1YY7A

Crystal structure of stringent starvation protein a (sspa), an rna polymerase-associated transcription factor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
206
structure length
206
Chain Sequence
AANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords stringent starvation protein A
publication title Structural basis for the function of stringent starvation protein A as a transcription factor
pubmed doi rcsb
source organism Yersinia pestis
total genus 74
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1yy7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1yy7A01
4IKHA 1R7HA 1GSDA 1UA5A 4ECJA 1NHOA 2C80A 2VAFA 5ELGA 3L9SA 1XZOA 3GA4A 5IPHA 5CREA 4V1Ap 2H0GA 2GT5A 5HFKA 3U6VA 2F8FA 2H19A 1OAZA 5LCZA 4XCSA 1KTEA 4GF0A 1EEMA 1TK5B 1DE1A 4KCEA 5AN1A 4ZBDA 4WF4A 5ELAA 4Q5FA 2Z9SA 2H71A 2LJRA 1BAYA 4MDCA 3M0FA 3LJRA 2CVBA 4PQHA 2GS3A 2CAQA 4FH8A 3GX8A 4JBBA 2K8VA 4WR5A 1XWGA 1GP1A 3FR3A 5FHIA 5G1LA 4TXVA 2C0DA 4K7IA 5D8IA 2GSSA 3D5JA 2XBIA 3DRNA 1SL0B 2VLTA 2I4AA 3BCKA 1YKCA 3R3EA 2YNXA 4N0ZA 5B7CA 4XS6A 2JADA 2WS2A 1VF2A 2JU5A 2FWFA 5ECRB 4OCFA 1U3AA 1YEXA 3CRUA 2H1DA 4Z7XA 2LEGA 1S3DA 2H6YA 1N8JA 4DSSB 2WRTA 3IA1A 3QFAC 3TOUA 3I69A 3PINA 3DWVA 4GRFA 2YJHA 1WP0A 4MJBA 2CVKA 2NBSA 1A0RP 2JZRA 1TXXA 2VCQA 1USBA 1LU4A 2OA7A 2VO4A 5CP1A 4D73A 3LYKA 5ECOB 1MDJA 4ZB8A 3FK8A 4ZILA 5DQSA 4XS4B 3NZNA 1FOVA 3UVTA 4OD7A 1FO5A 3BD2A 3A2WA 2BMXA 3VWXA 4KCAA 5AIXA 3GKNA 4NV5A 3IC8A 2JSZA 1I9DA 2K18A 1XW9A 4I97A 2VIMA 5F05A 1VF1A 1XBSA 2HSYA 1X0RA 1H75A 4IVFA 2JACA 1F3BA 4DSRA 2GSRA 3RBTA 2K6VA 1TRUA 4HQZA 5ID2A 1Z9HA 3IE3A 2D2ZA 3CYNA 17GSA 1SYRA 1TK8B 1IYHA 4HI7A 1TW9A 2PGTA 2H0HA 4OCEA 1U87A 2A4VA 4DSQA 1A2LA 4V2LA 2B5XA 3VPQA 3TGZA 4JR4A 4OFNA 4AF2A 2B7KA 2V6OA 5G5EA 1SK0A 2AV4A 5CRWA 3ZITA 1K0CA 5DALA 1T1VA 2PVQA 4KSMA 4IELA 3GH6A 3FY7A 4MJEA 2YCDA 3GNJA 5CNWA 1Y6EA 2EC4A 3GN3A 2RLIA 2R6KA 2MMNA 4MPGA 2FWGA 1PKWA 4MH2A 2DJ3A 5D93A 5JCGA 2IL3A 5IO2A 1PL1A 3IOSA 3CXGA 2QSIA 3E0UA 1HNCA 1AQXA 4KAEA 5J5NA 4TXOA 1UC7A 3ME7A 3H4KA 3FW2A 5H5SA 2IMEA 3LQ7A 5IIZA 4YH2A 2YWIA 1ST9A 2VCTA 4NAXA 3DEXA 2LNSA 1OE8A 2H1AA 5D9XA 2QKEA 2H0IA 3DKSA 4EL1A 19GSA 3GH9A 1SKSB 3APSA 2KUCA 4ACSA 4L8EA 3ZFBA 2KLXA 5G30A 4PTSA 4WETA 3TUEA 2OBKA 4K6XA 5F07A 3EMXA 1EOHA 3FEUA 4HZ4A 3GL5A 5G5FA 1T8EB 2IMDA 1TDIA 1YZXA 4MF6A 3A5WA 3D21A 1G7EA 2C1YA 3GRXA 1OC3A 1VRSD 4BVXA 2MBSA 3ZREA 2PVOC 3LG6A 1A2MA 4D73B 5GZZB 3WT1A 4I8BA 3EMPA 4DVCA 2GSQA 1SK2A 1OE7A 3K8NA 4NV2A 4XS1A 3J7Yk 3HZ8A 1PMTA 2C8UA 2IMFA 6GSVA 2O8VB 1DUGA 3VPTA 5EL8A 2HSNB 3P8WA 4OFMA 1B9XC 4N10A 1Z6MA 3TKSC 3LORA 1FG4A 4LL4B 3IRAA 2I3YA 2H6XA 2R3XA 4EDYA 3HJMA 1K0MA 2J23A 3H8QA 2L5OA 2WDUA 1K0BA 1F6MC 5AISA 3TB2A 5ID2B 3PPUA 2OE1A 3APOA 1JZOA 5ECSA 3P90A 4MA9A 20GSA 3A3TA 4LMVA 3ZZXA 1T4YA 3DMLA 2M46A 4Q5RA 2NVLA 2YJ7A 1GSUA 1XVWA 1XW6A 2C3NA 2P5RA 3TKSA 5G2ZA 1ERWA 1E2YA 2HRAA 2QC7A 4NXIA 2HRKB 4LL1B 3VURA 5EPFA 1HQOA 4F9ZA 2H6ZA 2PMTA 1U3IA 2VD1A 1Q98A 5IOWA 4XRAA 1X5DA 1ZYEA 2R37A 3DXBA 2C3TA 1GTUA 2MMAA 1XOBA 1O7UA 1O85A 2GLRA 4GSTA 2C0FA 4POBA 1FVKA 3G7JA 1Z7RA 1K0AA 2R5GA 2K8SA 2B3SA 1G7OA 1X9MB 1UN2A 5ECLB 2HSMA 1SJ6A 4GCIA 2MZCA 1JFUA 1QUWA 2VOCA 3EU4A 2FHEA 1O73A 4Q5QA 2LUSA 2VLVA 3HA9A 3TJFA 3GTUB 4EO3A 3ZRDA 4WF5A 1YQ1A 4KGIA 3H93A 5D9TA 4IW9A 2GSTA 11GSA 3FZ5A 3TKPA 4WXTA 4G19A 1DSBA 3HYPA 1ZGNA 2EIQA 4GLTA 4KDUA 5FT3A 1X9SB 2NTOA 5CRHA 2RIIA 1GLPA 1ERVA 2MYGA 1TK0B 3ZL5A 4G0LA 3IXRA 5ENUA 2X8CA 1XCCA 3GHAA 3QOUA 3Q18A 1OC8A 2LS5A 2WCIA 5GSSA 1U88A 4BVXB 4O92A 1FVJA 5LNKe 3FZ9A 3TRQA 1V57A 3ZIVA 3LYPA 4FYUA 3EU3A 5DAKA 3M3MA 2I1UA 5C04A 4ZL7A 5LD0A 4ILFA 2YZUA 4FQUA 3FKFA 4IN0A 5FWGA 1R5PA 5KN0A 4MPFA 4YQVA 4BA7A 2H8LA 2L6DA 5B8BA 3KJYA 4N11A 1TI3A 2OADA 3GYKA 1F3AA 1J0FA 1OKTA 4F2IA 2CX4A 4KA0A 2X8HA 2PN8A 1SKWB 3KCMA 3IK7A 6GSWA 2F8AA 2DJJA 5COHA 3WYWA 1YF1A 3JCML 1UVZA 1SENA 2RUEA 2FWHA 2A2SA 3HKRA 2XBQA 4GWRA 3F4TA 4IS0A 2YV7A 5HR3A 5IMVA 1TTZA 1PRXA 4TR1A 4G0IA 5DJMA 4TOPA 1WRYA 2H66A 3EVIA 4CW9A 4JEDA 3QD9A 4GTUA 3QAVA 4HUAA 3ZMLA 1PX7A 4ECBA 4KH7A 2DMLA 2CX3A 1BEDA 4HU7A 1I5GA 3R2QA 4PUAA 1OC9B 5DBQA 1K3OA 1SKRB 1N2AA 4LMWA 4EE0A 1QFNA 3TRPA 3BCIA 5J9BA 3MAKA 5ECPB 2HE3A 2VD0A 1J08A 2HQTA 2PU9C 1EWXA 1FHEA 2VLUA 4F03A 1XFLA 3S9FA 4BWQA 5J3RA 3HVXA 1THOA 2HZEB 5CRGA 3KM6A 5GAND 1RK4A 2MMZA 4CDOA 4ECCA 4MZBA 1SD8A 3L78A 4KUNA 1Z7PA 5F8BA 3ZFLA 2GTUA 2IFQB 4F0CA 1GL8A 2H70A 4MJCA 3KD0A 2X8GA 1NW2A 2YN1A 2AJQB 5JCWA 2B5YA 2J9HA 1JLWA 1MDKA 3LFLA 4XIHA 4JU5A 4IP6A 1A2JA 5DCGA 4G0KA 4MZCA 2OJLA 1EZKA 2G2QA 4MJAA 2E7PA 1SL2B 2CVDA 4XHMA 1Z5YE 5D96A 3CRTA 1BG5A 3ERFA 2LJAA 3DGQA 2WULA 1JZDA 4K7OA 1K0DA 2H1GA 1M99A 2PERA 4N0VA 4E8EA 1A24A 3UBKA 1MD4A 1KNGA 4IHUA 5H5RA 4KX4A 1EGRA 2H74A 4JZQA 1S3AA 5DAKB 2H72A 2EIRA 3GURA 2BJXA 4IP1A 3IAM2 4TR3A 3GL3A 3HCZA 1O8WA 1OVNA 5HFGA 5IMAA 3US3A 3KTLA 2FNOA 4IQAA 2LQOA 2PBJA 2M72A 2VCWA 1M2DA 4O32A 1SL1B 4NHZA 3EWLA 3G7YA 3C1RA 3IK9A 3HHVA 4HZ2A 2LKUA 3GKXA 3TJGA 4OWYA 5ECNB 2GVPA 4MLYA 3DVXA 3I6AA 1VGLA 4K0NA 1XWBA 2WGRA 3MNGA 2V6KA 3HZ4A 1WIKA 5JWQB 3J7Yb 3VWWA 2IN3A 1XIYA 5ECKB 1B4QA 4K2DA 4K9ZA 4AJ7A 3PH9A 2DSAA 2E2GA 3GUSA 4L0WA 1SJZA 2CT6A 2L4QA 5HR0A 5J41A 3QCPA 5ABRA 1VF4A 2IJYA 4BVYA 3KH7A 1FAAA 1ABAA 1QMVA 1TU8A 4PURA 4PX1A 2GZPA 3H79A 1SK1A 5ECQB 2LNTA 5DJLA 1V2AA 4X1UA 3GKKA 2PPTA 1M9BA 1LJRA 1QQ2A 3AY8A 1ZYQB 3HY2A 4PGTA 3KP8A 2GQKA 4BWSA 4RQXA 4HJ2A 4WEYA 1G6YA 5IMDA 3VWVA 2YWMA 1ML6A 3CBUA 1WOUA 2DIZA 1WE0A 2DJKA 2LRTA 4GQFA 3CSIA 2MMOA 5KN2A 2PUKC 4I2TA 3RPPA 4QQ7A 4EVMA 1RW1A 4KE3A 1THXA 2HZFA 1AC1A 1YY7A 3GX0A 4EF0A 1CQHA 1GSQA 3QR6A 1T4ZA 1M7TA 4FYCA 3ERWA 1YKAA 2YWNA 1JLVA 2DJ2A 3Q6OA 4ISDA 4TRXA 4USSA 3SBCA 5ECHB 3RAZA 3GKMA 9GSSA 2YZHA 3D4TA 4K7NA 6GSYA 4YQUA 3IDVA 3KH9A 2YV9A 3A2XA 1ZZYA 3UIWA 4EUYA 2B1LA 4HJMA 2KHPA 4KW6A 1E6BA 5IM9A 1EEJA 3EURA 3PGTA 2FD3A 4O7HA 1MEKA 3ZTLA 2VCXA 1PA3A 3TDGA 3UAPA 2GGTA 1PN9A 4HU9A 2HRNA 2RUFA 1BYEA 4EDZA 3WGDA 2PWJA 1O81A 5C00A 5J4UA 4WKWA 3LWAA 2IMKA 1Z3EA 3ERGA 5G1KA 4PQIA 2V1MA 1O6JA 2TIRA 1LBKA 3FR6A 2VL2C 5E59A 3IHQA 3MDKA 4X0XA 3QPMA 4F82A 5DALB 2FA4A 1B4PA 3LEFA 2O85A 2DBCA 3ZVJA 2FLSA 3KMNA 2L6CA 2B1KA 2VM2A 3IR4A 4L5OA 2GQMA 4JE1A 2IIYA 1KBNA 2JZSA 3M1GA 1AAZA 2YOIA 4KF9A 2B6MA 4FIWA 2B7JA 1T00A 1PQNA 2YWOA 3ZIJA 4HQSA 4K8MA 6GSSA 3RHBA 3N5OA 2HFDA 4TXOB 4HS1A 2P5QA 2CQ9A 4MF7A 2JZTA 3O76A 2TRCP 5IMZA 3ZVJD 2DJ0A 4DSSA 2AUVA 4G2EA 2VL2A 2EIOA 3O6TA 5KN3A 3F6FA 5B6MA 4ZBAA 1DE2A 4ZBBA 3D6IA 5INYA 2V41A 1OKDA 3ED3A 1XW5A 1GTBA 3FR9A 3QFBC 2VM1A 2DIYA 3LGCA 4GQCA 4MCUA 3VI5A 3D22A 4XTSA 1EGOA 5B6NA 3KEBA 3GMFA 4ULXA 2REMA 4POLA 1GUKA 4XS4A 3M9JA 1ZL9A 4ML6A 4ZXGA 2H75A 4HOJA 4J57E 1YJ6A 4GXZA 2HSHA 1Y25A 2H30A 2P0GA 3TKQA 1SU9A 1T7PB 2E2MA 1NM3A 4HDEA 1TJDA 4G10A 3F63A 1GNEA 3WGEA 1AIUA 3DYRA 5DCHA 5IMCA 1F2EA 3F3RA 4QL7A 1YF0A 3CSJA 3CTGA 3QAGA 2ALBA 5DQYA 3WD6A 1K3LA 5BMUA 3TRXA 2I81A 2LRCA 2MBTA 2KP1A 3FHKA 1EV9A 3KMOA 5D9VA 2YP6A 1SJIA 1ERTA 1SYXA 4MK3A 4MP4A 1NHYA 2XC2A 6GSUA 2ZUPA 1M2AA 3ISOA 2H01A 1KEBA 1XVQA 2F9SA 3W8JA 12GSA 1F37A 2IMIA 18GSA 2O87A 3EYTA 4Q5NA 3L9VA 3F8UA 1FB6A 2LQQA 1Q4JA 3H1NA 2I9HA 1B48A 3UBLA 2H76A 1MD3A 4MZWA 3ZYWA 2CZ3A 1PKZA 3UL3A 4IBPA 1URMA 1XXUA 3TOTA 14GSA 2DJ1A 3W6GA 1AUCA 1BQ7A 3P2AA 5JWRB 3ZLPA 2LV3A 2TRXA 1TRVA 2ON7A 3TJKA 5GAPD 4XRDA 5JCUA 2JSYA 3MWHA 2LJKA 2QGVA 2GZZA 5H5QA 4WBJA 1V40A 2HNLA 1B9YC 1PGTA 2RM6A 3TCOA 1QK8A 16GSA 4WBRD 4TW5A 2NDOA 4PQ1A 2C0GA 5D9WA 4IGJA 4NPBA 3L4NA 3VLNA 4LLRA 2X64A 3G9BA 1AQVA 2FUG2 3C8EA 1A8YA 1TRWA 4G9HA 4GSSA 3GIXA 3RPNA 2BTOT 2HYXA 2UZ8A 4O5RA 2WFCA 7GSSA 2HSMB 1G0TA 2L4CA 3DIEA 4TVEA 3HDCA 3IAS2 1W4VA 2OBIA 4KB3A 1XWKA 4BPYA 4X43A 2N5BA 4OO4A 4JR6A 1GRXA 1TKDB 5EY6A 4PNGA 3GFKA 2VCZA 1YEPA 2LSTA 3Q19A 1ILOA 4PNFA 5F06A 5E4WA 1R5AA 2WJUA 1J9BA 1K0OA 1GH2A 1TP9A 2FCHA 5ECIB 1B8XA 3D4MA 1JHBA 2CV4A 1ZCPA 3GSSA 3CTFA 3EC3A 1NSWA 3GV1A 1BJXA 4TKYA 2R2JA 3OR5A 1XPVA 1GTAA 2M80A 2L59A 1ERUA 2KP2A 1YDKA 3HD5A 1F9MA 2N5AA 3IPZA 3C71A 2ON5A 4QL9A 3C73A 3QDNA 2OE0A 4ZB9A 4P3YB 5HQPA 3F0IA 4FO5A 4ECIA 1CQGA 2CA8A 5IMFA 4ZL8A 3WT2A 4F0BA 1GUMA 2OACA 1X5CA 3M8NA 4N30A 4V2NA 6GSXA 5HR1A 2FA8A 2IPAA 3UVHA 4WR4A 3KIJA 4OFTA 1RQMA 10GSA 2DLXA 1OYJA 1JZWA 1EV4A 4MMMA 2CZ2A 4AGSA 4RI6A 3MSZA 2AYTA 1A0FA 2FY6A 1M9AA 3QMXA 4ZB6A 2HRKA 2VL3A 2R4VA 3U5RE 2OE3A 1XWCA 3UARA 2WZ9A 1GSEA 1K0NA 4NHWA 1K3YA 4JRRA 1X5EA 1GUHA 4TR1B 1O8XA 2G0FA 1T3BA 3BBYA 3UOMA 5IO0A 1HNBA 1A23A 3F9UA 4RQRA 2LTKA 2RM5A 4RUVA 4CHSA 3IBHA 5DVBA 4POKA 4I6XA 1PD21 1PX6A 2GQLA 2C0EA 2DC5A 2ES7A 1EOGA 4RI7A 2C3QA 4EXJA 4AJ6A 1HYUA 2JL4A 3ME8A 2C4JA 3GTUA 4V1Ag 1GTIA 2HT9A 4E8HA 3HVSA 4ID0A 3NOFA 1FB0A 3E3EA 4BL7A 13GSA 5IOXA 3KTBA 1TU7A 4L5LA 2HI7A 2B5EA 4J2FA 3UEMA 5L71A 3C1SA 1ZMAA 2A2RA 2YANA 3I9V2 1GWCA 3HVVA 4KSOA 1XWAA 1HD2A 2NPBA 3UJ1A 3LSZA 3N9JA 2X99A 3KXOA 4LA1A 2DMMA 3I43A 4TR0A 3V1WA 1ZOFA 3KZQA 4KDYA 1TOFA 2VCVA 3W8SA 1GSFA 3P7XA 2HRFA 3FZ4A 4HEA2 1W89A 4L0UA 4ZL9A 2CAIA 5J9CA 5HFIA 2ZNMA 2AAWA 5KN1A 3VI7A 1VF3A 4MF5A 5HR2A 5IQYA 1GLQA 1M2BA 3O3TA 4K0GA 1ON4A 3DVWA 4OO5A 5GSTA 1GNWA 4PUFC 3D0ZA 4NMUA 3QAWA 1BX9A 3E9JB 2VUPA 3DD3A 2XPEA 5AGYA 3GSTA 3RDWA 8GSSA 4OMVA 3WGXA 2AHEA 1U6TA 3L9UA 5CYYA 2ZCTA 3IC4A 5AIVA 3VWUA 1ACVA 3BOAA 4AJ8A 4YQMA 2H1BA 3ZMKA 2IWTA 3LXZA 4IQ1A 4KNDA 3Q74A 5D73A 3FZAA 2AB6A 1WJKA 4PXOA 1Z6NA 3KP9A 4TR4A 5A4UA 2GDRA 2L57A 3BJ5A 3L0HA 3IV4A 5EVOA 2WB9A 1OC9A 1QGVA 2K9FA 4ZIJA 4IJ3A 1TI1A 1XOAA 2HLSA 1GSYA 2GT6A 3VFIA 3PR8A 3HXSA 1H4OA 3M9KA 1HNAA 1X9WB 2H73A 5JWOB 3NIVA 3UMAA 5KEJA 1AQWA 2FWEA 3HJOA 4FYBA 2O89A 4TN8A 2HZEA 1GULA 1AXDA 2P31A 2HXKA 5DDLA 1FW1A 3APQA 3F3QA 3TKSE 22GSA 1G6WA 3FYGA 2N5FA 2FGXA 4BVYB 1QXHA 4I2UA 2VL9A 5CO3A 5CAXA 1V9WA 2XHFA 4ML1A 4MABA 2IFQA 4KDXA 2L5LA 3G7IA 1DBYA 3TKRA 4GSNA 1WPIA 3KGKA 2XPDA 5IPGA 2GZYA 1PL2A 5CRDA 1S3CA 1JZRA 4K1FA 1MDIA 3RHCA 5A5KA 1V58A 4H86A 1M0UA 1IYIA 4BL7B 3F4SA 3CSHA 5F0GA 6GSTA 4POMA 3SWLA 5G31A 4V2MA 3LXTA 3HJPA 4J56E 1EP7A 2V2GA 4MH3A 3TJJA 1TRSA 1R26A 1R4WA 4NWYA 2F51A 2O7KA 3A2VA 3F4RA 5ECMB 3TJBA 1C72A 4EC0A 5B8AA 2LRNA 1WMJA 4EKZA 1V98A 4I5QA 3F6DA 1MTCA 3EINA 1PSQA 1GSSA 2OKAA 5A4WA 2E0QA 1EP8A 1AW9A 4YAVA 1WWJA 3EE2A 4IJIA 3CMIA 1SD9A 5A4VA 2V32A 3VK9A 2KOKA 1A8LA 3FRCA 2YPMA 4YAPA 2F3MA 4DEJA 3C7MA
