3KJYA

Crystal structure of reduced homo sapiens clic3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
223
Chain Sequence
LEVLFQTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 3
publication title Structure of human CLIC3 at 2 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 71
structure length 223
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kjyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kjyA01
1S3DA 11GSA 2GTUA 1AQXA 4XHMA 3GSTA 3C8EA 5IMFA 4XRDA 1Z6MA 5AIXA 4EC0A 3MSZA 5E4WA 1X5DA 3DWVA 5A4VA 2H6XA 4KDYA 3L9VA 1SL2B 1ERWA 2YV7A 4DSRA 4HOJA 1GTAA 2NPBA 2V6OA 5JCUA 1GNWA 3MDKA 2L57A 5ECNB 2IJYA 1YY7A 4DSQA 5GAPD 1A0FA 5AN1A 4KCAA 5HQPA 4POMA 3M0FA 1T3BA 4AJ7A 5C04A 2VM2A 3QOUA 5CAXA 1TW9A 5ELGA 4I2UA 2KLXA 1GLPA 4OMVA 3DMLA 3EU4A 5KN3A 1DE1A 3H93A 1TKDB 4PUFC 4MJBA 5D9TA 3QAGA 5E59A 2L6DA 1A8LA 2QC7A 22GSA 2BTOT 1OC9B 2ON7A 2OA7A 1OYJA 2FWGA 3L4NA 2Z9SA 2NBSA 1EV4A 3L9SA 4FH8A 4EUYA 4JR4A 2GZYA 2K8VA 4TR1B 3EWLA 5EL8A 1QUWA 2GS3A 4HEA2 3TRQA 2VL2A 2L59A 1OKDA 2WB9A 3GKNA 3CRUA 6GSYA 4KGIA 4JRRA 1PSQA 2HE3A 4Z7XA 2AHEA 2KP2A 2H0HA 5IM9A 3HVSA 5CRHA 3G9BA 1U88A 3LJRA 2MZCA 4G19A 1ACVA 2AJQB 3H79A 3GV1A 5EY6A 5ID2B 5GSTA 4TVEA 3D22A 4I2TA 3APSA 4F0BA 3KZQA 1HNCA 3IK9A 2OBKA 5CP1A 2M72A 2OJLA 2B1LA 3GX0A 2HSNB 4IELA 3C7MA 3FZ5A 4MA9A 5DCGA 3GKXA 3TJGA 4N11A 4MLYA 4EDYA 3GHAA 5ECLB 1M9AA 3WT1A 1BQ7A 1O7UA 4NHWA 4ZIJA 1FOVA 4XS6A 5CRGA 1K0DA 2JSYA 5JWQB 1MEKA 3UIWA 3VWWA 2DJ1A 5FWGA 14GSA 3RHBA 2C8UA 5D9VA 2RUEA 6GSWA 4KDXA 3WYWA 2YNXA 1Q98A 3IA1A 2EIRA 2FNOA 4XS4B 2J9HA 4KDUA 3KTBA 4RQRA 6GSUA 4IJIA 2X8GA 4NV2A 4RI7A 3TKRA 2LNSA 5FT3A 4KNDA 4IQ1A 5JCWA 2MYGA 4PQHA 2VLTA 2DIYA 2HQTA 4HDEA 1HD2A 2LNTA 1EEMA 2E2MA 2C4JA 3IOSA 2X8CA 4PQIA 4YQUA 2PMTA 1AAZA 4AJ8A 2O85A 1OAZA 4BL7B 3KTLA 2AUVA 1FW1A 3EVIA 2PPTA 2DJJA 2H76A 3TDGA 1J0FA 3APOA 4TKYA 3JCML 3CSHA 4OFTA 4WF4A 2VCTA 3RBTA 1YJ6A 2ZCTA 2VLVA 1YF1A 3UAPA 3VURA 2H6ZA 1XWCA 4IHUA 4V2MA 4ZB9A 4WR4A 2D2ZA 2GSSA 2FWFA 5ELAA 3DVWA 3GL5A 1K0AA 2GSTA 5JWRB 3WT2A 3FEUA 3TJFA 3HVXA 3A2WA 3TJBA 1AXDA 2QSIA 3DYRA 2RIIA 1SU9A 3MAKA 1HQOA 4LL4B 2GZZA 1J08A 1XWBA 1U3AA 1SK2A 4ML6A 2C80A 3QAVA 2C0EA 1PKZA 3EMXA 3TJKA 2YZUA 3TKPA 2VCQA 3UVHA 4OWYA 4N10A 3E0UA 2VUPA 2FWHA 2F9SA 2V1MA 17GSA 2C3NA 2FUG2 