3VI7A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi7A01
4V2LA 2GSSA 2WZ9A 2BMXA 2H74A 4IQ1A 3GN3A 4AJ6A 5D9XA 5C04A 1XWKA 3VWUA 1SL0B 19GSA 2C1YA 1EOHA 3TJFA 3KP8A 1SJIA 3LYKA 3EVIA 2H71A 3F3RA 5D73A 2LEGA 3AY8A 5EY6A 5JCUA 1URMA 3FEUA 3UARA 4ILFA 1FW1A 4KA0A 2B6MA 2CA8A 5A4WA 2JACA 3P8WA 2C3QA 2B1KA 3TOTA 4JU5A 4JE1A 2NTOA 2Z9SA 1FHEA 4OD7A 2GS3A 2LRTA 2OBIA 4XIHA 3TKSE 3HY2A 3D4MA 4HUAA 1K0DA 1S3DA 3G7YA 2V32A 1OYJA 4HJMA 2HRNA 4NHWA 4POLA 5DALA 2GT6A 1DBYA 3GKKA 4LL1B 1EV9A 8GSSA 4K7IA 4QL7A 4X43A 1X5CA 2GDRA 4GCIA 3MNGA 3O6TA 1AUCA 2A2RA 4KX4A 1U3IA 5JCWA 1TI1A 1XWGA 5JCGA 6GSYA 4HU9A 5IMVA 4ECIA 3ZLPA 1EGRA 2C80A 2GZZA 2H8LA 2HI7A 3UMAA 2LJRA 2JZTA 1Z6NA 5DAKA 4O92A 2IMIA 5G30A 1OKDA 4PTSA 4K8MA 4E8HA 2PVQA 4V2MA 3OR5A 5KN3A 3GRXA 2R5GA 1M9AA 2L59A 4XS4B 4IN0A 2RM5A 2AJQB 3RHCA 3GH9A 5J3RA 1K0NA 4WF5A 3KP9A 2CQ9A 5H5SA 2R4VA 4NPBA 2IL3A 2PUKC 1GSFA 5B8BA 1UA5A 3I9V2 1I5GA 2IJYA 3IR4A 2YZUA 5HR3A 4G0KA 4POBA 5LCZA 1SKWB 2JSZA 5ABRA 3DVWA 3WGDA 3MWHA 4KSOA 3DWVA 1AQVA 2QGVA 3N9JA 2E2GA 3QFAC 1R4WA 1OAZA 4N0ZA 2IN3A 4HEA2 3PPUA 1O85A 3D21A 2DMMA 2WGRA 2KP2A 3CRUA 1TRUA 5CRWA 3ZREA 3WYWA 4MMMA 4F2IA 3W8SA 5GAND 1FAAA 3KM6A 5ECNB 4MF6A 2WFCA 3GTUB 1FB6A 4ZXGA 4KUNA 2MYGA 1Z5YE 1VRSD 3D0ZA 1TKDB 2V6KA 4BVXA 1KNGA 1ZL9A 2H6YA 1A2LA 3G7JA 1U3AA 2IIYA 2OE0A 3L0HA 2HE3A 2OBKA 1A0FA 1JFUA 4ZIJA 3ZVJA 4FIWA 5DALB 4MPFA 4BVYA 4N11A 5G5EA 14GSA 4K7OA 2IWTA 2MMOA 1R5PA 4HZ2A 1ZYQB 2PGTA 3A2XA 4OFNA 3ZZXA 2O89A 1YEPA 3N5OA 1V58A 3GFKA 3I43A 2EIQA 3W8JA 3ERFA 4WR5A 4MH2A 1OC3A 4K1FA 4HJ2A 5DQYA 4AJ7A 1XCCA 3GA4A 6GSWA 1ABAA 4X0XA 5F05A 2E0QA 1M99A 2R2JA 3C1SA 5ECMB 2P5QA 2YV9A 5B6NA 1HD2A 1PX6A 1ON4A 1C72A 18GSA 3M9KA 1JLVA 2FD3A 2LSTA 3TKRA 1TK0B 2JL4A 1F37A 1SYXA 1GSQA 5D8IA 3APSA 4YQUA 4BL7A 2C4JA 4ZILA 4MZCA 2VL3A 3JCML 1RW1A 5IMAA 1NM3A 3J7Yk 2YWOA 3Q74A 6GSUA 2H19A 1ZMAA 4ML6A 2DJ1A 4ZB9A 4I2UA 2HSNB 3HZ4A 4AF2A 1GSUA 3VWXA 4F9ZA 2VO4A 2R37A 2H1GA 4DSQA 2CZ2A 3L4NA 5BMUA 3LXZA 1M2AA 2C0GA 1Z7PA 2OKAA 1U88A 1AAZA 1CQHA 2JU5A 2CVBA 4V2NA 4TKYA 1X9WB 3C7MA 2VM2A 2BJXA 2X8HA 2F3MA 2HRAA 3FHKA 4MF7A 5ECPB 1GUMA 2YV7A 3SWLA 1KEBA 1K3OA 3EC3A 5B6MA 1YDKA 2KLXA 1TDIA 3IHQA 2HNLA 3GUSA 2DBCA 3M8NA 2WRTA 3APOA 2B5EA 1VF1A 3MSZA 5ECQB 1PL2A 3HVSA 2MBSA 1OC9A 3EURA 4IP6A 2V41A 2PVOC 2CVDA 4IQAA 1O8WA 3P7XA 2IFQA 1GTBA 1XOBA 2CV4A 2JZSA 2L5LA 3TRPA 4K0NA 1J9BA 3UOMA 5ECKB 4BVXB 1TOFA 5G2ZA 1O7UA 3UVTA 3O3TA 1CQGA 6GSTA 4MZBA 3VPTA 3H4KA 2N5FA 2YN1A 2N5AA 4KDXA 3GMFA 2HRFA 2C0DA 3M9JA 1QGVA 4BVYB 4KAEA 9GSSA 1GRXA 1M2DA 2P0GA 5FWGA 2VCTA 4O7HA 4MLYA 1SK1A 6GSVA 3ZRDA 2HT9A 5CAXA 1PKWA 2D2ZA 5DJLA 1T4YA 1W4VA 1H75A 1K3YA 2NDOA 1ST9A 1PMTA 4G0LA 1AIUA 4BA7A 4TVEA 4MH3A 3CRTA 2PMTA 1M2BA 1Q4JA 4I97A 2HRKB 3ZIJA 3CTGA 1XIYA 2H0GA 2QC7A 2HSHA 2R6KA 3KCMA 12GSA 1WIKA 5IO2A 4HS1A 5KN2A 3F6FA 5E4WA 2ES7A 1HNAA 2L4QA 1FVJA 4BL7B 3IK9A 1A8YA 4LLRA 3DD3A 3QD9A 2NPBA 3VI5A 2C0FA 1K3LA 1G0TA 2DJJA 4IP1A 5HR2A 3QOUA 6GSXA 2HLSA 4MZWA 3C73A 2GT5A 3ZYWA 4YAPA 4WBRD 3GL5A 2PPTA 2K8SA 3D6IA 3IE3A 2YP6A 3VURA 3KZQA 4PX1A 1F3AA 2H0HA 5JWOB 2HXKA 2HZFA 3IPZA 2WCIA 3IBHA 4NV5A 2OA7A 3W6GA 1JZDA 4ZBAA 2B7JA 1TI3A 3EINA 2LRCA 4EDYA 4PUAA 4G2EA 4CW9A 5G1LA 4OCEA 2OE1A 1N8JA 2KP1A 4ID0A 3LGCA 4FO5A 1SKRB 4LA1A 4EKZA 2WDUA 2DJ0A 3UEMA 3CSJA 2YJHA 4L8EA 2FA4A 1QXHA 2IFQB 3GV1A 3E9JB 3IXRA 4FQUA 1GSYA 5GSTA 4MF5A 3H93A 1PD21 4K0GA 5IMCA 5D96A 4HZ4A 3DVXA 3ERWA 2ZCTA 2RIIA 4Q5QA 2YWNA 1ERTA 2GZYA 3LJRA 5ECOB 3M1GA 5D9WA 4PURA 4GSNA 3CBUA 4GF0A 4J56E 1IYIA 3F8UA 1AXDA 4IBPA 1PX7A 1DUGA 4FYUA 2CZ3A 4MK3A 4YAVA 3R3EA 2B5XA 1SD9A 2G0FA 3DKSA 3QMXA 3QAVA 3GKNA 3TKSA 2LV3A 2PN8A 3V1WA 5GSSA 1QUWA 4Z7XA 3EU3A 2WJUA 2EC4A 2VD0A 3GX8A 4QL9A 1UC7A 1XZOA 4DVCA 4POKA 3H79A 3Q18A 2LJAA 4JRRA 4GLTA 2EIRA 6GSSA 1TK5B 4OMVA 2HSMB 2YCDA 1NHYA 4Q5NA 2XPEA 3L9UA 2CX3A 3UIWA 3FZAA 2A2SA 3DMLA 4TR3A 3TKSC 1YKAA 1A0RP 3KH7A 4ZL7A 1K0CA 4ECJA 1BYEA 2ALBA 2VUPA 4EE0A 4ZBBA 4XCSA 1JZWA 2DJ3A 4NAXA 4IHUA 1Q98A 17GSA 1GTIA 5DJMA 4MABA 2I1UA 4J57E 1PL1A 3FKFA 2FWEA 1V9WA 4NHZA 4KNDA 4TN8A 4AGSA 2CAQA 1AC1A 1B4PA 1H4OA 5ECLB 4TR1A 4EC0A 2XPDA 3RDWA 5ID2A 3EMPA 1K0BA 3L9SA 4EDZA 2FY6A 3DEXA 2V2GA 3GL3A 1X5EA 1ILOA 2AB6A 1A2JA 4PXOA 2DIYA 5DBQA 1TK8B 1GWCA 2K8VA 2V6OA 4EXJA 3UJ1A 4GSSA 4EF0A 2NVLA 3L9VA 3F6DA 1XW9A 3CYNA 1BG5A 3QAWA 2V1MA 1SD8A 4FYBA 3TUEA 3U5RE 2KUCA 2EIOA 3I69A 2HYXA 3GYKA 4TXOA 3GKXA 2MBTA 1S3AA 3A2VA 2ZNMA 4IJIA 1A23A 2J9HA 2YOIA 1M7TA 4E8EA 4GQFA 1PQNA 3ZMKA 4GSTA 2J23A 3KH9A 1IYHA 2LTKA 5LNKe 1ZZYA 5HR0A 4OFMA 13GSA 2H6XA 2C3TA 3O76A 5AGYA 5DVBA 1VGLA 1QMVA 3LFLA 3D5JA 3TRXA 5JWRB 1V40A 3U6VA 4QQ7A 3FY7A 3EMXA 2MZCA 3HCZA 1GUKA 4HQSA 3FK8A 4MJAA 1PA3A 4LL4B 4NV2A 1TRVA 4IJ3A 4EVMA 3WGEA 4JR4A 1VF4A 5KEJA 10GSA 2JZRA 1T1VA 2IMFA 1XWCA 3EWLA 2AYTA 3PH9A 2P31A 1VF2A 3UBLA 3CSIA 3FZ4A 3RPNA 2YZHA 1S3CA 3HKRA 2YNXA 3GKMA 2LRNA 2CAIA 5DAKB 1WRYA 1FVKA 4F0CA 2VCQA 3M0FA 3E3EA 3US3A 4V1Ag 3VLNA 2RUFA 1E2YA 4Q5RA 3TGZA 4MPGA 1XVQA 1GSSA 4EUYA 3RPPA 4WEYA 2TRCP 3FZ9A 2GVPA 3IOSA 1SJZA 1UVZA 4XRAA 4O32A 4CDOA 5IOWA 4L0UA 3KJYA 3Q19A 2DJKA 2B5YA 2VCWA 2AUVA 3I6AA 5H5QA 2GQMA 2YPMA 2RUEA 3ME7A 4ZL8A 2YANA 4N10A 3C71A 5INYA 1LJRA 3MAKA 2ON5A 5GZZB 1PGTA 2F9SA 4RI6A 2VCVA 5KN1A 1XOAA 3HDCA 2H1AA 4IVFA 3MDKA 1MEKA 1MDJA 1GULA 3WT2A 2H1BA 1NSWA 1GP1A 4PUFC 1FOVA 4HDEA 1B48A 4NMUA 4NXIA 3TCOA 5IPGA 2IMEA 2I4AA 5CO3A 2F8FA 5CRDA 3EYTA 1GSDA 1GUHA 2KOKA 2F8AA 5F06A 3G9BA 4DSSA 4L5LA 2FNOA 3KXOA 1PSQA 5FHIA 11GSA 2WULA 4PNFA 3UAPA 5HFGA 1TU8A 4G0IA 2XC2A 2H0IA 5ELGA 1XWBA 3F0IA 1VF3A 4K7NA 5EL8A 1ZOFA 2I81A 3LXTA 2O85A 2VOCA 4JBBA 3TDGA 1TP9A 2QSIA 4KDUA 2I9HA 1DE2A 4KH7A 4LMVA 1TXXA 2FA8A 1TRSA 2CT6A 2KHPA 4I8BA 1QQ2A 2JADA 1O81A 3BD2A 3ZVJD 1F2EA 1JZOA 1SJ6A 3GX0A 4ZB6A 5KN0A 1X9SB 3DRNA 3GNJA 2FLSA 4POMA 4TXVA 2R3XA 1F9MA 1Y25A 3QCPA 4G19A 5H5RA 2H1DA 1LU4A 5CRGA 4KE3A 3H8QA 3GIXA 3UVHA 5IO0A 4G9HA 5J9BA 2VLUA 2M72A 1PKZA 2GZPA 4ECCA 1YF1A 1XBSA 2YWIA 1EZKA 5DCGA 1A8LA 4JZQA 3UBKA 2H30A 5HFIA 4IGJA 5CREA 2FCHA 3P90A 1ERVA 3CTFA 2DMLA 2C0EA 4ZL9A 1OE7A 4EO3A 2AV4A 4L5OA 4GTUA 3FR6A 5FT3A 3HXSA 4O5RA 4RQXA 1G6WA 4X1UA 3ZTLA 3ED3A 2VLTA 4PQHA 1EGOA 1EEMA 1QFNA 4RI7A 1XWAA 2VL2A 1XVWA 3HJPA 2OADA 2XHFA 1RK4A 5C00A 3IAS2 3HJOA 3IDVA 1MTCA 7GSSA 3R2QA 2L4CA 2XBIA 2JSYA 2DLXA 4IW9A 1SL1B 4MDCA 2ZUPA 3TJKA 4YH2A 5HFKA 2CX4A 3H1NA 3VWVA 4P3YB 1V2AA 4MJEA 2IMKA 3HHVA 4GQCA 3VWWA 4ACSA 1ERWA 5ENUA 1GLPA 2VL2C 1TJDA 1OC9B 2IMDA 4WKWA 1R5AA 2WB9A 3IV4A 2XBQA 2P5RA 2K6VA 3FR3A 1O6JA 1YY7A 3HD5A 3SBCA 2FGXA 4I2TA 5F8BA 1SL2B 3QR6A 4KCAA 3FRCA 2H76A 2TRXA 1YKCA 1AQWA 1E6BA 1V57A 3TKQA 4NWYA 5IPHA 4KB3A 3KIJA 2A4VA 1JZRA 3IRAA 1M0UA 3GTUA 4IELA 4OCFA 2DIZA 2I3YA 5LD0A 1TW9A 4YQVA 5CRHA 3ZMLA 3HA9A 5CP1A 2H6ZA 5IM9A 3F63A 1GNWA 1B9YC 16GSA 1GNEA 2C8UA 1WE0A 2DJ2A 3HVVA 3LEFA 1R26A 4IS0A 3BBYA 2H66A 1GTUA 2H70A 2M46A 3NOFA 1GH2A 4MP4A 3IA1A 1GLQA 4G10A 3D22A 3ZFBA 4XRDA 1TTZA 2FWHA 4XTSA 5HQPA 3IAM2 5AIXA 4AJ8A 5G1KA 4ML1A 1EEJA 5D93A 4TRXA 5D9TA 1OVNA 1HYUA 2C3NA 4RQRA 2O87A 1AW9A 2PU9C 4TR4A 3LG6A 3PINA 2GTUA 3QFBC 5J4UA 3TB2A 3TOUA 1N2AA 4F03A 3C8EA 3ZIVA 2B3SA 3NIVA 4DSRA 5B8AA 4BWSA 2L5OA 2B1LA 4FYCA 2QKEA 3PR8A 5E59A 1M9BA 2VCXA 3BCIA 1MDIA 1SK0A 1Z7RA 3HYPA 3TRQA 2N5BA 4MCUA 2E2MA 1NW2A 3EU4A 4WXTA 2H72A 1XPVA 4K2DA 2MMAA 1RQMA 5G5FA 1T3BA 1BAYA 4CHSA 4RUVA 5GAPD 3F4RA 2FUG2 2OACA 22GSA 4PGTA 4KGIA 3RBTA 5IMFA 1Z3EA 3BCKA 4ECBA 4TR0A 1WWJA 2X8CA 3K8NA 4XS1A 3FW2A 1XW6A 4N0VA 1YF0A 3ZL5A 1USBA 1GL8A 5IQYA 4PQIA 4V1Ap 2F51A 5J5NA 1SYRA 5DQSA 1ML6A 2HZEA 2ON7A 2LQOA 2E7PA 1T8EB 3VPQA 3IK7A 4TOPA 3G7IA 2H73A 1HQOA 2LNTA 3GSSA 2HQTA 1UN2A 1B4QA 1BEDA 1X0RA 3NZNA 2O8VB 4I6XA 2AHEA 3GH6A 1DSBA 1K0OA 2LUSA 2GSRA 4PQ1A 4MJCA 4KCEA 4HU7A 1G6YA 3GSTA 2OJLA 2OE3A 2WS2A 4XHMA 1XW5A 1ACVA 2G2QA 1BQ7A 3F4SA 3ERGA 1OKTA 4OO5A 3C1RA 1G7EA 4HI7A 5F07A 3QDNA 5B7CA 1AQXA 5ECRB 1WJKA 3FYGA 5A4UA 4LMWA 1SU9A 3RAZA 3ZITA 2VCZA 1FB0A 2LNSA 3HZ8A 1X5DA 5J41A 1O73A 3F3QA 1XFLA 2LKUA 2GSQA 5COHA 4L0WA 1GTAA 1MD4A 4BWQA 4GWRA 1YEXA 3QAGA 5AN1A 1GSEA 2H75A 2DC5A 4BPYA 1O8XA 3QPMA 3KGKA 1Y6EA 3IC8A 2YJ7A 4OWYA 5AIVA 3WT1A 4J2FA 5AISA 2HRKA 1X9MB 5ECHB 4GXZA 3HJMA 3TJJA 1PRXA 4OO4A 3DIEA 4D73A 1MD3A 2VLVA 3J7Yb 4OFTA 4JR6A 3E0UA 1BJXA 4HQZA 3IC4A 2LQQA 4YQMA 1OE8A 2FHEA 3EE2A 2VIMA 4GRFA 1FO5A 3VFIA 3KMNA 3Q6OA 4TR1B 1JHBA 3DYRA 5ID2B 4XS6A 5G31A 1SENA 1J0FA 1PN9A 4ULXA 3FZ5A 1FG4A 3FR9A 4ZBDA 3TJBA 2FWFA 2GGTA 1F6MC 1B9XC 2REMA 1MDKA 3ME8A 3GURA 1DE1A 4KDYA 1EWXA 1V98A 4FH8A 1YJ6A 4F0BA 1HNBA 2GQLA 3LQ7A 4ZB8A 4WBJA 4TXOB 4ISDA 5ECIB 3TJGA 1T00A 3KTLA 1I9DA 2O7KA 3KD0A 3VI7A 2HZEB 4N30A 2X64A 1A2MA 2VD1A 3VK9A 2PWJA 2LJKA 3WGXA 3CSHA 1NHOA 3KTBA 3APQA 5IMDA 3F4TA 5EPFA 5L71A 2PERA 1A24A 3LSZA 4WETA 2TIRA 1ZCPA 1YZXA 2FWGA 2L57A 3KMOA 5IIZA 1TU7A 2RM6A 1THOA 3S9FA 4H86A 3KEBA 1U87A 2PBJA 3LYPA 5IMZA 2M80A 4USSA 3HVXA 3BJ5A 2CVKA 3A2WA 2IPAA 1XXUA 3GHAA 1YQ1A 3LORA 5CYYA 1K0MA 3TKPA 3LWAA 3DGQA 1T4ZA 4HOJA 2X8GA 4K9ZA 4IKHA 4KF9A 5ECSA 5CNWA 4KW6A 5DCHA 4MA9A 5IOXA 1OC8A 1ERUA 3UL3A 2LS5A 5A5KA 1WMJA 4I5QA 3D4TA 3DXBA 4Q5FA 4WF4A 5A4VA 3CMIA 1QK8A 5ELAA 4K6XA 3CXGA 1LBKA 2GLRA 5DDLA 5F0GA 4D73B 3A3TA 2VAFA 1BX9A 1SK2A 2HSMA 4EL1A 1EP8A 1EOGA 5HR1A 3ZFLA 1SKSB 5J9CA 2BTOT 3A5WA 4WR4A 2K9FA 1ZGNA 4PNGA 5JWQB 1R7HA 1WPIA 2VL9A 1JLWA 2VM1A 2AAWA 2B7KA 3ISOA 3WD6A 2HFDA 1Z9HA 3M3MA 2YWMA 2HSYA 1F3BA 20GSA 4DEJA 4XS4A 3PGTA 2DSAA 3F9UA 2GSTA 2UZ8A 2X99A 4MJBA 1EP7A 3P2AA 1THXA 1U6TA 1ZYEA 4F82A 2MMZA 2H01A 1KBNA 1K0AA 1WP0A 2L6DA 1TRWA 2K18A 3RHBA 2NBSA 2MMNA 4TW5A 1HNCA 1EV4A 1Z6MA 3L78A 4DSSB 4JEDA 1G7OA 1B8XA 5EVOA 1J08A 2L6CA 5D9VA 1KTEA 4KSMA 2RLIA 1T7PB 3BOAA 1WOUA 2GQKA 1W89A
