3VI7A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 75
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi7A01
1U3AA 1DE1A 2D2ZA 3Q18A 2GT5A 4IN0A 4YQVA 5IPHA 1HYUA 1VF4A 1OC3A 4ZB6A 1S3CA 5JCWA 2E0QA 2R4VA 1GUHA 1OKDA 4JR6A 8GSSA 3UBKA 1T8EB 3CRTA 3UBLA 4MCUA 1LBKA 2XPEA 4L0UA 3ZITA 1XOBA 4XRAA 2FLSA 4FYBA 3L4NA 4I2UA 3I6AA 2A4VA 3M1GA 4ZIJA 3FZ9A 5EVOA 2CAIA 1LJRA 3ZVJA 4I97A 1AUCA 9GSSA 3GX8A 1PMTA 3TGZA 2YP6A 2LNSA 3UL3A 2JACA 3S9FA 1XVQA 1Z6MA 3ZMKA 3BBYA 4EKZA 4MF7A 4J56E 2MYGA 2BJXA 3F4SA 4HJMA 4JEDA 2FHEA 1X5EA 2AV4A 3IR4A 1GP1A 3HVXA 2DJ0A 4MLYA 5IIZA 1O8WA 22GSA 1MDJA 2KP1A 5ELGA 1USBA 2ON7A 2KLXA 4LMVA 5B8BA 4J2FA 2ZNMA 4ECBA 1MDIA 3APSA 2JSZA 4K0NA 1O7UA 4P3YB 3O76A 1SKWB 1OKTA 2XC2A 3RDWA 5GZZB 6GSTA 2REMA 5CO3A 3CMIA 3F6DA 4DSSB 4GTUA 2IN3A 3Q19A 2P5QA 1OC8A 3QCPA 2H1AA 1TRSA 5C04A 1SL1B 1G6YA 1GULA 1GRXA 1YEXA 4IQAA 3N5OA 2M72A 1FOVA 5CP1A 5AGYA 5FHIA 4YAVA 2JL4A 3GSTA 2HZEB 2IJYA 3QFBC 1EP8A 3KTBA 2F8FA 2I9HA 2FNOA 2LEGA 1QQ2A 4HI7A 3F3QA 3MWHA 3D0ZA 1SJIA 1X9WB 2FWGA 3WT1A 1TTZA 1UC7A 1K0BA 1GTAA 2YJHA 3SBCA 1UN2A 5KN1A 4MZWA 1GSSA 3GL3A 3C1SA 3FKFA 1R4WA 1BJXA 4GXZA 2CVDA 2LUSA 1M7TA 3IA1A 4XS1A 5CRWA 4HJ2A 3E9JB 1EZKA 2H75A 1M99A 4V2LA 3BCIA 1K3OA 1W4VA 5CYYA 3FR3A 2H8LA 12GSA 3QMXA 3VLNA 4OMVA 2WULA 5DQYA 4KW6A 1ABAA 4ISDA 2VL2C 1F2EA 3JCML 5DCHA 2IL3A 3F9UA 4V2MA 1HQOA 3K8NA 1SKSB 3EVIA 1PX6A 4F9ZA 3KTLA 3Q6OA 3VI7A 3GSSA 4HZ2A 5J5NA 4DEJA 3HXSA 2ON5A 1B48A 1ZGNA 4Q5RA 3GTUA 1G7EA 3IAM2 5G1LA 3HVSA 4N0ZA 4RUVA 4F2IA 3IOSA 5C00A 4POBA 4QQ7A 4ZB9A 1MEKA 2RUEA 3KM6A 2ALBA 2NDOA 5ABRA 3FR6A 3H4KA 3O6TA 2HYXA 1S3DA 5DVBA 3EU4A 2YN1A 2CT6A 4K7NA 4BVXA 3C1RA 3FY7A 1AQXA 1MD4A 4KUNA 6GSXA 2H0IA 2QSIA 5G31A 1K0OA 1T1VA 4PURA 5D9VA 4RQXA 5HR2A 1MTCA 4MDCA 4MZCA 4G19A 2GQMA 3QAWA 3U6VA 1OE8A 3HZ8A 1JFUA 3TCOA 2B5EA 4NV5A 1U87A 1XCCA 2ZCTA 1GTBA 4PNFA 3EWLA 4EL1A 5A4WA 3CRUA 2PBJA 3MAKA 4NHZA 1XOAA 3GX0A 4CDOA 2YCDA 2CX3A 2B5YA 3BD2A 2PERA 1SK1A 2H0GA 2HNLA 4EVMA 1O81A 2IMDA 1PL2A 2DJ2A 5GSSA 3RBTA 4AJ8A 4TOPA 2H6XA 2PWJA 5F05A 3FEUA 3N9JA 6GSYA 3DEXA 2OE3A 3P8WA 4GWRA 1LU4A 2CZ2A 3C73A 1A2MA 2OBKA 4BWQA 1T4ZA 4MJEA 5E4WA 2C3NA 4TR0A 2AYTA 1C72A 4HOJA 2V6KA 1K3YA 2GS3A 2V32A 1O73A 1SK0A 2J23A 5B6NA 5HR0A 2OA7A 2YJ7A 3FYGA 3ZIVA 3CSHA 1A23A 3HYPA 3I43A 4LLRA 4JR4A 4USSA 1QGVA 2PPTA 1VGLA 4V2NA 1EV9A 3W8JA 4TR1A 1WOUA 3RHCA 3M0FA 4DSRA 4ECJA 4K1FA 2E2MA 2V6OA 2ZUPA 1XPVA 2VLVA 4ID0A 4EF0A 2HE3A 4AF2A 5HQPA 1T00A 4WXTA 5IMCA 1GSYA 3LYPA 5BMUA 3TB2A 5AIVA 2IMEA 1X0RA 3L9UA 3GV1A 2CA8A 2C1YA 3GURA 5G30A 2H74A 4WR5A 2O89A 2X8HA 1X5CA 1YKCA 5E59A 2V2GA 4RI6A 2GVPA 4PUFC 1AQVA 17GSA 3H8QA 3UVTA 3PPUA 2GZPA 2L5LA 4JU5A 1GTIA 4Q5FA 2IMIA 3L9VA 4MZBA 4OFNA 5IO0A 3TOUA 4MF6A 2O7KA 4IGJA 1B8XA 4K0GA 2R2JA 2KUCA 5B8AA 4ZL7A 1U88A 2VUPA 4MJCA 4KAEA 6GSSA 1V98A 3HJOA 4MPFA 4PQIA 1WJKA 3TKRA 4ZB8A 1F3BA 3L9SA 1DE2A 3M3MA 3GRXA 2CX4A 2AAWA 3ERFA 16GSA 5G1KA 2EIOA 2A2SA 1DBYA 3LG6A 5LCZA 1N8JA 2RIIA 4XRDA 3BJ5A 1WIKA 4IJIA 5DDLA 4HEA2 1SENA 3KIJA 3PR8A 4BVYA 2GTUA 2IMFA 5ECKB 3FRCA 3ERWA 1QUWA 4EO3A 5D93A 4PUAA 2H1BA 3IV4A 3QAVA 5ENUA 5G5FA 2GDRA 1FHEA 2GSRA 5D96A 4YQMA 3GKNA 5DQSA 1XWGA 2FD3A 4KDYA 1EV4A 2VO4A 2VL9A 3GYKA 1MD3A 1PGTA 2AHEA 1GLPA 2GSTA 3DXBA 4PQ1A 3RPPA 2H76A 3ZFBA 4KE3A 3M8NA 5COHA 5ID2A 2H73A 2FCHA 1V57A 2NVLA 1EP7A 1PKZA 4JBBA 4XS4B 4GSTA 5DAKA 2HSMB 3NIVA 3HJMA 4IVFA 1K0MA 2G0FA 2HRKB 3EC3A 5HFKA 3UEMA 1XWCA 2K9FA 3G7YA 2I81A 3EMXA 2H01A 3QR6A 3GN3A 2C80A 3ZVJD 3TOTA 3HA9A 3H93A 5J41A 4L0WA 4O5RA 5KEJA 1JZOA 1B4QA 4MH2A 5J3RA 4ZBDA 3HKRA 1TRWA 3GFKA 2FY6A 2YWMA 3IK7A 2CV4A 2K18A 1XW9A 3F0IA 1AW9A 2F51A 2LRCA 3Q74A 1ML6A 2YZHA 1M2BA 5JWQB 2WGRA 4ILFA 1XZOA 4OD7A 1F9MA 1YJ6A 3C7MA 4HDEA 1YDKA 1O6JA 2N5AA 2ES7A 4HU9A 1K0NA 2L6CA 1JZWA 1GSFA 1TI3A 2C0EA 3P2AA 4PXOA 1QK8A 1FW1A 4NHWA 5FWGA 1JLVA 2EC4A 3RHBA 2UZ8A 4E8HA 2VCXA 4IP6A 11GSA 5LD0A 4ZL9A 3M9KA 1Z7PA 4AJ6A 5DALB 5ECIB 5EY6A 3TRPA 4WF5A 2PGTA 1SYXA 1WP0A 1H4OA 1E2YA 2IPAA 2OACA 2PUKC 2HRFA 3E3EA 1ZMAA 2YPMA 3IRAA 2R6KA 1TDIA 1K0CA 1SL2B 4L8EA 1Y6EA 4G9HA 2QC7A 4FIWA 3KGKA 1XW6A 4MK3A 5JCUA 2VD1A 2K8SA 2XBIA 3J7Yb 3MNGA 1B9YC 3UIWA 1QXHA 2CVKA 2GT6A 2EIRA 2WB9A 5DBQA 1X9SB 1F3AA 3CTFA 3UARA 3SWLA 2LJKA 4WBRD 3VWXA 2P0GA 3TKSA 2CQ9A 1S3AA 2YWIA 3HZ4A 2B7JA 4OO4A 4MMMA 3F3RA 3NOFA 1M0UA 3VFIA 2CVBA 3A3TA 1M9AA 1SKRB 1ZL9A 1AC1A 3TKSE 2TRXA 2GZZA 4KNDA 1XVWA 4O32A 4KDUA 2FA8A 5IMZA 4OFMA 3W6GA 2YZUA 4GSSA 2JZRA 5ECNB 3GMFA 1V40A 1GSDA 3CSIA 2DIYA 4K2DA 1VF1A 1R7HA 4L5OA 2B6MA 1CQGA 1F6MC 4MP4A 3WGXA 3WD6A 4TR4A 3UOMA 2XHFA 2P31A 3MDKA 5IQYA 3IHQA 4ZBBA 2F8AA 3A2XA 5CRHA 3GL5A 4EUYA 3TKPA 3ZYWA 2IFQB 2PVOC 5D8IA 4HQSA 1B9XC 2DSAA 4LA1A 5H5RA 3VWVA 5INYA 1A24A 1BQ7A 4JZQA 4Z7XA 4RI7A 2H72A 3WGDA 3ZLPA 2YANA 4HUAA 2K6VA 3WT2A 5IM9A 2DJ3A 5D9XA 4ML1A 4GF0A 5CRGA 3VPQA 1OC9B 3IC8A 4DVCA 5ELAA 4XTSA 10GSA 3CBUA 2KHPA 4ECCA 3ZREA 1N2AA 5JWOB 2JZTA 1HNCA 4OCEA 1TK8B 3GA4A 2MMNA 1GSQA 2MZCA 4YAPA 1XIYA 2IWTA 4TVEA 1SL0B 1IYIA 5AN1A 2C0GA 1AXDA 2LRNA 2AB6A 1WMJA 2H71A 3R2QA 3UMAA 3VK9A 4PTSA 4MPGA 2VAFA 4OFTA 4MJBA 1G6WA 3ED3A 5F06A 2NPBA 2HXKA 3ZFLA 2C8UA 5DJLA 4N11A 1I5GA 4DSSA 1XWAA 1OYJA 1TOFA 2JADA 3D5JA 2RUFA 2RM5A 1FB6A 3KEBA 4G0KA 3ZRDA 1G0TA 2AUVA 2C0FA 2VD0A 5AISA 2QGVA 3L78A 2HZEA 2AJQB 3CYNA 3IC4A 5L71A 2HSNB 1E6BA 13GSA 1PL1A 3DWVA 1BX9A 1EOHA 2YV9A 2OKAA 2WFCA 4GRFA 1Z9HA 5IOXA 2OADA 4WF4A 1U6TA 4YH2A 4GCIA 2DMLA 3HY2A 1IYHA 2VM1A 1K3LA 4AGSA 4FYUA 4CW9A 5J9BA 2H19A 2FWHA 3LSZA 1RW1A 1YKAA 4WKWA 4KH7A 4I5QA 1Z7RA 2PN8A 1FG4A 3GH6A 1JZDA 4EC0A 5IPGA 1TP9A 5EL8A 2LQOA 1YQ1A 1GSEA 18GSA 2DMMA 1FB0A 1G7OA 5GSTA 4FQUA 1JLWA 2VCZA 4N0VA 2F3MA 1XFLA 4TRXA 1A2JA 4PX1A 4HS1A 3DGQA 1ACVA 5LNKe 1GWCA 1ERTA 1EWXA 4G0IA 4RQRA 2EIQA 3BOAA 1ST9A 1CQHA 2FWEA 1UA5A 5IOWA 2MBTA 3KJYA 2KP2A 2XPDA 3KCMA 1WRYA 2XBQA 6GSWA 1TW9A 4N30A 5JWRB 4KSOA 2N5FA 3D4TA 1GLQA 1XWBA 4I6XA 4IHUA 1JHBA 2WZ9A 3EU3A 1EGOA 1TRUA 2LV3A 3KMOA 1QFNA 1HD2A 2HI7A 3QD9A 5B7CA 2VM2A 1PSQA 3D22A 4GQFA 1SD9A 5IMAA 1KNGA 1PA3A 4F0CA 4K7IA 1NW2A 3F63A 19GSA 2DJKA 1TK5B 2PU9C 4ULXA 4K9ZA 4XS6A 3IK9A 3LWAA 3C71A 1NHOA 1FVJA 1SU9A 2HLSA 4IQ1A 1TXXA 2YOIA 3TKQA 1T4YA 2FWFA 2DJJA 1PRXA 1Z3EA 5HFGA 1ZZYA 3TUEA 5CAXA 3DYRA 1SYRA 4IP1A 2BMXA 5D9TA 2TIRA 1GUMA 1QMVA 1RK4A 1Q98A 3F6FA 3EURA 1Z5YE 4BL7A 3IPZA 3ZIJA 2MMOA 1V9WA 2MMZA 14GSA 2I3YA 2VCVA 5H5QA 1THOA 2LSTA 2L6DA 3HHVA 3VPTA 1EEMA 3E0UA 3GKXA 5IMDA 4PGTA 3EMPA 4IS0A 2LQQA 4GSNA 4XIHA 4G0LA 1YF1A 1NHYA 1BYEA 3GTUB 5A4VA 4ML6A 5KN0A 2JU5A 3A2VA 2H0HA 3R3EA 3EYTA 2YV7A 5ECPB 3GIXA 1TKDB 2C3QA 4F0BA 4G10A 2VCQA 3H1NA 2OE1A 3PH9A 5F07A 1TI1A 5G5EA 1J0FA 3DIEA 5J9CA 4EXJA 4BVXB 1NM3A 2C4JA 1BEDA 3KH7A 1GL8A 4X0XA 4ZXGA 3DVWA 4K7OA 3KMNA 2L4CA 4BPYA 2L57A 3EINA 1R5AA 3VI5A 1U3IA 1MDKA 5GAND 1X9MB 4K6XA 3ME8A 3ME7A 3PGTA 4POMA 6GSUA 1H75A 5ECSA 3D6IA 2P5RA 4MABA 2VLUA 4LL4B 1O85A 2OJLA 4KCEA 3LQ7A 3TRXA 4POKA 2HQTA 3TJKA 2X8GA 1ERVA 3P90A 1M2DA 20GSA 3L0HA 3DRNA 2GGTA 3TKSC 2DJ1A 5JCGA 1OVNA 4L5LA 2DLXA 2GQKA 2X8CA 1SD8A 1K0DA 1KEBA 3EE2A 2RLIA 2M46A 3GKMA 4O7HA 2N5BA 1GH2A 3G7JA 3IBHA 3WGEA 1AAZA 5J4UA 4XCSA 1FVKA 1WWJA 5A4UA 6GSVA 1V58A 1B4PA 2DBCA 5F8BA 1ZCPA 1GTUA 2CAQA 1M2AA 3G7IA 1YEPA 1R5PA 1WE0A 2VOCA 1HNBA 2RM6A 1DSBA 3RPNA 2FA4A 4TXOA 4KF9A 1T7PB 3HCZA 2FUG2 4H86A 3TRQA 5IMFA 1ZYQB 4E8EA 3TJBA 3FW2A 1ZYEA 2VCTA 4OCFA 1OAZA 4D73A 5HFIA 3GHAA 2BTOT 3CSJA 4HZ4A 4DSQA 4OWYA 2LJAA 4KCAA 5DCGA 3HDCA 3ZMLA 4AJ7A 4TR1B 1ERUA 3GH9A 3ZZXA 4ACSA 5CRDA 3FHKA 1EOGA 2O8VB 3D4MA 2HRNA 2J9HA 3GNJA 4YQUA 1A0RP 2VLTA 4TR3A 3TJFA 5HR3A 3LXZA 1YY7A 3HD5A 2HSHA 3KH9A 2E7PA 2WCIA 3TDGA 3CTGA 1J9BA 3IE3A 3LYKA 2X64A 4JRRA 3F8UA 7GSSA 4KX4A 3KP9A 4TXVA 2V41A 2LS5A 3LFLA 1BAYA 5ECRB 4NAXA 3HVVA 2NTOA 2GSQA 5ECOB 4QL7A 4MH3A 5G2ZA 4FH8A 2DIZA 5ECMB 5D73A 3AY8A 3MSZA 1XWKA 2A2RA 3NZNA 2H6YA 5KN2A 2X99A 4XS4A 1O8XA 3TJJA 3M9JA 2HSMA 1TK0B 1ILOA 4IBPA 1TJDA 2B5XA 4G2EA 3VWUA 4FYCA 2HRKA 1A2LA 3US3A 3HJPA 2KOKA 1VF2A 1TU7A 3FR9A 3OR5A 2HT9A 1RQMA 5D9WA 4TW5A 3H79A 1HNAA 2TRCP 2YNXA 1GNWA 4Q5QA 5B6MA 2LRTA 1DUGA 2O85A 4QL9A 2L4QA 4XHMA 2QKEA 3V1WA 2IIYA 4BWSA 3LXTA 2CZ3A 4KB3A 4BVYB 2E2GA 1KBNA 4ZL8A 1Q4JA 1YF0A 2HRAA 5F0GA 2LNTA 2LTKA 4NXIA 4ECIA 4EDYA 3DKSA 2Z9SA 5EPFA 2PMTA 3ZTLA 2VIMA 4V1Ap 3RAZA 3APOA 3LORA 3APQA 4GLTA 3VURA 4WR4A 1SK2A 2WRTA 2VCWA 2NBSA 3FZAA 4EE0A 4WBJA 3J7Yk 3ISOA 2M80A 2L5OA 4I2TA 2O87A 3DMLA 1PD21 1THXA 4CHSA 5ECHB 1W89A 2VL2A 4LL1B 2B1KA 1M9BA 1I9DA 1URMA 3FK8A 5CREA 1TU8A 4BL7B 2IMKA 4PNGA 3P7XA 5ID2B 5DALA 1Z6NA 5KN3A 1OE7A 1XW5A 3KP8A 3ERGA 2JSYA 5DAKB 4J57E 3A2WA 2H1DA 1ERWA 3QAGA 2H66A 3F4TA 3GKKA 1XXUA 2L59A 4NV2A 2GLRA 1J08A 5DJMA 1A0FA 2I1UA 1VF3A 2R3XA 4V1Ag 4HU7A 3CXGA 3KD0A 4GQCA 3O3TA 2YWOA 4KDXA 1XBSA 4EDZA 1F37A 3QDNA 1GUKA 2DC5A 1PN9A 1FO5A 3WYWA 2HFDA 2HZFA 3BCKA 2K8VA 4PQHA 4I8BA 1YZXA 4TN8A 1WPIA 3IXRA 4F03A 3QOUA 3C8EA 2C0DA 2WDUA 1K0AA 3A5WA 4HQZA 5A5KA 1TRVA 3QFAC 3FZ5A 1V2AA 5ECQB 1SJZA 2C3TA 3UJ1A 1AIUA 1PKWA 2OE0A 3LGCA 2B1LA 4IJ3A 5IO2A 2B7KA 2R37A 4IELA 4FO5A 3KXOA 2MBSA 4TXOB 3G9BA 3KZQA 1EEJA 2GZYA 2LKUA 2B3SA 3DVXA 3UAPA 1VRSD 3I9V2 3I69A 4D73B 4KSMA 5HR1A 3FZ4A 1NSWA 2G2QA 3U5RE 3UVHA 1T3BA 4K8MA 3DD3A 2H6ZA 4MA9A 3IAS2 2GSSA 4Q5NA 2IFQA 5AIXA 2H1GA 1A8YA 4NPBA 2VL3A 4KGIA 1BG5A 3LJRA 4BA7A 4LMWA 1PX7A 1X5DA 2H30A 2HSYA 3TJGA 2JZSA 2F9SA 5CNWA 3PINA 2I4AA 2R5GA 4ZBAA 4N10A 5ECLB 5GAPD 2H70A 1OC9A 1JZRA 3D21A 3IDVA 1R26A 1UVZA 4IKHA 4X1UA 4JE1A 2WS2A 3GUSA 4IW9A 2GQLA 4KA0A 2V1MA 4WETA 5FT3A 3W8SA 4X43A 1AQWA 5IMVA 4NWYA 3ZL5A 1EGRA 1PQNA 3F4RA 1ZOFA 4MJAA 4O92A 2PVQA 1FAAA 4ZILA 3QPMA 1GSUA 2OBIA 4WEYA 2WJUA 1ON4A 4NMUA 5H5SA 1Y25A 4OO5A 1SJ6A 4TKYA 4F82A 2FGXA 2YWNA 3VWWA 1KTEA 2MMAA 4MF5A 3LEFA 1A8LA 1GNEA 2LJRA 4POLA