4Q5FA 1BYEA 2GLRA 1KEBA 3GTUA 3EMPA 1G0TA 2NTOA 1YZXA 5J3RA 4BWQA 2H66A 1VF3A 4IP6A 4ML1A 3AY8A 4POLA 3J7Yb 3IDVA 2IFQB 4X43A 3BCKA 5D93A 3FW2A 2PERA 2R3XA 5INYA 4XRAA 4AF2A 2XC2A 1LBKA 4H86A 4ULXA 1R4WA 2OE0A 1EGRA 4G0LA 2H1BA 4GLTA 3GURA 3ISOA 1WOUA 3CXGA 4YH2A 5ENUA 4Q5RA 3PGTA 4XTSA 3UARA 4KF9A 2O7KA 2P0GA 2AAWA 4KAEA 2JZSA 1K0CA 3W8SA 2CV4A 2HSHA 4JEDA 3TOTA 2OACA 4TXOA 4O32A 1FVJA 2VCWA 3O76A 3KEBA 5GZZB 5HR0A 1TDIA 3SWLA 4GCIA 3D4TA 3ERFA 1Z5YE 2H30A 2XPEA 1R26A 4GWRA 2PBJA 1B4QA 1NSWA 2X8HA 3TJJA 3KGKA 4G9HA 1XVQA 3NOFA 3WGDA 2P5RA 5CRDA 5B6NA 3RPPA 2B7JA 2VCZA 4HUAA 5HR2A 1YQ1A 4PTSA 1ML6A 4ILFA 3TKSE 1T4YA 1UC7A 1SJZA 1BJXA 3HZ8A 1XOBA 5F8BA 3IR4A 1G7EA 1F9MA 2L4CA 2WCIA 1XFLA 3DIEA 2C3TA 1GSFA 6GSVA 4PNFA 2R2JA 2VM1A 2H1GA 1PRXA 4HJ2A 5DJMA 5LCZA 1EWXA 5IOWA 4JE1A 3ME8A 1A2MA 1GTUA 2H72A 2X99A 1ZMAA 2FY6A 2PU9C 4K1FA 4ECJA 2EC4A 3CTFA 2C0GA 1O8WA 4WKWA 3KMOA 2N5BA 2L4QA 4BPYA 3N9JA 1ABAA 6GSTA 4FQUA 1XIYA 1JZDA 1WPIA 3FZ4A 1GRXA 3TOUA 4O5RA 1K0OA 4NMUA 2YCDA 2DJ3A 2WULA 2K6VA 2CZ2A 2JZRA 5DVBA 2XHFA 4N0ZA 4ZBBA 2P31A 1M0UA 2LV3A 3RDWA 3LSZA 4KSOA 3ZITA 2LUSA 2L5LA 4ID0A 6GSXA 2CX4A 1XWGA 2B6MA 3VK9A 5KEJA 1S3CA 4TXVA 1TRUA 4PGTA 2WJUA 4HQZA 3Q19A 4K7NA 1BEDA 3GX8A 3E9JB 2IMEA 2GDRA 5EVOA 3HVVA 4MF7A 5ECOB 5CNWA 4O92A 3UVTA 4ZB6A 2R6KA 3HZ4A 1KNGA 2CQ9A 1TK0B 5IO2A 5F05A 2VCVA 1AUCA 2H71A 2PVOC 4K0GA 3ZTLA 2RUFA 1NHYA 2IPAA 1Z9HA 1SL0B 2HSYA 4KB3A 2V32A 2HRAA 1B9XC 1JLWA 3KH9A 1PA3A 5JCGA 4DEJA 1TK8B 1GWCA 4ECBA 5J9CA 1SK0A 3R2QA 5HFIA 1ST9A 4K9ZA 4IKHA 2H70A 2NDOA 4KCEA 3Q74A 2CZ3A 1AIUA 1HNBA 4KE3A 2B5XA 4MZCA 3HXSA 5A5KA 5DALA 1OE7A 3TCOA 4D73A 3TB2A 4IP1A 2RM6A 1JZWA 2CVDA 5G5FA 3HJMA 5CO3A 12GSA 2E2GA 3LG6A 3GKKA 3IHQA 1U87A 1W89A 2MBSA 4IGJA 4F03A 2G2QA 4MZWA 2VL2C 2HZEA 4Q5NA 4JU5A 4BWSA 1VF2A 1MDIA 3TRPA 4GSTA 1MD4A 1AQVA 1QQ2A 4EE0A 3GH6A 2VAFA 1GL8A 1DSBA 4MH3A 2WRTA 5KN2A 4DSSB 3ZFLA 2IMFA 4NHZA 3C73A 3LFLA 4IVFA 1F3BA 3QD9A 2VD0A 1PL2A 1TRWA 3TKSC 1YDKA 2B1KA 4PURA 1X9SB 2YWOA 4EF0A 1SK1A 3UBKA 1TRVA 1A23A 3BD2A 2H6YA 2L5OA 4G0KA 20GSA 3D5JA 3VPTA 3IC8A 5IMZA 1DE2A 1ZGNA 5DAKB 4ZXGA 4J56E 2R5GA 2HSMB 3DRNA 3QFBC 1TU8A 1XXUA 2UZ8A 1VGLA 4FIWA 4TW5A 1YF0A 1GTBA 4K7OA 1T8EB 4HS1A 1OVNA 1TI1A 6GSSA 4TR0A 3PINA 4WBJA 5LD0A 1NHOA 3TKSA 1K0BA 2H74A 