJH A;  1GH2 A;  4FIW A;  3GX8 A;  3KMO A;  2YN1 A;  3DML A;  1WPI A;  1TKD B;  3GL3 A;  1H4O A;  2Z9S A;  4TW5 A;  2IMK A;  3LOR A;  1GL8 A;  3MNG A;  5KN3 A;  2R3X A;  2H72 A;  1EOG A;  5DCH A;  2ON5 A;  2L57 A;  2H1B A;  4N30 A;  2TRC P;  1WIK A;  5AIX A;  2VL2 C;  3DD3 A;  1AC1 A;  4HJ2 A;  1GWC A;  4NV2 A;  1T4Y A;  3U6V A;  5D96 A;  3FZ5 A;  3KM6 A;  1EP7 A;  1PSQ A;  2WFC A;  3UOM A;  2YWM A;  3GTU A;  1U3I A;  4OFN A;  3ZIJ A;  2LTK A;  3GX0 A;  2FWG A;  3KTB A;  2I81 A;  3FKF A;  5IO2 A;  2XPE A;  1USB A;  1R5P A;  4K0G A;  2P0G A;  1MDK A;  3TKR A;  2YJ7 A;  2C0E A;  5IIZ A;  1R5A A;  5G1K A;  1SKS B;  2YV7 A;  1T8E B;  1EEM A;  3SWL A;  1GSE A;  2P5Q A;  4IS0 A;  2H6X A;  4MMM A;  3IDV A;  5F07 A;  4G19 A;  4BVX B;  1YJ6 A;  2C80 A;  2BJX A;  3ZYW A;  2HRK B;  3KGK A;  4ZIL A;  3KZQ A;  4LMW A;  1Z7P A;  2DBC A;  3E3E A;  1ZGN A;  4OCE A;  2C0G A;  5CNW A;  1VF4 A;  2C3T A;  4O32 A;  2M80 A;  2V41 A;  4OFT A;  1K3Y A;  3WYW A;  3QDN A;  1GSY A;  5DQY A;  16GS A;  1S3A A;  2VL9 A;  5IQY A;  4MZW A;  1PL1 A;  2H70 A;  4ZL8 A;  3FR6 A;  3ZFB A;  1A8L A;  5AGY A;  4RI7 A;  3APO A;  1KTE A;  3ZIV A;  3LXT A;  22GS A;  2MBT A;  2BMX A;  2VCW A;  3IE3 A;  2BTO T;  3ERF A;  4K7O A;  4L8E A;  3K8N A;  1OKT A;  4GQC A;  4FYB A;  1WOU A;  1O85 A;  2HRF A;  1A24 A;  2FD3 A;  4G9H A;  4NMU A;  2HSM B;  4MP4 A;  5DVB A;  4GTU A;  4KGI A;  2DIZ A;  1V9W A;  1FVJ A;  3C8E A;  2PVO C;  5LCZ A;  5ELA A;  2EC4 A;  3KD0 A;  3UL3 A;  3GHA A;  3IRA A;  3C1S A;  2WZ9 A;  3EIN A;  3VFI A;  3H8Q A;  3ZLP A;  5JWO B;  3HA9 A;  4TR4 A;  2CZ3 A;  1K0N A;  2CX3 A;  3DGQ A;  1EGR A;  2X8H A;  4IP1 A;  4MAB A;  2ZUP A;  2VUP A;  4F0C A;  2MMA A;  5LD0 A;  5COH A;  1A2L A;  4F0B A;  1Z7R A;  2P31 A;  2GQK A;  2FA4 A;  3O3T A;  1XIY A;  1PN9 A;  1T1V A;  4TR1 A;  1O73 A;  2HQT A;  4ZBB A;  2PBJ A;  3HJP A;  5HR2 A;  4DSS B;  4LLR A;  5ECQ B;  3WGE A;  4IN0 A;  1M2D A;  1GSQ A;  4Q5R A;  4WF5 A;  1HNA A;  3GST A;  2AUV A;  1NM3 A;  3TRP A;  2V32 A;  3CTF A;  4G0I A;  1GTI A;  4MF5 A;  5ID2 A;  2HFD A;  4HUA A;  4GF0 A;  3F4S A;  3ZVJ D;  4PX1 A;  2OAD A;  4V2L A;  1XWA A;  5ECS A;  4D73 B;  1GSD A;  4MDC A;  1ZCP A;  2C0D A;  5DAK A;  3DRN A;  5H5S A;  2L4Q A;  2GZZ A;  14GS A;  2ON7 A;  2O89 A;  3BD2 A;  1TP9 A;  3FR3 A;  2HSN B;  3C7M A;  4G0K A;  2GST A;  1SKW B;  1XCC A;  4I2T A;  1O8X A;  1SJI A;  3HXS A;  2YWI A;  5DAL B;  3GA4 A;  3GKK A;  3VWW A;  5ECL B;  3LYP A;  2VCV A;  3Q18 A;  2IL3 A;  1DE1 A;  2O85 A;  2F8A A;  2QC7 A;  3ERG A;  5E59 A;  2J9H A;  3EUR A;  3EWL A;  3UVT A;  4IW9 A;  3DXB A;  2C4J A;  2HZE B;  1KNG A;  4GQF A;  4POL A;  2B5X A;  5GZZ B;  1QUW A;  5IMA A;  10GS A;  2IFQ A;  5IMV A;  4K2D A;  3I43 A;  2K8V A;  5JWQ B;  1NHO A;  5IPH A;  3PH9 A;  2DJ3 A;  1DE2 A;  4ID0 A;  5D9W A;  4JBB A;  3VLN A;  4V2N A;  1B9X C;  1Z6N A;  2REM A;  3VK9 A;  5IMD A;  4L5O A;  1Z6M A;  2MYG A;  3W6G A;  2HRA A;  2GSS A;  3CRU A;  1B4P A;  1X9M B;  1BQ7 A;  2CQ9 A;  1PA3 A;  1WWJ A;  3AY8 A;  2B7J A;  1G7E A;  3VUR A;  1XFL A;  5CRH A;  1SEN A;  1OAZ A;  2HSH A;  4KND A;  1URM A;  1TW9 A;  19GS A;  1M9A A;  2TIR A;  1GNW A;  2H30 A;  3UAP A;  4CDO A;  1QGV A;  2V6O A;  5ECO B;  2VL3 A;  3LGC A;  1GNE A;  2MMN A;  5CAX A;  4TN8 A;  3TOU A;  4PGT A;  2OAC A;  4KSM A;  4GRF A;  3OR5 A;  2X99 A;  4DVC A;  1FHE A;  4XS4 B;  2H75 A;  3M1G A;  2HT9 A;  5IPG A;  3IAS 2;  2LST A;  1JZD A;  3Q74 A;  4XIH A;  3VPT A;  8GSS A;  3EVI A;  1S3C A;  1XWK A;  5D93 A;  4K7N A;  1TK8 B;  1EWX A;  5JWR B;  2WS2 A;  2C0F A;  4YH2 A;  3ED3 A;  1SU9 A;  5JCU A;  2GTU A;  2LRT A;  4BWQ A;  1B8X A;  2GS3 A;  2A2S A;  4PXO A;  1JZW A;  2DJK A;  3L9S A;  5G2Z A;  4POM A;  4WR4 A;  1BG5 A;  4KSO A;  3ISO A;  1OE7 A;  3BOA A;  1XVQ A;  2IMF A;  2KUC A;  5KN2 A;  1M7T A;  1UN2 A;  2HYX A;  3WT2 A;  4NWY A;  5ECR B;  2F51 A;  4NHW A;  2B5Y A;  2XHF A;  1XWG A;  4TR0 A;  2E0Q A;  3ZRD A;  2V1M A;  3GNJ A;  3HVS A;  4HU7 A;  2ALB A;  2DIY A;  4FO5 A;  3TOT A;  3HHV A;  1V57 A;  1Q4J A;  3M0F A;  2GT6 A;  1Y25 A;  1YF0 A;  4LMV A;  4IEL A;  2VIM A;  2EIO A;  2H01 A;  4KA0 A;  2IFQ B;  4Z7X A;  4ZL7 A;  4KDU A;  3WT1 A;  1X5D A;  2HRK A;  2R2J A;  3M9K A;  2R4V A;  2HSY A;  2H1D A;  1EOH A;  2O7K A;  3KXO A;  3RHC A;  3KEB A;  5CRG A;  3ZVJ A;  3BCI A;  3IHQ A;  4DSR A;  4V1A g;  1UVZ A;  4RI6 A;  4X43 A;  4IJ3 A;  2CAI A;  1ZZY A;  2HLS A;  1YDK A;  1THX A;  1R26 A;  3ME8 A;  4EXJ A;  4HQS A;  1RQM A;  2NDO A;  4HU9 A;  1HNC A;  1SJZ A;  1ZYE A;  3HKR A;  2IJY A;  3E9J B;  3HYP A;  4PNF A;  1SL2 B;  4E8H A;  5D8I A;  4MH3 A;  4GSS A;  1WJK A;  2RUF A;  1U88 A;  4FYC A;  4K0N A;  3TKS C;  1OC9 B;  2HSM A;  2C8U A;  2H74 A;  3KJY A;  4MJE A;  2H0I A;  3NZN A;  1DBY A;  3GH6 A;  2AV4 A;  4FH8 A;  1M9B A;  3LXZ A;  3A5W A;  6GSW A;  1OC8 A;  2GGT A;  2CVD A;  1C72 A;  1U87 A;  4JR6 A;  1A0R P;  1LBK A;  2IME A;  5FHI A;  2H73 A;  2OA7 A;  2VM2 A;  1FO5 A;  3BCK A;  4O7H A;  1BJX A;  2B3S A;  2KOK A;  3G9B A;  1FAA A;  3IPZ A;  4HI7 A;  2PVQ A;  4YAV A;  3F4T A;  1PGT A;  5ECM B;  3F3R A;  5J41 A;  3GSS A;  5JCG A;  2HXK A;  2LNT A;  2NVL A;  4AGS A;  3RBT A;  4LL1 B;  1K0A A;  1PMT A;  3QAV A;  2LKU A;  3HD5 A;  4EC0 A;  1TDI A;  3CSH A;  2X8G A;  2VD0 A;  5B7C A;  2NTO A;  2K18 A;  2X8C A;  3EMX A;  1GSS A;  4DSS A;  1TJD