5AIXA

Complex of human hematopoietic prostagandin d2 synthase (hh-pgds) in complex with an active site inhibitor.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
b'PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTENTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMATOPOIETIC PROSTAGLANDIN D SYNTHASE
publication title Identification of Indole Inhibitors of Human Hematopoietic Prostaglandin D2 Synthase (Hh-Pgds).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 69
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5aixA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5aixA01
1T00A 5COHA 3L78A 1GSFA 3RPNA 3GX0A 3K8NA 5ID2B 1OC9A 3NIVA 3D5JA 2EIQA 1SKSB 3A2WA 2TRXA 5HFGA 2LQOA 4K2DA 6GSVA 1XVQA 3F4SA 3FEUA 4PXOA 2RM5A 1I9DA 1GL8A 4MPFA 1Z3EA 2K8SA 1FVKA 3D22A 3D4TA 5D96A 1K3YA 3W8SA 1OVNA 2HSMA 3UOMA 2V6KA 2V2GA 4P3YB 2KHPA 3CBUA 2PPTA 4FQUA 4IP6A 2FD3A 1M9BA 5GSSA 3H1NA 5JWRB 1N2AA 1SYXA 1YJ6A 2H1DA 2H70A 4KNDA 3PPUA 2H30A 1PKZA 4EXJA 1AQWA 2H75A 2HT9A 1B9XC 3RBTA 3ZFBA 4XRDA 4BL7B 1ERWA 4L0WA 5FWGA 1RQMA 1HNCA 1J0FA 3EWLA 3IAM2 1TRUA 1THOA 1G6YA 2DSAA 1ILOA 2VCVA 2L4CA 5IMVA 3D21A 3GA4A 5B6NA 4EE0A 1OAZA 2PERA 1A2JA 2C0DA 1SL0B 3GRXA 2VM2A 4PUFC 3F8UA 3H79A 3BCKA 1A24A 1O7UA 2QSIA 3NZNA 2L5LA 3A5WA 1Z9HA 1K0AA 5EPFA 2REMA 2WB9A 4BA7A 1X5CA 5GAND 3UJ1A 2FWGA 3TUEA 2R5GA 2YP6A 2DMLA 1USBA 3RAZA 4NAXA 3O3TA 4JBBA 5AISA 3GL3A 3IV4A 3DGQA 4XS4A 4IGJA 1YZXA 3UVHA 3BOAA 2OBIA 4RQXA 4WR5A 2CAIA 2WDUA 3ISOA 1AC1A 2ALBA 2JZSA 3FKFA 4IP1A 3VK9A 2VCZA 1OC3A 1MDKA 2C0FA 2YPMA 2FCHA 2X8HA 2GZYA 4OFTA 4Q5NA 2CAQA 5F07A 1SL2B 5IQYA 4PTSA 1V98A 1XOAA 1MD4A 18GSA 1KBNA 4PUAA 1TRWA 2H0HA 1PX7A 2AV4A 4JR4A 5AGYA 2YWNA 3O76A 2DJ1A 2DJ3A 4I97A 3HZ4A 3ED3A 4IKHA 5ELGA 1FHEA 2YJ7A 3MWHA 5G31A 1KTEA 5IMZA 3DVWA 3HDCA 1Y25A 2H0GA 2LNTA 1O6JA 3UARA 1T7PB 3IK7A 5CRGA 4IBPA 3VPTA 1K0BA 2N5FA 4KF9A 5G5FA 2VM1A 2OBKA 4OCFA 2H1BA 1T3BA 2HI7A 2H71A 2L5OA 3IHQA 2X8GA 1X9SB 1XIYA 3C1SA 1XWCA 4HJMA 3G7IA 1MDIA 1EWXA 1X5DA 4HU9A 4ECJA 1YDKA 3LJRA 5DALB 4EL1A 3W8JA 2IMIA 4V2NA 3BCIA 2OKAA 3M9JA 1PQNA 5C04A 2H19A 3J7Yk 2IFQB 3P7XA 4NWYA 1TI3A 3ZITA 5G1LA 4HZ4A 2JZRA 5J9BA 3US3A 3ME7A 5B7CA 4EDYA 3APSA 4V1Ag 4OFMA 5A4UA 3VLNA 4EUYA 3MAKA 3M9KA 5KN0A 1MD3A 2H74A 4MABA 1TU8A 4N0VA 1PL2A 3I6AA 1K3LA 2FA4A 3HVVA 4N11A 2H1GA 3ZL5A 4F0CA 2B7JA 2LJRA 3HZ8A 3WGDA 2BJXA 5LCZA 4KCAA 2O85A 5D9TA 4BPYA 3HHVA 1GSDA 1XW5A 1TP9A 1ERUA 2VCWA 1XBSA 4KX4A 1AQXA 5CAXA 2P5QA 3U5RE 3CXGA 4V2LA 1HNAA 4GSTA 3EINA 4KDYA 3GSSA 1R5PA 1SU9A 5CREA 1TRSA 1EGRA 2P31A 1CQHA 5KN3A 3L9SA 2L57A 1A2LA 4GQFA 1SKRB 5DDLA 1XVWA 3EURA 4WEYA 5IMFA 3TRPA 5CO3A 4NHZA 1J9BA 3QDNA 3TCOA 3TRXA 4G0IA 2YZUA 1GH2A 3Q19A 2VCXA 1RW1A 1THXA 1Z6NA 3GV1A 2VD1A 1EP8A 3M8NA 4TXVA 2HRKB 5D9XA 3D4MA 1J08A 11GSA 1X9WB 4O92A 6GSSA 5DVBA 5BMUA 1SYRA 2IN3A 3BD2A 1GSUA 2JACA 4OO5A 2D2ZA 3WT2A 3IC8A 1U3IA 2A4VA 3A3TA 4HDEA 4FYUA 4EO3A 1F6MC 1BQ7A 2HRNA 4G2EA 5HR1A 4BVYB 4ID0A 4CDOA 4HI7A 1SK0A 2VD0A 4HU7A 4GSNA 4BVXA 3E3EA 3ZVJD 1A8YA 2HZFA 5B8AA 4FO5A 1S3AA 4JE1A 2F3MA 3GKMA 4ZIJA 1SD8A 2C8UA 3EMPA 4ILFA 2GT5A 5IOXA 1VF1A 3VWWA 3GKNA 2YWMA 1GNWA 5CP1A 5J41A 2JSZA 5C00A 1HNBA 3WT1A 1XW6A 4IJIA 3E9JB 3IRAA 2VL2A 3UAPA 2DIYA 2YZHA 1QMVA 2C3NA 3EE2A 2E7PA 2R6KA 5DJMA 2QKEA 4K1FA 2B1LA 2FHEA 1K0DA 3UL3A 3UBLA 2VLVA 4L0UA 1TOFA 4G10A 3FZ4A 1OC8A 1SKWB 4ECBA 2I9HA 3FHKA 4NPBA 1OKTA 4DSSA 2MYGA 1OYJA 2WRTA 4YAPA 4ECCA 10GSA 5H5QA 4KGIA 4POKA 3ZZXA 5G1KA 2JU5A 2PUKC 1HD2A 1FO5A 2XC2A 1VRSD 2HSYA 2C0GA 2V6OA 4EF0A 1EEJA 4K7NA 1AW9A 1GLQA 14GSA 3TKSC 19GSA 4MJBA 4WXTA 1QQ2A 4HEA2 3IC4A 3FY7A 2F8FA 2NDOA 3KIJA 3LYPA 3RDWA 4EVMA 2RIIA 4IVFA 2AUVA 2HRAA 1JZDA 4N0ZA 2GZZA 5DQSA 2H76A 3GTUB 3U6VA 5HR2A 4MZBA 1T1VA 4MLYA 3HD5A 1O8WA 1JFUA 6GSXA 1UN2A 3G7JA 3DIEA 3CSJA 4GWRA 3NOFA 2A2SA 3TJGA 5KN2A 2IMDA 1YEXA 1QK8A 3GHAA 5DAKB 5F05A 3WGEA 1Q98A 4KDXA 4TR0A 2WCIA 4OWYA 4ZBAA 1XW9A 3QPMA 5J3RA 1AXDA 4IS0A 1FW1A 3D6IA 2I1UA 4TR1B 1DE2A 2YN1A 2X8CA 3A2XA 5ECPB 3IBHA 3WGXA 1NSWA 3UMAA 5IM9A 3HY2A 2MZCA 2GLRA 5F06A 2EIOA 1E2YA 4V2MA 1MTCA 4QQ7A 4BL7A 4KH7A 4NXIA 1KEBA 3A2VA 3APQA 1AUCA 1TW9A 2H6YA 2LV3A 1EZKA 1EOGA 2E2GA 1FOVA 1F2EA 3N9JA 1YEPA 1V57A 1K0OA 2JL4A 4JEDA 1A23A 2KP2A 2MMNA 1T8EB 4MZWA 1ABAA 3APOA 2VLUA 3KTLA 5ECKB 5IO2A 1K0NA 1TXXA 1MDJA 1TK0B 4OCEA 2OE0A 4GRFA 4POMA 2XPDA 4MH2A 2PN8A 5DCGA 2HRFA 3IOSA 2AYTA 3FZ5A 3FR9A 3QAGA 2IMKA 2E2MA 2ZNMA 3KP8A 4KSOA 4K0GA 3BJ5A 2FUG2 2IPAA 1PX6A 1NW2A 3CTFA 3LGCA 2VCTA 3FYGA 2YANA 4RQRA 4XIHA 2VO4A 1SENA 1FB6A 4AJ7A 3GX8A 5F0GA 2LUSA 1FB0A 1VF3A 1PL1A 3TGZA 4YQUA 1Q4JA 2LEGA 2LJKA 4X43A 1U6TA 4DSQA 1GTIA 3QOUA 3UIWA 4KAEA 1EV9A 4TXOB 1M0UA 4PNFA 5IPGA 3IA1A 3QR6A 2EIRA 4Z7XA 1T4YA 1F9MA 1B48A 4I8BA 4MH3A 1TDIA 4XRAA 3F3QA 1KNGA 3QFBC 2WJUA 4DSRA 3ZYWA 2CT6A 1PKWA 1GSEA 3LSZA 1X0RA 2B5XA 2RUEA 3I43A 3H4KA 4KUNA 1F3BA 4ISDA 3GKKA 1TK8B 2DJJA 3VFIA 3IR4A 4QL9A 2O7KA 4WF5A 1GSQA 5E59A 2B5EA 3P2AA 3M1GA 3CSIA 6GSTA 2H66A 4ML1A 3EMXA 1B4QA 4Q5FA 5JCWA 4HZ2A 2LRCA 5CYYA 4JR6A 3RHCA 1TRVA 1VF4A 1HYUA 4K6XA 3JCML 2BTOT 3KCMA 4OMVA 1A2MA 2EC4A 1S3DA 3H93A 4RI7A 5DALA 2DBCA 2E0QA 5GSTA 7GSSA 5E4WA 2IFQA 2DLXA 2QC7A 4WR4A 5J5NA 4F82A 4K7OA 2HSHA 5ECSA 1WWJA 2GZPA 4XCSA 1AAZA 2XHFA 4TN8A 3G7YA 2IMEA 3GURA 1Z7PA 1YF1A 2H01A 1K0CA 3SBCA 1Z7RA 1FG4A 2VL9A 3UVTA 5ECIB 1JHBA 3LXTA 4J57E 2LNSA 3CSHA 4G9HA 1TTZA 1F37A 5HFIA 4MJCA 3C7MA 3GMFA 2NTOA 4X1UA 4K7IA 1ST9A 1SL1B 1WIKA 3PINA 4LMVA 3FRCA 2A2RA 3RPPA 1S3CA 1GTBA 1M7TA 2ON7A 4O7HA 2X64A 2FNOA 2B1KA 2M80A 5IOWA 2WZ9A 2LTKA 3EU4A 3IXRA 4HJ2A 1PN9A 3H8QA 5J9CA 5ECHB 1WPIA 2DJ0A 5HQPA 2HE3A 1GUMA 4K8MA 4MA9A 5INYA 5ECRB 2G0FA 4H86A 2KLXA 1X9MB 1NM3A 1PA3A 5G30A 1BYEA 2L4QA 4KE3A 1OE8A 4HQZA 4BWSA 4MP4A 2PVQA 1WOUA 2RM6A 1B4PA 3ZIJA 1I5GA 16GSA 2R37A 4JU5A 2JZTA 2UZ8A 4Q5RA 4OO4A 2HRKA 1EEMA 1AIUA 1JZOA 1TK5B 3VWVA 3KH9A 4N30A 1N8JA 3SWLA 4TR4A 1X5EA 2DMMA 3HXSA 2OACA 3TJFA 1LJRA 2N5AA 4XS6A 2PBJA 3IK9A 2F9SA 1DUGA 3LWAA 4FH8A 3IAS2 1TU7A 4AGSA 3DEXA 4D73B 3HKRA 5D8IA 5D73A 5AIXA 3KJYA 2KUCA 3ERGA 3F4TA 3KMNA 2H73A 1UC7A 2ON5A 1ERTA 1WP0A 5KN1A 2V41A 1XZOA 4KB3A 4GCIA 3W6GA 1GULA 2NPBA 4KW6A 1F3AA 3P90A 4ZILA 4TW5A 1GUKA 2CVBA 2F51A 1Y6EA 3L9VA 2J23A 3TJJA 4L8EA 5A4VA 2O8VB 4FIWA 2ES7A 2C3TA 4ZB9A 4XS1A 3ZIVA 2AB6A 1ZMAA 2K6VA 4L5OA 4K9ZA 3F0IA 5EVOA 1ACVA 1G7EA 4KSMA 2LRTA 3OR5A 12GSA 5JWOB 2OE1A 1ZGNA 4AJ6A 1UA5A 1BJXA 3KD0A 3C71A 1WMJA 5HFKA 2C80A 1BAYA 3QMXA 1EP7A 1IYHA 2CQ9A 3MSZA 1XWBA 3PH9A 4PQ1A 1GUHA 5H5RA 3VURA 4F9ZA 4WBJA 1G7OA 2WULA 4ML6A 1YKCA 2AJQB 2VCQA 3GSTA 3HVSA 2LKUA 3R2QA 2GGTA 3ZMKA 3I9V2 3R3EA 3FZ9A 3UEMA 2GS3A 3GTUA 4WETA 1HQOA 3CRUA 3F9UA 1XXUA 2HYXA 1V9WA 3P8WA 2VAFA 3VWXA 2FWFA 1YY7A 3N5OA 3UBKA 5DBQA 5EL8A 1R26A 5IPHA 3ZTLA 2KP1A 1LU4A 2YOIA 4QL7A 1QUWA 5DAKA 5ECQB 4ZB8A 2FA8A 4XHMA 4AJ8A 1JLVA 4L5LA 1XCCA 3QAWA 4TR1A 3Q74A 3KMOA 4ULXA 6GSYA 5HR0A 3GKXA 5ID2A 3TKRA 2I81A 3DD3A 4ZL7A 3PGTA 2DIZA 4IJ3A 4IQ1A 4WF4A 2YWOA 1PRXA 4G19A 2I4AA 3CRTA 4Q5QA 3EC3A 3AY8A 2IJYA 5CNWA 3LEFA 1GNEA 2B3SA 4F0BA 2HZEB 4MCUA 1GTAA 1NHYA 2CZ3A 5JWQB 2IWTA 3G9BA 3QD9A 2HLSA 1UVZA 2HFDA 4OD7A 4EDZA 4J56E 4POLA 4GF0A 2MMOA 4V1Ap 1SD9A 1JZWA 1SJIA 1M99A 3Q6OA 2YJHA 2CVKA 4BWQA 4F03A 3KH7A 2IL3A 4MK3A 4PQIA 5IIZA 4KDUA 1ML6A 1VGLA 3DVXA 1O8XA 5JCUA 3GYKA 4HOJA 5GZZB 4EC0A 3TJKA 3L4NA 1B8XA 2M46A 2V1MA 1A8LA 3VI5A 4IW9A 1IYIA 3HJOA 3TKQA 4YH2A 5CRHA 3TRQA 2CVDA 2FGXA 4LA1A 5LD0A 1QFNA 1JLWA 4TXOA 3L0HA 5D93A 1ZYEA 5CRWA 1SJZA 1OC9B 3LQ7A 4PX1A 4MF7A 1OE7A 1ZYQB 3LYKA 3L9UA 4JRRA 1U87A 2H6XA 1U88A 2NBSA 5D9WA 4POBA 2VL2C 1DE1A 1RK4A 2JSYA 1VF2A 3CTGA 5A4WA 2HSMB 4I5QA 3I69A 2GQLA 3ERWA 2H6ZA 1ERVA 2CX4A 1W4VA 3GUSA 2K8VA 4IELA 3GIXA 2RUFA 1R5AA 3CYNA 2VUPA 4USSA 4ACSA 3DXBA 4WKWA 3TJBA 4KCEA 2GSSA 4HUAA 1M2DA 2XBIA 2YWIA 1ZCPA 4ECIA 3FW2A 3LG6A 4N10A 3LFLA 1W89A 3TOTA 1GSSA 2MMZA 4GLTA 4K0NA 3LORA 2MMAA 5HR3A 1G0TA 1QXHA 2JADA 3GFKA 2F8AA 2MBSA 3MDKA 1GRXA 2L6DA 4KA0A 5DJLA 1AQVA 1EOHA 3DKSA 4ZL8A 3ZFLA 4TVEA 4DEJA 1YF0A 2XPEA 4MZCA 4NV2A 4X0XA 2C4JA 5B8BA 2YV7A 4ZBBA 4ZBDA 1PGTA 4IN0A 3ZVJA 4GQCA 3S9FA 2P0GA 2OE3A 3KM6A 2VOCA 4HS1A 4IQAA 3ERFA 1G6WA 1NHOA 2CA8A 1E6BA 4O32A 4XTSA 1Z6MA 4XS4B 4OFNA 4F2IA 3EVIA 3D0ZA 4MPGA 4J2FA 2L6CA 3EU3A 4TR3A 1V58A 2FWHA 4LMWA 5G2ZA 2G2QA 5IMDA 1XWAA 2KOKA 2OJLA 1K3OA 1CQGA 9GSSA 4MDCA 3WYWA 4FYCA 1ZL9A 8GSSA 2GTUA 2M72A 3VI7A 3C1RA 1ZZYA 2H8LA 4PGTA 2R3XA 4CHSA 1TJDA 3HJMA 1EGOA 1SJ6A 1ON4A 3ZLPA 2GSQA 2K9FA 1DBYA 3PR8A 3VPQA 5LNKe 5G5EA 1WE0A 4EKZA 5ELAA 1JZRA 2WGRA 2GT6A 3KP9A 1WRYA 2ZUPA 1SK1A 3ME8A 3O6TA 2YV9A 2LRNA 2VL3A 2LJAA 4LL4B 1XWGA 4PNGA 4MJEA 5IO0A 3C8EA 2VIMA 3TKSA 1GTUA 3GN3A 2C0EA 3CMIA 2H0IA 1BX9A 3E0UA 6GSWA 1GLPA 1XOBA 4YQMA 1QGVA 3QCPA 2X99A 2H1AA 4TRXA 3KTBA 4D73A 1GSYA 5AIVA 2P5RA 3KGKA 2AAWA 4NV5A 2DC5A 4TOPA 2DJ2A 3TDGA 2AHEA 3IE3A 1O73A 3GNJA 2BMXA 4E8EA 17GSA 1MEKA 3GL5A 2CX3A 2HSNB 4NHWA 4MMMA 4ZXGA 5ABRA 3KXOA 1M2BA 4ZL9A 2J9HA 2FY6A 2TIRA 2PWJA 3FZAA 2C3QA 4BVYA 1O85A 3F3RA 2MBTA 3FR3A 2I3YA 1FVJA 1TKDB 4E8HA 2N5BA 3TKPA 4I2UA 4PURA 5ENUA 2O89A 1V2AA 3DRNA 3DWVA 2XBQA 3WD6A 2GQKA 5IMCA 2OADA 3C73A 1R7HA 4TKYA 3V1WA 1URMA 5B6MA 3EYTA 3MNGA 5DCHA 1ZOFA 2L59A 5IMAA 1U3AA 2B7KA 1PD21 3M0FA 5KEJA 2WFCA 1YQ1A 2R4VA 2GDRA 2TRCP 4PQHA 1T4ZA 4AF2A 3LXZA 4GXZA 2CV4A 1R4WA 1OKDA 2B5YA 2ZCTA 4HQSA 2CZ2A 4GTUA 22GSA 4MF6A 4WBRD 3FK8A 3F63A 2IIYA 5JCGA 4RUVA 3DMLA 13GSA 4DVCA 2O87A 2HNLA 3IDVA 3ZRDA 2K18A 2LSTA 4LLRA 5ECNB 5H5SA 3HVXA 3J7Yb 1WJKA 4FYBA 4IHUA 1K0MA 1PMTA 2C1YA 4I2TA 3F6FA 1BEDA 2DJKA 4LL1B 5D9VA 2OA7A 1EV4A 2QGVA 3HA9A 1GWCA 2Z9SA 5ECLB 3DYRA 4BVXB 4NMUA 2YCDA 1DSBA 1XPVA 2GVPA 3FR6A 1SK2A 3ZREA 2LQQA 3RHBA 4O5RA 5GAPD 3F6DA 2PU9C 2H72A 2GSRA 2GSTA 3GH6A 4G0LA 3TKSE 6GSUA 3HCZA 2V32A 2PMTA 2RLIA 3GH9A 2B6MA 5CRDA 4ZB6A 5AN1A 1M2AA 3ZMLA 1V40A 2HZEA 1FAAA 2VLTA 1PSQA 3F4RA 4MF5A 4G0KA 1BG5A 2R2JA 1XFLA 4YAVA 1A0FA 5J4UA 4JZQA 3TB2A 2GQMA 3KZQA 1A0RP 3QAVA 5F8BA 1XWKA 3M3MA 2PVOC 4I6XA 5FT3A 2IMFA 2WS2A 3KEBA 2YNXA 5EY6A 5ECMB 20GSA 1O81A 1B9YC 5FHIA 1GP1A 1H75A 1H4OA 1M9AA 4YQVA 4DSSB 5A5KA 4GSSA 2LS5A 4MJAA 1TI1A 2FWEA 1C72A 2HXKA 2HQTA 3BBYA 3HJPA 3QFAC 4CW9A 4RI6A 3IPZA 3TOUA 1YKAA 5ECOB 1Z5YE 2PGTA 3VWUA 5L71A 2NVLA 5DQYA 1LBKA 3Q18A 2FLSA 3HYPA
