3VI7A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/isomerase inhibitor
molecule keywords Hematopoietic prostaglandin D synthase
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi7A01
4F0BA 5HFIA 3VLNA 3IC4A 3BCKA 3F4SA 2R3XA 4MABA 5AISA 1XXUA 2HZEB 3UBKA 5A4VA 3CSIA 2YPMA 3PH9A 4WF5A 3GN3A 4MF5A 3GTUA 3M0FA 4LMWA 1X9SB 3ZTLA 2IPAA 2VOCA 3M3MA 2CV4A 2VUPA 3UAPA 2LJRA 1FG4A 1BJXA 4L0WA 2LQQA 3ZVJD 2AHEA 1BEDA 1SYXA 1TP9A 4K7OA 2H6ZA 3GURA 2V41A 3TCOA 1K0BA 4OCEA 2CX4A 2HRNA 4XS6A 2I3YA 1Q98A 2YJHA 1FO5A 4TXVA 5IO2A 5J4UA 4IKHA 4BVXA 4PNFA 1HNCA 2F51A 2TIRA 1LU4A 4K1FA 1OYJA 1JZWA 3TJFA 4OD7A 1K3YA 3QFAC 1WMJA 3UIWA 4HI7A 4G0LA 1ERTA 4I97A 4FH8A 2OKAA 3F3RA 2WS2A 4EF0A 1A0FA 2PBJA 1VRSD 2AUVA 3UBLA 4JU5A 2VCVA 3GUSA 1PX7A 4XRAA 5LCZA 5EVOA 3HXSA 3TDGA 1T4YA 2O8VB 1YQ1A 5ENUA 3LEFA 3TKQA 1SD8A 3QCPA 4V2NA 2OE3A 4GQFA 1PGTA 2H70A 3VWUA 4V2MA 3RHBA 1WIKA 3HZ8A 1PX6A 1X9WB 1BYEA 2QC7A 3EURA 1M2DA 3A3TA 4EKZA 3FK8A 1SD9A 4MZCA 3Q18A 4PUAA 1F2EA 4XTSA 4GSNA 6GSVA 4XHMA 2CA8A 1Z3EA 3V1WA 4HS1A 2L59A 4GTUA 1GH2A 3UVHA 3L78A 2VCXA 1ML6A 4PX1A 1AIUA 2VM1A 2O85A 4KDYA 3U5RE 4D73A 2EC4A 4K8MA 5IQYA 1GRXA 1GSYA 3EINA 1TI1A 2VLUA 5D73A 3E0UA 5CRHA 4EO3A 2CVBA 1S3DA 1DSBA 3HVSA 2YN1A 2IMKA 2K8SA 4YQMA 3TUEA 5EL8A 4TR1A 1LBKA 4G9HA 2M80A 4PURA 3LFLA 3L4NA 4HU9A 1DUGA 2H0HA 2JL4A 2GT6A 2P0GA 2ZUPA 1W4VA 1MD3A 3E3EA 2I9HA 2RLIA 4KSOA 5J9CA 2B1LA 1XCCA 1K0MA 3HJMA 1B4QA 4BA7A 1EP7A 4KE3A 5AIXA 3QFBC 3RAZA 3TOUA 5G31A 4EXJA 1YKCA 2EIRA 5DQYA 2VLVA 4X0XA 3G9BA 4N0ZA 5IO0A 7GSSA 5GZZB 2GZZA 2V6OA 1V98A 5G1KA 2HNLA 4YAPA 3IPZA 5J41A 1GP1A 3TKSC 4F2IA 3BBYA 1J08A 2FA8A 3GYKA 2PMTA 5ECSA 1TRSA 4JR4A 4IBPA 3PINA 6GSXA 5ECQB 2C8UA 5KN0A 3LQ7A 4O32A 2FLSA 2HSYA 5AIVA 4I2TA 4F0CA 1Z6MA 4NMUA 4RI6A 2LNSA 1O85A 2E2MA 5ECLB 5F05A 4ZXGA 1XWKA 3KD0A 4BPYA 2IMFA 4POKA 1RK4A 1O7UA 4OFMA 4MZWA 1OC3A 2GQMA 5ECHB 1SJZA 2DJ0A 5JWQB 4NAXA 1TRVA 1K3LA 4WBJA 4WEYA 4Q5QA 4HQZA 2MBSA 1Y25A 1GLPA 5IMZA 5HR3A 1ST9A 1LJRA 2RM5A 5HFGA 2PVOC 4L8EA 3H8QA 4NV5A 1GSUA 4ECCA 2VL9A 1R5AA 1XVWA 2I1UA 2VCTA 3RBTA 1QGVA 1MDKA 4NHWA 2YWMA 3I6AA 4IVFA 1DE2A 1B4PA 4GSSA 1USBA 3UARA 1SK1A 1U6TA 4KCEA 2WDUA 4ML6A 1QFNA 1NM3A 5HR2A 1TU8A 4Z7XA 5B8BA 2VD1A 1AQVA 5D93A 2D2ZA 2DJ1A 1M2BA 3QPMA 1MDJA 4AJ6A 1E2YA 2GVPA 2A4VA 4IQ1A 1B8XA 4KDXA 4TOPA 2PWJA 3P7XA 3DWVA 4WBRD 4OO5A 2LUSA 3N9JA 1THXA 1OKDA 2WGRA 2L4QA 1RW1A 2GT5A 4DSQA 1K0DA 5A5KA 3IA1A 3GX0A 4ZBBA 3CRTA 3HJOA 5BMUA 6GSTA 5ID2B 3ZZXA 4ID0A 4OMVA 3GL5A 3EWLA 5IMDA 13GSA 2A2SA 6GSYA 1EGRA 4LL4B 2LSTA 3IOSA 1NW2A 2P5QA 4K9ZA 3P8WA 1DE1A 1AXDA 3W8SA 3EMPA 5GSSA 1YEXA 1ZGNA 2C0DA 1SJ6A 1E6BA 5DDLA 4P3YB 3MAKA 2IMEA 5J9BA 3F6FA 3ERWA 5DAKB 1O73A 1UVZA 10GSA 2PU9C 3TRXA 1KNGA 2I4AA 1K0OA 2R5GA 2LEGA 3HZ4A 2FWHA 1EOHA 3NZNA 1JHBA 1G6WA 4MJEA 5IMCA 2L4CA 3ME7A 3DMLA 3D22A 1K0AA 2F8AA 2IMDA 2F3MA 9GSSA 2L6DA 1AAZA 2WCIA 1GTUA 4WF4A 1EEJA 2H1AA 2X64A 1Q4JA 3GX8A 4MPGA 1XZOA 2FGXA 1OE7A 4KNDA 4RQRA 2MZCA 2L57A 4MP4A 4E8EA 4ZB9A 1S3AA 4J2FA 2XPDA 1IYIA 1OC9B 1WOUA 4EVMA 4BVYA 3N5OA 1U3IA 2C4JA 2E0QA 2DC5A 1EV4A 1M9AA 5G5EA 3AY8A 4PTSA 3ME8A 4USSA 4MJAA 3F8UA 4G19A 3NIVA 1G0TA 3MSZA 5C04A 3FZ9A 4XS4B 3R3EA 2OJLA 1T00A 1M7TA 2IMIA 3KP8A 3SWLA 3KM6A 3J7Yk 2GGTA 3WT2A 1KBNA 5DCHA 4I5QA 5JCGA 2F8FA 2N5BA 4AGSA 3D6IA 3LXTA 1XOAA 3G7YA 2ES7A 1GWCA 1XFLA 3EU4A 1XPVA 4GRFA 4Q5RA 3UOMA 3TKPA 3JCML 1X5DA 5F8BA 5D9XA 3DIEA 1XVQA 1TOFA 4L0UA 3HVVA 1VF2A 1I5GA 1G7EA 5E59A 1EGOA 4IELA 1GTAA 1ERVA 1R7HA 4X1UA 1TDIA 1KTEA 3H79A 2C3TA 5JWOB 3VWXA 4GSTA 2K18A 2CAIA 3ZIVA 4DSSA 1GNEA 4V2LA 4Q5NA 4K0GA 2UZ8A 2YZHA 1SU9A 4MDCA 3LJRA 5ABRA 3O6TA 4WR4A 3UMAA 3D0ZA 3G7JA 5DAKA 4ECJA 2AB6A 4F03A 1B9YC 4PUFC 3LG6A 3BD2A 5G2ZA 1XWCA 1YF1A 2X8HA 3C1RA 3QDNA 3KXOA 5H5SA 1Y6EA 2ZNMA 2LJKA 4ZL7A 4JE1A 3Q74A 4XS1A 2YJ7A 4QL7A 2CT6A 2HRAA 1NHYA 4ZBAA 3QD9A 1GULA 2H0IA 5HR0A 2X8CA 3FW2A 2QSIA 4KX4A 4J56E 1TU7A 5A4UA 4ZL8A 4OO4A 2X99A 1FHEA 4IJ3A 1SK0A 2C0EA 5DVBA 5EY6A 2PGTA 1SKSB 1V58A 2PPTA 5LD0A 1O8XA 4NXIA 4BL7B 4CHSA 4EDZA 3H93A 4CDOA 3DRNA 3ERGA 2YNXA 1PL2A 1J9BA 2YWIA 4IP1A 5AGYA 3CTGA 3GRXA 5GSTA 3KH7A 2C3QA 4POLA 1GUHA 4NV2A 4IQAA 1S3CA 2XHFA 2C0GA 3F9UA 5ECRB 6GSWA 4MPFA 4EDYA 4MJCA 5D9VA 4BWQA 1X0RA 2HZEA 2PVQA 1M0UA 4F9ZA 2HRKB 3LYKA 4EC0A 1K3OA 3IK7A 1VGLA 4ML1A 5ECMB 4RQXA 1M2AA 4TXOB 1A2LA 2B5YA 2MMAA 1JLWA 2B7KA 5GAND 1ON4A 5CYYA 2RIIA 2OA7A 1FVJA 2P5RA 1XOBA 3K8NA 2RM6A 1SKWB 2R6KA 4TW5A 1SKRB 4PNGA 4KW6A 2LQOA 2ON5A 4AF2A 1TJDA 5IIZA 3US3A 2NDOA 18GSA 2PUKC 1HNBA 3EVIA 4AJ8A 4KUNA 2REMA 4EE0A 1AC1A 2DJ2A 4KDUA 3O3TA 4GLTA 2V32A 1NSWA 3DYRA 1GSDA 3PGTA 2C0FA 4MLYA 3TJGA 4PGTA 4MF6A 1O81A 2V6KA 5JCUA 1T4ZA 2YV7A 4TRXA 1TTZA 5LNKe 3ED3A 3EE2A 3A2VA 3LYPA 2VIMA 1KEBA 4GCIA 5E4WA 4HUAA 1JLVA 1BAYA 4PQ1A 5B7CA 2GSTA 2GQKA 3L9SA 5ELGA 3D4MA 5IOWA 2K9FA 1R5PA 3Q19A 1Z7RA 2JZTA 3CMIA 1ZCPA 2GSRA 2EIQA 1EZKA 4V1Ap 1EEMA 1O8WA 3IAM2 1WP0A 1JZDA 2DMLA 4NWYA 1SL1B 5KN2A 5COHA 1WRYA 3MDKA 4MMMA 3RHCA 2C1YA 4NPBA 4MF7A 5D9WA 2H6XA 3D21A 3C7MA 3KEBA 2C3NA 2NVLA 4BWSA 1VF3A 2L5OA 3HDCA 2ZCTA 4J57E 1F3BA 3IHQA 3EC3A 1A24A 3SBCA 3HY2A 2IFQB 3IR4A 2HSMB 1K0CA 1FVKA 3KP9A 2H0GA 3IBHA 1U88A 4GQCA 3TB2A 5ECPB 2AJQB 4OFNA 5JCWA 1BG5A 1PSQA 2FHEA 2HSNB 1TW9A 2WZ9A 2MMOA 2NBSA 2G2QA 4KCAA 2HRKA 2VLTA 2PN8A 3ZRDA 3GL3A 4TKYA 1M99A 4ECBA 2M46A 4MH3A 2H66A 2LRCA 2DBCA 14GSA 2LV3A 3TJKA 4TXOA 1Z9HA 1ZYQB 3KGKA 4V1Ag 1AW9A 1M9BA 2N5AA 4FO5A 1XIYA 2O7KA 1TK0B 1YZXA 1UA5A 2B5EA 4OWYA 4IP6A 1X5EA 3ZREA 5CRWA 1TK8B 4K2DA 1GSSA 1JFUA 3DGQA 1FAAA 5KN3A 2HFDA 3M8NA 1V57A 3GHAA 5DCGA 4N11A 3QOUA 2YP6A 2BMXA 1FW1A 3TRPA 3WYWA 3W8JA 2FCHA 1N2AA 3KJYA 2CAQA 3UVTA 4N0VA 2V1MA 4HU7A 3KZQA 1TKDB 2QGVA 2HE3A 4ISDA 4OCFA 1PN9A 4CW9A 3GKXA 2XC2A 2YOIA 5CP1A 2KUCA 2R4VA 4IN0A 1XW9A 2E2GA 3F3QA 2VL2A 4TVEA 3VPQA 2H30A 3FHKA 3WGXA 2C80A 1GUKA 3GTUB 1XW5A 3GSTA 1YJ6A 3KCMA 2VCZA 3TOTA 4Q5FA 1SL2B 1PRXA 1QK8A 1OKTA 4GWRA 1WE0A 1F9MA 4QQ7A 3L0HA 1XWAA 4WXTA 3ISOA 3U6VA 4WKWA 1XWGA 5A4WA 4IGJA 5DBQA 4HZ2A 3ZVJA 5INYA 3IXRA 2IL3A 3TJJA 1QXHA 3Q6OA 4GXZA 1ACVA 1UC7A 1YEPA 5J5NA 2GQLA 5DJMA 1ZMAA 5ECKB 4IHUA 3D4TA 1X9MB 4RUVA 1AQWA 3DVWA 1WJKA 4AJ7A 1SENA 2VCQA 2JSZA 3KIJA 2WRTA 5F06A 3A2XA 2N5FA 2OACA 1Z6NA 4ILFA 3WD6A 1ERUA 4KB3A 4BVXB 3GKNA 2AAWA 1EV9A 1JZOA 3WT1A 3VWVA 3CSJA 2VCWA 1SYRA 1GNWA 1ERWA 3FR9A 4JZQA 1Z5YE 2X8GA 1OVNA 3CBUA 4JR6A 3KTBA 4FYCA 3VFIA 2K6VA 3IE3A 5IMAA 2NTOA 3L9VA 1ZOFA 5B8AA 3C8EA 2FWEA 4HZ4A 5D8IA 3VI5A 2HI7A 5IMFA 3KTLA 3BOAA 2CZ2A 4FYBA 2GSQA 3TKSE 3NOFA 2WB9A 4YAVA 4JRRA 4E8HA 1FOVA 2WFCA 4LLRA 3ZYWA 3BJ5A 1EP8A 1A8YA 3ZFLA 1VF4A 3D5JA 1IYHA 5ELAA 4ZB8A 4LL1B 4N30A 2H75A 3IAS2 2R37A 4HDEA 2AYTA 3UL3A 5IMVA 3ZMLA 2JZRA 3P90A 3FYGA 11GSA 2CX3A 4HEA2 4KAEA 4D73B 1CQHA 2JADA 2OE0A 1BQ7A 1QQ2A 5ID2A 3GSSA 3ZIJA 2LS5A 1GTIA 5JWRB 1AUCA 1F37A 1PKWA 4EUYA 4ZIJA 3C73A 2G0FA 1HD2A 1QMVA 2DIZA 2LRNA 2DLXA 1I9DA 1RQMA 4H86A 4YQVA 2Z9SA 2GZYA 4KH7A 2XPEA 4HJ2A 4TR1B 4MZBA 1HNAA 2V2GA 2IIYA 4DEJA 3VPTA 3F0IA 5IPGA 5AN1A 3APOA 3GKKA 1PQNA 2YV9A 2FWGA 1GSEA 5DJLA 3A5WA 1OE8A 2OADA 5DALB 2I81A 3FKFA 2JACA 3QAGA 1FB0A 2WULA 2HLSA 5CNWA 4L5LA 4I2UA 5J3RA 4MJBA 2YWOA 4TR3A 4XIHA 3R2QA 1JZRA 2M72A 1YDKA 1V9WA 2KP1A 1BX9A 5G1LA 2TRXA 2WJUA 2L5LA 4FQUA 2GSSA 4PQIA 2YWNA 2LNTA 19GSA 3FZ5A 3H1NA 1WPIA 2LJAA 1OC9A 2H1GA 2VM2A 5L71A 1TI3A 2FNOA 5IPHA 4G10A 2H73A 4ACSA 3IV4A 4G2EA 1J0FA 1MD4A 1A2JA 4X43A 4KF9A 5C00A 4XS4A 3IRAA 3HD5A 2QKEA 1GSQA 3P2AA 2KOKA 1XWBA 3I69A 3MWHA 3QAVA 1V2AA 3EU3A 2YCDA 4MA9A 3FY7A 1U3AA 1ZZYA 4EL1A 3QMXA 22GSA 1XW6A 3IC8A 4QL9A 3L9UA 2VAFA 2YZUA 3TKRA 5H5QA 3TRQA 1T3BA 4KGIA 5FWGA 2K8VA 3CXGA 5HR1A 2B1KA 4PQHA 4FIWA 3KH9A 2CVDA 4ULXA 1TRWA 3O76A 1THOA 2H1DA 4DVCA 3F6DA 2B3SA 3ZFBA 2H1BA 4ZBDA 4XRDA 4MK3A 1AQXA 1H75A 1PL1A 2A2RA 1B9XC 3GMFA 3HCZA 5CO3A 3QAWA 1FB6A 3GA4A 2HSHA 4JEDA 1HQOA 2CQ9A 3QR6A 4MCUA 4HOJA 2OBIA 5B6MA 1TK5B 5CREA 2DIYA 2EIOA 4HQSA 1ILOA 2BJXA 2O89A 2XBIA 1F3AA 1ZYEA 1N8JA 3PR8A 5DALA 4O5RA 3GH6A 3A2WA 2DSAA 4YH2A 1EOGA 4F82A 3LWAA 5DQSA 4I6XA 2FWFA 20GSA 1MTCA 3HVXA 3IDVA 3UEMA 2OBKA 3RPPA 3J7Yb 2MYGA 4POMA 4ZL9A 2J23A 5ECNB 2KHPA 1GLQA 2GDRA 6GSSA 3HKRA 5CAXA 3W6GA 5FHIA 1SK2A 1UN2A 2LKUA 5D9TA 4GF0A 5CRDA 4K7NA 1U87A 17GSA 2B5XA 2L6CA 2B7JA 4FYUA 1G7OA 2FA4A 1T8EB 3IK9A 3KMOA 1PKZA 3GV1A 1X5CA 2DMMA 2HYXA 4TN8A 3G7IA 3EMXA 5KEJA 2LTKA 4BL7A 3TGZA 4IW9A 4G0KA 2VL2C 2HT9A 3I9V2 2BTOT 5CRGA 2RUEA 3F4TA 2HXKA 3GFKA 1MEKA 4WETA 1EWXA 5ECOB 2NPBA 1PMTA 4OFTA 3HJPA 3CSHA 2OE1A 1T1VA 2H71A 3ZL5A 4IJIA 4MH2A 5HQPA 1A2MA 4I8BA 3DVXA 2ALBA 1A23A 1Z7PA 4IS0A 3WGEA 3EYTA 2VO4A 3FEUA 1PA3A 1T7PB 2PERA 3APSA 2XBQA 16GSA 5IOXA 2GS3A 1OC8A 2O87A 3H4KA 1A0RP 1R4WA 3DEXA 1SJIA 1CQGA 2MBTA 2E7PA 4BVYB 2HQTA 3WGDA 1YF0A 1QUWA 2J9HA 1V40A 2DJKA 2VL3A 3LORA 1F6MC 3HYPA 2H6YA 3CTFA 4XCSA 2GLRA 3RPNA 2H76A 2RUFA 4YQUA 4TR4A 4WR5A 2R2JA 3TKSA 2FUG2 3GNJA 3BCIA 2CZ3A 1O6JA 1SL0B 2IWTA 3DKSA 2AV4A 3VI7A 3FR3A 1PD21 4L5OA 3MNGA 1GTBA 4DSRA 1YKAA 4ECIA 1DBYA 3M9JA 4KSMA 4O7HA 3RDWA 3M9KA 3GKMA 2ON7A 3GIXA 5EPFA 3OR5A 2TRCP 1G6YA 2MMNA 5IM9A 3CRUA 1XBSA 2LRTA 2H19A 4LMVA 1ABAA 2CVKA 4LA1A 3VK9A 3LGCA 1A8LA 3E9JB 4N10A 5F0GA 3ZLPA 3DD3A 5H5RA 2FD3A 1K0NA 3LXZA 8GSSA 2FY6A 5G5FA 2H74A 2IN3A 4JBBA 4DSSB 1TXXA 4G0IA 2DJ3A 1C72A 1MDIA 1NHOA 2MMZA 3UJ1A 3VWWA 2DJJA 3CYNA 2JZSA 1VF1A 1B48A 2IFQA 2HSMA 2VD0A 4O92A 1GL8A 4ZB6A 3GH9A 4K7IA 4KA0A 1R26A 5KN1A 3M1GA 3C71A 1GSFA 3TJBA 2H01A 3S9FA 2H8LA 4PXOA 2IJYA 3LSZA 2P31A 5ECIB 5HFKA 4HJMA 4NHZA 2B6MA 1ZL9A 4K0NA 3FZAA 1HYUA 3F4RA 4K6XA 4TR0A 5GAPD 5G30A 3HHVA 5F07A 2KP2A 4POBA 3KMNA 3PPUA 2GTUA 3ZMKA 2JU5A 3VURA 1URMA 3C1SA 6GSUA 3ZITA 3DXBA 2JSYA 2HZFA 4RI7A 5D96A 3FRCA 1W89A 3I43A 1H4OA 3HA9A 5FT3A 3ERFA 1WWJA 3FZ4A 2HRFA 1TRUA 2F9SA 3APQA 12GSA 3FR6A 1GUMA 2KLXA 1OAZA 4ZILA 1YY7A 2H72A 2YANA 5B6NA 2GZPA 3F63A