A;  2N5A A;  1R7H A;  5B8A A;  3M9J A;  2FGX A;  3WGX A;  4N0V A;  5KN1 A;  3MWH A;  2GZY A;  3ZL5 A;  5CO3 A;  1JHB A;  5F0G A;  1GP1 A;  1G6W A;  3MDK A;  2AAW A;  2WJU A;  5IO0 A;  2YWO A;  1X9S B;  3MSZ A;  1VRS D;  2VOC A;  3EU3 A;  4D73 A;  2WRT A;  4WET A;  2OJL A;  4HJM A;  1N2A A;  2WCI A;  1OYJ A;  1HD2 A;  5KN0 A;  1GTA A;  2DML A;  5HFK A;  3WGD A;  5IMF A;  4WR5 A;  2K6V A;  1U6T A;  4GST A;  2N5F A;  2QKE A;  3DKS A;  2IMD A;  2VM1 A;  5DAL A;  2F8F A;  2VD1 A;  12GS A;  4L0W A;  2GZP A;  3NOF A;  2KP2 A;  4TR3 A;  4EDZ A;  3WD6 A;  2X64 A;  1N8J A;  2CX4 A;  3CBU A;  4QQ7 A;  3HY2 A;  2YP6 A;  1YKA A;  4EO3 A;  4X1U A;  2H66 A;  3U5R E;  1T00 A;  1THO A;  1MDI A;  2HZE A;  2VL2 A;  4ZB9 A;  3H1N A;  2M72 A;  2LS5 A;  3QMX A;  4HS1 A;  3JCM L;  4L0U A;  3Q6O A;  6GSU A;  4TXO B;  5ECP B;  3HVV A;  2B5E A;  4K6X A;  2PGT A;  4Q5Q A;  4JRR A;  3IC8 A;  3TJF A;  4AF2 A;  1I9D A;  5ECI B;  1AW9 A;  1U3A A;  3HVX A;  1WMJ A;  1SD9 A;  6GST A;  3PR8 A;  4ECC A;  3APS A;  3CXG A;  1OVN A;  3TKQ A;  3O76 A;  1NHY A;  2DJJ A;  1JLV A;  1YKC A;  4IQA A;  1A2M A;  1AIU A;  1TXX A;  5KEJ A;  2J23 A;  3F9U A;  2CZ2 A;  1Z9H A;  3PPU A;  1XW9 A;  3P8W A;  3HJM A;  4BL7 B;  4FYU A;  2LQO A;  2LV3 A;  2XPD A;  3L9U A;  4TVE A;  3FZ9 A;  2FUG 2;  4ISD A;  1XXU A;  1TTZ A;  1W4V A;  5F06 A;  3KCM A;  5ABR A;  1GLP A;  4NXI A;  3QAW A;  4PQH A;  3TGZ A;  1AQX A;  3P90 A;  2F3M A;  1ERT A;  2OBK A;  3EMP A;  2FY6 A;  5C04 A;  1TOF A;  4K8M A;  11GS A;  2HRN A;  2FCH A;  3V1W A;  2O8V B;  5IM9 A;  4XS4 A;  3L78 A;  4OO5 A;  4XS1 A;  4BVY B;  1TK5 B;  4HQZ A;  1ACV A;  2YPM A;  4POK A;  3UBL A;  2VCQ A;  1PRX A;  2IPA A;  2V6K A;  4LL4 B;  1QXH A;  4PUR A;  1X9W B;  4ECB A;  1EV4 A;  2E7P A;  4WEY A;  2CAQ A;  3D4T A;  4PNG A;  1BX9 A;  3VI5 A;  3VWX A;  4Q5N A;  2H1A A;  3QFA C;  2K8S A;  1G6Y A;  3FY7 A;  1ZL9 A;  1ERU A;  1SL1 B;  5DQS A;  3DVW A;  4XTS A;  9GSS A;  2MMZ A;  3VWV A;  4JED A;  2FA8 A;  4Q5F A;  4HDE A;  4FQU A;  1F37 A;  2JU5 A;  5J5N A;  4N10 A;  4EDY A;  3UAR A;  1E2Y A;  5JCW A;  2GSR A;  3DVX A;  2VCT A;  3GIX A;  3H93 A;  4ECJ A;  2A4V A;  2OE0 A;  5A4V A;  1VF2 A;  2JL4 A;  4EF0 A;  2XBI A;  3FR9 A;  1IYH A;  3GYK A;  5AN1 A;  2JZR A;  3GUR A;  2DLX A;  4OO4 A;  2VCX A;  2NBS A;  1CQG A;  2ZNM A;  4PUF C;  2IN3 A;  4NAX A;  1XW5 A;  3M3M A;  4KW6 A;  3DEX A;  4ML1 A;  1FOV A;  5B8B A;  2GDR A;  2L5L A;  13GS A;  4ML6 A;  2LUS A;  4E8E A;  1PD2 1;  1WRY A;  1BAY A;  2I1U A;  7GSS A;  4G0L A;  4AJ8 A;  3IBH A;  3J7Y k;  3KTL A;  2AYT A;  5H5R A;  4WKW A;  4GLT A;  3HZ8 A;  4X0X A;  6GSX A;  4V2M A;  4ULX A;  2HI7 A;  2DJ0 A;  2FNO A;  4KAE A;  1ST9 A;  4RQR A;  4J57 E;  2GLR A;  4MH2 A;  2JAC A;  4H86 A;  2H19 A;  1A0F A;  5A4W A;  4WXT A;  4TRX A;  1J08 A;  1OC9 A;  5LNK e;  1IYI A;  4L5L A;  4I8B A;  4DSQ A;  1EP8 A;  1KEB A;  1JZO A;  4XHM A;  1X5E A;  5B6N A;  3ZTL A;  2L4C A;  3QCP A;  3S9F A;  1EGO A;  4KE3 A;  3ZFL A;  5CRD A;  1GLQ A;  4ZB8 A;  1GTB A;  1OC3 A;  2LEG A;  4MPF A;  4NHZ A;  1DSB A;  3SBC A;  1NSW A;  2PU9 C;  3UIW A;  2YNX A;  1F2E A;  1XBS A;  2RM5 A;  3I6A A;  2H6Y A;  2KHP A;  3QR6 A;  1VF3 A;  3ZRE A;  4K7I A;  2M46 A;  4K9Z A;  1B9Y C;  2QSI A;  4J2F A;  3RHB A;  4KF9 A;  3LQ7 A;  3BJ5 A;  3IK9 A;  3GV1 A;  5DJL A;  5F05 A;  1O81 A;  3ZIT A;  5ECH B;  2YZH A;  5HFI A;  3F63 A;  1A2J A;  5D73 A;  3F6D A;  1TRU A;  3C1R A;  3P2A A;  1TU7 A;  3TDG A;  3GKX A;  3FRC A;  2GT5 A;  2GVP A;  4AJ6 A;  4QL9 A;  2OE1 A;  1VGL A;  2WB9 A;  1RW1 A;  4BPY A;  3E0U A;  4PQI A;  2PMT A;  3LG6 A;  1ZYQ B;  4OCF A;  6GSS A;  3F8U A;  1MDJ A;  3LWA A;  1ILO A;  3IA1 A;  5G5F A;  3TUE A;  4YQV A;  3ZMK A;  3PIN A;  1HNB A;  2H71 A;  3LSZ A;  3UJ1 A;  3L4N A;  5E4W A;  1GSU A;  1T7P B;  3FK8 A;  4EE0 A;  1PKW A;  3D5J A;  5H5Q A;  3I69 A;  4ZBA A;  2VO4 A;  5DDL A;  4F82 A;  1GTU A;  2JAD A;  1NW2 A;  2HE3 A;  5G5E A;  5HFG A;  1XPV A;  2LJR A;  20GS A;  2FWE A;  2LRC A;  2OE3 A;  3KMN A;  4RUV A;  3C71 A;  4IHU A;  3GH9 A;  2IWT A;  1M2A A;  1AUC A;  2AJQ B;  3RPP A;  4G10 A;  3P7X A;  3QOU A;  2E2M A;  2I9H A;  5GSS A;  2RLI A;  2YWN A;  4JE1 A;  1GUL A;  1SKR B;  3A3T A;  3J7Y b;  1AXD A;  4TXO A;  3D4M A;  2A2R A;  2GSQ A;  4KUN A;  3DIE A;  6GSV A;  1ERV A;  1XOB A;  2FWF A;  1ML6 A;  2FWH A;  4GSN A;  1SK2 A;  3W8J A;  1K0C A;  4HOJ A;  1ZMA A;  3CYN A;  4BL7 A;  5EL8 A;  1F9M A;  3DWV A;  4KCA A;  1MD4 A;  5B6M A;  2UZ8 A;  3F6F A;  2H0G A;  1O6J A;  2PUK C;  4PTS A;  1VF1 A;  3G7I A;  3IOS A;  1B4Q A;  5AIV A;  3EYT A;  4WF4 A;  3D0Z A;  4GXZ A;  3QPM A;  1TRS A;  1F3A A;  3PGT A;  2YOI A;  1FB0 A;  2YCD A;  4IP6 A;  5GAP D;  4ZBD A;  2L6D A;  4XRA A;  5CRW A;  5A5K A;  3UBK A;  3GMF A;  2OKA A;  2YZU A;  1YEX A;  3VWU A;  2EIQ A;  6GSY A;  2EIR A;  1SK0 A;  4BVY A;  5G1L A;  3RDW A;  5CRE A;  3H79 A;  3HZ4 A;  5EPF A;  3TJK A;  4DEJ A;  2R5G A;  2XC2 A;  1LU4 A;  4XCS A;  1SL0 B;  3G7J A;  1M99 A;  1V98 A;  2VLV A;  3L9V A;  1XOA A;  3TRX A;  2LRN A;  5G31 A;  2G2Q A;  2DC5 A;  3TKS A;  1SYX A;  2C3N A;  4OD7 A;  3GKN A;  3RAZ A;  2L6C A;  4OWY A;  5J4U A;  4MJB A;  2E2G A;  1YY7 A;  3TRQ A;  4YQM A;  1BYE A;  1JFU A;  4ZIJ A;  2KP1 A;  2R37 A;  1DUG A;  2ES7 A;  3TJG A;  1O7U A;  4POB A;  1SD8 A;  1PL2 A;  2LQQ A;  2I3Y A;  3F0I A;  3Q19 A;  