chains in the Genus database with same CATH superfamily
1TXUA 1T00A 5COHA 3L78A 1GSFA 3RPNA 3GX0A 3K8NA 5ID2B 1OC9A 3NIVA 3D5JA 2EIQA 1SKSB 3A2WA 2TRXA 5HFGA 2LQOA 4K2DA 6GSVA 2UV8G 1XVQA 1XG8A 3F4SA 3FEUA 4PXOA 2RM5A 1I9DA 1GL8A 4MPFA 1Z3EA 2K8SA 1FVKA 3D22A 4X4JA 3D4TA 5D96A 1K3YA 3W8SA 1OVNA 2HSMA 3UOMA 2V6KA 2V2GA 4P3YB 2KHPA 3CBUA 2PPTA 4FQUA 4IP6A 2FD3A 1M9BA 5GSSA 3H1NA 5JWRB 1N2AA 1SYXA 1YJ6A 2H1DA 2H70A 4KNDA 3PPUA 2H30A 1PKZA 4EXJA 1AQWA 2H75A 2HT9A 1B9XC 3RBTA 3ZFBA 4XRDA 4BL7B 1ERWA 4L0WA 5FWGA 1RQMA 1HNCA 1J0FA 3EWLA 3IAM2 4AKXB 1TRUA 1THOA 1G6YA 2DSAA 1ILOA 2VCVA 2L4CA 5IMVA 3D21A 3GA4A 5B6NA 4EE0A 1OAZA 2PERA 1A2JA 2C0DA 1SL0B 3GRXA 2VM2A 4PUFC 3F8UA 3H79A 3BCKA 1ZYPA 1A24A 1O7UA 2QSIA 3NZNA 2L5LA 3CQFA 3A5WA 1Z9HA 1K0AA 5EPFA 2REMA 2WB9A 4BA7A 1X5CA 5GAND 3UJ1A 2FWGA 3TUEA 2R5GA 1PFOA 2YP6A 2DMLA 1USBA 3RAZA 4NAXA 3O3TA 4JBBA 5AISA 3GL3A 3IV4A 3DGQA 4XS4A 4IGJA 1YZXA 3UVHA 3BOAA 2OBIA 4RQXA 4WR5A 2CAIA 2WDUA 3ISOA 1AC1A 2ALBA 4O5QA 2JZSA 3FKFA 4IP1A 3VK9A 2VCZA 1OC3A 1MDKA 2C0FA 2YPMA 2FCHA 2X8HA 2GZYA 4OFTA 4Q5NA 2CAQA 5F07A 1SL2B 5IQYA 4PTSA 1V98A 1XOAA 1MD4A 18GSA 1KBNA 4PUAA 1TRWA 2H0HA 1PX7A 1SVMA 2AV4A 4JR4A 5AGYA 2YWNA 3O76A 2DJ1A 2DJ3A 4I97A 5A5HB 3HZ4A 3ED3A 4IKHA 5ELGA 1FHEA 2YJ7A 3MWHA 5G31A 1KTEA 5IMZA 3DVWA 3HDCA 1Y25A 2H0GA 2LNTA 1O6JA 4W66A 3UARA 1T7PB 3IK7A 5CRGA 4IBPA 3VPTA 1K0BA 2N5FA 4KF9A 5G5FA 2VM1A 2OBKA 4OCFA 2H1BA 1T3BA 2HI7A 2H71A 2L5OA 3IHQA 2X8GA 1X9SB 1XIYA 3C1SA 1XWCA 2DKHA 4HJMA 3G7IA 1MDIA 1EWXA 1X5DA 4HU9A 4ECJA 1YDKA 3LJRA 5DALB 4EL1A 3W8JA 2IMIA 4V2NA 3BCIA 4QMKA 2OKAA 3M9JA 1PQNA 5C04A 2H19A 3J7Yk 2IFQB 3P7XA 2HSNA 4NWYA 1TI3A 3ZITA 5G1LA 4HZ4A 2JZRA 5J9BA 3US3A 3ME7A 5B7CA 4EDYA 3APSA 4V1Ag 4OFMA 5A4UA 3VLNA 4EUYA 3MAKA 3M9KA 5KN0A 1MD3A 2H74A 3A5IA 4MABA 1TU8A 4N0VA 1PL2A 3EPTA 3I6AA 1K3LA 2FA4A 3HVVA 4N11A 2H1GA 3ZL5A 4F0CA 2B7JA 2LJRA 3HZ8A 2OT3A 3WGDA 2BJXA 5LCZA 4KCAA 2O85A 5D9TA 4BPYA 3HHVA 1GSDA 1XW5A 1TP9A 1ERUA 2VCWA 1XBSA 4KX4A 1AQXA 5CAXA 2P5QA 3U5RE 3CXGA 2WW2A 4V2LA 1HNAA 4GSTA 3EINA 4KDYA 3GSSA 1R5PA 1SU9A 5CREA 1TRSA 3HVNA 1EGRA 2P31A 1CQHA 5KN3A 3L9SA 2L57A 4BIKA 1A2LA 4GQFA 1SKRB 5DDLA 1XVWA 3EURA 4WEYA 5IMFA 3TRPA 5CO3A 4NHZA 1J9BA 3QDNA 3TCOA 3TRXA 4G0IA 2YZUA 1GH2A 3Q19A 2VCXA 1RW1A 1THXA 1Z6NA 3GV1A 5A1NB 2VD1A 1EP8A 3M8NA 4TXVA 3CWGA 2HRKB 5D9XA 3D4MA 1J08A 11GSA 1X9WB 4O92A 6GSSA 5DVBA 5BMUA 1SYRA 2IN3A 3BD2A 1GSUA 2JACA 4OO5A 2D2ZA 3WT2A 3IC8A 2WZSA 1U3IA 2A4VA 3A3TA 4HDEA 4FYUA 4EO3A 1F6MC 1BQ7A 2HRNA 4G2EA 5HR1A 4BVYB 4ID0A 4CDOA 4HI7A 1SK0A 2VD0A 4HU7A 4GSNA 4BVXA 3E3EA 3ZVJD 1A8YA 2HZFA 2EFCA 5B8AA 4Z2TA 4FO5A 1S3AA 4JE1A 2F3MA 3GKMA 4ZIJA 1SD8A 2C8UA 3EMPA 4ILFA 2GT5A 5IOXA 1VF1A 3VWWA 3GKNA 2YWMA 1GNWA 3RGBC 5CP1A 5J41A 2EFEA 2JSZA 5C00A 1HNBA 3WT1A 1XW6A 4IJIA 3E9JB 3IRAA 1BF5A 2VL2A 3UAPA 2DIYA 2YZHA 1QMVA 2C3NA 3EE2A 4ICYA 2E7PA 2R6KA 5DJMA 2QKEA 4K1FA 2B1LA 2FHEA 1K0DA 3UL3A 3UBLA 2VLVA 4L0UA 1TOFA 4G10A 3FZ4A 2QA1A 1OC8A 1SKWB 4ECBA 4AI6A 2I9HA 3FHKA 4NPBA 1OKTA 4DSSA 2MYGA 1OYJA 2WRTA 4YAPA 4ECCA 10GSA 5H5QA 5A34A 4KGIA 4POKA 3ZZXA 5G1KA 2JU5A 2PUKC 1HD2A 1FO5A 2XC2A 1VRSD 2HSYA 2C0GA 2V6OA 4EF0A 1EEJA 4K7NA 1AW9A 1GLQA 14GSA 3TKSC 19GSA 4MJBA 4WXTA 1QQ2A 3IC4A 4HEA2 3FY7A 2F8FA 2NDOA 3KIJA 3LYPA 3RDWA 4EVMA 2RIIA 4IVFA 2AUVA 2HRAA 1JZDA 4N0ZA 2GZZA 5DQSA 2H76A 3GTUB 3U6VA 5HR2A 4MZBA 1T1VA 4MLYA 3HD5A 1O8WA 1JFUA 6GSXA 1UN2A 4PI0C 3G7JA 3DIEA 3CSJA 4GWRA 3NOFA 2A2SA 3TJGA 3MIXA 5KN2A 2IMDA 1YEXA 1QK8A 3GHAA 5DAKB 5F05A 3WGEA 1Q98A 4KDXA 4TR0A 2WCIA 4OWYA 4ZBAA 1XW9A 3QPMA 5J3RA 1AXDA 4IS0A 1FW1A 3D6IA 2I1UA 4TR1B 1DE2A 2YN1A 2X8CA 3A2XA 4AKHA 5ECPB 3IBHA 3WGXA 1NSWA 3UMAA 2QA2A 3HY2A 5IM9A 2MZCA 2GLRA 5F06A 2EIOA 1E2YA 4V2MA 1MTCA 4EIQA 4QQ7A 4BL7A 4KH7A 4NXIA 1KEBA 3A2VA 3APQA 1AUCA 1TW9A 2H6YA 2LV3A 1EZKA 1EOGA 2E2GA 1FOVA 1F2EA 3N9JA 1YEPA 1V57A 1K0OA 2JL4A 4JEDA 1A23A 2KP2A 2MMNA 1T8EB 4MZWA 1ABAA 3APOA 2VLUA 3KTLA 5ECKB 5IO2A 1K0NA 1TXXA 1MDJA 1TK0B 4OCEA 2OE0A 4GRFA 4POMA 2XPDA 4MH2A 2PN8A 5DCGA 2HRFA 3IOSA 2AYTA 3FZ5A 4YKGA 3FR9A 3QAGA 2IMKA 2E2MA 2ZNMA 3KP8A 4KSOA 4K0GA 3BJ5A 2FUG2 4O5UA 2IPAA 1PX6A 1NW2A 3CTFA 3LGCA 2VCTA 3FYGA 2YANA 4RQRA 4XIHA 2VO4A 1SENA 1FB6A 2X4AA 4AJ7A 3GX8A 5F0GA 2LUSA 1FB0A 1VF3A 1PL1A 3TGZA 4YQUA 1Q4JA 2LEGA 2LJKA 4X43A 1U6TA 4DSQA 1GTIA 3QOUA 4G01A 3UIWA 4KAEA 1EV9A 4TXOB 1M0UA 4PNFA 5IPGA 3IA1A 3QR6A 2EIRA 4Z7XA 1T4YA 1F9MA 1B48A 4I8BA 4MH3A 1TDIA 4MNNA 4XRAA 3F3QA 1KNGA 3QFBC 2WJUA 4DSRA 3ZYWA 2CT6A 1PKWA 2WW3A 5A5HA 1GSEA 3LSZA 1X0RA 2B5XA 2RUEA 3I43A 3H4KA 4KUNA 1F3BA 4ISDA 3GKKA 1TK8B 2DJJA 3VFIA 3IR4A 4QL9A 2O7KA 4WF5A 5KOWA 1GSQA 5E59A 2B5EA 3P2AA 3M1GA 4YKFA 3CSIA 6GSTA 2H66A 4ML1A 3EMXA 1SVOA 1B4QA 4Q5FA 5JCWA 4HZ2A 2LRCA 5CYYA 4JR6A 3RHCA 1TRVA 1VF4A 1HYUA 4K6XA 3JCML 2BTOT 3KCMA 4OMVA 1A2MA 2EC4A 1S3DA 3H93A 4RI7A 5DALA 2DBCA 2E0QA 5GSTA 7GSSA 5E4WA 2IFQA 2DLXA 2QC7A 4WR4A 5J5NA 4F82A 4K7OA 2HSHA 5ECSA 1WWJA 2GZPA 4XCSA 1AAZA 2XHFA 4TN8A 3G7YA 2IMEA 3GURA 1Z7PA 1YF1A 2H01A 1K0CA 3SBCA 1Z7RA 1FG4A 2VL9A 3RFRC 3UVTA 5ECIB 1JHBA 3LXTA 4J57E 2LNSA 1FOHA 3CSHA 4G9HA 1TTZA 1F37A 1S3RA 5HFIA 4MJCA 3C7MA 3GMFA 2NTOA 4X1UA 4K7IA 1ST9A 1SL1B 1WIKA 3PINA 4LMVA 3FRCA 2A2RA 3RPPA 1S3CA 1GTBA 1M7TA 2ON7A 4O7HA 2X64A 2FNOA 2B1KA 2M80A 5IOWA 2WZ9A 2LTKA 3EU4A 3IXRA 4HJ2A 1PN9A 3TU3B 3H8QA 5ECHB 5J9CA 1WPIA 2DJ0A 5HQPA 2HE3A 4A5PA 1GUMA 4K8MA 4MA9A 5INYA 5ECRB 2G0FA 4H86A 2KLXA 1X9MB 1NM3A 1PA3A 5G30A 1BYEA 2L4QA 4KE3A 1OE8A 4HQZA 4BWSA 4MP4A 2PVQA 1WOUA 2RM6A 1B4PA 3ZIJA 1I5GA 16GSA 5A1NA 2R37A 4JU5A 2JZTA 2UZ8A 4Q5RA 4OO4A 2HRKA 1EEMA 1AIUA 1JZOA 1TK5B 3VWVA 2EFDA 3KH9A 4N30A 1N8JA 3SWLA 4TR4A 1X5EA 2DMMA 3HXSA 2OACA 3TJFA 1LJRA 2N5AA 4XS6A 2PBJA 4K2XA 3IK9A 2F9SA 1DUGA 3LWAA 4FH8A 3IAS2 1TU7A 4AGSA 3DEXA 4D73B 3HKRA 5D8IA 5D73A 5AIXA 3KJYA 2WW0A 2KUCA 3ERGA 3F4TA 2R0CA 3KMNA 2H73A 4Z2RA 1UC7A 2ON5A 1ERTA 1WP0A 5KN1A 2V41A 1XZOA 4KB3A 4GCIA 3W6GA 1GULA 2NPBA 4KW6A 1F3AA 3P90A 4ZILA 4TW5A 1GUKA 2CVBA 2F51A 1Y6EA 3L9VA 1ZYNA 3HMJG 2J23A 3TJJA 4L8EA 5A4VA 2O8VB 4FIWA 2ES7A 2C3TA 4ZB9A 4XS1A 3ZIVA 2AB6A 1ZMAA 2K6VA 4L5OA 4K9ZA 3F0IA 5EVOA 1ACVA 1G7EA 4KSMA 2LRTA 3OR5A 4ZB7A 12GSA 5JWOB 2OE1A 4HSCX 1ZGNA 4AJ6A 1UA5A 2WVXB 1BJXA 3KD0A 3C71A 1WMJA 5HFKA 2C80A 1BAYA 3QMXA 1EP7A 1IYHA 2CQ9A 3MSZA 1XWBA 3PH9A 4PQ1A 1GUHA 5H5RA 3VURA 2X49A 4F9ZA 4WBJA 1G7OA 2WULA 4ML6A 1YKCA 2AJQB 2VCQA 3GSTA 3HVSA 2LKUA 3R2QA 2GGTA 3ZMKA 3I9V2 2R0PA 3R3EA 3FZ9A 3UEMA 2GS3A 3GTUA 4GDFA 4WETA 1HQOA 3CRUA 3F9UA 1XXUA 2HYXA 1V9WA 3P8WA 2VAFA 3VWXA 2FWFA 1YY7A 3N5OA 3UBKA 5DBQA 5EL8A 1R26A 5IPHA 5J4VA 3ZTLA 2KP1A 1LU4A 2YOIA 4QL7A 1QUWA 5DAKA 5ECQB 4ZB8A 2FA8A 4XHMA 4AJ8A 2H1LA 1JLVA 4L5LA 1XCCA 3QAWA 4TR1A 3Q74A 3KMOA 3MYDA 4ULXA 6GSYA 5HR0A 3GKXA 5ID2A 3TKRA 2I81A 3DD3A 4ZL7A 3PGTA 2DIZA 4IJ3A 4IQ1A 4WF4A 2YWOA 1PRXA 4G19A 2I4AA 5J4YA 3CRTA 4Q5QA 3EC3A 3AY8A 2IJYA 5CNWA 3LEFA 1GNEA 2B3SA 4F0BA 2HZEB 4CY6A 4MCUA 1GTAA 1NHYA 2CZ3A 5JWQB 2IWTA 3G9BA 3QD9A 2HLSA 1UVZA 2HFDA 4OD7A 4EDZA 4J56E 4POLA 4GF0A 2MMOA 3LW9A 4V1Ap 1SD9A 1JZWA 1SJIA 1M99A 3Q6OA 2YJHA 2CVKA 4BWQA 4F03A 3KH7A 2IL3A 4MK3A 4PQIA 5IIZA 4KDUA 1ML6A 1VGLA 3DVXA 1O8XA 5JCUA 3GYKA 4HOJA 5GZZB 2VKZG 4EC0A 3TJKA 3L4NA 1M3JA 1B8XA 2M46A 2V1MA 1A8LA 3VI5A 4IW9A 1IYIA 3HJOA 3TKQA 4YH2A 5CRHA 3TRQA 2CVDA 2FGXA 4LA1A 5LD0A 1QFNA 1JLWA 4TXOA 3L0HA 5D93A 1ZYEA 2DKIA 5CRWA 1SJZA 3CHXC 1OC9B 3LQ7A 4PX1A 4MF7A 1OE7A 1ZYQB 3LYKA 1M3IA 3L9UA 4JRRA 1U87A 2H6XA 1U88A 2NBSA 5D9WA 4POBA 2VL2C 1DE1A 1RK4A 2JSYA 1VF2A 3CTGA 5A4WA 2HSMB 4I5QA 3I69A 2GQLA 3ERWA 2H6ZA 1ERVA 2CX4A 1W4VA 3GUSA 2WW1A 2K8VA 4IELA 3GIXA 2RUFA 1R5AA 3CYNA 2VUPA 4USSA 4ACSA 3DXBA 2O5VA 4WKWA 3TJBA 4KCEA 2GSSA 5J47A 4HUAA 1M2DA 2XBIA 2YWIA 4AKGA 1ZCPA 4ECIA 3FW2A 3LG6A 4N10A 3LFLA 1W89A 3TOTA 1GSSA 2MMZA 4GLTA 4K0NA 4N3ZA 3LORA 2MMAA 5HR3A 1G0TA 1QXHA 2JADA 3GFKA 2F8AA 2MBSA 3MDKA 1GRXA 2L6DA 4KA0A 5DJLA 1AQVA 1EOHA 3DKSA 4ZL8A 3ZFLA 4TVEA 4DEJA 1YF0A 2XPEA 4MZCA 4NV2A 4X0XA 1YVLA 1Y1UA 2C4JA 5B8BA 2YV7A 4ZBBA 4ZBDA 1PGTA 4IN0A 3ZVJA 4GQCA 4PI2C 3S9FA 2P0GA 2R0GA 2OE3A 3KM6A 2VOCA 4HS1A 4IQAA 3ERFA 1G6WA 1NHOA 2CA8A 1E6BA 4O32A 2WVZA 4XTSA 1Z6MA 4XS4B 4OFNA 4F2IA 3EVIA 3D0ZA 4MPGA 4J2FA 2L6CA 3EU3A 4TR3A 1V58A 2FWHA 4LMWA 5G2ZA 2G2QA 5IMDA 1XWAA 2KOKA 2OJLA 1K3OA 1CQGA 9GSSA 4MDCA 3WYWA 4FYCA 1ZL9A 8GSSA 2GTUA 2M72A 3VI7A 3C1RA 3FMWA 1ZZYA 2H8LA 4CY8A 4PGTA 2R3XA 4CHSA 1TJDA 3HJMA 1EGOA 4E68A 1SJ6A 1ON4A 3ZLPA 2GSQA 2K9FA 1DBYA 3PR8A 3VPQA 5LNKe 5G5EA 1WE0A 4EKZA 5ELAA 1JZRA 2WGRA 2GT6A 3KP9A 1WRYA 2ZUPA 4PHZC 1SK1A 3ME8A 3O6TA 2YV9A 2LRNA 2VL3A 2LJAA 4LL4B 1XWGA 4PNGA 1S4BP 4MJEA 5IO0A 3C8EA 5KOXA 2VIMA 3TKSA 1GTUA 3GN3A 2C0EA 3CMIA 2H0IA 1BX9A 3E0UA 6GSWA 2O3EA 1GLPA 1XOBA 4YQMA 1QGVA 3QCPA 2X99A 2H1AA 4TRXA 3KTBA 4D73A 1GSYA 5AIVA 2P5RA 3KGKA 2AAWA 4NV5A 4K5SA 2DC5A 