4PI0C

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in copper
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
241
structure length
217
Chain Sequence
ESVVDLRGMWIGLVLLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVTPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGLFGWMALGVFGVVLQILMRIHALVGKEGVKLLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 79
structure length 217
sequence length 241
chains with identical sequence G, K
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 4pi0C00
3CHXC 4PI0C 4PI2C 3RFRC 1YEWC 3RGBC 4PHZC
chains in the Genus database with same CATH superfamily
3CHXC 3QR6A 1U87A 1M0UA 1MD3A 3FR9A 4FXYP 4MDCA 2CZ3A 4BL7A 4QQ7A 2WZSA 1B4PA 4ECJA 2VCTA 4PNGA 5F8BA 4IBPA 4ZB8A 3ZMKA 4IQAA 2EFCA 3W8SA 4KF9A 1R5AA 1HNBA 1M99A 2PERA 4GSSA 1TDIA 3FR3A 5GZZB 1U88A 22GSA 5A34A 4BVXA 4GSNA 3GX0A 3UVHA 3F6FA 4F0BA 5F06A 1K3OA 1I1IP 1OYJA 3RFRC 4PUAA 2OT3A 5A5HA 3CSJA 4WR4A 4JBBA 1GULA 5A1NA 2VCWA 1NHYA 4KDXA 3UARA 17GSA 1XW6A 3ERFA 1AW9A 4OFMA 1K0AA 5ECMB 4ZBDA 4IW9A 4F03A 2PVQA 3CBUA 4TOPA 3G7JA 5F05A 2WVYA 4G0LA 3N9JA 5B7CA 1YDKA 3DGQA 3IC8A 1G7OA 4MPGA 2AB6A 1FW1A 1LBKA 1G6YA 2HSNA 5DALA 3TOUA 4NAXA 4BL7B 1EV4A 1K0OA 3ISOA 2R6KA 3G7IA 5AGYA 4KSMA 4USSA 4HZ4A 2UV8G 3UAPA 6GSTA 5ECHB 3UBLA 4IGJA 1F3BA 2IL3A 4RI7A 2C3QA 5EVOA 1F2EA 2FHEA 4YQMA 1GSEA 4MF6A 1PN9A 1XW5A 12GSA 2AHEA 2WVZA 5A34B 4BVXB 4EE0A 2WW2A 2F3MA 2HRAA 3DD3A 5FWGA 3ZFBA 1TU7A 3PR8A 4WR5A 5AIXA 1E6BA 2WW0A 3FYGA 3GSTA 3FRCA 4AKXB 5BMUA 3PGTA 4L5LA 4L8EA 5D9VA 1YEWC 5A5HB 1BG5A 5A1NB 1YJ6A 4E68A 1N2AA 3CRUA 4ACSA 3R3EA 1GNWA 1BG1A 3F6DA 2VCZA 5FHIA 4HOJA 4AKHA 18GSA 2ON7A 4O7HA 4Q5FA 1PKWA 3KMOA 4KX4A 2WW3A 3U6VA 2GSSA 4G0IA 2V6KA 3FY7A 1EOHA 3TGZA 1GWCA 4GSTA 4KH7A 1JLVA 5ECNB 4E8EA 4RI6A 9GSSA 2HSNB 5IQYA 1KBNA 2FNOA 2YV9A 2C8UA 5DALB 5JCWA 5KEJA 5HFKA 1GSQA 3KXOA 1GUMA 1AXDA 1TW9A 3EE2A 3P90A 13GSA 4EC0A 10GSA 1RK4A 4KE3A 5ECQB 2GSRA 4GTUA 2OADA 3HMJG 1PD21 4PQIA 4IVFA 1PA3A 4G19A 3RBTA 1GTUA 3M1GA 2JL4A 5ECPB 1UA5A 5D9TA 2VCQA 4IS0A 4IQ1A 5F0GA 11GSA 1IYHA 2N5FA 5EL8A 5GSTA 8GSSA 