2WRTA

The 2.4 angstrom structure of the fasciola hepatica mu class gst, gst26
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
217
structure length
217
Chain Sequence
PAKLGYWKIRGLQQPVRLLLEYLGEEYEEHLYGRDDREKWLGDKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGSTPEERARISMIEGAAMDLRMGFVRVCYNPKFEEVKGDYLKELPTTLKMWSNFLGDRHYLTGSSVSHVDFMVYEALDCIRYLAPQCLEDFPKLKEFKSRIEDLPKIKAYMESEKFIKWPLNSWIASFGGGDAAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE CLASS-MU 26 KDA ISOZYME 51
publication title The 2.5 Angstrom Structure of a Mu Class Gst from Fasciola Hepatica
rcsb
source organism Fasciola hepatica
total genus 70
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wrtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wrtA01
2WS2A 1GSEA 1HNAA 5DJMA 5CAXA 4G0IA 2YJHA 3KJYA 2A2RA 3KP8A 4EVMA 1XOAA 3D4MA 2LJKA 1X9MB 3F3RA 3IA1A 4MPGA 2HE3A 1FAAA 2VM2A 4KSOA 3QAWA 2LEGA 2ON5A 3CMIA 3WGEA 4J2FA 4IKHA 3O76A 2KP1A 5IMDA 1YZXA 3GX0A 5C04A 3FHKA 1LBKA 1H75A 2PERA 4D73B 2WCIA 4TVEA 4AJ6A 5A4VA 2EC4A 2IMDA 4ZL8A 4KF9A 5LNKe 1V57A 1JZRA 3KEBA 1X9WB 5J41A 2FA4A 2GQMA 4OO5A 1Z9HA 4RI7A 4ZB6A 1K0AA 3TOTA 3VLNA 3A2WA 1YEXA 3MDKA 5ECKB 1XWAA 1XXUA 1AIUA 4POBA 3L9VA 3IOSA 2CVDA 3DWVA 1HYUA 4YAVA 1WMJA 2VL9A 3F8UA 4RI6A 4HQZA 1OAZA 4IHUA 2TRCP 2B5EA 3GKMA 1TDIA 5B8AA 3APQA 3HYPA 3IRAA 5LCZA 1GULA 2H1DA 1UN2A 1M99A 1XFLA 1PKWA 3FR9A 2IIYA 1PMTA 2H0IA 5DQYA 2H19A 1WOUA 3ZRDA 5AIVA 1K0MA 4Q5RA 2H74A 4G10A 3ZMLA 2HRAA 4V2NA 4OFTA 1UA5A 2C8UA 1SKWB 1ZZYA 1Z6MA 1O8XA 5F05A 1UC7A 4OFMA 4DSSB 2AV4A 2IPAA 1GSQA 4XS1A 2YJ7A 3KXOA 1OC8A 3FKFA 3BOAA 1ZMAA 8GSSA 2HYXA 4J56E 3PGTA 18GSA 3Q74A 2BJXA 2O8VB 4Q5FA 1TP9A 2IMFA 3M3MA 2R5GA 2DIYA 1SK0A 2VAFA 3E9JB 1DE2A 3NOFA 1PL1A 4EKZA 3PINA 2PU9C 1ABAA 3LXTA 1M2DA 1T1VA 2L5LA 1SYXA 3G7YA 2N5FA 3P7XA 2Z9SA 4YQUA 3ME8A 3TUEA 3L0HA 4K2DA 3DIEA 5CRHA 1OE7A 5JWOB 1QGVA 1RK4A 4NV2A 1PL2A 2VM1A 3TJFA 4MK3A 2YV7A 2L5OA 2CVKA 2IMIA 4K0GA 2ALBA 2OADA 3O3TA 1AQXA 4L0WA 3N5OA 2WJUA 5AISA 1NM3A 1WRYA 4WR5A 3FYGA 2MBSA 3UEMA 1WE0A 3F3QA 1GNWA 2LSTA 2G2QA 1TJDA 4MF5A 2LNTA 5CO3A 1XW9A 1QQ2A 3TJJA 1KTEA 3VPTA 1G6WA 2PBJA 1YJ6A 3KP9A 1PQNA 1O81A 1F3AA 4KDXA 1TKDB 2J23A 4KNDA 2DIZA 4LL1B 1BAYA 1C72A 2FA8A 4L5LA 1K3OA 4MPFA 3O6TA 3GL5A 2JZRA 1DSBA 1MDJA 5CRDA 4ULXA 1F3BA 1B8XA 1W89A 2O87A 3RPPA 4K6XA 4I5QA 2WDUA 2CVBA 1MD4A 2C1YA 4I97A 1X5DA 3QCPA 2OE0A 3TCOA 3RPNA 4POLA 5JCUA 3K8NA 5EVOA 5DJLA 2HRKB 2IMKA 4LMWA 5D9XA 3HY2A 4EXJA 1FG4A 2BTOT 4TXOB 5GSTA 1AUCA 3ISOA 4K0NA 2VD0A 1WPIA 4IJIA 1THOA 2C4JA 2B1LA 1TRWA 3VI5A 2X8GA 1ILOA 3KH7A 3TRPA 5AIXA 2FWFA 4K8MA 2HXKA 4BPYA 3L78A 3ZITA 4P3YB 1X9SB 5H5SA 4XRDA 2E2GA 4I2TA 3EE2A 4EUYA 4PUFC 3HVVA 3FRCA 4JEDA 5B7CA 4PUAA 3A5WA 3KD0A 1BG5A 2VCVA 3IE3A 4K7OA 2QGVA 3BBYA 1EOHA 3AY8A 4MA9A 3Q19A 4I6XA 3CRTA 2WGRA 1GSFA 1VF3A 1V2AA 2YNXA 1XZOA 2WFCA 2DSAA 4OFNA 4OD7A 3D5JA 4PX1A 4NMUA 2H0HA 2V41A 3DEXA 4JR6A 1GL8A 1SL0B 1EEMA 11GSA 2FWGA 3TKSA 1NHYA 2CQ9A 4IS0A 1U87A 3FZAA 4QQ7A 4OWYA 4KGIA 5CNWA 5B6NA 1BX9A 1XCCA 5G31A 4KUNA 3GUSA 1YY7A 1TI3A 4N30A 2OBKA 2D2ZA 4KCEA 3UARA 5ELAA 1J0FA 4IGJA 1XWKA 1ZOFA 1HNBA 5IMFA 1ZGNA 3QAGA 2H1AA 4Z7XA 1THXA 2ES7A 4PGTA 2EIRA 1GUMA 1GP1A 4GXZA 2I4AA 1A2MA 3HDCA 3A2XA 4XIHA 3F4TA 1BJXA 3E0UA 1NW2A 2AHEA 1TU7A 2XC2A 7GSSA 2PWJA 5DDLA 1M0UA 1K0BA 3G7JA 5F0GA 17GSA 3IXRA 5ECLB 2HZEB 5D93A 4TOPA 2GT6A 4RUVA 5IO2A 3LWAA 1XW5A 2XBQA 4ACSA 1W4VA 4MZCA 2IJYA 1IYIA 1GLQA 1PX7A 3ZIVA 3HJMA 2LTKA 1M9AA 5ELGA 3RBTA 2UZ8A 2N5AA 5IIZA 1VF1A 3RDWA 5IQYA 2ZCTA 1X5CA 4MF7A 4TXVA 5D73A 1S3CA 3W6GA 4ZB8A 1U3IA 3ZTLA 4HJMA 4KB3A 3DVWA 1WIKA 1ON4A 2YOIA 2JSZA 1PSQA 2VLVA 4XS4A 1GRXA 3GIXA 4KDYA 2H6ZA 2MMNA 2H76A 1Z5YE 4G0LA 2X99A 4BWSA 4EDYA 1WP0A 3M0FA 4TKYA 3TB2A 2YCDA 1SENA 1SL1B 5J3RA 2G0FA 3HCZA 2AYTA 1TK8B 2X8CA 4WEYA 5IOXA 1WJKA 2R6KA 1N8JA 5G2ZA 3J7Yb 1EV9A 4NV5A 2K6VA 4DSRA 2IN3A 5JWQB 1B4PA 1OVNA 2FGXA 4MH2A 2PVOC 5G5FA 2V6KA 4JRRA 3GFKA 2MYGA 4BVXA 3UOMA 1SKSB 1OC3A 3R2QA 1ERUA 10GSA 2VCXA 3WD6A 1A8LA 3ED3A 3CSHA 3D22A 4MJCA 1GSSA 1VF2A 1Y25A 3P2AA 3QMXA 4Q5NA 4MJAA 3G7IA 2REMA 3GV1A 3UBKA 1O85A 3F4SA 1R5AA 2PVQA 3LXZA 2LQQA 3NZNA 3CSJA 1AXDA 4L0UA 5FT3A 5DAKB 3LEFA 1F2EA 3WT1A 3CXGA 3FR6A 3RHBA 2YPMA 2JZTA 5GAND 1AC1A 2X64A 2O85A 4N0ZA 3US3A 3ZREA 1CQGA 1MDKA 4TR1A 4MABA 5E4WA 3C1RA 2YV9A 3V1WA 2EIQA 4LMVA 3GKXA 3TRQA 3HVSA 4IP6A 2CZ3A 5C00A 1SD9A 4MDCA 2O89A 4POMA 1YKAA 2H6XA 4TR0A 5DALA 1FOVA 1XPVA 3QAVA 2IFQA 4HDEA 4XHMA 3CYNA 3GH9A 1O8WA 3IC4A 3EWLA 2QC7A 3KM6A 3KCMA 3VWVA 4FH8A 1OKTA 1X5EA 5GAPD 2YWIA 1SK1A 4PNFA 1Z7PA 5ECMB 3J7Yk 2P5QA 1QK8A 2HSYA 3KMOA 2HZFA 2FHEA 2VL2C 6GSSA 2GQLA 12GSA 1Q98A 3KZQA 5D8IA 1M2BA 3DVXA 3TGZA 2P31A 1F9MA 2KP2A 4V2MA 6GSVA 4IP1A 2VLTA 2B7KA 2E2MA 3HJPA 4XS6A 2R3XA 3L4NA 3QDNA 2VCZA 1XWBA 3UL3A 3HA9A 4ZL9A 5L71A 2YZHA 4XTSA 4YH2A 1MEKA 4IELA 3ERWA 3DYRA 4GTUA 2YN1A 5CREA 1JLWA 3BCIA 3GTUA 4V1Ap 4ECJA 3EMPA 4AGSA 5HFKA 3LGCA 2F8AA 4E8EA 2H1GA 4PTSA 2FUG2 3IAS2 4HZ2A 1R5PA 4HU9A 4AJ7A 2B1KA 5D9VA 5LD0A 5CRGA 1SK2A 3DD3A 3L9SA 3FR3A 1FB6A 1YKCA 2HSMA 1TTZA 1XVQA 2LNSA 5ID2A 5DVBA 6GSWA 4X1UA 1B9XC 4POKA 2KLXA 2C80A 2LRNA 1QXHA 4G0KA 4GF0A 4F0CA 1I9DA 4TRXA 1VF4A 1JZOA 3HJOA 3ZFLA 3D4TA 5EPFA 5HFIA 5F06A 1FVJA 4BA7A 1M2AA 3TOUA 2DLXA 5EY6A 2YWOA 4FQUA 2KOKA 2GDRA 4OCEA 5H5RA 2H71A 3UAPA 1KEBA 1EP8A 2JACA 5HR0A 2B7JA 2HT9A 2FWEA 1EGOA 3GH6A 3KGKA 1JLVA 2WRTA 4GCIA 3BJ5A 1I5GA 2VLUA 3EMXA 1ERVA 2GTUA 3NIVA 3IDVA 1GTUA 3ZMKA 3GKNA 4G2EA 3C71A 3LQ7A 5EL8A 1TI1A 1T7PB 4EE0A 4USSA 2C0DA 5ECPB 4EL1A 2J9HA 1OC9B 4CHSA 4NAXA 3Q18A 3JCML 5D9WA 2NBSA 5COHA 1Z6NA 4O32A 2YWNA 4D73A 3I6AA 4LL4B 4GLTA 2AUVA 1EP7A 4V2LA 5BMUA 1XWCA 5G5EA 4PXOA 4BVYB 4TR4A 4F9ZA 4ECBA 2OA7A 5G1KA 4F03A 1QFNA 5G1LA 3H93A 2E0QA 4MP4A 1EGRA 3HHVA 1TXXA 3H79A 3HKRA 3WGDA 4HJ2A 4AJ8A 3I69A 4NHWA 5IMAA 4IBPA 2VO4A 3PH9A 2LV3A 1R7HA 2F3MA 1J9BA 1DUGA 2AAWA 3D6IA 1Y6EA 4HUAA 1CQHA 1PD21 3QR6A 2TRXA 1G0TA 2V1MA 3ZVJD 1GSYA 3GRXA 3U5RE 1T8EB 4BL7B 2GQKA 1H4OA 1T4ZA 4TR3A 2QKEA 4OMVA 3ZLPA 1MD3A 1TK5B 1FHEA 4JR4A 1SKRB 5ECSA 2DJJA 3CRUA 3G9BA 4L5OA 2CX3A 4MZBA 2ON7A 3TKPA 3FZ5A 1K3LA 4PURA 2WZ9A 1ZYEA 2DBCA 4KCAA 3TJKA 2YWMA 1SJ6A 1T4YA 2HLSA 3C7MA 1F37A 4MMMA 1V9WA 6GSUA 2L6DA 1GLPA 4DSSA 3UJ1A 4HOJA 2FY6A 1YF0A 1JHBA 5J5NA 2AJQB 4PQIA 4KA0A 4IVFA 3GHAA 1ERTA 1GWCA 1RQMA 3C8EA 1KNGA 2HRFA 1N2AA 4OCFA 4I2UA 4BWQA 2GZZA 1PKZA 3SBCA 2HQTA 4EO3A 1SJIA 2GGTA 4NPBA 4O92A 1A8YA 3SWLA 2VOCA 1DE1A 3LYPA 1TRVA 3D0ZA 3ZVJA 3CTGA 2OBIA 4O5RA 2OKAA 3EYTA 1ERWA 5H5QA 5KN3A 3HXSA 3GKKA 3W8SA 4LA1A 5HR3A 1G7EA 2I9HA 5INYA 2JU5A 4YAPA 4KAEA 3FY7A 4FYBA 3CSIA 6GSYA 2LJRA 3IV4A 2FNOA 2MMAA 2V2GA 4NXIA 1F6MC 4FYUA 4HI7A 2F9SA 1XWGA 1GTAA 4EC0A 4K7IA 2MBTA 1NSWA 1SJZA 2H30A 1LJRA 4WKWA 1GUKA 4K9ZA 2TIRA 4QL9A 2WULA 5A4UA 2K8VA 1E6BA 1Z3EA 1R26A 3BCKA 1B9YC 2H1BA 2VD1A 2RM5A 1GUHA 3IC8A 1ZCPA 3L9UA 5IPHA 1B4QA 2L4CA 4L8EA 4KH7A 3P8WA 3F0IA 3IAM2 1GSUA 3F4RA 3VFIA 2WB9A 1EZKA 4JE1A 5F8BA 3TJGA 2HRKA 3IBHA 1YF1A 3P90A 4TXOA 5HFGA 2B6MA 5A4WA 2VL3A 2F51A 3CTFA 2IWTA 3EU3A 2JZSA 1YQ1A 1OC9A 1K0CA 2KUCA 3A3TA 1AQWA 3KIJA 2GS3A 3LORA 1U88A 2R2JA 3HVXA 5GSSA 2MMZA 4MJEA 3VWWA 2DJ0A 1J08A 3KH9A 2HI7A 5IMZA 1TOFA 3N9JA 1M9BA 4GRFA 5KN0A 5A5KA 2HFDA 3TKSC 3PPUA 4NHZA 2EIOA 1EV4A 14GSA 4TW5A 2CAQA 4KSMA 4OO4A 2LJAA 2LKUA 2DJKA 1Q4JA 1O7UA 4XCSA 1HNCA 1U6TA 2LS5A 2M80A 2FWHA 1A0FA 3U6VA 1DBYA 1V98A 1XBSA 4CDOA 4I8BA 1A0RP 5CP1A 1Z7RA 3M9JA 3E3EA 3DRNA 4ECCA 3PR8A 2P5RA 2F8FA 3H1NA 1SD8A 2C3QA 3GYKA 4X0XA 4BL7A 2BMXA 5ECIB 1A2JA 4N10A 5ECHB 1K0NA 3I9V2 3FZ9A 4F82A 2GSSA 4PQ1A 9GSSA 1T00A 3APSA 4PNGA 3GX8A 4ZBBA 5J9CA 3ME7A 2DMLA 3GN3A 4IW9A 1RW1A 4DSQA 3M9KA 1G7OA 1VRSD 4XRAA 4DVCA 2H66A 2DJ3A 4GQCA 2I3YA 5DCGA 1FO5A 3VWUA 5ABRA 2HNLA 2GZPA 1HD2A 4FIWA 3H4KA 1XVWA 2NDOA 1NHOA 1JZDA 1WWJA 1PX6A 4ID0A 2NPBA 2CAIA 3LJRA 20GSA 1OKDA 22GSA 4GSSA 3QD9A 1X0RA 1GTIA 2I1UA 2HZEA 2ZNMA 2XPEA 1EEJA 5D96A 3IHQA 5KN1A 1E2YA 5B8BA 2PPTA 2GSQA 1K0OA 2DJ1A 4EDZA 3VK9A 5KN2A 1KBNA 4K1FA 2H01A 2N5BA 2GZYA 3FZ4A 3LYKA 3TJBA 1SU9A 2RM6A 3DMLA 3GA4A 5B6MA 3VPQA 1MTCA 2MZCA 2A2SA 3H8QA 1QMVA 1MDIA 2JADA 2CX4A 1TRSA 2L59A 2VUPA 4HQSA 3GMFA 4HZ4A 4F0BA 1AQVA 4GSTA 3OR5A 4N0VA 5HR1A 3GURA 1BYEA 4EF0A 4ZXGA 2H73A 3WGXA 4MZWA 1GSDA 1V40A 2LRTA 3I43A 1T3BA 19GSA 16GSA 5ENUA 2ZUPA 2C3TA 2RUEA 2DMMA 1GTBA 5IMVA 2X8HA 2V6OA 2XBIA 1TRUA 4IQAA 3WT2A 4MF6A 4PQHA 3VURA 2IL3A 2RLIA 2GVPA 4HU7A 4J57E 3LSZA 5G30A 4JBBA 2KHPA 1AAZA 2L4QA 2R37A 3MWHA 1ZL9A 1FVKA 4F2IA 4XS4B 3W8JA 2GSTA 4MJBA 3VI7A 4FO5A 3FK8A 2H72A 2FCHA 4ZBAA 1U3AA 1TW9A 2RIIA 3F63A 5DQSA 3FEUA 4KW6A 3IK7A 4X43A 2H0GA 3EVIA 4HS1A 4WBRD 4YQMA 5JWRB 4KDUA 1V58A 5J4UA 2DC5A 2VCTA 2HRNA 4WF4A 4WETA 3D21A 3EC3A 3EURA 4MH3A 2PGTA 2O7KA 3DXBA 3QOUA 5DAKA 1AW9A 1GH2A 5HQPA 4BVXB 5KEJA 4ZL7A 3LFLA 1BQ7A 2FD3A 5IM9A 4ILFA 1XIYA 1SL2B 1SYRA 5ECRB 1R4WA 2A4VA 1FW1A 4GQFA 4O7HA 5ECNB 1ST9A 4ECIA 2RUFA 3FW2A 1IYHA 5FWGA 4NWYA 4ZILA 4DEJA 4ZBDA 5E59A 3ZZXA 3RAZA 2C3NA 4ZB9A 4GSNA 1USBA 5ECQB 3MSZA 3C1SA 1B48A 2OJLA 3BD2A 3DGQA 3ZFBA 2B5YA 1OE8A 5AN1A 1VGLA 5CYYA 3KMNA 2VCQA 2C0FA 4TR1B 3UBLA 3RHCA 3QPMA 4RQRA 5FHIA 4V1Ag 2OE3A 4JZQA 1TU8A 1XW6A 1PRXA 3APOA 5J9BA 3CBUA 3QFBC 4ML6A 3M8NA 2L6CA 4ML1A 2M72A 2OE1A 3TRXA 2GSRA 5D9TA 2FLSA 13GSA 4TN8A 2YP6A 3UVTA 4AF2A 1TK0B 4YQVA 2R4VA 1UVZA 5DALB 1FB0A 2IFQB 2C0GA 1GNEA 1S3AA 3GL3A 3GNJA 1URMA 4KX4A 2XPDA 4G19A 3TKRA 1PN9A 3UVHA 3VWXA 4FYCA 2HSHA 2NVLA 5ECOB 3UIWA 4Q5QA 1G6YA 4HEA2 5IMCA 1BEDA 3HZ8A 4MLYA 1JFUA 2C0EA 4JU5A 3EINA 2PUKC 2H70A 3MAKA 2AB6A 2K8SA 4ZIJA 1O73A 2CZ2A 2H75A 1JZWA 2LRCA 4G9HA 1OYJA 1EOGA 2LQOA 1YDKA 3ZL5A 2IMEA 4IQ1A 2GT5A 3HZ4A 2PMTA 3MNGA 6GSXA 2LUSA 1EWXA 4LLRA 2JL4A 3ZYWA 2V32A 3QFAC 1ACVA 4GWRA 3ERGA 3KTBA 5HR2A 5DBQA 3WYWA 2VL2A 4ISDA 2YZUA 1A2LA 5AGYA 5JCWA 2OACA 3F6FA 2HSNB 5GZZB 2P0GA 3GSSA 1PA3A 1XOBA 4K7NA 2H8LA 3GTUB 2B3SA 1K3YA 5F07A 4E8HA 6GSTA 2JSYA 4MCUA 4KE3A 3Q6OA 3A2VA 4H86A 2M46A 2I81A 5IPGA 3S9FA 2QSIA 3IPZA 4IN0A 2E7PA 3LG6A 2K18A 2CA8A 4IJ3A 2H6YA 2MMOA 3IR4A 2K9FA 4QL7A 3IK9A 2DJ2A 2CT6A 3F6DA 4WF5A 2VCWA 2CV4A 2HSMB 3M1GA 1K0DA 4RQXA 1QUWA 3F9UA 5ID2B 3TDGA 5IO0A 1PGTA 1ZYQB 5DCHA 2NTOA 3C73A 2VIMA 2YANA 3ZIJA 1O6JA 4WR4A 2L57A 1ML6A 1LU4A 4WBJA 2B5XA 3TKQA 5JCGA 3R3EA 1A23A 2PN8A 3UMAA 2GLRA 1YEPA 3TKSE 3GSTA 2XHFA 1HQOA 3DKSA 4N11A 3EU4A 3KTLA 3HD5A 1S3DA 5CRWA 4CW9A 1M7TA 1A24A 3ERFA 5IOWA 4BVYA 4WXTA