3CYNA 16GSA 4PX1A 1FAAA 2JU5A 3FHKA 1V58A 4G2EA 1RW1A 2DJ0A 5KN1A 1EP8A 2P5QA 4LL1B 2E0QA 3F63A 1WMJA 5ECPB 4ZB8A 3F4SA 3I9V2 2GT6A 3EE2A 3D21A 3BJ5A 2MMNA 2MBTA 4MK3A 2IMIA 3ZMLA 3EURA 1GLQA 5J5NA 1GUHA 3VPQA 2I1UA 2YZHA 2K8SA 3A2VA 1XVWA 2LJKA 5IMDA 4LMVA 18GSA 2YN1A 3C71A 5DQYA 1UA5A 1ERUA 1K0MA 1BX9A 4OFMA 4I6XA 1B48A 1O85A 3UJ1A 4MP4A 4MZBA 5ECQB 3S9FA 2R4VA 2XBQA 2FWEA 5G31A 4EVMA 4FYBA 5CRWA 1OC9A 3KMNA 1HYUA 3RAZA 1Z6NA 4XIHA 1JZRA 2X64A 1TTZA 5G5EA 4WEYA 4MPFA 4FYUA 1THXA 1WJKA 4OD7A 5LNKe 1GUMA 1F6MC 2XBIA 4KA0A 4TR1A 2O8VB 3IXRA 5IPHA 5B8BA 2ALBA 4G0IA 1EOGA 1EGOA 2GQMA 3LWAA 2KHPA 3C1SA 4KH7A 3VLNA 3ZMKA 1SL1B 1AW9A 2N5FA 5D9XA 1FB6A 4TR4A 1JHBA 2KUCA 1GNEA 3HY2A 4I8BA 1DBYA 2A4VA 1I9DA 1QK8A 5ID2A 1PKWA 3KP8A 4JBBA 1QMVA 4J2FA 4K2DA 2H75A 4J57E 3WGEA 5HR1A 4BVXB 5HR3A 1PX6A 1CQGA 2LJAA 3RHCA 5G2ZA 2JL4A 5IIZA 5IO0A 5DJLA 2CT6A 3DVXA 3GIXA 4V2NA 4USSA 4HZ2A 1GSYA 3O6TA 4OO5A 1A8YA 3EYTA 4DVCA 3VI7A 2IMDA 4LLRA 1BG5A 4LA1A 1IYHA 2MMOA 1Z7RA 2H19A 3FR3A 2O87A 2TRCP 3BOAA 2OE3A 3KM6A 1X5EA 5KN0A 4GTUA 2LRTA 3EINA 1B4PA 2MMAA 4NWYA 4PXOA 4F0CA 4EL1A 2VIMA 4I97A 1SD9A 3LXZA 1HNAA 5D73A 3GKMA 4OO4A 2IIYA 1XW9A 4V2LA 1T4ZA 2L6CA 1MD3A 3ZIVA 1X9MB 2HXKA 1YEPA 4ZL7A 1AQWA 4ECIA 3RPNA 4GQFA 3ZVJD 2H0GA 2FD3A 4I5QA 2DMMA 2WZ9A 4P3YB 2LTKA 5COHA 4BVYB 5GSSA 4HU7A 4MPGA 2QGVA 1JZOA 2F8AA 5J9BA 4K7IA 5L71A 5CYYA 3KP9A 1GP1A 3Q18A 2LRNA 4CHSA 1GSUA 3VFIA 3DD3A 2GT5A 4N0VA 1WRYA 5ABRA 3A5WA 4HJMA 8GSSA 3A2XA 5F0GA 1H75A 4KX4A 4PNGA 2CX3A 2YPMA 4IN0A 2GQKA 1V57A 1YKCA 2KP1A 3IPZA 1PMTA 4ISDA 2E7PA 4QQ7A 2VO4A 4FO5A 1JFUA 3K8NA 3DEXA 5H5SA 1XWAA 5ECKB 4IW9A 2J23A 3P2AA 1PD21 3FR6A 1KTEA 1WE0A 3LQ7A 1ZZYA 2HRKA 1NM3A 2YWIA 3IV4A 3HYPA 3QR6A 1UN2A 4YAPA 5DALB 4ZBAA 2IWTA 1OE8A 4MF6A 3LYKA 1LJRA 3F4TA 1M9BA 1VRSD 2LKUA 1FB0A 4JZQA 3L78A 2HZEB 3P8WA 1FG4A 2IFQA 1ZOFA 1GSQA 1Q4JA 5ECIB 3E3EA 1GH2A 1GUKA 2ES7A 2OADA 1XWKA 2QKEA 3QCPA 3SBCA 5IMAA 4X0XA 1G7OA 3A3TA 4GXZA 3G7JA 2H8LA 3GMFA 3NIVA 1URMA 1WIKA 2C1YA 4TN8A 2YJHA 3H8QA 2F8FA 1TI3A 2AYTA 5G1KA 2KOKA 4CW9A 5DQSA 2JACA 2WGRA 3GUSA 5ECRB 2AB6A 2V41A 4PUAA 2F51A 3ZZXA 4EXJA 2YP6A 1ZCPA 3CMIA 2H0IA 3M9JA 3FY7A 3PH9A 1XZOA 2H1AA 2B7KA 1TU7A 1Z7PA 2B5YA 1X9WB 4Q5QA 2C0DA 1M2DA 3VWUA 5D96A 1MDJA 4MJCA 4GQCA 3U5RE 1TRSA 5IQYA 