chains in the Genus database with same CATH superfamily
1U3AA 1DE1A 2D2ZA 3Q18A 2GT5A 4IN0A 4YQVA 5IPHA 1HYUA 1VF4A 1OC3A 4ZB6A 1S3CA 5JCWA 2E0QA 2R4VA 1GUHA 1OKDA 4JR6A 8GSSA 3UBKA 1T8EB 3CRTA 3UBLA 4MCUA 1LBKA 2XPEA 4L0UA 3ZITA 1XOBA 4XRAA 2FLSA 4FYBA 3L4NA 4I2UA 3I6AA 2A4VA 2HSNA 3M1GA 4ZIJA 3FZ9A 5EVOA 2CAIA 1LJRA 3ZVJA 4I97A 1AUCA 9GSSA 3GX8A 1PMTA 3TGZA 2YP6A 2LNSA 3UL3A 2JACA 3S9FA 1XVQA 1Z6MA 3ZMKA 3BBYA 4EKZA 4MF7A 4J56E 2MYGA 2BJXA 3F4SA 4HJMA 4JEDA 2FHEA 1X5EA 2AV4A 3IR4A 1GP1A 3HVXA 2DJ0A 4MLYA 5IIZA 1O8WA 22GSA 1MDJA 2KP1A 5ELGA 1USBA 2ON7A 3FMWA 2KLXA 4LMVA 5B8BA 4J2FA 2ZNMA 4ECBA 1MDIA 3APSA 2JSZA 4K0NA 1O7UA 4P3YB 3O76A 1SKWB 1OKTA 2XC2A 3RDWA 5GZZB 6GSTA 2REMA 5CO3A 3CMIA 3F6DA 4DSSB 4GTUA 2IN3A 3Q19A 2P5QA 1OC8A 3QCPA 2H1AA 1TRSA 5C04A 1SL1B 1G6YA 1ZYNA 1GULA 1GRXA 5A1NA 2EFDA 3TU3B 1YEXA 4IQAA 4PHZC 3N5OA 2M72A 1FOVA 5CP1A 5AGYA 5FHIA 4YAVA 2JL4A 3GSTA 2HZEB 2IJYA 3QFBC 1EP8A 3KTBA 2F8FA 2I9HA 2FNOA 2LEGA 1QQ2A 4HI7A 3F3QA 3MWHA 3D0ZA 1SJIA 1X9WB 2FWGA 3WT1A 1TTZA 1UC7A 1K0BA 1GTAA 2YJHA 3SBCA 1UN2A 5KN1A 4MZWA 1GSSA 3GL3A 3C1SA 3FKFA 1R4WA 1BJXA 4GXZA 2CVDA 2LUSA 1M7TA 3IA1A 4XS1A 5CRWA 4HJ2A 3E9JB 1EZKA 2H75A 1M99A 4V2LA 3BCIA 1K3OA 1W4VA 5CYYA 3FR3A 2H8LA 12GSA 3QMXA 3VLNA 4OMVA 2WULA 5DQYA 4KW6A 1ABAA 4ISDA 2VL2C 1F2EA 3JCML 5DCHA 2IL3A 3F9UA 4V2MA 1HQOA 3K8NA 1SKSB 3EVIA 1PX6A 4F9ZA 3KTLA 3Q6OA 3VI7A 3GSSA 4HZ2A 5J5NA 4DEJA 3HXSA 2ON5A 1B48A 1ZGNA 4Q5RA 3GTUA 1G7EA 3IAM2 5G1LA 3HVSA 4N0ZA 4RUVA 4F2IA 3IOSA 5C00A 4POBA 4QQ7A 4ZB9A 1MEKA 2RUEA 3KM6A 2ALBA 2NDOA 5ABRA 3FR6A 3H4KA 3O6TA 2HYXA 4N3ZA 1S3DA 4K2XA 3EU4A 5DVBA 2YN1A 2CT6A 4K7NA 4BVXA 3C1RA 3FY7A 1AQXA 1MD4A 4KUNA 6GSXA 2H0IA 2QSIA 5G31A 1K0OA 1T1VA 4PURA 5D9VA 4RQXA 5HR2A 1MTCA 4MDCA 1BF5A 4MZCA 4G19A 2GQMA 3QAWA 3U6VA 1OE8A 3HZ8A 1JFUA 3TCOA 5KOWA 2B5EA 4NV5A 1U87A 1XCCA 2ZCTA 2A4HA 1GTBA 4PNFA 3EWLA 4EL1A 5A4WA 3CRUA 2PBJA 3MAKA 4NHZA 1XOAA 3GX0A 4CDOA 2YCDA 2CX3A 4ICYA 2B5YA 3BD2A 2PERA 5A5HA 1SK1A 2H0GA 2HNLA 4EVMA 1O81A 2IMDA 1PL2A 2DJ2A 5GSSA 3RBTA 4AJ8A 4TOPA 2H6XA 2PWJA 1SVMA 5F05A 3FEUA 3N9JA 6GSYA 3DEXA 2OE3A 3P8WA 5J4YA 4GWRA 1LU4A 2CZ2A 3C73A 1A2MA 4BIKA 2OBKA 4BWQA 1T4ZA 4MJEA 5E4WA 1SVOA 2C3NA 2R0PA 4TR0A 2AYTA 1C72A 4HOJA 2V6KA 1K3YA 2GS3A 2V32A 1O73A 1SK0A 2J23A 5B6NA 5HR0A 2OA7A 2YJ7A 3FYGA 4AKIA 3ZIVA 3CSHA 1A23A 3HYPA 3I43A 4LLRA 4Z2RA 4JR4A 4USSA 1QGVA 2PPTA 1VGLA 4V2NA 1EV9A 3W8JA 2WW2A 4TR1A 1WOUA 3RHCA 3M0FA 4DSRA 4ECJA 4K1FA 2E2MA 2V6OA 2ZUPA 1XPVA 2VLVA 4ID0A 4EF0A 2HE3A 4AF2A 5HQPA 1T00A 2WZSA 4WXTA 5IMCA 1GSYA 3LYPA 5BMUA 3TB2A 5AIVA 4AKXB 1X0RA 2IMEA 3L9UA 3GV1A 2CA8A 2C1YA 3GURA 5G30A 2H74A 4WR5A 2O89A 2X8HA 1X5CA 1YKCA 4O5QA 5E59A 2V2GA 4RI6A 2GVPA 4PUFC 1AQVA 17GSA 3H8QA 3UVTA 3PPUA 2GZPA 2L5LA 4JU5A 1GTIA 2WW1A 4Q5FA 2IMIA 3L9VA 4MZBA 2X4AA 4OFNA 5IO0A 3TOUA 4MF6A 2O7KA 4IGJA 4E68A 1B8XA 4K0GA 2R2JA 2KUCA 5B8AA 4ZL7A 1U88A 2VUPA 4MJCA 4KAEA 6GSSA 1V98A 3HJOA 4MPFA 4PQIA 1WJKA 3TKRA 4ZB8A 1F3BA 3L9SA 1DE2A 3M3MA 3GRXA 2CX4A 2AAWA 3ERFA 4MNNA 16GSA 5G1KA 2EIOA 1PFOA 2A2SA 5J47A 1DBYA 3LG6A 5LCZA 1N8JA 2RIIA 4XRDA 3BJ5A 1WIKA 4IJIA 1N25A 5DDLA 4HEA2 1SENA 3KIJA 3PR8A 4BVYA 2GTUA 2IMFA 5ECKB 3FRCA 3ERWA 1QUWA 4EO3A 5D93A 4PUAA 2H1BA 3IV4A 3QAVA 5ENUA 5G5FA 2GDRA 1FHEA 2GSRA 5D96A 4YQMA 3GKNA 5DQSA 1XWGA 2FD3A 4KDYA 1EV4A 2VO4A 2VL9A 3GYKA 1MD3A 1PGTA 2AHEA 1GLPA 2GSTA 3DXBA 4PQ1A 3RPPA 2H76A 1XG8A 3ZFBA 4KE3A 3M8NA 5COHA 5ID2A 2H73A 2FCHA 1V57A 2NVLA 1EP7A 1PKZA 2UV8G 4JBBA 4XS4B 4GSTA 5DAKA 2HSMB 3NIVA 3HJMA 4IVFA 1K0MA 2G0FA 2HRKB 3EC3A 1YVLA 5HFKA 3UEMA 1XWCA 2K9FA 3G7YA 2I81A 3EMXA 2H01A 3QR6A 3GN3A 2C80A 3ZVJD 3TOTA 3HA9A 1ZYPA 3H93A 5J41A 4L0WA 4O5RA 3IHGA 5KEJA 1JZOA 1B4QA 4MH2A 5J3RA 4ZBDA 3HKRA 1TRWA 3GFKA 2FY6A 3CHXC 2YWMA 3IK7A 2CV4A 2K18A 1XW9A 3F0IA 1AW9A 2F51A 2LRCA 5A34A 3Q74A 1ML6A 2YZHA 1M2BA 5JWQB 4YKFA 2WGRA 4ILFA 1XZOA 4OD7A 1F9MA 1YJ6A 3C7MA 4HDEA 1YDKA 1O6JA 2N5AA 2ES7A 2EFEA 4HU9A 1K0NA 2L6CA 4Z2TA 1JZWA 1GSFA 1TI3A 2C0EA 3P2AA 4PXOA 1QK8A 1FW1A 4NHWA 5FWGA 1JLVA 2EC4A 3RHBA 2UZ8A 4E8HA 2VCXA 4IP6A 11GSA 5LD0A 4ZL9A 3M9KA 1Z7PA 4AJ6A 5DALB 5ECIB 5EY6A 3TRPA 2DKIA 4WF5A 2PGTA 1SYXA 1WP0A 1H4OA 1E2YA 2IPAA 2OACA 2PUKC 2HRFA 3CWGA 3E3EA 1ZMAA 2YPMA 3IRAA 2R6KA 1TDIA 1K0CA 1SL2B 4L8EA 1Y6EA 4G9HA 2QC7A 4FIWA 3KGKA 1XW6A 2WVXA 4MK3A 5JCUA 2VD1A 2K8SA 2XBIA 3J7Yb 3MNGA 1B9YC 3UIWA 1QXHA 2CVKA 2GT6A 2EIRA 2WB9A 5DBQA 1X9SB 1F3AA 3CTFA 3UARA 3SWLA 2A2PA 2LJKA 4WBRD 3VWXA 2P0GA 3TKSA 2CQ9A 1S3AA 2YWIA 3HZ4A 2B7JA 4OO4A 4MMMA 3F3RA 3NOFA 1M0UA 3VFIA 2CVBA 3A3TA 1M9AA 1SKRB 1ZL9A 4FXYP 1AC1A 3TKSE 1Y1UA 2TRXA 4K5SA 2GZZA 4KNDA 1XVWA 4O32A 4KDUA 2FA8A 5IMZA 4OFMA 3W6GA 2YZUA 4GSSA 2JZRA 5ECNB 3GMFA 1V40A 1GSDA 3CSIA 2DIYA 4K2DA 1VF1A 3A5IA 1R7HA 4L5OA 2B6MA 1CQGA 1F6MC 2O36A 4MP4A 3WGXA 3WD6A 4TR4A 3UOMA 2XHFA 2P31A 3MDKA 5IQYA 3IHQA 4ZBBA 2F8AA 3A2XA 5CRHA 3GL5A 4EUYA 3TKPA 3ZYWA 2IFQB 2PVOC 1TXUA 5D8IA 4HQSA 1B9XC 2DSAA 4LA1A 5H5RA 3VWVA 5INYA 1A24A 1BQ7A 4JZQA 2VKZG 4Z7XA 4RI7A 2H72A 3WGDA 1S4BP 3ZLPA 2YANA 4HUAA 2K6VA 3WT2A 5IM9A 2DJ3A 5D9XA 4ML1A 4GF0A 2EFHA 5CRGA 3VPQA 1OC9B 3IC8A 4DVCA 5ELAA 4XTSA 10GSA 3CBUA 1YEWC 4ECCA 2KHPA 3ZREA 1N2AA 5JWOB 2JZTA 1HNCA 4OCEA 1TK8B 3GA4A 2MMNA 1GSQA 2MZCA 4YAPA 1XIYA 2IWTA 4TVEA 1SL0B 1IYIA 5AN1A 2C0GA 1AXDA 2LRNA 2AB6A 1WMJA 2H71A 3R2QA 3UMAA 3VK9A 4PTSA 4MPGA 2VAFA 4AKGA 4OFTA 4MJBA 1G6WA 3ED3A 5F06A 2NPBA 2HXKA 3ZFLA 2C8UA 5DJLA 5J4VA 4N11A 1I5GA 4DSSA 1XWAA 1OYJA 1TOFA 2JADA 4X4JA 3D5JA 2RUFA 2RM5A 4Z2UA 1FB6A 3KEBA 4G0KA 3ZRDA 1G0TA 2AUVA 2C0FA 2VD0A 5AISA 2QGVA 3L78A 2HZEA 2AJQB 3CYNA 3IC4A 3LW9A 5L71A 2HSNB 1E6BA 13GSA 1PL1A 3DWVA 1BX9A 1EOHA 2YV9A 2OKAA 2WFCA 4GRFA 1Z9HA 5IOXA 2OADA 4WF4A 1U6TA 4YH2A 4GCIA 2DMLA 3HY2A 1IYHA 2VM1A 1K3LA 4AGSA 4FYUA 4CW9A 5J9BA 2H19A 2FWHA 3LSZA 1RW1A 1YKAA 4WKWA 4KH7A 4I5QA 1Z7RA 2PN8A 1FG4A 3GH6A 1JZDA 4EC0A 5IPGA 1TP9A 5EL8A 2LQOA 1YQ1A 1GSEA 18GSA 2DMMA 1FB0A 1G7OA 5GSTA 4FQUA 1JLWA 2VCZA 4N0VA 2F3MA 1XFLA 4TRXA 1A2JA 4PX1A 4HS1A 3DGQA 1ACVA 5LNKe 2O5VA 1GWCA 1ERTA 1EWXA 4G0IA 4RQRA 2EIQA 3BOAA 2H1LA 1ST9A 1CQHA 2FWEA 1UA5A 5IOWA 2MBTA 3KJYA 5A1NB 2KP2A 2XPDA 3KCMA 1WRYA 2XBQA 6GSWA 1TW9A 4N30A 5JWRB 4KSOA 2N5FA 3D4TA 1GLQA 1XWBA 4I6XA 4IHUA 1JHBA 2WZ9A 3EU3A 1EGOA 1TRUA 2LV3A 3KMOA 1QFNA 1HD2A 2HI7A 3QD9A 5B7CA 2VM2A 1PSQA 3D22A 4GQFA 1SD9A 5IMAA 1KNGA 2WVXB 1PA3A 4F0CA 4K7IA 1NW2A 3F63A 19GSA 2DJKA 1TK5B 2PU9C 4ULXA 4K9ZA 4XS6A 3IK9A 3LWAA 3C71A 1NHOA 1FVJA 1SU9A 2HLSA 4IQ1A 1TXXA 2YOIA 3TKQA 4EIPA 1T4YA 2FWFA 2DJJA 1PRXA 1Z3EA 5HFGA 1ZZYA 3TUEA 5CAXA 3DYRA 1SYRA 4IP1A 2BMXA 5D9TA 2TIRA 1GUMA 1QMVA 1RK4A 1Q98A 2OT3A 3F6FA 5KOXA 3EURA 1Z5YE 4BL7A 3IPZA 3ZIJA 2MMOA 1V9WA 2MMZA 14GSA 2I3YA 2VCVA 2QA1A 5H5QA 1THOA 2LSTA 2L6DA 3HHVA 3VPTA 1EEMA 3E0UA 3GKXA 5IMDA 4PGTA 3EMPA 5BRTA 4IS0A 2LQQA 4GSNA 4XIHA 4G0LA 1YF1A 1NHYA 1BYEA 3GTUB 5A4VA 4ML6A 5KN0A 4PI2C 2JU5A 3A2VA 2H0HA 3R3EA 3EYTA 2YV7A 5ECPB 3GIXA 1TKDB 2C3QA 4F0BA 4G10A 2VCQA 3H1NA 2OE1A 3PH9A 5F07A 1TI1A 5G5EA 1J0FA 3DIEA 5J9CA 4EXJA 4BVXB 1NM3A 2C4JA 1BEDA 3KH7A 1GL8A 4X0XA 4ZXGA 3DVWA 4K7OA 3KMNA 2L4CA 4BPYA 2L57A 3EINA 1R5AA 3VI5A 1U3IA 1MDKA 5GAND 1X9MB 4K6XA 3ME8A 3ME7A 3PGTA 4POMA 6GSUA 1H75A 5ECSA 3D6IA 2P5RA 4MABA 2VLUA 4LL4B 3RFRC 1O85A 2OJLA 4KCEA 3LQ7A 3TRXA 4POKA 2HQTA 3TJKA 2X8GA 1ERVA 2WW3A 3P90A 1M2DA 20GSA 3L0HA 3DRNA 4QMKA 2GGTA 3TKSC 2DJ1A 5JCGA 1OVNA 4L5LA 2DLXA 2GQKA 2X8CA 1SD8A 1K0DA 1KEBA 3EE2A 2RLIA 2M46A 3GKMA 5A5HB 4O7HA 2N5BA 1GH2A 3G7JA 3IBHA 3WGEA 1AAZA 5J4UA 4XCSA 1FVKA 1WWJA 5A4UA 6GSVA 1V58A 1B4PA 2DBCA 5F8BA 1ZCPA 1GTUA 2CAQA 1M2AA 3G7IA 1YEPA 1R5PA 1WE0A 2VOCA 1HNBA 2RM6A 1DSBA 3RPNA 2FA4A 4TXOA 4KF9A 1T7PB 3HCZA 2FUG2 4H86A 3TRQA 5IMFA 1ZYQB 4E8EA 3TJBA 3FW2A 1ZYEA 2VCTA 4OCFA 1OAZA 4D73A 5HFIA 3GHAA 2BTOT 3CSJA 4HSCX 4HZ4A 2R0CA 4DSQA 3HVNA 4OWYA 2LJAA 4KCAA 5DCGA 3HDCA 3ZMLA 3RGBC 4AJ7A 4TR1B 1ERUA 3GH9A 3ZZXA 1I1IP 4ACSA 5CRDA 3FHKA 1EOGA 2O8VB 3D4MA 2HRNA 5BMUB 3HMJG 2J9HA 3GNJA 4YQUA 1A0RP 2VLTA 4TR3A 3TJFA 5HR3A 3LXZA 1YY7A 3HD5A 2HSHA 2DKHA 3KH9A 3MIXA 2E7PA 4O5UA 2WCIA 3TDGA 2WVYA 3CTGA 1J9BA 3IE3A 4K5RA 3LYKA 1BG1A 4CY6A 2X64A 4JRRA 3F8UA 7GSSA 4KX4A 3KP9A 4TXVA 2V41A 2LS5A 3LFLA 1BAYA 5ECRB 2WVZA 4NAXA 3HVVA 2NTOA 2GSQA 5ECOB 4QL7A 4MH3A 5G2ZA 4FH8A 2DIZA 4G01A 5ECMB 5D73A 3AY8A 3MSZA 1XWKA 2A2RA 3NZNA 2H6YA 5KN2A 2X99A 4XS4A 1O8XA 3TJJA 3M9JA 2HSMA 1TK0B 1ILOA 4IBPA 1TJDA 2B5XA 4G2EA 3VWUA 4FYCA 2HRKA 1A2LA 3US3A 3HJPA 2KOKA 1VF2A 1TU7A 3FR9A 3OR5A 2HT9A 2QA2A 1RQMA 5D9WA 4TW5A 3H79A 3CQFA 1HNAA 2TRCP 2YNXA 1GNWA 1FOHA 4Q5QA 5B6MA 2LRTA 1DUGA 2O85A 4QL9A 2L4QA 4XHMA 2QKEA 3V1WA 2IIYA 4BWSA 3LXTA 2CZ3A 4KB3A 4BVYB 2E2GA 1KBNA 4ZL8A 2WW0A 1Q4JA 1YF0A 2HRAA 5F0GA 2LNTA 2LTKA 4NXIA 4ECIA 4EDYA 3DKSA 2Z9SA 5EPFA 2PMTA 3ZTLA 2VIMA 4V1Ap 3RAZA 3APOA 3LORA 3APQA 4GLTA 3VURA 4WR4A 4GDFA 2WRTA 1SK2A 2VCWA 2NBSA 3FZAA 4EE0A 4WBJA 3J7Yk 3ISOA 2M80A 2L5OA 4I2TA 2O87A 3DMLA 1PD21 1THXA 4CHSA 5ECHB 1W89A 2VL2A 4LL1B 2B1KA 1M9BA 1I9DA 1URMA 3FK8A 5CREA 1TU8A 4BL7B 2IMKA 2O3EA 4PNGA 3P7XA 5ID2B 5DALA 2R0GA 1Z6NA 5KN3A 1OE7A 1XW5A 3KP8A 3ERGA 5J40A 2JSYA 5DAKB 4J57E 3A2WA 2H1DA 1ERWA 1S3RA 3QAGA 2H66A 2EFCA 3F4TA 3GKKA 1XXUA 2L59A 4NV2A 2GLRA 1J08A 4EIQA 5DJMA 4CY8A 1A0FA 2I1UA 1VF3A 2R3XA 4V1Ag 4HU7A 3CXGA 3KD0A 4GQCA 3O3TA 4AI6A 2YWOA 4KDXA 1XBSA 4EDZA 1F37A 3QDNA 1GUKA 5A34B 2DC5A 4AKHA 1PN9A 1FO5A 3WYWA 2HFDA 2HZFA 3BCKA 2K8VA 4PQHA 4I8BA 1YZXA 4TN8A 1WPIA 3IXRA 4F03A 3QOUA 3C8EA 2C0DA 4A5PA 2WDUA 1K0AA 4ZB7A 3A5WA 4HQZA 5A5KA 1TRVA 3QFAC 3FZ5A 1V2AA 5ECQB 1SJZA 2C3TA 3UJ1A 1AIUA 1PKWA 2OE0A 4PI0C 3LGCA 2B1LA 4IJ3A 5IO2A 2B7KA 2R37A 4IELA 4FO5A 3KXOA 2MBSA 4TXOB 3G9BA 3KZQA 1EEJA 3MYDA 2GZYA 2LKUA 2B3SA 3DVXA 2X49A 3UAPA 1VRSD 3I9V2 3EPTA 3I69A 4D73B 4KSMA 5HR1A 3FZ4A 1NSWA 2G2QA 3U5RE 3UVHA 1T3BA 4K8MA 3DD3A 2H6ZA 4MA9A 3IAS2 2GSSA 4Q5NA 4W66A 2IFQA 5AIXA 2H1GA 1A8YA 4NPBA 2VL3A 4KGIA 1BG5A 3LJRA 4BA7A 4LMWA 1PX7A 1X5DA 2H30A 2HSYA 3TJGA 2JZSA 2F9SA 5CNWA 3PINA 2I4AA 2R5GA 4ZBAA 4N10A 5ECLB 5GAPD 2H70A 1OC9A 1JZRA 3D21A 3IDVA 1R26A 1UVZA 4IKHA 4X1UA 4JE1A 2WS2A 3GUSA 4IW9A 2GQLA 4KA0A 2V1MA 4WETA 5FT3A 3W8SA 4X43A 1AQWA 1M3IA 5IMVA 4NWYA 3ZL5A 1EGRA 1PQNA 1SVLA 3F4RA 1ZOFA 4MJAA 4O92A 2PVQA 1FAAA 4ZILA 3QPMA 1GSUA 2OBIA 4WEYA 2WJUA 1ON4A 1M3JA 4NMUA 1Y25A 5H5SA 4OO5A 4YKGA 1SJ6A 4TKYA 4F82A 2FGXA 2YWNA 3VWWA 1KTEA 2MMAA 4MF5A 3LEFA 1A8LA 1GNEA 2LJRA 1PN0A 4POLA