chains in the Genus database with same CATH superfamily
2WS2A 1GSEA 4QMKA 1HNAA 5DJMA 5CAXA 4G0IA 2YJHA 3KJYA 2A2RA 1YEWC 3KP8A 4EVMA 1XOAA 3D4MA 2LJKA 1X9MB 3F3RA 3IA1A 4MPGA 2HE3A 1FAAA 2VM2A 4KSOA 3QAWA 2LEGA 2ON5A 3CMIA 3WGEA 4J2FA 4IKHA 3O76A 2KP1A 5IMDA 1YZXA 3GX0A 5C04A 3FHKA 1LBKA 1H75A 2PERA 4D73B 2WCIA 4TVEA 4AJ6A 5A4VA 2EC4A 2IMDA 4ZL8A 5BMUB 4KF9A 5LNKe 1V57A 1JZRA 3KEBA 1X9WB 5J41A 2FA4A 2GQMA 4OO5A 1Z9HA 4RI7A 4ZB6A 1K0AA 3TOTA 3VLNA 3A2WA 1YEXA 3MDKA 5ECKB 1XWAA 1XXUA 1AIUA 4POBA 1N25A 3L9VA 3IOSA 2CVDA 3DWVA 1HYUA 4YAVA 1WMJA 2VL9A 2EFHA 3F8UA 5KOXA 4RI6A 4HQZA 1OAZA 4IHUA 2TRCP 2B5EA 3GKMA 1TDIA 5B8AA 3APQA 3HYPA 3IRAA 5LCZA 1GULA 2O36A 2H1DA 1UN2A 1M99A 1XFLA 1PKWA 3FR9A 2IIYA 1PMTA 2H0IA 4Z2TA 5DQYA 2H19A 1WOUA 3ZRDA 5AIVA 1K0MA 4Q5RA 2H74A 4G10A 3ZMLA 2HRAA 4V2NA 4OFTA 1UA5A 2C8UA 1SKWB 1ZZYA 1Z6MA 1O8XA 5F05A 1UC7A 4OFMA 4DSSB 2AV4A 2IPAA 1GSQA 4XS1A 2YJ7A 3KXOA 1OC8A 3FKFA 3BOAA 1ZMAA 8GSSA 2HYXA 4J56E 3PGTA 18GSA 3Q74A 2BJXA 2O8VB 4Q5FA 1TP9A 2IMFA 3M3MA 2R5GA 2DIYA 1SK0A 2VAFA 3E9JB 1DE2A 3NOFA 1PL1A 4EKZA 3PINA 2PU9C 1ABAA 3LXTA 1M2DA 1T1VA 2L5LA 1SYXA 3G7YA 2N5FA 3P7XA 2Z9SA 4YQUA 1TXUA 3ME8A 3TUEA 3L0HA 4K2DA 3DIEA 5CRHA 1OE7A 5JWOB 1QGVA 1RK4A 4NV2A 1PL2A 2VM1A 3TJFA 4MK3A 4Z2UA 2YV7A 2L5OA 2CVKA 2IMIA 4K0GA 2ALBA 2OADA 3O3TA 1AQXA 4L0WA 3N5OA 2WJUA 5AISA 1NM3A 1WRYA 4WR5A 3FYGA 2MBSA 3UEMA 1WE0A 3F3QA 1GNWA 2LSTA 2G2QA 1TJDA 4MF5A 2LNTA 5CO3A 1XW9A 1QQ2A 3TJJA 1KTEA 1SVMA 3VPTA 1G6WA 2PBJA 1YJ6A 3KP9A 1PQNA 1O81A 4GDFA 1F3AA 4KDXA 1TKDB 2J23A 4KNDA 2DIZA 4LL1B 1BAYA 1C72A 2FA8A 4L5LA 1K3OA 4MPFA 3O6TA 3GL5A 2JZRA 1DSBA 1MDJA 5CRDA 4ULXA 1F3BA 1B8XA 1W89A 2O87A 3RPPA 4K6XA 4I5QA 2WDUA 2CVBA 3TU3B 1MD4A 4AKIA 2C1YA 4I97A 1X5DA 1M3IA 3QCPA 2OE0A 3TCOA 3RPNA 4POLA 5JCUA 3K8NA 5EVOA 5DJLA 2HRKB 2IMKA 4LMWA 5D9XA 3HY2A 4EXJA 1FG4A 2BTOT 4TXOB 5GSTA 1AUCA 3ISOA 4K0NA 2VD0A 1WPIA 4IJIA 1THOA 2C4JA 2B1LA 1TRWA 3VI5A 2X8GA 1ILOA 3KH7A 3TRPA 5AIXA 2FWFA 4K8MA 2HXKA 4FXYP 4BPYA 3L78A 3ZITA 4P3YB 1X9SB 5H5SA 4XRDA 2E2GA 4I2TA 3EE2A 4EUYA 4PUFC 3HVVA 3FRCA 4JEDA 5B7CA 4PUAA 3A5WA 3KD0A 1BG5A 2VCVA 3IE3A 4K7OA 2QGVA 3BBYA 1EOHA 3AY8A 4MA9A 3Q19A 4I6XA 3CRTA 2WGRA 1GSFA 1VF3A 1V2AA 2YNXA 1XZOA 2WFCA 4EIPA 2DSAA 4OFNA 4OD7A 3D5JA 4PX1A 4NMUA 2H0HA 2V41A 3DEXA 4JR6A 1GL8A 1SL0B 1EEMA 11GSA 2FWGA 3TKSA 1NHYA 2UV8G 2R0GA 2CQ9A 4IS0A 1U87A 3FZAA 4QQ7A 4OWYA 2WVZA 4KGIA 5CNWA 5B6NA 1BX9A 1XCCA 5A5HB 5G31A 4KUNA 3GUSA 1YY7A 1YVLA 1TI3A 4AI6A 4N30A 2OBKA 2D2ZA 4KCEA 3UARA 5ELAA 1J0FA 4IGJA 1XWKA 1ZOFA 1HNBA 5IMFA 1ZGNA 3QAGA 2H1AA 4Z7XA 4PHZC 1THXA 2ES7A 4PGTA 2EIRA 1GUMA 1GP1A 4GXZA 2I4AA 1A2MA 3HDCA 3A2XA 1SVOA 4XIHA 3F4TA 1BJXA 3E0UA 1NW2A 2AHEA 1TU7A 2XC2A 7GSSA 2PWJA 5DDLA 1M0UA 1K0BA 3G7JA 5F0GA 17GSA 3IXRA 5ECLB 2HZEB 5D93A 4TOPA 2GT6A 4RUVA 5IO2A 5J4YA 3LWAA 1XW5A 2XBQA 4ACSA 1W4VA 4MZCA 5A1NB 2IJYA 1IYIA 1GLQA 1PX7A 3ZIVA 4PI0C 3HJMA 2LTKA 1M9AA 5ELGA 3RBTA 2UZ8A 2N5AA 5IIZA 1VF1A 3RDWA 5IQYA 3RFRC 2ZCTA 1X5CA 4MF7A 4TXVA 5D73A 1S3CA 3W6GA 4ZB8A 1U3IA 3ZTLA 4HJMA 4KB3A 3DVWA 1WIKA 2QA1A 1ON4A 4Z2RA 2YOIA 1BG1A 2JSZA 1PSQA 2VLVA 3HMJG 4XS4A 1GRXA 3GIXA 4KDYA 2H6ZA 2MMNA 2H76A 1Z5YE 4G0LA 2X99A 4BWSA 4EDYA 1WP0A 3M0FA 4TKYA 3TB2A 5KOWA 2YCDA 1SENA 1SL1B 5J3RA 2G0FA 3HCZA 2AYTA 1TK8B 4W66A 2X8CA 4WEYA 5IOXA 1WJKA 2R6KA 1N8JA 5G2ZA 3HVNA 3J7Yb 2WVYA 1EV9A 4NV5A 2K6VA 4DSRA 2IN3A 5JWQB 1B4PA 1OVNA 2FGXA 4MH2A 2PVOC 4N3ZA 5G5FA 2V6KA 4JRRA 3GFKA 2MYGA 4BVXA 3UOMA 1SKSB 1OC3A 3R2QA 1ERUA 10GSA 2X4AA 2VCXA 2WVXA 3WD6A 1A8LA 3ED3A 3CSHA 3D22A 4MJCA 1GSSA 1VF2A 1Y25A 3FMWA 3P2AA 3QMXA 4Q5NA 4MJAA 1S4BP 3G7IA 2REMA 3GV1A 3UBKA 1O85A 3F4SA 1R5AA 2PVQA 4AKHA 3LXZA 2LQQA 3NZNA 3CSJA 1AXDA 4L0UA 5FT3A 5DAKB 3LEFA 1F2EA 3WT1A 3CXGA 3FR6A 3RHBA 4AKGA 2YPMA 2JZTA 5GAND 1AC1A 2X64A 2O85A 4N0ZA 3US3A 3ZREA 1CQGA 1MDKA 4TR1A 4MABA 5E4WA 3C1RA 2YV9A 3V1WA 2EIQA 4LMVA 3GKXA 3TRQA 3HVSA 4IP6A 2CZ3A 5C00A 1SD9A 4MDCA 2O89A 4POMA 1YKAA 2H6XA 4TR0A 5DALA 1FOVA 1XPVA 3QAVA 2IFQA 4HDEA 4XHMA 3CYNA 3GH9A 1O8WA 3IC4A 3EWLA 2QC7A 5A5HA 3KM6A 3KCMA 3VWVA 4FH8A 1OKTA 1X5EA 5GAPD 2YWIA 1SK1A 4K5SA 4PNFA 1Z7PA 5ECMB 3J7Yk 2P5QA 1QK8A 2HSYA 3KMOA 2HZFA 2FHEA 2VL2C 6GSSA 2GQLA 5BRTA 12GSA 1Q98A 3KZQA 2O5VA 2VKZG 5D8IA 1M2BA 3DVXA 3TGZA 2P31A 1F9MA 2KP2A 4V2MA 4X4JA 4MNNA 6GSVA 4IP1A 2X49A 2VLTA 2B7KA 2E2MA 3HJPA 4XS6A 2R3XA 3L4NA 3QDNA 2VCZA 1XWBA 3UL3A 5A34A 3HA9A 4ZL9A 5L71A 2YZHA 4XTSA 4O5UA 4YH2A 2HSNA 1MEKA 4IELA 3ERWA 3DYRA 4GTUA 2YN1A 5CREA 1JLWA 3BCIA 3GTUA 4V1Ap 4ECJA 3EMPA 4AGSA 5HFKA 3LGCA 4K2XA 2F8AA 4E8EA 3MIXA 2H1GA 4PTSA 2FUG2 3IAS2 4HZ2A 1R5PA 4HU9A 4AJ7A 2B1KA 5D9VA 2A2PA 5LD0A 5CRGA 1SK2A 3DD3A 2DKHA 3L9SA 3FR3A 1FB6A 1YKCA 2HSMA 1TTZA 1XVQA 2LNSA 5ID2A 5DVBA 6GSWA 4X1UA 1B9XC 4POKA 2KLXA 2C80A 2LRNA 1QXHA 4G0KA 4GF0A 4F0CA 1I9DA 4TRXA 1VF4A 1JZOA 3HJOA 3ZFLA 3D4TA 5EPFA 5HFIA 5F06A 1FVJA 4BA7A 1PFOA 1M2AA 1M3JA 3TOUA 2DLXA 5EY6A 2YWOA 2OT3A 4FQUA 2KOKA 2GDRA 4OCEA 5H5RA 2H71A 1ZYPA 3UAPA 1KEBA 1EP8A 2JACA 5HR0A 2B7JA 2HT9A 2FWEA 4O5QA 1EGOA 3GH6A 3KGKA 1JLVA 2WRTA 4GCIA 3BJ5A 1I5GA 2VLUA 3EMXA 1ERVA 2GTUA 3NIVA 3IDVA 4CY6A 1GTUA 3ZMKA 3GKNA 4G2EA 1ZYNA 3C71A 3LQ7A 5EL8A 1TI1A 1T7PB 4EE0A 4USSA 2C0DA 5ECPB 4EL1A 2J9HA 1OC9B 4CHSA 4NAXA 3Q18A 3JCML 5D9WA 2NBSA 5COHA 1Z6NA 4O32A 2YWNA 4D73A 3I6AA 4LL4B 4GLTA 2AUVA 1EP7A 4V2LA 5BMUA 1XWCA 5G5EA 4PXOA 4BVYB 4TR4A 4F9ZA 4ECBA 2OA7A 5G1KA 4F03A 1QFNA 5G1LA 3H93A 2E0QA 4MP4A 1EGRA 3HHVA 1TXXA 4A5PA 3H79A 3HKRA 3WGDA 4HJ2A 4AJ8A 3I69A 4NHWA 5IMAA 4IBPA 2VO4A 3PH9A 2LV3A 1R7HA 2F3MA 1J9BA 1DUGA 2AAWA 3D6IA 1Y6EA 4HUAA 1CQHA 1PD21 3QR6A 2TRXA 4ICYA 1G0TA 2V1MA 3ZVJD 1GSYA 3A5IA 3GRXA 3U5RE 1T8EB 4BL7B 2GQKA 1H4OA 1T4ZA 4TR3A 2QKEA 4OMVA 3ZLPA 1MD3A 1TK5B 1FHEA 4JR4A 1SKRB 5ECSA 2DJJA 3CRUA 3G9BA 4L5OA 2CX3A 4MZBA 2ON7A 3TKPA 3FZ5A 1K3LA 4PURA 2WZ9A 2H1LA 1ZYEA 2DBCA 4KCAA 3TJKA 2YWMA 1SJ6A 2EFCA 2EFEA 1T4YA 2HLSA 3C7MA 1F37A 4MMMA 1V9WA 6GSUA 2L6DA 1GLPA 4DSSA 3UJ1A 4HOJA 2FY6A 1YF0A 1JHBA 5J5NA 2AJQB 4PQIA 4KA0A 4E68A 4IVFA 3GHAA 1ERTA 1GWCA 1RQMA 3C8EA 1KNGA 2HRFA 1N2AA 4OCFA 4I2UA 4BWQA 2GZZA 1PKZA 3SBCA 2HQTA 2O3EA 4EO3A 1SJIA 2GGTA 4NPBA 4O92A 1A8YA 3SWLA 2VOCA 1DE1A 3LYPA 1TRVA 3D0ZA 3ZVJA 3CTGA 2OBIA 1I1IP 4O5RA 1S3RA 2OKAA 3EYTA 1ERWA 5H5QA 3RGBC 5KN3A 3HXSA 3GKKA 4YKGA 3W8SA 4LA1A 5HR3A 1G7EA 2I9HA 5INYA 1BF5A 2JU5A 4YAPA 4KAEA 3FY7A 4FYBA 3CSIA 6GSYA 2LJRA 3IV4A 2FNOA 2MMAA 2V2GA 4NXIA 1SVLA 1F6MC 4FYUA 4HI7A 2F9SA 1XWGA 1GTAA 4EC0A 4K7IA 2MBTA 1NSWA 1SJZA 2H30A 1LJRA 4WKWA 1GUKA 4K9ZA 2TIRA 4QL9A 2WULA 5A4UA 2K8VA 1E6BA 1Z3EA 1R26A 3BCKA 1B9YC 2H1BA 2VD1A 2RM5A 1GUHA 3IC8A 1ZCPA 3L9UA 5IPHA 1B4QA 3MYDA 2L4CA 4L8EA 4KH7A 2WW1A 3P8WA 3LW9A 3F0IA 3IAM2 1GSUA 3F4RA 3VFIA 2WB9A 1EZKA 4JE1A 5F8BA 3TJGA 2HRKA 3IBHA 1YF1A 3P90A 4TXOA 5HFGA 2B6MA 5A4WA 2VL3A 2F51A 2DKIA 3CTFA 2IWTA 3EU3A 2JZSA 1YQ1A 1OC9A 1K0CA 2KUCA 3A3TA 1AQWA 3KIJA 2GS3A 3LORA 1U88A 2R2JA 3HVXA 5GSSA 2MMZA 4MJEA 3VWWA 2DJ0A 1J08A 3KH9A 2HI7A 5IMZA 1TOFA 3N9JA 1M9BA 4GRFA 5KN0A 5A5KA 2HFDA 3TKSC 3PPUA 4NHZA 4EIQA 2EIOA 1EV4A 14GSA 4TW5A 2CAQA 4KSMA 4OO4A 2LJAA 2LKUA 2DJKA 1Q4JA 1O7UA 4XCSA 1HNCA 1U6TA 2LS5A 2M80A 2FWHA 1A0FA 3U6VA 1DBYA 1V98A 4AKXB 1XBSA 4CDOA 4I8BA 1A0RP 5CP1A 1Z7RA 3M9JA 3E3EA 3DRNA 4ECCA 3PR8A 2P5RA 2F8FA 3H1NA 1SD8A 2C3QA 3GYKA 4X0XA 4BL7A 2BMXA 5ECIB 1A2JA 4N10A 5ECHB 1K0NA 3I9V2 3FZ9A 4F82A 2GSSA 4PQ1A 9GSSA 1T00A 3APSA 4PNGA 3GX8A 4ZBBA 5J9CA 3ME7A 2DMLA 3GN3A 4IW9A 1RW1A 4DSQA 3M9KA 1G7OA 1VRSD 4XRAA 4DVCA 2H66A 2DJ3A 4GQCA 2I3YA 5DCGA 1FO5A 3VWUA 5ABRA 3CHXC 2HNLA 2GZPA 1HD2A 4FIWA 3H4KA 1XVWA 2NDOA 1NHOA 1JZDA 1WWJA 2WW2A 1PX6A 4ID0A 2NPBA 2CAIA 3LJRA 20GSA 1OKDA 22GSA 4GSSA 3QD9A 1X0RA 1GTIA 2I1UA 2HZEA 2ZNMA 2XPEA 1EEJA 5D96A 2QA2A 3IHQA 5KN1A 1E2YA 5B8BA 5A1NA 2PPTA 2GSQA 1K0OA 2DJ1A 4EDZA 3VK9A 5KN2A 1KBNA 4K1FA 2H01A 2N5BA 2GZYA 3FZ4A 3LYKA 3TJBA 1SU9A 2RM6A 3DMLA 3GA4A 5B6MA 3VPQA 1MTCA 2MZCA 2A2SA 3H8QA 1QMVA 1MDIA 2JADA 2CX4A 1TRSA 2L59A 2VUPA 4HQSA 3GMFA 4HZ4A 4K5RA 4F0BA 1AQVA 4GSTA 3OR5A 4N0VA 5HR1A 3GURA 1BYEA 4EF0A 4ZXGA 2H73A 3WGXA 4MZWA 1GSDA 1V40A 2LRTA 3I43A 1T3BA 19GSA 16GSA 3CQFA 5ENUA 2ZUPA 2C3TA 2RUEA 2DMMA 1GTBA 5IMVA 2X8HA 2A4HA 2V6OA 2XBIA 1TRUA 4IQAA 3WT2A 4MF6A 4PQHA 3VURA 2IL3A 2RLIA 2GVPA 4HU7A 4J57E 3LSZA 5G30A 4JBBA 2KHPA 1AAZA 2L4QA 2R37A 3MWHA 1ZL9A 1FVKA 4F2IA 2EFDA 4XS4B 3W8JA 2GSTA 4MJBA 3VI7A 4FO5A 3FK8A 2H72A 2FCHA 4ZBAA 1U3AA 1TW9A 2RIIA 3F63A 5DQSA 2WZSA 3FEUA 4KW6A 3IK7A 4X43A 2H0GA 3EVIA 4HS1A 4WBRD 4YQMA 5JWRB 4KDUA 1V58A 4CY8A 5J4UA 2DC5A 2VCTA 2HRNA 4WF4A 4WETA 3D21A 3EC3A 3EURA 4MH3A 2PGTA 2O7KA 3DXBA 3QOUA 5DAKA 1AW9A 1GH2A 5HQPA 2R0PA 4BVXB 5KEJA 4ZB7A 4ZL7A 3LFLA 1BQ7A 2FD3A 5IM9A 4ILFA 1XIYA 