5DCGA

Crystal structure of wt apo human glutathione transferase pi
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Visualisation of Organoarsenic Human Glutathione Transferase P1-1 Complexes: Metabolism of Arsenic-based Therapeutics
rcsb
source organism Homo sapiens
total genus 78
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5dcgA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dcgA01
3WT2A 4PUAA 1FW1A 4KX4A 4IKHA 2OE3A 5IPGA 2A2SA 1X9MB 4RUVA 2GQLA 3DKSA 1GP1A 1JZRA 3FZ5A 2GSTA 5A4UA 4ID0A 5FT3A 3DXBA 2F8AA 1M2AA 4POBA 3TB2A 4HU7A 2LUSA 3KTLA 4OMVA 1XXUA 4EL1A 1XW6A 2VAFA 5H5SA 1WMJA 2J23A 2HQTA 2GT6A 3HVXA 4X1UA 2J9HA 4WF4A 4ZIJA 1MDIA 3DIEA 4TR0A 3EC3A 1RW1A 3FEUA 3M1GA 4IQ1A 4MZBA 2JADA 3F4RA 2VLTA 4MJBA 3TRXA 2GLRA 4KE3A 2HZEB 2CVDA 1K3YA 4BL7A 2L57A 14GSA 3DVXA 4MDCA 3IE3A 4BVXA 2RLIA 2E7PA 4MP4A 2AAWA 1PX7A 2CVKA 3TCOA 1SK0A 2GSQA 2FY6A 1A2LA 4I2TA 4XS4A 1T4YA 4N10A 2NTOA 2LS5A 2H01A 4ECCA 1SL0B 4K0GA 5AISA 2H72A 5J4UA 3PINA 4TN8A 5H5RA 3O76A 3D4MA 1V57A 2FCHA 2C0DA 4Q5QA 2GQKA 3H4KA 5IMZA 2R3XA 2RM5A 2CV4A 5ECSA 2GZYA 1ZMAA 4NPBA 5AIVA 1A8LA 4G10A 1I5GA 1BAYA 2VL2A 3M9KA 1SKSB 3IDVA 5DAKB 4CW9A 2MYGA 4MMMA 4I2UA 3IOSA 1YEPA 3QMXA 3DGQA 3HZ8A 1F9MA 2I1UA 2HT9A 3QOUA 2IPAA 2GSSA 5KN2A 1XOBA 4V1Ag 1A8YA 2WB9A 3KM6A 2IIYA 2NDOA 5B6NA 1PSQA 4KF9A 1GSEA 2O89A 3F3RA 3ZIVA 2CT6A 1O85A 2VCWA 2FGXA 5EPFA 1GTIA 3KP8A 2CZ2A 1C72A 1QQ2A 1GNEA 1B4QA 4POLA 1A0FA 4GQCA 13GSA 1XWBA 2FLSA 5C00A 3TKRA 1G7EA 3ZRDA 3R2QA 4K7OA 2KP1A 1O7UA 1PKWA 2K6VA 4PQ1A 3I69A 3NIVA 1A2JA 2C0FA 1YDKA 3MWHA 1AQWA 3HCZA 3ME7A 3GA4A 5DBQA 1T00A 1U3IA 1SKRB 2B5EA 4F2IA 4IHUA 4YH2A 2YZUA 2H1BA 1G6WA 4PQHA 3UVTA 5ABRA 1EOHA 1FB0A 2MBSA 1SD9A 3DD3A 2YV9A 1Z7RA 2FWEA 2O87A 2DJ2A 5HFKA 2HSMB 3RHCA 3KMOA 1EWXA 4WETA 5F06A 2IMEA 1K0AA 4PURA 1EEMA 2JZRA 1GSSA 2YJHA 1SK1A 2GS3A 1M7TA 2LNTA 3I9V2 2PVQA 1TTZA 2D2ZA 1HYUA 3IR4A 5JCGA 4O5RA 6GSYA 3GYKA 3UMAA 2DJKA 4ECJA 1F3AA 2PPTA 3UOMA 1GUKA 2WRTA 4V1Ap 4V2NA 3F0IA 3RHBA 4GCIA 3FR9A 2PERA 3KCMA 1Y25A 1TRWA 1GTAA 4DEJA 3I43A 1M2BA 4GSNA 1AQVA 4RI7A 3UVHA 3F6FA 3TUEA 3ZTLA 4USSA 2H70A 3RBTA 2YJ7A 3PR8A 4FIWA 2RIIA 4ZBAA 3L4NA 1TRSA 2PN8A 1Y6EA 1PL1A 3Q19A 3ZMLA 5CRGA 4ZILA 4V2LA 4OCFA 4HJMA 1ST9A 5D9WA 1PMTA 2I81A 4X43A 3EYTA 5GAND 1OVNA 2CQ9A 3MDKA 5ECQB 4ZXGA 3L0HA 3O6TA 4ZB9A 3ERFA 2LQOA 1TXXA 1GTUA 5J9CA 2HRAA 2VOCA 4PNGA 4NAXA 1HNAA 5G2ZA 4O7HA 3D6IA 2X8CA 1Z7PA 3APOA 4NHZA 3SBCA 4IJIA 1URMA 5A5KA 3DEXA 3PH9A 3VWUA 2HRKA 3UBKA 3LSZA 1MEKA 2FD3A 4TR3A 1M2DA 5B8AA 4HJ2A 3HZ4A 20GSA 4LMVA 1IYIA 4GQFA 4BL7B 5B6MA 1KNGA 1MDJA 4MLYA 1USBA 5GAPD 1O6JA 4L0UA 4BVXB 1SJ6A 4YAPA 2RM6A 4I6XA 3NOFA 4OO5A 2DJ3A 2V6OA 3ERGA 4TKYA 3CTGA 1TOFA 2XPDA 2CX3A 5COHA 2WFCA 2K8VA 3GTUB 4F0BA 4TR1A 4HI7A 1Z6MA 4D73A 1N2AA 4PTSA 3M8NA 5IQYA 2TRCP 4K2DA 2B5YA 4K8MA 2L5OA 4IP6A 3TJFA 3RAZA 2LKUA 1DUGA 1OAZA 4K6XA 2OE1A 5CP1A 5JWRB 2C1YA 4DVCA 2VIMA 3KTBA 3CRUA 3UBLA 1K0MA 3BCIA 1XWAA 4G19A 4ISDA 1H4OA 1WE0A 3GKNA 3IRAA 3HA9A 1HNCA 2CX4A 4O32A 2XHFA 3A2WA 1Q98A 5DALA 2I9HA 1XW5A 2ZNMA 4IP1A 2DBCA 3ZITA 3NZNA 5DCGA 1S3AA 2XBQA 3ZIJA 4X0XA 3E9JB 3FKFA 2FNOA 2OADA 3N5OA 1GL8A 2GT5A 4NV2A 1OC8A 5G5FA 1ZYQB 3M0FA 1EOGA 3QCPA 3P8WA 3VI5A 1OYJA 4WXTA 3WYWA 2JACA 3KXOA 2HRNA 2X99A 5IOXA 3QAGA 2R5GA 1M9AA 2H19A 2IFQA 3P90A 3CBUA 2DLXA 1GWCA 2O8VB 1V2AA 4F03A 1SD8A 4TR4A 2L6CA 1S3DA 2C0EA 4P3YB 3HY2A 4J2FA 5FWGA 1K3LA 3UL3A 2E2MA 3CMIA 3F4TA 4K1FA 19GSA 1PRXA 1ZCPA 2DIYA 4MJCA 1X0RA 2P5QA 3LXTA 3C71A 1GSFA 2JZTA 3VFIA 2YN1A 2H0GA 3VWWA 4HUAA 1ERUA 1AW9A 4OFTA 2K8SA 5DDLA 2V41A 3US3A 3GSTA 4KNDA 1PA3A 2N5AA 2OBIA 5D93A 4MF5A 4BWQA 2F3MA 1DE2A 2H6ZA 1JZWA 5HR3A 2H1GA 3BBYA 4EUYA 2DJ0A 3QD9A 2B3SA 2QKEA 5KEJA 3ZFBA 3GKKA 1BQ7A 1R5AA 3RPPA 3M9JA 4N0ZA 1EV9A 4V2MA 3F8UA 2YANA 2XC2A 1TK8B 6GSXA 4OO4A 4HOJA 6GSWA 2QC7A 3FRCA 5D9XA 2XPEA 1G0TA 2HZFA 4ILFA 3QPMA 5IO2A 2X8GA 2EIRA 1I9DA 3C73A 2GGTA 1AXDA 4PXOA 1GLQA 3WT1A 3HJOA 1B9XC 3F63A 3LG6A 5G1KA 5HR1A 3A3TA 2H6YA 1FB6A 2H74A 2L6DA 3IXRA 1FO5A 2KP2A 2HSNB 2NPBA 3VURA 3D21A 4Z7XA 3GIXA 4JEDA 1HQOA 3E0UA 1JLWA 2GZZA 3G7IA 1OE8A 4MF6A 5IO0A 1SJIA 4KGIA 3ME8A 2ALBA 1Z9HA 2K9FA 4TVEA 4OFNA 3D5JA 1YQ1A 1XVQA 4GRFA 1YF1A 5CNWA 5J41A 3IC8A 5CAXA 3A5WA 1U87A 4XIHA 4GTUA 4BPYA 2VCTA 2ON7A 1T8EB 3FY7A 5IIZA 5G30A 2LTKA 5EVOA 4MH2A 1YJ6A 2GZPA 2VM1A 4BWSA 4GF0A 5HR0A 1AQXA 1M99A 1TRUA 3ZREA 3KH9A 17GSA 2AJQB 3U5RE 1V98A 4I8BA 1R5PA 1UA5A 5G31A 1ACVA 2E0QA 4ZL8A 4EC0A 4TR1B 4RQRA 2Z9SA 4N11A 4EO3A 4D73B 1OC9A 1ILOA 1NM3A 1QXHA 1XCCA 5DJMA 2LJAA 3TRPA 1FVKA 3F6DA 3E3EA 5F07A 1RQMA 1XBSA 1AC1A 3HVSA 4YQMA 1SK2A 3GKMA 5LCZA 3KD0A 1TW9A 3FK8A 2YV7A 2LRCA 3BOAA 2WZ9A 4QQ7A 4TXOA 5FHIA 2KLXA 2H71A 4F0CA 5DALB 4XCSA 4ACSA 5AIXA 5IOWA 2HRFA 3S9FA 4PNFA 1BYEA 3CSHA 3WD6A 2M72A 1A24A 5HQPA 5J3RA 3WGXA 5AGYA 16GSA 1YEXA 1G7OA 4BVYA 4FH8A 4EDYA 4MABA 2DJ1A 3IAS2 2JSYA 1CQGA 5IMAA 3MSZA 4L0WA 5JCWA 2O7KA 3VPTA 1ZL9A 1E6BA 4FQUA 2KHPA 5D8IA 3LORA 4ML1A 1KBNA 5E59A 5JWQB 2AYTA 2RUEA 4KSMA 2MMNA 5ECKB 2G2QA 1SU9A 2IFQB 5GZZB 2QGVA 1UC7A 4XTSA 3RDWA 4AJ7A 2MMAA 5L71A 3GH6A 4F82A 2OA7A 1QFNA 2DSAA 4AJ6A 2ES7A 1DE1A 3ISOA 2XBIA 5KN0A 1XWCA 1SJZA 2C0GA 5ELGA 1YF0A 5AN1A 3FR3A 3GX8A 5CRDA 3Q74A 2HNLA 3L9SA 3OR5A 4DSQA 5GSTA 2OACA 3H93A 1TJDA 3ERWA 3GL5A 4JR4A 2N5BA 2V6KA 3O3TA 4IGJA 1THXA 4NMUA 4FO5A 2IMIA 3VWVA 4CHSA 3IA1A 1TP9A 2TRXA 2V32A 3BD2A 1R4WA 2VD1A 1MDKA 1YKAA 3ZL5A 1GSQA 5EL8A 1QMVA 2FWGA 3EU3A 1SL1B 2JZSA 2LRTA 2AV4A 1GSUA 5B7CA 2R4VA 3L9VA 1U3AA 2YWMA 2DJJA 2ZCTA 2VCVA 4ECIA 2GVPA 2H66A 1XWGA 5CRWA 3A2XA 1FVJA 3HJPA 4GXZA 5CYYA 2YNXA 1UVZA 4OFMA 3C1SA 1K0BA 4IW9A 2PUKC 3EMPA 3P2AA 4EDZA 3IK7A 2KOKA 5G5EA 3LXZA 3RPNA 3GL3A 1GRXA 2R6KA 3M3MA 4PUFC 5ECIB 3W8JA 1PQNA 3VK9A 2AB6A 5ECMB 3QFAC 1X9SB 3HVVA 4KSOA 3UAPA 3EWLA 3ZYWA 2VCQA 2HLSA 2K18A 3ZMKA 3QFBC 5IMVA 3D0ZA 5IM9A 4XS4B 2GQMA 1KEBA 2H30A 2WJUA 1O81A 2NBSA 3IC4A 5ECPB 5ECLB 1QUWA 5F05A 3TJGA 2F8FA 2DMMA 4N0VA 4EVMA 1XOAA 5CREA 4LLRA 2B7JA 1SYRA 1VF3A 1OKDA 2M46A 2P0GA 3CSIA 2VUPA 2EC4A 2CAIA 4XRDA 2B7KA 3TKSE 8GSSA 4NWYA 1YY7A 1B48A 3HXSA 4KDXA 3EU4A 10GSA 3Q6OA 1T1VA 3TKSC 4HU9A 3LWAA 4J56E 4JR6A 4KH7A 1YZXA 4PGTA 1JFUA 3N9JA 2GDRA 4ZBDA 4CDOA 2L4CA 4ZL9A 2LNSA 2VCXA 4PQIA 5H5QA 4HEA2 1F6MC 4IELA 3KEBA 2HXKA 3GV1A 3QAWA 1FG4A 2H1DA 1THOA 3LYPA 4L5OA 2CA8A 2VL9A 2HSMA 2N5FA 1NHYA 2IMDA 1OC9B 3VPQA 1EV4A 1OKTA 2IN3A 1ZZYA 3DWVA 5CO3A 2YWIA 2FWFA 4EXJA 4TW5A 6GSSA 3L9UA 1LBKA 2H1AA 3DRNA 3GX0A 1F3BA 3U6VA 3IPZA 2PMTA 2PVOC 3KIJA 5IPHA 5IMCA 2WS2A 4TXOB 5KN3A 2BMXA 4EE0A 5G1LA 5ECOB 2WDUA 3FZ9A 2C80A 2H76A 4G0KA 1XFLA 3HJMA 2IJYA 1DSBA 1DBYA 2VD0A 3BJ5A 4RI6A 4YQUA 4HDEA 4XHMA 1Z5YE 4F9ZA 4WR4A 3MNGA 4BVYB 1RK4A 5ECNB 2HSHA 4E8EA 2HE3A 1GUMA 1OC3A 4ULXA 3WGDA 3TOUA 3Q18A 1ZGNA 1K3OA 2UZ8A 2LQQA 4IBPA 1ZYEA 4MH3A 3AY8A 3LFLA 3ZLPA 4K0NA 2MMZA 1JZOA 3GURA 2X64A 2VM2A 4POKA 2VLUA 3FYGA 1JLVA 3ZZXA 1WIKA 5ID2A 3KJYA 4XS1A 4MJAA 1CQHA 2WGRA 3EMXA 2IMFA 1IYHA 3KMNA 1T3BA 4YQVA 1TKDB 4QL7A 2FHEA 1WRYA 3EINA 2O85A 1WWJA 2REMA 4POMA 1B9YC 3W8SA 2H6XA 3V1WA 3ZVJA 2MZCA 1A23A 1AIUA 3W6GA 1K0OA 3HHVA 1T4ZA 3TRQA 2PGTA 1QK8A 5GSSA 2V1MA 5INYA 4HQZA 4NXIA 1J0FA 3H1NA 2BTOT 4JRRA 3R3EA 4MPFA 5A4VA 2C3QA 2HI7A 4ZBBA 2JL4A 5DJLA 3FHKA 3D22A 1Q4JA 1R7HA 5ECRB 1PGTA 1X9WB 1O8WA 4ML6A 3ZFLA 4O92A 1W89A 4MZCA 3GTUA 2LV3A 1EP8A 4K7NA 1VGLA 1GH2A 2VCZA 2HRKB 5J9BA 4HZ4A 3TKSA 3C1RA 1K0CA 5E4WA 1EZKA 5ECHB 1X5EA 3SWLA 2I4AA 3JCML 4WBJA 3APSA 4G0LA 4LA1A 5D9TA 4IS0A 4KCEA 2PWJA 3IK9A 1G6YA 4KAEA 1X5CA 1Z3EA 1EGRA 2FWHA 4LL4B 3TJJA 3CYNA 2R37A 1XIYA 1WPIA 4FYCA 2DC5A 1TRVA 4PX1A 2MMOA 5DCHA 1VRSD 1ERWA 2YOIA 3G9BA 3H79A 1X5DA 3FR6A 1AAZA 1UN2A 4Q5NA 1SENA 2B1LA 1A0RP 1Z6NA 4E8HA 1GSDA 3UARA 3F9UA 2DMLA 3DMLA 4OWYA 5D73A 3GKXA 3K8NA 3VLNA 4EF0A 1TU8A 3QDNA 1WJKA 2AUVA 1OE7A 2NVLA 3F3QA 1LU4A 3P7XA 1BEDA 4KW6A 5JWOB 1PKZA 3GN3A 1PX6A 1K0NA 3GFKA 4XRAA 2BJXA 3KZQA 4WEYA 5DVBA 2AHEA 2OKAA 5J5NA 2WCIA 2LEGA 3PPUA 3WGEA 1TI1A 1F37A 3LEFA 1QGVA 1BX9A 4IN0A 2L59A 3EURA 1ERVA 2LJKA 3UIWA 1XVWA 3FZ4A 3IAM2 1NW2A 1EEJA 3BCKA 5HFGA 5ENUA 6GSVA 2E2GA 2VLVA 1M9BA 1A2MA 2ON5A 2CZ3A 2EIQA 3TGZA 2YZHA 2F9SA 4DSSA 2TIRA 1FOVA 4AGSA 3GUSA 5CRHA 5D96A 1VF2A 3LJRA 3I6AA 4L5LA 3TOTA 1HD2A 4WKWA 3HKRA 11GSA 4K7IA 3HYPA 2GTUA 2A4VA 22GSA 1O73A 4GSSA 2B1KA 2X8HA 1MD4A 1MD3A 3KH7A 4AF2A 3IHQA 3J7Yk 3UJ1A 2B6MA 1M0UA 1MTCA 3TJKA 4MCUA 1O8XA 2JU5A 2MBTA 2YWOA 4LMWA 2HFDA 4JZQA 5IMDA 1WOUA 2QSIA 3G7YA 1GNWA 3QAVA 2H75A 4HZ2A 3VWXA 3J7Yb 9GSSA 1T7PB 3GNJA 1V9WA 4FYBA 4MZWA 1U6TA 2R2JA 4BA7A 3ZVJD 1FAAA 2LSTA 3GH9A 3CRTA 2C8UA 4HQSA 4NHWA 4NV5A 2HZEA 1EP7A 5F0GA 3CSJA 2H8LA 2C3NA 1TK5B 2V2GA 1NSWA 2RUFA 1NHOA 1XZOA 1ABAA 5DQSA 1ON4A 2IMKA 7GSSA 1K0DA 1V58A 4KB3A 5JCUA 4ECBA 5ID2B 1ML6A 12GSA 1B8XA 4G9HA 2CVBA 3C8EA 6GSTA 5D9VA 3APQA 4MJEA 3IV4A 5LNKe 1JZDA 4HS1A 4J57E 4KUNA 4LL1B 5B8BA 3C7MA 1SL2B 2A2RA 1ZOFA 2IWTA 2EIOA 4IJ3A 1V40A 2OBKA 4Q5FA 1XW9A 4ZB6A 2YWNA 5IMFA 5DQYA 2HSYA 1TK0B 1U88A 3LQ7A 4GWRA 4I97A 3LGCA 2H0IA 3CXGA 2I3YA 1GLPA 4Q5RA 1EGOA 2YCDA 3IBHA 2CAQA 4YAVA 5DAKA 4MA9A 3TJBA 2GSRA 1J08A 4TXVA 1JHBA 5ELAA 2FA8A 4I5QA 3D4TA 4JBBA 4RQXA 2P5RA 4XS6A 2PU9C 3G7JA 2HYXA 1PL2A 2H73A 5KN1A 1GSYA 4KDUA 3HDCA 2ZUPA 1S3CA 1R26A 4MPGA 5BMUA 3LYKA 3F4SA 5F8BA 4G2EA 3KP9A 2KUCA 2YPMA 2G0FA 2WULA 1PN9A 4H86A 1PD21 1SKWB 1GTBA 1W4VA 2H0HA 4G0IA 1H75A 1TI3A 4OD7A 3FZAA 1FHEA 1GUHA 1YKCA 1E2YA 3GSSA 1B4PA 4MK3A 1TDIA 2C3TA 4KCAA 2C4JA 2IL3A 3A2VA 18GSA 1HNBA 2L4QA 2F51A 3EE2A 3QR6A 5HFIA 3L78A 4OCEA 1XPVA 3FW2A 3HD5A 5LD0A 4KDYA 2VL2C 4L8EA 4MF7A 1TU7A 2LRNA 5C04A 2VL3A 4WR5A 1AUCA 3EVIA 4GSTA 4TOPA 2FA4A 1VF1A 2FUG2 5HR2A 4QL9A 3ED3A 3GHAA 4WF5A 4GLTA 2LJRA 1SYXA 3H8QA 2L5LA 4KA0A 5EY6A 3DVWA 1BG5A 1F2EA 3GRXA 2M80A 3VI7A 2VO4A 3TKQA 4AJ8A 1GULA 1BJXA 1VF4A 4FYUA 2OJLA 4IQAA 3CTFA 2YP6A 3UEMA 1N8JA 2B5XA 4ZB8A 4WBRD 2DIZA 2JSZA 1KTEA 4DSRA 4JU5A 3TKPA 1J9BA 3KGKA 6GSUA 3TDGA 3DYRA 1XWKA 3MAKA 4TRXA 2P31A 1ERTA 4ZL7A 2OE0A 1LJRA 3GMFA 4K9ZA 4N30A 1WP0A 4IVFA 4DSSB 4EKZA 4JE1A 2PBJA 3PGTA 5A4WA