chains in the Genus database with same CATH topology
1U3AA 1DE1A 2D2ZA 3Q18A 2GT5A 4IN0A 4YQVA 5IPHA 1HYUA 1VF4A 1OC3A 4ZB6A 1S3CA 5JCWA 2E0QA 2R4VA 1GUHA 1OKDA 4JR6A 8GSSA 3UBKA 1T8EB 3CRTA 3UBLA 4MCUA 1LBKA 2XPEA 4L0UA 3ZITA 1XOBA 4XRAA 2FLSA 4FYBA 3L4NA 4I2UA 3I6AA 2A4VA 2HSNA 3M1GA 4ZIJA 3FZ9A 5EVOA 2CAIA 1LJRA 3ZVJA 4I97A 1AUCA 9GSSA 3GX8A 1PMTA 3TGZA 2YP6A 2LNSA 3UL3A 2JACA 3S9FA 1XVQA 1Z6MA 3ZMKA 3BBYA 4EKZA 4MF7A 4J56E 2MYGA 2BJXA 3F4SA 4HJMA 4JEDA 2FHEA 1X5EA 2AV4A 3IR4A 1GP1A 3HVXA 2DJ0A 4MLYA 5IIZA 1O8WA 22GSA 1MDJA 2KP1A 5ELGA 1USBA 2ON7A 3FMWA 2KLXA 4LMVA 5B8BA 4J2FA 2ZNMA 4ECBA 1MDIA 3APSA 2JSZA 4K0NA 1O7UA 4P3YB 3O76A 1SKWB 1OKTA 2XC2A 3RDWA 5GZZB 6GSTA 2REMA 5CO3A 3CMIA 3F6DA 4DSSB 4GTUA 2IN3A 3Q19A 2P5QA 1OC8A 3QCPA 2H1AA 1TRSA 5C04A 1SL1B 1G6YA 1ZYNA 1GULA 1GRXA 5A1NA 2EFDA 3TU3B 1YEXA 4IQAA 3N5OA 2M72A 1FOVA 5CP1A 5AGYA 5FHIA 4YAVA 2JL4A 3GSTA 2HZEB 2IJYA 3QFBC 1EP8A 3KTBA 2F8FA 2I9HA 2FNOA 2LEGA 1QQ2A 4HI7A 3F3QA 3MWHA 3D0ZA 1SJIA 1X9WB 2FWGA 3WT1A 1TTZA 1UC7A 1K0BA 1GTAA 2YJHA 3SBCA 1UN2A 5KN1A 4MZWA 1GSSA 3GL3A 3C1SA 3FKFA 1R4WA 1BJXA 4GXZA 2CVDA 2LUSA 1M7TA 3IA1A 4XS1A 5CRWA 4HJ2A 3E9JB 1EZKA 2H75A 1M99A 4V2LA 3BCIA 1K3OA 1W4VA 5CYYA 3FR3A 2H8LA 12GSA 3QMXA 3VLNA 4OMVA 2WULA 5DQYA 4KW6A 1ABAA 4ISDA 2VL2C 1F2EA 3JCML 5DCHA 2IL3A 3F9UA 4V2MA 1HQOA 3K8NA 1SKSB 3EVIA 1PX6A 4F9ZA 3KTLA 3Q6OA 3VI7A 3GSSA 4HZ2A 5J5NA 4DEJA 3HXSA 2ON5A 1B48A 1ZGNA 4Q5RA 3GTUA 1G7EA 3IAM2 5G1LA 3HVSA 4N0ZA 4RUVA 4F2IA 3IOSA 5C00A 4POBA 4QQ7A 4ZB9A 1MEKA 2RUEA 3KM6A 2ALBA 2NDOA 5ABRA 3FR6A 3H4KA 3O6TA 2HYXA 4N3ZA 1S3DA 4K2XA 3EU4A 5DVBA 2YN1A 2CT6A 4K7NA 4BVXA 3C1RA 3FY7A 1AQXA 1MD4A 4KUNA 6GSXA 2H0IA 2QSIA 5G31A 1K0OA 1T1VA 4PURA 5D9VA 4RQXA 5HR2A 1MTCA 4MDCA 1BF5A 4MZCA 4G19A 2GQMA 3QAWA 3U6VA 1OE8A 3HZ8A 1JFUA 3TCOA 5KOWA 2B5EA 4NV5A 1U87A 1XCCA 2ZCTA 2A4HA 1GTBA 4PNFA 3EWLA 4EL1A 5A4WA 3CRUA 2PBJA 3MAKA 4NHZA 1XOAA 3GX0A 4CDOA 2YCDA 2CX3A 4ICYA 2B5YA 3BD2A 2PERA 5A5HA 1SK1A 2H0GA 2HNLA 4EVMA 1O81A 2IMDA 1PL2A 2DJ2A 5GSSA 3RBTA 4AJ8A 4TOPA 2H6XA 2PWJA 1SVMA 5F05A 3FEUA 3N9JA 6GSYA 3DEXA 2OE3A 3P8WA 5J4YA 4GWRA 1LU4A 2CZ2A 3C73A 1A2MA 2OBKA 4BWQA 1T4ZA 4MJEA 5E4WA 1SVOA 2C3NA 2R0PA 4TR0A 2AYTA 1C72A 4HOJA 2V6KA 1K3YA 2GS3A 2V32A 1O73A 1SK0A 2J23A 5B6NA 5HR0A 2OA7A 2YJ7A 3FYGA 4AKIA 3ZIVA 3CSHA 1A23A 3HYPA 3I43A 4LLRA 4Z2RA 4JR4A 4USSA 1QGVA 2PPTA 1VGLA 4V2NA 1EV9A 3W8JA 4TR1A 1WOUA 3RHCA 3M0FA 4DSRA 4ECJA 4K1FA 2E2MA 2V6OA 2ZUPA 1XPVA 2VLVA 4ID0A 4EF0A 2HE3A 4AF2A 5HQPA 1T00A 4WXTA 5IMCA 1GSYA 3LYPA 5BMUA 3TB2A 5AIVA 4AKXB 1X0RA 2IMEA 3L9UA 3GV1A 2CA8A 2C1YA 3GURA 5G30A 2H74A 4WR5A 2O89A 2X8HA 1X5CA 1YKCA 4O5QA 5E59A 2V2GA 4RI6A 2GVPA 4PUFC 1AQVA 17GSA 3H8QA 3UVTA 3PPUA 2GZPA 2L5LA 4JU5A 1GTIA 4Q5FA 2IMIA 3L9VA 4MZBA 2X4AA 4OFNA 5IO0A 3TOUA 4MF6A 2O7KA 4IGJA 4E68A 1B8XA 4K0GA 2R2JA 2KUCA 5B8AA 4ZL7A 1U88A 2VUPA 4MJCA 4KAEA 6GSSA 1V98A 3HJOA 4MPFA 4PQIA 1WJKA 3TKRA 4ZB8A 1F3BA 3L9SA 1DE2A 3M3MA 3GRXA 2CX4A 2AAWA 3ERFA 4MNNA 16GSA 5G1KA 2EIOA 2A2SA 5J47A 1DBYA 3LG6A 5LCZA 1N8JA 2RIIA 4XRDA 3BJ5A 1WIKA 4IJIA 1N25A 5DDLA 4HEA2 1SENA 3KIJA 3PR8A 4BVYA 2GTUA 2IMFA 5ECKB 3FRCA 3ERWA 1QUWA 4EO3A 5D93A 4PUAA 2H1BA 3IV4A 3QAVA 5ENUA 5G5FA 2GDRA 1FHEA 2GSRA 5D96A 4YQMA 3GKNA 5DQSA 1XWGA 2FD3A 4KDYA 1EV4A 2VO4A 2VL9A 3GYKA 1MD3A 1PGTA 2AHEA 1GLPA 2GSTA 3DXBA 4PQ1A 3RPPA 2H76A 3ZFBA 4KE3A 3M8NA 5COHA 5ID2A 2H73A 2FCHA 1V57A 2NVLA 1EP7A 1PKZA 2UV8G 4JBBA 4XS4B 4GSTA 5DAKA 2HSMB 3NIVA 3HJMA 4IVFA 1K0MA 2G0FA 2HRKB 3EC3A 1YVLA 5HFKA 3UEMA 1XWCA 2K9FA 3G7YA 2I81A 3EMXA 2H01A 3QR6A 3GN3A 2C80A 3ZVJD 3TOTA 3HA9A 1ZYPA 3H93A 5J41A 4L0WA 4O5RA 3IHGA 5KEJA 1JZOA 1B4QA 4MH2A 5J3RA 4ZBDA 3HKRA 1TRWA 3GFKA 2FY6A 2YWMA 3IK7A 2CV4A 2K18A 1XW9A 3F0IA 1AW9A 2F51A 2LRCA 5A34A 3Q74A 1ML6A 2YZHA 1M2BA 5JWQB 4YKFA 2WGRA 4ILFA 1XZOA 4OD7A 1F9MA 1YJ6A 3C7MA 4HDEA 1YDKA 1O6JA 2N5AA 2ES7A 2EFEA 4HU9A 1K0NA 2L6CA 4Z2TA 1JZWA 1GSFA 1TI3A 2C0EA 3P2AA 4PXOA 1QK8A 1FW1A 4NHWA 5FWGA 1JLVA 2EC4A 3RHBA 2UZ8A 4E8HA 2VCXA 4IP6A 11GSA 5LD0A 4ZL9A 3M9KA 1Z7PA 4AJ6A 5DALB 5ECIB 5EY6A 3TRPA 2DKIA 4WF5A 2PGTA 1SYXA 1WP0A 1H4OA 1E2YA 2IPAA 2OACA 2PUKC 2HRFA 3CWGA 3E3EA 1ZMAA 2YPMA 3IRAA 2R6KA 1TDIA 1K0CA 1SL2B 4L8EA 1Y6EA 4G9HA 2QC7A 4FIWA 3KGKA 1XW6A 4MK3A 5JCUA 2VD1A 2K8SA 2XBIA 3J7Yb 3MNGA 1B9YC 3UIWA 1QXHA 2CVKA 2GT6A 2EIRA 2WB9A 5DBQA 1X9SB 1F3AA 3CTFA 3UARA 3SWLA 2A2PA 2LJKA 4WBRD 3VWXA 2P0GA 3TKSA 2CQ9A 1S3AA 2YWIA 3HZ4A 2B7JA 4OO4A 4MMMA 3F3RA 3NOFA 1M0UA 3VFIA 2CVBA 3A3TA 1M9AA 1SKRB 1ZL9A 1AC1A 3TKSE 1Y1UA 2TRXA 4K5SA 2GZZA 4KNDA 1XVWA 4O32A 4KDUA 2FA8A 5IMZA 4OFMA 3W6GA 2YZUA 4GSSA 2JZRA 5ECNB 3GMFA 1V40A 1GSDA 3CSIA 2DIYA 4K2DA 1VF1A 3A5IA 1R7HA 4L5OA 2B6MA 1CQGA 1F6MC 4MP4A 3WGXA 3WD6A 4TR4A 3UOMA 2XHFA 2P31A 3MDKA 5IQYA 3IHQA 4ZBBA 2F8AA 3A2XA 5CRHA 3GL5A 4EUYA 3TKPA 3ZYWA 2IFQB 2PVOC 1TXUA 5D8IA 4HQSA 1B9XC 2DSAA 4LA1A 5H5RA 3VWVA 5INYA 1A24A 1BQ7A 4JZQA 2VKZG 4Z7XA 4RI7A 2H72A 3WGDA 3ZLPA 2YANA 4HUAA 2K6VA 3WT2A 5IM9A 2DJ3A 5D9XA 4ML1A 4GF0A 2EFHA 5CRGA 3VPQA 1OC9B 3IC8A 4DVCA 5ELAA 4XTSA 10GSA 3CBUA 2KHPA 4ECCA 3ZREA 1N2AA 5JWOB 2JZTA 1HNCA 4OCEA 1TK8B 3GA4A 2MMNA 1GSQA 2MZCA 4YAPA 1XIYA 2IWTA 4TVEA 1SL0B 1IYIA 5AN1A 2C0GA 1AXDA 2LRNA 2AB6A 1WMJA 2H71A 3R2QA 3UMAA 3VK9A 4PTSA 4MPGA 2VAFA 4AKGA 4OFTA 4MJBA 1G6WA 3ED3A 5F06A 2NPBA 2HXKA 3ZFLA 2C8UA 5DJLA 5J4VA 4N11A 1I5GA 4DSSA 1XWAA 1OYJA 1TOFA 2JADA 4X4JA 3D5JA 2RUFA 2RM5A 4Z2UA 1FB6A 3KEBA 4G0KA 3ZRDA 1G0TA 2AUVA 2C0FA 2VD0A 5AISA 2QGVA 3L78A 2HZEA 2AJQB 3CYNA 3IC4A 3LW9A 5L71A 2HSNB 1E6BA 13GSA 1PL1A 3DWVA 1BX9A 1EOHA 2YV9A 2OKAA 2WFCA 4GRFA 1Z9HA 5IOXA 2OADA 4WF4A 1U6TA 4YH2A 4GCIA 2DMLA 3HY2A 1IYHA 2VM1A 1K3LA 4AGSA 4FYUA 4CW9A 5J9BA 2H19A 2FWHA 3LSZA 1RW1A 1YKAA 4WKWA 4KH7A 4I5QA 1Z7RA 2PN8A 1FG4A 3GH6A 1JZDA 4EC0A 5IPGA 1TP9A 5EL8A 2LQOA 1YQ1A 1GSEA 18GSA 2DMMA 1FB0A 1G7OA 5GSTA 4FQUA 1JLWA 2VCZA 4N0VA 2F3MA 1XFLA 4TRXA 1A2JA 4PX1A 4HS1A 3DGQA 1ACVA 5LNKe 2O5VA 1GWCA 1ERTA 1EWXA 4G0IA 4RQRA 2EIQA 3BOAA 2H1LA 1ST9A 1CQHA 2FWEA 1UA5A 5IOWA 2MBTA 3KJYA 5A1NB 2KP2A 2XPDA 3KCMA 1WRYA 2XBQA 6GSWA 1TW9A 4N30A 5JWRB 4KSOA 2N5FA 3D4TA 1GLQA 1XWBA 4I6XA 4IHUA 1JHBA 2WZ9A 3EU3A 1EGOA 1TRUA 2LV3A 3KMOA 1QFNA 1HD2A 2HI7A 3QD9A 5B7CA 2VM2A 1PSQA 3D22A 4GQFA 1SD9A 5IMAA 1KNGA 1PA3A 4F0CA 4K7IA 1NW2A 3F63A 19GSA 2DJKA 1TK5B 2PU9C 4ULXA 4K9ZA 4XS6A 3IK9A 3LWAA 3C71A 1NHOA 1FVJA 1SU9A 2HLSA 4IQ1A 1TXXA 2YOIA 3TKQA 4EIPA 1T4YA 2FWFA 2DJJA 1PRXA 1Z3EA 5HFGA 1ZZYA 3TUEA 5CAXA 3DYRA 1SYRA 4IP1A 2BMXA 5D9TA 2TIRA 1GUMA 1QMVA 1RK4A 1Q98A 2OT3A 3F6FA 5KOXA 3EURA 1Z5YE 4BL7A 3IPZA 3ZIJA 2MMOA 1V9WA 2MMZA 14GSA 2I3YA 2VCVA 2QA1A 5H5QA 1THOA 2LSTA 2L6DA 3HHVA 3VPTA 1EEMA 3E0UA 3GKXA 5IMDA 4PGTA 3EMPA 5BRTA 4IS0A 2LQQA 4GSNA 4XIHA 4G0LA 1YF1A 1NHYA 1BYEA 3GTUB 5A4VA 4ML6A 5KN0A 2JU5A 3A2VA 2H0HA 3R3EA 3EYTA 2YV7A 5ECPB 3GIXA 1TKDB 2C3QA 4F0BA 4G10A 2VCQA 3H1NA 2OE1A 3PH9A 5F07A 1TI1A 5G5EA 1J0FA 3DIEA 5J9CA 4EXJA 4BVXB 1NM3A 2C4JA 1BEDA 3KH7A 1GL8A 4X0XA 4ZXGA 3DVWA 4K7OA 3KMNA 2L4CA 4BPYA 2L57A 3EINA 1R5AA 3VI5A 1U3IA 1MDKA 5GAND 1X9MB 4K6XA 3ME8A 3ME7A 3PGTA 4POMA 6GSUA 1H75A 5ECSA 3D6IA 2P5RA 4MABA 2VLUA 4LL4B 1O85A 2OJLA 4KCEA 3LQ7A 3TRXA 4POKA 2HQTA 3TJKA 2X8GA 1ERVA 3P90A 1M2DA 20GSA 3L0HA 3DRNA 4QMKA 2GGTA 3TKSC 2DJ1A 5JCGA 1OVNA 4L5LA 2DLXA 2GQKA 2X8CA 1SD8A 1K0DA 1KEBA 3EE2A 2RLIA 2M46A 3GKMA 5A5HB 4O7HA 2N5BA 1GH2A 3G7JA 3IBHA 3WGEA 1AAZA 5J4UA 4XCSA 1FVKA 1WWJA 5A4UA 6GSVA 1V58A 1B4PA 2DBCA 5F8BA 1ZCPA 1GTUA 2CAQA 1M2AA 3G7IA 1YEPA 1R5PA 1WE0A 2VOCA 1HNBA 2RM6A 1DSBA 3RPNA 2FA4A 4TXOA 4KF9A 1T7PB 3HCZA 2FUG2 4H86A 3TRQA 5IMFA 1ZYQB 4E8EA 3TJBA 3FW2A 1ZYEA 2VCTA 4OCFA 1OAZA 4D73A 5HFIA 3GHAA 2BTOT 3CSJA 4HZ4A 2R0CA 4DSQA 4OWYA 2LJAA 4KCAA 5DCGA 3HDCA 3ZMLA 4AJ7A 4TR1B 1ERUA 3GH9A 3ZZXA 4ACSA 5CRDA 3FHKA 1EOGA 2O8VB 3D4MA 2HRNA 5BMUB 3HMJG 2J9HA 3GNJA 4YQUA 1A0RP 2VLTA 4TR3A 3TJFA 5HR3A 3LXZA 1YY7A 3HD5A 2HSHA 2DKHA 3KH9A 3MIXA 2E7PA 4O5UA 2WCIA 3TDGA 3CTGA 1J9BA 3IE3A 4K5RA 3LYKA 1BG1A 4CY6A 2X64A 4JRRA 3F8UA 7GSSA 4KX4A 3KP9A 4TXVA 2V41A 2LS5A 3LFLA 1BAYA 5ECRB 4NAXA 3HVVA 2NTOA 2GSQA 5ECOB 4QL7A 4MH3A 5G2ZA 4FH8A 2DIZA 4G01A 5ECMB 5D73A 3AY8A 3MSZA 1XWKA 2A2RA 3NZNA 2H6YA 5KN2A 2X99A 4XS4A 1O8XA 3TJJA 3M9JA 2HSMA 1TK0B 1ILOA 4IBPA 1TJDA 2B5XA 