chains in the Genus database with same CATH superfamily
4CY8A 4IKHA 1R7HA 1GSDA 1UA5A 4ECJA 1NHOA 2C80A 2VAFA 5ELGA 3L9SA 1XZOA 5A34B 1S4BP 3GA4A 5CREA 5IPHA 4V1Ap 2H0GA 1S3RA 2GT5A 5HFKA 3U6VA 2F8FA 2H19A 1OAZA 5LCZA 4XCSA 1KTEA 4GF0A 1EEMA 1TK5B 1DE1A 4KCEA 5AN1A 4ZBDA 4WF4A 5ELAA 4Q5FA 2Z9SA 2H71A 2LJRA 1BAYA 4MDCA 3M0FA 3LJRA 2CVBA 4PQHA 2GS3A 2CAQA 4FH8A 3GX8A 4JBBA 2K8VA 4WR5A 1XWGA 1GP1A 1ZYPA 3FR3A 4Z2TA 5FHIA 5G1LA 4TXVA 2C0DA 4K7IA 5D8IA 2GSSA 3D5JA 2XBIA 3DRNA 1SL0B 2VLTA 2I4AA 3BCKA 1YKCA 3R3EA 2YNXA 4N0ZA 5B7CA 4E68A 4XS6A 2JADA 2WS2A 1VF2A 2JU5A 2FWFA 5ECRB 4OCFA 1SVOA 1U3AA 1YEXA 3CRUA 2H1DA 4Z7XA 2LEGA 1S3DA 2H6YA 1N8JA 4DSSB 2WRTA 3IA1A 3QFAC 3TOUA 3I69A 3PINA 3DWVA 4GRFA 2YJHA 1WP0A 4K5RA 4MJBA 2CVKA 5J4VA 2NBSA 1A0RP 2JZRA 1TXXA 2VCQA 1USBA 1LU4A 2OA7A 2VO4A 5CP1A 4D73A 3LYKA 5ECOB 1MDJA 4ZB8A 3FK8A 4ZILA 5DQSA 4XS4B 3NZNA 1FOVA 3UVTA 4OD7A 1FO5A 3BD2A 3A2WA 2BMXA 3VWXA 2HSNA 2R0CA 4KCAA 5AIXA 3GKNA 4NV5A 3IC8A 2JSZA 1I9DA 2K18A 1XW9A 4I97A 2VIMA 5F05A 1VF1A 1XBSA 2HSYA 1X0RA 1H75A 4IVFA 2JACA 1F3BA 3CWGA 4DSRA 2GSRA 3RBTA 4Z2RA 2K6VA 5BMUB 1TRUA 4HQZA 5ID2A 1Z9HA 3IE3A 2D2ZA 3CYNA 17GSA 1SYRA 1TK8B 1IYHA 4HI7A 1TW9A 2PGTA 2H0HA 4OCEA 5J40A 1U87A 2A4VA 4DSQA 1A2LA 4V2LA 2B5XA 3VPQA 3TGZA 4JR4A 4OFNA 4AF2A 2B7KA 1XG8A 2V6OA 5G5EA 1SK0A 2AV4A 5CRWA 3ZITA 1K0CA 5DALA 1T1VA 2PVQA 4KSMA 4IELA 3GH6A 3FY7A 4MJEA 2YCDA 3GNJA 5CNWA 1Y6EA 2EC4A 2EFDA 3GN3A 2RLIA 2R6KA 2MMNA 4MPGA 2FWGA 1PKWA 4MH2A 5J4YA 2DJ3A 5D93A 5JCGA 2IL3A 5IO2A 1PL1A 3IOSA 3CXGA 2QSIA 3E0UA 1HNCA 1AQXA 2DKHA 4KAEA 5J5NA 4TXOA 1UC7A 3ME7A 2QA2A 3H4KA 3FW2A 5H5SA 2IMEA 3LQ7A 5IIZA 4YH2A 2YWIA 1ST9A 2VCTA 4NAXA 3DEXA 2VKZG 2LNSA 1OE8A 2H1AA 5D9XA 2QKEA 2H0IA 3DKSA 4EL1A 19GSA 2EFCA 3GH9A 1SKSB 3APSA 2KUCA 4ACSA 5KOWA 4YKGA 4L8EA 3ZFBA 2KLXA 5G30A 4PTSA 4WETA 3TUEA 2OBKA 4K6XA 4O5UA 5F07A 3EMXA 1EOHA 3FEUA 4HZ4A 3GL5A 5G5FA 1T8EB 2IMDA 1TDIA 2UV8G 3HVNA 1YZXA 4MF6A 3A5WA 3D21A 1G7EA 2C1YA 3GRXA 1OC3A 1VRSD 4BVXA 2MBSA 3ZREA 2PVOC 3LG6A 1A2MA 4D73B 5GZZB 3WT1A 4I8BA 2WVZA 3EMPA 4DVCA 2GSQA 5A5HB 1SK2A 1OE7A 3K8NA 4NV2A 4XS1A 3J7Yk 3HZ8A 1PMTA 2C8UA 2IMFA 6GSVA 2O8VB 1DUGA 3VPTA 5EL8A 2HSNB 3P8WA 4OFMA 1B9XC 4N10A 1Z6MA 3TKSC 3LORA 1FG4A 4LL4B 3IRAA 2I3YA 2H6XA 2R3XA 4BIKA 4EDYA 3HJMA 1K0MA 2J23A 3H8QA 2L5OA 2WDUA 1K0BA 1F6MC 5AISA 3TB2A 2WVYA 5ID2B 3PPUA 2OE1A 3APOA 1JZOA 5ECSA 3P90A 4MA9A 20GSA 3A3TA 4LMVA 3ZZXA 1T4YA 3DMLA 4AKXB 4Q5RA 2M46A 2NVLA 2YJ7A 4X4JA 1GSUA 1XVWA 1XW6A 2C3NA 2P5RA 3TKSA 5G2ZA 1ERWA 1E2YA 2HRAA 2WW2A 2QC7A 2X4AA 4NXIA 2HRKB 4LL1B 3VURA 5EPFA 1HQOA 4F9ZA 2H6ZA 2PMTA 1U3IA 2VD1A 1Q98A 5IOWA 4XRAA 1X5DA 1ZYEA 2R37A 3DXBA 1PFOA 2C3TA 1GTUA 2MMAA 1XOBA 1O7UA 1O85A 2GLRA 4GSTA 2C0FA 4POBA 1FVKA 3G7JA 1BF5A 1Z7RA 1K0AA 2R5GA 2K8SA 2B3SA 1G7OA 1X9MB 1UN2A 5ECLB 2HSMA 1SJ6A 4GCIA 2MZCA 1JFUA 1QUWA 2VOCA 3EU4A 2FHEA 1O73A 4Q5QA 2LUSA 2VLVA 3HA9A 3TJFA 3GTUB 4EO3A 3ZRDA 4WF5A 4YKFA 1YQ1A 4KGIA 3H93A 5D9TA 4IW9A 2GSTA 11GSA 3FZ5A 2DKIA 3TKPA 4WXTA 4G19A 1DSBA 3HYPA 1ZGNA 2EIQA 4GLTA 1BG1A 4KDUA 5FT3A 1X9SB 2NTOA 5CRHA 2RIIA 1GLPA 1ERVA 2MYGA 1TK0B 3ZL5A 4G0LA 3IXRA 5ENUA 2X8CA 1XCCA 3GHAA 3QOUA 3Q18A 1OC8A 2LS5A 2WCIA 5GSSA 1U88A 2WZSA 4BVXB 4O92A 1FVJA 5LNKe 3FZ9A 3TRQA 1V57A 3ZIVA 3LYPA 4FYUA 3EU3A 5DAKA 3M3MA 2I1UA 5C04A 4ZL7A 5LD0A 4ILFA 2YZUA 4FQUA 3FKFA 4IN0A 5FWGA 1R5PA 5KN0A 4MPFA 4YQVA 4BA7A 2H8LA 2L6DA 5B8BA 3KJYA 2X49A 4N11A 1TI3A 2OADA 3GYKA 1F3AA 1J0FA 1OKTA 4F2IA 2CX4A 4KA0A 2X8HA 2PN8A 1SKWB 3KCMA 3IK7A 6GSWA 2F8AA 2DJJA 5COHA 3WYWA 1YF1A 3JCML 1UVZA 1SVLA 2EFEA 1SENA 2RUEA 2FWHA 2A2SA 3HKRA 2XBQA 4GWRA 3F4TA 4IS0A 2YV7A 5HR3A 5IMVA 2O5VA 1TTZA 1PRXA 4TR1A 4G0IA 5DJMA 4ICYA 4TOPA 1WRYA 2H66A 3EVIA 3LW9A 4CW9A 4JEDA 3QD9A 4GTUA 3QAVA 4HUAA 3A5IA 3ZMLA 1PX7A 4ECBA 4KH7A 2DMLA 2CX3A 1BEDA 4HU7A 1I5GA 3R2QA 4PUAA 1OC9B 5DBQA 1K3OA 1SKRB 1N2AA 4LMWA 4EE0A 1QFNA 3TRPA 3BCIA 5J9BA 3MAKA 5ECPB 2HE3A 2VD0A 1J08A 2HQTA 2PU9C 1EWXA 1FHEA 2VLUA 4F03A 1XFLA 3S9FA 4BWQA 5J3RA 3HVXA 1THOA 2HZEB 5CRGA 3KM6A 5GAND 1RK4A 2MMZA 4CDOA 4ECCA 4MZBA 1SD8A 4PI0C 3L78A 4KUNA 1Z7PA 5F8BA 3ZFLA 2GTUA 2IFQB 4F0CA 1GL8A 2H70A 4MJCA 3CQFA 3KD0A 2X8GA 1NW2A 2YN1A 2AJQB 5JCWA 2B5YA 4AI6A 2J9HA 1JLWA 1MDKA 3LFLA 4XIHA 4JU5A 4IP6A 1A2JA 5DCGA 4G0KA 4MZCA 2OJLA 1EZKA 3HMJG 2G2QA 3RFRC 4MJAA 2E7PA 1SL2B 2CVDA 4XHMA 4O5QA 1Z5YE 5D96A 3CRTA 1BG5A 3ERFA 2LJAA 3DGQA 2O36A 2WULA 1JZDA 4K7OA 1K0DA 2H1GA 1M99A 2PERA 1N25A 4N0VA 4E8EA 1A24A 2OT3A 3UBKA 1MD4A 1YEWC 1KNGA 4IHUA 5H5RA 4KX4A 3MIXA 1EGRA 2H74A 4JZQA 1S3AA 5DAKB 2H72A 2EIRA 3GURA 2BJXA 4IP1A 3IAM2 4TR3A 3GL3A 3HCZA 1O8WA 1OVNA 5HFGA 4EIPA 2R0GA 5IMAA 3US3A 3KTLA 2FNOA 4IQAA 5A1NA 2LQOA 2PBJA 2M72A 5KOXA 2VCWA 1M2DA 4O32A 1SL1B 4NHZA 3EWLA 3G7YA 3C1RA 3IK9A 4AKHA 3HHVA 4HZ2A 2LKUA 3GKXA 3TJGA 4OWYA 5ECNB 2GVPA 4MLYA 3DVXA 1I1IP 3I6AA 1VGLA 4K0NA 1XWBA 2WGRA 3MNGA 2V6KA 3HZ4A 1WIKA 5JWQB 3J7Yb 3VWWA 2IN3A 1XIYA 5ECKB 1B4QA 4K2DA 4K9ZA 4AJ7A 3PH9A 2DSAA 2E2GA 3EPTA 3GUSA 4L0WA 1SJZA 2CT6A 2L4QA 5HR0A 5J41A 3QCPA 5ABRA 1VF4A 2IJYA 4BVYA 3KH7A 4AKGA 1FAAA 1ABAA 1QMVA 1TU8A 4PURA 4PX1A 2GZPA 3H79A 1SK1A 5ECQB 2LNTA 5DJLA 1V2AA 4X1UA 3GKKA 2PPTA 1M9BA 1LJRA 1QQ2A 3AY8A 1ZYQB 2A2PA 3HY2A 4PGTA 3KP8A 2GQKA 4BWSA 4RQXA 4HJ2A 4WEYA 1G6YA 5IMDA 3VWVA 2YWMA 1ML6A 3CBUA 1WOUA 2DIZA 1WE0A 2DJKA 2LRTA 4GQFA 3CSIA 2MMOA 5KN2A 2PUKC 2WVXA 4I2TA 3RPPA 4QQ7A 4EVMA 1RW1A 4KE3A 1THXA 2HZFA 1AC1A 1YY7A 3GX0A 4EF0A 1CQHA 1GSQA 3QR6A 1T4ZA 1M7TA 4FYCA 5J47A 3ERWA 1YKAA 1SVMA 2YWNA 1JLVA 2DJ2A 3Q6OA 4ISDA 4TRXA 4USSA 3SBCA 5ECHB 3RAZA 3GKMA 9GSSA 2YZHA 3D4TA 4K7NA 6GSYA 4YQUA 3IDVA 3KH9A 2YV9A 3A2XA 1ZZYA 3UIWA 4EUYA 2B1LA 4HJMA 2KHPA 4KW6A 1E6BA 5IM9A 4EIQA 1EEJA 3EURA 3PGTA 2FD3A 4O7HA 1MEKA 3ZTLA 2VCXA 1PA3A 5A34A 3TDGA 3UAPA 2GGTA 1PN9A 4HU9A 2HRNA 2RUFA 1BYEA 4EDZA 3WGDA 2PWJA 5BRTA 1O81A 5C00A 5J4UA 4WKWA 3LWAA 2IMKA 1Z3EA 3ERGA 5G1KA 4PQIA 3IHGA 2V1MA 2A4HA 1O6JA 2WW3A 2TIRA 1LBKA 3FR6A 2VL2C 5E59A 3IHQA 3MDKA 4X0XA 3QPMA 4F82A 5DALB 2FA4A 1B4PA 3LEFA 2O85A 2DBCA 3ZVJA 2FLSA 3KMNA 2L6CA 2B1KA 2VM2A 3IR4A 4L5OA 2GQMA 4JE1A 3MYDA 2IIYA 1KBNA 2JZSA 3M1GA 1AAZA 2YOIA 4KF9A 2B6MA 4FIWA 2B7JA 1T00A 1PQNA 2YWOA 3ZIJA 4HQSA 4K8MA 4K2XA 6GSSA 3RHBA 4N3ZA 3N5OA 2HFDA 4TXOB 4HS1A 2P5QA 2CQ9A 4MF7A 2JZTA 3O76A 2TRCP 5IMZA 3ZVJD 2DJ0A 4DSSA 2AUVA 4G2EA 2VL2A 2EIOA 3O6TA 5KN3A 3F6FA 5B6MA 4ZBAA 1DE2A 4ZBBA 3D6IA 5INYA 4Z2UA 2V41A 1OKDA 3ED3A 1XW5A 1GTBA 3FR9A 3QFBC 2VM1A 2DIYA 3LGCA 4GQCA 4MCUA 3VI5A 3D22A 4XTSA 1EGOA 5B6NA 3KEBA 1ZYNA 3GMFA 4ULXA 2REMA 4POLA 1GUKA 4XS4A 3M9JA 1ZL9A 4ML6A 4ZXGA 2H75A 4HOJA 4J57E 1YJ6A 4GXZA 2HSHA 1Y25A 4ZB7A 3TU3B 2H30A 2P0GA 3TKQA 1SU9A 1T7PB 2E2MA 1NM3A 4HDEA 1TJDA 4G10A 3F63A 1GNEA 3WGEA 1AIUA 3DYRA 5DCHA 5IMCA 1F2EA 3F3RA 4QL7A 1YF0A 3CSJA 3CTGA 3QAGA 2ALBA 5DQYA 3WD6A 1K3LA 5BMUA 3TRXA 2I81A 2LRCA 2MBTA 2H1LA 2KP1A 3FHKA 1EV9A 3KMOA 5D9VA 2YP6A 1SJIA 4W66A 1ERTA 1SYXA 4MK3A 4MP4A 4PHZC 1NHYA 2XC2A 6GSUA 2ZUPA 1M2AA 3ISOA 2H01A 1KEBA 1XVQA 2F9SA 3W8JA 12GSA 1F37A 2IMIA 18GSA 2O87A 3EYTA 4Q5NA 3L9VA 3F8UA 1FB6A 2LQQA 1Q4JA 3H1NA 2I9HA 4CY6A 1B48A 3UBLA 2H76A 1MD3A 4MZWA 3ZYWA 2CZ3A 1PKZA 3UL3A 4IBPA 1URMA 1XXUA 3TOTA 14GSA 2DJ1A 3W6GA 1AUCA 1BQ7A 3P2AA 5JWRB 3ZLPA 2LV3A 2TRXA 1TRVA 2ON7A 3TJKA 5GAPD 4XRDA 5JCUA 2JSYA 3MWHA 2LJKA 2QGVA 2GZZA 5H5QA 4WBJA 1V40A 2HNLA 1B9YC 1PGTA 1YVLA 2RM6A 3TCOA 1QK8A 16GSA 4WBRD 4TW5A 2NDOA 4PQ1A 2C0GA 5D9WA 4IGJA 4NPBA 3L4NA 3VLNA 4LLRA 4K5SA 2X64A 3G9BA 4PI2C 1AQVA 2FUG2 3C8EA 1A8YA 1M3JA 1TRWA 4G9HA 4GSSA 3GIXA 3RPNA 4QMKA 2BTOT 2HYXA 2UZ8A 4O5RA 2WFCA 7GSSA 2HSMB 1G0TA 2L4CA 3DIEA 4TVEA 3HDCA 3IAS2 1W4VA 2OBIA 4KB3A 1XWKA 4BPYA 4X43A 2N5BA 4OO4A 4JR6A 1GRXA 1TKDB 5EY6A 3RGBC 4PNGA 3GFKA 2VCZA 1YEPA 2LSTA 3Q19A 1ILOA 4PNFA 5F06A 5E4WA 5A5HA 1R5AA 2O3EA 2WJUA 1J9BA 1K0OA 1GH2A 1TP9A 2FCHA 5ECIB 1B8XA 3D4MA 1JHBA 2CV4A 1ZCPA 3GSSA 3CTFA 3EC3A 1NSWA 3GV1A 1BJXA 4TKYA 2R2JA 3OR5A 1XPVA 1GTAA 2M80A 2L59A 1ERUA 2KP2A 1YDKA 3HD5A 1F9MA 2N5AA 3IPZA 3C71A 2ON5A 4QL9A 3C73A 3QDNA 2OE0A 4ZB9A 4P3YB 5HQPA 3F0IA 4FO5A 4ECIA 1CQGA 2CA8A 5IMFA 4ZL8A 3WT2A 4F0BA 1GUMA 2OACA 1X5CA 3M8NA 4N30A 4V2NA 6GSXA 5HR1A 2FA8A 2IPAA 3UVHA 4WR4A 3KIJA 4AKIA 4OFTA 1RQMA 10GSA 2DLXA 1OYJA 1JZWA 1EV4A 4HSCX 2CZ2A 4MMMA 4AGSA 4RI6A 3FMWA 3MSZA 2AYTA 1A0FA 2FY6A 1M9AA 3QMXA 4ZB6A 4FXYP 2HRKA 2VL3A 2R4VA 3U5RE 2OE3A 1XWCA 3UARA 2WZ9A 1GSEA 1PN0A 1K0NA 4NHWA 1K3YA 4JRRA 2WW1A 1X5EA 1GUHA 4TR1B 1O8XA 2G0FA 1T3BA 3BBYA 3UOMA 5IO0A 1HNBA 1A23A 3F9UA 4RQRA 1Y1UA 2LTKA 2RM5A 4RUVA 4CHSA 3IBHA 5DVBA 4POKA 4I6XA 1PD21 1PX6A 2GQLA 2C0EA 2DC5A 2ES7A 1EOGA 4RI7A 2C3QA 4EXJA 4AJ6A 1HYUA 2JL4A 3ME8A 2C4JA 3GTUA 4V1Ag 1GTIA 2HT9A 4E8HA 3HVSA 4ID0A 1TXUA 3NOFA 1FB0A 3E3EA 4BL7A 13GSA 5IOXA 3KTBA 1TU7A 4G01A 4L5LA 2HI7A 2B5EA 4J2FA 3UEMA 5L71A 3C1SA 1ZMAA 2A2RA 2YANA 