1Z3EA 1UVZA 3PPUA 4K6XA 1GSDA 3KH7A 3TKQA 3CTGA 5B6MA 1T1VA 1AC1A 1SYXA 2PGTA 2LQOA 2TIRA 3J7Yk 4MH2A 4O7HA 1PGTA 2V6KA 2PN8A 1X0RA 2RM5A 1VF1A 3QDNA 2VD1A 4BA7A 1ERVA 3F8UA 2DC5A 5B8AA 1GULA 1XW6A 2CVBA 4XCSA 2DMLA 5C00A 4F2IA 2LRCA 1EP7A 4WF5A 3GFKA 3FKFA 2VCXA 1M99A 4HU9A 3D4MA 3R3EA 3QMXA 1XCCA 4WETA 3F9UA 1XPVA 4QL9A 3P7XA 1ZYQB 5DBQA 2YOIA 1T00A 1O73A 4MF5A 2FLSA 1RQMA 2JZTA 3KIJA 1H4OA 3I6AA 3QFAC 3ZRDA 1R7HA 4QL7A 2H1DA 2YWMA 3HD5A 2ZUPA 1EEJA 2K9FA 3LORA 4IJ3A 5G1LA 2FGXA 3D6IA 4G10A 4TR3A 4L5LA 2CA8A 3TRXA 2BJXA 3LXTA 2FHEA 3W8JA 1MTCA 3FK8A 3GSSA 2LJRA 2GZPA 2R37A 3ZVJA 5HFKA 3UL3A 3F0IA 1S3AA 2B5EA 5H5RA 3CSJA 3QAWA 1E2YA 2ZNMA 2MMZA 1FVKA 3IE3A 3UOMA 5DDLA 4POBA 3V1WA 2HZFA 5GAND 4ZL8A 5CREA 4ZBDA 3KCMA 2OE1A 3GA4A 4MDCA 3G7IA 1SYRA 2G0FA 1G6YA 4KW6A 4WBRD 2M80A 2M46A 4XS1A 5A4UA 1RK4A 3VI5A 5H5QA 3PR8A 4MCUA 2PVQA 3KXOA 3M9KA 3ERWA 3ZL5A 3LEFA 2CVKA 1Y25A 2FA4A 1ON4A 3GYKA 2FA8A 1PQNA 4ZL9A 3ZLPA 2IL3A 2DJKA 3Q6OA 3NZNA 3U6VA 4DSSA 3GTUB 1OC8A 4MJEA 1DUGA 1OKTA 3I69A 1QGVA 3O3TA 3D0ZA 2OKAA 5IMCA 13GSA 2IN3A 3MWHA 5D9WA 2ON5A 1QXHA 5IPGA 4NXIA 10GSA 5DAKA 3N5OA 4LMWA 3US3A 4NAXA 5A4WA 2HSMA 5IMVA 1A2JA 4GSNA 4F9ZA 1V2AA 5F06A 1CQHA 3BBYA 4K8MA 7GSSA 1K0NA 4OCFA 3HA9A 1R5PA 5DCHA 4L0UA 4MJAA 1O81A 3FRCA 3F3RA 1PN9A 2A2SA 2HRNA 2OBIA 3IBHA 3CBUA 1SKWB 4AJ6A 4AGSA 5EPFA 4ZILA 2GSRA 3ZFBA 1JLVA 4YQVA 3GN3A 1G6WA 4GRFA 1C72A 4HQSA 4TXOB 3GH9A 2DSAA 2N5AA 4POKA 2YWNA 2I4AA 3LGCA 3WD6A 5AGYA 2A2RA 4OFNA 3LYPA 5FHIA 4K0NA 1SD8A 1OC3A 2GVPA 4E8HA 3W6GA 4EKZA 2C0FA 4RQXA 3HHVA 2B3SA 4NPBA 3GRXA 3VWVA 2CAIA 1SJIA 5HFGA 3ZIJA 1K3YA 5IOXA 2H73A 3HDCA 1O6JA 3OR5A 3VWXA 3BCIA 2LEGA 1FHEA 1EZKA 1R5AA 2WS2A 5J41A 2HNLA 1F3AA 2CAQA 2HRFA 2LS5A 4XS4A 2YJ7A 2HT9A 1TJDA 3FZAA 1GSEA 1O8XA 3C1RA 1VF4A 3DKSA 2LQQA 4MABA 5D8IA 2GQLA 2XPDA 3F6DA 1THOA 4L5OA 4L8EA 1GSSA 2VL9A 1SKRB 2HRKB 1J9BA 1TK5B 3DXBA 3M1GA 3FR9A 2VL3A 3IAS2 2JADA 4V1Ag 1PL1A 4OCEA 4TRXA 1K3OA 3ZYWA 1A0RP 1GTIA 1ZL9A 1YKAA 3HJOA 1TOFA 19GSA 3QPMA 4BL7A 4WXTA 2PWJA 4RUVA 1QFNA 4IBPA 4ACSA 3UBLA 2HYXA 3HJPA 3IK7A 2JSZA 2VOCA 1WWJA 1U3IA 3HKRA 4E8EA 1B9YC 4X1UA 5B7CA 1ILOA 4YAVA 3EC3A 3TGZA 1V40A 3P90A 5AIVA 5F07A 4EDZA 5ECHB 5ECMB 1XW5A 2EIOA 2DJ2A 2I3YA 9GSSA 3ZREA 2YV9A 1ERTA 4PQ1A 4JR6A 3F6FA 4KSMA 5J4UA 