4G2EA 3VWUA 4FYCA 2HRKA 1A2LA 3US3A 3HJPA 2KOKA 1VF2A 1TU7A 3FR9A 3OR5A 2HT9A 2QA2A 1RQMA 5D9WA 4TW5A 3H79A 1HNAA 2TRCP 2YNXA 1GNWA 1FOHA 4Q5QA 5B6MA 2LRTA 1DUGA 2O85A 4QL9A 2L4QA 4XHMA 2QKEA 3V1WA 2IIYA 4BWSA 3LXTA 2CZ3A 4KB3A 4BVYB 2E2GA 1KBNA 4ZL8A 1Q4JA 1YF0A 2HRAA 5F0GA 2LNTA 2LTKA 4NXIA 4ECIA 4EDYA 3DKSA 2Z9SA 5EPFA 2PMTA 3ZTLA 2VIMA 4V1Ap 3RAZA 3APOA 3LORA 3APQA 4GLTA 3VURA 4WR4A 4GDFA 2WRTA 1SK2A 2VCWA 2NBSA 3FZAA 4EE0A 4WBJA 3J7Yk 3ISOA 2M80A 2L5OA 4I2TA 2O87A 3DMLA 1PD21 1THXA 4CHSA 5ECHB 1W89A 2VL2A 4LL1B 2B1KA 1M9BA 1I9DA 1URMA 3FK8A 5CREA 1TU8A 4BL7B 2IMKA 4PNGA 3P7XA 5ID2B 5DALA 2R0GA 1Z6NA 5KN3A 1OE7A 1XW5A 3KP8A 3ERGA 5J40A 2JSYA 5DAKB 4J57E 3A2WA 2H1DA 1ERWA 3QAGA 2H66A 2EFCA 3F4TA 3GKKA 1XXUA 2L59A 4NV2A 2GLRA 1J08A 4EIQA 5DJMA 4CY8A 1A0FA 2I1UA 1VF3A 2R3XA 4V1Ag 4HU7A 3CXGA 3KD0A 4GQCA 3O3TA 4AI6A 2YWOA 4KDXA 1XBSA 4EDZA 1F37A 3QDNA 1GUKA 5A34B 2DC5A 4AKHA 1PN9A 1FO5A 3WYWA 2HFDA 2HZFA 3BCKA 2K8VA 4PQHA 4I8BA 1YZXA 4TN8A 1WPIA 3IXRA 4F03A 3QOUA 3C8EA 2C0DA 4A5PA 2WDUA 1K0AA 4ZB7A 3A5WA 4HQZA 5A5KA 1TRVA 3QFAC 3FZ5A 1V2AA 5ECQB 1SJZA 2C3TA 3UJ1A 1AIUA 1PKWA 2OE0A 3LGCA 2B1LA 4IJ3A 5IO2A 2B7KA 2R37A 4IELA 4FO5A 3KXOA 2MBSA 4TXOB 3G9BA 3KZQA 1EEJA 3MYDA 2GZYA 2LKUA 2B3SA 3DVXA 2X49A 3UAPA 1VRSD 3I9V2 3EPTA 3I69A 4D73B 4KSMA 5HR1A 3FZ4A 1NSWA 2G2QA 3U5RE 3UVHA 1T3BA 4K8MA 3DD3A 2H6ZA 4MA9A 3IAS2 2GSSA 4Q5NA 4W66A 2IFQA 5AIXA 2H1GA 1A8YA 4NPBA 2VL3A 4KGIA 1BG5A 3LJRA 4BA7A 4LMWA 1PX7A 1X5DA 2H30A 2HSYA 3TJGA 2JZSA 2F9SA 5CNWA 3PINA 2I4AA 2R5GA 4ZBAA 4N10A 5ECLB 5GAPD 2H70A 1OC9A 1JZRA 3D21A 3IDVA 1R26A 1UVZA 4IKHA 4X1UA 4JE1A 2WS2A 3GUSA 4IW9A 2GQLA 4KA0A 2V1MA 4WETA 5FT3A 3W8SA 4X43A 1AQWA 5IMVA 4NWYA 3ZL5A 1EGRA 1PQNA 1SVLA 3F4RA 1ZOFA 4MJAA 4O92A 2PVQA 1FAAA 4ZILA 3QPMA 1GSUA 2OBIA 4WEYA 2WJUA 1ON4A 4NMUA 5H5SA 1Y25A 4OO5A 4YKGA 1SJ6A 4TKYA 4F82A 2FGXA 2YWNA 3VWWA 1KTEA 2MMAA 4MF5A 3LEFA 1A8LA 1GNEA 2LJRA 1PN0A 4POLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3A A;  1DE1 A;  2D2Z A;  3Q18 A;  2GT5 A;  4IN0 A;  4YQV A;  5IPH A;  1HYU A;  1VF4 A;  1OC3 A;  4ZB6 A;  1S3C A;  5JCW A;  2E0Q A;  2R4V A;  1GUH A;  1OKD A;  4JR6 A;  8GSS A;  3UBK A;  1T8E B;  3CRT A;  3UBL A;  4MCU A;  1LBK A;  2XPE A;  4L0U A;  3ZIT A;  1XOB A;  4XRA A;  2FLS A;  4FYB A;  3L4N A;  4I2U A;  3I6A A;  2A4V A;  3M1G A;  4ZIJ A;  3FZ9 A;  5EVO A;  2CAI A;  1LJR A;  3ZVJ A;  4I97 A;  1AUC A;  9GSS A;  3GX8 A;  1PMT A;  3TGZ A;  2YP6 A;  2LNS A;  3UL3 A;  2JAC A;  3S9F A;  1XVQ A;  1Z6M A;  3ZMK A;  3BBY A;  4EKZ A;  4MF7 A;  4J56 E;  2MYG A;  2BJX A;  3F4S A;  4HJM A;  4JED A;  2FHE A;  1X5E A;  2AV4 A;  3IR4 A;  1GP1 A;  3HVX A;  2DJ0 A;  4MLY A;  5IIZ A;  1O8W A;  22GS A;  1MDJ A;  2KP1 A;  5ELG A;  1USB A;  2ON7 A;  2KLX A;  4LMV A;  5B8B A;  4J2F A;  2ZNM A;  4ECB A;  1MDI A;  3APS A;  2JSZ A;  4K0N A;  1O7U A;  4P3Y B;  3O76 A;  1SKW B;  1OKT A;  2XC2 A;  3RDW A;  5GZZ B;  6GST A;  2REM A;  5CO3 A;  3CMI A;  3F6D A;  4DSS B;  4GTU A;  2IN3 A;  3Q19 A;  2P5Q A;  1OC8 A;  3QCP A;  2H1A A;  1TRS A;  5C04 A;  1SL1 B;  1G6Y A;  1GUL A;  1GRX A;  1YEX A;  4IQA A;  3N5O A;  2M72 A;  1FOV A;  5CP1 A;  5AGY A;  5FHI A;  4YAV A;  2JL4 A;  3GST A;  2HZE B;  2IJY A;  3QFB C;  1EP8 A;  3KTB A;  2F8F A;  2I9H A;  2FNO A;  2LEG A;  1QQ2 A;  4HI7 A;  3F3Q A;  3MWH A;  3D0Z A;  1SJI A;  1X9W B;  2FWG A;  3WT1 A;  1TTZ A;  1UC7 A;  1K0B A;  1GTA A;  2YJH A;  3SBC A;  1UN2 A;  5KN1 A;  4MZW A;  1GSS A;  3GL3 A;  3C1S A;  3FKF A;  1R4W A;  1BJX A;  4GXZ A;  2CVD A;  2LUS A;  1M7T A;  3IA1 A;  4XS1 A;  5CRW A;  4HJ2 A;  3E9J B;  1EZK A;  2H75 A;  1M99 A;  4V2L A;  3BCI A;  1K3O A;  1W4V A;  5CYY A;  3FR3 A;  2H8L A;  12GS A;  3QMX A;  3VLN A;  4OMV A;  2WUL A;  5DQY A;  4KW6 A;  1ABA A;  4ISD A;  2VL2 C;  1F2E A;  3JCM L;  5DCH A;  2IL3 A;  3F9U A;  4V2M A;  1HQO A;  3K8N A;  1SKS B;  3EVI A;  1PX6 A;  4F9Z A;  3KTL A;  3Q6O A;  3VI7 A;  3GSS A;  4HZ2 A;  5J5N A;  4DEJ A;  3HXS A;  2ON5 A;  1B48 A;  1ZGN A;  4Q5R A;  3GTU A;  1G7E A;  3IAM 2;  5G1L A;  3HVS A;  4N0Z A;  4RUV A;  4F2I A;  3IOS A;  5C00 A;  4POB A;  4QQ7 A;  4ZB9 A;  1MEK A;  2RUE A;  3KM6 A;  2ALB A;  2NDO A;  5ABR A;  3FR6 A;  3H4K A;  3O6T A;  2HYX A;  1S3D A;  5DVB A;  3EU4 A;  2YN1 A;  2CT6 A;  4K7N A;  4BVX A;  3C1R A;  3FY7 A;  1AQX A;  1MD4 A;  4KUN A;  6GSX A;  2H0I A;  2QSI A;  5G31 A;  1K0O A;  1T1V A;  4PUR A;  5D9V A;  4RQX A;  5HR2 A;  1MTC A;  4MDC A;  4MZC A;  4G19 A;  2GQM A;  3QAW A;  3U6V A;  1OE8 A;  3HZ8 A;  1JFU A;  3TCO A;  2B5E A;  4NV5 A;  1U87 A;  1XCC A;  2ZCT A;  1GTB A;  4PNF A;  3EWL A;  4EL1 A;  5A4W A;  3CRU A;  2PBJ A;  3MAK A;  4NHZ A;  1XOA A;  3GX0 A;  4CDO A;  2YCD A;  2CX3 A;  2B5Y A;  3BD2 A;  2PER A;  1SK1 A;  2H0G A;  2HNL A;  4EVM A;  1O81 A;  2IMD A;  1PL2 A;  2DJ2 A;  5GSS A;  3RBT A;  4AJ8 A;  4TOP A;  2H6X A;  2PWJ A;  5F05 A;  3FEU A;  3N9J A;  6GSY A;  3DEX A;  2OE3 A;  3P8W A;  4GWR A;  1LU4 A;  2CZ2 A;  3C73 A;  1A2M A;  2OBK A;  4BWQ A;  1T4Z A;  4MJE A;  5E4W A;  2C3N A;  4TR0 A;  2AYT A;  1C72 A;  4HOJ A;  2V6K A;  1K3Y A;  2GS3 A;  2V32 A;  1O73 A;  1SK0 A;  2J23 A;  5B6N A;  5HR0 A;  2OA7 A;  2YJ7 A;  3FYG A;  3ZIV A;  3CSH A;  1A23 A;  3HYP A;  3I43 A;  4LLR A;  4JR4 A;  4USS A;  1QGV A;  2PPT A;  1VGL A;  4V2N A;  1EV9 A;  3W8J A;  4TR1 A;  1WOU A;  3RHC A;  3M0F A;  4DSR A;  4ECJ A;  4K1F A;  2E2M A;  2V6O A;  2ZUP A;  1XPV A;  2VLV A;  4ID0 A;  4EF0 A;  2HE3 A;  4AF2 A;  5HQP A;  1T00 A;  4WXT A;  5IMC A;  1GSY A;  3LYP A;  5BMU A;  3TB2 A;  5AIV A;  2IME A;  1X0R A;  3L9U A;  3GV1 A;  2CA8 A;  2C1Y A;  3GUR A;  5G30 A;  2H74 A;  4WR5 A;  2O89 A;  2X8H A;  1X5C A;  1YKC A;  5E59 A;  2V2G A;  4RI6 A;  2GVP A;  4PUF C;  1AQV A;  17GS A;  3H8Q A;  3UVT A;  3PPU A;  2GZP A;  2L5L A;  4JU5 A;  1GTI A;  4Q5F A;  2IMI A;  3L9V A;  4MZB A;  4OFN A;  5IO0 A;  3TOU A;  4MF6 A;  2O7K A;  4IGJ A;  1B8X A;  4K0G A;  2R2J A;  2KUC A;  5B8A A;  4ZL7 A;  1U88 A;  2VUP A;  4MJC A;  4KAE A;  6GSS A;  1V98 A;  3HJO A;  4MPF A;  4PQI A;  1WJK A;  3TKR A;  4ZB8 A;  1F3B A;  3L9S A;  1DE2 A;  3M3M A;  3GRX A;  2CX4 A;  2AAW A;  3ERF A;  16GS A;  5G1K A;  2EIO A;  2A2S A;  1DBY A;  3LG6 A;  5LCZ A;  1N8J A;  2RII A;  4XRD A;  3BJ5 A;  1WIK A;  4IJI A;  5DDL A;  4HEA 2;  1SEN A;  3KIJ A;  3PR8 A;  4BVY A;  2GTU A;  2IMF A;  5ECK B;  3FRC A;  3ERW A;  1QUW A;  4EO3 A;  5D93 A;  4PUA A;  2H1B A;  3IV4 A;  3QAV A;  5ENU A;  5G5F A;  2GDR A;  1FHE A;  2GSR A;  5D96 A;  4YQM A;  3GKN A;  5DQS A;  1XWG A;  2FD3 A;  4KDY A;  1EV4 A;  2VO4 A;  2VL9 A;  3GYK A;  1MD3 A;  1PGT A;  2AHE A;  1GLP A;  2GST A;  3DXB A;  4PQ1 A;  3RPP A;  2H76 A;  3ZFB A;  4KE3 A;  3M8N A;  5COH A;  5ID2 A;  2H73 A;  2FCH A;  1V57 A;  2NVL A;  1EP7 A;  1PKZ A;  4JBB A;  4XS4 B;  4GST A;  5DAK A;  2HSM B;  3NIV A;  3HJM A;  4IVF A;  1K0M A;  2G0F A;  2HRK B;  3EC3 A;  5HFK A;  3UEM A;  1XWC A;  2K9F A;  3G7Y A;  2I81 A;  3EMX A;  2H01 A;  3QR6 A;  3GN3 A;  2C80 A;  3ZVJ D;  3TOT A;  3HA9 A;  3H93 A;  5J41 A;  4L0W A;  4O5R A;  5KEJ A;  1JZO A;  1B4Q A;  4MH2 A;  5J3R A;  4ZBD A;  3HKR A;  1TRW A;  3GFK A;  2FY6 A;  2YWM A;  3IK7 A;  2CV4 A;  2K18 A;  1XW9 A;  3F0I A;  1AW9 A;  2F51 A;  2LRC A;  3Q74 A;  1ML6 A;  2YZH A;  1M2B A;  5JWQ B;  2WGR A;  4ILF A;  1XZO A;  4OD7 A;  1F9M A;  1YJ6 A;  3C7M A;  4HDE A;  1YDK A;  1O6J A;  2N5A A;  2ES7 A;  4HU9 A;  1K0N A;  2L6C A;  1JZW A;  1GSF A;  1TI3 A;  2C0E A;  3P2A A;  4PXO A;  1QK8 A;  1FW1 A;  4NHW A;  5FWG A;  1JLV A;  2EC4 A;  3RHB A;  2UZ8 A;  4E8H A;  2VCX A;  4IP6 A;  11GS A;  5LD0 A;  4ZL9 A;  3M9K A;  1Z7P A;  4AJ6 A;  5DAL B;  5ECI B;  5EY6 A;  3TRP A;  4WF5 A;  2PGT A;  1SYX A;  1WP0 A;  1H4O A;  1E2Y A;  2IPA A;  2OAC A;  2PUK C;  2HRF A;  3E3E A;  1ZMA A;  2YPM A;  3IRA A;  2R6K A;  1TDI A;  1K0C A;  1SL2 B;  4L8E A;  1Y6E A;  4G9H A;  2QC7 A;  4FIW A;  3KGK A;  1XW6 A;  4MK3 A;  5JCU A;  2VD1 A;  2K8S A;  2XBI A;  3J7Y b;  3MNG A;  1B9Y C;  3UIW A;  1QXH A;  2CVK A;  2GT6 A;  2EIR A;  2WB9 A;  5DBQ A;  1X9S B;  1F3A A;  3CTF A;  3UAR A;  3SWL A;  2LJK A;  4WBR D;  3VWX A;  2P0G A;  3TKS A;  2CQ9 A;  1S3A A;  2YWI A;  3HZ4 A;  2B7J A;  4OO4 A;  4MMM A;  3F3R A;  3NOF A;  1M0U A;  3VFI A;  2CVB A;  3A3T A;  1M9A A;  1SKR B;  1ZL9 A;  1AC1 A;  3TKS E;  2TRX A;  2GZZ A;  4KND A;  1XVW A;  4O32 A;  4KDU A;  2FA8 A;  5IMZ A;  4OFM A;  3W6G A;  2YZU A;  4GSS A;  2JZR A;  5ECN B;  3GMF A;  1V40 A;  1GSD A;  3CSI A;  2DIY A;  4K2D A;  1VF1 A;  1R7H A;  4L5O A;  2B6M A;  1CQG A;  1F6M C;  4MP4 A;  3WGX A;  3WD6 A;  4TR4 A;  3UOM A;  2XHF A;  2P31 A;  3MDK A;  5IQY A;  3IHQ A;  4ZBB A;  2F8A A;  3A2X A;  5CRH A;  3GL5 A;  4EUY A;  3TKP A;  3ZYW A;  2IFQ B;  2PVO C;  5D8I A;  4HQS A;  1B9X C;  2DSA A;  4LA1 A;  5H5R A;  3VWV A;  5INY A;  1A24 A;  1BQ7 A;  4JZQ A;  4Z7X A;  4RI7 A;  2H72 A;  3WGD A;  3ZLP A;  2YAN A;  4HUA A;  2K6V A;  3WT2 A;  5IM9 A;  2DJ3 A;  5D9X A;  4ML1 A;  4GF0 A;  5CRG A;  3VPQ A;  1OC9 B;  3IC8 A;  4DVC A;  5ELA A;  4XTS A;  10GS A;  3CBU A;  2KHP A;  4ECC A;  3ZRE A;  1N2A A;  5JWO B;  2JZT A;  1HNC A;  4OCE A;  1TK8 B;  3GA4 A;  2MMN A;  1GSQ A;  2MZC A;  4YAP A;  1XIY A;  2IWT A;  4TVE A;  1SL0 B;  1IYI A;  5AN1 A;  2C0G A;  1AXD A;  2LRN A;  2AB6 A;  1WMJ A;  2H71 A;  3R2Q A;  3UMA A;  3VK9 A;  4PTS A;  4MPG A;  2VAF A;  4OFT A;  4MJB A;  1G6W A;  3ED3 