1PX6 A;  5DCG A;  4KCE A;  2CA8 A;  3N9J A;  3KP9 A;  1PX7 A;  3DYR A;  1K3O A;  3HJO A;  1I5G A;  2KLX A;  1K3L A;  4G2E A;  4N0Z A;  3FZ4 A;  3O6T A;  2FLS A;  2G0F A;  2CT6 A;  3APQ A;  3W8S A;  1HQO A;  3A2X A;  3GFK A;  3D22 A;  5HR0 A;  4JZQ A;  5EVO A;  3ERW A;  5J9B A;  5A4U A;  3KIJ A;  4BA7 A;  4CW9 A;  2C3Q A;  3UEM A;  3VI7 A;  3M8N A;  3LJR A;  4I5Q A;  1AQV A;  3CMI A;  1CQH A;  1Q98 A;  5ELG A;  4YQU A;  5BMU A;  4OFM A;  4WBJ A;  5IOX A;  2WDU A;  5HR1 A;  2O87 A;  3H4K A;  4IBP A;  3UVH A;  4ZL9 A;  2JZS A;  5D9T A;  4OMV A;  18GS A;  3KH7 A;  1GUM A;  1RK4 A;  2CVK A;  1A23 A;  1QMV A;  3IV4 A;  2AB6 A;  5HQP A;  4HZ2 A;  1SYR A;  1AQW A;  2DJ1 A;  3FEU A;  1T3B A;  4ILF A;  1TI3 A;  4ZB6 A;  5HR3 A;  4CHS A;  4EKZ A;  3LFL A;  2WUL A;  3IXR A;  2MZC A;  4F03 A;  3ME7 A;  3FZA A;  1FG4 A;  2L59 A;  1SK1 A;  4WBR D;  4JU5 A;  1X0R A;  4BWS A;  4MF6 A;  2V2G A;  3GTU B;  1O8W A;  2YV9 A;  2LJA A;  3GUS A;  4V1A p;  3BBY A;  1E6B A;  1XWB A;  1XWC A;  3IR4 A;  1F6M C;  1K0O A;  3TJB A;  1QK8 A;  3QFB C;  1FB6 A;  3UMA A;  2JZT A;  1BED A;  4RQX A;  2LNS A;  3IC4 A;  1A8Y A;  17GS A;  4IVF A;  4QL7 A;  3TKP A;  2YAN A;  1S3D A;  4F9Z A;  2VCZ A;  4MPG A;  3G7Y A;  2R6K A;  3CSJ A;  3QAG A;  4LA1 A;  1WP0 A;  5FWG A;  2H8L A;  4XRD A;  3EE2 A;  1GUH A;  2ZCT A;  3C73 A;  1K0B A;  4ACS A;  3GN3 A;  1WE0 A;  1GSF A;  4PUA A;  1X5C A;  1YF1 A;  1B48 A;  1Y6E A;  2B1K A;  2C1Y A;  2QGV A;  2DSA A;  2H1G A;  2FHE A;  4O92 A; 
#chains in the Genus database with same CATH topology
 4KH7 A;  1J9B A;  5IOW A;  3KH9 A;  2XBQ A;  4Z2U A;  1W89 A;  5ENU A;  2B6M A;  3QD9 A;  3GRX A;  1V40 A;  4HZ4 A;  1SJ6 A;  4EUY A;  2WW1 A;  4MA9 A;  3GL5 A;  1YQ1 A;  1T4Z A;  1ON4 A;  3D21 A;  1S3R A;  1TI1 A;  2PWJ A;  2N5B A;  1TRV A;  5FT3 A;  3TCO A;  3FYG A;  2B7K A;  5J4Y A;  1YEP A;  5BMU B;  3ZML A;  1TU8 A;  3NIV A;  1K0D A;  3TKS E;  4KX4 A;  2RM6 A;  3VPQ A;  1QQ2 A;  5J9C A;  5GST A;  4IQ1 A;  2I4A A;  4O5Q A;  4F2I A;  4HEA 2;  5C00 A;  5AIS A;  3N5O A;  1M3I A;  4IGJ A;  4AJ7 A;  4NPB A;  2H76 A;  5A1N A;  2PPT A;  1ABA A;  5DBQ A;  3EC3 A;  5IMC A;  2IIY A;  3A2W A;  4X4J A;  2AHE A;  1ERW A;  2OBI A;  4G01 A;  3GKM A;  1EZK A;  4ZB7 A;  4J56 E;  2VAF A;  4MJA A;  2D2Z A;  4TR1 B;  3CSI A;  4I6X A;  4P3Y B;  4PI2 C;  1Z5Y E;  1FW1 A;  3I9V 2;  4MJC A;  3FW2 A;  2CVB A;  4MCU A;  5J3R A;  3US3 A;  5G30 A;  4A5P A;  5INY A;  1GRX A;  1K0M A;  3CTG A;  5ECK B;  3RGB C;  2H0H A;  3FHK A;  1TK0 B;  4YKF A;  5IMZ A;  5A5H A;  1PQN A;  3LEF A;  4N11 A;  2NPB A;  1XZO A;  5DJM A;  3F3Q A;  3TJJ A;  4MZC A;  1PFO A;  5ID2 B;  2WZS A;  1XVW A;  2A2P A;  3R2Q A;  1OKD A;  4TOP A;  4K1F A;  1MD3 A;  3CQF A;  5DAK B;  2PER A;  2WGR A;  2DKH A;  5D9X A;  1JLW A;  2IMI A;  3F4R A;  1XW6 A;  2GQL A;  1UA5 A;  4I97 A;  1EEJ A;  1Z3E A;  1MEK A;  1ZOF A;  1V2A A;  1TRW A;  3A2V A;  1M0U A;  4XS6 A;  4KDX A;  2RUE A;  4I2U A;  4ICY A;  1YEW C;  3TU3 B;  2L5O A;  4GWR A;  2DJ2 A;  3D6I A;  5L71 A;  4IJI A;  4MK3 A;  2DKI A;  4O5R A;  3IK7 A;  1J0F A;  1GUK A;  1OE8 A;  4IKH A;  3R3E A;  2VLT A;  1I1I P;  5EY6 A;  4USS A;  3IAM 2;  2PN8 A;  1AAZ A;  1G0T A;  2HNL A;  1M2B A;  5CP1 A;  3RPN A;  3CRT A;  1LJR A;  5ECN B;  2CV4 A;  5CYY A;  1MTC A;  5F8B A;  4NV5 A;  1G7O A;  3TB2 A;  2LJK A;  1F3B A;  2H6Z A;  1UC7 A;  4ZXG A;  3HDC A;  2VLU A;  3HCZ A;  3L0H A;  4BVX A;  2JSZ A;  1FVK A;  2RII A;  3LYK A;  2MMO A;  3MAK A;  4GCI A;  2H1L A;  2K9F A;  4TXV A;  4TKY A;  1HYU A;  3KP8 A;  2DMM A;  1EV9 A;  2TRX A;  2P5R A;  4EVM A;  2HZF A;  1QFN A;  3EU4 A;  4YAP A;  1Y1U A;  1V58 A;  2GQM A;  4ECI A;  4KDY A;  2F9S A;  4PQ1 A;  1PKZ A;  4MLY A;  5D9V A;  4MF7 A;  1JZR A;  2JSY A;  4MZB A;  2B1L A;  5GAN D;  3ZZX A;  1H75 A;  1KBN A;  2VKZ G;  1R4W A;  4KB3 A;  4JR4 A;  2MBS A;  4EL1 A;  1YZX A;  2YJH A;  1GH2 A;  4FIW A;  3GX8 A;  3KMO A;  2YN1 A;  3DML A;  1WPI A;  4K5S A;  1TKD B;  3GL3 A;  1H4O A;  2Z9S A;  4TW5 A;  2IMK A;  3LOR A;  1GL8 A;  3MNG A;  5KN3 A;  2R3X A;  2H72 A;  1EOG A;  5DCH A;  2ON5 A;  2L57 A;  2H1B A;  2WW2 A;  4N30 A;  2TRC P;  1WIK A;  5AIX A;  2VL2 C;  3DD3 A;  1AC1 A;  4HJ2 A;  1GWC A;  4NV2 A;  1T4Y A;  3U6V A;  5D96 A;  3FZ5 A;  3KM6 A;  1EP7 A;  1PSQ A;  2WFC A;  3UOM A;  2R0G A;  2YWM A;  3GTU A;  1U3I A;  4OFN A;  3LW9 A;  3ZIJ A;  2LTK A;  3GX0 A;  2FWG A;  3KTB A;  2I81 A;  3FKF A;  5IO2 A;  2WW3 A;  2XPE A;  1USB A;  2EFD A;  1R5P A;  4K0G A;  2P0G A;  1MDK A;  3TKR A;  2YJ7 A;  2C0E A;  5IIZ A;  1R5A A;  5G1K A;  1SKS B;  2YV7 A;  3RFR C;  1T8E B;  1EEM A;  3SWL A;  1GSE A;  2P5Q A;  4IS0 A;  2H6X A;  2R0C A;  4MMM A;  3IDV A;  5F07 A;  4G19 A;  4BVX B;  1YJ6 A;  2C80 A;  2BJX A;  3ZYW A;  2HRK B;  3KGK A;  4ZIL A;  3A5I A;  3KZQ A;  4LMW A;  1Z7P A;  2DBC A;  3E3E A;  3MYD A;  1ZGN A;  4OCE A;  2C0G A;  5A34 A;  5CNW A;  1VF4 A;  2C3T A;  4O32 A;  5J4V A;  2M80 A;  2V41 A;  4OFT A;  1K3Y A;  3WYW A;  3QDN A;  1GSY A;  5DQY A;  16GS A;  1S3A A;  2VL9 A;  5IQY A;  4MZW A;  1PL1 A;  2H70 A;  4ZL8 A;  3FR6 A;  3ZFB A;  4FXY P;  1A8L A;  5AGY A;  4RI7 A;  3APO A;  1KTE A;  3ZIV A;  3LXT A;  22GS A;  2MBT A;  2BMX A;  2VCW A;  3IE3 A;  2BTO T;  3ERF A;  4K7O A;  4L8E A;  3K8N A;  1OKT A;  4GQC A;  4FYB A;  4E68 A;  1WOU A;  1O85 A;  2HRF A;  1A24 A;  2FD3 A;  