chains in the Genus database with same CATH superfamily
4V2LA 2GSSA 2WZ9A 2BMXA 2H74A 4IQ1A 3GN3A 4AJ6A 5D9XA 5C04A 1XWKA 3VWUA 1SL0B 19GSA 2C1YA 1EOHA 3TJFA 3KP8A 1BG1A 1SJIA 3LYKA 3EVIA 2H71A 3F3RA 5D73A 2LEGA 3AY8A 5EY6A 5JCUA 1URMA 3FEUA 3UARA 4ILFA 1FW1A 5A34A 4KA0A 2B6MA 2CA8A 5A4WA 2JACA 3P8WA 4N3ZA 2C3QA 4AKIA 2B1KA 3TOTA 4JU5A 4JE1A 2NTOA 2Z9SA 1FHEA 4OD7A 2GS3A 2LRTA 2OBIA 4XIHA 3TKSE 3HY2A 3D4MA 4HUAA 1K0DA 1S3DA 3G7YA 2V32A 1OYJA 4HJMA 2HRNA 4NHWA 4POLA 5DALA 2GT6A 1DBYA 3GKKA 4LL1B 1EV9A 8GSSA 4K7IA 4QL7A 4X43A 1X5CA 2GDRA 4GCIA 3MNGA 3O6TA 1AUCA 2A2RA 4KX4A 1U3IA 5JCWA 1TI1A 1XWGA 5JCGA 6GSYA 4HU9A 5IMVA 4ECIA 3ZLPA 1EGRA 2C80A 2GZZA 2H8LA 2WW1A 2HI7A 3UMAA 2LJRA 2JZTA 1Z6NA 5DAKA 4O92A 2IMIA 5G30A 1OKDA 2A2PA 4PTSA 4K8MA 4E8HA 2PVQA 4V2MA 3OR5A 5KN3A 3GRXA 2R5GA 1M9AA 2L59A 4XS4B 4IN0A 2RM5A 2AJQB 3RHCA 3GH9A 5J3RA 1K0NA 4WF5A 3KP9A 2CQ9A 5H5SA 2R4VA 4NPBA 2IL3A 2PUKC 1GSFA 5B8BA 1UA5A 3MYDA 3I9V2 1I5GA 2IJYA 3IR4A 2YZUA 5HR3A 4G0KA 4CY6A 4POBA 5LCZA 4GDFA 1SKWB 2JSZA 5ABRA 3DVWA 3WGDA 4O5UA 3MWHA 4KSOA 3DWVA 1AQVA 2QGVA 3N9JA 1Y1UA 2E2GA 3QFAC 1R4WA 1OAZA 4N0ZA 2IN3A 4HEA2 3PPUA 1O85A 3D21A 2DMMA 2WGRA 4QMKA 2KP2A 3CRUA 1TRUA 5CRWA 3ZREA 3WYWA 4MMMA 4F2IA 5KOWA 3W8SA 5GAND 1FAAA 3KM6A 5ECNB 4MF6A 2WFCA 3GTUB 1FB6A 1SVOA 5A34B 4ZXGA 4KUNA 2MYGA 1Z5YE 1VRSD 3D0ZA 1TKDB 2V6KA 4BVXA 1KNGA 5A5HA 1ZL9A 2H6YA 1A2LA 3G7JA 1U3AA 2IIYA 2OE0A 3L0HA 2HE3A 2OBKA 1A0FA 1JFUA 4ZIJA 4X4JA 3ZVJA 4FIWA 5DALB 4MPFA 4BVYA 4N11A 5G5EA 14GSA 4K7OA 2IWTA 2MMOA 1R5PA 4HZ2A 1ZYQB 2PGTA 3A2XA 4OFNA 3ZZXA 2O89A 1YEPA 3N5OA 1V58A 3GFKA 3I43A 2EIQA 3W8JA 3ERFA 4WR5A 4MH2A 1OC3A 4K1FA 4HJ2A 5DQYA 4AJ7A 1XCCA 3GA4A 6GSWA 1ABAA 4X0XA 5F05A 2E0QA 1M99A 2R2JA 3C1SA 5ECMB 2P5QA 2YV9A 5B6NA 1HD2A 1PX6A 1ON4A 1C72A 18GSA 3M9KA 1JLVA 2FD3A 2LSTA 3TKRA 1TK0B 2JL4A 1F37A 1SYXA 1GSQA 5D8IA 3APSA 4YQUA 4BL7A 2C4JA 4ZILA 4MZCA 2VL3A 3JCML 1RW1A 5IMAA 1NM3A 3J7Yk 2YWOA 3Q74A 6GSUA 2H19A 1ZMAA 4ML6A 2DJ1A 4ZB9A 1S4BP 4I2UA 2HSNB 3HZ4A 4AF2A 2VKZG 1GSUA 3VWXA 4F9ZA 2VO4A 1ZYPA 2R37A 2H1GA 4DSQA 2CZ2A 3L4NA 5BMUA 3LXZA 2QA2A 1M2AA 2C0GA 1Z7PA 2OKAA 1U88A 1AAZA 1CQHA 2JU5A 2CVBA 4V2NA 4TKYA 1X9WB 3C7MA 2VM2A 2BJXA 2X8HA 2F3MA 2HRAA 3FHKA 4MF7A 5ECPB 1GUMA 2YV7A 3SWLA 1KEBA 1K3OA 3EC3A 5B6MA 2EFDA 1YDKA 1M3JA 1TDIA 2KLXA 3IHQA 2HNLA 3GUSA 2DBCA 3M8NA 2WRTA 3APOA 2B5EA 1VF1A 3MSZA 5ECQB 1PL2A 3HVSA 2MBSA 1OC9A 3EURA 4EIPA 4IP6A 2V41A 2PVOC 2CVDA 4IQAA 1O8WA 4YKFA 3P7XA 2IFQA 1GTBA 1XOBA 2CV4A 2JZSA 2L5LA 3TRPA 4K0NA 1J9BA 3UOMA 5ECKB 4BVXB 5A5HB 1TOFA 5G2ZA 1O7UA 3UVTA 3O3TA 1CQGA 6GSTA 4MZBA 3VPTA 3EPTA 3H4KA 2N5FA 2YN1A 2N5AA 4KDXA 3GMFA 2HRFA 2C0DA 3M9JA 1QGVA 4BVYB 4KAEA 9GSSA 2UV8G 1GRXA 1M2DA 2WVYA 2P0GA 5FWGA 2VCTA 4O7HA 4MLYA 1SK1A 6GSVA 3ZRDA 2HT9A 4AKXB 5CAXA 1PKWA 2WVZA 2D2ZA 4PI0C 5DJLA 1T4YA 1W4VA 1H75A 1K3YA 2NDOA 1ST9A 1PMTA 4G0LA 1AIUA 4BA7A 4TVEA 4MH3A 3CRTA 1SVMA 4CY8A 2PMTA 1M2BA 1Q4JA 4I97A 2HRKB 3ZIJA 3CTGA 4MNNA 1XIYA 2H0GA 2QC7A 2HSHA 2R6KA 3KCMA 12GSA 1WIKA 5IO2A 4G01A 4HS1A 5KN2A 3F6FA 5E4WA 2ES7A 1HNAA 2L4QA 1FVJA 4BL7B 3IK9A 1A8YA 4LLRA 3DD3A 3QD9A 2NPBA 3VI5A 2C0FA 1K3LA 1G0TA 2DJJA 4IP1A 5HR2A 3QOUA 6GSXA 2HLSA 4MZWA 3C73A 2GT5A 3ZYWA 4YAPA 4WBRD 3GL5A 2PPTA 2K8SA 5BMUB 3D6IA 3CWGA 3IE3A 2YP6A 3VURA 3KZQA 4PX1A 1F3AA 2H0HA 5JWOB 2HXKA 2HZFA 3IPZA 2WCIA 3IBHA 4NV5A 2OA7A 3W6GA 1JZDA 4ZBAA 2B7JA 1TI3A 3EINA 2LRCA 1I1IP 4EDYA 4PUAA 4G2EA 4CW9A 5G1LA 4OCEA 2OE1A 1N8JA 2KP1A 4ID0A 3LGCA 4FO5A 1SKRB 4LA1A 4EKZA 2WDUA 2DJ0A 3UEMA 3CSJA 2YJHA 4L8EA 2FA4A 1QXHA 2IFQB 3GV1A 3E9JB 3IXRA 4FQUA 1GSYA 5GSTA 4MF5A 3H93A 1PD21 1BF5A 4K0GA 5IMCA 5D96A 4HZ4A 3DVXA 3ERWA 2ZCTA 2RIIA 4Q5QA 2YWNA 1ERTA 2GZYA 3LJRA 5ECOB 1TXUA 3M1GA 5D9WA 4PURA 4GSNA 3CBUA 4GF0A 4J56E 1IYIA 3F8UA 1AXDA 4IBPA 1PX7A 1DUGA 4FYUA 2CZ3A 4MK3A 4YAVA 3R3EA 3FMWA 2B5XA 1SD9A 2G0FA 3DKSA 3QMXA 2H1LA 3QAVA 3GKNA 3TKSA 2LV3A 2PN8A 3V1WA 5GSSA 1QUWA 4Z7XA 3EU3A 2WJUA 2EC4A 2VD0A 3GX8A 4QL9A 1UC7A 1XZOA 4DVCA 4POKA 3H79A 3Q18A 2LJAA 4JRRA 4GLTA 2EIRA 6GSSA 1TK5B 4OMVA 2HSMB 2YCDA 1NHYA 4Q5NA 4K5RA 2XPEA 3L9UA 2CX3A 3UIWA 3FZAA 2A2SA 3DMLA 4TR3A 3TKSC 1YKAA 1S3RA 1A0RP 3KH7A 4ZL7A 1K0CA 4ECJA 1BYEA 2ALBA 2DKHA 2VUPA 4K2XA 4EE0A 4ZBBA 4XCSA 1JZWA 2DJ3A 4NAXA 4IHUA 1Q98A 17GSA 1GTIA 5DJMA 4MABA 2I1UA 4J57E 1PL1A 3FKFA 2FWEA 1V9WA 4NHZA 4KNDA 4TN8A 5KOXA 4AGSA 2CAQA 1AC1A 1B4PA 1H4OA 5ECLB 4TR1A 4EC0A 3TU3B 2XPDA 3RDWA 5ID2A 3EMPA 1K0BA 3L9SA 4EDZA 2FY6A 3DEXA 2V2GA 3GL3A 1X5EA 1ILOA 2AB6A 1A2JA 4PXOA 2DIYA 5DBQA 1TK8B 4AKHA 1GWCA 2K8VA 2V6OA 4EXJA 3UJ1A 4A5PA 4GSSA 4EF0A 2NVLA 3L9VA 3F6DA 1XW9A 3CYNA 1BG5A 3QAWA 2V1MA 1SD8A 4FYBA 3TUEA 3U5RE 2KUCA 2EIOA 3I69A 2HYXA 3GYKA 4TXOA 4BIKA 3GKXA 2MBTA 1S3AA 3A2VA 2ZNMA 4IJIA 1A23A 2J9HA 2YOIA 1M7TA 2O5VA 4E8EA 4GQFA 1PQNA 3ZMKA 4GSTA 4ZB7A 2J23A 2WVXA 3KH9A 1IYHA 2WZSA 2LTKA 5LNKe 1ZZYA 5HR0A 4OFMA 13GSA 2H6XA 2C3TA 3O76A 5AGYA 5J47A 5DVBA 1VGLA 1QMVA 3LFLA 3D5JA 3TRXA 5JWRB 1V40A 3U6VA 4QQ7A 3FY7A 3EMXA 2MZCA 3HCZA 1GUKA 4HQSA 1N25A 3FK8A 4MJAA 1PA3A 4LL4B 4NV2A 1TRVA 4E68A 4IJ3A 3WGEA 4EVMA 4JR4A 1VF4A 5KEJA 10GSA 2JZRA 1T1VA 2IMFA 1XWCA 3EWLA 2AYTA 3PH9A 2P31A 4PHZC 1VF2A 3UBLA 3CSIA 3FZ4A 3RPNA 2YZHA 1S3CA 3HKRA 2YNXA 3GKMA 2LRNA 2CAIA 5DAKB 1WRYA 1FVKA 4F0CA 2VCQA 3M0FA 3E3EA 3US3A 4V1Ag 3VLNA 2RUFA 1E2YA 4Q5RA 3TGZA 4MPGA 1XVQA 1GSSA 4EUYA 3RPPA 4WEYA 2TRCP 3FZ9A 2GVPA 3IOSA 1SJZA 1UVZA 4XRAA 4O32A 4CDOA 5IOWA 4L0UA 3KJYA 3Q19A 2DJKA 2B5YA 2VCWA 2AUVA 2EFCA 3I6AA 5H5QA 2GQMA 2YPMA 2RUEA 3ME7A 3CHXC 4ZL8A 2YANA 4N10A 3C71A 5INYA 1LJRA 3MAKA 2ON5A 5GZZB 3RFRC 1PGTA 2F9SA 4RI6A 2VCVA 5KN1A 1XOAA 3HDCA 2H1AA 4IVFA 3MDKA 1MEKA 1MDJA 1FOHA 1GULA 3WT2A 2H1BA 1NSWA 1GP1A 4PUFC 4Z2TA 1FOVA 4HDEA 1B48A 4NMUA 4NXIA 3TCOA 5IPGA 2IMEA 2I4AA 5CO3A 2F8FA 5CRDA 3EYTA 1GSDA 1GUHA 2KOKA 3HMJG 2F8AA 5F06A 3G9BA 4DSSA 4L5LA 2FNOA 3KXOA 1PSQA 5FHIA 11GSA 2WULA 4PNFA 3UAPA 5HFGA 1TU8A 4G0IA 2XC2A 2H0IA 5ELGA 1SVLA 1XWBA 3F0IA 1VF3A 4K7NA 5EL8A 2EFHA 1ZOFA 2I81A 3LXTA 2O85A 2VOCA 4JBBA 3TDGA 1TP9A 2QSIA 4KDUA 2I9HA 2A4HA 1DE2A 4KH7A 4LMVA 1TXXA 2R0CA 2FA8A 1TRSA 2CT6A 2KHPA 4I8BA 1QQ2A 2JADA 1O81A 3BD2A 3ZVJD 1F2EA 1JZOA 1SJ6A 3GX0A 4ZB6A 5KN0A 1X9SB 3DRNA 3GNJA 2FLSA 4POMA 4TXVA 2R3XA 1F9MA 1Y25A 3QCPA 4G19A 5H5RA 2H1DA 1LU4A 5CRGA 2WW3A 4KE3A 3H8QA 3GIXA 3UVHA 5IO0A 4G9HA 5J9BA 2VLUA 2M72A 1PKZA 2GZPA 4ECCA 1YF1A 1XBSA 2YWIA 1EZKA 5DCGA 1A8LA 4JZQA 3UBKA 2H30A 5HFIA 4IGJA 5CREA 2FCHA 3P90A 2WW0A 1ERVA 1PN0A 3CTFA 2DMLA 2C0EA 4ZL9A 1OE7A 4EO3A 2AV4A 4L5OA 4GTUA 3FR6A 5FT3A 3HXSA 4O5RA 4RQXA 1G6WA 4X1UA 3ZTLA 3ED3A 2VLTA 4PQHA 1EGOA 1EEMA 3LW9A 1QFNA 4RI7A 5J4YA 1XWAA 2VL2A 1XVWA 3HJPA 2OADA 2XHFA 1RK4A 5C00A 3IAS2 3HJOA 4Z2RA 3IDVA 1MTCA 7GSSA 3R2QA 2L4CA 2XBIA 2JSYA 2DLXA 4IW9A 1SL1B 4MDCA 2ZUPA 3TJKA 4YH2A 5HFKA 2CX4A 3H1NA 3VWVA 4P3YB 1V2AA 4MJEA 4W66A 2IMKA 3HHVA 4GQCA 3VWWA 4ACSA 1ERWA 5ENUA 1GLPA 2VL2C 1TJDA 1OC9B 2IMDA 2WW2A 4WKWA 1R5AA 3MIXA 2WB9A 3IV4A 2XBQA 2P5RA 2K6VA 3FR3A 1O6JA 1YY7A 3HD5A 3SBCA 2FGXA 4I2TA 5F8BA 1SL2B 1PFOA 3QR6A 4KCAA 3FRCA 1YEWC 2H76A 1XG8A 2TRXA 1YKCA 1AQWA 1E6BA 1V57A 3TKQA 4NWYA 5IPHA 4KB3A 3KIJA 2A4VA 1JZRA 3IRAA 1M0UA 3GTUA 4IELA 4OCFA 2DIZA 2I3YA 5LD0A 1TW9A 4YQVA 5CRHA 3ZMLA 3HA9A 5CP1A 2H6ZA 5IM9A 3F63A 1GNWA 1B9YC 16GSA 1GNEA 2C8UA 1WE0A 2DJ2A 3HVVA 3LEFA 1R26A 2X4AA 4IS0A 3BBYA 2H66A 1GTUA 2H70A 2M46A 3NOFA 1GH2A 4MP4A 3IA1A 4FXYP 1GLQA 4G10A 3D22A 3ZFBA 4XRDA 1TTZA 2FWHA 4XTSA 5HQPA 3IAM2 5AIXA 4AJ8A 5G1KA 4ML1A 1EEJA 5D93A 4TRXA 5D9TA 1OVNA 1HYUA 2C3NA 4RQRA 2O87A 1AW9A 2PU9C 4TR4A 3LG6A 2R0GA 3PINA 2GTUA 3QFBC 5J4UA 3TB2A 4AI6A 3TOUA 1N2AA 4F03A 3C8EA 3ZIVA 2B3SA 3NIVA 4DSRA 5B8AA 4BWSA 2L5OA 2B1LA 4FYCA 2QKEA 2X49A 3PR8A 5E59A 1M9BA 2VCXA 3BCIA 1MDIA 1SK0A 1ZYNA 1Z7RA 3HYPA 3TRQA 2N5BA 4MCUA 2E2MA 1NW2A 3EU4A 4WXTA 2H72A 1XPVA 4K2DA 1YVLA 2MMAA 2HSNA 1RQMA 5G5FA 1T3BA 1BAYA 4CHSA 4RUVA 2DKIA 5GAPD 3F4RA 2FUG2 2OACA 22GSA 4PGTA 4KGIA 3RBTA 5IMFA 1Z3EA 3BCKA 4ECBA 4TR0A 4ICYA 1WWJA 4AKGA 2X8CA 3K8NA 4XS1A 3FW2A 1XW6A 4N0VA 1YF0A 3ZL5A 1USBA 1GL8A 5IQYA 4PQIA 4V1Ap 2F51A 5J5NA 1SYRA 5DQSA 1ML6A 2HZEA 2ON7A 2LQOA 2E7PA 1T8EB 3VPQA 3IK7A 4TOPA 4O5QA 3G7IA 2H73A 1HQOA 2LNTA 3RGBC 3GSSA 2HQTA 1UN2A 2EFEA 1B4QA 3IHGA 1BEDA 1X0RA 3NZNA 2O8VB 4I6XA 2AHEA 3GH6A 2QA1A 1DSBA 1K0OA 2LUSA 2GSRA 4PQ1A 4MJCA 4KCEA 4HU7A 1G6YA 3GSTA 2OJLA 2OE3A 2WS2A 4XHMA 1XW5A 1ACVA 2G2QA 1BQ7A 5J4VA 3F4SA 3ERGA 1OKTA 4OO5A 3C1RA 1G7EA 4HI7A 5F07A 3QDNA 5B7CA 1AQXA 5ECRB 1WJKA 3FYGA 5A4UA 4LMWA 1SU9A 3RAZA 3ZITA 2VCZA 1FB0A 2LNSA 3HZ8A 1X5DA 5J41A 1O73A 3F3QA 4EIQA 1XFLA 2LKUA 2GSQA 5COHA 4L0WA 4YKGA 1GTAA 1MD4A 4BWQA 4GWRA 2O3EA 1YEXA 3QAGA 5AN1A 1GSEA 2H75A 2DC5A 4BPYA 1O8XA 3QPMA 3KGKA 1Y6EA 1M3IA 3IC8A 2YJ7A 4OWYA 5AIVA 3WT1A 4J2FA 5AISA 2HRKA 1X9MB 5ECHB 4GXZA 3HJMA 3TJJA 1PRXA 4OO4A 3DIEA 4D73A 1MD3A 2VLVA 3J7Yb 4OFTA 4PI2C 4JR6A 3E0UA 1BJXA 4HQZA 3IC4A 2LQQA 4YQMA 1OE8A 2FHEA 3EE2A 2VIMA 4GRFA 1FO5A 3VFIA 3KMNA 3Q6OA 4TR1B 1JHBA 3DYRA 5ID2B 4XS6A 2O36A 5G31A 1SENA 1J0FA 1PN9A 4ULXA 3FZ5A 1FG4A 3FR9A 4ZBDA 3TJBA 2FWFA 2GGTA 1F6MC 1B9XC 2REMA 1MDKA 3ME8A 5A1NA 3GURA 1DE1A 4KDYA 1EWXA 1V98A 4FH8A 1YJ6A 4F0BA 1HNBA 2GQLA 3LQ7A 4ZB8A 4WBJA 4TXOB 4ISDA 5ECIB 3TJGA 1T00A 3KTLA 1I9DA 2O7KA 3KD0A 3VI7A 2HZEB 2WVXB 4N30A 2X64A 1A2MA 2VD1A 3VK9A 2PWJA 2LJKA 3WGXA 3CSHA 1NHOA 3KTBA 3APQA 5IMDA 3F4TA 5EPFA 5L71A 2PERA 1A24A 3LSZA 4WETA 2TIRA 1ZCPA 1YZXA 2FWGA 2L57A 3KMOA 5IIZA 1TU7A 2RM6A 1THOA 5J40A 3S9FA 4H86A 3KEBA 1U87A 2PBJA 3LYPA 5IMZA 2M80A 4USSA 3HVXA 3BJ5A 2CVKA 3A2WA 2IPAA 1XXUA 3GHAA 1YQ1A 3LORA 5CYYA 1K0MA 3TKPA 4K5SA 3LWAA 3DGQA 1T4ZA 4HOJA 2X8GA 4K9ZA 4IKHA 4KF9A 5ECSA 5CNWA 3CQFA 4KW6A 5DCHA 4MA9A 5IOXA 1OC8A 1ERUA 3UL3A 2LS5A 5A5KA 1WMJA 4I5QA 3D4TA 3DXBA 4Q5FA 4WF4A 5A4VA 3CMIA 1QK8A 5ELAA 4K6XA 3CXGA 1LBKA 2GLRA 5DDLA 5F0GA 4D73B 3A3TA 2VAFA 1BX9A 1SK2A 2HSMA 4EL1A 1EP8A 1EOGA 5HR1A 3ZFLA 1SKSB 5J9CA 2BTOT 3A5WA 4WR4A 5BRTA 2K9FA 1ZGNA 4PNGA 5JWQB 1R7HA 1WPIA 2VL9A 1JLWA 2VM1A 2AAWA 2B7KA 3ISOA 3WD6A 2R0PA 2HFDA 1Z9HA 3M3MA 2YWMA 2HSYA 1F3BA 3HVNA 20GSA 4DEJA 4XS4A 3PGTA 2DSAA 3F9UA 4Z2UA 2GSTA 2UZ8A 2X99A 4MJBA 1EP7A 3P2AA 1THXA 1U6TA 1ZYEA 4F82A 2MMZA 2H01A 1KBNA 1K0AA 1WP0A 2L6DA 1TRWA 2K18A 3RHBA 2NBSA 5A1NB 2MMNA 4TW5A 1HNCA 1EV4A 1Z6MA 3L78A 4DSSB 4JEDA 3A5IA 1G7OA 1B8XA 5EVOA 1J08A 2OT3A 4HSCX 2L6CA 5D9VA 1KTEA 4KSMA 2RLIA 1T7PB 3BOAA 1WOUA 2GQKA 1W89A