A;  5F06 A;  2NPB A;  2HXK A;  3ZFL A;  2C8U A;  5DJL A;  4N11 A;  1I5G A;  4DSS A;  1XWA A;  1OYJ A;  1TOF A;  2JAD A;  3D5J A;  2RUF A;  2RM5 A;  1FB6 A;  3KEB A;  4G0K A;  3ZRD A;  1G0T A;  2AUV A;  2C0F A;  2VD0 A;  5AIS A;  2QGV A;  3L78 A;  2HZE A;  2AJQ B;  3CYN A;  3IC4 A;  5L71 A;  2HSN B;  1E6B A;  13GS A;  1PL1 A;  3DWV A;  1BX9 A;  1EOH A;  2YV9 A;  2OKA A;  2WFC A;  4GRF A;  1Z9H A;  5IOX A;  2OAD A;  4WF4 A;  1U6T A;  4YH2 A;  4GCI A;  2DML A;  3HY2 A;  1IYH A;  2VM1 A;  1K3L A;  4AGS A;  4FYU A;  4CW9 A;  5J9B A;  2H19 A;  2FWH A;  3LSZ A;  1RW1 A;  1YKA A;  4WKW A;  4KH7 A;  4I5Q A;  1Z7R A;  2PN8 A;  1FG4 A;  3GH6 A;  1JZD A;  4EC0 A;  5IPG A;  1TP9 A;  5EL8 A;  2LQO A;  1YQ1 A;  1GSE A;  18GS A;  2DMM A;  1FB0 A;  1G7O A;  5GST A;  4FQU A;  1JLW A;  2VCZ A;  4N0V A;  2F3M A;  1XFL A;  4TRX A;  1A2J A;  4PX1 A;  4HS1 A;  3DGQ A;  1ACV A;  5LNK e;  1GWC A;  1ERT A;  1EWX A;  4G0I A;  4RQR A;  2EIQ A;  3BOA A;  1ST9 A;  1CQH A;  2FWE A;  1UA5 A;  5IOW A;  2MBT A;  3KJY A;  2KP2 A;  2XPD A;  3KCM A;  1WRY A;  2XBQ A;  6GSW A;  1TW9 A;  4N30 A;  5JWR B;  4KSO A;  2N5F A;  3D4T A;  1GLQ A;  1XWB A;  4I6X A;  4IHU A;  1JHB A;  2WZ9 A;  3EU3 A;  1EGO A;  1TRU A;  2LV3 A;  3KMO A;  1QFN A;  1HD2 A;  2HI7 A;  3QD9 A;  5B7C A;  2VM2 A;  1PSQ A;  3D22 A;  4GQF A;  1SD9 A;  5IMA A;  1KNG A;  1PA3 A;  4F0C A;  4K7I A;  1NW2 A;  3F63 A;  19GS A;  2DJK A;  1TK5 B;  2PU9 C;  4ULX A;  4K9Z A;  4XS6 A;  3IK9 A;  3LWA A;  3C71 A;  1NHO A;  1FVJ A;  1SU9 A;  2HLS A;  4IQ1 A;  1TXX A;  2YOI A;  3TKQ A;  1T4Y A;  2FWF A;  2DJJ A;  1PRX A;  1Z3E A;  5HFG A;  1ZZY A;  3TUE A;  5CAX A;  3DYR A;  1SYR A;  4IP1 A;  2BMX A;  5D9T A;  2TIR A;  1GUM A;  1QMV A;  1RK4 A;  1Q98 A;  3F6F A;  3EUR A;  1Z5Y E;  4BL7 A;  3IPZ A;  3ZIJ A;  2MMO A;  1V9W A;  2MMZ A;  14GS A;  2I3Y A;  2VCV A;  5H5Q A;  1THO A;  2LST A;  2L6D A;  3HHV A;  3VPT A;  1EEM A;  3E0U A;  3GKX A;  5IMD A;  4PGT A;  3EMP A;  4IS0 A;  2LQQ A;  4GSN A;  4XIH A;  4G0L A;  1YF1 A;  1NHY A;  1BYE A;  3GTU B;  5A4V A;  4ML6 A;  5KN0 A;  2JU5 A;  3A2V A;  2H0H A;  3R3E A;  3EYT A;  2YV7 A;  5ECP B;  3GIX A;  1TKD B;  2C3Q A;  4F0B A;  4G10 A;  2VCQ A;  3H1N A;  2OE1 A;  3PH9 A;  5F07 A;  1TI1 A;  5G5E A;  1J0F A;  3DIE A;  5J9C A;  4EXJ A;  4BVX B;  1NM3 A;  2C4J A;  1BED A;  3KH7 A;  1GL8 A;  4X0X A;  4ZXG A;  3DVW A;  4K7O A;  3KMN A;  2L4C A;  4BPY A;  2L57 A;  3EIN A;  1R5A A;  3VI5 A;  1U3I A;  1MDK A;  5GAN D;  1X9M B;  4K6X A;  3ME8 A;  3ME7 A;  3PGT A;  4POM A;  6GSU A;  1H75 A;  5ECS A;  3D6I A;  2P5R A;  4MAB A;  2VLU A;  4LL4 B;  1O85 A;  2OJL A;  4KCE A;  3LQ7 A;  3TRX A;  4POK A;  2HQT A;  3TJK A;  2X8G A;  1ERV A;  3P90 A;  1M2D A;  20GS A;  3L0H A;  3DRN A;  2GGT A;  3TKS C;  2DJ1 A;  5JCG A;  1OVN A;  4L5L A;  2DLX A;  2GQK A;  2X8C A;  1SD8 A;  1K0D A;  1KEB A;  3EE2 A;  2RLI A;  2M46 A;  3GKM A;  4O7H A;  2N5B A;  1GH2 A;  3G7J A;  3IBH A;  3WGE A;  1AAZ A;  5J4U A;  4XCS A;  1FVK A;  1WWJ A;  5A4U A;  6GSV A;  1V58 A;  1B4P A;  2DBC A;  5F8B A;  1ZCP A;  1GTU A;  2CAQ A;  1M2A A;  3G7I A;  1YEP A;  1R5P A;  1WE0 A;  2VOC A;  1HNB A;  2RM6 A;  1DSB A;  3RPN A;  2FA4 A;  4TXO A;  4KF9 A;  1T7P B;  3HCZ A;  2FUG 2;  4H86 A;  3TRQ A;  5IMF A;  1ZYQ B;  4E8E A;  3TJB A;  3FW2 A;  1ZYE A;  2VCT A;  4OCF A;  1OAZ A;  4D73 A;  5HFI A;  3GHA A;  2BTO T;  3CSJ A;  4HZ4 A;  4DSQ A;  4OWY A;  2LJA A;  4KCA A;  5DCG A;  3HDC A;  3ZML A;  4AJ7 A;  4TR1 B;  1ERU A;  3GH9 A;  3ZZX A;  4ACS A;  5CRD A;  3FHK A;  1EOG A;  2O8V B;  3D4M A;  2HRN A;  2J9H A;  3GNJ A;  4YQU A;  1A0R P;  2VLT A;  4TR3 A;  3TJF A;  5HR3 A;  3LXZ A;  1YY7 A;  3HD5 A;  2HSH A;  3KH9 A;  2E7P A;  2WCI A;  3TDG A;  3CTG A;  1J9B A;  3IE3 A;  3LYK A;  2X64 A;  4JRR A;  3F8U A;  7GSS A;  4KX4 A;  3KP9 A;  4TXV A;  2V41 A;  2LS5 A;  3LFL A;  1BAY A;  5ECR B;  4NAX A;  3HVV A;  2NTO A;  2GSQ A;  5ECO B;  4QL7 A;  4MH3 A;  5G2Z A;  4FH8 A;  2DIZ A;  5ECM B;  5D73 A;  3AY8 A;  3MSZ A;  1XWK A;  2A2R A;  3NZN A;  2H6Y A;  5KN2 A;  2X99 A;  4XS4 A;  1O8X A;  3TJJ A;  3M9J A;  2HSM A;  1TK0 B;  1ILO A;  4IBP A;  1TJD A;  2B5X A;  4G2E A;  3VWU A;  4FYC A;  2HRK A;  1A2L A;  3US3 A;  3HJP A;  2KOK A;  1VF2 A;  1TU7 A;  3FR9 A;  3OR5 A;  2HT9 A;  1RQM A;  5D9W A;  4TW5 A;  3H79 A;  1HNA A;  2TRC P;  2YNX A;  1GNW A;  4Q5Q A;  5B6M A;  2LRT A;  1DUG A;  2O85 A;  4QL9 A;  2L4Q A;  4XHM A;  2QKE A;  3V1W A;  2IIY A;  4BWS A;  3LXT A;  2CZ3 A;  4KB3 A;  4BVY B;  2E2G A;  1KBN A;  4ZL8 A;  1Q4J A;  1YF0 A;  2HRA A;  5F0G A;  2LNT A;  2LTK A;  4NXI A;  4ECI A;  4EDY A;  3DKS A;  2Z9S A;  5EPF A;  2PMT A;  3ZTL A;  2VIM A;  4V1A p;  3RAZ A;  3APO A;  3LOR A;  3APQ A;  4GLT A;  3VUR A;  4WR4 A;  1SK2 A;  2WRT A;  2VCW A;  2NBS A;  3FZA A;  4EE0 A;  4WBJ A;  3J7Y k;  3ISO A;  2M80 A;  2L5O A;  4I2T A;  2O87 A;  3DML A;  1PD2 1;  1THX A;  4CHS A;  5ECH B;  1W89 A;  2VL2 A;  4LL1 B;  2B1K A;  1M9B A;  1I9D A;  1URM A;  3FK8 A;  5CRE A;  1TU8 A;  4BL7 B;  2IMK A;  4PNG A;  3P7X A;  5ID2 B;  5DAL A;  1Z6N A;  5KN3 A;  1OE7 A;  1XW5 A;  3KP8 A;  3ERG A;  2JSY A;  5DAK B;  4J57 E;  3A2W A;  2H1D A;  1ERW A;  3QAG A;  2H66 A;  3F4T A;  3GKK A;  1XXU A;  2L59 A;  4NV2 A;  2GLR A;  1J08 A;  5DJM A;  1A0F A;  2I1U A;  1VF3 A;  2R3X A;  4V1A g;  4HU7 A;  3CXG A;  3KD0 A;  4GQC A;  3O3T A;  2YWO A;  4KDX A;  1XBS A;  4EDZ A;  1F37 A;  3QDN A;  1GUK A;  2DC5 A;  1PN9 A;  1FO5 A;  3WYW A;  2HFD A;  2HZF A;  3BCK A;  2K8V A;  4PQH A;  4I8B A;  1YZX A;  4TN8 A;  1WPI A;  3IXR A;  4F03 A;  3QOU A;  3C8E A;  2C0D A;  2WDU A;  1K0A A;  3A5W A;  4HQZ A;  5A5K A;  1TRV A;  3QFA C;  3FZ5 A;  1V2A A;  5ECQ B;  1SJZ A;  2C3T A;  3UJ1 A;  1AIU A;  1PKW A;  2OE0 A;  3LGC A;  2B1L A;  4IJ3 A;  5IO2 A;  2B7K A;  2R37 A;  4IEL A;  4FO5 A;  3KXO A;  2MBS A;  4TXO B;  3G9B A;  3KZQ A;  1EEJ A;  2GZY A;  2LKU A;  2B3S A;  3DVX A;  3UAP A;  1VRS D;  3I9V 2;  3I69 A;  4D73 B;  4KSM A;  5HR1 A;  3FZ4 A;  1NSW A;  2G2Q A;  3U5R E;  3UVH A;  1T3B A;  4K8M A;  3DD3 A;  2H6Z A;  4MA9 A;  3IAS 2;  2GSS A;  4Q5N A;  2IFQ A;  5AIX A;  2H1G A;  1A8Y A;  4NPB A;  2VL3 A;  4KGI A;  1BG5 A;  3LJR A;  4BA7 A;  4LMW A;  1PX7 A;  1X5D A;  2H30 A;  2HSY A;  3TJG A;  2JZS A;  2F9S A;  5CNW A;  3PIN A;  2I4A A;  2R5G A;  4ZBA A;  4N10 A;  5ECL B;  5GAP D;  2H70 A;  1OC9 A;  1JZR A;  3D21 A;  3IDV A;  1R26 A;  1UVZ A;  4IKH A;  4X1U A;  4JE1 A;  2WS2 A;  3GUS A;  4IW9 A;  2GQL A;  4KA0 A;  2V1M A;  4WET A;  5FT3 A;  3W8S A;  4X43 A;  1AQW A;  5IMV A;  4NWY A;  3ZL5 A;  1EGR A;  1PQN A;  3F4R A;  1ZOF A;  4MJA A;  4O92 A;  2PVQ A;  1FAA A;  4ZIL A;  3QPM A;  1GSU A;  2OBI A;  4WEY A;  2WJU A;  1ON4 A;  4NMU A;  5H5S A;  1Y25 A;  4OO5 A;  1SJ6 A;  4TKY A;  4F82 A;  2FGX A;  2YWN A;  3VWW A;  1KTE A;  2MMA A;  4MF5 A;  3LEF A;  1A8L A;  1GNE A;  2LJR A;  4POL A; 
#chains in the Genus database with same CATH topology
 1U3A A;  1DE1 A;  2D2Z A;  3Q18 A;  2GT5 A;  4IN0 A;  4YQV A;  5IPH A;  1HYU A;  1VF4 A;  1OC3 A;  4ZB6 A;  1S3C A;  5JCW A;  2E0Q A;  2R4V A;  1GUH A;  1OKD A;  4JR6 A;  8GSS A;  3UBK A;  1T8E B;  3CRT A;  3UBL A;  4MCU A;  1LBK A;  2XPE A;  4L0U A;  3ZIT A;  1XOB A;  4XRA A;  2FLS A;  4FYB A;  3L4N A;  4I2U A;  3I6A A;  2A4V A;  2HSN A;  3M1G A;  4ZIJ A;  3FZ9 A;  5EVO A;  2CAI A;  1LJR A;  3ZVJ A;  4I97 A;  1AUC A;  9GSS A;  3GX8 A;  1PMT A;  3TGZ A;  2YP6 A;  2LNS A;  3UL3 A;  2JAC A;  3S9F A;  1XVQ A;  1Z6M A;  3ZMK A;  3BBY A;  4EKZ A;  4MF7 A;  4J56 E;  2MYG A;  2BJX A;  3F4S A;  4HJM A;  4JED A;  2FHE A;  1X5E A;  2AV4 A;  3IR4 A;  1GP1 A;  3HVX A;  2DJ0 A;  4MLY A;  5IIZ A;  1O8W A;  22GS A;  1MDJ A;  2KP1 A;  5ELG A;  1USB A;  2ON7 A;  3FMW A;  2KLX A;  4LMV A;  5B8B A;  4J2F A;  2ZNM A;  4ECB A;  1MDI A;  3APS A;  2JSZ A;  4K0N A;  1O7U A;  4P3Y B;  3O76 A;  1SKW B;  1OKT A;  2XC2 A;  3RDW A;  5GZZ B;  6GST A;  2REM A;  5CO3 A;  3CMI A;  3F6D A;  4DSS B;  4GTU A;  2IN3 A;  3Q19 A;  2P5Q A;  1OC8 A;  3QCP A;  2H1A A;  1TRS A;  5C04 A;  1SL1 B;  1G6Y A;  1ZYN A;  1GUL A;  1GRX A;  5A1N A;  2EFD A;  3TU3 B;  1YEX A;  4IQA A;  4PHZ C;  3N5O A;  2M72 A;  1FOV A;  5CP1 A;  5AGY A;  5FHI A;  4YAV A;  2JL4 A;  3GST A;  2HZE B;  2IJY A;  3QFB C;  1EP8 A;  3KTB A;  2F8F A;  2I9H A;  2FNO A;  2LEG A;  1QQ2 A;  4HI7 A;  3F3Q A;  3MWH A;  3D0Z A;  1SJI A;  1X9W B;  2FWG A;  3WT1 A;  1TTZ A;  1UC7 A;  1K0B A;  1GTA A;  2YJH A;  3SBC A;  1UN2 A;  5KN1 A;  4MZW A;  1GSS A;  3GL3 A;  3C1S A;  3FKF A;  1R4W A;  1BJX A;  4GXZ A;  2CVD A;  2LUS A;  1M7T A;  3IA1 A;  4XS1 A;  5CRW A;  4HJ2 A;  3E9J B;  1EZK A;  2H75 A;  1M99 A;  4V2L A;  3BCI A;  1K3O A;  1W4V A;  5CYY A;  3FR3 A;  2H8L A;  12GS A;  3QMX A;  3VLN A;  4OMV A;  2WUL A;  5DQY A;  4KW6 A;  1ABA A;  4ISD A;  2VL2 C;  1F2E A;  3JCM L;  5DCH A;  2IL3 A;  3F9U A;  4V2M A;  1HQO A;  3K8N A;  1SKS B;  3EVI A;  1PX6 A;  4F9Z A;  3KTL A;  3Q6O A;  3VI7 A;  3GSS A;  4HZ2 A;  5J5N A;  4DEJ A;  3HXS A;  2ON5 A;  1B48 A;  1ZGN A;  4Q5R A;  3GTU A;  1G7E A;  3IAM 2;  5G1L A;  3HVS A;  4N0Z A;  4RUV A;  4F2I A;  3IOS A;  5C00 A;  4POB A;  4QQ7 A;  4ZB9 A;  1MEK A;  2RUE A;  3KM6 A;  2ALB A;  2NDO A;  5ABR A;  3FR6 A;  3H4K A;  3O6T A;  2HYX A;  4N3Z A;  1S3D A;  4K2X A;  3EU4 A;  5DVB A;  2YN1 A;  2CT6 A;  4K7N A;  4BVX A;  3C1R A;  3FY7 A;  1AQX A;  1MD4 A;  4KUN A;  6GSX A;  