4G9H A;  4NMU A;  2HSM B;  4MP4 A;  5DVB A;  4GTU A;  4KGI A;  2DIZ A;  1V9W A;  1FVJ A;  3C8E A;  2PVO C;  5LCZ A;  5ELA A;  2EC4 A;  3KD0 A;  3UL3 A;  3GHA A;  3IRA A;  3C1S A;  2WZ9 A;  3EIN A;  3VFI A;  3H8Q A;  3ZLP A;  5JWO B;  3HA9 A;  4TR4 A;  2CZ3 A;  1K0N A;  2CX3 A;  3DGQ A;  1EGR A;  2X8H A;  4IP1 A;  4MAB A;  2ZUP A;  2VUP A;  4F0C A;  2MMA A;  5LD0 A;  5COH A;  1A2L A;  4F0B A;  1Z7R A;  2P31 A;  2GQK A;  2X49 A;  2FA4 A;  3O3T A;  1XIY A;  1PN9 A;  1T1V A;  4TR1 A;  4AKX B;  1O73 A;  2HQT A;  4ZBB A;  2PBJ A;  3HJP A;  5HR2 A;  4DSS B;  4LLR A;  5ECQ B;  3WGE A;  4IN0 A;  1M2D A;  1GSQ A;  4Q5R A;  4WF5 A;  1HNA A;  3GST A;  2AUV A;  1NM3 A;  3TRP A;  2V32 A;  3CTF A;  4G0I A;  1GTI A;  4MF5 A;  2QA1 A;  5ID2 A;  2HFD A;  4HUA A;  4GF0 A;  3F4S A;  3ZVJ D;  4PX1 A;  2OAD A;  4V2L A;  1XWA A;  5ECS A;  1SVO A;  4D73 B;  1GSD A;  4MDC A;  1ZCP A;  2C0D A;  5DAK A;  3DRN A;  3EPT A;  5H5S A;  2L4Q A;  2GZZ A;  14GS A;  2ON7 A;  2O89 A;  3BD2 A;  1TP9 A;  5J47 A;  3FR3 A;  2HSN B;  3C7M A;  4G0K A;  2GST A;  2WVZ A;  1SKW B;  1XCC A;  4I2T A;  1O8X A;  1SJI A;  3HXS A;  2YWI A;  5DAL B;  3GA4 A;  1S4B P;  3GKK A;  3VWW A;  5ECL B;  3LYP A;  2VCV A;  3Q18 A;  2IL3 A;  1DE1 A;  2O85 A;  2F8A A;  2QC7 A;  3ERG A;  5E59 A;  2J9H A;  3EUR A;  3EWL A;  3UVT A;  4IW9 A;  3DXB A;  2C4J A;  2HZE B;  1KNG A;  4GQF A;  4POL A;  2B5X A;  5GZZ B;  1QUW A;  5IMA A;  10GS A;  2IFQ A;  5IMV A;  4K2D A;  3I43 A;  2K8V A;  5JWQ B;  1NHO A;  5IPH A;  3PH9 A;  2DJ3 A;  1DE2 A;  4ID0 A;  5D9W A;  4JBB A;  3VLN A;  3CWG A;  4V2N A;  1B9X C;  1Z6N A;  2REM A;  3VK9 A;  5IMD A;  4L5O A;  1Z6M A;  2MYG A;  3W6G A;  2HRA A;  2GSS A;  3CRU A;  1B4P A;  1X9M B;  1BQ7 A;  2CQ9 A;  1PA3 A;  1WWJ A;  2OT3 A;  3AY8 A;  2B7J A;  1G7E A;  3VUR A;  1XFL A;  5CRH A;  1SEN A;  1OAZ A;  2HSH A;  4KND A;  1URM A;  1TW9 A;  19GS A;  1M9A A;  2TIR A;  1GNW A;  2H30 A;  3UAP A;  4CDO A;  1QGV A;  2V6O A;  5ECO B;  2VL3 A;  3LGC A;  1GNE A;  2MMN A;  5CAX A;  4TN8 A;  3TOU A;  4PGT A;  2OAC A;  4KSM A;  4GRF A;  3OR5 A;  2X99 A;  4DVC A;  1FHE A;  4XS4 B;  4K2X A;  2H75 A;  3M1G A;  2HT9 A;  5IPG A;  3IAS 2;  2LST A;  1JZD A;  3Q74 A;  4XIH A;  3VPT A;  8GSS A;  3EVI A;  1S3C A;  1XWK A;  5D93 A;  4K7N A;  4Z2T A;  1TK8 B;  1EWX A;  3HMJ G;  5JWR B;  2WS2 A;  2C0F A;  4YH2 A;  3ED3 A;  1SU9 A;  5JCU A;  2GTU A;  2LRT A;  4BWQ A;  1B8X A;  2GS3 A;  2A2S A;  4PXO A;  1JZW A;  2DJK A;  2EFC A;  3L9S A;  5G2Z A;  4POM A;  4WR4 A;  1BG5 A;  1N25 A;  4KSO A;  3ISO A;  1OE7 A;  3BOA A;  1XVQ A;  2IMF A;  2KUC A;  5KN2 A;  1M7T A;  1UN2 A;  2HYX A;  3WT2 A;  4NWY A;  5ECR B;  2F51 A;  4NHW A;  2B5Y A;  2XHF A;  1XWG A;  4TR0 A;  2E0Q A;  3ZRD A;  2V1M A;  3GNJ A;  3HVS A;  4HU7 A;  2ALB A;  2DIY A;  4FO5 A;  3TOT A;  3HHV A;  1V57 A;  1Q4J A;  3M0F A;  2GT6 A;  1Y25 A;  1YF0 A;  4LMV A;  4IEL A;  2VIM A;  2EIO A;  2H01 A;  4KA0 A;  2IFQ B;  4Z7X A;  4ZL7 A;  4KDU A;  3WT1 A;  1X5D A;  2HRK A;  2R2J A;  3M9K A;  2R4V A;  1PN0 A;  2HSY A;  2H1D A;  1EOH A;  2O7K A;  3KXO A;  3RHC A;  3KEB A;  5CRG A;  3ZVJ A;  3BCI A;  3IHQ A;  4DSR A;  4V1A g;  1UVZ A;  4RI6 A;  4X43 A;  4IJ3 A;  2CAI A;  1ZZY A;  2HLS A;  1YDK A;  1THX A;  1R26 A;  3ME8 A;  4EXJ A;  4HQS A;  1RQM A;  2NDO A;  4HU9 A;  1HNC A;  1SJZ A;  1ZYE A;  3HKR A;  2IJY A;  3E9J B;  3HYP A;  4PNF A;  1SL2 B;  4E8H A;  5D8I A;  4MH3 A;  4GSS A;  1WJK A;  2RUF A;  1U88 A;  4FYC A;  4K0N A;  3TKS C;  1OC9 B;  2HSM A;  2C8U A;  2H74 A;  3KJY A;  4MJE A;  2H0I A;  3NZN A;  1DBY A;  4YKG A;  3GH6 A;  2AV4 A;  4FH8 A;  1M9B A;  1FOH A;  3LXZ A;  3A5W A;  6GSW A;  1OC8 A;  2GGT A;  2CVD A;  1C72 A;  1U87 A;  4JR6 A;  5KOX A;  1A0R P;  1LBK A;  2IME A;  5FHI A;  2H73 A;  2OA7 A;  2VM2 A;  1FO5 A;  3BCK A;  4O7H A;  1BJX A;  2B3S A;  2KOK A;  3G9B A;  1FAA A;  3IPZ A;  4HI7 A;  2PVQ A;  4YAV A;  3F4T A;  1PGT A;  2O36 A;  3F3R A;  5ECM B;  3GSS A;  5J41 A;  5JCG A;  2HXK A;  2LNT A;  4QMK A;  2NVL A;  4AGS A;  3RBT A;  4LL1 B;  1K0A A;  1PMT A;  1YVL A;  1SVM A;  3QAV A;  2LKU A;  3HD5 A;  4EC0 A;  1TDI A;  3CSH A;  2X8G A;  2VD0 A;  5B7C A;  2NTO A;  2K18 A;  2X8C A;  3EMX A;  1GSS A;  4DSS A;  1TJD A;  2N5A A;  1R7H A;  1M3J A;  5B8A A;  3M9J A;  2FGX A;  3WGX A;  4N0V A;  5KN1 A;  3MWH A;  2GZY A;  3ZL5 A;  5CO3 A;  1JHB A;  5F0G A;  1GP1 A;  1G6W A;  3MDK A;  2AAW A;  2WJU A;  5IO0 A;  2YWO A;  5BRT A;  1X9S B;  3MSZ A;  1VRS D;  2VOC A;  3EU3 A;  4D73 A;  2WRT A;  4WET A;  2OJL A;  4HJM A;  1N2A A;  2QA2 A;  2WCI A;  1OYJ A;  1HD2 A;  5KN0 A;  5KOW A;  1GTA A;  2DML A;  5HFK A;  1BG1 A;  3WGD A;  5IMF A;  4WR5 A;  2HSN A;  2K6V A;  1U6T A;  4GST A;  2N5F A;  2QKE A;  3DKS A;  2IMD A;  2VM1 A;  5DAL A;  2F8F A;  2VD1 A;  12GS A;  4L0W A;  2GZP A;  3NOF A;  2KP2 A;  4TR3 A;  4EDZ A;  3WD6 A;  2X64 A;  1N8J A;  2CX4 A;  3CBU A;  4EIP A;  4QQ7 A;  3HY2 A;  2YP6 A;  1YKA A;  4EO3 A;  4X1U A;  2H66 A;  3U5R E;  1T00 A;  1THO A;  1MDI A;  2HZE A;  2VL2 A;  4ZB9 A;  3H1N A;  2M72 A;  2LS5 A;  3QMX A;  4HS1 A;  3JCM L;  4L0U A;  3Q6O A;  6GSU A;  4TXO B;  5ECP B;  3HVV A;  2B5E A;  4K6X A;  2PGT A;  4Q5Q A;  4JRR A;  3IC8 A;  3TJF A;  4AF2 A;  1I9D A;  5ECI B;  1AW9 A;  1U3A A;  3HVX A;  1WMJ A;  1SD9 A;  6GST A;  3PR8 A;  4ECC A;  3APS A;  3CXG A;  1OVN A;  3TKQ A;  3O76 