chains in the Genus database with same CATH topology
4V2LA 2GSSA 2WZ9A 2BMXA 2H74A 4IQ1A 3GN3A 4AJ6A 5D9XA 5C04A 1XWKA 3VWUA 1SL0B 19GSA 2C1YA 1EOHA 3TJFA 3KP8A 1BG1A 1SJIA 3LYKA 3EVIA 2H71A 3F3RA 5D73A 2LEGA 3AY8A 5EY6A 5JCUA 1URMA 3FEUA 3UARA 4ILFA 1FW1A 5A34A 4KA0A 2B6MA 2CA8A 5A4WA 2JACA 3P8WA 4N3ZA 2C3QA 4AKIA 2B1KA 3TOTA 4JU5A 4JE1A 2NTOA 2Z9SA 1FHEA 4OD7A 2GS3A 2LRTA 2OBIA 4XIHA 3TKSE 3HY2A 3D4MA 4HUAA 1K0DA 1S3DA 3G7YA 2V32A 1OYJA 4HJMA 2HRNA 4NHWA 4POLA 5DALA 2GT6A 1DBYA 3GKKA 4LL1B 1EV9A 8GSSA 4K7IA 4QL7A 4X43A 1X5CA 2GDRA 4GCIA 3MNGA 3O6TA 1AUCA 2A2RA 4KX4A 1U3IA 5JCWA 1TI1A 1XWGA 5JCGA 6GSYA 4HU9A 5IMVA 4ECIA 3ZLPA 1EGRA 2C80A 2GZZA 2H8LA 2HI7A 3UMAA 2LJRA 2JZTA 1Z6NA 5DAKA 4O92A 2IMIA 5G30A 1OKDA 2A2PA 4PTSA 4K8MA 4E8HA 2PVQA 4V2MA 3OR5A 5KN3A 3GRXA 2R5GA 1M9AA 2L59A 4XS4B 4IN0A 2RM5A 2AJQB 3RHCA 3GH9A 5J3RA 1K0NA 4WF5A 3KP9A 2CQ9A 5H5SA 2R4VA 4NPBA 2IL3A 2PUKC 1GSFA 5B8BA 1UA5A 3MYDA 3I9V2 1I5GA 2IJYA 3IR4A 2YZUA 5HR3A 4G0KA 4CY6A 4POBA 5LCZA 4GDFA 1SKWB 2JSZA 5ABRA 3DVWA 3WGDA 4O5UA 3MWHA 4KSOA 3DWVA 1AQVA 2QGVA 3N9JA 1Y1UA 2E2GA 3QFAC 1R4WA 1OAZA 4N0ZA 2IN3A 4HEA2 3PPUA 1O85A 3D21A 2DMMA 2WGRA 4QMKA 2KP2A 3CRUA 1TRUA 5CRWA 3ZREA 3WYWA 4MMMA 4F2IA 5KOWA 3W8SA 5GAND 1FAAA 3KM6A 5ECNB 4MF6A 2WFCA 3GTUB 1FB6A 1SVOA 5A34B 4ZXGA 4KUNA 2MYGA 1Z5YE 1VRSD 3D0ZA 1TKDB 2V6KA 4BVXA 1KNGA 5A5HA 1ZL9A 2H6YA 1A2LA 3G7JA 1U3AA 2IIYA 2OE0A 3L0HA 2HE3A 2OBKA 1A0FA 1JFUA 4ZIJA 4X4JA 3ZVJA 4FIWA 5DALB 4MPFA 4BVYA 4N11A 5G5EA 14GSA 4K7OA 2IWTA 2MMOA 1R5PA 4HZ2A 1ZYQB 2PGTA 3A2XA 4OFNA 3ZZXA 2O89A 1YEPA 3N5OA 1V58A 3GFKA 3I43A 2EIQA 3W8JA 3ERFA 4WR5A 4MH2A 1OC3A 4K1FA 4HJ2A 5DQYA 4AJ7A 1XCCA 3GA4A 6GSWA 1ABAA 4X0XA 5F05A 2E0QA 1M99A 2R2JA 3C1SA 5ECMB 2P5QA 2YV9A 5B6NA 1HD2A 1PX6A 1ON4A 1C72A 18GSA 3M9KA 1JLVA 2FD3A 2LSTA 3TKRA 1TK0B 2JL4A 1F37A 1SYXA 1GSQA 5D8IA 3APSA 4YQUA 4BL7A 2C4JA 4ZILA 4MZCA 2VL3A 3JCML 1RW1A 5IMAA 1NM3A 3J7Yk 2YWOA 3Q74A 6GSUA 2H19A 1ZMAA 4ML6A 2DJ1A 4ZB9A 4I2UA 2HSNB 3HZ4A 4AF2A 2VKZG 1GSUA 3VWXA 4F9ZA 2VO4A 1ZYPA 2R37A 2H1GA 4DSQA 2CZ2A 3L4NA 5BMUA 3LXZA 2QA2A 1M2AA 2C0GA 1Z7PA 2OKAA 1U88A 1AAZA 1CQHA 2JU5A 2CVBA 4V2NA 4TKYA 1X9WB 3C7MA 2VM2A 2BJXA 2X8HA 2F3MA 2HRAA 3FHKA 4MF7A 5ECPB 1GUMA 2YV7A 3SWLA 1KEBA 1K3OA 3EC3A 5B6MA 2EFDA 1YDKA 2KLXA 1TDIA 3IHQA 2HNLA 3GUSA 2DBCA 3M8NA 2WRTA 3APOA 2B5EA 1VF1A 3MSZA 5ECQB 1PL2A 3HVSA 2MBSA 1OC9A 3EURA 4EIPA 4IP6A 2V41A 2PVOC 2CVDA 4IQAA 1O8WA 4YKFA 3P7XA 2IFQA 1GTBA 1XOBA 2CV4A 2JZSA 2L5LA 3TRPA 4K0NA 1J9BA 3UOMA 5ECKB 4BVXB 5A5HB 1TOFA 5G2ZA 1O7UA 3UVTA 3O3TA 1CQGA 6GSTA 4MZBA 3VPTA 3EPTA 3H4KA 2N5FA 2YN1A 2N5AA 4KDXA 3GMFA 2HRFA 2C0DA 3M9JA 1QGVA 4BVYB 4KAEA 9GSSA 2UV8G 1GRXA 1M2DA 2P0GA 5FWGA 2VCTA 4O7HA 4MLYA 1SK1A 6GSVA 3ZRDA 2HT9A 4AKXB 5CAXA 1PKWA 2D2ZA 5DJLA 1T4YA 1W4VA 1H75A 1K3YA 2NDOA 1ST9A 1PMTA 4G0LA 1AIUA 4BA7A 4TVEA 4MH3A 3CRTA 1SVMA 4CY8A 2PMTA 1M2BA 1Q4JA 4I97A 2HRKB 3ZIJA 3CTGA 4MNNA 1XIYA 2H0GA 2QC7A 2HSHA 2R6KA 3KCMA 12GSA 1WIKA 5IO2A 4G01A 4HS1A 5KN2A 3F6FA 5E4WA 2ES7A 1HNAA 2L4QA 1FVJA 4BL7B 3IK9A 1A8YA 4LLRA 3DD3A 3QD9A 2NPBA 3VI5A 2C0FA 1K3LA 1G0TA 2DJJA 4IP1A 5HR2A 3QOUA 6GSXA 2HLSA 4MZWA 3C73A 2GT5A 3ZYWA 4YAPA 4WBRD 3GL5A 2PPTA 2K8SA 5BMUB 3D6IA 3CWGA 3IE3A 2YP6A 3VURA 3KZQA 4PX1A 1F3AA 2H0HA 5JWOB 2HXKA 2HZFA 3IPZA 2WCIA 3IBHA 4NV5A 2OA7A 3W6GA 1JZDA 4ZBAA 2B7JA 1TI3A 3EINA 2LRCA 4EDYA 4PUAA 4G2EA 4CW9A 5G1LA 4OCEA 2OE1A 1N8JA 2KP1A 4ID0A 3LGCA 4FO5A 1SKRB 4LA1A 4EKZA 2WDUA 2DJ0A 3UEMA 3CSJA 2YJHA 4L8EA 2FA4A 1QXHA 2IFQB 3GV1A 3E9JB 3IXRA 4FQUA 1GSYA 5GSTA 4MF5A 3H93A 1PD21 1BF5A 4K0GA 5IMCA 5D96A 4HZ4A 3DVXA 3ERWA 2ZCTA 2RIIA 4Q5QA 2YWNA 1ERTA 2GZYA 3LJRA 5ECOB 1TXUA 3M1GA 5D9WA 4PURA 4GSNA 3CBUA 4GF0A 4J56E 1IYIA 3F8UA 1AXDA 4IBPA 1PX7A 1DUGA 4FYUA 2CZ3A 4MK3A 4YAVA 3R3EA 3FMWA 2B5XA 1SD9A 2G0FA 3DKSA 3QMXA 2H1LA 3QAVA 3GKNA 3TKSA 2LV3A 2PN8A 3V1WA 5GSSA 1QUWA 4Z7XA 3EU3A 2WJUA 2EC4A 2VD0A 3GX8A 4QL9A 1UC7A 1XZOA 4DVCA 4POKA 3H79A 3Q18A 2LJAA 4JRRA 4GLTA 2EIRA 6GSSA 1TK5B 4OMVA 2HSMB 2YCDA 1NHYA 4Q5NA 4K5RA 2XPEA 3L9UA 2CX3A 3UIWA 3FZAA 2A2SA 3DMLA 4TR3A 3TKSC 1YKAA 1A0RP 3KH7A 4ZL7A 1K0CA 4ECJA 1BYEA 2ALBA 2DKHA 2VUPA 4K2XA 4EE0A 4ZBBA 4XCSA 1JZWA 2DJ3A 4NAXA 4IHUA 1Q98A 17GSA 1GTIA 5DJMA 4MABA 2I1UA 4J57E 1PL1A 3FKFA 2FWEA 1V9WA 4NHZA 4KNDA 4TN8A 5KOXA 4AGSA 2CAQA 1AC1A 1B4PA 1H4OA 5ECLB 4TR1A 4EC0A 3TU3B 2XPDA 3RDWA 5ID2A 3EMPA 1K0BA 3L9SA 4EDZA 2FY6A 3DEXA 2V2GA 3GL3A 1X5EA 1ILOA 2AB6A 1A2JA 4PXOA 2DIYA 5DBQA 1TK8B 4AKHA 1GWCA 2K8VA 2V6OA 4EXJA 3UJ1A 4A5PA 4GSSA 4EF0A 2NVLA 3L9VA 3F6DA 1XW9A 3CYNA 1BG5A 3QAWA 2V1MA 1SD8A 4FYBA 3TUEA 3U5RE 2KUCA 2EIOA 3I69A 2HYXA 3GYKA 4TXOA 3GKXA 2MBTA 1S3AA 3A2VA 2ZNMA 4IJIA 1A23A 2J9HA 2YOIA 1M7TA 2O5VA 4E8EA 4GQFA 1PQNA 3ZMKA 4GSTA 4ZB7A 2J23A 3KH9A 1IYHA 2LTKA 5LNKe 1ZZYA 5HR0A 4OFMA 13GSA 2H6XA 2C3TA 3O76A 5AGYA 5J47A 5DVBA 1VGLA 1QMVA 3LFLA 3D5JA 3TRXA 5JWRB 1V40A 3U6VA 4QQ7A 3FY7A 3EMXA 2MZCA 3HCZA 1GUKA 4HQSA 1N25A 3FK8A 4MJAA 1PA3A 4LL4B 4NV2A 1TRVA 4E68A 4IJ3A 3WGEA 4EVMA 4JR4A 1VF4A 5KEJA 10GSA 2JZRA 1T1VA 2IMFA 1XWCA 3EWLA 2AYTA 3PH9A 2P31A 1VF2A 3UBLA 3CSIA 3FZ4A 3RPNA 2YZHA 1S3CA 3HKRA 2YNXA 3GKMA 2LRNA 2CAIA 5DAKB 1WRYA 1FVKA 4F0CA 2VCQA 3M0FA 3E3EA 3US3A 4V1Ag 3VLNA 2RUFA 1E2YA 4Q5RA 3TGZA 4MPGA 1XVQA 1GSSA 4EUYA 3RPPA 4WEYA 2TRCP 3FZ9A 2GVPA 3IOSA 1SJZA 1UVZA 4XRAA 4O32A 4CDOA 5IOWA 4L0UA 3KJYA 3Q19A 2DJKA 2B5YA 2VCWA 2AUVA 2EFCA 3I6AA 5H5QA 2GQMA 2YPMA 2RUEA 3ME7A 4ZL8A 2YANA 4N10A 3C71A 5INYA 1LJRA 3MAKA 2ON5A 5GZZB 1PGTA 2F9SA 4RI6A 2VCVA 5KN1A 1XOAA 3HDCA 2H1AA 4IVFA 3MDKA 1MEKA 1MDJA 1FOHA 1GULA 3WT2A 2H1BA 1NSWA 1GP1A 4PUFC 4Z2TA 1FOVA 4HDEA 1B48A 4NMUA 4NXIA 3TCOA 5IPGA 2IMEA 2I4AA 5CO3A 2F8FA 5CRDA 3EYTA 1GSDA 1GUHA 2KOKA 3HMJG 2F8AA 5F06A 3G9BA 4DSSA 4L5LA 2FNOA 3KXOA 1PSQA 5FHIA 11GSA 2WULA 4PNFA 3UAPA 5HFGA 1TU8A 4G0IA 2XC2A 2H0IA 5ELGA 1SVLA 1XWBA 3F0IA 1VF3A 4K7NA 5EL8A 2EFHA 1ZOFA 2I81A 3LXTA 2O85A 2VOCA 4JBBA 3TDGA 1TP9A 2QSIA 4KDUA 2I9HA 2A4HA 1DE2A 4KH7A 4LMVA 1TXXA 2R0CA 2FA8A 1TRSA 2CT6A 2KHPA 4I8BA 1QQ2A 2JADA 1O81A 3BD2A 3ZVJD 1F2EA 1JZOA 1SJ6A 3GX0A 4ZB6A 5KN0A 1X9SB 3DRNA 3GNJA 2FLSA 4POMA 4TXVA 2R3XA 1F9MA 1Y25A 3QCPA 4G19A 5H5RA 2H1DA 1LU4A 5CRGA 4KE3A 3H8QA 3GIXA 3UVHA 5IO0A 4G9HA 5J9BA 2VLUA 2M72A 1PKZA 2GZPA 4ECCA 1YF1A 1XBSA 2YWIA 1EZKA 5DCGA 1A8LA 4JZQA 3UBKA 2H30A 5HFIA 4IGJA 5CREA 2FCHA 3P90A 1ERVA 1PN0A 3CTFA 2DMLA 2C0EA 4ZL9A 1OE7A 4EO3A 2AV4A 4L5OA 4GTUA 3FR6A 5FT3A 3HXSA 4O5RA 4RQXA 1G6WA 4X1UA 3ZTLA 3ED3A 2VLTA 4PQHA 1EGOA 1EEMA 3LW9A 1QFNA 4RI7A 5J4YA 1XWAA 2VL2A 1XVWA 3HJPA 2OADA 2XHFA 1RK4A 5C00A 3IAS2 3HJOA 4Z2RA 3IDVA 1MTCA 7GSSA 3R2QA 2L4CA 2XBIA 2JSYA 2DLXA 4IW9A 1SL1B 4MDCA 2ZUPA 3TJKA 4YH2A 5HFKA 2CX4A 3H1NA 3VWVA 4P3YB 1V2AA 4MJEA 4W66A 2IMKA 3HHVA 4GQCA 3VWWA 4ACSA 1ERWA 5ENUA 1GLPA 2VL2C 1TJDA 1OC9B 2IMDA 4WKWA 1R5AA 3MIXA 2WB9A 3IV4A 2XBQA 2P5RA 2K6VA 3FR3A 1O6JA 1YY7A 3HD5A 3SBCA 2FGXA 4I2TA 5F8BA 1SL2B 3QR6A 4KCAA 3FRCA 2H76A 2TRXA 1YKCA 1AQWA 1E6BA 1V57A 3TKQA 4NWYA 5IPHA 4KB3A 3KIJA 2A4VA 1JZRA 3IRAA 1M0UA 3GTUA 4IELA 4OCFA 2DIZA 2I3YA 5LD0A 1TW9A 4YQVA 5CRHA 3ZMLA 3HA9A 5CP1A 2H6ZA 5IM9A 3F63A 1GNWA 1B9YC 16GSA 1GNEA 2C8UA 1WE0A 2DJ2A 3HVVA 3LEFA 1R26A 2X4AA 4IS0A 3BBYA 2H66A 1GTUA 2H70A 2M46A 3NOFA 1GH2A 4MP4A 3IA1A 1GLQA 4G10A 3D22A 3ZFBA 4XRDA 1TTZA 2FWHA 4XTSA 5HQPA 3IAM2 5AIXA 4AJ8A 5G1KA 4ML1A 1EEJA 5D93A 4TRXA 5D9TA 1OVNA 1HYUA 2C3NA 4RQRA 2O87A 1AW9A 2PU9C 4TR4A 3LG6A 2R0GA 3PINA 2GTUA 3QFBC 5J4UA 3TB2A 4AI6A 3TOUA 1N2AA 4F03A 3C8EA 3ZIVA 2B3SA 3NIVA 4DSRA 5B8AA 4BWSA 2L5OA 2B1LA 4FYCA 2QKEA 2X49A 3PR8A 5E59A 1M9BA 2VCXA 3BCIA 1MDIA 1SK0A 1ZYNA 1Z7RA 3HYPA 3TRQA 2N5BA 4MCUA 2E2MA 1NW2A 3EU4A 4WXTA 2H72A 1XPVA 4K2DA 1YVLA 2MMAA 2HSNA 1RQMA 5G5FA 1T3BA 1BAYA 4CHSA 4RUVA 2DKIA 5GAPD 3F4RA 2FUG2 2OACA 22GSA 4PGTA 4KGIA 3RBTA 5IMFA 1Z3EA 3BCKA 4ECBA 4TR0A 4ICYA 1WWJA 4AKGA 2X8CA 3K8NA 4XS1A 3FW2A 1XW6A 4N0VA 1YF0A 3ZL5A 1USBA 1GL8A 5IQYA 4PQIA 4V1Ap 2F51A 5J5NA 1SYRA 5DQSA 1ML6A 2HZEA 2ON7A 2LQOA 2E7PA 1T8EB 3VPQA 3IK7A 4TOPA 4O5QA 3G7IA 2H73A 1HQOA 2LNTA 3GSSA 2HQTA 1UN2A 2EFEA 1B4QA 3IHGA 1BEDA 1X0RA 3NZNA 2O8VB 4I6XA 2AHEA 3GH6A 2QA1A 1DSBA 1K0OA 2LUSA 2GSRA 4PQ1A 4MJCA 4KCEA 4HU7A 1G6YA 3GSTA 2OJLA 2OE3A 2WS2A 4XHMA 1XW5A 1ACVA 2G2QA 1BQ7A 5J4VA 3F4SA 3ERGA 1OKTA 4OO5A 3C1RA 