chains in the Genus database with same CATH superfamily
4F0BA 5HFIA 3VLNA 3IC4A 3BCKA 3F4SA 2R3XA 4MABA 5AISA 1XXUA 2HZEB 3UBKA 5A4VA 3CSIA 2YPMA 3PH9A 4WF5A 3GN3A 4MF5A 3GTUA 2WVXA 4E68A 3M0FA 4LMWA 1X9SB 3ZTLA 2IPAA 2VOCA 3M3MA 4PI0C 2CV4A 2VUPA 3UAPA 2LJRA 1FG4A 1BJXA 4L0WA 2LQQA 3ZVJD 2AHEA 1BEDA 1SYXA 1TP9A 4K7OA 2H6ZA 3GURA 2V41A 3TCOA 1K0BA 4OCEA 2CX4A 2HRNA 1BF5A 4XS6A 2I3YA 1Q98A 2YJHA 1FO5A 4TXVA 5IO2A 5J4UA 4IKHA 4BVXA 4PNFA 1HNCA 2F51A 2TIRA 1LU4A 4K1FA 1OYJA 1JZWA 3TJFA 4OD7A 3A5IA 1K3YA 3QFAC 1WMJA 3UIWA 4HI7A 4G0LA 1ERTA 4I97A 4FH8A 2OKAA 3F3RA 2WS2A 4EF0A 1A0FA 2PBJA 1VRSD 4N3ZA 2AUVA 3UBLA 4JU5A 2VCVA 3GUSA 1PX7A 4XRAA 5LCZA 5EVOA 3HXSA 3TDGA 1T4YA 2O8VB 1YQ1A 5ENUA 3LEFA 3TKQA 1SD8A 3QCPA 1FOHA 4V2NA 2OE3A 4GQFA 1PGTA 2H70A 3VWUA 4V2MA 3RHBA 1WIKA 3HZ8A 5A5HB 1PX6A 1X9WB 1BYEA 2QC7A 3EURA 1M2DA 3A3TA 4EKZA 2WW3A 3FK8A 1SD9A 4MZCA 3Q18A 4PUAA 1F2EA 4XTSA 4GSNA 6GSVA 4XHMA 2CA8A 1Z3EA 3V1WA 4HS1A 2L59A 4GTUA 1GH2A 3UVHA 2VCXA 3L78A 1ML6A 4PX1A 1AIUA 2VM1A 2O85A 4KDYA 3U5RE 4D73A 2EC4A 4K8MA 5IQYA 1GRXA 1GSYA 3EINA 1TI1A 2VLUA 2WW2A 5D73A 3E0UA 5CRHA 4EO3A 2CVBA 1S3DA 1DSBA 3HVSA 2YN1A 2IMKA 2K8SA 4YQMA 3TUEA 5EL8A 4TR1A 1LBKA 4G9HA 2M80A 4PURA 2R0PA 3LFLA 3L4NA 4HU9A 1DUGA 2H0HA 2JL4A 2GT6A 2P0GA 2ZUPA 1W4VA 1MD3A 3E3EA 2I9HA 2RLIA 4KSOA 5J9CA 2B1LA 1XCCA 1K0MA 3HJMA 1B4QA 4BA7A 1EP7A 4KE3A 5AIXA 3QFBC 3IHGA 3RAZA 3TOUA 5G31A 4EXJA 1YKCA 2EIRA 5DQYA 2VLVA 4X0XA 3G9BA 4N0ZA 5IO0A 7GSSA 5GZZB 2GZZA 2V6OA 1V98A 5G1KA 2HNLA 4YAPA 3IPZA 5J41A 1GP1A 3TKSC 4F2IA 3BBYA 1J08A 2FA8A 3GYKA 4AI6A 2PMTA 5ECSA 1TRSA 4JR4A 4IBPA 3PINA 6GSXA 5ECQB 2C8UA 5KN0A 3LQ7A 4O32A 2FLSA 2HSYA 5AIVA 4I2TA 4F0CA 1Z6MA 4NMUA 4CY6A 4RI6A 2LNSA 1O85A 2E2MA 5ECLB 4ICYA 5F05A 4ZXGA 1XWKA 3KD0A 4BPYA 2IMFA 4POKA 1RK4A 1O7UA 4OFMA 4MZWA 1OC3A 2GQMA 5ECHB 1SJZA 2DJ0A 4YKFA 5JWQB 4NAXA 1TRVA 1K3LA 4A5PA 4WBJA 4WEYA 4Q5QA 4HQZA 2MBSA 1Y25A 1GLPA 5IMZA 5HR3A 1ST9A 1LJRA 2RM5A 5HFGA 2PVOC 4L8EA 4YKGA 3H8QA 4NV5A 1GSUA 4ECCA 2VL9A 1R5AA 1XVWA 2I1UA 2VCTA 3RBTA 1Y1UA 1QGVA 1MDKA 4NHWA 2YWMA 3I6AA 4IVFA 1DE2A 1B4PA 2X49A 4GSSA 1USBA 3UARA 1SK1A 1U6TA 4KCEA 2WDUA 4ML6A 1QFNA 1NM3A 5HR2A 1TU8A 4Z7XA 2EFEA 5B8BA 2DKIA 2VD1A 1AQVA 5D93A 2D2ZA 2DJ1A 1M2BA 3QPMA 1MDJA 4AJ6A 1E2YA 2GVPA 2A4VA 4IQ1A 1B8XA 4KDXA 4TOPA 2PWJA 3P7XA 3DWVA 4WBRD 3HMJG 4OO5A 2LUSA 3N9JA 1THXA 1OKDA 2WGRA 2L4QA 1RW1A 4O5UA 2GT5A 4K5RA 4DSQA 1K0DA 3IA1A 5A5KA 1S4BP 3GX0A 3CRTA 4ZBBA 3HJOA 5BMUA 6GSTA 5ID2B 3ZZXA 4ID0A 4OMVA 3GL5A 3EWLA 5IMDA 13GSA 2A2SA 6GSYA 1EGRA 4LL4B 2LSTA 3IOSA 1NW2A 2P5QA 4K9ZA 3P8WA 1DE1A 1AXDA 3W8SA 3EMPA 5GSSA 1YEXA 1ZGNA 2C0DA 1SJ6A 1E6BA 5DDLA 4P3YB 3MAKA 2IMEA 5J9BA 3F6FA 3ERWA 5A34A 1TXUA 5DAKB 1O73A 1UVZA 10GSA 2PU9C 3TRXA 1KNGA 2I4AA 1K0OA 2R5GA 2LEGA 3HZ4A 2FWHA 1EOHA 3NZNA 2R0CA 1JHBA 1G6WA 4MJEA 5IMCA 2L4CA 3ME7A 3DMLA 3D22A 2A2PA 1K0AA 2F8AA 2IMDA 2F3MA 9GSSA 2L6DA 1AAZA 2WCIA 1GTUA 4WF4A 1EEJA 2H1AA 2X64A 1Q4JA 3FMWA 4MPGA 3GX8A 1XZOA 2FGXA 1OE7A 4KNDA 4RQRA 2MZCA 4EIPA 2L57A 4MP4A 5KOWA 4E8EA 4AKIA 4ZB9A 1S3AA 2O3EA 4J2FA 2XPDA 1IYIA 1OC9B 1WOUA 4EVMA 4BVYA 3N5OA 1U3IA 2C4JA 2E0QA 2DC5A 1EV4A 1M9AA 5G5EA 3RGBC 3AY8A 4PTSA 3ME8A 4USSA 4MJAA 3F8UA 4G19A 3NIVA 1G0TA 1M3JA 3MSZA 5C04A 3FZ9A 4XS4B 3R3EA 2OJLA 4AKXB 1T00A 1M7TA 2IMIA 3KP8A 3SWLA 3KM6A 3J7Yk 2GGTA 3WT2A 1KBNA 5DCHA 4I5QA 5JCGA 2F8FA 2N5BA 4AGSA 3D6IA 3LXTA 1XOAA 3G7YA 2ES7A 1GWCA 1XFLA 3EU4A 1XPVA 4GRFA 4Q5RA 4X4JA 3MYDA 3UOMA 3TKPA 3JCML 1X5DA 5F8BA 5D9XA 3DIEA 1XVQA 1TOFA 4L0UA 3HVVA 1VF2A 1I5GA 1G7EA 5E59A 1EGOA 4IELA 1GTAA 1ERVA 1R7HA 4X1UA 1TDIA 1KTEA 4PI2C 3H79A 2C3TA 5JWOB 3VWXA 4GSTA 2K18A 2CAIA 3ZIVA 4DSSA 1GNEA 4V2LA 4Q5NA 4K0GA 2UZ8A 2YZHA 1SU9A 4MDCA 3LJRA 5ABRA 3O6TA 4WR4A 3UMAA 3D0ZA 3G7JA 5DAKA 4ECJA 2AB6A 4F03A 1SVLA 1B9YC 4PUFC 3LG6A 3BD2A 3RFRC 5G2ZA 1XWCA 1YF1A 2X8HA 3C1RA 3QDNA 4K5SA 3KXOA 5H5SA 1Y6EA 2ZNMA 2LJKA 4ZL7A 4JE1A 3Q74A 4XS1A 2YJ7A 4QL7A 2CT6A 2HRAA 1NHYA 4ZBAA 3QD9A 1GULA 2H0IA 5HR0A 2X8CA 3FW2A 2QSIA 4KX4A 4J56E 5J4VA 1TU7A 5A4UA 4ZL8A 4OO4A 2X99A 1FHEA 4IJ3A 1SK0A 2C0EA 5DVBA 5EY6A 2PGTA 1SKSB 1V58A 2PPTA 5LD0A 1O8XA 4NXIA 4BL7B 4CHSA 4EDZA 3H93A 4CDOA 3DRNA 3ERGA 2YNXA 1PL2A 1J9BA 2YWIA 4IP1A 5AGYA 3CTGA 3GRXA 5GSTA 3KH7A 2C3QA 4POLA 1GUHA 4NV2A 4IQAA 1S3CA 2XHFA 2C0GA 3F9UA 5ECRB 6GSWA 4MPFA 4EDYA 4MJCA 5D9VA 1XG8A 4BWQA 1X0RA 2HZEA 2PVQA 2X4AA 1M0UA 4F9ZA 2HRKB 3LYKA 4EC0A 3CHXC 1K3OA 3IK7A 1VGLA 4ML1A 5ECMB 4RQXA 1M2AA 4TXOB 1A2LA 2B5YA 2MMAA 1JLWA 2B7KA 2WZSA 5GAND 1ON4A 5CYYA 2A4HA 2RIIA 2OA7A 1FVJA 2P5RA 1XOBA 3K8NA 2RM6A 1SKWB 2R6KA 4TW5A 1SKRB 4PNGA 4KW6A 2LQOA 2ON5A 4AF2A 1TJDA 5IIZA 5A1NB 3LW9A 3US3A 2NDOA 18GSA 2PUKC 1HNBA 3EVIA 4AJ8A 4KUNA 2REMA 4EE0A 1AC1A 2DJ2A 4KDUA 3O3TA 4GLTA 2V32A 1NSWA 3DYRA 4Z2RA 1GSDA 3PGTA 2C0FA 4MLYA 3TJGA 4PGTA 4MF6A 1O81A 2V6KA 5JCUA 1T4ZA 2YV7A 4TRXA 1TTZA 3MIXA 2EFCA 5LNKe 3ED3A 3EE2A 3A2VA 3LYPA 2VIMA 1KEBA 4GCIA 5E4WA 4HUAA 1JLVA 1BAYA 4PQ1A 5B7CA 2GSTA 2GQKA 3L9SA 2O36A 5ELGA 3D4MA 5IOWA 2K9FA 1R5PA 3Q19A 1Z7RA 2JZTA 3CMIA 1ZCPA 2GSRA 2EIQA 1EZKA 4V1Ap 1EEMA 1O8WA 3IAM2 1WP0A 1JZDA 2DMLA 4NWYA 1SL1B 5KN2A 5A5HA 5COHA 1S3RA 1WRYA 3MDKA 4MMMA 3RHCA 2C1YA 4NPBA 4MF7A 5D9WA 2H6XA 3D21A 3C7MA 3KEBA 2C3NA 2NVLA 4BWSA 1VF3A 2L5OA 3HDCA 2ZCTA 4J57E 1F3BA 3IHQA 3EC3A 1A24A 3SBCA 3HY2A 2IFQB 3IR4A 2HSMB 1K0CA 1FVKA 3KP9A 2H0GA 3IBHA 1U88A 4GQCA 3TB2A 5ECPB 4W66A 2AJQB 4OFNA 5JCWA 1BG5A 1PSQA 2FHEA 2HSNB 1TW9A 2WZ9A 2MMOA 2NBSA 2G2QA 4KCAA 2HRKA 2VLTA 2PN8A 3ZRDA 3GL3A 4TKYA 1M99A 4ECBA 2M46A 4MH3A 2H66A 2LRCA 2DBCA 14GSA 2LV3A 3TJKA 4TXOA 1Z9HA 1ZYQB 4FXYP 3KGKA 4V1Ag 4ZB7A 1AW9A 1M9BA 2N5AA 4FO5A 4G01A 1XIYA 2O7KA 1TK0B 1YZXA 1UA5A 2B5EA 4OWYA 4IP6A 1X5EA 3ZREA 5CRWA 1TK8B 4K2DA 1GSSA 1JFUA 3DGQA 2O5VA 1FAAA 5KN3A 2HFDA 3M8NA 1V57A 5A1NA 3GHAA 5DCGA 4N11A 3QOUA 2YP6A 2BMXA 1FW1A 3TRPA 3WYWA 3W8JA 2FCHA 1N2AA 3KJYA 2CAQA 3UVTA 4N0VA 2V1MA 4HU7A 3KZQA 1TKDB 2QGVA 2HE3A 4ISDA 4OCFA 1PN9A 4CW9A 3GKXA 2XC2A 2YOIA 5CP1A 2KUCA 2R4VA 4BIKA 4IN0A 1XW9A 2E2GA 2EFHA 1ZYNA 3F3QA 2VL2A 4TVEA 3VPQA 2H30A 3FHKA 3WGXA 4AKHA 2C80A 1GUKA 5KOXA 3GTUB 1XW5A 3GSTA 1YJ6A 3KCMA 2VCZA 2WVXB 3TOTA 4Q5FA 1SL2B 1PRXA 1QK8A 1OKTA 4GWRA 1WE0A 1F9MA 4QQ7A 3L0HA 1XWAA 4WXTA 3ISOA 3U6VA 4WKWA 1XWGA 5A4WA 4IGJA 5DBQA 4HZ2A 3ZVJA 5INYA 3IXRA 2IL3A 3TJJA 1QXHA 1ZYPA 3Q6OA 4GXZA 4O5QA 1ACVA 1UC7A 4QMKA 5J5NA 1YEPA 5DJMA 2GQLA 1ZMAA 3TU3B 5ECKB 4IHUA 3D4TA 1X9MB 4RUVA 1AQWA 3DVWA 1WJKA 4AJ7A 1SENA 2VCQA 2JSZA 3KIJA 2WRTA 5F06A 3A2XA 2N5FA 2OACA 1Z6NA 4ILFA 3WD6A 1ERUA 4KB3A 4BVXB 3GKNA 2AAWA 1EV9A 1JZOA 3WT1A 3VWVA 3CSJA 2VCWA 1SYRA 1GNWA 2WW1A 3HVNA 1ERWA 3FR9A 4JZQA 1Z5YE 2X8GA 1OVNA 3CBUA 4JR6A 3KTBA 3CQFA 4FYCA 3VFIA 2K6VA 3IE3A 5IMAA 4EIQA 2NTOA 3L9VA 1ZOFA 5B8AA 3C8EA 2FWEA 4HZ4A 5D8IA 3VI5A 2HI7A 5IMFA 3KTLA 3BOAA 2CZ2A 4FYBA 2GSQA 3TKSE 3NOFA 2WB9A 4YAVA 4JRRA 4E8HA 1FOVA 2WFCA 4LLRA 3ZYWA 3BJ5A 1EP8A 1A8YA 3ZFLA 1VF4A 3D5JA 3EPTA 1IYHA 5ELAA 4ZB8A 4LL1B 4N30A 2H75A 3IAS2 2R37A 4HDEA 2AYTA 3UL3A 5IMVA 3ZMLA 2JZRA 3P90A 3FYGA 11GSA 2CX3A 4Z2UA 4HEA2 4KAEA 4D73B 1BG1A 1CQHA 2JADA 2OE0A 1BQ7A 4Z2TA 1QQ2A 5ID2A 3GSSA 3ZIJA 2LS5A 1GTIA 5JWRB 1AUCA 1F37A 1PKWA 1PFOA 4EUYA 4ZIJA 3C73A 2G0FA 1HD2A 1QMVA 2DIZA 2LRNA 2DLXA 1I9DA 1RQMA 4H86A 4YQVA 2Z9SA 2GZYA 4KH7A 2XPEA 4HJ2A 4AKGA 4TR1B 4MZBA 1HNAA 2V2GA 2IIYA 4DEJA 3VPTA 3F0IA 5IPGA 5AN1A 3APOA 3GKKA 4GDFA 1PQNA 2YV9A 2FWGA 3CWGA 1GSEA 5DJLA 3A5WA 1OE8A 2OADA 5DALB 4MNNA 2I81A 3FKFA 2JACA 3QAGA 1FB0A 1PN0A 2WULA 2HLSA 5CNWA 4L5LA 4I2UA 5J3RA 4MJBA 2YWOA 4TR3A 4XIHA 3R2QA 1JZRA 2DKHA 2M72A 1YDKA 1V9WA 2KP1A 1BX9A 5G1LA 2TRXA 2WJUA 2L5LA 2EFDA 2GSSA 4FQUA 1I1IP 4PQIA 2YWNA 2LNTA 19GSA 3FZ5A 3H1NA 1WPIA 2LJAA 1OC9A 2H1GA 2VM2A 5L71A 1TI3A 2FNOA 2QA1A 4G10A 5IPHA 2H73A 4ACSA 2UV8G 3IV4A 4G2EA 1J0FA 1MD4A 1A2JA 4X43A 2H1LA 4KF9A 5C00A 4XS4A 3IRAA 3HD5A 2QKEA 1GSQA 3P2AA 2KOKA 1XWBA 3I69A 3MWHA 3QAVA 1V2AA 3EU3A 2YCDA 4MA9A 3FY7A 1U3AA 1ZZYA 4EL1A 3QMXA 22GSA 1XW6A 3IC8A 4QL9A 3L9UA 2VAFA 2YZUA 3TKRA 5H5QA 3TRQA 1T3BA 4KGIA 5FWGA 4CY8A 2K8VA 3CXGA 5HR1A 2B1KA 1N25A 4PQHA 5J40A 4FIWA 3KH9A 2CVDA 4ULXA 1TRWA 3O76A 1THOA 2H1DA 4DVCA 3F6DA 2B3SA 3ZFBA 2H1BA 4ZBDA 4XRDA 4MK3A 5BRTA 1AQXA 1H75A 1PL1A 5J47A 2A2RA 1B9XC 3GMFA 3HCZA 5CO3A 3QAWA 1FB6A 3GA4A 2HSHA 4JEDA 1HQOA 2CQ9A 3QR6A 4MCUA 4HOJA 2OBIA 5B6MA 1TK5B 5CREA 2DIYA 2EIOA 4K2XA 4HQSA 1ILOA 2BJXA 2O89A 2XBIA 4PHZC 1F3AA 1ZYEA 2OT3A 1N8JA 3PR8A 5DALA 4O5RA 3GH6A 3A2WA 2DSAA 4YH2A 1EOGA 4F82A 3LWAA 5DQSA 4I6XA 2FWFA 20GSA 1MTCA 3HVXA 3IDVA 1SVOA 3UEMA 2OBKA 3RPPA 3J7Yb 2MYGA 4POMA 4ZL9A 5BMUB 2J23A 5ECNB 2KHPA 1GLQA 2GDRA 6GSSA 3HKRA 5CAXA 3W6GA 5FHIA 1SK2A 1UN2A 2LKUA 5D9TA 4GF0A 5CRDA 4K7NA 1U87A 17GSA 2B5XA 2L6CA 2B7JA 4FYUA 1G7OA 2FA4A 1T8EB 2WVYA 3IK9A 3KMOA 1PKZA 3GV1A 1X5CA 2DMMA 2HYXA 4TN8A 3G7IA 3EMXA 4HSCX 5KEJA 1M3IA 5A34B 2R0GA 2LTKA 4BL7A 3TGZA 4IW9A 2QA2A 4G0KA 2VL2C 2HT9A 3I9V2 2BTOT 5CRGA 2RUEA 3F4TA 2HXKA 2VKZG 3GFKA 1MEKA 4WETA 1EWXA 5ECOB 2NPBA 1PMTA 4OFTA 3HJPA 3CSHA 2OE1A 1T1VA 2H71A 3ZL5A 4IJIA 4MH2A 5HQPA 1A2MA 4I8BA 3DVXA 2ALBA 1A23A 1Z7PA 4IS0A 3WGEA 3EYTA 2VO4A 3FEUA 1PA3A 1T7PB 2PERA 5J4YA 3APSA 2XBQA 16GSA 5IOXA 2GS3A 1OC8A 3H4KA 2O87A 1A0RP 1R4WA 3DEXA 1SJIA 1CQGA 2MBTA 2E7PA 4BVYB 2HQTA 3WGDA 1YF0A 1QUWA 2J9HA 1V40A 2DJKA 2VL3A 3LORA 1F6MC 3HYPA 2H6YA 3CTFA 4XCSA 2GLRA 3RPNA 2H76A 2RUFA 4YQUA 4TR4A 4WR5A 2R2JA 3TKSA 2FUG2 3GNJA 3BCIA 2CZ3A 1O6JA 1SL0B 2IWTA 3DKSA 2AV4A 3VI7A 1YVLA 3FR3A 1PD21 4L5OA 3MNGA 1GTBA 4DSRA 1YKAA 4ECIA 1DBYA 3M9JA 4KSMA 4O7HA 3RDWA 3M9KA 3GKMA 2ON7A 3GIXA 5EPFA 3OR5A 2TRCP 1G6YA 2MMNA 5IM9A 3CRUA 1XBSA 2LRTA 2H19A 4LMVA 1ABAA 2CVKA 4LA1A 3VK9A 3LGCA 1A8LA 3E9JB 4N10A 5F0GA 3ZLPA 3DD3A 5H5RA 2FD3A 1K0NA 3LXZA 8GSSA 2FY6A 5G5FA 2H74A 2IN3A 4JBBA 4DSSB 1TXXA 4G0IA 2DJ3A 1C72A 1MDIA 1NHOA 2MMZA 3UJ1A 3VWWA 2DJJA 3CYNA 2JZSA 1VF1A 1B48A 2IFQA 2HSMA 2VD0A 4O92A 2WW0A 1GL8A 4ZB6A 3GH9A 4K7IA 4KA0A 1R26A 5KN1A 3M1GA 3C71A 1GSFA 3TJBA 2H01A 3S9FA 2H8LA 4PXOA 2IJYA 2HSNA 3LSZA 2P31A 5ECIB 5HFKA 4HJMA 4NHZA 2B6MA 1ZL9A 4K0NA 3FZAA 1HYUA 3F4RA 4K6XA 4TR0A 5GAPD 5G30A 3HHVA 5F07A 1SVMA 2KP2A 4POBA 3KMNA 3PPUA 2GTUA 3ZMKA 2JU5A 3VURA 1URMA 3C1SA 6GSUA 1YEWC 3ZITA 3DXBA 2JSYA 2HZFA 4RI7A 5D96A 3FRCA 1W89A 3I43A 1H4OA 3HA9A 5FT3A 3ERFA 1WWJA 3FZ4A 2HRFA 1TRUA 2WVZA 2F9SA 3APQA 12GSA 3FR6A 1GUMA 2KLXA 1OAZA 4ZILA 1YY7A 2H72A 2YANA 5B6NA 2GZPA 3F63A