1SL2B 2WVXB 1SYRA 5ECRB 1R4WA 2A4VA 3CWGA 1FW1A 4GQFA 4O7HA 5ECNB 1ST9A 4ECIA 2RUFA 3FW2A 1IYHA 5FWGA 4NWYA 4ZILA 4DEJA 4ZBDA 5E59A 3ZZXA 3RAZA 2C3NA 4ZB9A 5J4VA 4GSNA 1USBA 5ECQB 3MSZA 3C1SA 1B48A 2OJLA 3BD2A 3DGQA 3EPTA 3ZFBA 2B5YA 1OE8A 5AN1A 1VGLA 5CYYA 3KMNA 2VCQA 2C0FA 4TR1B 3UBLA 3RHCA 3QPMA 4RQRA 5FHIA 4V1Ag 1Y1UA 2OE3A 4JZQA 1TU8A 1XW6A 1PRXA 4PI2C 3APOA 5J9BA 3CBUA 3QFBC 4ML6A 3M8NA 2L6CA 4ML1A 2M72A 2OE1A 3TRXA 2GSRA 5D9TA 2FLSA 13GSA 4TN8A 2YP6A 3UVTA 4AF2A 1TK0B 4YQVA 2R4VA 1UVZA 5DALB 1FB0A 2IFQB 2C0GA 1GNEA 1S3AA 3GL3A 3GNJA 1URMA 4KX4A 2XPDA 4G19A 3TKRA 1PN9A 3UVHA 3VWXA 4FYCA 2HSHA 2NVLA 5ECOB 3UIWA 4Q5QA 2WW3A 1G6YA 4HEA2 5IMCA 1BEDA 3HZ8A 4MLYA 1JFUA 2C0EA 4JU5A 3EINA 2PUKC 1PN0A 2H70A 3MAKA 2AB6A 2K8SA 4ZIJA 1O73A 2CZ2A 2H75A 1JZWA 2LRCA 4G9HA 1OYJA 1EOGA 2LQOA 2R0CA 1YDKA 3ZL5A 4YKFA 2IMEA 4IQ1A 2GT5A 3HZ4A 2PMTA 3MNGA 6GSXA 2LUSA 1EWXA 4LLRA 2JL4A 3IHGA 3ZYWA 2V32A 3QFAC 1ACVA 4GWRA 3ERGA 3KTBA 5HR2A 5DBQA 3WYWA 2VL2A 4ISDA 2YZUA 5A34B 1A2LA 5AGYA 5JCWA 2OACA 3F6FA 2HSNB 5GZZB 2P0GA 3GSSA 1PA3A 1XOBA 4K7NA 2H8LA 3GTUB 2B3SA 1K3YA 5F07A 4E8HA 6GSTA 2JSYA 4MCUA 4KE3A 1FOHA 3A2VA 3Q6OA 4H86A 2M46A 2I81A 5IPGA 3S9FA 2QSIA 3IPZA 5J47A 4IN0A 2E7PA 3LG6A 2K18A 2CA8A 4IJ3A 2H6YA 2MMOA 3IR4A 2K9FA 4QL7A 3IK9A 2DJ2A 2CT6A 3F6DA 4WF5A 2VCWA 2CV4A 4BIKA 2HSMB 3M1GA 1K0DA 4RQXA 1QUWA 3F9UA 5ID2B 3TDGA 5IO0A 1PGTA 1ZYQB 5DCHA 2NTOA 3C73A 2VIMA 2YANA 3ZIJA 1O6JA 4WR4A 2WW0A 2L57A 1ML6A 4HSCX 1LU4A 4WBJA 2B5XA 3TKQA 5JCGA 3R3EA 1A23A 2PN8A 3UMAA 2GLRA 1YEPA 3TKSE 3GSTA 2XHFA 1HQOA 3DKSA 4N11A 3EU4A 4G01A 3KTLA 3HD5A 1S3DA 5CRWA 1XG8A 4CW9A 1M7TA 1A24A 5J40A 3ERFA 5IOWA 4BVYA 4WXTA
chains in the Genus database with same CATH topology
2WS2A 1GSEA 4QMKA 1HNAA 5DJMA 5CAXA 4G0IA 2YJHA 3KJYA 2A2RA 3KP8A 4EVMA 1XOAA 3D4MA 2LJKA 1X9MB 3F3RA 3IA1A 4MPGA 2HE3A 1FAAA 2VM2A 4KSOA 3QAWA 2LEGA 2ON5A 3CMIA 3WGEA 4J2FA 4IKHA 3O76A 2KP1A 5IMDA 1YZXA 3GX0A 5C04A 3FHKA 1LBKA 1H75A 2PERA 4D73B 2WCIA 4TVEA 4AJ6A 5A4VA 2EC4A 2IMDA 4ZL8A 5BMUB 4KF9A 5LNKe 1V57A 1JZRA 3KEBA 1X9WB 5J41A 2FA4A 2GQMA 4OO5A 1Z9HA 4RI7A 4ZB6A 1K0AA 3TOTA 3VLNA 3A2WA 1YEXA 3MDKA 5ECKB 1XWAA 1XXUA 1AIUA 4POBA 1N25A 3L9VA 3IOSA 2CVDA 3DWVA 1HYUA 4YAVA 1WMJA 2VL9A 2EFHA 3F8UA 5KOXA 4RI6A 4HQZA 1OAZA 4IHUA 2TRCP 2B5EA 3GKMA 1TDIA 5B8AA 3APQA 3HYPA 3IRAA 5LCZA 1GULA 2H1DA 1UN2A 1M99A 1XFLA 1PKWA 3FR9A 2IIYA 1PMTA 2H0IA 4Z2TA 5DQYA 2H19A 1WOUA 3ZRDA 5AIVA 1K0MA 4Q5RA 2H74A 4G10A 3ZMLA 2HRAA 4V2NA 4OFTA 1UA5A 2C8UA 1SKWB 1ZZYA 1Z6MA 1O8XA 5F05A 1UC7A 4OFMA 4DSSB 2AV4A 2IPAA 1GSQA 4XS1A 2YJ7A 3KXOA 1OC8A 3FKFA 3BOAA 1ZMAA 8GSSA 2HYXA 4J56E 3PGTA 18GSA 3Q74A 2BJXA 2O8VB 4Q5FA 1TP9A 2IMFA 3M3MA 2R5GA 2DIYA 1SK0A 2VAFA 3E9JB 1DE2A 3NOFA 1PL1A 4EKZA 3PINA 2PU9C 1ABAA 3LXTA 1M2DA 1T1VA 2L5LA 1SYXA 3G7YA 2N5FA 3P7XA 2Z9SA 4YQUA 1TXUA 3ME8A 3TUEA 3L0HA 4K2DA 3DIEA 5CRHA 1OE7A 5JWOB 1QGVA 1RK4A 4NV2A 1PL2A 2VM1A 3TJFA 4MK3A 4Z2UA 2YV7A 2L5OA 2CVKA 2IMIA 4K0GA 2ALBA 2OADA 3O3TA 1AQXA 4L0WA 3N5OA 2WJUA 5AISA 1NM3A 1WRYA 4WR5A 3FYGA 2MBSA 3UEMA 1WE0A 3F3QA 1GNWA 2LSTA 2G2QA 1TJDA 4MF5A 2LNTA 5CO3A 1XW9A 1QQ2A 3TJJA 1KTEA 1SVMA 3VPTA 1G6WA 2PBJA 1YJ6A 3KP9A 1PQNA 1O81A 4GDFA 1F3AA 4KDXA 1TKDB 2J23A 4KNDA 2DIZA 4LL1B 1BAYA 1C72A 2FA8A 4L5LA 1K3OA 4MPFA 3O6TA 3GL5A 2JZRA 1DSBA 1MDJA 5CRDA 4ULXA 1F3BA 1B8XA 1W89A 2O87A 3RPPA 4K6XA 4I5QA 2WDUA 2CVBA 3TU3B 1MD4A 4AKIA 2C1YA 4I97A 1X5DA 3QCPA 2OE0A 3TCOA 3RPNA 4POLA 5JCUA 3K8NA 5EVOA 5DJLA 2HRKB 2IMKA 4LMWA 5D9XA 3HY2A 4EXJA 1FG4A 2BTOT 4TXOB 5GSTA 1AUCA 3ISOA 4K0NA 2VD0A 1WPIA 4IJIA 1THOA 2C4JA 2B1LA 1TRWA 3VI5A 2X8GA 1ILOA 3KH7A 3TRPA 5AIXA 2FWFA 4K8MA 2HXKA 4BPYA 3L78A 3ZITA 4P3YB 1X9SB 5H5SA 4XRDA 2E2GA 4I2TA 3EE2A 4EUYA 4PUFC 3HVVA 3FRCA 4JEDA 5B7CA 4PUAA 3A5WA 3KD0A 1BG5A 2VCVA 3IE3A 4K7OA 2QGVA 3BBYA 1EOHA 3AY8A 4MA9A 3Q19A 4I6XA 3CRTA 2WGRA 1GSFA 1VF3A 1V2AA 2YNXA 1XZOA 2WFCA 4EIPA 2DSAA 4OFNA 4OD7A 3D5JA 4PX1A 4NMUA 2H0HA 2V41A 3DEXA 4JR6A 1GL8A 1SL0B 1EEMA 11GSA 2FWGA 3TKSA 1NHYA 2UV8G 2R0GA 2CQ9A 4IS0A 1U87A 3FZAA 4QQ7A 4OWYA 4KGIA 5CNWA 5B6NA 1BX9A 1XCCA 5A5HB 5G31A 4KUNA 3GUSA 1YY7A 1YVLA 1TI3A 4AI6A 4N30A 2OBKA 2D2ZA 4KCEA 3UARA 5ELAA 1J0FA 4IGJA 1XWKA 1ZOFA 1HNBA 5IMFA 1ZGNA 3QAGA 2H1AA 4Z7XA 1THXA 2ES7A 4PGTA 2EIRA 1GUMA 1GP1A 4GXZA 2I4AA 1A2MA 3HDCA 3A2XA 1SVOA 4XIHA 3F4TA 1BJXA 3E0UA 1NW2A 2AHEA 1TU7A 2XC2A 7GSSA 2PWJA 5DDLA 1M0UA 1K0BA 3G7JA 5F0GA 17GSA 3IXRA 5ECLB 2HZEB 5D93A 4TOPA 2GT6A 4RUVA 5IO2A 5J4YA 3LWAA 1XW5A 2XBQA 4ACSA 1W4VA 4MZCA 5A1NB 2IJYA 1IYIA 1GLQA 1PX7A 3ZIVA 3HJMA 2LTKA 1M9AA 5ELGA 3RBTA 2UZ8A 2N5AA 5IIZA 1VF1A 3RDWA 5IQYA 2ZCTA 1X5CA 4MF7A 4TXVA 5D73A 1S3CA 3W6GA 4ZB8A 1U3IA 3ZTLA 4HJMA 4KB3A 3DVWA 1WIKA 2QA1A 1ON4A 4Z2RA 2YOIA 1BG1A 2JSZA 1PSQA 2VLVA 3HMJG 4XS4A 1GRXA 3GIXA 4KDYA 2H6ZA 2MMNA 2H76A 1Z5YE 4G0LA 2X99A 4BWSA 4EDYA 1WP0A 3M0FA 4TKYA 3TB2A 5KOWA 2YCDA 1SENA 1SL1B 5J3RA 2G0FA 3HCZA 2AYTA 1TK8B 4W66A 2X8CA 4WEYA 5IOXA 1WJKA 2R6KA 1N8JA 5G2ZA 3J7Yb 1EV9A 4NV5A 2K6VA 4DSRA 2IN3A 5JWQB 1B4PA 1OVNA 2FGXA 4MH2A 2PVOC 4N3ZA 5G5FA 2V6KA 4JRRA 3GFKA 2MYGA 4BVXA 3UOMA 1SKSB 1OC3A 3R2QA 1ERUA 10GSA 2X4AA 2VCXA 3WD6A 1A8LA 3ED3A 3CSHA 3D22A 4MJCA 1GSSA 1VF2A 1Y25A 3FMWA 3P2AA 3QMXA 4Q5NA 4MJAA 3G7IA 2REMA 3GV1A 3UBKA 1O85A 3F4SA 1R5AA 2PVQA 4AKHA 3LXZA 2LQQA 3NZNA 3CSJA 1AXDA 4L0UA 5FT3A 5DAKB 3LEFA 1F2EA 3WT1A 3CXGA 3FR6A 3RHBA 4AKGA 2YPMA 2JZTA 5GAND 1AC1A 2X64A 2O85A 4N0ZA 3US3A 3ZREA 1CQGA 1MDKA 4TR1A 4MABA 5E4WA 3C1RA 2YV9A 3V1WA 2EIQA 4LMVA 3GKXA 3TRQA 3HVSA 4IP6A 2CZ3A 5C00A 1SD9A 4MDCA 2O89A 4POMA 1YKAA 2H6XA 4TR0A 5DALA 1FOVA 1XPVA 3QAVA 2IFQA 4HDEA 4XHMA 3CYNA 3GH9A 1O8WA 3IC4A 3EWLA 2QC7A 5A5HA 3KM6A 3KCMA 3VWVA 4FH8A 1OKTA 1X5EA 5GAPD 2YWIA 1SK1A 4K5SA 4PNFA 1Z7PA 5ECMB 3J7Yk 2P5QA 1QK8A 2HSYA 3KMOA 2HZFA 2FHEA 2VL2C 6GSSA 2GQLA 5BRTA 12GSA 1Q98A 3KZQA 2O5VA 2VKZG 5D8IA 1M2BA 3DVXA 3TGZA 2P31A 1F9MA 2KP2A 4V2MA 4X4JA 4MNNA 6GSVA 4IP1A 2X49A 2VLTA 2B7KA 2E2MA 3HJPA 4XS6A 2R3XA 3L4NA 3QDNA 2VCZA 1XWBA 3UL3A 5A34A 3HA9A 4ZL9A 5L71A 2YZHA 4XTSA 4O5UA 4YH2A 2HSNA 1MEKA 4IELA 3ERWA 3DYRA 4GTUA 2YN1A 5CREA 1JLWA 3BCIA 3GTUA 4V1Ap 4ECJA 3EMPA 4AGSA 5HFKA 3LGCA 4K2XA 2F8AA 4E8EA 3MIXA 2H1GA 4PTSA 2FUG2 3IAS2 4HZ2A 1R5PA 4HU9A 4AJ7A 2B1KA 5D9VA 2A2PA 5LD0A 5CRGA 1SK2A 3DD3A 2DKHA 3L9SA 3FR3A 1FB6A 1YKCA 2HSMA 1TTZA 1XVQA 2LNSA 5ID2A 5DVBA 6GSWA 4X1UA 1B9XC 4POKA 2KLXA 2C80A 2LRNA 1QXHA 4G0KA 4GF0A 4F0CA 1I9DA 4TRXA 1VF4A 1JZOA 3HJOA 3ZFLA 3D4TA 5EPFA 5HFIA 5F06A 1FVJA 4BA7A 1M2AA 3TOUA 2DLXA 5EY6A 2YWOA 2OT3A 4FQUA 2KOKA 2GDRA 4OCEA 5H5RA 2H71A 1ZYPA 3UAPA 1KEBA 1EP8A 2JACA 5HR0A 2B7JA 2HT9A 2FWEA 4O5QA 1EGOA 3GH6A 3KGKA 1JLVA 2WRTA 4GCIA 3BJ5A 1I5GA 2VLUA 3EMXA 1ERVA 2GTUA 3NIVA 3IDVA 4CY6A 1GTUA 3ZMKA 3GKNA 4G2EA 1ZYNA 3C71A 3LQ7A 5EL8A 1TI1A 1T7PB 4EE0A 4USSA 2C0DA 5ECPB 4EL1A 2J9HA 1OC9B 4CHSA 4NAXA 3Q18A 3JCML 5D9WA 2NBSA 5COHA 1Z6NA 4O32A 2YWNA 4D73A 3I6AA 4LL4B 4GLTA 2AUVA 1EP7A 4V2LA 5BMUA 1XWCA 5G5EA 4PXOA 4BVYB 4TR4A 4F9ZA 4ECBA 2OA7A 5G1KA 4F03A 1QFNA 5G1LA 3H93A 2E0QA 4MP4A 1EGRA 3HHVA 1TXXA 4A5PA 3H79A 3HKRA 3WGDA 4HJ2A 4AJ8A 3I69A 4NHWA 5IMAA 4IBPA 2VO4A 3PH9A 2LV3A 1R7HA 2F3MA 1J9BA 1DUGA 2AAWA 3D6IA 1Y6EA 4HUAA 1CQHA 1PD21 3QR6A 2TRXA 4ICYA 1G0TA 2V1MA 3ZVJD 1GSYA 3A5IA 3GRXA 3U5RE 1T8EB 4BL7B 2GQKA 1H4OA 1T4ZA 4TR3A 2QKEA 4OMVA 3ZLPA 1MD3A 1TK5B 1FHEA 4JR4A 1SKRB 5ECSA 2DJJA 3CRUA 3G9BA 4L5OA 2CX3A 4MZBA 2ON7A 3TKPA 3FZ5A 1K3LA 4PURA 2WZ9A 2H1LA 1ZYEA 2DBCA 4KCAA 3TJKA 2YWMA 1SJ6A 2EFCA 2EFEA 1T4YA 2HLSA 3C7MA 1F37A 4MMMA 1V9WA 6GSUA 2L6DA 1GLPA 4DSSA 3UJ1A 4HOJA 2FY6A 1YF0A 1JHBA 5J5NA 2AJQB 4PQIA 4KA0A 4E68A 4IVFA 3GHAA 1ERTA 1GWCA 1RQMA 3C8EA 1KNGA 2HRFA 1N2AA 4OCFA 4I2UA 4BWQA 2GZZA 1PKZA 3SBCA 2HQTA 4EO3A 1SJIA 2GGTA 4NPBA 4O92A 1A8YA 3SWLA 2VOCA 1DE1A 3LYPA 1TRVA 3D0ZA 3ZVJA 3CTGA 2OBIA 4O5RA 2OKAA 3EYTA 1ERWA 5H5QA 5KN3A 3HXSA 3GKKA 4YKGA 3W8SA 4LA1A 5HR3A 1G7EA 2I9HA 5INYA 1BF5A 2JU5A 4YAPA 4KAEA 3FY7A 4FYBA 3CSIA 6GSYA 2LJRA 3IV4A 2FNOA 2MMAA 2V2GA 4NXIA 1SVLA 1F6MC 4FYUA 4HI7A 2F9SA 1XWGA 1GTAA 4EC0A 4K7IA 2MBTA 1NSWA 1SJZA 2H30A 1LJRA 4WKWA 1GUKA 4K9ZA 2TIRA 4QL9A 2WULA 5A4UA 2K8VA 1E6BA 1Z3EA 1R26A 3BCKA 1B9YC 2H1BA 2VD1A 2RM5A 1GUHA 3IC8A 1ZCPA 3L9UA 5IPHA 1B4QA 3MYDA 2L4CA 4L8EA 4KH7A 3P8WA 3LW9A 3F0IA 3IAM2 1GSUA 3F4RA 3VFIA 2WB9A 1EZKA 4JE1A 5F8BA 3TJGA 2HRKA 3IBHA 1YF1A 3P90A 4TXOA 5HFGA 2B6MA 5A4WA 2VL3A 2F51A 2DKIA 3CTFA 2IWTA 3EU3A 2JZSA 1YQ1A 1OC9A 1K0CA 2KUCA 3A3TA 1AQWA 3KIJA 2GS3A 3LORA 1U88A 2R2JA 3HVXA 5GSSA 2MMZA 4MJEA 3VWWA 2DJ0A 1J08A 3KH9A 2HI7A 5IMZA 1TOFA 3N9JA 1M9BA 4GRFA 5KN0A 5A5KA 2HFDA 3TKSC 3PPUA 4NHZA 4EIQA 2EIOA 1EV4A 14GSA 4TW5A 2CAQA 4KSMA 4OO4A 2LJAA 2LKUA 2DJKA 1Q4JA 1O7UA 4XCSA 1HNCA 1U6TA 2LS5A 2M80A 2FWHA 1A0FA 3U6VA 1DBYA 1V98A 4AKXB 1XBSA 4CDOA 4I8BA 1A0RP 5CP1A 1Z7RA 3M9JA 3E3EA 3DRNA 4ECCA 3PR8A 2P5RA 2F8FA 3H1NA 1SD8A 2C3QA 3GYKA 4X0XA 4BL7A 2BMXA 5ECIB 1A2JA 4N10A 5ECHB 1K0NA 3I9V2 3FZ9A 4F82A 2GSSA 4PQ1A 9GSSA 1T00A 3APSA 4PNGA 3GX8A 4ZBBA 5J9CA 3ME7A 2DMLA 3GN3A 4IW9A 1RW1A 4DSQA 3M9KA 1G7OA 1VRSD 4XRAA 4DVCA 2H66A 2DJ3A 4GQCA 2I3YA 5DCGA 1FO5A 3VWUA 5ABRA 2HNLA 2GZPA 1HD2A 4FIWA 3H4KA 1XVWA 2NDOA 1NHOA 1JZDA 1WWJA 1PX6A 4ID0A 2NPBA 2CAIA 3LJRA 20GSA 1OKDA 22GSA 4GSSA 3QD9A 1X0RA 1GTIA 2I1UA 2HZEA 2ZNMA 2XPEA 1EEJA 5D96A 2QA2A 3IHQA 5KN1A 1E2YA 5B8BA 5A1NA 2PPTA 2GSQA 1K0OA 2DJ1A 4EDZA 3VK9A 5KN2A 1KBNA 4K1FA 2H01A 2N5BA 2GZYA 3FZ4A 3LYKA 3TJBA 1SU9A 2RM6A 3DMLA 3GA4A 5B6MA 3VPQA 1MTCA 2MZCA 2A2SA 3H8QA 1QMVA 1MDIA 2JADA 2CX4A 1TRSA 2L59A 2VUPA 4HQSA 3GMFA 