5AIXA

Complex of human hematopoietic prostagandin d2 synthase (hh-pgds) in complex with an active site inhibitor.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTENTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Identification of Indole Inhibitors of Human Hematopoietic Prostaglandin D2 Synthase (Hh-Pgds).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5aixA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5aixA01
2E2GA 5A4WA 2GVPA 1HNCA 4F9ZA 3H79A 3LFLA 1ZYQB 1F2EA 12GSA 3HZ4A 3I43A 1AAZA 4GSTA 5D96A 5ID2A 2H75A 2O89A 1GH2A 3ZRDA 5LD0A 2H6XA 1MD3A 1I9DA 3RDWA 4KSOA 3A2VA 4XTSA 3TOUA 2MMAA 2PN8A 3GYKA 5GSTA 2V6KA 3EWLA 3ME7A 3F9UA 2VL2A 2C3NA 1Y6EA 1WOUA 4PQ1A 1M0UA 2C0FA 3DVWA 3IAS2 3QFBC 3TJKA 22GSA 2IMIA 3F6FA 2GTUA 3FW2A 3ZLPA 1KBNA 2MBSA 2LEGA 14GSA 5DCHA 3KH7A 4I2TA 4KDYA 4NHWA 3IDVA 3EE2A 3L9VA 2N5FA 2F8FA 2QGVA 3M0FA 1K0AA 5JWOB 1ON4A 2M72A 1HNBA 3D5JA 1W4VA 1M99A 4KDUA 3VI7A 3WD6A 4YQVA 5CRWA 4POLA 4X0XA 2K8SA 6GSSA 5F07A 1FO5A 1F6MC 4ECJA 3P8WA 2CZ3A 2UZ8A 3QAVA 1ERWA 1T3BA 2IL3A 4FO5A 5IMFA 5CP1A 4G19A 1OAZA 2F51A 3WT1A 4PUAA 4XS4A 1M9BA 4WETA 1AUCA 1XCCA 1SKSB 3VFIA 3GV1A 3UJ1A 3K8NA 4FH8A 2HNLA 3GTUB 4J2FA 3VPQA 2ALBA 1T1VA 2VUPA 2DIZA 1PL2A 2C1YA 2WZ9A 1LJRA 2H6YA 2PVOC 3IOSA 3LXZA 3F3RA 1PD21 3IC8A 3LQ7A 3HHVA 5FWGA 4I6XA 1A8LA 3ZFLA 2H76A 3CXGA 3EURA 1FG4A 5IPGA 1AQWA 2NBSA 1SKRB 1GSDA 4EDZA 2YWMA 2HZEB 1EGRA 1NW2A 1TRWA 3GIXA 4EUYA 4PGTA 4GXZA 4GSSA 4KF9A 4PXOA 2P31A 3GSTA 17GSA 4KGIA 3CRUA 4G10A 2FHEA 5DAKB 2YPMA 2MMZA 4BL7A 1A2LA 3G7IA 2VLVA 4ML1A 1WMJA 5D73A 1EOGA 1OC9B 4D73A 5D8IA 1XFLA 3LJRA 4ECIA 4KSMA 2NTOA 1PX7A 5IMDA 3FZAA 5J4UA 2BMXA 5CNWA 5DCGA 5G2ZA 2B1LA 2LKUA 2C4JA 3EINA 1KEBA 4PX1A 1QFNA 1VGLA 10GSA 1G0TA 4ZB6A 3KMOA 2CVDA 5G1KA 3MDKA 2H73A 1X5CA 2LTKA 1KNGA 3APQA 2ZUPA 5ABRA 1T4ZA 3KEBA 5E4WA 1OC8A 1GUHA 2HRKA 1TJDA 3RPNA 2KUCA 4I2UA 5JCWA 3SWLA 3IE3A 5IMCA 2X64A 1DSBA 3GX8A 4FYBA 1X5EA 4HS1A 3HDCA 1PL1A 1MEKA 1U3IA 2DJ2A 1BAYA 2G2QA 2AJQB 1B9YC 4PNFA 2HT9A 3EC3A 3DYRA 1EGOA 1V40A 1OC3A 1F3BA 3C73A 4J57E 4HOJA 3KZQA 3TGZA 1SJ6A 1K0OA 1QGVA 2KHPA 5LCZA 3M3MA 1GUKA 1DBYA 1O7UA 1RQMA 3QAWA 2H01A 2B5XA 4ECCA 2GQKA 4O5RA 2LS5A 2FCHA 1XBSA 1S3CA 4GF0A 1X5DA 2C8UA 2R5GA 2A4VA 1GTIA 4L8EA 4DSSB 2GT6A 3FR6A 1TRUA 2CA8A 3UVHA 4POBA 1FW1A 3ZYWA 3D4MA 2DIYA 2LRNA 1MDIA 3D6IA 1GSEA 1Z5YE 2WGRA 4KNDA 3GN3A 1SD9A 5ECKB 4EXJA 1PGTA 2HE3A 3RPPA 1K3YA 4I97A 4IJIA 5D9WA 4TRXA 2WJUA 4F0CA 2GZZA 2MMOA 2BTOT 4IP6A 2CQ9A 4K7IA 2FWGA 4Q5RA 4OCEA 2H1DA 5KEJA 4TR0A 1ZGNA 4GSNA 1XOAA 2JZRA 3IRAA 3LYPA 2R3XA 19GSA 1MDKA 1N2AA 5GAND 2C0DA 4EE0A 1YQ1A 3CSIA 1H75A 3R2QA 3ZTLA 5H5QA 3P90A 5D9TA 1T7PB 1B48A 5ECQB 4TXVA 2K8VA 3LG6A 5D93A 4AF2A 4ZL8A 5J9BA 5AIVA 4KCEA 4XHMA 2H30A 2A2RA 1GTBA 1I5GA 1KTEA 3PR8A 5G30A 3M8NA 2L4QA 5A4UA 3HVSA 4EC0A 1Z6NA 3O6TA 2FA8A 2RLIA 3TCOA 4AJ8A 3VWVA 2DBCA 1S3AA 3FKFA 1U88A 3FK8A 5G1LA 2CAIA 2C3TA 1CQGA 1XWKA 3FZ5A 3CYNA 5ECOB 2JU5A 2BJXA 4MPFA 2FGXA 1SL1B 1GRXA 3ZIJA 3QOUA 1THXA 1U6TA 3CSJA 4MH3A 1Y25A 1PN9A 1HQOA 4NPBA 1U3AA 4FQUA 2O7KA 1GWCA 1EP7A 2R6KA 3LWAA 5HR3A 4I5QA 2C0GA 2I4AA 1YEPA 1NM3A 5B6MA 13GSA 1GLPA 4YH2A 3TDGA 4OFNA 1GSSA 5EVOA 2MYGA 3IXRA 3CBUA 3TKRA 4DSRA 4PQIA 4F0BA 3LYKA 2RUEA 3HYPA 3UVTA 2NVLA 2VL2C 3QR6A 4YAVA 1TXXA 3GNJA 2JZSA 4ISDA 3KIJA 5ID2B 4FYUA 2CT6A 2F3MA 1WE0A 3F0IA 4WXTA 2DC5A 3D4TA 5DBQA 1MD4A 1R4WA 5C00A 5JCGA 3BJ5A 2QSIA 4K1FA 3APOA 3BBYA 2R37A 4NV2A 1ABAA 3F3QA 4EO3A 3QAGA 4CHSA 2FUG2 5JWQB 3LXTA 4ACSA 1AIUA 2L57A 3GFKA 5IMAA 5IQYA 4G2EA 3GH6A 3DMLA 4MF7A 2GQLA 5JWRB 1K0NA 4HQSA 4RI6A 2FWEA 1TU8A 4AGSA 1SK1A 1JHBA 4QL9A 1XVWA 4Q5FA 2GSRA 2OJLA 5IM9A 1Z9HA 4LLRA 3FZ9A 4OO4A 1YEXA 3W8JA 2PMTA 3Q18A 1TTZA 1A0FA 4G0IA 1E2YA 2LJRA 2H66A 4K7OA 2CV4A 4IQAA 4L5OA 4ILFA 5ECNB 1J9BA 2FA4A 3TJBA 4HUAA 5HR0A 6GSVA 3UMAA 1GUMA 5CAXA 1FHEA 3C1SA 4XS4B 2B6MA 2MZCA 4XRAA 4MP4A 3NIVA 1R26A 4OFMA 1JFUA 2HYXA 4O32A 3FHKA 3VLNA 1EOHA 18GSA 4MJAA 1IYIA 2RM5A 3EVIA 1LBKA 1V9WA 3HVVA 3DGQA 3CRTA 4F82A 1GSYA 1UA5A 4MZBA 2HSMB 4LMWA 5FT3A 1S3DA 2EC4A 3GL3A 4ZIJA 2IMDA 6GSXA 3Q19A 2DLXA 3G7YA 4DEJA 1ILOA 3F4TA 2AV4A 2GSSA 4E8EA 3EMXA 4MF5A 4L0WA 4PQHA 4KA0A 4ECBA 2E0QA 4RQXA 2LUSA 2L6CA 1OVNA 1CQHA 2OA7A 1SK0A 3U5RE 1JLWA 3FEUA 2F8AA 1UC7A 4IGJA 3H1NA 4WF4A 6GSWA 3ZVJA 1O8XA 2E2MA 3NZNA 1VF3A 1AXDA 4LL1B 3US3A 3VK9A 4ZBAA 3QD9A 2E7PA 2VCQA 3L9UA 1PMTA 2VLUA 4MDCA 4HJ2A 4HZ4A 4GCIA 3WGEA 1SK2A 3D22A 2JZTA 3E3EA 2VCZA 2D2ZA 3TB2A 3VPTA 5B6NA 2HRKB 1NHYA 2WRTA 1ERVA 3L4NA 1HYUA 1HD2A 1EV9A 4EL1A 3FRCA 4MJCA 2OADA 1XW9A 4IKHA 2LV3A 3AY8A 5IOWA 4KDXA 1SD8A 3ME8A 7GSSA 2JACA 2AAWA 2EIOA 4ZB8A 1Z3EA 5INYA 1RK4A 4BVYA 1WRYA 2P5QA 1SJIA 4FIWA 4ML6A 3M9JA 5CRHA 5DDLA 2H74A 1G7EA 4L0UA 2ZNMA 4TR4A 2C3QA 4KCAA 2JADA 4XS6A 3HJMA 2GT5A 4X1UA 2CAQA 1SU9A 1EZKA 4NAXA 5ECIB 4HEA2 1BJXA 2LQOA 2XBQA 3F4RA 4YQUA 1F3AA 1JZRA 2YOIA 1YDKA 3IK7A 2NPBA 5J41A 4K0GA 3GKMA 1AC1A 4DSQA 4K8MA 2HRAA 1H4OA 1TP9A 3HZ8A 3KTBA 5CRGA 1F9MA 3M9KA 2V2GA 2DJ3A 3D21A 2B3SA 3DVXA 2LNSA 3IHQA 1SKWB 4BVXA 1BEDA 2V41A 2XHFA 3CSHA 3GTUA 4KUNA 2H19A 2OBIA 3VWXA 1RW1A 3IR4A 4OCFA 4HDEA 2KLXA 3MNGA 5ECRB 2VM1A 1QQ2A 3HA9A 2EIRA 5BMUA 16GSA 1XIYA 3RHCA 4KX4A 3HVXA 3UAPA 5JCUA 2XPDA 1E6BA 3ZVJD 4LMVA 2AB6A 1QK8A 1GSQA 1GP1A 4JBBA 1TW9A 2L5LA 5GZZB 2PERA 2MMNA 3TRPA 4V1Ap 5D9XA 3RBTA 2KOKA 5DAKA 4OD7A 1YKAA 3UBLA 4TXOB 2H71A 2VCVA 4MABA 2OE1A 3C71A 3E0UA 2HRFA 1K0MA 5C04A 1QMVA 5AGYA 4MF6A 3QDNA 4MJEA 2DJKA 3GX0A 3KMNA 1T00A 2GDRA 1OC9A 2HXKA 2HZFA 2V6OA 2LJAA 2N5BA 2IWTA 3DD3A 4TVEA 1TI3A 2VLTA 2DMMA 2GSQA 4EKZA 3EU3A 4ZB9A 1WWJA 4ZL7A 2HFDA 5HR2A 3IK9A 2DMLA 2H72A 3VWUA 4E8HA 2IFQA 5G31A 2HSNB 3TRQA 2YWNA 5DQYA 2FY6A 5DJLA 3WGXA 2L4CA 5GSSA 1YKCA 4AJ6A 3V1WA 1JZOA 4AJ7A 2VAFA 2RUFA 1GNWA 4N10A 3TKPA 5HFIA 1GSUA 1J0FA 4XCSA 3HD5A 5IMZA 3H4KA 3IV4A 4HJMA 4POMA 1PKZA 1V57A 2OE0A 2IMKA 4TR1B 3KP9A 4MA9A 2DJJA 5B8AA 1M9AA 3D0ZA 2B5EA 3ERGA 1PRXA 4IN0A 4WBRD 4RQRA 3QCPA 3KTLA 1O73A 1XWAA 3CMIA 5G5FA 1K0CA 1N8JA 3G7JA 11GSA 4K9ZA 1USBA 1O81A 5H5SA 4IVFA 3A3TA 2YCDA 4HQZA 3W8SA 2IJYA 1T8EB 2ZCTA 4DSSA 3KP8A 1OKDA 1PX6A 2TRCP 3F6DA 3GA4A 1URMA 4PUFC 4ZL9A 5ECSA 3UL3A 1ZMAA 2VM2A 3S9FA 2YANA 5J5NA 3HJPA 4BPYA 5IO2A 2IMFA 3J7Yb 4G0LA 5IO0A 3VURA 1M7TA 5H5RA 2NDOA 3PINA 2IPAA 5B8BA 1YY7A 2H1BA 4N30A 3GRXA 3H8QA 4WEYA 1K3OA 4LL4B 3O76A 6GSTA 2VOCA 5CREA 1TU7A 1VF4A 4QQ7A 3Q74A 5A5KA 5IOXA 3F63A 5IIZA 1NHOA 3C1RA 4XRDA 1TRVA 3H93A 3ZL5A 3TRXA 4L5LA 2LQQA 2V32A 2KP1A 1XPVA 3KD0A 4I8BA 5IPHA 2IIYA 2PVQA 4NV5A 3ZREA 2VCXA 8GSSA 4LA1A 4JU5A 1A23A 3QPMA 4TR3A 4XIHA 4ULXA 1GL8A 1F37A 5DALA 4MH2A 3N5OA 3IBHA 1TOFA 3BD2A 5HFKA 4K7NA 5J3RA 5AISA 3DRNA 1M2DA 4NWYA 1W89A 3G9BA 3GSSA 2WDUA 3NOFA 1Z7RA 1M2BA 2FWHA 4F03A 2K6VA 5DQSA 1XXUA 3KH9A 2CVKA 3LEFA 1G6WA 3IPZA 3PGTA 4HU9A 1UN2A 2YNXA 5CYYA 2F9SA 3IA1A 4IS0A 3A5WA 4JE1A 4O7HA 3A2XA 2L5OA 4ZBDA 2OACA 3EYTA 3KGKA 3TOTA 3GURA 2GGTA 2Z9SA 2VCWA 5CRDA 1B9XC 1G7OA 4G0KA 2B5YA 2YN1A 4KAEA 1ST9A 2GQMA 3TJGA 1ZL9A 1NSWA 2YZUA 3UIWA 2DSAA 1VRSD 5E59A 3ZITA 1GLQA 1FB6A 3UBKA 5EPFA 5F06A 1A8YA 4G9HA 4NMUA 2N5AA 3C7MA 1EEMA 2VD1A 2X8CA 4JZQA 2KP2A 4KH7A 2TRXA 2H0GA 1XOBA 3HJOA 4OFTA 3LGCA 1K0BA 2J9HA 3R3EA 2YWOA 3KJYA 1WIKA 3LORA 3ZZXA 1FAAA 3J7Yk 4K2DA 2C80A 4BWQA 4CDOA 4FYCA 4V2MA 1SENA 2DJ1A 1PQNA 4MLYA 1HNAA 1PKWA 4MZCA 4ID0A 3TKSE 3WT2A 2H0IA 4MJBA 1XWBA 2WCIA 2YWIA 3TUEA 4HI7A 5ECHB 1X9WB 4OWYA 4QL7A 5EL8A 3F4SA 3FR3A 3P2AA 4BVYB 4BL7B 5J9CA 1O85A 2M80A 1ERTA 4EF0A 1Q98A 5G5EA 2PU9C 1EV4A 1GSFA 2VD0A 1EEJA 5KN3A 3UEMA 4D73B 1WPIA 4JR6A 2LNTA 1ACVA 2K9FA 1SJZA 2GZPA 2O87A 5F8BA 4DVCA 2V1MA 2YJHA 2CX4A 2ON5A 2I9HA 9GSSA 2WULA 3RHBA 4WBJA 5ENUA 2VL9A 3PPUA 1R5AA 1XWCA 3IC4A 4YQMA 1XW5A 1U87A 4WF5A 4KB3A 4IQ1A 1YZXA 4TW5A 2YZHA 4BVXB 5ELAA 2PGTA 2B7JA 2LSTA 3LSZA 1V58A 1WP0A 1SL0B 2ES7A 2C0EA 1SYXA 3W6GA 2IN3A 1LU4A 2JSYA 5IMVA 2OBKA 3ZMKA 2HSMA 1ERUA 2WFCA 4IHUA 2WS2A 5LNKe 1T4YA 3M1GA 4KE3A 1JLVA 4IW9A 3DWVA 4MZWA 2WB9A 3GUSA 2H70A 3E9JB 2H0HA 1DE2A 2GSTA 2A2SA 2XC2A 3L0HA 4JEDA 1AW9A 3UARA 3I6AA 3QMXA 2MBTA 1B4PA 1Z7PA 2R2JA 1YJ6A 4RI7A 4N0ZA 1OE8A 3ZFBA 2VIMA 1O8WA 3U6VA 1O6JA 1M2AA 2AYTA 1JZDA 2JSZA 4WR5A 1WJKA 2X8GA 1FOVA 2CX3A 1R7HA 3L9SA 4EVMA 3HKRA 3I9V2 1DUGA 1PSQA 3C8EA 1SYRA 1BX9A 1QUWA 4PURA 3GL5A 3ZIVA 1TK8B 2GS3A 5F05A 1ZYEA 1TI1A 2REMA 1A0RP 2HSYA 4Q5QA 4USSA 2PWJA 1BYEA 3MAKA 2IFQB 2VL3A 4H86A 3VI5A 4O92A 4NXIA 2QC7A 5AIXA 2TIRA 4K0NA 1XVQA 3HXSA 5DVBA 4TOPA 5ECPB 2I1UA 4EDYA 1THOA 3N9JA 4IELA 2FLSA 2HI7A 1ZCPA 1R5PA 2H1AA 5A4VA 2HZEA 2VCTA 3IAM2 3GKXA 3DXBA 3QFAC 2X99A 3JCML 1XWGA 1K3LA 2RM6A 4POKA 2P0GA 3P7XA 3CTGA 4JR4A 3UOMA 4MCUA 2YJ7A 3DEXA 1IYHA 3SBCA 1X0RA 2AHEA 3MWHA 4GLTA 2AUVA 3KCMA 3EMPA 5COHA 1A2JA 3BOAA 5ECMB 4PNGA 2YP6A 5KN1A 1EP8A 5B7CA 4PTSA 2XPEA 2OE3A 3GH9A 1A24A 5HQPA 3APSA 4V2NA 4WR4A 1V98A 1TK0B 4JRRA 4XS1A 4X43A 1Z6MA 2GLRA 5KN2A 1OKTA 4IJ3A 4MK3A 5EY6A 5KN0A 2LRTA 6GSYA 2I3YA 3ZMLA 2G0FA 1A2MA 4GQCA 1TRSA 1J08A 4GTUA 1Q4JA 4HU7A 2I81A 1OYJA 2HRNA 4TN8A 3WGDA 1X9MB 1ZZYA 3HCZA 3TKSC 4MMMA 3OR5A 2XBIA 3FR9A 4HZ2A 1FVJA 2LRCA 3KM6A 3FY7A 4IP1A 2B7KA 3ERFA 20GSA 1ZOFA 1B4QA 1MTCA 4TKYA 3BCKA 1TKDB 4BWSA 4GQFA 2VO4A 1TK5B 5D9VA 1BQ7A 5HR1A 4TXOA 2PUKC 1FB0A 2H8LA 4BA7A 3FYGA 2PBJA 3RAZA 1BG5A 1QXHA 1UVZA 2J23A 2YV9A 5L71A 2DJ0A 1C72A 4OO5A 3TJFA 3GKKA 4J56E 5DALB 5CO3A 1FVKA 1EWXA 2H6ZA 2FWFA 1AQVA 2RIIA 4OMVA 1GULA 2CZ2A 2PPTA 2H1GA 4GRFA 3ED3A 2O8VB 4V1Ag 3A2WA 5ELGA 3WYWA 2LJKA 4ZILA 1VF1A 3GKNA 3BCIA 3F8UA 5ECLB 2K18A 1GNEA 2X8HA 5FHIA 3Q6OA 4Q5NA 2HQTA 2FD3A 5HFGA 1XZOA 1OE7A 4YAPA 4N11A 1PA3A 4V2LA 1YF1A 3ERWA 4RUVA 2YV7A 4IBPA 3TJJA 2M46A 1TDIA 2IMEA 2ON7A 3EU4A 3TKSA 4TR1A 2P5RA 2CVBA 2OKAA 4CW9A 1G6YA 2HSHA 3MSZA 4ZBBA 4Z7XA 3ISOA 4WKWA 3KXOA 1GTAA 3TKQA 3L78A 1ML6A 1VF2A 3VWWA 3I69A 1K0DA 2B1KA 4NHZA 2FNOA 3DIEA 4MPGA 5DJMA 2L59A 1MDJA 1JZWA 4GWRA 1YF0A 3PH9A 5AN1A 1V2AA 2HLSA 2QKEA 3DKSA 6GSUA 1B8XA 4F2IA 2GZYA 2R4VA 1X9SB 3GMFA 3O3TA 1SL2B 4ZXGA 2O85A 2JL4A 2EIQA 3HY2A 5GAPD 3CTFA 1DE1A 1XW6A 1AQXA 3FZ4A 3GHAA 4KW6A 4P3YB 2L6DA 4K6XA 4N0VA 5F0GA 1GTUA