A;  1NHY A;  2DJJ A;  1JLV A;  1YKC A;  4IQA A;  1A2M A;  1AIU A;  1TXX A;  5KEJ A;  2J23 A;  3F9U A;  2CZ2 A;  1Z9H A;  3PPU A;  1XW9 A;  3P8W A;  3HJM A;  4BL7 B;  4FYU A;  2LQO A;  2LV3 A;  2XPD A;  3L9U A;  4TVE A;  3FZ9 A;  2FUG 2;  4ISD A;  1XXU A;  1TTZ A;  3IHG A;  1W4V A;  5F06 A;  3KCM A;  5ABR A;  1GLP A;  1BF5 A;  2X4A A;  4NXI A;  3QAW A;  4PQH A;  3TGZ A;  1AQX A;  3P90 A;  2F3M A;  1ERT A;  2OBK A;  3EMP A;  2FY6 A;  5C04 A;  1TOF A;  4K8M A;  11GS A;  2HRN A;  2FCH A;  4BIK A;  3V1W A;  2O8V B;  5IM9 A;  4XS4 A;  3L78 A;  4OO5 A;  4XS1 A;  4BVY B;  1TK5 B;  4HQZ A;  1ACV A;  2YPM A;  4POK A;  3UBL A;  2VCQ A;  1PRX A;  1ZYN A;  2IPA A;  2V6K A;  4LL4 B;  1QXH A;  4PUR A;  1X9W B;  4ECB A;  1EV4 A;  2E7P A;  4WEY A;  2CAQ A;  3D4T A;  4PNG A;  1BX9 A;  3VI5 A;  3VWX A;  4Q5N A;  2H1A A;  3QFA C;  2K8S A;  1G6Y A;  3FY7 A;  1ZL9 A;  1ERU A;  1SL1 B;  5DQS A;  3DVW A;  4XTS A;  9GSS A;  2MMZ A;  3VWV A;  4JED A;  2FA8 A;  4Q5F A;  4HDE A;  4FQU A;  1F37 A;  2JU5 A;  5J5N A;  4N10 A;  4EDY A;  3UAR A;  1E2Y A;  5JCW A;  2GSR A;  3DVX A;  2VCT A;  3GIX A;  3H93 A;  4ECJ A;  2A4V A;  2OE0 A;  5A4V A;  1VF2 A;  2JL4 A;  4EF0 A;  2XBI A;  3FR9 A;  1IYH A;  3GYK A;  5AN1 A;  2JZR A;  3GUR A;  2DLX A;  4OO4 A;  2VCX A;  2NBS A;  1CQG A;  2ZNM A;  4PUF C;  2IN3 A;  4NAX A;  1XW5 A;  3M3M A;  4KW6 A;  3DEX A;  4ML1 A;  1FOV A;  5B8B A;  2GDR A;  2L5L A;  13GS A;  4ML6 A;  2LUS A;  4E8E A;  2WVY A;  1PD2 1;  4K5R A;  1WRY A;  1BAY A;  4AKH A;  2I1U A;  7GSS A;  4G0L A;  4AJ8 A;  3IBH A;  3J7Y k;  3KTL A;  2AYT A;  5H5R A;  4WKW A;  4GLT A;  3HZ8 A;  4X0X A;  4AI6 A;  6GSX A;  4V2M A;  4ULX A;  2HI7 A;  2DJ0 A;  2FNO A;  4KAE A;  1ST9 A;  4RQR A;  4AKI A;  4J57 E;  2GLR A;  2WVX B;  4MH2 A;  2JAC A;  4H86 A;  2H19 A;  1A0F A;  5A4W A;  3FMW A;  4WXT A;  4TRX A;  1J08 A;  1OC9 A;  2EFH A;  5LNK e;  1IYI A;  4L5L A;  2R0P A;  4I8B A;  4DSQ A;  4GDF A;  1EP8 A;  1KEB A;  4Z2R A;  1JZO A;  4XHM A;  1X5E A;  5B6N A;  3ZTL A;  2L4C A;  3QCP A;  3S9F A;  1EGO A;  4KE3 A;  3HVN A;  3ZFL A;  5CRD A;  1GLQ A;  4ZB8 A;  2WW0 A;  1GTB A;  1OC3 A;  2LEG A;  4MPF A;  4NHZ A;  1DSB A;  3SBC A;  4HSC X;  4O5U A;  1NSW A;  2PU9 C;  3UIW A;  2YNX A;  1F2E A;  1XBS A;  2RM5 A;  3I6A A;  2H6Y A;  2KHP A;  3QR6 A;  1VF3 A;  3CHX C;  3ZRE A;  4K7I A;  2M46 A;  4K9Z A;  1B9Y C;  2QSI A;  4J2F A;  3RHB A;  4KF9 A;  3LQ7 A;  3BJ5 A;  3IK9 A;  3GV1 A;  5DJL A;  5F05 A;  1O81 A;  3ZIT A;  5ECH B;  2YZH A;  5HFI A;  3F63 A;  1A2J A;  5D73 A;  3F6D A;  1TRU A;  3C1R A;  3P2A A;  1TU7 A;  3TDG A;  4W66 A;  3GKX A;  3FRC A;  2GT5 A;  4AKG A;  2GVP A;  4AJ6 A;  4QL9 A;  2OE1 A;  1VGL A;  2WB9 A;  1RW1 A;  4BPY A;  1ZYP A;  3E0U A;  4PQI A;  2PMT A;  3LG6 A;  1ZYQ B;  4OCF A;  6GSS A;  3F8U A;  4PHZ C;  1MDJ A;  3LWA A;  1ILO A;  3IA1 A;  5G5F A;  3TUE A;  4YQV A;  3ZMK A;  3PIN A;  1HNB A;  2H71 A;  3LSZ A;  3UJ1 A;  3L4N A;  5E4W A;  1GSU A;  1T7P B;  3FK8 A;  4EE0 A;  1PKW A;  3D5J A;  3MIX A;  5H5Q A;  3I69 A;  4ZBA A;  2VO4 A;  5DDL A;  4F82 A;  1GTU A;  2JAD A;  1NW2 A;  2HE3 A;  5G5E A;  5HFG A;  1SVL A;  1XPV A;  2LJR A;  20GS A;  2FWE A;  2LRC A;  2OE3 A;  3KMN A;  4RUV A;  3C71 A;  4IHU A;  3GH9 A;  2IWT A;  1M2A A;  1AUC A;  2AJQ B;  3RPP A;  4G10 A;  3P7X A;  3QOU A;  2E2M A;  2I9H A;  5GSS A;  2RLI A;  2YWN A;  5A1N B;  4JE1 A;  1GUL A;  1SKR B;  3A3T A;  3J7Y b;  1AXD A;  4TXO A;  3D4M A;  2A2R A;  2GSQ A;  4KUN A;  3DIE A;  6GSV A;  1ERV A;  1XOB A;  2FWF A;  1ML6 A;  2FWH A;  4GSN A;  2A4H A;  1SK2 A;  3W8J A;  1K0C A;  5A5H B;  4HOJ A;  1ZMA A;  3CYN A;  4BL7 A;  5EL8 A;  1F9M A;  3DWV A;  4KCA A;  1MD4 A;  5B6M A;  2UZ8 A;  3F6F A;  2H0G A;  1O6J A;  2PUK C;  4PTS A;  1VF1 A;  3G7I A;  3IOS A;  1B4Q A;  5AIV A;  3EYT A;  4WF4 A;  3D0Z A;  4GXZ A;  3QPM A;  1TRS A;  1F3A A;  3PGT A;  2YOI A;  1FB0 A;  2YCD A;  4IP6 A;  5GAP D;  4ZBD A;  2L6D A;  4XRA A;  5CRW A;  5A5K A;  3UBK A;  3GMF A;  2OKA A;  2YZU A;  1YEX A;  3VWU A;  2EIQ A;  6GSY A;  2EIR A;  1SK0 A;  4BVY A;  5G1L A;  3RDW A;  5CRE A;  3H79 A;  3HZ4 A;  5EPF A;  3TJK A;  4DEJ A;  2R5G A;  2XC2 A;  1LU4 A;  4XCS A;  1SL0 B;  3G7J A;  1M99 A;  1V98 A;  2VLV A;  3L9V A;  1XOA A;  3TRX A;  2LRN A;  4PI0 C;  5G31 A;  2G2Q A;  2DC5 A;  3TKS A;  1SYX A;  2C3N A;  4OD7 A;  3GKN A;  3RAZ A;  2L6C A;  4OWY A;  5J4U A;  4MJB A;  2E2G A;  1YY7 A;  3TRQ A;  4YQM A;  1BYE A;  1JFU A;  4ZIJ A;  2KP1 A;  2R37 A;  1DUG A;  2ES7 A;  3TJG A;  1O7U A;  4POB A;  1SD8 A;  1PL2 A;  2LQQ A;  2I3Y A;  3F0I A;  3Q19 A;  1PX6 A;  5DCG A;  4KCE A;  2CA8 A;  3N9J A;  3KP9 A;  1PX7 A;  3DYR A;  1K3O A;  3HJO A;  1I5G A;  2KLX A;  1K3L A;  4G2E A;  4N0Z A;  3FZ4 A;  2FLS A;  3O6T A;  2G0F A;  2CT6 A;  3APQ A;  3W8S A;  1HQO A;  4EIQ A;  3A2X A;  3GFK A;  3D22 A;  5HR0 A;  4JZQ A;  5EVO A;  3ERW A;  5J9B A;  5A4U A;  2O3E A;  4N3Z A;  3KIJ A;  4BA7 A;  4CW9 A;  2C3Q A;  3UEM A;  3VI7 A;  3M8N A;  3LJR A;  4I5Q A;  1AQV A;  3CMI A;  1CQH A;  1Q98 A;  5ELG A;  4YQU A;  5BMU A;  4OFM A;  4WBJ A;  5IOX A;  2WDU A;  5HR1 A;  2O87 A;  3H4K A;  4IBP A;  3UVH A;  4ZL9 A;  2UV8 G;  2JZS A;  5D9T A;  4OMV A;  2WVX A;  18GS A;  3KH7 A;  1GUM A;  1RK4 A;  2CVK A;  1A23 A;  1QMV A;  3IV4 A;  2AB6 A;  5HQP A;  4HZ2 A;  1SYR A;  1AQW A;  2DJ1 A;  3FEU A;  1T3B A;  4ILF