4HZ4A 4K5RA 4F0BA 1AQVA 4GSTA 3OR5A 4N0VA 5HR1A 3GURA 1BYEA 4EF0A 4ZXGA 2H73A 3WGXA 4MZWA 1GSDA 1V40A 2LRTA 3I43A 1T3BA 19GSA 16GSA 5ENUA 2ZUPA 2C3TA 2RUEA 2DMMA 1GTBA 5IMVA 2X8HA 2A4HA 2V6OA 2XBIA 1TRUA 4IQAA 3WT2A 4MF6A 4PQHA 3VURA 2IL3A 2RLIA 2GVPA 4HU7A 4J57E 3LSZA 5G30A 4JBBA 2KHPA 1AAZA 2L4QA 2R37A 3MWHA 1ZL9A 1FVKA 4F2IA 2EFDA 4XS4B 3W8JA 2GSTA 4MJBA 3VI7A 4FO5A 3FK8A 2H72A 2FCHA 4ZBAA 1U3AA 1TW9A 2RIIA 3F63A 5DQSA 3FEUA 4KW6A 3IK7A 4X43A 2H0GA 3EVIA 4HS1A 4WBRD 4YQMA 5JWRB 4KDUA 1V58A 4CY8A 5J4UA 2DC5A 2VCTA 2HRNA 4WF4A 4WETA 3D21A 3EC3A 3EURA 4MH3A 2PGTA 2O7KA 3DXBA 3QOUA 5DAKA 1AW9A 1GH2A 5HQPA 2R0PA 4BVXB 5KEJA 4ZB7A 4ZL7A 3LFLA 1BQ7A 2FD3A 5IM9A 4ILFA 1XIYA 1SL2B 1SYRA 5ECRB 1R4WA 2A4VA 3CWGA 1FW1A 4GQFA 4O7HA 5ECNB 1ST9A 4ECIA 2RUFA 3FW2A 1IYHA 5FWGA 4NWYA 4ZILA 4DEJA 4ZBDA 5E59A 3ZZXA 3RAZA 2C3NA 4ZB9A 5J4VA 4GSNA 1USBA 5ECQB 3MSZA 3C1SA 1B48A 2OJLA 3BD2A 3DGQA 3EPTA 3ZFBA 2B5YA 1OE8A 5AN1A 1VGLA 5CYYA 3KMNA 2VCQA 2C0FA 4TR1B 3UBLA 3RHCA 3QPMA 4RQRA 5FHIA 4V1Ag 1Y1UA 2OE3A 4JZQA 1TU8A 1XW6A 1PRXA 3APOA 5J9BA 3CBUA 3QFBC 4ML6A 3M8NA 2L6CA 4ML1A 2M72A 2OE1A 3TRXA 2GSRA 5D9TA 2FLSA 13GSA 4TN8A 2YP6A 3UVTA 4AF2A 1TK0B 4YQVA 2R4VA 1UVZA 5DALB 1FB0A 2IFQB 2C0GA 1GNEA 1S3AA 3GL3A 3GNJA 1URMA 4KX4A 2XPDA 4G19A 3TKRA 1PN9A 3UVHA 3VWXA 4FYCA 2HSHA 2NVLA 5ECOB 3UIWA 4Q5QA 1G6YA 4HEA2 5IMCA 1BEDA 3HZ8A 4MLYA 1JFUA 2C0EA 4JU5A 3EINA 2PUKC 1PN0A 2H70A 3MAKA 2AB6A 2K8SA 4ZIJA 1O73A 2CZ2A 2H75A 1JZWA 2LRCA 4G9HA 1OYJA 1EOGA 2LQOA 2R0CA 1YDKA 3ZL5A 4YKFA 2IMEA 4IQ1A 2GT5A 3HZ4A 2PMTA 3MNGA 6GSXA 2LUSA 1EWXA 4LLRA 2JL4A 3IHGA 3ZYWA 2V32A 3QFAC 1ACVA 4GWRA 3ERGA 3KTBA 5HR2A 5DBQA 3WYWA 2VL2A 4ISDA 2YZUA 5A34B 1A2LA 5AGYA 5JCWA 2OACA 3F6FA 2HSNB 5GZZB 2P0GA 3GSSA 1PA3A 1XOBA 4K7NA 2H8LA 3GTUB 2B3SA 1K3YA 5F07A 4E8HA 6GSTA 2JSYA 4MCUA 4KE3A 1FOHA 3A2VA 3Q6OA 4H86A 2M46A 2I81A 5IPGA 3S9FA 2QSIA 3IPZA 5J47A 4IN0A 2E7PA 3LG6A 2K18A 2CA8A 4IJ3A 2H6YA 2MMOA 3IR4A 2K9FA 4QL7A 3IK9A 2DJ2A 2CT6A 3F6DA 4WF5A 2VCWA 2CV4A 2HSMB 3M1GA 1K0DA 4RQXA 1QUWA 3F9UA 5ID2B 3TDGA 5IO0A 1PGTA 1ZYQB 5DCHA 2NTOA 3C73A 2VIMA 2YANA 3ZIJA 1O6JA 4WR4A 2L57A 1ML6A 1LU4A 4WBJA 2B5XA 3TKQA 5JCGA 3R3EA 1A23A 2PN8A 3UMAA 2GLRA 1YEPA 3TKSE 3GSTA 2XHFA 1HQOA 3DKSA 4N11A 3EU4A 4G01A 3KTLA 3HD5A 1S3DA 5CRWA 4CW9A 1M7TA 1A24A 5J40A 3ERFA 5IOWA 4BVYA 4WXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WS2 A;  1GSE A;  1HNA A;  5DJM A;  5CAX A;  4G0I A;  2YJH A;  3KJY A;  2A2R A;  3KP8 A;  4EVM A;  1XOA A;  3D4M A;  2LJK A;  1X9M B;  3F3R A;  3IA1 A;  4MPG A;  2HE3 A;  1FAA A;  2VM2 A;  4KSO A;  3QAW A;  2LEG A;  2ON5 A;  3CMI A;  3WGE A;  4J2F A;  4IKH A;  3O76 A;  2KP1 A;  5IMD A;  1YZX A;  3GX0 A;  5C04 A;  3FHK A;  1LBK A;  1H75 A;  2PER A;  4D73 B;  2WCI A;  4TVE A;  4AJ6 A;  5A4V A;  2EC4 A;  2IMD A;  4ZL8 A;  4KF9 A;  5LNK e;  1V57 A;  1JZR A;  3KEB A;  1X9W B;  5J41 A;  2FA4 A;  2GQM A;  4OO5 A;  1Z9H A;  4RI7 A;  4ZB6 A;  1K0A A;  3TOT A;  3VLN A;  3A2W A;  1YEX A;  3MDK A;  5ECK B;  1XWA A;  1XXU A;  1AIU A;  4POB A;  3L9V A;  3IOS A;  2CVD A;  3DWV A;  1HYU A;  4YAV A;  1WMJ A;  2VL9 A;  3F8U A;  4RI6 A;  4HQZ A;  1OAZ A;  4IHU A;  2TRC P;  2B5E A;  3GKM A;  1TDI A;  5B8A A;  3APQ A;  3HYP A;  3IRA A;  5LCZ A;  1GUL A;  2H1D A;  1UN2 A;  1M99 A;  1XFL A;  1PKW A;  3FR9 A;  2IIY A;  1PMT A;  2H0I A;  5DQY A;  2H19 A;  1WOU A;  3ZRD A;  5AIV A;  1K0M A;  4Q5R A;  2H74 A;  4G10 A;  3ZML A;  2HRA A;  4V2N A;  4OFT A;  1UA5 A;  2C8U A;  1SKW B;  1ZZY A;  1Z6M A;  1O8X A;  5F05 A;  1UC7 A;  4OFM A;  4DSS B;  2AV4 A;  2IPA A;  1GSQ A;  4XS1 A;  2YJ7 A;  3KXO A;  1OC8 A;  3FKF A;  3BOA A;  1ZMA A;  8GSS A;  2HYX A;  4J56 E;  3PGT A;  18GS A;  3Q74 A;  2BJX A;  2O8V B;  4Q5F A;  1TP9 A;  2IMF A;  3M3M A;  2R5G A;  2DIY A;  1SK0 A;  2VAF A;  3E9J B;  1DE2 A;  3NOF A;  1PL1 A;  4EKZ A;  3PIN A;  2PU9 C;  1ABA A;  3LXT A;  1M2D A;  1T1V A;  2L5L A;  1SYX A;  3G7Y A;  2N5F A;  3P7X A;  2Z9S A;  4YQU A;  3ME8 A;  3TUE A;  3L0H A;  4K2D A;  3DIE A;  5CRH A;  1OE7 A;  5JWO B;  1QGV A;  1RK4 A;  4NV2 A;  1PL2 A;  2VM1 A;  3TJF A;  4MK3 A;  2YV7 A;  2L5O A;  2CVK A;  2IMI A;  4K0G A;  2ALB A;  2OAD A;  3O3T A;  1AQX A;  4L0W A;  3N5O A;  2WJU A;  5AIS A;  1NM3 A;  1WRY A;  4WR5 A;  3FYG A;  2MBS A;  3UEM A;  1WE0 A;  3F3Q A;  1GNW A;  2LST A;  2G2Q A;  1TJD A;  4MF5 A;  2LNT A;  5CO3 A;  1XW9 A;  1QQ2 A;  3TJJ A;  1KTE A;  3VPT A;  1G6W A;  2PBJ A;  1YJ6 A;  3KP9 A;  1PQN A;  1O81 A;  1F3A A;  4KDX A;  1TKD B;  2J23 A;  4KND A;  2DIZ A;  4LL1 B;  1BAY A;  1C72 A;  2FA8 A;  4L5L A;  1K3O A;  4MPF A;  3O6T A;  3GL5 A;  2JZR A;  1DSB A;  1MDJ A;  5CRD A;  4ULX A;  1F3B A;  1B8X A;  1W89 A;  2O87 A;  3RPP A;  4K6X A;  4I5Q A;  2WDU A;  2CVB A;  1MD4 A;  2C1Y A;  4I97 A;  1X5D A;  3QCP A;  2OE0 A;  3TCO A;  3RPN A;  4POL A;  5JCU A;  3K8N A;  5EVO A;  5DJL A;  2HRK B;  2IMK A;  4LMW A;  5D9X A;  3HY2 A;  4EXJ A;  1FG4 A;  2BTO T;  4TXO B;  5GST A;  1AUC A;  3ISO A;  4K0N A;  2VD0 A;  1WPI A;  4IJI A;  1THO A;  2C4J A;  2B1L A;  1TRW A;  3VI5 A;  2X8G A;  1ILO A;  3KH7 A;  3TRP A;  5AIX A;  2FWF A;  4K8M A;  2HXK A;  4BPY A;  3L78 A;  3ZIT A;  4P3Y B;  1X9S B;  5H5S A;  4XRD A;  2E2G A;  4I2T A;  3EE2 A;  4EUY A;  4PUF C;  3HVV A;  3FRC A;  4JED A;  5B7C A;  4PUA A;  3A5W A;  3KD0 A;  1BG5 A;  2VCV A;  3IE3 A;  4K7O A;  2QGV A;  3BBY A;  1EOH A;  3AY8 A;  4MA9 A;  3Q19 A;  4I6X A;  3CRT A;  2WGR A;  1GSF A;  1VF3 A;  1V2A A;  2YNX A;  1XZO A;  2WFC A;  2DSA A;  4OFN A;  4OD7 A;  3D5J A;  4PX1 A;  4NMU A;  2H0H A;  2V41 A;  3DEX A;  4JR6 A;  1GL8 A;  1SL0 B;  1EEM A;  11GS A;  2FWG A;  3TKS A;  1NHY A;  2CQ9 A;  4IS0 A;  1U87 A;  3FZA A;  4QQ7 A;  4OWY A;  4KGI A;  5CNW A;  5B6N A;  1BX9 A;  1XCC A;  5G31 A;  4KUN A;  3GUS A;  1YY7 A;  1TI3 A;  4N30 A;  2OBK A;  2D2Z A;  4KCE A;  3UAR A;  5ELA A;  1J0F A;  4IGJ A;  1XWK A;  1ZOF A;  1HNB A;  5IMF A;  1ZGN A;  3QAG A;  2H1A A;  4Z7X A;  1THX A;  2ES7 A;  4PGT A;  2EIR A;  1GUM A;  1GP1 A;  4GXZ A;  2I4A A;  1A2M A;  3HDC A;  3A2X A;  4XIH A;  3F4T A;  1BJX A;  3E0U A;  1NW2 A;  2AHE A;  1TU7 A;  2XC2 A;  7GSS A;  2PWJ A;  5DDL A;  1M0U A;  1K0B A;  3G7J A;  5F0G A;  17GS A;  3IXR A;  5ECL B;  2HZE B;  5D93 A;  4TOP A;  2GT6 A;  4RUV A;  5IO2 A;  3LWA A;  1XW5 A;  2XBQ A;  4ACS A;  1W4V A;  4MZC A;  2IJY A;  1IYI A;  1GLQ A;  1PX7 A;  3ZIV A;  3HJM A;  2LTK A;  1M9A A;  5ELG A;  3RBT A;  2UZ8 A;  2N5A A;  5IIZ A;  1VF1 A;  3RDW A;  5IQY A;  2ZCT A;  1X5C A;  4MF7 A;  4TXV A;  5D73 A;  1S3C A;  3W6G A;  4ZB8 A;  1U3I A;  3ZTL A;  4HJM A;  4KB3 A;  3DVW A;  1WIK A;  1ON4 A;  2YOI A;  2JSZ A;  1PSQ A;  2VLV A;  4XS4 A;  1GRX A;  3GIX A;  4KDY A;  2H6Z A;  2MMN A;  2H76 A;  1Z5Y E;  4G0L A;  2X99 A;  4BWS A;  4EDY A;  1WP0 A;  3M0F A;  4TKY A;  3TB2 A;  2YCD A;  1SEN A;  1SL1 B;  5J3R A;  2G0F A;  3HCZ A;  2AYT A;  1TK8 B;  2X8C A;  4WEY A;  5IOX A;  1WJK A;  2R6K A;  1N8J A;  5G2Z A;  3J7Y b;  1EV9 A;  4NV5 A;  2K6V A;  4DSR A;  2IN3 A;  5JWQ B;  1B4P A;  1OVN A;  2FGX A;  4MH2 A;  2PVO C;  5G5F A;  2V6K A;  4JRR A;  3GFK A;  2MYG A;  4BVX A;  3UOM A;  1SKS B;  1OC3 A;  3R2Q A;  1ERU A;  10GS A;  2VCX A;  3WD6 A;  1A8L A;  3ED3 A;  3CSH A;  3D22 A;  4MJC A;  1GSS A;  1VF2 A;  1Y25 A;  3P2A A;  3QMX A;  4Q5N A;  4MJA A;  3G7I A;  2REM A;  3GV1 A;  3UBK A;  1O85 A;  3F4S A;  1R5A A;  2PVQ A;  3LXZ A;  2LQQ A;  3NZN A;  3CSJ A;  1AXD A;  4L0U A;  5FT3 A;  5DAK B;  3LEF A;  1F2E A;  3WT1 A;  3CXG A;  3FR6 A;  3RHB A;  2YPM A;  2JZT A;  5GAN D;  1AC1 A;  2X64 A;  2O85 A;  4N0Z A;  3US3 A;  3ZRE A;  1CQG A;  1MDK A;  4TR1 A;  4MAB A;  5E4W A;  3C1R A;  2YV9 A;  3V1W A;  2EIQ A;  4LMV A;  3GKX A;  3TRQ A;  3HVS A;  4IP6 A;  2CZ3 A;  5C00 A;  1SD9 A;  4MDC A;  2O89 A;  4POM A;  1YKA A;  2H6X A;  4TR0 A;  5DAL A;  1FOV A;  1XPV A;  3QAV A;  2IFQ A;  4HDE A;  4XHM A;  3CYN A;  3GH9 A;  1O8W A;  3IC4 A;  3EWL A;  2QC7 A;  3KM6 A;  3KCM A;  3VWV A;  4FH8 A;  1OKT A;  1X5E A;  5GAP D;  2YWI A;  1SK1 A;  4PNF A;  1Z7P A;  5ECM B;  3J7Y k;  2P5Q A;  1QK8 A;  2HSY A;  3KMO A;  2HZF A;  2FHE A;  2VL2 C;  6GSS A;  2GQL A;  12GS A;  1Q98 A;  3KZQ A;  5D8I A;  1M2B A;  3DVX A;  3TGZ A;  2P31 A;  1F9M A;  2KP2 A;  4V2M A;  6GSV A;  4IP1 A;  2VLT A;  2B7K A;  2E2M A;  3HJP A;  4XS6 A;  2R3X A;  3L4N A;  3QDN A;  2VCZ A;  1XWB A;  3UL3 A;  3HA9 A;  4ZL9 A;  5L71 A;  2YZH A;  4XTS A;  4YH2 A;  1MEK A;  4IEL A;  3ERW A;  3DYR A;  4GTU A;  2YN1 A;  5CRE A;  1JLW A;  3BCI A;  3GTU A;  4V1A p;  4ECJ A;  3EMP A;  4AGS A;  5HFK A;  3LGC A;  2F8A A;  4E8E A;  2H1G A;  4PTS A;  2FUG 2;  3IAS 2;  4HZ2 A;  1R5P A;  4HU9 A;  4AJ7 A;  2B1K A;  5D9V A;  5LD0 A;  5CRG A;  1SK2 A;  3DD3 A;  3L9S A;  3FR3 A;  1FB6 A;  1YKC A;  2HSM A;  1TTZ A;  1XVQ A;  2LNS A;  5ID2 A;  5DVB A;  6GSW A;  4X1U A;  1B9X C;  4POK A;  2KLX A;  2C80 A;  2LRN A;  1QXH A;  4G0K A;  4GF0 A;  4F0C A;  1I9D A;  4TRX A;  1VF4 A;  1JZO A;  3HJO A;  3ZFL A;  3D4T A;  5EPF A;  5HFI A;  5F06 A;  1FVJ A;  4BA7 A;  1M2A A;  3TOU A;  2DLX A;  5EY6 A;  2YWO A;  4FQU A;  2KOK A;  2GDR A;  4OCE A;  5H5R A;  2H71 A;  3UAP A;  1KEB A;  1EP8 A;  2JAC A;  5HR0 A;  2B7J A;  2HT9 A;  2FWE A;  1EGO A;  3GH6 A;  3KGK A;  1JLV A;  2WRT A;  4GCI A;  3BJ5 A;  1I5G A;  2VLU A;  3EMX A;  1ERV A;  2GTU A;  3NIV A;  3IDV A;  1GTU A;  3ZMK A;  3GKN A;  4G2E A;  3C71 A;  3LQ7 A;  5EL8 A;  1TI1 A;  1T7P B;  4EE0 A;  4USS A;  2C0D A;  5ECP B;  4EL1 A;  