1N2AA 4BVXA 2HLSA 3UMAA 3M3MA 1IYIA 2REMA 3GNJA 1T7PB 1TP9A 1WP0A 4NV5A 1X5CA 2HI7A 3IC4A 1N8JA 4N30A 3ME7A 1EOHA 4TOPA 1V9WA 2I9HA 2IMKA 4WR5A 3DGQA 4HZ4A 2V2GA 1K3LA 2O89A 2WDUA 3IAM2 3APQA 1Y6EA 1BAYA 1FO5A 4F82A 1M7TA 3L0HA 3KJYA 4RI6A 5AISA 4IQAA 1U6TA 4GSSA 1USBA 2RLIA 1MDKA 1PX7A 2BMXA 1TXXA 2WFCA 5BMUA 3FZ9A 1NW2A 3CRTA 3FYGA 2C3QA 4D73B 2HFDA 1W4VA 3ED3A 2VLUA 2GSQA 2H01A 4L0WA 2NVLA 2F3MA 2I81A 2YANA 2EIQA 3ERGA 4MMMA 3MNGA 1EV9A 2TRXA 1XBSA 1B8XA 1M2BA 4HI7A 2AV4A 5JWOB 2DLXA 5G30A 1E6BA 3UEMA 5ECSA 1A2LA 4EO3A 3WGXA 1F2EA 3HCZA 3G7YA 1SENA 2K18A 2GGTA 3F3QA 1M2AA 3IRAA 3M8NA 2LSTA 3F4RA 1ZYEA 3EU3A 4FYCA 1KBNA 3I43A 3H4KA 4V1Ap 1SKSB 1F37A 4BVYA 2DBCA 2DIZA 1SJ6A 1YEXA 3H1NA 4IS0A 4CDOA 1LU4A 1A24A 3GL3A 1I5GA 4YQMA 4GF0A 2FCHA 3L9UA 4ECCA 2PUKC 3KD0A 3TUEA 1V98A 3CSIA 1XOAA 4KUNA
chains in the Genus database with same CATH superfamily
2WW1A 1S3DA 11GSA 2GTUA 1AQXA 4XHMA 3GSTA 3C8EA 5IMFA 4XRDA 1Z6MA 5AIXA 4EC0A 4QMKA 3MSZA 5E4WA 1X5DA 3DWVA 5A4VA 2H6XA 4KDYA 3L9VA 1SL2B 1ERWA 2YV7A 4DSRA 4HOJA 1GTAA 2NPBA 2V6OA 5JCUA 1GNWA 3MDKA 2L57A 5ECNB 2IJYA 1YY7A 4DSQA 5GAPD 1A0FA 5AN1A 4KCAA 5HQPA 4POMA 3M0FA 1T3BA 4AJ7A 5C04A 2VM2A 3QOUA 1Y1UA 5CAXA 4W66A 1TW9A 5ELGA 4I2UA 2KLXA 1GLPA 4OMVA 2R0PA 3DMLA 3EU4A 5KN3A 1DE1A 3H93A 1TKDB 4PUFC 4MJBA 5D9TA 3QAGA 5E59A 2L6DA 1A8LA 2QC7A 22GSA 2BTOT 5A1NA 1OC9B 2ON7A 2OA7A 1OYJA 2FWGA 3L4NA 2Z9SA 2NBSA 1EV4A 3L9SA 4FH8A 2EFDA 4EUYA 4JR4A 2GZYA 2K8VA 4TR1B 3EWLA 5EL8A 1QUWA 2GS3A 4HEA2 3TRQA 2VL2A 2L59A 1OKDA 2WB9A 3GKNA 3CRUA 6GSYA 4BIKA 4KGIA 4JRRA 1PSQA 5J47A 2HE3A 4Z7XA 2AHEA 2KP2A 2H0HA 5IM9A 3HVSA 5CRHA 3G9BA 1U88A 3LJRA 2MZCA 4G19A 1ACVA 2AJQB 3H79A 3GV1A 5EY6A 3CHXC 5ID2B 5GSTA 4TVEA 3D22A 4I2TA 3APSA 4F0BA 3KZQA 1HNCA 3IK9A 2OBKA 5CP1A 2M72A 2OJLA 2B1LA 3GX0A 2HSNB 4IELA 3C7MA 3FZ5A 4MA9A 1S4BP 5DCGA 3GKXA 3TJGA 4N11A 4MLYA 2X49A 4EDYA 3GHAA 5ECLB 1M9AA 3WT1A 1BQ7A 1O7UA 4NHWA 4ZIJA 1FOVA 4XS6A 5CRGA 1K0DA 2JSYA 5JWQB 1MEKA 3UIWA 3VWWA 2DJ1A 5FWGA 14GSA 3RHBA 2C8UA 5D9VA 2RUEA 6GSWA 4KDXA 3WYWA 2YNXA 1Q98A 3IA1A 2EIRA 2FNOA 4XS4B 2J9HA 4KDUA 3KTBA 2EFEA 4RQRA 6GSUA 4IJIA 2X8GA 4NV2A 4RI7A 3TKRA 2LNSA 5FT3A 4KNDA 4IQ1A 5JCWA 2MYGA 4PQHA 2VLTA 2DIYA 2HQTA 4HDEA 1HD2A 2LNTA 1EEMA 2E2MA 2C4JA 3IOSA 2X8CA 4PQIA 4YQUA 