chains in the Genus database with same CATH superfamily
2E2GA 5A4WA 2GVPA 1HNCA 4F9ZA 3H79A 3LFLA 1ZYQB 2DKIA 1F2EA 12GSA 3HZ4A 3I43A 1AAZA 4GSTA 5D96A 5ID2A 2H75A 2O89A 1GH2A 3ZRDA 3HVNA 5LD0A 2H6XA 1MD3A 1I9DA 3RDWA 4KSOA 3A2VA 4XTSA 3TOUA 2MMAA 2PN8A 3GYKA 5GSTA 2V6KA 3EWLA 3ME7A 3F9UA 2VL2A 2C3NA 1Y6EA 1WOUA 4PQ1A 1M0UA 2C0FA 3DVWA 3IAS2 3QFBC 2OT3A 3TJKA 22GSA 2IMIA 3F6FA 2GTUA 3FW2A 3ZLPA 3FMWA 1KBNA 2MBSA 1FOHA 2LEGA 14GSA 5DCHA 3KH7A 4I2TA 4KDYA 4NHWA 5KOXA 3IDVA 3EE2A 3L9VA 2N5FA 2F8FA 2QGVA 3M0FA 1K0AA 5JWOB 1ON4A 2M72A 1HNBA 3D5JA 1W4VA 1M99A 4KDUA 3VI7A 3WD6A 4YQVA 5CRWA 4POLA 4X0XA 2K8SA 6GSSA 5F07A 1FO5A 1F6MC 4ECJA 3P8WA 3CWGA 2CZ3A 2UZ8A 3QAVA 1ERWA 1T3BA 2IL3A 4FO5A 5IMFA 2WVZA 5CP1A 4G19A 1OAZA 1YVLA 2F51A 3WT1A 4PUAA 4XS4A 1M9BA 4WETA 1AUCA 1I1IP 1XCCA 1SKSB 3VFIA 3GV1A 3UJ1A 3K8NA 4FH8A 2HNLA 3GTUB 4J2FA 3VPQA 1M3IA 2ALBA 1T1VA 2VUPA 2DIZA 1PL2A 2C1YA 2WZ9A 1LJRA 2H6YA 2PVOC 3IOSA 3LXZA 3F3RA 1PD21 5J40A 3IC8A 3LQ7A 5BMUB 3HHVA 5FWGA 4I6XA 1A8LA 3ZFLA 2H76A 3CXGA 3EURA 1FG4A 5IPGA 1AQWA 2NBSA 1SKRB 1GSDA 4EDZA 2A2PA 2YWMA 2HZEB 1EGRA 1NW2A 1TRWA 3GIXA 4EUYA 4PGTA 4GXZA 4GSSA 4KF9A 4PXOA 2P31A 3GSTA 17GSA 4KGIA 3CRUA 4G10A 2FHEA 5DAKB 2YPMA 2MMZA 4BL7A 1A2LA 3G7IA 2VLVA 4ML1A 1WMJA 5D73A 1EOGA 1OC9B 4D73A 5D8IA 1M3JA 1XFLA 3LJRA 4ECIA 4KSMA 2NTOA 1PX7A 5IMDA 3FZAA 5J4UA 2BMXA 5CNWA 5DCGA 5G2ZA 2B1LA 2LKUA 2C4JA 3EINA 1KEBA 4PX1A 1QFNA 1VGLA 10GSA 1G0TA 4ZB6A 3KMOA 2CVDA 5G1KA 3MDKA 2H73A 1X5CA 2LTKA 1KNGA 3APQA 2ZUPA 5ABRA 4Z2TA 1T4ZA 3KEBA 5E4WA 1OC8A 1GUHA 2HRKA 1TJDA 3RPNA 2KUCA 1S4BP 4I2UA 5JCWA 3SWLA 3IE3A 5IMCA 2X64A 1DSBA 3GX8A 4FYBA 1X5EA 4HS1A 3HDCA 1PL1A 1MEKA 1U3IA 2DJ2A 1BAYA 2G2QA 2AJQB 1B9YC 4PNFA 2HT9A 3EC3A 3DYRA 1EGOA 1V40A 1OC3A 1F3BA 3C73A 4J57E 4HOJA 3KZQA 3TGZA 1SJ6A 1BG1A 1K0OA 1QGVA 2KHPA 5LCZA 3M3MA 1GUKA 1DBYA 1O7UA 1RQMA 3QAWA 3TU3B 2H01A 2B5XA 4ECCA 2GQKA 4O5RA 2LS5A 2FCHA 1XBSA 1S3CA 4GF0A 1X5DA 2C8UA 2R5GA 2A4VA 1GTIA 4L8EA 4DSSB 2GT6A 3FR6A 1TRUA 2CA8A 3UVHA 4POBA 1FW1A 3ZYWA 3D4MA 2DIYA 2LRNA 1MDIA 3D6IA 1GSEA 1Z5YE 2WGRA 4KNDA 1PFOA 3GN3A 1SD9A 5ECKB 4EXJA 1PGTA 2HE3A 3RPPA 1K3YA 4I97A 4IJIA 2EFCA 5D9WA 4TRXA 2WJUA 4F0CA 2GZZA 2MMOA 2BTOT 4IP6A 2CQ9A 4K7IA 2FWGA 4Q5RA 4OCEA 2H1DA 5KEJA 4TR0A 1ZGNA 4GSNA 1XOAA 4CY6A 2JZRA 3IRAA 3LYPA 2R3XA 19GSA 1MDKA 1N2AA 5GAND 2C0DA 4EE0A 1YQ1A 3CSIA 1H75A 3R2QA 3ZTLA 5H5QA 3P90A 5D9TA 1T7PB 1B48A 5ECQB 4TXVA 2K8VA 3LG6A 5D93A 4AF2A 4ZL8A 5J9BA 5AIVA 4KCEA 4XHMA 2H30A 2A2RA 1GTBA 1I5GA 1KTEA 3PR8A 5G30A 3M8NA 2L4QA 5A4UA 3HVSA 4EC0A 1Z6NA 3O6TA 2FA8A 2RLIA 3TCOA 4AJ8A 3VWVA 2DBCA 1S3AA 3FKFA 4O5UA 2HSNA 1U88A 3FK8A 5G1LA 2CAIA 2C3TA 4AKXB 1CQGA 1XWKA 3FZ5A 3CYNA 5ECOB 2JU5A 2BJXA 4MPFA 2FGXA 1SL1B 1GRXA 3ZIJA 3QOUA 1THXA 2EFHA 1U6TA 3CSJA 4MH3A 1Y25A 1PN9A 1HQOA 4NPBA 1U3AA 4FQUA 1PN0A 2O7KA 1GWCA 1EP7A 2R6KA 3LWAA 5HR3A 4I5QA 2C0GA 2I4AA 1YEPA 1NM3A 5B6MA 13GSA 1GLPA 4YH2A 3TDGA 4OFNA 1GSSA 5EVOA 2MYGA 3IXRA 3CBUA 3TKRA 4DSRA 4PQIA 4F0BA 3LYKA 2RUEA 3HYPA 3UVTA 2NVLA 2VL2C 3QR6A 4YAVA 1TXXA 3GNJA 2JZSA 4ISDA 3KIJA 5ID2B 4FYUA 2CT6A 4Z2UA 2F3MA 1WE0A 3F0IA 4WXTA 2DC5A 3D4TA 5DBQA 1MD4A 1R4WA 5C00A 5JCGA 3BJ5A 2QSIA 4K1FA 3APOA 2EFDA 3BBYA 2R37A 4NV2A 1ABAA 3F3QA 4EO3A 3QAGA 4CHSA 2FUG2 5JWQB 3LXTA 4ACSA 1AIUA 2L57A 4AI6A 3GFKA 5IMAA 5IQYA 4G2EA 3GH6A 3DMLA 4MF7A 2GQLA 5JWRB 1K0NA 4HQSA 4RI6A 2FWEA 1TU8A 4AGSA 1SK1A 1JHBA 4QL9A 1XVWA 4Q5FA 2GSRA 2OJLA 5IM9A 1Z9HA 4LLRA 3FZ9A 4OO4A 1YEXA 4PHZC 3W8JA 2PMTA 3Q18A 1TTZA 1A0FA 4G0IA 1E2YA 2LJRA 2H66A 4K7OA 2CV4A 4IQAA 4L5OA 4ILFA 5ECNB 1J9BA 2FA4A 3TJBA 4ZB7A 2WW0A 4HUAA 2WW3A 5HR0A 6GSVA 3UMAA 1GUMA 5CAXA 1FHEA 3C1SA 4XS4B 2B6MA 1BF5A 2MZCA 4XRAA 4MP4A 5A5HA 3NIVA 1R26A 4OFMA 4MNNA 1JFUA 4PI0C 2HYXA 4O32A 3FHKA 3VLNA 1EOHA 18GSA 4MJAA 4PI2C 1IYIA 2RM5A 3EVIA 1LBKA 1V9WA 3HVVA 3DGQA 3CRTA 4F82A 1GSYA 4YKFA 4EIPA 1UA5A 4MZBA 2HSMB 4LMWA 5FT3A 1S3DA 2EC4A 3GL3A 4ZIJA 2IMDA 6GSXA 3Q19A 3EPTA 2DLXA 3G7YA 4DEJA 1ILOA 3F4TA 2AV4A 2GSSA 4E8EA 3EMXA 4MF5A 4L0WA 2WW2A 4PQHA 4KA0A 4ECBA 2E0QA 4RQXA 2LUSA 2L6CA 2WVYA 1OVNA 1CQHA 2OA7A 2O5VA 1SK0A 3U5RE 1JLWA 3FEUA 2F8AA 1UC7A 4IGJA 3H1NA 4WF4A 6GSWA 3ZVJA 1O8XA 2E2MA 3NZNA 1VF3A 1AXDA 4LL1B 3US3A 3VK9A 4ZBAA 3QD9A 2E7PA 2VCQA 3L9UA 1PMTA 2A4HA 2VLUA 4MDCA 4HJ2A 4HZ4A 4GCIA 3WGEA 4ICYA 1SK2A 3D22A 2JZTA 3E3EA 2VCZA 1ZYPA 2D2ZA 3TB2A 3VPTA 5B6NA 2HRKB 1NHYA 2O36A 2WRTA 1ERVA 3L4NA 1HYUA 1HD2A 1EV9A 4EL1A 3FRCA 4MJCA 5A1NA 2OADA 1XW9A 4IKHA 2LV3A 3AY8A 5IOWA 2VKZG 4KDXA 1SD8A 3ME8A 7GSSA 2JACA 2AAWA 2EIOA 4ZB8A 1Z3EA 4HSCX 5INYA 1RK4A 4BVYA 1WRYA 2P5QA 1SJIA 4FIWA 4ML6A 3M9JA 5CRHA 5DDLA 2H74A 1G7EA 4L0UA 2ZNMA 4TR4A 2C3QA 4KCAA 2JADA 4XS6A 3HJMA 2GT5A 4X1UA 2CAQA 1SU9A 4BIKA 1EZKA 4NAXA 1SVMA 5ECIB 4HEA2 1BJXA 2LQOA 2XBQA 3F4RA 4YQUA 2QA2A 1F3AA 1JZRA 2YOIA 1YDKA 3IK7A 2NPBA 5J41A 4K0GA 3GKMA 1AC1A 4DSQA 4K8MA 2HRAA 1H4OA 1TP9A 3HZ8A 3KTBA 5CRGA 1F9MA 3M9KA 2V2GA 2DJ3A 3D21A 2B3SA 2R0PA 3DVXA 2LNSA 3IHQA 1SKWB 4BVXA 1BEDA 2V41A 2XHFA 3CSHA 3GTUA 4KUNA 2H19A 2OBIA 3VWXA 1RW1A 3IR4A 4OCFA 4HDEA 2KLXA 3MNGA 5ECRB 2VM1A 1QQ2A 3HA9A 2EIRA 5BMUA 16GSA 1XIYA 2DKHA 3RHCA 4KX4A 3HVXA 3UAPA 5JCUA 1N25A 2XPDA 1E6BA 2UV8G 4LMVA 3ZVJD 2AB6A 1QK8A 1GSQA 1GP1A 4JBBA 1TW9A 2L5LA 5GZZB 2PERA 2MMNA 3TRPA 4V1Ap 5D9XA 1S3RA 3RBTA 2KOKA 5DAKA 4OD7A 2H1LA 1YKAA 3UBLA 4TXOB 2H71A 2VCVA 4MABA 2OE1A 3C71A 3E0UA 2HRFA 1K0MA 5C04A 1QMVA 5AGYA 4MF6A 3QDNA 4MJEA 2DJKA 3GX0A 3KMNA 1T00A 2GDRA 1OC9A 2HXKA 2HZFA 2V6OA 2LJAA 2N5BA 2IWTA 3DD3A 4TVEA 1TI3A 2VLTA 2DMMA 2GSQA 4EKZA 3EU3A 4ZB9A 1WWJA 4ZL7A 2HFDA 5BRTA 5HR2A 3IK9A 2DMLA 2H72A 3VWUA 5A34A 4E8HA 2IFQA 5G31A 2HSNB 3TRQA 2YWNA 5DQYA 2FY6A 5DJLA 3WGXA 2L4CA 5GSSA 4AKGA 1YKCA 4AJ6A 3V1WA 1JZOA 4AJ7A 2VAFA 2RUFA 1GNWA 4N10A 3TKPA 5HFIA 1GSUA 1J0FA 4XCSA 3HD5A 5IMZA 3H4KA 3MIXA 3IV4A 4HJMA 4POMA 1PKZA 1V57A 2OE0A 2IMKA 4TR1B 3KP9A 4MA9A 2DJJA 5B8AA 1M9AA 3D0ZA 2B5EA 3ERGA 2WW1A 1PRXA 5J4YA 4IN0A 4WBRD 4RQRA 3QCPA 3KTLA 1O73A 1XWAA 3CMIA 5G5FA 1K0CA 1N8JA 3G7JA 11GSA 4K9ZA 1USBA 1O81A 5H5SA 4IVFA 3A5IA 2WVXB 3A3TA 2YCDA 4HQZA 3W8SA 4YKGA 2IJYA 1T8EB 2ZCTA 4DSSA 4A5PA 3KP8A 1OKDA 1PX6A 2TRCP 3F6DA 3GA4A 1URMA 4PUFC 4ZL9A 5ECSA 3UL3A 1ZMAA 2O3EA 1SVOA 2VM2A 3S9FA 2YANA 5J5NA 3HJPA 4BPYA 5IO2A 2IMFA 3J7Yb 4G0LA 5IO0A 3VURA 1M7TA 5H5RA 2NDOA 3PINA 2IPAA 5B8BA 1YY7A 2H1BA 4N30A 3GRXA 3H8QA 3LW9A 4WEYA 1K3OA 4W66A 4LL4B 3O76A 6GSTA 2VOCA 5CREA 1TU7A 1VF4A 4QQ7A 3Q74A 4CY8A 5A5KA 5IOXA 3F63A 5IIZA 3RFRC 1NHOA 3C1RA 4XRDA 1TRVA 3H93A 3ZL5A 3TRXA 4L5LA 2LQQA 2V32A 2KP1A 1XPVA 4K2XA 3KD0A 4I8BA 5IPHA 2IIYA 2PVQA 4NV5A 3ZREA 2VCXA 8GSSA 4LA1A 4JU5A 1A23A 3QPMA 4TR3A 4XIHA 4ULXA 1GL8A 1F37A 5DALA 4MH2A 3N5OA 3IBHA 1TOFA 3BD2A 5HFKA 4K7NA 5J3RA 5AISA 3DRNA 1M2DA 4NWYA 1W89A 3G9BA 3GSSA 2WDUA 3NOFA 1Z7RA 1M2BA 2FWHA 4F03A 2K6VA 5DQSA 1XXUA 3KH9A 2CVKA 3LEFA 4K5RA 1G6WA 3IPZA 3PGTA 4HU9A 1UN2A 2YNXA 5CYYA 2F9SA 3IA1A 4IS0A 3A5WA 4JE1A 4O7HA 3A2XA 2L5OA 4ZBDA 2OACA 3EYTA 3KGKA 3TOTA 3GURA 2GGTA 2Z9SA 2VCWA 5CRDA 1B9XC 1G7OA 4G0KA 2B5YA 2YN1A 4KAEA 1ST9A 2GQMA 3TJGA 1ZL9A 1NSWA 2YZUA 3UIWA 2DSAA 1Y1UA 1VRSD 5E59A 3ZITA 1GLQA 1YEWC 1FB6A 3UBKA 5EPFA 5F06A 1A8YA 4G9HA 4NMUA 2N5AA 3C7MA 1EEMA 2VD1A 2X8CA 4JZQA 2KP2A 4KH7A 2TRXA 2H0GA 1XOBA 3HJOA 5J47A 4OFTA 4K5SA 3LGCA 1K0BA 2J9HA 3R3EA 2YWOA 3KJYA 1WIKA 3LORA 3ZZXA 1FAAA 3J7Yk 4K2DA 2C80A 4BWQA 4CDOA 4N3ZA 5A1NB 4FYCA 4V2MA 1SENA 2DJ1A 1PQNA 4MLYA 1HNAA 1PKWA 4MZCA 4ID0A 3TKSE 3WT2A 2H0IA 4MJBA 1XWBA 2WCIA 2YWIA 3TUEA 4HI7A 5ECHB 3IHGA 1X9WB 4OWYA 4QL7A 5EL8A 3F4SA 2QA1A 3FR3A 3P2AA 4BVYB 4BL7B 5J9CA 1O85A 2M80A 1ERTA 4EF0A 1Q98A 5G5EA 2PU9C 1EV4A 1GSFA 2VD0A 1EEJA 5KN3A 3UEMA 4D73B 1WPIA 4JR6A 4G01A 2LNTA 1ACVA 2K9FA 1SJZA 2GZPA 2O87A 3RGBC 5F8BA 4DVCA 2R0CA 2V1MA 2YJHA 2CX4A 2ON5A 2I9HA 9GSSA 2WULA 3RHBA 4WBJA 5ENUA 2VL9A 3PPUA 1R5AA 1XWCA 3IC4A 4YQMA 1XW5A 1U87A 4WF5A 4KB3A 4IQ1A 1YZXA 4TW5A 2YZHA 4BVXB 5ELAA 2PGTA 2B7JA 2LSTA 3LSZA 1V58A 1WP0A 1SL0B 2ES7A 2C0EA 1SYXA 4GDFA 3W6GA 2R0GA 2IN3A 1LU4A 2JSYA 5IMVA 2OBKA 3ZMKA 2HSMA 1ERUA 2WFCA 4IHUA 2WS2A 5LNKe 1T4YA 3M1GA 4KE3A 1JLVA 4IW9A 3DWVA 4MZWA 2WB9A 3GUSA 2H70A 3E9JB 2H0HA 1DE2A 2GSTA 2A2SA 2XC2A 3L0HA 4JEDA 1AW9A 3UARA 3I6AA 4QMKA 3QMXA 2MBTA 4Z2RA 1B4PA 1Z7PA 2R2JA 1YJ6A 4RI7A 4N0ZA 1OE8A 3ZFBA 2VIMA 1O8WA 3U6VA 1O6JA 1M2AA 2AYTA 4EIQA 1JZDA 2JSZA 4WR5A 1WJKA 2X8GA 1FOVA 2CX3A 1R7HA 3L9SA 4EVMA 3HKRA 3I9V2 1DUGA 1PSQA 3C8EA 1SYRA 1BX9A 1QUWA 4PURA 3GL5A 5KOWA 3ZIVA 1TK8B 4E68A 2GS3A 5F05A 1ZYEA 2X49A 1TI1A 2REMA 1A0RP 5A34B 2HSYA 4Q5QA 4USSA 2PWJA 1BYEA 3MAKA 2IFQB 2VL3A 4H86A 3VI5A 4O92A 4NXIA 4AKIA 2QC7A 5AIXA 2TIRA 4K0NA 1XVQA 3HXSA 5DVBA 4TOPA 5ECPB 2I1UA 4EDYA 1THOA 3N9JA 4IELA 2FLSA 2HI7A 1ZCPA 1R5PA 2H1AA 5A4VA 2HZEA 2VCTA 3IAM2 2X4AA 3DXBA 3GKXA 3QFAC 2X99A 3JCML 4O5QA 1XWGA 1K3LA 2RM6A 4POKA 2P0GA 3P7XA 3CTGA 4JR4A 3UOMA 4MCUA 2YJ7A 3DEXA 1IYHA 3SBCA 1X0RA 2AHEA 3MWHA 4GLTA 2AUVA 3KCMA 3EMPA 5COHA 1A2JA 3BOAA 