3I9V2 1GWCA 3HVVA 4KSOA 1XWAA 1HD2A 2NPBA 3UJ1A 3LSZA 3N9JA 2X99A 3KXOA 4LA1A 2DMMA 3I43A 4TR0A 3V1WA 1ZOFA 3KZQA 4KDYA 1TOFA 2VCVA 3W8SA 1GSFA 2WW0A 3P7XA 2HRFA 3FZ4A 4HEA2 1W89A 4L0UA 4ZL9A 2CAIA 5J9CA 5HFIA 2ZNMA 2AAWA 5KN1A 3VI7A 1VF3A 4MF5A 5HR2A 5IQYA 1GLQA 1M2BA 3O3TA 4K0GA 1ON4A 3DVWA 4OO5A 5GSTA 1GNWA 4PUFC 3D0ZA 4NMUA 3QAWA 1BX9A 3E9JB 2VUPA 3DD3A 2XPEA 5AGYA 3GSTA 3RDWA 8GSSA 4OMVA 3WGXA 2AHEA 1U6TA 3L9UA 5CYYA 2ZCTA 4GDFA 3IC4A 5AIVA 3VWUA 1ACVA 5A1NB 4MNNA 3BOAA 4AJ8A 2QA1A 4YQMA 2H1BA 3ZMKA 2IWTA 3LXZA 4IQ1A 4KNDA 3Q74A 5D73A 3FZAA 2AB6A 1WJKA 4PXOA 1Z6NA 3KP9A 4TR4A 5A4UA 2GDRA 2L57A 3BJ5A 3L0HA 3IV4A 5EVOA 2WB9A 1OC9A 1QGVA 2K9FA 4ZIJA 4IJ3A 1TI1A 1XOAA 2HLSA 1GSYA 4A5PA 2GT6A 3VFIA 3PR8A 3HXSA 1H4OA 3M9KA 1HNAA 1X9WB 2H73A 5JWOB 3NIVA 3UMAA 5KEJA 1AQWA 2FWEA 2R0PA 3HJOA 4FYBA 2O89A 4TN8A 2HZEA 1GULA 1AXDA 2P31A 2HXKA 5DDLA 1FW1A 3APQA 3F3QA 3TKSE 22GSA 1G6WA 3FYGA 2N5FA 2FGXA 4BVYB 1QXHA 4I2UA 2VL9A 5CO3A 5CAXA 1V9WA 2XHFA 4ML1A 4MABA 2EFHA 2IFQA 4KDXA 2L5LA 3G7IA 1DBYA 3TKRA 4GSNA 1WPIA 3KGKA 2XPDA 5IPGA 2GZYA 1PL2A 5CRDA 1S3CA 1JZRA 4K1FA 1MDIA 3RHCA 5A5KA 1V58A 4H86A 1M0UA 1IYIA 4BL7B 3F4SA 3CSHA 5F0GA 6GSTA 4POMA 3SWLA 5G31A 4V2MA 3LXTA 3HJPA 4J56E 1EP7A 2V2GA 4MH3A 3TJJA 2WVXB 1TRSA 1R26A 1R4WA 4NWYA 2F51A 2O7KA 3A2VA 3F4RA 5ECMB 3TJBA 1C72A 4EC0A 5B8AA 2LRNA 1WMJA 4EKZA 1V98A 4I5QA 3F6DA 1MTCA 3EINA 1PSQA 1M3IA 1GSSA 2OKAA 1FOHA 5A4WA 2E0QA 1EP8A 1AW9A 4YAVA 1WWJA 3EE2A 4IJIA 3CMIA 1SD9A 5A4VA 2V32A 3VK9A 2KOKA 3CHXC 1A8LA 3FRCA 2YPMA 4YAPA 2F3MA 4DEJA 3C7MA
chains in the Genus database with same CATH topology
4CY8A 4IKHA 1R7HA 1GSDA 1UA5A 4ECJA 1NHOA 2C80A 2VAFA 5ELGA 3L9SA 1XZOA 5A34B 3GA4A 5CREA 5IPHA 4V1Ap 2H0GA 2GT5A 5HFKA 3U6VA 2F8FA 2H19A 1OAZA 5LCZA 4XCSA 1KTEA 4GF0A 1EEMA 1TK5B 1DE1A 4KCEA 5AN1A 4ZBDA 4WF4A 5ELAA 4Q5FA 2Z9SA 2H71A 2LJRA 1BAYA 4MDCA 3M0FA 3LJRA 2CVBA 4PQHA 2GS3A 2CAQA 4FH8A 3GX8A 4JBBA 2K8VA 4WR5A 1XWGA 1GP1A 1ZYPA 3FR3A 4Z2TA 5FHIA 5G1LA 4TXVA 2C0DA 4K7IA 5D8IA 2GSSA 3D5JA 2XBIA 3DRNA 1SL0B 2VLTA 2I4AA 3BCKA 1YKCA 3R3EA 2YNXA 4N0ZA 5B7CA 4E68A 4XS6A 2JADA 2WS2A 1VF2A 2JU5A 2FWFA 5ECRB 4OCFA 1SVOA 1U3AA 1YEXA 3CRUA 2H1DA 4Z7XA 2LEGA 1S3DA 2H6YA 1N8JA 4DSSB 2WRTA 3IA1A 3QFAC 3TOUA 3I69A 3PINA 3DWVA 4GRFA 2YJHA 1WP0A 4K5RA 4MJBA 2CVKA 5J4VA 2NBSA 1A0RP 2JZRA 1TXXA 2VCQA 1USBA 1LU4A 2OA7A 2VO4A 5CP1A 4D73A 3LYKA 5ECOB 1MDJA 4ZB8A 3FK8A 4ZILA 5DQSA 4XS4B 3NZNA 1FOVA 3UVTA 4OD7A 1FO5A 3BD2A 3A2WA 2BMXA 3VWXA 2HSNA 2R0CA 4KCAA 5AIXA 3GKNA 4NV5A 3IC8A 2JSZA 1I9DA 2K18A 1XW9A 4I97A 2VIMA 5F05A 1VF1A 1XBSA 2HSYA 1X0RA 1H75A 4IVFA 2JACA 1F3BA 3CWGA 4DSRA 2GSRA 3RBTA 4Z2RA 2K6VA 5BMUB 1TRUA 4HQZA 5ID2A 1Z9HA 3IE3A 2D2ZA 3CYNA 17GSA 1SYRA 1TK8B 1IYHA 4HI7A 1TW9A 2PGTA 2H0HA 4OCEA 5J40A 1U87A 2A4VA 4DSQA 1A2LA 4V2LA 2B5XA 3VPQA 3TGZA 4JR4A 4OFNA 4AF2A 2B7KA 2V6OA 5G5EA 1SK0A 2AV4A 5CRWA 3ZITA 1K0CA 5DALA 1T1VA 2PVQA 4KSMA 4IELA 3GH6A 3FY7A 4MJEA 2YCDA 3GNJA 5CNWA 1Y6EA 2EC4A 2EFDA 3GN3A 2RLIA 2R6KA 2MMNA 4MPGA 2FWGA 1PKWA 4MH2A 5J4YA 2DJ3A 5D93A 5JCGA 2IL3A 5IO2A 1PL1A 3IOSA 3CXGA 2QSIA 3E0UA 1HNCA 1AQXA 2DKHA 4KAEA 5J5NA 4TXOA 1UC7A 3ME7A 2QA2A 3H4KA 3FW2A 5H5SA 2IMEA 3LQ7A 5IIZA 4YH2A 2YWIA 1ST9A 2VCTA 4NAXA 3DEXA 2VKZG 2LNSA 1OE8A 2H1AA 5D9XA 2QKEA 2H0IA 3DKSA 4EL1A 19GSA 2EFCA 3GH9A 1SKSB 3APSA 2KUCA 4ACSA 5KOWA 4YKGA 4L8EA 3ZFBA 2KLXA 5G30A 4PTSA 4WETA 3TUEA 2OBKA 4K6XA 4O5UA 5F07A 3EMXA 1EOHA 3FEUA 4HZ4A 3GL5A 5G5FA 1T8EB 2IMDA 1TDIA 2UV8G 1YZXA 4MF6A 3A5WA 3D21A 1G7EA 2C1YA 3GRXA 1OC3A 1VRSD 4BVXA 2MBSA 3ZREA 2PVOC 3LG6A 1A2MA 4D73B 5GZZB 3WT1A 4I8BA 3EMPA 4DVCA 2GSQA 5A5HB 1SK2A 1OE7A 3K8NA 4NV2A 4XS1A 3J7Yk 3HZ8A 1PMTA 2C8UA 2IMFA 6GSVA 2O8VB 1DUGA 3VPTA 5EL8A 2HSNB 3P8WA 4OFMA 1B9XC 4N10A 1Z6MA 3TKSC 3LORA 1FG4A 4LL4B 3IRAA 2I3YA 2H6XA 2R3XA 4EDYA 3HJMA 1K0MA 2J23A 3H8QA 2L5OA 2WDUA 1K0BA 1F6MC 5AISA 3TB2A 5ID2B 3PPUA 2OE1A 3APOA 1JZOA 5ECSA 3P90A 4MA9A 20GSA 3A3TA 4LMVA 3ZZXA 1T4YA 3DMLA 4AKXB 4Q5RA 2M46A 2NVLA 2YJ7A 4X4JA 1GSUA 1XVWA 1XW6A 2C3NA 2P5RA 3TKSA 5G2ZA 1ERWA 1E2YA 2HRAA 2QC7A 2X4AA 4NXIA 2HRKB 4LL1B 3VURA 5EPFA 1HQOA 4F9ZA 2H6ZA 2PMTA 1U3IA 2VD1A 1Q98A 5IOWA 4XRAA 1X5DA 1ZYEA 2R37A 3DXBA 2C3TA 1GTUA 2MMAA 1XOBA 1O7UA 1O85A 2GLRA 4GSTA 2C0FA 4POBA 1FVKA 3G7JA 1BF5A 1Z7RA 1K0AA 2R5GA 2K8SA 2B3SA 1G7OA 1X9MB 1UN2A 5ECLB 2HSMA 1SJ6A 4GCIA 2MZCA 1JFUA 1QUWA 2VOCA 3EU4A 2FHEA 1O73A 4Q5QA 2LUSA 2VLVA 3HA9A 3TJFA 3GTUB 4EO3A 3ZRDA 4WF5A 4YKFA 1YQ1A 4KGIA 3H93A 5D9TA 4IW9A 2GSTA 11GSA 3FZ5A 2DKIA 3TKPA 4WXTA 4G19A 1DSBA 3HYPA 1ZGNA 2EIQA 4GLTA 1BG1A 4KDUA 5FT3A 1X9SB 2NTOA 5CRHA 2RIIA 1GLPA 1ERVA 2MYGA 1TK0B 3ZL5A 4G0LA 3IXRA 5ENUA 2X8CA 1XCCA 3GHAA 3QOUA 3Q18A 1OC8A 2LS5A 2WCIA 5GSSA 1U88A 4BVXB 4O92A 1FVJA 5LNKe 3FZ9A 3TRQA 1V57A 3ZIVA 3LYPA 4FYUA 3EU3A 5DAKA 3M3MA 2I1UA 5C04A 4ZL7A 5LD0A 4ILFA 2YZUA 4FQUA 3FKFA 4IN0A 5FWGA 1R5PA 5KN0A 4MPFA 4YQVA 4BA7A 2H8LA 2L6DA 5B8BA 3KJYA 2X49A 4N11A 1TI3A 2OADA 3GYKA 1F3AA 1J0FA 1OKTA 4F2IA 2CX4A 4KA0A 2X8HA 2PN8A 1SKWB 3KCMA 3IK7A 6GSWA 2F8AA 2DJJA 5COHA 3WYWA 1YF1A 3JCML 1UVZA 1SVLA 2EFEA 1SENA 2RUEA 2FWHA 2A2SA 3HKRA 2XBQA 4GWRA 3F4TA 4IS0A 2YV7A 5HR3A 5IMVA 2O5VA 1TTZA 1PRXA 4TR1A 4G0IA 5DJMA 4ICYA 4TOPA 1WRYA 2H66A 3EVIA 3LW9A 4CW9A 4JEDA 3QD9A 4GTUA 3QAVA 4HUAA 3A5IA 3ZMLA 1PX7A 4ECBA 4KH7A 2DMLA 2CX3A 1BEDA 4HU7A 1I5GA 3R2QA 4PUAA 1OC9B 5DBQA 1K3OA 1SKRB 1N2AA 4LMWA 4EE0A 1QFNA 3TRPA 3BCIA 5J9BA 3MAKA 5ECPB 2HE3A 2VD0A 1J08A 2HQTA 2PU9C 1EWXA 1FHEA 2VLUA 4F03A 1XFLA 3S9FA 4BWQA 5J3RA 3HVXA 1THOA 2HZEB 5CRGA 3KM6A 5GAND 1RK4A 2MMZA 4CDOA 4ECCA 4MZBA 1SD8A 3L78A 4KUNA 1Z7PA 5F8BA 3ZFLA 2GTUA 2IFQB 4F0CA 1GL8A 2H70A 4MJCA 3KD0A 2X8GA 1NW2A 2YN1A 2AJQB 5JCWA 2B5YA 4AI6A 2J9HA 1JLWA 1MDKA 3LFLA 4XIHA 4JU5A 4IP6A 1A2JA 5DCGA 4G0KA 4MZCA 2OJLA 1EZKA 3HMJG 2G2QA 4MJAA 2E7PA 1SL2B 2CVDA 4XHMA 4O5QA 1Z5YE 5D96A 3CRTA 1BG5A 3ERFA 2LJAA 3DGQA 2WULA 1JZDA 4K7OA 1K0DA 2H1GA 1M99A 2PERA 1N25A 4N0VA 4E8EA 1A24A 2OT3A 3UBKA 1MD4A 1KNGA 4IHUA 5H5RA 4KX4A 3MIXA 1EGRA 2H74A 4JZQA 1S3AA 5DAKB 2H72A 2EIRA 3GURA 2BJXA 4IP1A 3IAM2 4TR3A 3GL3A 3HCZA 1O8WA 1OVNA 5HFGA 4EIPA 2R0GA 5IMAA 3US3A 3KTLA 2FNOA 4IQAA 5A1NA 2LQOA 2PBJA 2M72A 5KOXA 2VCWA 1M2DA 4O32A 1SL1B 4NHZA 3EWLA 3G7YA 3C1RA 3IK9A 4AKHA 3HHVA 4HZ2A 2LKUA 3GKXA 3TJGA 4OWYA 5ECNB 2GVPA 4MLYA 3DVXA 3I6AA 1VGLA 4K0NA 1XWBA 2WGRA 3MNGA 2V6KA 3HZ4A 1WIKA 5JWQB 3J7Yb 3VWWA 2IN3A 1XIYA 5ECKB 1B4QA 4K2DA 4K9ZA 4AJ7A 3PH9A 2DSAA 2E2GA 3EPTA 3GUSA 4L0WA 1SJZA 2CT6A 2L4QA 5HR0A 5J41A 3QCPA 5ABRA 1VF4A 2IJYA 4BVYA 3KH7A 4AKGA 1FAAA 1ABAA 1QMVA 1TU8A 4PURA 4PX1A 2GZPA 3H79A 1SK1A 5ECQB 2LNTA 5DJLA 1V2AA 4X1UA 3GKKA 2PPTA 1M9BA 1LJRA 1QQ2A 3AY8A 1ZYQB 2A2PA 3HY2A 4PGTA 3KP8A 2GQKA 4BWSA 4RQXA 4HJ2A 4WEYA 1G6YA 5IMDA 3VWVA 2YWMA 1ML6A 3CBUA 1WOUA 2DIZA 1WE0A 2DJKA 2LRTA 4GQFA 3CSIA 2MMOA 5KN2A 2PUKC 4I2TA 3RPPA 4QQ7A 4EVMA 1RW1A 4KE3A 1THXA 2HZFA 1AC1A 1YY7A 3GX0A 4EF0A 1CQHA 1GSQA 3QR6A 1T4ZA 1M7TA 4FYCA 5J47A 3ERWA 1YKAA 1SVMA 2YWNA 1JLVA 2DJ2A 3Q6OA 4ISDA 4TRXA 4USSA 3SBCA 5ECHB 3RAZA 3GKMA 9GSSA 2YZHA 3D4TA 4K7NA 6GSYA 4YQUA 3IDVA 3KH9A 2YV9A 3A2XA 1ZZYA 3UIWA 4EUYA 2B1LA 4HJMA 2KHPA 4KW6A 1E6BA 5IM9A 4EIQA 1EEJA 3EURA 3PGTA 2FD3A 4O7HA 1MEKA 3ZTLA 2VCXA 1PA3A 5A34A 3TDGA 3UAPA 2GGTA 1PN9A 4HU9A 2HRNA 2RUFA 1BYEA 4EDZA 3WGDA 2PWJA 5BRTA 1O81A 5C00A 5J4UA 4WKWA 3LWAA 2IMKA 1Z3EA 3ERGA 5G1KA 4PQIA 3IHGA 2V1MA 2A4HA 1O6JA 2TIRA 1LBKA 3FR6A 2VL2C 5E59A 3IHQA 3MDKA 4X0XA 3QPMA 4F82A 5DALB 2FA4A 1B4PA 3LEFA 2O85A 2DBCA 3ZVJA 2FLSA 3KMNA 2L6CA 2B1KA 2VM2A 3IR4A 4L5OA 2GQMA 4JE1A 3MYDA 2IIYA 1KBNA 2JZSA 3M1GA 1AAZA 2YOIA 4KF9A 2B6MA 4FIWA 2B7JA 1T00A 1PQNA 2YWOA 3ZIJA 4HQSA 4K8MA 4K2XA 6GSSA 3RHBA 4N3ZA 3N5OA 2HFDA 4TXOB 4HS1A 2P5QA 2CQ9A 4MF7A 2JZTA 3O76A 2TRCP 5IMZA 3ZVJD 2DJ0A 4DSSA 2AUVA 4G2EA 2VL2A 2EIOA 3O6TA 5KN3A 3F6FA 5B6MA 4ZBAA 1DE2A 4ZBBA 3D6IA 5INYA 4Z2UA 2V41A 1OKDA 3ED3A 1XW5A 1GTBA 3FR9A 3QFBC 2VM1A 2DIYA 3LGCA 4GQCA 4MCUA 3VI5A 3D22A 4XTSA 1EGOA 5B6NA 3KEBA 1ZYNA 3GMFA 4ULXA 2REMA 4POLA 1GUKA 4XS4A 3M9JA 1ZL9A 4ML6A 4ZXGA 2H75A 4HOJA 4J57E 1YJ6A 4GXZA 2HSHA 1Y25A 4ZB7A 3TU3B 2H30A 2P0GA 3TKQA 1SU9A 1T7PB 2E2MA 1NM3A 4HDEA 1TJDA 4G10A 3F63A 1GNEA 3WGEA 1AIUA 3DYRA 5DCHA 5IMCA 1F2EA 3F3RA 4QL7A 1YF0A 3CSJA 3CTGA 3QAGA 2ALBA 5DQYA 3WD6A 1K3LA 5BMUA 3TRXA 2I81A 2LRCA 2MBTA 2H1LA 2KP1A 3FHKA 1EV9A 3KMOA 5D9VA 2YP6A 1SJIA 4W66A 1ERTA 1SYXA 4MK3A 4MP4A 1NHYA 2XC2A 6GSUA 2ZUPA 1M2AA 3ISOA 2H01A 1KEBA 1XVQA 2F9SA 3W8JA 12GSA 1F37A 2IMIA 18GSA 2O87A 3EYTA 4Q5NA 3L9VA 3F8UA 1FB6A 2LQQA 1Q4JA 3H1NA 2I9HA 4CY6A 1B48A 3UBLA 2H76A 1MD3A 4MZWA 3ZYWA 2CZ3A 1PKZA 3UL3A 4IBPA 1URMA 1XXUA 3TOTA 14GSA 2DJ1A 3W6GA 1AUCA 1BQ7A 3P2AA 5JWRB 3ZLPA 2LV3A 2TRXA 1TRVA 2ON7A 3TJKA 5GAPD 4XRDA 5JCUA 2JSYA 3MWHA 2LJKA 2QGVA 2GZZA 5H5QA 4WBJA 1V40A 2HNLA 1B9YC 1PGTA 1YVLA 2RM6A 3TCOA 1QK8A 16GSA 4WBRD 4TW5A 2NDOA 4PQ1A 2C0GA 5D9WA 4IGJA 4NPBA 3L4NA 3VLNA 4LLRA 4K5SA 2X64A 3G9BA 1AQVA 2FUG2 3C8EA 1A8YA 1TRWA 4G9HA 4GSSA 3GIXA 3RPNA 4QMKA 2BTOT 2HYXA 2UZ8A 4O5RA 2WFCA 7GSSA 2HSMB 1G0TA 2L4CA 3DIEA 4TVEA 3HDCA 3IAS2 1W4VA 2OBIA 4KB3A 1XWKA 4BPYA 4X43A 2N5BA 4OO4A 4JR6A 1GRXA 1TKDB 5EY6A 4PNGA 3GFKA 2VCZA 1YEPA 2LSTA 3Q19A 1ILOA 4PNFA 5F06A 5E4WA 5A5HA 1R5AA 2WJUA 1J9BA 1K0OA 1GH2A 1TP9A 2FCHA 5ECIB 1B8XA 3D4MA 1JHBA 2CV4A 1ZCPA 3GSSA 3CTFA 3EC3A 1NSWA 3GV1A 1BJXA 4TKYA 2R2JA 3OR5A 1XPVA 1GTAA 2M80A 2L59A 1ERUA 2KP2A 1YDKA 3HD5A 1F9MA 2N5AA 3IPZA 3C71A 2ON5A 4QL9A 3C73A 3QDNA 2OE0A 4ZB9A 4P3YB 5HQPA 3F0IA 4FO5A 4ECIA 1CQGA 2CA8A 5IMFA 4ZL8A 