chains in the Genus database with same CATH topology
4F0BA 5HFIA 3VLNA 3IC4A 3BCKA 3F4SA 2R3XA 4MABA 5AISA 1XXUA 2HZEB 3UBKA 5A4VA 3CSIA 2YPMA 3PH9A 4WF5A 3GN3A 4MF5A 3GTUA 4E68A 3M0FA 4LMWA 1X9SB 3ZTLA 2IPAA 2VOCA 3M3MA 2CV4A 2VUPA 3UAPA 2LJRA 1FG4A 1BJXA 4L0WA 2LQQA 3ZVJD 2AHEA 1BEDA 1SYXA 1TP9A 4K7OA 2H6ZA 3GURA 2V41A 3TCOA 1K0BA 4OCEA 2CX4A 2HRNA 1BF5A 4XS6A 2I3YA 1Q98A 2YJHA 1FO5A 4TXVA 5IO2A 5J4UA 4IKHA 4BVXA 4PNFA 1HNCA 2F51A 2TIRA 1LU4A 4K1FA 1OYJA 1JZWA 3TJFA 4OD7A 3A5IA 1K3YA 3QFAC 1WMJA 3UIWA 4HI7A 4G0LA 1ERTA 4I97A 4FH8A 2OKAA 3F3RA 2WS2A 4EF0A 1A0FA 2PBJA 1VRSD 4N3ZA 2AUVA 3UBLA 4JU5A 2VCVA 3GUSA 1PX7A 4XRAA 5LCZA 5EVOA 3HXSA 3TDGA 1T4YA 2O8VB 1YQ1A 5ENUA 3LEFA 3TKQA 1SD8A 3QCPA 1FOHA 4V2NA 2OE3A 4GQFA 1PGTA 2H70A 3VWUA 4V2MA 3RHBA 1WIKA 3HZ8A 5A5HB 1PX6A 1X9WB 1BYEA 2QC7A 3EURA 1M2DA 3A3TA 4EKZA 3FK8A 1SD9A 4MZCA 3Q18A 4PUAA 1F2EA 4XTSA 4GSNA 6GSVA 4XHMA 2CA8A 1Z3EA 3V1WA 4HS1A 2L59A 4GTUA 1GH2A 3UVHA 3L78A 2VCXA 1ML6A 4PX1A 1AIUA 2VM1A 2O85A 4KDYA 3U5RE 4D73A 2EC4A 4K8MA 5IQYA 1GRXA 1GSYA 3EINA 1TI1A 2VLUA 5D73A 3E0UA 5CRHA 4EO3A 2CVBA 1S3DA 1DSBA 3HVSA 2YN1A 2IMKA 2K8SA 4YQMA 3TUEA 5EL8A 4TR1A 1LBKA 4G9HA 2M80A 4PURA 2R0PA 3LFLA 3L4NA 4HU9A 1DUGA 2H0HA 2JL4A 2GT6A 2P0GA 2ZUPA 1W4VA 1MD3A 3E3EA 2I9HA 2RLIA 4KSOA 5J9CA 2B1LA 1XCCA 1K0MA 3HJMA 1B4QA 4BA7A 1EP7A 4KE3A 5AIXA 3QFBC 3IHGA 3RAZA 3TOUA 5G31A 4EXJA 1YKCA 2EIRA 5DQYA 2VLVA 4X0XA 3G9BA 4N0ZA 5IO0A 7GSSA 5GZZB 2GZZA 2V6OA 1V98A 5G1KA 2HNLA 4YAPA 3IPZA 5J41A 1GP1A 3TKSC 4F2IA 3BBYA 1J08A 2FA8A 3GYKA 4AI6A 2PMTA 5ECSA 1TRSA 4JR4A 4IBPA 3PINA 6GSXA 5ECQB 2C8UA 5KN0A 3LQ7A 4O32A 2FLSA 2HSYA 5AIVA 4I2TA 4F0CA 1Z6MA 4NMUA 4CY6A 4RI6A 2LNSA 1O85A 2E2MA 5ECLB 4ICYA 5F05A 4ZXGA 1XWKA 3KD0A 4BPYA 2IMFA 4POKA 1RK4A 1O7UA 4OFMA 4MZWA 1OC3A 2GQMA 5ECHB 1SJZA 2DJ0A 4YKFA 5JWQB 4NAXA 1TRVA 1K3LA 4A5PA 4WBJA 4WEYA 4Q5QA 4HQZA 2MBSA 1Y25A 1GLPA 5IMZA 5HR3A 1ST9A 1LJRA 2RM5A 5HFGA 2PVOC 4L8EA 4YKGA 3H8QA 4NV5A 1GSUA 4ECCA 2VL9A 1R5AA 1XVWA 2I1UA 2VCTA 3RBTA 1Y1UA 1QGVA 1MDKA 4NHWA 2YWMA 3I6AA 4IVFA 1DE2A 1B4PA 2X49A 4GSSA 1USBA 3UARA 1SK1A 1U6TA 4KCEA 2WDUA 4ML6A 1QFNA 1NM3A 5HR2A 1TU8A 4Z7XA 2EFEA 5B8BA 2DKIA 2VD1A 1AQVA 5D93A 2D2ZA 2DJ1A 1M2BA 3QPMA 1MDJA 4AJ6A 1E2YA 2GVPA 2A4VA 4IQ1A 1B8XA 4KDXA 4TOPA 2PWJA 3P7XA 3DWVA 4WBRD 3HMJG 4OO5A 2LUSA 3N9JA 1THXA 1OKDA 2WGRA 2L4QA 1RW1A 4O5UA 2GT5A 4K5RA 4DSQA 1K0DA 5A5KA 3IA1A 3GX0A 4ZBBA 3CRTA 3HJOA 5BMUA 6GSTA 5ID2B 3ZZXA 4ID0A 4OMVA 3GL5A 3EWLA 5IMDA 13GSA 2A2SA 6GSYA 1EGRA 4LL4B 2LSTA 3IOSA 1NW2A 2P5QA 4K9ZA 3P8WA 1DE1A 1AXDA 3W8SA 3EMPA 5GSSA 1YEXA 1ZGNA 2C0DA 1SJ6A 1E6BA 5DDLA 4P3YB 3MAKA 2IMEA 5J9BA 3F6FA 3ERWA 5A34A 1TXUA 5DAKB 1O73A 1UVZA 10GSA 2PU9C 3TRXA 1KNGA 2I4AA 1K0OA 2R5GA 2LEGA 3HZ4A 2FWHA 1EOHA 3NZNA 2R0CA 1JHBA 1G6WA 4MJEA 5IMCA 2L4CA 3ME7A 3DMLA 3D22A 2A2PA 1K0AA 2F8AA 2IMDA 2F3MA 9GSSA 2L6DA 1AAZA 2WCIA 1GTUA 4WF4A 1EEJA 2H1AA 2X64A 1Q4JA 3FMWA 4MPGA 3GX8A 1XZOA 2FGXA 1OE7A 4KNDA 4RQRA 2MZCA 4EIPA 2L57A 4MP4A 5KOWA 4E8EA 4AKIA 4ZB9A 1S3AA 4J2FA 2XPDA 1IYIA 1OC9B 1WOUA 4EVMA 4BVYA 3N5OA 1U3IA 2C4JA 2E0QA 2DC5A 1EV4A 1M9AA 5G5EA 3AY8A 4PTSA 3ME8A 4USSA 4MJAA 3F8UA 4G19A 3NIVA 1G0TA 3MSZA 5C04A 3FZ9A 4XS4B 3R3EA 2OJLA 4AKXB 1T00A 1M7TA 2IMIA 3KP8A 3SWLA 3KM6A 3J7Yk 2GGTA 3WT2A 1KBNA 5DCHA 4I5QA 5JCGA 2F8FA 2N5BA 4AGSA 3D6IA 3LXTA 1XOAA 3G7YA 2ES7A 1GWCA 1XFLA 3EU4A 1XPVA 4GRFA 4Q5RA 4X4JA 3MYDA 3UOMA 3TKPA 3JCML 1X5DA 5F8BA 5D9XA 3DIEA 1XVQA 1TOFA 4L0UA 3HVVA 1VF2A 1I5GA 1G7EA 5E59A 1EGOA 4IELA 1GTAA 1ERVA 1R7HA 4X1UA 1TDIA 1KTEA 3H79A 2C3TA 5JWOB 3VWXA 4GSTA 2K18A 2CAIA 3ZIVA 4DSSA 1GNEA 4V2LA 4Q5NA 4K0GA 2UZ8A 2YZHA 1SU9A 4MDCA 3LJRA 5ABRA 3O6TA 4WR4A 3UMAA 3D0ZA 3G7JA 5DAKA 4ECJA 2AB6A 4F03A 1SVLA 1B9YC 4PUFC 3LG6A 3BD2A 5G2ZA 1XWCA 1YF1A 2X8HA 3C1RA 3QDNA 4K5SA 3KXOA 5H5SA 1Y6EA 2ZNMA 2LJKA 4ZL7A 4JE1A 3Q74A 4XS1A 2YJ7A 4QL7A 2CT6A 2HRAA 1NHYA 4ZBAA 3QD9A 1GULA 2H0IA 5HR0A 2X8CA 3FW2A 2QSIA 4KX4A 4J56E 5J4VA 1TU7A 5A4UA 4ZL8A 4OO4A 2X99A 1FHEA 4IJ3A 1SK0A 2C0EA 5DVBA 5EY6A 2PGTA 1SKSB 1V58A 2PPTA 5LD0A 1O8XA 4NXIA 4BL7B 4CHSA 4EDZA 3H93A 4CDOA 3DRNA 3ERGA 2YNXA 1PL2A 1J9BA 2YWIA 4IP1A 5AGYA 3CTGA 3GRXA 5GSTA 3KH7A 2C3QA 4POLA 1GUHA 4NV2A 4IQAA 1S3CA 2XHFA 2C0GA 3F9UA 5ECRB 6GSWA 4MPFA 4EDYA 4MJCA 5D9VA 4BWQA 1X0RA 2HZEA 2PVQA 2X4AA 1M0UA 4F9ZA 2HRKB 3LYKA 4EC0A 1K3OA 3IK7A 1VGLA 4ML1A 5ECMB 4RQXA 1M2AA 4TXOB 1A2LA 2B5YA 2MMAA 1JLWA 2B7KA 5GAND 1ON4A 5CYYA 2A4HA 2RIIA 2OA7A 1FVJA 2P5RA 1XOBA 3K8NA 2RM6A 1SKWB 2R6KA 4TW5A 1SKRB 4PNGA 4KW6A 2LQOA 2ON5A 4AF2A 1TJDA 5IIZA 5A1NB 3LW9A 3US3A 2NDOA 18GSA 2PUKC 1HNBA 3EVIA 4AJ8A 4KUNA 2REMA 4EE0A 1AC1A 2DJ2A 4KDUA 3O3TA 4GLTA 2V32A 1NSWA 3DYRA 4Z2RA 1GSDA 3PGTA 2C0FA 4MLYA 3TJGA 4PGTA 4MF6A 1O81A 2V6KA 5JCUA 1T4ZA 2YV7A 4TRXA 1TTZA 3MIXA 2EFCA 5LNKe 3ED3A 3EE2A 3A2VA 3LYPA 2VIMA 1KEBA 4GCIA 5E4WA 4HUAA 1JLVA 1BAYA 4PQ1A 5B7CA 2GSTA 2GQKA 3L9SA 5ELGA 3D4MA 5IOWA 2K9FA 1R5PA 3Q19A 1Z7RA 2JZTA 3CMIA 1ZCPA 2GSRA 2EIQA 1EZKA 4V1Ap 1EEMA 1O8WA 3IAM2 1WP0A 1JZDA 2DMLA 4NWYA 1SL1B 5KN2A 5A5HA 5COHA 1WRYA 3MDKA 4MMMA 3RHCA 2C1YA 4NPBA 4MF7A 5D9WA 2H6XA 3D21A 3C7MA 3KEBA 2C3NA 2NVLA 4BWSA 1VF3A 2L5OA 3HDCA 2ZCTA 4J57E 1F3BA 3IHQA 3EC3A 1A24A 3SBCA 3HY2A 2IFQB 3IR4A 2HSMB 1K0CA 1FVKA 3KP9A 2H0GA 3IBHA 1U88A 4GQCA 3TB2A 5ECPB 4W66A 2AJQB 4OFNA 5JCWA 1BG5A 1PSQA 2FHEA 2HSNB 1TW9A 2WZ9A 2MMOA 2NBSA 2G2QA 4KCAA 2HRKA 2VLTA 2PN8A 3ZRDA 3GL3A 4TKYA 1M99A 4ECBA 2M46A 4MH3A 2H66A 2LRCA 2DBCA 14GSA 2LV3A 3TJKA 4TXOA 1Z9HA 1ZYQB 3KGKA 4V1Ag 4ZB7A 1AW9A 1M9BA 2N5AA 4FO5A 4G01A 1XIYA 2O7KA 1TK0B 1YZXA 1UA5A 2B5EA 4OWYA 4IP6A 1X5EA 3ZREA 5CRWA 1TK8B 4K2DA 1GSSA 1JFUA 3DGQA 2O5VA 1FAAA 5KN3A 2HFDA 3M8NA 1V57A 5A1NA 3GHAA 5DCGA 4N11A 3QOUA 2YP6A 2BMXA 1FW1A 3TRPA 3WYWA 3W8JA 2FCHA 1N2AA 3KJYA 2CAQA 3UVTA 4N0VA 2V1MA 4HU7A 3KZQA 1TKDB 2QGVA 2HE3A 4ISDA 4OCFA 1PN9A 4CW9A 3GKXA 2XC2A 2YOIA 5CP1A 2KUCA 2R4VA 4IN0A 1XW9A 2E2GA 2EFHA 1ZYNA 3F3QA 2VL2A 4TVEA 3VPQA 2H30A 3FHKA 3WGXA 4AKHA 2C80A 1GUKA 5KOXA 3GTUB 1XW5A 3GSTA 1YJ6A 3KCMA 2VCZA 3TOTA 4Q5FA 1SL2B 1PRXA 1QK8A 1OKTA 4GWRA 1WE0A 1F9MA 4QQ7A 3L0HA 1XWAA 4WXTA 3ISOA 3U6VA 4WKWA 1XWGA 5A4WA 4IGJA 5DBQA 4HZ2A 3ZVJA 5INYA 3IXRA 2IL3A 3TJJA 1QXHA 1ZYPA 3Q6OA 4GXZA 4O5QA 1ACVA 1UC7A 4QMKA 5J5NA 1YEPA 5DJMA 2GQLA 1ZMAA 3TU3B 5ECKB 4IHUA 3D4TA 1X9MB 4RUVA 1AQWA 3DVWA 1WJKA 4AJ7A 1SENA 2VCQA 2JSZA 3KIJA 2WRTA 5F06A 3A2XA 2N5FA 2OACA 1Z6NA 4ILFA 3WD6A 1ERUA 4KB3A 4BVXB 3GKNA 2AAWA 1EV9A 1JZOA 3WT1A 3VWVA 3CSJA 2VCWA 1SYRA 1GNWA 1ERWA 3FR9A 4JZQA 1Z5YE 2X8GA 1OVNA 3CBUA 4JR6A 3KTBA 4FYCA 3VFIA 2K6VA 3IE3A 5IMAA 4EIQA 2NTOA 3L9VA 1ZOFA 5B8AA 3C8EA 2FWEA 4HZ4A 5D8IA 3VI5A 2HI7A 5IMFA 3KTLA 3BOAA 2CZ2A 4FYBA 2GSQA 3TKSE 3NOFA 2WB9A 4YAVA 4JRRA 4E8HA 1FOVA 2WFCA 4LLRA 3ZYWA 3BJ5A 1EP8A 1A8YA 3ZFLA 1VF4A 3D5JA 3EPTA 1IYHA 5ELAA 4ZB8A 4LL1B 4N30A 2H75A 3IAS2 2R37A 4HDEA 2AYTA 3UL3A 5IMVA 3ZMLA 2JZRA 3P90A 3FYGA 11GSA 2CX3A 4Z2UA 4HEA2 4KAEA 4D73B 1BG1A 1CQHA 2JADA 2OE0A 1BQ7A 4Z2TA 1QQ2A 5ID2A 3GSSA 3ZIJA 2LS5A 1GTIA 5JWRB 1AUCA 1F37A 1PKWA 4EUYA 4ZIJA 3C73A 2G0FA 1HD2A 1QMVA 2DIZA 2LRNA 2DLXA 1I9DA 1RQMA 4H86A 4YQVA 2Z9SA 2GZYA 4KH7A 2XPEA 4HJ2A 4AKGA 4TR1B 4MZBA 1HNAA 2V2GA 2IIYA 4DEJA 3VPTA 3F0IA 5IPGA 5AN1A 3APOA 3GKKA 4GDFA 1PQNA 2YV9A 2FWGA 3CWGA 1GSEA 5DJLA 3A5WA 1OE8A 2OADA 5DALB 4MNNA 2I81A 3FKFA 2JACA 3QAGA 1FB0A 1PN0A 2WULA 2HLSA 5CNWA 4L5LA 4I2UA 5J3RA 4MJBA 2YWOA 4TR3A 4XIHA 3R2QA 1JZRA 2DKHA 2M72A 1YDKA 1V9WA 2KP1A 1BX9A 5G1LA 2TRXA 2WJUA 2L5LA 2EFDA 2GSSA 4FQUA 4PQIA 2YWNA 2LNTA 19GSA 3FZ5A 3H1NA 1WPIA 2LJAA 1OC9A 2H1GA 2VM2A 5L71A 1TI3A 2FNOA 2QA1A 4G10A 5IPHA 2H73A 4ACSA 2UV8G 3IV4A 4G2EA 1J0FA 1MD4A 1A2JA 4X43A 2H1LA 4KF9A 5C00A 4XS4A 3IRAA 3HD5A 2QKEA 1GSQA 3P2AA 2KOKA 1XWBA 3I69A 3MWHA 3QAVA 1V2AA 3EU3A 2YCDA 4MA9A 3FY7A 1U3AA 1ZZYA 4EL1A 3QMXA 22GSA 1XW6A 3IC8A 4QL9A 3L9UA 2VAFA 2YZUA 3TKRA 5H5QA 3TRQA 1T3BA 4KGIA 5FWGA 4CY8A 2K8VA 3CXGA 5HR1A 2B1KA 1N25A 4PQHA 5J40A 4FIWA 3KH9A 2CVDA 4ULXA 1TRWA 3O76A 1THOA 2H1DA 4DVCA 3F6DA 2B3SA 3ZFBA 2H1BA 4ZBDA 4XRDA 4MK3A 5BRTA 1AQXA 1H75A 1PL1A 5J47A 2A2RA 1B9XC 3GMFA 3HCZA 5CO3A 3QAWA 1FB6A 3GA4A 2HSHA 4JEDA 1HQOA 2CQ9A 3QR6A 4MCUA 4HOJA 2OBIA 5B6MA 1TK5B 5CREA 2DIYA 2EIOA 