5ECMB 4PNGA 2YP6A 5KN1A 1EP8A 5B7CA 4PTSA 2XPEA 2OE3A 3GH9A 1A24A 5HQPA 3APSA 4V2NA 4WR4A 1V98A 1TK0B 4JRRA 4XS1A 4X43A 1Z6MA 2GLRA 5KN2A 1OKTA 4IJ3A 4MK3A 5EY6A 2WZSA 5KN0A 2LRTA 6GSYA 2I3YA 3ZMLA 2G0FA 1A2MA 4GQCA 1TRSA 1J08A 4GTUA 1Q4JA 2I81A 4HU7A 1OYJA 2HRNA 3MYDA 4TN8A 3WGDA 1X9MB 1ZZYA 3HCZA 4X4JA 1ZYNA 3TKSC 4MMMA 3OR5A 2XBIA 3FR9A 4HZ2A 1FVJA 2LRCA 3KM6A 3FY7A 4IP1A 2B7KA 3ERFA 20GSA 1ZOFA 1B4QA 1MTCA 4TKYA 3BCKA 1TKDB 4BWSA 4GQFA 2VO4A 1TK5B 5D9VA 1BQ7A 1XG8A 5HR1A 4TXOA 2PUKC 1FB0A 2H8LA 4BA7A 3FYGA 2PBJA 3RAZA 1BG5A 1QXHA 1UVZA 2J23A 2YV9A 5L71A 2DJ0A 1C72A 4OO5A 3TJFA 3GKKA 3CHXC 4J56E 5DALB 5CO3A 5J4VA 1FVKA 1EWXA 2H6ZA 2FWFA 1AQVA 2RIIA 4OMVA 1GULA 2CZ2A 2PPTA 2H1GA 4GRFA 3ED3A 2O8VB 4V1Ag 3A2WA 4AKHA 5ELGA 3WYWA 2LJKA 4ZILA 1VF1A 3GKNA 3BCIA 3F8UA 5ECLB 2K18A 1GNEA 2X8HA 5FHIA 3Q6OA 4Q5NA 2HQTA 2FD3A 5HFGA 1XZOA 1OE7A 4YAPA 4N11A 1PA3A 4V2LA 1YF1A 3ERWA 4RUVA 2YV7A 4IBPA 3TJJA 2M46A 1TDIA 2IMEA 2ON7A 3EU4A 3TKSA 4TR1A 2P5RA 2CVBA 2OKAA 4CW9A 1G6YA 2HSHA 5A5HB 1SVLA 3MSZA 4ZBBA 3CQFA 4Z7XA 3ISOA 4WKWA 3KXOA 2WVXA 1GTAA 3TKQA 3L78A 1ML6A 1VF2A 3VWWA 3I69A 1K0DA 2B1KA 4NHZA 2FNOA 3DIEA 4MPGA 5DJMA 2L59A 1MDJA 3HMJG 1JZWA 4GWRA 1YF0A 3PH9A 5AN1A 1V2AA 2HLSA 2QKEA 1TXUA 3DKSA 6GSUA 2EFEA 1B8XA 4F2IA 2GZYA 2R4VA 1X9SB 3GMFA 3O3TA 1SL2B 4ZXGA 2O85A 2JL4A 2EIQA 4FXYP 3HY2A 5GAPD 3CTFA 1DE1A 1XW6A 1AQXA 3FZ4A 3GHAA 4KW6A 4P3YB 2L6DA 4K6XA 4N0VA 5F0GA 1GTUA
chains in the Genus database with same CATH topology
2E2GA 5A4WA 2GVPA 1HNCA 4F9ZA 3H79A 3LFLA 1ZYQB 2DKIA 1F2EA 12GSA 3HZ4A 3I43A 1AAZA 4GSTA 5D96A 5ID2A 2H75A 2O89A 1GH2A 3ZRDA 5LD0A 2H6XA 1MD3A 1I9DA 3RDWA 4KSOA 3A2VA 4XTSA 3TOUA 2MMAA 2PN8A 3GYKA 5GSTA 2V6KA 3EWLA 3ME7A 3F9UA 2VL2A 2C3NA 1Y6EA 1WOUA 4PQ1A 1M0UA 2C0FA 3DVWA 3IAS2 3QFBC 2OT3A 3TJKA 22GSA 2IMIA 3F6FA 2GTUA 3FW2A 3ZLPA 3FMWA 1KBNA 2MBSA 1FOHA 2LEGA 14GSA 5DCHA 3KH7A 4I2TA 4KDYA 4NHWA 5KOXA 3IDVA 3EE2A 3L9VA 2N5FA 2F8FA 2QGVA 3M0FA 1K0AA 5JWOB 1ON4A 2M72A 1HNBA 3D5JA 1W4VA 1M99A 4KDUA 3VI7A 3WD6A 4YQVA 5CRWA 4POLA 4X0XA 2K8SA 6GSSA 5F07A 1FO5A 1F6MC 4ECJA 3P8WA 3CWGA 2CZ3A 2UZ8A 3QAVA 1ERWA 1T3BA 2IL3A 4FO5A 5IMFA 5CP1A 4G19A 1OAZA 1YVLA 2F51A 3WT1A 4PUAA 4XS4A 1M9BA 4WETA 1AUCA 1XCCA 1SKSB 3VFIA 3GV1A 3UJ1A 3K8NA 4FH8A 2HNLA 3GTUB 4J2FA 3VPQA 2ALBA 1T1VA 2VUPA 2DIZA 1PL2A 2C1YA 2WZ9A 1LJRA 2H6YA 2PVOC 3IOSA 3LXZA 3F3RA 1PD21 5J40A 3IC8A 3LQ7A 5BMUB 3HHVA 5FWGA 4I6XA 1A8LA 3ZFLA 2H76A 3CXGA 3EURA 1FG4A 5IPGA 1AQWA 2NBSA 1SKRB 1GSDA 4EDZA 2A2PA 2YWMA 2HZEB 1EGRA 1NW2A 1TRWA 3GIXA 4EUYA 4PGTA 4GXZA 4GSSA 4KF9A 4PXOA 2P31A 3GSTA 17GSA 4KGIA 3CRUA 4G10A 2FHEA 5DAKB 2YPMA 2MMZA 4BL7A 1A2LA 3G7IA 2VLVA 4ML1A 1WMJA 5D73A 1EOGA 1OC9B 4D73A 5D8IA 1XFLA 3LJRA 4ECIA 4KSMA 2NTOA 1PX7A 5IMDA 3FZAA 5J4UA 2BMXA 5CNWA 5DCGA 5G2ZA 2B1LA 2LKUA 2C4JA 3EINA 1KEBA 4PX1A 1QFNA 1VGLA 10GSA 1G0TA 4ZB6A 3KMOA 2CVDA 5G1KA 3MDKA 2H73A 1X5CA 2LTKA 1KNGA 3APQA 2ZUPA 5ABRA 4Z2TA 1T4ZA 3KEBA 5E4WA 1OC8A 1GUHA 2HRKA 1TJDA 3RPNA 2KUCA 4I2UA 5JCWA 3SWLA 3IE3A 5IMCA 2X64A 1DSBA 3GX8A 4FYBA 1X5EA 4HS1A 3HDCA 1PL1A 1MEKA 1U3IA 2DJ2A 1BAYA 2G2QA 2AJQB 1B9YC 4PNFA 2HT9A 3EC3A 3DYRA 1EGOA 1V40A 1OC3A 1F3BA 3C73A 4J57E 4HOJA 3KZQA 3TGZA 1SJ6A 1BG1A 1K0OA 1QGVA 2KHPA 5LCZA 3M3MA 1GUKA 1DBYA 1O7UA 1RQMA 3QAWA 3TU3B 2H01A 2B5XA 4ECCA 2GQKA 4O5RA 2LS5A 2FCHA 1XBSA 1S3CA 4GF0A 1X5DA 2C8UA 2R5GA 2A4VA 1GTIA 4L8EA 4DSSB 2GT6A 3FR6A 1TRUA 2CA8A 3UVHA 4POBA 1FW1A 3ZYWA 3D4MA 2DIYA 2LRNA 1MDIA 3D6IA 1GSEA 1Z5YE 2WGRA 4KNDA 3GN3A 1SD9A 5ECKB 4EXJA 1PGTA 2HE3A 3RPPA 1K3YA 4I97A 4IJIA 2EFCA 5D9WA 4TRXA 2WJUA 4F0CA 2GZZA 2MMOA 2BTOT 4IP6A 2CQ9A 4K7IA 2FWGA 4Q5RA 4OCEA 2H1DA 5KEJA 4TR0A 1ZGNA 4GSNA 1XOAA 4CY6A 2JZRA 3IRAA 3LYPA 2R3XA 19GSA 1MDKA 1N2AA 5GAND 2C0DA 4EE0A 1YQ1A 3CSIA 1H75A 3R2QA 3ZTLA 5H5QA 3P90A 5D9TA 1T7PB 1B48A 5ECQB 4TXVA 2K8VA 3LG6A 5D93A 4AF2A 4ZL8A 5J9BA 5AIVA 4KCEA 4XHMA 2H30A 2A2RA 1GTBA 1I5GA 1KTEA 3PR8A 5G30A 3M8NA 2L4QA 5A4UA 3HVSA 4EC0A 1Z6NA 3O6TA 2FA8A 2RLIA 3TCOA 4AJ8A 3VWVA 2DBCA 1S3AA 3FKFA 4O5UA 2HSNA 1U88A 3FK8A 5G1LA 2CAIA 2C3TA 4AKXB 1CQGA 1XWKA 3FZ5A 3CYNA 5ECOB 2JU5A 2BJXA 4MPFA 2FGXA 1SL1B 1GRXA 3ZIJA 3QOUA 1THXA 2EFHA 1U6TA 3CSJA 4MH3A 1Y25A 1PN9A 1HQOA 4NPBA 1U3AA 4FQUA 1PN0A 2O7KA 1GWCA 1EP7A 2R6KA 3LWAA 5HR3A 4I5QA 2C0GA 2I4AA 1YEPA 1NM3A 5B6MA 13GSA 1GLPA 4YH2A 3TDGA 4OFNA 1GSSA 5EVOA 2MYGA 3IXRA 3CBUA 3TKRA 4DSRA 4PQIA 4F0BA 3LYKA 2RUEA 3HYPA 3UVTA 2NVLA 2VL2C 3QR6A 4YAVA 1TXXA 3GNJA 2JZSA 4ISDA 3KIJA 5ID2B 4FYUA 2CT6A 4Z2UA 2F3MA 1WE0A 3F0IA 4WXTA 2DC5A 3D4TA 5DBQA 1MD4A 1R4WA 5C00A 5JCGA 3BJ5A 2QSIA 4K1FA 3APOA 2EFDA 3BBYA 2R37A 4NV2A 1ABAA 3F3QA 4EO3A 3QAGA 4CHSA 2FUG2 5JWQB 3LXTA 4ACSA 1AIUA 2L57A 4AI6A 3GFKA 5IMAA 5IQYA 4G2EA 3GH6A 3DMLA 4MF7A 2GQLA 5JWRB 1K0NA 4HQSA 4RI6A 2FWEA 1TU8A 4AGSA 1SK1A 1JHBA 4QL9A 1XVWA 4Q5FA 2GSRA 2OJLA 5IM9A 1Z9HA 4LLRA 3FZ9A 4OO4A 1YEXA 3W8JA 2PMTA 3Q18A 1TTZA 1A0FA 4G0IA 1E2YA 2LJRA 2H66A 4K7OA 2CV4A 4IQAA 4L5OA 4ILFA 5ECNB 1J9BA 2FA4A 3TJBA 4ZB7A 4HUAA 5HR0A 6GSVA 3UMAA 1GUMA 5CAXA 1FHEA 3C1SA 4XS4B 2B6MA 1BF5A 2MZCA 4XRAA 4MP4A 5A5HA 3NIVA 1R26A 4OFMA 4MNNA 1JFUA 2HYXA 4O32A 3FHKA 3VLNA 1EOHA 18GSA 4MJAA 1IYIA 2RM5A 3EVIA 1LBKA 1V9WA 3HVVA 3DGQA 3CRTA 4F82A 1GSYA 4YKFA 4EIPA 1UA5A 4MZBA 2HSMB 4LMWA 5FT3A 1S3DA 2EC4A 3GL3A 4ZIJA 2IMDA 6GSXA 3Q19A 3EPTA 2DLXA 3G7YA 4DEJA 1ILOA 3F4TA 2AV4A 2GSSA 4E8EA 3EMXA 4MF5A 4L0WA 4PQHA 4KA0A 4ECBA 2E0QA 4RQXA 2LUSA 2L6CA 1OVNA 1CQHA 2OA7A 2O5VA 1SK0A 3U5RE 1JLWA 3FEUA 2F8AA 1UC7A 4IGJA 3H1NA 4WF4A 6GSWA 3ZVJA 1O8XA 2E2MA 3NZNA 1VF3A 1AXDA 4LL1B 3US3A 3VK9A 4ZBAA 3QD9A 2E7PA 2VCQA 3L9UA 1PMTA 2A4HA 2VLUA 4MDCA 4HJ2A 4HZ4A 4GCIA 3WGEA 4ICYA 1SK2A 3D22A 2JZTA 3E3EA 2VCZA 1ZYPA 2D2ZA 3TB2A 3VPTA 5B6NA 2HRKB 1NHYA 2WRTA 1ERVA 3L4NA 1HYUA 1HD2A 1EV9A 4EL1A 3FRCA 4MJCA 5A1NA 2OADA 1XW9A 4IKHA 2LV3A 3AY8A 5IOWA 2VKZG 4KDXA 1SD8A 3ME8A 7GSSA 2JACA 2AAWA 2EIOA 4ZB8A 1Z3EA 5INYA 1RK4A 4BVYA 1WRYA 2P5QA 1SJIA 4FIWA 4ML6A 3M9JA 5CRHA 5DDLA 2H74A 1G7EA 4L0UA 2ZNMA 4TR4A 2C3QA 4KCAA 2JADA 4XS6A 3HJMA 2GT5A 4X1UA 2CAQA 1SU9A 1EZKA 4NAXA 1SVMA 5ECIB 4HEA2 1BJXA 2LQOA 2XBQA 3F4RA 4YQUA 2QA2A 1F3AA 1JZRA 2YOIA 1YDKA 3IK7A 2NPBA 5J41A 4K0GA 3GKMA 1AC1A 4DSQA 4K8MA 2HRAA 1H4OA 1TP9A 3HZ8A 3KTBA 5CRGA 1F9MA 3M9KA 2V2GA 2DJ3A 3D21A 2B3SA 2R0PA 3DVXA 2LNSA 3IHQA 1SKWB 4BVXA 1BEDA 2V41A 2XHFA 3CSHA 3GTUA 4KUNA 2H19A 2OBIA 3VWXA 1RW1A 3IR4A 4OCFA 4HDEA 2KLXA 3MNGA 5ECRB 2VM1A 1QQ2A 3HA9A 2EIRA 5BMUA 16GSA 1XIYA 2DKHA 3RHCA 4KX4A 3HVXA 3UAPA 5JCUA 1N25A 2XPDA 1E6BA 2UV8G 4LMVA 3ZVJD 2AB6A 1QK8A 1GSQA 1GP1A 4JBBA 1TW9A 2L5LA 5GZZB 2PERA 2MMNA 3TRPA 4V1Ap 5D9XA 3RBTA 2KOKA 5DAKA 4OD7A 2H1LA 1YKAA 3UBLA 4TXOB 2H71A 2VCVA 4MABA 2OE1A 3C71A 3E0UA 2HRFA 1K0MA 5C04A 1QMVA 5AGYA 4MF6A 3QDNA 4MJEA 2DJKA 3GX0A 3KMNA 1T00A 2GDRA 1OC9A 2HXKA 2HZFA 2V6OA 2LJAA 2N5BA 2IWTA 3DD3A 4TVEA 1TI3A 2VLTA 2DMMA 2GSQA 4EKZA 3EU3A 4ZB9A 1WWJA 4ZL7A 2HFDA 5BRTA 5HR2A 3IK9A 2DMLA 2H72A 3VWUA 5A34A 4E8HA 2IFQA 5G31A 2HSNB 3TRQA 2YWNA 5DQYA 2FY6A 5DJLA 3WGXA 2L4CA 5GSSA 4AKGA 1YKCA 4AJ6A 3V1WA 1JZOA 4AJ7A 2VAFA 2RUFA 1GNWA 4N10A 3TKPA 5HFIA 1GSUA 1J0FA 4XCSA 3HD5A 5IMZA 3H4KA 3MIXA 3IV4A 4HJMA 4POMA 1PKZA 1V57A 2OE0A 2IMKA 4TR1B 3KP9A 4MA9A 2DJJA 5B8AA 1M9AA 3D0ZA 2B5EA 3ERGA 1PRXA 5J4YA 4IN0A 4WBRD 4RQRA 3QCPA 3KTLA 1O73A 1XWAA 3CMIA 5G5FA 1K0CA 1N8JA 3G7JA 11GSA 4K9ZA 1USBA 1O81A 5H5SA 4IVFA 3A5IA 3A3TA 2YCDA 4HQZA 3W8SA 4YKGA 2IJYA 1T8EB 2ZCTA 4DSSA 4A5PA 3KP8A 1OKDA 1PX6A 2TRCP 3F6DA 3GA4A 1URMA 4PUFC 4ZL9A 5ECSA 3UL3A 1ZMAA 1SVOA 2VM2A 3S9FA 2YANA 5J5NA 3HJPA 4BPYA 5IO2A 2IMFA 3J7Yb 4G0LA 5IO0A 3VURA 1M7TA 5H5RA 2NDOA 3PINA 2IPAA 5B8BA 1YY7A 2H1BA 4N30A 3GRXA 3H8QA 3LW9A 4WEYA 1K3OA 4W66A 4LL4B 3O76A 6GSTA 2VOCA 5CREA 1TU7A 1VF4A 4QQ7A 3Q74A 4CY8A 5A5KA 5IOXA 3F63A 5IIZA 1NHOA 3C1RA 4XRDA 1TRVA 3H93A 3ZL5A 3TRXA 4L5LA 2LQQA 2V32A 2KP1A 1XPVA 4K2XA 3KD0A 4I8BA 5IPHA 2IIYA 2PVQA 4NV5A 3ZREA 2VCXA 8GSSA 4LA1A 4JU5A 1A23A 3QPMA 4TR3A 4XIHA 4ULXA 1GL8A 1F37A 5DALA 4MH2A 3N5OA 3IBHA 1TOFA 3BD2A 5HFKA 4K7NA 5J3RA 5AISA 3DRNA 1M2DA 4NWYA 1W89A 3G9BA 3GSSA 2WDUA 3NOFA 1Z7RA 1M2BA 2FWHA 4F03A 2K6VA 5DQSA 1XXUA 3KH9A 2CVKA 3LEFA 4K5RA 1G6WA 3IPZA 3PGTA 4HU9A 1UN2A 2YNXA 5CYYA 2F9SA 3IA1A 4IS0A 3A5WA 4JE1A 4O7HA 3A2XA 2L5OA 4ZBDA 2OACA 3EYTA 3KGKA 3TOTA 3GURA 2GGTA 2Z9SA 2VCWA 5CRDA 1B9XC 1G7OA 4G0KA 2B5YA 2YN1A 4KAEA 1ST9A 2GQMA 3TJGA 1ZL9A 1NSWA 2YZUA 3UIWA 2DSAA 1Y1UA 1VRSD 5E59A 3ZITA 1GLQA 1FB6A 3UBKA 5EPFA 5F06A 1A8YA 4G9HA 4NMUA 2N5AA 3C7MA 1EEMA 2VD1A 2X8CA 4JZQA 2KP2A 4KH7A 2TRXA 2H0GA 1XOBA 3HJOA 5J47A 4OFTA 4K5SA 3LGCA 1K0BA 2J9HA 3R3EA 2YWOA 3KJYA 1WIKA 3LORA 3ZZXA 1FAAA 3J7Yk 4K2DA 2C80A 4BWQA 4CDOA 4N3ZA 5A1NB 4FYCA 4V2MA 1SENA 2DJ1A 1PQNA 4MLYA 1HNAA 1PKWA 4MZCA 4ID0A 3TKSE 3WT2A 2H0IA 4MJBA 1XWBA 2WCIA 2YWIA 3TUEA 4HI7A 5ECHB 3IHGA 1X9WB 4OWYA 4QL7A 5EL8A 3F4SA 2QA1A 3FR3A 3P2AA 4BVYB 4BL7B 5J9CA 1O85A 2M80A 1ERTA 4EF0A 1Q98A 5G5EA 2PU9C 1EV4A 1GSFA 2VD0A 1EEJA 5KN3A 3UEMA 4D73B 1WPIA 4JR6A 4G01A 2LNTA 1ACVA 2K9FA 1SJZA 2GZPA 2O87A 5F8BA 4DVCA 2R0CA 2V1MA 2YJHA 2CX4A 2ON5A 2I9HA 9GSSA 2WULA 3RHBA 4WBJA 5ENUA 2VL9A 3PPUA 1R5AA 1XWCA 3IC4A 4YQMA 1XW5A 1U87A 4WF5A 4KB3A 4IQ1A 1YZXA 4TW5A 2YZHA 4BVXB 5ELAA 2PGTA 2B7JA 2LSTA 3LSZA 1V58A 1WP0A 1SL0B 2ES7A 2C0EA 1SYXA 4GDFA 3W6GA 2R0GA 2IN3A 1LU4A 2JSYA 5IMVA 2OBKA 3ZMKA 2HSMA 1ERUA 2WFCA 4IHUA 2WS2A 5LNKe 1T4YA 3M1GA 4KE3A 1JLVA 4IW9A 3DWVA 4MZWA 2WB9A 3GUSA 2H70A 3E9JB 2H0HA 1DE2A 2GSTA 2A2SA 2XC2A 3L0HA 4JEDA 1AW9A 3UARA 