3WT2A 4F0BA 1GUMA 2OACA 1X5CA 3M8NA 4N30A 4V2NA 6GSXA 5HR1A 2FA8A 2IPAA 3UVHA 4WR4A 3KIJA 4AKIA 4OFTA 1RQMA 10GSA 2DLXA 1OYJA 1JZWA 1EV4A 4MMMA 2CZ2A 4AGSA 4RI6A 3FMWA 3MSZA 2AYTA 1A0FA 2FY6A 1M9AA 3QMXA 4ZB6A 2HRKA 2VL3A 2R4VA 3U5RE 2OE3A 1XWCA 3UARA 2WZ9A 1GSEA 1PN0A 1K0NA 4NHWA 1K3YA 4JRRA 1X5EA 1GUHA 4TR1B 1O8XA 2G0FA 1T3BA 3BBYA 3UOMA 5IO0A 1HNBA 1A23A 3F9UA 4RQRA 1Y1UA 2LTKA 2RM5A 4RUVA 4CHSA 3IBHA 5DVBA 4POKA 4I6XA 1PD21 1PX6A 2GQLA 2C0EA 2DC5A 2ES7A 1EOGA 4RI7A 2C3QA 4EXJA 4AJ6A 1HYUA 2JL4A 3ME8A 2C4JA 3GTUA 4V1Ag 1GTIA 2HT9A 4E8HA 3HVSA 4ID0A 1TXUA 3NOFA 1FB0A 3E3EA 4BL7A 13GSA 5IOXA 3KTBA 1TU7A 4G01A 4L5LA 2HI7A 2B5EA 4J2FA 3UEMA 5L71A 3C1SA 1ZMAA 2A2RA 2YANA 3I9V2 1GWCA 3HVVA 4KSOA 1XWAA 1HD2A 2NPBA 3UJ1A 3LSZA 3N9JA 2X99A 3KXOA 4LA1A 2DMMA 3I43A 4TR0A 3V1WA 1ZOFA 3KZQA 4KDYA 1TOFA 2VCVA 3W8SA 1GSFA 3P7XA 2HRFA 3FZ4A 4HEA2 1W89A 4L0UA 4ZL9A 2CAIA 5J9CA 5HFIA 2ZNMA 2AAWA 5KN1A 3VI7A 1VF3A 4MF5A 5HR2A 5IQYA 1GLQA 1M2BA 3O3TA 4K0GA 1ON4A 3DVWA 4OO5A 5GSTA 1GNWA 4PUFC 3D0ZA 4NMUA 3QAWA 1BX9A 3E9JB 2VUPA 3DD3A 2XPEA 5AGYA 3GSTA 3RDWA 8GSSA 4OMVA 3WGXA 2AHEA 1U6TA 3L9UA 5CYYA 2ZCTA 4GDFA 3IC4A 5AIVA 3VWUA 1ACVA 5A1NB 4MNNA 3BOAA 4AJ8A 2QA1A 4YQMA 2H1BA 3ZMKA 2IWTA 3LXZA 4IQ1A 4KNDA 3Q74A 5D73A 3FZAA 2AB6A 1WJKA 4PXOA 1Z6NA 3KP9A 4TR4A 5A4UA 2GDRA 2L57A 3BJ5A 3L0HA 3IV4A 5EVOA 2WB9A 1OC9A 1QGVA 2K9FA 4ZIJA 4IJ3A 1TI1A 1XOAA 2HLSA 1GSYA 4A5PA 2GT6A 3VFIA 3PR8A 3HXSA 1H4OA 3M9KA 1HNAA 1X9WB 2H73A 5JWOB 3NIVA 3UMAA 5KEJA 1AQWA 2FWEA 2R0PA 3HJOA 4FYBA 2O89A 4TN8A 2HZEA 1GULA 1AXDA 2P31A 2HXKA 5DDLA 1FW1A 3APQA 3F3QA 3TKSE 22GSA 1G6WA 3FYGA 2N5FA 2FGXA 4BVYB 1QXHA 4I2UA 2VL9A 5CO3A 5CAXA 1V9WA 2XHFA 4ML1A 4MABA 2EFHA 2IFQA 4KDXA 2L5LA 3G7IA 1DBYA 3TKRA 4GSNA 1WPIA 3KGKA 2XPDA 5IPGA 2GZYA 1PL2A 5CRDA 1S3CA 1JZRA 4K1FA 1MDIA 3RHCA 5A5KA 1V58A 4H86A 1M0UA 1IYIA 4BL7B 3F4SA 3CSHA 5F0GA 6GSTA 4POMA 3SWLA 5G31A 4V2MA 3LXTA 3HJPA 4J56E 1EP7A 2V2GA 4MH3A 3TJJA 1TRSA 1R26A 1R4WA 4NWYA 2F51A 2O7KA 3A2VA 3F4RA 5ECMB 3TJBA 1C72A 4EC0A 5B8AA 2LRNA 1WMJA 4EKZA 1V98A 4I5QA 3F6DA 1MTCA 3EINA 1PSQA 1GSSA 2OKAA 1FOHA 5A4WA 2E0QA 1EP8A 1AW9A 4YAVA 1WWJA 3EE2A 4IJIA 3CMIA 1SD9A 5A4VA 2V32A 3VK9A 2KOKA 1A8LA 3FRCA 2YPMA 4YAPA 2F3MA 4DEJA 3C7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKH A;  1R7H A;  1GSD A;  1UA5 A;  4ECJ A;  1NHO A;  2C80 A;  2VAF A;  5ELG A;  3L9S A;  1XZO A;  3GA4 A;  5IPH A;  5CRE A;  4V1A p;  2H0G A;  2GT5 A;  5HFK A;  3U6V A;  2F8F A;  2H19 A;  1OAZ A;  5LCZ A;  4XCS A;  1KTE A;  4GF0 A;  1EEM A;  1TK5 B;  1DE1 A;  4KCE A;  5AN1 A;  4ZBD A;  4WF4 A;  5ELA A;  4Q5F A;  2Z9S A;  2H71 A;  2LJR A;  1BAY A;  4MDC A;  3M0F A;  3LJR A;  2CVB A;  4PQH A;  2GS3 A;  2CAQ A;  4FH8 A;  3GX8 A;  4JBB A;  2K8V A;  4WR5 A;  1XWG A;  1GP1 A;  3FR3 A;  5FHI A;  5G1L A;  4TXV A;  2C0D A;  4K7I A;  5D8I A;  2GSS A;  3D5J A;  2XBI A;  3DRN A;  1SL0 B;  2VLT A;  2I4A A;  3BCK A;  1YKC A;  3R3E A;  2YNX A;  4N0Z A;  5B7C A;  4XS6 A;  2JAD A;  2WS2 A;  1VF2 A;  2JU5 A;  2FWF A;  5ECR B;  4OCF A;  1U3A A;  1YEX A;  3CRU A;  2H1D A;  4Z7X A;  2LEG A;  1S3D A;  2H6Y A;  1N8J A;  4DSS B;  2WRT A;  3IA1 A;  3QFA C;  3TOU A;  3I69 A;  3PIN A;  3DWV A;  4GRF A;  2YJH A;  1WP0 A;  4MJB A;  2CVK A;  2NBS A;  1A0R P;  2JZR A;  1TXX A;  2VCQ A;  1USB A;  1LU4 A;  2OA7 A;  2VO4 A;  5CP1 A;  4D73 A;  3LYK A;  5ECO B;  1MDJ A;  4ZB8 A;  3FK8 A;  4ZIL A;  5DQS A;  4XS4 B;  3NZN A;  1FOV A;  3UVT A;  4OD7 A;  1FO5 A;  3BD2 A;  3A2W A;  2BMX A;  3VWX A;  4KCA A;  5AIX A;  3GKN A;  4NV5 A;  3IC8 A;  2JSZ A;  1I9D A;  2K18 A;  1XW9 A;  4I97 A;  2VIM A;  5F05 A;  1VF1 A;  1XBS A;  2HSY A;  1X0R A;  1H75 A;  4IVF A;  2JAC A;  1F3B A;  4DSR A;  2GSR A;  3RBT A;  2K6V A;  1TRU A;  4HQZ A;  5ID2 A;  1Z9H A;  3IE3 A;  2D2Z A;  3CYN A;  17GS A;  1SYR A;  1TK8 B;  1IYH A;  4HI7 A;  1TW9 A;  2PGT A;  2H0H A;  4OCE A;  1U87 A;  2A4V A;  4DSQ A;  1A2L A;  4V2L A;  2B5X A;  3VPQ A;  3TGZ A;  4JR4 A;  4OFN A;  4AF2 A;  2B7K A;  2V6O A;  5G5E A;  1SK0 A;  2AV4 A;  5CRW A;  3ZIT A;  1K0C A;  5DAL A;  1T1V A;  2PVQ A;  4KSM A;  4IEL A;  3GH6 A;  3FY7 A;  4MJE A;  2YCD A;  3GNJ A;  5CNW A;  1Y6E A;  2EC4 A;  3GN3 A;  2RLI A;  2R6K A;  2MMN A;  4MPG A;  2FWG A;  1PKW A;  4MH2 A;  2DJ3 A;  5D93 A;  5JCG A;  2IL3 A;  5IO2 A;  1PL1 A;  3IOS A;  3CXG A;  2QSI A;  3E0U A;  1HNC A;  1AQX A;  4KAE A;  5J5N A;  4TXO A;  1UC7 A;  3ME7 A;  3H4K A;  3FW2 A;  5H5S A;  2IME A;  3LQ7 A;  5IIZ A;  4YH2 A;  2YWI A;  1ST9 A;  2VCT A;  4NAX A;  3DEX A;  2LNS A;  1OE8 A;  2H1A A;  5D9X A;  2QKE A;  2H0I A;  3DKS A;  4EL1 A;  19GS A;  3GH9 A;  1SKS B;  3APS A;  2KUC A;  4ACS A;  4L8E A;  3ZFB A;  2KLX A;  5G30 A;  4PTS A;  4WET A;  3TUE A;  2OBK A;  4K6X A;  5F07 A;  3EMX A;  1EOH A;  3FEU A;  4HZ4 A;  3GL5 A;  5G5F A;  1T8E B;  2IMD A;  1TDI A;  1YZX A;  4MF6 A;  3A5W A;  3D21 A;  1G7E A;  2C1Y A;  3GRX A;  1OC3 A;  1VRS D;  4BVX A;  2MBS A;  3ZRE A;  2PVO C;  3LG6 A;  1A2M A;  4D73 B;  5GZZ B;  3WT1 A;  4I8B A;  3EMP A;  4DVC A;  2GSQ A;  1SK2 A;  1OE7 A;  3K8N A;  4NV2 A;  4XS1 A;  3J7Y k;  3HZ8 A;  1PMT A;  2C8U A;  2IMF A;  6GSV A;  2O8V B;  1DUG A;  3VPT A;  5EL8 A;  2HSN B;  3P8W A;  4OFM A;  1B9X C;  4N10 A;  1Z6M A;  3TKS C;  3LOR A;  1FG4 A;  4LL4 B;  3IRA A;  2I3Y A;  2H6X A;  2R3X A;  4EDY A;  3HJM A;  1K0M A;  2J23 A;  3H8Q A;  2L5O A;  2WDU A;  1K0B A;  1F6M C;  5AIS A;  3TB2 A;  5ID2 B;  3PPU A;  2OE1 A;  3APO A;  1JZO A;  5ECS A;  3P90 A;  4MA9 A;  20GS A;  3A3T A;  4LMV A;  3ZZX A;  1T4Y A;  3DML A;  2M46 A;  4Q5R A;  2NVL A;  2YJ7 A;  1GSU A;  1XVW A;  1XW6 A;  2C3N A;  2P5R A;  3TKS A;  5G2Z A;  1ERW A;  1E2Y A;  2HRA A;  2QC7 A;  4NXI A;  2HRK B;  4LL1 B;  3VUR A;  5EPF A;  1HQO A;  4F9Z A;  2H6Z A;  2PMT A;  1U3I A;  2VD1 A;  1Q98 A;  5IOW A;  4XRA A;  1X5D A;  1ZYE A;  2R37 A;  3DXB A;  2C3T A;  1GTU A;  2MMA A;  1XOB A;  1O7U A;  1O85 A;  2GLR A;  4GST A;  2C0F A;  4POB A;  1FVK A;  3G7J A;  1Z7R A;  1K0A A;  2R5G A;  2K8S A;  2B3S A;  1G7O A;  1X9M B;  1UN2 A;  5ECL B;  2HSM A;  1SJ6 A;  4GCI A;  2MZC A;  1JFU A;  1QUW A;  2VOC A;  3EU4 A;  2FHE A;  1O73 A;  4Q5Q A;  2LUS A;  2VLV A;  3HA9 A;  3TJF A;  3GTU B;  4EO3 A;  3ZRD A;  4WF5 A;  1YQ1 A;  4KGI A;  3H93 A;  5D9T A;  4IW9 A;  2GST A;  11GS A;  3FZ5 A;  3TKP A;  4WXT A;  4G19 A;  1DSB A;  3HYP A;  1ZGN A;  2EIQ A;  4GLT A;  4KDU A;  5FT3 A;  1X9S B;  2NTO A;  5CRH A;  2RII A;  1GLP A;  1ERV A;  2MYG A;  1TK0 B;  3ZL5 A;  4G0L A;  3IXR A;  5ENU A;  2X8C A;  1XCC A;  3GHA A;  3QOU A;  3Q18 A;  1OC8 A;  2LS5 A;  2WCI A;  5GSS A;  1U88 A;  4BVX B;  4O92 A;  1FVJ A;  5LNK e;  3FZ9 A;  3TRQ A;  1V57 A;  3ZIV A;  3LYP A;  4FYU A;  3EU3 A;  5DAK A;  3M3M A;  2I1U A;  5C04 A;  4ZL7 A;  5LD0 A;  4ILF A;  2YZU A;  4FQU A;  3FKF A;  4IN0 A;  5FWG A;  1R5P A;  5KN0 A;  4MPF A;  4YQV A;  4BA7 A;  2H8L A;  2L6D A;  5B8B A;  3KJY A;  4N11 A;  1TI3 A;  2OAD A;  3GYK A;  1F3A A;  1J0F A;  1OKT A;  4F2I A;  2CX4 A;  4KA0 A;  2X8H A;  2PN8 A;  1SKW B;  3KCM A;  3IK7 A;  6GSW A;  2F8A A;  2DJJ A;  5COH A;  3WYW A;  1YF1 A;  3JCM L;  1UVZ A;  1SEN A;  2RUE A;  2FWH A;  2A2S A;  3HKR A;  2XBQ A;  4GWR A;  3F4T A;  4IS0 A;  2YV7 A;  5HR3 A;  5IMV A;  1TTZ A;  1PRX A;  4TR1 A;  4G0I A;  5DJM A;  4TOP A;  1WRY A;  2H66 A;  3EVI A;  4CW9 A;  4JED A;  3QD9 A;  4GTU A;  3QAV A;  4HUA A;  3ZML A;  1PX7 A;  4ECB A;  4KH7 A;  2DML A;  2CX3 A;  1BED A;  4HU7 A;  1I5G A;  3R2Q A;  4PUA A;  1OC9 B;  5DBQ A;  1K3O A;  1SKR B;  1N2A A;  4LMW A;  4EE0 A;  1QFN A;  3TRP A;  3BCI A;  5J9B A;  3MAK A;  5ECP B;  2HE3 A;  2VD0 A;  1J08 A;  2HQT A;  2PU9 C;  1EWX A;  1FHE A;  2VLU A;  4F03 A;  1XFL A;  3S9F A;  4BWQ A;  5J3R A;  3HVX A;  1THO A;  2HZE B;  5CRG A;  3KM6 A;  5GAN D;  1RK4 A;  2MMZ A;  4CDO A;  4ECC A;  4MZB A;  1SD8 A;  3L78 A;  4KUN A;  1Z7P A;  5F8B A;  3ZFL A;  2GTU A;  2IFQ B;  4F0C A;  1GL8 A;  2H70 A;  4MJC A;  3KD0 A;  2X8G A;  1NW2 A;  2YN1 A;  2AJQ B;  5JCW A;  2B5Y A;  2J9H A;  1JLW A;  1MDK A;  3LFL A;  4XIH A;  4JU5 A;  4IP6 A;  1A2J A;  5DCG A;  4G0K A;  4MZC A;  2OJL A;  1EZK A;  2G2Q A;  4MJA A;  2E7P A;  1SL2 B;  2CVD A;  4XHM A;  1Z5Y E;  5D96 A;  3CRT A;  1BG5 A;  3ERF A;  2LJA A;  3DGQ A;  2WUL A;  1JZD A;  4K7O A;  1K0D A;  2H1G A;  1M99 A;  2PER A;  4N0V A;  4E8E A;  1A24 A;  3UBK A;  1MD4 A;  1KNG A;  4IHU A;  5H5R A;  4KX4 A;  1EGR A;  2H74 A;  4JZQ A;  1S3A A;  5DAK B;  2H72 A;  2EIR A;  3GUR A;  2BJX A;  4IP1 A;  3IAM 2;  4TR3 A;  3GL3 A;  3HCZ A;  1O8W A;  1OVN A;  5HFG A;  5IMA A;  3US3 A;  3KTL A;  2FNO A;  4IQA A;  2LQO A;  2PBJ A;  2M72 A;  2VCW A;  1M2D A;  4O32 A;  1SL1 B;  4NHZ A;  3EWL A;  3G7Y A;  3C1R A;  3IK9 A;  3HHV A;  4HZ2 A;  2LKU A;  3GKX A;  3TJG A;  4OWY A;  5ECN B;  2GVP A;  4MLY A;  3DVX A;  3I6A A;  1VGL A;  4K0N A;  1XWB A;  2WGR A;  3MNG A;  2V6K A;  3HZ4 A;  1WIK A;  5JWQ B;  3J7Y b;  3VWW A;  2IN3 A;  1XIY A;  5ECK B;  1B4Q A;  4K2D A;  4K9Z A;  4AJ7 A;  3PH9 A;  2DSA A;  2E2G A;  3GUS A;  4L0W A;  1SJZ A;  2CT6 A;  2L4Q A;  5HR0 A;  5J41 A;  3QCP A;  5ABR A;  1VF4 A;  2IJY A;  4BVY A;  3KH7 A;  1FAA A;  1ABA A;  1QMV A;  1TU8 A;  4PUR A;  4PX1 A;  2GZP A;  3H79 A;  1SK1 A;  5ECQ B;  2LNT A;  5DJL A;  1V2A A;  4X1U A;  3GKK A;  2PPT A;  1M9B A;  1LJR A;  1QQ2 A;  3AY8 A;  1ZYQ B;  3HY2 A;  4PGT A;  3KP8 A;  2GQK A;  4BWS A;  4RQX A;  4HJ2 A;  4WEY A;  1G6Y A;  5IMD A;  3VWV A;  2YWM A;  1ML6 A;  3CBU