chains in the Genus database with same CATH superfamily
3WT2A 4PUAA 1FW1A 4KX4A 4IKHA 2OE3A 5IPGA 2A2SA 1X9MB 4RUVA 2GQLA 3DKSA 1GP1A 1JZRA 3FZ5A 2GSTA 5A4UA 4ID0A 5FT3A 3DXBA 2F8AA 1M2AA 4POBA 3TB2A 4HU7A 2LUSA 3EPTA 3KTLA 4OMVA 1XXUA 4EL1A 1XW6A 2VAFA 5H5SA 1WMJA 2J23A 2HQTA 2GT6A 3HVXA 4X1UA 2J9HA 4WF4A 4ZIJA 1MDIA 3DIEA 4TR0A 3EC3A 1RW1A 3FEUA 3M1GA 4IQ1A 4MZBA 2JADA 3F4RA 2VLTA 4MJBA 4PI2C 3TRXA 2GLRA 4KE3A 2HZEB 2CVDA 1K3YA 1SVOA 4BL7A 2L57A 14GSA 3DVXA 4MDCA 1N25A 3IE3A 4BVXA 2RLIA 2E7PA 4MP4A 2AAWA 1PX7A 2CVKA 3TCOA 1SK0A 2GSQA 2FY6A 1A2LA 2WVXB 4I2TA 5KOXA 1SVMA 4XS4A 1T4YA 4N10A 2NTOA 1YVLA 2LS5A 2H01A 4ECCA 1SL0B 4K0GA 5AISA 4EIPA 2H72A 5J4UA 3PINA 4TN8A 5H5RA 3O76A 3D4MA 2QA2A 1V57A 2FCHA 2C0DA 4Q5QA 2GQKA 3H4KA 5IMZA 2R3XA 2RM5A 2CV4A 5ECSA 2GZYA 1ZMAA 4NPBA 5AIVA 1A8LA 4G10A 1I5GA 1BAYA 2VL2A 3M9KA 1SKSB 3IDVA 5DAKB 4CW9A 2MYGA 4MMMA 4I2UA 3IOSA 1YEPA 3QMXA 3DGQA 3HZ8A 1F9MA 2I1UA 2HT9A 3QOUA 2IPAA 2GSSA 5KN2A 1XOBA 4V1Ag 1A8YA 5KOWA 2WB9A 3KM6A 2IIYA 2NDOA 5B6NA 1PSQA 4KF9A 1GSEA 2O89A 5BMUB 3F3RA 3ZIVA 2CT6A 1O85A 2VCWA 2FGXA 5EPFA 1GTIA 3KP8A 2CZ2A 1C72A 1QQ2A 1S3RA 1GNEA 1B4QA 4POLA 1A0FA 4GQCA 13GSA 1XWBA 2FLSA 5C00A 3TKRA 1G7EA 3ZRDA 3R2QA 4K7OA 2KP1A 1O7UA 1PKWA 2K6VA 4PQ1A 3I69A 3NIVA 1A2JA 2C0FA 1YDKA 3MWHA 1AQWA 3HCZA 3ME7A 3GA4A 5DBQA 1T00A 1U3IA 1SKRB 2B5EA 4F2IA 4IHUA 4YH2A 2YZUA 2H1BA 1G6WA 4PQHA 3UVTA 5ABRA 1EOHA 1FB0A 2MBSA 1XG8A 1SD9A 3DD3A 2YV9A 1Z7RA 2FWEA 2O87A 2DJ2A 5HFKA 2HSMB 3RHCA 3KMOA 1EWXA 4WETA 5F06A 2IMEA 1K0AA 4PURA 1EEMA 2JZRA 1GSSA 2YJHA 1SK1A 2GS3A 1M7TA 1S4BP 2LNTA 3I9V2 2PVQA 1TTZA 3MYDA 2D2ZA 1HYUA 3IR4A 2DKIA 5JCGA 4W66A 4O5RA 6GSYA 3GYKA 3UMAA 2DJKA 4ECJA 1F3AA 2PPTA 3UOMA 1GUKA 2WRTA 4V1Ap 4O5UA 4YKFA 4V2NA 3F0IA 3RHBA 4GCIA 3FR9A 2PERA 3KCMA 1Y25A 1TRWA 1GTAA 4DEJA 3I43A 1M2BA 4GSNA 1AQVA 4RI7A 3UVHA 3F6FA 3TUEA 3ZTLA 4USSA 2H70A 3RBTA 2YJ7A 3PR8A 4HSCX 4FIWA 2RIIA 4ZBAA 4N3ZA 3L4NA 4O5QA 1TRSA 2PN8A 2WVYA 1Y6EA 1PL1A 3Q19A 3ZMLA 5CRGA 4ZILA 4V2LA 4OCFA 4HJMA 1ST9A 1TXUA 5D9WA 1PMTA 2I81A 4X43A 3EYTA 5GAND 1OVNA 2CQ9A 3MDKA 5ECQB 4ZXGA 3L0HA 3O6TA 4ZB9A 3ERFA 2LQOA 1TXXA 1GTUA 5J9CA 2HRAA 2VOCA 4PNGA 4NAXA 1HNAA 5G2ZA 4O7HA 3D6IA 2X8CA 5A5HA 1Z7PA 3APOA 4NHZA 3SBCA 4IJIA 1URMA 5A5KA 2WW3A 3DEXA 4PI0C 3PH9A 3VWUA 2HRKA 3UBKA 3LSZA 1MEKA 2FD3A 4TR3A 1M2DA 5B8AA 4HJ2A 3HZ4A 20GSA 4LMVA 1IYIA 4BIKA 4GQFA 4BL7B 5B6MA 1KNGA 1MDJA 4MLYA 1USBA 5GAPD 1O6JA 4L0UA 4BVXB 1SJ6A 4YAPA 2RM6A 4I6XA 3NOFA 4OO5A 2DJ3A 2V6OA 3ERGA 4TKYA 3CTGA 1TOFA 2XPDA 2CX3A 5COHA 3FMWA 2WFCA 2K8VA 3GTUB 4F0BA 4TR1A 4HI7A 1Z6MA 4D73A 1N2AA 4PTSA 3M8NA 4GDFA 5IQYA 2TRCP 4K2DA 2B5YA 4K8MA 2L5OA 4IP6A 3TJFA 3RAZA 2LKUA 1DUGA 1OAZA 4K6XA 2OE1A 5CP1A 5JWRB 2C1YA 4DVCA 2X4AA 2VIMA 2X49A 3KTBA 3CRUA 3UBLA 1K0MA 3BCIA 1XWAA 4G19A 4ISDA 1H4OA 1WE0A 3GKNA 3IRAA 3HA9A 1HNCA 2CX4A 4O32A 2XHFA 3A2WA 1Q98A 5DALA 2I9HA 1XW5A 2ZNMA 4IP1A 2DBCA 3ZITA 3NZNA 5DCGA 1S3AA 2XBQA 1PFOA 3HMJG 3ZIJA 4X0XA 3E9JB 3FKFA 2FNOA 2OADA 3N5OA 1GL8A 2GT5A 4NV2A 1OC8A 5G5FA 1ZYQB 3M0FA 1EOGA 3QCPA 3P8WA 3VI5A 1OYJA 4WXTA 3WYWA 2JACA 3KXOA 2HRNA 2X99A 5IOXA 3QAGA 2R5GA 1M9AA 2H19A 2IFQA 3P90A 3CBUA 2DLXA 1GWCA 2O8VB 1V2AA 4F03A 1SD8A 4TR4A 2L6CA 1S3DA 2C0EA 4P3YB 3HY2A 4J2FA 5FWGA 1K3LA 3UL3A 2E2MA 3CMIA 3F4TA 4K1FA 19GSA 1PRXA 1ZCPA 2DIYA 4MJCA 1X0RA 2P5QA 3LXTA 3C71A 1GSFA 2JZTA 4K5RA 3VFIA 2YN1A 2H0GA 3VWWA 4HUAA 1ERUA 1AW9A 4OFTA 2K8SA 5DDLA 2V41A 3US3A 3GSTA 4KNDA 1PA3A 2N5AA 2OBIA 5D93A 4MF5A 4BWQA 2F3MA 1DE2A 2H6ZA 3A5IA 1JZWA 5HR3A 2H1GA 3BBYA 4EUYA 2DJ0A 3QD9A 2B3SA 2QKEA 5KEJA 3ZFBA 3GKKA 1BQ7A 1R5AA 3RPPA 3M9JA 4N0ZA 1EV9A 4V2MA 3F8UA 2YANA 2XC2A 1TK8B 6GSXA 4OO4A 4HOJA 6GSWA 2QC7A 3FRCA 5D9XA 2XPEA 4QMKA 1G0TA 2HZFA 4ILFA 1M3IA 3QPMA 5IO2A 2X8GA 2R0GA 2EIRA 1I9DA 3C73A 2GGTA 1AXDA 4PXOA 1GLQA 3WT1A 3HJOA 1PN0A 1B9XC 3F63A 3LG6A 5G1KA 5HR1A 3A3TA 2H6YA 4AKXB 1FB6A 2H74A 2L6DA 3IXRA 1FO5A 2KP2A 3RGBC 2HSNB 2NPBA 3VURA 3D21A 5J4YA 4Z7XA 3GIXA 4JEDA 1HQOA 3E0UA 1JLWA 2GZZA 3G7IA 1OE8A 4MF6A 5IO0A 1SJIA 4KGIA 3ME8A 2ALBA 5A5HB 1Z9HA 2K9FA 4TVEA 4OFNA 3D5JA 1YQ1A 3LW9A 1XVQA 4GRFA 1YF1A 5CNWA 5J41A 4AKGA 3IC8A 5CAXA 3A5WA 1U87A 4XIHA 4GTUA 4BPYA 2VCTA 2ON7A 1T8EB 2R0CA 3FY7A 5IIZA 5G30A 2LTKA 5EVOA 4MH2A 1YJ6A 2GZPA 2H1LA 2VM1A 4BWSA 4GF0A 5HR0A 1AQXA 1M99A 1TRUA 4CY8A 3ZREA 3KH9A 17GSA 2AJQB 3U5RE 3CQFA 1V98A 4I8BA 1R5PA 1UA5A 5G31A 1ACVA 2E0QA 4ZL8A 4EC0A 4TR1B 4RQRA 2Z9SA 4N11A 4EO3A 4D73B 1OC9A 1ILOA 1NM3A 1QXHA 1XCCA 5DJMA 2LJAA 3TRPA 1FVKA 3F6DA 3E3EA 5F07A 1RQMA 2WW2A 1XBSA 1AC1A 3HVSA 4YQMA 1SK2A 3GKMA 5LCZA 3KD0A 1TW9A 3FK8A 2YV7A 2LRCA 3BOAA 2WZ9A 4QQ7A 4ZB7A 5FHIA 4TXOA 2KLXA 2H71A 4F0CA 5DALB 4XCSA 4ACSA 5AIXA 5IOWA 2HRFA 3S9FA 4PNFA 1BYEA 3CSHA 3WD6A 2M72A 1A24A 5HQPA 5J4VA 5J3RA 3WGXA 5AGYA 16GSA 1YEXA 1G7OA 4BVYA 4FH8A 4EDYA 4MABA 2DJ1A 3IAS2 2JSYA 1CQGA 5IMAA 3MSZA 4L0WA 5JCWA 2O7KA 3VPTA 1ZL9A 1E6BA 3MIXA 4FQUA 2KHPA 5D8IA 3LORA 4ML1A 1KBNA 5E59A 5JWQB 2AYTA 2RUEA 4KSMA 2MMNA 5ECKB 2G2QA 1SU9A 2IFQB 5GZZB 2QGVA 1UC7A 4XTSA 3RDWA 4AJ7A 2MMAA 5L71A 3GH6A 4F82A 2OA7A 1QFNA 2DSAA 4AJ6A 2ES7A 1DE1A 3ISOA 2XBIA 5KN0A 1XWCA 1SJZA 2C0GA 5ELGA 3CHXC 1YF0A 5AN1A 3FR3A 3GX8A 5CRDA 3Q74A 4A5PA 2HNLA 3L9SA 3OR5A 4DSQA 3HVNA 5GSTA 2OACA 3H93A 1TJDA 3ERWA 3GL5A 4JR4A 4Z2RA 2N5BA 2V6KA 3O3TA 4IGJA 1THXA 4NMUA 4FO5A 2IMIA 3VWVA 4CHSA 3IA1A 4Z2TA 4Z2UA 2O3EA 1TP9A 2TRXA 2V32A 1SVLA 3BD2A 1R4WA 2VD1A 1MDKA 1YKAA 3ZL5A 1GSQA 5EL8A 1QMVA 2FWGA 3EU3A 1SL1B 2JZSA 2LRTA 2AV4A 2WVXA 1GSUA 5B7CA 2R4VA 3L9VA 1U3AA 2YWMA 2DJJA 2ZCTA 2VCVA 4ECIA 2GVPA 2H66A 1XWGA 5CRWA 3A2XA 1FVJA 3HJPA 4GXZA 5CYYA 2YNXA 1UVZA 4OFMA 3C1SA 1K0BA 4IW9A 2PUKC 3EMPA 3P2AA 4EDZA 3IK7A 2KOKA 5G5EA 3LXZA 3RPNA 3GL3A 1GRXA 2R6KA 3M3MA 4PUFC 5ECIB 3W8JA 1PQNA 3VK9A 2AB6A 5ECMB 3QFAC 1X9SB 3HVVA 4KSOA 3UAPA 3EWLA 3ZYWA 2VCQA 2HLSA 2K18A 3ZMKA 3QFBC 5IMVA 4YKGA 3D0ZA 5IM9A 4XS4B 2GQMA 1KEBA 2H30A 2WJUA 1O81A 2NBSA 3IC4A 5ECPB 5ECLB 1QUWA 5F05A 3TJGA 2F8FA 2DMMA 4N0VA 4EVMA 1XOAA 5CREA 4LLRA 2B7JA 4X4JA 1SYRA 1VF3A 1OKDA 2M46A 2P0GA 3CSIA 2VUPA 2EC4A 2CAIA 4XRDA 2B7KA 3TKSE 8GSSA 4NWYA 1YY7A 1B48A 3HXSA 5A1NA 4KDXA 3EU4A 10GSA 3Q6OA 1T1VA 3TKSC 4HU9A 3LWAA 4J56E 4JR6A 4KH7A 1YZXA 4PGTA 1JFUA 3N9JA 2GDRA 4ZBDA 4CDOA 2L4CA 4ZL9A 2OT3A 2LNSA 2VCXA 4PQIA 5H5QA 4HEA2 1F6MC 4IELA 3KEBA 2HXKA 3GV1A 3QAWA 1FG4A 4K5SA 2H1DA 1THOA 1M3JA 3LYPA 4L5OA 2CA8A 2VL9A 2HSMA 2N5FA 1NHYA 2IMDA 1OC9B 3VPQA 1EV4A 1OKTA 2IN3A 1ZZYA 3DWVA 5CO3A 2YWIA 2FWFA 4EXJA 4TW5A 6GSSA 3L9UA 2A2PA 1LBKA 2H1AA 3DRNA 3GX0A 1F3BA 3U6VA 3IPZA 2PMTA 2PVOC 3KIJA 5BRTA 5IPHA 1FOHA 5IMCA 2WS2A 4TXOB 5KN3A 2BMXA 4EE0A 5G1LA 5ECOB 2WDUA 3FZ9A 2C80A 2H76A 4G0KA 1XFLA 2O36A 3HJMA 2IJYA 1DSBA 1DBYA 2VD0A 5J47A 3BJ5A 2WW1A 4RI6A 4YQUA 4HDEA 4XHMA 1Z5YE 4F9ZA 4WR4A 3MNGA 4BVYB 1RK4A 5ECNB 2HSHA 4E8EA 2HE3A 1GUMA 1OC3A 4ULXA 3WGDA 3TOUA 3Q18A 2O5VA 1ZGNA 1K3OA 2UZ8A 4CY6A 2LQQA 4IBPA 1ZYEA 4MH3A 3AY8A 3LFLA 3ZLPA 4K0NA 4AI6A 2MMZA 1JZOA 3GURA 2X64A 2VM2A 4POKA 2VLUA 3FYGA 1JLVA 4G01A 3ZZXA 1WIKA 5ID2A 3KJYA 4XS1A 4MJAA 1BF5A 1CQHA 2WGRA 3EMXA 2IMFA 1IYHA 3KMNA 1T3BA 4YQVA 1TKDB 4QL7A 2FHEA 4AKIA 1WRYA 3EINA 2O85A 1WWJA 2REMA 4POMA 1B9YC 3W8SA 2H6XA 3V1WA 3ZVJA 2MZCA 1A23A 1AIUA 3W6GA 1K0OA 3HHVA 1T4ZA 3TRQA 2PGTA 1QK8A 2WVZA 5GSSA 2V1MA 2DKHA 5INYA 4HQZA 4NXIA 1J0FA 3H1NA 2BTOT 4JRRA 3R3EA 4MPFA 5A4VA 2C3QA 2HI7A 4ZBBA 2JL4A 5DJLA 3FHKA 3D22A 1Q4JA 1R7HA 5ECRB 1PGTA 1ZYPA 1O8WA 1X9WB 4ML6A 3ZFLA 1BG1A 4O92A 1W89A 4MZCA 3GTUA 2LV3A 3IHGA 1EP8A 5A34A 4K7NA 1VGLA 1GH2A 2VCZA 2HRKB 5J9BA 4HZ4A 3TKSA 3C1RA 1K0CA 5E4WA 1EZKA 5ECHB 1X5EA 3SWLA 2I4AA 3JCML 4WBJA 3APSA 4G0LA 4LA1A 5D9TA 3TU3B 4IS0A 4KCEA 2PWJA 3IK9A 4PHZC 1G6YA 4KAEA 1X5CA 1Z3EA 1EGRA 2FWHA 4LL4B 3TJJA 4FXYP 3CYNA 2R37A 1XIYA 1WPIA 4FYCA 2DC5A 1TRVA 4PX1A 2MMOA 5DCHA 1VRSD 1ERWA 2YOIA 3G9BA 3H79A 1X5DA 3FR6A 1AAZA 1UN2A 4Q5NA 1SENA 2B1LA 1A0RP 2EFEA 1Z6NA 4E8HA 1GSDA 3UARA 3F9UA 2DMLA 3DMLA 1ZYNA 4OWYA 5D73A 3GKXA 3K8NA 3VLNA 4EF0A 1TU8A 3QDNA 1WJKA 5A1NB 2AUVA 1OE7A 2NVLA 3F3QA 1LU4A 3P7XA 1BEDA 4KW6A 5JWOB 1PKZA 3GN3A 1PX6A 1K0NA 3GFKA 4XRAA 2BJXA 1Y1UA 3KZQA 2QA1A 4WEYA 5DVBA 2AHEA 2OKAA 5J5NA 2WCIA 2LEGA 3PPUA 3WGEA 1TI1A 1F37A 3LEFA 1QGVA 1BX9A 4IN0A 2L59A 3EURA 1ERVA 2LJKA 3UIWA 1XVWA 3FZ4A 3IAM2 1NW2A 1EEJA 3BCKA 5HFGA 4EIQA 5ENUA 6GSVA 2E2GA 2VLVA 1M9BA 1A2MA 2ON5A 2CZ3A 2EIQA 3TGZA 2YZHA 2F9SA 4DSSA 2TIRA 1FOVA 4AGSA 3GUSA 5CRHA 5D96A 1VF2A 3LJRA 3I6AA 4L5LA 3TOTA 1HD2A 4WKWA 3HKRA 11GSA 2EFCA 4K7IA 3HYPA 2GTUA 2A4VA 22GSA 1O73A 4GSSA 2B1KA 2X8HA 1MD4A 1MD3A 3KH7A 4AF2A 3IHQA 3J7Yk 3UJ1A 2B6MA 1M0UA 1MTCA 3TJKA 4MCUA 1O8XA 2JU5A 2MBTA 2YWOA 4LMWA 2HFDA 4JZQA 5IMDA 1WOUA 2QSIA 3G7YA 1GNWA 3QAVA 2H75A 4HZ2A 3VWXA 3J7Yb 9GSSA 1T7PB 3GNJA 1V9WA 4FYBA 4MZWA 2WZSA 1U6TA 2R2JA 4BA7A 3ZVJD 1FAAA 2LSTA 3GH9A 3CRTA 2C8UA 4HQSA 4NHWA 4NV5A 2HZEA 1YEWC 1EP7A 5F0GA 3CSJA 2UV8G 2H8LA 2C3NA 3CWGA 1TK5B 2V2GA 2HSNA 1NSWA 2RUFA 1NHOA 1XZOA 1ABAA 5DQSA 1ON4A 2IMKA 7GSSA 