4TOPA 2DJ2A 3TDGA 2AHEA 3IE3A 1O73A 3GNJA 2BMXA 4E8EA 17GSA 1MEKA 3GL5A 2CX3A 2HSNB 4NHWA 4MMMA 4ZXGA 5ABRA 3KXOA 1M2BA 4ZL9A 2J9HA 2FY6A 2TIRA 2PWJA 3FZAA 2C3QA 4BVYA 4FXYP 1O85A 3F3RA 2MBTA 3FR3A 2I3YA 1FVJA 1TKDB 4E8HA 2N5BA 3TKPA 4I2UA 4PURA 5ENUA 2O89A 1V2AA 3DRNA 3DWVA 2XBQA 3WD6A 2GQKA 5IMCA 2OADA 3C73A 1BG1A 1R7HA 4TKYA 3V1WA 1URMA 4Z2UA 5B6MA 3EYTA 3MNGA 5DCHA 1ZOFA 2L59A 2WVXA 5IMAA 1U3AA 2B7KA 1PD21 3M0FA 5KEJA 2WFCA 1YQ1A 2R4VA 2GDRA 2TRCP 4PQHA 1T4ZA 4AF2A 3LXZA 4GXZA 2CV4A 1R4WA 1OKDA 2B5YA 2ZCTA 4HQSA 2CZ2A 4GTUA 22GSA 4MF6A 4WBRD 4K5RA 3FK8A 3F63A 2IIYA 5JCGA 1YEWC 4RUVA 3DMLA 13GSA 4DVCA 2O87A 2HNLA 3IDVA 3ZRDA 2K18A 2LSTA 4LLRA 5ECNB 5H5SA 3HVXA 3J7Yb 2WVYA 1WJKA 5J40A 4FYBA 4AKIA 4IHUA 1K0MA 1PMTA 2C1YA 4I2TA 5BMUB 1I1IP 3F6FA 1BEDA 2DJKA 4LL1B 5D9VA 2OA7A 1EV4A 4EIPA 2QGVA 3HA9A 1GWCA 2Z9SA 5ECLB 3DYRA 4BVXB 4NMUA 2YCDA 1DSBA 1XPVA 2GVPA 2A2PA 3FR6A 1SK2A 3ZREA 2LQQA 3RHBA 4O5RA 5GAPD 3F6DA 2PU9C 2H72A 2GSRA 2GSTA 3GH6A 4G0LA 3TKSE 6GSUA 3HCZA 2V32A 2PMTA 2RLIA 3GH9A 1PN0A 2O36A 2B6MA 5CRDA 4ZB6A 5AN1A 1M2AA 3ZMLA 1V40A 2HZEA 1FAAA 2VLTA 1PSQA 3F4RA 4MF5A 4G0KA 1BG5A 2R2JA 1XFLA 4YAVA 1A0FA 5J4UA 4JZQA 3TB2A 2GQMA 3KZQA 1A0RP 3QAVA 5F8BA 1XWKA 3M3MA 3IHGA 2PVOC 4I6XA 5FT3A 2IMFA 2WS2A 3KEBA 2YNXA 5EY6A 5ECMB 20GSA 1O81A 1B9YC 5FHIA 1GP1A 2A4HA 5BRTA 1H75A 1H4OA 1M9AA 4YQVA 4DSSB 5A5KA 4GSSA 2LS5A 5A34B 1N25A 2EFHA 4MJAA 1TI1A 2FWEA 1C72A 2HXKA 2HQTA 3BBYA 3HJPA 3QFAC 1SVLA 4CW9A 4RI6A 3IPZA 3TOUA 1YKAA 5ECOB 1Z5YE 2PGTA 3VWUA 5L71A 2NVLA 5DQYA 1LBKA 3Q18A 2FLSA 3HYPA
chains in the Genus database with same CATH topology
1TXUA 1T00A 5COHA 3L78A 1GSFA 3RPNA 3GX0A 3K8NA 5ID2B 1OC9A 3NIVA 3D5JA 2EIQA 1SKSB 3A2WA 2TRXA 5HFGA 2LQOA 4K2DA 6GSVA 2UV8G 1XVQA 3F4SA 3FEUA 4PXOA 2RM5A 1I9DA 1GL8A 4MPFA 1Z3EA 2K8SA 1FVKA 3D22A 4X4JA 3D4TA 5D96A 1K3YA 3W8SA 1OVNA 2HSMA 3UOMA 2V6KA 2V2GA 4P3YB 2KHPA 3CBUA 2PPTA 4FQUA 4IP6A 2FD3A 1M9BA 5GSSA 3H1NA 5JWRB 1N2AA 1SYXA 1YJ6A 2H1DA 2H70A 4KNDA 3PPUA 2H30A 1PKZA 4EXJA 1AQWA 2H75A 2HT9A 1B9XC 3RBTA 3ZFBA 4XRDA 4BL7B 1ERWA 4L0WA 5FWGA 1RQMA 1HNCA 1J0FA 3EWLA 3IAM2 4AKXB 1TRUA 1THOA 1G6YA 2DSAA 1ILOA 2VCVA 2L4CA 5IMVA 3D21A 3GA4A 5B6NA 4EE0A 1OAZA 2PERA 1A2JA 2C0DA 1SL0B 3GRXA 2VM2A 4PUFC 3F8UA 3H79A 3BCKA 1ZYPA 1A24A 1O7UA 2QSIA 3NZNA 2L5LA 3A5WA 1Z9HA 1K0AA 5EPFA 2REMA 2WB9A 4BA7A 1X5CA 5GAND 3UJ1A 2FWGA 3TUEA 2R5GA 2YP6A 2DMLA 1USBA 3RAZA 4NAXA 3O3TA 4JBBA 5AISA 3GL3A 3IV4A 3DGQA 4XS4A 4IGJA 1YZXA 3UVHA 3BOAA 2OBIA 4RQXA 4WR5A 2CAIA 2WDUA 3ISOA 1AC1A 2ALBA 4O5QA 2JZSA 3FKFA 4IP1A 3VK9A 2VCZA 1OC3A 1MDKA 2C0FA 2YPMA 2FCHA 2X8HA 2GZYA 4OFTA 4Q5NA 2CAQA 5F07A 1SL2B 5IQYA 4PTSA 1V98A 1XOAA 1MD4A 18GSA 1KBNA 4PUAA 1TRWA 2H0HA 1PX7A 1SVMA 2AV4A 4JR4A 5AGYA 2YWNA 3O76A 2DJ1A 2DJ3A 4I97A 5A5HB 3HZ4A 3ED3A 4IKHA 5ELGA 1FHEA 2YJ7A 3MWHA 5G31A 1KTEA 5IMZA 3DVWA 3HDCA 1Y25A 2H0GA 2LNTA 1O6JA 4W66A 3UARA 1T7PB 3IK7A 5CRGA 4IBPA 3VPTA 1K0BA 2N5FA 4KF9A 5G5FA 2VM1A 2OBKA 4OCFA 2H1BA 1T3BA 2HI7A 2H71A 2L5OA 3IHQA 2X8GA 1X9SB 1XIYA 3C1SA 1XWCA 2DKHA 4HJMA 3G7IA 1MDIA 1EWXA 1X5DA 4HU9A 4ECJA 1YDKA 3LJRA 5DALB 4EL1A 3W8JA 2IMIA 4V2NA 3BCIA 4QMKA 2OKAA 3M9JA 1PQNA 5C04A 2H19A 3J7Yk 2IFQB 3P7XA 2HSNA 4NWYA 1TI3A 3ZITA 5G1LA 4HZ4A 2JZRA 5J9BA 3US3A 3ME7A 5B7CA 4EDYA 3APSA 4V1Ag 4OFMA 5A4UA 3VLNA 4EUYA 3MAKA 3M9KA 5KN0A 1MD3A 2H74A 3A5IA 4MABA 1TU8A 4N0VA 1PL2A 3EPTA 3I6AA 1K3LA 2FA4A 3HVVA 4N11A 2H1GA 3ZL5A 4F0CA 2B7JA 2LJRA 3HZ8A 2OT3A 3WGDA 2BJXA 5LCZA 4KCAA 2O85A 5D9TA 4BPYA 3HHVA 1GSDA 1XW5A 1TP9A 1ERUA 2VCWA 1XBSA 4KX4A 1AQXA 5CAXA 2P5QA 3U5RE 3CXGA 4V2LA 1HNAA 4GSTA 3EINA 4KDYA 3GSSA 1R5PA 1SU9A 5CREA 1TRSA 1EGRA 2P31A 1CQHA 5KN3A 3L9SA 2L57A 1A2LA 4GQFA 1SKRB 5DDLA 1XVWA 3EURA 4WEYA 5IMFA 3TRPA 5CO3A 4NHZA 1J9BA 3QDNA 3TCOA 3TRXA 4G0IA 2YZUA 1GH2A 3Q19A 2VCXA 1RW1A 1THXA 1Z6NA 3GV1A 5A1NB 2VD1A 1EP8A 3M8NA 4TXVA 3CWGA 2HRKB 5D9XA 3D4MA 1J08A 11GSA 1X9WB 4O92A 6GSSA 5DVBA 5BMUA 1SYRA 2IN3A 3BD2A 1GSUA 2JACA 4OO5A 2D2ZA 3WT2A 3IC8A 1U3IA 2A4VA 3A3TA 4HDEA 4FYUA 4EO3A 1F6MC 1BQ7A 2HRNA 4G2EA 5HR1A 4BVYB 4ID0A 4CDOA 4HI7A 1SK0A 2VD0A 4HU7A 4GSNA 4BVXA 3E3EA 3ZVJD 1A8YA 2HZFA 2EFCA 5B8AA 4Z2TA 4FO5A 1S3AA 4JE1A 2F3MA 3GKMA 4ZIJA 1SD8A 2C8UA 3EMPA 4ILFA 2GT5A 5IOXA 1VF1A 3VWWA 3GKNA 2YWMA 1GNWA 5CP1A 5J41A 2EFEA 2JSZA 5C00A 1HNBA 3WT1A 1XW6A 4IJIA 3E9JB 3IRAA 1BF5A 2VL2A 3UAPA 2DIYA 2YZHA 1QMVA 2C3NA 3EE2A 4ICYA 2E7PA 2R6KA 5DJMA 2QKEA 4K1FA 2B1LA 2FHEA 1K0DA 3UL3A 3UBLA 2VLVA 4L0UA 1TOFA 4G10A 3FZ4A 2QA1A 1OC8A 1SKWB 4ECBA 4AI6A 2I9HA 3FHKA 4NPBA 1OKTA 4DSSA 2MYGA 1OYJA 2WRTA 4YAPA 4ECCA 10GSA 5H5QA 5A34A 4KGIA 4POKA 3ZZXA 5G1KA 2JU5A 2PUKC 1HD2A 1FO5A 2XC2A 1VRSD 2HSYA 2C0GA 2V6OA 4EF0A 1EEJA 4K7NA 1AW9A 1GLQA 14GSA 3TKSC 19GSA 4MJBA 4WXTA 1QQ2A 3IC4A 4HEA2 3FY7A 2F8FA 2NDOA 3KIJA 3LYPA 3RDWA 4EVMA 2RIIA 4IVFA 2AUVA 2HRAA 1JZDA 4N0ZA 2GZZA 5DQSA 2H76A 3GTUB 3U6VA 5HR2A 4MZBA 1T1VA 4MLYA 3HD5A 1O8WA 1JFUA 6GSXA 1UN2A 3G7JA 3DIEA 3CSJA 4GWRA 3NOFA 2A2SA 3TJGA 3MIXA 5KN2A 2IMDA 1YEXA 1QK8A 3GHAA 5DAKB 5F05A 3WGEA 1Q98A 4KDXA 4TR0A 2WCIA 4OWYA 4ZBAA 1XW9A 3QPMA 5J3RA 1AXDA 4IS0A 1FW1A 3D6IA 2I1UA 4TR1B 1DE2A 2YN1A 2X8CA 3A2XA 4AKHA 5ECPB 3IBHA 3WGXA 1NSWA 3UMAA 2QA2A 3HY2A 5IM9A 2MZCA 2GLRA 5F06A 2EIOA 1E2YA 4V2MA 1MTCA 4EIQA 4QQ7A 4BL7A 4KH7A 4NXIA 1KEBA 3A2VA 3APQA 1AUCA 1TW9A 2H6YA 2LV3A 1EZKA 1EOGA 2E2GA 1FOVA 1F2EA 3N9JA 1YEPA 1V57A 1K0OA 2JL4A 4JEDA 1A23A 2KP2A 2MMNA 1T8EB 4MZWA 1ABAA 3APOA 2VLUA 3KTLA 5ECKB 5IO2A 1K0NA 1TXXA 1MDJA 1TK0B 4OCEA 2OE0A 4GRFA 4POMA 2XPDA 4MH2A 2PN8A 5DCGA 2HRFA 3IOSA 2AYTA 3FZ5A 4YKGA 3FR9A 3QAGA 2IMKA 2E2MA 2ZNMA 3KP8A 4KSOA 4K0GA 3BJ5A 2FUG2 4O5UA 2IPAA 1PX6A 1NW2A 3CTFA 3LGCA 2VCTA 3FYGA 2YANA 4RQRA 4XIHA 2VO4A 1SENA 1FB6A 2X4AA 4AJ7A 3GX8A 5F0GA 2LUSA 1FB0A 1VF3A 1PL1A 3TGZA 4YQUA 1Q4JA 2LEGA 2LJKA 4X43A 1U6TA 4DSQA 1GTIA 3QOUA 4G01A 3UIWA 4KAEA 1EV9A 4TXOB 1M0UA 4PNFA 5IPGA 3IA1A 3QR6A 2EIRA 4Z7XA 1T4YA 1F9MA 1B48A 4I8BA 4MH3A 1TDIA 4MNNA 4XRAA 3F3QA 1KNGA 3QFBC 2WJUA 4DSRA 3ZYWA 2CT6A 1PKWA 5A5HA 1GSEA 3LSZA 1X0RA 2B5XA 2RUEA 3I43A 3H4KA 4KUNA 1F3BA 4ISDA 3GKKA 1TK8B 2DJJA 3VFIA 3IR4A 4QL9A 2O7KA 4WF5A 5KOWA 1GSQA 5E59A 2B5EA 3P2AA 3M1GA 4YKFA 3CSIA 6GSTA 2H66A 4ML1A 3EMXA 1SVOA 1B4QA 4Q5FA 5JCWA 4HZ2A 2LRCA 5CYYA 4JR6A 3RHCA 1TRVA 1VF4A 1HYUA 4K6XA 3JCML 2BTOT 3KCMA 4OMVA 1A2MA 2EC4A 1S3DA 3H93A 4RI7A 5DALA 2DBCA 2E0QA 5GSTA 7GSSA 5E4WA 2IFQA 2DLXA 2QC7A 4WR4A 5J5NA 4F82A 4K7OA 2HSHA 5ECSA 1WWJA 2GZPA 4XCSA 1AAZA 2XHFA 4TN8A 3G7YA 2IMEA 3GURA 1Z7PA 1YF1A 2H01A 1K0CA 3SBCA 1Z7RA 1FG4A 2VL9A 3UVTA 5ECIB 1JHBA 3LXTA 4J57E 2LNSA 1FOHA 3CSHA 4G9HA 1TTZA 1F37A 5HFIA 4MJCA 3C7MA 3GMFA 2NTOA 4X1UA 4K7IA 1ST9A 1SL1B 1WIKA 3PINA 4LMVA 3FRCA 2A2RA 3RPPA 1S3CA 1GTBA 1M7TA 2ON7A 4O7HA 2X64A 2FNOA 2B1KA 2M80A 5IOWA 2WZ9A 2LTKA 3EU4A 3IXRA 4HJ2A 1PN9A 3TU3B 3H8QA 5ECHB 5J9CA 1WPIA 2DJ0A 5HQPA 2HE3A 4A5PA 1GUMA 4K8MA 4MA9A 5INYA 5ECRB 2G0FA 4H86A 2KLXA 1X9MB 1NM3A 1PA3A 5G30A 1BYEA 2L4QA 4KE3A 1OE8A 4HQZA 4BWSA 4MP4A 2PVQA 1WOUA 2RM6A 1B4PA 3ZIJA 1I5GA 16GSA 5A1NA 2R37A 4JU5A 2JZTA 2UZ8A 4Q5RA 4OO4A 2HRKA 1EEMA 1AIUA 1JZOA 1TK5B 3VWVA 2EFDA 3KH9A 4N30A 1N8JA 3SWLA 4TR4A 1X5EA 2DMMA 3HXSA 2OACA 3TJFA 1LJRA 2N5AA 4XS6A 2PBJA 4K2XA 3IK9A 2F9SA 1DUGA 3LWAA 4FH8A 3IAS2 1TU7A 4AGSA 3DEXA 4D73B 3HKRA 5D8IA 5D73A 5AIXA 3KJYA 2KUCA 3ERGA 3F4TA 2R0CA 3KMNA 2H73A 4Z2RA 1UC7A 2ON5A 1ERTA 1WP0A 5KN1A 2V41A 1XZOA 4KB3A 4GCIA 3W6GA 1GULA 2NPBA 4KW6A 1F3AA 3P90A 4ZILA 4TW5A 1GUKA 2CVBA 2F51A 1Y6EA 3L9VA 1ZYNA 3HMJG 2J23A 3TJJA 4L8EA 5A4VA 2O8VB 4FIWA 2ES7A 2C3TA 4ZB9A 4XS1A 3ZIVA 2AB6A 1ZMAA 2K6VA 4L5OA 4K9ZA 3F0IA 5EVOA 1ACVA 1G7EA 4KSMA 2LRTA 3OR5A 4ZB7A 12GSA 5JWOB 2OE1A 1ZGNA 4AJ6A 1UA5A 1BJXA 3KD0A 3C71A 1WMJA 5HFKA 2C80A 1BAYA 3QMXA 1EP7A 1IYHA 2CQ9A 3MSZA 1XWBA 3PH9A 4PQ1A 1GUHA 5H5RA 3VURA 2X49A 4F9ZA 4WBJA 1G7OA 2WULA 4ML6A 1YKCA 2AJQB 2VCQA 3GSTA 3HVSA 2LKUA 3R2QA 2GGTA 3ZMKA 3I9V2 2R0PA 3R3EA 3FZ9A 3UEMA 2GS3A 3GTUA 4GDFA 4WETA 1HQOA 3CRUA 3F9UA 1XXUA 2HYXA 1V9WA 3P8WA 2VAFA 3VWXA 2FWFA 1YY7A 3N5OA 3UBKA 5DBQA 5EL8A 1R26A 5IPHA 5J4VA 3ZTLA 2KP1A 1LU4A 2YOIA 4QL7A 1QUWA 5DAKA 5ECQB 4ZB8A 2FA8A 4XHMA 4AJ8A 2H1LA 1JLVA 4L5LA 1XCCA 3QAWA 4TR1A 3Q74A 3KMOA 3MYDA 4ULXA 6GSYA 5HR0A 3GKXA 5ID2A 3TKRA 2I81A 3DD3A 4ZL7A 3PGTA 2DIZA 4IJ3A 4IQ1A 4WF4A 2YWOA 1PRXA 4G19A 2I4AA 5J4YA 3CRTA 4Q5QA 3EC3A 3AY8A 2IJYA 5CNWA 3LEFA 1GNEA 2B3SA 4F0BA 2HZEB 4CY6A 4MCUA 1GTAA 1NHYA 2CZ3A 5JWQB 2IWTA 3G9BA 3QD9A 2HLSA 1UVZA 2HFDA 4OD7A 4EDZA 4J56E 4POLA 4GF0A 2MMOA 3LW9A 4V1Ap 1SD9A 1JZWA 1SJIA 1M99A 3Q6OA 2YJHA 2CVKA 4BWQA 4F03A 3KH7A 2IL3A 4MK3A 4PQIA 5IIZA 4KDUA 1ML6A 1VGLA 3DVXA 1O8XA 5JCUA 3GYKA 4HOJA 5GZZB 2VKZG 4EC0A 3TJKA 3L4NA 1B8XA 2M46A 2V1MA 1A8LA 3VI5A 4IW9A 1IYIA 3HJOA 3TKQA 4YH2A 5CRHA 3TRQA 2CVDA 2FGXA 4LA1A 5LD0A 1QFNA 1JLWA 4TXOA 3L0HA 5D93A 1ZYEA 2DKIA 5CRWA 1SJZA 1OC9B 3LQ7A 4PX1A 4MF7A 1OE7A 1ZYQB 3LYKA 3L9UA 4JRRA 1U87A 2H6XA 1U88A 2NBSA 5D9WA 4POBA 2VL2C 1DE1A 1RK4A 2JSYA 1VF2A 3CTGA 5A4WA 2HSMB 4I5QA 3I69A 2GQLA 3ERWA 2H6ZA 1ERVA 2CX4A 1W4VA 3GUSA 2K8VA 4IELA 3GIXA 2RUFA 1R5AA 3CYNA 2VUPA 4USSA 4ACSA 3DXBA 2O5VA 4WKWA 3TJBA 4KCEA 2GSSA 5J47A 4HUAA 1M2DA 2XBIA 2YWIA 4AKGA 1ZCPA 4ECIA 3FW2A 3LG6A 4N10A 3LFLA 1W89A 3TOTA 1GSSA 2MMZA 4GLTA 4K0NA 4N3ZA 3LORA 2MMAA 5HR3A 1G0TA 1QXHA 2JADA 3GFKA 2F8AA 2MBSA 3MDKA 1GRXA 2L6DA 4KA0A 5DJLA 1AQVA 1EOHA 3DKSA 4ZL8A 3ZFLA 4TVEA 4DEJA 1YF0A 2XPEA 4MZCA 4NV2A 4X0XA 1YVLA 1Y1UA 2C4JA 5B8BA 2YV7A 4ZBBA 4ZBDA 1PGTA 4IN0A 3ZVJA 4GQCA 3S9FA 2P0GA 2R0GA 2OE3A 