1G7EA 4HI7A 5F07A 3QDNA 5B7CA 1AQXA 5ECRB 1WJKA 3FYGA 5A4UA 4LMWA 1SU9A 3RAZA 3ZITA 2VCZA 1FB0A 2LNSA 3HZ8A 1X5DA 5J41A 1O73A 3F3QA 4EIQA 1XFLA 2LKUA 2GSQA 5COHA 4L0WA 4YKGA 1GTAA 1MD4A 4BWQA 4GWRA 1YEXA 3QAGA 5AN1A 1GSEA 2H75A 2DC5A 4BPYA 1O8XA 3QPMA 3KGKA 1Y6EA 3IC8A 2YJ7A 4OWYA 5AIVA 3WT1A 4J2FA 5AISA 2HRKA 1X9MB 5ECHB 4GXZA 3HJMA 3TJJA 1PRXA 4OO4A 3DIEA 4D73A 1MD3A 2VLVA 3J7Yb 4OFTA 4JR6A 3E0UA 1BJXA 4HQZA 3IC4A 2LQQA 4YQMA 1OE8A 2FHEA 3EE2A 2VIMA 4GRFA 1FO5A 3VFIA 3KMNA 3Q6OA 4TR1B 1JHBA 3DYRA 5ID2B 4XS6A 5G31A 1SENA 1J0FA 1PN9A 4ULXA 3FZ5A 1FG4A 3FR9A 4ZBDA 3TJBA 2FWFA 2GGTA 1F6MC 1B9XC 2REMA 1MDKA 3ME8A 5A1NA 3GURA 1DE1A 4KDYA 1EWXA 1V98A 4FH8A 1YJ6A 4F0BA 1HNBA 2GQLA 3LQ7A 4ZB8A 4WBJA 4TXOB 4ISDA 5ECIB 3TJGA 1T00A 3KTLA 1I9DA 2O7KA 3KD0A 3VI7A 2HZEB 4N30A 2X64A 1A2MA 2VD1A 3VK9A 2PWJA 2LJKA 3WGXA 3CSHA 1NHOA 3KTBA 3APQA 5IMDA 3F4TA 5EPFA 5L71A 2PERA 1A24A 3LSZA 4WETA 2TIRA 1ZCPA 1YZXA 2FWGA 2L57A 3KMOA 5IIZA 1TU7A 2RM6A 1THOA 5J40A 3S9FA 4H86A 3KEBA 1U87A 2PBJA 3LYPA 5IMZA 2M80A 4USSA 3HVXA 3BJ5A 2CVKA 3A2WA 2IPAA 1XXUA 3GHAA 1YQ1A 3LORA 5CYYA 1K0MA 3TKPA 4K5SA 3LWAA 3DGQA 1T4ZA 4HOJA 2X8GA 4K9ZA 4IKHA 4KF9A 5ECSA 5CNWA 4KW6A 5DCHA 4MA9A 5IOXA 1OC8A 1ERUA 3UL3A 2LS5A 5A5KA 1WMJA 4I5QA 3D4TA 3DXBA 4Q5FA 4WF4A 5A4VA 3CMIA 1QK8A 5ELAA 4K6XA 3CXGA 1LBKA 2GLRA 5DDLA 5F0GA 4D73B 3A3TA 2VAFA 1BX9A 1SK2A 2HSMA 4EL1A 1EP8A 1EOGA 5HR1A 3ZFLA 1SKSB 5J9CA 2BTOT 3A5WA 4WR4A 5BRTA 2K9FA 1ZGNA 4PNGA 5JWQB 1R7HA 1WPIA 2VL9A 1JLWA 2VM1A 2AAWA 2B7KA 3ISOA 3WD6A 2R0PA 2HFDA 1Z9HA 3M3MA 2YWMA 2HSYA 1F3BA 20GSA 4DEJA 4XS4A 3PGTA 2DSAA 3F9UA 4Z2UA 2GSTA 2UZ8A 2X99A 4MJBA 1EP7A 3P2AA 1THXA 1U6TA 1ZYEA 4F82A 2MMZA 2H01A 1KBNA 1K0AA 1WP0A 2L6DA 1TRWA 2K18A 3RHBA 2NBSA 5A1NB 2MMNA 4TW5A 1HNCA 1EV4A 1Z6MA 3L78A 4DSSB 4JEDA 3A5IA 1G7OA 1B8XA 5EVOA 1J08A 2OT3A 2L6CA 5D9VA 1KTEA 4KSMA 2RLIA 1T7PB 3BOAA 1WOUA 2GQKA 1W89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2L A;  2GSS A;  2WZ9 A;  2BMX A;  2H74 A;  4IQ1 A;  3GN3 A;  4AJ6 A;  5D9X A;  5C04 A;  1XWK A;  3VWU A;  1SL0 B;  19GS A;  2C1Y A;  1EOH A;  3TJF A;  3KP8 A;  1SJI A;  3LYK A;  3EVI A;  2H71 A;  3F3R A;  5D73 A;  2LEG A;  3AY8 A;  5EY6 A;  5JCU A;  1URM A;  3FEU A;  3UAR A;  4ILF A;  1FW1 A;  4KA0 A;  2B6M A;  2CA8 A;  5A4W A;  2JAC A;  3P8W A;  2C3Q A;  2B1K A;  3TOT A;  4JU5 A;  4JE1 A;  2NTO A;  2Z9S A;  1FHE A;  4OD7 A;  2GS3 A;  2LRT A;  2OBI A;  4XIH A;  3TKS E;  3HY2 A;  3D4M A;  4HUA A;  1K0D A;  1S3D A;  3G7Y A;  2V32 A;  1OYJ A;  4HJM A;  2HRN A;  4NHW A;  4POL A;  5DAL A;  2GT6 A;  1DBY A;  3GKK A;  4LL1 B;  1EV9 A;  8GSS A;  4K7I A;  4QL7 A;  4X43 A;  1X5C A;  2GDR A;  4GCI A;  3MNG A;  3O6T A;  1AUC A;  2A2R A;  4KX4 A;  1U3I A;  5JCW A;  1TI1 A;  1XWG A;  5JCG A;  6GSY A;  4HU9 A;  5IMV A;  4ECI A;  3ZLP A;  1EGR A;  2C80 A;  2GZZ A;  2H8L A;  2HI7 A;  3UMA A;  2LJR A;  2JZT A;  1Z6N A;  5DAK A;  4O92 A;  2IMI A;  5G30 A;  1OKD A;  4PTS A;  4K8M A;  4E8H A;  2PVQ A;  4V2M A;  3OR5 A;  5KN3 A;  3GRX A;  2R5G A;  1M9A A;  2L59 A;  4XS4 B;  4IN0 A;  2RM5 A;  2AJQ B;  3RHC A;  3GH9 A;  5J3R A;  1K0N A;  4WF5 A;  3KP9 A;  2CQ9 A;  5H5S A;  2R4V A;  4NPB A;  2IL3 A;  2PUK C;  1GSF A;  5B8B A;  1UA5 A;  3I9V 2;  1I5G A;  2IJY A;  3IR4 A;  2YZU A;  5HR3 A;  4G0K A;  4POB A;  5LCZ A;  1SKW B;  2JSZ A;  5ABR A;  3DVW A;  3WGD A;  3MWH A;  4KSO A;  3DWV A;  1AQV A;  2QGV A;  3N9J A;  2E2G A;  3QFA C;  1R4W A;  1OAZ A;  4N0Z A;  2IN3 A;  4HEA 2;  3PPU A;  1O85 A;  3D21 A;  2DMM A;  2WGR A;  2KP2 A;  3CRU A;  1TRU A;  5CRW A;  3ZRE A;  3WYW A;  4MMM A;  4F2I A;  3W8S A;  5GAN D;  1FAA A;  3KM6 A;  5ECN B;  4MF6 A;  2WFC A;  3GTU B;  1FB6 A;  4ZXG A;  4KUN A;  2MYG A;  1Z5Y E;  1VRS D;  3D0Z A;  1TKD B;  2V6K A;  4BVX A;  1KNG A;  1ZL9 A;  2H6Y A;  1A2L A;  3G7J A;  1U3A A;  2IIY A;  2OE0 A;  3L0H A;  2HE3 A;  2OBK A;  1A0F A;  1JFU A;  4ZIJ A;  3ZVJ A;  4FIW A;  5DAL B;  4MPF A;  4BVY A;  4N11 A;  5G5E A;  14GS A;  4K7O A;  2IWT A;  2MMO A;  1R5P A;  4HZ2 A;  1ZYQ B;  2PGT A;  3A2X A;  4OFN A;  3ZZX A;  2O89 A;  1YEP A;  3N5O A;  1V58 A;  3GFK A;  3I43 A;  2EIQ A;  3W8J A;  3ERF A;  4WR5 A;  4MH2 A;  1OC3 A;  4K1F A;  4HJ2 A;  5DQY A;  4AJ7 A;  1XCC A;  3GA4 A;  6GSW A;  1ABA A;  4X0X A;  5F05 A;  2E0Q A;  1M99 A;  2R2J A;  3C1S A;  5ECM B;  2P5Q A;  2YV9 A;  5B6N A;  1HD2 A;  1PX6 A;  1ON4 A;  1C72 A;  18GS A;  3M9K A;  1JLV A;  2FD3 A;  2LST A;  3TKR A;  1TK0 B;  2JL4 A;  1F37 A;  1SYX A;  1GSQ A;  5D8I A;  3APS A;  4YQU A;  4BL7 A;  2C4J A;  4ZIL A;  4MZC A;  2VL3 A;  3JCM L;  1RW1 A;  5IMA A;  1NM3 A;  3J7Y k;  2YWO A;  3Q74 A;  6GSU A;  2H19 A;  1ZMA A;  4ML6 A;  2DJ1 A;  4ZB9 A;  4I2U A;  2HSN B;  3HZ4 A;  4AF2 A;  1GSU A;  3VWX A;  4F9Z A;  2VO4 A;  2R37 A;  2H1G A;  4DSQ A;  2CZ2 A;  3L4N A;  5BMU A;  3LXZ A;  1M2A A;  2C0G A;  1Z7P A;  2OKA A;  1U88 A;  1AAZ A;  1CQH A;  2JU5 A;  2CVB A;  4V2N A;  4TKY A;  1X9W B;  3C7M A;  2VM2 A;  2BJX A;  2X8H A;  2F3M A;  2HRA A;  3FHK A;  4MF7 A;  5ECP B;  1GUM A;  2YV7 A;  3SWL A;  1KEB A;  1K3O A;  3EC3 A;  5B6M A;  1YDK A;  2KLX A;  1TDI A;  3IHQ A;  2HNL A;  3GUS A;  2DBC A;  3M8N A;  2WRT A;  3APO A;  2B5E A;  1VF1 A;  3MSZ A;  5ECQ B;  1PL2 A;  3HVS A;  2MBS A;  1OC9 A;  3EUR A;  4IP6 A;  2V41 A;  2PVO C;  2CVD A;  4IQA A;  1O8W A;  3P7X A;  2IFQ A;  1GTB A;  1XOB A;  2CV4 A;  2JZS A;  2L5L A;  3TRP A;  4K0N A;  1J9B A;  3UOM A;  5ECK B;  4BVX B;  1TOF A;  5G2Z A;  1O7U A;  3UVT A;  3O3T A;  1CQG A;  6GST A;  4MZB A;  3VPT A;  3H4K A;  2N5F A;  2YN1 A;  2N5A A;  4KDX A;  3GMF A;  2HRF A;  2C0D A;  3M9J A;  1QGV A;  4BVY B;  4KAE A;  9GSS A;  1GRX A;  1M2D A;  2P0G A;  5FWG A;  2VCT A;  4O7H A;  4MLY A;  1SK1 A;  6GSV A;  3ZRD A;  2HT9 A;  5CAX A;  1PKW A;  2D2Z A;  5DJL A;  1T4Y A;  1W4V A;  1H75 A;  1K3Y A;  2NDO A;  1ST9 A;  1PMT A;  4G0L A;  1AIU A;  4BA7 A;  4TVE A;  4MH3 A;  3CRT A;  2PMT A;  1M2B A;  1Q4J A;  4I97 A;  2HRK B;  3ZIJ A;  3CTG A;  1XIY A;  2H0G A;  2QC7 A;  2HSH A;  2R6K A;  3KCM A;  12GS A;  1WIK A;  5IO2 A;  4HS1 A;  5KN2 A;  3F6F A;  5E4W A;  2ES7 A;  1HNA A;  2L4Q A;  1FVJ A;  4BL7 B;  3IK9 A;  1A8Y A;  4LLR A;  3DD3 A;  3QD9 A;  2NPB A;  3VI5 A;  2C0F A;  1K3L A;  1G0T A;  2DJJ A;  4IP1 A;  5HR2 A;  3QOU A;  6GSX A;  2HLS A;  4MZW A;  3C73 A;  2GT5 A;  3ZYW A;  4YAP A;  4WBR D;  3GL5 A;  2PPT A;  2K8S A;  3D6I A;  3IE3 A;  2YP6 A;  3VUR A;  3KZQ A;  4PX1 A;  1F3A A;  2H0H A;  5JWO B;  2HXK A;  2HZF A;  3IPZ A;  2WCI A;  3IBH A;  4NV5 A;  2OA7 A;  3W6G A;  1JZD A;  4ZBA A;  2B7J A;  1TI3 A;  3EIN A;  2LRC A;  4EDY A;  4PUA A;  4G2E A;  4CW9 A;  5G1L A;  4OCE A;  2OE1 A;  1N8J A;  2KP1 A;  4ID0 A;  3LGC A;  4FO5 A;  1SKR B;  4LA1 A;  4EKZ A;  2WDU A;  2DJ0 A;  3UEM A;  3CSJ A;  2YJH A;  4L8E A;  2FA4 A;  1QXH A;  2IFQ B;  3GV1 A;  3E9J B;  3IXR A;  4FQU A;  1GSY A;  5GST A;  4MF5 A;  3H93 A;  1PD2 1;  4K0G A;  5IMC A;  5D96 A;  4HZ4 A;  3DVX A;  3ERW A;  2ZCT A;  2RII A;  4Q5Q A;  2YWN A;  1ERT A;  2GZY A;  3LJR A;  5ECO B;  3M1G A;  5D9W A;  4PUR A;  4GSN A;  3CBU A;  4GF0 A;  4J56 E;  1IYI A;  3F8U A;  1AXD A;  4IBP A;  1PX7 A;  1DUG A;  4FYU A;  2CZ3 A;  4MK3 A;  4YAV A;  3R3E A;  2B5X A;  1SD9 A;  2G0F A;  3DKS A;  3QMX A;  3QAV A;  3GKN A;  3TKS A;  2LV3 A;  2PN8 A;  3V1W A;  5GSS A;  1QUW A;  4Z7X A;  3EU3 A;  2WJU A;  2EC4 A;  2VD0 A;  3GX8 A;  4QL9 A;  1UC7 A;  1XZO A;  4DVC A;  4POK A;  3H79 A;  3Q18 A;  2LJA A;  4JRR A;  4GLT A;  2EIR A;  6GSS A;  1TK5 B;  4OMV A;  2HSM B;  2YCD A;  1NHY A;  4Q5N A;  2XPE A;  3L9U A;  2CX3 A;  3UIW A;  3FZA A;  2A2S A;  3DML A;  4TR3 A;  3TKS C;  1YKA A;  1A0R P;  3KH7 A;  4ZL7 A;  1K0C A;  4ECJ A;  1BYE A;  2ALB A;  2VUP A;  4EE0 A;  4ZBB A;  4XCS A;  1JZW A;  2DJ3 A;  4NAX A;  4IHU A;  1Q98 A;  17GS A;  1GTI A;  5DJM A;  4MAB A;  2I1U A;  4J57 E;  1PL1 A;  3FKF A;  2FWE A;  1V9W A;  4NHZ A;  4KND A;  4TN8 A;  4AGS A;  2CAQ A;  1AC1 A;  1B4P A;  1H4O A;  5ECL B;  4TR1 A;  4EC0 A;  2XPD A;  3RDW A;  5ID2 A;  3EMP A;  1K0B A;  3L9S A;  4EDZ A;  2FY6 A;  3DEX A;  2V2G A;  3GL3 A;  1X5E A;  1ILO A;  2AB6 A;  1A2J A;  4PXO A;  2DIY A;  5DBQ A;  1TK8 B;  1GWC A;  2K8V A;  2V6O A;  4EXJ A;  3UJ1 A;  4GSS A;  4EF0 A;  2NVL A;  3L9V A;  3F6D A;  1XW9 A;  3CYN A;  1BG5 A;  3QAW A;  2V1M A;  1SD8 A;  4FYB A;  3TUE A;  3U5R E;  2KUC A;  2EIO A;  3I69 A;  2HYX A;  3GYK A;  4TXO A;  3GKX A;  2MBT A;  1S3A A;  3A2V A;  2ZNM A;  4IJI A;  1A23 A;  2J9H A;  2YOI A;  1M7T A;  4E8E A;  4GQF A;  1PQN A;  3ZMK A;  4GST A;  2J23 A;  3KH9 A;  1IYH A;  2LTK A;  5LNK e;  1ZZY A;  5HR0 A;  4OFM A;  13GS A;  2H6X A;  2C3T A;  3O76 A;  5AGY A;  5DVB A;  1VGL A;  1QMV A;  3LFL A;  3D5J A;  3TRX A;  5JWR B;  1V40 A;  3U6V A;  4QQ7 A;  3FY7 A;  3EMX A;  2MZC A;  3HCZ A;  1GUK A;  4HQS A;  3FK8 A;  4MJA A;  1PA3 A;  4LL4 B;  4NV2 A;  1TRV A;  4IJ3 A;  4EVM A;  3WGE A;  4JR4 A;  1VF4 A;  5KEJ A;  10GS A;  2JZR A;  1T1V A;  2IMF A;  1XWC A;  3EWL A;  2AYT A;  3PH9 A;  2P31 A;  1VF2 A;  3UBL A;  3CSI A;  3FZ4 A;  3RPN A;  2YZH A;  1S3C A;  3HKR A;  2YNX A;  3GKM A;  2LRN A;  2CAI A;  5DAK B;  1WRY A;  1FVK A;  4F0C A;  2VCQ A;  3M0F A;  3E3E A;  3US3 A;  4V1A g;  3VLN A;  2RUF A;  1E2Y A;  4Q5R A;  3TGZ A;  4MPG A;  1XVQ A;  1GSS A;  4EUY A;  3RPP A;  4WEY A;  2TRC P;  3FZ9 A;  2GVP A;  3IOS A;  1SJZ A;  1UVZ A;  4XRA A;  4O32 A;  4CDO A;  