3I6AA 4QMKA 3QMXA 2MBTA 4Z2RA 1B4PA 1Z7PA 2R2JA 1YJ6A 4RI7A 4N0ZA 1OE8A 3ZFBA 2VIMA 1O8WA 3U6VA 1O6JA 1M2AA 2AYTA 4EIQA 1JZDA 2JSZA 4WR5A 1WJKA 2X8GA 1FOVA 2CX3A 1R7HA 3L9SA 4EVMA 3HKRA 3I9V2 1DUGA 1PSQA 3C8EA 1SYRA 1BX9A 1QUWA 4PURA 3GL5A 5KOWA 3ZIVA 1TK8B 4E68A 2GS3A 5F05A 1ZYEA 2X49A 1TI1A 2REMA 1A0RP 5A34B 2HSYA 4Q5QA 4USSA 2PWJA 1BYEA 3MAKA 2IFQB 2VL3A 4H86A 3VI5A 4O92A 4NXIA 4AKIA 2QC7A 5AIXA 2TIRA 4K0NA 1XVQA 3HXSA 5DVBA 4TOPA 5ECPB 2I1UA 4EDYA 1THOA 3N9JA 4IELA 2FLSA 2HI7A 1ZCPA 1R5PA 2H1AA 5A4VA 2HZEA 2VCTA 3IAM2 2X4AA 3DXBA 3GKXA 3QFAC 2X99A 3JCML 4O5QA 1XWGA 1K3LA 2RM6A 4POKA 2P0GA 3P7XA 3CTGA 4JR4A 3UOMA 4MCUA 2YJ7A 3DEXA 1IYHA 3SBCA 1X0RA 2AHEA 3MWHA 4GLTA 2AUVA 3KCMA 3EMPA 5COHA 1A2JA 3BOAA 5ECMB 4PNGA 2YP6A 5KN1A 1EP8A 5B7CA 4PTSA 2XPEA 2OE3A 3GH9A 1A24A 5HQPA 3APSA 4V2NA 4WR4A 1V98A 1TK0B 4JRRA 4XS1A 4X43A 1Z6MA 2GLRA 5KN2A 1OKTA 4IJ3A 4MK3A 5EY6A 5KN0A 2LRTA 6GSYA 2I3YA 3ZMLA 2G0FA 1A2MA 4GQCA 1TRSA 1J08A 4GTUA 1Q4JA 2I81A 4HU7A 1OYJA 2HRNA 3MYDA 4TN8A 3WGDA 1X9MB 1ZZYA 3HCZA 4X4JA 1ZYNA 3TKSC 4MMMA 3OR5A 2XBIA 3FR9A 4HZ2A 1FVJA 2LRCA 3KM6A 3FY7A 4IP1A 2B7KA 3ERFA 20GSA 1ZOFA 1B4QA 1MTCA 4TKYA 3BCKA 1TKDB 4BWSA 4GQFA 2VO4A 1TK5B 5D9VA 1BQ7A 5HR1A 4TXOA 2PUKC 1FB0A 2H8LA 4BA7A 3FYGA 2PBJA 3RAZA 1BG5A 1QXHA 1UVZA 2J23A 2YV9A 5L71A 2DJ0A 1C72A 4OO5A 3TJFA 3GKKA 4J56E 5DALB 5CO3A 5J4VA 1FVKA 1EWXA 2H6ZA 2FWFA 1AQVA 2RIIA 4OMVA 1GULA 2CZ2A 2PPTA 2H1GA 4GRFA 3ED3A 2O8VB 4V1Ag 3A2WA 4AKHA 5ELGA 3WYWA 2LJKA 4ZILA 1VF1A 3GKNA 3BCIA 3F8UA 5ECLB 2K18A 1GNEA 2X8HA 5FHIA 3Q6OA 4Q5NA 2HQTA 2FD3A 5HFGA 1XZOA 1OE7A 4YAPA 4N11A 1PA3A 4V2LA 1YF1A 3ERWA 4RUVA 2YV7A 4IBPA 3TJJA 2M46A 1TDIA 2IMEA 2ON7A 3EU4A 3TKSA 4TR1A 2P5RA 2CVBA 2OKAA 4CW9A 1G6YA 2HSHA 3MSZA 5A5HB 1SVLA 4ZBBA 4Z7XA 3ISOA 4WKWA 3KXOA 1GTAA 3TKQA 3L78A 1ML6A 1VF2A 3VWWA 3I69A 1K0DA 2B1KA 4NHZA 2FNOA 3DIEA 4MPGA 5DJMA 2L59A 1MDJA 3HMJG 1JZWA 4GWRA 1YF0A 3PH9A 5AN1A 1V2AA 2HLSA 2QKEA 1TXUA 3DKSA 6GSUA 2EFEA 1B8XA 4F2IA 2GZYA 2R4VA 1X9SB 3GMFA 3O3TA 1SL2B 4ZXGA 2O85A 2JL4A 2EIQA 3HY2A 5GAPD 3CTFA 1DE1A 1XW6A 1AQXA 3FZ4A 3GHAA 4KW6A 4P3YB 2L6DA 4K6XA 4N0VA 5F0GA 1GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2G A;  5A4W A;  2GVP A;  1HNC A;  4F9Z A;  3H79 A;  3LFL A;  1ZYQ B;  1F2E A;  12GS A;  3HZ4 A;  3I43 A;  1AAZ A;  4GST A;  5D96 A;  5ID2 A;  2H75 A;  2O89 A;  1GH2 A;  3ZRD A;  5LD0 A;  2H6X A;  1MD3 A;  1I9D A;  3RDW A;  4KSO A;  3A2V A;  4XTS A;  3TOU A;  2MMA A;  2PN8 A;  3GYK A;  5GST A;  2V6K A;  3EWL A;  3ME7 A;  3F9U A;  2VL2 A;  2C3N A;  1Y6E A;  1WOU A;  4PQ1 A;  1M0U A;  2C0F A;  3DVW A;  3IAS 2;  3QFB C;  3TJK A;  22GS A;  2IMI A;  3F6F A;  2GTU A;  3FW2 A;  3ZLP A;  1KBN A;  2MBS A;  2LEG A;  14GS A;  5DCH A;  3KH7 A;  4I2T A;  4KDY A;  4NHW A;  3IDV A;  3EE2 A;  3L9V A;  2N5F A;  2F8F A;  2QGV A;  3M0F A;  1K0A A;  5JWO B;  1ON4 A;  2M72 A;  1HNB A;  3D5J A;  1W4V A;  1M99 A;  4KDU A;  3VI7 A;  3WD6 A;  4YQV A;  5CRW A;  4POL A;  4X0X A;  2K8S A;  6GSS A;  5F07 A;  1FO5 A;  1F6M C;  4ECJ A;  3P8W A;  2CZ3 A;  2UZ8 A;  3QAV A;  1ERW A;  1T3B A;  2IL3 A;  4FO5 A;  5IMF A;  5CP1 A;  4G19 A;  1OAZ A;  2F51 A;  3WT1 A;  4PUA A;  4XS4 A;  1M9B A;  4WET A;  1AUC A;  1XCC A;  1SKS B;  3VFI A;  3GV1 A;  3UJ1 A;  3K8N A;  4FH8 A;  2HNL A;  3GTU B;  4J2F A;  3VPQ A;  2ALB A;  1T1V A;  2VUP A;  2DIZ A;  1PL2 A;  2C1Y A;  2WZ9 A;  1LJR A;  2H6Y A;  2PVO C;  3IOS A;  3LXZ A;  3F3R A;  1PD2 1;  3IC8 A;  3LQ7 A;  3HHV A;  5FWG A;  4I6X A;  1A8L A;  3ZFL A;  2H76 A;  3CXG A;  3EUR A;  1FG4 A;  5IPG A;  1AQW A;  2NBS A;  1SKR B;  1GSD A;  4EDZ A;  2YWM A;  2HZE B;  1EGR A;  1NW2 A;  1TRW A;  3GIX A;  4EUY A;  4PGT A;  4GXZ A;  4GSS A;  4KF9 A;  4PXO A;  2P31 A;  3GST A;  17GS A;  4KGI A;  3CRU A;  4G10 A;  2FHE A;  5DAK B;  2YPM A;  2MMZ A;  4BL7 A;  1A2L A;  3G7I A;  2VLV A;  4ML1 A;  1WMJ A;  5D73 A;  1EOG A;  1OC9 B;  4D73 A;  5D8I A;  1XFL A;  3LJR A;  4ECI A;  4KSM A;  2NTO A;  1PX7 A;  5IMD A;  3FZA A;  5J4U A;  2BMX A;  5CNW A;  5DCG A;  5G2Z A;  2B1L A;  2LKU A;  2C4J A;  3EIN A;  1KEB A;  4PX1 A;  1QFN A;  1VGL A;  10GS A;  1G0T A;  4ZB6 A;  3KMO A;  2CVD A;  5G1K A;  3MDK A;  2H73 A;  1X5C A;  2LTK A;  1KNG A;  3APQ A;  2ZUP A;  5ABR A;  1T4Z A;  3KEB A;  5E4W A;  1OC8 A;  1GUH A;  2HRK A;  1TJD A;  3RPN A;  2KUC A;  4I2U A;  5JCW A;  3SWL A;  3IE3 A;  5IMC A;  2X64 A;  1DSB A;  3GX8 A;  4FYB A;  1X5E A;  4HS1 A;  3HDC A;  1PL1 A;  1MEK A;  1U3I A;  2DJ2 A;  1BAY A;  2G2Q A;  2AJQ B;  1B9Y C;  4PNF A;  2HT9 A;  3EC3 A;  3DYR A;  1EGO A;  1V40 A;  1OC3 A;  1F3B A;  3C73 A;  4J57 E;  4HOJ A;  3KZQ A;  3TGZ A;  1SJ6 A;  1K0O A;  1QGV A;  2KHP A;  5LCZ A;  3M3M A;  1GUK A;  1DBY A;  1O7U A;  1RQM A;  3QAW A;  2H01 A;  2B5X A;  4ECC A;  2GQK A;  4O5R A;  2LS5 A;  2FCH A;  1XBS A;  1S3C A;  4GF0 A;  1X5D A;  2C8U A;  2R5G A;  2A4V A;  1GTI A;  4L8E A;  4DSS B;  2GT6 A;  3FR6 A;  1TRU A;  2CA8 A;  3UVH A;  4POB A;  1FW1 A;  3ZYW A;  3D4M A;  2DIY A;  2LRN A;  1MDI A;  3D6I A;  1GSE A;  1Z5Y E;  2WGR A;  4KND A;  3GN3 A;  1SD9 A;  5ECK B;  4EXJ A;  1PGT A;  2HE3 A;  3RPP A;  1K3Y A;  4I97 A;  4IJI A;  5D9W A;  4TRX A;  2WJU A;  4F0C A;  2GZZ A;  2MMO A;  2BTO T;  4IP6 A;  2CQ9 A;  4K7I A;  2FWG A;  4Q5R A;  4OCE A;  2H1D A;  5KEJ A;  4TR0 A;  1ZGN A;  4GSN A;  1XOA A;  2JZR A;  3IRA A;  3LYP A;  2R3X A;  19GS A;  1MDK A;  1N2A A;  5GAN D;  2C0D A;  4EE0 A;  1YQ1 A;  3CSI A;  1H75 A;  3R2Q A;  3ZTL A;  5H5Q A;  3P90 A;  5D9T A;  1T7P B;  1B48 A;  5ECQ B;  4TXV A;  2K8V A;  3LG6 A;  5D93 A;  4AF2 A;  4ZL8 A;  5J9B A;  5AIV A;  4KCE A;  4XHM A;  2H30 A;  2A2R A;  1GTB A;  1I5G A;  1KTE A;  3PR8 A;  5G30 A;  3M8N A;  2L4Q A;  5A4U A;  3HVS A;  4EC0 A;  1Z6N A;  3O6T A;  2FA8 A;  2RLI A;  3TCO A;  4AJ8 A;  3VWV A;  2DBC A;  1S3A A;  3FKF A;  1U88 A;  3FK8 A;  5G1L A;  2CAI A;  2C3T A;  1CQG A;  1XWK A;  3FZ5 A;  3CYN A;  5ECO B;  2JU5 A;  2BJX A;  4MPF A;  2FGX A;  1SL1 B;  1GRX A;  3ZIJ A;  3QOU A;  1THX A;  1U6T A;  3CSJ A;  4MH3 A;  1Y25 A;  1PN9 A;  1HQO A;  4NPB A;  1U3A A;  4FQU A;  2O7K A;  1GWC A;  1EP7 A;  2R6K A;  3LWA A;  5HR3 A;  4I5Q A;  2C0G A;  2I4A A;  1YEP A;  1NM3 A;  5B6M A;  13GS A;  1GLP A;  4YH2 A;  3TDG A;  4OFN A;  1GSS A;  5EVO A;  2MYG A;  3IXR A;  3CBU A;  3TKR A;  4DSR A;  4PQI A;  4F0B A;  3LYK A;  2RUE A;  3HYP A;  3UVT A;  2NVL A;  2VL2 C;  3QR6 A;  4YAV A;  1TXX A;  3GNJ A;  2JZS A;  4ISD A;  3KIJ A;  5ID2 B;  4FYU A;  2CT6 A;  2F3M A;  1WE0 A;  3F0I A;  4WXT A;  2DC5 A;  3D4T A;  5DBQ A;  1MD4 A;  1R4W A;  5C00 A;  5JCG A;  3BJ5 A;  2QSI A;  4K1F A;  3APO A;  3BBY A;  2R37 A;  4NV2 A;  1ABA A;  3F3Q A;  4EO3 A;  3QAG A;  4CHS A;  2FUG 2;  5JWQ B;  3LXT A;  4ACS A;  1AIU A;  2L57 A;  3GFK A;  5IMA A;  5IQY A;  4G2E A;  3GH6 A;  3DML A;  4MF7 A;  2GQL A;  5JWR B;  1K0N A;  4HQS A;  4RI6 A;  2FWE A;  1TU8 A;  4AGS A;  1SK1 A;  1JHB A;  4QL9 A;  1XVW A;  4Q5F A;  2GSR A;  2OJL A;  5IM9 A;  1Z9H A;  4LLR A;  3FZ9 A;  4OO4 A;  1YEX A;  3W8J A;  2PMT A;  3Q18 A;  1TTZ A;  1A0F A;  4G0I A;  1E2Y A;  2LJR A;  2H66 A;  4K7O A;  2CV4 A;  4IQA A;  4L5O A;  4ILF A;  5ECN B;  1J9B A;  2FA4 A;  3TJB A;  4HUA A;  5HR0 A;  6GSV A;  3UMA A;  1GUM A;  5CAX A;  1FHE A;  3C1S A;  4XS4 B;  2B6M A;  2MZC A;  4XRA A;  4MP4 A;  3NIV A;  1R26 A;  4OFM A;  1JFU A;  2HYX A;  4O32 A;  3FHK A;  3VLN A;  1EOH A;  18GS A;  4MJA A;  1IYI A;  2RM5 A;  3EVI A;  1LBK A;  1V9W A;  3HVV A;  3DGQ A;  3CRT A;  4F82 A;  1GSY A;  1UA5 A;  4MZB A;  2HSM B;  4LMW A;  5FT3 A;  1S3D A;  2EC4 A;  3GL3 A;  4ZIJ A;  2IMD A;  6GSX A;  3Q19 A;  2DLX A;  3G7Y A;  4DEJ A;  1ILO A;  3F4T A;  2AV4 A;  2GSS A;  4E8E A;  3EMX A;  4MF5 A;  4L0W A;  4PQH A;  4KA0 A;  4ECB A;  2E0Q A;  4RQX A;  2LUS A;  2L6C A;  1OVN A;  1CQH A;  2OA7 A;  1SK0 A;  3U5R E;  1JLW A;  3FEU A;  2F8A A;  1UC7 A;  4IGJ A;  3H1N A;  4WF4 A;  6GSW A;  3ZVJ A;  1O8X A;  2E2M A;  3NZN A;  1VF3 A;  1AXD A;  4LL1 B;  3US3 A;  3VK9 A;  4ZBA A;  3QD9 A;  2E7P A;  2VCQ A;  3L9U A;  1PMT A;  2VLU A;  4MDC A;  4HJ2 A;  4HZ4 A;  4GCI A;  3WGE A;  1SK2 A;  3D22 A;  2JZT A;  3E3E A;  2VCZ A;  2D2Z A;  3TB2 A;  3VPT A;  5B6N A;  2HRK B;  1NHY A;  2WRT A;  1ERV A;  3L4N A;  1HYU A;  1HD2 A;  1EV9 A;  4EL1 A;  3FRC A;  4MJC A;  2OAD A;  1XW9 A;  4IKH A;  2LV3 A;  3AY8 A;  5IOW A;  4KDX A;  1SD8 A;  3ME8 A;  7GSS A;  2JAC A;  2AAW A;  2EIO A;  4ZB8 A;  1Z3E A;  5INY A;  1RK4 A;  4BVY A;  1WRY A;  2P5Q A;  1SJI A;  4FIW A;  4ML6 A;  3M9J A;  5CRH A;  5DDL A;  2H74 A;  1G7E A;  4L0U A;  2ZNM A;  4TR4 A;  2C3Q A;  4KCA A;  2JAD A;  4XS6 A;  3HJM A;  2GT5 A;  4X1U A;  2CAQ A;  1SU9 A;  1EZK A;  4NAX A;  5ECI B;  4HEA 2;  1BJX A;  2LQO A;  2XBQ A;  3F4R A;  4YQU A;  1F3A A;  1JZR A;  2YOI A;  1YDK A;  3IK7 A;  2NPB A;  5J41 A;  4K0G A;  3GKM A;  1AC1 A;  4DSQ A;  4K8M A;  2HRA A;  1H4O A;  1TP9 A;  3HZ8 A;  3KTB A;  5CRG A;  1F9M A;  3M9K A;  2V2G A;  2DJ3 A;  3D21 A;  2B3S A;  3DVX A;  2LNS A;  3IHQ A;  1SKW B;  4BVX A;  1BED A;  2V41 A;  2XHF A;  3CSH A;  3GTU A;  4KUN A;  2H19 A;  2OBI A;  3VWX A;  1RW1 A;  3IR4 A;  4OCF A;  4HDE A;  2KLX A;  3MNG A;  5ECR B;  2VM1 A;  1QQ2 A;  3HA9 A;  2EIR A;  5BMU A;  16GS A;  1XIY A;  3RHC A;  4KX4 A;  3HVX A;  3UAP A;  5JCU A;  2XPD A;  1E6B A;  3ZVJ D;  4LMV A;  2AB6 A;  1QK8 A;  1GSQ A;  1GP1 A;  4JBB A;  1TW9 A;  2L5L A;  5GZZ B;  2PER A;  2MMN A;  3TRP A;  4V1A p;  5D9X A;  