2J9H A;  1OC9 B;  4CHS A;  4NAX A;  3Q18 A;  3JCM L;  5D9W A;  2NBS A;  5COH A;  1Z6N A;  4O32 A;  2YWN A;  4D73 A;  3I6A A;  4LL4 B;  4GLT A;  2AUV A;  1EP7 A;  4V2L A;  5BMU A;  1XWC A;  5G5E A;  4PXO A;  4BVY B;  4TR4 A;  4F9Z A;  4ECB A;  2OA7 A;  5G1K A;  4F03 A;  1QFN A;  5G1L A;  3H93 A;  2E0Q A;  4MP4 A;  1EGR A;  3HHV A;  1TXX A;  3H79 A;  3HKR A;  3WGD A;  4HJ2 A;  4AJ8 A;  3I69 A;  4NHW A;  5IMA A;  4IBP A;  2VO4 A;  3PH9 A;  2LV3 A;  1R7H A;  2F3M A;  1J9B A;  1DUG A;  2AAW A;  3D6I A;  1Y6E A;  4HUA A;  1CQH A;  1PD2 1;  3QR6 A;  2TRX A;  1G0T A;  2V1M A;  3ZVJ D;  1GSY A;  3GRX A;  3U5R E;  1T8E B;  4BL7 B;  2GQK A;  1H4O A;  1T4Z A;  4TR3 A;  2QKE A;  4OMV A;  3ZLP A;  1MD3 A;  1TK5 B;  1FHE A;  4JR4 A;  1SKR B;  5ECS A;  2DJJ A;  3CRU A;  3G9B A;  4L5O A;  2CX3 A;  4MZB A;  2ON7 A;  3TKP A;  3FZ5 A;  1K3L A;  4PUR A;  2WZ9 A;  1ZYE A;  2DBC A;  4KCA A;  3TJK A;  2YWM A;  1SJ6 A;  1T4Y A;  2HLS A;  3C7M A;  1F37 A;  4MMM A;  1V9W A;  6GSU A;  2L6D A;  1GLP A;  4DSS A;  3UJ1 A;  4HOJ A;  2FY6 A;  1YF0 A;  1JHB A;  5J5N A;  2AJQ B;  4PQI A;  4KA0 A;  4IVF A;  3GHA A;  1ERT A;  1GWC A;  1RQM A;  3C8E A;  1KNG A;  2HRF A;  1N2A A;  4OCF A;  4I2U A;  4BWQ A;  2GZZ A;  1PKZ A;  3SBC A;  2HQT A;  4EO3 A;  1SJI A;  2GGT A;  4NPB A;  4O92 A;  1A8Y A;  3SWL A;  2VOC A;  1DE1 A;  3LYP A;  1TRV A;  3D0Z A;  3ZVJ A;  3CTG A;  2OBI A;  4O5R A;  2OKA A;  3EYT A;  1ERW A;  5H5Q A;  5KN3 A;  3HXS A;  3GKK A;  3W8S A;  4LA1 A;  5HR3 A;  1G7E A;  2I9H A;  5INY A;  2JU5 A;  4YAP A;  4KAE A;  3FY7 A;  4FYB A;  3CSI A;  6GSY A;  2LJR A;  3IV4 A;  2FNO A;  2MMA A;  2V2G A;  4NXI A;  1F6M C;  4FYU A;  4HI7 A;  2F9S A;  1XWG A;  1GTA A;  4EC0 A;  4K7I A;  2MBT A;  1NSW A;  1SJZ A;  2H30 A;  1LJR A;  4WKW A;  1GUK A;  4K9Z A;  2TIR A;  4QL9 A;  2WUL A;  5A4U A;  2K8V A;  1E6B A;  1Z3E A;  1R26 A;  3BCK A;  1B9Y C;  2H1B A;  2VD1 A;  2RM5 A;  1GUH A;  3IC8 A;  1ZCP A;  3L9U A;  5IPH A;  1B4Q A;  2L4C A;  4L8E A;  4KH7 A;  3P8W A;  3F0I A;  3IAM 2;  1GSU A;  3F4R A;  3VFI A;  2WB9 A;  1EZK A;  4JE1 A;  5F8B A;  3TJG A;  2HRK A;  3IBH A;  1YF1 A;  3P90 A;  4TXO A;  5HFG A;  2B6M A;  5A4W A;  2VL3 A;  2F51 A;  3CTF A;  2IWT A;  3EU3 A;  2JZS A;  1YQ1 A;  1OC9 A;  1K0C A;  2KUC A;  3A3T A;  1AQW A;  3KIJ A;  2GS3 A;  3LOR A;  1U88 A;  2R2J A;  3HVX A;  5GSS A;  2MMZ A;  4MJE A;  3VWW A;  2DJ0 A;  1J08 A;  3KH9 A;  2HI7 A;  5IMZ A;  1TOF A;  3N9J A;  1M9B A;  4GRF A;  5KN0 A;  5A5K A;  2HFD A;  3TKS C;  3PPU A;  4NHZ A;  2EIO A;  1EV4 A;  14GS A;  4TW5 A;  2CAQ A;  4KSM A;  4OO4 A;  2LJA A;  2LKU A;  2DJK A;  1Q4J A;  1O7U A;  4XCS A;  1HNC A;  1U6T A;  2LS5 A;  2M80 A;  2FWH A;  1A0F A;  3U6V A;  1DBY A;  1V98 A;  1XBS A;  4CDO A;  4I8B A;  1A0R P;  5CP1 A;  1Z7R A;  3M9J A;  3E3E A;  3DRN A;  4ECC A;  3PR8 A;  2P5R A;  2F8F A;  3H1N A;  1SD8 A;  2C3Q A;  3GYK A;  4X0X A;  4BL7 A;  2BMX A;  5ECI B;  1A2J A;  4N10 A;  5ECH B;  1K0N A;  3I9V 2;  3FZ9 A;  4F82 A;  2GSS A;  4PQ1 A;  9GSS A;  1T00 A;  3APS A;  4PNG A;  3GX8 A;  4ZBB A;  5J9C A;  3ME7 A;  2DML A;  3GN3 A;  4IW9 A;  1RW1 A;  4DSQ A;  3M9K A;  1G7O A;  1VRS D;  4XRA A;  4DVC A;  2H66 A;  2DJ3 A;  4GQC A;  2I3Y A;  5DCG A;  1FO5 A;  3VWU A;  5ABR A;  2HNL A;  2GZP A;  1HD2 A;  4FIW A;  3H4K A;  1XVW A;  2NDO A;  1NHO A;  1JZD A;  1WWJ A;  1PX6 A;  4ID0 A;  2NPB A;  2CAI A;  3LJR A;  20GS A;  1OKD A;  22GS A;  4GSS A;  3QD9 A;  1X0R A;  1GTI A;  2I1U A;  2HZE A;  2ZNM A;  2XPE A;  1EEJ A;  5D96 A;  3IHQ A;  5KN1 A;  1E2Y A;  5B8B A;  2PPT A;  2GSQ A;  1K0O A;  2DJ1 A;  4EDZ A;  3VK9 A;  5KN2 A;  1KBN A;  4K1F A;  2H01 A;  2N5B A;  2GZY A;  3FZ4 A;  3LYK A;  3TJB A;  1SU9 A;  2RM6 A;  3DML A;  3GA4 A;  5B6M A;  3VPQ A;  1MTC A;  2MZC A;  2A2S A;  3H8Q A;  1QMV A;  1MDI A;  2JAD A;  2CX4 A;  1TRS A;  2L59 A;  2VUP A;  4HQS A;  3GMF A;  4HZ4 A;  4F0B A;  1AQV A;  4GST A;  3OR5 A;  4N0V A;  5HR1 A;  3GUR A;  1BYE A;  4EF0 A;  4ZXG A;  2H73 A;  3WGX A;  4MZW A;  1GSD A;  1V40 A;  2LRT A;  3I43 A;  1T3B A;  19GS A;  16GS A;  5ENU A;  2ZUP A;  2C3T A;  2RUE A;  2DMM A;  1GTB A;  5IMV A;  2X8H A;  2V6O A;  2XBI A;  1TRU A;  4IQA A;  3WT2 A;  4MF6 A;  4PQH A;  3VUR A;  2IL3 A;  2RLI A;  2GVP A;  4HU7 A;  4J57 E;  3LSZ A;  5G30 A;  4JBB A;  2KHP A;  1AAZ A;  2L4Q A;  2R37 A;  3MWH A;  1ZL9 A;  1FVK A;  4F2I A;  4XS4 B;  3W8J A;  2GST A;  4MJB A;  3VI7 A;  4FO5 A;  3FK8 A;  2H72 A;  2FCH A;  4ZBA A;  1U3A A;  1TW9 A;  2RII A;  3F63 A;  5DQS A;  3FEU A;  4KW6 A;  3IK7 A;  4X43 A;  2H0G A;  3EVI A;  4HS1 A;  4WBR D;  4YQM A;  5JWR B;  4KDU A;  1V58 A;  5J4U A;  2DC5 A;  2VCT A;  2HRN A;  4WF4 A;  4WET A;  3D21 A;  3EC3 A;  3EUR A;  4MH3 A;  2PGT A;  2O7K A;  3DXB A;  3QOU A;  5DAK A;  1AW9 A;  1GH2 A;  5HQP A;  4BVX B;  5KEJ A;  4ZL7 A;  3LFL A;  1BQ7 A;  2FD3 A;  5IM9 A;  4ILF A;  1XIY A;  1SL2 B;  1SYR A;  5ECR B;  1R4W A;  2A4V A;  1FW1 A;  4GQF A;  4O7H A;  5ECN B;  1ST9 A;  4ECI A;  2RUF A;  3FW2 A;  1IYH A;  5FWG A;  4NWY A;  4ZIL A;  4DEJ A;  4ZBD A;  5E59 A;  3ZZX A;  3RAZ A;  2C3N A;  4ZB9 A;  4GSN A;  1USB A;  5ECQ B;  3MSZ A;  3C1S A;  1B48 A;  2OJL A;  3BD2 A;  3DGQ A;  3ZFB A;  2B5Y A;  1OE8 A;  5AN1 A;  1VGL A;  5CYY A;  3KMN A;  2VCQ A;  2C0F A;  4TR1 B;  3UBL A;  3RHC A;  3QPM A;  4RQR A;  5FHI A;  4V1A g;  2OE3 A;  4JZQ A;  1TU8 A;  1XW6 A;  1PRX A;  3APO A;  5J9B A;  3CBU A;  3QFB C;  4ML6 A;  3M8N A;  2L6C A;  4ML1 A;  2M72 A;  2OE1 A;  3TRX A;  2GSR A;  5D9T A;  2FLS A;  13GS A;  4TN8 A;  2YP6 A;  3UVT A;  4AF2 A;  1TK0 B;  4YQV A;  2R4V A;  1UVZ A;  5DAL B;  1FB0 A;  2IFQ B;  2C0G A;  1GNE A;  1S3A A;  3GL3 A;  3GNJ A;  1URM A;  4KX4 A;  2XPD A;  4G19 A;  3TKR A;  1PN9 A;  3UVH A;  3VWX A;  4FYC A;  2HSH A;  2NVL A;  5ECO B;  3UIW A;  4Q5Q A;  1G6Y A;  4HEA 2;  5IMC A;  1BED A;  3HZ8 A;  4MLY A;  1JFU A;  2C0E A;  4JU5 A;  3EIN A;  2PUK C;  2H70 A;  3MAK A;  2AB6 A;  2K8S A;  4ZIJ A;  1O73 A;  2CZ2 A;  2H75 A;  1JZW A;  2LRC A;  4G9H A;  1OYJ A;  1EOG A;  2LQO A;  1YDK A;  3ZL5 A;  2IME A;  4IQ1 A;  2GT5 A;  3HZ4 A;  2PMT A;  3MNG A;  6GSX A;  2LUS A;  1EWX A;  4LLR A;  2JL4 A;  3ZYW A;  2V32 A;  3QFA C;  1ACV A;  4GWR A;  3ERG A;  3KTB A;  5HR2 A;  5DBQ A;  3WYW A;  2VL2 A;  4ISD A;  2YZU A;  1A2L A;  5AGY A;  5JCW A;  2OAC A;  3F6F A;  2HSN B;  5GZZ B;  2P0G A;  3GSS A;  1PA3 A;  1XOB A;  4K7N A;  2H8L A;  3GTU B;  2B3S A;  1K3Y A;  5F07 A;  4E8H A;  6GST A;  2JSY A;  4MCU A;  4KE3 A;  3Q6O A;  3A2V A;  4H86 A;  2M46 A;  2I81 A;  5IPG A;  3S9F A;  2QSI A;  3IPZ A;  4IN0 A;  2E7P A;  3LG6 A;  2K18 A;  2CA8 A;  4IJ3 A;  2H6Y A;  2MMO A;  3IR4 A;  2K9F A;  4QL7 A;  3IK9 A;  2DJ2 A;  2CT6 A;  3F6D A;  4WF5 A;  2VCW A;  2CV4 A;  2HSM B;  3M1G A;  1K0D A;  4RQX A;  1QUW A;  3F9U A;  5ID2 B;  3TDG A;  5IO0 A;  1PGT A;  1ZYQ B;  5DCH A;  2NTO A;  3C73 A;  2VIM A;  2YAN A;  3ZIJ A;  1O6J A;  4WR4 A;  2L57 A;  1ML6 A;  1LU4 A;  4WBJ A;  2B5X A;  3TKQ A;  5JCG A;  3R3E A;  1A23 A;  2PN8 A;  3UMA A;  2GLR A;  1YEP A;  3TKS E;  3GST A;  2XHF A;  1HQO A;  3DKS A;  4N11 A;  3EU4 A;  3KTL A;  3HD5 A;  1S3D A;  5CRW A;  4CW9 A;  1M7T A;  1A24 A;  3ERF A;  5IOW A;  4BVY A;  4WXT A; 
#chains in the Genus database with same CATH topology
 2WS2 A;  1GSE A;  4QMK A;  1HNA A;  5DJM A;  5CAX A;  4G0I A;  2YJH A;  3KJY A;  2A2R A;  1YEW C;  3KP8 A;  4EVM A;  1XOA A;  3D4M A;  2LJK A;  1X9M B;  3F3R A;  3IA1 A;  4MPG A;  2HE3 A;  1FAA A;  2VM2 A;  4KSO A;  3QAW A;  2LEG A;  2ON5 A;  3CMI A;  3WGE A;  4J2F A;  4IKH A;  3O76 A;  2KP1 A;  5IMD A;  1YZX A;  3GX0 A;  5C04 A;  3FHK A;  1LBK A;  1H75 A;  2PER A;  4D73 B;  2WCI A;  4TVE A;  4AJ6 A;  5A4V A;  2EC4 A;  2IMD A;  4ZL8 A;  5BMU B;  4KF9 A;  5LNK e;  1V57 A;  1JZR A;  3KEB A;  1X9W B;  5J41 A;  2FA4 A;  2GQM A;  4OO5 A;  1Z9H A;  4RI7 A;  4ZB6 A;  1K0A A;  3TOT A;  3VLN A;  3A2W A;  1YEX A;  3MDK A;  5ECK B;  1XWA A;  1XXU A;  1AIU A;  4POB A;  1N25 A;  3L9V A;  3IOS A;  2CVD A;  3DWV A;  1HYU A;  4YAV A;  1WMJ A;  2VL9 A;  2EFH A;  3F8U A;  5KOX A;  4RI6 A;  4HQZ A;  1OAZ A;  4IHU A;  2TRC P;  2B5E A;  3GKM A;  1TDI A;  5B8A A;  3APQ A;  3HYP A;  3IRA A;  5LCZ A;  1GUL A;  2O36 A;  2H1D A;  1UN2 A;  1M99 A;  1XFL A;  1PKW A;  3FR9 A;  2IIY A;  1PMT A;  2H0I A;  4Z2T A;  5DQY A;  2H19 A;  1WOU A;  3ZRD A;  5AIV A;  1K0M A;  4Q5R A;  2H74 A;  4G10 A;  3ZML A;  2HRA A;  4V2N A;  4OFT A;  1UA5 A;  2C8U A;  1SKW B;  1ZZY A;  1Z6M A;  1O8X A;  5F05 A;  1UC7 A;  4OFM A;  4DSS B;  2AV4 A;  2IPA A;  1GSQ A;  4XS1 A;  2YJ7 A;  3KXO A;  1OC8 A;  3FKF A;  3BOA A;  1ZMA A;  8GSS A;  2HYX A;  4J56 E;  3PGT A;  18GS A;  3Q74 A;  2BJX A;  2O8V B;  4Q5F A;  1TP9 A;  2IMF A;  3M3M A;  2R5G A;  2DIY A;  1SK0 A;  2VAF A;  3E9J B;  1DE2 A;  3NOF A;  1PL1 A;  4EKZ A;  3PIN A;  2PU9 C;  1ABA A;  3LXT A;  1M2D A;  1T1V A;  2L5L A;  1SYX A;  3G7Y A;  2N5F A;  3P7X A;  2Z9S A;  4YQU A;  1TXU A;  3ME8 A;  3TUE A;  3L0H A;  4K2D A;  3DIE A;  5CRH A;  1OE7 A;  5JWO B;  1QGV A;  1RK4 A;  4NV2 A;  1PL2 A;  2VM1 A;  3TJF A;  4MK3 A;  4Z2U A;  2YV7 A;  2L5O A;  2CVK A;  2IMI A;  4K0G A;  2ALB A;  2OAD A;  3O3T A;  1AQX A;  4L0W A;  3N5O A;  2WJU A;  5AIS A;  1NM3 A;  1WRY A;  4WR5 A;  3FYG A;  2MBS A;  3UEM A;  1WE0 A;  3F3Q A;  1GNW A;  2LST A;  2G2Q A;  1TJD A;  4MF5 A;  2LNT A;  5CO3 A;  1XW9 A;  1QQ2 A;  3TJJ A;  1KTE A;  1SVM A;  3VPT A;  1G6W A;  2PBJ A;  1YJ6 A;  3KP9 A;  1PQN A;  1O81 A;  4GDF A;  