5IOW A;  4L0U A;  3KJY A;  3Q19 A;  2DJK A;  2B5Y A;  2VCW A;  2AUV A;  3I6A A;  5H5Q A;  2GQM A;  2YPM A;  2RUE A;  3ME7 A;  4ZL8 A;  2YAN A;  4N10 A;  3C71 A;  5INY A;  1LJR A;  3MAK A;  2ON5 A;  5GZZ B;  1PGT A;  2F9S A;  4RI6 A;  2VCV A;  5KN1 A;  1XOA A;  3HDC A;  2H1A A;  4IVF A;  3MDK A;  1MEK A;  1MDJ A;  1GUL A;  3WT2 A;  2H1B A;  1NSW A;  1GP1 A;  4PUF C;  1FOV A;  4HDE A;  1B48 A;  4NMU A;  4NXI A;  3TCO A;  5IPG A;  2IME A;  2I4A A;  5CO3 A;  2F8F A;  5CRD A;  3EYT A;  1GSD A;  1GUH A;  2KOK A;  2F8A A;  5F06 A;  3G9B A;  4DSS A;  4L5L A;  2FNO A;  3KXO A;  1PSQ A;  5FHI A;  11GS A;  2WUL A;  4PNF A;  3UAP A;  5HFG A;  1TU8 A;  4G0I A;  2XC2 A;  2H0I A;  5ELG A;  1XWB A;  3F0I A;  1VF3 A;  4K7N A;  5EL8 A;  1ZOF A;  2I81 A;  3LXT A;  2O85 A;  2VOC A;  4JBB A;  3TDG A;  1TP9 A;  2QSI A;  4KDU A;  2I9H A;  1DE2 A;  4KH7 A;  4LMV A;  1TXX A;  2FA8 A;  1TRS A;  2CT6 A;  2KHP A;  4I8B A;  1QQ2 A;  2JAD A;  1O81 A;  3BD2 A;  3ZVJ D;  1F2E A;  1JZO A;  1SJ6 A;  3GX0 A;  4ZB6 A;  5KN0 A;  1X9S B;  3DRN A;  3GNJ A;  2FLS A;  4POM A;  4TXV A;  2R3X A;  1F9M A;  1Y25 A;  3QCP A;  4G19 A;  5H5R A;  2H1D A;  1LU4 A;  5CRG A;  4KE3 A;  3H8Q A;  3GIX A;  3UVH A;  5IO0 A;  4G9H A;  5J9B A;  2VLU A;  2M72 A;  1PKZ A;  2GZP A;  4ECC A;  1YF1 A;  1XBS A;  2YWI A;  1EZK A;  5DCG A;  1A8L A;  4JZQ A;  3UBK A;  2H30 A;  5HFI A;  4IGJ A;  5CRE A;  2FCH A;  3P90 A;  1ERV A;  3CTF A;  2DML A;  2C0E A;  4ZL9 A;  1OE7 A;  4EO3 A;  2AV4 A;  4L5O A;  4GTU A;  3FR6 A;  5FT3 A;  3HXS A;  4O5R A;  4RQX A;  1G6W A;  4X1U A;  3ZTL A;  3ED3 A;  2VLT A;  4PQH A;  1EGO A;  1EEM A;  1QFN A;  4RI7 A;  1XWA A;  2VL2 A;  1XVW A;  3HJP A;  2OAD A;  2XHF A;  1RK4 A;  5C00 A;  3IAS 2;  3HJO A;  3IDV A;  1MTC A;  7GSS A;  3R2Q A;  2L4C A;  2XBI A;  2JSY A;  2DLX A;  4IW9 A;  1SL1 B;  4MDC A;  2ZUP A;  3TJK A;  4YH2 A;  5HFK A;  2CX4 A;  3H1N A;  3VWV A;  4P3Y B;  1V2A A;  4MJE A;  2IMK A;  3HHV A;  4GQC A;  3VWW A;  4ACS A;  1ERW A;  5ENU A;  1GLP A;  2VL2 C;  1TJD A;  1OC9 B;  2IMD A;  4WKW A;  1R5A A;  2WB9 A;  3IV4 A;  2XBQ A;  2P5R A;  2K6V A;  3FR3 A;  1O6J A;  1YY7 A;  3HD5 A;  3SBC A;  2FGX A;  4I2T A;  5F8B A;  1SL2 B;  3QR6 A;  4KCA A;  3FRC A;  2H76 A;  2TRX A;  1YKC A;  1AQW A;  1E6B A;  1V57 A;  3TKQ A;  4NWY A;  5IPH A;  4KB3 A;  3KIJ A;  2A4V A;  1JZR A;  3IRA A;  1M0U A;  3GTU A;  4IEL A;  4OCF A;  2DIZ A;  2I3Y A;  5LD0 A;  1TW9 A;  4YQV A;  5CRH A;  3ZML A;  3HA9 A;  5CP1 A;  2H6Z A;  5IM9 A;  3F63 A;  1GNW A;  1B9Y C;  16GS A;  1GNE A;  2C8U A;  1WE0 A;  2DJ2 A;  3HVV A;  3LEF A;  1R26 A;  4IS0 A;  3BBY A;  2H66 A;  1GTU A;  2H70 A;  2M46 A;  3NOF A;  1GH2 A;  4MP4 A;  3IA1 A;  1GLQ A;  4G10 A;  3D22 A;  3ZFB A;  4XRD A;  1TTZ A;  2FWH A;  4XTS A;  5HQP A;  3IAM 2;  5AIX A;  4AJ8 A;  5G1K A;  4ML1 A;  1EEJ A;  5D93 A;  4TRX A;  5D9T A;  1OVN A;  1HYU A;  2C3N A;  4RQR A;  2O87 A;  1AW9 A;  2PU9 C;  4TR4 A;  3LG6 A;  3PIN A;  2GTU A;  3QFB C;  5J4U A;  3TB2 A;  3TOU A;  1N2A A;  4F03 A;  3C8E A;  3ZIV A;  2B3S A;  3NIV A;  4DSR A;  5B8A A;  4BWS A;  2L5O A;  2B1L A;  4FYC A;  2QKE A;  3PR8 A;  5E59 A;  1M9B A;  2VCX A;  3BCI A;  1MDI A;  1SK0 A;  1Z7R A;  3HYP A;  3TRQ A;  2N5B A;  4MCU A;  2E2M A;  1NW2 A;  3EU4 A;  4WXT A;  2H72 A;  1XPV A;  4K2D A;  2MMA A;  1RQM A;  5G5F A;  1T3B A;  1BAY A;  4CHS A;  4RUV A;  5GAP D;  3F4R A;  2FUG 2;  2OAC A;  22GS A;  4PGT A;  4KGI A;  3RBT A;  5IMF A;  1Z3E A;  3BCK A;  4ECB A;  4TR0 A;  1WWJ A;  2X8C A;  3K8N A;  4XS1 A;  3FW2 A;  1XW6 A;  4N0V A;  1YF0 A;  3ZL5 A;  1USB A;  1GL8 A;  5IQY A;  4PQI A;  4V1A p;  2F51 A;  5J5N A;  1SYR A;  5DQS A;  1ML6 A;  2HZE A;  2ON7 A;  2LQO A;  2E7P A;  1T8E B;  3VPQ A;  3IK7 A;  4TOP A;  3G7I A;  2H73 A;  1HQO A;  2LNT A;  3GSS A;  2HQT A;  1UN2 A;  1B4Q A;  1BED A;  1X0R A;  3NZN A;  2O8V B;  4I6X A;  2AHE A;  3GH6 A;  1DSB A;  1K0O A;  2LUS A;  2GSR A;  4PQ1 A;  4MJC A;  4KCE A;  4HU7 A;  1G6Y A;  3GST A;  2OJL A;  2OE3 A;  2WS2 A;  4XHM A;  1XW5 A;  1ACV A;  2G2Q A;  1BQ7 A;  3F4S A;  3ERG A;  1OKT A;  4OO5 A;  3C1R A;  1G7E A;  4HI7 A;  5F07 A;  3QDN A;  5B7C A;  1AQX A;  5ECR B;  1WJK A;  3FYG A;  5A4U A;  4LMW A;  1SU9 A;  3RAZ A;  3ZIT A;  2VCZ A;  1FB0 A;  2LNS A;  3HZ8 A;  1X5D A;  5J41 A;  1O73 A;  3F3Q A;  1XFL A;  2LKU A;  2GSQ A;  5COH A;  4L0W A;  1GTA A;  1MD4 A;  4BWQ A;  4GWR A;  1YEX A;  3QAG A;  5AN1 A;  1GSE A;  2H75 A;  2DC5 A;  4BPY A;  1O8X A;  3QPM A;  3KGK A;  1Y6E A;  3IC8 A;  2YJ7 A;  4OWY A;  5AIV A;  3WT1 A;  4J2F A;  5AIS A;  2HRK A;  1X9M B;  5ECH B;  4GXZ A;  3HJM A;  3TJJ A;  1PRX A;  4OO4 A;  3DIE A;  4D73 A;  1MD3 A;  2VLV A;  3J7Y b;  4OFT A;  4JR6 A;  3E0U A;  1BJX A;  4HQZ A;  3IC4 A;  2LQQ A;  4YQM A;  1OE8 A;  2FHE A;  3EE2 A;  2VIM A;  4GRF A;  1FO5 A;  3VFI A;  3KMN A;  3Q6O A;  4TR1 B;  1JHB A;  3DYR A;  5ID2 B;  4XS6 A;  5G31 A;  1SEN A;  1J0F A;  1PN9 A;  4ULX A;  3FZ5 A;  1FG4 A;  3FR9 A;  4ZBD A;  3TJB A;  2FWF A;  2GGT A;  1F6M C;  1B9X C;  2REM A;  1MDK A;  3ME8 A;  3GUR A;  1DE1 A;  4KDY A;  1EWX A;  1V98 A;  4FH8 A;  1YJ6 A;  4F0B A;  1HNB A;  2GQL A;  3LQ7 A;  4ZB8 A;  4WBJ A;  4TXO B;  4ISD A;  5ECI B;  3TJG A;  1T00 A;  3KTL A;  1I9D A;  2O7K A;  3KD0 A;  3VI7 A;  2HZE B;  4N30 A;  2X64 A;  1A2M A;  2VD1 A;  3VK9 A;  2PWJ A;  2LJK A;  3WGX A;  3CSH A;  1NHO A;  3KTB A;  3APQ A;  5IMD A;  3F4T A;  5EPF A;  5L71 A;  2PER A;  1A24 A;  3LSZ A;  4WET A;  2TIR A;  1ZCP A;  1YZX A;  2FWG A;  2L57 A;  3KMO A;  5IIZ A;  1TU7 A;  2RM6 A;  1THO A;  3S9F A;  4H86 A;  3KEB A;  1U87 A;  2PBJ A;  3LYP A;  5IMZ A;  2M80 A;  4USS A;  3HVX A;  3BJ5 A;  2CVK A;  3A2W A;  2IPA A;  1XXU A;  3GHA A;  1YQ1 A;  3LOR A;  5CYY A;  1K0M A;  3TKP A;  3LWA A;  3DGQ A;  1T4Z A;  4HOJ A;  2X8G A;  4K9Z A;  4IKH A;  4KF9 A;  5ECS A;  5CNW A;  4KW6 A;  5DCH A;  4MA9 A;  5IOX A;  1OC8 A;  1ERU A;  3UL3 A;  2LS5 A;  5A5K A;  1WMJ A;  4I5Q A;  3D4T A;  3DXB A;  4Q5F A;  4WF4 A;  5A4V A;  3CMI A;  1QK8 A;  5ELA A;  4K6X A;  3CXG A;  1LBK A;  2GLR A;  5DDL A;  5F0G A;  4D73 B;  3A3T A;  2VAF A;  1BX9 A;  1SK2 A;  2HSM A;  4EL1 A;  1EP8 A;  1EOG A;  5HR1 A;  3ZFL A;  1SKS B;  5J9C A;  2BTO T;  3A5W A;  4WR4 A;  2K9F A;  1ZGN A;  4PNG A;  5JWQ B;  1R7H A;  1WPI A;  2VL9 A;  1JLW A;  2VM1 A;  2AAW A;  2B7K A;  3ISO A;  3WD6 A;  2HFD A;  1Z9H A;  3M3M A;  2YWM A;  2HSY A;  1F3B A;  20GS A;  4DEJ A;  4XS4 A;  3PGT A;  2DSA A;  3F9U A;  2GST A;  2UZ8 A;  2X99 A;  4MJB A;  1EP7 A;  3P2A A;  1THX A;  1U6T A;  1ZYE A;  4F82 A;  2MMZ A;  2H01 A;  1KBN A;  1K0A A;  1WP0 A;  2L6D A;  1TRW A;  2K18 A;  3RHB A;  2NBS A;  2MMN A;  4TW5 A;  1HNC A;  1EV4 A;  1Z6M A;  3L78 A;  4DSS B;  4JED A;  1G7O A;  1B8X A;  5EVO A;  1J08 A;  2L6C A;  5D9V A;  1KTE A;  4KSM A;  2RLI A;  1T7P B;  3BOA A;  1WOU A;  2GQK A;  1W89 A; 
#chains in the Genus database with same CATH topology
 4V2L A;  2GSS A;  2WZ9 A;  2BMX A;  2H74 A;  4IQ1 A;  3GN3 A;  4AJ6 A;  5D9X A;  5C04 A;  1XWK A;  3VWU A;  1SL0 B;  19GS A;  2C1Y A;  1EOH A;  3TJF A;  3KP8 A;  1BG1 A;  1SJI A;  3LYK A;  3EVI A;  2H71 A;  3F3R A;  5D73 A;  2LEG A;  3AY8 A;  5EY6 A;  5JCU A;  1URM A;  3FEU A;  3UAR A;  4ILF A;  1FW1 A;  5A34 A;  4KA0 A;  2B6M A;  2CA8 A;  5A4W A;  2JAC A;  3P8W A;  4N3Z A;  2C3Q A;  4AKI A;  2B1K A;  3TOT A;  4JU5 A;  4JE1 A;  2NTO A;  2Z9S A;  1FHE A;  4OD7 A;  2GS3 A;  2LRT A;  2OBI A;  4XIH A;  3TKS E;  3HY2 A;  3D4M A;  4HUA A;  1K0D A;  1S3D A;  3G7Y A;  2V32 A;  1OYJ A;  4HJM A;  2HRN A;  4NHW A;  4POL A;  5DAL A;  2GT6 A;  1DBY A;  3GKK A;  4LL1 B;  1EV9 A;  8GSS A;  4K7I A;  4QL7 A;  4X43 A;  1X5C A;  2GDR A;  4GCI A;  3MNG A;  3O6T A;  1AUC A;  2A2R A;  4KX4 A;  1U3I A;  5JCW A;  1TI1 A;  1XWG A;  5JCG A;  6GSY A;  4HU9 A;  5IMV A;  4ECI A;  3ZLP A;  1EGR A;  2C80 A;  2GZZ A;  2H8L A;  2WW1 A;  2HI7 A;  3UMA A;  2LJR A;  2JZT A;  1Z6N A;  5DAK A;  4O92 A;  2IMI A;  5G30 A;  1OKD A;  2A2P A;  4PTS A;  4K8M A;  4E8H A;  2PVQ A;  4V2M A;  3OR5 A;  5KN3 A;  3GRX A;  2R5G A;  1M9A A;  2L59 A;  4XS4 B;  4IN0 A;  2RM5 A;  2AJQ B;  3RHC A;  3GH9 A;  5J3R A;  1K0N A;  4WF5 A;  3KP9 A;  2CQ9 A;  5H5S A;  2R4V A;  4NPB A;  2IL3 A;  2PUK C;  1GSF A;  5B8B A;  1UA5 A;  3MYD A;  3I9V 2;  1I5G A;  2IJY A;  3IR4 A;  2YZU A;  5HR3 A;  4G0K A;  4CY6 A;  4POB A;  5LCZ A;  4GDF A;  1SKW B;  2JSZ A;  5ABR A;  3DVW A;  3WGD A;  4O5U A;  3MWH A;  4KSO A;  3DWV A;  1AQV A;  2QGV A;  3N9J A;  1Y1U A;  2E2G A;  3QFA C;  1R4W A;  1OAZ A;  4N0Z A;  2IN3 A;  4HEA 2;  3PPU A;  1O85 A;  3D21 A;  2DMM A;  2WGR A;  4QMK A;  2KP2 A;  3CRU A;  1TRU A;  5CRW A;  3ZRE A;  3WYW A;  4MMM A;  4F2I A;  5KOW A;  3W8S A;  5GAN D;  1FAA A;  3KM6 A;  5ECN B;  4MF6 A;  2WFC A;  3GTU B;  1FB6 A;  1SVO A;  5A34 B;  4ZXG A;  4KUN A;  2MYG A;  1Z5Y E;  1VRS D;  3D0Z A;  1TKD B;  2V6K A;  4BVX A;  1KNG A;  5A5H A;  1ZL9 A;  2H6Y A;  1A2L A;  3G7J A;  1U3A A;  2IIY A;  2OE0 A;  3L0H A;  2HE3 A;  2OBK A;  1A0F A;  1JFU A;  4ZIJ A;  4X4J A;  3ZVJ A;  4FIW A;  5DAL B;  4MPF A;  4BVY A;  4N11 A;  5G5E A;  14GS A;  4K7O A;  2IWT A;  2MMO A;  1R5P A;  4HZ2 A;  1ZYQ B;  2PGT A;  3A2X A;  4OFN A;  3ZZX A;  2O89 A;  1YEP A;  3N5O A;  1V58 A;  3GFK A;  3I43 A;  2EIQ A;  3W8J A;  3ERF A;  4WR5 A;  4MH2 A;  1OC3 A;  4K1F A;  4HJ2 A;  5DQY A;  4AJ7 A;  1XCC A;  3GA4 A;  6GSW A;  1ABA A;  4X0X