3RBT A;  2KOK A;  5DAK A;  4OD7 A;  1YKA A;  3UBL A;  4TXO B;  2H71 A;  2VCV A;  4MAB A;  2OE1 A;  3C71 A;  3E0U A;  2HRF A;  1K0M A;  5C04 A;  1QMV A;  5AGY A;  4MF6 A;  3QDN A;  4MJE A;  2DJK A;  3GX0 A;  3KMN A;  1T00 A;  2GDR A;  1OC9 A;  2HXK A;  2HZF A;  2V6O A;  2LJA A;  2N5B A;  2IWT A;  3DD3 A;  4TVE A;  1TI3 A;  2VLT A;  2DMM A;  2GSQ A;  4EKZ A;  3EU3 A;  4ZB9 A;  1WWJ A;  4ZL7 A;  2HFD A;  5HR2 A;  3IK9 A;  2DML A;  2H72 A;  3VWU A;  4E8H A;  2IFQ A;  5G31 A;  2HSN B;  3TRQ A;  2YWN A;  5DQY A;  2FY6 A;  5DJL A;  3WGX A;  2L4C A;  5GSS A;  1YKC A;  4AJ6 A;  3V1W A;  1JZO A;  4AJ7 A;  2VAF A;  2RUF A;  1GNW A;  4N10 A;  3TKP A;  5HFI A;  1GSU A;  1J0F A;  4XCS A;  3HD5 A;  5IMZ A;  3H4K A;  3IV4 A;  4HJM A;  4POM A;  1PKZ A;  1V57 A;  2OE0 A;  2IMK A;  4TR1 B;  3KP9 A;  4MA9 A;  2DJJ A;  5B8A A;  1M9A A;  3D0Z A;  2B5E A;  3ERG A;  1PRX A;  4IN0 A;  4WBR D;  4RQR A;  3QCP A;  3KTL A;  1O73 A;  1XWA A;  3CMI A;  5G5F A;  1K0C A;  1N8J A;  3G7J A;  11GS A;  4K9Z A;  1USB A;  1O81 A;  5H5S A;  4IVF A;  3A3T A;  2YCD A;  4HQZ A;  3W8S A;  2IJY A;  1T8E B;  2ZCT A;  4DSS A;  3KP8 A;  1OKD A;  1PX6 A;  2TRC P;  3F6D A;  3GA4 A;  1URM A;  4PUF C;  4ZL9 A;  5ECS A;  3UL3 A;  1ZMA A;  2VM2 A;  3S9F A;  2YAN A;  5J5N A;  3HJP A;  4BPY A;  5IO2 A;  2IMF A;  3J7Y b;  4G0L A;  5IO0 A;  3VUR A;  1M7T A;  5H5R A;  2NDO A;  3PIN A;  2IPA A;  5B8B A;  1YY7 A;  2H1B A;  4N30 A;  3GRX A;  3H8Q A;  4WEY A;  1K3O A;  4LL4 B;  3O76 A;  6GST A;  2VOC A;  5CRE A;  1TU7 A;  1VF4 A;  4QQ7 A;  3Q74 A;  5A5K A;  5IOX A;  3F63 A;  5IIZ A;  1NHO A;  3C1R A;  4XRD A;  1TRV A;  3H93 A;  3ZL5 A;  3TRX A;  4L5L A;  2LQQ A;  2V32 A;  2KP1 A;  1XPV A;  3KD0 A;  4I8B A;  5IPH A;  2IIY A;  2PVQ A;  4NV5 A;  3ZRE A;  2VCX A;  8GSS A;  4LA1 A;  4JU5 A;  1A23 A;  3QPM A;  4TR3 A;  4XIH A;  4ULX A;  1GL8 A;  1F37 A;  5DAL A;  4MH2 A;  3N5O A;  3IBH A;  1TOF A;  3BD2 A;  5HFK A;  4K7N A;  5J3R A;  5AIS A;  3DRN A;  1M2D A;  4NWY A;  1W89 A;  3G9B A;  3GSS A;  2WDU A;  3NOF A;  1Z7R A;  1M2B A;  2FWH A;  4F03 A;  2K6V A;  5DQS A;  1XXU A;  3KH9 A;  2CVK A;  3LEF A;  1G6W A;  3IPZ A;  3PGT A;  4HU9 A;  1UN2 A;  2YNX A;  5CYY A;  2F9S A;  3IA1 A;  4IS0 A;  3A5W A;  4JE1 A;  4O7H A;  3A2X A;  2L5O A;  4ZBD A;  2OAC A;  3EYT A;  3KGK A;  3TOT A;  3GUR A;  2GGT A;  2Z9S A;  2VCW A;  5CRD A;  1B9X C;  1G7O A;  4G0K A;  2B5Y A;  2YN1 A;  4KAE A;  1ST9 A;  2GQM A;  3TJG A;  1ZL9 A;  1NSW A;  2YZU A;  3UIW A;  2DSA A;  1VRS D;  5E59 A;  3ZIT A;  1GLQ A;  1FB6 A;  3UBK A;  5EPF A;  5F06 A;  1A8Y A;  4G9H A;  4NMU A;  2N5A A;  3C7M A;  1EEM A;  2VD1 A;  2X8C A;  4JZQ A;  2KP2 A;  4KH7 A;  2TRX A;  2H0G A;  1XOB A;  3HJO A;  4OFT A;  3LGC A;  1K0B A;  2J9H A;  3R3E A;  2YWO A;  3KJY A;  1WIK A;  3LOR A;  3ZZX A;  1FAA A;  3J7Y k;  4K2D A;  2C80 A;  4BWQ A;  4CDO A;  4FYC A;  4V2M A;  1SEN A;  2DJ1 A;  1PQN A;  4MLY A;  1HNA A;  1PKW A;  4MZC A;  4ID0 A;  3TKS E;  3WT2 A;  2H0I A;  4MJB A;  1XWB A;  2WCI A;  2YWI A;  3TUE A;  4HI7 A;  5ECH B;  1X9W B;  4OWY A;  4QL7 A;  5EL8 A;  3F4S A;  3FR3 A;  3P2A A;  4BVY B;  4BL7 B;  5J9C A;  1O85 A;  2M80 A;  1ERT A;  4EF0 A;  1Q98 A;  5G5E A;  2PU9 C;  1EV4 A;  1GSF A;  2VD0 A;  1EEJ A;  5KN3 A;  3UEM A;  4D73 B;  1WPI A;  4JR6 A;  2LNT A;  1ACV A;  2K9F A;  1SJZ A;  2GZP A;  2O87 A;  5F8B A;  4DVC A;  2V1M A;  2YJH A;  2CX4 A;  2ON5 A;  2I9H A;  9GSS A;  2WUL A;  3RHB A;  4WBJ A;  5ENU A;  2VL9 A;  3PPU A;  1R5A A;  1XWC A;  3IC4 A;  4YQM A;  1XW5 A;  1U87 A;  4WF5 A;  4KB3 A;  4IQ1 A;  1YZX A;  4TW5 A;  2YZH A;  4BVX B;  5ELA A;  2PGT A;  2B7J A;  2LST A;  3LSZ A;  1V58 A;  1WP0 A;  1SL0 B;  2ES7 A;  2C0E A;  1SYX A;  3W6G A;  2IN3 A;  1LU4 A;  2JSY A;  5IMV A;  2OBK A;  3ZMK A;  2HSM A;  1ERU A;  2WFC A;  4IHU A;  2WS2 A;  5LNK e;  1T4Y A;  3M1G A;  4KE3 A;  1JLV A;  4IW9 A;  3DWV A;  4MZW A;  2WB9 A;  3GUS A;  2H70 A;  3E9J B;  2H0H A;  1DE2 A;  2GST A;  2A2S A;  2XC2 A;  3L0H A;  4JED A;  1AW9 A;  3UAR A;  3I6A A;  3QMX A;  2MBT A;  1B4P A;  1Z7P A;  2R2J A;  1YJ6 A;  4RI7 A;  4N0Z A;  1OE8 A;  3ZFB A;  2VIM A;  1O8W A;  3U6V A;  1O6J A;  1M2A A;  2AYT A;  1JZD A;  2JSZ A;  4WR5 A;  1WJK A;  2X8G A;  1FOV A;  2CX3 A;  1R7H A;  3L9S A;  4EVM A;  3HKR A;  3I9V 2;  1DUG A;  1PSQ A;  3C8E A;  1SYR A;  1BX9 A;  1QUW A;  4PUR A;  3GL5 A;  3ZIV A;  1TK8 B;  2GS3 A;  5F05 A;  1ZYE A;  1TI1 A;  2REM A;  1A0R P;  2HSY A;  4Q5Q A;  4USS A;  2PWJ A;  1BYE A;  3MAK A;  2IFQ B;  2VL3 A;  4H86 A;  3VI5 A;  4O92 A;  4NXI A;  2QC7 A;  5AIX A;  2TIR A;  4K0N A;  1XVQ A;  3HXS A;  5DVB A;  4TOP A;  5ECP B;  2I1U A;  4EDY A;  1THO A;  3N9J A;  4IEL A;  2FLS A;  2HI7 A;  1ZCP A;  1R5P A;  2H1A A;  5A4V A;  2HZE A;  2VCT A;  3IAM 2;  3GKX A;  3DXB A;  3QFA C;  2X99 A;  3JCM L;  1XWG A;  1K3L A;  2RM6 A;  4POK A;  2P0G A;  3P7X A;  3CTG A;  4JR4 A;  3UOM A;  4MCU A;  2YJ7 A;  3DEX A;  1IYH A;  3SBC A;  1X0R A;  2AHE A;  3MWH A;  4GLT A;  2AUV A;  3KCM A;  3EMP A;  5COH A;  1A2J A;  3BOA A;  5ECM B;  4PNG A;  2YP6 A;  5KN1 A;  1EP8 A;  5B7C A;  4PTS A;  2XPE A;  2OE3 A;  3GH9 A;  1A24 A;  5HQP A;  3APS A;  4V2N A;  4WR4 A;  1V98 A;  1TK0 B;  4JRR A;  4XS1 A;  4X43 A;  1Z6M A;  2GLR A;  5KN2 A;  1OKT A;  4IJ3 A;  4MK3 A;  5EY6 A;  5KN0 A;  2LRT A;  6GSY A;  2I3Y A;  3ZML A;  2G0F A;  1A2M A;  4GQC A;  1TRS A;  1J08 A;  4GTU A;  1Q4J A;  4HU7 A;  2I81 A;  1OYJ A;  2HRN A;  4TN8 A;  3WGD A;  1X9M B;  1ZZY A;  3HCZ A;  3TKS C;  4MMM A;  3OR5 A;  2XBI A;  3FR9 A;  4HZ2 A;  1FVJ A;  2LRC A;  3KM6 A;  3FY7 A;  4IP1 A;  2B7K A;  3ERF A;  20GS A;  1ZOF A;  1B4Q A;  1MTC A;  4TKY A;  3BCK A;  1TKD B;  4BWS A;  4GQF A;  2VO4 A;  1TK5 B;  5D9V A;  1BQ7 A;  5HR1 A;  4TXO A;  2PUK C;  1FB0 A;  2H8L A;  4BA7 A;  3FYG A;  2PBJ A;  3RAZ A;  1BG5 A;  1QXH A;  1UVZ A;  2J23 A;  2YV9 A;  5L71 A;  2DJ0 A;  1C72 A;  4OO5 A;  3TJF A;  3GKK A;  4J56 E;  5DAL B;  5CO3 A;  1FVK A;  1EWX A;  2H6Z A;  2FWF A;  1AQV A;  2RII A;  4OMV A;  1GUL A;  2CZ2 A;  2PPT A;  2H1G A;  4GRF A;  3ED3 A;  2O8V B;  4V1A g;  3A2W A;  5ELG A;  3WYW A;  2LJK A;  4ZIL A;  1VF1 A;  3GKN A;  3BCI A;  3F8U A;  5ECL B;  2K18 A;  1GNE A;  2X8H A;  5FHI A;  3Q6O A;  4Q5N A;  2HQT A;  2FD3 A;  5HFG A;  1XZO A;  1OE7 A;  4YAP A;  4N11 A;  1PA3 A;  4V2L A;  1YF1 A;  3ERW A;  4RUV A;  2YV7 A;  4IBP A;  3TJJ A;  2M46 A;  1TDI A;  2IME A;  2ON7 A;  3EU4 A;  3TKS A;  4TR1 A;  2P5R A;  2CVB A;  2OKA A;  4CW9 A;  1G6Y A;  2HSH A;  3MSZ A;  4ZBB A;  4Z7X A;  3ISO A;  4WKW A;  3KXO A;  1GTA A;  3TKQ A;  3L78 A;  1ML6 A;  1VF2 A;  3VWW A;  3I69 A;  1K0D A;  2B1K A;  4NHZ A;  2FNO A;  3DIE A;  4MPG A;  5DJM A;  2L59 A;  1MDJ A;  1JZW A;  4GWR A;  1YF0 A;  3PH9 A;  5AN1 A;  1V2A A;  2HLS A;  2QKE A;  3DKS A;  6GSU A;  1B8X A;  4F2I A;  2GZY A;  2R4V A;  1X9S B;  3GMF A;  3O3T A;  1SL2 B;  4ZXG A;  2O85 A;  2JL4 A;  2EIQ A;  3HY2 A;  5GAP D;  3CTF A;  1DE1 A;  1XW6 A;  1AQX A;  3FZ4 A;  3GHA A;  4KW6 A;  4P3Y B;  2L6D A;  4K6X A;  4N0V A;  5F0G A;  1GTU A; 
#chains in the Genus database with same CATH topology
 2E2G A;  5A4W A;  2GVP A;  1HNC A;  4F9Z A;  3H79 A;  3LFL A;  1ZYQ B;  2DKI A;  1F2E A;  12GS A;  3HZ4 A;  3I43 A;  1AAZ A;  4GST A;  5D96 A;  5ID2 A;  2H75 A;  2O89 A;  1GH2 A;  3ZRD A;  3HVN A;  5LD0 A;  2H6X A;  1MD3 A;  1I9D A;  3RDW A;  4KSO A;  3A2V A;  4XTS A;  3TOU A;  2MMA A;  2PN8 A;  3GYK A;  5GST A;  2V6K A;  3EWL A;  3ME7 A;  3F9U A;  2VL2 A;  2C3N A;  1Y6E A;  1WOU A;  4PQ1 A;  1M0U A;  2C0F A;  3DVW A;  3IAS 2;  3QFB C;  2OT3 A;  3TJK A;  22GS A;  2IMI A;  3F6F A;  2GTU A;  3FW2 A;  3ZLP A;  3FMW A;  1KBN A;  2MBS A;  1FOH A;  2LEG A;  14GS A;  5DCH A;  3KH7 A;  4I2T A;  4KDY A;  4NHW A;  5KOX A;  3IDV A;  3EE2 A;  3L9V A;  2N5F A;  2F8F A;  2QGV A;  3M0F A;  1K0A A;  5JWO B;  1ON4 A;  2M72 A;  1HNB A;  3D5J A;  1W4V A;  1M99 A;  4KDU A;  3VI7 A;  3WD6 A;  4YQV A;  5CRW A;  4POL A;  4X0X A;  2K8S A;  6GSS A;  5F07 A;  1FO5 A;  1F6M C;  4ECJ A;  3P8W A;  3CWG A;  2CZ3 A;  2UZ8 A;  3QAV A;  1ERW A;  1T3B A;  2IL3 A;  4FO5 A;  5IMF A;  2WVZ A;  5CP1 A;  4G19 A;  1OAZ A;  1YVL A;  2F51 A;  3WT1 A;  4PUA A;  4XS4 A;  1M9B A;  4WET A;  1AUC A;  1I1I P;  1XCC A;  1SKS B;  3VFI A;  3GV1 A;  3UJ1 A;  3K8N A;  4FH8 A;  2HNL A;  3GTU B;  4J2F A;  3VPQ A;  1M3I A;  2ALB A;  1T1V A;  2VUP A;  2DIZ A;  1PL2 A;  2C1Y A;  2WZ9 A;  1LJR A;  2H6Y A;  2PVO C;  3IOS A;  3LXZ A;  3F3R A;  1PD2 1;  5J40 A;  3IC8 A;  3LQ7 A;  5BMU B;  3HHV A;  5FWG A;  4I6X A;  1A8L A;  3ZFL A;  2H76 A;  3CXG A;  3EUR A;  1FG4 A;  5IPG A;  1AQW A;  2NBS A;  1SKR B;  1GSD A;  4EDZ A;  2A2P A;  2YWM A;  2HZE B;  1EGR A;  1NW2 A;  1TRW A;  3GIX A;  4EUY A;  4PGT A;  4GXZ A;  4GSS A;  4KF9 A;  4PXO A;  2P31 A;  3GST A;  17GS A;  4KGI A;  3CRU A;  4G10 A;  2FHE A;  5DAK B;  2YPM A;  2MMZ A;  4BL7 A;  1A2L A;  3G7I A;  2VLV A;  4ML1 A;  1WMJ A;  5D73 A;  1EOG A;  1OC9 B;  4D73 A;  5D8I A;  1M3J A;  1XFL A;  3LJR A;  4ECI A;  4KSM A;  2NTO A;  1PX7 A;  5IMD A;  3FZA A;  5J4U A;  2BMX A;  5CNW A;  5DCG A;  5G2Z A;  2B1L A;  2LKU A;  2C4J A;  3EIN A;  1KEB A;  4PX1 A;  1QFN A;  1VGL A;  10GS A;  1G0T A;  4ZB6 A;  3KMO A;  2CVD A;  5G1K A;  3MDK A;  2H73 A;  1X5C A;  2LTK A;  1KNG A;  3APQ A;  2ZUP A;  5ABR A;  4Z2T A;  1T4Z A;  3KEB A;  5E4W A;  1OC8 A;  1GUH A;  2HRK A;  1TJD A;  3RPN A;  2KUC A;  1S4B P;  4I2U A;  5JCW A;  3SWL