A;  1WOU A;  2DIZ A;  1WE0 A;  2DJK A;  2LRT A;  4GQF A;  3CSI A;  2MMO A;  5KN2 A;  2PUK C;  4I2T A;  3RPP A;  4QQ7 A;  4EVM A;  1RW1 A;  4KE3 A;  1THX A;  2HZF A;  1AC1 A;  1YY7 A;  3GX0 A;  4EF0 A;  1CQH A;  1GSQ A;  3QR6 A;  1T4Z A;  1M7T A;  4FYC A;  3ERW A;  1YKA A;  2YWN A;  1JLV A;  2DJ2 A;  3Q6O A;  4ISD A;  4TRX A;  4USS A;  3SBC A;  5ECH B;  3RAZ A;  3GKM A;  9GSS A;  2YZH A;  3D4T A;  4K7N A;  6GSY A;  4YQU A;  3IDV A;  3KH9 A;  2YV9 A;  3A2X A;  1ZZY A;  3UIW A;  4EUY A;  2B1L A;  4HJM A;  2KHP A;  4KW6 A;  1E6B A;  5IM9 A;  1EEJ A;  3EUR A;  3PGT A;  2FD3 A;  4O7H A;  1MEK A;  3ZTL A;  2VCX A;  1PA3 A;  3TDG A;  3UAP A;  2GGT A;  1PN9 A;  4HU9 A;  2HRN A;  2RUF A;  1BYE A;  4EDZ A;  3WGD A;  2PWJ A;  1O81 A;  5C00 A;  5J4U A;  4WKW A;  3LWA A;  2IMK A;  1Z3E A;  3ERG A;  5G1K A;  4PQI A;  2V1M A;  1O6J A;  2TIR A;  1LBK A;  3FR6 A;  2VL2 C;  5E59 A;  3IHQ A;  3MDK A;  4X0X A;  3QPM A;  4F82 A;  5DAL B;  2FA4 A;  1B4P A;  3LEF A;  2O85 A;  2DBC A;  3ZVJ A;  2FLS A;  3KMN A;  2L6C A;  2B1K A;  2VM2 A;  3IR4 A;  4L5O A;  2GQM A;  4JE1 A;  2IIY A;  1KBN A;  2JZS A;  3M1G A;  1AAZ A;  2YOI A;  4KF9 A;  2B6M A;  4FIW A;  2B7J A;  1T00 A;  1PQN A;  2YWO A;  3ZIJ A;  4HQS A;  4K8M A;  6GSS A;  3RHB A;  3N5O A;  2HFD A;  4TXO B;  4HS1 A;  2P5Q A;  2CQ9 A;  4MF7 A;  2JZT A;  3O76 A;  2TRC P;  5IMZ A;  3ZVJ D;  2DJ0 A;  4DSS A;  2AUV A;  4G2E A;  2VL2 A;  2EIO A;  3O6T A;  5KN3 A;  3F6F A;  5B6M A;  4ZBA A;  1DE2 A;  4ZBB A;  3D6I A;  5INY A;  2V41 A;  1OKD A;  3ED3 A;  1XW5 A;  1GTB A;  3FR9 A;  3QFB C;  2VM1 A;  2DIY A;  3LGC A;  4GQC A;  4MCU A;  3VI5 A;  3D22 A;  4XTS A;  1EGO A;  5B6N A;  3KEB A;  3GMF A;  4ULX A;  2REM A;  4POL A;  1GUK A;  4XS4 A;  3M9J A;  1ZL9 A;  4ML6 A;  4ZXG A;  2H75 A;  4HOJ A;  4J57 E;  1YJ6 A;  4GXZ A;  2HSH A;  1Y25 A;  2H30 A;  2P0G A;  3TKQ A;  1SU9 A;  1T7P B;  2E2M A;  1NM3 A;  4HDE A;  1TJD A;  4G10 A;  3F63 A;  1GNE A;  3WGE A;  1AIU A;  3DYR A;  5DCH A;  5IMC A;  1F2E A;  3F3R A;  4QL7 A;  1YF0 A;  3CSJ A;  3CTG A;  3QAG A;  2ALB A;  5DQY A;  3WD6 A;  1K3L A;  5BMU A;  3TRX A;  2I81 A;  2LRC A;  2MBT A;  2KP1 A;  3FHK A;  1EV9 A;  3KMO A;  5D9V A;  2YP6 A;  1SJI A;  1ERT A;  1SYX A;  4MK3 A;  4MP4 A;  1NHY A;  2XC2 A;  6GSU A;  2ZUP A;  1M2A A;  3ISO A;  2H01 A;  1KEB A;  1XVQ A;  2F9S A;  3W8J A;  12GS A;  1F37 A;  2IMI A;  18GS A;  2O87 A;  3EYT A;  4Q5N A;  3L9V A;  3F8U A;  1FB6 A;  2LQQ A;  1Q4J A;  3H1N A;  2I9H A;  1B48 A;  3UBL A;  2H76 A;  1MD3 A;  4MZW A;  3ZYW A;  2CZ3 A;  1PKZ A;  3UL3 A;  4IBP A;  1URM A;  1XXU A;  3TOT A;  14GS A;  2DJ1 A;  3W6G A;  1AUC A;  1BQ7 A;  3P2A A;  5JWR B;  3ZLP A;  2LV3 A;  2TRX A;  1TRV A;  2ON7 A;  3TJK A;  5GAP D;  4XRD A;  5JCU A;  2JSY A;  3MWH A;  2LJK A;  2QGV A;  2GZZ A;  5H5Q A;  4WBJ A;  1V40 A;  2HNL A;  1B9Y C;  1PGT A;  2RM6 A;  3TCO A;  1QK8 A;  16GS A;  4WBR D;  4TW5 A;  2NDO A;  4PQ1 A;  2C0G A;  5D9W A;  4IGJ A;  4NPB A;  3L4N A;  3VLN A;  4LLR A;  2X64 A;  3G9B A;  1AQV A;  2FUG 2;  3C8E A;  1A8Y A;  1TRW A;  4G9H A;  4GSS A;  3GIX A;  3RPN A;  2BTO T;  2HYX A;  2UZ8 A;  4O5R A;  2WFC A;  7GSS A;  2HSM B;  1G0T A;  2L4C A;  3DIE A;  4TVE A;  3HDC A;  3IAS 2;  1W4V A;  2OBI A;  4KB3 A;  1XWK A;  4BPY A;  4X43 A;  2N5B A;  4OO4 A;  4JR6 A;  1GRX A;  1TKD B;  5EY6 A;  4PNG A;  3GFK A;  2VCZ A;  1YEP A;  2LST A;  3Q19 A;  1ILO A;  4PNF A;  5F06 A;  5E4W A;  1R5A A;  2WJU A;  1J9B A;  1K0O A;  1GH2 A;  1TP9 A;  2FCH A;  5ECI B;  1B8X A;  3D4M A;  1JHB A;  2CV4 A;  1ZCP A;  3GSS A;  3CTF A;  3EC3 A;  1NSW A;  3GV1 A;  1BJX A;  4TKY A;  2R2J A;  3OR5 A;  1XPV A;  1GTA A;  2M80 A;  2L59 A;  1ERU A;  2KP2 A;  1YDK A;  3HD5 A;  1F9M A;  2N5A A;  3IPZ A;  3C71 A;  2ON5 A;  4QL9 A;  3C73 A;  3QDN A;  2OE0 A;  4ZB9 A;  4P3Y B;  5HQP A;  3F0I A;  4FO5 A;  4ECI A;  1CQG A;  2CA8 A;  5IMF A;  4ZL8 A;  3WT2 A;  4F0B A;  1GUM A;  2OAC A;  1X5C A;  3M8N A;  4N30 A;  4V2N A;  6GSX A;  5HR1 A;  2FA8 A;  2IPA A;  3UVH A;  4WR4 A;  3KIJ A;  4OFT A;  1RQM A;  10GS A;  2DLX A;  1OYJ A;  1JZW A;  1EV4 A;  4MMM A;  2CZ2 A;  4AGS A;  4RI6 A;  3MSZ A;  2AYT A;  1A0F A;  2FY6 A;  1M9A A;  3QMX A;  4ZB6 A;  2HRK A;  2VL3 A;  2R4V A;  3U5R E;  2OE3 A;  1XWC A;  3UAR A;  2WZ9 A;  1GSE A;  1K0N A;  4NHW A;  1K3Y A;  4JRR A;  1X5E A;  1GUH A;  4TR1 B;  1O8X A;  2G0F A;  1T3B A;  3BBY A;  3UOM A;  5IO0 A;  1HNB A;  1A23 A;  3F9U A;  4RQR A;  2LTK A;  2RM5 A;  4RUV A;  4CHS A;  3IBH A;  5DVB A;  4POK A;  4I6X A;  1PD2 1;  1PX6 A;  2GQL A;  2C0E A;  2DC5 A;  2ES7 A;  1EOG A;  4RI7 A;  2C3Q A;  4EXJ A;  4AJ6 A;  1HYU A;  2JL4 A;  3ME8 A;  2C4J A;  3GTU A;  4V1A g;  1GTI A;  2HT9 A;  4E8H A;  3HVS A;  4ID0 A;  3NOF A;  1FB0 A;  3E3E A;  4BL7 A;  13GS A;  5IOX A;  3KTB A;  1TU7 A;  4L5L A;  2HI7 A;  2B5E A;  4J2F A;  3UEM A;  5L71 A;  3C1S A;  1ZMA A;  2A2R A;  2YAN A;  3I9V 2;  1GWC A;  3HVV A;  4KSO A;  1XWA A;  1HD2 A;  2NPB A;  3UJ1 A;  3LSZ A;  3N9J A;  2X99 A;  3KXO A;  4LA1 A;  2DMM A;  3I43 A;  4TR0 A;  3V1W A;  1ZOF A;  3KZQ A;  4KDY A;  1TOF A;  2VCV A;  3W8S A;  1GSF A;  3P7X A;  2HRF A;  3FZ4 A;  4HEA 2;  1W89 A;  4L0U A;  4ZL9 A;  2CAI A;  5J9C A;  5HFI A;  2ZNM A;  2AAW A;  5KN1 A;  3VI7 A;  1VF3 A;  4MF5 A;  5HR2 A;  5IQY A;  1GLQ A;  1M2B A;  3O3T A;  4K0G A;  1ON4 A;  3DVW A;  4OO5 A;  5GST A;  1GNW A;  4PUF C;  3D0Z A;  4NMU A;  3QAW A;  1BX9 A;  3E9J B;  2VUP A;  3DD3 A;  2XPE A;  5AGY A;  3GST A;  3RDW A;  8GSS A;  4OMV A;  3WGX A;  2AHE A;  1U6T A;  3L9U A;  5CYY A;  2ZCT A;  3IC4 A;  5AIV A;  3VWU A;  1ACV A;  3BOA A;  4AJ8 A;  4YQM A;  2H1B A;  3ZMK A;  2IWT A;  3LXZ A;  4IQ1 A;  4KND A;  3Q74 A;  5D73 A;  3FZA A;  2AB6 A;  1WJK A;  4PXO A;  1Z6N A;  3KP9 A;  4TR4 A;  5A4U A;  2GDR A;  2L57 A;  3BJ5 A;  3L0H A;  3IV4 A;  5EVO A;  2WB9 A;  1OC9 A;  1QGV A;  2K9F A;  4ZIJ A;  4IJ3 A;  1TI1 A;  1XOA A;  2HLS A;  1GSY A;  2GT6 A;  3VFI A;  3PR8 A;  3HXS A;  1H4O A;  3M9K A;  1HNA A;  1X9W B;  2H73 A;  5JWO B;  3NIV A;  3UMA A;  5KEJ A;  1AQW A;  2FWE A;  3HJO A;  4FYB A;  2O89 A;  4TN8 A;  2HZE A;  1GUL A;  1AXD A;  2P31 A;  2HXK A;  5DDL A;  1FW1 A;  3APQ A;  3F3Q A;  3TKS E;  22GS A;  1G6W A;  3FYG A;  2N5F A;  2FGX A;  4BVY B;  1QXH A;  4I2U A;  2VL9 A;  5CO3 A;  5CAX A;  1V9W A;  2XHF A;  4ML1 A;  4MAB A;  2IFQ A;  4KDX A;  2L5L A;  3G7I A;  1DBY A;  3TKR A;  4GSN A;  1WPI A;  3KGK A;  2XPD A;  5IPG A;  2GZY A;  1PL2 A;  5CRD A;  1S3C A;  1JZR A;  4K1F A;  1MDI A;  3RHC A;  5A5K A;  1V58 A;  4H86 A;  1M0U A;  1IYI A;  4BL7 B;  3F4S A;  3CSH A;  5F0G A;  6GST A;  4POM A;  3SWL A;  5G31 A;  4V2M A;  3LXT A;  3HJP A;  4J56 E;  1EP7 A;  2V2G A;  4MH3 A;  3TJJ A;  1TRS A;  1R26 A;  1R4W A;  4NWY A;  2F51 A;  2O7K A;  3A2V A;  3F4R A;  5ECM B;  3TJB A;  1C72 A;  4EC0 A;  5B8A A;  2LRN A;  1WMJ A;  4EKZ A;  1V98 A;  4I5Q A;  3F6D A;  1MTC A;  3EIN A;  1PSQ A;  1GSS A;  2OKA A;  5A4W A;  2E0Q A;  1EP8 A;  1AW9 A;  4YAV A;  1WWJ A;  3EE2 A;  4IJI A;  3CMI A;  1SD9 A;  5A4V A;  2V32 A;  3VK9 A;  2KOK A;  1A8L A;  3FRC A;  2YPM A;  4YAP A;  2F3M A;  4DEJ A;  3C7M A; 
#chains in the Genus database with same CATH topology
 4CY8 A;  4IKH A;  1R7H A;  1GSD A;  1UA5 A;  4ECJ A;  1NHO A;  2C80 A;  2VAF A;  5ELG A;  3L9S A;  1XZO A;  5A34 B;  1S4B P;  3GA4 A;  5CRE A;  5IPH A;  4V1A p;  2H0G A;  1S3R A;  2GT5 A;  5HFK A;  3U6V A;  2F8F A;  2H19 A;  1OAZ A;  5LCZ A;  4XCS A;  1KTE A;  4GF0 A;  1EEM A;  1TK5 B;  1DE1 A;  4KCE A;  5AN1 A;  4ZBD A;  4WF4 A;  5ELA A;  4Q5F A;  2Z9S A;  2H71 A;  2LJR A;  1BAY A;  4MDC A;  3M0F A;  3LJR A;  2CVB A;  4PQH A;  2GS3 A;  2CAQ A;  4FH8 A;  3GX8 A;  4JBB A;  2K8V A;  4WR5 A;  1XWG A;  1GP1 A;  1ZYP A;  3FR3 A;  4Z2T A;  5FHI A;  5G1L A;  4TXV A;  2C0D A;  4K7I A;  5D8I A;  2GSS A;  3D5J A;  2XBI A;  3DRN A;  1SL0 B;  2VLT A;  2I4A A;  3BCK A;  1YKC A;  3R3E A;  2YNX A;  4N0Z A;  5B7C A;  4E68 A;  4XS6 A;  2JAD A;  2WS2 A;  1VF2 A;  2JU5 A;  2FWF A;  5ECR B;  4OCF A;  1SVO A;  1U3A A;  1YEX A;  3CRU A;  2H1D A;  4Z7X A;  2LEG A;  1S3D A;  2H6Y A;  1N8J A;  4DSS B;  2WRT A;  3IA1 A;  3QFA C;  3TOU A;  3I69 A;  3PIN A;  3DWV A;  4GRF A;  2YJH A;  1WP0 A;  4K5R A;  4MJB A;  2CVK A;  5J4V A;  2NBS A;  1A0R P;  2JZR A;  1TXX A;  2VCQ A;  1USB A;  1LU4 A;  2OA7 A;  2VO4 A;  5CP1 A;  4D73 A;  3LYK A;  5ECO B;  1MDJ A;  4ZB8 A;  3FK8 A;  4ZIL A;  5DQS A;  4XS4 B;  3NZN A;  1FOV A;  3UVT A;  4OD7 A;  1FO5 A;  3BD2 A;  3A2W A;  2BMX A;  3VWX A;  2HSN A;  2R0C A;  4KCA A;  5AIX A;  3GKN A;  4NV5 A;  3IC8 A;  2JSZ A;  1I9D A;  2K18 A;  1XW9 A;  4I97 A;  2VIM A;  5F05 A;  1VF1 A;  1XBS A;  2HSY A;  1X0R A;  1H75 A;  4IVF A;  2JAC A;  1F3B A;  3CWG A;  4DSR A;  2GSR A;  3RBT A;  4Z2R A;  2K6V A;  5BMU B;  1TRU A;  4HQZ A;  5ID2 A;  1Z9H A;  3IE3 A;  2D2Z A;  3CYN A;  17GS A;  1SYR A;  1TK8 B;  1IYH A;  4HI7 A;  1TW9 A;  2PGT A;  2H0H A;  4OCE A;  5J40 A;  1U87 A;  2A4V A;  4DSQ A;  1A2L A;  4V2L A;  2B5X A;  3VPQ A;  3TGZ A;  4JR4 A;  4OFN A;  4AF2 A;  2B7K A;  1XG8 A;  2V6O A;  5G5E A;  1SK0 A;  2AV4 A;  5CRW A;  3ZIT A;  1K0C A;  5DAL A;  1T1V A;  2PVQ A;  4KSM A;  4IEL A;  3GH6 A;  3FY7 A;  4MJE A;  2YCD A;  3GNJ A;  5CNW A;  1Y6E A;  2EC4 A;  2EFD A;  3GN3 A;  2RLI A;  2R6K A;  2MMN A;  4MPG A;  2FWG A;  1PKW A;  4MH2 A;  5J4Y A;  2DJ3 A;  5D93 A;  5JCG A;  2IL3 A;  5IO2 A;  1PL1 A;  3IOS A;  3CXG A;  2QSI A;  3E0U A;  1HNC A;  1AQX A;  