A;  5F05 A;  2E0Q A;  1M99 A;  2R2J A;  3C1S A;  5ECM B;  2P5Q A;  2YV9 A;  5B6N A;  1HD2 A;  1PX6 A;  1ON4 A;  1C72 A;  18GS A;  3M9K A;  1JLV A;  2FD3 A;  2LST A;  3TKR A;  1TK0 B;  2JL4 A;  1F37 A;  1SYX A;  1GSQ A;  5D8I A;  3APS A;  4YQU A;  4BL7 A;  2C4J A;  4ZIL A;  4MZC A;  2VL3 A;  3JCM L;  1RW1 A;  5IMA A;  1NM3 A;  3J7Y k;  2YWO A;  3Q74 A;  6GSU A;  2H19 A;  1ZMA A;  4ML6 A;  2DJ1 A;  4ZB9 A;  1S4B P;  4I2U A;  2HSN B;  3HZ4 A;  4AF2 A;  2VKZ G;  1GSU A;  3VWX A;  4F9Z A;  2VO4 A;  1ZYP A;  2R37 A;  2H1G A;  4DSQ A;  2CZ2 A;  3L4N A;  5BMU A;  3LXZ A;  2QA2 A;  1M2A A;  2C0G A;  1Z7P A;  2OKA A;  1U88 A;  1AAZ A;  1CQH A;  2JU5 A;  2CVB A;  4V2N A;  4TKY A;  1X9W B;  3C7M A;  2VM2 A;  2BJX A;  2X8H A;  2F3M A;  2HRA A;  3FHK A;  4MF7 A;  5ECP B;  1GUM A;  2YV7 A;  3SWL A;  1KEB A;  1K3O A;  3EC3 A;  5B6M A;  2EFD A;  1YDK A;  1M3J A;  1TDI A;  2KLX A;  3IHQ A;  2HNL A;  3GUS A;  2DBC A;  3M8N A;  2WRT A;  3APO A;  2B5E A;  1VF1 A;  3MSZ A;  5ECQ B;  1PL2 A;  3HVS A;  2MBS A;  1OC9 A;  3EUR A;  4EIP A;  4IP6 A;  2V41 A;  2PVO C;  2CVD A;  4IQA A;  1O8W A;  4YKF A;  3P7X A;  2IFQ A;  1GTB A;  1XOB A;  2CV4 A;  2JZS A;  2L5L A;  3TRP A;  4K0N A;  1J9B A;  3UOM A;  5ECK B;  4BVX B;  5A5H B;  1TOF A;  5G2Z A;  1O7U A;  3UVT A;  3O3T A;  1CQG A;  6GST A;  4MZB A;  3VPT A;  3EPT A;  3H4K A;  2N5F A;  2YN1 A;  2N5A A;  4KDX A;  3GMF A;  2HRF A;  2C0D A;  3M9J A;  1QGV A;  4BVY B;  4KAE A;  9GSS A;  2UV8 G;  1GRX A;  1M2D A;  2WVY A;  2P0G A;  5FWG A;  2VCT A;  4O7H A;  4MLY A;  1SK1 A;  6GSV A;  3ZRD A;  2HT9 A;  4AKX B;  5CAX A;  1PKW A;  2WVZ A;  2D2Z A;  4PI0 C;  5DJL A;  1T4Y A;  1W4V A;  1H75 A;  1K3Y A;  2NDO A;  1ST9 A;  1PMT A;  4G0L A;  1AIU A;  4BA7 A;  4TVE A;  4MH3 A;  3CRT A;  1SVM A;  4CY8 A;  2PMT A;  1M2B A;  1Q4J A;  4I97 A;  2HRK B;  3ZIJ A;  3CTG A;  4MNN A;  1XIY A;  2H0G A;  2QC7 A;  2HSH A;  2R6K A;  3KCM A;  12GS A;  1WIK A;  5IO2 A;  4G01 A;  4HS1 A;  5KN2 A;  3F6F A;  5E4W A;  2ES7 A;  1HNA A;  2L4Q A;  1FVJ A;  4BL7 B;  3IK9 A;  1A8Y A;  4LLR A;  3DD3 A;  3QD9 A;  2NPB A;  3VI5 A;  2C0F A;  1K3L A;  1G0T A;  2DJJ A;  4IP1 A;  5HR2 A;  3QOU A;  6GSX A;  2HLS A;  4MZW A;  3C73 A;  2GT5 A;  3ZYW A;  4YAP A;  4WBR D;  3GL5 A;  2PPT A;  2K8S A;  5BMU B;  3D6I A;  3CWG A;  3IE3 A;  2YP6 A;  3VUR A;  3KZQ A;  4PX1 A;  1F3A A;  2H0H A;  5JWO B;  2HXK A;  2HZF A;  3IPZ A;  2WCI A;  3IBH A;  4NV5 A;  2OA7 A;  3W6G A;  1JZD A;  4ZBA A;  2B7J A;  1TI3 A;  3EIN A;  2LRC A;  1I1I P;  4EDY A;  4PUA A;  4G2E A;  4CW9 A;  5G1L A;  4OCE A;  2OE1 A;  1N8J A;  2KP1 A;  4ID0 A;  3LGC A;  4FO5 A;  1SKR B;  4LA1 A;  4EKZ A;  2WDU A;  2DJ0 A;  3UEM A;  3CSJ A;  2YJH A;  4L8E A;  2FA4 A;  1QXH A;  2IFQ B;  3GV1 A;  3E9J B;  3IXR A;  4FQU A;  1GSY A;  5GST A;  4MF5 A;  3H93 A;  1PD2 1;  1BF5 A;  4K0G A;  5IMC A;  5D96 A;  4HZ4 A;  3DVX A;  3ERW A;  2ZCT A;  2RII A;  4Q5Q A;  2YWN A;  1ERT A;  2GZY A;  3LJR A;  5ECO B;  1TXU A;  3M1G A;  5D9W A;  4PUR A;  4GSN A;  3CBU A;  4GF0 A;  4J56 E;  1IYI A;  3F8U A;  1AXD A;  4IBP A;  1PX7 A;  1DUG A;  4FYU A;  2CZ3 A;  4MK3 A;  4YAV A;  3R3E A;  3FMW A;  2B5X A;  1SD9 A;  2G0F A;  3DKS A;  3QMX A;  2H1L A;  3QAV A;  3GKN A;  3TKS A;  2LV3 A;  2PN8 A;  3V1W A;  5GSS A;  1QUW A;  4Z7X A;  3EU3 A;  2WJU A;  2EC4 A;  2VD0 A;  3GX8 A;  4QL9 A;  1UC7 A;  1XZO A;  4DVC A;  4POK A;  3H79 A;  3Q18 A;  2LJA A;  4JRR A;  4GLT A;  2EIR A;  6GSS A;  1TK5 B;  4OMV A;  2HSM B;  2YCD A;  1NHY A;  4Q5N A;  4K5R A;  2XPE A;  3L9U A;  2CX3 A;  3UIW A;  3FZA A;  2A2S A;  3DML A;  4TR3 A;  3TKS C;  1YKA A;  1S3R A;  1A0R P;  3KH7 A;  4ZL7 A;  1K0C A;  4ECJ A;  1BYE A;  2ALB A;  2DKH A;  2VUP A;  4K2X A;  4EE0 A;  4ZBB A;  4XCS A;  1JZW A;  2DJ3 A;  4NAX A;  4IHU A;  1Q98 A;  17GS A;  1GTI A;  5DJM A;  4MAB A;  2I1U A;  4J57 E;  1PL1 A;  3FKF A;  2FWE A;  1V9W A;  4NHZ A;  4KND A;  4TN8 A;  5KOX A;  4AGS A;  2CAQ A;  1AC1 A;  1B4P A;  1H4O A;  5ECL B;  4TR1 A;  4EC0 A;  3TU3 B;  2XPD A;  3RDW A;  5ID2 A;  3EMP A;  1K0B A;  3L9S A;  4EDZ A;  2FY6 A;  3DEX A;  2V2G A;  3GL3 A;  1X5E A;  1ILO A;  2AB6 A;  1A2J A;  4PXO A;  2DIY A;  5DBQ A;  1TK8 B;  4AKH A;  1GWC A;  2K8V A;  2V6O A;  4EXJ A;  3UJ1 A;  4A5P A;  4GSS A;  4EF0 A;  2NVL A;  3L9V A;  3F6D A;  1XW9 A;  3CYN A;  1BG5 A;  3QAW A;  2V1M A;  1SD8 A;  4FYB A;  3TUE A;  3U5R E;  2KUC A;  2EIO A;  3I69 A;  2HYX A;  3GYK A;  4TXO A;  4BIK A;  3GKX A;  2MBT A;  1S3A A;  3A2V A;  2ZNM A;  4IJI A;  1A23 A;  2J9H A;  2YOI A;  1M7T A;  2O5V A;  4E8E A;  4GQF A;  1PQN A;  3ZMK A;  4GST A;  4ZB7 A;  2J23 A;  2WVX A;  3KH9 A;  1IYH A;  2WZS A;  2LTK A;  5LNK e;  1ZZY A;  5HR0 A;  4OFM A;  13GS A;  2H6X A;  2C3T A;  3O76 A;  5AGY A;  5J47 A;  5DVB A;  1VGL A;  1QMV A;  3LFL A;  3D5J A;  3TRX A;  5JWR B;  1V40 A;  3U6V A;  4QQ7 A;  3FY7 A;  3EMX A;  2MZC A;  3HCZ A;  1GUK A;  4HQS A;  1N25 A;  3FK8 A;  4MJA A;  1PA3 A;  4LL4 B;  4NV2 A;  1TRV A;  4E68 A;  4IJ3 A;  3WGE A;  4EVM A;  4JR4 A;  1VF4 A;  5KEJ A;  10GS A;  2JZR A;  1T1V A;  2IMF A;  1XWC A;  3EWL A;  2AYT A;  3PH9 A;  2P31 A;  4PHZ C;  1VF2 A;  3UBL A;  3CSI A;  3FZ4 A;  3RPN A;  2YZH A;  1S3C A;  3HKR A;  2YNX A;  3GKM A;  2LRN A;  2CAI A;  5DAK B;  1WRY A;  1FVK A;  4F0C A;  2VCQ A;  3M0F A;  3E3E A;  3US3 A;  4V1A g;  3VLN A;  2RUF A;  1E2Y A;  4Q5R A;  3TGZ A;  4MPG A;  1XVQ A;  1GSS A;  4EUY A;  3RPP A;  4WEY A;  2TRC P;  3FZ9 A;  2GVP A;  3IOS A;  1SJZ A;  1UVZ A;  4XRA A;  4O32 A;  4CDO A;  5IOW A;  4L0U A;  3KJY A;  3Q19 A;  2DJK A;  2B5Y A;  2VCW A;  2AUV A;  2EFC A;  3I6A A;  5H5Q A;  2GQM A;  2YPM A;  2RUE A;  3ME7 A;  3CHX C;  4ZL8 A;  2YAN A;  4N10 A;  3C71 A;  5INY A;  1LJR A;  3MAK A;  2ON5 A;  5GZZ B;  3RFR C;  1PGT A;  2F9S A;  4RI6 A;  2VCV A;  5KN1 A;  1XOA A;  3HDC A;  2H1A A;  4IVF A;  3MDK A;  1MEK A;  1MDJ A;  1FOH A;  1GUL A;  3WT2 A;  2H1B A;  1NSW A;  1GP1 A;  4PUF C;  4Z2T A;  1FOV A;  4HDE A;  1B48 A;  4NMU A;  4NXI A;  3TCO A;  5IPG A;  2IME A;  2I4A A;  5CO3 A;  2F8F A;  5CRD A;  3EYT A;  1GSD A;  1GUH A;  2KOK A;  3HMJ G;  2F8A A;  5F06 A;  3G9B A;  4DSS A;  4L5L A;  2FNO A;  3KXO A;  1PSQ A;  5FHI A;  11GS A;  2WUL A;  4PNF A;  3UAP A;  5HFG A;  1TU8 A;  4G0I A;  2XC2 A;  2H0I A;  5ELG A;  1SVL A;  1XWB A;  3F0I A;  1VF3 A;  4K7N A;  5EL8 A;  2EFH A;  1ZOF A;  2I81 A;  3LXT A;  2O85 A;  2VOC A;  4JBB A;  3TDG A;  1TP9 A;  2QSI A;  4KDU A;  2I9H A;  2A4H A;  1DE2 A;  4KH7 A;  4LMV A;  1TXX A;  2R0C A;  2FA8 A;  1TRS A;  2CT6 A;  2KHP A;  4I8B A;  1QQ2 A;  2JAD A;  1O81 A;  3BD2 A;  3ZVJ D;  1F2E A;  1JZO A;  1SJ6 A;  3GX0 A;  4ZB6 A;  5KN0 A;  1X9S B;  3DRN A;  3GNJ A;  2FLS A;  4POM A;  4TXV A;  2R3X A;  1F9M A;  1Y25 A;  3QCP A;  4G19 A;  5H5R A;  2H1D A;  1LU4 A;  5CRG A;  2WW3 A;  4KE3 A;  3H8Q A;  3GIX A;  3UVH A;  5IO0 A;  4G9H A;  5J9B A;  2VLU A;  2M72 A;  1PKZ A;  2GZP A;  4ECC A;  1YF1 A;  1XBS A;  2YWI A;  1EZK A;  5DCG A;  1A8L A;  4JZQ A;  3UBK A;  2H30 A;  5HFI A;  4IGJ A;  5CRE A;  2FCH A;  3P90 A;  2WW0 A;  1ERV A;  1PN0 A;  3CTF A;  2DML A;  2C0E A;  4ZL9 A;  1OE7 A;  4EO3 A;  2AV4 A;  4L5O A;  4GTU A;  3FR6 A;  5FT3 A;  3HXS A;  4O5R A;  4RQX A;  1G6W A;  4X1U A;  3ZTL A;  3ED3 A;  2VLT A;  4PQH A;  1EGO A;  1EEM A;  3LW9 A;  1QFN A;  4RI7 A;  5J4Y A;  1XWA A;  2VL2 A;  1XVW A;  3HJP A;  2OAD A;  2XHF A;  1RK4 A;  5C00 A;  3IAS 2;  3HJO A;  4Z2R A;  3IDV A;  1MTC A;  7GSS A;  3R2Q A;  2L4C A;  2XBI A;  2JSY A;  2DLX A;  4IW9 A;  1SL1 B;  4MDC A;  2ZUP A;  3TJK A;  4YH2 A;  5HFK A;  2CX4 A;  3H1N A;  3VWV A;  4P3Y B;  1V2A A;  4MJE A;  4W66 A;  2IMK A;  3HHV A;  4GQC A;  3VWW A;  4ACS A;  1ERW A;  5ENU A;  1GLP A;  2VL2 C;  1TJD A;  1OC9 B;  2IMD A;  2WW2 A;  4WKW A;  1R5A A;  3MIX A;  2WB9 A;  3IV4 A;  2XBQ A;  2P5R A;  2K6V A;  3FR3 A;  1O6J A;  1YY7 A;  3HD5 A;  3SBC A;  2FGX A;  4I2T A;  5F8B A;  1SL2 B;  1PFO A;  3QR6 A;  4KCA A;  3FRC A;  1YEW C;  2H76 A;  1XG8 A;  2TRX A;  1YKC A;  1AQW A;  1E6B A;  1V57 A;  3TKQ A;  4NWY A;  5IPH A;  4KB3 A;  3KIJ A;  2A4V A;  1JZR A;  3IRA A;  1M0U A;  3GTU A;  4IEL A;  4OCF A;  2DIZ A;  2I3Y A;  5LD0 A;  1TW9 A;  4YQV A;  5CRH A;  3ZML A;  3HA9 A;  5CP1 A;  2H6Z A;  5IM9 A;  3F63 A;  1GNW A;  1B9Y C;  16GS A;  1GNE A;  2C8U A;  1WE0 A;  2DJ2 A;  3HVV A;  3LEF A;  1R26 A;  2X4A A;  4IS0 A;  3BBY A;  2H66 A;  1GTU A;  2H70 A;  2M46 A;  3NOF A;  1GH2 A;  4MP4 A;  3IA1 A;  4FXY P;  1GLQ A;  4G10 A;  3D22 A;  3ZFB A;  4XRD A;  1TTZ A;  2FWH A;  4XTS A;  5HQP A;  3IAM 2;  5AIX A;  4AJ8 A;  5G1K A;  4ML1 A;  1EEJ A;  5D93 A;  4TRX A;  5D9T A;  1OVN A;  1HYU A;  2C3N A;  4RQR A;  2O87 A;  1AW9 A;  2PU9 C;  4TR4 A;  3LG6 A;  2R0G A;  3PIN A;  2GTU A;  3QFB C;  5J4U A;  3TB2 A;  4AI6 A;  3TOU A;  1N2A A;  4F03 A;  3C8E A;  3ZIV A;  2B3S A;  3NIV A;  4DSR A;  5B8A A;  4BWS A;  2L5O A;  2B1L A;  4FYC A;  2QKE A;  2X49 A;  3PR8 A;  5E59 A;  1M9B A;  2VCX A;  3BCI A;  1MDI A;  1SK0 A;  1ZYN A;  1Z7R A;  3HYP A;  3TRQ A;  2N5B A;  4MCU A;  2E2M A;  1NW2 A;  3EU4 A;  4WXT A;  2H72 A;  1XPV A;  4K2D A;  1YVL A;  2MMA A;  2HSN A;  1RQM A;  5G5F A;  1T3B A;  1BAY A;  4CHS A;  4RUV A;  2DKI A;  5GAP D;  3F4R A;  2FUG 2;  2OAC A;  22GS A;  4PGT A;  4KGI A;  3RBT A;  5IMF A;  1Z3E A;  3BCK A;  4ECB A;  4TR0 A;  4ICY A;  1WWJ A;  4AKG A;  2X8C A;  3K8N A;  4XS1 A;  3FW2 A;  