2PMTA 1AAZA 4AJ8A 2O85A 1OAZA 2R0CA 4BL7B 3KTLA 2AUVA 1FW1A 3EVIA 2PPTA 2DJJA 2H76A 3TDGA 1J0FA 3APOA 4TKYA 3JCML 3CSHA 4OFTA 4WF4A 2VCTA 2WVXB 3RBTA 1YJ6A 2ZCTA 2VLVA 1YF1A 3UAPA 3VURA 2H6ZA 1XWCA 4IHUA 4V2MA 4ZB9A 4WR4A 2D2ZA 2GSSA 3TU3B 2FWFA 5ELAA 3DVWA 3GL5A 1K0AA 2GSTA 5JWRB 1PFOA 3WT2A 3FEUA 3TJFA 3HVXA 3A2WA 3TJBA 1AXDA 2QSIA 3DYRA 2RIIA 1SU9A 3MAKA 1YEWC 1HQOA 4LL4B 2GZZA 1J08A 1XWBA 1U3AA 1SK2A 4ML6A 2C80A 4Z2RA 3QAVA 2C0EA 1PKZA 3EMXA 3TJKA 4K2XA 2YZUA 3TKPA 2VCQA 3UVHA 4OWYA 4N10A 1SVMA 3E0UA 2VUPA 2FWHA 2F9SA 2V1MA 17GSA 2C3NA 2FUG2 4Q5FA 1BYEA 2GLRA 1KEBA 3GTUA 5J4YA 3EMPA 1G0TA 2NTOA 1YZXA 5J3RA 4BWQA 5J4VA 2H66A 1VF3A 4IP6A 4ML1A 3AY8A 2H1LA 4POLA 3J7Yb 3IDVA 2IFQB 3HMJG 4X43A 3BCKA 5D93A 3FW2A 2PERA 2O5VA 2R3XA 5INYA 4XRAA 4AF2A 2XC2A 1LBKA 4H86A 4ULXA 5A34A 1R4WA 2OE0A 1EGRA 4G0LA 2H1BA 2OT3A 4GLTA 3GURA 3ISOA 1WOUA 3CXGA 4YH2A 5ENUA 1I1IP 4Q5RA 3PGTA 4XTSA 3UARA 4KF9A 2O7KA 2P0GA 2AAWA 4KAEA 2JZSA 1K0CA 1TXUA 3W8SA 2CV4A 2HSHA 4JEDA 3TOTA 2OACA 4TXOA 4O32A 1FVJA 2VCWA 3O76A 3KEBA 5GZZB 4MNNA 5HR0A 4N3ZA 3FMWA 1TDIA 3SWLA 4GCIA 3D4TA 3ERFA 1Z5YE 2H30A 2XPEA 1R26A 4GWRA 2PBJA 1B4QA 1NSWA 2X8HA 3TJJA 2DKHA 3KGKA 4G9HA 1XVQA 3NOFA 3WGDA 2P5RA 5CRDA 5B6NA 3RPPA 2B7JA 2VCZA 4HUAA 5HR2A 1YQ1A 4PTSA 1ML6A 4ILFA 3TKSE 1T4YA 4AKXB 1UC7A 1SJZA 1BJXA 3HZ8A 1XOBA 5F8BA 3IR4A 1G7EA 1F9MA 2L4CA 2WCIA 1XFLA 3DIEA 2C3TA 1GSFA 6GSVA 4PNFA 2R2JA 2VM1A 2H1GA 1PRXA 4HJ2A 5DJMA 5LCZA 1EWXA 5IOWA 4JE1A 2QA1A 3ME8A 1A2MA 3HVNA 1GTUA 2H72A 2X99A 1ZMAA 2O3EA 2FY6A 2PU9C 4K1FA 4ECJA 2EC4A 3CTFA 2C0GA 1O8WA 4WKWA 3KMOA 2N5BA 2L4QA 4BPYA 3N9JA 1ABAA 6GSTA 4FQUA 1XIYA 1JZDA 1WPIA 3FZ4A 1GRXA 3TOUA 4O5RA 1K0OA 4NMUA 2YCDA 2DJ3A 2WULA 2K6VA 2CZ2A 2JZRA 5DVBA 2XHFA 4N0ZA 4ZBBA 2P31A 1M0UA 2LV3A 5A5HA 3RDWA 3LSZA 4KSOA 3ZITA 2LUSA 2L5LA 5A1NB 4ID0A 6GSXA 2CX4A 1XWGA 2B6MA 3VK9A 5KEJA 1S3CA 4TXVA 1TRUA 4PGTA 2WJUA 4HQZA 3Q19A 4K5SA 4K7NA 1BEDA 3GX8A 3E9JB 2IMEA 2R0GA 2GDRA 5EVOA 3HVVA 4MF7A 5ECOB 5CNWA 4O92A 3UVTA 4ZB6A 2R6KA 3HZ4A 1KNGA 2CQ9A 1TK0B 5IO2A 5F05A 2VCVA 1AUCA 2H71A 2PVOC 4K0GA 4PI2C 3ZTLA 2RUFA 1NHYA 2IPAA 1Z9HA 1SL0B 2HSYA 4KB3A 2V32A 2HRAA 1B9XC 1JLWA 3KH9A 1PA3A 5JCGA 4DEJA 1TK8B 1GWCA 4ECBA 5J9CA 1SK0A 3R2QA 5HFIA 1ST9A 4K9ZA 4IKHA 2H70A 2NDOA 4KCEA 3Q74A 2CZ3A 