A;  3IE3 A;  5IMC A;  2X64 A;  1DSB A;  3GX8 A;  4FYB A;  1X5E A;  4HS1 A;  3HDC A;  1PL1 A;  1MEK A;  1U3I A;  2DJ2 A;  1BAY A;  2G2Q A;  2AJQ B;  1B9Y C;  4PNF A;  2HT9 A;  3EC3 A;  3DYR A;  1EGO A;  1V40 A;  1OC3 A;  1F3B A;  3C73 A;  4J57 E;  4HOJ A;  3KZQ A;  3TGZ A;  1SJ6 A;  1BG1 A;  1K0O A;  1QGV A;  2KHP A;  5LCZ A;  3M3M A;  1GUK A;  1DBY A;  1O7U A;  1RQM A;  3QAW A;  3TU3 B;  2H01 A;  2B5X A;  4ECC A;  2GQK A;  4O5R A;  2LS5 A;  2FCH A;  1XBS A;  1S3C A;  4GF0 A;  1X5D A;  2C8U A;  2R5G A;  2A4V A;  1GTI A;  4L8E A;  4DSS B;  2GT6 A;  3FR6 A;  1TRU A;  2CA8 A;  3UVH A;  4POB A;  1FW1 A;  3ZYW A;  3D4M A;  2DIY A;  2LRN A;  1MDI A;  3D6I A;  1GSE A;  1Z5Y E;  2WGR A;  4KND A;  1PFO A;  3GN3 A;  1SD9 A;  5ECK B;  4EXJ A;  1PGT A;  2HE3 A;  3RPP A;  1K3Y A;  4I97 A;  4IJI A;  2EFC A;  5D9W A;  4TRX A;  2WJU A;  4F0C A;  2GZZ A;  2MMO A;  2BTO T;  4IP6 A;  2CQ9 A;  4K7I A;  2FWG A;  4Q5R A;  4OCE A;  2H1D A;  5KEJ A;  4TR0 A;  1ZGN A;  4GSN A;  1XOA A;  4CY6 A;  2JZR A;  3IRA A;  3LYP A;  2R3X A;  19GS A;  1MDK A;  1N2A A;  5GAN D;  2C0D A;  4EE0 A;  1YQ1 A;  3CSI A;  1H75 A;  3R2Q A;  3ZTL A;  5H5Q A;  3P90 A;  5D9T A;  1T7P B;  1B48 A;  5ECQ B;  4TXV A;  2K8V A;  3LG6 A;  5D93 A;  4AF2 A;  4ZL8 A;  5J9B A;  5AIV A;  4KCE A;  4XHM A;  2H30 A;  2A2R A;  1GTB A;  1I5G A;  1KTE A;  3PR8 A;  5G30 A;  3M8N A;  2L4Q A;  5A4U A;  3HVS A;  4EC0 A;  1Z6N A;  3O6T A;  2FA8 A;  2RLI A;  3TCO A;  4AJ8 A;  3VWV A;  2DBC A;  1S3A A;  3FKF A;  4O5U A;  2HSN A;  1U88 A;  3FK8 A;  5G1L A;  2CAI A;  2C3T A;  4AKX B;  1CQG A;  1XWK A;  3FZ5 A;  3CYN A;  5ECO B;  2JU5 A;  2BJX A;  4MPF A;  2FGX A;  1SL1 B;  1GRX A;  3ZIJ A;  3QOU A;  1THX A;  2EFH A;  1U6T A;  3CSJ A;  4MH3 A;  1Y25 A;  1PN9 A;  1HQO A;  4NPB A;  1U3A A;  4FQU A;  1PN0 A;  2O7K A;  1GWC A;  1EP7 A;  2R6K A;  3LWA A;  5HR3 A;  4I5Q A;  2C0G A;  2I4A A;  1YEP A;  1NM3 A;  5B6M A;  13GS A;  1GLP A;  4YH2 A;  3TDG A;  4OFN A;  1GSS A;  5EVO A;  2MYG A;  3IXR A;  3CBU A;  3TKR A;  4DSR A;  4PQI A;  4F0B A;  3LYK A;  2RUE A;  3HYP A;  3UVT A;  2NVL A;  2VL2 C;  3QR6 A;  4YAV A;  1TXX A;  3GNJ A;  2JZS A;  4ISD A;  3KIJ A;  5ID2 B;  4FYU A;  2CT6 A;  4Z2U A;  2F3M A;  1WE0 A;  3F0I A;  4WXT A;  2DC5 A;  3D4T A;  5DBQ A;  1MD4 A;  1R4W A;  5C00 A;  5JCG A;  3BJ5 A;  2QSI A;  4K1F A;  3APO A;  2EFD A;  3BBY A;  2R37 A;  4NV2 A;  1ABA A;  3F3Q A;  4EO3 A;  3QAG A;  4CHS A;  2FUG 2;  5JWQ B;  3LXT A;  4ACS A;  1AIU A;  2L57 A;  4AI6 A;  3GFK A;  5IMA A;  5IQY A;  4G2E A;  3GH6 A;  3DML A;  4MF7 A;  2GQL A;  5JWR B;  1K0N A;  4HQS A;  4RI6 A;  2FWE A;  1TU8 A;  4AGS A;  1SK1 A;  1JHB A;  4QL9 A;  1XVW A;  4Q5F A;  2GSR A;  2OJL A;  5IM9 A;  1Z9H A;  4LLR A;  3FZ9 A;  4OO4 A;  1YEX A;  4PHZ C;  3W8J A;  2PMT A;  3Q18 A;  1TTZ A;  1A0F A;  4G0I A;  1E2Y A;  2LJR A;  2H66 A;  4K7O A;  2CV4 A;  4IQA A;  4L5O A;  4ILF A;  5ECN B;  1J9B A;  2FA4 A;  3TJB A;  4ZB7 A;  2WW0 A;  4HUA A;  2WW3 A;  5HR0 A;  6GSV A;  3UMA A;  1GUM A;  5CAX A;  1FHE A;  3C1S A;  4XS4 B;  2B6M A;  1BF5 A;  2MZC A;  4XRA A;  4MP4 A;  5A5H A;  3NIV A;  1R26 A;  4OFM A;  4MNN A;  1JFU A;  4PI0 C;  2HYX A;  4O32 A;  3FHK A;  3VLN A;  1EOH A;  18GS A;  4MJA A;  4PI2 C;  1IYI A;  2RM5 A;  3EVI A;  1LBK A;  1V9W A;  3HVV A;  3DGQ A;  3CRT A;  4F82 A;  1GSY A;  4YKF A;  4EIP A;  1UA5 A;  4MZB A;  2HSM B;  4LMW A;  5FT3 A;  1S3D A;  2EC4 A;  3GL3 A;  4ZIJ A;  2IMD A;  6GSX A;  3Q19 A;  3EPT A;  2DLX A;  3G7Y A;  4DEJ A;  1ILO A;  3F4T A;  2AV4 A;  2GSS A;  4E8E A;  3EMX A;  4MF5 A;  4L0W A;  2WW2 A;  4PQH A;  4KA0 A;  4ECB A;  2E0Q A;  4RQX A;  2LUS A;  2L6C A;  2WVY A;  1OVN A;  1CQH A;  2OA7 A;  2O5V A;  1SK0 A;  3U5R E;  1JLW A;  3FEU A;  2F8A A;  1UC7 A;  4IGJ A;  3H1N A;  4WF4 A;  6GSW A;  3ZVJ A;  1O8X A;  2E2M A;  3NZN A;  1VF3 A;  1AXD A;  4LL1 B;  3US3 A;  3VK9 A;  4ZBA A;  3QD9 A;  2E7P A;  2VCQ A;  3L9U A;  1PMT A;  2A4H A;  2VLU A;  4MDC A;  4HJ2 A;  4HZ4 A;  4GCI A;  3WGE A;  4ICY A;  1SK2 A;  3D22 A;  2JZT A;  3E3E A;  2VCZ A;  1ZYP A;  2D2Z A;  3TB2 A;  3VPT A;  5B6N A;  2HRK B;  1NHY A;  2O36 A;  2WRT A;  1ERV A;  3L4N A;  1HYU A;  1HD2 A;  1EV9 A;  4EL1 A;  3FRC A;  4MJC A;  5A1N A;  2OAD A;  1XW9 A;  4IKH A;  2LV3 A;  3AY8 A;  5IOW A;  2VKZ G;  4KDX A;  1SD8 A;  3ME8 A;  7GSS A;  2JAC A;  2AAW A;  2EIO A;  4ZB8 A;  1Z3E A;  4HSC X;  5INY A;  1RK4 A;  4BVY A;  1WRY A;  2P5Q A;  1SJI A;  4FIW A;  4ML6 A;  3M9J A;  5CRH A;  5DDL A;  2H74 A;  1G7E A;  4L0U A;  2ZNM A;  4TR4 A;  2C3Q A;  4KCA A;  2JAD A;  4XS6 A;  3HJM A;  2GT5 A;  4X1U A;  2CAQ A;  1SU9 A;  4BIK A;  1EZK A;  4NAX A;  1SVM A;  5ECI B;  4HEA 2;  1BJX A;  2LQO A;  2XBQ A;  3F4R A;  4YQU A;  2QA2 A;  1F3A A;  1JZR A;  2YOI A;  1YDK A;  3IK7 A;  2NPB A;  5J41 A;  4K0G A;  3GKM A;  1AC1 A;  4DSQ A;  4K8M A;  2HRA A;  1H4O A;  1TP9 A;  3HZ8 A;  3KTB A;  5CRG A;  1F9M A;  3M9K A;  2V2G A;  2DJ3 A;  3D21 A;  2B3S A;  2R0P A;  3DVX A;  2LNS A;  3IHQ A;  1SKW B;  4BVX A;  1BED A;  2V41 A;  2XHF A;  3CSH A;  3GTU A;  4KUN A;  2H19 A;  2OBI A;  3VWX A;  1RW1 A;  3IR4 A;  4OCF A;  4HDE A;  2KLX A;  3MNG A;  5ECR B;  2VM1 A;  1QQ2 A;  3HA9 A;  2EIR A;  5BMU A;  16GS A;  1XIY A;  2DKH A;  3RHC A;  4KX4 A;  3HVX A;  3UAP A;  5JCU A;  1N25 A;  2XPD A;  1E6B A;  2UV8 G;  4LMV A;  3ZVJ D;  2AB6 A;  1QK8 A;  1GSQ A;  1GP1 A;  4JBB A;  1TW9 A;  2L5L A;  5GZZ B;  2PER A;  2MMN A;  3TRP A;  4V1A p;  5D9X A;  1S3R A;  3RBT A;  2KOK A;  5DAK A;  4OD7 A;  2H1L A;  1YKA A;  3UBL A;  4TXO B;  2H71 A;  2VCV A;  4MAB A;  2OE1 A;  3C71 A;  3E0U A;  2HRF A;  1K0M A;  5C04 A;  1QMV A;  5AGY A;  4MF6 A;  3QDN A;  4MJE A;  2DJK A;  3GX0 A;  3KMN A;  1T00 A;  2GDR A;  1OC9 A;  2HXK A;  2HZF A;  2V6O A;  2LJA A;  2N5B A;  2IWT A;  3DD3 A;  4TVE A;  1TI3 A;  2VLT A;  2DMM A;  2GSQ A;  4EKZ A;  3EU3 A;  4ZB9 A;  1WWJ A;  4ZL7 A;  2HFD A;  5BRT A;  5HR2 A;  3IK9 A;  2DML A;  2H72 A;  3VWU A;  5A34 A;  4E8H A;  2IFQ A;  5G31 A;  2HSN B;  3TRQ A;  2YWN A;  5DQY A;  2FY6 A;  5DJL A;  3WGX A;  2L4C A;  5GSS A;  4AKG A;  1YKC A;  4AJ6 A;  3V1W A;  1JZO A;  4AJ7 A;  2VAF A;  2RUF A;  1GNW A;  4N10 A;  3TKP A;  5HFI A;  1GSU A;  1J0F A;  4XCS A;  3HD5 A;  5IMZ A;  3H4K A;  3MIX A;  3IV4 A;  4HJM A;  4POM A;  1PKZ A;  1V57 A;  2OE0 A;  2IMK A;  4TR1 B;  3KP9 A;  4MA9 A;  2DJJ A;  5B8A A;  1M9A A;  3D0Z A;  2B5E A;  3ERG A;  2WW1 A;  1PRX A;  5J4Y A;  4IN0 A;  4WBR D;  4RQR A;  3QCP A;  3KTL A;  1O73 A;  1XWA A;  3CMI A;  5G5F A;  1K0C A;  1N8J A;  3G7J A;  11GS A;  4K9Z A;  1USB A;  1O81 A;  5H5S A;  4IVF A;  3A5I A;  2WVX B;  3A3T A;  2YCD A;  4HQZ A;  3W8S A;  4YKG A;  2IJY A;  1T8E B;  2ZCT A;  4DSS A;  4A5P A;  3KP8 A;  1OKD A;  1PX6 A;  2TRC P;  3F6D A;  3GA4 A;  1URM A;  4PUF C;  4ZL9 A;  5ECS A;  3UL3 A;  1ZMA A;  2O3E A;  1SVO A;  2VM2 A;  3S9F A;  2YAN A;  5J5N A;  3HJP A;  4BPY A;  5IO2 A;  2IMF A;  3J7Y b;  4G0L A;  5IO0 A;  3VUR A;  1M7T A;  5H5R A;  2NDO A;  3PIN A;  2IPA A;  5B8B A;  1YY7 A;  2H1B A;  4N30 A;  3GRX A;  3H8Q A;  3LW9 A;  4WEY A;  1K3O A;  4W66 A;  4LL4 B;  3O76 A;  6GST A;  2VOC A;  5CRE A;  1TU7 A;  1VF4 A;  4QQ7 A;  3Q74 A;  4CY8 A;  5A5K A;  5IOX A;  3F63 A;  5IIZ A;  3RFR C;  1NHO A;  3C1R A;  4XRD A;  1TRV A;  3H93 A;  3ZL5 A;  3TRX A;  4L5L A;  2LQQ A;  2V32 A;  2KP1 A;  1XPV A;  4K2X A;  3KD0 A;  4I8B A;  5IPH A;  2IIY A;  2PVQ A;  4NV5 A;  3ZRE A;  2VCX A;  8GSS A;  4LA1 A;  4JU5 A;  1A23 A;  3QPM A;  4TR3 A;  4XIH A;  4ULX A;  1GL8 A;  1F37 A;  5DAL A;  4MH2 A;  3N5O A;  3IBH A;  1TOF A;  3BD2 A;  5HFK A;  4K7N A;  5J3R A;  5AIS A;  3DRN A;  1M2D A;  4NWY A;  1W89 A;  3G9B A;  3GSS A;  2WDU A;  3NOF A;  1Z7R A;  1M2B A;  2FWH A;  4F03 A;  2K6V A;  5DQS A;  1XXU A;  3KH9 A;  2CVK A;  3LEF A;  4K5R A;  1G6W A;  3IPZ A;  3PGT A;  4HU9 A;  1UN2 A;  2YNX A;  5CYY A;  2F9S A;  3IA1 A;  4IS0 A;  3A5W A;  4JE1 A;  4O7H A;  3A2X A;  2L5O A;  4ZBD A;  2OAC A;  3EYT A;  3KGK A;  3TOT A;  3GUR A;  2GGT A;  2Z9S A;  2VCW A;  5CRD A;  1B9X C;  1G7O A;  4G0K A;  2B5Y A;  2YN1 A;  4KAE A;  1ST9 A;  2GQM A;  3TJG A;  1ZL9 A;  1NSW A;  2YZU A;  3UIW A;  2DSA A;  1Y1U A;  1VRS D;  5E59 A;  3ZIT A;  1GLQ A;  1YEW C;  1FB6 A;  3UBK A;  5EPF A;  5F06 A;  1A8Y A;  4G9H A;  4NMU A;  2N5A A;  3C7M A;  1EEM A;  2VD1 A;  2X8C A;  4JZQ A;  2KP2 A;  4KH7 A;  2TRX A;  2H0G A;  1XOB A;  3HJO A;  5J47 A;  4OFT A;  4K5S A;  3LGC A;  1K0B A;  2J9H A;  3R3E A;  2YWO A;  3KJY A;  1WIK A;  3LOR A;  3ZZX A;  1FAA A;  3J7Y k;  4K2D A;  2C80 A;  4BWQ A;  4CDO A;  4N3Z A;  5A1N B;  4FYC A;  4V2M A;  1SEN A;  2DJ1 A;  1PQN A;  4MLY A;  1HNA A;  1PKW A;  4MZC A;  4ID0 A;  3TKS E;  3WT2 A;  2H0I A;  4MJB A;  1XWB A;  2WCI A;  2YWI A;  3TUE A;  4HI7 A;  5ECH B;  3IHG A;  1X9W B;  4OWY A;  4QL7 A;  5EL8 A;  3F4S A;  2QA1 A;  3FR3 A;  3P2A A;  4BVY B;  4BL7 B;  5J9C A;  1O85 A;  2M80 A;  1ERT A;  4EF0 A;  1Q98 A;  5G5E A;  2PU9 C;  1EV4 A;  1GSF A;  2VD0 A;  1EEJ A;  5KN3 A;  3UEM A;  4D73 B;  1WPI A;  4JR6 A;  4G01 A;  2LNT A;  1ACV A;  2K9F A;  1SJZ A;  2GZP A;  2O87 A;  3RGB C;  5F8B A;  4DVC A;  2R0C A;  2V1M A;  2YJH A;  2CX4 A;  2ON5 A;  2I9H A;  9GSS A;  2WUL A;  3RHB A;  4WBJ A;  5ENU A;  2VL9 A;  3PPU A;  1R5A A;  1XWC A;  3IC4 A;  4YQM A;  1XW5 A;  1U87 A;  4WF5 A;  4KB3 A;  4IQ1 A;  1YZX A;  4TW5 A;  2YZH A;  4BVX B;  5ELA A;  2PGT A;  2B7J A;  2LST A;  3LSZ A;  1V58 A;  1WP0 