4K2XA 4HQSA 1ILOA 2BJXA 2O89A 2XBIA 1F3AA 1ZYEA 2OT3A 1N8JA 3PR8A 5DALA 4O5RA 3GH6A 3A2WA 2DSAA 4YH2A 1EOGA 4F82A 3LWAA 5DQSA 4I6XA 2FWFA 20GSA 1MTCA 3HVXA 3IDVA 1SVOA 3UEMA 2OBKA 3RPPA 3J7Yb 2MYGA 4POMA 4ZL9A 5BMUB 2J23A 5ECNB 2KHPA 1GLQA 2GDRA 6GSSA 3HKRA 5CAXA 3W6GA 5FHIA 1SK2A 1UN2A 2LKUA 5D9TA 4GF0A 5CRDA 4K7NA 1U87A 17GSA 2B5XA 2L6CA 2B7JA 4FYUA 1G7OA 2FA4A 1T8EB 3IK9A 3KMOA 1PKZA 3GV1A 1X5CA 2DMMA 2HYXA 4TN8A 3G7IA 3EMXA 5KEJA 5A34B 2R0GA 2LTKA 4BL7A 3TGZA 4IW9A 2QA2A 4G0KA 2VL2C 2HT9A 3I9V2 2BTOT 5CRGA 2RUEA 3F4TA 2HXKA 2VKZG 3GFKA 1MEKA 4WETA 1EWXA 5ECOB 2NPBA 1PMTA 4OFTA 3HJPA 3CSHA 2OE1A 1T1VA 2H71A 3ZL5A 4IJIA 4MH2A 5HQPA 1A2MA 4I8BA 3DVXA 2ALBA 1A23A 1Z7PA 4IS0A 3WGEA 3EYTA 2VO4A 3FEUA 1PA3A 1T7PB 2PERA 5J4YA 3APSA 2XBQA 16GSA 5IOXA 2GS3A 1OC8A 2O87A 3H4KA 1A0RP 1R4WA 3DEXA 1SJIA 1CQGA 2MBTA 2E7PA 4BVYB 2HQTA 3WGDA 1YF0A 1QUWA 2J9HA 1V40A 2DJKA 2VL3A 3LORA 1F6MC 3HYPA 2H6YA 3CTFA 4XCSA 2GLRA 3RPNA 2H76A 2RUFA 4YQUA 4TR4A 4WR5A 2R2JA 3TKSA 2FUG2 3GNJA 3BCIA 2CZ3A 1O6JA 1SL0B 2IWTA 3DKSA 2AV4A 3VI7A 1YVLA 3FR3A 1PD21 4L5OA 3MNGA 1GTBA 4DSRA 1YKAA 4ECIA 1DBYA 3M9JA 4KSMA 4O7HA 3RDWA 3M9KA 3GKMA 2ON7A 3GIXA 5EPFA 3OR5A 2TRCP 1G6YA 2MMNA 5IM9A 3CRUA 1XBSA 2LRTA 2H19A 4LMVA 1ABAA 2CVKA 4LA1A 3VK9A 3LGCA 1A8LA 3E9JB 4N10A 5F0GA 3ZLPA 3DD3A 5H5RA 2FD3A 1K0NA 3LXZA 8GSSA 2FY6A 5G5FA 2H74A 2IN3A 4JBBA 4DSSB 1TXXA 4G0IA 2DJ3A 1C72A 1MDIA 1NHOA 2MMZA 3UJ1A 3VWWA 2DJJA 3CYNA 2JZSA 1VF1A 1B48A 2IFQA 2HSMA 2VD0A 4O92A 1GL8A 4ZB6A 3GH9A 4K7IA 4KA0A 1R26A 5KN1A 3M1GA 3C71A 1GSFA 3TJBA 2H01A 3S9FA 2H8LA 4PXOA 2IJYA 2HSNA 3LSZA 2P31A 5ECIB 5HFKA 4HJMA 4NHZA 2B6MA 1ZL9A 4K0NA 3FZAA 1HYUA 3F4RA 4K6XA 4TR0A 5GAPD 5G30A 3HHVA 5F07A 1SVMA 2KP2A 4POBA 3KMNA 3PPUA 2GTUA 3ZMKA 2JU5A 3VURA 1URMA 3C1SA 6GSUA 3ZITA 3DXBA 2JSYA 2HZFA 4RI7A 5D96A 3FRCA 1W89A 3I43A 1H4OA 3HA9A 5FT3A 3ERFA 1WWJA 3FZ4A 2HRFA 1TRUA 2F9SA 3APQA 12GSA 3FR6A 1GUMA 2KLXA 1OAZA 4ZILA 1YY7A 2H72A 2YANA 5B6NA 2GZPA 3F63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0B A;  5HFI A;  3VLN A;  3IC4 A;  3BCK A;  3F4S A;  2R3X A;  4MAB A;  5AIS A;  1XXU A;  2HZE B;  3UBK A;  5A4V A;  3CSI A;  2YPM A;  3PH9 A;  4WF5 A;  3GN3 A;  4MF5 A;  3GTU A;  3M0F A;  4LMW A;  1X9S B;  3ZTL A;  2IPA A;  2VOC A;  3M3M A;  2CV4 A;  2VUP A;  3UAP A;  2LJR A;  1FG4 A;  1BJX A;  4L0W A;  2LQQ A;  3ZVJ D;  2AHE A;  1BED A;  1SYX A;  1TP9 A;  4K7O A;  2H6Z A;  3GUR A;  2V41 A;  3TCO A;  1K0B A;  4OCE A;  2CX4 A;  2HRN A;  4XS6 A;  2I3Y A;  1Q98 A;  2YJH A;  1FO5 A;  4TXV A;  5IO2 A;  5J4U A;  4IKH A;  4BVX A;  4PNF A;  1HNC A;  2F51 A;  2TIR A;  1LU4 A;  4K1F A;  1OYJ A;  1JZW A;  3TJF A;  4OD7 A;  1K3Y A;  3QFA C;  1WMJ A;  3UIW A;  4HI7 A;  4G0L A;  1ERT A;  4I97 A;  4FH8 A;  2OKA A;  3F3R A;  2WS2 A;  4EF0 A;  1A0F A;  2PBJ A;  1VRS D;  2AUV A;  3UBL A;  4JU5 A;  2VCV A;  3GUS A;  1PX7 A;  4XRA A;  5LCZ A;  5EVO A;  3HXS A;  3TDG A;  1T4Y A;  2O8V B;  1YQ1 A;  5ENU A;  3LEF A;  3TKQ A;  1SD8 A;  3QCP A;  4V2N A;  2OE3 A;  4GQF A;  1PGT A;  2H70 A;  3VWU A;  4V2M A;  3RHB A;  1WIK A;  3HZ8 A;  1PX6 A;  1X9W B;  1BYE A;  2QC7 A;  3EUR A;  1M2D A;  3A3T A;  4EKZ A;  3FK8 A;  1SD9 A;  4MZC A;  3Q18 A;  4PUA A;  1F2E A;  4XTS A;  4GSN A;  6GSV A;  4XHM A;  2CA8 A;  1Z3E A;  3V1W A;  4HS1 A;  2L59 A;  4GTU A;  1GH2 A;  3UVH A;  3L78 A;  2VCX A;  1ML6 A;  4PX1 A;  1AIU A;  2VM1 A;  2O85 A;  4KDY A;  3U5R E;  4D73 A;  2EC4 A;  4K8M A;  5IQY A;  1GRX A;  1GSY A;  3EIN A;  1TI1 A;  2VLU A;  5D73 A;  3E0U A;  5CRH A;  4EO3 A;  2CVB A;  1S3D A;  1DSB A;  3HVS A;  2YN1 A;  2IMK A;  2K8S A;  4YQM A;  3TUE A;  5EL8 A;  4TR1 A;  1LBK A;  4G9H A;  2M80 A;  4PUR A;  3LFL A;  3L4N A;  4HU9 A;  1DUG A;  2H0H A;  2JL4 A;  2GT6 A;  2P0G A;  2ZUP A;  1W4V A;  1MD3 A;  3E3E A;  2I9H A;  2RLI A;  4KSO A;  5J9C A;  2B1L A;  1XCC A;  1K0M A;  3HJM A;  1B4Q A;  4BA7 A;  1EP7 A;  4KE3 A;  5AIX A;  3QFB C;  3RAZ A;  3TOU A;  5G31 A;  4EXJ A;  1YKC A;  2EIR A;  5DQY A;  2VLV A;  4X0X A;  3G9B A;  4N0Z A;  5IO0 A;  7GSS A;  5GZZ B;  2GZZ A;  2V6O A;  1V98 A;  5G1K A;  2HNL A;  4YAP A;  3IPZ A;  5J41 A;  1GP1 A;  3TKS C;  4F2I A;  3BBY A;  1J08 A;  2FA8 A;  3GYK A;  2PMT A;  5ECS A;  1TRS A;  4JR4 A;  4IBP A;  3PIN A;  6GSX A;  5ECQ B;  2C8U A;  5KN0 A;  3LQ7 A;  4O32 A;  2FLS A;  2HSY A;  5AIV A;  4I2T A;  4F0C A;  1Z6M A;  4NMU A;  4RI6 A;  2LNS A;  1O85 A;  2E2M A;  5ECL B;  5F05 A;  4ZXG A;  1XWK A;  3KD0 A;  4BPY A;  2IMF A;  4POK A;  1RK4 A;  1O7U A;  4OFM A;  4MZW A;  1OC3 A;  2GQM A;  5ECH B;  1SJZ A;  2DJ0 A;  5JWQ B;  4NAX A;  1TRV A;  1K3L A;  4WBJ A;  4WEY A;  4Q5Q A;  4HQZ A;  2MBS A;  1Y25 A;  1GLP A;  5IMZ A;  5HR3 A;  1ST9 A;  1LJR A;  2RM5 A;  5HFG A;  2PVO C;  4L8E A;  3H8Q A;  4NV5 A;  1GSU A;  4ECC A;  2VL9 A;  1R5A A;  1XVW A;  2I1U A;  2VCT A;  3RBT A;  1QGV A;  1MDK A;  4NHW A;  2YWM A;  3I6A A;  4IVF A;  1DE2 A;  1B4P A;  4GSS A;  1USB A;  3UAR A;  1SK1 A;  1U6T A;  4KCE A;  2WDU A;  4ML6 A;  1QFN A;  1NM3 A;  5HR2 A;  1TU8 A;  4Z7X A;  5B8B A;  2VD1 A;  1AQV A;  5D93 A;  2D2Z A;  2DJ1 A;  1M2B A;  3QPM A;  1MDJ A;  4AJ6 A;  1E2Y A;  2GVP A;  2A4V A;  4IQ1 A;  1B8X A;  4KDX A;  4TOP A;  2PWJ A;  3P7X A;  3DWV A;  4WBR D;  4OO5 A;  2LUS A;  3N9J A;  1THX A;  1OKD A;  2WGR A;  2L4Q A;  1RW1 A;  2GT5 A;  4DSQ A;  1K0D A;  5A5K A;  3IA1 A;  3GX0 A;  4ZBB A;  3CRT A;  3HJO A;  5BMU A;  6GST A;  5ID2 B;  3ZZX A;  4ID0 A;  4OMV A;  3GL5 A;  3EWL A;  5IMD A;  13GS A;  2A2S A;  6GSY A;  1EGR A;  4LL4 B;  2LST A;  3IOS A;  1NW2 A;  2P5Q A;  4K9Z A;  3P8W A;  1DE1 A;  1AXD A;  3W8S A;  3EMP A;  5GSS A;  1YEX A;  1ZGN A;  2C0D A;  1SJ6 A;  1E6B A;  5DDL A;  4P3Y B;  3MAK A;  2IME A;  5J9B A;  3F6F A;  3ERW A;  5DAK B;  1O73 A;  1UVZ A;  10GS A;  2PU9 C;  3TRX A;  1KNG A;  2I4A A;  1K0O A;  2R5G A;  2LEG A;  3HZ4 A;  2FWH A;  1EOH A;  3NZN A;  1JHB A;  1G6W A;  4MJE A;  5IMC A;  2L4C A;  3ME7 A;  3DML A;  3D22 A;  1K0A A;  2F8A A;  2IMD A;  2F3M A;  9GSS A;  2L6D A;  1AAZ A;  2WCI A;  1GTU A;  4WF4 A;  1EEJ A;  2H1A A;  2X64 A;  1Q4J A;  3GX8 A;  4MPG A;  1XZO A;  2FGX A;  1OE7 A;  4KND A;  4RQR A;  2MZC A;  2L57 A;  4MP4 A;  4E8E A;  4ZB9 A;  1S3A A;  4J2F A;  2XPD A;  1IYI A;  1OC9 B;  1WOU A;  4EVM A;  4BVY A;  3N5O A;  1U3I A;  2C4J A;  2E0Q A;  2DC5 A;  1EV4 A;  1M9A A;  5G5E A;  3AY8 A;  4PTS A;  3ME8 A;  4USS A;  4MJA A;  3F8U A;  4G19 A;  3NIV A;  1G0T A;  3MSZ A;  5C04 A;  3FZ9 A;  4XS4 B;  3R3E A;  2OJL A;  1T00 A;  1M7T A;  2IMI A;  3KP8 A;  3SWL A;  3KM6 A;  3J7Y k;  2GGT A;  3WT2 A;  1KBN A;  5DCH A;  4I5Q A;  5JCG A;  2F8F A;  2N5B A;  4AGS A;  3D6I A;  3LXT A;  1XOA A;  3G7Y A;  2ES7 A;  1GWC A;  1XFL A;  3EU4 A;  1XPV A;  4GRF A;  4Q5R A;  3UOM A;  3TKP A;  3JCM L;  1X5D A;  5F8B A;  5D9X A;  3DIE A;  1XVQ A;  1TOF A;  4L0U A;  3HVV A;  1VF2 A;  1I5G A;  1G7E A;  5E59 A;  1EGO A;  4IEL A;  1GTA A;  1ERV A;  1R7H A;  4X1U A;  1TDI A;  1KTE A;  3H79 A;  2C3T A;  5JWO B;  3VWX A;  4GST A;  2K18 A;  2CAI A;  3ZIV A;  4DSS A;  1GNE A;  4V2L A;  4Q5N A;  4K0G A;  2UZ8 A;  2YZH A;  1SU9 A;  4MDC A;  3LJR A;  5ABR A;  3O6T A;  4WR4 A;  3UMA A;  3D0Z A;  3G7J A;  5DAK A;  4ECJ A;  2AB6 A;  4F03 A;  1B9Y C;  4PUF C;  3LG6 A;  3BD2 A;  5G2Z A;  1XWC A;  1YF1 A;  2X8H A;  3C1R A;  3QDN A;  3KXO A;  5H5S A;  1Y6E A;  2ZNM A;  2LJK A;  4ZL7 A;  4JE1 A;  3Q74 A;  4XS1 A;  2YJ7 A;  4QL7 A;  2CT6 A;  2HRA A;  1NHY A;  4ZBA A;  3QD9 A;  1GUL A;  2H0I A;  5HR0 A;  2X8C A;  3FW2 A;  2QSI A;  4KX4 A;  4J56 E;  1TU7 A;  5A4U A;  4ZL8 A;  4OO4 A;  2X99 A;  1FHE A;  4IJ3 A;  1SK0 A;  2C0E A;  5DVB A;  5EY6 A;  2PGT A;  1SKS B;  1V58 A;  2PPT A;  5LD0 A;  1O8X A;  4NXI A;  4BL7 B;  4CHS A;  4EDZ A;  3H93 A;  4CDO A;  3DRN A;  3ERG A;  2YNX A;  1PL2 A;  1J9B A;  2YWI A;  4IP1 A;  5AGY A;  3CTG A;  3GRX A;  5GST A;  3KH7 A;  2C3Q A;  4POL A;  1GUH A;  4NV2 A;  4IQA A;  1S3C A;  2XHF A;  2C0G A;  3F9U A;  5ECR B;  6GSW A;  4MPF A;  4EDY A;  4MJC A;  5D9V A;  4BWQ A;  1X0R A;  2HZE A;  2PVQ A;  1M0U A;  4F9Z A;  2HRK B;  3LYK A;  4EC0 A;  1K3O A;  3IK7 A;  1VGL A;  4ML1 A;  5ECM B;  4RQX A;  1M2A A;  4TXO B;  1A2L A;  2B5Y A;  2MMA A;  1JLW A;  2B7K A;  5GAN D;  1ON4 A;  5CYY A;  2RII A;  2OA7 A;  1FVJ A;  2P5R A;  1XOB A;  3K8N A;  2RM6 A;  1SKW B;  2R6K A;  4TW5 A;  1SKR B;  4PNG A;  4KW6 A;  2LQO A;  2ON5 A;  4AF2 A;  1TJD A;  5IIZ A;  3US3 A;  2NDO A;  18GS A;  2PUK C;  1HNB A;  3EVI A;  4AJ8 A;  4KUN A;  2REM A;  4EE0 A;  1AC1 A;  2DJ2 A;  4KDU A;  3O3T A;  4GLT A;  2V32 A;  1NSW A;  3DYR A;  1GSD A;  3PGT A;  2C0F A;  4MLY A;  3TJG A;  4PGT A;  4MF6 A;  1O81 A;  2V6K A;  5JCU A;  1T4Z A;  2YV7 A;  4TRX A;  1TTZ A;  5LNK e;  3ED3 A;  3EE2 A;  3A2V A;  3LYP A;  2VIM A;  1KEB A;  4GCI A;  5E4W A;  4HUA A;  1JLV A;  1BAY A;  4PQ1 A;  5B7C A;  2GST A;  2GQK A;  3L9S A;  5ELG A;  3D4M A;  5IOW A;  2K9F A;  1R5P A;  3Q19 A;  1Z7R A;  2JZT A;  3CMI A;  1ZCP A;  2GSR A;  2EIQ A;  1EZK A;  4V1A p;  1EEM A;  1O8W A;  3IAM 2;  1WP0 A;  1JZD A;  2DML A;  4NWY A;  1SL1 B;  5KN2 A;  5COH A;  1WRY A;  3MDK A;  4MMM A;  3RHC A;  2C1Y A;  4NPB A;  4MF7 A;  5D9W A;  2H6X A;  3D21 A;  3C7M A;  3KEB A;  2C3N A;  2NVL A;  4BWS A;  1VF3 A;  2L5O A;  3HDC A;  2ZCT A;  4J57 E;  1F3B A;  3IHQ A;  3EC3 A;  1A24 A;  3SBC A;  3HY2 A;  2IFQ B;  3IR4 A;  2HSM B;  1K0C A;  1FVK A;  3KP9 A;  2H0G A;  3IBH