1K0DA 4E68A 1V58A 4KB3A 5JCUA 4ECBA 5ID2B 4K2XA 1ML6A 12GSA 1B8XA 4G9HA 2CVBA 3C8EA 6GSTA 5D9VA 3APQA 4MJEA 3IV4A 2R0PA 5LNKe 2WW0A 1JZDA 4HS1A 4J57E 4KUNA 4LL1B 5B8BA 3C7MA 1SL2B 2A2RA 1ZOFA 2IWTA 2EIOA 4IJ3A 1V40A 2OBKA 4Q5FA 1XW9A 4ZB6A 2YWNA 5IMFA 5DQYA 2HSYA 1TK0B 1U88A 3LQ7A 4GWRA 4I97A 3LGCA 2H0IA 3CXGA 2I3YA 1GLPA 4Q5RA 1EGOA 2YCDA 3IBHA 2CAQA 4YAVA 5DAKA 4MA9A 3TJBA 2EFDA 2GSRA 1J08A 4TXVA 1JHBA 5ELAA 2FA8A 4I5QA 3D4TA 4JBBA 4RQXA 2P5RA 4XS6A 2PU9C 3G7JA 2HYXA 1PL2A 2H73A 5KN1A 1GSYA 4KDUA 3HDCA 2ZUPA 1S3CA 1R26A 4MPGA 5BMUA 3LYKA 3F4SA 5F8BA 4G2EA 3KP9A 2KUCA 2YPMA 5A34B 2G0FA 1PN9A 2WULA 4H86A 1PD21 1SKWB 1GTBA 1W4VA 2H0HA 4G0IA 1H75A 1TI3A 4OD7A 3FZAA 1FHEA 1GUHA 1YKCA 1E2YA 3GSSA 1B4PA 4MK3A 1TDIA 2C3TA 4KCAA 2C4JA 2IL3A 3A2VA 18GSA 1HNBA 2L4QA 2F51A 3EE2A 3QR6A 5HFIA 3L78A 4OCEA 4ICYA 1XPVA 3FW2A 3HD5A 5LD0A 4KDYA 2VL2C 4L8EA 3RFRC 4MF7A 1I1IP 1TU7A 2LRNA 5C04A 2VL3A 4WR5A 1AUCA 3EVIA 4GSTA 4TOPA 5J40A 2FA4A 1VF1A 2FUG2 4MNNA 5HR2A 4QL9A 3ED3A 3GHAA 4WF5A 4GLTA 2LJRA 1SYXA 3H8QA 2L5LA 4KA0A 5EY6A 2A4HA 3DVWA 1BG5A 1F2EA 3GRXA 2M80A 3VI7A 2VO4A 3TKQA 4AJ8A 1GULA 1BJXA 1VF4A 4FYUA 2OJLA 4IQAA 3CTFA 2YP6A 3UEMA 1N8JA 2B5XA 4ZB8A 4WBRD 2DIZA 2JSZA 1KTEA 4DSRA 4JU5A 3TKPA 1J9BA 3KGKA 6GSUA 3TDGA 3DYRA 1XWKA 3MAKA 4TRXA 2P31A 4AKHA 1ERTA 2EFHA 4ZL7A 2OE0A 1LJRA 3GMFA 4K9ZA 4N30A 1WP0A 4IVFA 4DSSB 4EKZA 4JE1A 2PBJA 3PGTA 2VKZG 5A4WA
chains in the Genus database with same CATH topology
3WT2A 4PUAA 1FW1A 4KX4A 4IKHA 2OE3A 5IPGA 2A2SA 1X9MB 4RUVA 2GQLA 3DKSA 1GP1A 1JZRA 3FZ5A 2GSTA 5A4UA 4ID0A 5FT3A 3DXBA 2F8AA 1M2AA 4POBA 3TB2A 4HU7A 2LUSA 3EPTA 3KTLA 4OMVA 1XXUA 4EL1A 1XW6A 2VAFA 5H5SA 1WMJA 2J23A 2HQTA 2GT6A 3HVXA 4X1UA 2J9HA 4WF4A 4ZIJA 1MDIA 3DIEA 4TR0A 3EC3A 1RW1A 3FEUA 3M1GA 4IQ1A 4MZBA 2JADA 3F4RA 2VLTA 4MJBA 3TRXA 2GLRA 4KE3A 2HZEB 2CVDA 1K3YA 1SVOA 4BL7A 2L57A 14GSA 3DVXA 4MDCA 1N25A 3IE3A 4BVXA 2RLIA 2E7PA 4MP4A 2AAWA 1PX7A 2CVKA 3TCOA 1SK0A 2GSQA 2FY6A 1A2LA 4I2TA 5KOXA 1SVMA 4XS4A 1T4YA 4N10A 2NTOA 1YVLA 2LS5A 2H01A 4ECCA 1SL0B 4K0GA 5AISA 4EIPA 2H72A 5J4UA 3PINA 4TN8A 5H5RA 3O76A 3D4MA 2QA2A 1V57A 2FCHA 2C0DA 4Q5QA 2GQKA 3H4KA 5IMZA 2R3XA 2RM5A 2CV4A 5ECSA 2GZYA 1ZMAA 4NPBA 5AIVA 1A8LA 4G10A 1I5GA 1BAYA 2VL2A 3M9KA 1SKSB 3IDVA 5DAKB 4CW9A 2MYGA 4MMMA 4I2UA 3IOSA 1YEPA 3QMXA 3DGQA 3HZ8A 1F9MA 2I1UA 2HT9A 3QOUA 2IPAA 2GSSA 5KN2A 1XOBA 4V1Ag 1A8YA 5KOWA 2WB9A 3KM6A 2IIYA 2NDOA 5B6NA 1PSQA 4KF9A 1GSEA 2O89A 5BMUB 3F3RA 3ZIVA 2CT6A 1O85A 2VCWA 2FGXA 5EPFA 1GTIA 3KP8A 2CZ2A 1C72A 1QQ2A 1GNEA 1B4QA 4POLA 1A0FA 4GQCA 13GSA 1XWBA 2FLSA 5C00A 3TKRA 1G7EA 3ZRDA 3R2QA 4K7OA 2KP1A 1O7UA 1PKWA 2K6VA 4PQ1A 3I69A 3NIVA 1A2JA 2C0FA 1YDKA 3MWHA 1AQWA 3HCZA 3ME7A 3GA4A 5DBQA 1T00A 1U3IA 1SKRB 2B5EA 4F2IA 4IHUA 4YH2A 2YZUA 2H1BA 1G6WA 4PQHA 3UVTA 5ABRA 1EOHA 1FB0A 2MBSA 1SD9A 3DD3A 2YV9A 1Z7RA 2FWEA 2O87A 2DJ2A 5HFKA 2HSMB 3RHCA 3KMOA 1EWXA 4WETA 5F06A 2IMEA 1K0AA 4PURA 1EEMA 2JZRA 1GSSA 2YJHA 1SK1A 2GS3A 1M7TA 2LNTA 3I9V2 2PVQA 1TTZA 3MYDA 2D2ZA 1HYUA 3IR4A 2DKIA 5JCGA 4W66A 4O5RA 6GSYA 3GYKA 3UMAA 2DJKA 4ECJA 1F3AA 2PPTA 3UOMA 1GUKA 2WRTA 4V1Ap 4O5UA 4YKFA 4V2NA 3F0IA 3RHBA 4GCIA 3FR9A 2PERA 3KCMA 1Y25A 1TRWA 1GTAA 4DEJA 3I43A 1M2BA 4GSNA 1AQVA 4RI7A 3UVHA 3F6FA 3TUEA 3ZTLA 4USSA 2H70A 3RBTA 2YJ7A 3PR8A 4FIWA 2RIIA 4ZBAA 4N3ZA 3L4NA 4O5QA 1TRSA 2PN8A 1Y6EA 1PL1A 3Q19A 3ZMLA 5CRGA 4ZILA 4V2LA 4OCFA 4HJMA 1ST9A 1TXUA 5D9WA 1PMTA 2I81A 4X43A 3EYTA 5GAND 1OVNA 2CQ9A 3MDKA 5ECQB 4ZXGA 3L0HA 3O6TA 4ZB9A 3ERFA 2LQOA 1TXXA 1GTUA 5J9CA 2HRAA 2VOCA 4PNGA 4NAXA 1HNAA 5G2ZA 4O7HA 3D6IA 2X8CA 5A5HA 1Z7PA 3APOA 4NHZA 3SBCA 4IJIA 1URMA 5A5KA 3DEXA 3PH9A 3VWUA 2HRKA 3UBKA 3LSZA 1MEKA 2FD3A 4TR3A 1M2DA 5B8AA 4HJ2A 3HZ4A 20GSA 4LMVA 1IYIA 4GQFA 4BL7B 5B6MA 1KNGA 1MDJA 4MLYA 1USBA 5GAPD 1O6JA 4L0UA 4BVXB 1SJ6A 4YAPA 2RM6A 4I6XA 3NOFA 4OO5A 2DJ3A 2V6OA 3ERGA 4TKYA 3CTGA 1TOFA 2XPDA 2CX3A 5COHA 3FMWA 2WFCA 2K8VA 3GTUB 4F0BA 4TR1A 4HI7A 1Z6MA 4D73A 1N2AA 4PTSA 3M8NA 4GDFA 5IQYA 2TRCP 4K2DA 2B5YA 4K8MA 2L5OA 4IP6A 3TJFA 3RAZA 2LKUA 1DUGA 1OAZA 4K6XA 2OE1A 5CP1A 5JWRB 2C1YA 4DVCA 2X4AA 2VIMA 2X49A 3KTBA 3CRUA 3UBLA 1K0MA 3BCIA 1XWAA 4G19A 4ISDA 1H4OA 1WE0A 3GKNA 3IRAA 3HA9A 1HNCA 2CX4A 4O32A 2XHFA 3A2WA 1Q98A 5DALA 2I9HA 1XW5A 2ZNMA 4IP1A 2DBCA 3ZITA 3NZNA 5DCGA 1S3AA 2XBQA 3HMJG 3ZIJA 4X0XA 3E9JB 3FKFA 2FNOA 2OADA 3N5OA 1GL8A 2GT5A 4NV2A 1OC8A 5G5FA 1ZYQB 3M0FA 1EOGA 3QCPA 3P8WA 3VI5A 1OYJA 4WXTA 3WYWA 2JACA 3KXOA 2HRNA 2X99A 5IOXA 3QAGA 2R5GA 1M9AA 2H19A 2IFQA 3P90A 3CBUA 2DLXA 1GWCA 2O8VB 1V2AA 4F03A 1SD8A 4TR4A 2L6CA 1S3DA 2C0EA 4P3YB 3HY2A 4J2FA 5FWGA 1K3LA 3UL3A 2E2MA 3CMIA 3F4TA 4K1FA 19GSA 1PRXA 1ZCPA 2DIYA 4MJCA 1X0RA 2P5QA 3LXTA 3C71A 1GSFA 2JZTA 4K5RA 3VFIA 2YN1A 2H0GA 3VWWA 4HUAA 1ERUA 1AW9A 4OFTA 2K8SA 5DDLA 2V41A 3US3A 3GSTA 4KNDA 1PA3A 2N5AA 2OBIA 5D93A 4MF5A 4BWQA 2F3MA 1DE2A 2H6ZA 3A5IA 1JZWA 5HR3A 2H1GA 3BBYA 4EUYA 2DJ0A 3QD9A 2B3SA 2QKEA 5KEJA 3ZFBA 3GKKA 1BQ7A 1R5AA 3RPPA 3M9JA 4N0ZA 1EV9A 4V2MA 3F8UA 2YANA 2XC2A 1TK8B 6GSXA 4OO4A 4HOJA 6GSWA 2QC7A 3FRCA 5D9XA 2XPEA 4QMKA 1G0TA 2HZFA 4ILFA 3QPMA 5IO2A 2X8GA 2R0GA 2EIRA 1I9DA 3C73A 2GGTA 1AXDA 4PXOA 1GLQA 3WT1A 3HJOA 1PN0A 1B9XC 3F63A 3LG6A 5G1KA 5HR1A 3A3TA 2H6YA 4AKXB 1FB6A 2H74A 2L6DA 3IXRA 1FO5A 2KP2A 2HSNB 2NPBA 3VURA 3D21A 5J4YA 4Z7XA 3GIXA 4JEDA 1HQOA 3E0UA 1JLWA 2GZZA 3G7IA 1OE8A 4MF6A 5IO0A 1SJIA 4KGIA 3ME8A 2ALBA 5A5HB 1Z9HA 2K9FA 4TVEA 4OFNA 3D5JA 1YQ1A 3LW9A 1XVQA 4GRFA 1YF1A 5CNWA 5J41A 4AKGA 3IC8A 5CAXA 3A5WA 1U87A 4XIHA 4GTUA 4BPYA 2VCTA 2ON7A 1T8EB 2R0CA 3FY7A 5IIZA 5G30A 2LTKA 5EVOA 4MH2A 1YJ6A 2GZPA 2H1LA 2VM1A 4BWSA 4GF0A 5HR0A 1AQXA 1M99A 1TRUA 4CY8A 3ZREA 3KH9A 17GSA 2AJQB 3U5RE 1V98A 4I8BA 1R5PA 1UA5A 5G31A 1ACVA 2E0QA 4ZL8A 4EC0A 4TR1B 4RQRA 2Z9SA 4N11A 4EO3A 4D73B 1OC9A 1ILOA 1NM3A 1QXHA 1XCCA 5DJMA 2LJAA 3TRPA 1FVKA 3F6DA 3E3EA 5F07A 1RQMA 1XBSA 1AC1A 3HVSA 4YQMA 1SK2A 3GKMA 5LCZA 3KD0A 1TW9A 3FK8A 2YV7A 2LRCA 3BOAA 2WZ9A 4QQ7A 4ZB7A 5FHIA 4TXOA 2KLXA 2H71A 4F0CA 5DALB 4XCSA 4ACSA 5AIXA 5IOWA 2HRFA 3S9FA 4PNFA 1BYEA 3CSHA 3WD6A 2M72A 1A24A 5HQPA 5J4VA 5J3RA 3WGXA 5AGYA 16GSA 1YEXA 1G7OA 4BVYA 4FH8A 4EDYA 4MABA 2DJ1A 3IAS2 2JSYA 1CQGA 5IMAA 3MSZA 4L0WA 5JCWA 2O7KA 3VPTA 1ZL9A 1E6BA 3MIXA 4FQUA 2KHPA 5D8IA 3LORA 4ML1A 1KBNA 5E59A 5JWQB 2AYTA 2RUEA 4KSMA 2MMNA 5ECKB 2G2QA 1SU9A 2IFQB 5GZZB 2QGVA 1UC7A 4XTSA 3RDWA 4AJ7A 2MMAA 5L71A 3GH6A 4F82A 2OA7A 1QFNA 2DSAA 4AJ6A 2ES7A 1DE1A 3ISOA 2XBIA 5KN0A 1XWCA 1SJZA 2C0GA 5ELGA 1YF0A 5AN1A 3FR3A 3GX8A 5CRDA 3Q74A 4A5PA 2HNLA 3L9SA 3OR5A 4DSQA 5GSTA 2OACA 3H93A 1TJDA 3ERWA 3GL5A 4JR4A 4Z2RA 2N5BA 2V6KA 3O3TA 4IGJA 1THXA 4NMUA 4FO5A 2IMIA 3VWVA 4CHSA 3IA1A 4Z2TA 4Z2UA 1TP9A 2TRXA 2V32A 1SVLA 3BD2A 1R4WA 2VD1A 1MDKA 1YKAA 3ZL5A 1GSQA 5EL8A 1QMVA 2FWGA 3EU3A 1SL1B 2JZSA 2LRTA 2AV4A 1GSUA 5B7CA 2R4VA 3L9VA 1U3AA 2YWMA 2DJJA 2ZCTA 2VCVA 4ECIA 2GVPA 2H66A 1XWGA 5CRWA 3A2XA 1FVJA 3HJPA 4GXZA 5CYYA 2YNXA 1UVZA 4OFMA 3C1SA 1K0BA 4IW9A 2PUKC 3EMPA 3P2AA 4EDZA 3IK7A 2KOKA 5G5EA 3LXZA 3RPNA 3GL3A 1GRXA 2R6KA 3M3MA 4PUFC 5ECIB 3W8JA 1PQNA 3VK9A 2AB6A 5ECMB 3QFAC 1X9SB 3HVVA 4KSOA 3UAPA 3EWLA 3ZYWA 2VCQA 2HLSA 2K18A 3ZMKA 3QFBC 5IMVA 4YKGA 3D0ZA 5IM9A 4XS4B 2GQMA 1KEBA 2H30A 2WJUA 1O81A 2NBSA 3IC4A 5ECPB 5ECLB 1QUWA 5F05A 3TJGA 2F8FA 2DMMA 4N0VA 4EVMA 1XOAA 5CREA 4LLRA 2B7JA 4X4JA 1SYRA 1VF3A 1OKDA 2M46A 2P0GA 3CSIA 2VUPA 2EC4A 2CAIA 4XRDA 2B7KA 3TKSE 8GSSA 4NWYA 1YY7A 1B48A 3HXSA 5A1NA 4KDXA 3EU4A 10GSA 3Q6OA 1T1VA 3TKSC 4HU9A 3LWAA 4J56E 4JR6A 4KH7A 1YZXA 4PGTA 1JFUA 3N9JA 2GDRA 4ZBDA 4CDOA 2L4CA 4ZL9A 2OT3A 2LNSA 2VCXA 4PQIA 5H5QA 4HEA2 1F6MC 4IELA 3KEBA 2HXKA 3GV1A 3QAWA 1FG4A 4K5SA 2H1DA 1THOA 3LYPA 4L5OA 2CA8A 2VL9A 2HSMA 2N5FA 1NHYA 2IMDA 1OC9B 3VPQA 1EV4A 1OKTA 2IN3A 1ZZYA 3DWVA 5CO3A 2YWIA 2FWFA 4EXJA 4TW5A 6GSSA 3L9UA 2A2PA 1LBKA 2H1AA 3DRNA 3GX0A 1F3BA 3U6VA 3IPZA 2PMTA 2PVOC 3KIJA 5BRTA 5IPHA 1FOHA 5IMCA 2WS2A 4TXOB 5KN3A 2BMXA 4EE0A 5G1LA 5ECOB 2WDUA 3FZ9A 2C80A 2H76A 4G0KA 1XFLA 3HJMA 2IJYA 1DSBA 1DBYA 2VD0A 5J47A 3BJ5A 4RI6A 4YQUA 4HDEA 4XHMA 1Z5YE 4F9ZA 4WR4A 3MNGA 4BVYB 1RK4A 5ECNB 2HSHA 4E8EA 2HE3A 1GUMA 1OC3A 4ULXA 3WGDA 3TOUA 3Q18A 2O5VA 1ZGNA 1K3OA 2UZ8A 4CY6A 2LQQA 4IBPA 1ZYEA 4MH3A 3AY8A 3LFLA 3ZLPA 4K0NA 4AI6A 2MMZA 1JZOA 3GURA 2X64A 2VM2A 4POKA 2VLUA 3FYGA 1JLVA 4G01A 3ZZXA 1WIKA 5ID2A 3KJYA 4XS1A 4MJAA 1BF5A 1CQHA 2WGRA 3EMXA 2IMFA 1IYHA 3KMNA 1T3BA 4YQVA 1TKDB 4QL7A 2FHEA 4AKIA 1WRYA 3EINA 2O85A 1WWJA 2REMA 4POMA 1B9YC 3W8SA 2H6XA 3V1WA 3ZVJA 2MZCA 1A23A 1AIUA 3W6GA 1K0OA 3HHVA 1T4ZA 3TRQA 2PGTA 1QK8A 5GSSA 2V1MA 2DKHA 5INYA 4HQZA 4NXIA 1J0FA 3H1NA 2BTOT 4JRRA 3R3EA 4MPFA 5A4VA 2C3QA 2HI7A 4ZBBA 2JL4A 5DJLA 3FHKA 3D22A 1Q4JA 1R7HA 5ECRB 1PGTA 1ZYPA 1O8WA 1X9WB 4ML6A 3ZFLA 1BG1A 4O92A 1W89A 4MZCA 3GTUA 2LV3A 3IHGA 1EP8A 5A34A 4K7NA 1VGLA 1GH2A 2VCZA 2HRKB 5J9BA 4HZ4A 3TKSA 3C1RA 1K0CA 5E4WA 1EZKA 5ECHB 1X5EA 3SWLA 2I4AA 3JCML 4WBJA 3APSA 4G0LA 4LA1A 5D9TA 3TU3B 4IS0A 4KCEA 2PWJA 3IK9A 1G6YA 4KAEA 1X5CA 1Z3EA 1EGRA 2FWHA 4LL4B 3TJJA 3CYNA 2R37A 1XIYA 1WPIA 4FYCA 2DC5A 1TRVA 4PX1A 2MMOA 5DCHA 1VRSD 1ERWA 2YOIA 3G9BA 3H79A 1X5DA 3FR6A 1AAZA 1UN2A 4Q5NA 1SENA 2B1LA 1A0RP 2EFEA 1Z6NA 4E8HA 1GSDA 3UARA 3F9UA 2DMLA 3DMLA 1ZYNA 4OWYA 5D73A 3GKXA 3K8NA 3VLNA 4EF0A 1TU8A 3QDNA 1WJKA 5A1NB 2AUVA 1OE7A 2NVLA 3F3QA 1LU4A 3P7XA 1BEDA 4KW6A 5JWOB 1PKZA 3GN3A 1PX6A 1K0NA 3GFKA 4XRAA 2BJXA 1Y1UA 3KZQA 2QA1A 4WEYA 5DVBA 2AHEA 2OKAA 5J5NA 2WCIA 2LEGA 3PPUA 3WGEA 1TI1A 1F37A 3LEFA 1QGVA 1BX9A 4IN0A 2L59A 3EURA 