1XW6 A;  4N0V A;  1YF0 A;  3ZL5 A;  1USB A;  1GL8 A;  5IQY A;  4PQI A;  4V1A p;  2F51 A;  5J5N A;  1SYR A;  5DQS A;  1ML6 A;  2HZE A;  2ON7 A;  2LQO A;  2E7P A;  1T8E B;  3VPQ A;  3IK7 A;  4TOP A;  4O5Q A;  3G7I A;  2H73 A;  1HQO A;  2LNT A;  3RGB C;  3GSS A;  2HQT A;  1UN2 A;  2EFE A;  1B4Q A;  3IHG A;  1BED A;  1X0R A;  3NZN A;  2O8V B;  4I6X A;  2AHE A;  3GH6 A;  2QA1 A;  1DSB A;  1K0O A;  2LUS A;  2GSR A;  4PQ1 A;  4MJC A;  4KCE A;  4HU7 A;  1G6Y A;  3GST A;  2OJL A;  2OE3 A;  2WS2 A;  4XHM A;  1XW5 A;  1ACV A;  2G2Q A;  1BQ7 A;  5J4V A;  3F4S A;  3ERG A;  1OKT A;  4OO5 A;  3C1R A;  1G7E A;  4HI7 A;  5F07 A;  3QDN A;  5B7C A;  1AQX A;  5ECR B;  1WJK A;  3FYG A;  5A4U A;  4LMW A;  1SU9 A;  3RAZ A;  3ZIT A;  2VCZ A;  1FB0 A;  2LNS A;  3HZ8 A;  1X5D A;  5J41 A;  1O73 A;  3F3Q A;  4EIQ A;  1XFL A;  2LKU A;  2GSQ A;  5COH A;  4L0W A;  4YKG A;  1GTA A;  1MD4 A;  4BWQ A;  4GWR A;  2O3E A;  1YEX A;  3QAG A;  5AN1 A;  1GSE A;  2H75 A;  2DC5 A;  4BPY A;  1O8X A;  3QPM A;  3KGK A;  1Y6E A;  1M3I A;  3IC8 A;  2YJ7 A;  4OWY A;  5AIV A;  3WT1 A;  4J2F A;  5AIS A;  2HRK A;  1X9M B;  5ECH B;  4GXZ A;  3HJM A;  3TJJ A;  1PRX A;  4OO4 A;  3DIE A;  4D73 A;  1MD3 A;  2VLV A;  3J7Y b;  4OFT A;  4PI2 C;  4JR6 A;  3E0U A;  1BJX A;  4HQZ A;  3IC4 A;  2LQQ A;  4YQM A;  1OE8 A;  2FHE A;  3EE2 A;  2VIM A;  4GRF A;  1FO5 A;  3VFI A;  3KMN A;  3Q6O A;  4TR1 B;  1JHB A;  3DYR A;  5ID2 B;  4XS6 A;  2O36 A;  5G31 A;  1SEN A;  1J0F A;  1PN9 A;  4ULX A;  3FZ5 A;  1FG4 A;  3FR9 A;  4ZBD A;  3TJB A;  2FWF A;  2GGT A;  1F6M C;  1B9X C;  2REM A;  1MDK A;  3ME8 A;  5A1N A;  3GUR A;  1DE1 A;  4KDY A;  1EWX A;  1V98 A;  4FH8 A;  1YJ6 A;  4F0B A;  1HNB A;  2GQL A;  3LQ7 A;  4ZB8 A;  4WBJ A;  4TXO B;  4ISD A;  5ECI B;  3TJG A;  1T00 A;  3KTL A;  1I9D A;  2O7K A;  3KD0 A;  3VI7 A;  2HZE B;  2WVX B;  4N30 A;  2X64 A;  1A2M A;  2VD1 A;  3VK9 A;  2PWJ A;  2LJK A;  3WGX A;  3CSH A;  1NHO A;  3KTB A;  3APQ A;  5IMD A;  3F4T A;  5EPF A;  5L71 A;  2PER A;  1A24 A;  3LSZ A;  4WET A;  2TIR A;  1ZCP A;  1YZX A;  2FWG A;  2L57 A;  3KMO A;  5IIZ A;  1TU7 A;  2RM6 A;  1THO A;  5J40 A;  3S9F A;  4H86 A;  3KEB A;  1U87 A;  2PBJ A;  3LYP A;  5IMZ A;  2M80 A;  4USS A;  3HVX A;  3BJ5 A;  2CVK A;  3A2W A;  2IPA A;  1XXU A;  3GHA A;  1YQ1 A;  3LOR A;  5CYY A;  1K0M A;  3TKP A;  4K5S A;  3LWA A;  3DGQ A;  1T4Z A;  4HOJ A;  2X8G A;  4K9Z A;  4IKH A;  4KF9 A;  5ECS A;  5CNW A;  3CQF A;  4KW6 A;  5DCH A;  4MA9 A;  5IOX A;  1OC8 A;  1ERU A;  3UL3 A;  2LS5 A;  5A5K A;  1WMJ A;  4I5Q A;  3D4T A;  3DXB A;  4Q5F A;  4WF4 A;  5A4V A;  3CMI A;  1QK8 A;  5ELA A;  4K6X A;  3CXG A;  1LBK A;  2GLR A;  5DDL A;  5F0G A;  4D73 B;  3A3T A;  2VAF A;  1BX9 A;  1SK2 A;  2HSM A;  4EL1 A;  1EP8 A;  1EOG A;  5HR1 A;  3ZFL A;  1SKS B;  5J9C A;  2BTO T;  3A5W A;  4WR4 A;  5BRT A;  2K9F A;  1ZGN A;  4PNG A;  5JWQ B;  1R7H A;  1WPI A;  2VL9 A;  1JLW A;  2VM1 A;  2AAW A;  2B7K A;  3ISO A;  3WD6 A;  2R0P A;  2HFD A;  1Z9H A;  3M3M A;  2YWM A;  2HSY A;  1F3B A;  3HVN A;  20GS A;  4DEJ A;  4XS4 A;  3PGT A;  2DSA A;  3F9U A;  4Z2U A;  2GST A;  2UZ8 A;  2X99 A;  4MJB A;  1EP7 A;  3P2A A;  1THX A;  1U6T A;  1ZYE A;  4F82 A;  2MMZ A;  2H01 A;  1KBN A;  1K0A A;  1WP0 A;  2L6D A;  1TRW A;  2K18 A;  3RHB A;  2NBS A;  5A1N B;  2MMN A;  4TW5 A;  1HNC A;  1EV4 A;  1Z6M A;  3L78 A;  4DSS B;  4JED A;  3A5I A;  1G7O A;  1B8X A;  5EVO A;  1J08 A;  2OT3 A;  4HSC X;  2L6C A;  5D9V A;  1KTE A;  4KSM A;  2RLI A;  1T7P B;  3BOA A;  1WOU A;  2GQK A;  1W89 A; 
#chains in the Genus database with same CATH homology
 4V2L A;  2GSS A;  2WZ9 A;  2BMX A;  2H74 A;  4IQ1 A;  3GN3 A;  4AJ6 A;  5D9X A;  5C04 A;  1XWK A;  3VWU A;  1SL0 B;  19GS A;  2C1Y A;  1EOH A;  3TJF A;  3KP8 A;  1BG1 A;  1SJI A;  3LYK A;  3EVI A;  2H71 A;  3F3R A;  5D73 A;  2LEG A;  3AY8 A;  5EY6 A;  5JCU A;  1URM A;  3FEU A;  3UAR A;  4ILF A;  1FW1 A;  5A34 A;  4KA0 A;  2B6M A;  2CA8 A;  5A4W A;  2JAC A;  3P8W A;  4N3Z A;  2C3Q A;  4AKI A;  2B1K A;  3TOT A;  4JU5 A;  4JE1 A;  2NTO A;  2Z9S A;  1FHE A;  4OD7 A;  2GS3 A;  2LRT A;  2OBI A;  4XIH A;  3TKS E;  3HY2 A;  3D4M A;  4HUA A;  1K0D A;  1S3D A;  3G7Y A;  2V32 A;  1OYJ A;  4HJM A;  2HRN A;  4NHW A;  4POL A;  5DAL A;  2GT6 A;  1DBY A;  3GKK A;  4LL1 B;  1EV9 A;  8GSS A;  4K7I A;  4QL7 A;  4X43 A;  1X5C A;  2GDR A;  4GCI A;  3MNG A;  3O6T A;  1AUC A;  2A2R A;  4KX4 A;  1U3I A;  5JCW A;  1TI1 A;  1XWG A;  5JCG A;  6GSY A;  4HU9 A;  5IMV A;  4ECI A;  3ZLP A;  1EGR A;  2C80 A;  2GZZ A;  2H8L A;  2HI7 A;  3UMA A;  2LJR A;  2JZT A;  1Z6N A;  5DAK A;  4O92 A;  2IMI A;  5G30 A;  1OKD A;  2A2P A;  4PTS A;  4K8M A;  4E8H A;  2PVQ A;  4V2M A;  3OR5 A;  5KN3 A;  3GRX A;  2R5G A;  1M9A A;  2L59 A;  4XS4 B;  4IN0 A;  2RM5 A;  2AJQ B;  3RHC A;  3GH9 A;  5J3R A;  1K0N A;  4WF5 A;  3KP9 A;  2CQ9 A;  5H5S A;  2R4V A;  4NPB A;  2IL3 A;  2PUK C;  1GSF A;  5B8B A;  1UA5 A;  3MYD A;  3I9V 2;  1I5G A;  2IJY A;  3IR4 A;  2YZU A;  5HR3 A;  4G0K A;  4CY6 A;  4POB A;  5LCZ A;  4GDF A;  1SKW B;  2JSZ A;  5ABR A;  3DVW A;  3WGD A;  4O5U A;  3MWH A;  4KSO A;  3DWV A;  1AQV A;  2QGV A;  3N9J A;  1Y1U A;  2E2G A;  3QFA C;  1R4W A;  1OAZ A;  4N0Z A;  2IN3 A;  4HEA 2;  3PPU A;  1O85 A;  3D21 A;  2DMM A;  2WGR A;  4QMK A;  2KP2 A;  3CRU A;  1TRU A;  5CRW A;  3ZRE A;  3WYW A;  4MMM A;  4F2I A;  5KOW A;  3W8S A;  5GAN D;  1FAA A;  3KM6 A;  5ECN B;  4MF6 A;  2WFC A;  3GTU B;  1FB6 A;  1SVO A;  5A34 B;  4ZXG A;  4KUN A;  2MYG A;  1Z5Y E;  1VRS D;  3D0Z A;  1TKD B;  2V6K A;  4BVX A;  1KNG A;  5A5H A;  1ZL9 A;  2H6Y A;  1A2L A;  3G7J A;  1U3A A;  2IIY A;  2OE0 A;  3L0H A;  2HE3 A;  2OBK A;  1A0F A;  1JFU A;  4ZIJ A;  4X4J A;  3ZVJ A;  4FIW A;  5DAL B;  4MPF A;  4BVY A;  4N11 A;  5G5E A;  14GS A;  4K7O A;  2IWT A;  2MMO A;  1R5P A;  4HZ2 A;  1ZYQ B;  2PGT A;  3A2X A;  4OFN A;  3ZZX A;  2O89 A;  1YEP A;  3N5O A;  1V58 A;  3GFK A;  3I43 A;  2EIQ A;  3W8J A;  3ERF A;  4WR5 A;  4MH2 A;  1OC3 A;  4K1F A;  4HJ2 A;  5DQY A;  4AJ7 A;  1XCC A;  3GA4 A;  6GSW A;  1ABA A;  4X0X A;  5F05 A;  2E0Q A;  1M99 A;  2R2J A;  3C1S A;  5ECM B;  2P5Q A;  2YV9 A;  5B6N A;  1HD2 A;  1PX6 A;  1ON4 A;  1C72 A;  18GS A;  3M9K A;  1JLV A;  2FD3 A;  2LST A;  3TKR A;  1TK0 B;  2JL4 A;  1F37 A;  1SYX A;  1GSQ A;  5D8I A;  3APS A;  4YQU A;  4BL7 A;  2C4J A;  4ZIL A;  4MZC A;  2VL3 A;  3JCM L;  1RW1 A;  5IMA A;  1NM3 A;  3J7Y k;  2YWO A;  3Q74 A;  6GSU A;  2H19 A;  1ZMA A;  4ML6 A;  2DJ1 A;  4ZB9 A;  4I2U A;  2HSN B;  3HZ4 A;  4AF2 A;  2VKZ G;  1GSU A;  3VWX A;  4F9Z A;  2VO4 A;  1ZYP A;  2R37 A;  2H1G A;  4DSQ A;  2CZ2 A;  3L4N A;  5BMU A;  3LXZ A;  2QA2 A;  1M2A A;  2C0G A;  1Z7P A;  2OKA A;  1U88 A;  1AAZ A;  1CQH A;  2JU5 A;  2CVB A;  4V2N A;  4TKY A;  1X9W B;  3C7M A;  2VM2 A;  2BJX A;  2X8H A;  2F3M A;  2HRA A;  3FHK A;  4MF7 A;  5ECP B;  1GUM A;  2YV7 A;  3SWL A;  1KEB A;  1K3O A;  3EC3 A;  5B6M A;  2EFD A;  1YDK A;  2KLX A;  1TDI A;  3IHQ A;  2HNL A;  3GUS A;  2DBC A;  3M8N A;  2WRT A;  3APO A;  2B5E A;  1VF1 A;  3MSZ A;  5ECQ B;  1PL2 A;  3HVS A;  2MBS A;  1OC9 A;  3EUR A;  4EIP A;  4IP6 A;  2V41 A;  2PVO C;  2CVD A;  4IQA A;  1O8W A;  4YKF A;  3P7X A;  2IFQ A;  1GTB A;  1XOB A;  2CV4 A;  2JZS A;  2L5L A;  3TRP A;  4K0N A;  1J9B A;  3UOM A;  5ECK B;  4BVX B;  5A5H B;  1TOF A;  5G2Z A;  1O7U A;  3UVT A;  3O3T A;  1CQG A;  6GST A;  4MZB A;  3VPT A;  3EPT A;  3H4K A;  2N5F A;  2YN1 A;  2N5A A;  4KDX A;  3GMF A;  2HRF A;  2C0D A;  3M9J A;  1QGV A;  4BVY B;  4KAE A;  9GSS A;  2UV8 G;  1GRX A;  1M2D A;  2P0G A;  5FWG A;  2VCT A;  4O7H A;  4MLY A;  1SK1 A;  6GSV A;  3ZRD A;  2HT9 A;  4AKX B;  5CAX A;  1PKW A;  2D2Z A;  5DJL A;  1T4Y A;  1W4V A;  1H75 A;  1K3Y A;  2NDO A;  1ST9 A;  1PMT A;  4G0L A;  1AIU A;  4BA7 A;  4TVE A;  4MH3 A;  3CRT A;  1SVM A;  4CY8 A;  2PMT A;  1M2B A;  1Q4J A;  4I97 A;  2HRK B;  3ZIJ A;  3CTG A;  4MNN A;  1XIY A;  2H0G A;  2QC7 A;  2HSH A;  2R6K A;  3KCM A;  12GS A;  1WIK A;  5IO2 A;  4G01 A;  4HS1 A;  5KN2 A;  3F6F A;  5E4W A;  2ES7 A;  1HNA A;  2L4Q A;  1FVJ A;  4BL7 B;  3IK9 A;  1A8Y A;  4LLR A;  3DD3 A;  3QD9 A;  2NPB A;  3VI5 A;  2C0F A;  1K3L A;  1G0T A;  2DJJ A;  4IP1 A;  5HR2 A;  3QOU A;  6GSX A;  2HLS A;  4MZW A;  3C73 A;  2GT5 A;  3ZYW A;  4YAP A;  4WBR D;  3GL5 A;  2PPT A;  2K8S A;  5BMU B;  3D6I A;  3CWG A;  3IE3 A;  2YP6 A;  3VUR A;  3KZQ A;  4PX1 A;  1F3A A;  2H0H A;  5JWO B;  2HXK A;  2HZF A;  3IPZ A;  2WCI A;  3IBH A;  4NV5 A;  2OA7 A;  3W6G A;  1JZD A;  4ZBA A;  2B7J A;  1TI3 A;  3EIN A;  2LRC A;  4EDY A;  4PUA A;  4G2E A;  4CW9 A;  5G1L A;  4OCE A;  2OE1 A;  1N8J A;  2KP1 A;  4ID0 A;  3LGC A;  4FO5 A;  1SKR B;  4LA1 A;  4EKZ A;  2WDU A;  2DJ0 A;  3UEM A;  3CSJ A;  2YJH A;  4L8E A;  2FA4 A;  1QXH A;  2IFQ B;  3GV1 A;  3E9J B;  3IXR A;  4FQU A;  1GSY A;  5GST A;  4MF5 A;  3H93 A;  1PD2 1;  1BF5 A;  4K0G A;  5IMC A;  5D96 A;  4HZ4 A;  3DVX A;  3ERW A;  2ZCT A;  2RII A;  4Q5Q A;  2YWN A;  1ERT A;  2GZY A;  3LJR A;  5ECO B;  1TXU A;  3M1G A;  5D9W A;  4PUR A;  4GSN A;  3CBU A;  4GF0 A;  4J56 E;  1IYI A;  3F8U A;  1AXD A;  4IBP A;  1PX7 A;  1DUG A;  4FYU A;  2CZ3 A;  4MK3 A;  4YAV A;  3R3E A;  3FMW A;  2B5X A;  1SD9 A;  2G0F A;  3DKS A;  3QMX A;  2H1L A;  3QAV A;  3GKN A;  3TKS A;  2LV3 A;  2PN8 A;  3V1W A;  5GSS A;  1QUW A;  4Z7X A;  3EU3 A;  2WJU A;  2EC4 A;  2VD0 A;  3GX8 A;  4QL9 A;  1UC7 A;  