A;  1U88 A;  4GQC A;  3TB2 A;  5ECP B;  2AJQ B;  4OFN A;  5JCW A;  1BG5 A;  1PSQ A;  2FHE A;  2HSN B;  1TW9 A;  2WZ9 A;  2MMO A;  2NBS A;  2G2Q A;  4KCA A;  2HRK A;  2VLT A;  2PN8 A;  3ZRD A;  3GL3 A;  4TKY A;  1M99 A;  4ECB A;  2M46 A;  4MH3 A;  2H66 A;  2LRC A;  2DBC A;  14GS A;  2LV3 A;  3TJK A;  4TXO A;  1Z9H A;  1ZYQ B;  3KGK A;  4V1A g;  1AW9 A;  1M9B A;  2N5A A;  4FO5 A;  1XIY A;  2O7K A;  1TK0 B;  1YZX A;  1UA5 A;  2B5E A;  4OWY A;  4IP6 A;  1X5E A;  3ZRE A;  5CRW A;  1TK8 B;  4K2D A;  1GSS A;  1JFU A;  3DGQ A;  1FAA A;  5KN3 A;  2HFD A;  3M8N A;  1V57 A;  3GHA A;  5DCG A;  4N11 A;  3QOU A;  2YP6 A;  2BMX A;  1FW1 A;  3TRP A;  3WYW A;  3W8J A;  2FCH A;  1N2A A;  3KJY A;  2CAQ A;  3UVT A;  4N0V A;  2V1M A;  4HU7 A;  3KZQ A;  1TKD B;  2QGV A;  2HE3 A;  4ISD A;  4OCF A;  1PN9 A;  4CW9 A;  3GKX A;  2XC2 A;  2YOI A;  5CP1 A;  2KUC A;  2R4V A;  4IN0 A;  1XW9 A;  2E2G A;  3F3Q A;  2VL2 A;  4TVE A;  3VPQ A;  2H30 A;  3FHK A;  3WGX A;  2C80 A;  1GUK A;  3GTU B;  1XW5 A;  3GST A;  1YJ6 A;  3KCM A;  2VCZ A;  3TOT A;  4Q5F A;  1SL2 B;  1PRX A;  1QK8 A;  1OKT A;  4GWR A;  1WE0 A;  1F9M A;  4QQ7 A;  3L0H A;  1XWA A;  4WXT A;  3ISO A;  3U6V A;  4WKW A;  1XWG A;  5A4W A;  4IGJ A;  5DBQ A;  4HZ2 A;  3ZVJ A;  5INY A;  3IXR A;  2IL3 A;  3TJJ A;  1QXH A;  3Q6O A;  4GXZ A;  1ACV A;  1UC7 A;  1YEP A;  5J5N A;  2GQL A;  5DJM A;  1ZMA A;  5ECK B;  4IHU A;  3D4T A;  1X9M B;  4RUV A;  1AQW A;  3DVW A;  1WJK A;  4AJ7 A;  1SEN A;  2VCQ A;  2JSZ A;  3KIJ A;  2WRT A;  5F06 A;  3A2X A;  2N5F A;  2OAC A;  1Z6N A;  4ILF A;  3WD6 A;  1ERU A;  4KB3 A;  4BVX B;  3GKN A;  2AAW A;  1EV9 A;  1JZO A;  3WT1 A;  3VWV A;  3CSJ A;  2VCW A;  1SYR A;  1GNW A;  1ERW A;  3FR9 A;  4JZQ A;  1Z5Y E;  2X8G A;  1OVN A;  3CBU A;  4JR6 A;  3KTB A;  4FYC A;  3VFI A;  2K6V A;  3IE3 A;  5IMA A;  2NTO A;  3L9V A;  1ZOF A;  5B8A A;  3C8E A;  2FWE A;  4HZ4 A;  5D8I A;  3VI5 A;  2HI7 A;  5IMF A;  3KTL A;  3BOA A;  2CZ2 A;  4FYB A;  2GSQ A;  3TKS E;  3NOF A;  2WB9 A;  4YAV A;  4JRR A;  4E8H A;  1FOV A;  2WFC A;  4LLR A;  3ZYW A;  3BJ5 A;  1EP8 A;  1A8Y A;  3ZFL A;  1VF4 A;  3D5J A;  1IYH A;  5ELA A;  4ZB8 A;  4LL1 B;  4N30 A;  2H75 A;  3IAS 2;  2R37 A;  4HDE A;  2AYT A;  3UL3 A;  5IMV A;  3ZML A;  2JZR A;  3P90 A;  3FYG A;  11GS A;  2CX3 A;  4HEA 2;  4KAE A;  4D73 B;  1CQH A;  2JAD A;  2OE0 A;  1BQ7 A;  1QQ2 A;  5ID2 A;  3GSS A;  3ZIJ A;  2LS5 A;  1GTI A;  5JWR B;  1AUC A;  1F37 A;  1PKW A;  4EUY A;  4ZIJ A;  3C73 A;  2G0F A;  1HD2 A;  1QMV A;  2DIZ A;  2LRN A;  2DLX A;  1I9D A;  1RQM A;  4H86 A;  4YQV A;  2Z9S A;  2GZY A;  4KH7 A;  2XPE A;  4HJ2 A;  4TR1 B;  4MZB A;  1HNA A;  2V2G A;  2IIY A;  4DEJ A;  3VPT A;  3F0I A;  5IPG A;  5AN1 A;  3APO A;  3GKK A;  1PQN A;  2YV9 A;  2FWG A;  1GSE A;  5DJL A;  3A5W A;  1OE8 A;  2OAD A;  5DAL B;  2I81 A;  3FKF A;  2JAC A;  3QAG A;  1FB0 A;  2WUL A;  2HLS A;  5CNW A;  4L5L A;  4I2U A;  5J3R A;  4MJB A;  2YWO A;  4TR3 A;  4XIH A;  3R2Q A;  1JZR A;  2M72 A;  1YDK A;  1V9W A;  2KP1 A;  1BX9 A;  5G1L A;  2TRX A;  2WJU A;  2L5L A;  4FQU A;  2GSS A;  4PQI A;  2YWN A;  2LNT A;  19GS A;  3FZ5 A;  3H1N A;  1WPI A;  2LJA A;  1OC9 A;  2H1G A;  2VM2 A;  5L71 A;  1TI3 A;  2FNO A;  5IPH A;  4G10 A;  2H73 A;  4ACS A;  3IV4 A;  4G2E A;  1J0F A;  1MD4 A;  1A2J A;  4X43 A;  4KF9 A;  5C00 A;  4XS4 A;  3IRA A;  3HD5 A;  2QKE A;  1GSQ A;  3P2A A;  2KOK A;  1XWB A;  3I69 A;  3MWH A;  3QAV A;  1V2A A;  3EU3 A;  2YCD A;  4MA9 A;  3FY7 A;  1U3A A;  1ZZY A;  4EL1 A;  3QMX A;  22GS A;  1XW6 A;  3IC8 A;  4QL9 A;  3L9U A;  2VAF A;  2YZU A;  3TKR A;  5H5Q A;  3TRQ A;  1T3B A;  4KGI A;  5FWG A;  2K8V A;  3CXG A;  5HR1 A;  2B1K A;  4PQH A;  4FIW A;  3KH9 A;  2CVD A;  4ULX A;  1TRW A;  3O76 A;  1THO A;  2H1D A;  4DVC A;  3F6D A;  2B3S A;  3ZFB A;  2H1B A;  4ZBD A;  4XRD A;  4MK3 A;  1AQX A;  1H75 A;  1PL1 A;  2A2R A;  1B9X C;  3GMF A;  3HCZ A;  5CO3 A;  3QAW A;  1FB6 A;  3GA4 A;  2HSH A;  4JED A;  1HQO A;  2CQ9 A;  3QR6 A;  4MCU A;  4HOJ A;  2OBI A;  5B6M A;  1TK5 B;  5CRE A;  2DIY A;  2EIO A;  4HQS A;  1ILO A;  2BJX A;  2O89 A;  2XBI A;  1F3A A;  1ZYE A;  1N8J A;  3PR8 A;  5DAL A;  4O5R A;  3GH6 A;  3A2W A;  2DSA A;  4YH2 A;  1EOG A;  4F82 A;  3LWA A;  5DQS A;  4I6X A;  2FWF A;  20GS A;  1MTC A;  3HVX A;  3IDV A;  3UEM A;  2OBK A;  3RPP A;  3J7Y b;  2MYG A;  4POM A;  4ZL9 A;  2J23 A;  5ECN B;  2KHP A;  1GLQ A;  2GDR A;  6GSS A;  3HKR A;  5CAX A;  3W6G A;  5FHI A;  1SK2 A;  1UN2 A;  2LKU A;  5D9T A;  4GF0 A;  5CRD A;  4K7N A;  1U87 A;  17GS A;  2B5X A;  2L6C A;  2B7J A;  4FYU A;  1G7O A;  2FA4 A;  1T8E B;  3IK9 A;  3KMO A;  1PKZ A;  3GV1 A;  1X5C A;  2DMM A;  2HYX A;  4TN8 A;  3G7I A;  3EMX A;  5KEJ A;  2LTK A;  4BL7 A;  3TGZ A;  4IW9 A;  4G0K A;  2VL2 C;  2HT9 A;  3I9V 2;  2BTO T;  5CRG A;  2RUE A;  3F4T A;  2HXK A;  3GFK A;  1MEK A;  4WET A;  1EWX A;  5ECO B;  2NPB A;  1PMT A;  4OFT A;  3HJP A;  3CSH A;  2OE1 A;  1T1V A;  2H71 A;  3ZL5 A;  4IJI A;  4MH2 A;  5HQP A;  1A2M A;  4I8B A;  3DVX A;  2ALB A;  1A23 A;  1Z7P A;  4IS0 A;  3WGE A;  3EYT A;  2VO4 A;  3FEU A;  1PA3 A;  1T7P B;  2PER A;  3APS A;  2XBQ A;  16GS A;  5IOX A;  2GS3 A;  1OC8 A;  2O87 A;  3H4K A;  1A0R P;  1R4W A;  3DEX A;  1SJI A;  1CQG A;  2MBT A;  2E7P A;  4BVY B;  2HQT A;  3WGD A;  1YF0 A;  1QUW A;  2J9H A;  1V40 A;  2DJK A;  2VL3 A;  3LOR A;  1F6M C;  3HYP A;  2H6Y A;  3CTF A;  4XCS A;  2GLR A;  3RPN A;  2H76 A;  2RUF A;  4YQU A;  4TR4 A;  4WR5 A;  2R2J A;  3TKS A;  2FUG 2;  3GNJ A;  3BCI A;  2CZ3 A;  1O6J A;  1SL0 B;  2IWT A;  3DKS A;  2AV4 A;  3VI7 A;  3FR3 A;  1PD2 1;  4L5O A;  3MNG A;  1GTB A;  4DSR A;  1YKA A;  4ECI A;  1DBY A;  3M9J A;  4KSM A;  4O7H A;  3RDW A;  3M9K A;  3GKM A;  2ON7 A;  3GIX A;  5EPF A;  3OR5 A;  2TRC P;  1G6Y A;  2MMN A;  5IM9 A;  3CRU A;  1XBS A;  2LRT A;  2H19 A;  4LMV A;  1ABA A;  2CVK A;  4LA1 A;  3VK9 A;  3LGC A;  1A8L A;  3E9J B;  4N10 A;  5F0G A;  3ZLP A;  3DD3 A;  5H5R A;  2FD3 A;  1K0N A;  3LXZ A;  8GSS A;  2FY6 A;  5G5F A;  2H74 A;  2IN3 A;  4JBB A;  4DSS B;  1TXX A;  4G0I A;  2DJ3 A;  1C72 A;  1MDI A;  1NHO A;  2MMZ A;  3UJ1 A;  3VWW A;  2DJJ A;  3CYN A;  2JZS A;  1VF1 A;  1B48 A;  2IFQ A;  2HSM A;  2VD0 A;  4O92 A;  1GL8 A;  4ZB6 A;  3GH9 A;  4K7I A;  4KA0 A;  1R26 A;  5KN1 A;  3M1G A;  3C71 A;  1GSF A;  3TJB A;  2H01 A;  3S9F A;  2H8L A;  4PXO A;  2IJY A;  3LSZ A;  2P31 A;  5ECI B;  5HFK A;  4HJM A;  4NHZ A;  2B6M A;  1ZL9 A;  4K0N A;  3FZA A;  1HYU A;  3F4R A;  4K6X A;  4TR0 A;  5GAP D;  5G30 A;  3HHV A;  5F07 A;  2KP2 A;  4POB A;  3KMN A;  3PPU A;  2GTU A;  3ZMK A;  2JU5 A;  3VUR A;  1URM A;  3C1S A;  6GSU A;  3ZIT A;  3DXB A;  2JSY A;  2HZF A;  4RI7 A;  5D96 A;  3FRC A;  1W89 A;  3I43 A;  1H4O A;  3HA9 A;  5FT3 A;  3ERF A;  1WWJ A;  3FZ4 A;  2HRF A;  1TRU A;  2F9S A;  3APQ A;  12GS A;  3FR6 A;  1GUM A;  2KLX A;  1OAZ A;  4ZIL A;  1YY7 A;  2H72 A;  2YAN A;  5B6N A;  2GZP A;  3F63 A; 
#chains in the Genus database with same CATH topology
 4F0B A;  5HFI A;  3VLN A;  3IC4 A;  3BCK A;  3F4S A;  2R3X A;  4MAB A;  5AIS A;  1XXU A;  2HZE B;  3UBK A;  5A4V A;  3CSI A;  2YPM A;  3PH9 A;  4WF5 A;  3GN3 A;  4MF5 A;  3GTU A;  2WVX A;  4E68 A;  3M0F A;  4LMW A;  1X9S B;  3ZTL A;  2IPA A;  2VOC A;  3M3M A;  4PI0 C;  2CV4 A;  2VUP A;  3UAP A;  2LJR A;  1FG4 A;  1BJX A;  4L0W A;  2LQQ A;  3ZVJ D;  2AHE A;  1BED A;  1SYX A;  1TP9 A;  4K7O A;  2H6Z A;  3GUR A;  2V41 A;  3TCO A;  1K0B A;  4OCE A;  2CX4 A;  2HRN A;  1BF5 A;  4XS6 A;  2I3Y A;  1Q98 A;  2YJH A;  1FO5 A;  4TXV A;  5IO2 A;  5J4U A;  4IKH A;  4BVX A;  4PNF A;  1HNC A;  2F51 A;  2TIR A;  1LU4 A;  4K1F A;  1OYJ A;  1JZW A;  3TJF A;  4OD7 A;  3A5I A;  1K3Y A;  3QFA C;  1WMJ A;  3UIW A;  4HI7 A;  4G0L A;  1ERT A;  4I97 A;  4FH8 A;  2OKA A;  3F3R A;  2WS2 A;  4EF0 A;  1A0F A;  2PBJ A;  1VRS D;  4N3Z A;  2AUV A;  3UBL A;  4JU5 A;  2VCV A;  3GUS A;  1PX7 A;  4XRA A;  5LCZ A;  5EVO A;  3HXS A;  3TDG A;  1T4Y A;  2O8V B;  1YQ1 A;  5ENU A;  3LEF A;  3TKQ A;  1SD8 A;  3QCP A;  1FOH A;  4V2N A;  2OE3 A;  4GQF A;  1PGT A;  2H70 A;  3VWU A;  4V2M A;  3RHB A;  1WIK A;  3HZ8 A;  5A5H B;  1PX6 A;  1X9W B;  1BYE A;  2QC7 A;  3EUR A;  1M2D A;  3A3T A;  4EKZ A;  2WW3 A;  3FK8 A;  1SD9 A;  4MZC A;  3Q18 A;  4PUA A;  1F2E A;  4XTS A;  4GSN A;  6GSV A;  4XHM A;  2CA8 A;  1Z3E A;  3V1W A;  4HS1 A;  2L59 A;  4GTU A;  1GH2 A;  3UVH A;  2VCX A;  3L78 A;  1ML6 A;  4PX1 A;  1AIU A;  2VM1 A;  2O85 A;  4KDY A;  3U5R E;  4D73 A;  2EC4 A;  4K8M A;  5IQY A;  1GRX A;  1GSY A;  3EIN A;  1TI1 A;  2VLU A;  2WW2 A;  5D73 A;  3E0U A;  5CRH A;  4EO3 A;  2CVB A;  1S3D A;  1DSB A;  3HVS A;  2YN1 A;  2IMK A;  2K8S A;  4YQM A;  3TUE A;  5EL8 A;  4TR1 A;  1LBK A;  4G9H A;  2M80 A;  4PUR A;  2R0P A;  3LFL A;  3L4N A;  4HU9 A;  1DUG A;  2H0H A;  2JL4 A;  2GT6 A;  2P0G A;  2ZUP A;  1W4V A;  1MD3 A;  3E3E A;  2I9H A;  2RLI A;  4KSO A;  5J9C A;  2B1L A;  1XCC A;  1K0M A;  3HJM A;  1B4Q A;  4BA7 A;  1EP7 A;  4KE3 A;  5AIX A;  3QFB C;  3IHG A;  3RAZ A;  3TOU A;  5G31 A;  4EXJ A;  1YKC A;  2EIR A;  5DQY A;  2VLV A;  4X0X A;  3G9B A;  4N0Z A;  5IO0 A;  7GSS A;  5GZZ B;  2GZZ A;  2V6O A;  1V98 A;  5G1K A;  2HNL A;  4YAP A;  3IPZ A;  5J41 A;  1GP1 A;  3TKS C;  4F2I A;  3BBY A;  1J08 A;  2FA8 A;  3GYK A;  4AI6 A;  2PMT A;  5ECS A;  1TRS A;  4JR4 A;  4IBP A;  3PIN A;  6GSX A;  5ECQ B;  2C8U A;  5KN0 A;  3LQ7 A;  4O32 A;  2FLS A;  2HSY A;  