A;  1SL0 B;  2ES7 A;  2C0E A;  1SYX A;  4GDF A;  3W6G A;  2R0G A;  2IN3 A;  1LU4 A;  2JSY A;  5IMV A;  2OBK A;  3ZMK A;  2HSM A;  1ERU A;  2WFC A;  4IHU A;  2WS2 A;  5LNK e;  1T4Y A;  3M1G A;  4KE3 A;  1JLV A;  4IW9 A;  3DWV A;  4MZW A;  2WB9 A;  3GUS A;  2H70 A;  3E9J B;  2H0H A;  1DE2 A;  2GST A;  2A2S A;  2XC2 A;  3L0H A;  4JED A;  1AW9 A;  3UAR A;  3I6A A;  4QMK A;  3QMX A;  2MBT A;  4Z2R A;  1B4P A;  1Z7P A;  2R2J A;  1YJ6 A;  4RI7 A;  4N0Z A;  1OE8 A;  3ZFB A;  2VIM A;  1O8W A;  3U6V A;  1O6J A;  1M2A A;  2AYT A;  4EIQ A;  1JZD A;  2JSZ A;  4WR5 A;  1WJK A;  2X8G A;  1FOV A;  2CX3 A;  1R7H A;  3L9S A;  4EVM A;  3HKR A;  3I9V 2;  1DUG A;  1PSQ A;  3C8E A;  1SYR A;  1BX9 A;  1QUW A;  4PUR A;  3GL5 A;  5KOW A;  3ZIV A;  1TK8 B;  4E68 A;  2GS3 A;  5F05 A;  1ZYE A;  2X49 A;  1TI1 A;  2REM A;  1A0R P;  5A34 B;  2HSY A;  4Q5Q A;  4USS A;  2PWJ A;  1BYE A;  3MAK A;  2IFQ B;  2VL3 A;  4H86 A;  3VI5 A;  4O92 A;  4NXI A;  4AKI A;  2QC7 A;  5AIX A;  2TIR A;  4K0N A;  1XVQ A;  3HXS A;  5DVB A;  4TOP A;  5ECP B;  2I1U A;  4EDY A;  1THO A;  3N9J A;  4IEL A;  2FLS A;  2HI7 A;  1ZCP A;  1R5P A;  2H1A A;  5A4V A;  2HZE A;  2VCT A;  3IAM 2;  2X4A A;  3DXB A;  3GKX A;  3QFA C;  2X99 A;  3JCM L;  4O5Q A;  1XWG A;  1K3L A;  2RM6 A;  4POK A;  2P0G A;  3P7X A;  3CTG A;  4JR4 A;  3UOM A;  4MCU A;  2YJ7 A;  3DEX A;  1IYH A;  3SBC A;  1X0R A;  2AHE A;  3MWH A;  4GLT A;  2AUV A;  3KCM A;  3EMP A;  5COH A;  1A2J A;  3BOA A;  5ECM B;  4PNG A;  2YP6 A;  5KN1 A;  1EP8 A;  5B7C A;  4PTS A;  2XPE A;  2OE3 A;  3GH9 A;  1A24 A;  5HQP A;  3APS A;  4V2N A;  4WR4 A;  1V98 A;  1TK0 B;  4JRR A;  4XS1 A;  4X43 A;  1Z6M A;  2GLR A;  5KN2 A;  1OKT A;  4IJ3 A;  4MK3 A;  5EY6 A;  2WZS A;  5KN0 A;  2LRT A;  6GSY A;  2I3Y A;  3ZML A;  2G0F A;  1A2M A;  4GQC A;  1TRS A;  1J08 A;  4GTU A;  1Q4J A;  2I81 A;  4HU7 A;  1OYJ A;  2HRN A;  3MYD A;  4TN8 A;  3WGD A;  1X9M B;  1ZZY A;  3HCZ A;  4X4J A;  1ZYN A;  3TKS C;  4MMM A;  3OR5 A;  2XBI A;  3FR9 A;  4HZ2 A;  1FVJ A;  2LRC A;  3KM6 A;  3FY7 A;  4IP1 A;  2B7K A;  3ERF A;  20GS A;  1ZOF A;  1B4Q A;  1MTC A;  4TKY A;  3BCK A;  1TKD B;  4BWS A;  4GQF A;  2VO4 A;  1TK5 B;  5D9V A;  1BQ7 A;  1XG8 A;  5HR1 A;  4TXO A;  2PUK C;  1FB0 A;  2H8L A;  4BA7 A;  3FYG A;  2PBJ A;  3RAZ A;  1BG5 A;  1QXH A;  1UVZ A;  2J23 A;  2YV9 A;  5L71 A;  2DJ0 A;  1C72 A;  4OO5 A;  3TJF A;  3GKK A;  3CHX C;  4J56 E;  5DAL B;  5CO3 A;  5J4V A;  1FVK A;  1EWX A;  2H6Z A;  2FWF A;  1AQV A;  2RII A;  4OMV A;  1GUL A;  2CZ2 A;  2PPT A;  2H1G A;  4GRF A;  3ED3 A;  2O8V B;  4V1A g;  3A2W A;  4AKH A;  5ELG A;  3WYW A;  2LJK A;  4ZIL A;  1VF1 A;  3GKN A;  3BCI A;  3F8U A;  5ECL B;  2K18 A;  1GNE A;  2X8H A;  5FHI A;  3Q6O A;  4Q5N A;  2HQT A;  2FD3 A;  5HFG A;  1XZO A;  1OE7 A;  4YAP A;  4N11 A;  1PA3 A;  4V2L A;  1YF1 A;  3ERW A;  4RUV A;  2YV7 A;  4IBP A;  3TJJ A;  2M46 A;  1TDI A;  2IME A;  2ON7 A;  3EU4 A;  3TKS A;  4TR1 A;  2P5R A;  2CVB A;  2OKA A;  4CW9 A;  1G6Y A;  2HSH A;  5A5H B;  1SVL A;  3MSZ A;  4ZBB A;  3CQF A;  4Z7X A;  3ISO A;  4WKW A;  3KXO A;  2WVX A;  1GTA A;  3TKQ A;  3L78 A;  1ML6 A;  1VF2 A;  3VWW A;  3I69 A;  1K0D A;  2B1K A;  4NHZ A;  2FNO A;  3DIE A;  4MPG A;  5DJM A;  2L59 A;  1MDJ A;  3HMJ G;  1JZW A;  4GWR A;  1YF0 A;  3PH9 A;  5AN1 A;  1V2A A;  2HLS A;  2QKE A;  1TXU A;  3DKS A;  6GSU A;  2EFE A;  1B8X A;  4F2I A;  2GZY A;  2R4V A;  1X9S B;  3GMF A;  3O3T A;  1SL2 B;  4ZXG A;  2O85 A;  2JL4 A;  2EIQ A;  4FXY P;  3HY2 A;  5GAP D;  3CTF A;  1DE1 A;  1XW6 A;  1AQX A;  3FZ4 A;  3GHA A;  4KW6 A;  4P3Y B;  2L6D A;  4K6X A;  4N0V A;  5F0G A;  1GTU A; 
#chains in the Genus database with same CATH homology
 2E2G A;  5A4W A;  2GVP A;  1HNC A;  4F9Z A;  3H79 A;  3LFL A;  1ZYQ B;  2DKI A;  1F2E A;  12GS A;  3HZ4 A;  3I43 A;  1AAZ A;  4GST A;  5D96 A;  5ID2 A;  2H75 A;  2O89 A;  1GH2 A;  3ZRD A;  5LD0 A;  2H6X A;  1MD3 A;  1I9D A;  3RDW A;  4KSO A;  3A2V A;  4XTS A;  3TOU A;  2MMA A;  2PN8 A;  3GYK A;  5GST A;  2V6K A;  3EWL A;  3ME7 A;  3F9U A;  2VL2 A;  2C3N A;  1Y6E A;  1WOU A;  4PQ1 A;  1M0U A;  2C0F A;  3DVW A;  3IAS 2;  3QFB C;  2OT3 A;  3TJK A;  22GS A;  2IMI A;  3F6F A;  2GTU A;  3FW2 A;  3ZLP A;  3FMW A;  1KBN A;  2MBS A;  1FOH A;  2LEG A;  14GS A;  5DCH A;  3KH7 A;  4I2T A;  4KDY A;  4NHW A;  5KOX A;  3IDV A;  3EE2 A;  3L9V A;  2N5F A;  2F8F A;  2QGV A;  3M0F A;  1K0A A;  5JWO B;  1ON4 A;  2M72 A;  1HNB A;  3D5J A;  1W4V A;  1M99 A;  4KDU A;  3VI7 A;  3WD6 A;  4YQV A;  5CRW A;  4POL A;  4X0X A;  2K8S A;  6GSS A;  5F07 A;  1FO5 A;  1F6M C;  4ECJ A;  3P8W A;  3CWG A;  2CZ3 A;  2UZ8 A;  3QAV A;  1ERW A;  1T3B A;  2IL3 A;  4FO5 A;  5IMF A;  5CP1 A;  4G19 A;  1OAZ A;  1YVL A;  2F51 A;  3WT1 A;  4PUA A;  4XS4 A;  1M9B A;  4WET A;  1AUC A;  1XCC A;  1SKS B;  3VFI A;  3GV1 A;  3UJ1 A;  3K8N A;  4FH8 A;  2HNL A;  3GTU B;  4J2F A;  3VPQ A;  2ALB A;  1T1V A;  2VUP A;  2DIZ A;  1PL2 A;  2C1Y A;  2WZ9 A;  1LJR A;  2H6Y A;  2PVO C;  3IOS A;  3LXZ A;  3F3R A;  1PD2 1;  5J40 A;  3IC8 A;  3LQ7 A;  5BMU B;  3HHV A;  5FWG A;  4I6X A;  1A8L A;  3ZFL A;  2H76 A;  3CXG A;  3EUR A;  1FG4 A;  5IPG A;  1AQW A;  2NBS A;  1SKR B;  1GSD A;  4EDZ A;  2A2P A;  2YWM A;  2HZE B;  1EGR A;  1NW2 A;  1TRW A;  3GIX A;  4EUY A;  4PGT A;  4GXZ A;  4GSS A;  4KF9 A;  4PXO A;  2P31 A;  3GST A;  17GS A;  4KGI A;  3CRU A;  4G10 A;  2FHE A;  5DAK B;  2YPM A;  2MMZ A;  4BL7 A;  1A2L A;  3G7I A;  2VLV A;  4ML1 A;  1WMJ A;  5D73 A;  1EOG A;  1OC9 B;  4D73 A;  5D8I A;  1XFL A;  3LJR A;  4ECI A;  4KSM A;  2NTO A;  1PX7 A;  5IMD A;  3FZA A;  5J4U A;  2BMX A;  5CNW A;  5DCG A;  5G2Z A;  2B1L A;  2LKU A;  2C4J A;  3EIN A;  1KEB A;  4PX1 A;  1QFN A;  1VGL A;  10GS A;  1G0T A;  4ZB6 A;  3KMO A;  2CVD A;  5G1K A;  3MDK A;  2H73 A;  1X5C A;  2LTK A;  1KNG A;  3APQ A;  2ZUP A;  5ABR A;  4Z2T A;  1T4Z A;  3KEB A;  5E4W A;  1OC8 A;  1GUH A;  2HRK A;  1TJD A;  3RPN A;  2KUC A;  4I2U A;  5JCW A;  3SWL A;  3IE3 A;  5IMC A;  2X64 A;  1DSB A;  3GX8 A;  4FYB A;  1X5E A;  4HS1 A;  3HDC A;  1PL1 A;  1MEK A;  1U3I A;  2DJ2 A;  1BAY A;  2G2Q A;  2AJQ B;  1B9Y C;  4PNF A;  2HT9 A;  3EC3 A;  3DYR A;  1EGO A;  1V40 A;  1OC3 A;  1F3B A;  3C73 A;  4J57 E;  4HOJ A;  3KZQ A;  3TGZ A;  1SJ6 A;  1BG1 A;  1K0O A;  1QGV A;  2KHP A;  5LCZ A;  3M3M A;  1GUK A;  1DBY A;  1O7U A;  1RQM A;  3QAW A;  3TU3 B;  2H01 A;  2B5X A;  4ECC A;  2GQK A;  4O5R A;  2LS5 A;  2FCH A;  1XBS A;  1S3C A;  4GF0 A;  1X5D A;  2C8U A;  2R5G A;  2A4V A;  1GTI A;  4L8E A;  4DSS B;  2GT6 A;  3FR6 A;  1TRU A;  2CA8 A;  3UVH A;  4POB A;  1FW1 A;  3ZYW A;  3D4M A;  2DIY A;  2LRN A;  1MDI A;  3D6I A;  1GSE A;  1Z5Y E;  2WGR A;  4KND A;  3GN3 A;  1SD9 A;  5ECK B;  4EXJ A;  1PGT A;  2HE3 A;  3RPP A;  1K3Y A;  4I97 A;  4IJI A;  2EFC A;  5D9W A;  4TRX A;  2WJU A;  4F0C A;  2GZZ A;  2MMO A;  2BTO T;  4IP6 A;  2CQ9 A;  4K7I A;  2FWG A;  4Q5R A;  4OCE A;  2H1D A;  5KEJ A;  4TR0 A;  1ZGN A;  4GSN A;  1XOA A;  4CY6 A;  2JZR A;  3IRA A;  3LYP A;  2R3X A;  19GS A;  1MDK A;  1N2A A;  5GAN D;  2C0D A;  4EE0 A;  1YQ1 A;  3CSI A;  1H75 A;  3R2Q A;  3ZTL A;  5H5Q A;  3P90 A;  5D9T A;  1T7P B;  1B48 A;  5ECQ B;  4TXV A;  2K8V A;  3LG6 A;  5D93 A;  4AF2 A;  4ZL8 A;  5J9B A;  5AIV A;  4KCE A;  4XHM A;  2H30 A;  2A2R A;  1GTB A;  1I5G A;  1KTE A;  3PR8 A;  5G30 A;  3M8N A;  2L4Q A;  5A4U A;  3HVS A;  4EC0 A;  1Z6N A;  3O6T A;  2FA8 A;  2RLI A;  3TCO A;  4AJ8 A;  3VWV A;  2DBC A;  1S3A A;  3FKF A;  4O5U A;  2HSN A;  1U88 A;  3FK8 A;  5G1L A;  2CAI A;  2C3T A;  4AKX B;  1CQG A;  1XWK A;  3FZ5 A;  3CYN A;  5ECO B;  2JU5 A;  2BJX A;  4MPF A;  2FGX A;  1SL1 B;  1GRX A;  3ZIJ A;  3QOU A;  1THX A;  2EFH A;  1U6T A;  3CSJ A;  4MH3 A;  1Y25 A;  1PN9 A;  1HQO A;  4NPB A;  1U3A A;  4FQU A;  1PN0 A;  2O7K A;  1GWC A;  1EP7 A;  2R6K A;  3LWA A;  5HR3 A;  4I5Q A;  2C0G A;  2I4A A;  1YEP A;  1NM3 A;  5B6M A;  13GS A;  1GLP A;  4YH2 A;  3TDG A;  4OFN A;  1GSS A;  5EVO A;  2MYG A;  3IXR A;  3CBU A;  3TKR A;  4DSR A;  4PQI A;  4F0B A;  3LYK A;  2RUE A;  3HYP A;  3UVT A;  2NVL A;  2VL2 C;  3QR6 A;  4YAV A;  1TXX A;  3GNJ A;  2JZS A;  4ISD A;  3KIJ A;  5ID2 B;  4FYU A;  2CT6 A;  4Z2U A;  2F3M A;  1WE0 A;  3F0I A;  4WXT A;  2DC5 A;  3D4T A;  5DBQ A;  1MD4 A;  1R4W A;  5C00 A;  5JCG A;  3BJ5 A;  2QSI A;  4K1F A;  3APO A;  2EFD A;  3BBY A;  2R37 A;  4NV2 A;  1ABA A;  3F3Q A;  4EO3 A;  3QAG A;  4CHS A;  2FUG 2;  5JWQ B;  3LXT A;  4ACS A;  1AIU A;  2L57 A;  4AI6 A;  3GFK A;  5IMA A;  5IQY A;  4G2E A;  3GH6 A;  3DML A;  4MF7 A;  2GQL A;  5JWR B;  1K0N A;  4HQS A;  4RI6 A;  2FWE A;  1TU8 A;  4AGS A;  1SK1 A;  1JHB A;  4QL9 A;  1XVW A;  4Q5F A;  2GSR A;  2OJL A;  5IM9 A;  1Z9H A;  4LLR A;  3FZ9 A;  4OO4 A;  1YEX A;  3W8J A;  2PMT A;  3Q18 A;  1TTZ A;  1A0F A;  4G0I A;  1E2Y A;  2LJR A;  2H66 A;  4K7O A;  2CV4 A;  4IQA A;  4L5O A;  4ILF A;  5ECN B;  1J9B A;  2FA4 A;  3TJB A;  4ZB7 A;  4HUA A;  5HR0 A;  6GSV A;  3UMA A;  1GUM A;  5CAX A;  1FHE A;  3C1S A;  4XS4 B;  2B6M A;  1BF5 A;  2MZC A;  4XRA A;  4MP4 A;  5A5H A;  3NIV A;  1R26 A;  4OFM A;  4MNN A;  1JFU A;  2HYX A;  4O32 A;  3FHK A;  3VLN A;  1EOH A;  18GS A;  4MJA A;  1IYI A;  2RM5 A;  3EVI A;  1LBK A;  1V9W A;  3HVV A;  3DGQ A;  3CRT A;  4F82 A;  1GSY A;  4YKF A;  4EIP A;  1UA5 A;  4MZB A;  2HSM B;  4LMW A;  5FT3 A;  1S3D A;  2EC4 A;  3GL3 A;  4ZIJ A;  2IMD A;  6GSX A;  3Q19 A;  3EPT A;  2DLX A;  3G7Y A;  4DEJ A;  1ILO A;  