2H0I A;  2QSI A;  5G31 A;  1K0O A;  1T1V A;  4PUR A;  5D9V A;  4RQX A;  5HR2 A;  1MTC A;  4MDC A;  1BF5 A;  4MZC A;  4G19 A;  2GQM A;  3QAW A;  3U6V A;  1OE8 A;  3HZ8 A;  1JFU A;  3TCO A;  5KOW A;  2B5E A;  4NV5 A;  1U87 A;  1XCC A;  2ZCT A;  2A4H A;  1GTB A;  4PNF A;  3EWL A;  4EL1 A;  5A4W A;  3CRU A;  2PBJ A;  3MAK A;  4NHZ A;  1XOA A;  3GX0 A;  4CDO A;  2YCD A;  2CX3 A;  4ICY A;  2B5Y A;  3BD2 A;  2PER A;  5A5H A;  1SK1 A;  2H0G A;  2HNL A;  4EVM A;  1O81 A;  2IMD A;  1PL2 A;  2DJ2 A;  5GSS A;  3RBT A;  4AJ8 A;  4TOP A;  2H6X A;  2PWJ A;  1SVM A;  5F05 A;  3FEU A;  3N9J A;  6GSY A;  3DEX A;  2OE3 A;  3P8W A;  5J4Y A;  4GWR A;  1LU4 A;  2CZ2 A;  3C73 A;  1A2M A;  4BIK A;  2OBK A;  4BWQ A;  1T4Z A;  4MJE A;  5E4W A;  1SVO A;  2C3N A;  2R0P A;  4TR0 A;  2AYT A;  1C72 A;  4HOJ A;  2V6K A;  1K3Y A;  2GS3 A;  2V32 A;  1O73 A;  1SK0 A;  2J23 A;  5B6N A;  5HR0 A;  2OA7 A;  2YJ7 A;  3FYG A;  4AKI A;  3ZIV A;  3CSH A;  1A23 A;  3HYP A;  3I43 A;  4LLR A;  4Z2R A;  4JR4 A;  4USS A;  1QGV A;  2PPT A;  1VGL A;  4V2N A;  1EV9 A;  3W8J A;  2WW2 A;  4TR1 A;  1WOU A;  3RHC A;  3M0F A;  4DSR A;  4ECJ A;  4K1F A;  2E2M A;  2V6O A;  2ZUP A;  1XPV A;  2VLV A;  4ID0 A;  4EF0 A;  2HE3 A;  4AF2 A;  5HQP A;  1T00 A;  2WZS A;  4WXT A;  5IMC A;  1GSY A;  3LYP A;  5BMU A;  3TB2 A;  5AIV A;  4AKX B;  1X0R A;  2IME A;  3L9U A;  3GV1 A;  2CA8 A;  2C1Y A;  3GUR A;  5G30 A;  2H74 A;  4WR5 A;  2O89 A;  2X8H A;  1X5C A;  1YKC A;  4O5Q A;  5E59 A;  2V2G A;  4RI6 A;  2GVP A;  4PUF C;  1AQV A;  17GS A;  3H8Q A;  3UVT A;  3PPU A;  2GZP A;  2L5L A;  4JU5 A;  1GTI A;  2WW1 A;  4Q5F A;  2IMI A;  3L9V A;  4MZB A;  2X4A A;  4OFN A;  5IO0 A;  3TOU A;  4MF6 A;  2O7K A;  4IGJ A;  4E68 A;  1B8X A;  4K0G A;  2R2J A;  2KUC A;  5B8A A;  4ZL7 A;  1U88 A;  2VUP A;  4MJC A;  4KAE A;  6GSS A;  1V98 A;  3HJO A;  4MPF A;  4PQI A;  1WJK A;  3TKR A;  4ZB8 A;  1F3B A;  3L9S A;  1DE2 A;  3M3M A;  3GRX A;  2CX4 A;  2AAW A;  3ERF A;  4MNN A;  16GS A;  5G1K A;  2EIO A;  1PFO A;  2A2S A;  5J47 A;  1DBY A;  3LG6 A;  5LCZ A;  1N8J A;  2RII A;  4XRD A;  3BJ5 A;  1WIK A;  4IJI A;  1N25 A;  5DDL A;  4HEA 2;  1SEN A;  3KIJ A;  3PR8 A;  4BVY A;  2GTU A;  2IMF A;  5ECK B;  3FRC A;  3ERW A;  1QUW A;  4EO3 A;  5D93 A;  4PUA A;  2H1B A;  3IV4 A;  3QAV A;  5ENU A;  5G5F A;  2GDR A;  1FHE A;  2GSR A;  5D96 A;  4YQM A;  3GKN A;  5DQS A;  1XWG A;  2FD3 A;  4KDY A;  1EV4 A;  2VO4 A;  2VL9 A;  3GYK A;  1MD3 A;  1PGT A;  2AHE A;  1GLP A;  2GST A;  3DXB A;  4PQ1 A;  3RPP A;  2H76 A;  1XG8 A;  3ZFB A;  4KE3 A;  3M8N A;  5COH A;  5ID2 A;  2H73 A;  2FCH A;  1V57 A;  2NVL A;  1EP7 A;  1PKZ A;  2UV8 G;  4JBB A;  4XS4 B;  4GST A;  5DAK A;  2HSM B;  3NIV A;  3HJM A;  4IVF A;  1K0M A;  2G0F A;  2HRK B;  3EC3 A;  1YVL A;  5HFK A;  3UEM A;  1XWC A;  2K9F A;  3G7Y A;  2I81 A;  3EMX A;  2H01 A;  3QR6 A;  3GN3 A;  2C80 A;  3ZVJ D;  3TOT A;  3HA9 A;  1ZYP A;  3H93 A;  5J41 A;  4L0W A;  4O5R A;  3IHG A;  5KEJ A;  1JZO A;  1B4Q A;  4MH2 A;  5J3R A;  4ZBD A;  3HKR A;  1TRW A;  3GFK A;  2FY6 A;  3CHX C;  2YWM A;  3IK7 A;  2CV4 A;  2K18 A;  1XW9 A;  3F0I A;  1AW9 A;  2F51 A;  2LRC A;  5A34 A;  3Q74 A;  1ML6 A;  2YZH A;  1M2B A;  5JWQ B;  4YKF A;  2WGR A;  4ILF A;  1XZO A;  4OD7 A;  1F9M A;  1YJ6 A;  3C7M A;  4HDE A;  1YDK A;  1O6J A;  2N5A A;  2ES7 A;  2EFE A;  4HU9 A;  1K0N A;  2L6C A;  4Z2T A;  1JZW A;  1GSF A;  1TI3 A;  2C0E A;  3P2A A;  4PXO A;  1QK8 A;  1FW1 A;  4NHW A;  5FWG A;  1JLV A;  2EC4 A;  3RHB A;  2UZ8 A;  4E8H A;  2VCX A;  4IP6 A;  11GS A;  5LD0 A;  4ZL9 A;  3M9K A;  1Z7P A;  4AJ6 A;  5DAL B;  5ECI B;  5EY6 A;  3TRP A;  2DKI A;  4WF5 A;  2PGT A;  1SYX A;  1WP0 A;  1H4O A;  1E2Y A;  2IPA A;  2OAC A;  2PUK C;  2HRF A;  3CWG A;  3E3E A;  1ZMA A;  2YPM A;  3IRA A;  2R6K A;  1TDI A;  1K0C A;  1SL2 B;  4L8E A;  1Y6E A;  4G9H A;  2QC7 A;  4FIW A;  3KGK A;  1XW6 A;  2WVX A;  4MK3 A;  5JCU A;  2VD1 A;  2K8S A;  2XBI A;  3J7Y b;  3MNG A;  1B9Y C;  3UIW A;  1QXH A;  2CVK A;  2GT6 A;  2EIR A;  2WB9 A;  5DBQ A;  1X9S B;  1F3A A;  3CTF A;  3UAR A;  3SWL A;  2A2P A;  2LJK A;  4WBR D;  3VWX A;  2P0G A;  3TKS A;  2CQ9 A;  1S3A A;  2YWI A;  3HZ4 A;  2B7J A;  4OO4 A;  4MMM A;  3F3R A;  3NOF A;  1M0U A;  3VFI A;  2CVB A;  3A3T A;  1M9A A;  1SKR B;  1ZL9 A;  4FXY P;  1AC1 A;  3TKS E;  1Y1U A;  2TRX A;  4K5S A;  2GZZ A;  4KND A;  1XVW A;  4O32 A;  4KDU A;  2FA8 A;  5IMZ A;  4OFM A;  3W6G A;  2YZU A;  4GSS A;  2JZR A;  5ECN B;  3GMF A;  1V40 A;  1GSD A;  3CSI A;  2DIY A;  4K2D A;  1VF1 A;  3A5I A;  1R7H A;  4L5O A;  2B6M A;  1CQG A;  1F6M C;  2O36 A;  4MP4 A;  3WGX A;  3WD6 A;  4TR4 A;  3UOM A;  2XHF A;  2P31 A;  3MDK A;  5IQY A;  3IHQ A;  4ZBB A;  2F8A A;  3A2X A;  5CRH A;  3GL5 A;  4EUY A;  3TKP A;  3ZYW A;  2IFQ B;  2PVO C;  1TXU A;  5D8I A;  4HQS A;  1B9X C;  2DSA A;  4LA1 A;  5H5R A;  3VWV A;  5INY A;  1A24 A;  1BQ7 A;  4JZQ A;  2VKZ G;  4Z7X A;  4RI7 A;  2H72 A;  3WGD A;  1S4B P;  3ZLP A;  2YAN A;  4HUA A;  2K6V A;  3WT2 A;  5IM9 A;  2DJ3 A;  5D9X A;  4ML1 A;  4GF0 A;  2EFH A;  5CRG A;  3VPQ A;  1OC9 B;  3IC8 A;  4DVC A;  5ELA A;  4XTS A;  10GS A;  3CBU A;  1YEW C;  4ECC A;  2KHP A;  3ZRE A;  1N2A A;  5JWO B;  2JZT A;  1HNC A;  4OCE A;  1TK8 B;  3GA4 A;  2MMN A;  1GSQ A;  2MZC A;  4YAP A;  1XIY A;  2IWT A;  4TVE A;  1SL0 B;  1IYI A;  5AN1 A;  2C0G A;  1AXD A;  2LRN A;  2AB6 A;  1WMJ A;  2H71 A;  3R2Q A;  3UMA A;  3VK9 A;  4PTS A;  4MPG A;  2VAF A;  4AKG A;  4OFT A;  4MJB A;  1G6W A;  3ED3 A;  5F06 A;  2NPB A;  2HXK A;  3ZFL A;  2C8U A;  5DJL A;  5J4V A;  4N11 A;  1I5G A;  4DSS A;  1XWA A;  1OYJ A;  1TOF A;  2JAD A;  4X4J A;  3D5J A;  2RUF A;  2RM5 A;  4Z2U A;  1FB6 A;  3KEB A;  4G0K A;  3ZRD A;  1G0T A;  2AUV A;  2C0F A;  2VD0 A;  5AIS A;  2QGV A;  3L78 A;  2HZE A;  2AJQ B;  3CYN A;  3IC4 A;  3LW9 A;  5L71 A;  2HSN B;  1E6B A;  13GS A;  1PL1 A;  3DWV A;  1BX9 A;  1EOH A;  2YV9 A;  2OKA A;  2WFC A;  4GRF A;  1Z9H A;  5IOX A;  2OAD A;  4WF4 A;  1U6T A;  4YH2 A;  4GCI A;  2DML A;  3HY2 A;  1IYH A;  2VM1 A;  1K3L A;  4AGS A;  4FYU A;  4CW9 A;  5J9B A;  2H19 A;  2FWH A;  3LSZ A;  1RW1 A;  1YKA A;  4WKW A;  4KH7 A;  4I5Q A;  1Z7R A;  2PN8 A;  1FG4 A;  3GH6 A;  1JZD A;  4EC0 A;  5IPG A;  1TP9 A;  5EL8 A;  2LQO A;  1YQ1 A;  1GSE A;  18GS A;  2DMM A;  1FB0 A;  1G7O A;  5GST A;  4FQU A;  1JLW A;  2VCZ A;  4N0V A;  2F3M A;  1XFL A;  4TRX A;  1A2J A;  4PX1 A;  4HS1 A;  3DGQ A;  1ACV A;  5LNK e;  2O5V A;  1GWC A;  1ERT A;  1EWX A;  4G0I A;  4RQR A;  2EIQ A;  3BOA A;  2H1L A;  1ST9 A;  1CQH A;  2FWE A;  1UA5 A;  5IOW A;  2MBT A;  3KJY A;  5A1N B;  2KP2 A;  2XPD A;  3KCM A;  1WRY A;  2XBQ A;  6GSW A;  1TW9 A;  4N30 A;  5JWR B;  4KSO A;  2N5F A;  3D4T A;  1GLQ A;  1XWB A;  4I6X A;  4IHU A;  1JHB A;  2WZ9 A;  3EU3 A;  1EGO A;  1TRU A;  2LV3 A;  3KMO A;  1QFN A;  1HD2 A;  2HI7 A;  3QD9 A;  5B7C A;  2VM2 A;  1PSQ A;  3D22 A;  4GQF A;  1SD9 A;  5IMA A;  1KNG A;  2WVX B;  1PA3 A;  4F0C A;  4K7I A;  1NW2 A;  3F63 A;  19GS A;  2DJK A;  1TK5 B;  2PU9 C;  4ULX A;  4K9Z A;  4XS6 A;  3IK9 A;  3LWA A;  3C71 A;  1NHO A;  1FVJ A;  1SU9 A;  2HLS A;  4IQ1 A;  1TXX A;  2YOI A;  3TKQ A;  4EIP A;  1T4Y A;  2FWF A;  2DJJ A;  1PRX A;  1Z3E A;  5HFG A;  1ZZY A;  3TUE A;  5CAX A;  3DYR A;  1SYR A;  4IP1 A;  2BMX A;  5D9T A;  2TIR A;  1GUM A;  1QMV A;  1RK4 A;  1Q98 A;  2OT3 A;  3F6F A;  5KOX A;  3EUR A;  1Z5Y E;  4BL7 A;  3IPZ A;  3ZIJ A;  2MMO A;  1V9W A;  2MMZ A;  14GS A;  2I3Y A;  2VCV A;  2QA1 A;  5H5Q A;  1THO A;  2LST A;  2L6D A;  3HHV A;  3VPT A;  1EEM A;  3E0U A;  3GKX A;  5IMD A;  4PGT A;  3EMP A;  5BRT A;  4IS0 A;  2LQQ A;  4GSN A;  4XIH A;  4G0L A;  1YF1 A;  1NHY A;  1BYE A;  3GTU B;  5A4V A;  4ML6 A;  5KN0 A;  4PI2 C;  2JU5 A;  3A2V A;  2H0H A;  3R3E A;  3EYT A;  2YV7 A;  5ECP B;  3GIX A;  1TKD B;  2C3Q A;  4F0B A;  4G10 A;  2VCQ A;  3H1N A;  2OE1 A;  3PH9 A;  5F07 A;  1TI1 A;  5G5E A;  1J0F A;  3DIE A;  5J9C A;  4EXJ A;  4BVX B;  1NM3 A;  2C4J A;  1BED A;  3KH7 A;  1GL8 A;  4X0X A;  4ZXG A;  3DVW A;  4K7O A;  3KMN A;  2L4C A;  4BPY A;  2L57 A;  3EIN A;  1R5A A;  3VI5 A;  1U3I A;  1MDK A;  5GAN D;  1X9M B;  4K6X A;  3ME8 A;  3ME7 A;  3PGT A;  4POM A;  6GSU A;  1H75 A;  5ECS A;  3D6I A;  2P5R A;  4MAB A;  2VLU A;  4LL4 B;  3RFR C;  1O85 A;  2OJL A;  4KCE A;  3LQ7 A;  3TRX A;  4POK A;  2HQT A;  3TJK A;  2X8G A;  1ERV A;  2WW3 A;  3P90 A;  1M2D A;  20GS A;  3L0H A;  3DRN A;  4QMK A;  2GGT A;  3TKS C;  2DJ1 A;  5JCG A;  1OVN A;  4L5L A;  2DLX A;  2GQK A;  2X8C A;  1SD8 A;  1K0D A;  1KEB A;  3EE2 A;  2RLI A;  2M46 A;  3GKM A;  5A5H B;  4O7H A;  2N5B A;  1GH2 A;  3G7J A;  3IBH A;  3WGE A;  1AAZ A;  5J4U A;  4XCS A;  1FVK A;  1WWJ A;  5A4U A;  6GSV A;  1V58 A;  1B4P A;  2DBC A;  5F8B A;  1ZCP A;  1GTU A;  2CAQ A;  1M2A A;  3G7I A;  1YEP A;  1R5P A;  1WE0 A;  2VOC A;  1HNB A;  2RM6 A;  1DSB A;  3RPN A;  2FA4 A;  4TXO A;  4KF9 A;  1T7P B;  3HCZ A;  2FUG 2;  4H86 A;  3TRQ A;  5IMF A;  1ZYQ B;  4E8E A;  3TJB A;  3FW2 A;  1ZYE A;  2VCT A;  4OCF A;  1OAZ A;  4D73 A;  5HFI A;  3GHA A;  2BTO T;  3CSJ A;  4HSC X;  4HZ4 A;  2R0C A;  4DSQ A;  3HVN A;  4OWY A;  2LJA A;  4KCA A;  5DCG A;  3HDC A;  3ZML A;  3RGB C;  4AJ7 A;  4TR1 B;  1ERU A;  3GH9 A;  3ZZX A;  1I1I P;  4ACS A;  5CRD A;  3FHK A;  1EOG A;  2O8V B;  3D4M A;  2HRN A;  5BMU B;  3HMJ G;  2J9H A;  3GNJ A;  4YQU A;  1A0R P;  2VLT A;  4TR3 A;  3TJF A;  5HR3 A;  