1ERVA 2LJKA 3UIWA 1XVWA 3FZ4A 3IAM2 1NW2A 1EEJA 3BCKA 5HFGA 4EIQA 5ENUA 6GSVA 2E2GA 2VLVA 1M9BA 1A2MA 2ON5A 2CZ3A 2EIQA 3TGZA 2YZHA 2F9SA 4DSSA 2TIRA 1FOVA 4AGSA 3GUSA 5CRHA 5D96A 1VF2A 3LJRA 3I6AA 4L5LA 3TOTA 1HD2A 4WKWA 3HKRA 11GSA 2EFCA 4K7IA 3HYPA 2GTUA 2A4VA 22GSA 1O73A 4GSSA 2B1KA 2X8HA 1MD4A 1MD3A 3KH7A 4AF2A 3IHQA 3J7Yk 3UJ1A 2B6MA 1M0UA 1MTCA 3TJKA 4MCUA 1O8XA 2JU5A 2MBTA 2YWOA 4LMWA 2HFDA 4JZQA 5IMDA 1WOUA 2QSIA 3G7YA 1GNWA 3QAVA 2H75A 4HZ2A 3VWXA 3J7Yb 9GSSA 1T7PB 3GNJA 1V9WA 4FYBA 4MZWA 1U6TA 2R2JA 4BA7A 3ZVJD 1FAAA 2LSTA 3GH9A 3CRTA 2C8UA 4HQSA 4NHWA 4NV5A 2HZEA 1EP7A 5F0GA 3CSJA 2UV8G 2H8LA 2C3NA 3CWGA 1TK5B 2V2GA 2HSNA 1NSWA 2RUFA 1NHOA 1XZOA 1ABAA 5DQSA 1ON4A 2IMKA 7GSSA 1K0DA 4E68A 1V58A 4KB3A 5JCUA 4ECBA 5ID2B 4K2XA 1ML6A 12GSA 1B8XA 4G9HA 2CVBA 3C8EA 6GSTA 5D9VA 3APQA 4MJEA 3IV4A 2R0PA 5LNKe 1JZDA 4HS1A 4J57E 4KUNA 4LL1B 5B8BA 3C7MA 1SL2B 2A2RA 1ZOFA 2IWTA 2EIOA 4IJ3A 1V40A 2OBKA 4Q5FA 1XW9A 4ZB6A 2YWNA 5IMFA 5DQYA 2HSYA 1TK0B 1U88A 3LQ7A 4GWRA 4I97A 3LGCA 2H0IA 3CXGA 2I3YA 1GLPA 4Q5RA 1EGOA 2YCDA 3IBHA 2CAQA 4YAVA 5DAKA 4MA9A 3TJBA 2EFDA 2GSRA 1J08A 4TXVA 1JHBA 5ELAA 2FA8A 4I5QA 3D4TA 4JBBA 4RQXA 2P5RA 4XS6A 2PU9C 3G7JA 2HYXA 1PL2A 2H73A 5KN1A 1GSYA 4KDUA 3HDCA 2ZUPA 1S3CA 1R26A 4MPGA 5BMUA 3LYKA 3F4SA 5F8BA 4G2EA 3KP9A 2KUCA 2YPMA 5A34B 2G0FA 1PN9A 2WULA 4H86A 1PD21 1SKWB 1GTBA 1W4VA 2H0HA 4G0IA 1H75A 1TI3A 4OD7A 3FZAA 1FHEA 1GUHA 1YKCA 1E2YA 3GSSA 1B4PA 4MK3A 1TDIA 2C3TA 4KCAA 2C4JA 2IL3A 3A2VA 18GSA 1HNBA 2L4QA 2F51A 3EE2A 3QR6A 5HFIA 3L78A 4OCEA 4ICYA 1XPVA 3FW2A 3HD5A 5LD0A 4KDYA 2VL2C 4L8EA 4MF7A 1TU7A 2LRNA 5C04A 2VL3A 4WR5A 1AUCA 3EVIA 4GSTA 4TOPA 5J40A 2FA4A 1VF1A 2FUG2 4MNNA 5HR2A 4QL9A 3ED3A 3GHAA 4WF5A 4GLTA 2LJRA 1SYXA 3H8QA 2L5LA 4KA0A 5EY6A 2A4HA 3DVWA 1BG5A 1F2EA 3GRXA 2M80A 3VI7A 2VO4A 3TKQA 4AJ8A 1GULA 1BJXA 1VF4A 4FYUA 2OJLA 4IQAA 3CTFA 2YP6A 3UEMA 1N8JA 2B5XA 4ZB8A 4WBRD 2DIZA 2JSZA 1KTEA 4DSRA 4JU5A 3TKPA 1J9BA 3KGKA 6GSUA 3TDGA 3DYRA 1XWKA 3MAKA 4TRXA 2P31A 4AKHA 1ERTA 2EFHA 4ZL7A 2OE0A 1LJRA 3GMFA 4K9ZA 4N30A 1WP0A 4IVFA 4DSSB 4EKZA 4JE1A 2PBJA 3PGTA 2VKZG 5A4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WT2 A;  4PUA A;  1FW1 A;  4KX4 A;  4IKH A;  2OE3 A;  5IPG A;  2A2S A;  1X9M B;  4RUV A;  2GQL A;  3DKS A;  1GP1 A;  1JZR A;  3FZ5 A;  2GST A;  5A4U A;  4ID0 A;  5FT3 A;  3DXB A;  2F8A A;  1M2A A;  4POB A;  3TB2 A;  4HU7 A;  2LUS A;  3KTL A;  4OMV A;  1XXU A;  4EL1 A;  1XW6 A;  2VAF A;  5H5S A;  1WMJ A;  2J23 A;  2HQT A;  2GT6 A;  3HVX A;  4X1U A;  2J9H A;  4WF4 A;  4ZIJ A;  1MDI A;  3DIE A;  4TR0 A;  3EC3 A;  1RW1 A;  3FEU A;  3M1G A;  4IQ1 A;  4MZB A;  2JAD A;  3F4R A;  2VLT A;  4MJB A;  3TRX A;  2GLR A;  4KE3 A;  2HZE B;  2CVD A;  1K3Y A;  4BL7 A;  2L57 A;  14GS A;  3DVX A;  4MDC A;  3IE3 A;  4BVX A;  2RLI A;  2E7P A;  4MP4 A;  2AAW A;  1PX7 A;  2CVK A;  3TCO A;  1SK0 A;  2GSQ A;  2FY6 A;  1A2L A;  4I2T A;  4XS4 A;  1T4Y A;  4N10 A;  2NTO A;  2LS5 A;  2H01 A;  4ECC A;  1SL0 B;  4K0G A;  5AIS A;  2H72 A;  5J4U A;  3PIN A;  4TN8 A;  5H5R A;  3O76 A;  3D4M A;  1V57 A;  2FCH A;  2C0D A;  4Q5Q A;  2GQK A;  3H4K A;  5IMZ A;  2R3X A;  2RM5 A;  2CV4 A;  5ECS A;  2GZY A;  1ZMA A;  4NPB A;  5AIV A;  1A8L A;  4G10 A;  1I5G A;  1BAY A;  2VL2 A;  3M9K A;  1SKS B;  3IDV A;  5DAK B;  4CW9 A;  2MYG A;  4MMM A;  4I2U A;  3IOS A;  1YEP A;  3QMX A;  3DGQ A;  3HZ8 A;  1F9M A;  2I1U A;  2HT9 A;  3QOU A;  2IPA A;  2GSS A;  5KN2 A;  1XOB A;  4V1A g;  1A8Y A;  2WB9 A;  3KM6 A;  2IIY A;  2NDO A;  5B6N A;  1PSQ A;  4KF9 A;  1GSE A;  2O89 A;  3F3R A;  3ZIV A;  2CT6 A;  1O85 A;  2VCW A;  2FGX A;  5EPF A;  1GTI A;  3KP8 A;  2CZ2 A;  1C72 A;  1QQ2 A;  1GNE A;  1B4Q A;  4POL A;  1A0F A;  4GQC A;  13GS A;  1XWB A;  2FLS A;  5C00 A;  3TKR A;  1G7E A;  3ZRD A;  3R2Q A;  4K7O A;  2KP1 A;  1O7U A;  1PKW A;  2K6V A;  4PQ1 A;  3I69 A;  3NIV A;  1A2J A;  2C0F A;  1YDK A;  3MWH A;  1AQW A;  3HCZ A;  3ME7 A;  3GA4 A;  5DBQ A;  1T00 A;  1U3I A;  1SKR B;  2B5E A;  4F2I A;  4IHU A;  4YH2 A;  2YZU A;  2H1B A;  1G6W A;  4PQH A;  3UVT A;  5ABR A;  1EOH A;  1FB0 A;  2MBS A;  1SD9 A;  3DD3 A;  2YV9 A;  1Z7R A;  2FWE A;  2O87 A;  2DJ2 A;  5HFK A;  2HSM B;  3RHC A;  3KMO A;  1EWX A;  4WET A;  5F06 A;  2IME A;  1K0A A;  4PUR A;  1EEM A;  2JZR A;  1GSS A;  2YJH A;  1SK1 A;  2GS3 A;  1M7T A;  2LNT A;  3I9V 2;  2PVQ A;  1TTZ A;  2D2Z A;  1HYU A;  3IR4 A;  5JCG A;  4O5R A;  6GSY A;  3GYK A;  3UMA A;  2DJK A;  4ECJ A;  1F3A A;  2PPT A;  3UOM A;  1GUK A;  2WRT A;  4V1A p;  4V2N A;  3F0I A;  3RHB A;  4GCI A;  3FR9 A;  2PER A;  3KCM A;  1Y25 A;  1TRW A;  1GTA A;  4DEJ A;  3I43 A;  1M2B A;  4GSN A;  1AQV A;  4RI7 A;  3UVH A;  3F6F A;  3TUE A;  3ZTL A;  4USS A;  2H70 A;  3RBT A;  2YJ7 A;  3PR8 A;  4FIW A;  2RII A;  4ZBA A;  3L4N A;  1TRS A;  2PN8 A;  1Y6E A;  1PL1 A;  3Q19 A;  3ZML A;  5CRG A;  4ZIL A;  4V2L A;  4OCF A;  4HJM A;  1ST9 A;  5D9W A;  1PMT A;  2I81 A;  4X43 A;  3EYT A;  5GAN D;  1OVN A;  2CQ9 A;  3MDK A;  5ECQ B;  4ZXG A;  3L0H A;  3O6T A;  4ZB9 A;  3ERF A;  2LQO A;  1TXX A;  1GTU A;  5J9C A;  2HRA A;  2VOC A;  4PNG A;  4NAX A;  1HNA A;  5G2Z A;  4O7H A;  3D6I A;  2X8C A;  1Z7P A;  3APO A;  4NHZ A;  3SBC A;  4IJI A;  1URM A;  5A5K A;  3DEX A;  3PH9 A;  3VWU A;  2HRK A;  3UBK A;  3LSZ A;  1MEK A;  2FD3 A;  4TR3 A;  1M2D A;  5B8A A;  4HJ2 A;  3HZ4 A;  20GS A;  4LMV A;  1IYI A;  4GQF A;  4BL7 B;  5B6M A;  1KNG A;  1MDJ A;  4MLY A;  1USB A;  5GAP D;  1O6J A;  4L0U A;  4BVX B;  1SJ6 A;  4YAP A;  2RM6 A;  4I6X A;  3NOF A;  4OO5 A;  2DJ3 A;  2V6O A;  3ERG A;  4TKY A;  3CTG A;  1TOF A;  2XPD A;  2CX3 A;  5COH A;  2WFC A;  2K8V A;  3GTU B;  4F0B A;  4TR1 A;  4HI7 A;  1Z6M A;  4D73 A;  1N2A A;  4PTS A;  3M8N A;  5IQY A;  2TRC P;  4K2D A;  2B5Y A;  4K8M A;  2L5O A;  4IP6 A;  3TJF A;  3RAZ A;  2LKU A;  1DUG A;  1OAZ A;  4K6X A;  2OE1 A;  5CP1 A;  5JWR B;  2C1Y A;  4DVC A;  2VIM A;  3KTB A;  3CRU A;  3UBL A;  1K0M A;  3BCI A;  1XWA A;  4G19 A;  4ISD A;  1H4O A;  1WE0 A;  3GKN A;  3IRA A;  3HA9 A;  1HNC A;  2CX4 A;  4O32 A;  2XHF A;  3A2W A;  1Q98 A;  5DAL A;  2I9H A;  1XW5 A;  2ZNM A;  4IP1 A;  2DBC A;  3ZIT A;  3NZN A;  5DCG A;  1S3A A;  2XBQ A;  3ZIJ A;  4X0X A;  3E9J B;  3FKF A;  2FNO A;  2OAD A;  3N5O A;  1GL8 A;  2GT5 A;  4NV2 A;  1OC8 A;  5G5F A;  1ZYQ B;  3M0F A;  1EOG A;  3QCP A;  3P8W A;  3VI5 A;  1OYJ A;  4WXT A;  3WYW A;  2JAC A;  3KXO A;  2HRN A;  2X99 A;  5IOX A;  3QAG A;  2R5G A;  1M9A A;  2H19 A;  2IFQ A;  3P90 A;  3CBU A;  2DLX A;  1GWC A;  2O8V B;  1V2A A;  4F03 A;  1SD8 A;  4TR4 A;  2L6C A;  1S3D A;  2C0E A;  4P3Y B;  3HY2 A;  4J2F A;  5FWG A;  1K3L A;  3UL3 A;  2E2M A;  3CMI A;  3F4T A;  4K1F A;  19GS A;  1PRX A;  1ZCP A;  2DIY A;  4MJC A;  1X0R A;  2P5Q A;  3LXT A;  3C71 A;  1GSF A;  2JZT A;  3VFI A;  2YN1 A;  2H0G A;  3VWW A;  4HUA A;  1ERU A;  1AW9 A;  4OFT A;  2K8S A;  5DDL A;  2V41 A;  3US3 A;  3GST A;  4KND A;  1PA3 A;  2N5A A;  2OBI A;  5D93 A;  4MF5 A;  4BWQ A;  2F3M A;  1DE2 A;  2H6Z A;  1JZW A;  5HR3 A;  2H1G A;  3BBY A;  4EUY A;  2DJ0 A;  3QD9 A;  2B3S A;  2QKE A;  5KEJ A;  3ZFB A;  3GKK A;  1BQ7 A;  1R5A A;  3RPP A;  3M9J A;  4N0Z A;  1EV9 A;  4V2M A;  3F8U A;  2YAN A;  2XC2 A;  1TK8 B;  6GSX A;  4OO4 A;  4HOJ A;  6GSW A;  2QC7 A;  3FRC A;  5D9X A;  2XPE A;  1G0T A;  2HZF A;  4ILF A;  3QPM A;  5IO2 A;  2X8G A;  2EIR A;  1I9D A;  3C73 A;  2GGT A;  1AXD A;  4PXO A;  1GLQ A;  3WT1 A;  3HJO A;  1B9X C;  3F63 A;  3LG6 A;  5G1K A;  5HR1 A;  3A3T A;  2H6Y A;  1FB6 A;  2H74 A;  2L6D A;  3IXR A;  1FO5 A;  2KP2 A;  2HSN B;  2NPB A;  3VUR A;  3D21 A;  4Z7X A;  3GIX A;  4JED A;  1HQO A;  3E0U A;  1JLW A;  2GZZ A;  3G7I A;  1OE8 A;  4MF6 A;  5IO0 A;  1SJI A;  4KGI A;  3ME8 A;  2ALB A;  1Z9H A;  2K9F A;  4TVE A;  4OFN A;  3D5J A;  1YQ1 A;  1XVQ A;  4GRF A;  1YF1 A;  5CNW A;  5J41 A;  3IC8 A;  5CAX A;  3A5W A;  1U87 A;  4XIH A;  4GTU A;  4BPY A;  2VCT A;  2ON7 A;  1T8E B;  3FY7 A;  5IIZ A;  5G30 A;  2LTK A;  5EVO A;  4MH2 A;  1YJ6 A;  2GZP A;  2VM1 A;  4BWS A;  4GF0 A;  5HR0 A;  1AQX A;  1M99 A;  1TRU A;  3ZRE A;  3KH9 A;  17GS A;  2AJQ B;  3U5R E;  1V98 A;  4I8B A;  1R5P A;  1UA5 A;  5G31 A;  1ACV A;  2E0Q A;  4ZL8 A;  4EC0 A;  4TR1 B;  4RQR A;  2Z9S A;  4N11 A;  4EO3 A;  4D73 B;  1OC9 A;  1ILO A;  1NM3 A;  1QXH A;  1XCC A;  5DJM A;  2LJA A;  3TRP A;  1FVK A;  3F6D A;  3E3E A;  5F07 A;  1RQM A;  1XBS A;  1AC1 A;  3HVS A;  4YQM A;  1SK2 A;  3GKM A;  5LCZ A;  3KD0 A;  1TW9 A;  3FK8 A;  2YV7 A;  2LRC A;  3BOA A;  2WZ9 A;  4QQ7 A;  4TXO A;  5FHI A;  2KLX A;  2H71 A;  4F0C A;  5DAL B;  4XCS A;  4ACS A;  5AIX A;  5IOW A;  2HRF A;  3S9F A;  4PNF A;  1BYE A;  3CSH A;  3WD6 A;  2M72 A;  1A24 A;  5HQP A;  5J3R A;  3WGX A;  5AGY A;  16GS A;  1YEX A;  1G7O A;  4BVY A;  4FH8 A;  4EDY A;  4MAB A;  2DJ1 A;  3IAS 2;  2JSY A;  1CQG A;  5IMA A;  3MSZ A;  4L0W A;  5JCW A;  2O7K A;  3VPT A;  1ZL9 A;  1E6B A;  4FQU A;  2KHP A;  5D8I A;  3LOR A;  4ML1 A;  1KBN A;  5E59 A;  5JWQ B;  2AYT A;  2RUE A;  4KSM A;  2MMN A;  5ECK B;  2G2Q A;  1SU9 A;  2IFQ B;  5GZZ B;  2QGV A;  1UC7 A;  4XTS A;  3RDW A;  4AJ7 A;  2MMA A;  5L71 A;  3GH6 A;  4F82 A;  2OA7 A;  1QFN A;  2DSA A;  4AJ6 A;  2ES7 A;  1DE1 A;  3ISO A;  2XBI A;  5KN0 A;  1XWC A;  1SJZ A;  2C0G A;  5ELG A;  1YF0 A;  5AN1 A;  3FR3 A;  3GX8 A;  5CRD A;  3Q74 A;  2HNL A;  3L9S A;  3OR5 A;  4DSQ A;  5GST A;  2OAC A;  3H93 A;  1TJD A;  3ERW A;  3GL5 A;  4JR4 A;  2N5B A;  2V6K A;  