3KM6A 2VOCA 4HS1A 4IQAA 3ERFA 1G6WA 1NHOA 2CA8A 1E6BA 4O32A 4XTSA 1Z6MA 4XS4B 4OFNA 4F2IA 3EVIA 3D0ZA 4MPGA 4J2FA 2L6CA 3EU3A 4TR3A 1V58A 2FWHA 4LMWA 5G2ZA 2G2QA 5IMDA 1XWAA 2KOKA 2OJLA 1K3OA 1CQGA 9GSSA 4MDCA 3WYWA 4FYCA 1ZL9A 8GSSA 2GTUA 2M72A 3VI7A 3C1RA 3FMWA 1ZZYA 2H8LA 4CY8A 4PGTA 2R3XA 4CHSA 1TJDA 3HJMA 1EGOA 4E68A 1SJ6A 1ON4A 3ZLPA 2GSQA 2K9FA 1DBYA 3PR8A 3VPQA 5LNKe 5G5EA 1WE0A 4EKZA 5ELAA 1JZRA 2WGRA 2GT6A 3KP9A 1WRYA 2ZUPA 1SK1A 3ME8A 3O6TA 2YV9A 2LRNA 2VL3A 2LJAA 4LL4B 1XWGA 4PNGA 4MJEA 5IO0A 3C8EA 5KOXA 2VIMA 3TKSA 1GTUA 3GN3A 2C0EA 3CMIA 2H0IA 1BX9A 3E0UA 6GSWA 1GLPA 1XOBA 4YQMA 1QGVA 3QCPA 2X99A 2H1AA 4TRXA 3KTBA 4D73A 1GSYA 5AIVA 2P5RA 3KGKA 2AAWA 4NV5A 4K5SA 2DC5A 4TOPA 2DJ2A 3TDGA 2AHEA 3IE3A 1O73A 3GNJA 2BMXA 4E8EA 17GSA 1MEKA 3GL5A 2CX3A 2HSNB 4NHWA 4MMMA 4ZXGA 5ABRA 3KXOA 1M2BA 4ZL9A 2J9HA 2FY6A 2TIRA 2PWJA 3FZAA 2C3QA 4BVYA 1O85A 3F3RA 2MBTA 3FR3A 2I3YA 1FVJA 1TKDB 4E8HA 2N5BA 3TKPA 4I2UA 4PURA 5ENUA 2O89A 1V2AA 3DRNA 3DWVA 2XBQA 3WD6A 2GQKA 5IMCA 2OADA 3C73A 1BG1A 1R7HA 4TKYA 3V1WA 1URMA 4Z2UA 5B6MA 3EYTA 3MNGA 5DCHA 1ZOFA 2L59A 5IMAA 1U3AA 2B7KA 1PD21 3M0FA 5KEJA 2WFCA 1YQ1A 2R4VA 2GDRA 2TRCP 4PQHA 1T4ZA 4AF2A 3LXZA 4GXZA 2CV4A 1R4WA 1OKDA 2B5YA 2ZCTA 4HQSA 2CZ2A 4GTUA 22GSA 4MF6A 4WBRD 4K5RA 3FK8A 3F63A 2IIYA 5JCGA 4RUVA 3DMLA 13GSA 4DVCA 2O87A 2HNLA 3IDVA 3ZRDA 2K18A 2LSTA 4LLRA 5ECNB 5H5SA 3HVXA 3J7Yb 1WJKA 5J40A 4FYBA 4AKIA 4IHUA 1K0MA 1PMTA 2C1YA 4I2TA 5BMUB 3F6FA 1BEDA 2DJKA 4LL1B 5D9VA 2OA7A 1EV4A 4EIPA 2QGVA 3HA9A 1GWCA 2Z9SA 5ECLB 3DYRA 4BVXB 4NMUA 2YCDA 1DSBA 1XPVA 2GVPA 2A2PA 3FR6A 1SK2A 3ZREA 2LQQA 3RHBA 4O5RA 5GAPD 3F6DA 2PU9C 2H72A 2GSRA 2GSTA 3GH6A 4G0LA 3TKSE 6GSUA 3HCZA 2V32A 2PMTA 2RLIA 3GH9A 1PN0A 2B6MA 5CRDA 4ZB6A 5AN1A 1M2AA 3ZMLA 1V40A 2HZEA 1FAAA 2VLTA 1PSQA 3F4RA 4MF5A 4G0KA 1BG5A 2R2JA 1XFLA 4YAVA 1A0FA 5J4UA 4JZQA 3TB2A 2GQMA 3KZQA 1A0RP 3QAVA 5F8BA 1XWKA 3M3MA 3IHGA 2PVOC 4I6XA 5FT3A 2IMFA 2WS2A 3KEBA 2YNXA 5EY6A 5ECMB 20GSA 1O81A 1B9YC 5FHIA 1GP1A 2A4HA 5BRTA 1H75A 1H4OA 1M9AA 4YQVA 4DSSB 5A5KA 4GSSA 2LS5A 5A34B 1N25A 2EFHA 4MJAA 1TI1A 2FWEA 1C72A 2HXKA 2HQTA 3BBYA 3HJPA 3QFAC 1SVLA 4CW9A 4RI6A 3IPZA 3TOUA 1YKAA 5ECOB 1Z5YE 2PGTA 3VWUA 5L71A 2NVLA 5DQYA 1LBKA 3Q18A 2FLSA 3HYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T00 A;  5COH A;  3L78 A;  1GSF A;  3RPN A;  3GX0 A;  3K8N A;  5ID2 B;  1OC9 A;  3NIV A;  3D5J A;  2EIQ A;  1SKS B;  3A2W A;  2TRX A;  5HFG A;  2LQO A;  4K2D A;  6GSV A;  1XVQ A;  3F4S A;  3FEU A;  4PXO A;  2RM5 A;  1I9D A;  1GL8 A;  4MPF A;  1Z3E A;  2K8S A;  1FVK A;  3D22 A;  3D4T A;  5D96 A;  1K3Y A;  3W8S A;  1OVN A;  2HSM A;  3UOM A;  2V6K A;  2V2G A;  4P3Y B;  2KHP A;  3CBU A;  2PPT A;  4FQU A;  4IP6 A;  2FD3 A;  1M9B A;  5GSS A;  3H1N A;  5JWR B;  1N2A A;  1SYX A;  1YJ6 A;  2H1D A;  2H70 A;  4KND A;  3PPU A;  2H30 A;  1PKZ A;  4EXJ A;  1AQW A;  2H75 A;  2HT9 A;  1B9X C;  3RBT A;  3ZFB A;  4XRD A;  4BL7 B;  1ERW A;  4L0W A;  5FWG A;  1RQM A;  1HNC A;  1J0F A;  3EWL A;  3IAM 2;  1TRU A;  1THO A;  1G6Y A;  2DSA A;  1ILO A;  2VCV A;  2L4C A;  5IMV A;  3D21 A;  3GA4 A;  5B6N A;  4EE0 A;  1OAZ A;  2PER A;  1A2J A;  2C0D A;  1SL0 B;  3GRX A;  2VM2 A;  4PUF C;  3F8U A;  3H79 A;  3BCK A;  1A24 A;  1O7U A;  2QSI A;  3NZN A;  2L5L A;  3A5W A;  1Z9H A;  1K0A A;  5EPF A;  2REM A;  2WB9 A;  4BA7 A;  1X5C A;  5GAN D;  3UJ1 A;  2FWG A;  3TUE A;  2R5G A;  2YP6 A;  2DML A;  1USB A;  3RAZ A;  4NAX A;  3O3T A;  4JBB A;  5AIS A;  3GL3 A;  3IV4 A;  3DGQ A;  4XS4 A;  4IGJ A;  1YZX A;  3UVH A;  3BOA A;  2OBI A;  4RQX A;  4WR5 A;  2CAI A;  2WDU A;  3ISO A;  1AC1 A;  2ALB A;  2JZS A;  3FKF A;  4IP1 A;  3VK9 A;  2VCZ A;  1OC3 A;  1MDK A;  2C0F A;  2YPM A;  2FCH A;  2X8H A;  2GZY A;  4OFT A;  4Q5N A;  2CAQ A;  5F07 A;  1SL2 B;  5IQY A;  4PTS A;  1V98 A;  1XOA A;  1MD4 A;  18GS A;  1KBN A;  4PUA A;  1TRW A;  2H0H A;  1PX7 A;  2AV4 A;  4JR4 A;  5AGY A;  2YWN A;  3O76 A;  2DJ1 A;  2DJ3 A;  4I97 A;  3HZ4 A;  3ED3 A;  4IKH A;  5ELG A;  1FHE A;  2YJ7 A;  3MWH A;  5G31 A;  1KTE A;  5IMZ A;  3DVW A;  3HDC A;  1Y25 A;  2H0G A;  2LNT A;  1O6J A;  3UAR A;  1T7P B;  3IK7 A;  5CRG A;  4IBP A;  3VPT A;  1K0B A;  2N5F A;  4KF9 A;  5G5F A;  2VM1 A;  2OBK A;  4OCF A;  2H1B A;  1T3B A;  2HI7 A;  2H71 A;  2L5O A;  3IHQ A;  2X8G A;  1X9S B;  1XIY A;  3C1S A;  1XWC A;  4HJM A;  3G7I A;  1MDI A;  1EWX A;  1X5D A;  4HU9 A;  4ECJ A;  1YDK A;  3LJR A;  5DAL B;  4EL1 A;  3W8J A;  2IMI A;  4V2N A;  3BCI A;  2OKA A;  3M9J A;  1PQN A;  5C04 A;  2H19 A;  3J7Y k;  2IFQ B;  3P7X A;  4NWY A;  1TI3 A;  3ZIT A;  5G1L A;  4HZ4 A;  2JZR A;  5J9B A;  3US3 A;  3ME7 A;  5B7C A;  4EDY A;  3APS A;  4V1A g;  4OFM A;  5A4U A;  3VLN A;  4EUY A;  3MAK A;  3M9K A;  5KN0 A;  1MD3 A;  2H74 A;  4MAB A;  1TU8 A;  4N0V A;  1PL2 A;  3I6A A;  1K3L A;  2FA4 A;  3HVV A;  4N11 A;  2H1G A;  3ZL5 A;  4F0C A;  2B7J A;  2LJR A;  3HZ8 A;  3WGD A;  2BJX A;  5LCZ A;  4KCA A;  2O85 A;  5D9T A;  4BPY A;  3HHV A;  1GSD A;  1XW5 A;  1TP9 A;  1ERU A;  2VCW A;  1XBS A;  4KX4 A;  1AQX A;  5CAX A;  2P5Q A;  3U5R E;  3CXG A;  4V2L A;  1HNA A;  4GST A;  3EIN A;  4KDY A;  3GSS A;  1R5P A;  1SU9 A;  5CRE A;  1TRS A;  1EGR A;  2P31 A;  1CQH A;  5KN3 A;  3L9S A;  2L57 A;  1A2L A;  4GQF A;  1SKR B;  5DDL A;  1XVW A;  3EUR A;  4WEY A;  5IMF A;  3TRP A;  5CO3 A;  4NHZ A;  1J9B A;  3QDN A;  3TCO A;  3TRX A;  4G0I A;  2YZU A;  1GH2 A;  3Q19 A;  2VCX A;  1RW1 A;  1THX A;  1Z6N A;  3GV1 A;  2VD1 A;  1EP8 A;  3M8N A;  4TXV A;  2HRK B;  5D9X A;  3D4M A;  1J08 A;  11GS A;  1X9W B;  4O92 A;  6GSS A;  5DVB A;  5BMU A;  1SYR A;  2IN3 A;  3BD2 A;  1GSU A;  2JAC A;  4OO5 A;  2D2Z A;  3WT2 A;  3IC8 A;  1U3I A;  2A4V A;  3A3T A;  4HDE A;  4FYU A;  4EO3 A;  1F6M C;  1BQ7 A;  2HRN A;  4G2E A;  5HR1 A;  4BVY B;  4ID0 A;  4CDO A;  4HI7 A;  1SK0 A;  2VD0 A;  4HU7 A;  4GSN A;  4BVX A;  3E3E A;  3ZVJ D;  1A8Y A;  2HZF A;  5B8A A;  4FO5 A;  1S3A A;  4JE1 A;  2F3M A;  3GKM A;  4ZIJ A;  1SD8 A;  2C8U A;  3EMP A;  4ILF A;  2GT5 A;  5IOX A;  1VF1 A;  3VWW A;  3GKN A;  2YWM A;  1GNW A;  5CP1 A;  5J41 A;  2JSZ A;  5C00 A;  1HNB A;  3WT1 A;  1XW6 A;  4IJI A;  3E9J B;  3IRA A;  2VL2 A;  3UAP A;  2DIY A;  2YZH A;  1QMV A;  2C3N A;  3EE2 A;  2E7P A;  2R6K A;  5DJM A;  2QKE A;  4K1F A;  2B1L A;  2FHE A;  1K0D A;  3UL3 A;  3UBL A;  2VLV A;  4L0U A;  1TOF A;  4G10 A;  3FZ4 A;  1OC8 A;  1SKW B;  4ECB A;  2I9H A;  3FHK A;  4NPB A;  1OKT A;  4DSS A;  2MYG A;  1OYJ A;  2WRT A;  4YAP A;  4ECC A;  10GS A;  5H5Q A;  4KGI A;  4POK A;  3ZZX A;  5G1K A;  2JU5 A;  2PUK C;  1HD2 A;  1FO5 A;  2XC2 A;  1VRS D;  2HSY A;  2C0G A;  2V6O A;  4EF0 A;  1EEJ A;  4K7N A;  1AW9 A;  1GLQ A;  14GS A;  3TKS C;  19GS A;  4MJB A;  4WXT A;  1QQ2 A;  4HEA 2;  3IC4 A;  3FY7 A;  2F8F A;  2NDO A;  3KIJ A;  3LYP A;  3RDW A;  4EVM A;  2RII A;  4IVF A;  2AUV A;  2HRA A;  1JZD A;  4N0Z A;  2GZZ A;  5DQS A;  2H76 A;  3GTU B;  3U6V A;  5HR2 A;  4MZB A;  1T1V A;  4MLY A;  3HD5 A;  1O8W A;  1JFU A;  6GSX A;  1UN2 A;  3G7J A;  3DIE A;  3CSJ A;  4GWR A;  3NOF A;  2A2S A;  3TJG A;  5KN2 A;  2IMD A;  1YEX A;  1QK8 A;  3GHA A;  5DAK B;  5F05 A;  3WGE A;  1Q98 A;  4KDX A;  4TR0 A;  2WCI A;  4OWY A;  4ZBA A;  1XW9 A;  3QPM A;  5J3R A;  1AXD A;  4IS0 A;  1FW1 A;  3D6I A;  2I1U A;  4TR1 B;  1DE2 A;  2YN1 A;  2X8C A;  3A2X A;  5ECP B;  3IBH A;  3WGX A;  1NSW A;  3UMA A;  5IM9 A;  3HY2 A;  2MZC A;  2GLR A;  5F06 A;  2EIO A;  1E2Y A;  4V2M A;  1MTC A;  4QQ7 A;  4BL7 A;  4KH7 A;  4NXI A;  1KEB A;  3A2V A;  3APQ A;  1AUC A;  1TW9 A;  2H6Y A;  2LV3 A;  1EZK A;  1EOG A;  2E2G A;  1FOV A;  1F2E A;  3N9J A;  1YEP A;  1V57 A;  1K0O A;  2JL4 A;  4JED A;  1A23 A;  2KP2 A;  2MMN A;  1T8E B;  4MZW A;  1ABA A;  3APO A;  2VLU A;  3KTL A;  5ECK B;  5IO2 A;  1K0N A;  1TXX A;  1MDJ A;  1TK0 B;  4OCE A;  2OE0 A;  4GRF A;  4POM A;  2XPD A;  4MH2 A;  2PN8 A;  5DCG A;  2HRF A;  3IOS A;  2AYT A;  3FZ5 A;  3FR9 A;  3QAG A;  2IMK A;  2E2M A;  2ZNM A;  3KP8 A;  4KSO A;  4K0G A;  3BJ5 A;  2FUG 2;  2IPA A;  1PX6 A;  1NW2 A;  3CTF A;  3LGC A;  2VCT A;  3FYG A;  2YAN A;  4RQR A;  4XIH A;  2VO4 A;  1SEN A;  1FB6 A;  4AJ7 A;  3GX8 A;  5F0G A;  2LUS A;  1FB0 A;  1VF3 A;  1PL1 A;  3TGZ A;  4YQU A;  1Q4J A;  2LEG A;  2LJK A;  4X43 A;  1U6T A;  4DSQ A;  1GTI A;  3QOU A;  3UIW A;  4KAE A;  1EV9 A;  4TXO B;  1M0U A;  4PNF A;  5IPG A;  3IA1 A;  3QR6 A;  2EIR A;  4Z7X A;  1T4Y A;  1F9M A;  1B48 A;  4I8B A;  4MH3 A;  1TDI A;  4XRA A;  3F3Q A;  1KNG A;  3QFB C;  2WJU A;  4DSR A;  3ZYW A;  2CT6 A;  1PKW A;  1GSE A;  3LSZ A;  1X0R A;  2B5X A;  2RUE A;  3I43 A;  3H4K A;  4KUN A;  1F3B A;  4ISD A;  3GKK A;  1TK8 B;  2DJJ A;  3VFI A;  3IR4 A;  4QL9 A;  2O7K A;  4WF5 A;  1GSQ A;  5E59 A;  2B5E A;  3P2A A;  3M1G A;  3CSI A;  6GST A;  2H66 A;  4ML1 A;  3EMX A;  1B4Q A;  4Q5F A;  5JCW A;  4HZ2 A;  2LRC A;  5CYY A;  4JR6 A;  3RHC A;  1TRV A;  1VF4 A;  1HYU A;  4K6X A;  3JCM L;  2BTO T;  3KCM A;  4OMV A;  1A2M A;  2EC4 A;  1S3D A;  3H93 A;  4RI7 A;  5DAL A;  2DBC A;  2E0Q A;  5GST A;  7GSS A;  5E4W A;  2IFQ A;  2DLX A;  2QC7 A;  4WR4 A;  5J5N A;  4F82 A;  4K7O A;  2HSH A;  5ECS A;  1WWJ A;  2GZP A;  4XCS A;  1AAZ A;  2XHF A;  4TN8 A;  3G7Y A;  2IME A;  3GUR A;  1Z7P A;  1YF1 A;  2H01 A;  1K0C A;  3SBC A;  1Z7R A;  1FG4 A;  2VL9 A;  3UVT A;  5ECI B;  1JHB A;  3LXT A;  4J57 E;  2LNS A;  3CSH A;  4G9H A;  1TTZ A;  1F37 A;  5HFI A;  4MJC A;  3C7M A;  3GMF A;  2NTO A;  4X1U A;  4K7I A;  1ST9 A;  1SL1 