1AIUA 1HNBA 4KE3A 2B5XA 4MZCA 3HXSA 5A5KA 5DALA 1OE7A 3TCOA 4D73A 3TB2A 4IP1A 2RM6A 1JZWA 2CVDA 5G5FA 3HJMA 5CO3A 12GSA 2E2GA 3LG6A 3GKKA 3IHQA 1U87A 1W89A 2MBSA 4IGJA 4F03A 2G2QA 4MZWA 2VL2C 2HZEA 4Q5NA 4JU5A 4BWSA 1VF2A 1MDIA 3TRPA 4GSTA 1MD4A 1AQVA 1QQ2A 4EE0A 2QA2A 3GH6A 2VAFA 1GL8A 1DSBA 4MH3A 2WRTA 5KN2A 4DSSB 3ZFLA 2IMFA 4NHZA 3C73A 3LFLA 4IVFA 1F3BA 3QD9A 2VD0A 1PL2A 1TRWA 3TKSC 1YDKA 2B1KA 4PURA 4ICYA 1X9SB 2YWOA 4Z2UA 4EF0A 1SK1A 3UBKA 1TRVA 1A23A 3BD2A 2H6YA 2L5OA 4G0KA 20GSA 3D5JA 3VPTA 3IC8A 5IMZA 1DE2A 1ZGNA 5DAKB 4ZXGA 4J56E 2R5GA 2HSMB 3DRNA 3QFBC 1TU8A 1XXUA 2UZ8A 1VGLA 4FIWA 4TW5A 1YF0A 1GTBA 4K7OA 1T8EB 4HS1A 1OVNA 4G01A 1TI1A 6GSSA 4TR0A 3PINA 4WBJA 5LD0A 1NHOA 3TKSA 1K0BA 2H74A 3CYNA 16GSA 4PX1A 1FAAA 2DKIA 2JU5A 3FHKA 1V58A 4G2EA 1RW1A 2DJ0A 5KN1A 3MIXA 1EP8A 2P5QA 4LL1B 2E0QA 3F63A 1WMJA 5ECPB 4PHZC 4ZB8A 3F4SA 3I9V2 2GT6A 3EE2A 3D21A 3BJ5A 5KOWA 1ZYNA 2MMNA 2MBTA 4MK3A 2IMIA 3ZMLA 3EURA 1GLQA 5J5NA 1GUHA 4AKHA 3VPQA 2I1UA 2YZHA 2K8SA 3A2VA 4EIPA 1XVWA 2LJKA 5IMDA 4LMVA 18GSA 2YN1A 3C71A 5DQYA 1UA5A 1ERUA 1K0MA 1BX9A 4OFMA 4I6XA 1B48A 1O85A 3UJ1A 4MP4A 4MZBA 5ECQB 1S3RA 3S9FA 2R4VA 2XBQA 2FWEA 5G31A 4EVMA 4FYBA 5CRWA 1OC9A 3KMNA 1HYUA 3RAZA 1Z6NA 4XIHA 1JZRA 2X64A 1PN0A 1TTZA 5G5EA 4WEYA 4MPFA 4FYUA 1THXA 1WJKA 4OD7A 5LNKe 1GUMA 1F6MC 2XBIA 4KA0A 4TR1A 2O8VB 3IXRA 5IPHA 5B8BA 2ALBA 4G0IA 1EOGA 1EGOA 2GQMA 3LWAA 4X4JA 2KHPA 3C1SA 4KH7A 3VLNA 3ZMKA 1SL1B 1AW9A 2N5FA 4E68A 5D9XA 1FB6A 4TR4A 1JHBA 2KUCA 1GNEA 3HY2A 4I8BA 1DBYA 2A4VA 1I9DA 1QK8A 5ID2A 1PKWA 3KP8A 4JBBA 1QMVA 4J2FA 4K2DA 2H75A 1SVLA 4J57E 3WGEA 2HSNA 4BVXB 5HR1A 5HR3A 1PX6A 1CQGA 2LJAA 3RHCA 5G2ZA 2JL4A 4EIQA 5IIZA 5IO0A 5DJLA 2CT6A 3DVXA 3GIXA 4V2NA 2UV8G 4USSA 4HZ2A 1GSYA 3O6TA 4OO5A 1A8YA 3EYTA 1BF5A 4DVCA 4Z2TA 3VI7A 2IMDA 4LLRA 1BG5A 4LA1A 1IYHA 2MMOA 1Z7RA 4O5UA 2H19A 5BMUB 3FR3A 2O87A 2TRCP 3BOAA 2OE3A 3KM6A 1X5EA 5KN0A 4GTUA 2LRTA 3EINA 1B4PA 2MMAA 4NWYA 4PXOA 4F0CA 4EL1A 2VIMA 4I97A 1SD9A 3LXZA 1HNAA 5D73A 3GKMA 4CY8A 4OO4A 2IIYA 3LW9A 1XW9A 1N25A 4V2LA 1T4ZA 2L6CA 1MD3A 3ZIVA 1X9MB 1SVOA 2HXKA 1YEPA 2WW2A 4ZL7A 1AQWA 4ECIA 3RPNA 4GQFA 3ZVJD 2H0GA 2FD3A 4I5QA 2DMMA 2WZSA 2WZ9A 4P3YB 2LTKA 4PI0C 5COHA 4BVYB 2WVXA 5GSSA 5A5HB 4HU7A 4MPGA 2QGVA 4AKIA 4A5PA 1JZOA 2F8AA 5J9BA 4K7IA 