1ZL9A 5ELAA 3IBHA 4QMKA 5BMUB 4ZXGA 3IK9A 1M9BA 3KM6A 4ZB9A 2WS2A 3VI5A 4KGIA 3ERGA 2GDRA 4ECCA 2GSQA 1F3AA 5ECLB 5A4WA 4EXJA 4MF7A 2C3TA 3AY8A 4MF5A 5LD0A 4AI6A 1K0NA 2PGTA 3LYPA 1YQ1A 1BX9A 3LXTA 2J9HA 3VWXA 3N5OA 1B48A 1OKTA 2C4JA 4HI7A 1GSUA 1K0DA 1PMTA 4PNFA 2CAIA 3KTLA 5D73A 2HNLA 5AIVA 3M0FA 5DJLA 4YH2A 4KDUA 1HNAA 1K0CA 3C8EA 2DC5A 4OFNA 5ECKB 1GSDA 2HSMA 1N25A 3GH6A 5ELGA 1BF5A 1K0MA 4Q5RA 1GLQA 2EFHA 4GCIA 2OA7A 1MTCA 3M3MA 2GLRA 4PXOA 4IJIA 2LJRA 2VCXA 3Q74A 4E8HA 1MD4A 1Q4JA 4N0VA 1YVLA 4AKIA 5J5NA 1SVLA 3KMNA 3F63A 5A5KA 2VCVA 4PQHA 6GSWA 5AN1A 3R2QA 5LCZA 4G9HA 1GTBA 2NTOA 4ECIA 4ZBBA 2PBJA 1SVOA 2EFEA 1A0FA 5J4UA 3IR4A 2R3XA 2IMIA 1XWGA 1Y6EA 4AKGA 1PX7A 3LFLA 1U3IA 3GURA 1BAYA 3NIVA 5ECSA 5FT3A 2VD0A 3GUSA 5ECOB 2O5VA 3GSSA 3D0ZA 2C3NA 2F8FA 3GTUA 4ECBA 2D2ZA 3I69A 4OMVA 4G01A 4YAVA 2ON5A 2OACA 2R5GA 19GSA 2GSTA 3O76A 1XWKA 2UZ8A 4I97A 3HKRA 4MK3A 5AISA 3VI7A 4IKHA 5G5FA 4G10A 5D9XA 1GSYA 2HSMB 3LYKA 1BYEA 4Q5NA 2HRKA 1PKZA 4NHWA 1VF2A 4N3ZA 1GUHA 1VF3A 2VO4A 2WVXA 1EV9A 3P8WA 2A2SA 4HZ2A 3LJRA 1V2AA 4PI0C 6GSYA 4FQUA 3CWGA 2EFDA 2A2RA 3WYWA 3PPUA 4NHZA 2VD1A 3L0HA 5J41A 1AQWA 1VF1A 1DUGA 3VURA 1FHEA 2WRTA 3CSHA 2C80A 1PGTA 1Z9HA 3QAVA 5ECRB 1TXUA 5GSSA 3MDKA 4GLTA 3QAGA 4KAEA 1K3YA 1Y1UA 1K3LA 3HJOA 5D9WA 4J2FA 4G0KA 3TU3B 1ML6A 3ZMLA 14GSA 2AAWA 5ECIB 1OE7A 1VF4A 6GSVA 4GF0A 16GSA 5DDLA 1PL1A 4BVYA 1USBA 2YV7A 4MP4A 5DAKA 1ZGNA 1C72A 3GTUB 3RGBC 4PTSA 1AQVA 4ID0A 3ZFLA 1OE8A 4HJ2A 3Q19A 1S4BP 2IMKA 4ZB7A 5A4VA 3I6AA 1GSSA 1G6WA 4O92A 4W66A 1PX6A 4ZB6A 20GSA 2HQTA 3VK9A 3M8NA 1GUKA 1K0BA 1IYIA 5A4UA 2O36A 5DQSA 4K0NA 3KJYA 3BBYA 4IELA 2HRKB 2X64A 1AQXA 7GSSA 1YKCA 4LMWA 2O3EA 2WVXB 4OFTA 4MPFA 1GTAA 3LSZA 5EY6A 3FR6A 4L5OA 3LG6A 4PGTA 4PI2C 5JCUA 4ISDA 4EDZA 4GDFA 3IK7A 3LQ7A 2WW1A 4DEJA 5F07A 3MAKA 4YQVA 2CA8A 1EEMA 5J4VA 3H1NA 2WB9A 2H1LA 4JEDA 2YCDA 1PL2A 3UBKA 3WD6A 2WJUA 3HJMA 4PHZC 3EINA 2VKZG 6GSSA 4LMVA 2GTUA 4PURA 1EOGA 4K0GA 4CHSA 1JZRA 1GNEA 5J40A 3LXZA 3O3TA 4YQUA 5J47A 5J4YA 2CZ2A 1HQOA 2WDUA 3QAWA 4F0CA 4MZWA 1HNCA 3TOTA 4BVYB 3VLNA 6GSUA 5DAKB 1GSFA 1SVMA 1GLPA 2R4VA 3VPQA 4PX1A 3VPTA 4YAPA 4AGSA 1TU8A 4EDYA 2CVDA 2CAQA 5G5EA 1B8XA 3IE3A 6GSXA 5DJMA 1YY7A 1GTIA 3CRTA 4JZQA 4KDYA 4Q5QA 3SWLA 1M9AA 2PMTA 3CSIA 3Q18A 5DCGA 1LJRA 2DSAA 4ZBAA 1V40A 1JLWA