B;  1WIK A;  3PIN A;  4LMV A;  3FRC A;  2A2R A;  3RPP A;  1S3C A;  1GTB A;  1M7T A;  2ON7 A;  4O7H A;  2X64 A;  2FNO A;  2B1K A;  2M80 A;  5IOW A;  2WZ9 A;  2LTK A;  3EU4 A;  3IXR A;  4HJ2 A;  1PN9 A;  3H8Q A;  5J9C A;  5ECH B;  1WPI A;  2DJ0 A;  5HQP A;  2HE3 A;  1GUM A;  4K8M A;  4MA9 A;  5INY A;  5ECR B;  2G0F A;  4H86 A;  2KLX A;  1X9M B;  1NM3 A;  1PA3 A;  5G30 A;  1BYE A;  2L4Q A;  4KE3 A;  1OE8 A;  4HQZ A;  4BWS A;  4MP4 A;  2PVQ A;  1WOU A;  2RM6 A;  1B4P A;  3ZIJ A;  1I5G A;  16GS A;  2R37 A;  4JU5 A;  2JZT A;  2UZ8 A;  4Q5R A;  4OO4 A;  2HRK A;  1EEM A;  1AIU A;  1JZO A;  1TK5 B;  3VWV A;  3KH9 A;  4N30 A;  1N8J A;  3SWL A;  4TR4 A;  1X5E A;  2DMM A;  3HXS A;  2OAC A;  3TJF A;  1LJR A;  2N5A A;  4XS6 A;  2PBJ A;  3IK9 A;  2F9S A;  1DUG A;  3LWA A;  4FH8 A;  3IAS 2;  1TU7 A;  4AGS A;  3DEX A;  4D73 B;  3HKR A;  5D8I A;  5D73 A;  5AIX A;  3KJY A;  2KUC A;  3ERG A;  3F4T A;  3KMN A;  2H73 A;  1UC7 A;  2ON5 A;  1ERT A;  1WP0 A;  5KN1 A;  2V41 A;  1XZO A;  4KB3 A;  4GCI A;  3W6G A;  1GUL A;  2NPB A;  4KW6 A;  1F3A A;  3P90 A;  4ZIL A;  4TW5 A;  1GUK A;  2CVB A;  2F51 A;  1Y6E A;  3L9V A;  2J23 A;  3TJJ A;  4L8E A;  5A4V A;  2O8V B;  4FIW A;  2ES7 A;  2C3T A;  4ZB9 A;  4XS1 A;  3ZIV A;  2AB6 A;  1ZMA A;  2K6V A;  4L5O A;  4K9Z A;  3F0I A;  5EVO A;  1ACV A;  1G7E A;  4KSM A;  2LRT A;  3OR5 A;  12GS A;  5JWO B;  2OE1 A;  1ZGN A;  4AJ6 A;  1UA5 A;  1BJX A;  3KD0 A;  3C71 A;  1WMJ A;  5HFK A;  2C80 A;  1BAY A;  3QMX A;  1EP7 A;  1IYH A;  2CQ9 A;  3MSZ A;  1XWB A;  3PH9 A;  4PQ1 A;  1GUH A;  5H5R A;  3VUR A;  4F9Z A;  4WBJ A;  1G7O A;  2WUL A;  4ML6 A;  1YKC A;  2AJQ B;  2VCQ A;  3GST A;  3HVS A;  2LKU A;  3R2Q A;  2GGT A;  3ZMK A;  3I9V 2;  3R3E A;  3FZ9 A;  3UEM A;  2GS3 A;  3GTU A;  4WET A;  1HQO A;  3CRU A;  3F9U A;  1XXU A;  2HYX A;  1V9W A;  3P8W A;  2VAF A;  3VWX A;  2FWF A;  1YY7 A;  3N5O A;  3UBK A;  5DBQ A;  5EL8 A;  1R26 A;  5IPH A;  3ZTL A;  2KP1 A;  1LU4 A;  2YOI A;  4QL7 A;  1QUW A;  5DAK A;  5ECQ B;  4ZB8 A;  2FA8 A;  4XHM A;  4AJ8 A;  1JLV A;  4L5L A;  1XCC A;  3QAW A;  4TR1 A;  3Q74 A;  3KMO A;  4ULX A;  6GSY A;  5HR0 A;  3GKX A;  5ID2 A;  3TKR A;  2I81 A;  3DD3 A;  4ZL7 A;  3PGT A;  2DIZ A;  4IJ3 A;  4IQ1 A;  4WF4 A;  2YWO A;  1PRX A;  4G19 A;  2I4A A;  3CRT A;  4Q5Q A;  3EC3 A;  3AY8 A;  2IJY A;  5CNW A;  3LEF A;  1GNE A;  2B3S A;  4F0B A;  2HZE B;  4MCU A;  1GTA A;  1NHY A;  2CZ3 A;  5JWQ B;  2IWT A;  3G9B A;  3QD9 A;  2HLS A;  1UVZ A;  2HFD A;  4OD7 A;  4EDZ A;  4J56 E;  4POL A;  4GF0 A;  2MMO A;  4V1A p;  1SD9 A;  1JZW A;  1SJI A;  1M99 A;  3Q6O A;  2YJH A;  2CVK A;  4BWQ A;  4F03 A;  3KH7 A;  2IL3 A;  4MK3 A;  4PQI A;  5IIZ A;  4KDU A;  1ML6 A;  1VGL A;  3DVX A;  1O8X A;  5JCU A;  3GYK A;  4HOJ A;  5GZZ B;  4EC0 A;  3TJK A;  3L4N A;  1B8X A;  2M46 A;  2V1M A;  1A8L A;  3VI5 A;  4IW9 A;  1IYI A;  3HJO A;  3TKQ A;  4YH2 A;  5CRH A;  3TRQ A;  2CVD A;  2FGX A;  4LA1 A;  5LD0 A;  1QFN A;  1JLW A;  4TXO A;  3L0H A;  5D93 A;  1ZYE A;  5CRW A;  1SJZ A;  1OC9 B;  3LQ7 A;  4PX1 A;  4MF7 A;  1OE7 A;  1ZYQ B;  3LYK A;  3L9U A;  4JRR A;  1U87 A;  2H6X A;  1U88 A;  2NBS A;  5D9W A;  4POB A;  2VL2 C;  1DE1 A;  1RK4 A;  2JSY A;  1VF2 A;  3CTG A;  5A4W A;  2HSM B;  4I5Q A;  3I69 A;  2GQL A;  3ERW A;  2H6Z A;  1ERV A;  2CX4 A;  1W4V A;  3GUS A;  2K8V A;  4IEL A;  3GIX A;  2RUF A;  1R5A A;  3CYN A;  2VUP A;  4USS A;  4ACS A;  3DXB A;  4WKW A;  3TJB A;  4KCE A;  2GSS A;  4HUA A;  1M2D A;  2XBI A;  2YWI A;  1ZCP A;  4ECI A;  3FW2 A;  3LG6 A;  4N10 A;  3LFL A;  1W89 A;  3TOT A;  1GSS A;  2MMZ A;  4GLT A;  4K0N A;  3LOR A;  2MMA A;  5HR3 A;  1G0T A;  1QXH A;  2JAD A;  3GFK A;  2F8A A;  2MBS A;  3MDK A;  1GRX A;  2L6D A;  4KA0 A;  5DJL A;  1AQV A;  1EOH A;  3DKS A;  4ZL8 A;  3ZFL A;  4TVE A;  4DEJ A;  1YF0 A;  2XPE A;  4MZC A;  4NV2 A;  4X0X A;  2C4J A;  5B8B A;  2YV7 A;  4ZBB A;  4ZBD A;  1PGT A;  4IN0 A;  3ZVJ A;  4GQC A;  3S9F A;  2P0G A;  2OE3 A;  3KM6 A;  2VOC A;  4HS1 A;  4IQA A;  3ERF A;  1G6W A;  1NHO A;  2CA8 A;  1E6B A;  4O32 A;  4XTS A;  1Z6M A;  4XS4 B;  4OFN A;  4F2I A;  3EVI A;  3D0Z A;  4MPG A;  4J2F A;  2L6C A;  3EU3 A;  4TR3 A;  1V58 A;  2FWH A;  4LMW A;  5G2Z A;  2G2Q A;  5IMD A;  1XWA A;  2KOK A;  2OJL A;  1K3O A;  1CQG A;  9GSS A;  4MDC A;  3WYW A;  4FYC A;  1ZL9 A;  8GSS A;  2GTU A;  2M72 A;  3VI7 A;  3C1R A;  1ZZY A;  2H8L A;  4PGT A;  2R3X A;  4CHS A;  1TJD A;  3HJM A;  1EGO A;  1SJ6 A;  1ON4 A;  3ZLP A;  2GSQ A;  2K9F A;  1DBY A;  3PR8 A;  3VPQ A;  5LNK e;  5G5E A;  1WE0 A;  4EKZ A;  5ELA A;  1JZR A;  2WGR A;  2GT6 A;  3KP9 A;  1WRY A;  2ZUP A;  1SK1 A;  3ME8 A;  3O6T A;  2YV9 A;  2LRN A;  2VL3 A;  2LJA A;  4LL4 B;  1XWG A;  4PNG A;  4MJE A;  5IO0 A;  3C8E A;  2VIM A;  3TKS A;  1GTU A;  3GN3 A;  2C0E A;  3CMI A;  2H0I A;  1BX9 A;  3E0U A;  6GSW A;  1GLP A;  1XOB A;  4YQM A;  1QGV A;  3QCP A;  2X99 A;  2H1A A;  4TRX A;  3KTB A;  4D73 A;  1GSY A;  5AIV A;  2P5R A;  3KGK A;  2AAW A;  4NV5 A;  2DC5 A;  4TOP A;  2DJ2 A;  3TDG A;  2AHE A;  3IE3 A;  1O73 A;  3GNJ A;  2BMX A;  4E8E A;  17GS A;  1MEK A;  3GL5 A;  2CX3 A;  2HSN B;  4NHW A;  4MMM A;  4ZXG A;  5ABR A;  3KXO A;  1M2B A;  4ZL9 A;  2J9H A;  2FY6 A;  2TIR A;  2PWJ A;  3FZA A;  2C3Q A;  4BVY A;  1O85 A;  3F3R A;  2MBT A;  3FR3 A;  2I3Y A;  1FVJ A;  1TKD B;  4E8H A;  2N5B A;  3TKP A;  4I2U A;  4PUR A;  5ENU A;  2O89 A;  1V2A A;  3DRN A;  3DWV A;  2XBQ A;  3WD6 A;  2GQK A;  5IMC A;  2OAD A;  3C73 A;  1R7H A;  4TKY A;  3V1W A;  1URM A;  5B6M A;  3EYT A;  3MNG A;  5DCH A;  1ZOF A;  2L59 A;  5IMA A;  1U3A A;  2B7K A;  1PD2 1;  3M0F A;  5KEJ A;  2WFC A;  1YQ1 A;  2R4V A;  2GDR A;  2TRC P;  4PQH A;  1T4Z A;  4AF2 A;  3LXZ A;  4GXZ A;  2CV4 A;  1R4W A;  1OKD A;  2B5Y A;  2ZCT A;  4HQS A;  2CZ2 A;  4GTU A;  22GS A;  4MF6 A;  4WBR D;  3FK8 A;  3F63 A;  2IIY A;  5JCG A;  4RUV A;  3DML A;  13GS A;  4DVC A;  2O87 A;  2HNL A;  3IDV A;  3ZRD A;  2K18 A;  2LST A;  4LLR A;  5ECN B;  5H5S A;  3HVX A;  3J7Y b;  1WJK A;  4FYB A;  4IHU A;  1K0M A;  1PMT A;  2C1Y A;  4I2T A;  3F6F A;  1BED A;  2DJK A;  4LL1 B;  5D9V A;  2OA7 A;  1EV4 A;  2QGV A;  3HA9 A;  1GWC A;  2Z9S A;  5ECL B;  3DYR A;  4BVX B;  4NMU A;  2YCD A;  1DSB A;  1XPV A;  2GVP A;  3FR6 A;  1SK2 A;  3ZRE A;  2LQQ A;  3RHB A;  4O5R A;  5GAP D;  3F6D A;  2PU9 C;  2H72 A;  2GSR A;  2GST A;  3GH6 A;  4G0L A;  3TKS E;  6GSU A;  3HCZ A;  2V32 A;  2PMT A;  2RLI A;  3GH9 A;  2B6M A;  5CRD A;  4ZB6 A;  5AN1 A;  1M2A A;  3ZML A;  1V40 A;  2HZE A;  1FAA A;  2VLT A;  1PSQ A;  3F4R A;  4MF5 A;  4G0K A;  1BG5 A;  2R2J A;  1XFL A;  4YAV A;  1A0F A;  5J4U A;  4JZQ A;  3TB2 A;  2GQM A;  3KZQ A;  1A0R P;  3QAV A;  5F8B A;  1XWK A;  3M3M A;  2PVO C;  4I6X A;  5FT3 A;  2IMF A;  2WS2 A;  3KEB A;  2YNX A;  5EY6 A;  5ECM B;  20GS A;  1O81 A;  1B9Y C;  5FHI A;  1GP1 A;  1H75 A;  1H4O A;  1M9A A;  4YQV A;  4DSS B;  5A5K A;  4GSS A;  2LS5 A;  4MJA A;  1TI1 A;  2FWE A;  1C72 A;  2HXK A;  2HQT A;  3BBY A;  3HJP A;  3QFA C;  4CW9 A;  4RI6 A;  3IPZ A;  3TOU A;  1YKA A;  5ECO B;  1Z5Y E;  2PGT A;  3VWU A;  5L71 A;  2NVL A;  5DQY A;  1LBK A;  3Q18 A;  2FLS A;  3HYP A; 
#chains in the Genus database with same CATH topology
 1TXU A;  1T00 A;  5COH A;  3L78 A;  1GSF A;  3RPN A;  3GX0 A;  3K8N A;  5ID2 B;  1OC9 A;  3NIV A;  3D5J A;  2EIQ A;  1SKS B;  3A2W A;  2TRX A;  5HFG A;  2LQO A;  4K2D A;  6GSV A;  2UV8 G;  1XVQ A;  1XG8 A;  3F4S A;  3FEU A;  4PXO A;  2RM5 A;  1I9D A;  1GL8 A;  4MPF A;  1Z3E A;  2K8S A;  1FVK A;  3D22 A;  4X4J A;  3D4T A;  5D96 A;  1K3Y A;  3W8S A;  1OVN A;  2HSM A;  3UOM A;  2V6K A;  2V2G A;  4P3Y B;  2KHP A;  3CBU A;  2PPT A;  4FQU A;  4IP6 A;  2FD3 A;  1M9B A;  5GSS A;  3H1N A;  5JWR B;  1N2A A;  1SYX A;  1YJ6 A;  2H1D A;  2H70 A;  4KND A;  3PPU A;  2H30 A;  1PKZ A;  4EXJ A;  1AQW A;  2H75 A;  2HT9 A;  1B9X C;  3RBT A;  3ZFB A;  4XRD A;  4BL7 B;  1ERW A;  4L0W A;  5FWG A;  1RQM A;  1HNC A;  1J0F A;  3EWL A;  3IAM 2;  4AKX B;  1TRU A;  1THO A;  1G6Y A;  2DSA A;  1ILO A;  2VCV A;  2L4C A;  5IMV A;  3D21 A;  3GA4 A;  5B6N A;  4EE0 A;  1OAZ A;  2PER A;  1A2J A;  2C0D A;  1SL0 B;  3GRX A;  2VM2 A;  4PUF C;  3F8U A;  3H79 A;  3BCK A;  1ZYP A;  1A24 A;  1O7U A;  2QSI A;  3NZN A;  2L5L A;  3CQF A;  3A5W A;  1Z9H A;  1K0A A;  5EPF A;  2REM A;  2WB9 A;  4BA7 A;  1X5C A;  5GAN D;  3UJ1 A;  2FWG A;  3TUE A;  2R5G A;  1PFO A;  2YP6 A;  2DML A;  1USB A;  3RAZ A;  4NAX A;  3O3T A;  4JBB A;  5AIS A;  3GL3 A;  3IV4 A;  3DGQ A;  4XS4 A;  4IGJ A;  1YZX A;  3UVH A;  3BOA A;  2OBI A;  4RQX A;  4WR5 A;  2CAI A;  2WDU A;  3ISO A;  1AC1 A;  2ALB A;  4O5Q A;  2JZS A;  3FKF A;  4IP1 A;  3VK9 A;  2VCZ A;  1OC3 A;  1MDK A;  2C0F A;  2YPM A;  2FCH A;  2X8H A;  2GZY A;  4OFT A;  4Q5N A;  2CAQ A;  5F07 A;  1SL2 B;  5IQY A;  4PTS A;  1V98 A;  1XOA A;  1MD4 A;  18GS A;  1KBN A;  4PUA A;  1TRW A;  2H0H A;  1PX7 A;  1SVM A;  2AV4 A;  4JR4 A;  5AGY A;  2YWN A;  3O76 A;  2DJ1 A;  2DJ3 A;  4I97 A;  5A5H B;  3HZ4 A;  3ED3 A;  4IKH A;  5ELG A;  1FHE A;  2YJ7 A;  3MWH A;  5G31 A;  1KTE A;  5IMZ A;  3DVW A;  3HDC A;  1Y25 A;  2H0G A;  2LNT A;  1O6J A;  4W66 A;  3UAR A;  1T7P B;  3IK7 A;  5CRG A;  4IBP A;  3VPT A;  1K0B A;  2N5F A;  4KF9 A;  5G5F A;  2VM1 A;  2OBK A;  4OCF A;  2H1B A;  1T3B A;  2HI7 A;  2H71 A;  2L5O A;  3IHQ A;  2X8G A;  1X9S B;  1XIY A;  3C1S A;  1XWC A;  2DKH A;  4HJM A;  3G7I A;  1MDI A;  1EWX A;  1X5D A;  4HU9 A;  4ECJ A;  1YDK A;  3LJR A;  5DAL B;  4EL1 