A;  1TI3 A;  4ZB6 A;  5HR3 A;  4CHS A;  4EKZ A;  3LFL A;  2WUL A;  3IXR A;  2MZC A;  4CY8 A;  4F03 A;  3ME7 A;  3FZA A;  4MNN A;  1FG4 A;  2L59 A;  1SK1 A;  4WBR D;  4JU5 A;  1X0R A;  4BWS A;  4MF6 A;  2V2G A;  3GTU B;  1O8W A;  2YV9 A;  2LJA A;  3GUS A;  4V1A p;  3BBY A;  1E6B A;  1XWB A;  1XWC A;  3IR4 A;  1F6M C;  1K0O A;  3TJB A;  1QK8 A;  3QFB C;  1FB6 A;  2EFE A;  3UMA A;  2JZT A;  1BED A;  4RQX A;  2LNS A;  3IC4 A;  4CY6 A;  1A8Y A;  17GS A;  4IVF A;  4QL7 A;  3TKP A;  2YAN A;  1S3D A;  4F9Z A;  2VCZ A;  4MPG A;  3G7Y A;  2R6K A;  3CSJ A;  3QAG A;  4LA1 A;  5A34 B;  5J40 A;  1WP0 A;  2O5V A;  5FWG A;  2H8L A;  1TXU A;  4XRD A;  3EE2 A;  1GUH A;  2ZCT A;  3C73 A;  1K0B A;  4ACS A;  3GN3 A;  1WE0 A;  1GSF A;  4PUA A;  1X5C A;  1XG8 A;  1YF1 A;  2B1K A;  1B48 A;  1Y6E A;  2C1Y A;  2QGV A;  2DSA A;  2H1G A;  2FHE A;  4O92 A; 
#chains in the Genus database with same CATH homology
 4KH7 A;  1J9B A;  5IOW A;  3KH9 A;  2XBQ A;  4Z2U A;  1W89 A;  5ENU A;  2B6M A;  3QD9 A;  3GRX A;  1V40 A;  4HZ4 A;  1SJ6 A;  4EUY A;  4MA9 A;  3GL5 A;  1YQ1 A;  1T4Z A;  1ON4 A;  3D21 A;  1TI1 A;  2PWJ A;  2N5B A;  1TRV A;  5FT3 A;  3TCO A;  3FYG A;  2B7K A;  5J4Y A;  1YEP A;  5BMU B;  3ZML A;  1TU8 A;  3NIV A;  1K0D A;  3TKS E;  4KX4 A;  2RM6 A;  3VPQ A;  1QQ2 A;  5J9C A;  5GST A;  4IQ1 A;  2I4A A;  4O5Q A;  4F2I A;  4HEA 2;  5C00 A;  5AIS A;  3N5O A;  4IGJ A;  4AJ7 A;  4NPB A;  2H76 A;  5A1N A;  2PPT A;  1ABA A;  5DBQ A;  3EC3 A;  5IMC A;  2IIY A;  3A2W A;  4X4J A;  2AHE A;  1ERW A;  2OBI A;  4G01 A;  3GKM A;  1EZK A;  4ZB7 A;  4J56 E;  2VAF A;  4MJA A;  2D2Z A;  4TR1 B;  3CSI A;  4I6X A;  4P3Y B;  1Z5Y E;  1FW1 A;  3I9V 2;  4MJC A;  3FW2 A;  2CVB A;  4MCU A;  5J3R A;  3US3 A;  5G30 A;  4A5P A;  5INY A;  1GRX A;  1K0M A;  3CTG A;  5ECK B;  2H0H A;  3FHK A;  1TK0 B;  4YKF A;  5IMZ A;  5A5H A;  1PQN A;  3LEF A;  4N11 A;  2NPB A;  1XZO A;  5DJM A;  3F3Q A;  3TJJ A;  4MZC A;  5ID2 B;  1XVW A;  2A2P A;  3R2Q A;  1OKD A;  4TOP A;  4K1F A;  1MD3 A;  5DAK B;  2PER A;  2WGR A;  2DKH A;  5D9X A;  1JLW A;  2IMI A;  3F4R A;  1XW6 A;  2GQL A;  1UA5 A;  4I97 A;  1EEJ A;  1Z3E A;  1MEK A;  1ZOF A;  1V2A A;  1TRW A;  3A2V A;  1M0U A;  4XS6 A;  4KDX A;  2RUE A;  4I2U A;  4ICY A;  3TU3 B;  2L5O A;  4GWR A;  2DJ2 A;  3D6I A;  5L71 A;  4IJI A;  4MK3 A;  2DKI A;  4O5R A;  3IK7 A;  1J0F A;  1GUK A;  1OE8 A;  4IKH A;  3R3E A;  2VLT A;  5EY6 A;  4USS A;  3IAM 2;  2PN8 A;  1AAZ A;  1G0T A;  2HNL A;  1M2B A;  5CP1 A;  3RPN A;  3CRT A;  1LJR A;  5ECN B;  2CV4 A;  5CYY A;  1MTC A;  5F8B A;  4NV5 A;  1G7O A;  3TB2 A;  2LJK A;  1F3B A;  2H6Z A;  1UC7 A;  4ZXG A;  3HDC A;  2VLU A;  3HCZ A;  3L0H A;  4BVX A;  2JSZ A;  1FVK A;  2RII A;  3LYK A;  2MMO A;  3MAK A;  4GCI A;  2H1L A;  2K9F A;  4TXV A;  4TKY A;  1HYU A;  3KP8 A;  2DMM A;  1EV9 A;  2TRX A;  2P5R A;  4EVM A;  2HZF A;  1QFN A;  3EU4 A;  4YAP A;  1Y1U A;  1V58 A;  2GQM A;  4ECI A;  4KDY A;  2F9S A;  4PQ1 A;  1PKZ A;  4MLY A;  5D9V A;  4MF7 A;  1JZR A;  2JSY A;  4MZB A;  2B1L A;  5GAN D;  3ZZX A;  1H75 A;  1KBN A;  2VKZ G;  1R4W A;  4KB3 A;  4JR4 A;  2MBS A;  4EL1 A;  1YZX A;  2YJH A;  1GH2 A;  4FIW A;  3GX8 A;  3KMO A;  2YN1 A;  3DML A;  1WPI A;  4K5S A;  1TKD B;  3GL3 A;  1H4O A;  2Z9S A;  4TW5 A;  2IMK A;  3LOR A;  1GL8 A;  3MNG A;  5KN3 A;  2R3X A;  2H72 A;  1EOG A;  5DCH A;  2ON5 A;  2L57 A;  2H1B A;  4N30 A;  2TRC P;  1WIK A;  5AIX A;  2VL2 C;  3DD3 A;  1AC1 A;  4HJ2 A;  1GWC A;  4NV2 A;  1T4Y A;  3U6V A;  5D96 A;  3FZ5 A;  3KM6 A;  1EP7 A;  1PSQ A;  2WFC A;  3UOM A;  2R0G A;  2YWM A;  3GTU A;  1U3I A;  4OFN A;  3LW9 A;  3ZIJ A;  2LTK A;  3GX0 A;  2FWG A;  3KTB A;  2I81 A;  3FKF A;  5IO2 A;  2XPE A;  1USB A;  2EFD A;  1R5P A;  4K0G A;  2P0G A;  1MDK A;  3TKR A;  2YJ7 A;  2C0E A;  5IIZ A;  1R5A A;  5G1K A;  1SKS B;  2YV7 A;  1T8E B;  1EEM A;  3SWL A;  1GSE A;  2P5Q A;  4IS0 A;  2H6X A;  2R0C A;  4MMM A;  3IDV A;  5F07 A;  4G19 A;  4BVX B;  1YJ6 A;  2C80 A;  2BJX A;  3ZYW A;  2HRK B;  3KGK A;  4ZIL A;  3A5I A;  3KZQ A;  4LMW A;  1Z7P A;  2DBC A;  3E3E A;  3MYD A;  1ZGN A;  4OCE A;  2C0G A;  5A34 A;  5CNW A;  1VF4 A;  2C3T A;  4O32 A;  5J4V A;  2M80 A;  2V41 A;  4OFT A;  1K3Y A;  3WYW A;  3QDN A;  1GSY A;  5DQY A;  16GS A;  1S3A A;  2VL9 A;  5IQY A;  4MZW A;  1PL1 A;  2H70 A;  4ZL8 A;  3FR6 A;  3ZFB A;  1A8L A;  5AGY A;  4RI7 A;  3APO A;  1KTE A;  3ZIV A;  3LXT A;  22GS A;  2MBT A;  2BMX A;  2VCW A;  3IE3 A;  2BTO T;  3ERF A;  4K7O A;  4L8E A;  3K8N A;  1OKT A;  4GQC A;  4FYB A;  4E68 A;  1WOU A;  1O85 A;  2HRF A;  1A24 A;  2FD3 A;  4G9H A;  4NMU A;  2HSM B;  4MP4 A;  5DVB A;  4GTU A;  4KGI A;  2DIZ A;  1V9W A;  1FVJ A;  3C8E A;  2PVO C;  5LCZ A;  5ELA A;  2EC4 A;  3KD0 A;  3UL3 A;  3GHA A;  3IRA A;  3C1S A;  2WZ9 A;  3EIN A;  3VFI A;  3H8Q A;  3ZLP A;  5JWO B;  3HA9 A;  4TR4 A;  2CZ3 A;  1K0N A;  2CX3 A;  3DGQ A;  1EGR A;  2X8H A;  4IP1 A;  4MAB A;  2ZUP A;  2VUP A;  4F0C A;  2MMA A;  5LD0 A;  5COH A;  1A2L A;  4F0B A;  1Z7R A;  2P31 A;  2GQK A;  2X49 A;  2FA4 A;  3O3T A;  1XIY A;  1PN9 A;  1T1V A;  4TR1 A;  4AKX B;  1O73 A;  2HQT A;  4ZBB A;  2PBJ A;  3HJP A;  5HR2 A;  4DSS B;  4LLR A;  5ECQ B;  3WGE A;  4IN0 A;  1M2D A;  1GSQ A;  4Q5R A;  4WF5 A;  1HNA A;  3GST A;  2AUV A;  1NM3 A;  3TRP A;  2V32 A;  3CTF A;  4G0I A;  1GTI A;  4MF5 A;  2QA1 A;  5ID2 A;  2HFD A;  