5AIV A;  4I2T A;  4F0C A;  1Z6M A;  4NMU A;  4CY6 A;  4RI6 A;  2LNS A;  1O85 A;  2E2M A;  5ECL B;  4ICY A;  5F05 A;  4ZXG A;  1XWK A;  3KD0 A;  4BPY A;  2IMF A;  4POK A;  1RK4 A;  1O7U A;  4OFM A;  4MZW A;  1OC3 A;  2GQM A;  5ECH B;  1SJZ A;  2DJ0 A;  4YKF A;  5JWQ B;  4NAX A;  1TRV A;  1K3L A;  4A5P A;  4WBJ A;  4WEY A;  4Q5Q A;  4HQZ A;  2MBS A;  1Y25 A;  1GLP A;  5IMZ A;  5HR3 A;  1ST9 A;  1LJR A;  2RM5 A;  5HFG A;  2PVO C;  4L8E A;  4YKG A;  3H8Q A;  4NV5 A;  1GSU A;  4ECC A;  2VL9 A;  1R5A A;  1XVW A;  2I1U A;  2VCT A;  3RBT A;  1Y1U A;  1QGV A;  1MDK A;  4NHW A;  2YWM A;  3I6A A;  4IVF A;  1DE2 A;  1B4P A;  2X49 A;  4GSS A;  1USB A;  3UAR A;  1SK1 A;  1U6T A;  4KCE A;  2WDU A;  4ML6 A;  1QFN A;  1NM3 A;  5HR2 A;  1TU8 A;  4Z7X A;  2EFE A;  5B8B A;  2DKI A;  2VD1 A;  1AQV A;  5D93 A;  2D2Z A;  2DJ1 A;  1M2B A;  3QPM A;  1MDJ A;  4AJ6 A;  1E2Y A;  2GVP A;  2A4V A;  4IQ1 A;  1B8X A;  4KDX A;  4TOP A;  2PWJ A;  3P7X A;  3DWV A;  4WBR D;  3HMJ G;  4OO5 A;  2LUS A;  3N9J A;  1THX A;  1OKD A;  2WGR A;  2L4Q A;  1RW1 A;  4O5U A;  2GT5 A;  4K5R A;  4DSQ A;  1K0D A;  3IA1 A;  5A5K A;  1S4B P;  3GX0 A;  3CRT A;  4ZBB A;  3HJO A;  5BMU A;  6GST A;  5ID2 B;  3ZZX A;  4ID0 A;  4OMV A;  3GL5 A;  3EWL A;  5IMD A;  13GS A;  2A2S A;  6GSY A;  1EGR A;  4LL4 B;  2LST A;  3IOS A;  1NW2 A;  2P5Q A;  4K9Z A;  3P8W A;  1DE1 A;  1AXD A;  3W8S A;  3EMP A;  5GSS A;  1YEX A;  1ZGN A;  2C0D A;  1SJ6 A;  1E6B A;  5DDL A;  4P3Y B;  3MAK A;  2IME A;  5J9B A;  3F6F A;  3ERW A;  5A34 A;  1TXU A;  5DAK B;  1O73 A;  1UVZ A;  10GS A;  2PU9 C;  3TRX A;  1KNG A;  2I4A A;  1K0O A;  2R5G A;  2LEG A;  3HZ4 A;  2FWH A;  1EOH A;  3NZN A;  2R0C A;  1JHB A;  1G6W A;  4MJE A;  5IMC A;  2L4C A;  3ME7 A;  3DML A;  3D22 A;  2A2P A;  1K0A A;  2F8A A;  2IMD A;  2F3M A;  9GSS A;  2L6D A;  1AAZ A;  2WCI A;  1GTU A;  4WF4 A;  1EEJ A;  2H1A A;  2X64 A;  1Q4J A;  3FMW A;  4MPG A;  3GX8 A;  1XZO A;  2FGX A;  1OE7 A;  4KND A;  4RQR A;  2MZC A;  4EIP A;  2L57 A;  4MP4 A;  5KOW A;  4E8E A;  4AKI A;  4ZB9 A;  1S3A A;  2O3E A;  4J2F A;  2XPD A;  1IYI A;  1OC9 B;  1WOU A;  4EVM A;  4BVY A;  3N5O A;  1U3I A;  2C4J A;  2E0Q A;  2DC5 A;  1EV4 A;  1M9A A;  5G5E A;  3RGB C;  3AY8 A;  4PTS A;  3ME8 A;  4USS A;  4MJA A;  3F8U A;  4G19 A;  3NIV A;  1G0T A;  1M3J A;  3MSZ A;  5C04 A;  3FZ9 A;  4XS4 B;  3R3E A;  2OJL A;  4AKX B;  1T00 A;  1M7T A;  2IMI A;  3KP8 A;  3SWL A;  3KM6 A;  3J7Y k;  2GGT A;  3WT2 A;  1KBN A;  5DCH A;  4I5Q A;  5JCG A;  2F8F A;  2N5B A;  4AGS A;  3D6I A;  3LXT A;  1XOA A;  3G7Y A;  2ES7 A;  1GWC A;  1XFL A;  3EU4 A;  1XPV A;  4GRF A;  4Q5R A;  4X4J A;  3MYD A;  3UOM A;  3TKP A;  3JCM L;  1X5D A;  5F8B A;  5D9X A;  3DIE A;  1XVQ A;  1TOF A;  4L0U A;  3HVV A;  1VF2 A;  1I5G A;  1G7E A;  5E59 A;  1EGO A;  4IEL A;  1GTA A;  1ERV A;  1R7H A;  4X1U A;  1TDI A;  1KTE A;  4PI2 C;  3H79 A;  2C3T A;  5JWO B;  3VWX A;  4GST A;  2K18 A;  2CAI A;  3ZIV A;  4DSS A;  1GNE A;  4V2L A;  4Q5N A;  4K0G A;  2UZ8 A;  2YZH A;  1SU9 A;  4MDC A;  3LJR A;  5ABR A;  3O6T A;  4WR4 A;  3UMA A;  3D0Z A;  3G7J A;  5DAK A;  4ECJ A;  2AB6 A;  4F03 A;  1SVL A;  1B9Y C;  4PUF C;  3LG6 A;  3BD2 A;  3RFR C;  5G2Z A;  1XWC A;  1YF1 A;  2X8H A;  3C1R A;  3QDN A;  4K5S A;  3KXO A;  5H5S A;  1Y6E A;  2ZNM A;  2LJK A;  4ZL7 A;  4JE1 A;  3Q74 A;  4XS1 A;  2YJ7 A;  4QL7 A;  2CT6 A;  2HRA A;  1NHY A;  4ZBA A;  3QD9 A;  1GUL A;  2H0I A;  5HR0 A;  2X8C A;  3FW2 A;  2QSI A;  4KX4 A;  4J56 E;  5J4V A;  1TU7 A;  5A4U A;  4ZL8 A;  4OO4 A;  2X99 A;  1FHE A;  4IJ3 A;  1SK0 A;  2C0E A;  5DVB A;  5EY6 A;  2PGT A;  1SKS B;  1V58 A;  2PPT A;  5LD0 A;  1O8X A;  4NXI A;  4BL7 B;  4CHS A;  4EDZ A;  3H93 A;  4CDO A;  3DRN A;  3ERG A;  2YNX A;  1PL2 A;  1J9B A;  2YWI A;  4IP1 A;  5AGY A;  3CTG A;  3GRX A;  5GST A;  3KH7 A;  2C3Q A;  4POL A;  1GUH A;  4NV2 A;  4IQA A;  1S3C A;  2XHF A;  2C0G A;  3F9U A;  5ECR B;  6GSW A;  4MPF A;  4EDY A;  4MJC A;  5D9V A;  1XG8 A;  4BWQ A;  1X0R A;  2HZE A;  2PVQ A;  2X4A A;  1M0U A;  4F9Z A;  2HRK B;  3LYK A;  4EC0 A;  3CHX C;  1K3O A;  3IK7 A;  1VGL A;  4ML1 A;  5ECM B;  4RQX A;  1M2A A;  4TXO B;  1A2L A;  2B5Y A;  2MMA A;  1JLW A;  2B7K A;  2WZS A;  5GAN D;  1ON4 A;  5CYY A;  2A4H A;  2RII A;  2OA7 A;  1FVJ A;  2P5R A;  1XOB A;  3K8N A;  2RM6 A;  1SKW B;  2R6K A;  4TW5 A;  1SKR B;  4PNG A;  4KW6 A;  2LQO A;  2ON5 A;  4AF2 A;  1TJD A;  5IIZ A;  5A1N B;  3LW9 A;  3US3 A;  2NDO A;  18GS A;  2PUK C;  1HNB A;  3EVI A;  4AJ8 A;  4KUN A;  2REM A;  4EE0 A;  1AC1 A;  2DJ2 A;  4KDU A;  3O3T A;  4GLT A;  2V32 A;  1NSW A;  3DYR A;  4Z2R A;  1GSD A;  3PGT A;  2C0F A;  4MLY A;  3TJG A;  4PGT A;  4MF6 A;  1O81 A;  2V6K A;  5JCU A;  1T4Z A;  2YV7 A;  4TRX A;  1TTZ A;  3MIX A;  2EFC A;  5LNK e;  3ED3 A;  3EE2 A;  3A2V A;  3LYP A;  2VIM A;  1KEB A;  4GCI A;  5E4W A;  4HUA A;  1JLV A;  1BAY A;  4PQ1 A;  5B7C A;  2GST A;  2GQK A;  3L9S A;  2O36 A;  5ELG A;  3D4M A;  5IOW A;  2K9F A;  1R5P A;  3Q19 A;  1Z7R A;  2JZT A;  3CMI A;  1ZCP A;  2GSR A;  2EIQ A;  1EZK A;  4V1A p;  1EEM A;  1O8W A;  3IAM 2;  1WP0 A;  1JZD A;  2DML A;  4NWY A;  1SL1 B;  5KN2 A;  5A5H A;  5COH A;  1S3R A;  1WRY A;  3MDK A;  4MMM A;  3RHC A;  2C1Y A;  4NPB A;  4MF7 A;  5D9W A;  2H6X A;  3D21 A;  3C7M A;  3KEB A;  2C3N A;  2NVL A;  4BWS A;  1VF3 A;  2L5O A;  3HDC A;  2ZCT A;  4J57 E;  1F3B A;  3IHQ A;  3EC3 A;  1A24 A;  3SBC A;  3HY2 A;  2IFQ B;  3IR4 A;  2HSM B;  1K0C A;  1FVK A;  3KP9 A;  2H0G A;  3IBH A;  1U88 A;  4GQC A;  3TB2 A;  5ECP B;  4W66 A;  2AJQ B;  4OFN A;  5JCW A;  1BG5 A;  1PSQ A;  2FHE A;  2HSN B;  1TW9 A;  2WZ9 A;  2MMO A;  2NBS A;  2G2Q A;  4KCA A;  2HRK A;  2VLT A;  2PN8 A;  3ZRD A;  3GL3 A;  4TKY A;  1M99 A;  4ECB A;  2M46 A;  4MH3 A;  2H66 A;  2LRC A;  2DBC A;  14GS A;  2LV3 A;  3TJK A;  4TXO A;  1Z9H A;  1ZYQ B;  4FXY P;  3KGK A;  4V1A g;  4ZB7 A;  1AW9 A;  1M9B A;  2N5A A;  4FO5 A;  4G01 A;  1XIY A;  2O7K A;  1TK0 B;  1YZX A;  1UA5 A;  2B5E A;  4OWY A;  4IP6 A;  1X5E A;  3ZRE A;  5CRW A;  1TK8 B;  4K2D A;  1GSS A;  1JFU A;  3DGQ A;  2O5V A;  1FAA A;  5KN3 A;  2HFD A;  3M8N A;  1V57 A;  5A1N A;  3GHA A;  5DCG A;  4N11 A;  3QOU A;  2YP6 A;  2BMX A;  1FW1 A;  3TRP A;  3WYW A;  3W8J A;  2FCH A;  1N2A A;  3KJY A;  2CAQ A;  3UVT A;  4N0V A;  2V1M A;  4HU7 A;  3KZQ A;  1TKD B;  2QGV A;  2HE3 A;  4ISD A;  4OCF A;  1PN9 A;  4CW9 A;  3GKX A;  2XC2 A;  2YOI A;  5CP1 A;  2KUC A;  2R4V A;  4BIK A;  4IN0 A;  1XW9 A;  2E2G A;  2EFH A;  1ZYN A;  3F3Q A;  2VL2 A;  4TVE A;  3VPQ A;  2H30 A;  3FHK A;  3WGX A;  4AKH A;  2C80 A;  1GUK A;  5KOX A;  3GTU B;  1XW5 A;  3GST A;  1YJ6 A;  3KCM A;  2VCZ A;  2WVX B;  3TOT A;  4Q5F A;  1SL2 B;  1PRX A;  1QK8 A;  1OKT A;  4GWR A;  1WE0 A;  1F9M A;  4QQ7 A;  3L0H A;  1XWA A;  4WXT A;  3ISO A;  3U6V A;  4WKW A;  1XWG A;  5A4W A;  4IGJ A;  5DBQ A;  4HZ2 A;  3ZVJ A;  5INY A;  3IXR A;  2IL3 A;  3TJJ A;  1QXH A;  1ZYP A;  3Q6O A;  4GXZ A;  4O5Q A;  1ACV A;  1UC7 A;  4QMK A;  5J5N A;  1YEP A;  5DJM A;  2GQL A;  1ZMA A;  3TU3 B;  5ECK B;  4IHU A;  3D4T A;  1X9M B;  4RUV A;  1AQW A;  3DVW A;  1WJK A;  4AJ7 A;  1SEN A;  2VCQ A;  2JSZ A;  3KIJ A;  2WRT A;  5F06 A;  3A2X A;  2N5F A;  2OAC A;  1Z6N A;  4ILF A;  3WD6 A;  1ERU A;  4KB3 A;  4BVX B;  3GKN A;  2AAW A;  1EV9 A;  1JZO A;  3WT1 A;  3VWV A;  3CSJ A;  2VCW A;  1SYR A;  1GNW A;  2WW1 A;  3HVN A;  1ERW A;  3FR9 A;  4JZQ A;  1Z5Y E;  2X8G A;  1OVN A;  3CBU A;  4JR6 A;  3KTB A;  3CQF A;  4FYC A;  3VFI A;  2K6V A;  3IE3 A;  5IMA A;  4EIQ A;  2NTO A;  3L9V A;  1ZOF A;  5B8A A;  3C8E A;  2FWE A;  4HZ4 A;  5D8I A;  3VI5 A;  2HI7 A;  5IMF A;  3KTL A;  3BOA A;  2CZ2 A;  4FYB A;  2GSQ A;  3TKS E;  3NOF A;  2WB9 A;  4YAV A;  4JRR A;  4E8H A;  1FOV A;  2WFC A;  4LLR A;  3ZYW A;  3BJ5 A;  1EP8 A;  1A8Y A;  3ZFL A;  1VF4 A;  3D5J A;  3EPT A;  1IYH A;  5ELA A;  4ZB8 A;  4LL1 B;  4N30 A;  2H75 A;  3IAS 2;  2R37 A;  4HDE A;  2AYT A;  3UL3 A;  5IMV A;  3ZML A;  2JZR A;  3P90 A;  3FYG A;  11GS A;  2CX3 A;  4Z2U A;  4HEA 2;  4KAE A;  4D73 B;  1BG1 A;  1CQH A;  2JAD A;  2OE0 A;  1BQ7 A;  4Z2T A;  1QQ2 A;  5ID2 A;  3GSS A;  3ZIJ A;  2LS5 A;  1GTI A;  5JWR B;  1AUC A;  1F37 A;  1PKW A;  1PFO A;  4EUY A;  4ZIJ A;  3C73 A;  2G0F A;  1HD2 A;  1QMV A;  2DIZ A;  2LRN A;  2DLX A;  1I9D A;  1RQM A;  4H86 A;  4YQV A;  2Z9S A;  2GZY A;  4KH7 A;  2XPE A;  4HJ2 A;  4AKG A;  4TR1 B;  4MZB A;  1HNA A;  2V2G A;  2IIY A;  4DEJ A;  3VPT A;  3F0I A;  5IPG A;  5AN1 A;  3APO A;  3GKK A;  4GDF A;  1PQN A;  2YV9 A;  2FWG A;  3CWG A;  1GSE A;  5DJL A;  3A5W A;  1OE8 A;  2OAD A;  5DAL B;  4MNN A;  2I81 A;  3FKF A;  2JAC A;  3QAG A;  1FB0 A;  1PN0 A;  2WUL A;  2HLS A;  5CNW A;  4L5L A;  4I2U A;  5J3R A;  4MJB A;  2YWO A;  4TR3 A;  4XIH A;  3R2Q A;  1JZR A;  2DKH A;  2M72 A;  1YDK A;  1V9W A;  2KP1 A;  1BX9 A;  5G1L A;  2TRX A;  2WJU A;  2L5L A;  2EFD A;  2GSS A;  4FQU A;  1I1I P;  4PQI A;  2YWN A;  2LNT A;  19GS A;  3FZ5 A;  3H1N A;  1WPI A;  2LJA A;  1OC9 A;  2H1G A;  2VM2 A;  5L71 A;  1TI3 A;  2FNO A;  2QA1 A;  4G10 A;  5IPH A;  2H73 A;  4ACS A;  2UV8 G;  3IV4 A;  4G2E A;  1J0F A;  1MD4 A;  1A2J A;  4X43 A;  2H1L A;  4KF9 A;  5C00 A;  4XS4 A;  3IRA A;  3HD5 A;  2QKE A;  1GSQ A;  3P2A A;  2KOK A;  1XWB A;  3I69 A;  3MWH A;  3QAV A;  1V2A A;  3EU3 A;  2YCD A;  4MA9 A;  3FY7 A;  1U3A A;  1ZZY A;  4EL1 A;  3QMX A;  22GS A;  1XW6 A;  3IC8 A;  4QL9 A;  3L9U A;  