1F3A A;  4KDX A;  1TKD B;  2J23 A;  4KND A;  2DIZ A;  4LL1 B;  1BAY A;  1C72 A;  2FA8 A;  4L5L A;  1K3O A;  4MPF A;  3O6T A;  3GL5 A;  2JZR A;  1DSB A;  1MDJ A;  5CRD A;  4ULX A;  1F3B A;  1B8X A;  1W89 A;  2O87 A;  3RPP A;  4K6X A;  4I5Q A;  2WDU A;  2CVB A;  3TU3 B;  1MD4 A;  4AKI A;  2C1Y A;  4I97 A;  1X5D A;  1M3I A;  3QCP A;  2OE0 A;  3TCO A;  3RPN A;  4POL A;  5JCU A;  3K8N A;  5EVO A;  5DJL A;  2HRK B;  2IMK A;  4LMW A;  5D9X A;  3HY2 A;  4EXJ A;  1FG4 A;  2BTO T;  4TXO B;  5GST A;  1AUC A;  3ISO A;  4K0N A;  2VD0 A;  1WPI A;  4IJI A;  1THO A;  2C4J A;  2B1L A;  1TRW A;  3VI5 A;  2X8G A;  1ILO A;  3KH7 A;  3TRP A;  5AIX A;  2FWF A;  4K8M A;  2HXK A;  4FXY P;  4BPY A;  3L78 A;  3ZIT A;  4P3Y B;  1X9S B;  5H5S A;  4XRD A;  2E2G A;  4I2T A;  3EE2 A;  4EUY A;  4PUF C;  3HVV A;  3FRC A;  4JED A;  5B7C A;  4PUA A;  3A5W A;  3KD0 A;  1BG5 A;  2VCV A;  3IE3 A;  4K7O A;  2QGV A;  3BBY A;  1EOH A;  3AY8 A;  4MA9 A;  3Q19 A;  4I6X A;  3CRT A;  2WGR A;  1GSF A;  1VF3 A;  1V2A A;  2YNX A;  1XZO A;  2WFC A;  4EIP A;  2DSA A;  4OFN A;  4OD7 A;  3D5J A;  4PX1 A;  4NMU A;  2H0H A;  2V41 A;  3DEX A;  4JR6 A;  1GL8 A;  1SL0 B;  1EEM A;  11GS A;  2FWG A;  3TKS A;  1NHY A;  2UV8 G;  2R0G A;  2CQ9 A;  4IS0 A;  1U87 A;  3FZA A;  4QQ7 A;  4OWY A;  2WVZ A;  4KGI A;  5CNW A;  5B6N A;  1BX9 A;  1XCC A;  5A5H B;  5G31 A;  4KUN A;  3GUS A;  1YY7 A;  1YVL A;  1TI3 A;  4AI6 A;  4N30 A;  2OBK A;  2D2Z A;  4KCE A;  3UAR A;  5ELA A;  1J0F A;  4IGJ A;  1XWK A;  1ZOF A;  1HNB A;  5IMF A;  1ZGN A;  3QAG A;  2H1A A;  4Z7X A;  4PHZ C;  1THX A;  2ES7 A;  4PGT A;  2EIR A;  1GUM A;  1GP1 A;  4GXZ A;  2I4A A;  1A2M A;  3HDC A;  3A2X A;  1SVO A;  4XIH A;  3F4T A;  1BJX A;  3E0U A;  1NW2 A;  2AHE A;  1TU7 A;  2XC2 A;  7GSS A;  2PWJ A;  5DDL A;  1M0U A;  1K0B A;  3G7J A;  5F0G A;  17GS A;  3IXR A;  5ECL B;  2HZE B;  5D93 A;  4TOP A;  2GT6 A;  4RUV A;  5IO2 A;  5J4Y A;  3LWA A;  1XW5 A;  2XBQ A;  4ACS A;  1W4V A;  4MZC A;  5A1N B;  2IJY A;  1IYI A;  1GLQ A;  1PX7 A;  3ZIV A;  4PI0 C;  3HJM A;  2LTK A;  1M9A A;  5ELG A;  3RBT A;  2UZ8 A;  2N5A A;  5IIZ A;  1VF1 A;  3RDW A;  5IQY A;  3RFR C;  2ZCT A;  1X5C A;  4MF7 A;  4TXV A;  5D73 A;  1S3C A;  3W6G A;  4ZB8 A;  1U3I A;  3ZTL A;  4HJM A;  4KB3 A;  3DVW A;  1WIK A;  2QA1 A;  1ON4 A;  4Z2R A;  2YOI A;  1BG1 A;  2JSZ A;  1PSQ A;  2VLV A;  3HMJ G;  4XS4 A;  1GRX A;  3GIX A;  4KDY A;  2H6Z A;  2MMN A;  2H76 A;  1Z5Y E;  4G0L A;  2X99 A;  4BWS A;  4EDY A;  1WP0 A;  3M0F A;  4TKY A;  3TB2 A;  5KOW A;  2YCD A;  1SEN A;  1SL1 B;  5J3R A;  2G0F A;  3HCZ A;  2AYT A;  1TK8 B;  4W66 A;  2X8C A;  4WEY A;  5IOX A;  1WJK A;  2R6K A;  1N8J A;  5G2Z A;  3HVN A;  3J7Y b;  2WVY A;  1EV9 A;  4NV5 A;  2K6V A;  4DSR A;  2IN3 A;  5JWQ B;  1B4P A;  1OVN A;  2FGX A;  4MH2 A;  2PVO C;  4N3Z A;  5G5F A;  2V6K A;  4JRR A;  3GFK A;  2MYG A;  4BVX A;  3UOM A;  1SKS B;  1OC3 A;  3R2Q A;  1ERU A;  10GS A;  2X4A A;  2VCX A;  2WVX A;  3WD6 A;  1A8L A;  3ED3 A;  3CSH A;  3D22 A;  4MJC A;  1GSS A;  1VF2 A;  1Y25 A;  3FMW A;  3P2A A;  3QMX A;  4Q5N A;  4MJA A;  1S4B P;  3G7I A;  2REM A;  3GV1 A;  3UBK A;  1O85 A;  3F4S A;  1R5A A;  2PVQ A;  4AKH A;  3LXZ A;  2LQQ A;  3NZN A;  3CSJ A;  1AXD A;  4L0U A;  5FT3 A;  5DAK B;  3LEF A;  1F2E A;  3WT1 A;  3CXG A;  3FR6 A;  3RHB A;  4AKG A;  2YPM A;  2JZT A;  5GAN D;  1AC1 A;  2X64 A;  2O85 A;  4N0Z A;  3US3 A;  3ZRE A;  1CQG A;  1MDK A;  4TR1 A;  4MAB A;  5E4W A;  3C1R A;  2YV9 A;  3V1W A;  2EIQ A;  4LMV A;  3GKX A;  3TRQ A;  3HVS A;  4IP6 A;  2CZ3 A;  5C00 A;  1SD9 A;  4MDC A;  2O89 A;  4POM A;  1YKA A;  2H6X A;  4TR0 A;  5DAL A;  1FOV A;  1XPV A;  3QAV A;  2IFQ A;  4HDE A;  4XHM A;  3CYN A;  3GH9 A;  1O8W A;  3IC4 A;  3EWL A;  2QC7 A;  5A5H A;  3KM6 A;  3KCM A;  3VWV A;  4FH8 A;  1OKT A;  1X5E A;  5GAP D;  2YWI A;  1SK1 A;  4K5S A;  4PNF A;  1Z7P A;  5ECM B;  3J7Y k;  2P5Q A;  1QK8 A;  2HSY A;  3KMO A;  2HZF A;  2FHE A;  2VL2 C;  6GSS A;  2GQL A;  5BRT A;  12GS A;  1Q98 A;  3KZQ A;  2O5V A;  2VKZ G;  5D8I A;  1M2B A;  3DVX A;  3TGZ A;  2P31 A;  1F9M A;  2KP2 A;  4V2M A;  4X4J A;  4MNN A;  6GSV A;  4IP1 A;  2X49 A;  2VLT A;  2B7K A;  2E2M A;  3HJP A;  4XS6 A;  2R3X A;  3L4N A;  3QDN A;  2VCZ A;  1XWB A;  3UL3 A;  5A34 A;  3HA9 A;  4ZL9 A;  5L71 A;  2YZH A;  4XTS A;  4O5U A;  4YH2 A;  2HSN A;  1MEK A;  4IEL A;  3ERW A;  3DYR A;  4GTU A;  2YN1 A;  5CRE A;  1JLW A;  3BCI A;  3GTU A;  4V1A p;  4ECJ A;  3EMP A;  4AGS A;  5HFK A;  3LGC A;  4K2X A;  2F8A A;  4E8E A;  3MIX A;  2H1G A;  4PTS A;  2FUG 2;  3IAS 2;  4HZ2 A;  1R5P A;  4HU9 A;  4AJ7 A;  2B1K A;  5D9V A;  2A2P A;  5LD0 A;  5CRG A;  1SK2 A;  3DD3 A;  2DKH A;  3L9S A;  3FR3 A;  1FB6 A;  1YKC A;  2HSM A;  1TTZ A;  1XVQ A;  2LNS A;  5ID2 A;  5DVB A;  6GSW A;  4X1U A;  1B9X C;  4POK A;  2KLX A;  2C80 A;  2LRN A;  1QXH A;  4G0K A;  4GF0 A;  4F0C A;  1I9D A;  4TRX A;  1VF4 A;  1JZO A;  3HJO A;  3ZFL A;  3D4T A;  5EPF A;  5HFI A;  5F06 A;  1FVJ A;  4BA7 A;  1PFO A;  1M2A A;  1M3J A;  3TOU A;  2DLX A;  5EY6 A;  2YWO A;  2OT3 A;  4FQU A;  2KOK A;  2GDR A;  4OCE A;  5H5R A;  2H71 A;  1ZYP A;  3UAP A;  1KEB A;  1EP8 A;  2JAC A;  5HR0 A;  2B7J A;  2HT9 A;  2FWE A;  4O5Q A;  1EGO A;  3GH6 A;  3KGK A;  1JLV A;  2WRT A;  4GCI A;  3BJ5 A;  1I5G A;  2VLU A;  3EMX A;  1ERV A;  2GTU A;  3NIV A;  3IDV A;  4CY6 A;  1GTU A;  3ZMK A;  3GKN A;  4G2E A;  1ZYN A;  3C71 A;  3LQ7 A;  5EL8 A;  1TI1 A;  1T7P B;  4EE0 A;  4USS A;  2C0D A;  5ECP B;  4EL1 A;  2J9H A;  1OC9 B;  4CHS A;  4NAX A;  3Q18 A;  3JCM L;  5D9W A;  2NBS A;  5COH A;  1Z6N A;  4O32 A;  2YWN A;  4D73 A;  3I6A A;  4LL4 B;  4GLT A;  2AUV A;  1EP7 A;  4V2L A;  5BMU A;  1XWC A;  5G5E A;  4PXO A;  4BVY B;  4TR4 A;  4F9Z A;  4ECB A;  2OA7 A;  5G1K A;  4F03 A;  1QFN A;  5G1L A;  3H93 A;  2E0Q A;  4MP4 A;  1EGR A;  3HHV A;  1TXX A;  4A5P A;  3H79 A;  3HKR A;  3WGD A;  4HJ2 A;  4AJ8 A;  3I69 A;  4NHW A;  5IMA A;  4IBP A;  2VO4 A;  3PH9 A;  2LV3 A;  1R7H A;  2F3M A;  1J9B A;  1DUG A;  2AAW A;  3D6I A;  1Y6E A;  4HUA A;  1CQH A;  1PD2 1;  3QR6 A;  2TRX A;  4ICY A;  1G0T A;  2V1M A;  3ZVJ D;  1GSY A;  3A5I A;  3GRX A;  3U5R E;  1T8E B;  4BL7 B;  2GQK A;  1H4O A;  1T4Z A;  4TR3 A;  2QKE A;  4OMV A;  3ZLP A;  1MD3 A;  1TK5 B;  1FHE A;  4JR4 A;  1SKR B;  5ECS A;  2DJJ A;  3CRU A;  3G9B A;  4L5O A;  2CX3 A;  4MZB A;  2ON7 A;  3TKP A;  3FZ5 A;  1K3L A;  4PUR A;  2WZ9 A;  2H1L A;  1ZYE A;  2DBC A;  4KCA A;  3TJK A;  2YWM A;  1SJ6 A;  2EFC A;  2EFE A;  1T4Y A;  2HLS A;  3C7M A;  1F37 A;  4MMM A;  1V9W A;  6GSU A;  2L6D A;  1GLP A;  4DSS A;  3UJ1 A;  4HOJ A;  2FY6 A;  1YF0 A;  1JHB A;  5J5N A;  2AJQ B;  4PQI A;  4KA0 A;  4E68 A;  4IVF A;  3GHA A;  1ERT A;  1GWC A;  1RQM A;  3C8E A;  1KNG A;  2HRF A;  1N2A A;  4OCF A;  4I2U A;  4BWQ A;  2GZZ A;  1PKZ A;  3SBC A;  2HQT A;  2O3E A;  4EO3 A;  1SJI A;  2GGT A;  4NPB A;  4O92 A;  1A8Y A;  3SWL A;  2VOC A;  1DE1 A;  3LYP A;  1TRV A;  3D0Z A;  3ZVJ A;  3CTG A;  2OBI A;  1I1I P;  4O5R A;  1S3R A;  2OKA A;  3EYT A;  1ERW A;  5H5Q A;  3RGB C;  5KN3 A;  3HXS A;  3GKK A;  4YKG A;  3W8S A;  4LA1 A;  5HR3 A;  1G7E A;  2I9H A;  5INY A;  1BF5 A;  2JU5 A;  4YAP A;  4KAE A;  3FY7 A;  4FYB A;  3CSI A;  6GSY A;  2LJR A;  3IV4 A;  2FNO A;  2MMA A;  2V2G A;  4NXI A;  1SVL A;  1F6M C;  4FYU A;  4HI7 A;  2F9S A;  1XWG A;  1GTA A;  4EC0 A;  4K7I A;  2MBT A;  1NSW A;  1SJZ A;  2H30 A;  1LJR A;  4WKW A;  1GUK A;  4K9Z A;  2TIR A;  4QL9 A;  2WUL A;  5A4U A;  2K8V A;  1E6B A;  1Z3E A;  1R26 A;  3BCK A;  1B9Y C;  2H1B A;  2VD1 A;  2RM5 A;  1GUH A;  3IC8 A;  1ZCP A;  3L9U A;  5IPH A;  1B4Q A;  3MYD A;  2L4C A;  4L8E A;  4KH7 A;  2WW1 A;  3P8W A;  3LW9 A;  3F0I A;  3IAM 2;  1GSU A;  3F4R A;  3VFI A;  2WB9 A;  1EZK A;  4JE1 A;  5F8B A;  3TJG A;  2HRK A;  3IBH A;  1YF1 A;  3P90 A;  4TXO A;  5HFG A;  2B6M A;  5A4W A;  2VL3 A;  2F51 A;  2DKI A;  3CTF A;  2IWT A;  3EU3 A;  2JZS A;  1YQ1 A;  1OC9 A;  1K0C A;  2KUC A;  3A3T A;  1AQW A;  3KIJ A;  2GS3 A;  3LOR A;  1U88 A;  2R2J A;  3HVX A;  5GSS A;  2MMZ A;  4MJE A;  3VWW A;  2DJ0 A;  1J08 A;  3KH9 A;  2HI7 A;  5IMZ A;  1TOF A;  3N9J A;  1M9B A;  4GRF A;  5KN0 A;  5A5K A;  2HFD A;  3TKS C;  3PPU A;  4NHZ A;  4EIQ A;  2EIO A;  1EV4 A;  14GS A;  4TW5 A;  2CAQ A;  4KSM A;  4OO4 A;  2LJA A;  2LKU A;  2DJK A;  1Q4J A;  1O7U A;  4XCS A;  1HNC A;  1U6T A;  2LS5 A;  2M80 A;  2FWH A;  1A0F A;  3U6V A;  1DBY A;  1V98 A;  4AKX B;  1XBS A;  4CDO A;  4I8B A;  1A0R P;  5CP1 A;  1Z7R A;  3M9J A;  3E3E A;  3DRN A;  4ECC A;  3PR8 A;  2P5R A;  2F8F A;  3H1N A;  1SD8 A;  2C3Q A;  3GYK A;  4X0X A;  4BL7 A;  2BMX A;  5ECI B;  1A2J A;  4N10 A;  5ECH B;  1K0N A;  3I9V 2;  3FZ9 A;  4F82 A;  2GSS A;  4PQ1 A;  9GSS A;  1T00 A;  3APS A;  4PNG A;  3GX8 A;  4ZBB A;  5J9C A;  3ME7 A;  2DML A;  3GN3 A;  4IW9 A;  1RW1 A;  4DSQ A;  3M9K A;  1G7O A;  1VRS D;  4XRA A;  4DVC A;  2H66 A;  2DJ3 A;  4GQC A;  2I3Y A;  5DCG A;  1FO5 A;  3VWU A;  5ABR A;  3CHX C;  2HNL A;  2GZP A;  1HD2 A;  4FIW A;  3H4K A;  1XVW A;  2NDO A;  1NHO A;  1JZD A;  1WWJ A;  2WW2 A;  1PX6 A;  4ID0 A;  2NPB A;  2CAI A;  3LJR A;  20GS A;  1OKD A;  22GS A;  4GSS A;  3QD9 A;  1X0R A;  1GTI A;  2I1U A;  2HZE A;  2ZNM A;  2XPE A;  1EEJ A;  5D96 A;  2QA2 A;  3IHQ A;  5KN1 A;  1E2Y A;  5B8B A;  5A1N A;  2PPT A;  2GSQ A;  1K0O A;  2DJ1 A;  4EDZ A;  3VK9 A;  5KN2 A;  1KBN A;  4K1F A;  2H01 A;  2N5B A;  2GZY A;  3FZ4 A;  3LYK A;  3TJB A;  1SU9 A;  2RM6 A;  3DML A;  3GA4 A;  5B6M A;  