chains in the Genus database with same CATH topology
3CHXC 4PI0C 4PI2C 3RFRC 1YEWC 3RGBC 4PHZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHX C;  4PI0 C;  4PI2 C;  3RFR C;  1YEW C;  3RGB C;  4PHZ C; 
#chains in the Genus database with same CATH topology
 3CHX C;  3QR6 A;  1U87 A;  1M0U A;  1MD3 A;  3FR9 A;  4FXY P;  4MDC A;  2CZ3 A;  4BL7 A;  4QQ7 A;  2WZS A;  1B4P A;  4ECJ A;  2VCT A;  4PNG A;  5F8B A;  4IBP A;  4ZB8 A;  3ZMK A;  4IQA A;  2EFC A;  3W8S A;  4KF9 A;  1R5A A;  1HNB A;  1M99 A;  2PER A;  4GSS A;  1TDI A;  3FR3 A;  5GZZ B;  1U88 A;  22GS A;  5A34 A;  4BVX A;  4GSN A;  3GX0 A;  3UVH A;  3F6F A;  4F0B A;  5F06 A;  1K3O A;  1I1I P;  1OYJ A;  3RFR C;  4PUA A;  2OT3 A;  5A5H A;  3CSJ A;  4WR4 A;  4JBB A;  1GUL A;  5A1N A;  2VCW A;  1NHY A;  4KDX A;  3UAR A;  17GS A;  1XW6 A;  3ERF A;  1AW9 A;  4OFM A;  1K0A A;  5ECM B;  4ZBD A;  4IW9 A;  4F03 A;  2PVQ A;  3CBU A;  4TOP A;  3G7J A;  5F05 A;  2WVY A;  4G0L A;  3N9J A;  5B7C A;  1YDK A;  3DGQ A;  3IC8 A;  1G7O A;  4MPG A;  2AB6 A;  1FW1 A;  1LBK A;  1G6Y A;  2HSN A;  5DAL A;  3TOU A;  4NAX A;  4BL7 B;  1EV4 A;  1K0O A;  3ISO A;  2R6K A;  3G7I A;  5AGY A;  4KSM A;  4USS A;  4HZ4 A;  2UV8 G;  3UAP A;  6GST A;  5ECH B;  3UBL A;  4IGJ A;  1F3B A;  2IL3 A;  4RI7 A;  2C3Q A;  5EVO A;  1F2E A;  2FHE A;  4YQM A;  1GSE A;  4MF6 A;  1PN9 A;  1XW5 A;  12GS A;  2AHE A;  2WVZ A;  5A34 B;  4BVX B;  4EE0 A;  2WW2 A;  2F3M A;  2HRA A;  3DD3 A;  5FWG A;  3ZFB A;  1TU7 A;  3PR8 A;  4WR5 A;  5AIX A;  1E6B A;  2WW0 A;  3FYG A;  3GST A;  3FRC A;  4AKX B;  5BMU A;  3PGT A;  4L5L A;  4L8E A;  5D9V A;  1YEW C;  5A5H B;  1BG5 A;  5A1N B;  1YJ6 A;  4E68 A;  1N2A A;  3CRU A;  4ACS A;  3R3E A;  1GNW A;  1BG1 A;  3F6D A;  2VCZ A;  5FHI A;  4HOJ A;  4AKH A;  18GS A;  2ON7 A;  4O7H A;  4Q5F A;  1PKW A;  3KMO A;  4KX4 A;  2WW3 A;  3U6V A;  2GSS A;  4G0I A;  2V6K