2VAF A;  2YZU A;  3TKR A;  5H5Q A;  3TRQ A;  1T3B A;  4KGI A;  5FWG A;  4CY8 A;  2K8V A;  3CXG A;  5HR1 A;  2B1K A;  1N25 A;  4PQH A;  5J40 A;  4FIW A;  3KH9 A;  2CVD A;  4ULX A;  1TRW A;  3O76 A;  1THO A;  2H1D A;  4DVC A;  3F6D A;  2B3S A;  3ZFB A;  2H1B A;  4ZBD A;  4XRD A;  4MK3 A;  5BRT A;  1AQX A;  1H75 A;  1PL1 A;  5J47 A;  2A2R A;  1B9X C;  3GMF A;  3HCZ A;  5CO3 A;  3QAW A;  1FB6 A;  3GA4 A;  2HSH A;  4JED A;  1HQO A;  2CQ9 A;  3QR6 A;  4MCU A;  4HOJ A;  2OBI A;  5B6M A;  1TK5 B;  5CRE A;  2DIY A;  2EIO A;  4K2X A;  4HQS A;  1ILO A;  2BJX A;  2O89 A;  2XBI A;  4PHZ C;  1F3A A;  1ZYE A;  2OT3 A;  1N8J A;  3PR8 A;  5DAL A;  4O5R A;  3GH6 A;  3A2W A;  2DSA A;  4YH2 A;  1EOG A;  4F82 A;  3LWA A;  5DQS A;  4I6X A;  2FWF A;  20GS A;  1MTC A;  3HVX A;  3IDV A;  1SVO A;  3UEM A;  2OBK A;  3RPP A;  3J7Y b;  2MYG A;  4POM A;  4ZL9 A;  5BMU B;  2J23 A;  5ECN B;  2KHP A;  1GLQ A;  2GDR A;  6GSS A;  3HKR A;  5CAX A;  3W6G A;  5FHI A;  1SK2 A;  1UN2 A;  2LKU A;  5D9T A;  4GF0 A;  5CRD A;  4K7N A;  1U87 A;  17GS A;  2B5X A;  2L6C A;  2B7J A;  4FYU A;  1G7O A;  2FA4 A;  1T8E B;  2WVY A;  3IK9 A;  3KMO A;  1PKZ A;  3GV1 A;  1X5C A;  2DMM A;  2HYX A;  4TN8 A;  3G7I A;  3EMX A;  4HSC X;  5KEJ A;  1M3I A;  5A34 B;  2R0G A;  2LTK A;  4BL7 A;  3TGZ A;  4IW9 A;  2QA2 A;  4G0K A;  2VL2 C;  2HT9 A;  3I9V 2;  2BTO T;  5CRG A;  2RUE A;  3F4T A;  2HXK A;  2VKZ G;  3GFK A;  1MEK A;  4WET A;  1EWX A;  5ECO B;  2NPB A;  1PMT A;  4OFT A;  3HJP A;  3CSH A;  2OE1 A;  1T1V A;  2H71 A;  3ZL5 A;  4IJI A;  4MH2 A;  5HQP A;  1A2M A;  4I8B A;  3DVX A;  2ALB A;  1A23 A;  1Z7P A;  4IS0 A;  3WGE A;  3EYT A;  2VO4 A;  3FEU A;  1PA3 A;  1T7P B;  2PER A;  5J4Y A;  3APS A;  2XBQ A;  16GS A;  5IOX A;  2GS3 A;  1OC8 A;  3H4K A;  2O87 A;  1A0R P;  1R4W A;  3DEX A;  1SJI A;  1CQG A;  2MBT A;  2E7P A;  4BVY B;  2HQT A;  3WGD A;  1YF0 A;  1QUW A;  2J9H A;  1V40 A;  2DJK A;  2VL3 A;  3LOR A;  1F6M C;  3HYP A;  2H6Y A;  3CTF A;  4XCS A;  2GLR A;  3RPN A;  2H76 A;  2RUF A;  4YQU A;  4TR4 A;  4WR5 A;  2R2J A;  3TKS A;  2FUG 2;  3GNJ A;  3BCI A;  2CZ3 A;  1O6J A;  1SL0 B;  2IWT A;  3DKS A;  2AV4 A;  3VI7 A;  1YVL A;  3FR3 A;  1PD2 1;  4L5O A;  3MNG A;  1GTB A;  4DSR A;  1YKA A;  4ECI A;  1DBY A;  3M9J A;  4KSM A;  4O7H A;  3RDW A;  3M9K A;  3GKM A;  2ON7 A;  3GIX A;  5EPF A;  3OR5 A;  2TRC P;  1G6Y A;  2MMN A;  5IM9 A;  3CRU A;  1XBS A;  2LRT A;  2H19 A;  4LMV A;  1ABA A;  2CVK A;  4LA1 A;  3VK9 A;  3LGC A;  1A8L A;  3E9J B;  4N10 A;  5F0G A;  3ZLP A;  3DD3 A;  5H5R A;  2FD3 A;  1K0N A;  3LXZ A;  8GSS A;  2FY6 A;  5G5F A;  2H74 A;  2IN3 A;  4JBB A;  4DSS B;  1TXX A;  4G0I A;  2DJ3 A;  1C72 A;  1MDI A;  1NHO A;  2MMZ A;  3UJ1 A;  3VWW A;  2DJJ A;  3CYN A;  2JZS A;  1VF1 A;  1B48 A;  2IFQ A;  2HSM A;  2VD0 A;  4O92 A;  2WW0 A;  1GL8 A;  4ZB6 A;  3GH9 A;  4K7I A;  4KA0 A;  1R26 A;  5KN1 A;  3M1G A;  3C71 A;  1GSF A;  3TJB A;  2H01 A;  3S9F A;  2H8L A;  4PXO A;  2IJY A;  2HSN A;  3LSZ A;  2P31 A;  5ECI B;  5HFK A;  4HJM A;  4NHZ A;  2B6M A;  1ZL9 A;  4K0N A;  3FZA A;  1HYU A;  3F4R A;  4K6X A;  4TR0 A;  5GAP D;  5G30 A;  3HHV A;  5F07 A;  1SVM A;  2KP2 A;  4POB A;  3KMN A;  3PPU A;  2GTU A;  3ZMK A;  2JU5 A;  3VUR A;  1URM A;  3C1S A;  6GSU A;  1YEW C;  3ZIT A;  3DXB A;  2JSY A;  2HZF A;  4RI7 A;  5D96 A;  3FRC A;  1W89 A;  3I43 A;  1H4O A;  3HA9 A;  5FT3 A;  3ERF A;  1WWJ A;  3FZ4 A;  2HRF A;  1TRU A;  2WVZ A;  2F9S A;  3APQ A;  12GS A;  3FR6 A;  1GUM A;  2KLX A;  1OAZ A;  4ZIL A;  1YY7 A;  2H72 A;  2YAN A;  5B6N A;  2GZP A;  3F63 A; 
#chains in the Genus database with same CATH homology
 4F0B A;  5HFI A;  3VLN A;  3IC4 A;  3BCK A;  3F4S A;  2R3X A;  4MAB A;  5AIS A;  1XXU A;  2HZE B;  3UBK A;  5A4V A;  3CSI A;  2YPM A;  3PH9 A;  4WF5 A;  3GN3 A;  4MF5 A;  3GTU A;  4E68 A;  3M0F A;  4LMW A;  1X9S B;  3ZTL A;  2IPA A;  2VOC A;  3M3M A;  2CV4 A;  2VUP A;  3UAP A;  2LJR A;  1FG4 A;  1BJX A;  4L0W A;  2LQQ A;  3ZVJ D;  2AHE A;  1BED A;  1SYX A;  1TP9 A;  4K7O A;  2H6Z A;  3GUR A;  2V41 A;  3TCO A;  1K0B A;  4OCE A;  2CX4 A;  2HRN A;  1BF5 A;  4XS6 A;  2I3Y A;  1Q98 A;  2YJH A;  1FO5 A;  4TXV A;  5IO2 A;  5J4U A;  4IKH A;  4BVX A;  4PNF A;  1HNC A;  2F51 A;  2TIR A;  1LU4 A;  4K1F A;  1OYJ A;  1JZW A;  3TJF A;  4OD7 A;  3A5I A;  1K3Y A;  3QFA C;  1WMJ A;  3UIW A;  4HI7 A;  4G0L A;  1ERT A;  4I97 A;  4FH8 A;  2OKA A;  3F3R A;  2WS2 A;  4EF0 A;  1A0F A;  2PBJ A;  1VRS D;  4N3Z A;  2AUV A;  3UBL A;  4JU5 A;  2VCV A;  3GUS A;  1PX7 A;  4XRA A;  5LCZ A;  5EVO A;  3HXS A;  3TDG A;  1T4Y A;  2O8V B;  1YQ1 A;  5ENU A;  3LEF A;  3TKQ A;  1SD8 A;  3QCP A;  1FOH A;  4V2N A;  2OE3 A;  4GQF A;  1PGT A;  2H70 A;  3VWU A;  4V2M A;  3RHB A;  1WIK A;  3HZ8 A;  5A5H B;  1PX6 A;  1X9W B;  1BYE A;  2QC7 A;  3EUR A;  1M2D A;  3A3T A;  4EKZ A;  3FK8 A;  1SD9 A;  4MZC A;  3Q18 A;  4PUA A;  1F2E A;  4XTS A;  4GSN A;  6GSV A;  4XHM A;  2CA8 A;  1Z3E A;  3V1W A;  4HS1 A;  2L59 A;  4GTU A;  1GH2 A;  3UVH A;  3L78 A;  2VCX A;  1ML6 A;  4PX1 A;  1AIU A;  2VM1 A;  2O85 A;  4KDY A;  3U5R E;  4D73 A;  2EC4 A;  4K8M A;  5IQY A;  1GRX A;  1GSY A;  3EIN A;  1TI1 A;  2VLU A;  5D73 A;  3E0U A;  5CRH A;  4EO3 A;  2CVB A;  1S3D A;  1DSB A;  3HVS A;  2YN1 A;  2IMK A;  2K8S A;  4YQM A;  3TUE A;  5EL8 A;  4TR1 A;  1LBK A;  4G9H A;  2M80 A;  4PUR A;  2R0P A;  3LFL A;  3L4N A;  4HU9 A;  1DUG A;  2H0H A;  2JL4 A;  2GT6 A;  2P0G A;  2ZUP A;  1W4V A;  1MD3 A;  3E3E A;  2I9H A;  2RLI A;  4KSO A;  5J9C A;  2B1L A;  1XCC A;  1K0M A;  3HJM A;  1B4Q A;  4BA7 A;  1EP7 A;  4KE3 A;  5AIX A;  3QFB C;  3IHG A;  3RAZ A;  3TOU A;  5G31 A;  4EXJ A;  1YKC A;  2EIR A;  5DQY A;  2VLV A;  4X0X A;  3G9B A;  4N0Z A;  5IO0 A;  7GSS A;  5GZZ B;  2GZZ A;  2V6O A;  1V98 A;  5G1K A;  2HNL A;  4YAP A;  3IPZ A;  5J41 A;  1GP1 A;  3TKS C;  4F2I A;  3BBY A;  1J08 A;  2FA8 A;  3GYK A;  4AI6 A;  2PMT A;  5ECS A;  1TRS A;  4JR4 A;  4IBP A;  3PIN A;  6GSX A;  5ECQ B;  2C8U A;  5KN0 A;  3LQ7 A;  4O32 A;  2FLS A;  2HSY A;  5AIV A;  4I2T A;  4F0C A;  1Z6M A;  4NMU A;  4CY6 A;  4RI6 A;  2LNS A;  1O85 A;  2E2M A;  5ECL B;  4ICY A;  5F05 A;  4ZXG A;  1XWK A;  3KD0 A;  4BPY A;  2IMF A;  4POK A;  1RK4 A;  1O7U A;  4OFM A;  4MZW A;  1OC3 A;  2GQM A;  5ECH B;  1SJZ A;  2DJ0 A;  4YKF A;  5JWQ B;  4NAX A;  1TRV A;  1K3L A;  4A5P A;  4WBJ A;  4WEY A;  4Q5Q A;  4HQZ A;  2MBS A;  1Y25 A;  1GLP A;  5IMZ A;  5HR3 A;  1ST9 A;  1LJR A;  2RM5 A;  5HFG A;  2PVO C;  4L8E A;  4YKG A;  3H8Q A;  4NV5 A;  1GSU A;  4ECC A;  2VL9 A;  1R5A A;  1XVW A;  2I1U A;  2VCT A;  3RBT A;  1Y1U A;  1QGV A;  1MDK A;  4NHW A;  2YWM A;  3I6A A;  4IVF A;  1DE2 A;  1B4P A;  2X49 A;  4GSS A;  1USB A;  3UAR A;  1SK1 A;  1U6T A;  4KCE A;  2WDU A;  4ML6 A;  1QFN A;  1NM3 A;  5HR2 A;  1TU8 A;  4Z7X A;  2EFE A;  5B8B A;  2DKI A;  2VD1 A;  1AQV A;  5D93 A;  2D2Z A;  2DJ1 A;  1M2B A;  3QPM A;  1MDJ A;  4AJ6 A;  1E2Y A;  2GVP A;  2A4V A;  4IQ1 A;  1B8X A;  4KDX A;  4TOP A;  2PWJ A;  3P7X A;  3DWV A;  4WBR D;  3HMJ G;  4OO5 A;  2LUS A;  3N9J A;  1THX A;  1OKD A;  2WGR A;  2L4Q A;  1RW1 A;  4O5U A;  2GT5 A;  4K5R A;  4DSQ A;  1K0D A;  5A5K A;  3IA1 A;  3GX0 A;  4ZBB A;  3CRT A;  3HJO A;  5BMU A;  6GST A;  5ID2 B;  3ZZX A;  4ID0 A;  4OMV A;  3GL5 A;  3EWL A;  5IMD A;  13GS A;  2A2S A;  6GSY A;  1EGR A;  4LL4 B;  2LST A;  3IOS A;  1NW2 A;  2P5Q A;  4K9Z A;  3P8W A;  1DE1 A;  1AXD A;  3W8S A;  3EMP A;  5GSS A;  1YEX A;  1ZGN A;  2C0D A;  1SJ6 A;  1E6B A;  5DDL A;  4P3Y B;  3MAK A;  2IME A;  5J9B A;  3F6F A;  3ERW A;  5A34 A;  1TXU A;  5DAK B;  1O73 A;  1UVZ A;  10GS A;  2PU9 C;  3TRX A;  1KNG A;  2I4A A;  1K0O A;  2R5G A;  2LEG A;  3HZ4 A;  2FWH A;  1EOH A;  3NZN A;  2R0C A;  1JHB A;  1G6W A;  4MJE A;  5IMC A;  2L4C A;  3ME7 A;  3DML A;  3D22 A;  2A2P A;  1K0A A;  2F8A A;  2IMD A;  2F3M A;  9GSS A;  2L6D A;  1AAZ A;  2WCI A;  1GTU A;  4WF4 A;  1EEJ A;  2H1A A;  2X64 A;  1Q4J A;  3FMW A;  4MPG A;  3GX8 A;  1XZO A;  2FGX A;  1OE7 A;  4KND A;  4RQR A;  2MZC A;  4EIP A;  2L57 A;  4MP4 A;  5KOW A;  4E8E A;  4AKI A;  4ZB9 A;  1S3A A;  4J2F A;  2XPD A;  1IYI A;  1OC9 B;  1WOU A;  4EVM A;  4BVY A;  3N5O A;  1U3I A;  2C4J A;  2E0Q A;  2DC5 A;  1EV4 A;  1M9A A;  5G5E A;  3AY8 A;  4PTS A;  3ME8 A;  4USS A;  4MJA A;  3F8U A;  4G19 A;  3NIV A;  1G0T A;  3MSZ A;  5C04 A;  3FZ9 A;  4XS4 B;  3R3E A;  2OJL A;  4AKX B;  1T00 A;  1M7T A;  2IMI A;  3KP8 A;  3SWL A;  3KM6 A;  3J7Y k;  2GGT A;  3WT2 A;  1KBN A;  5DCH A;  4I5Q A;  5JCG A;  2F8F A;  2N5B A;  4AGS A;  3D6I A;  3LXT A;  1XOA A;  3G7Y A;  2ES7 A;  1GWC A;  1XFL A;  3EU4 A;  1XPV A;  4GRF A;  4Q5R A;  4X4J A;  3MYD A;  3UOM A;  3TKP A;  3JCM L;  1X5D A;  5F8B A;  5D9X A;  3DIE A;  1XVQ A;  1TOF A;  4L0U A;  3HVV A;  1VF2 A;  1I5G A;  1G7E A;  5E59 A;  1EGO A;  4IEL A;  1GTA A;  1ERV A;  1R7H A;  4X1U A;  1TDI A;  1KTE A;  3H79 A;  2C3T A;  5JWO B;  3VWX A;  4GST A;  2K18 A;  2CAI A;  3ZIV A;  4DSS A;  1GNE A;  4V2L A;  4Q5N A;  4K0G A;  2UZ8 A;  2YZH A;  1SU9 A;  4MDC A;  3LJR A;  5ABR A;  3O6T A;  4WR4 A;  3UMA A;  3D0Z A;  3G7J A;  5DAK A;  4ECJ A;  2AB6 A;  4F03 A;  1SVL A;  1B9Y C;  4PUF C;  3LG6 A;  3BD2 A;  5G2Z A;  1XWC A;  1YF1 A;  2X8H A;  3C1R A;  3QDN A;  4K5S A;  3KXO A;  5H5S A;  1Y6E A;  2ZNM A;  2LJK A;  4ZL7 A;  4JE1 A;  3Q74 A;  4XS1 A;  2YJ7 A;  4QL7 A;  2CT6 A;  2HRA A;  1NHY A;  4ZBA A;  3QD9 A;  1GUL A;  2H0I A;  5HR0 