2DKH A;  4KAE A;  5J5N A;  4TXO A;  1UC7 A;  3ME7 A;  2QA2 A;  3H4K A;  3FW2 A;  5H5S A;  2IME A;  3LQ7 A;  5IIZ A;  4YH2 A;  2YWI A;  1ST9 A;  2VCT A;  4NAX A;  3DEX A;  2VKZ G;  2LNS A;  1OE8 A;  2H1A A;  5D9X A;  2QKE A;  2H0I A;  3DKS A;  4EL1 A;  19GS A;  2EFC A;  3GH9 A;  1SKS B;  3APS A;  2KUC A;  4ACS A;  5KOW A;  4YKG A;  4L8E A;  3ZFB A;  2KLX A;  5G30 A;  4PTS A;  4WET A;  3TUE A;  2OBK A;  4K6X A;  4O5U A;  5F07 A;  3EMX A;  1EOH A;  3FEU A;  4HZ4 A;  3GL5 A;  5G5F A;  1T8E B;  2IMD A;  1TDI A;  2UV8 G;  3HVN A;  1YZX A;  4MF6 A;  3A5W A;  3D21 A;  1G7E A;  2C1Y A;  3GRX A;  1OC3 A;  1VRS D;  4BVX A;  2MBS A;  3ZRE A;  2PVO C;  3LG6 A;  1A2M A;  4D73 B;  5GZZ B;  3WT1 A;  4I8B A;  2WVZ A;  3EMP A;  4DVC A;  2GSQ A;  5A5H B;  1SK2 A;  1OE7 A;  3K8N A;  4NV2 A;  4XS1 A;  3J7Y k;  3HZ8 A;  1PMT A;  2C8U A;  2IMF A;  6GSV A;  2O8V B;  1DUG A;  3VPT A;  5EL8 A;  2HSN B;  3P8W A;  4OFM A;  1B9X C;  4N10 A;  1Z6M A;  3TKS C;  3LOR A;  1FG4 A;  4LL4 B;  3IRA A;  2I3Y A;  2H6X A;  2R3X A;  4BIK A;  4EDY A;  3HJM A;  1K0M A;  2J23 A;  3H8Q A;  2L5O A;  2WDU A;  1K0B A;  1F6M C;  5AIS A;  3TB2 A;  2WVY A;  5ID2 B;  3PPU A;  2OE1 A;  3APO A;  1JZO A;  5ECS A;  3P90 A;  4MA9 A;  20GS A;  3A3T A;  4LMV A;  3ZZX A;  1T4Y A;  3DML A;  4AKX B;  4Q5R A;  2M46 A;  2NVL A;  2YJ7 A;  4X4J A;  1GSU A;  1XVW A;  1XW6 A;  2C3N A;  2P5R A;  3TKS A;  5G2Z A;  1ERW A;  1E2Y A;  2HRA A;  2WW2 A;  2QC7 A;  2X4A A;  4NXI A;  2HRK B;  4LL1 B;  3VUR A;  5EPF A;  1HQO A;  4F9Z A;  2H6Z A;  2PMT A;  1U3I A;  2VD1 A;  1Q98 A;  5IOW A;  4XRA A;  1X5D A;  1ZYE A;  2R37 A;  3DXB A;  1PFO A;  2C3T A;  1GTU A;  2MMA A;  1XOB A;  1O7U A;  1O85 A;  2GLR A;  4GST A;  2C0F A;  4POB A;  1FVK A;  3G7J A;  1BF5 A;  1Z7R A;  1K0A A;  2R5G A;  2K8S A;  2B3S A;  1G7O A;  1X9M B;  1UN2 A;  5ECL B;  2HSM A;  1SJ6 A;  4GCI A;  2MZC A;  1JFU A;  1QUW A;  2VOC A;  3EU4 A;  2FHE A;  1O73 A;  4Q5Q A;  2LUS A;  2VLV A;  3HA9 A;  3TJF A;  3GTU B;  4EO3 A;  3ZRD A;  4WF5 A;  4YKF A;  1YQ1 A;  4KGI A;  3H93 A;  5D9T A;  4IW9 A;  2GST A;  11GS A;  3FZ5 A;  2DKI A;  3TKP A;  4WXT A;  4G19 A;  1DSB A;  3HYP A;  1ZGN A;  2EIQ A;  4GLT A;  1BG1 A;  4KDU A;  5FT3 A;  1X9S B;  2NTO A;  5CRH A;  2RII A;  1GLP A;  1ERV A;  2MYG A;  1TK0 B;  3ZL5 A;  4G0L A;  3IXR A;  5ENU A;  2X8C A;  1XCC A;  3GHA A;  3QOU A;  3Q18 A;  1OC8 A;  2LS5 A;  2WCI A;  5GSS A;  1U88 A;  2WZS A;  4BVX B;  4O92 A;  1FVJ A;  5LNK e;  3FZ9 A;  3TRQ A;  1V57 A;  3ZIV A;  3LYP A;  4FYU A;  3EU3 A;  5DAK A;  3M3M A;  2I1U A;  5C04 A;  4ZL7 A;  5LD0 A;  4ILF A;  2YZU A;  4FQU A;  3FKF A;  4IN0 A;  5FWG A;  1R5P A;  5KN0 A;  4MPF A;  4YQV A;  4BA7 A;  2H8L A;  2L6D A;  5B8B A;  3KJY A;  2X49 A;  4N11 A;  1TI3 A;  2OAD A;  3GYK A;  1F3A A;  1J0F A;  1OKT A;  4F2I A;  2CX4 A;  4KA0 A;  2X8H A;  2PN8 A;  1SKW B;  3KCM A;  3IK7 A;  6GSW A;  2F8A A;  2DJJ A;  5COH A;  3WYW A;  1YF1 A;  3JCM L;  1UVZ A;  1SVL A;  2EFE A;  1SEN A;  2RUE A;  2FWH A;  2A2S A;  3HKR A;  2XBQ A;  4GWR A;  3F4T A;  4IS0 A;  2YV7 A;  5HR3 A;  5IMV A;  2O5V A;  1TTZ A;  1PRX A;  4TR1 A;  4G0I A;  5DJM A;  4ICY A;  4TOP A;  1WRY A;  2H66 A;  3EVI A;  3LW9 A;  4CW9 A;  4JED A;  3QD9 A;  4GTU A;  3QAV A;  4HUA A;  3A5I A;  3ZML A;  1PX7 A;  4ECB A;  4KH7 A;  2DML A;  2CX3 A;  1BED A;  4HU7 A;  1I5G A;  3R2Q A;  4PUA A;  1OC9 B;  5DBQ A;  1K3O A;  1SKR B;  1N2A A;  4LMW A;  4EE0 A;  1QFN A;  3TRP A;  3BCI A;  5J9B A;  3MAK A;  5ECP B;  2HE3 A;  2VD0 A;  1J08 A;  2HQT A;  2PU9 C;  1EWX A;  1FHE A;  2VLU A;  4F03 A;  1XFL A;  3S9F A;  4BWQ A;  5J3R A;  3HVX A;  1THO A;  2HZE B;  5CRG A;  3KM6 A;  5GAN D;  1RK4 A;  2MMZ A;  4CDO A;  4ECC A;  4MZB A;  1SD8 A;  4PI0 C;  3L78 A;  4KUN A;  1Z7P A;  5F8B A;  3ZFL A;  2GTU A;  2IFQ B;  4F0C A;  1GL8 A;  2H70 A;  4MJC A;  3CQF A;  3KD0 A;  2X8G A;  1NW2 A;  2YN1 A;  2AJQ B;  5JCW A;  2B5Y A;  4AI6 A;  2J9H A;  1JLW A;  1MDK A;  3LFL A;  4XIH A;  4JU5 A;  4IP6 A;  1A2J A;  5DCG A;  4G0K A;  4MZC A;  2OJL A;  1EZK A;  3HMJ G;  2G2Q A;  3RFR C;  4MJA A;  2E7P A;  1SL2 B;  2CVD A;  4XHM A;  4O5Q A;  1Z5Y E;  5D96 A;  3CRT A;  1BG5 A;  3ERF A;  2LJA A;  3DGQ A;  2O36 A;  2WUL A;  1JZD A;  4K7O A;  1K0D A;  2H1G A;  1M99 A;  2PER A;  1N25 A;  4N0V A;  4E8E A;  1A24 A;  2OT3 A;  3UBK A;  1MD4 A;  1YEW C;  1KNG A;  4IHU A;  5H5R A;  4KX4 A;  3MIX A;  1EGR A;  2H74 A;  4JZQ A;  1S3A A;  5DAK B;  2H72 A;  2EIR A;  3GUR A;  2BJX A;  4IP1 A;  3IAM 2;  4TR3 A;  3GL3 A;  3HCZ A;  1O8W A;  1OVN A;  5HFG A;  4EIP A;  2R0G A;  5IMA A;  3US3 A;  3KTL A;  2FNO A;  4IQA A;  5A1N A;  2LQO A;  2PBJ A;  2M72 A;  5KOX A;  2VCW A;  1M2D A;  4O32 A;  1SL1 B;  4NHZ A;  3EWL A;  3G7Y A;  3C1R A;  3IK9 A;  4AKH A;  3HHV A;  4HZ2 A;  2LKU A;  3GKX A;  3TJG A;  4OWY A;  5ECN B;  2GVP A;  4MLY A;  3DVX A;  1I1I P;  3I6A A;  1VGL A;  4K0N A;  1XWB A;  2WGR A;  3MNG A;  2V6K A;  3HZ4 A;  1WIK A;  5JWQ B;  3J7Y b;  3VWW A;  2IN3 A;  1XIY A;  5ECK B;  1B4Q A;  4K2D A;  4K9Z A;  4AJ7 A;  3PH9 A;  2DSA A;  2E2G A;  3EPT A;  3GUS A;  4L0W A;  1SJZ A;  2CT6 A;  2L4Q A;  5HR0 A;  5J41 A;  3QCP A;  5ABR A;  1VF4 A;  2IJY A;  4BVY A;  3KH7 A;  4AKG A;  1FAA A;  1ABA A;  1QMV A;  1TU8 A;  4PUR A;  4PX1 A;  2GZP A;  3H79 A;  1SK1 A;  5ECQ B;  2LNT A;  5DJL A;  1V2A A;  4X1U A;  3GKK A;  2PPT A;  1M9B A;  1LJR A;  1QQ2 A;  3AY8 A;  1ZYQ B;  2A2P A;  3HY2 A;  4PGT A;  3KP8 A;  2GQK A;  4BWS A;  4RQX A;  4HJ2 A;  4WEY A;  1G6Y A;  5IMD A;  3VWV A;  2YWM A;  1ML6 A;  3CBU A;  1WOU A;  2DIZ A;  1WE0 A;  2DJK A;  2LRT A;  4GQF A;  3CSI A;  2MMO A;  5KN2 A;  2PUK C;  2WVX A;  4I2T A;  3RPP A;  4QQ7 A;  4EVM A;  1RW1 A;  4KE3 A;  1THX A;  2HZF A;  1AC1 A;  1YY7 A;  3GX0 A;  4EF0 A;  1CQH A;  1GSQ A;  3QR6 A;  1T4Z A;  1M7T A;  4FYC A;  5J47 A;  3ERW A;  1YKA A;  1SVM A;  2YWN A;  1JLV A;  2DJ2 A;  3Q6O A;  4ISD A;  4TRX A;  4USS A;  3SBC A;  5ECH B;  3RAZ A;  3GKM A;  9GSS A;  2YZH A;  3D4T A;  4K7N A;  6GSY A;  4YQU A;  3IDV A;  3KH9 A;  2YV9 A;  3A2X A;  1ZZY A;  3UIW A;  4EUY A;  2B1L A;  4HJM A;  2KHP A;  4KW6 A;  1E6B A;  5IM9 A;  4EIQ A;  1EEJ A;  3EUR A;  3PGT A;  2FD3 A;  4O7H A;  1MEK A;  3ZTL A;  2VCX A;  1PA3 A;  5A34 A;  3TDG A;  3UAP A;  2GGT A;  1PN9 A;  4HU9 A;  2HRN A;  2RUF A;  1BYE A;  4EDZ A;  3WGD A;  2PWJ A;  5BRT A;  1O81 A;  5C00 A;  5J4U A;  4WKW A;  3LWA A;  2IMK A;  1Z3E A;  3ERG A;  5G1K A;  4PQI A;  3IHG A;  2V1M A;  2A4H A;  1O6J A;  2WW3 A;  2TIR A;  1LBK A;  3FR6 A;  2VL2 C;  5E59 A;  3IHQ A;  3MDK A;  4X0X A;  3QPM A;  4F82 A;  5DAL B;  2FA4 A;  1B4P A;  3LEF A;  2O85 A;  2DBC A;  3ZVJ A;  2FLS A;  3KMN A;  2L6C A;  2B1K A;  2VM2 A;  3IR4 A;  4L5O A;  2GQM A;  4JE1 A;  3MYD A;  2IIY A;  1KBN A;  2JZS A;  3M1G A;  1AAZ A;  2YOI A;  4KF9 A;  2B6M A;  4FIW A;  2B7J A;  1T00 A;  1PQN A;  2YWO A;  3ZIJ A;  4HQS A;  4K8M A;  4K2X A;  6GSS A;  3RHB A;  4N3Z A;  3N5O A;  2HFD A;  4TXO B;  4HS1 A;  2P5Q A;  2CQ9 A;  4MF7 A;  2JZT A;  3O76 A;  2TRC P;  5IMZ A;  3ZVJ D;  2DJ0 A;  4DSS A;  2AUV A;  4G2E A;  2VL2 A;  2EIO A;  3O6T A;  5KN3 A;  3F6F A;  5B6M A;  4ZBA A;  1DE2 A;  4ZBB A;  3D6I A;  5INY A;  4Z2U A;  2V41 A;  1OKD A;  3ED3 A;  1XW5 A;  1GTB A;  3FR9 A;  3QFB C;  2VM1 A;  2DIY A;  3LGC A;  4GQC A;  4MCU A;  3VI5 A;  3D22 A;  4XTS A;  1EGO A;  5B6N A;  3KEB A;  1ZYN A;  3GMF A;  4ULX A;  2REM A;  4POL A;  1GUK A;  4XS4 A;  3M9J A;  1ZL9 A;  4ML6 A;  4ZXG A;  2H75 A;  4HOJ A;  4J57 E;  1YJ6 A;  4GXZ A;  2HSH A;  1Y25 A;  4ZB7 A;  3TU3 B;  2H30 A;  2P0G A;  3TKQ A;  1SU9 A;  1T7P B;  2E2M A;  1NM3 A;  4HDE A;  1TJD A;  4G10 A;  3F63 A;  1GNE A;  3WGE A;  1AIU A;  3DYR A;  5DCH A;  5IMC A;  1F2E A;  3F3R A;  4QL7 A;  1YF0 A;  3CSJ A;  3CTG A;  3QAG A;  2ALB A;  5DQY A;  3WD6 A;  1K3L A;  5BMU A;  3TRX A;  2I81 A;  2LRC A;  2MBT A;  2H1L A;  2KP1 A;  3FHK A;  1EV9 A;  3KMO A;  5D9V A;  2YP6 A;  1SJI A;  4W66 A;  1ERT A;  1SYX A;  4MK3 A;  4MP4 A;  4PHZ C;  1NHY A;  2XC2 A;  6GSU A;  2ZUP A;  1M2A A;  3ISO A;  2H01 A;  1KEB A;  1XVQ A;  2F9S A;  3W8J A;  12GS A;  1F37 A;  2IMI A;  18GS A;  2O87 A;  3EYT A;  4Q5N A;  3L9V A;  3F8U A;  1FB6 A;  2LQQ A;  1Q4J A;  3H1N A;  2I9H A;  4CY6 A;  1B48 A;  3UBL A;  2H76 A;  1MD3 A;  4MZW A;  3ZYW A;  2CZ3 A;  1PKZ A;  3UL3 A;  4IBP A;  1URM A;  1XXU A;  3TOT A;  14GS A;  2DJ1 A;  3W6G A;  1AUC A;  1BQ7 A;  3P2A A;  5JWR B;  3ZLP A;  2LV3 A;  2TRX A;  1TRV A;  2ON7 A;  3TJK A;  5GAP D;  4XRD A;  5JCU A;  2JSY A;  3MWH A;  2LJK A;  2QGV A;  2GZZ A;  5H5Q A;  4WBJ A;  1V40 A;  2HNL A;  1B9Y C;  1PGT A;  1YVL A;  2RM6 A;  3TCO A;  1QK8 A;  16GS A;  4WBR D;  4TW5 A;  2NDO A;  4PQ1 A;  2C0G A;  5D9W A;  4IGJ A;  4NPB A;  3L4N A;  3VLN A;  4LLR A;  4K5S A;  2X64 A;  3G9B A;  4PI2 C;  1AQV A;  2FUG 2;  3C8E A;  1A8Y A;  1M3J A;  1TRW A;  4G9H A;  4GSS A;  3GIX A;  3RPN A;  4QMK A;  2BTO T;  2HYX A;  2UZ8 A;  4O5R A;  2WFC A;  7GSS A;  2HSM B;  1G0T A;  2L4C A;  3DIE A;  4TVE A;  3HDC A;  3IAS 2;  1W4V A;  2OBI A;  4KB3 A;  1XWK A;  4BPY A;  4X43 A;  2N5B A;  4OO4 A;  4JR6 A;  1GRX A;  1TKD B;  5EY6 A;  3RGB C;  4PNG A;  3GFK A;  2VCZ A;  1YEP A;  2LST A;  3Q19 A;  1ILO A;  4PNF A;  5F06 A;  5E4W A;  5A5H A;  1R5A A;  2O3E A;  2WJU A;  1J9B A;  1K0O A;  1GH2 A;  1TP9 A;  2FCH A;  5ECI B;  1B8X A;  3D4M A;  1JHB A;  2CV4 A;  1ZCP A;  3GSS A;  3CTF A;  3EC3 A;  1NSW A;  3GV1 A;  1BJX A;  4TKY A;  2R2J A;  3OR5 A;  