3VPQ A;  1MTC A;  2MZC A;  2A2S A;  3H8Q A;  1QMV A;  1MDI A;  2JAD A;  2CX4 A;  1TRS A;  2L59 A;  2VUP A;  4HQS A;  3GMF A;  4HZ4 A;  4K5R A;  4F0B A;  1AQV A;  4GST A;  3OR5 A;  4N0V A;  5HR1 A;  3GUR A;  1BYE A;  4EF0 A;  4ZXG A;  2H73 A;  3WGX A;  4MZW A;  1GSD A;  1V40 A;  2LRT A;  3I43 A;  1T3B A;  19GS A;  16GS A;  3CQF A;  5ENU A;  2ZUP A;  2C3T A;  2RUE A;  2DMM A;  1GTB A;  5IMV A;  2X8H A;  2A4H A;  2V6O A;  2XBI A;  1TRU A;  4IQA A;  3WT2 A;  4MF6 A;  4PQH A;  3VUR A;  2IL3 A;  2RLI A;  2GVP A;  4HU7 A;  4J57 E;  3LSZ A;  5G30 A;  4JBB A;  2KHP A;  1AAZ A;  2L4Q A;  2R37 A;  3MWH A;  1ZL9 A;  1FVK A;  4F2I A;  2EFD A;  4XS4 B;  3W8J A;  2GST A;  4MJB A;  3VI7 A;  4FO5 A;  3FK8 A;  2H72 A;  2FCH A;  4ZBA A;  1U3A A;  1TW9 A;  2RII A;  3F63 A;  5DQS A;  2WZS A;  3FEU A;  4KW6 A;  3IK7 A;  4X43 A;  2H0G A;  3EVI A;  4HS1 A;  4WBR D;  4YQM A;  5JWR B;  4KDU A;  1V58 A;  4CY8 A;  5J4U A;  2DC5 A;  2VCT A;  2HRN A;  4WF4 A;  4WET A;  3D21 A;  3EC3 A;  3EUR A;  4MH3 A;  2PGT A;  2O7K A;  3DXB A;  3QOU A;  5DAK A;  1AW9 A;  1GH2 A;  5HQP A;  2R0P A;  4BVX B;  5KEJ A;  4ZB7 A;  4ZL7 A;  3LFL A;  1BQ7 A;  2FD3 A;  5IM9 A;  4ILF A;  1XIY A;  1SL2 B;  2WVX B;  1SYR A;  5ECR B;  1R4W A;  2A4V A;  3CWG A;  1FW1 A;  4GQF A;  4O7H A;  5ECN B;  1ST9 A;  4ECI A;  2RUF A;  3FW2 A;  1IYH A;  5FWG A;  4NWY A;  4ZIL A;  4DEJ A;  4ZBD A;  5E59 A;  3ZZX A;  3RAZ A;  2C3N A;  4ZB9 A;  5J4V A;  4GSN A;  1USB A;  5ECQ B;  3MSZ A;  3C1S A;  1B48 A;  2OJL A;  3BD2 A;  3DGQ A;  3EPT A;  3ZFB A;  2B5Y A;  1OE8 A;  5AN1 A;  1VGL A;  5CYY A;  3KMN A;  2VCQ A;  2C0F A;  4TR1 B;  3UBL A;  3RHC A;  3QPM A;  4RQR A;  5FHI A;  4V1A g;  1Y1U A;  2OE3 A;  4JZQ A;  1TU8 A;  1XW6 A;  1PRX A;  4PI2 C;  3APO A;  5J9B A;  3CBU A;  3QFB C;  4ML6 A;  3M8N A;  2L6C A;  4ML1 A;  2M72 A;  2OE1 A;  3TRX A;  2GSR A;  5D9T A;  2FLS A;  13GS A;  4TN8 A;  2YP6 A;  3UVT A;  4AF2 A;  1TK0 B;  4YQV A;  2R4V A;  1UVZ A;  5DAL B;  1FB0 A;  2IFQ B;  2C0G A;  1GNE A;  1S3A A;  3GL3 A;  3GNJ A;  1URM A;  4KX4 A;  2XPD A;  4G19 A;  3TKR A;  1PN9 A;  3UVH A;  3VWX A;  4FYC A;  2HSH A;  2NVL A;  5ECO B;  3UIW A;  4Q5Q A;  2WW3 A;  1G6Y A;  4HEA 2;  5IMC A;  1BED A;  3HZ8 A;  4MLY A;  1JFU A;  2C0E A;  4JU5 A;  3EIN A;  2PUK C;  1PN0 A;  2H70 A;  3MAK A;  2AB6 A;  2K8S A;  4ZIJ A;  1O73 A;  2CZ2 A;  2H75 A;  1JZW A;  2LRC A;  4G9H A;  1OYJ A;  1EOG A;  2LQO A;  2R0C A;  1YDK A;  3ZL5 A;  4YKF A;  2IME A;  4IQ1 A;  2GT5 A;  3HZ4 A;  2PMT A;  3MNG A;  6GSX A;  2LUS A;  1EWX A;  4LLR A;  2JL4 A;  3IHG A;  3ZYW A;  2V32 A;  3QFA C;  1ACV A;  4GWR A;  3ERG A;  3KTB A;  5HR2 A;  5DBQ A;  3WYW A;  2VL2 A;  4ISD A;  2YZU A;  5A34 B;  1A2L A;  5AGY A;  5JCW A;  2OAC A;  3F6F A;  2HSN B;  5GZZ B;  2P0G A;  3GSS A;  1PA3 A;  1XOB A;  4K7N A;  2H8L A;  3GTU B;  2B3S A;  1K3Y A;  5F07 A;  4E8H A;  6GST A;  2JSY A;  4MCU A;  4KE3 A;  1FOH A;  3A2V A;  3Q6O A;  4H86 A;  2M46 A;  2I81 A;  5IPG A;  3S9F A;  2QSI A;  3IPZ A;  5J47 A;  4IN0 A;  2E7P A;  3LG6 A;  2K18 A;  2CA8 A;  4IJ3 A;  2H6Y A;  2MMO A;  3IR4 A;  2K9F A;  4QL7 A;  3IK9 A;  2DJ2 A;  2CT6 A;  3F6D A;  4WF5 A;  2VCW A;  2CV4 A;  4BIK A;  2HSM B;  3M1G A;  1K0D A;  4RQX A;  1QUW A;  3F9U A;  5ID2 B;  3TDG A;  5IO0 A;  1PGT A;  1ZYQ B;  5DCH A;  2NTO A;  3C73 A;  2VIM A;  2YAN A;  3ZIJ A;  1O6J A;  4WR4 A;  2WW0 A;  2L57 A;  1ML6 A;  4HSC X;  1LU4 A;  4WBJ A;  2B5X A;  3TKQ A;  5JCG A;  3R3E A;  1A23 A;  2PN8 A;  3UMA A;  2GLR A;  1YEP A;  3TKS E;  3GST A;  2XHF A;  1HQO A;  3DKS A;  4N11 A;  3EU4 A;  4G01 A;  3KTL A;  3HD5 A;  1S3D A;  5CRW A;  1XG8 A;  4CW9 A;  1M7T A;  1A24 A;  5J40 A;  3ERF A;  5IOW A;  4BVY A;  4WXT A; 
#chains in the Genus database with same CATH homology
 2WS2 A;  1GSE A;  4QMK A;  1HNA A;  5DJM A;  5CAX A;  4G0I A;  2YJH A;  3KJY A;  2A2R A;  3KP8 A;  4EVM A;  1XOA A;  3D4M A;  2LJK A;  1X9M B;  3F3R A;  3IA1 A;  4MPG A;  2HE3 A;  1FAA A;  2VM2 A;  4KSO A;  3QAW A;  2LEG A;  2ON5 A;  3CMI A;  3WGE A;  4J2F A;  4IKH A;  3O76 A;  2KP1 A;  5IMD A;  1YZX A;  3GX0 A;  5C04 A;  3FHK A;  1LBK A;  1H75 A;  2PER A;  4D73 B;  2WCI A;  4TVE A;  4AJ6 A;  5A4V A;  2EC4 A;  2IMD A;  4ZL8 A;  5BMU B;  4KF9 A;  5LNK e;  1V57 A;  1JZR A;  3KEB A;  1X9W B;  5J41 A;  2FA4 A;  2GQM A;  4OO5 A;  1Z9H A;  4RI7 A;  4ZB6 A;  1K0A A;  3TOT A;  3VLN A;  3A2W A;  1YEX A;  3MDK A;  5ECK B;  1XWA A;  1XXU A;  1AIU A;  4POB A;  1N25 A;  3L9V A;  3IOS A;  2CVD A;  3DWV A;  1HYU A;  4YAV A;  1WMJ A;  2VL9 A;  2EFH A;  3F8U A;  5KOX A;  4RI6 A;  4HQZ A;  1OAZ A;  4IHU A;  2TRC P;  2B5E A;  3GKM A;  1TDI A;  5B8A A;  3APQ A;  3HYP A;  3IRA A;  5LCZ A;  1GUL A;  2H1D A;  1UN2 A;  1M99 A;  1XFL A;  1PKW A;  3FR9 A;  2IIY A;  1PMT A;  2H0I A;  4Z2T A;  5DQY A;  2H19 A;  1WOU A;  3ZRD A;  5AIV A;  1K0M A;  4Q5R A;  2H74 A;  4G10 A;  3ZML A;  2HRA A;  4V2N A;  4OFT A;  1UA5 A;  2C8U A;  1SKW B;  1ZZY A;  1Z6M A;  1O8X A;  5F05 A;  1UC7 A;  4OFM A;  4DSS B;  2AV4 A;  2IPA A;  1GSQ A;  4XS1 A;  2YJ7 A;  3KXO A;  1OC8 A;  3FKF A;  3BOA A;  1ZMA A;  8GSS A;  2HYX A;  4J56 E;  3PGT A;  18GS A;  3Q74 A;  2BJX A;  2O8V B;  4Q5F A;  1TP9 A;  2IMF A;  3M3M A;  2R5G A;  2DIY A;  1SK0 A;  2VAF A;  3E9J B;  1DE2 A;  3NOF A;  1PL1 A;  4EKZ A;  3PIN A;  2PU9 C;  1ABA A;  3LXT A;  1M2D A;  1T1V A;  2L5L A;  1SYX A;  3G7Y A;  2N5F A;  3P7X A;  2Z9S A;  4YQU A;  1TXU A;  3ME8 A;  3TUE A;  3L0H A;  4K2D A;  3DIE A;  5CRH A;  1OE7 A;  5JWO B;  1QGV A;  1RK4 A;  4NV2 A;  1PL2 A;  2VM1 A;  3TJF A;  4MK3 A;  4Z2U A;  2YV7 A;  2L5O A;  2CVK A;  2IMI A;  4K0G A;  2ALB A;  2OAD A;  3O3T A;  1AQX A;  4L0W A;  3N5O A;  2WJU A;  5AIS A;  1NM3 A;  1WRY A;  4WR5 A;  3FYG A;  2MBS A;  3UEM A;  1WE0 A;  3F3Q A;  1GNW A;  2LST A;  2G2Q A;  1TJD A;  4MF5 A;  2LNT A;  5CO3 A;  1XW9 A;  1QQ2 A;  3TJJ A;  1KTE A;  1SVM A;  3VPT A;  1G6W A;  2PBJ A;  1YJ6 A;  3KP9 A;  1PQN A;  1O81 A;  4GDF A;  1F3A A;  4KDX A;  1TKD B;  2J23 A;  4KND A;  2DIZ A;  4LL1 B;  1BAY A;  1C72 A;  2FA8 A;  4L5L A;  1K3O A;  4MPF A;  3O6T A;  3GL5 A;  2JZR A;  1DSB A;  1MDJ A;  5CRD A;  4ULX A;  1F3B A;  1B8X A;  1W89 A;  2O87 A;  3RPP A;  4K6X A;  4I5Q A;  2WDU A;  2CVB A;  3TU3 B;  1MD4 A;  4AKI A;  2C1Y A;  4I97 A;  1X5D A;  3QCP A;  2OE0 A;  3TCO A;  3RPN A;  4POL A;  5JCU A;  3K8N A;  5EVO A;  5DJL A;  2HRK B;  2IMK A;  4LMW A;  5D9X A;  3HY2 A;  4EXJ A;  1FG4 A;  2BTO T;  4TXO B;  5GST A;  1AUC A;  3ISO A;  4K0N A;  2VD0 A;  1WPI A;  4IJI A;  1THO A;  2C4J A;  2B1L A;  1TRW A;  3VI5 A;  2X8G A;  1ILO A;  3KH7 A;  3TRP A;  5AIX A;  2FWF A;  4K8M A;  2HXK A;  4BPY A;  3L78 A;  3ZIT A;  4P3Y B;  1X9S B;  5H5S A;  4XRD A;  2E2G A;  4I2T A;  3EE2 A;  4EUY A;  4PUF C;  3HVV A;  3FRC A;  4JED A;  5B7C A;  4PUA A;  3A5W A;  3KD0 A;  1BG5 A;  2VCV A;  3IE3 A;  4K7O A;  2QGV A;  3BBY A;  1EOH A;  3AY8 A;  4MA9 A;  3Q19 A;  4I6X A;  3CRT A;  2WGR A;  1GSF A;  1VF3 A;  1V2A A;  2YNX A;  1XZO A;  2WFC A;  4EIP A;  2DSA A;  4OFN A;  4OD7 A;  3D5J A;  4PX1 A;  4NMU A;  2H0H A;  2V41 A;  3DEX A;  4JR6 A;  1GL8 A;  1SL0 B;  1EEM A;  11GS A;  2FWG A;  3TKS A;  1NHY A;  2UV8 G;  2R0G A;  2CQ9 A;  4IS0 A;  1U87 A;  3FZA A;  4QQ7 A;  4OWY A;  4KGI A;  5CNW A;  5B6N A;  1BX9 A;  1XCC A;  5A5H B;  5G31 A;  4KUN A;  3GUS A;  1YY7 A;  1YVL A;  1TI3 A;  4AI6 A;  4N30 A;  2OBK A;  2D2Z A;  4KCE A;  3UAR A;  5ELA A;  1J0F A;  4IGJ A;  1XWK A;  1ZOF A;  1HNB A;  5IMF A;  1ZGN A;  3QAG A;  2H1A A;  4Z7X A;  1THX A;  2ES7 A;  4PGT A;  2EIR A;  1GUM A;  1GP1 A;  4GXZ A;  2I4A A;  1A2M A;  3HDC A;  3A2X A;  1SVO A;  4XIH A;  3F4T A;  1BJX A;  3E0U A;  1NW2 A;  2AHE A;  1TU7 A;  2XC2 A;  7GSS A;  2PWJ A;  5DDL A;  1M0U A;  1K0B A;  3G7J A;  5F0G A;  17GS A;  3IXR A;  5ECL B;  2HZE B;  5D93 A;  4TOP A;  2GT6 A;  4RUV A;  5IO2 A;  5J4Y A;  3LWA A;  1XW5 A;  2XBQ A;  4ACS A;  1W4V A;  4MZC A;  5A1N B;  2IJY A;  1IYI A;  1GLQ A;  1PX7 A;  3ZIV A;  3HJM A;  2LTK A;  1M9A A;  5ELG A;  3RBT A;  2UZ8 A;  2N5A A;  5IIZ A;  1VF1 A;  3RDW A;  5IQY A;  2ZCT A;  1X5C A;  4MF7 A;  4TXV A;  5D73 A;  1S3C A;  3W6G A;  4ZB8 A;  1U3I A;  3ZTL A;  4HJM A;  4KB3 A;  3DVW A;  1WIK A;  2QA1 A;  1ON4 A;  4Z2R A;  2YOI A;  1BG1 A;  2JSZ A;  1PSQ A;  2VLV A;  3HMJ G;  4XS4 A;  1GRX A;  3GIX A;  4KDY A;  2H6Z A;  2MMN A;  2H76 A;  1Z5Y E;  4G0L A;  2X99 A;  4BWS A;  4EDY A;  1WP0 A;  3M0F A;  4TKY A;  3TB2 A;  5KOW A;  2YCD A;  1SEN A;  1SL1 B;  5J3R A;  2G0F A;  3HCZ A;  2AYT A;  1TK8 B;  4W66 A;  2X8C A;  4WEY A;  5IOX A;  1WJK A;  2R6K A;  1N8J A;  5G2Z A;  3J7Y b;  1EV9 A;  4NV5 A;  2K6V A;  4DSR A;  2IN3 A;  5JWQ B;  1B4P A;  1OVN A;  2FGX A;  4MH2 A;  2PVO C;  4N3Z A;  5G5F A;  2V6K A;  4JRR A;  3GFK A;  2MYG A;  4BVX A;  3UOM A;  1SKS B;  1OC3 A;  3R2Q A;  1ERU A;  10GS A;  2X4A A;  2VCX A;  3WD6 A;  1A8L A;  3ED3 A;  3CSH A;  3D22 A;  4MJC A;  1GSS A;  1VF2 A;  1Y25 A;  3FMW A;  3P2A A;  3QMX A;  4Q5N A;  4MJA A;  3G7I A;  2REM A;  3GV1 A;  3UBK A;  1O85 A;  3F4S A;  1R5A A;  2PVQ A;  4AKH A;  3LXZ A;  2LQQ A;  3NZN A;  3CSJ A;  1AXD A;  4L0U A;  5FT3 A;  5DAK B;  3LEF A;  1F2E A;  3WT1 A;  3CXG A;  3FR6 A;  3RHB A;  4AKG A;  2YPM A;  2JZT A;  5GAN D;  1AC1 A;  2X64 A;  2O85 A;  4N0Z A;  3US3 A;  3ZRE A;  1CQG A;  1MDK A;  4TR1 A;  4MAB A;  5E4W A;  3C1R A;  2YV9 A;  3V1W A;  2EIQ A;  4LMV A;  3GKX A;  3TRQ A;  3HVS A;  4IP6 A;  2CZ3 A;  5C00 A;  1SD9 A;  4MDC A;  2O89 A;  4POM