4HUA A;  4GF0 A;  3F4S A;  3ZVJ D;  4PX1 A;  2OAD A;  4V2L A;  1XWA A;  5ECS A;  1SVO A;  4D73 B;  1GSD A;  4MDC A;  1ZCP A;  2C0D A;  5DAK A;  3DRN A;  3EPT A;  5H5S A;  2L4Q A;  2GZZ A;  14GS A;  2ON7 A;  2O89 A;  3BD2 A;  1TP9 A;  5J47 A;  3FR3 A;  2HSN B;  3C7M A;  4G0K A;  2GST A;  1SKW B;  1XCC A;  4I2T A;  1O8X A;  1SJI A;  3HXS A;  2YWI A;  5DAL B;  3GA4 A;  3GKK A;  3VWW A;  5ECL B;  3LYP A;  2VCV A;  3Q18 A;  2IL3 A;  1DE1 A;  2O85 A;  2F8A A;  2QC7 A;  3ERG A;  5E59 A;  2J9H A;  3EUR A;  3EWL A;  3UVT A;  4IW9 A;  3DXB A;  2C4J A;  2HZE B;  1KNG A;  4GQF A;  4POL A;  2B5X A;  5GZZ B;  1QUW A;  5IMA A;  10GS A;  2IFQ A;  5IMV A;  4K2D A;  3I43 A;  2K8V A;  5JWQ B;  1NHO A;  5IPH A;  3PH9 A;  2DJ3 A;  1DE2 A;  4ID0 A;  5D9W A;  4JBB A;  3VLN A;  3CWG A;  4V2N A;  1B9X C;  1Z6N A;  2REM A;  3VK9 A;  5IMD A;  4L5O A;  1Z6M A;  2MYG A;  3W6G A;  2HRA A;  2GSS A;  3CRU A;  1B4P A;  1X9M B;  1BQ7 A;  2CQ9 A;  1PA3 A;  1WWJ A;  2OT3 A;  3AY8 A;  2B7J A;  1G7E A;  3VUR A;  1XFL A;  5CRH A;  1SEN A;  1OAZ A;  2HSH A;  4KND A;  1URM A;  1TW9 A;  19GS A;  1M9A A;  2TIR A;  1GNW A;  2H30 A;  3UAP A;  4CDO A;  1QGV A;  2V6O A;  5ECO B;  2VL3 A;  3LGC A;  1GNE A;  2MMN A;  5CAX A;  4TN8 A;  3TOU A;  4PGT A;  2OAC A;  4KSM A;  4GRF A;  3OR5 A;  2X99 A;  4DVC A;  1FHE A;  4XS4 B;  4K2X A;  2H75 A;  3M1G A;  2HT9 A;  5IPG A;  3IAS 2;  2LST A;  1JZD A;  3Q74 A;  4XIH A;  3VPT A;  8GSS A;  3EVI A;  1S3C A;  1XWK A;  5D93 A;  4K7N A;  4Z2T A;  1TK8 B;  1EWX A;  3HMJ G;  5JWR B;  2WS2 A;  2C0F A;  4YH2 A;  3ED3 A;  1SU9 A;  5JCU A;  2GTU A;  2LRT A;  4BWQ A;  1B8X A;  2GS3 A;  2A2S A;  4PXO A;  1JZW A;  2DJK A;  2EFC A;  3L9S A;  5G2Z A;  4POM A;  4WR4 A;  1BG5 A;  1N25 A;  4KSO A;  3ISO A;  1OE7 A;  3BOA A;  1XVQ A;  2IMF A;  2KUC A;  5KN2 A;  1M7T A;  1UN2 A;  2HYX A;  3WT2 A;  4NWY A;  5ECR B;  2F51 A;  4NHW A;  2B5Y A;  2XHF A;  1XWG A;  4TR0 A;  2E0Q A;  3ZRD A;  2V1M A;  3GNJ A;  3HVS A;  4HU7 A;  2ALB A;  2DIY A;  4FO5 A;  3TOT A;  3HHV A;  1V57 A;  1Q4J A;  3M0F A;  2GT6 A;  1Y25 A;  1YF0 A;  4LMV A;  4IEL A;  2VIM A;  2EIO A;  2H01 A;  4KA0 A;  2IFQ B;  4Z7X A;  4ZL7 A;  4KDU A;  3WT1 A;  1X5D A;  2HRK A;  2R2J A;  3M9K A;  2R4V A;  1PN0 A;  2HSY A;  2H1D A;  1EOH A;  2O7K A;  3KXO A;  3RHC A;  3KEB A;  5CRG A;  3ZVJ A;  3BCI A;  3IHQ A;  4DSR A;  4V1A g;  1UVZ A;  4RI6 A;  4X43 A;  4IJ3 A;  2CAI A;  1ZZY A;  2HLS A;  1YDK A;  1THX A;  1R26 A;  3ME8 A;  4EXJ A;  4HQS A;  1RQM A;  2NDO A;  4HU9 A;  1HNC A;  1SJZ A;  1ZYE A;  3HKR A;  2IJY A;  3E9J B;  3HYP A;  4PNF A;  1SL2 B;  4E8H A;  5D8I A;  4MH3 A;  4GSS A;  1WJK A;  2RUF A;  1U88 A;  4FYC A;  4K0N A;  3TKS C;  1OC9 B;  2HSM A;  2C8U A;  2H74 A;  3KJY A;  4MJE A;  2H0I A;  3NZN A;  1DBY A;  4YKG A;  3GH6 A;  2AV4 A;  4FH8 A;  1M9B A;  1FOH A;  3LXZ A;  3A5W A;  6GSW A;  1OC8 A;  2GGT A;  2CVD A;  1C72 A;  1U87 A;  4JR6 A;  5KOX A;  1A0R P;  1LBK A;  2IME A;  5FHI A;  2H73 A;  2OA7 A;  2VM2 A;  1FO5 A;  3BCK A;  4O7H A;  1BJX A;  2B3S A;  2KOK A;  3G9B A;  1FAA A;  3IPZ A;  4HI7 A;  2PVQ A;  4YAV A;  3F4T A;  1PGT A;  5ECM B;  3F3R A;  5J41 A;  3GSS A;  5JCG A;  2HXK A;  2LNT A;  4QMK A;  2NVL A;  4AGS A;  3RBT A;  4LL1 B;  1K0A A;  1PMT A;  1YVL A;  1SVM A;  3QAV A;  2LKU A;  3HD5 A;  4EC0 A;  1TDI A;  3CSH A;  2X8G A;  2VD0 A;  5B7C A;  2NTO A;  2K18 A;  2X8C A;  3EMX A;  1GSS A;  4DSS A;  1TJD A;  2N5A A;  1R7H A;  5B8A A;  3M9J A;  2FGX A;  3WGX A;  4N0V A;  5KN1 A;  3MWH A;  2GZY A;  3ZL5 A;  5CO3 A;  1JHB A;  5F0G A;  1GP1 A;  1G6W A;  3MDK A;  2AAW A;  2WJU A;  5IO0 A;  2YWO A;  5BRT A;  1X9S B;  3MSZ A;  1VRS D;  2VOC A;  3EU3 A;  4D73 A;  2WRT A;  4WET A;  2OJL A;  4HJM A;  1N2A A;  2QA2 A;  2WCI A;  1OYJ A;  1HD2 A;  5KN0 A;  5KOW A;  1GTA A;  2DML A;  5HFK A;  1BG1 A;  3WGD A;  5IMF A;  4WR5 A;  2HSN A;  2K6V A;  1U6T A;  4GST A;  2N5F A;  2QKE A;  3DKS A;  2IMD A;  2VM1 A;  5DAL A;  2F8F A;  2VD1 A;  12GS A;  4L0W A;  2GZP A;  3NOF A;  2KP2 A;  4TR3 A;  4EDZ A;  3WD6 A;  2X64 A;  1N8J A;  2CX4 A;  3CBU A;  4EIP A;  4QQ7 A;  3HY2 A;  2YP6 A;  1YKA A;  4EO3 A;  4X1U A;  2H66 A;  3U5R E;  1T00 A;  1THO A;  1MDI A;  2HZE A;  2VL2 A;  4ZB9 A;  3H1N A;  2M72 A;  2LS5 A;  3QMX A;  4HS1 A;  3JCM L;  4L0U A;  3Q6O A;  6GSU A;  4TXO B;  5ECP B;  3HVV A;  2B5E A;  4K6X A;  2PGT A;  4Q5Q A;  4JRR A;  3IC8 A;  3TJF A;  4AF2 A;  1I9D A;  5ECI B;  1AW9 A;  1U3A A;  3HVX A;  1WMJ A;  1SD9 A;  6GST A;  3PR8 A;  4ECC A;  3APS A;  3CXG A;  1OVN A;  3TKQ A;  3O76 A;  1NHY A;  2DJJ A;  1JLV A;  1YKC A;  4IQA A;  1A2M A;  1AIU A;  1TXX A;  5KEJ A;  2J23 A;  3F9U A;  2CZ2 A;  1Z9H A;  3PPU A;  1XW9 A;  3P8W A;  3HJM A;  4BL7 B;  4FYU A;  2LQO A;  2LV3 A;  2XPD A;  3L9U A;  4TVE A;  3FZ9 A;  2FUG 2;  4ISD A;  1XXU A;  1TTZ A;  3IHG A;  1W4V A;  5F06 A;  3KCM A;  5ABR A;  1GLP A;  1BF5 A;  2X4A A;  4NXI A;  3QAW A;  4PQH A;  3TGZ A;  1AQX A;  3P90 A;  2F3M A;  1ERT A;  2OBK A;  3EMP A;  2FY6 A;  5C04 A;  1TOF A;  4K8M A;  11GS A;  2HRN A;  2FCH A;  3V1W A;  2O8V B;  5IM9 A;  4XS4 A;  3L78 A;  4OO5 A;  4XS1 A;  4BVY B;  1TK5 B;  4HQZ A;  1ACV A;  2YPM A;  4POK A;  3UBL A;  2VCQ A;  1PRX A;  1ZYN A;  2IPA A;  2V6K A;  4LL4 B;  1QXH A;  4PUR A;  1X9W B;  4ECB A;  1EV4 A;  2E7P A;  4WEY A;  2CAQ A;  3D4T A;  4PNG A;  1BX9 A;  3VI5 A;  3VWX