1XPV A;  1GTA A;  2M80 A;  2L59 A;  1ERU A;  2KP2 A;  1YDK A;  3HD5 A;  1F9M A;  2N5A A;  3IPZ A;  3C71 A;  2ON5 A;  4QL9 A;  3C73 A;  3QDN A;  2OE0 A;  4ZB9 A;  4P3Y B;  5HQP A;  3F0I A;  4FO5 A;  4ECI A;  1CQG A;  2CA8 A;  5IMF A;  4ZL8 A;  3WT2 A;  4F0B A;  1GUM A;  2OAC A;  1X5C A;  3M8N A;  4N30 A;  4V2N A;  6GSX A;  5HR1 A;  2FA8 A;  2IPA A;  3UVH A;  4WR4 A;  3KIJ A;  4AKI A;  4OFT A;  1RQM A;  10GS A;  2DLX A;  1OYJ A;  1JZW A;  1EV4 A;  4HSC X;  2CZ2 A;  4MMM A;  4AGS A;  4RI6 A;  3FMW A;  3MSZ A;  2AYT A;  1A0F A;  2FY6 A;  1M9A A;  3QMX A;  4ZB6 A;  4FXY P;  2HRK A;  2VL3 A;  2R4V A;  3U5R E;  2OE3 A;  1XWC A;  3UAR A;  2WZ9 A;  1GSE A;  1PN0 A;  1K0N A;  4NHW A;  1K3Y A;  4JRR A;  2WW1 A;  1X5E A;  1GUH A;  4TR1 B;  1O8X A;  2G0F A;  1T3B A;  3BBY A;  3UOM A;  5IO0 A;  1HNB A;  1A23 A;  3F9U A;  4RQR A;  1Y1U A;  2LTK A;  2RM5 A;  4RUV A;  4CHS A;  3IBH A;  5DVB A;  4POK A;  4I6X A;  1PD2 1;  1PX6 A;  2GQL A;  2C0E A;  2DC5 A;  2ES7 A;  1EOG A;  4RI7 A;  2C3Q A;  4EXJ A;  4AJ6 A;  1HYU A;  2JL4 A;  3ME8 A;  2C4J A;  3GTU A;  4V1A g;  1GTI A;  2HT9 A;  4E8H A;  3HVS A;  4ID0 A;  1TXU A;  3NOF A;  1FB0 A;  3E3E A;  4BL7 A;  13GS A;  5IOX A;  3KTB A;  1TU7 A;  4G01 A;  4L5L A;  2HI7 A;  2B5E A;  4J2F A;  3UEM A;  5L71 A;  3C1S A;  1ZMA A;  2A2R A;  2YAN A;  3I9V 2;  1GWC A;  3HVV A;  4KSO A;  1XWA A;  1HD2 A;  2NPB A;  3UJ1 A;  3LSZ A;  3N9J A;  2X99 A;  3KXO A;  4LA1 A;  2DMM A;  3I43 A;  4TR0 A;  3V1W A;  1ZOF A;  3KZQ A;  4KDY A;  1TOF A;  2VCV A;  3W8S A;  1GSF A;  2WW0 A;  3P7X A;  2HRF A;  3FZ4 A;  4HEA 2;  1W89 A;  4L0U A;  4ZL9 A;  2CAI A;  5J9C A;  5HFI A;  2ZNM A;  2AAW A;  5KN1 A;  3VI7 A;  1VF3 A;  4MF5 A;  5HR2 A;  5IQY A;  1GLQ A;  1M2B A;  3O3T A;  4K0G A;  1ON4 A;  3DVW A;  4OO5 A;  5GST A;  1GNW A;  4PUF C;  3D0Z A;  4NMU A;  3QAW A;  1BX9 A;  3E9J B;  2VUP A;  3DD3 A;  2XPE A;  5AGY A;  3GST A;  3RDW A;  8GSS A;  4OMV A;  3WGX A;  2AHE A;  1U6T A;  3L9U A;  5CYY A;  2ZCT A;  4GDF A;  3IC4 A;  5AIV A;  3VWU A;  1ACV A;  5A1N B;  4MNN A;  3BOA A;  4AJ8 A;  2QA1 A;  4YQM A;  2H1B A;  3ZMK A;  2IWT A;  3LXZ A;  4IQ1 A;  4KND A;  3Q74 A;  5D73 A;  3FZA A;  2AB6 A;  1WJK A;  4PXO A;  1Z6N A;  3KP9 A;  4TR4 A;  5A4U A;  2GDR A;  2L57 A;  3BJ5 A;  3L0H A;  3IV4 A;  5EVO A;  2WB9 A;  1OC9 A;  1QGV A;  2K9F A;  4ZIJ A;  4IJ3 A;  1TI1 A;  1XOA A;  2HLS A;  1GSY A;  4A5P A;  2GT6 A;  3VFI A;  3PR8 A;  3HXS A;  1H4O A;  3M9K A;  1HNA A;  1X9W B;  2H73 A;  5JWO B;  3NIV A;  3UMA A;  5KEJ A;  1AQW A;  2FWE A;  2R0P A;  3HJO A;  4FYB A;  2O89 A;  4TN8 A;  2HZE A;  1GUL A;  1AXD A;  2P31 A;  2HXK A;  5DDL A;  1FW1 A;  3APQ A;  3F3Q A;  3TKS E;  22GS A;  1G6W A;  3FYG A;  2N5F A;  2FGX A;  4BVY B;  1QXH A;  4I2U A;  2VL9 A;  5CO3 A;  5CAX A;  1V9W A;  2XHF A;  4ML1 A;  4MAB A;  2EFH A;  2IFQ A;  4KDX A;  2L5L A;  3G7I A;  1DBY A;  3TKR A;  4GSN A;  1WPI A;  3KGK A;  2XPD A;  5IPG A;  2GZY A;  1PL2 A;  5CRD A;  1S3C A;  1JZR A;  4K1F A;  1MDI A;  3RHC A;  5A5K A;  1V58 A;  4H86 A;  1M0U A;  1IYI A;  4BL7 B;  3F4S A;  3CSH A;  5F0G A;  6GST A;  4POM A;  3SWL A;  5G31 A;  4V2M A;  3LXT A;  3HJP A;  4J56 E;  1EP7 A;  2V2G A;  4MH3 A;  3TJJ A;  2WVX B;  1TRS A;  1R26 A;  1R4W A;  4NWY A;  2F51 A;  2O7K A;  3A2V A;  3F4R A;  5ECM B;  3TJB A;  1C72 A;  4EC0 A;  5B8A A;  2LRN A;  1WMJ A;  4EKZ A;  1V98 A;  4I5Q A;  3F6D A;  1MTC A;  3EIN A;  1PSQ A;  1M3I A;  1GSS A;  2OKA A;  1FOH A;  5A4W A;  2E0Q A;  1EP8 A;  1AW9 A;  4YAV A;  1WWJ A;  3EE2 A;  4IJI A;  3CMI A;  1SD9 A;  5A4V A;  2V32 A;  3VK9 A;  2KOK A;  3CHX C;  1A8L A;  3FRC A;  2YPM A;  4YAP A;  2F3M A;  4DEJ A;  3C7M A; 
#chains in the Genus database with same CATH homology
 4CY8 A;  4IKH A;  1R7H A;  1GSD A;  1UA5 A;  4ECJ A;  1NHO A;  2C80 A;  2VAF A;  5ELG A;  3L9S A;  1XZO A;  5A34 B;  3GA4 A;  5CRE A;  5IPH A;  4V1A p;  2H0G A;  2GT5 A;  5HFK A;  3U6V A;  2F8F A;  2H19 A;  1OAZ A;  5LCZ A;  4XCS A;  1KTE A;  4GF0 A;  1EEM A;  1TK5 B;  1DE1 A;  4KCE A;  5AN1 A;  4ZBD A;  4WF4 A;  5ELA A;  4Q5F A;  2Z9S A;  2H71 A;  2LJR A;  1BAY A;  4MDC A;  3M0F A;  3LJR A;  2CVB A;  4PQH A;  2GS3 A;  2CAQ A;  4FH8 A;  3GX8 A;  4JBB A;  2K8V A;  4WR5 A;  1XWG A;  1GP1 A;  1ZYP A;  3FR3 A;  4Z2T A;  5FHI A;  5G1L A;  4TXV A;  2C0D A;  4K7I A;  5D8I A;  2GSS A;  3D5J A;  2XBI A;  3DRN A;  1SL0 B;  2VLT A;  2I4A A;  3BCK A;  1YKC A;  3R3E A;  2YNX A;  4N0Z A;  5B7C A;  4E68 A;  4XS6 A;  2JAD A;  2WS2 A;  1VF2 A;  2JU5 A;  2FWF A;  5ECR B;  4OCF A;  1SVO A;  1U3A A;  1YEX A;  3CRU A;  2H1D A;  4Z7X A;  2LEG A;  1S3D A;  2H6Y A;  1N8J A;  4DSS B;  2WRT A;  3IA1 A;  3QFA C;  3TOU A;  3I69 A;  3PIN A;  3DWV A;  4GRF A;  2YJH A;  1WP0 A;  4K5R A;  4MJB A;  2CVK A;  5J4V A;  2NBS A;  1A0R P;  2JZR A;  1TXX A;  2VCQ A;  1USB A;  1LU4 A;  2OA7 A;  2VO4 A;  5CP1 A;  4D73 A;  3LYK A;  5ECO B;  1MDJ A;  4ZB8 A;  3FK8 A;  4ZIL A;  5DQS A;  4XS4 B;  3NZN A;  1FOV A;  3UVT A;  4OD7 A;  1FO5 A;  3BD2 A;  3A2W A;  2BMX A;  3VWX A;  2HSN A;  2R0C A;  4KCA A;  5AIX A;  3GKN A;  4NV5 A;  3IC8 A;  2JSZ A;  1I9D A;  2K18 A;  1XW9 A;  4I97 A;  2VIM A;  5F05 A;  1VF1 A;  1XBS A;  2HSY A;  1X0R A;  1H75 A;  4IVF A;  2JAC A;  1F3B A;  3CWG A;  4DSR A;  2GSR A;  3RBT A;  4Z2R A;  2K6V A;  5BMU B;  1TRU A;  4HQZ A;  5ID2 A;  1Z9H A;  3IE3 A;  2D2Z A;  3CYN A;  17GS A;  1SYR A;  1TK8 B;  1IYH A;  4HI7 A;  1TW9 A;  2PGT A;  2H0H A;  4OCE A;  5J40 A;  1U87 A;  2A4V A;  4DSQ A;  1A2L A;  4V2L A;  2B5X A;  3VPQ A;  3TGZ A;  4JR4 A;  4OFN A;  4AF2 A;  2B7K A;  2V6O A;  5G5E A;  1SK0 A;  2AV4 A;  5CRW A;  3ZIT A;  1K0C A;  5DAL A;  1T1V A;  2PVQ A;  4KSM A;  4IEL A;  3GH6 A;  3FY7 A;  4MJE A;  2YCD A;  3GNJ A;  5CNW A;  1Y6E A;  2EC4 A;  2EFD A;  3GN3 A;  2RLI A;  2R6K A;  2MMN A;  4MPG A;  2FWG A;  1PKW A;  4MH2 A;  5J4Y A;  2DJ3 A;  5D93 A;  5JCG A;  2IL3 A;  5IO2 A;  1PL1 A;  3IOS A;  3CXG A;  2QSI A;  3E0U A;  1HNC A;  1AQX A;  2DKH A;  4KAE A;  5J5N A;  4TXO A;  1UC7 A;  3ME7 A;  2QA2 A;  3H4K A;  3FW2 A;  5H5S A;  2IME A;  3LQ7 A;  5IIZ A;  4YH2 A;  2YWI A;  1ST9 A;  2VCT A;  4NAX A;  3DEX A;  2VKZ G;  2LNS A;  1OE8 A;  2H1A A;  5D9X A;  2QKE A;  2H0I A;  3DKS A;  4EL1 A;  19GS A;  2EFC A;  3GH9 A;  1SKS B;  3APS A;  2KUC A;  4ACS A;  5KOW A;  4YKG A;  4L8E A;  3ZFB A;  2KLX A;  5G30 A;  4PTS A;  4WET A;  3TUE A;  2OBK A;  4K6X A;  4O5U A;  5F07 A;  3EMX A;  1EOH A;  3FEU A;  4HZ4 A;  3GL5 A;  5G5F A;  1T8E B;  2IMD A;  1TDI A;  2UV8 G;  1YZX A;  4MF6 A;  3A5W A;  3D21 A;  1G7E A;  2C1Y A;  3GRX A;  1OC3 A;  1VRS D;  4BVX A;  2MBS A;  3ZRE A;  2PVO C;  3LG6 A;  1A2M A;  4D73 B;  5GZZ B;  3WT1 A;  4I8B A;  3EMP A;  4DVC A;  2GSQ A;  5A5H B;  1SK2 A;  1OE7 A;  3K8N A;  4NV2 A;  4XS1 A;  3J7Y k;  3HZ8 A;  1PMT A;  2C8U A;  2IMF A;  6GSV A;  2O8V B;  1DUG A;  3VPT A;  5EL8 A;  2HSN B;  3P8W A;  4OFM A;  1B9X C;  4N10 A;  1Z6M A;  3TKS C;  3LOR A;  1FG4 A;  4LL4 B;  3IRA A;  2I3Y A;  2H6X A;  2R3X A;  4EDY A;  3HJM A;  1K0M A;  2J23 A;  3H8Q A;  2L5O A;  2WDU A;  1K0B A;  1F6M C;  5AIS A;  3TB2 A;  5ID2 B;  3PPU A;  2OE1 A;  3APO A;  1JZO A;  5ECS A;  3P90 A;  4MA9 A;  20GS A;  3A3T A;  4LMV A;  3ZZX A;  1T4Y A;  3DML A;  4AKX B;  4Q5R A;  2M46 A;  2NVL A;  2YJ7 A;  4X4J A;  1GSU A;  1XVW A;  1XW6 A;  2C3N A;  2P5R A;  3TKS A;  5G2Z A;  1ERW A;  1E2Y A;  2HRA A;  2QC7 A;  2X4A A;  4NXI A;  2HRK B;  4LL1 B;  3VUR A;  5EPF A;  1HQO A;  4F9Z A;  2H6Z A;  2PMT A;  1U3I A;  2VD1 A;  1Q98 A;  5IOW A;  4XRA A;  1X5D A;  1ZYE A;  2R37 A;  3DXB A;  2C3T A;  1GTU A;  2MMA A;  1XOB A;  1O7U A;  1O85 A;  2GLR A;  4GST A;  2C0F A;  4POB A;  1FVK A;  3G7J A;  1BF5 A;  1Z7R A;  1K0A A;  2R5G A;  2K8S A;  2B3S A;  1G7O A;  1X9M B;  1UN2 A;  5ECL B;  2HSM A;  1SJ6 A;  4GCI A;  2MZC A;  1JFU A;  1QUW A;  2VOC A;  3EU4 A;  2FHE A;  1O73 A;  4Q5Q A;  2LUS A;  2VLV A;  3HA9 A;  3TJF A;  3GTU B;  4EO3 A;  3ZRD A;  4WF5 A;  4YKF A;  1YQ1 A;  4KGI A;  3H93 A;  5D9T A;  4IW9 A;  2GST A;  11GS A;  3FZ5 A;  2DKI A;  3TKP A;  4WXT A;  4G19 A;  1DSB A;  3HYP A;  1ZGN A;  2EIQ A;  4GLT A;  1BG1 A;  4KDU A;  5FT3 A;  1X9S B;  2NTO A;  5CRH A;  2RII A;  1GLP A;  1ERV A;  2MYG A;  1TK0 B;  3ZL5 A;  4G0L A;  3IXR A;  5ENU A;  2X8C A;  1XCC A;  3GHA A;  3QOU A;  3Q18 A;  1OC8 A;  2LS5 A;  2WCI A;  5GSS A;  1U88 A;  4BVX B;  4O92 A;  1FVJ A;  5LNK e;  3FZ9 A;  3TRQ A;  1V57 A;  3ZIV A;  3LYP A;  4FYU A;  3EU3 A;  5DAK A;  3M3M A;  2I1U A;  5C04 A;  4ZL7 A;  5LD0 A;  4ILF A;  2YZU A;  4FQU A;  3FKF A;  4IN0 A;  5FWG A;  1R5P A;  5KN0 A;  4MPF A;  4YQV A;  4BA7 A;  2H8L A;  2L6D A;  5B8B A;  3KJY A;  2X49 A;  4N11 A;  1TI3 A;  2OAD A;  3GYK A;  1F3A A;  1J0F A;  1OKT A;  4F2I A;  2CX4 A;  4KA0 A;  2X8H A;  2PN8 A;  1SKW B;  3KCM A;  3IK7 A;  6GSW A;  2F8A A;  2DJJ A;  5COH A;  3WYW A;  1YF1 A;  3JCM L;  1UVZ A;  1SVL A;  2EFE A;  1SEN A;  2RUE A;  2FWH A;  2A2S A;  3HKR A;  2XBQ A;  4GWR A;  3F4T A;  4IS0 A;  2YV7 A;  5HR3 A;  5IMV A;  2O5V A;  1TTZ A;  1PRX A;  4TR1 A;  4G0I A;  5DJM A;  4ICY A;  4TOP A;  1WRY A;  2H66 A;  3EVI A;  3LW9 A;  4CW9 A;  4JED A;  3QD9 A;  4GTU A;  3QAV A;  4HUA A;  3A5I A;  3ZML A;  1PX7 A;  4ECB A;  4KH7 A;  2DML A;  2CX3 A;  1BED A;  4HU7 A;  1I5G A;  3R2Q A;  4PUA A;  1OC9 B;  5DBQ A;  1K3O A;  1SKR B;  1N2A A;  4LMW A;  4EE0 A;  1QFN A;  3TRP A;  3BCI A;  5J9B A;  3MAK A;  5ECP B;  2HE3 A;  2VD0 A;  1J08 A;  2HQT A;  2PU9 