3O3T A;  4IGJ A;  1THX A;  4NMU A;  4FO5 A;  2IMI A;  3VWV A;  4CHS A;  3IA1 A;  1TP9 A;  2TRX A;  2V32 A;  3BD2 A;  1R4W A;  2VD1 A;  1MDK A;  1YKA A;  3ZL5 A;  1GSQ A;  5EL8 A;  1QMV A;  2FWG A;  3EU3 A;  1SL1 B;  2JZS A;  2LRT A;  2AV4 A;  1GSU A;  5B7C A;  2R4V A;  3L9V A;  1U3A A;  2YWM A;  2DJJ A;  2ZCT A;  2VCV A;  4ECI A;  2GVP A;  2H66 A;  1XWG A;  5CRW A;  3A2X A;  1FVJ A;  3HJP A;  4GXZ A;  5CYY A;  2YNX A;  1UVZ A;  4OFM A;  3C1S A;  1K0B A;  4IW9 A;  2PUK C;  3EMP A;  3P2A A;  4EDZ A;  3IK7 A;  2KOK A;  5G5E A;  3LXZ A;  3RPN A;  3GL3 A;  1GRX A;  2R6K A;  3M3M A;  4PUF C;  5ECI B;  3W8J A;  1PQN A;  3VK9 A;  2AB6 A;  5ECM B;  3QFA C;  1X9S B;  3HVV A;  4KSO A;  3UAP A;  3EWL A;  3ZYW A;  2VCQ A;  2HLS A;  2K18 A;  3ZMK A;  3QFB C;  5IMV A;  3D0Z A;  5IM9 A;  4XS4 B;  2GQM A;  1KEB A;  2H30 A;  2WJU A;  1O81 A;  2NBS A;  3IC4 A;  5ECP B;  5ECL B;  1QUW A;  5F05 A;  3TJG A;  2F8F A;  2DMM A;  4N0V A;  4EVM A;  1XOA A;  5CRE A;  4LLR A;  2B7J A;  1SYR A;  1VF3 A;  1OKD A;  2M46 A;  2P0G A;  3CSI A;  2VUP A;  2EC4 A;  2CAI A;  4XRD A;  2B7K A;  3TKS E;  8GSS A;  4NWY A;  1YY7 A;  1B48 A;  3HXS A;  4KDX A;  3EU4 A;  10GS A;  3Q6O A;  1T1V A;  3TKS C;  4HU9 A;  3LWA A;  4J56 E;  4JR6 A;  4KH7 A;  1YZX A;  4PGT A;  1JFU A;  3N9J A;  2GDR A;  4ZBD A;  4CDO A;  2L4C A;  4ZL9 A;  2LNS A;  2VCX A;  4PQI A;  5H5Q A;  4HEA 2;  1F6M C;  4IEL A;  3KEB A;  2HXK A;  3GV1 A;  3QAW A;  1FG4 A;  2H1D A;  1THO A;  3LYP A;  4L5O A;  2CA8 A;  2VL9 A;  2HSM A;  2N5F A;  1NHY A;  2IMD A;  1OC9 B;  3VPQ A;  1EV4 A;  1OKT A;  2IN3 A;  1ZZY A;  3DWV A;  5CO3 A;  2YWI A;  2FWF A;  4EXJ A;  4TW5 A;  6GSS A;  3L9U A;  1LBK A;  2H1A A;  3DRN A;  3GX0 A;  1F3B A;  3U6V A;  3IPZ A;  2PMT A;  2PVO C;  3KIJ A;  5IPH A;  5IMC A;  2WS2 A;  4TXO B;  5KN3 A;  2BMX A;  4EE0 A;  5G1L A;  5ECO B;  2WDU A;  3FZ9 A;  2C80 A;  2H76 A;  4G0K A;  1XFL A;  3HJM A;  2IJY A;  1DSB A;  1DBY A;  2VD0 A;  3BJ5 A;  4RI6 A;  4YQU A;  4HDE A;  4XHM A;  1Z5Y E;  4F9Z A;  4WR4 A;  3MNG A;  4BVY B;  1RK4 A;  5ECN B;  2HSH A;  4E8E A;  2HE3 A;  1GUM A;  1OC3 A;  4ULX A;  3WGD A;  3TOU A;  3Q18 A;  1ZGN A;  1K3O A;  2UZ8 A;  2LQQ A;  4IBP A;  1ZYE A;  4MH3 A;  3AY8 A;  3LFL A;  3ZLP A;  4K0N A;  2MMZ A;  1JZO A;  3GUR A;  2X64 A;  2VM2 A;  4POK A;  2VLU A;  3FYG A;  1JLV A;  3ZZX A;  1WIK A;  5ID2 A;  3KJY A;  4XS1 A;  4MJA A;  1CQH A;  2WGR A;  3EMX A;  2IMF A;  1IYH A;  3KMN A;  1T3B A;  4YQV A;  1TKD B;  4QL7 A;  2FHE A;  1WRY A;  3EIN A;  2O85 A;  1WWJ A;  2REM A;  4POM A;  1B9Y C;  3W8S A;  2H6X A;  3V1W A;  3ZVJ A;  2MZC A;  1A23 A;  1AIU A;  3W6G A;  1K0O A;  3HHV A;  1T4Z A;  3TRQ A;  2PGT A;  1QK8 A;  5GSS A;  2V1M A;  5INY A;  4HQZ A;  4NXI A;  1J0F A;  3H1N A;  2BTO T;  4JRR A;  3R3E A;  4MPF A;  5A4V A;  2C3Q A;  2HI7 A;  4ZBB A;  2JL4 A;  5DJL A;  3FHK A;  3D22 A;  1Q4J A;  1R7H A;  5ECR B;  1PGT A;  1X9W B;  1O8W A;  4ML6 A;  3ZFL A;  4O92 A;  1W89 A;  4MZC A;  3GTU A;  2LV3 A;  1EP8 A;  4K7N A;  1VGL A;  1GH2 A;  2VCZ A;  2HRK B;  5J9B A;  4HZ4 A;  3TKS A;  3C1R A;  1K0C A;  5E4W A;  1EZK A;  5ECH B;  1X5E A;  3SWL A;  2I4A A;  3JCM L;  4WBJ A;  3APS A;  4G0L A;  4LA1 A;  5D9T A;  4IS0 A;  4KCE A;  2PWJ A;  3IK9 A;  1G6Y A;  4KAE A;  1X5C A;  1Z3E A;  1EGR A;  2FWH A;  4LL4 B;  3TJJ A;  3CYN A;  2R37 A;  1XIY A;  1WPI A;  4FYC A;  2DC5 A;  1TRV A;  4PX1 A;  2MMO A;  5DCH A;  1VRS D;  1ERW A;  2YOI A;  3G9B A;  3H79 A;  1X5D A;  3FR6 A;  1AAZ A;  1UN2 A;  4Q5N A;  1SEN A;  2B1L A;  1A0R P;  1Z6N A;  4E8H A;  1GSD A;  3UAR A;  3F9U A;  2DML A;  3DML A;  4OWY A;  5D73 A;  3GKX A;  3K8N A;  3VLN A;  4EF0 A;  1TU8 A;  3QDN A;  1WJK A;  2AUV A;  1OE7 A;  2NVL A;  3F3Q A;  1LU4 A;  3P7X A;  1BED A;  4KW6 A;  5JWO B;  1PKZ A;  3GN3 A;  1PX6 A;  1K0N A;  3GFK A;  4XRA A;  2BJX A;  3KZQ A;  4WEY A;  5DVB A;  2AHE A;  2OKA A;  5J5N A;  2WCI A;  2LEG A;  3PPU A;  3WGE A;  1TI1 A;  1F37 A;  3LEF A;  1QGV A;  1BX9 A;  4IN0 A;  2L59 A;  3EUR A;  1ERV A;  2LJK A;  3UIW A;  1XVW A;  3FZ4 A;  3IAM 2;  1NW2 A;  1EEJ A;  3BCK A;  5HFG A;  5ENU A;  6GSV A;  2E2G A;  2VLV A;  1M9B A;  1A2M A;  2ON5 A;  2CZ3 A;  2EIQ A;  3TGZ A;  2YZH A;  2F9S A;  4DSS A;  2TIR A;  1FOV A;  4AGS A;  3GUS A;  5CRH A;  5D96 A;  1VF2 A;  3LJR A;  3I6A A;  4L5L A;  3TOT A;  1HD2 A;  4WKW A;  3HKR A;  11GS A;  4K7I A;  3HYP A;  2GTU A;  2A4V A;  22GS A;  1O73 A;  4GSS A;  2B1K A;  2X8H A;  1MD4 A;  1MD3 A;  3KH7 A;  4AF2 A;  3IHQ A;  3J7Y k;  3UJ1 A;  2B6M A;  1M0U A;  1MTC A;  3TJK A;  4MCU A;  1O8X A;  2JU5 A;  2MBT A;  2YWO A;  4LMW A;  2HFD A;  4JZQ A;  5IMD A;  1WOU A;  2QSI A;  3G7Y A;  1GNW A;  3QAV A;  2H75 A;  4HZ2 A;  3VWX A;  3J7Y b;  9GSS A;  1T7P B;  3GNJ A;  1V9W A;  4FYB A;  4MZW A;  1U6T A;  2R2J A;  4BA7 A;  3ZVJ D;  1FAA A;  2LST A;  3GH9 A;  3CRT A;  2C8U A;  4HQS A;  4NHW A;  4NV5 A;  2HZE A;  1EP7 A;  5F0G A;  3CSJ A;  2H8L A;  2C3N A;  1TK5 B;  2V2G A;  1NSW A;  2RUF A;  1NHO A;  1XZO A;  1ABA A;  5DQS A;  1ON4 A;  2IMK A;  7GSS A;  1K0D A;  1V58 A;  4KB3 A;  5JCU A;  4ECB A;  5ID2 B;  1ML6 A;  12GS A;  1B8X A;  4G9H A;  2CVB A;  3C8E A;  6GST A;  5D9V A;  3APQ A;  4MJE A;  3IV4 A;  5LNK e;  1JZD A;  4HS1 A;  4J57 E;  4KUN A;  4LL1 B;  5B8B A;  3C7M A;  1SL2 B;  2A2R A;  1ZOF A;  2IWT A;  2EIO A;  4IJ3 A;  1V40 A;  2OBK A;  4Q5F A;  1XW9 A;  4ZB6 A;  2YWN A;  5IMF A;  5DQY A;  2HSY A;  1TK0 B;  1U88 A;  3LQ7 A;  4GWR A;  4I97 A;  3LGC A;  2H0I A;  3CXG A;  2I3Y A;  1GLP A;  4Q5R A;  1EGO A;  2YCD A;  3IBH A;  2CAQ A;  4YAV A;  5DAK A;  4MA9 A;  3TJB A;  2GSR A;  1J08 A;  4TXV A;  1JHB A;  5ELA A;  2FA8 A;  4I5Q A;  3D4T A;  4JBB A;  4RQX A;  2P5R A;  4XS6 A;  2PU9 C;  3G7J A;  2HYX A;  1PL2 A;  2H73 A;  5KN1 A;  1GSY A;  4KDU A;  3HDC A;  2ZUP A;  1S3C A;  1R26 A;  4MPG A;  5BMU A;  3LYK A;  3F4S A;  5F8B A;  4G2E A;  3KP9 A;  2KUC A;  2YPM A;  2G0F A;  2WUL A;  1PN9 A;  4H86 A;  1PD2 1;  1SKW B;  1GTB A;  1W4V A;  2H0H A;  4G0I A;  1H75 A;  1TI3 A;  4OD7 A;  3FZA A;  1FHE A;  1GUH A;  1YKC A;  1E2Y A;  3GSS A;  1B4P A;  4MK3 A;  1TDI A;  2C3T A;  4KCA A;  2C4J A;  2IL3 A;  3A2V A;  18GS A;  1HNB A;  2L4Q A;  2F51 A;  3EE2 A;  3QR6 A;  5HFI A;  3L78 A;  4OCE A;  1XPV A;  3FW2 A;  3HD5 A;  5LD0 A;  4KDY A;  2VL2 C;  4L8E A;  4MF7 A;  1TU7 A;  2LRN A;  5C04 A;  2VL3 A;  4WR5 A;  1AUC A;  3EVI A;  4GST A;  4TOP A;  2FA4 A;  1VF1 A;  2FUG 2;  5HR2 A;  4QL9 A;  3ED3 A;  3GHA A;  4WF5 A;  4GLT A;  2LJR A;  1SYX A;  3H8Q A;  2L5L A;  4KA0 A;  5EY6 A;  3DVW A;  1BG5 A;  1F2E A;  3GRX A;  2M80 A;  3VI7 A;  2VO4 A;  3TKQ A;  4AJ8 A;  1GUL A;  1BJX A;  1VF4 A;  4FYU A;  2OJL A;  4IQA A;  3CTF A;  2YP6 A;  3UEM A;  1N8J A;  2B5X A;  4ZB8 A;  4WBR D;  2DIZ A;  2JSZ A;  1KTE A;  4DSR A;  4JU5 A;  3TKP A;  1J9B A;  3KGK A;  6GSU A;  3TDG A;  3DYR A;  1XWK A;  3MAK A;  4TRX A;  2P31 A;  1ERT A;  4ZL7 A;  2OE0 A;  1LJR A;  3GMF A;  4K9Z A;  4N30 A;  1WP0 A;  4IVF A;  4DSS B;  4EKZ A;  4JE1 A;  2PBJ A;  3PGT A;  5A4W A; 
#chains in the Genus database with same CATH topology
 3WT2 A;  4PUA A;  1FW1 A;  4KX4 A;  4IKH A;  2OE3 A;  5IPG A;  2A2S A;  1X9M B;  4RUV A;  2GQL A;  3DKS A;  1GP1 A;  1JZR A;  3FZ5 A;  2GST A;  5A4U A;  4ID0 A;  5FT3 A;  3DXB A;  2F8A A;  1M2A A;  4POB A;  3TB2 A;  4HU7 A;  2LUS A;  3EPT A;  3KTL A;  4OMV A;  1XXU A;  4EL1 A;  1XW6 A;  2VAF A;  5H5S A;  1WMJ A;  2J23 A;  2HQT A;  2GT6 A;  3HVX A;  4X1U A;  2J9H A;  4WF4 A;  4ZIJ A;  1MDI A;  3DIE A;  4TR0 A;  3EC3 A;  1RW1 A;  3FEU A;  3M1G A;  4IQ1 A;  4MZB A;  2JAD A;  3F4R A;  2VLT A;  4MJB A;  4PI2 C;  3TRX A;  2GLR A;  4KE3 A;  2HZE B;  2CVD A;  1K3Y A;  1SVO A;  4BL7 A;  2L57 A;  14GS A;  3DVX A;  4MDC A;  1N25 A;  3IE3 A;  4BVX A;  2RLI A;  2E7P A;  4MP4 A;  2AAW A;  1PX7 A;  2CVK A;  3TCO A;  1SK0 A;  2GSQ A;  2FY6 A;  1A2L A;  2WVX B;  4I2T A;  5KOX A;  1SVM A;  4XS4 A;  1T4Y A;  4N10 A;  2NTO A;  1YVL A;  2LS5 A;  2H01 A;  4ECC A;  1SL0 B;  4K0G A;  5AIS A;  4EIP A;  2H72 A;  5J4U A;  3PIN A;  4TN8 A;  5H5R A;  3O76 A;  3D4M A;  2QA2 A;  1V57 A;  2FCH A;  2C0D A;  4Q5Q A;  2GQK A;  3H4K A;  5IMZ A;  2R3X A;  2RM5 A;  2CV4 A;  5ECS A;  2GZY A;  1ZMA A;  4NPB A;  5AIV A;  1A8L A;  4G10 A;  1I5G A;  1BAY A;  2VL2 A;  3M9K A;  1SKS B;  3IDV A;  5DAK B;  4CW9 A;  2MYG A;  4MMM A;  4I2U A;  3IOS A;  1YEP A;  3QMX A;  3DGQ A;  3HZ8 A;  1F9M A;  2I1U A;  2HT9 A;  3QOU A;  2IPA A;  2GSS A;  5KN2 A;  1XOB A;  4V1A g;  1A8Y A;  5KOW A;  2WB9 A;  3KM6 A;  2IIY A;  2NDO A;  5B6N A;  1PSQ A;  4KF9 A;  1GSE A;  2O89 A;  5BMU B;  3F3R A;  3ZIV A;  2CT6 A;  1O85 A;  2VCW A;  2FGX A;  5EPF A;  1GTI A;  3KP8 A;  2CZ2 A;  1C72 A;  1QQ2 A;  1S3R A;  1GNE A;  1B4Q A;  4POL A;  1A0F A;  4GQC A;  13GS A;  1XWB A;  2FLS A;  5C00 A;  3TKR A;  1G7E A;  3ZRD A;  3R2Q A;  4K7O A;  2KP1 A;  1O7U A;  1PKW A;  2K6V A;  4PQ1 A;  3I69 A;  3NIV A;  1A2J A;  2C0F A;  1YDK A;  3MWH A;  1AQW A;  3HCZ A;  3ME7 A;  3GA4 A;  5DBQ A;  1T00 A;  1U3I A;  1SKR B;  2B5E A;  4F2I A;  4IHU A;  4YH2 A;  2YZU A;  2H1B A;  1G6W A;  4PQH A;  3UVT A;  5ABR A;  1EOH A;  1FB0 A;  2MBS A;  1XG8 A;  1SD9 A;  3DD3 A;  2YV9 A;  1Z7R A;  2FWE A;  2O87 A;  2DJ2 A;  5HFK A;  2HSM B;  3RHC A;  3KMO A;  1EWX A;  4WET A;  5F06 A;  2IME A;  1K0A A;  4PUR A;  1EEM A;  2JZR A;  1GSS A;  2YJH A;  1SK1 A;  2GS3 A;  1M7T A;  1S4B P;  2LNT A;  3I9V 2;  2PVQ A;  1TTZ A;  