A;  4Q5N A;  2H1A A;  3QFA C;  2K8S A;  1G6Y A;  3FY7 A;  1ZL9 A;  1ERU A;  1SL1 B;  5DQS A;  3DVW A;  4XTS A;  9GSS A;  2MMZ A;  3VWV A;  4JED A;  2FA8 A;  4Q5F A;  4HDE A;  4FQU A;  1F37 A;  2JU5 A;  5J5N A;  4N10 A;  4EDY A;  3UAR A;  1E2Y A;  5JCW A;  2GSR A;  3DVX A;  2VCT A;  3GIX A;  3H93 A;  4ECJ A;  2A4V A;  2OE0 A;  5A4V A;  1VF2 A;  2JL4 A;  4EF0 A;  2XBI A;  3FR9 A;  1IYH A;  3GYK A;  5AN1 A;  2JZR A;  3GUR A;  2DLX A;  4OO4 A;  2VCX A;  2NBS A;  1CQG A;  2ZNM A;  4PUF C;  2IN3 A;  4NAX A;  1XW5 A;  3M3M A;  4KW6 A;  3DEX A;  4ML1 A;  1FOV A;  5B8B A;  2GDR A;  2L5L A;  13GS A;  4ML6 A;  2LUS A;  4E8E A;  1PD2 1;  4K5R A;  1WRY A;  1BAY A;  4AKH A;  2I1U A;  7GSS A;  4G0L A;  4AJ8 A;  3IBH A;  3J7Y k;  3KTL A;  2AYT A;  5H5R A;  4WKW A;  4GLT A;  3HZ8 A;  4X0X A;  4AI6 A;  6GSX A;  4V2M A;  4ULX A;  2HI7 A;  2DJ0 A;  2FNO A;  4KAE A;  1ST9 A;  4RQR A;  4AKI A;  4J57 E;  2GLR A;  4MH2 A;  2JAC A;  4H86 A;  2H19 A;  1A0F A;  5A4W A;  3FMW A;  4WXT A;  4TRX A;  1J08 A;  1OC9 A;  2EFH A;  5LNK e;  1IYI A;  4L5L A;  2R0P A;  4I8B A;  4DSQ A;  4GDF A;  1EP8 A;  1KEB A;  4Z2R A;  1JZO A;  4XHM A;  1X5E A;  5B6N A;  3ZTL A;  2L4C A;  3QCP A;  3S9F A;  1EGO A;  4KE3 A;  3ZFL A;  5CRD A;  1GLQ A;  4ZB8 A;  1GTB A;  1OC3 A;  2LEG A;  4MPF A;  4NHZ A;  1DSB A;  3SBC A;  4O5U A;  1NSW A;  2PU9 C;  3UIW A;  2YNX A;  1F2E A;  1XBS A;  2RM5 A;  3I6A A;  2H6Y A;  2KHP A;  3QR6 A;  1VF3 A;  3ZRE A;  4K7I A;  2M46 A;  4K9Z A;  1B9Y C;  2QSI A;  4J2F A;  3RHB A;  4KF9 A;  3LQ7 A;  3BJ5 A;  3IK9 A;  3GV1 A;  5DJL A;  5F05 A;  1O81 A;  3ZIT A;  5ECH B;  2YZH A;  5HFI A;  3F63 A;  1A2J A;  5D73 A;  3F6D A;  1TRU A;  3C1R A;  3P2A A;  1TU7 A;  3TDG A;  4W66 A;  3GKX A;  3FRC A;  2GT5 A;  4AKG A;  2GVP A;  4AJ6 A;  4QL9 A;  2OE1 A;  1VGL A;  2WB9 A;  1RW1 A;  4BPY A;  1ZYP A;  3E0U A;  4PQI A;  2PMT A;  3LG6 A;  1ZYQ B;  4OCF A;  6GSS A;  3F8U A;  1MDJ A;  3LWA A;  1ILO A;  3IA1 A;  5G5F A;  3TUE A;  4YQV A;  3ZMK A;  3PIN A;  1HNB A;  2H71 A;  3LSZ A;  3UJ1 A;  3L4N A;  5E4W A;  1GSU A;  1T7P B;  3FK8 A;  4EE0 A;  1PKW A;  3D5J A;  3MIX A;  5H5Q A;  3I69 A;  4ZBA A;  2VO4 A;  5DDL A;  4F82 A;  1GTU A;  2JAD A;  1NW2 A;  2HE3 A;  5G5E A;  5HFG A;  1SVL A;  1XPV A;  2LJR A;  20GS A;  2FWE A;  2LRC A;  2OE3 A;  3KMN A;  4RUV A;  3C71 A;  4IHU A;  3GH9 A;  2IWT A;  1M2A A;  1AUC A;  2AJQ B;  3RPP A;  4G10 A;  3P7X A;  3QOU A;  2E2M A;  2I9H A;  5GSS A;  2RLI A;  2YWN A;  5A1N B;  4JE1 A;  1GUL A;  1SKR B;  3A3T A;  3J7Y b;  1AXD A;  4TXO A;  3D4M A;  2A2R A;  2GSQ A;  4KUN A;  3DIE A;  6GSV A;  1ERV A;  1XOB A;  2FWF A;  1ML6 A;  2FWH A;  4GSN A;  2A4H A;  1SK2 A;  3W8J A;  1K0C A;  5A5H B;  4HOJ A;  1ZMA A;  3CYN A;  4BL7 A;  5EL8 A;  1F9M A;  3DWV A;  4KCA A;  1MD4 A;  5B6M A;  2UZ8 A;  3F6F A;  2H0G A;  1O6J A;  2PUK C;  4PTS A;  1VF1 A;  3G7I A;  3IOS A;  1B4Q A;  5AIV A;  3EYT A;  4WF4 A;  3D0Z A;  4GXZ A;  3QPM A;  1TRS A;  1F3A A;  3PGT A;  2YOI A;  1FB0 A;  2YCD A;  4IP6 A;  5GAP D;  4ZBD A;  2L6D A;  4XRA A;  5CRW A;  5A5K A;  3UBK A;  3GMF A;  2OKA A;  2YZU A;  1YEX A;  3VWU A;  2EIQ A;  6GSY A;  2EIR A;  1SK0 A;  4BVY A;  5G1L A;  3RDW A;  5CRE A;  3H79 A;  3HZ4 A;  5EPF A;  3TJK A;  4DEJ A;  2R5G A;  2XC2 A;  1LU4 A;  4XCS A;  1SL0 B;  3G7J A;  1M99 A;  1V98 A;  2VLV A;  3L9V A;  1XOA A;  3TRX A;  2LRN A;  5G31 A;  2G2Q A;  2DC5 A;  3TKS A;  1SYX A;  2C3N A;  4OD7 A;  3GKN A;  3RAZ A;  2L6C A;  4OWY A;  5J4U A;  4MJB A;  2E2G A;  1YY7 A;  3TRQ A;  4YQM A;  1BYE A;  1JFU A;  4ZIJ A;  2KP1 A;  2R37 A;  1DUG A;  2ES7 A;  3TJG A;  1O7U A;  4POB A;  1SD8 A;  1PL2 A;  2LQQ A;  2I3Y A;  3F0I A;  3Q19 A;  1PX6 A;  5DCG A;  4KCE A;  2CA8 A;  3N9J A;  3KP9 A;  1PX7 A;  3DYR A;  1K3O A;  3HJO A;  1I5G A;  2KLX A;  1K3L A;  4G2E A;  4N0Z A;  3FZ4 A;  2FLS A;  3O6T A;  2G0F A;  2CT6 A;  3APQ A;  3W8S A;  1HQO A;  4EIQ A;  3A2X A;  3GFK A;  3D22 A;  5HR0 A;  4JZQ A;  5EVO A;  3ERW A;  5J9B A;  5A4U A;  4N3Z A;  3KIJ A;  4BA7 A;  4CW9 A;  2C3Q A;  3UEM A;  3VI7 A;  3M8N A;  3LJR A;  4I5Q A;  1AQV A;  3CMI A;  1CQH A;  1Q98 A;  5ELG A;  4YQU A;  5BMU A;  4OFM A;  4WBJ A;  5IOX A;  2WDU A;  5HR1 A;  2O87 A;  3H4K A;  4IBP A;  3UVH A;  4ZL9 A;  2UV8 G;  2JZS A;  5D9T A;  4OMV A;  18GS A;  3KH7 A;  1GUM A;  1RK4 A;  2CVK A;  1A23 A;  1QMV A;  3IV4 A;  2AB6 A;  5HQP A;  4HZ2 A;  1SYR A;  1AQW A;  2DJ1 A;  3FEU A;  1T3B A;  4ILF A;  1TI3 A;  4ZB6 A;  5HR3 A;  4CHS A;  4EKZ A;  3LFL A;  2WUL A;  3IXR A;  2MZC A;  4CY8 A;  4F03 A;  3ME7 A;  3FZA A;  4MNN A;  1FG4 A;  2L59 A;  1SK1 A;  4WBR D;  4JU5 A;  1X0R A;  4BWS A;  4MF6 A;  2V2G A;  3GTU B;  1O8W A;  2YV9 A;  2LJA A;  3GUS A;  4V1A p;  3BBY A;  1E6B A;  1XWB A;  1XWC A;  3IR4 A;  1F6M C;  1K0O A;  3TJB A;  1QK8 A;  3QFB C;  1FB6 A;  2EFE A;  3UMA A;  2JZT A;  1BED A;  4RQX A;  2LNS A;  3IC4 A;  4CY6 A;  1A8Y A;  17GS A;  4IVF A;  4QL7 A;  3TKP A;  2YAN A;  1S3D A;  4F9Z A;  2VCZ A;  4MPG A;  3G7Y A;  2R6K A;  3CSJ A;  3QAG A;  4LA1 A;  5A34 B;  5J40 A;  1WP0 A;  2O5V A;  5FWG A;  2H8L A;  1TXU A;  4XRD A;  3EE2 A;  1GUH A;  2ZCT A;  3C73 A;  1K0B A;  4ACS A;  3GN3 A;  1WE0 A;  1GSF A;  4PUA A;  1X5C A;  1YF1 A;  1B48 A;  1Y6E A;  2B1K A;  2C1Y A;  2QGV A;  2DSA A;  2H1G A;  2FHE A;  4O92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...