1XZO A;  4DVC A;  4POK A;  3H79 A;  3Q18 A;  2LJA A;  4JRR A;  4GLT A;  2EIR A;  6GSS A;  1TK5 B;  4OMV A;  2HSM B;  2YCD A;  1NHY A;  4Q5N A;  4K5R A;  2XPE A;  3L9U A;  2CX3 A;  3UIW A;  3FZA A;  2A2S A;  3DML A;  4TR3 A;  3TKS C;  1YKA A;  1A0R P;  3KH7 A;  4ZL7 A;  1K0C A;  4ECJ A;  1BYE A;  2ALB A;  2DKH A;  2VUP A;  4K2X A;  4EE0 A;  4ZBB A;  4XCS A;  1JZW A;  2DJ3 A;  4NAX A;  4IHU A;  1Q98 A;  17GS A;  1GTI A;  5DJM A;  4MAB A;  2I1U A;  4J57 E;  1PL1 A;  3FKF A;  2FWE A;  1V9W A;  4NHZ A;  4KND A;  4TN8 A;  5KOX A;  4AGS A;  2CAQ A;  1AC1 A;  1B4P A;  1H4O A;  5ECL B;  4TR1 A;  4EC0 A;  3TU3 B;  2XPD A;  3RDW A;  5ID2 A;  3EMP A;  1K0B A;  3L9S A;  4EDZ A;  2FY6 A;  3DEX A;  2V2G A;  3GL3 A;  1X5E A;  1ILO A;  2AB6 A;  1A2J A;  4PXO A;  2DIY A;  5DBQ A;  1TK8 B;  4AKH A;  1GWC A;  2K8V A;  2V6O A;  4EXJ A;  3UJ1 A;  4A5P A;  4GSS A;  4EF0 A;  2NVL A;  3L9V A;  3F6D A;  1XW9 A;  3CYN A;  1BG5 A;  3QAW A;  2V1M A;  1SD8 A;  4FYB A;  3TUE A;  3U5R E;  2KUC A;  2EIO A;  3I69 A;  2HYX A;  3GYK A;  4TXO A;  3GKX A;  2MBT A;  1S3A A;  3A2V A;  2ZNM A;  4IJI A;  1A23 A;  2J9H A;  2YOI A;  1M7T A;  2O5V A;  4E8E A;  4GQF A;  1PQN A;  3ZMK A;  4GST A;  4ZB7 A;  2J23 A;  3KH9 A;  1IYH A;  2LTK A;  5LNK e;  1ZZY A;  5HR0 A;  4OFM A;  13GS A;  2H6X A;  2C3T A;  3O76 A;  5AGY A;  5J47 A;  5DVB A;  1VGL A;  1QMV A;  3LFL A;  3D5J A;  3TRX A;  5JWR B;  1V40 A;  3U6V A;  4QQ7 A;  3FY7 A;  3EMX A;  2MZC A;  3HCZ A;  1GUK A;  4HQS A;  1N25 A;  3FK8 A;  4MJA A;  1PA3 A;  4LL4 B;  4NV2 A;  1TRV A;  4E68 A;  4IJ3 A;  3WGE A;  4EVM A;  4JR4 A;  1VF4 A;  5KEJ A;  10GS A;  2JZR A;  1T1V A;  2IMF A;  1XWC A;  3EWL A;  2AYT A;  3PH9 A;  2P31 A;  1VF2 A;  3UBL A;  3CSI A;  3FZ4 A;  3RPN A;  2YZH A;  1S3C A;  3HKR A;  2YNX A;  3GKM A;  2LRN A;  2CAI A;  5DAK B;  1WRY A;  1FVK A;  4F0C A;  2VCQ A;  3M0F A;  3E3E A;  3US3 A;  4V1A g;  3VLN A;  2RUF A;  1E2Y A;  4Q5R A;  3TGZ A;  4MPG A;  1XVQ A;  1GSS A;  4EUY A;  3RPP A;  4WEY A;  2TRC P;  3FZ9 A;  2GVP A;  3IOS A;  1SJZ A;  1UVZ A;  4XRA A;  4O32 A;  4CDO A;  5IOW A;  4L0U A;  3KJY A;  3Q19 A;  2DJK A;  2B5Y A;  2VCW A;  2AUV A;  2EFC A;  3I6A A;  5H5Q A;  2GQM A;  2YPM A;  2RUE A;  3ME7 A;  4ZL8 A;  2YAN A;  4N10 A;  3C71 A;  5INY A;  1LJR A;  3MAK A;  2ON5 A;  5GZZ B;  1PGT A;  2F9S A;  4RI6 A;  2VCV A;  5KN1 A;  1XOA A;  3HDC A;  2H1A A;  4IVF A;  3MDK A;  1MEK A;  1MDJ A;  1FOH A;  1GUL A;  3WT2 A;  2H1B A;  1NSW A;  1GP1 A;  4PUF C;  4Z2T A;  1FOV A;  4HDE A;  1B48 A;  4NMU A;  4NXI A;  3TCO A;  5IPG A;  2IME A;  2I4A A;  5CO3 A;  2F8F A;  5CRD A;  3EYT A;  1GSD A;  1GUH A;  2KOK A;  3HMJ G;  2F8A A;  5F06 A;  3G9B A;  4DSS A;  4L5L A;  2FNO A;  3KXO A;  1PSQ A;  5FHI A;  11GS A;  2WUL A;  4PNF A;  3UAP A;  5HFG A;  1TU8 A;  4G0I A;  2XC2 A;  2H0I A;  5ELG A;  1SVL A;  1XWB A;  3F0I A;  1VF3 A;  4K7N A;  5EL8 A;  2EFH A;  1ZOF A;  2I81 A;  3LXT A;  2O85 A;  2VOC A;  4JBB A;  3TDG A;  1TP9 A;  2QSI A;  4KDU A;  2I9H A;  2A4H A;  1DE2 A;  4KH7 A;  4LMV A;  1TXX A;  2R0C A;  2FA8 A;  1TRS A;  2CT6 A;  2KHP A;  4I8B A;  1QQ2 A;  2JAD A;  1O81 A;  3BD2 A;  3ZVJ D;  1F2E A;  1JZO A;  1SJ6 A;  3GX0 A;  4ZB6 A;  5KN0 A;  1X9S B;  3DRN A;  3GNJ A;  2FLS A;  4POM A;  4TXV A;  2R3X A;  1F9M A;  1Y25 A;  3QCP A;  4G19 A;  5H5R A;  2H1D A;  1LU4 A;  5CRG A;  4KE3 A;  3H8Q A;  3GIX A;  3UVH A;  5IO0 A;  4G9H A;  5J9B A;  2VLU A;  2M72 A;  1PKZ A;  2GZP A;  4ECC A;  1YF1 A;  1XBS A;  2YWI A;  1EZK A;  5DCG A;  1A8L A;  4JZQ A;  3UBK A;  2H30 A;  5HFI A;  4IGJ A;  5CRE A;  2FCH A;  3P90 A;  1ERV A;  1PN0 A;  3CTF A;  2DML A;  2C0E A;  4ZL9 A;  1OE7 A;  4EO3 A;  2AV4 A;  4L5O A;  4GTU A;  3FR6 A;  5FT3 A;  3HXS A;  4O5R A;  4RQX A;  1G6W A;  4X1U A;  3ZTL A;  3ED3 A;  2VLT A;  4PQH A;  1EGO A;  1EEM A;  3LW9 A;  1QFN A;  4RI7 A;  5J4Y A;  1XWA A;  2VL2 A;  1XVW A;  3HJP A;  2OAD A;  2XHF A;  1RK4 A;  5C00 A;  3IAS 2;  3HJO A;  4Z2R A;  3IDV A;  1MTC A;  7GSS A;  3R2Q A;  2L4C A;  2XBI A;  2JSY A;  2DLX A;  4IW9 A;  1SL1 B;  4MDC A;  2ZUP A;  3TJK A;  4YH2 A;  5HFK A;  2CX4 A;  3H1N A;  3VWV A;  4P3Y B;  1V2A A;  4MJE A;  4W66 A;  2IMK A;  3HHV A;  4GQC A;  3VWW A;  4ACS A;  1ERW A;  5ENU A;  1GLP A;  2VL2 C;  1TJD A;  1OC9 B;  2IMD A;  4WKW A;  1R5A A;  3MIX A;  2WB9 A;  3IV4 A;  2XBQ A;  2P5R A;  2K6V A;  3FR3 A;  1O6J A;  1YY7 A;  3HD5 A;  3SBC A;  2FGX A;  4I2T A;  5F8B A;  1SL2 B;  3QR6 A;  4KCA A;  3FRC A;  2H76 A;  2TRX A;  1YKC A;  1AQW A;  1E6B A;  1V57 A;  3TKQ A;  4NWY A;  5IPH A;  4KB3 A;  3KIJ A;  2A4V A;  1JZR A;  3IRA A;  1M0U A;  3GTU A;  4IEL A;  4OCF A;  2DIZ A;  2I3Y A;  5LD0 A;  1TW9 A;  4YQV A;  5CRH A;  3ZML A;  3HA9 A;  5CP1 A;  2H6Z A;  5IM9 A;  3F63 A;  1GNW A;  1B9Y C;  16GS A;  1GNE A;  2C8U A;  1WE0 A;  2DJ2 A;  3HVV A;  3LEF A;  1R26 A;  2X4A A;  4IS0 A;  3BBY A;  2H66 A;  1GTU A;  2H70 A;  2M46 A;  3NOF A;  1GH2 A;  4MP4 A;  3IA1 A;  1GLQ A;  4G10 A;  3D22 A;  3ZFB A;  4XRD A;  1TTZ A;  2FWH A;  4XTS A;  5HQP A;  3IAM 2;  5AIX A;  4AJ8 A;  5G1K A;  4ML1 A;  1EEJ A;  5D93 A;  4TRX A;  5D9T A;  1OVN A;  1HYU A;  2C3N A;  4RQR A;  2O87 A;  1AW9 A;  2PU9 C;  4TR4 A;  3LG6 A;  2R0G A;  3PIN A;  2GTU A;  3QFB C;  5J4U A;  3TB2 A;  4AI6 A;  3TOU A;  1N2A A;  4F03 A;  3C8E A;  3ZIV A;  2B3S A;  3NIV A;  4DSR A;  5B8A A;  4BWS A;  2L5O A;  2B1L A;  4FYC A;  2QKE A;  2X49 A;  3PR8 A;  5E59 A;  1M9B A;  2VCX A;  3BCI A;  1MDI A;  1SK0 A;  1ZYN A;  1Z7R A;  3HYP A;  3TRQ A;  2N5B A;  4MCU A;  2E2M A;  1NW2 A;  3EU4 A;  4WXT A;  2H72 A;  1XPV A;  4K2D A;  1YVL A;  2MMA A;  2HSN A;  1RQM A;  5G5F A;  1T3B A;  1BAY A;  4CHS A;  4RUV A;  2DKI A;  5GAP D;  3F4R A;  2FUG 2;  2OAC A;  22GS A;  4PGT A;  4KGI A;  3RBT A;  5IMF A;  1Z3E A;  3BCK A;  4ECB A;  4TR0 A;  4ICY A;  1WWJ A;  4AKG A;  2X8C A;  3K8N A;  4XS1 A;  3FW2 A;  1XW6 A;  4N0V A;  1YF0 A;  3ZL5 A;  1USB A;  1GL8 A;  5IQY A;  4PQI A;  4V1A p;  2F51 A;  5J5N A;  1SYR A;  5DQS A;  1ML6 A;  2HZE A;  2ON7 A;  2LQO A;  2E7P A;  1T8E B;  3VPQ A;  3IK7 A;  4TOP A;  4O5Q A;  3G7I A;  2H73 A;  1HQO A;  2LNT A;  3GSS A;  2HQT A;  1UN2 A;  2EFE A;  1B4Q A;  3IHG A;  1BED A;  1X0R A;  3NZN A;  2O8V B;  4I6X A;  2AHE A;  3GH6 A;  2QA1 A;  1DSB A;  1K0O A;  2LUS A;  2GSR A;  4PQ1 A;  4MJC A;  4KCE A;  4HU7 A;  1G6Y A;  3GST A;  2OJL A;  2OE3 A;  2WS2 A;  4XHM A;  1XW5 A;  1ACV A;  2G2Q A;  1BQ7 A;  5J4V A;  3F4S A;  3ERG A;  1OKT A;  4OO5 A;  3C1R A;  1G7E A;  4HI7 A;  5F07 A;  3QDN A;  5B7C A;  1AQX A;  5ECR B;  1WJK A;  3FYG A;  5A4U A;  4LMW A;  1SU9 A;  3RAZ A;  3ZIT A;  2VCZ A;  1FB0 A;  2LNS A;  3HZ8 A;  1X5D A;  5J41 A;  1O73 A;  3F3Q A;  4EIQ A;  1XFL A;  2LKU A;  2GSQ A;  5COH A;  4L0W A;  4YKG A;  1GTA A;  1MD4 A;  4BWQ A;  4GWR A;  1YEX A;  3QAG A;  5AN1 A;  1GSE A;  2H75 A;  2DC5 A;  4BPY A;  1O8X A;  3QPM A;  3KGK A;  1Y6E A;  3IC8 A;  2YJ7 A;  4OWY A;  5AIV A;  3WT1 A;  4J2F A;  5AIS A;  2HRK A;  1X9M B;  5ECH B;  4GXZ A;  3HJM A;  3TJJ A;  1PRX A;  4OO4 A;  3DIE A;  4D73 A;  1MD3 A;  2VLV A;  3J7Y b;  4OFT A;  4JR6 A;  3E0U A;  1BJX A;  4HQZ A;  3IC4 A;  2LQQ A;  4YQM A;  1OE8 A;  2FHE A;  3EE2 A;  2VIM A;  4GRF A;  1FO5 A;  3VFI A;  3KMN A;  3Q6O A;  4TR1 B;  1JHB A;  3DYR A;  5ID2 B;  4XS6 A;  5G31 A;  1SEN A;  1J0F A;  1PN9 A;  4ULX A;  3FZ5 A;  1FG4 A;  3FR9 A;  4ZBD A;  3TJB A;  2FWF A;  2GGT A;  1F6M C;  1B9X C;  2REM A;  1MDK A;  3ME8 A;  5A1N A;  3GUR A;  1DE1 A;  4KDY A;  1EWX A;  1V98 A;  4FH8 A;  1YJ6 A;  4F0B A;  1HNB A;  2GQL A;  3LQ7 A;  4ZB8 A;  4WBJ A;  4TXO B;  4ISD A;  5ECI B;  3TJG A;  1T00 A;  3KTL A;  1I9D A;  2O7K A;  3KD0 A;  3VI7 A;  2HZE B;  4N30 A;  2X64 A;  1A2M A;  2VD1 A;  3VK9 A;  2PWJ A;  2LJK A;  3WGX A;  3CSH A;  1NHO A;  3KTB A;  3APQ A;  5IMD A;  3F4T A;  5EPF A;  5L71 A;  2PER A;  1A24 A;  3LSZ A;  4WET A;  2TIR A;  1ZCP A;  1YZX A;  2FWG A;  2L57 A;  3KMO A;  5IIZ A;  1TU7 A;  2RM6 A;  1THO A;  5J40 A;  3S9F A;  4H86 A;  3KEB A;  1U87 A;  2PBJ A;  3LYP A;  5IMZ A;  2M80 A;  4USS A;  3HVX A;  3BJ5 A;  2CVK A;  3A2W A;  2IPA A;  1XXU A;  3GHA A;  1YQ1 A;  3LOR A;  5CYY A;  1K0M A;  3TKP A;  4K5S A;  3LWA A;  3DGQ A;  1T4Z A;  4HOJ A;  2X8G A;  4K9Z A;  4IKH A;  4KF9 A;  5ECS A;  5CNW A;  4KW6 A;  5DCH A;  4MA9 A;  5IOX A;  1OC8 A;  1ERU A;  3UL3 A;  2LS5 A;  5A5K A;  1WMJ A;  4I5Q A;  3D4T A;  3DXB A;  4Q5F A;  4WF4 A;  5A4V A;  3CMI A;  1QK8 A;  5ELA A;  4K6X A;  3CXG A;  1LBK A;  2GLR A;  5DDL A;  5F0G A;  4D73 B;  3A3T A;  2VAF A;  1BX9 A;  1SK2 A;  2HSM A;  4EL1 A;  1EP8 A;  1EOG A;  5HR1 A;  3ZFL A;  1SKS B;  5J9C A;  2BTO T;  3A5W A;  4WR4 A;  5BRT A;  2K9F A;  1ZGN A;  4PNG A;  5JWQ B;  1R7H A;  1WPI A;  2VL9 A;  1JLW A;  2VM1 A;  2AAW A;  2B7K A;  3ISO A;  3WD6 A;  2R0P A;  2HFD A;  1Z9H A;  3M3M A;  2YWM A;  2HSY A;  1F3B A;  20GS A;  4DEJ A;  4XS4 A;  3PGT A;  2DSA A;  3F9U A;  4Z2U A;  2GST A;  2UZ8 A;  2X99 A;  4MJB A;  1EP7 A;  3P2A A;  1THX A;  1U6T A;  1ZYE A;  4F82 A;  2MMZ A;  2H01 A;  1KBN A;  1K0A A;  1WP0 A;  2L6D A;  1TRW A;  2K18 A;  3RHB A;  2NBS A;  5A1N B;  2MMN A;  4TW5 A;  1HNC A;  1EV4 A;  1Z6M A;  3L78 A;  4DSS B;  4JED A;  3A5I A;  1G7O A;  1B8X A;  5EVO A;  1J08 A;  2OT3 A;  2L6C A;  5D9V A;  1KTE A;  4KSM A;  2RLI A;  1T7P B;  3BOA A;  1WOU A;  2GQK A;  1W89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...