3MYD A;  2D2Z A;  1HYU A;  3IR4 A;  2DKI A;  5JCG A;  4W66 A;  4O5R A;  6GSY A;  3GYK A;  3UMA A;  2DJK A;  4ECJ A;  1F3A A;  2PPT A;  3UOM A;  1GUK A;  2WRT A;  4V1A p;  4O5U A;  4YKF A;  4V2N A;  3F0I A;  3RHB A;  4GCI A;  3FR9 A;  2PER A;  3KCM A;  1Y25 A;  1TRW A;  1GTA A;  4DEJ A;  3I43 A;  1M2B A;  4GSN A;  1AQV A;  4RI7 A;  3UVH A;  3F6F A;  3TUE A;  3ZTL A;  4USS A;  2H70 A;  3RBT A;  2YJ7 A;  3PR8 A;  4HSC X;  4FIW A;  2RII A;  4ZBA A;  4N3Z A;  3L4N A;  4O5Q A;  1TRS A;  2PN8 A;  2WVY A;  1Y6E A;  1PL1 A;  3Q19 A;  3ZML A;  5CRG A;  4ZIL A;  4V2L A;  4OCF A;  4HJM A;  1ST9 A;  1TXU A;  5D9W A;  1PMT A;  2I81 A;  4X43 A;  3EYT A;  5GAN D;  1OVN A;  2CQ9 A;  3MDK A;  5ECQ B;  4ZXG A;  3L0H A;  3O6T A;  4ZB9 A;  3ERF A;  2LQO A;  1TXX A;  1GTU A;  5J9C A;  2HRA A;  2VOC A;  4PNG A;  4NAX A;  1HNA A;  5G2Z A;  4O7H A;  3D6I A;  2X8C A;  5A5H A;  1Z7P A;  3APO A;  4NHZ A;  3SBC A;  4IJI A;  1URM A;  5A5K A;  2WW3 A;  3DEX A;  4PI0 C;  3PH9 A;  3VWU A;  2HRK A;  3UBK A;  3LSZ A;  1MEK A;  2FD3 A;  4TR3 A;  1M2D A;  5B8A A;  4HJ2 A;  3HZ4 A;  20GS A;  4LMV A;  1IYI A;  4BIK A;  4GQF A;  4BL7 B;  5B6M A;  1KNG A;  1MDJ A;  4MLY A;  1USB A;  5GAP D;  1O6J A;  4L0U A;  4BVX B;  1SJ6 A;  4YAP A;  2RM6 A;  4I6X A;  3NOF A;  4OO5 A;  2DJ3 A;  2V6O A;  3ERG A;  4TKY A;  3CTG A;  1TOF A;  2XPD A;  2CX3 A;  5COH A;  3FMW A;  2WFC A;  2K8V A;  3GTU B;  4F0B A;  4TR1 A;  4HI7 A;  1Z6M A;  4D73 A;  1N2A A;  4PTS A;  3M8N A;  4GDF A;  5IQY A;  2TRC P;  4K2D A;  2B5Y A;  4K8M A;  2L5O A;  4IP6 A;  3TJF A;  3RAZ A;  2LKU A;  1DUG A;  1OAZ A;  4K6X A;  2OE1 A;  5CP1 A;  5JWR B;  2C1Y A;  4DVC A;  2X4A A;  2VIM A;  2X49 A;  3KTB A;  3CRU A;  3UBL A;  1K0M A;  3BCI A;  1XWA A;  4G19 A;  4ISD A;  1H4O A;  1WE0 A;  3GKN A;  3IRA A;  3HA9 A;  1HNC A;  2CX4 A;  4O32 A;  2XHF A;  3A2W A;  1Q98 A;  5DAL A;  2I9H A;  1XW5 A;  2ZNM A;  4IP1 A;  2DBC A;  3ZIT A;  3NZN A;  5DCG A;  1S3A A;  2XBQ A;  1PFO A;  3HMJ G;  3ZIJ A;  4X0X A;  3E9J B;  3FKF A;  2FNO A;  2OAD A;  3N5O A;  1GL8 A;  2GT5 A;  4NV2 A;  1OC8 A;  5G5F A;  1ZYQ B;  3M0F A;  1EOG A;  3QCP A;  3P8W A;  3VI5 A;  1OYJ A;  4WXT A;  3WYW A;  2JAC A;  3KXO A;  2HRN A;  2X99 A;  5IOX A;  3QAG A;  2R5G A;  1M9A A;  2H19 A;  2IFQ A;  3P90 A;  3CBU A;  2DLX A;  1GWC A;  2O8V B;  1V2A A;  4F03 A;  1SD8 A;  4TR4 A;  2L6C A;  1S3D A;  2C0E A;  4P3Y B;  3HY2 A;  4J2F A;  5FWG A;  1K3L A;  3UL3 A;  2E2M A;  3CMI A;  3F4T A;  4K1F A;  19GS A;  1PRX A;  1ZCP A;  2DIY A;  4MJC A;  1X0R A;  2P5Q A;  3LXT A;  3C71 A;  1GSF A;  2JZT A;  4K5R A;  3VFI A;  2YN1 A;  2H0G A;  3VWW A;  4HUA A;  1ERU A;  1AW9 A;  4OFT A;  2K8S A;  5DDL A;  2V41 A;  3US3 A;  3GST A;  4KND A;  1PA3 A;  2N5A A;  2OBI A;  5D93 A;  4MF5 A;  4BWQ A;  2F3M A;  1DE2 A;  2H6Z A;  3A5I A;  1JZW A;  5HR3 A;  2H1G A;  3BBY A;  4EUY A;  2DJ0 A;  3QD9 A;  2B3S A;  2QKE A;  5KEJ A;  3ZFB A;  3GKK A;  1BQ7 A;  1R5A A;  3RPP A;  3M9J A;  4N0Z A;  1EV9 A;  4V2M A;  3F8U A;  2YAN A;  2XC2 A;  1TK8 B;  6GSX A;  4OO4 A;  4HOJ A;  6GSW A;  2QC7 A;  3FRC A;  5D9X A;  2XPE A;  4QMK A;  1G0T A;  2HZF A;  4ILF A;  1M3I A;  3QPM A;  5IO2 A;  2X8G A;  2R0G A;  2EIR A;  1I9D A;  3C73 A;  2GGT A;  1AXD A;  4PXO A;  1GLQ A;  3WT1 A;  3HJO A;  1PN0 A;  1B9X C;  3F63 A;  3LG6 A;  5G1K A;  5HR1 A;  3A3T A;  2H6Y A;  4AKX B;  1FB6 A;  2H74 A;  2L6D A;  3IXR A;  1FO5 A;  2KP2 A;  3RGB C;  2HSN B;  2NPB A;  3VUR A;  3D21 A;  5J4Y A;  4Z7X A;  3GIX A;  4JED A;  1HQO A;  3E0U A;  1JLW A;  2GZZ A;  3G7I A;  1OE8 A;  4MF6 A;  5IO0 A;  1SJI A;  4KGI A;  3ME8 A;  2ALB A;  5A5H B;  1Z9H A;  2K9F A;  4TVE A;  4OFN A;  3D5J A;  1YQ1 A;  3LW9 A;  1XVQ A;  4GRF A;  1YF1 A;  5CNW A;  5J41 A;  4AKG A;  3IC8 A;  5CAX A;  3A5W A;  1U87 A;  4XIH A;  4GTU A;  4BPY A;  2VCT A;  2ON7 A;  1T8E B;  2R0C A;  3FY7 A;  5IIZ A;  5G30 A;  2LTK A;  5EVO A;  4MH2 A;  1YJ6 A;  2GZP A;  2H1L A;  2VM1 A;  4BWS A;  4GF0 A;  5HR0 A;  1AQX A;  1M99 A;  1TRU A;  4CY8 A;  3ZRE A;  3KH9 A;  17GS A;  2AJQ B;  3U5R E;  3CQF A;  1V98 A;  4I8B A;  1R5P A;  1UA5 A;  5G31 A;  1ACV A;  2E0Q A;  4ZL8 A;  4EC0 A;  4TR1 B;  4RQR A;  2Z9S A;  4N11 A;  4EO3 A;  4D73 B;  1OC9 A;  1ILO A;  1NM3 A;  1QXH A;  1XCC A;  5DJM A;  2LJA A;  3TRP A;  1FVK A;  3F6D A;  3E3E A;  5F07 A;  1RQM A;  2WW2 A;  1XBS A;  1AC1 A;  3HVS A;  4YQM A;  1SK2 A;  3GKM A;  5LCZ A;  3KD0 A;  1TW9 A;  3FK8 A;  2YV7 A;  2LRC A;  3BOA A;  2WZ9 A;  4QQ7 A;  4ZB7 A;  5FHI A;  4TXO A;  2KLX A;  2H71 A;  4F0C A;  5DAL B;  4XCS A;  4ACS A;  5AIX A;  5IOW A;  2HRF A;  3S9F A;  4PNF A;  1BYE A;  3CSH A;  3WD6 A;  2M72 A;  1A24 A;  5HQP A;  5J4V A;  5J3R A;  3WGX A;  5AGY A;  16GS A;  1YEX A;  1G7O A;  4BVY A;  4FH8 A;  4EDY A;  4MAB A;  2DJ1 A;  3IAS 2;  2JSY A;  1CQG A;  5IMA A;  3MSZ A;  4L0W A;  5JCW A;  2O7K A;  3VPT A;  1ZL9 A;  1E6B A;  3MIX A;  4FQU A;  2KHP A;  5D8I A;  3LOR A;  4ML1 A;  1KBN A;  5E59 A;  5JWQ B;  2AYT A;  2RUE A;  4KSM A;  2MMN A;  5ECK B;  2G2Q A;  1SU9 A;  2IFQ B;  5GZZ B;  2QGV A;  1UC7 A;  4XTS A;  3RDW A;  4AJ7 A;  2MMA A;  5L71 A;  3GH6 A;  4F82 A;  2OA7 A;  1QFN A;  2DSA A;  4AJ6 A;  2ES7 A;  1DE1 A;  3ISO A;  2XBI A;  5KN0 A;  1XWC A;  1SJZ A;  2C0G A;  5ELG A;  3CHX C;  1YF0 A;  5AN1 A;  3FR3 A;  3GX8 A;  5CRD A;  3Q74 A;  4A5P A;  2HNL A;  3L9S A;  3OR5 A;  4DSQ A;  3HVN A;  5GST A;  2OAC A;  3H93 A;  1TJD A;  3ERW A;  3GL5 A;  4JR4 A;  4Z2R A;  2N5B A;  2V6K A;  3O3T A;  4IGJ A;  1THX A;  4NMU A;  4FO5 A;  2IMI A;  3VWV A;  4CHS A;  3IA1 A;  4Z2T A;  4Z2U A;  2O3E A;  1TP9 A;  2TRX A;  2V32 A;  1SVL A;  3BD2 A;  1R4W A;  2VD1 A;  1MDK A;  1YKA A;  3ZL5 A;  1GSQ A;  5EL8 A;  1QMV A;  2FWG A;  3EU3 A;  1SL1 B;  2JZS A;  2LRT A;  2AV4 A;  2WVX A;  1GSU A;  5B7C A;  2R4V A;  3L9V A;  1U3A A;  2YWM A;  2DJJ A;  2ZCT A;  2VCV A;  4ECI A;  2GVP A;  2H66 A;  1XWG A;  5CRW A;  3A2X A;  1FVJ A;  3HJP A;  4GXZ A;  5CYY A;  2YNX A;  1UVZ A;  4OFM A;  3C1S A;  1K0B A;  4IW9 A;  2PUK C;  3EMP A;  3P2A A;  4EDZ A;  3IK7 A;  2KOK A;  5G5E A;  3LXZ A;  3RPN A;  3GL3 A;  1GRX A;  2R6K A;  3M3M A;  4PUF C;  5ECI B;  3W8J A;  1PQN A;  3VK9 A;  2AB6 A;  5ECM B;  3QFA C;  1X9S B;  3HVV A;  4KSO A;  3UAP A;  3EWL A;  3ZYW A;  2VCQ A;  2HLS A;  2K18 A;  3ZMK A;  3QFB C;  5IMV A;  4YKG A;  3D0Z A;  5IM9 A;  4XS4 B;  2GQM A;  1KEB A;  2H30 A;  2WJU A;  1O81 A;  2NBS A;  3IC4 A;  5ECP B;  5ECL B;  1QUW A;  5F05 A;  3TJG A;  2F8F A;  2DMM A;  4N0V A;  4EVM A;  1XOA A;  5CRE A;  4LLR A;  2B7J A;  4X4J A;  1SYR A;  1VF3 A;  1OKD A;  2M46 A;  2P0G A;  3CSI A;  2VUP A;  2EC4 A;  2CAI A;  4XRD A;  2B7K A;  3TKS E;  8GSS A;  4NWY A;  1YY7 A;  1B48 A;  3HXS A;  5A1N A;  4KDX A;  3EU4 A;  10GS A;  3Q6O A;  1T1V A;  3TKS C;  4HU9 A;  3LWA A;  4J56 E;  4JR6 A;  4KH7 A;  1YZX A;  4PGT A;  1JFU A;  3N9J A;  2GDR A;  4ZBD A;  4CDO A;  2L4C A;  4ZL9 A;  2OT3 A;  2LNS A;  2VCX A;  4PQI A;  5H5Q A;  4HEA 2;  1F6M C;  4IEL A;  3KEB A;  2HXK A;  3GV1 A;  3QAW A;  1FG4 A;  4K5S A;  2H1D A;  1THO A;  1M3J A;  3LYP A;  4L5O A;  2CA8 A;  2VL9 A;  2HSM A;  2N5F A;  1NHY A;  2IMD A;  1OC9 B;  3VPQ A;  1EV4 A;  1OKT A;  2IN3 A;  1ZZY A;  3DWV A;  5CO3 A;  2YWI A;  2FWF A;  4EXJ A;  4TW5 A;  6GSS A;  3L9U A;  2A2P A;  1LBK A;  2H1A A;  3DRN A;  3GX0 A;  1F3B A;  3U6V A;  3IPZ A;  2PMT A;  2PVO C;  3KIJ A;  5BRT A;  5IPH A;  1FOH A;  5IMC A;  2WS2 A;  4TXO B;  5KN3 A;  2BMX A;  4EE0 A;  5G1L A;  5ECO B;  2WDU A;  3FZ9 A;  2C80 A;  2H76 A;  4G0K A;  1XFL A;  2O36 A;  3HJM A;  2IJY A;  1DSB A;  1DBY A;  2VD0 A;  5J47 A;  3BJ5 A;  2WW1 A;  4RI6 A;  4YQU A;  4HDE A;  4XHM A;  1Z5Y E;  4F9Z A;  4WR4 A;  3MNG A;  4BVY B;  1RK4 A;  5ECN B;  2HSH A;  4E8E A;  2HE3 A;  1GUM A;  1OC3 A;  4ULX A;  3WGD A;  3TOU A;  3Q18 A;  2O5V A;  1ZGN A;  1K3O A;  2UZ8 A;  4CY6 A;  2LQQ A;  4IBP A;  1ZYE A;  4MH3 A;  3AY8 A;  3LFL A;  3ZLP A;  4K0N A;  4AI6 A;  2MMZ A;  1JZO A;  3GUR A;  2X64 A;  2VM2 A;  4POK A;  2VLU A;  3FYG A;  1JLV A;  4G01 A;  3ZZX A;  1WIK A;  5ID2 A;  3KJY A;  4XS1 A;  4MJA A;  1BF5 A;  1CQH A;  2WGR A;  3EMX A;  2IMF A;  1IYH A;  3KMN A;  1T3B A;  4YQV A;  1TKD B;  4QL7 A;  2FHE A;  4AKI A;  1WRY A;  3EIN A;  2O85 A;  1WWJ A;  2REM A;  4POM A;  1B9Y C;  3W8S A;  2H6X A;  3V1W A;  3ZVJ A;  2MZC A;  1A23 A;  1AIU A;  3W6G A;  1K0O A;  3HHV A;  1T4Z A;  3TRQ A;  2PGT A;  1QK8 A;  2WVZ A;  5GSS A;  2V1M A;  2DKH A;  5INY A;  4HQZ A;  4NXI A;  1J0F A;  3H1N A;  2BTO T;  4JRR A;  3R3E A;  4MPF A;  5A4V A;  2C3Q A;  2HI7 A;  4ZBB A;  2JL4 A;  5DJL A;  3FHK A;  3D22 A;  1Q4J A;  1R7H A;  5ECR B;  1PGT A;  1ZYP A;  1O8W A;  1X9W B;  4ML6 A;  3ZFL A;  1BG1 A;  4O92 A;  1W89 A;  4MZC A;  3GTU A;  2LV3 A;  3IHG A;  1EP8 A;  5A34 A;  4K7N A;  1VGL A;  1GH2 A;  2VCZ A;  2HRK B;  5J9B A;  4HZ4 A;  3TKS A;  3C1R A;  1K0C A;  5E4W A;  1EZK A;  5ECH B;  1X5E A;  3SWL A;  2I4A A;  3JCM L;  4WBJ A;  3APS A;  4G0L A;  4LA1 A;  5D9T A;  3TU3 B;  4IS0 A;  4KCE A;  2PWJ A;  3IK9 A;  4PHZ C;  1G6Y A;  4KAE A;  1X5C A;  1Z3E A;  1EGR A;  2FWH A;  4LL4 B;  3TJJ A;  4FXY P;  3CYN A;  2R37 A;  1XIY A;  1WPI A;  4FYC A;  2DC5 A;  1TRV A;  4PX1 A;  2MMO A;  5DCH A;  1VRS D;  1ERW A;  2YOI A;  3G9B A;  3H79 A;  1X5D A;  3FR6 A;  1AAZ A;  1UN2 A;  4Q5N A;  1SEN A;  2B1L A;  1A0R P;  2EFE A;  1Z6N A;  4E8H A;  1GSD A;  3UAR A;  3F9U A;  2DML A;  3DML A;  1ZYN A;  4OWY A;  5D73 A;  