3LXZ A;  1YY7 A;  3HD5 A;  2HSH A;  2DKH A;  3KH9 A;  3MIX A;  2E7P A;  4O5U A;  2WCI A;  3TDG A;  2WVY A;  3CTG A;  1J9B A;  3IE3 A;  4K5R A;  3LYK A;  1BG1 A;  4CY6 A;  2X64 A;  4JRR A;  3F8U A;  7GSS A;  4KX4 A;  3KP9 A;  4TXV A;  2V41 A;  2LS5 A;  3LFL A;  1BAY A;  5ECR B;  2WVZ A;  4NAX A;  3HVV A;  2NTO A;  2GSQ A;  5ECO B;  4QL7 A;  4MH3 A;  5G2Z A;  4FH8 A;  2DIZ A;  4G01 A;  5ECM B;  5D73 A;  3AY8 A;  3MSZ A;  1XWK A;  2A2R A;  3NZN A;  2H6Y A;  5KN2 A;  2X99 A;  4XS4 A;  1O8X A;  3TJJ A;  3M9J A;  2HSM A;  1TK0 B;  1ILO A;  4IBP A;  1TJD A;  2B5X A;  4G2E A;  3VWU A;  4FYC A;  2HRK A;  1A2L A;  3US3 A;  3HJP A;  2KOK A;  1VF2 A;  1TU7 A;  3FR9 A;  3OR5 A;  2HT9 A;  2QA2 A;  1RQM A;  5D9W A;  4TW5 A;  3H79 A;  3CQF A;  1HNA A;  2TRC P;  2YNX A;  1GNW A;  1FOH A;  4Q5Q A;  5B6M A;  2LRT A;  1DUG A;  2O85 A;  4QL9 A;  2L4Q A;  4XHM A;  2QKE A;  3V1W A;  2IIY A;  4BWS A;  3LXT A;  2CZ3 A;  4KB3 A;  4BVY B;  2E2G A;  1KBN A;  4ZL8 A;  2WW0 A;  1Q4J A;  1YF0 A;  2HRA A;  5F0G A;  2LNT A;  2LTK A;  4NXI A;  4ECI A;  4EDY A;  3DKS A;  2Z9S A;  5EPF A;  2PMT A;  3ZTL A;  2VIM A;  4V1A p;  3RAZ A;  3APO A;  3LOR A;  3APQ A;  4GLT A;  3VUR A;  4WR4 A;  4GDF A;  2WRT A;  1SK2 A;  2VCW A;  2NBS A;  3FZA A;  4EE0 A;  4WBJ A;  3J7Y k;  3ISO A;  2M80 A;  2L5O A;  4I2T A;  2O87 A;  3DML A;  1PD2 1;  1THX A;  4CHS A;  5ECH B;  1W89 A;  2VL2 A;  4LL1 B;  2B1K A;  1M9B A;  1I9D A;  1URM A;  3FK8 A;  5CRE A;  1TU8 A;  4BL7 B;  2IMK A;  2O3E A;  4PNG A;  3P7X A;  5ID2 B;  5DAL A;  2R0G A;  1Z6N A;  5KN3 A;  1OE7 A;  1XW5 A;  3KP8 A;  3ERG A;  5J40 A;  2JSY A;  5DAK B;  4J57 E;  3A2W A;  2H1D A;  1ERW A;  1S3R A;  3QAG A;  2H66 A;  2EFC A;  3F4T A;  3GKK A;  1XXU A;  2L59 A;  4NV2 A;  2GLR A;  1J08 A;  4EIQ A;  5DJM A;  4CY8 A;  1A0F A;  2I1U A;  1VF3 A;  2R3X A;  4V1A g;  4HU7 A;  3CXG A;  3KD0 A;  4GQC A;  3O3T A;  4AI6 A;  2YWO A;  4KDX A;  1XBS A;  4EDZ A;  1F37 A;  3QDN A;  1GUK A;  5A34 B;  2DC5 A;  4AKH A;  1PN9 A;  1FO5 A;  3WYW A;  2HFD A;  2HZF A;  3BCK A;  2K8V A;  4PQH A;  4I8B A;  1YZX A;  4TN8 A;  1WPI A;  3IXR A;  4F03 A;  3QOU A;  3C8E A;  2C0D A;  4A5P A;  2WDU A;  1K0A A;  4ZB7 A;  3A5W A;  4HQZ A;  5A5K A;  1TRV A;  3QFA C;  3FZ5 A;  1V2A A;  5ECQ B;  1SJZ A;  2C3T A;  3UJ1 A;  1AIU A;  1PKW A;  2OE0 A;  4PI0 C;  3LGC A;  2B1L A;  4IJ3 A;  5IO2 A;  2B7K A;  2R37 A;  4IEL A;  4FO5 A;  3KXO A;  2MBS A;  4TXO B;  3G9B A;  3KZQ A;  1EEJ A;  3MYD A;  2GZY A;  2LKU A;  2B3S A;  3DVX A;  2X49 A;  3UAP A;  1VRS D;  3I9V 2;  3EPT A;  3I69 A;  4D73 B;  4KSM A;  5HR1 A;  3FZ4 A;  1NSW A;  2G2Q A;  3U5R E;  3UVH A;  1T3B A;  4K8M A;  3DD3 A;  2H6Z A;  4MA9 A;  3IAS 2;  2GSS A;  4Q5N A;  4W66 A;  2IFQ A;  5AIX A;  2H1G A;  1A8Y A;  4NPB A;  2VL3 A;  4KGI A;  1BG5 A;  3LJR A;  4BA7 A;  4LMW A;  1PX7 A;  1X5D A;  2H30 A;  2HSY A;  3TJG A;  2JZS A;  2F9S A;  5CNW A;  3PIN A;  2I4A A;  2R5G A;  4ZBA A;  4N10 A;  5ECL B;  5GAP D;  2H70 A;  1OC9 A;  1JZR A;  3D21 A;  3IDV A;  1R26 A;  1UVZ A;  4IKH A;  4X1U A;  4JE1 A;  2WS2 A;  3GUS A;  4IW9 A;  2GQL A;  4KA0 A;  2V1M A;  4WET A;  5FT3 A;  3W8S A;  4X43 A;  1AQW A;  1M3I A;  5IMV A;  4NWY A;  3ZL5 A;  1EGR A;  1PQN A;  1SVL A;  3F4R A;  1ZOF A;  4MJA A;  4O92 A;  2PVQ A;  1FAA A;  4ZIL A;  3QPM A;  1GSU A;  2OBI A;  4WEY A;  2WJU A;  1ON4 A;  1M3J A;  4NMU A;  1Y25 A;  5H5S A;  4OO5 A;  4YKG A;  1SJ6 A;  4TKY A;  4F82 A;  2FGX A;  2YWN A;  3VWW A;  1KTE A;  2MMA A;  4MF5 A;  3LEF A;  1A8L A;  1GNE A;  2LJR A;  1PN0 A;  4POL A; 
#chains in the Genus database with same CATH homology
 1U3A A;  1DE1 A;  2D2Z A;  3Q18 A;  2GT5 A;  4IN0 A;  4YQV A;  5IPH A;  1HYU A;  1VF4 A;  1OC3 A;  4ZB6 A;  1S3C A;  5JCW A;  2E0Q A;  2R4V A;  1GUH A;  1OKD A;  4JR6 A;  8GSS A;  3UBK A;  1T8E B;  3CRT A;  3UBL A;  4MCU A;  1LBK A;  2XPE A;  4L0U A;  3ZIT A;  1XOB A;  4XRA A;  2FLS A;  4FYB A;  3L4N A;  4I2U A;  3I6A A;  2A4V A;  2HSN A;  3M1G A;  4ZIJ A;  3FZ9 A;  5EVO A;  2CAI A;  1LJR A;  3ZVJ A;  4I97 A;  1AUC A;  9GSS A;  3GX8 A;  1PMT A;  3TGZ A;  2YP6 A;  2LNS A;  3UL3 A;  2JAC A;  3S9F A;  1XVQ A;  1Z6M A;  3ZMK A;  3BBY A;  4EKZ A;  4MF7 A;  4J56 E;  2MYG A;  2BJX A;  3F4S A;  4HJM A;  4JED A;  2FHE A;  1X5E A;  2AV4 A;  3IR4 A;  1GP1 A;  3HVX A;  2DJ0 A;  4MLY A;  5IIZ A;  1O8W A;  22GS A;  1MDJ A;  2KP1 A;  5ELG A;  1USB A;  2ON7 A;  3FMW A;  2KLX A;  4LMV A;  5B8B A;  4J2F A;  2ZNM A;  4ECB A;  1MDI A;  3APS A;  2JSZ A;  4K0N A;  1O7U A;  4P3Y B;  3O76 A;  1SKW B;  1OKT A;  2XC2 A;  3RDW A;  5GZZ B;  6GST A;  2REM A;  5CO3 A;  3CMI A;  3F6D A;  4DSS B;  4GTU A;  2IN3 A;  3Q19 A;  2P5Q A;  1OC8 A;  3QCP A;  2H1A A;  1TRS A;  5C04 A;  1SL1 B;  1G6Y A;  1ZYN A;  1GUL A;  1GRX A;  5A1N A;  2EFD A;  3TU3 B;  1YEX A;  4IQA A;  3N5O A;  2M72 A;  1FOV A;  5CP1 A;  5AGY A;  5FHI A;  4YAV A;  2JL4 A;  3GST A;  2HZE B;  2IJY A;  3QFB C;  1EP8 A;  3KTB A;  2F8F A;  2I9H A;  2FNO A;  2LEG A;  1QQ2 A;  4HI7 A;  3F3Q A;  3MWH A;  3D0Z A;  1SJI A;  1X9W B;  2FWG A;  3WT1 A;  1TTZ A;  1UC7 A;  1K0B A;  1GTA A;  2YJH A;  3SBC A;  1UN2 A;  5KN1 A;  4MZW A;  1GSS A;  3GL3 A;  3C1S A;  3FKF A;  1R4W A;  1BJX A;  4GXZ A;  2CVD A;  2LUS A;  1M7T A;  3IA1 A;  4XS1 A;  5CRW A;  4HJ2 A;  3E9J B;  1EZK A;  2H75 A;  1M99 A;  4V2L A;  3BCI A;  1K3O A;  1W4V A;  5CYY A;  3FR3 A;  2H8L A;  12GS A;  3QMX A;  3VLN A;  4OMV A;  2WUL A;  5DQY A;  4KW6 A;  1ABA A;  4ISD A;  2VL2 C;  1F2E A;  3JCM L;  5DCH A;  2IL3 A;  3F9U A;  4V2M A;  1HQO A;  3K8N A;  1SKS B;  3EVI A;  1PX6 A;  4F9Z A;  3KTL A;  3Q6O A;  3VI7 A;  3GSS A;  4HZ2 A;  5J5N A;  4DEJ A;  3HXS A;  2ON5 A;  1B48 A;  1ZGN A;  4Q5R A;  3GTU A;  1G7E A;  3IAM 2;  5G1L A;  3HVS A;  4N0Z A;  4RUV A;  4F2I A;  3IOS A;  5C00 A;  4POB A;  4QQ7 A;  4ZB9 A;  1MEK A;  2RUE A;  3KM6 A;  2ALB A;  2NDO A;  5ABR A;  3FR6 A;  3H4K A;  3O6T A;  2HYX A;  4N3Z A;  1S3D A;  4K2X A;  3EU4 A;  5DVB A;  2YN1 A;  2CT6 A;  4K7N A;  4BVX A;  3C1R A;  3FY7 A;  1AQX A;  1MD4 A;  4KUN A;  6GSX A;  2H0I A;  2QSI A;  5G31 A;  1K0O A;  1T1V A;  4PUR A;  5D9V A;  4RQX A;  5HR2 A;  1MTC A;  4MDC A;  1BF5 A;  4MZC A;  4G19 A;  2GQM A;  3QAW A;  3U6V A;  1OE8 A;  3HZ8 A;  1JFU A;  3TCO A;  5KOW A;  2B5E A;  4NV5 A;  1U87 A;  1XCC A;  2ZCT A;  2A4H A;  1GTB A;  4PNF A;  3EWL A;  4EL1 A;  5A4W A;  3CRU A;  2PBJ A;  3MAK A;  4NHZ A;  1XOA A;  3GX0 A;  4CDO A;  2YCD A;  2CX3 A;  4ICY A;  2B5Y A;  3BD2 A;  2PER A;  5A5H A;  1SK1 A;  2H0G A;  2HNL A;  4EVM A;  1O81 A;  2IMD A;  1PL2 A;  2DJ2 A;  5GSS A;  3RBT A;  4AJ8 A;  4TOP A;  2H6X A;  2PWJ A;  1SVM A;  5F05 A;  3FEU A;  3N9J A;  6GSY A;  3DEX A;  2OE3 A;  3P8W A;  5J4Y A;  4GWR A;  1LU4 A;  2CZ2 A;  3C73 A;  1A2M A;  2OBK A;  4BWQ A;  1T4Z A;  4MJE A;  5E4W A;  1SVO A;  2C3N A;  2R0P A;  4TR0 A;  2AYT A;  1C72 A;  4HOJ A;  2V6K A;  1K3Y A;  2GS3 A;  2V32 A;  1O73 A;  1SK0 A;  2J23 A;  5B6N A;  5HR0 A;  2OA7 A;  2YJ7 A;  3FYG A;  4AKI A;  3ZIV A;  3CSH A;  1A23 A;  3HYP A;  3I43 A;  4LLR A;  4Z2R A;  4JR4 A;  4USS A;  1QGV A;  2PPT A;  1VGL A;  4V2N A;  1EV9 A;  3W8J A;  4TR1 A;  1WOU A;  3RHC A;  3M0F A;  4DSR A;  4ECJ A;  4K1F A;  2E2M A;  2V6O A;  2ZUP A;  1XPV A;  2VLV A;  4ID0 A;  4EF0 A;  2HE3 A;  4AF2 A;  5HQP A;  1T00 A;  4WXT A;  5IMC A;  1GSY A;  3LYP A;  5BMU A;  3TB2 A;  5AIV A;  4AKX B;  1X0R A;  2IME A;  3L9U A;  3GV1 A;  2CA8 A;  2C1Y A;  3GUR A;  5G30 A;  2H74 A;  4WR5 A;  2O89 A;  2X8H A;  1X5C A;  1YKC A;  4O5Q A;  5E59 A;  2V2G A;  4RI6 A;  2GVP A;  4PUF C;  1AQV A;  17GS A;  3H8Q A;  3UVT A;  3PPU A;  2GZP A;  2L5L A;  4JU5 A;  1GTI A;  4Q5F A;  2IMI A;  3L9V A;  4MZB A;  2X4A A;  4OFN A;  5IO0 A;  3TOU A;  4MF6 A;  2O7K A;  4IGJ A;  4E68 A;  1B8X A;  4K0G A;  2R2J A;  2KUC A;  5B8A A;  4ZL7 A;  1U88 A;  2VUP A;  4MJC A;  4KAE A;  6GSS A;  1V98 A;  3HJO A;  4MPF A;  4PQI A;  1WJK A;  3TKR A;  4ZB8 A;  1F3B A;  3L9S A;  1DE2 A;  3M3M A;  3GRX A;  2CX4 A;  2AAW A;  3ERF A;  4MNN A;  16GS A;  5G1K A;  2EIO A;  2A2S A;  5J47 A;  1DBY A;  3LG6 A;  5LCZ A;  1N8J A;  2RII A;  4XRD A;  3BJ5 A;  1WIK A;  4IJI A;  1N25 A;  5DDL A;  4HEA 2;  1SEN A;  3KIJ A;  3PR8 A;  4BVY A;  2GTU A;  2IMF A;  5ECK B;  3FRC A;  3ERW A;  1QUW A;  4EO3 A;  5D93 A;  4PUA A;  2H1B A;  3IV4 A;  3QAV A;  5ENU A;  5G5F A;  2GDR A;  1FHE A;  2GSR A;  5D96 A;  4YQM A;  3GKN A;  5DQS A;  1XWG A;  2FD3 A;  4KDY A;  1EV4 A;  2VO4 A;  2VL9 A;  3GYK A;  1MD3 A;  1PGT A;  2AHE A;  1GLP A;  2GST A;  3DXB A;  4PQ1 A;  3RPP A;  2H76 A;  3ZFB A;  4KE3 A;  3M8N A;  5COH A;  5ID2 A;  2H73 A;  2FCH A;  1V57 A;  2NVL A;  1EP7 A;  1PKZ A;  2UV8 G;  4JBB A;  4XS4 B;  4GST A;  5DAK A;  2HSM B;  3NIV A;  3HJM A;  4IVF A;  1K0M A;  2G0F A;  2HRK B;  3EC3 A;  1YVL A;  5HFK A;  3UEM A;  1XWC A;  2K9F A;  3G7Y A;  2I81 A;  3EMX A;  2H01 A;  3QR6 A;  3GN3 A;  2C80 A;  3ZVJ D;  3TOT A;  3HA9 A;  1ZYP A;  3H93 A;  5J41 A;  4L0W A;  4O5R A;  3IHG A;  5KEJ A;  1JZO A;  1B4Q A;  4MH2 A;  5J3R A;  4ZBD A;  3HKR A;  1TRW A;  3GFK A;  2FY6 A;  2YWM A;  3IK7 A;  2CV4 A;  2K18 A;  1XW9 A;  3F0I A;  1AW9 A;  2F51 A;  2LRC A;  5A34 A;  3Q74 A;  1ML6 A;  2YZH A;  1M2B A;  5JWQ B;  4YKF A;  2WGR A;  4ILF A;  1XZO A;  4OD7 A;  1F9M A;  1YJ6 A;  3C7M A;  4HDE A;  1YDK A;  1O6J A;  2N5A A;  2ES7 A;  2EFE A;  4HU9 A;  1K0N A;  2L6C A;  4Z2T A;  1JZW A;  1GSF A;  1TI3 