A;  3W8J A;  2IMI A;  4V2N A;  3BCI A;  4QMK A;  2OKA A;  3M9J A;  1PQN A;  5C04 A;  2H19 A;  3J7Y k;  2IFQ B;  3P7X A;  2HSN A;  4NWY A;  1TI3 A;  3ZIT A;  5G1L A;  4HZ4 A;  2JZR A;  5J9B A;  3US3 A;  3ME7 A;  5B7C A;  4EDY A;  3APS A;  4V1A g;  4OFM A;  5A4U A;  3VLN A;  4EUY A;  3MAK A;  3M9K A;  5KN0 A;  1MD3 A;  2H74 A;  3A5I A;  4MAB A;  1TU8 A;  4N0V A;  1PL2 A;  3EPT A;  3I6A A;  1K3L A;  2FA4 A;  3HVV A;  4N11 A;  2H1G A;  3ZL5 A;  4F0C A;  2B7J A;  2LJR A;  3HZ8 A;  2OT3 A;  3WGD A;  2BJX A;  5LCZ A;  4KCA A;  2O85 A;  5D9T A;  4BPY A;  3HHV A;  1GSD A;  1XW5 A;  1TP9 A;  1ERU A;  2VCW A;  1XBS A;  4KX4 A;  1AQX A;  5CAX A;  2P5Q A;  3U5R E;  3CXG A;  2WW2 A;  4V2L A;  1HNA A;  4GST A;  3EIN A;  4KDY A;  3GSS A;  1R5P A;  1SU9 A;  5CRE A;  1TRS A;  3HVN A;  1EGR A;  2P31 A;  1CQH A;  5KN3 A;  3L9S A;  2L57 A;  4BIK A;  1A2L A;  4GQF A;  1SKR B;  5DDL A;  1XVW A;  3EUR A;  4WEY A;  5IMF A;  3TRP A;  5CO3 A;  4NHZ A;  1J9B A;  3QDN A;  3TCO A;  3TRX A;  4G0I A;  2YZU A;  1GH2 A;  3Q19 A;  2VCX A;  1RW1 A;  1THX A;  1Z6N A;  3GV1 A;  5A1N B;  2VD1 A;  1EP8 A;  3M8N A;  4TXV A;  3CWG A;  2HRK B;  5D9X A;  3D4M A;  1J08 A;  11GS A;  1X9W B;  4O92 A;  6GSS A;  5DVB A;  5BMU A;  1SYR A;  2IN3 A;  3BD2 A;  1GSU A;  2JAC A;  4OO5 A;  2D2Z A;  3WT2 A;  3IC8 A;  2WZS A;  1U3I A;  2A4V A;  3A3T A;  4HDE A;  4FYU A;  4EO3 A;  1F6M C;  1BQ7 A;  2HRN A;  4G2E A;  5HR1 A;  4BVY B;  4ID0 A;  4CDO A;  4HI7 A;  1SK0 A;  2VD0 A;  4HU7 A;  4GSN A;  4BVX A;  3E3E A;  3ZVJ D;  1A8Y A;  2HZF A;  2EFC A;  5B8A A;  4Z2T A;  4FO5 A;  1S3A A;  4JE1 A;  2F3M A;  3GKM A;  4ZIJ A;  1SD8 A;  2C8U A;  3EMP A;  4ILF A;  2GT5 A;  5IOX A;  1VF1 A;  3VWW A;  3GKN A;  2YWM A;  1GNW A;  3RGB C;  5CP1 A;  5J41 A;  2EFE A;  2JSZ A;  5C00 A;  1HNB A;  3WT1 A;  1XW6 A;  4IJI A;  3E9J B;  3IRA A;  1BF5 A;  2VL2 A;  3UAP A;  2DIY A;  2YZH A;  1QMV A;  2C3N A;  3EE2 A;  4ICY A;  2E7P A;  2R6K A;  5DJM A;  2QKE A;  4K1F A;  2B1L A;  2FHE A;  1K0D A;  3UL3 A;  3UBL A;  2VLV A;  4L0U A;  1TOF A;  4G10 A;  3FZ4 A;  2QA1 A;  1OC8 A;  1SKW B;  4ECB A;  4AI6 A;  2I9H A;  3FHK A;  4NPB A;  1OKT A;  4DSS A;  2MYG A;  1OYJ A;  2WRT A;  4YAP A;  4ECC A;  10GS A;  5H5Q A;  5A34 A;  4KGI A;  4POK A;  3ZZX A;  5G1K A;  2JU5 A;  2PUK C;  1HD2 A;  1FO5 A;  2XC2 A;  1VRS D;  2HSY A;  2C0G A;  2V6O A;  4EF0 A;  1EEJ A;  4K7N A;  1AW9 A;  1GLQ A;  14GS A;  3TKS C;  19GS A;  4MJB A;  4WXT A;  1QQ2 A;  3IC4 A;  4HEA 2;  3FY7 A;  2F8F A;  2NDO A;  3KIJ A;  3LYP A;  3RDW A;  4EVM A;  2RII A;  4IVF A;  2AUV A;  2HRA A;  1JZD A;  4N0Z A;  2GZZ A;  5DQS A;  2H76 A;  3GTU B;  3U6V A;  5HR2 A;  4MZB A;  1T1V A;  4MLY A;  3HD5 A;  1O8W A;  1JFU A;  6GSX A;  1UN2 A;  4PI0 C;  3G7J A;  3DIE A;  3CSJ A;  4GWR A;  3NOF A;  2A2S A;  3TJG A;  3MIX A;  5KN2 A;  2IMD A;  1YEX A;  1QK8 A;  3GHA A;  5DAK B;  5F05 A;  3WGE A;  1Q98 A;  4KDX A;  4TR0 A;  2WCI A;  4OWY A;  4ZBA A;  1XW9 A;  3QPM A;  5J3R A;  1AXD A;  4IS0 A;  1FW1 A;  3D6I A;  2I1U A;  4TR1 B;  1DE2 A;  2YN1 A;  2X8C A;  3A2X A;  4AKH A;  5ECP B;  3IBH A;  3WGX A;  1NSW A;  3UMA A;  2QA2 A;  3HY2 A;  5IM9 A;  2MZC A;  2GLR A;  5F06 A;  2EIO A;  1E2Y A;  4V2M A;  1MTC A;  4EIQ A;  4QQ7 A;  4BL7 A;  4KH7 A;  4NXI A;  1KEB A;  3A2V A;  3APQ A;  1AUC A;  1TW9 A;  2H6Y A;  2LV3 A;  1EZK A;  1EOG A;  2E2G A;  1FOV A;  1F2E A;  3N9J A;  1YEP A;  1V57 A;  1K0O A;  2JL4 A;  4JED A;  1A23 A;  2KP2 A;  2MMN A;  1T8E B;  4MZW A;  1ABA A;  3APO A;  2VLU A;  3KTL A;  5ECK B;  5IO2 A;  1K0N A;  1TXX A;  1MDJ A;  1TK0 B;  4OCE A;  2OE0 A;  4GRF A;  4POM A;  2XPD A;  4MH2 A;  2PN8 A;  5DCG A;  2HRF A;  3IOS A;  2AYT A;  3FZ5 A;  4YKG A;  3FR9 A;  3QAG A;  2IMK A;  2E2M A;  2ZNM A;  3KP8 A;  4KSO A;  4K0G A;  3BJ5 A;  2FUG 2;  4O5U A;  2IPA A;  1PX6 A;  1NW2 A;  3CTF A;  3LGC A;  2VCT A;  3FYG A;  2YAN A;  4RQR A;  4XIH A;  2VO4 A;  1SEN A;  1FB6 A;  2X4A A;  4AJ7 A;  3GX8 A;  5F0G A;  2LUS A;  1FB0 A;  1VF3 A;  1PL1 A;  3TGZ A;  4YQU A;  1Q4J A;  2LEG A;  2LJK A;  4X43 A;  1U6T A;  4DSQ A;  1GTI A;  3QOU A;  4G01 A;  3UIW A;  4KAE A;  1EV9 A;  4TXO B;  1M0U A;  4PNF A;  5IPG A;  3IA1 A;  3QR6 A;  2EIR A;  4Z7X A;  1T4Y A;  1F9M A;  1B48 A;  4I8B A;  4MH3 A;  1TDI A;  4MNN A;  4XRA A;  3F3Q A;  1KNG A;  3QFB C;  2WJU A;  4DSR A;  3ZYW A;  2CT6 A;  1PKW A;  2WW3 A;  5A5H A;  1GSE A;  3LSZ A;  1X0R A;  2B5X A;  2RUE A;  3I43 A;  3H4K A;  4KUN A;  1F3B A;  4ISD A;  3GKK A;  1TK8 B;  2DJJ A;  3VFI A;  3IR4 A;  4QL9 A;  2O7K A;  4WF5 A;  5KOW A;  1GSQ A;  5E59 A;  2B5E A;  3P2A A;  3M1G A;  4YKF A;  3CSI A;  6GST A;  2H66 A;  4ML1 A;  3EMX A;  1SVO A;  1B4Q A;  4Q5F A;  5JCW A;  4HZ2 A;  2LRC A;  5CYY A;  4JR6 A;  3RHC A;  1TRV A;  1VF4 A;  1HYU A;  4K6X A;  3JCM L;  2BTO T;  3KCM A;  4OMV A;  1A2M A;  2EC4 A;  1S3D A;  3H93 A;  4RI7 A;  5DAL A;  2DBC A;  2E0Q A;  5GST A;  7GSS A;  5E4W A;  2IFQ A;  2DLX A;  2QC7 A;  4WR4 A;  5J5N A;  4F82 A;  4K7O A;  2HSH A;  5ECS A;  1WWJ A;  2GZP A;  4XCS A;  1AAZ A;  2XHF A;  4TN8 A;  3G7Y A;  2IME A;  3GUR A;  1Z7P A;  1YF1 A;  2H01 A;  1K0C A;  3SBC A;  1Z7R A;  1FG4 A;  2VL9 A;  3RFR C;  3UVT A;  5ECI B;  1JHB A;  3LXT A;  4J57 E;  2LNS A;  1FOH A;  3CSH A;  4G9H A;  1TTZ A;  1F37 A;  1S3R A;  5HFI A;  4MJC A;  3C7M A;  3GMF A;  2NTO A;  4X1U A;  4K7I A;  1ST9 A;  1SL1 B;  1WIK A;  3PIN A;  4LMV A;  3FRC A;  2A2R A;  3RPP A;  1S3C A;  1GTB A;  1M7T A;  2ON7 A;  4O7H A;  2X64 A;  2FNO A;  2B1K A;  2M80 A;  5IOW A;  2WZ9 A;  2LTK A;  3EU4 A;  3IXR A;  4HJ2 A;  1PN9 A;  3TU3 B;  3H8Q A;  5ECH B;  5J9C A;  1WPI A;  2DJ0 A;  5HQP A;  2HE3 A;  4A5P A;  1GUM A;  4K8M A;  4MA9 A;  5INY A;  5ECR B;  2G0F A;  4H86 A;  2KLX A;  1X9M B;  1NM3 A;  1PA3 A;  5G30 A;  1BYE A;  2L4Q A;  4KE3 A;  1OE8 A;  4HQZ A;  4BWS A;  4MP4 A;  2PVQ A;  1WOU A;  2RM6 A;  1B4P A;  3ZIJ A;  1I5G A;  16GS A;  5A1N A;  2R37 A;  4JU5 A;  2JZT A;  2UZ8 A;  4Q5R A;  4OO4 A;  2HRK A;  1EEM A;  1AIU A;  1JZO A;  1TK5 B;  3VWV A;  2EFD A;  3KH9 A;  4N30 A;  1N8J A;  3SWL A;  4TR4 A;  1X5E A;  2DMM A;  3HXS A;  2OAC A;  3TJF A;  1LJR A;  2N5A A;  4XS6 A;  2PBJ A;  4K2X A;  3IK9 A;  2F9S A;  1DUG A;  3LWA A;  4FH8 A;  3IAS 2;  1TU7 A;  4AGS A;  3DEX A;  4D73 B;  3HKR A;  5D8I A;  5D73 A;  5AIX A;  3KJY A;  2WW0 A;  2KUC A;  3ERG A;  3F4T A;  2R0C A;  3KMN A;  2H73 A;  4Z2R A;  1UC7 A;  2ON5 A;  1ERT A;  1WP0 A;  5KN1 A;  2V41 A;  1XZO A;  4KB3 A;  4GCI A;  3W6G A;  1GUL A;  2NPB A;  4KW6 A;  1F3A A;  3P90 A;  4ZIL A;  4TW5 A;  1GUK A;  2CVB A;  2F51 A;  1Y6E A;  3L9V A;  1ZYN A;  3HMJ G;  2J23 A;  3TJJ A;  4L8E A;  5A4V A;  2O8V B;  4FIW A;  2ES7 A;  2C3T A;  4ZB9 A;  4XS1 A;  3ZIV A;  2AB6 A;  1ZMA A;  2K6V A;  4L5O A;  4K9Z A;  3F0I A;  5EVO A;  1ACV A;  1G7E A;  4KSM A;  2LRT A;  3OR5 A;  4ZB7 A;  12GS A;  5JWO B;  2OE1 A;  4HSC X;  1ZGN A;  4AJ6 A;  1UA5 A;  2WVX B;  1BJX A;  3KD0 A;  3C71 A;  1WMJ A;  5HFK A;  2C80 A;  1BAY A;  3QMX A;  1EP7 A;  1IYH A;  2CQ9 A;  3MSZ A;  1XWB A;  3PH9 A;  4PQ1 A;  1GUH A;  5H5R A;  3VUR A;  2X49 A;  4F9Z A;  4WBJ A;  1G7O A;  2WUL A;  4ML6 A;  1YKC A;  2AJQ B;  2VCQ A;  3GST A;  3HVS A;  2LKU A;  3R2Q A;  2GGT A;  3ZMK A;  3I9V 2;  2R0P A;  3R3E A;  3FZ9 A;  3UEM A;  2GS3 A;  3GTU A;  4GDF A;  4WET A;  1HQO A;  3CRU A;  3F9U A;  1XXU A;  2HYX A;  1V9W A;  3P8W A;  2VAF A;  3VWX A;  2FWF A;  1YY7 A;  3N5O A;  3UBK A;  5DBQ A;  5EL8 A;  1R26 A;  5IPH A;  5J4V A;  3ZTL A;  2KP1 A;  1LU4 A;  2YOI A;  4QL7 A;  1QUW A;  5DAK A;  5ECQ B;  4ZB8 A;  2FA8 A;  4XHM A;  4AJ8 A;  2H1L A;  1JLV A;  4L5L A;  1XCC A;  3QAW A;  4TR1 A;  3Q74 A;  3KMO A;  3MYD A;  4ULX A;  6GSY A;  5HR0 A;  3GKX A;  5ID2 A;  3TKR A;  2I81 A;  3DD3 A;  4ZL7 A;  3PGT A;  2DIZ A;  4IJ3 A;  4IQ1 A;  4WF4 A;  2YWO A;  1PRX A;  4G19 A;  2I4A A;  5J4Y A;  3CRT A;  4Q5Q A;  3EC3 A;  3AY8 A;  2IJY A;  5CNW A;  3LEF A;  1GNE A;  2B3S A;  4F0B A;  2HZE B;  4CY6 A;  4MCU A;  1GTA A;  1NHY A;  2CZ3 A;  5JWQ B;  2IWT A;  3G9B A;  3QD9 A;  2HLS A;  1UVZ A;  2HFD A;  4OD7 A;  4EDZ A;  4J56 E;  4POL A;  4GF0 A;  2MMO A;  3LW9 A;  4V1A p;  1SD9 A;  1JZW A;  1SJI A;  1M99 A;  3Q6O A;  2YJH A;  2CVK A;  4BWQ A;  4F03 A;  3KH7 A;  2IL3 A;  4MK3 A;  4PQI A;  5IIZ A;  4KDU A;  1ML6 A;  1VGL A;  3DVX A;  1O8X A;  5JCU A;  3GYK A;  4HOJ A;  5GZZ B;  2VKZ G;  4EC0 A;  3TJK A;  3L4N A;  1M3J A;  1B8X A;  2M46 A;  2V1M A;  1A8L A;  3VI5 A;  4IW9 A;  1IYI A;  3HJO A;  3TKQ A;  4YH2 A;  5CRH A;  3TRQ A;  2CVD A;  2FGX A;  4LA1 A;  5LD0 A;  1QFN A;  1JLW A;  4TXO A;  3L0H A;  5D93 A;  1ZYE A;  2DKI A;  5CRW A;  1SJZ A;  3CHX C;  1OC9 B;  3LQ7 A;  4PX1 A;  4MF7 A;  1OE7 A;  1ZYQ B;  3LYK A;  1M3I A;  3L9U A;  4JRR A;  1U87 A;  2H6X A;  1U88 A;  2NBS A;  5D9W A;  4POB A;  2VL2 C;  1DE1 A;  1RK4 A;  2JSY A;  1VF2 A;  3CTG A;  5A4W A;  2HSM B;  4I5Q A;  3I69 A;  2GQL A;  3ERW A;  2H6Z A;  1ERV A;  2CX4 A;  1W4V A;  3GUS A;  2WW1 A;  2K8V A;  4IEL A;  3GIX A;  2RUF A;  1R5A A;  3CYN A;  2VUP A;  4USS A;  4ACS A;  3DXB A;  2O5V A;  4WKW A;  3TJB A;  4KCE A;  2GSS A;  5J47 A;  4HUA A;  1M2D A;  2XBI A;  2YWI A;  4AKG A;  1ZCP A;  4ECI A;  3FW2 A;  3LG6 A;  4N10 A;  3LFL A;  1W89 A;  3TOT A;  1GSS A;  2MMZ A;  4GLT A;  4K0N A;  4N3Z A;  3LOR A;  2MMA A;  5HR3 A;  1G0T A;  1QXH A;  2JAD A;  3GFK A;  2F8A A;  2MBS A;  3MDK A;  1GRX A;  2L6D A;  4KA0 A;  5DJL A;  1AQV A;  1EOH A;  3DKS A;  4ZL8 A;  3ZFL