A;  2X8C A;  3FW2 A;  2QSI A;  4KX4 A;  4J56 E;  5J4V A;  1TU7 A;  5A4U A;  4ZL8 A;  4OO4 A;  2X99 A;  1FHE A;  4IJ3 A;  1SK0 A;  2C0E A;  5DVB A;  5EY6 A;  2PGT A;  1SKS B;  1V58 A;  2PPT A;  5LD0 A;  1O8X A;  4NXI A;  4BL7 B;  4CHS A;  4EDZ A;  3H93 A;  4CDO A;  3DRN A;  3ERG A;  2YNX A;  1PL2 A;  1J9B A;  2YWI A;  4IP1 A;  5AGY A;  3CTG A;  3GRX A;  5GST A;  3KH7 A;  2C3Q A;  4POL A;  1GUH A;  4NV2 A;  4IQA A;  1S3C A;  2XHF A;  2C0G A;  3F9U A;  5ECR B;  6GSW A;  4MPF A;  4EDY A;  4MJC A;  5D9V A;  4BWQ A;  1X0R A;  2HZE A;  2PVQ A;  2X4A A;  1M0U A;  4F9Z A;  2HRK B;  3LYK A;  4EC0 A;  1K3O A;  3IK7 A;  1VGL A;  4ML1 A;  5ECM B;  4RQX A;  1M2A A;  4TXO B;  1A2L A;  2B5Y A;  2MMA A;  1JLW A;  2B7K A;  5GAN D;  1ON4 A;  5CYY A;  2A4H A;  2RII A;  2OA7 A;  1FVJ A;  2P5R A;  1XOB A;  3K8N A;  2RM6 A;  1SKW B;  2R6K A;  4TW5 A;  1SKR B;  4PNG A;  4KW6 A;  2LQO A;  2ON5 A;  4AF2 A;  1TJD A;  5IIZ A;  5A1N B;  3LW9 A;  3US3 A;  2NDO A;  18GS A;  2PUK C;  1HNB A;  3EVI A;  4AJ8 A;  4KUN A;  2REM A;  4EE0 A;  1AC1 A;  2DJ2 A;  4KDU A;  3O3T A;  4GLT A;  2V32 A;  1NSW A;  3DYR A;  4Z2R A;  1GSD A;  3PGT A;  2C0F A;  4MLY A;  3TJG A;  4PGT A;  4MF6 A;  1O81 A;  2V6K A;  5JCU A;  1T4Z A;  2YV7 A;  4TRX A;  1TTZ A;  3MIX A;  2EFC A;  5LNK e;  3ED3 A;  3EE2 A;  3A2V A;  3LYP A;  2VIM A;  1KEB A;  4GCI A;  5E4W A;  4HUA A;  1JLV A;  1BAY A;  4PQ1 A;  5B7C A;  2GST A;  2GQK A;  3L9S A;  5ELG A;  3D4M A;  5IOW A;  2K9F A;  1R5P A;  3Q19 A;  1Z7R A;  2JZT A;  3CMI A;  1ZCP A;  2GSR A;  2EIQ A;  1EZK A;  4V1A p;  1EEM A;  1O8W A;  3IAM 2;  1WP0 A;  1JZD A;  2DML A;  4NWY A;  1SL1 B;  5KN2 A;  5A5H A;  5COH A;  1WRY A;  3MDK A;  4MMM A;  3RHC A;  2C1Y A;  4NPB A;  4MF7 A;  5D9W A;  2H6X A;  3D21 A;  3C7M A;  3KEB A;  2C3N A;  2NVL A;  4BWS A;  1VF3 A;  2L5O A;  3HDC A;  2ZCT A;  4J57 E;  1F3B A;  3IHQ A;  3EC3 A;  1A24 A;  3SBC A;  3HY2 A;  2IFQ B;  3IR4 A;  2HSM B;  1K0C A;  1FVK A;  3KP9 A;  2H0G A;  3IBH A;  1U88 A;  4GQC A;  3TB2 A;  5ECP B;  4W66 A;  2AJQ B;  4OFN A;  5JCW A;  1BG5 A;  1PSQ A;  2FHE A;  2HSN B;  1TW9 A;  2WZ9 A;  2MMO A;  2NBS A;  2G2Q A;  4KCA A;  2HRK A;  2VLT A;  2PN8 A;  3ZRD A;  3GL3 A;  4TKY A;  1M99 A;  4ECB A;  2M46 A;  4MH3 A;  2H66 A;  2LRC A;  2DBC A;  14GS A;  2LV3 A;  3TJK A;  4TXO A;  1Z9H A;  1ZYQ B;  3KGK A;  4V1A g;  4ZB7 A;  1AW9 A;  1M9B A;  2N5A A;  4FO5 A;  4G01 A;  1XIY A;  2O7K A;  1TK0 B;  1YZX A;  1UA5 A;  2B5E A;  4OWY A;  4IP6 A;  1X5E A;  3ZRE A;  5CRW A;  1TK8 B;  4K2D A;  1GSS A;  1JFU A;  3DGQ A;  2O5V A;  1FAA A;  5KN3 A;  2HFD A;  3M8N A;  1V57 A;  5A1N A;  3GHA A;  5DCG A;  4N11 A;  3QOU A;  2YP6 A;  2BMX A;  1FW1 A;  3TRP A;  3WYW A;  3W8J A;  2FCH A;  1N2A A;  3KJY A;  2CAQ A;  3UVT A;  4N0V A;  2V1M A;  4HU7 A;  3KZQ A;  1TKD B;  2QGV A;  2HE3 A;  4ISD A;  4OCF A;  1PN9 A;  4CW9 A;  3GKX A;  2XC2 A;  2YOI A;  5CP1 A;  2KUC A;  2R4V A;  4IN0 A;  1XW9 A;  2E2G A;  2EFH A;  1ZYN A;  3F3Q A;  2VL2 A;  4TVE A;  3VPQ A;  2H30 A;  3FHK A;  3WGX A;  4AKH A;  2C80 A;  1GUK A;  5KOX A;  3GTU B;  1XW5 A;  3GST A;  1YJ6 A;  3KCM A;  2VCZ A;  3TOT A;  4Q5F A;  1SL2 B;  1PRX A;  1QK8 A;  1OKT A;  4GWR A;  1WE0 A;  1F9M A;  4QQ7 A;  3L0H A;  1XWA A;  4WXT A;  3ISO A;  3U6V A;  4WKW A;  1XWG A;  5A4W A;  4IGJ A;  5DBQ A;  4HZ2 A;  3ZVJ A;  5INY A;  3IXR A;  2IL3 A;  3TJJ A;  1QXH A;  1ZYP A;  3Q6O A;  4GXZ A;  4O5Q A;  1ACV A;  1UC7 A;  4QMK A;  5J5N A;  1YEP A;  5DJM A;  2GQL A;  1ZMA A;  3TU3 B;  5ECK B;  4IHU A;  3D4T A;  1X9M B;  4RUV A;  1AQW A;  3DVW A;  1WJK A;  4AJ7 A;  1SEN A;  2VCQ A;  2JSZ A;  3KIJ A;  2WRT A;  5F06 A;  3A2X A;  2N5F A;  2OAC A;  1Z6N A;  4ILF A;  3WD6 A;  1ERU A;  4KB3 A;  4BVX B;  3GKN A;  2AAW A;  1EV9 A;  1JZO A;  3WT1 A;  3VWV A;  3CSJ A;  2VCW A;  1SYR A;  1GNW A;  1ERW A;  3FR9 A;  4JZQ A;  1Z5Y E;  2X8G A;  1OVN A;  3CBU A;  4JR6 A;  3KTB A;  4FYC A;  3VFI A;  2K6V A;  3IE3 A;  5IMA A;  4EIQ A;  2NTO A;  3L9V A;  1ZOF A;  5B8A A;  3C8E A;  2FWE A;  4HZ4 A;  5D8I A;  3VI5 A;  2HI7 A;  5IMF A;  3KTL A;  3BOA A;  2CZ2 A;  4FYB A;  2GSQ A;  3TKS E;  3NOF A;  2WB9 A;  4YAV A;  4JRR A;  4E8H A;  1FOV A;  2WFC A;  4LLR A;  3ZYW A;  3BJ5 A;  1EP8 A;  1A8Y A;  3ZFL A;  1VF4 A;  3D5J A;  3EPT A;  1IYH A;  5ELA A;  4ZB8 A;  4LL1 B;  4N30 A;  2H75 A;  3IAS 2;  2R37 A;  4HDE A;  2AYT A;  3UL3 A;  5IMV A;  3ZML A;  2JZR A;  3P90 A;  3FYG A;  11GS A;  2CX3 A;  4Z2U A;  4HEA 2;  4KAE A;  4D73 B;  1BG1 A;  1CQH A;  2JAD A;  2OE0 A;  1BQ7 A;  4Z2T A;  1QQ2 A;  5ID2 A;  3GSS A;  3ZIJ A;  2LS5 A;  1GTI A;  5JWR B;  1AUC A;  1F37 A;  1PKW A;  4EUY A;  4ZIJ A;  3C73 A;  2G0F A;  1HD2 A;  1QMV A;  2DIZ A;  2LRN A;  2DLX A;  1I9D A;  1RQM A;  4H86 A;  4YQV A;  2Z9S A;  2GZY A;  4KH7 A;  2XPE A;  4HJ2 A;  4AKG A;  4TR1 B;  4MZB A;  1HNA A;  2V2G A;  2IIY A;  4DEJ A;  3VPT A;  3F0I A;  5IPG A;  5AN1 A;  3APO A;  3GKK A;  4GDF A;  1PQN A;  2YV9 A;  2FWG A;  3CWG A;  1GSE A;  5DJL A;  3A5W A;  1OE8 A;  2OAD A;  5DAL B;  4MNN A;  2I81 A;  3FKF A;  2JAC A;  3QAG A;  1FB0 A;  1PN0 A;  2WUL A;  2HLS A;  5CNW A;  4L5L A;  4I2U A;  5J3R A;  4MJB A;  2YWO A;  4TR3 A;  4XIH A;  3R2Q A;  1JZR A;  2DKH A;  2M72 A;  1YDK A;  1V9W A;  2KP1 A;  1BX9 A;  5G1L A;  2TRX A;  2WJU A;  2L5L A;  2EFD A;  2GSS A;  4FQU A;  4PQI A;  2YWN A;  2LNT A;  19GS A;  3FZ5 A;  3H1N A;  1WPI A;  2LJA A;  1OC9 A;  2H1G A;  2VM2 A;  5L71 A;  1TI3 A;  2FNO A;  2QA1 A;  4G10 A;  5IPH A;  2H73 A;  4ACS A;  2UV8 G;  3IV4 A;  4G2E A;  1J0F A;  1MD4 A;  1A2J A;  4X43 A;  2H1L A;  4KF9 A;  5C00 A;  4XS4 A;  3IRA A;  3HD5 A;  2QKE A;  1GSQ A;  3P2A A;  2KOK A;  1XWB A;  3I69 A;  3MWH A;  3QAV A;  1V2A A;  3EU3 A;  2YCD A;  4MA9 A;  3FY7 A;  1U3A A;  1ZZY A;  4EL1 A;  3QMX A;  22GS A;  1XW6 A;  3IC8 A;  4QL9 A;  3L9U A;  2VAF A;  2YZU A;  3TKR A;  5H5Q A;  3TRQ A;  1T3B A;  4KGI A;  5FWG A;  4CY8 A;  2K8V A;  3CXG A;  5HR1 A;  2B1K A;  1N25 A;  4PQH A;  5J40 A;  4FIW A;  3KH9 A;  2CVD A;  4ULX A;  1TRW A;  3O76 A;  1THO A;  2H1D A;  4DVC A;  3F6D A;  2B3S A;  3ZFB A;  2H1B A;  4ZBD A;  4XRD A;  4MK3 A;  5BRT A;  1AQX A;  1H75 A;  1PL1 A;  5J47 A;  2A2R A;  1B9X C;  3GMF A;  3HCZ A;  5CO3 A;  3QAW A;  1FB6 A;  3GA4 A;  2HSH A;  4JED A;  1HQO A;  2CQ9 A;  3QR6 A;  4MCU A;  4HOJ A;  2OBI A;  5B6M A;  1TK5 B;  5CRE A;  2DIY A;  2EIO A;  4K2X A;  4HQS A;  1ILO A;  2BJX A;  2O89 A;  2XBI A;  1F3A A;  1ZYE A;  2OT3 A;  1N8J A;  3PR8 A;  5DAL A;  4O5R A;  3GH6 A;  3A2W A;  2DSA A;  4YH2 A;  1EOG A;  4F82 A;  3LWA A;  5DQS A;  4I6X A;  2FWF A;  20GS A;  1MTC A;  3HVX A;  3IDV A;  1SVO A;  3UEM A;  2OBK A;  3RPP A;  3J7Y b;  2MYG A;  4POM A;  4ZL9 A;  5BMU B;  2J23 A;  5ECN B;  2KHP A;  1GLQ A;  2GDR A;  6GSS A;  3HKR A;  5CAX A;  3W6G A;  5FHI A;  1SK2 A;  1UN2 A;  2LKU A;  5D9T A;  4GF0 A;  5CRD A;  4K7N A;  1U87 A;  17GS A;  2B5X A;  2L6C A;  2B7J A;  4FYU A;  1G7O A;  2FA4 A;  1T8E B;  3IK9 A;  3KMO A;  1PKZ A;  3GV1 A;  1X5C A;  2DMM A;  2HYX A;  4TN8 A;  3G7I A;  3EMX A;  5KEJ A;  5A34 B;  2R0G A;  2LTK A;  4BL7 A;  3TGZ A;  4IW9 A;  2QA2 A;  4G0K A;  2VL2 C;  2HT9 A;  3I9V 2;  2BTO T;  5CRG A;  2RUE A;  3F4T A;  2HXK A;  2VKZ G;  3GFK A;  1MEK A;  4WET A;  1EWX A;  5ECO B;  2NPB A;  1PMT A;  4OFT A;  3HJP A;  3CSH A;  2OE1 A;  1T1V A;  2H71 A;  3ZL5 A;  4IJI A;  4MH2 A;  5HQP A;  1A2M A;  4I8B A;  3DVX A;  2ALB A;  1A23 A;  1Z7P A;  4IS0 A;  3WGE A;  3EYT A;  2VO4 A;  3FEU A;  1PA3 A;  1T7P B;  2PER A;  5J4Y A;  3APS A;  2XBQ A;  16GS A;  5IOX A;  2GS3 A;  1OC8 A;  2O87 A;  3H4K A;  1A0R P;  1R4W A;  3DEX A;  1SJI A;  1CQG A;  2MBT A;  2E7P A;  4BVY B;  2HQT A;  3WGD A;  1YF0 A;  1QUW A;  2J9H A;  1V40 A;  2DJK A;  2VL3 A;  3LOR A;  1F6M C;  3HYP A;  2H6Y A;  3CTF A;  4XCS A;  2GLR A;  3RPN A;  2H76 A;  2RUF A;  4YQU A;  4TR4 A;  4WR5 A;  2R2J A;  3TKS A;  2FUG 2;  3GNJ A;  3BCI A;  2CZ3 A;  1O6J A;  1SL0 B;  2IWT A;  3DKS A;  2AV4 A;  3VI7 A;  1YVL A;  3FR3 A;  1PD2 1;  4L5O A;  3MNG A;  1GTB A;  4DSR A;  1YKA A;  4ECI A;  1DBY A;  3M9J A;  4KSM A;  4O7H A;  3RDW A;  3M9K A;  3GKM A;  2ON7 A;  3GIX A;  5EPF A;  3OR5 A;  2TRC P;  1G6Y A;  2MMN A;  5IM9 A;  3CRU A;  1XBS A;  2LRT A;  2H19 A;  4LMV A;  1ABA A;  2CVK A;  4LA1 A;  3VK9 A;  3LGC A;  1A8L A;  3E9J B;  4N10 A;  5F0G A;  3ZLP A;  3DD3 A;  5H5R A;  2FD3 A;  1K0N A;  3LXZ A;  8GSS A;  2FY6 A;  5G5F A;  2H74 A;  2IN3 A;  4JBB A;  4DSS B;  1TXX A;  4G0I A;  2DJ3 A;  1C72 A;  1MDI A;  1NHO A;  2MMZ A;  3UJ1 A;  3VWW A;  2DJJ A;  3CYN A;  2JZS A;  1VF1 A;  1B48 A;  2IFQ A;  2HSM A;  2VD0 A;  4O92 A;  1GL8 A;  4ZB6 A;  3GH9 A;  4K7I A;  4KA0 A;  1R26 A;  5KN1 A;  3M1G A;  3C71 A;  1GSF A;  3TJB A;  2H01 A;  3S9F A;  2H8L A;  4PXO A;  2IJY A;  2HSN A;  3LSZ A;  2P31 A;  5ECI B;  5HFK A;  4HJM A;  4NHZ A;  2B6M A;  1ZL9 A;  4K0N A;  3FZA A;  1HYU A;  3F4R A;  4K6X A;  4TR0 A;  5GAP D;  5G30 A;  3HHV A;  5F07 A;  1SVM A;  2KP2 A;  4POB A;  3KMN A;  3PPU A;  2GTU A;  3ZMK A;  2JU5 A;  3VUR A;  1URM A;  3C1S A;  6GSU A;  3ZIT A;  3DXB A;  2JSY A;  2HZF A;  4RI7 A;  5D96 A;  3FRC A;  1W89 A;  3I43 A;  1H4O A;  3HA9 A;  5FT3 A;  3ERF A;  1WWJ A;  3FZ4 A;  2HRF A;  1TRU A;  2F9S A;  3APQ A;  12GS A;  3FR6 A;  1GUM A;  2KLX A;  1OAZ A;  4ZIL A;  1YY7 A;  2H72 A;  2YAN A;  5B6N A;  2GZP A;  3F63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...