C;  1EWX A;  1FHE A;  2VLU A;  4F03 A;  1XFL A;  3S9F A;  4BWQ A;  5J3R A;  3HVX A;  1THO A;  2HZE B;  5CRG A;  3KM6 A;  5GAN D;  1RK4 A;  2MMZ A;  4CDO A;  4ECC A;  4MZB A;  1SD8 A;  3L78 A;  4KUN A;  1Z7P A;  5F8B A;  3ZFL A;  2GTU A;  2IFQ B;  4F0C A;  1GL8 A;  2H70 A;  4MJC A;  3KD0 A;  2X8G A;  1NW2 A;  2YN1 A;  2AJQ B;  5JCW A;  2B5Y A;  4AI6 A;  2J9H A;  1JLW A;  1MDK A;  3LFL A;  4XIH A;  4JU5 A;  4IP6 A;  1A2J A;  5DCG A;  4G0K A;  4MZC A;  2OJL A;  1EZK A;  3HMJ G;  2G2Q A;  4MJA A;  2E7P A;  1SL2 B;  2CVD A;  4XHM A;  4O5Q A;  1Z5Y E;  5D96 A;  3CRT A;  1BG5 A;  3ERF A;  2LJA A;  3DGQ A;  2WUL A;  1JZD A;  4K7O A;  1K0D A;  2H1G A;  1M99 A;  2PER A;  1N25 A;  4N0V A;  4E8E A;  1A24 A;  2OT3 A;  3UBK A;  1MD4 A;  1KNG A;  4IHU A;  5H5R A;  4KX4 A;  3MIX A;  1EGR A;  2H74 A;  4JZQ A;  1S3A A;  5DAK B;  2H72 A;  2EIR A;  3GUR A;  2BJX A;  4IP1 A;  3IAM 2;  4TR3 A;  3GL3 A;  3HCZ A;  1O8W A;  1OVN A;  5HFG A;  4EIP A;  2R0G A;  5IMA A;  3US3 A;  3KTL A;  2FNO A;  4IQA A;  5A1N A;  2LQO A;  2PBJ A;  2M72 A;  5KOX A;  2VCW A;  1M2D A;  4O32 A;  1SL1 B;  4NHZ A;  3EWL A;  3G7Y A;  3C1R A;  3IK9 A;  4AKH A;  3HHV A;  4HZ2 A;  2LKU A;  3GKX A;  3TJG A;  4OWY A;  5ECN B;  2GVP A;  4MLY A;  3DVX A;  3I6A A;  1VGL A;  4K0N A;  1XWB A;  2WGR A;  3MNG A;  2V6K A;  3HZ4 A;  1WIK A;  5JWQ B;  3J7Y b;  3VWW A;  2IN3 A;  1XIY A;  5ECK B;  1B4Q A;  4K2D A;  4K9Z A;  4AJ7 A;  3PH9 A;  2DSA A;  2E2G A;  3EPT A;  3GUS A;  4L0W A;  1SJZ A;  2CT6 A;  2L4Q A;  5HR0 A;  5J41 A;  3QCP A;  5ABR A;  1VF4 A;  2IJY A;  4BVY A;  3KH7 A;  4AKG A;  1FAA A;  1ABA A;  1QMV A;  1TU8 A;  4PUR A;  4PX1 A;  2GZP A;  3H79 A;  1SK1 A;  5ECQ B;  2LNT A;  5DJL A;  1V2A A;  4X1U A;  3GKK A;  2PPT A;  1M9B A;  1LJR A;  1QQ2 A;  3AY8 A;  1ZYQ B;  2A2P A;  3HY2 A;  4PGT A;  3KP8 A;  2GQK A;  4BWS A;  4RQX A;  4HJ2 A;  4WEY A;  1G6Y A;  5IMD A;  3VWV A;  2YWM A;  1ML6 A;  3CBU A;  1WOU A;  2DIZ A;  1WE0 A;  2DJK A;  2LRT A;  4GQF A;  3CSI A;  2MMO A;  5KN2 A;  2PUK C;  4I2T A;  3RPP A;  4QQ7 A;  4EVM A;  1RW1 A;  4KE3 A;  1THX A;  2HZF A;  1AC1 A;  1YY7 A;  3GX0 A;  4EF0 A;  1CQH A;  1GSQ A;  3QR6 A;  1T4Z A;  1M7T A;  4FYC A;  5J47 A;  3ERW A;  1YKA A;  1SVM A;  2YWN A;  1JLV A;  2DJ2 A;  3Q6O A;  4ISD A;  4TRX A;  4USS A;  3SBC A;  5ECH B;  3RAZ A;  3GKM A;  9GSS A;  2YZH A;  3D4T A;  4K7N A;  6GSY A;  4YQU A;  3IDV A;  3KH9 A;  2YV9 A;  3A2X A;  1ZZY A;  3UIW A;  4EUY A;  2B1L A;  4HJM A;  2KHP A;  4KW6 A;  1E6B A;  5IM9 A;  4EIQ A;  1EEJ A;  3EUR A;  3PGT A;  2FD3 A;  4O7H A;  1MEK A;  3ZTL A;  2VCX A;  1PA3 A;  5A34 A;  3TDG A;  3UAP A;  2GGT A;  1PN9 A;  4HU9 A;  2HRN A;  2RUF A;  1BYE A;  4EDZ A;  3WGD A;  2PWJ A;  5BRT A;  1O81 A;  5C00 A;  5J4U A;  4WKW A;  3LWA A;  2IMK A;  1Z3E A;  3ERG A;  5G1K A;  4PQI A;  3IHG A;  2V1M A;  2A4H A;  1O6J A;  2TIR A;  1LBK A;  3FR6 A;  2VL2 C;  5E59 A;  3IHQ A;  3MDK A;  4X0X A;  3QPM A;  4F82 A;  5DAL B;  2FA4 A;  1B4P A;  3LEF A;  2O85 A;  2DBC A;  3ZVJ A;  2FLS A;  3KMN A;  2L6C A;  2B1K A;  2VM2 A;  3IR4 A;  4L5O A;  2GQM A;  4JE1 A;  3MYD A;  2IIY A;  1KBN A;  2JZS A;  3M1G A;  1AAZ A;  2YOI A;  4KF9 A;  2B6M A;  4FIW A;  2B7J A;  1T00 A;  1PQN A;  2YWO A;  3ZIJ A;  4HQS A;  4K8M A;  4K2X A;  6GSS A;  3RHB A;  4N3Z A;  3N5O A;  2HFD A;  4TXO B;  4HS1 A;  2P5Q A;  2CQ9 A;  4MF7 A;  2JZT A;  3O76 A;  2TRC P;  5IMZ A;  3ZVJ D;  2DJ0 A;  4DSS A;  2AUV A;  4G2E A;  2VL2 A;  2EIO A;  3O6T A;  5KN3 A;  3F6F A;  5B6M A;  4ZBA A;  1DE2 A;  4ZBB A;  3D6I A;  5INY A;  4Z2U A;  2V41 A;  1OKD A;  3ED3 A;  1XW5 A;  1GTB A;  3FR9 A;  3QFB C;  2VM1 A;  2DIY A;  3LGC A;  4GQC A;  4MCU A;  3VI5 A;  3D22 A;  4XTS A;  1EGO A;  5B6N A;  3KEB A;  1ZYN A;  3GMF A;  4ULX A;  2REM A;  4POL A;  1GUK A;  4XS4 A;  3M9J A;  1ZL9 A;  4ML6 A;  4ZXG A;  2H75 A;  4HOJ A;  4J57 E;  1YJ6 A;  4GXZ A;  2HSH A;  1Y25 A;  4ZB7 A;  3TU3 B;  2H30 A;  2P0G A;  3TKQ A;  1SU9 A;  1T7P B;  2E2M A;  1NM3 A;  4HDE A;  1TJD A;  4G10 A;  3F63 A;  1GNE A;  3WGE A;  1AIU A;  3DYR A;  5DCH A;  5IMC A;  1F2E A;  3F3R A;  4QL7 A;  1YF0 A;  3CSJ A;  3CTG A;  3QAG A;  2ALB A;  5DQY A;  3WD6 A;  1K3L A;  5BMU A;  3TRX A;  2I81 A;  2LRC A;  2MBT A;  2H1L A;  2KP1 A;  3FHK A;  1EV9 A;  3KMO A;  5D9V A;  2YP6 A;  1SJI A;  4W66 A;  1ERT A;  1SYX A;  4MK3 A;  4MP4 A;  1NHY A;  2XC2 A;  6GSU A;  2ZUP A;  1M2A A;  3ISO A;  2H01 A;  1KEB A;  1XVQ A;  2F9S A;  3W8J A;  12GS A;  1F37 A;  2IMI A;  18GS A;  2O87 A;  3EYT A;  4Q5N A;  3L9V A;  3F8U A;  1FB6 A;  2LQQ A;  1Q4J A;  3H1N A;  2I9H A;  4CY6 A;  1B48 A;  3UBL A;  2H76 A;  1MD3 A;  4MZW A;  3ZYW A;  2CZ3 A;  1PKZ A;  3UL3 A;  4IBP A;  1URM A;  1XXU A;  3TOT A;  14GS A;  2DJ1 A;  3W6G A;  1AUC A;  1BQ7 A;  3P2A A;  5JWR B;  3ZLP A;  2LV3 A;  2TRX A;  1TRV A;  2ON7 A;  3TJK A;  5GAP D;  4XRD A;  5JCU A;  2JSY A;  3MWH A;  2LJK A;  2QGV A;  2GZZ A;  5H5Q A;  4WBJ A;  1V40 A;  2HNL A;  1B9Y C;  1PGT A;  1YVL A;  2RM6 A;  3TCO A;  1QK8 A;  16GS A;  4WBR D;  4TW5 A;  2NDO A;  4PQ1 A;  2C0G A;  5D9W A;  4IGJ A;  4NPB A;  3L4N A;  3VLN A;  4LLR A;  4K5S A;  2X64 A;  3G9B A;  1AQV A;  2FUG 2;  3C8E A;  1A8Y A;  1TRW A;  4G9H A;  4GSS A;  3GIX A;  3RPN A;  4QMK A;  2BTO T;  2HYX A;  2UZ8 A;  4O5R A;  2WFC A;  7GSS A;  2HSM B;  1G0T A;  2L4C A;  3DIE A;  4TVE A;  3HDC A;  3IAS 2;  1W4V A;  2OBI A;  4KB3 A;  1XWK A;  4BPY A;  4X43 A;  2N5B A;  4OO4 A;  4JR6 A;  1GRX A;  1TKD B;  5EY6 A;  4PNG A;  3GFK A;  2VCZ A;  1YEP A;  2LST A;  3Q19 A;  1ILO A;  4PNF A;  5F06 A;  5E4W A;  5A5H A;  1R5A A;  2WJU A;  1J9B A;  1K0O A;  1GH2 A;  1TP9 A;  2FCH A;  5ECI B;  1B8X A;  3D4M A;  1JHB A;  2CV4 A;  1ZCP A;  3GSS A;  3CTF A;  3EC3 A;  1NSW A;  3GV1 A;  1BJX A;  4TKY A;  2R2J A;  3OR5 A;  1XPV A;  1GTA A;  2M80 A;  2L59 A;  1ERU A;  2KP2 A;  1YDK A;  3HD5 A;  1F9M A;  2N5A A;  3IPZ A;  3C71 A;  2ON5 A;  4QL9 A;  3C73 A;  3QDN A;  2OE0 A;  4ZB9 A;  4P3Y B;  5HQP A;  3F0I A;  4FO5 A;  4ECI A;  1CQG A;  2CA8 A;  5IMF A;  4ZL8 A;  3WT2 A;  4F0B A;  1GUM A;  2OAC A;  1X5C A;  3M8N A;  4N30 A;  4V2N A;  6GSX A;  5HR1 A;  2FA8 A;  2IPA A;  3UVH A;  4WR4 A;  3KIJ A;  4AKI A;  4OFT A;  1RQM A;  10GS A;  2DLX A;  1OYJ A;  1JZW A;  1EV4 A;  4MMM A;  2CZ2 A;  4AGS A;  4RI6 A;  3FMW A;  3MSZ A;  2AYT A;  1A0F A;  2FY6 A;  1M9A A;  3QMX A;  4ZB6 A;  2HRK A;  2VL3 A;  2R4V A;  3U5R E;  2OE3 A;  1XWC A;  3UAR A;  2WZ9 A;  1GSE A;  1PN0 A;  1K0N A;  4NHW A;  1K3Y A;  4JRR A;  1X5E A;  1GUH A;  4TR1 B;  1O8X A;  2G0F A;  1T3B A;  3BBY A;  3UOM A;  5IO0 A;  1HNB A;  1A23 A;  3F9U A;  4RQR A;  1Y1U A;  2LTK A;  2RM5 A;  4RUV A;  4CHS A;  3IBH A;  5DVB A;  4POK A;  4I6X A;  1PD2 1;  1PX6 A;  2GQL A;  2C0E A;  2DC5 A;  2ES7 A;  1EOG A;  4RI7 A;  2C3Q A;  4EXJ A;  4AJ6 A;  1HYU A;  2JL4 A;  3ME8 A;  2C4J A;  3GTU A;  4V1A g;  1GTI A;  2HT9 A;  4E8H A;  3HVS A;  4ID0 A;  1TXU A;  3NOF A;  1FB0 A;  3E3E A;  4BL7 A;  13GS A;  5IOX A;  3KTB A;  1TU7 A;  4G01 A;  4L5L A;  2HI7 A;  2B5E A;  4J2F A;  3UEM A;  5L71 A;  3C1S A;  1ZMA A;  2A2R A;  2YAN A;  3I9V 2;  1GWC A;  3HVV A;  4KSO A;  1XWA A;  1HD2 A;  2NPB A;  3UJ1 A;  3LSZ A;  3N9J A;  2X99 A;  3KXO A;  4LA1 A;  2DMM A;  3I43 A;  4TR0 A;  3V1W A;  1ZOF A;  3KZQ A;  4KDY A;  1TOF A;  2VCV A;  3W8S A;  1GSF A;  3P7X A;  2HRF A;  3FZ4 A;  4HEA 2;  1W89 A;  4L0U A;  4ZL9 A;  2CAI A;  5J9C A;  5HFI A;  2ZNM A;  2AAW A;  5KN1 A;  3VI7 A;  1VF3 A;  4MF5 A;  5HR2 A;  5IQY A;  1GLQ A;  1M2B A;  3O3T A;  4K0G A;  1ON4 A;  3DVW A;  4OO5 A;  5GST A;  1GNW A;  4PUF C;  3D0Z A;  4NMU A;  3QAW A;  1BX9 A;  3E9J B;  2VUP A;  3DD3 A;  2XPE A;  5AGY A;  3GST A;  3RDW A;  8GSS A;  4OMV A;  3WGX A;  2AHE A;  1U6T A;  3L9U A;  5CYY A;  2ZCT A;  4GDF A;  3IC4 A;  5AIV A;  3VWU A;  1ACV A;  5A1N B;  4MNN A;  3BOA A;  4AJ8 A;  2QA1 A;  4YQM A;  2H1B A;  3ZMK A;  2IWT A;  3LXZ A;  4IQ1 A;  4KND A;  3Q74 A;  5D73 A;  3FZA A;  2AB6 A;  1WJK A;  4PXO A;  1Z6N A;  3KP9 A;  4TR4 A;  5A4U A;  2GDR A;  2L57 A;  3BJ5 A;  3L0H A;  3IV4 A;  5EVO A;  2WB9 A;  1OC9 A;  1QGV A;  2K9F A;  4ZIJ A;  4IJ3 A;  1TI1 A;  1XOA A;  2HLS A;  1GSY A;  4A5P A;  2GT6 A;  3VFI A;  3PR8 A;  3HXS A;  1H4O A;  3M9K A;  1HNA A;  1X9W B;  2H73 A;  5JWO B;  3NIV A;  3UMA A;  5KEJ A;  1AQW A;  2FWE A;  2R0P A;  3HJO A;  4FYB A;  2O89 A;  4TN8 A;  2HZE A;  1GUL A;  1AXD A;  2P31 A;  2HXK A;  5DDL A;  1FW1 A;  3APQ A;  3F3Q A;  3TKS E;  22GS A;  1G6W A;  3FYG A;  2N5F A;  2FGX A;  4BVY B;  1QXH A;  4I2U A;  2VL9 A;  5CO3 A;  5CAX A;  1V9W A;  2XHF A;  4ML1 A;  4MAB A;  2EFH A;  2IFQ A;  4KDX A;  2L5L A;  3G7I A;  1DBY A;  3TKR A;  4GSN A;  1WPI A;  3KGK A;  2XPD A;  5IPG A;  2GZY A;  1PL2 A;  5CRD A;  1S3C A;  1JZR A;  4K1F A;  1MDI A;  3RHC A;  5A5K A;  1V58 A;  4H86 A;  1M0U A;  1IYI A;  4BL7 B;  3F4S A;  3CSH A;  5F0G A;  6GST A;  4POM A;  3SWL A;  5G31 A;  4V2M A;  3LXT A;  3HJP A;  4J56 E;  1EP7 A;  2V2G A;  4MH3 A;  3TJJ A;  1TRS A;  1R26 A;  1R4W A;  4NWY A;  2F51 A;  2O7K A;  3A2V A;  3F4R A;  5ECM B;  3TJB A;  1C72 A;  4EC0 A;  5B8A A;  2LRN A;  1WMJ A;  4EKZ A;  1V98 A;  4I5Q A;  3F6D A;  1MTC A;  3EIN A;  1PSQ A;  1GSS A;  2OKA A;  1FOH A;  5A4W A;  2E0Q A;  1EP8 A;  1AW9 A;  4YAV A;  1WWJ A;  3EE2 A;  4IJI A;  3CMI A;  1SD9 A;  5A4V A;  2V32 A;  3VK9 A;  2KOK A;  1A8L A;  3FRC A;  2YPM A;  4YAP A;  2F3M A;  4DEJ A;  3C7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...