A;  3FY7 A;  1EOH A;  3TGZ A;  1GWC A;  4GST A;  4KH7 A;  1JLV A;  5ECN B;  4E8E A;  4RI6 A;  9GSS A;  2HSN B;  5IQY A;  1KBN A;  2FNO A;  2YV9 A;  2C8U A;  5DAL B;  5JCW A;  5KEJ A;  5HFK A;  1GSQ A;  3KXO A;  1GUM A;  1AXD A;  1TW9 A;  3EE2 A;  3P90 A;  13GS A;  4EC0 A;  10GS A;  1RK4 A;  4KE3 A;  5ECQ B;  2GSR A;  4GTU A;  2OAD A;  3HMJ G;  1PD2 1;  4PQI A;  4IVF A;  1PA3 A;  4G19 A;  3RBT A;  1GTU A;  3M1G A;  2JL4 A;  5ECP B;  1UA5 A;  5D9T A;  2VCQ A;  4IS0 A;  4IQ1 A;  5F0G A;  11GS A;  1IYH A;  2N5F A;  5EL8 A;  5GST A;  8GSS A;  1ZL9 A;  5ELA A;  3IBH A;  4QMK A;  5BMU B;  4ZXG A;  3IK9 A;  1M9B A;  3KM6 A;  4ZB9 A;  2WS2 A;  3VI5 A;  4KGI A;  3ERG A;  2GDR A;  4ECC A;  2GSQ A;  1F3A A;  5ECL B;  5A4W A;  4EXJ A;  4MF7 A;  2C3T A;  3AY8 A;  4MF5 A;  5LD0 A;  4AI6 A;  1K0N A;  2PGT A;  3LYP A;  1YQ1 A;  1BX9 A;  3LXT A;  2J9H A;  3VWX A;  3N5O A;  1B48 A;  1OKT A;  2C4J A;  4HI7 A;  1GSU A;  1K0D A;  1PMT A;  4PNF A;  2CAI A;  3KTL A;  5D73 A;  2HNL A;  5AIV A;  3M0F A;  5DJL A;  4YH2 A;  4KDU A;  1HNA A;  1K0C A;  3C8E A;  2DC5 A;  4OFN A;  5ECK B;  1GSD A;  2HSM A;  1N25 A;  3GH6 A;  5ELG A;  1BF5 A;  1K0M A;  4Q5R A;  1GLQ A;  2EFH A;  4GCI A;  2OA7 A;  1MTC A;  3M3M A;  2GLR A;  4PXO A;  4IJI A;  2LJR A;  2VCX A;  3Q74 A;  4E8H A;  1MD4 A;  1Q4J A;  4N0V A;  1YVL A;  4AKI A;  5J5N A;  1SVL A;  3KMN A;  3F63 A;  5A5K A;  2VCV A;  4PQH A;  6GSW A;  5AN1 A;  3R2Q A;  5LCZ A;  4G9H A;  1GTB A;  2NTO A;  4ECI A;  4ZBB A;  2PBJ A;  1SVO A;  2EFE A;  1A0F A;  5J4U A;  3IR4 A;  2R3X A;  2IMI A;  1XWG A;  1Y6E A;  4AKG A;  1PX7 A;  3LFL A;  1U3I A;  3GUR A;  1BAY A;  3NIV A;  5ECS A;  5FT3 A;  2VD0 A;  3GUS A;  5ECO B;  2O5V A;  3GSS A;  3D0Z A;  2C3N A;  2F8F A;  3GTU A;  4ECB A;  2D2Z A;  3I69 A;  4OMV A;  4G01 A;  4YAV A;  2ON5 A;  2OAC A;  2R5G A;  19GS A;  2GST A;  3O76 A;  1XWK A;  2UZ8 A;  4I97 A;  3HKR A;  4MK3 A;  5AIS A;  3VI7 A;  4IKH A;  5G5F A;  4G10 A;  5D9X A;  1GSY A;  2HSM B;  3LYK A;  1BYE A;  4Q5N A;  2HRK A;  1PKZ A;  4NHW A;  1VF2 A;  4N3Z A;  1GUH A;  1VF3 A;  