A;  1YKA A;  2H6X A;  4TR0 A;  5DAL A;  1FOV A;  1XPV A;  3QAV A;  2IFQ A;  4HDE A;  4XHM A;  3CYN A;  3GH9 A;  1O8W A;  3IC4 A;  3EWL A;  2QC7 A;  5A5H A;  3KM6 A;  3KCM A;  3VWV A;  4FH8 A;  1OKT A;  1X5E A;  5GAP D;  2YWI A;  1SK1 A;  4K5S A;  4PNF A;  1Z7P A;  5ECM B;  3J7Y k;  2P5Q A;  1QK8 A;  2HSY A;  3KMO A;  2HZF A;  2FHE A;  2VL2 C;  6GSS A;  2GQL A;  5BRT A;  12GS A;  1Q98 A;  3KZQ A;  2O5V A;  2VKZ G;  5D8I A;  1M2B A;  3DVX A;  3TGZ A;  2P31 A;  1F9M A;  2KP2 A;  4V2M A;  4X4J A;  4MNN A;  6GSV A;  4IP1 A;  2X49 A;  2VLT A;  2B7K A;  2E2M A;  3HJP A;  4XS6 A;  2R3X A;  3L4N A;  3QDN A;  2VCZ A;  1XWB A;  3UL3 A;  5A34 A;  3HA9 A;  4ZL9 A;  5L71 A;  2YZH A;  4XTS A;  4O5U A;  4YH2 A;  2HSN A;  1MEK A;  4IEL A;  3ERW A;  3DYR A;  4GTU A;  2YN1 A;  5CRE A;  1JLW A;  3BCI A;  3GTU A;  4V1A p;  4ECJ A;  3EMP A;  4AGS A;  5HFK A;  3LGC A;  4K2X A;  2F8A A;  4E8E A;  3MIX A;  2H1G A;  4PTS A;  2FUG 2;  3IAS 2;  4HZ2 A;  1R5P A;  4HU9 A;  4AJ7 A;  2B1K A;  5D9V A;  2A2P A;  5LD0 A;  5CRG A;  1SK2 A;  3DD3 A;  2DKH A;  3L9S A;  3FR3 A;  1FB6 A;  1YKC A;  2HSM A;  1TTZ A;  1XVQ A;  2LNS A;  5ID2 A;  5DVB A;  6GSW A;  4X1U A;  1B9X C;  4POK A;  2KLX A;  2C80 A;  2LRN A;  1QXH A;  4G0K A;  4GF0 A;  4F0C A;  1I9D A;  4TRX A;  1VF4 A;  1JZO A;  3HJO A;  3ZFL A;  3D4T A;  5EPF A;  5HFI A;  5F06 A;  1FVJ A;  4BA7 A;  1M2A A;  3TOU A;  2DLX A;  5EY6 A;  2YWO A;  2OT3 A;  4FQU A;  2KOK A;  2GDR A;  4OCE A;  5H5R A;  2H71 A;  1ZYP A;  3UAP A;  1KEB A;  1EP8 A;  2JAC A;  5HR0 A;  2B7J A;  2HT9 A;  2FWE A;  4O5Q A;  1EGO A;  3GH6 A;  3KGK A;  1JLV A;  2WRT A;  4GCI A;  3BJ5 A;  1I5G A;  2VLU A;  3EMX A;  1ERV A;  2GTU A;  3NIV A;  3IDV A;  4CY6 A;  1GTU A;  3ZMK A;  3GKN A;  4G2E A;  1ZYN A;  3C71 A;  3LQ7 A;  5EL8 A;  1TI1 A;  1T7P B;  4EE0 A;  4USS A;  2C0D A;  5ECP B;  4EL1 A;  2J9H A;  1OC9 B;  4CHS A;  4NAX A;  3Q18 A;  3JCM L;  5D9W A;  2NBS A;  5COH A;  1Z6N A;  4O32 A;  2YWN A;  4D73 A;  3I6A A;  4LL4 B;  4GLT A;  2AUV A;  1EP7 A;  4V2L A;  5BMU A;  1XWC A;  5G5E A;  4PXO A;  4BVY B;  4TR4 A;  4F9Z A;  4ECB A;  2OA7 A;  5G1K A;  4F03 A;  1QFN A;  5G1L A;  3H93 A;  2E0Q A;  4MP4 A;  1EGR A;  3HHV A;  1TXX A;  4A5P A;  3H79 A;  3HKR A;  3WGD A;  4HJ2 A;  4AJ8 A;  3I69 A;  4NHW A;  5IMA A;  4IBP A;  2VO4 A;  3PH9 A;  2LV3 A;  1R7H A;  2F3M A;  1J9B A;  1DUG A;  2AAW A;  3D6I A;  1Y6E A;  4HUA A;  1CQH A;  1PD2 1;  3QR6 A;  2TRX A;  4ICY A;  1G0T A;  2V1M A;  3ZVJ D;  1GSY A;  3A5I A;  3GRX A;  3U5R E;  1T8E B;  4BL7 B;  2GQK A;  1H4O A;  1T4Z A;  4TR3 A;  2QKE A;  4OMV A;  3ZLP A;  1MD3 A;  1TK5 B;  1FHE A;  4JR4 A;  1SKR B;  5ECS A;  2DJJ A;  3CRU A;  3G9B A;  4L5O A;  2CX3 A;  4MZB A;  2ON7 A;  3TKP A;  3FZ5 A;  1K3L A;  4PUR A;  2WZ9 A;  2H1L A;  1ZYE A;  2DBC A;  4KCA A;  3TJK A;  2YWM A;  1SJ6 A;  2EFC A;  2EFE A;  1T4Y A;  2HLS A;  3C7M A;  1F37 A;  4MMM A;  1V9W A;  6GSU A;  2L6D A;  1GLP A;  4DSS A;  3UJ1 A;  4HOJ A;  2FY6 A;  1YF0 A;  1JHB A;  5J5N A;  2AJQ B;  4PQI A;  4KA0 A;  4E68 A;  4IVF A;  3GHA A;  1ERT A;  1GWC A;  1RQM A;  3C8E A;  1KNG A;  2HRF A;  1N2A A;  4OCF A;  4I2U A;  4BWQ A;  2GZZ A;  1PKZ A;  3SBC A;  2HQT A;  4EO3 A;  1SJI A;  2GGT A;  4NPB A;  4O92 A;  1A8Y A;  3SWL A;  2VOC A;  1DE1 A;  3LYP A;  1TRV A;  3D0Z A;  3ZVJ A;  3CTG A;  2OBI A;  4O5R A;  2OKA A;  3EYT A;  1ERW A;  5H5Q A;  5KN3 A;  3HXS A;  3GKK A;  4YKG A;  3W8S A;  4LA1 A;  5HR3 A;  1G7E A;  2I9H A;  5INY A;  1BF5 A;  2JU5 A;  4YAP A;  4KAE A;  3FY7 A;  4FYB A;  3CSI A;  6GSY A;  2LJR A;  3IV4 A;  2FNO A;  2MMA A;  2V2G A;  4NXI A;  1SVL A;  1F6M C;  4FYU A;  4HI7 A;  2F9S A;  1XWG A;  1GTA A;  4EC0 A;  4K7I A;  2MBT A;  1NSW A;  1SJZ A;  2H30 A;  1LJR A;  4WKW A;  1GUK A;  4K9Z A;  2TIR A;  4QL9 A;  2WUL A;  5A4U A;  2K8V A;  1E6B A;  1Z3E A;  1R26 A;  3BCK A;  1B9Y C;  2H1B A;  2VD1 A;  2RM5 A;  1GUH A;  3IC8 A;  1ZCP A;  3L9U A;  5IPH A;  1B4Q A;  3MYD A;  2L4C A;  4L8E A;  4KH7 A;  3P8W A;  3LW9 A;  3F0I A;  3IAM 2;  1GSU A;  3F4R A;  3VFI A;  2WB9 A;  1EZK A;  4JE1 A;  5F8B A;  3TJG A;  2HRK A;  3IBH A;  1YF1 A;  3P90 A;  4TXO A;  5HFG A;  2B6M A;  5A4W A;  2VL3 A;  2F51 A;  2DKI A;  3CTF A;  2IWT A;  3EU3 A;  2JZS A;  1YQ1 A;  1OC9 A;  1K0C A;  2KUC A;  3A3T A;  1AQW A;  3KIJ A;  2GS3 A;  3LOR A;  1U88 A;  2R2J A;  3HVX A;  5GSS A;  2MMZ A;  4MJE A;  3VWW A;  2DJ0 A;  1J08 A;  3KH9 A;  2HI7 A;  5IMZ A;  1TOF A;  3N9J A;  1M9B A;  4GRF A;  5KN0 A;  5A5K A;  2HFD A;  3TKS C;  3PPU A;  4NHZ A;  4EIQ A;  2EIO A;  1EV4 A;  14GS A;  4TW5 A;  2CAQ A;  4KSM A;  4OO4 A;  2LJA A;  2LKU A;  2DJK A;  1Q4J A;  1O7U A;  4XCS A;  1HNC A;  1U6T A;  2LS5 A;  2M80 A;  2FWH A;  1A0F A;  3U6V A;  1DBY A;  1V98 A;  4AKX B;  1XBS A;  4CDO A;  4I8B A;  1A0R P;  5CP1 A;  1Z7R A;  3M9J A;  3E3E A;  3DRN A;  4ECC A;  3PR8 A;  2P5R A;  2F8F A;  3H1N A;  1SD8 A;  2C3Q A;  3GYK A;  4X0X A;  4BL7 A;  2BMX A;  5ECI B;  1A2J A;  4N10 A;  5ECH B;  1K0N A;  3I9V 2;  3FZ9 A;  4F82 A;  2GSS A;  4PQ1 A;  9GSS A;  1T00 A;  3APS A;  4PNG A;  3GX8 A;  4ZBB A;  5J9C A;  3ME7 A;  2DML A;  3GN3 A;  4IW9 A;  1RW1 A;  4DSQ A;  3M9K A;  1G7O A;  1VRS D;  4XRA A;  4DVC A;  2H66 A;  2DJ3 A;  4GQC A;  2I3Y A;  5DCG A;  1FO5 A;  3VWU A;  5ABR A;  2HNL A;  2GZP A;  1HD2 A;  4FIW A;  3H4K A;  1XVW A;  2NDO A;  1NHO A;  1JZD A;  1WWJ A;  1PX6 A;  4ID0 A;  2NPB A;  2CAI A;  3LJR A;  20GS A;  1OKD A;  22GS A;  4GSS A;  3QD9 A;  1X0R A;  1GTI A;  2I1U A;  2HZE A;  2ZNM A;  2XPE A;  1EEJ A;  5D96 A;  2QA2 A;  3IHQ A;  5KN1 A;  1E2Y A;  5B8B A;  5A1N A;  2PPT A;  2GSQ A;  1K0O A;  2DJ1 A;  4EDZ A;  3VK9 A;  5KN2 A;  1KBN A;  4K1F A;  2H01 A;  2N5B A;  2GZY A;  3FZ4 A;  3LYK A;  3TJB A;  1SU9 A;  2RM6 A;  3DML A;  3GA4 A;  5B6M A;  3VPQ A;  1MTC A;  2MZC A;  2A2S A;  3H8Q A;  1QMV A;  1MDI A;  2JAD A;  2CX4 A;  1TRS A;  2L59 A;  2VUP A;  4HQS A;  3GMF A;  4HZ4 A;  4K5R A;  4F0B A;  1AQV A;  4GST A;  3OR5 A;  4N0V A;  5HR1 A;  3GUR A;  1BYE A;  4EF0 A;  4ZXG A;  2H73 A;  3WGX A;  4MZW A;  1GSD A;  1V40 A;  2LRT A;  3I43 A;  1T3B A;  19GS A;  16GS A;  5ENU A;  2ZUP A;  2C3T A;  2RUE A;  2DMM A;  1GTB A;  5IMV A;  2X8H A;  2A4H A;  2V6O A;  2XBI A;  1TRU A;  4IQA A;  3WT2 A;  4MF6 A;  4PQH A;  3VUR A;  2IL3 A;  2RLI A;  2GVP A;  4HU7 A;  4J57 E;  3LSZ A;  5G30 A;  4JBB A;  2KHP A;  1AAZ A;  2L4Q A;  2R37 A;  3MWH A;  1ZL9 A;  1FVK A;  4F2I A;  2EFD A;  4XS4 B;  3W8J A;  2GST A;  4MJB A;  3VI7 A;  4FO5 A;  3FK8 A;  2H72 A;  2FCH A;  4ZBA A;  1U3A A;  1TW9 A;  2RII A;  3F63 A;  5DQS A;  3FEU A;  4KW6 A;  3IK7 A;  4X43 A;  2H0G A;  3EVI A;  4HS1 A;  4WBR D;  4YQM A;  5JWR B;  4KDU A;  1V58 A;  4CY8 A;  5J4U A;  2DC5 A;  2VCT A;  2HRN A;  4WF4 A;  4WET A;  3D21 A;  3EC3 A;  3EUR A;  4MH3 A;  2PGT A;  2O7K A;  3DXB A;  3QOU A;  5DAK A;  1AW9 A;  1GH2 A;  5HQP A;  2R0P A;  4BVX B;  5KEJ A;  4ZB7 A;  4ZL7 A;  3LFL A;  1BQ7 A;  2FD3 A;  5IM9 A;  4ILF A;  1XIY A;  1SL2 B;  1SYR A;  5ECR B;  1R4W A;  2A4V A;  3CWG A;  1FW1 A;  4GQF A;  4O7H A;  5ECN B;  1ST9 A;  4ECI A;  2RUF A;  3FW2 A;  1IYH A;  5FWG A;  4NWY A;  4ZIL A;  4DEJ A;  4ZBD A;  5E59 A;  3ZZX A;  3RAZ A;  2C3N A;  4ZB9 A;  5J4V A;  4GSN A;  1USB A;  5ECQ B;  3MSZ A;  3C1S A;  1B48 A;  2OJL A;  3BD2 A;  3DGQ A;  3EPT A;  3ZFB A;  2B5Y A;  1OE8 A;  5AN1 A;  1VGL A;  5CYY A;  3KMN A;  2VCQ A;  2C0F A;  4TR1 B;  3UBL A;  3RHC A;  3QPM A;  4RQR A;  5FHI A;  4V1A g;  1Y1U A;  2OE3 A;  4JZQ A;  1TU8 A;  1XW6 A;  1PRX A;  3APO A;  5J9B A;  3CBU A;  3QFB C;  4ML6 A;  3M8N A;  2L6C A;  4ML1 A;  2M72 A;  2OE1 A;  3TRX A;  2GSR A;  5D9T A;  2FLS A;  13GS A;  4TN8 A;  2YP6 A;  3UVT A;  4AF2 A;  1TK0 B;  4YQV A;  2R4V A;  1UVZ A;  5DAL B;  1FB0 A;  2IFQ B;  2C0G A;  1GNE A;  1S3A A;  3GL3 A;  3GNJ A;  1URM A;  4KX4 A;  2XPD A;  4G19 A;  3TKR A;  1PN9 A;  3UVH A;  3VWX A;  4FYC A;  2HSH A;  2NVL A;  5ECO B;  3UIW A;  4Q5Q A;  1G6Y A;  4HEA 2;  5IMC A;  1BED A;  3HZ8 A;  4MLY A;  1JFU A;  2C0E A;  4JU5 A;  3EIN A;  2PUK C;  1PN0 A;  2H70 A;  3MAK A;  2AB6 A;  2K8S A;  4ZIJ A;  1O73 A;  2CZ2 A;  2H75 A;  1JZW A;  2LRC A;  4G9H A;  1OYJ A;  1EOG A;  2LQO A;  2R0C A;  1YDK A;  3ZL5 A;  4YKF A;  2IME A;  4IQ1 A;  2GT5 A;  3HZ4 A;  2PMT A;  3MNG A;  6GSX A;  2LUS A;  1EWX A;  4LLR A;  2JL4 A;  3IHG A;  3ZYW A;  2V32 A;  3QFA C;  1ACV A;  4GWR A;  3ERG A;  3KTB A;  5HR2 A;  5DBQ A;  3WYW A;  2VL2 A;  4ISD A;  2YZU A;  5A34 B;  1A2L A;  5AGY A;  5JCW A;  2OAC A;  3F6F A;  2HSN B;  5GZZ B;  2P0G A;  3GSS A;  1PA3 A;  1XOB A;  4K7N A;  2H8L A;  3GTU B;  2B3S A;  1K3Y A;  5F07 A;  4E8H A;  6GST A;  2JSY A;  4MCU A;  4KE3 A;  1FOH A;  3A2V A;  3Q6O A;  4H86 A;  2M46 A;  2I81 A;  5IPG A;  3S9F A;  2QSI A;  3IPZ A;  5J47 A;  4IN0 A;  2E7P A;  3LG6 A;  2K18 A;  2CA8 A;  4IJ3 A;  2H6Y A;  2MMO A;  3IR4 A;  2K9F A;  4QL7 A;  3IK9 A;  2DJ2 A;  2CT6 A;  3F6D A;  4WF5 A;  2VCW A;  2CV4 A;  2HSM B;  3M1G A;  1K0D A;  4RQX A;  1QUW A;  3F9U A;  5ID2 B;  3TDG A;  5IO0 A;  1PGT A;  1ZYQ B;  5DCH A;  2NTO A;  3C73 A;  2VIM A;  2YAN A;  3ZIJ A;  1O6J A;  4WR4 A;  2L57 A;  1ML6 A;  1LU4 A;  4WBJ A;  2B5X A;  3TKQ A;  5JCG A;  3R3E A;  1A23 A;  2PN8 A;  3UMA A;  2GLR A;  1YEP A;  3TKS E;  3GST A;  2XHF A;  1HQO A;  3DKS A;  4N11 A;  3EU4 A;  4G01 A;  3KTL A;  3HD5 A;  1S3D A;  5CRW A;  4CW9 A;  1M7T A;  1A24 A;  5J40 A;  3ERF A;  5IOW A;  4BVY A;  4WXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...