A;  4TVE A;  4DEJ A;  1YF0 A;  2XPE A;  4MZC A;  4NV2 A;  4X0X A;  1YVL A;  1Y1U A;  2C4J A;  5B8B A;  2YV7 A;  4ZBB A;  4ZBD A;  1PGT A;  4IN0 A;  3ZVJ A;  4GQC A;  4PI2 C;  3S9F A;  2P0G A;  2R0G A;  2OE3 A;  3KM6 A;  2VOC A;  4HS1 A;  4IQA A;  3ERF A;  1G6W A;  1NHO A;  2CA8 A;  1E6B A;  4O32 A;  2WVZ A;  4XTS A;  1Z6M A;  4XS4 B;  4OFN A;  4F2I A;  3EVI A;  3D0Z A;  4MPG A;  4J2F A;  2L6C A;  3EU3 A;  4TR3 A;  1V58 A;  2FWH A;  4LMW A;  5G2Z A;  2G2Q A;  5IMD A;  1XWA A;  2KOK A;  2OJL A;  1K3O A;  1CQG A;  9GSS A;  4MDC A;  3WYW A;  4FYC A;  1ZL9 A;  8GSS A;  2GTU A;  2M72 A;  3VI7 A;  3C1R A;  3FMW A;  1ZZY A;  2H8L A;  4CY8 A;  4PGT A;  2R3X A;  4CHS A;  1TJD A;  3HJM A;  1EGO A;  4E68 A;  1SJ6 A;  1ON4 A;  3ZLP A;  2GSQ A;  2K9F A;  1DBY A;  3PR8 A;  3VPQ A;  5LNK e;  5G5E A;  1WE0 A;  4EKZ A;  5ELA A;  1JZR A;  2WGR A;  2GT6 A;  3KP9 A;  1WRY A;  2ZUP A;  4PHZ C;  1SK1 A;  3ME8 A;  3O6T A;  2YV9 A;  2LRN A;  2VL3 A;  2LJA A;  4LL4 B;  1XWG A;  4PNG A;  1S4B P;  4MJE A;  5IO0 A;  3C8E A;  5KOX A;  2VIM A;  3TKS A;  1GTU A;  3GN3 A;  2C0E A;  3CMI A;  2H0I A;  1BX9 A;  3E0U A;  6GSW A;  2O3E A;  1GLP A;  1XOB A;  4YQM A;  1QGV A;  3QCP A;  2X99 A;  2H1A A;  4TRX A;  3KTB A;  4D73 A;  1GSY A;  5AIV A;  2P5R A;  3KGK A;  2AAW A;  4NV5 A;  4K5S A;  2DC5 A;  4TOP A;  2DJ2 A;  3TDG A;  2AHE A;  3IE3 A;  1O73 A;  3GNJ A;  2BMX A;  4E8E A;  17GS A;  1MEK A;  3GL5 A;  2CX3 A;  2HSN B;  4NHW A;  4MMM A;  4ZXG A;  5ABR A;  3KXO A;  1M2B A;  4ZL9 A;  2J9H A;  2FY6 A;  2TIR A;  2PWJ A;  3FZA A;  2C3Q A;  4BVY A;  4FXY P;  1O85 A;  3F3R A;  2MBT A;  3FR3 A;  2I3Y A;  1FVJ A;  1TKD B;  4E8H A;  2N5B A;  3TKP A;  4I2U A;  4PUR A;  5ENU A;  2O89 A;  1V2A A;  3DRN A;  3DWV A;  2XBQ A;  3WD6 A;  2GQK A;  5IMC A;  2OAD A;  3C73 A;  1BG1 A;  1R7H A;  4TKY A;  3V1W A;  1URM A;  4Z2U A;  5B6M A;  3EYT A;  3MNG A;  5DCH A;  1ZOF A;  2L59 A;  2WVX A;  5IMA A;  1U3A A;  2B7K A;  1PD2 1;  3M0F A;  5KEJ A;  2WFC A;  1YQ1 A;  2R4V A;  2GDR A;  2TRC P;  4PQH A;  1T4Z A;  4AF2 A;  3LXZ A;  4GXZ A;  2CV4 A;  1R4W A;  1OKD A;  2B5Y A;  2ZCT A;  4HQS A;  2CZ2 A;  4GTU A;  22GS A;  4MF6 A;  4WBR D;  4K5R A;  3FK8 A;  3F63 A;  2IIY A;  5JCG A;  1YEW C;  4RUV A;  3DML A;  13GS A;  4DVC A;  2O87 A;  2HNL A;  3IDV A;  3ZRD A;  2K18 A;  2LST A;  4LLR A;  5ECN B;  5H5S A;  3HVX A;  3J7Y b;  2WVY A;  1WJK A;  5J40 A;  4FYB A;  4AKI A;  4IHU A;  1K0M A;  1PMT A;  2C1Y A;  4I2T A;  5BMU B;  1I1I P;  3F6F A;  1BED A;  2DJK A;  4LL1 B;  5D9V A;  2OA7 A;  1EV4 A;  4EIP A;  2QGV A;  3HA9 A;  1GWC A;  2Z9S A;  5ECL B;  3DYR A;  4BVX B;  4NMU A;  2YCD A;  1DSB A;  1XPV A;  2GVP A;  2A2P A;  3FR6 A;  1SK2 A;  3ZRE A;  2LQQ A;  3RHB A;  4O5R A;  5GAP D;  3F6D A;  2PU9 C;  2H72 A;  2GSR A;  2GST A;  3GH6 A;  4G0L A;  3TKS E;  6GSU A;  3HCZ A;  2V32 A;  2PMT A;  2RLI A;  3GH9 A;  1PN0 A;  2O36 A;  2B6M A;  5CRD A;  4ZB6 A;  5AN1 A;  1M2A A;  3ZML A;  1V40 A;  2HZE A;  1FAA A;  2VLT A;  1PSQ A;  3F4R A;  4MF5 A;  4G0K A;  1BG5 A;  2R2J A;  1XFL A;  4YAV A;  1A0F A;  5J4U A;  4JZQ A;  3TB2 A;  2GQM A;  3KZQ A;  1A0R P;  3QAV A;  5F8B A;  1XWK A;  3M3M A;  3IHG A;  2PVO C;  4I6X A;  5FT3 A;  2IMF A;  2WS2 A;  3KEB A;  2YNX A;  5EY6 A;  5ECM B;  20GS A;  1O81 A;  1B9Y C;  5FHI A;  1GP1 A;  2A4H A;  5BRT A;  1H75 A;  1H4O A;  1M9A A;  4YQV A;  4DSS B;  5A5K A;  4GSS A;  2LS5 A;  5A34 B;  1N25 A;  2EFH A;  4MJA A;  1TI1 A;  2FWE A;  1C72 A;  2HXK A;  2HQT A;  3BBY A;  3HJP A;  3QFA C;  1SVL A;  4CW9 A;  4RI6 A;  3IPZ A;  3TOU A;  1YKA A;  5ECO B;  1Z5Y E;  2PGT A;  3VWU A;  5L71 A;  2NVL A;  5DQY A;  1LBK A;  3Q18 A;  2FLS A;  3HYP A; 
#chains in the Genus database with same CATH homology
 1TXU A;  1T00 A;  5COH A;  3L78 A;  1GSF A;  3RPN A;  3GX0 A;  3K8N A;  5ID2 B;  1OC9 A;  3NIV A;  3D5J A;  2EIQ A;  1SKS B;  3A2W A;  2TRX A;  5HFG A;  2LQO A;  4K2D A;  6GSV A;  2UV8 G;  1XVQ A;  3F4S A;  3FEU A;  4PXO A;  2RM5 A;  1I9D A;  1GL8 A;  4MPF A;  1Z3E A;  2K8S A;  1FVK A;  3D22 A;  4X4J A;  3D4T A;  5D96 A;  1K3Y A;  3W8S A;  1OVN A;  2HSM A;  3UOM A;  2V6K A;  2V2G A;  4P3Y B;  2KHP A;  3CBU A;  2PPT A;  4FQU A;  4IP6 A;  2FD3 A;  1M9B A;  5GSS A;  3H1N A;  5JWR B;  1N2A A;  1SYX A;  1YJ6 A;  2H1D A;  2H70 A;  4KND A;  3PPU A;  2H30 A;  1PKZ A;  4EXJ A;  1AQW A;  2H75 A;  2HT9 A;  1B9X C;  3RBT A;  3ZFB A;  4XRD A;  4BL7 B;  1ERW A;  4L0W A;  5FWG A;  1RQM A;  1HNC A;  1J0F A;  3EWL A;  3IAM 2;  4AKX B;  1TRU A;  1THO A;  1G6Y A;  2DSA A;  1ILO A;  2VCV A;  2L4C A;  5IMV A;  3D21 A;  3GA4 A;  5B6N A;  4EE0 A;  1OAZ A;  2PER A;  1A2J A;  2C0D A;  1SL0 B;  3GRX A;  2VM2 A;  4PUF C;  3F8U A;  3H79 A;  3BCK A;  1ZYP A;  1A24 A;  1O7U A;  2QSI A;  3NZN A;  2L5L A;  3A5W A;  1Z9H A;  1K0A A;  5EPF A;  2REM A;  2WB9 A;  4BA7 A;  1X5C A;  5GAN D;  3UJ1 A;  2FWG A;  3TUE A;  2R5G A;  2YP6 A;  2DML A;  1USB A;  3RAZ A;  4NAX A;  3O3T A;  4JBB A;  5AIS A;  3GL3 A;  3IV4 A;  3DGQ A;  4XS4 A;  4IGJ A;  1YZX A;  3UVH A;  3BOA A;  2OBI A;  4RQX A;  4WR5 A;  2CAI A;  2WDU A;  3ISO A;  1AC1 A;  2ALB A;  4O5Q A;  2JZS A;  3FKF A;  4IP1 A;  3VK9 A;  2VCZ A;  1OC3 A;  1MDK A;  2C0F A;  2YPM A;  2FCH A;  2X8H A;  2GZY A;  4OFT A;  4Q5N A;  2CAQ A;  5F07 A;  1SL2 B;  5IQY A;  4PTS A;  1V98 A;  1XOA A;  1MD4 A;  18GS A;  1KBN A;  4PUA A;  1TRW A;  2H0H A;  1PX7 A;  1SVM A;  2AV4 A;  4JR4 A;  5AGY A;  2YWN A;  3O76 A;  2DJ1 A;  2DJ3 A;  4I97 A;  5A5H B;  3HZ4 A;  3ED3 A;  4IKH A;  5ELG A;  1FHE A;  2YJ7 A;  3MWH A;  5G31 A;  1KTE A;  5IMZ A;  3DVW A;  3HDC A;  1Y25 A;  2H0G A;  2LNT A;  1O6J A;  4W66 A;  3UAR A;  1T7P B;  3IK7 A;  5CRG A;  4IBP A;  3VPT A;  1K0B A;  2N5F A;  4KF9 A;  5G5F A;  2VM1 A;  2OBK A;  4OCF A;  2H1B A;  1T3B A;  2HI7 A;  2H71 A;  2L5O A;  3IHQ A;  2X8G A;  1X9S B;  1XIY A;  3C1S A;  1XWC A;  2DKH A;  4HJM A;  3G7I A;  1MDI A;  1EWX A;  1X5D A;  4HU9 A;  4ECJ A;  1YDK A;  3LJR A;  5DAL B;  4EL1 A;  3W8J A;  2IMI A;  4V2N A;  3BCI A;  4QMK A;  2OKA A;  3M9J A;  1PQN A;  5C04 A;  2H19 A;  3J7Y k;  2IFQ B;  3P7X A;  2HSN A;  4NWY A;  1TI3 A;  3ZIT A;  5G1L A;  4HZ4 A;  2JZR A;  5J9B A;  3US3 A;  3ME7 A;  5B7C A;  4EDY A;  3APS A;  4V1A g;  4OFM A;  5A4U A;  3VLN A;  4EUY A;  3MAK A;  3M9K A;  5KN0 A;  1MD3 A;  2H74 A;  3A5I A;  4MAB A;  1TU8 A;  4N0V A;  1PL2 A;  3EPT A;  3I6A A;  1K3L A;  2FA4 A;  3HVV A;  4N11 A;  2H1G A;  3ZL5 A;  4F0C A;  2B7J A;  2LJR A;  3HZ8 A;  2OT3 A;  3WGD A;  2BJX A;  5LCZ A;  4KCA A;  2O85 A;  5D9T A;  4BPY A;  3HHV A;  1GSD A;  1XW5 A;  1TP9 A;  1ERU A;  2VCW A;  1XBS A;  4KX4 A;  1AQX A;  5CAX A;  2P5Q A;  3U5R E;  3CXG A;  4V2L A;  1HNA A;  4GST A;  3EIN A;  4KDY A;  3GSS A;  1R5P A;  1SU9 A;  5CRE A;  1TRS A;  1EGR A;  2P31 A;  1CQH A;  5KN3 A;  3L9S A;  2L57 A;  1A2L A;  4GQF A;  1SKR B;  5DDL A;  1XVW A;  3EUR A;  4WEY A;  5IMF A;  3TRP A;  5CO3 A;  4NHZ A;  1J9B A;  3QDN A;  3TCO A;  3TRX A;  4G0I A;  2YZU A;  1GH2 A;  3Q19 A;  2VCX A;  1RW1 A;  1THX A;  1Z6N A;  3GV1 A;  5A1N B;  2VD1 A;  1EP8 A;  3M8N A;  4TXV A;  3CWG A;  2HRK B;  5D9X A;  3D4M A;  1J08 A;  11GS A;  1X9W B;  4O92 A;  6GSS A;  5DVB A;  5BMU A;  1SYR A;  2IN3 A;  3BD2 A;  1GSU A;  2JAC A;  4OO5 A;  2D2Z A;  3WT2 A;  3IC8 A;  1U3I A;  2A4V A;  3A3T A;  4HDE A;  4FYU A;  4EO3 A;  1F6M C;  1BQ7 A;  2HRN A;  4G2E A;  5HR1 A;  4BVY B;  4ID0 A;  4CDO A;  4HI7 A;  1SK0 A;  2VD0 A;  4HU7 A;  4GSN A;  4BVX A;  3E3E A;  3ZVJ D;  1A8Y A;  2HZF A;  2EFC A;  5B8A A;  4Z2T A;  4FO5 A;  1S3A A;  4JE1 A;  2F3M A;  3GKM A;  4ZIJ A;  1SD8 A;  2C8U A;  3EMP A;  4ILF A;  2GT5 A;  5IOX A;  1VF1 A;  3VWW A;  3GKN A;  2YWM A;  1GNW A;  5CP1 A;  5J41 A;  2EFE A;  2JSZ A;  5C00 A;  1HNB A;  3WT1 A;  1XW6 A;  4IJI A;  3E9J B;  3IRA A;  1BF5 A;  2VL2 A;  3UAP A;  2DIY A;  2YZH A;  1QMV A;  2C3N A;  3EE2 A;  4ICY A;  2E7P A;  2R6K A;  5DJM A;  2QKE A;  4K1F A;  2B1L A;  2FHE A;  1K0D A;  3UL3 A;  3UBL A;  2VLV A;  4L0U A;  1TOF A;  4G10 A;  3FZ4 A;  2QA1 A;  1OC8 A;  1SKW B;  4ECB A;  4AI6 A;  2I9H A;  3FHK A;  4NPB A;  1OKT A;  4DSS A;  2MYG A;  1OYJ A;  2WRT A;  4YAP A;  4ECC A;  10GS A;  5H5Q A;  5A34 A;  4KGI A;  4POK A;  3ZZX A;  5G1K A;  2JU5 A;  2PUK C;  1HD2 A;  1FO5 A;  2XC2 A;  1VRS D;  2HSY A;  2C0G A;  2V6O A;  4EF0 A;  1EEJ A;  4K7N A;  1AW9 A;  1GLQ A;  14GS A;  3TKS C;  19GS A;  4MJB A;  4WXT A;  1QQ2 A;  3IC4 A;  4HEA 2;  3FY7 A;  2F8F A;  2NDO A;  3KIJ A;  3LYP A;  3RDW A;  4EVM A;  2RII A;  4IVF A;  2AUV A;  2HRA A;  1JZD A;  4N0Z A;  2GZZ A;  5DQS A;  2H76 A;  3GTU B;  3U6V A;  5HR2 A;  4MZB A;  1T1V A;  4MLY A;  3HD5 A;  1O8W A;  1JFU A;  6GSX A;  1UN2 A;  3G7J A;  3DIE A;  3CSJ A;  4GWR A;  3NOF A;  2A2S A;  3TJG A;  3MIX A;  5KN2 A;  2IMD A;  1YEX A;  1QK8 A;  3GHA A;  5DAK B;  5F05 A;  3WGE A;  1Q98 A;  4KDX A;  4TR0 A;  2WCI A;  4OWY A;  4ZBA A;  1XW9 A;  3QPM A;  5J3R A;  1AXD A;  4IS0 A;  1FW1 A;  3D6I A;  2I1U A;  4TR1 B;  1DE2 A;  2YN1 A;  2X8C A;  3A2X A;  4AKH A;  5ECP B;  3IBH A;  3WGX A;  1NSW A;  3UMA A;  2QA2 A;  3HY2 A;  5IM9 A;  2MZC A;  2GLR A;  5F06 A;  2EIO A;  1E2Y A;  4V2M A;  1MTC A;  4EIQ A;  4QQ7 A;  4BL7 A;  4KH7 A;  4NXI A;  1KEB A;  3A2V A;  3APQ A;  1AUC A;  1TW9 A;  2H6Y A;  2LV3 A;  1EZK A;  1EOG A;  2E2G A;  1FOV A;  1F2E A;  3N9J A;  1YEP A;  1V57 A;  1K0O A;  2JL4 A;  4JED A;  1A23 A;  2KP2 A;  2MMN A;  1T8E B;  4MZW A;  1ABA A;  3APO A;  2VLU A;  3KTL A;  5ECK