2VO4 A;  2WVX A;  1EV9 A;  3P8W A;  2A2S A;  4HZ2 A;  3LJR A;  1V2A A;  4PI0 C;  6GSY A;  4FQU A;  3CWG A;  2EFD A;  2A2R A;  3WYW A;  3PPU A;  4NHZ A;  2VD1 A;  3L0H A;  5J41 A;  1AQW A;  1VF1 A;  1DUG A;  3VUR A;  1FHE A;  2WRT A;  3CSH A;  2C80 A;  1PGT A;  1Z9H A;  3QAV A;  5ECR B;  1TXU A;  5GSS A;  3MDK A;  4GLT A;  3QAG A;  4KAE A;  1K3Y A;  1Y1U A;  1K3L A;  3HJO A;  5D9W A;  4J2F A;  4G0K A;  3TU3 B;  1ML6 A;  3ZML A;  14GS A;  2AAW A;  5ECI B;  1OE7 A;  1VF4 A;  6GSV A;  4GF0 A;  16GS A;  5DDL A;  1PL1 A;  4BVY A;  1USB A;  2YV7 A;  4MP4 A;  5DAK A;  1ZGN A;  1C72 A;  3GTU B;  3RGB C;  4PTS A;  1AQV A;  4ID0 A;  3ZFL A;  1OE8 A;  4HJ2 A;  3Q19 A;  1S4B P;  2IMK A;  4ZB7 A;  5A4V A;  3I6A A;  1GSS A;  1G6W A;  4O92 A;  4W66 A;  1PX6 A;  4ZB6 A;  20GS A;  2HQT A;  3VK9 A;  3M8N A;  1GUK A;  1K0B A;  1IYI A;  5A4U A;  2O36 A;  5DQS A;  4K0N A;  3KJY A;  3BBY A;  4IEL A;  2HRK B;  2X64 A;  1AQX A;  7GSS A;  1YKC A;  4LMW A;  2O3E A;  2WVX B;  4OFT A;  4MPF A;  1GTA A;  3LSZ A;  5EY6 A;  3FR6 A;  4L5O A;  3LG6 A;  4PGT A;  4PI2 C;  5JCU A;  4ISD A;  4EDZ A;  4GDF A;  3IK7 A;  3LQ7 A;  2WW1 A;  4DEJ A;  5F07 A;  3MAK A;  4YQV A;  2CA8 A;  1EEM A;  5J4V A;  3H1N A;  2WB9 A;  2H1L A;  4JED A;  2YCD A;  1PL2 A;  3UBK A;  3WD6 A;  2WJU A;  3HJM A;  4PHZ C;  3EIN A;  2VKZ G;  6GSS A;  4LMV A;  2GTU A;  4PUR A;  1EOG A;  4K0G A;  4CHS A;  1JZR A;  1GNE A;  5J40 A;  3LXZ A;  3O3T A;  4YQU A;  5J47 A;  5J4Y A;  2CZ2 A;  1HQO A;  2WDU A;  3QAW A;  4F0C A;  4MZW A;  1HNC A;  3TOT A;  4BVY B;  3VLN A;  6GSU A;  5DAK B;  1GSF A;  1SVM A;  1GLP A;  2R4V A;  3VPQ A;  4PX1 A;  3VPT A;  4YAP A;  4AGS A;  1TU8 A;  4EDY A;  2CVD A;  2CAQ A;  5G5E A;  1B8X A;  3IE3 A;  6GSX A;  5DJM A;  1YY7 A;  1GTI A;  3CRT A;  4JZQ A;  4KDY A;  4Q5Q A;  3SWL A;  1M9A A;  2PMT A;  3CSI A;  3Q18 A;  5DCG A;  1LJR A;  2DSA A;  4ZBA A;  1V40 A;  1JLW A; 
#chains in the Genus database with same CATH homology
 3CHX C;  4PI0 C;  4PI2 C;  3RFR C;  1YEW C;  3RGB C;  4PHZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...