3F4T A;  2AV4 A;  2GSS A;  4E8E A;  3EMX A;  4MF5 A;  4L0W A;  4PQH A;  4KA0 A;  4ECB A;  2E0Q A;  4RQX A;  2LUS A;  2L6C A;  1OVN A;  1CQH A;  2OA7 A;  2O5V A;  1SK0 A;  3U5R E;  1JLW A;  3FEU A;  2F8A A;  1UC7 A;  4IGJ A;  3H1N A;  4WF4 A;  6GSW A;  3ZVJ A;  1O8X A;  2E2M A;  3NZN A;  1VF3 A;  1AXD A;  4LL1 B;  3US3 A;  3VK9 A;  4ZBA A;  3QD9 A;  2E7P A;  2VCQ A;  3L9U A;  1PMT A;  2A4H A;  2VLU A;  4MDC A;  4HJ2 A;  4HZ4 A;  4GCI A;  3WGE A;  4ICY A;  1SK2 A;  3D22 A;  2JZT A;  3E3E A;  2VCZ A;  1ZYP A;  2D2Z A;  3TB2 A;  3VPT A;  5B6N A;  2HRK B;  1NHY A;  2WRT A;  1ERV A;  3L4N A;  1HYU A;  1HD2 A;  1EV9 A;  4EL1 A;  3FRC A;  4MJC A;  5A1N A;  2OAD A;  1XW9 A;  4IKH A;  2LV3 A;  3AY8 A;  5IOW A;  2VKZ G;  4KDX A;  1SD8 A;  3ME8 A;  7GSS A;  2JAC A;  2AAW A;  2EIO A;  4ZB8 A;  1Z3E A;  5INY A;  1RK4 A;  4BVY A;  1WRY A;  2P5Q A;  1SJI A;  4FIW A;  4ML6 A;  3M9J A;  5CRH A;  5DDL A;  2H74 A;  1G7E A;  4L0U A;  2ZNM A;  4TR4 A;  2C3Q A;  4KCA A;  2JAD A;  4XS6 A;  3HJM A;  2GT5 A;  4X1U A;  2CAQ A;  1SU9 A;  1EZK A;  4NAX A;  1SVM A;  5ECI B;  4HEA 2;  1BJX A;  2LQO A;  2XBQ A;  3F4R A;  4YQU A;  2QA2 A;  1F3A A;  1JZR A;  2YOI A;  1YDK A;  3IK7 A;  2NPB A;  5J41 A;  4K0G A;  3GKM A;  1AC1 A;  4DSQ A;  4K8M A;  2HRA A;  1H4O A;  1TP9 A;  3HZ8 A;  3KTB A;  5CRG A;  1F9M A;  3M9K A;  2V2G A;  2DJ3 A;  3D21 A;  2B3S A;  2R0P A;  3DVX A;  2LNS A;  3IHQ A;  1SKW B;  4BVX A;  1BED A;  2V41 A;  2XHF A;  3CSH A;  3GTU A;  4KUN A;  2H19 A;  2OBI A;  3VWX A;  1RW1 A;  3IR4 A;  4OCF A;  4HDE A;  2KLX A;  3MNG A;  5ECR B;  2VM1 A;  1QQ2 A;  3HA9 A;  2EIR A;  5BMU A;  16GS A;  1XIY A;  2DKH A;  3RHC A;  4KX4 A;  3HVX A;  3UAP A;  5JCU A;  1N25 A;  2XPD A;  1E6B A;  2UV8 G;  4LMV A;  3ZVJ D;  2AB6 A;  1QK8 A;  1GSQ A;  1GP1 A;  4JBB A;  1TW9 A;  2L5L A;  5GZZ B;  2PER A;  2MMN A;  3TRP A;  4V1A p;  5D9X A;  3RBT A;  2KOK A;  5DAK A;  4OD7 A;  2H1L A;  1YKA A;  3UBL A;  4TXO B;  2H71 A;  2VCV A;  4MAB A;  2OE1 A;  3C71 A;  3E0U A;  2HRF A;  1K0M A;  5C04 A;  1QMV A;  5AGY A;  4MF6 A;  3QDN A;  4MJE A;  2DJK A;  3GX0 A;  3KMN A;  1T00 A;  2GDR A;  1OC9 A;  2HXK A;  2HZF A;  2V6O A;  2LJA A;  2N5B A;  2IWT A;  3DD3 A;  4TVE A;  1TI3 A;  2VLT A;  2DMM A;  2GSQ A;  4EKZ A;  3EU3 A;  4ZB9 A;  1WWJ A;  4ZL7 A;  2HFD A;  5BRT A;  5HR2 A;  3IK9 A;  2DML A;  2H72 A;  3VWU A;  5A34 A;  4E8H A;  2IFQ A;  5G31 A;  2HSN B;  3TRQ A;  2YWN A;  5DQY A;  2FY6 A;  5DJL A;  3WGX A;  2L4C A;  5GSS A;  4AKG A;  1YKC A;  4AJ6 A;  3V1W A;  1JZO A;  4AJ7 A;  2VAF A;  2RUF A;  1GNW A;  4N10 A;  3TKP A;  5HFI A;  1GSU A;  1J0F A;  4XCS A;  3HD5 A;  5IMZ A;  3H4K A;  3MIX A;  3IV4 A;  4HJM A;  4POM A;  1PKZ A;  1V57 A;  2OE0 A;  2IMK A;  4TR1 B;  3KP9 A;  4MA9 A;  2DJJ A;  5B8A A;  1M9A A;  3D0Z A;  2B5E A;  3ERG A;  1PRX A;  5J4Y A;  4IN0 A;  4WBR D;  4RQR A;  3QCP A;  3KTL A;  1O73 A;  1XWA A;  3CMI A;  5G5F A;  1K0C A;  1N8J A;  3G7J A;  11GS A;  4K9Z A;  1USB A;  1O81 A;  5H5S A;  4IVF A;  3A5I A;  3A3T A;  2YCD A;  4HQZ A;  3W8S A;  4YKG A;  2IJY A;  1T8E B;  2ZCT A;  4DSS A;  4A5P A;  3KP8 A;  1OKD A;  1PX6 A;  2TRC P;  3F6D A;  3GA4 A;  1URM A;  4PUF C;  4ZL9 A;  5ECS A;  3UL3 A;  1ZMA A;  1SVO A;  2VM2 A;  3S9F A;  2YAN A;  5J5N A;  3HJP A;  4BPY A;  5IO2 A;  2IMF A;  3J7Y b;  4G0L A;  5IO0 A;  3VUR A;  1M7T A;  5H5R A;  2NDO A;  3PIN A;  2IPA A;  5B8B A;  1YY7 A;  2H1B A;  4N30 A;  3GRX A;  3H8Q A;  3LW9 A;  4WEY A;  1K3O A;  4W66 A;  4LL4 B;  3O76 A;  6GST A;  2VOC A;  5CRE A;  1TU7 A;  1VF4 A;  4QQ7 A;  3Q74 A;  4CY8 A;  5A5K A;  5IOX A;  3F63 A;  5IIZ A;  1NHO A;  3C1R A;  4XRD A;  1TRV A;  3H93 A;  3ZL5 A;  3TRX A;  4L5L A;  2LQQ A;  2V32 A;  2KP1 A;  1XPV A;  4K2X A;  3KD0 A;  4I8B A;  5IPH A;  2IIY A;  2PVQ A;  4NV5 A;  3ZRE A;  2VCX A;  8GSS A;  4LA1 A;  4JU5 A;  1A23 A;  3QPM A;  4TR3 A;  4XIH A;  4ULX A;  1GL8 A;  1F37 A;  5DAL A;  4MH2 A;  3N5O A;  3IBH A;  1TOF A;  3BD2 A;  5HFK A;  4K7N A;  5J3R A;  5AIS A;  3DRN A;  1M2D A;  4NWY A;  1W89 A;  3G9B A;  3GSS A;  2WDU A;  3NOF A;  1Z7R A;  1M2B A;  2FWH A;  4F03 A;  2K6V A;  5DQS A;  1XXU A;  3KH9 A;  2CVK A;  3LEF A;  4K5R A;  1G6W A;  3IPZ A;  3PGT A;  4HU9 A;  1UN2 A;  2YNX A;  5CYY A;  2F9S A;  3IA1 A;  4IS0 A;  3A5W A;  4JE1 A;  4O7H A;  3A2X A;  2L5O A;  4ZBD A;  2OAC A;  3EYT A;  3KGK A;  3TOT A;  3GUR A;  2GGT A;  2Z9S A;  2VCW A;  5CRD A;  1B9X C;  1G7O A;  4G0K A;  2B5Y A;  2YN1 A;  4KAE A;  1ST9 A;  2GQM A;  3TJG A;  1ZL9 A;  1NSW A;  2YZU A;  3UIW A;  2DSA A;  1Y1U A;  1VRS D;  5E59 A;  3ZIT A;  1GLQ A;  1FB6 A;  3UBK A;  5EPF A;  5F06 A;  1A8Y A;  4G9H A;  4NMU A;  2N5A A;  3C7M A;  1EEM A;  2VD1 A;  2X8C A;  4JZQ A;  2KP2 A;  4KH7 A;  2TRX A;  2H0G A;  1XOB A;  3HJO A;  5J47 A;  4OFT A;  4K5S A;  3LGC A;  1K0B A;  2J9H A;  3R3E A;  2YWO A;  3KJY A;  1WIK A;  3LOR A;  3ZZX A;  1FAA A;  3J7Y k;  4K2D A;  2C80 A;  4BWQ A;  4CDO A;  4N3Z A;  5A1N B;  4FYC A;  4V2M A;  1SEN A;  2DJ1 A;  1PQN A;  4MLY A;  1HNA A;  1PKW A;  4MZC A;  4ID0 A;  3TKS E;  3WT2 A;  2H0I A;  4MJB A;  1XWB A;  2WCI A;  2YWI A;  3TUE A;  4HI7 A;  5ECH B;  3IHG A;  1X9W B;  4OWY A;  4QL7 A;  5EL8 A;  3F4S A;  2QA1 A;  3FR3 A;  3P2A A;  4BVY B;  4BL7 B;  5J9C A;  1O85 A;  2M80 A;  1ERT A;  4EF0 A;  1Q98 A;  5G5E A;  2PU9 C;  1EV4 A;  1GSF A;  2VD0 A;  1EEJ A;  5KN3 A;  3UEM A;  4D73 B;  1WPI A;  4JR6 A;  4G01 A;  2LNT A;  1ACV A;  2K9F A;  1SJZ A;  2GZP A;  2O87 A;  5F8B A;  4DVC A;  2R0C A;  2V1M A;  2YJH A;  2CX4 A;  2ON5 A;  2I9H A;  9GSS A;  2WUL A;  3RHB A;  4WBJ A;  5ENU A;  2VL9 A;  3PPU A;  1R5A A;  1XWC A;  3IC4 A;  4YQM A;  1XW5 A;  1U87 A;  4WF5 A;  4KB3 A;  4IQ1 A;  1YZX A;  4TW5 A;  2YZH A;  4BVX B;  5ELA A;  2PGT A;  2B7J A;  2LST A;  3LSZ A;  1V58 A;  1WP0 A;  1SL0 B;  2ES7 A;  2C0E A;  1SYX A;  4GDF A;  3W6G A;  2R0G A;  2IN3 A;  1LU4 A;  2JSY A;  5IMV A;  2OBK A;  3ZMK A;  2HSM A;  1ERU A;  2WFC A;  4IHU A;  2WS2 A;  5LNK e;  1T4Y A;  3M1G A;  4KE3 A;  1JLV A;  4IW9 A;  3DWV A;  4MZW A;  2WB9 A;  3GUS A;  2H70 A;  3E9J B;  2H0H A;  1DE2 A;  2GST A;  2A2S A;  2XC2 A;  3L0H A;  4JED A;  1AW9 A;  3UAR A;  3I6A A;  4QMK A;  3QMX A;  2MBT A;  4Z2R A;  1B4P A;  1Z7P A;  2R2J A;  1YJ6 A;  4RI7 A;  4N0Z A;  1OE8 A;  3ZFB A;  2VIM A;  1O8W A;  3U6V A;  1O6J A;  1M2A A;  2AYT A;  4EIQ A;  1JZD A;  2JSZ A;  4WR5 A;  1WJK A;  2X8G A;  1FOV A;  2CX3 A;  1R7H A;  3L9S A;  4EVM A;  3HKR A;  3I9V 2;  1DUG A;  1PSQ A;  3C8E A;  1SYR A;  1BX9 A;  1QUW A;  4PUR A;  3GL5 A;  5KOW A;  3ZIV A;  1TK8 B;  4E68 A;  2GS3 A;  5F05 A;  1ZYE A;  2X49 A;  1TI1 A;  2REM A;  1A0R P;  5A34 B;  2HSY A;  4Q5Q A;  4USS A;  2PWJ A;  1BYE A;  3MAK A;  2IFQ B;  2VL3 A;  4H86 A;  3VI5 A;  4O92 A;  4NXI A;  4AKI A;  2QC7 A;  5AIX A;  2TIR A;  4K0N A;  1XVQ A;  3HXS A;  5DVB A;  4TOP A;  5ECP B;  2I1U A;  4EDY A;  1THO A;  3N9J A;  4IEL A;  2FLS A;  2HI7 A;  1ZCP A;  1R5P A;  2H1A A;  5A4V A;  2HZE A;  2VCT A;  3IAM 2;  2X4A A;  3DXB A;  3GKX A;  3QFA C;  2X99 A;  3JCM L;  4O5Q A;  1XWG A;  1K3L A;  2RM6 A;  4POK A;  2P0G A;  3P7X A;  3CTG A;  4JR4 A;  3UOM A;  4MCU A;  2YJ7 A;  3DEX A;  1IYH A;  3SBC A;  1X0R A;  2AHE A;  3MWH A;  4GLT A;  2AUV A;  3KCM A;  3EMP A;  5COH A;  1A2J A;  3BOA A;  5ECM B;  4PNG A;  2YP6 A;  5KN1 A;  1EP8 A;  5B7C A;  4PTS A;  2XPE A;  2OE3 A;  3GH9 A;  1A24 A;  5HQP A;  3APS A;  4V2N A;  4WR4 A;  1V98 A;  1TK0 B;  4JRR A;  4XS1 A;  4X43 A;  1Z6M A;  2GLR A;  5KN2 A;  1OKT A;  4IJ3 A;  4MK3 A;  5EY6 A;  5KN0 A;  2LRT A;  6GSY A;  2I3Y A;  3ZML A;  2G0F A;  1A2M A;  4GQC A;  1TRS A;  1J08 A;  4GTU A;  1Q4J A;  2I81 A;  4HU7 A;  1OYJ A;  2HRN A;  3MYD A;  4TN8 A;  3WGD A;  1X9M B;  1ZZY A;  3HCZ A;  4X4J A;  1ZYN A;  3TKS C;  4MMM A;  3OR5 A;  2XBI A;  3FR9 A;  4HZ2 A;  1FVJ A;  2LRC A;  3KM6 A;  3FY7 A;  4IP1 A;  2B7K A;  3ERF A;  20GS A;  1ZOF A;  1B4Q A;  1MTC A;  4TKY A;  3BCK A;  1TKD B;  4BWS A;  4GQF A;  2VO4 A;  1TK5 B;  5D9V A;  1BQ7 A;  5HR1 A;  4TXO A;  2PUK C;  1FB0 A;  2H8L A;  4BA7 A;  3FYG A;  2PBJ A;  3RAZ A;  1BG5 A;  1QXH A;  1UVZ A;  2J23 A;  2YV9 A;  5L71 A;  2DJ0 A;  1C72 A;  4OO5 A;  3TJF A;  3GKK A;  4J56 E;  5DAL B;  5CO3 A;  5J4V A;  1FVK A;  1EWX A;  2H6Z A;  2FWF A;  1AQV A;  2RII A;  4OMV A;  1GUL A;  2CZ2 A;  2PPT A;  2H1G A;  4GRF A;  3ED3 A;  2O8V B;  4V1A g;  3A2W A;  4AKH A;  5ELG A;  3WYW A;  2LJK A;  4ZIL A;  1VF1 A;  3GKN A;  3BCI A;  3F8U A;  5ECL B;  2K18 A;  1GNE A;  2X8H A;  5FHI A;  3Q6O A;  4Q5N A;  2HQT A;  2FD3 A;  5HFG A;  1XZO A;  1OE7 A;  4YAP A;  4N11 A;  1PA3 A;  4V2L A;  1YF1 A;  3ERW A;  4RUV A;  2YV7 A;  4IBP A;  3TJJ A;  2M46 A;  1TDI A;  2IME A;  2ON7 A;  3EU4 A;  3TKS A;  4TR1 A;  2P5R A;  2CVB A;  2OKA A;  4CW9 A;  1G6Y A;  2HSH A;  3MSZ A;  5A5H B;  1SVL A;  4ZBB A;  4Z7X A;  3ISO A;  4WKW A;  3KXO A;  1GTA A;  3TKQ A;  3L78 A;  1ML6 A;  1VF2 A;  3VWW A;  3I69 A;  1K0D A;  2B1K A;  4NHZ A;  2FNO A;  3DIE A;  4MPG A;  5DJM A;  2L59 A;  1MDJ A;  3HMJ G;  1JZW A;  4GWR A;  1YF0 A;  3PH9 A;  5AN1 A;  1V2A A;  2HLS A;  2QKE A;  1TXU A;  3DKS A;  6GSU A;  2EFE A;  1B8X A;  4F2I A;  2GZY A;  2R4V A;  1X9S B;  3GMF A;  3O3T A;  1SL2 B;  4ZXG A;  2O85 A;  2JL4 A;  2EIQ A;  3HY2 A;  5GAP D;  3CTF A;  1DE1 A;  1XW6 A;  1AQX A;  3FZ4 A;  3GHA A;  4KW6 A;  4P3Y B;  2L6D A;  4K6X A;  4N0V A;  5F0G A;  1GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...