A;  2C0E A;  3P2A A;  4PXO A;  1QK8 A;  1FW1 A;  4NHW A;  5FWG A;  1JLV A;  2EC4 A;  3RHB A;  2UZ8 A;  4E8H A;  2VCX A;  4IP6 A;  11GS A;  5LD0 A;  4ZL9 A;  3M9K A;  1Z7P A;  4AJ6 A;  5DAL B;  5ECI B;  5EY6 A;  3TRP A;  2DKI A;  4WF5 A;  2PGT A;  1SYX A;  1WP0 A;  1H4O A;  1E2Y A;  2IPA A;  2OAC A;  2PUK C;  2HRF A;  3CWG A;  3E3E A;  1ZMA A;  2YPM A;  3IRA A;  2R6K A;  1TDI A;  1K0C A;  1SL2 B;  4L8E A;  1Y6E A;  4G9H A;  2QC7 A;  4FIW A;  3KGK A;  1XW6 A;  4MK3 A;  5JCU A;  2VD1 A;  2K8S A;  2XBI A;  3J7Y b;  3MNG A;  1B9Y C;  3UIW A;  1QXH A;  2CVK A;  2GT6 A;  2EIR A;  2WB9 A;  5DBQ A;  1X9S B;  1F3A A;  3CTF A;  3UAR A;  3SWL A;  2A2P A;  2LJK A;  4WBR D;  3VWX A;  2P0G A;  3TKS A;  2CQ9 A;  1S3A A;  2YWI A;  3HZ4 A;  2B7J A;  4OO4 A;  4MMM A;  3F3R A;  3NOF A;  1M0U A;  3VFI A;  2CVB A;  3A3T A;  1M9A A;  1SKR B;  1ZL9 A;  1AC1 A;  3TKS E;  1Y1U A;  2TRX A;  4K5S A;  2GZZ A;  4KND A;  1XVW A;  4O32 A;  4KDU A;  2FA8 A;  5IMZ A;  4OFM A;  3W6G A;  2YZU A;  4GSS A;  2JZR A;  5ECN B;  3GMF A;  1V40 A;  1GSD A;  3CSI A;  2DIY A;  4K2D A;  1VF1 A;  3A5I A;  1R7H A;  4L5O A;  2B6M A;  1CQG A;  1F6M C;  4MP4 A;  3WGX A;  3WD6 A;  4TR4 A;  3UOM A;  2XHF A;  2P31 A;  3MDK A;  5IQY A;  3IHQ A;  4ZBB A;  2F8A A;  3A2X A;  5CRH A;  3GL5 A;  4EUY A;  3TKP A;  3ZYW A;  2IFQ B;  2PVO C;  1TXU A;  5D8I A;  4HQS A;  1B9X C;  2DSA A;  4LA1 A;  5H5R A;  3VWV A;  5INY A;  1A24 A;  1BQ7 A;  4JZQ A;  2VKZ G;  4Z7X A;  4RI7 A;  2H72 A;  3WGD A;  3ZLP A;  2YAN A;  4HUA A;  2K6V A;  3WT2 A;  5IM9 A;  2DJ3 A;  5D9X A;  4ML1 A;  4GF0 A;  2EFH A;  5CRG A;  3VPQ A;  1OC9 B;  3IC8 A;  4DVC A;  5ELA A;  4XTS A;  10GS A;  3CBU A;  2KHP A;  4ECC A;  3ZRE A;  1N2A A;  5JWO B;  2JZT A;  1HNC A;  4OCE A;  1TK8 B;  3GA4 A;  2MMN A;  1GSQ A;  2MZC A;  4YAP A;  1XIY A;  2IWT A;  4TVE A;  1SL0 B;  1IYI A;  5AN1 A;  2C0G A;  1AXD A;  2LRN A;  2AB6 A;  1WMJ A;  2H71 A;  3R2Q A;  3UMA A;  3VK9 A;  4PTS A;  4MPG A;  2VAF A;  4AKG A;  4OFT A;  4MJB A;  1G6W A;  3ED3 A;  5F06 A;  2NPB A;  2HXK A;  3ZFL A;  2C8U A;  5DJL A;  5J4V A;  4N11 A;  1I5G A;  4DSS A;  1XWA A;  1OYJ A;  1TOF A;  2JAD A;  4X4J A;  3D5J A;  2RUF A;  2RM5 A;  4Z2U A;  1FB6 A;  3KEB A;  4G0K A;  3ZRD A;  1G0T A;  2AUV A;  2C0F A;  2VD0 A;  5AIS A;  2QGV A;  3L78 A;  2HZE A;  2AJQ B;  3CYN A;  3IC4 A;  3LW9 A;  5L71 A;  2HSN B;  1E6B A;  13GS A;  1PL1 A;  3DWV A;  1BX9 A;  1EOH A;  2YV9 A;  2OKA A;  2WFC A;  4GRF A;  1Z9H A;  5IOX A;  2OAD A;  4WF4 A;  1U6T A;  4YH2 A;  4GCI A;  2DML A;  3HY2 A;  1IYH A;  2VM1 A;  1K3L A;  4AGS A;  4FYU A;  4CW9 A;  5J9B A;  2H19 A;  2FWH A;  3LSZ A;  1RW1 A;  1YKA A;  4WKW A;  4KH7 A;  4I5Q A;  1Z7R A;  2PN8 A;  1FG4 A;  3GH6 A;  1JZD A;  4EC0 A;  5IPG A;  1TP9 A;  5EL8 A;  2LQO A;  1YQ1 A;  1GSE A;  18GS A;  2DMM A;  1FB0 A;  1G7O A;  5GST A;  4FQU A;  1JLW A;  2VCZ A;  4N0V A;  2F3M A;  1XFL A;  4TRX A;  1A2J A;  4PX1 A;  4HS1 A;  3DGQ A;  1ACV A;  5LNK e;  2O5V A;  1GWC A;  1ERT A;  1EWX A;  4G0I A;  4RQR A;  2EIQ A;  3BOA A;  2H1L A;  1ST9 A;  1CQH A;  2FWE A;  1UA5 A;  5IOW A;  2MBT A;  3KJY A;  5A1N B;  2KP2 A;  2XPD A;  3KCM A;  1WRY A;  2XBQ A;  6GSW A;  1TW9 A;  4N30 A;  5JWR B;  4KSO A;  2N5F A;  3D4T A;  1GLQ A;  1XWB A;  4I6X A;  4IHU A;  1JHB A;  2WZ9 A;  3EU3 A;  1EGO A;  1TRU A;  2LV3 A;  3KMO A;  1QFN A;  1HD2 A;  2HI7 A;  3QD9 A;  5B7C A;  2VM2 A;  1PSQ A;  3D22 A;  4GQF A;  1SD9 A;  5IMA A;  1KNG A;  1PA3 A;  4F0C A;  4K7I A;  1NW2 A;  3F63 A;  19GS A;  2DJK A;  1TK5 B;  2PU9 C;  4ULX A;  4K9Z A;  4XS6 A;  3IK9 A;  3LWA A;  3C71 A;  1NHO A;  1FVJ A;  1SU9 A;  2HLS A;  4IQ1 A;  1TXX A;  2YOI A;  3TKQ A;  4EIP A;  1T4Y A;  2FWF A;  2DJJ A;  1PRX A;  1Z3E A;  5HFG A;  1ZZY A;  3TUE A;  5CAX A;  3DYR A;  1SYR A;  4IP1 A;  2BMX A;  5D9T A;  2TIR A;  1GUM A;  1QMV A;  1RK4 A;  1Q98 A;  2OT3 A;  3F6F A;  5KOX A;  3EUR A;  1Z5Y E;  4BL7 A;  3IPZ A;  3ZIJ A;  2MMO A;  1V9W A;  2MMZ A;  14GS A;  2I3Y A;  2VCV A;  2QA1 A;  5H5Q A;  1THO A;  2LST A;  2L6D A;  3HHV A;  3VPT A;  1EEM A;  3E0U A;  3GKX A;  5IMD A;  4PGT A;  3EMP A;  5BRT A;  4IS0 A;  2LQQ A;  4GSN A;  4XIH A;  4G0L A;  1YF1 A;  1NHY A;  1BYE A;  3GTU B;  5A4V A;  4ML6 A;  5KN0 A;  2JU5 A;  3A2V A;  2H0H A;  3R3E A;  3EYT A;  2YV7 A;  5ECP B;  3GIX A;  1TKD B;  2C3Q A;  4F0B A;  4G10 A;  2VCQ A;  3H1N A;  2OE1 A;  3PH9 A;  5F07 A;  1TI1 A;  5G5E A;  1J0F A;  3DIE A;  5J9C A;  4EXJ A;  4BVX B;  1NM3 A;  2C4J A;  1BED A;  3KH7 A;  1GL8 A;  4X0X A;  4ZXG A;  3DVW A;  4K7O A;  3KMN A;  2L4C A;  4BPY A;  2L57 A;  3EIN A;  1R5A A;  3VI5 A;  1U3I A;  1MDK A;  5GAN D;  1X9M B;  4K6X A;  3ME8 A;  3ME7 A;  3PGT A;  4POM A;  6GSU A;  1H75 A;  5ECS A;  3D6I A;  2P5R A;  4MAB A;  2VLU A;  4LL4 B;  1O85 A;  2OJL A;  4KCE A;  3LQ7 A;  3TRX A;  4POK A;  2HQT A;  3TJK A;  2X8G A;  1ERV A;  3P90 A;  1M2D A;  20GS A;  3L0H A;  3DRN A;  4QMK A;  2GGT A;  3TKS C;  2DJ1 A;  5JCG A;  1OVN A;  4L5L A;  2DLX A;  2GQK A;  2X8C A;  1SD8 A;  1K0D A;  1KEB A;  3EE2 A;  2RLI A;  2M46 A;  3GKM A;  5A5H B;  4O7H A;  2N5B A;  1GH2 A;  3G7J A;  3IBH A;  3WGE A;  1AAZ A;  5J4U A;  4XCS A;  1FVK A;  1WWJ A;  5A4U A;  6GSV A;  1V58 A;  1B4P A;  2DBC A;  5F8B A;  1ZCP A;  1GTU A;  2CAQ A;  1M2A A;  3G7I A;  1YEP A;  1R5P A;  1WE0 A;  2VOC A;  1HNB A;  2RM6 A;  1DSB A;  3RPN A;  2FA4 A;  4TXO A;  4KF9 A;  1T7P B;  3HCZ A;  2FUG 2;  4H86 A;  3TRQ A;  5IMF A;  1ZYQ B;  4E8E A;  3TJB A;  3FW2 A;  1ZYE A;  2VCT A;  4OCF A;  1OAZ A;  4D73 A;  5HFI A;  3GHA A;  2BTO T;  3CSJ A;  4HZ4 A;  2R0C A;  4DSQ A;  4OWY A;  2LJA A;  4KCA A;  5DCG A;  3HDC A;  3ZML A;  4AJ7 A;  4TR1 B;  1ERU A;  3GH9 A;  3ZZX A;  4ACS A;  5CRD A;  3FHK A;  1EOG A;  2O8V B;  3D4M A;  2HRN A;  5BMU B;  3HMJ G;  2J9H A;  3GNJ A;  4YQU A;  1A0R P;  2VLT A;  4TR3 A;  3TJF A;  5HR3 A;  3LXZ A;  1YY7 A;  3HD5 A;  2HSH A;  2DKH A;  3KH9 A;  3MIX A;  2E7P A;  4O5U A;  2WCI A;  3TDG A;  3CTG A;  1J9B A;  3IE3 A;  4K5R A;  3LYK A;  1BG1 A;  4CY6 A;  2X64 A;  4JRR A;  3F8U A;  7GSS A;  4KX4 A;  3KP9 A;  4TXV A;  2V41 A;  2LS5 A;  3LFL A;  1BAY A;  5ECR B;  4NAX A;  3HVV A;  2NTO A;  2GSQ A;  5ECO B;  4QL7 A;  4MH3 A;  5G2Z A;  4FH8 A;  2DIZ A;  4G01 A;  5ECM B;  5D73 A;  3AY8 A;  3MSZ A;  1XWK A;  2A2R A;  3NZN A;  2H6Y A;  5KN2 A;  2X99 A;  4XS4 A;  1O8X A;  3TJJ A;  3M9J A;  2HSM A;  1TK0 B;  1ILO A;  4IBP A;  1TJD A;  2B5X A;  4G2E A;  3VWU A;  4FYC A;  2HRK A;  1A2L A;  3US3 A;  3HJP A;  2KOK A;  1VF2 A;  1TU7 A;  3FR9 A;  3OR5 A;  2HT9 A;  2QA2 A;  1RQM A;  5D9W A;  4TW5 A;  3H79 A;  1HNA A;  2TRC P;  2YNX A;  1GNW A;  1FOH A;  4Q5Q A;  5B6M A;  2LRT A;  1DUG A;  2O85 A;  4QL9 A;  2L4Q A;  4XHM A;  2QKE A;  3V1W A;  2IIY A;  4BWS A;  3LXT A;  2CZ3 A;  4KB3 A;  4BVY B;  2E2G A;  1KBN A;  4ZL8 A;  1Q4J A;  1YF0 A;  2HRA A;  5F0G A;  2LNT A;  2LTK A;  4NXI A;  4ECI A;  4EDY A;  3DKS A;  2Z9S A;  5EPF A;  2PMT A;  3ZTL A;  2VIM A;  4V1A p;  3RAZ A;  3APO A;  3LOR A;  3APQ A;  4GLT A;  3VUR A;  4WR4 A;  4GDF A;  2WRT A;  1SK2 A;  2VCW A;  2NBS A;  3FZA A;  4EE0 A;  4WBJ A;  3J7Y k;  3ISO A;  2M80 A;  2L5O A;  4I2T A;  2O87 A;  3DML A;  1PD2 1;  1THX A;  4CHS A;  5ECH B;  1W89 A;  2VL2 A;  4LL1 B;  2B1K A;  1M9B A;  1I9D A;  1URM A;  3FK8 A;  5CRE A;  1TU8 A;  4BL7 B;  2IMK A;  4PNG A;  3P7X A;  5ID2 B;  5DAL A;  2R0G A;  1Z6N A;  5KN3 A;  1OE7 A;  1XW5 A;  3KP8 A;  3ERG A;  5J40 A;  2JSY A;  5DAK B;  4J57 E;  3A2W A;  2H1D A;  1ERW A;  3QAG A;  2H66 A;  2EFC A;  3F4T A;  3GKK A;  1XXU A;  2L59 A;  4NV2 A;  2GLR A;  1J08 A;  4EIQ A;  5DJM A;  4CY8 A;  1A0F A;  2I1U A;  1VF3 A;  2R3X A;  4V1A g;  4HU7 A;  3CXG A;  3KD0 A;  4GQC A;  3O3T A;  4AI6 A;  2YWO A;  4KDX A;  1XBS A;  4EDZ A;  1F37 A;  3QDN A;  1GUK A;  5A34 B;  2DC5 A;  4AKH A;  1PN9 A;  1FO5 A;  3WYW A;  2HFD A;  2HZF A;  3BCK A;  2K8V A;  4PQH A;  4I8B A;  1YZX A;  4TN8 A;  1WPI A;  3IXR A;  4F03 A;  3QOU A;  3C8E A;  2C0D A;  4A5P A;  2WDU A;  1K0A A;  4ZB7 A;  3A5W A;  4HQZ A;  5A5K A;  1TRV A;  3QFA C;  3FZ5 A;  1V2A A;  5ECQ B;  1SJZ A;  2C3T A;  3UJ1 A;  1AIU A;  1PKW A;  2OE0 A;  3LGC A;  2B1L A;  4IJ3 A;  5IO2 A;  2B7K A;  2R37 A;  4IEL A;  4FO5 A;  3KXO A;  2MBS A;  4TXO B;  3G9B A;  3KZQ A;  1EEJ A;  3MYD A;  2GZY A;  2LKU A;  2B3S A;  3DVX A;  2X49 A;  3UAP A;  1VRS D;  3I9V 2;  3EPT A;  3I69 A;  4D73 B;  4KSM A;  5HR1 A;  3FZ4 A;  1NSW A;  2G2Q A;  3U5R E;  3UVH A;  1T3B A;  4K8M A;  3DD3 A;  2H6Z A;  4MA9 A;  3IAS 2;  2GSS A;  4Q5N A;  4W66 A;  2IFQ A;  5AIX A;  2H1G A;  1A8Y A;  4NPB A;  2VL3 A;  4KGI A;  1BG5 A;  3LJR A;  4BA7 A;  4LMW A;  1PX7 A;  1X5D A;  2H30 A;  2HSY A;  3TJG A;  2JZS A;  2F9S A;  5CNW A;  3PIN A;  2I4A A;  2R5G A;  4ZBA A;  4N10 A;  5ECL B;  5GAP D;  2H70 A;  1OC9 A;  1JZR A;  3D21 A;  3IDV A;  1R26 A;  1UVZ A;  4IKH A;  4X1U A;  4JE1 A;  2WS2 A;  3GUS A;  4IW9 A;  2GQL A;  4KA0 A;  2V1M A;  4WET A;  5FT3 A;  3W8S A;  4X43 A;  1AQW A;  5IMV A;  4NWY A;  3ZL5 A;  1EGR A;  1PQN A;  1SVL A;  3F4R A;  1ZOF A;  4MJA A;  4O92 A;  2PVQ A;  1FAA A;  4ZIL A;  3QPM A;  1GSU A;  2OBI A;  4WEY A;  2WJU A;  1ON4 A;  4NMU A;  5H5S A;  1Y25 A;  4OO5 A;  4YKG A;  1SJ6 A;  4TKY A;  4F82 A;  2FGX A;  2YWN A;  3VWW A;  1KTE A;  2MMA A;  4MF5 A;  3LEF A;  1A8L A;  1GNE A;  2LJR A;  1PN0 A;  4POL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...