3GKX A;  3K8N A;  3VLN A;  4EF0 A;  1TU8 A;  3QDN A;  1WJK A;  5A1N B;  2AUV A;  1OE7 A;  2NVL A;  3F3Q A;  1LU4 A;  3P7X A;  1BED A;  4KW6 A;  5JWO B;  1PKZ A;  3GN3 A;  1PX6 A;  1K0N A;  3GFK A;  4XRA A;  2BJX A;  1Y1U A;  3KZQ A;  2QA1 A;  4WEY A;  5DVB A;  2AHE A;  2OKA A;  5J5N A;  2WCI A;  2LEG A;  3PPU A;  3WGE A;  1TI1 A;  1F37 A;  3LEF A;  1QGV A;  1BX9 A;  4IN0 A;  2L59 A;  3EUR A;  1ERV A;  2LJK A;  3UIW A;  1XVW A;  3FZ4 A;  3IAM 2;  1NW2 A;  1EEJ A;  3BCK A;  5HFG A;  4EIQ A;  5ENU A;  6GSV A;  2E2G A;  2VLV A;  1M9B A;  1A2M A;  2ON5 A;  2CZ3 A;  2EIQ A;  3TGZ A;  2YZH A;  2F9S A;  4DSS A;  2TIR A;  1FOV A;  4AGS A;  3GUS A;  5CRH A;  5D96 A;  1VF2 A;  3LJR A;  3I6A A;  4L5L A;  3TOT A;  1HD2 A;  4WKW A;  3HKR A;  11GS A;  2EFC A;  4K7I A;  3HYP A;  2GTU A;  2A4V A;  22GS A;  1O73 A;  4GSS A;  2B1K A;  2X8H A;  1MD4 A;  1MD3 A;  3KH7 A;  4AF2 A;  3IHQ A;  3J7Y k;  3UJ1 A;  2B6M A;  1M0U A;  1MTC A;  3TJK A;  4MCU A;  1O8X A;  2JU5 A;  2MBT A;  2YWO A;  4LMW A;  2HFD A;  4JZQ A;  5IMD A;  1WOU A;  2QSI A;  3G7Y A;  1GNW A;  3QAV A;  2H75 A;  4HZ2 A;  3VWX A;  3J7Y b;  9GSS A;  1T7P B;  3GNJ A;  1V9W A;  4FYB A;  4MZW A;  2WZS A;  1U6T A;  2R2J A;  4BA7 A;  3ZVJ D;  1FAA A;  2LST A;  3GH9 A;  3CRT A;  2C8U A;  4HQS A;  4NHW A;  4NV5 A;  2HZE A;  1YEW C;  1EP7 A;  5F0G A;  3CSJ A;  2UV8 G;  2H8L A;  2C3N A;  3CWG A;  1TK5 B;  2V2G A;  2HSN A;  1NSW A;  2RUF A;  1NHO A;  1XZO A;  1ABA A;  5DQS A;  1ON4 A;  2IMK A;  7GSS A;  1K0D A;  4E68 A;  1V58 A;  4KB3 A;  5JCU A;  4ECB A;  5ID2 B;  4K2X A;  1ML6 A;  12GS A;  1B8X A;  4G9H A;  2CVB A;  3C8E A;  6GST A;  5D9V A;  3APQ A;  4MJE A;  3IV4 A;  2R0P A;  5LNK e;  2WW0 A;  1JZD A;  4HS1 A;  4J57 E;  4KUN A;  4LL1 B;  5B8B A;  3C7M A;  1SL2 B;  2A2R A;  1ZOF A;  2IWT A;  2EIO A;  4IJ3 A;  1V40 A;  2OBK A;  4Q5F A;  1XW9 A;  4ZB6 A;  2YWN A;  5IMF A;  5DQY A;  2HSY A;  1TK0 B;  1U88 A;  3LQ7 A;  4GWR A;  4I97 A;  3LGC A;  2H0I A;  3CXG A;  2I3Y A;  1GLP A;  4Q5R A;  1EGO A;  2YCD A;  3IBH A;  2CAQ A;  4YAV A;  5DAK A;  4MA9 A;  3TJB A;  2EFD A;  2GSR A;  1J08 A;  4TXV A;  1JHB A;  5ELA A;  2FA8 A;  4I5Q A;  3D4T A;  4JBB A;  4RQX A;  2P5R A;  4XS6 A;  2PU9 C;  3G7J A;  2HYX A;  1PL2 A;  2H73 A;  5KN1 A;  1GSY A;  4KDU A;  3HDC A;  2ZUP A;  1S3C A;  1R26 A;  4MPG A;  5BMU A;  3LYK A;  3F4S A;  5F8B A;  4G2E A;  3KP9 A;  2KUC A;  2YPM A;  5A34 B;  2G0F A;  1PN9 A;  2WUL A;  4H86 A;  1PD2 1;  1SKW B;  1GTB A;  1W4V A;  2H0H A;  4G0I A;  1H75 A;  1TI3 A;  4OD7 A;  3FZA A;  1FHE A;  1GUH A;  1YKC A;  1E2Y A;  3GSS A;  1B4P A;  4MK3 A;  1TDI A;  2C3T A;  4KCA A;  2C4J A;  2IL3 A;  3A2V A;  18GS A;  1HNB A;  2L4Q A;  2F51 A;  3EE2 A;  3QR6 A;  5HFI A;  3L78 A;  4OCE A;  4ICY A;  1XPV A;  3FW2 A;  3HD5 A;  5LD0 A;  4KDY A;  2VL2 C;  4L8E A;  3RFR C;  4MF7 A;  1I1I P;  1TU7 A;  2LRN A;  5C04 A;  2VL3 A;  4WR5 A;  1AUC A;  3EVI A;  4GST A;  4TOP A;  5J40 A;  2FA4 A;  1VF1 A;  2FUG 2;  4MNN A;  5HR2 A;  4QL9 A;  3ED3 A;  3GHA A;  4WF5 A;  4GLT A;  2LJR A;  1SYX A;  3H8Q A;  2L5L A;  4KA0 A;  5EY6 A;  2A4H A;  3DVW A;  1BG5 A;  1F2E A;  3GRX A;  2M80 A;  3VI7 A;  2VO4 A;  3TKQ A;  4AJ8 A;  1GUL A;  1BJX A;  1VF4 A;  4FYU A;  2OJL A;  4IQA A;  3CTF A;  2YP6 A;  3UEM A;  1N8J A;  2B5X A;  4ZB8 A;  4WBR D;  2DIZ A;  2JSZ A;  1KTE A;  4DSR A;  4JU5 A;  3TKP A;  1J9B A;  3KGK A;  6GSU A;  3TDG A;  3DYR A;  1XWK A;  3MAK A;  4TRX A;  2P31 A;  4AKH A;  1ERT A;  2EFH A;  4ZL7 A;  2OE0 A;  1LJR A;  3GMF A;  4K9Z A;  4N30 A;  1WP0 A;  4IVF A;  4DSS B;  4EKZ A;  4JE1 A;  2PBJ A;  3PGT A;  2VKZ G;  5A4W A; 
#chains in the Genus database with same CATH homology
 3WT2 A;  4PUA A;  1FW1 A;  4KX4 A;  4IKH A;  2OE3 A;  5IPG A;  2A2S A;  1X9M B;  4RUV A;  2GQL A;  3DKS A;  1GP1 A;  1JZR A;  3FZ5 A;  2GST A;  5A4U A;  4ID0 A;  5FT3 A;  3DXB A;  2F8A A;  1M2A A;  4POB A;  3TB2 A;  4HU7 A;  2LUS A;  3EPT A;  3KTL A;  4OMV A;  1XXU A;  4EL1 A;  1XW6 A;  2VAF A;  5H5S A;  1WMJ A;  2J23 A;  2HQT A;  2GT6 A;  3HVX A;  4X1U A;  2J9H A;  4WF4 A;  4ZIJ A;  1MDI A;  3DIE A;  4TR0 A;  3EC3 A;  1RW1 A;  3FEU A;  3M1G A;  4IQ1 A;  4MZB A;  2JAD A;  3F4R A;  2VLT A;  4MJB A;  3TRX A;  2GLR A;  4KE3 A;  2HZE B;  2CVD A;  1K3Y A;  1SVO A;  4BL7 A;  2L57 A;  14GS A;  3DVX A;  4MDC A;  1N25 A;  3IE3 A;  4BVX A;  2RLI A;  2E7P A;  4MP4 A;  2AAW A;  1PX7 A;  2CVK A;  3TCO A;  1SK0 A;  2GSQ A;  2FY6 A;  1A2L A;  4I2T A;  5KOX A;  1SVM A;  4XS4 A;  1T4Y A;  4N10 A;  2NTO A;  1YVL A;  2LS5 A;  2H01 A;  4ECC A;  1SL0 B;  4K0G A;  5AIS A;  4EIP A;  2H72 A;  5J4U A;  3PIN A;  4TN8 A;  5H5R A;  3O76 A;  3D4M A;  2QA2 A;  1V57 A;  2FCH A;  2C0D A;  4Q5Q A;  2GQK A;  3H4K A;  5IMZ A;  2R3X A;  2RM5 A;  2CV4 A;  5ECS A;  2GZY A;  1ZMA A;  4NPB A;  5AIV A;  1A8L A;  4G10 A;  1I5G A;  1BAY A;  2VL2 A;  3M9K A;  1SKS B;  3IDV A;  5DAK B;  4CW9 A;  2MYG A;  4MMM A;  4I2U A;  3IOS A;  1YEP A;  3QMX A;  3DGQ A;  3HZ8 A;  1F9M A;  2I1U A;  2HT9 A;  3QOU A;  2IPA A;  2GSS A;  5KN2 A;  1XOB A;  4V1A g;  1A8Y A;  5KOW A;  2WB9 A;  3KM6 A;  2IIY A;  2NDO A;  5B6N A;  1PSQ A;  4KF9 A;  1GSE A;  2O89 A;  5BMU B;  3F3R A;  3ZIV A;  2CT6 A;  1O85 A;  2VCW A;  2FGX A;  5EPF A;  1GTI A;  3KP8 A;  2CZ2 A;  1C72 A;  1QQ2 A;  1GNE A;  1B4Q A;  4POL A;  1A0F A;  4GQC A;  13GS A;  1XWB A;  2FLS A;  5C00 A;  3TKR A;  1G7E A;  3ZRD A;  3R2Q A;  4K7O A;  2KP1 A;  1O7U A;  1PKW A;  2K6V A;  4PQ1 A;  3I69 A;  3NIV A;  1A2J A;  2C0F A;  1YDK A;  3MWH A;  1AQW A;  3HCZ A;  3ME7 A;  3GA4 A;  5DBQ A;  1T00 A;  1U3I A;  1SKR B;  2B5E A;  4F2I A;  4IHU A;  4YH2 A;  2YZU A;  2H1B A;  1G6W A;  4PQH A;  3UVT A;  5ABR A;  1EOH A;  1FB0 A;  2MBS A;  1SD9 A;  3DD3 A;  2YV9 A;  1Z7R A;  2FWE A;  2O87 A;  2DJ2 A;  5HFK A;  2HSM B;  3RHC A;  3KMO A;  1EWX A;  4WET A;  5F06 A;  2IME A;  1K0A A;  4PUR A;  1EEM A;  2JZR A;  1GSS A;  2YJH A;  1SK1 A;  2GS3 A;  1M7T A;  2LNT A;  3I9V 2;  2PVQ A;  1TTZ A;  3MYD A;  2D2Z A;  1HYU A;  3IR4 A;  2DKI A;  5JCG A;  4W66 A;  4O5R A;  6GSY A;  3GYK A;  3UMA A;  2DJK A;  4ECJ A;  1F3A A;  2PPT A;  3UOM A;  1GUK A;  2WRT A;  4V1A p;  4O5U A;  4YKF A;  4V2N A;  3F0I A;  3RHB A;  4GCI A;  3FR9 A;  2PER A;  3KCM A;  1Y25 A;  1TRW A;  1GTA A;  4DEJ A;  3I43 A;  1M2B A;  4GSN A;  1AQV A;  4RI7 A;  3UVH A;  3F6F A;  3TUE A;  3ZTL A;  4USS A;  2H70 A;  3RBT A;  2YJ7 A;  3PR8 A;  4FIW A;  2RII A;  4ZBA A;  4N3Z A;  3L4N A;  4O5Q A;  1TRS A;  2PN8 A;  1Y6E A;  1PL1 A;  3Q19 A;  3ZML A;  5CRG A;  4ZIL A;  4V2L A;  4OCF A;  4HJM A;  1ST9 A;  1TXU A;  5D9W A;  1PMT A;  2I81 A;  4X43 A;  3EYT A;  5GAN D;  1OVN A;  2CQ9 A;  3MDK A;  5ECQ B;  4ZXG A;  3L0H A;  3O6T A;  4ZB9 A;  3ERF A;  2LQO A;  1TXX A;  1GTU A;  5J9C A;  2HRA A;  2VOC A;  4PNG A;  4NAX A;  1HNA A;  5G2Z A;  4O7H A;  3D6I A;  2X8C A;  5A5H A;  1Z7P A;  3APO A;  4NHZ A;  3SBC A;  4IJI A;  1URM A;  5A5K A;  3DEX A;  3PH9 A;  3VWU A;  2HRK A;  3UBK A;  3LSZ A;  1MEK A;  2FD3 A;  4TR3 A;  1M2D A;  5B8A A;  4HJ2 A;  3HZ4 A;  20GS A;  4LMV A;  1IYI A;  4GQF A;  4BL7 B;  5B6M A;  1KNG A;  1MDJ A;  4MLY A;  1USB A;  5GAP D;  1O6J A;  4L0U A;  4BVX B;  1SJ6 A;  4YAP A;  2RM6 A;  4I6X A;  3NOF A;  4OO5 A;  2DJ3 A;  2V6O A;  3ERG A;  4TKY A;  3CTG A;  1TOF A;  2XPD A;  2CX3 A;  5COH A;  3FMW A;  2WFC A;  2K8V A;  3GTU B;  4F0B A;  4TR1 A;  4HI7 A;  1Z6M A;  4D73 A;  1N2A A;  4PTS A;  3M8N A;  4GDF A;  5IQY A;  2TRC P;  4K2D A;  2B5Y A;  4K8M A;  2L5O A;  4IP6 A;  3TJF A;  3RAZ A;  2LKU A;  1DUG A;  1OAZ A;  4K6X A;  2OE1 A;  5CP1 A;  5JWR B;  2C1Y A;  4DVC A;  2X4A A;  2VIM A;  2X49 A;  3KTB A;  3CRU A;  3UBL A;  1K0M A;  3BCI A;  1XWA A;  4G19 A;  4ISD A;  1H4O A;  1WE0 A;  3GKN A;  3IRA A;  3HA9 A;  1HNC A;  2CX4 A;  4O32 A;  2XHF A;  3A2W A;  1Q98 A;  5DAL A;  2I9H A;  1XW5 A;  2ZNM A;  4IP1 A;  2DBC A;  3ZIT A;  3NZN A;  5DCG A;  1S3A A;  2XBQ A;  3HMJ G;  3ZIJ A;  4X0X A;  3E9J B;  3FKF A;  2FNO A;  2OAD A;  3N5O A;  1GL8 A;  2GT5 A;  4NV2 A;  1OC8 A;  5G5F A;  1ZYQ B;  3M0F A;  1EOG A;  3QCP A;  3P8W A;  3VI5 A;  1OYJ A;  4WXT A;  3WYW A;  2JAC A;  3KXO A;  2HRN A;  2X99 A;  5IOX A;  3QAG A;  2R5G A;  1M9A A;  2H19 A;  2IFQ A;  3P90 A;  3CBU A;  2DLX A;  1GWC A;  2O8V B;  1V2A A;  4F03 A;  1SD8 A;  4TR4 A;  2L6C A;  1S3D A;  2C0E A;  4P3Y B;  3HY2 A;  4J2F A;  5FWG A;  1K3L A;  3UL3 A;  2E2M A;  3CMI A;  3F4T A;  4K1F A;  19GS A;  1PRX A;  1ZCP A;  2DIY A;  4MJC A;  1X0R A;  2P5Q A;  3LXT A;  3C71 A;  1GSF A;  2JZT A;  4K5R A;  3VFI A;  2YN1 A;  2H0G A;  3VWW A;  4HUA A;  1ERU A;  1AW9 A;  4OFT A;  2K8S A;  5DDL A;  2V41 A;  3US3 A;  3GST A;  4KND A;  1PA3 A;  2N5A A;  2OBI A;  5D93 A;  4MF5 A;  4BWQ A;  2F3M A;  1DE2 A;  2H6Z A;  3A5I A;  1JZW A;  5HR3 A;  2H1G A;  3BBY A;  4EUY A;  2DJ0 A;  3QD9 A;  2B3S A;  2QKE A;  5KEJ A;  3ZFB A;  3GKK A;  1BQ7 A;  1R5A A;  3RPP A;  3M9J A;  4N0Z A;  1EV9 A;  4V2M A;  3F8U A;  2YAN A;  2XC2 A;  1TK8 B;  6GSX A;  4OO4 A;  4HOJ A;  6GSW A;  2QC7 A;  3FRC A;  5D9X A;  2XPE A;  4QMK A;  1G0T A;  2HZF A;  4ILF A;  3QPM A;  5IO2 A;  2X8G A;  2R0G A;  2EIR A;  1I9D A;  3C73 A;  2GGT A;  1AXD A;  4PXO A;  1GLQ A;  3WT1 A;  3HJO A;  1PN0 A;  1B9X C;  3F63 A;  3LG6 A;  5G1K A;  5HR1 A;  3A3T A;  2H6Y A;  4AKX B;  1FB6 A;  2H74 A;  2L6D A;  3IXR A;  1FO5 A;  2KP2 A;  2HSN B;  2NPB A;  3VUR A;  3D21 A;  5J4Y A;  4Z7X A;  3GIX A;  4JED A;  1HQO A;  3E0U