B;  5IO2 A;  1K0N A;  1TXX A;  1MDJ A;  1TK0 B;  4OCE A;  2OE0 A;  4GRF A;  4POM A;  2XPD A;  4MH2 A;  2PN8 A;  5DCG A;  2HRF A;  3IOS A;  2AYT A;  3FZ5 A;  4YKG A;  3FR9 A;  3QAG A;  2IMK A;  2E2M A;  2ZNM A;  3KP8 A;  4KSO A;  4K0G A;  3BJ5 A;  2FUG 2;  4O5U A;  2IPA A;  1PX6 A;  1NW2 A;  3CTF A;  3LGC A;  2VCT A;  3FYG A;  2YAN A;  4RQR A;  4XIH A;  2VO4 A;  1SEN A;  1FB6 A;  2X4A A;  4AJ7 A;  3GX8 A;  5F0G A;  2LUS A;  1FB0 A;  1VF3 A;  1PL1 A;  3TGZ A;  4YQU A;  1Q4J A;  2LEG A;  2LJK A;  4X43 A;  1U6T A;  4DSQ A;  1GTI A;  3QOU A;  4G01 A;  3UIW A;  4KAE A;  1EV9 A;  4TXO B;  1M0U A;  4PNF A;  5IPG A;  3IA1 A;  3QR6 A;  2EIR A;  4Z7X A;  1T4Y A;  1F9M A;  1B48 A;  4I8B A;  4MH3 A;  1TDI A;  4MNN A;  4XRA A;  3F3Q A;  1KNG A;  3QFB C;  2WJU A;  4DSR A;  3ZYW A;  2CT6 A;  1PKW A;  5A5H A;  1GSE A;  3LSZ A;  1X0R A;  2B5X A;  2RUE A;  3I43 A;  3H4K A;  4KUN A;  1F3B A;  4ISD A;  3GKK A;  1TK8 B;  2DJJ A;  3VFI A;  3IR4 A;  4QL9 A;  2O7K A;  4WF5 A;  5KOW A;  1GSQ A;  5E59 A;  2B5E A;  3P2A A;  3M1G A;  4YKF A;  3CSI A;  6GST A;  2H66 A;  4ML1 A;  3EMX A;  1SVO A;  1B4Q A;  4Q5F A;  5JCW A;  4HZ2 A;  2LRC A;  5CYY A;  4JR6 A;  3RHC A;  1TRV A;  1VF4 A;  1HYU A;  4K6X A;  3JCM L;  2BTO T;  3KCM A;  4OMV A;  1A2M A;  2EC4 A;  1S3D A;  3H93 A;  4RI7 A;  5DAL A;  2DBC A;  2E0Q A;  5GST A;  7GSS A;  5E4W A;  2IFQ A;  2DLX A;  2QC7 A;  4WR4 A;  5J5N A;  4F82 A;  4K7O A;  2HSH A;  5ECS A;  1WWJ A;  2GZP A;  4XCS A;  1AAZ A;  2XHF A;  4TN8 A;  3G7Y A;  2IME A;  3GUR A;  1Z7P A;  1YF1 A;  2H01 A;  1K0C A;  3SBC A;  1Z7R A;  1FG4 A;  2VL9 A;  3UVT A;  5ECI B;  1JHB A;  3LXT A;  4J57 E;  2LNS A;  1FOH A;  3CSH A;  4G9H A;  1TTZ A;  1F37 A;  5HFI A;  4MJC A;  3C7M A;  3GMF A;  2NTO A;  4X1U A;  4K7I A;  1ST9 A;  1SL1 B;  1WIK A;  3PIN A;  4LMV A;  3FRC A;  2A2R A;  3RPP A;  1S3C A;  1GTB A;  1M7T A;  2ON7 A;  4O7H A;  2X64 A;  2FNO A;  2B1K A;  2M80 A;  5IOW A;  2WZ9 A;  2LTK A;  3EU4 A;  3IXR A;  4HJ2 A;  1PN9 A;  3TU3 B;  3H8Q A;  5ECH B;  5J9C A;  1WPI A;  2DJ0 A;  5HQP A;  2HE3 A;  4A5P A;  1GUM A;  4K8M A;  4MA9 A;  5INY A;  5ECR B;  2G0F A;  4H86 A;  2KLX A;  1X9M B;  1NM3 A;  1PA3 A;  5G30 A;  1BYE A;  2L4Q A;  4KE3 A;  1OE8 A;  4HQZ A;  4BWS A;  4MP4 A;  2PVQ A;  1WOU A;  2RM6 A;  1B4P A;  3ZIJ A;  1I5G A;  16GS A;  5A1N A;  2R37 A;  4JU5 A;  2JZT A;  2UZ8 A;  4Q5R A;  4OO4 A;  2HRK A;  1EEM A;  1AIU A;  1JZO A;  1TK5 B;  3VWV A;  2EFD A;  3KH9 A;  4N30 A;  1N8J A;  3SWL A;  4TR4 A;  1X5E A;  2DMM A;  3HXS A;  2OAC A;  3TJF A;  1LJR A;  2N5A A;  4XS6 A;  2PBJ A;  4K2X A;  3IK9 A;  2F9S A;  1DUG A;  3LWA A;  4FH8 A;  3IAS 2;  1TU7 A;  4AGS A;  3DEX A;  4D73 B;  3HKR A;  5D8I A;  5D73 A;  5AIX A;  3KJY A;  2KUC A;  3ERG A;  3F4T A;  2R0C A;  3KMN A;  2H73 A;  4Z2R A;  1UC7 A;  2ON5 A;  1ERT A;  1WP0 A;  5KN1 A;  2V41 A;  1XZO A;  4KB3 A;  4GCI A;  3W6G A;  1GUL A;  2NPB A;  4KW6 A;  1F3A A;  3P90 A;  4ZIL A;  4TW5 A;  1GUK A;  2CVB A;  2F51 A;  1Y6E A;  3L9V A;  1ZYN A;  3HMJ G;  2J23 A;  3TJJ A;  4L8E A;  5A4V A;  2O8V B;  4FIW A;  2ES7 A;  2C3T A;  4ZB9 A;  4XS1 A;  3ZIV A;  2AB6 A;  1ZMA A;  2K6V A;  4L5O A;  4K9Z A;  3F0I A;  5EVO A;  1ACV A;  1G7E A;  4KSM A;  2LRT A;  3OR5 A;  4ZB7 A;  12GS A;  5JWO B;  2OE1 A;  1ZGN A;  4AJ6 A;  1UA5 A;  1BJX A;  3KD0 A;  3C71 A;  1WMJ A;  5HFK A;  2C80 A;  1BAY A;  3QMX A;  1EP7 A;  1IYH A;  2CQ9 A;  3MSZ A;  1XWB A;  3PH9 A;  4PQ1 A;  1GUH A;  5H5R A;  3VUR A;  2X49 A;  4F9Z A;  4WBJ A;  1G7O A;  2WUL A;  4ML6 A;  1YKC A;  2AJQ B;  2VCQ A;  3GST A;  3HVS A;  2LKU A;  3R2Q A;  2GGT A;  3ZMK A;  3I9V 2;  2R0P A;  3R3E A;  3FZ9 A;  3UEM A;  2GS3 A;  3GTU A;  4GDF A;  4WET A;  1HQO A;  3CRU A;  3F9U A;  1XXU A;  2HYX A;  1V9W A;  3P8W A;  2VAF A;  3VWX A;  2FWF A;  1YY7 A;  3N5O A;  3UBK A;  5DBQ A;  5EL8 A;  1R26 A;  5IPH A;  5J4V A;  3ZTL A;  2KP1 A;  1LU4 A;  2YOI A;  4QL7 A;  1QUW A;  5DAK A;  5ECQ B;  4ZB8 A;  2FA8 A;  4XHM A;  4AJ8 A;  2H1L A;  1JLV A;  4L5L A;  1XCC A;  3QAW A;  4TR1 A;  3Q74 A;  3KMO A;  3MYD A;  4ULX A;  6GSY A;  5HR0 A;  3GKX A;  5ID2 A;  3TKR A;  2I81 A;  3DD3 A;  4ZL7 A;  3PGT A;  2DIZ A;  4IJ3 A;  4IQ1 A;  4WF4 A;  2YWO A;  1PRX A;  4G19 A;  2I4A A;  5J4Y A;  3CRT A;  4Q5Q A;  3EC3 A;  3AY8 A;  2IJY A;  5CNW A;  3LEF A;  1GNE A;  2B3S A;  4F0B A;  2HZE B;  4CY6 A;  4MCU A;  1GTA A;  1NHY A;  2CZ3 A;  5JWQ B;  2IWT A;  3G9B A;  3QD9 A;  2HLS A;  1UVZ A;  2HFD A;  4OD7 A;  4EDZ A;  4J56 E;  4POL A;  4GF0 A;  2MMO A;  3LW9 A;  4V1A p;  1SD9 A;  1JZW A;  1SJI A;  1M99 A;  3Q6O A;  2YJH A;  2CVK A;  4BWQ A;  4F03 A;  3KH7 A;  2IL3 A;  4MK3 A;  4PQI A;  5IIZ A;  4KDU A;  1ML6 A;  1VGL A;  3DVX A;  1O8X A;  5JCU A;  3GYK A;  4HOJ A;  5GZZ B;  2VKZ G;  4EC0 A;  3TJK A;  3L4N A;  1B8X A;  2M46 A;  2V1M A;  1A8L A;  3VI5 A;  4IW9 A;  1IYI A;  3HJO A;  3TKQ A;  4YH2 A;  5CRH A;  3TRQ A;  2CVD A;  2FGX A;  4LA1 A;  5LD0 A;  1QFN A;  1JLW A;  4TXO A;  3L0H A;  5D93 A;  1ZYE A;  2DKI A;  5CRW A;  1SJZ A;  1OC9 B;  3LQ7 A;  4PX1 A;  4MF7 A;  1OE7 A;  1ZYQ B;  3LYK A;  3L9U A;  4JRR A;  1U87 A;  2H6X A;  1U88 A;  2NBS A;  5D9W A;  4POB A;  2VL2 C;  1DE1 A;  1RK4 A;  2JSY A;  1VF2 A;  3CTG A;  5A4W A;  2HSM B;  4I5Q A;  3I69 A;  2GQL A;  3ERW A;  2H6Z A;  1ERV A;  2CX4 A;  1W4V A;  3GUS A;  2K8V A;  4IEL A;  3GIX A;  2RUF A;  1R5A A;  3CYN A;  2VUP A;  4USS A;  4ACS A;  3DXB A;  2O5V A;  4WKW A;  3TJB A;  4KCE A;  2GSS A;  5J47 A;  4HUA A;  1M2D A;  2XBI A;  2YWI A;  4AKG A;  1ZCP A;  4ECI A;  3FW2 A;  3LG6 A;  4N10 A;  3LFL A;  1W89 A;  3TOT A;  1GSS A;  2MMZ A;  4GLT A;  4K0N A;  4N3Z A;  3LOR A;  2MMA A;  5HR3 A;  1G0T A;  1QXH A;  2JAD A;  3GFK A;  2F8A A;  2MBS A;  3MDK A;  1GRX A;  2L6D A;  4KA0 A;  5DJL A;  1AQV A;  1EOH A;  3DKS A;  4ZL8 A;  3ZFL A;  4TVE A;  4DEJ A;  1YF0 A;  2XPE A;  4MZC A;  4NV2 A;  4X0X A;  1YVL A;  1Y1U A;  2C4J A;  5B8B A;  2YV7 A;  4ZBB A;  4ZBD A;  1PGT A;  4IN0 A;  3ZVJ A;  4GQC A;  3S9F A;  2P0G A;  2R0G A;  2OE3 A;  3KM6 A;  2VOC A;  4HS1 A;  4IQA A;  3ERF A;  1G6W A;  1NHO A;  2CA8 A;  1E6B A;  4O32 A;  4XTS A;  1Z6M A;  4XS4 B;  4OFN A;  4F2I A;  3EVI A;  3D0Z A;  4MPG A;  4J2F A;  2L6C A;  3EU3 A;  4TR3 A;  1V58 A;  2FWH A;  4LMW A;  5G2Z A;  2G2Q A;  5IMD A;  1XWA A;  2KOK A;  2OJL A;  1K3O A;  1CQG A;  9GSS A;  4MDC A;  3WYW A;  4FYC A;  1ZL9 A;  8GSS A;  2GTU A;  2M72 A;  3VI7 A;  3C1R A;  3FMW A;  1ZZY A;  2H8L A;  4CY8 A;  4PGT A;  2R3X A;  4CHS A;  1TJD A;  3HJM A;  1EGO A;  4E68 A;  1SJ6 A;  1ON4 A;  3ZLP A;  2GSQ A;  2K9F A;  1DBY A;  3PR8 A;  3VPQ A;  5LNK e;  5G5E A;  1WE0 A;  4EKZ A;  5ELA A;  1JZR A;  2WGR A;  2GT6 A;  3KP9 A;  1WRY A;  2ZUP A;  1SK1 A;  3ME8 A;  3O6T A;  2YV9 A;  2LRN A;  2VL3 A;  2LJA A;  4LL4 B;  1XWG A;  4PNG A;  4MJE A;  5IO0 A;  3C8E A;  5KOX A;  2VIM A;  3TKS A;  1GTU A;  3GN3 A;  2C0E A;  3CMI A;  2H0I A;  1BX9 A;  3E0U A;  6GSW A;  1GLP A;  1XOB A;  4YQM A;  1QGV A;  3QCP A;  2X99 A;  2H1A A;  4TRX A;  3KTB A;  4D73 A;  1GSY A;  5AIV A;  2P5R A;  3KGK A;  2AAW A;  4NV5 A;  4K5S A;  2DC5 A;  4TOP A;  2DJ2 A;  3TDG A;  2AHE A;  3IE3 A;  1O73 A;  3GNJ A;  2BMX A;  4E8E A;  17GS A;  1MEK A;  3GL5 A;  2CX3 A;  2HSN B;  4NHW A;  4MMM A;  4ZXG A;  5ABR A;  3KXO A;  1M2B A;  4ZL9 A;  2J9H A;  2FY6 A;  2TIR A;  2PWJ A;  3FZA A;  2C3Q A;  4BVY A;  1O85 A;  3F3R A;  2MBT A;  3FR3 A;  2I3Y A;  1FVJ A;  1TKD B;  4E8H A;  2N5B A;  3TKP A;  4I2U A;  4PUR A;  5ENU A;  2O89 A;  1V2A A;  3DRN A;  3DWV A;  2XBQ A;  3WD6 A;  2GQK A;  5IMC A;  2OAD A;  3C73 A;  1BG1 A;  1R7H A;  4TKY A;  3V1W A;  1URM A;  4Z2U A;  5B6M A;  3EYT A;  3MNG A;  5DCH A;  1ZOF A;  2L59 A;  5IMA A;  1U3A A;  2B7K A;  1PD2 1;  3M0F A;  5KEJ A;  2WFC A;  1YQ1 A;  2R4V A;  2GDR A;  2TRC P;  4PQH A;  1T4Z A;  4AF2 A;  3LXZ A;  4GXZ A;  2CV4 A;  1R4W A;  1OKD A;  2B5Y A;  2ZCT A;  4HQS A;  2CZ2 A;  4GTU A;  22GS A;  4MF6 A;  4WBR D;  4K5R A;  3FK8 A;  3F63 A;  2IIY A;  5JCG A;  4RUV A;  3DML A;  13GS A;  4DVC A;  2O87 A;  2HNL A;  3IDV A;  3ZRD A;  2K18 A;  2LST A;  4LLR A;  5ECN B;  5H5S A;  3HVX A;  3J7Y b;  1WJK A;  5J40 A;  4FYB A;  4AKI A;  4IHU A;  1K0M A;  1PMT A;  2C1Y A;  4I2T A;  5BMU B;  3F6F A;  1BED A;  2DJK A;  4LL1 B;  5D9V A;  2OA7 A;  1EV4 A;  4EIP A;  2QGV A;  3HA9 A;  1GWC A;  2Z9S A;  5ECL B;  3DYR A;  4BVX B;  4NMU A;  2YCD A;  1DSB A;  1XPV A;  2GVP A;  2A2P A;  3FR6 A;  1SK2 A;  3ZRE A;  2LQQ A;  3RHB A;  4O5R A;  5GAP D;  3F6D A;  2PU9 C;  2H72 A;  2GSR A;  2GST A;  3GH6 A;  4G0L A;  3TKS E;  6GSU A;  3HCZ A;  2V32 A;  2PMT A;  2RLI A;  3GH9 A;  1PN0 A;  2B6M A;  5CRD A;  4ZB6 A;  5AN1 A;  1M2A A;  3ZML A;  1V40 A;  2HZE A;  1FAA A;  2VLT A;  1PSQ A;  3F4R A;  4MF5 A;  4G0K A;  1BG5 A;  2R2J A;  1XFL A;  4YAV A;  1A0F A;  5J4U A;  4JZQ A;  3TB2 A;  2GQM A;  3KZQ A;  1A0R P;  3QAV A;  5F8B A;  1XWK A;  3M3M A;  3IHG A;  2PVO C;  4I6X A;  5FT3 A;  2IMF A;  2WS2 A;  3KEB A;  2YNX A;  5EY6 A;  5ECM B;  20GS A;  1O81 A;  1B9Y C;  5FHI A;  1GP1 A;  2A4H A;  5BRT A;  1H75 A;  1H4O A;  1M9A A;  4YQV A;  4DSS B;  5A5K A;  4GSS A;  2LS5 A;  5A34 B;  1N25 A;  2EFH A;  4MJA A;  1TI1 A;  2FWE A;  1C72 A;  2HXK A;  2HQT A;  3BBY A;  3HJP A;  3QFA C;  1SVL A;  4CW9 A;  4RI6 A;  3IPZ A;  3TOU A;  1YKA A;  5ECO B;  1Z5Y E;  2PGT A;  3VWU A;  5L71 A;  2NVL A;  5DQY A;  1LBK A;  3Q18 A;  2FLS A;  3HYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...