A;  1JLW A;  2GZZ A;  3G7I A;  1OE8 A;  4MF6 A;  5IO0 A;  1SJI A;  4KGI A;  3ME8 A;  2ALB A;  5A5H B;  1Z9H A;  2K9F A;  4TVE A;  4OFN A;  3D5J A;  1YQ1 A;  3LW9 A;  1XVQ A;  4GRF A;  1YF1 A;  5CNW A;  5J41 A;  4AKG A;  3IC8 A;  5CAX A;  3A5W A;  1U87 A;  4XIH A;  4GTU A;  4BPY A;  2VCT A;  2ON7 A;  1T8E B;  2R0C A;  3FY7 A;  5IIZ A;  5G30 A;  2LTK A;  5EVO A;  4MH2 A;  1YJ6 A;  2GZP A;  2H1L A;  2VM1 A;  4BWS A;  4GF0 A;  5HR0 A;  1AQX A;  1M99 A;  1TRU A;  4CY8 A;  3ZRE A;  3KH9 A;  17GS A;  2AJQ B;  3U5R E;  1V98 A;  4I8B A;  1R5P A;  1UA5 A;  5G31 A;  1ACV A;  2E0Q A;  4ZL8 A;  4EC0 A;  4TR1 B;  4RQR A;  2Z9S A;  4N11 A;  4EO3 A;  4D73 B;  1OC9 A;  1ILO A;  1NM3 A;  1QXH A;  1XCC A;  5DJM A;  2LJA A;  3TRP A;  1FVK A;  3F6D A;  3E3E A;  5F07 A;  1RQM A;  1XBS A;  1AC1 A;  3HVS A;  4YQM A;  1SK2 A;  3GKM A;  5LCZ A;  3KD0 A;  1TW9 A;  3FK8 A;  2YV7 A;  2LRC A;  3BOA A;  2WZ9 A;  4QQ7 A;  4ZB7 A;  5FHI A;  4TXO A;  2KLX A;  2H71 A;  4F0C A;  5DAL B;  4XCS A;  4ACS A;  5AIX A;  5IOW A;  2HRF A;  3S9F A;  4PNF A;  1BYE A;  3CSH A;  3WD6 A;  2M72 A;  1A24 A;  5HQP A;  5J4V A;  5J3R A;  3WGX A;  5AGY A;  16GS A;  1YEX A;  1G7O A;  4BVY A;  4FH8 A;  4EDY A;  4MAB A;  2DJ1 A;  3IAS 2;  2JSY A;  1CQG A;  5IMA A;  3MSZ A;  4L0W A;  5JCW A;  2O7K A;  3VPT A;  1ZL9 A;  1E6B A;  3MIX A;  4FQU A;  2KHP A;  5D8I A;  3LOR A;  4ML1 A;  1KBN A;  5E59 A;  5JWQ B;  2AYT A;  2RUE A;  4KSM A;  2MMN A;  5ECK B;  2G2Q A;  1SU9 A;  2IFQ B;  5GZZ B;  2QGV A;  1UC7 A;  4XTS A;  3RDW A;  4AJ7 A;  2MMA A;  5L71 A;  3GH6 A;  4F82 A;  2OA7 A;  1QFN A;  2DSA A;  4AJ6 A;  2ES7 A;  1DE1 A;  3ISO A;  2XBI A;  5KN0 A;  1XWC A;  1SJZ A;  2C0G A;  5ELG A;  1YF0 A;  5AN1 A;  3FR3 A;  3GX8 A;  5CRD A;  3Q74 A;  4A5P A;  2HNL A;  3L9S A;  3OR5 A;  4DSQ A;  5GST A;  2OAC A;  3H93 A;  1TJD A;  3ERW A;  3GL5 A;  4JR4 A;  4Z2R A;  2N5B A;  2V6K A;  3O3T A;  4IGJ A;  1THX A;  4NMU A;  4FO5 A;  2IMI A;  3VWV A;  4CHS A;  3IA1 A;  4Z2T A;  4Z2U A;  1TP9 A;  2TRX A;  2V32 A;  1SVL A;  3BD2 A;  1R4W A;  2VD1 A;  1MDK A;  1YKA A;  3ZL5 A;  1GSQ A;  5EL8 A;  1QMV A;  2FWG A;  3EU3 A;  1SL1 B;  2JZS A;  2LRT A;  2AV4 A;  1GSU A;  5B7C A;  2R4V A;  3L9V A;  1U3A A;  2YWM A;  2DJJ A;  2ZCT A;  2VCV A;  4ECI A;  2GVP A;  2H66 A;  1XWG A;  5CRW A;  3A2X A;  1FVJ A;  3HJP A;  4GXZ A;  5CYY A;  2YNX A;  1UVZ A;  4OFM A;  3C1S A;  1K0B A;  4IW9 A;  2PUK C;  3EMP A;  3P2A A;  4EDZ A;  3IK7 A;  2KOK A;  5G5E A;  3LXZ A;  3RPN A;  3GL3 A;  1GRX A;  2R6K A;  3M3M A;  4PUF C;  5ECI B;  3W8J A;  1PQN A;  3VK9 A;  2AB6 A;  5ECM B;  3QFA C;  1X9S B;  3HVV A;  4KSO A;  3UAP A;  3EWL A;  3ZYW A;  2VCQ A;  2HLS A;  2K18 A;  3ZMK A;  3QFB C;  5IMV A;  4YKG A;  3D0Z A;  5IM9 A;  4XS4 B;  2GQM A;  1KEB A;  2H30 A;  2WJU A;  1O81 A;  2NBS A;  3IC4 A;  5ECP B;  5ECL B;  1QUW A;  5F05 A;  3TJG A;  2F8F A;  2DMM A;  4N0V A;  4EVM A;  1XOA A;  5CRE A;  4LLR A;  2B7J A;  4X4J A;  1SYR A;  1VF3 A;  1OKD A;  2M46 A;  2P0G A;  3CSI A;  2VUP A;  2EC4 A;  2CAI A;  4XRD A;  2B7K A;  3TKS E;  8GSS A;  4NWY A;  1YY7 A;  1B48 A;  3HXS A;  5A1N A;  4KDX A;  3EU4 A;  10GS A;  3Q6O A;  1T1V A;  3TKS C;  4HU9 A;  3LWA A;  4J56 E;  4JR6 A;  4KH7 A;  1YZX A;  4PGT A;  1JFU A;  3N9J A;  2GDR A;  4ZBD A;  4CDO A;  2L4C A;  4ZL9 A;  2OT3 A;  2LNS A;  2VCX A;  4PQI A;  5H5Q A;  4HEA 2;  1F6M C;  4IEL A;  3KEB A;  2HXK A;  3GV1 A;  3QAW A;  1FG4 A;  4K5S A;  2H1D A;  1THO A;  3LYP A;  4L5O A;  2CA8 A;  2VL9 A;  2HSM A;  2N5F A;  1NHY A;  2IMD A;  1OC9 B;  3VPQ A;  1EV4 A;  1OKT A;  2IN3 A;  1ZZY A;  3DWV A;  5CO3 A;  2YWI A;  2FWF A;  4EXJ A;  4TW5 A;  6GSS A;  3L9U A;  2A2P A;  1LBK A;  2H1A A;  3DRN A;  3GX0 A;  1F3B A;  3U6V A;  3IPZ A;  2PMT A;  2PVO C;  3KIJ A;  5BRT A;  5IPH A;  1FOH A;  5IMC A;  2WS2 A;  4TXO B;  5KN3 A;  2BMX A;  4EE0 A;  5G1L A;  5ECO B;  2WDU A;  3FZ9 A;  2C80 A;  2H76 A;  4G0K A;  1XFL A;  3HJM A;  2IJY A;  1DSB A;  1DBY A;  2VD0 A;  5J47 A;  3BJ5 A;  4RI6 A;  4YQU A;  4HDE A;  4XHM A;  1Z5Y E;  4F9Z A;  4WR4 A;  3MNG A;  4BVY B;  1RK4 A;  5ECN B;  2HSH A;  4E8E A;  2HE3 A;  1GUM A;  1OC3 A;  4ULX A;  3WGD A;  3TOU A;  3Q18 A;  2O5V A;  1ZGN A;  1K3O A;  2UZ8 A;  4CY6 A;  2LQQ A;  4IBP A;  1ZYE A;  4MH3 A;  3AY8 A;  3LFL A;  3ZLP A;  4K0N A;  4AI6 A;  2MMZ A;  1JZO A;  3GUR A;  2X64 A;  2VM2 A;  4POK A;  2VLU A;  3FYG A;  1JLV A;  4G01 A;  3ZZX A;  1WIK A;  5ID2 A;  3KJY A;  4XS1 A;  4MJA A;  1BF5 A;  1CQH A;  2WGR A;  3EMX A;  2IMF A;  1IYH A;  3KMN A;  1T3B A;  4YQV A;  1TKD B;  4QL7 A;  2FHE A;  4AKI A;  1WRY A;  3EIN A;  2O85 A;  1WWJ A;  2REM A;  4POM A;  1B9Y C;  3W8S A;  2H6X A;  3V1W A;  3ZVJ A;  2MZC A;  1A23 A;  1AIU A;  3W6G A;  1K0O A;  3HHV A;  1T4Z A;  3TRQ A;  2PGT A;  1QK8 A;  5GSS A;  2V1M A;  2DKH A;  5INY A;  4HQZ A;  4NXI A;  1J0F A;  3H1N A;  2BTO T;  4JRR A;  3R3E A;  4MPF A;  5A4V A;  2C3Q A;  2HI7 A;  4ZBB A;  2JL4 A;  5DJL A;  3FHK A;  3D22 A;  1Q4J A;  1R7H A;  5ECR B;  1PGT A;  1ZYP A;  1O8W A;  1X9W B;  4ML6 A;  3ZFL A;  1BG1 A;  4O92 A;  1W89 A;  4MZC A;  3GTU A;  2LV3 A;  3IHG A;  1EP8 A;  5A34 A;  4K7N A;  1VGL A;  1GH2 A;  2VCZ A;  2HRK B;  5J9B A;  4HZ4 A;  3TKS A;  3C1R A;  1K0C A;  5E4W A;  1EZK A;  5ECH B;  1X5E A;  3SWL A;  2I4A A;  3JCM L;  4WBJ A;  3APS A;  4G0L A;  4LA1 A;  5D9T A;  3TU3 B;  4IS0 A;  4KCE A;  2PWJ A;  3IK9 A;  1G6Y A;  4KAE A;  1X5C A;  1Z3E A;  1EGR A;  2FWH A;  4LL4 B;  3TJJ A;  3CYN A;  2R37 A;  1XIY A;  1WPI A;  4FYC A;  2DC5 A;  1TRV A;  4PX1 A;  2MMO A;  5DCH A;  1VRS D;  1ERW A;  2YOI A;  3G9B A;  3H79 A;  1X5D A;  3FR6 A;  1AAZ A;  1UN2 A;  4Q5N A;  1SEN A;  2B1L A;  1A0R P;  2EFE A;  1Z6N A;  4E8H A;  1GSD A;  3UAR A;  3F9U A;  2DML A;  3DML A;  1ZYN A;  4OWY A;  5D73 A;  3GKX A;  3K8N A;  3VLN A;  4EF0 A;  1TU8 A;  3QDN A;  1WJK A;  5A1N B;  2AUV A;  1OE7 A;  2NVL A;  3F3Q A;  1LU4 A;  3P7X A;  1BED A;  4KW6 A;  5JWO B;  1PKZ A;  3GN3 A;  1PX6 A;  1K0N A;  3GFK A;  4XRA A;  2BJX A;  1Y1U A;  3KZQ A;  2QA1 A;  4WEY A;  5DVB A;  2AHE A;  2OKA A;  5J5N A;  2WCI A;  2LEG A;  3PPU A;  3WGE A;  1TI1 A;  1F37 A;  3LEF A;  1QGV A;  1BX9 A;  4IN0 A;  2L59 A;  3EUR A;  1ERV A;  2LJK A;  3UIW A;  1XVW A;  3FZ4 A;  3IAM 2;  1NW2 A;  1EEJ A;  3BCK A;  5HFG A;  4EIQ A;  5ENU A;  6GSV A;  2E2G A;  2VLV A;  1M9B A;  1A2M A;  2ON5 A;  2CZ3 A;  2EIQ A;  3TGZ A;  2YZH A;  2F9S A;  4DSS A;  2TIR A;  1FOV A;  4AGS A;  3GUS A;  5CRH A;  5D96 A;  1VF2 A;  3LJR A;  3I6A A;  4L5L A;  3TOT A;  1HD2 A;  4WKW A;  3HKR A;  11GS A;  2EFC A;  4K7I A;  3HYP A;  2GTU A;  2A4V A;  22GS A;  1O73 A;  4GSS A;  2B1K A;  2X8H A;  1MD4 A;  1MD3 A;  3KH7 A;  4AF2 A;  3IHQ A;  3J7Y k;  3UJ1 A;  2B6M A;  1M0U A;  1MTC A;  3TJK A;  4MCU A;  1O8X A;  2JU5 A;  2MBT A;  2YWO A;  4LMW A;  2HFD A;  4JZQ A;  5IMD A;  1WOU A;  2QSI A;  3G7Y A;  1GNW A;  3QAV A;  2H75 A;  4HZ2 A;  3VWX A;  3J7Y b;  9GSS A;  1T7P B;  3GNJ A;  1V9W A;  4FYB A;  4MZW A;  1U6T A;  2R2J A;  4BA7 A;  3ZVJ D;  1FAA A;  2LST A;  3GH9 A;  3CRT A;  2C8U A;  4HQS A;  4NHW A;  4NV5 A;  2HZE A;  1EP7 A;  5F0G A;  3CSJ A;  2UV8 G;  2H8L A;  2C3N A;  3CWG A;  1TK5 B;  2V2G A;  2HSN A;  1NSW A;  2RUF A;  1NHO A;  1XZO A;  1ABA A;  5DQS A;  1ON4 A;  2IMK A;  7GSS A;  1K0D A;  4E68 A;  1V58 A;  4KB3 A;  5JCU A;  4ECB A;  5ID2 B;  4K2X A;  1ML6 A;  12GS A;  1B8X A;  4G9H A;  2CVB A;  3C8E A;  6GST A;  5D9V A;  3APQ A;  4MJE A;  3IV4 A;  2R0P A;  5LNK e;  1JZD A;  4HS1 A;  4J57 E;  4KUN A;  4LL1 B;  5B8B A;  3C7M A;  1SL2 B;  2A2R A;  1ZOF A;  2IWT A;  2EIO A;  4IJ3 A;  1V40 A;  2OBK A;  4Q5F A;  1XW9 A;  4ZB6 A;  2YWN A;  5IMF A;  5DQY A;  2HSY A;  1TK0 B;  1U88 A;  3LQ7 A;  4GWR A;  4I97 A;  3LGC A;  2H0I A;  3CXG A;  2I3Y A;  1GLP A;  4Q5R A;  1EGO A;  2YCD A;  3IBH A;  2CAQ A;  4YAV A;  5DAK A;  4MA9 A;  3TJB A;  2EFD A;  2GSR A;  1J08 A;  4TXV A;  1JHB A;  5ELA A;  2FA8 A;  4I5Q A;  3D4T A;  4JBB A;  4RQX A;  2P5R A;  4XS6 A;  2PU9 C;  3G7J A;  2HYX A;  1PL2 A;  2H73 A;  5KN1 A;  1GSY A;  4KDU A;  3HDC A;  2ZUP A;  1S3C A;  1R26 A;  4MPG A;  5BMU A;  3LYK A;  3F4S A;  5F8B A;  4G2E A;  3KP9 A;  2KUC A;  2YPM A;  5A34 B;  2G0F A;  1PN9 A;  2WUL A;  4H86 A;  1PD2 1;  1SKW B;  1GTB A;  1W4V A;  2H0H A;  4G0I A;  1H75 A;  1TI3 A;  4OD7 A;  3FZA A;  1FHE A;  1GUH A;  1YKC A;  1E2Y A;  3GSS A;  1B4P A;  4MK3 A;  1TDI A;  2C3T A;  4KCA A;  2C4J A;  2IL3 A;  3A2V A;  18GS A;  1HNB A;  2L4Q A;  2F51 A;  3EE2 A;  3QR6 A;  5HFI A;  3L78 A;  4OCE A;  4ICY A;  1XPV A;  3FW2 A;  3HD5 A;  5LD0 A;  4KDY A;  2VL2 C;  4L8E A;  4MF7 A;  1TU7 A;  2LRN A;  5C04 A;  2VL3 A;  4WR5 A;  1AUC A;  3EVI A;  4GST A;  4TOP A;  5J40 A;  2FA4 A;  1VF1 A;  2FUG 2;  4MNN A;  5HR2 A;  4QL9 A;  3ED3 A;  3GHA A;  4WF5 A;  4GLT A;  2LJR A;  1SYX A;  3H8Q A;  2L5L A;  4KA0 A;  5EY6 A;  2A4H A;  3DVW A;  1BG5 A;  1F2E A;  3GRX A;  2M80 A;  3VI7 A;  2VO4 A;  3TKQ A;  4AJ8 A;  1GUL A;  1BJX A;  1VF4 A;  4FYU A;  2OJL A;  4IQA A;  3CTF A;  2YP6 A;  3UEM A;  1N8J A;  2B5X A;  4ZB8 A;  4WBR D;  2DIZ A;  2JSZ A;  1KTE A;  4DSR A;  4JU5 A;  3TKP A;  1J9B A;  3KGK A;  6GSU A;  3TDG A;  3DYR A;  1XWK A;  3MAK A;  4TRX A;  2P31 A;  4AKH A;  1ERT A;  2EFH A;  4ZL7 A;  2OE0 A;  1LJR A;  3GMF A;  4K9Z A;  4N30 A;  1WP0 A;  4IVF A;  4DSS B;  4EKZ A;  4JE1 A;  2PBJ A;  3PGT A;  2VKZ G;  5A4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...