5L71A 5CYYA 3KP9A 1GP1A 3Q18A 2LRNA 4CHSA 1GSUA 3VFIA 3DD3A 2GT5A 3A5IA 4N0VA 1WRYA 5ABRA 3A5WA 4HJMA 8GSSA 3A2XA 2X4AA 5F0GA 1H75A 4KX4A 4PNGA 2CX3A 2YPMA 4IN0A 2GQKA 1V57A 1YKCA 2KP1A 3IPZA 1PMTA 4ISDA 2E7PA 4QQ7A 2VO4A 4FO5A 1JFUA 3K8NA 3DEXA 5H5SA 1XWAA 5ECKB 4IW9A 2J23A 3P2AA 1PD21 3FR6A 1KTEA 1WE0A 3LQ7A 1ZZYA 2HRKA 1NM3A 2YWIA 3IV4A 3HYPA 3QR6A 1UN2A 4YAPA 5DALB 4ZBAA 2IWTA 1OE8A 4MF6A 3LYKA 1LJRA 3F4TA 1M9BA 1VRSD 2LKUA 1FB0A 4JZQA 3L78A 2HZEB 3P8WA 1FG4A 2IFQA 1ZOFA 4YKGA 1GSQA 1Q4JA 2WVYA 5ECIB 3E3EA 1GH2A 1GUKA 2ES7A 2OADA 1XWKA 2QKEA 3QCPA 3SBCA 5IMAA 4X0XA 1G7OA 3A3TA 4GXZA 3G7JA 2H8LA 3GMFA 3NIVA 1URMA 1WIKA 2WW0A 2C1YA 4TN8A 2YJHA 3H8QA 2F8FA 1TI3A 2AYTA 5G1KA 2KOKA 4CW9A 5DQSA 2JACA 2VKZG 2WGRA 3GUSA 5ECRB 2AB6A 2V41A 4PUAA 2F51A 3ZZXA 4EXJA 2YP6A 4AKGA 1ZCPA 3CMIA 2H0IA 3M9JA 3FY7A 3PH9A 1XZOA 2H1AA 2B7KA 1TU7A 1Z7PA 2B5YA 1X9WB 4Q5QA 2C0DA 1M2DA 3VWUA 3MYDA 5D96A 1MDJA 4MJCA 4GQCA 4FXYP 3U5RE 1TRSA 5IQYA 1Z3EA 1UVZA 3PPUA 4K6XA 1GSDA 3KH7A 3TKQA 4K5RA 3CTGA 3IHGA 5B6MA 1T1VA 1AC1A 1SYXA 2PGTA 2LQOA 2TIRA 3J7Yk 4MH2A 4O7HA 1PGTA 4AI6A 2V6KA 2PN8A 1X0RA 2RM5A 1VF1A 3QDNA 2VD1A 4BA7A 1ERVA 3F8UA 2DC5A 5B8AA 1GULA 1XW6A 2CVBA 4XCSA 2DMLA 5C00A 4F2IA 2LRCA 1EP7A 4WF5A 3GFKA 3FKFA 2VCXA 4ZB7A 1M99A 4HU9A 3D4MA 2WW3A 3R3EA 3QMXA 1XCCA 4WETA 3F9UA 1XPVA 4QL9A 1BG1A 3P7XA 1ZYQB 5DBQA 2YOIA 1T00A 1O73A 4MF5A 2FLSA 1RQMA 2JZTA 3KIJA 1H4OA 3I6AA 3QFAC 3ZRDA 1R7HA 4QL7A 2H1DA 2YWMA 3HD5A 2ZUPA 1EEJA 2K9FA 3LORA 4IJ3A 5G1LA 2FGXA 3D6IA 4G10A 4TR3A 4L5LA 2CA8A 3TRXA 2BJXA 3LXTA 2FHEA 3W8JA 1MTCA 3FK8A 3GSSA 2LJRA 2GZPA 3CQFA 2R37A 3ZVJA 5HFKA 3UL3A 5J40A 3F0IA 1S3AA 2B5EA 5H5RA 3CSJA 3QAWA 1E2YA 2ZNMA 2MMZA 1FVKA 3IE3A 3UOMA 5DDLA 4POBA 3V1WA 2HZFA 5GAND 4ZL8A 5CREA 4ZBDA 3KCMA 2EFHA 2OE1A 3GA4A 4MDCA 3G7IA 1SYRA 2G0FA 1G6YA 4KW6A 4WBRD 2M80A 2M46A 4XS1A 5A4UA 2O36A 1RK4A 3VI5A 5H5QA 3PR8A 4MCUA 2PVQA 3KXOA 3M9KA 3ERWA 4GDFA 3ZL5A 3LEFA 2CVKA 1Y25A 2FA4A 1ON4A 3GYKA 2FA8A 1PQNA 4ZL9A 3ZLPA 2IL3A 3EPTA 2DJKA 3Q6OA 3NZNA 3U6VA 2EFCA 4DSSA 3GTUB 1OC8A 4MJEA 1DUGA 1OKTA 3I69A 1QGVA 3O3TA 3D0ZA 2OKAA 5IMCA 13GSA 2IN3A 3MWHA 4CY6A 5D9WA 2ON5A 1QXHA 5IPGA 4NXIA 10GSA 1M3JA 5DAKA 3N5OA 4LMWA 3US3A 4NAXA 5A4WA 2HSMA 5IMVA 1A2JA 4GSNA 4F9ZA 1V2AA 5F06A 1CQHA 3BBYA 5A34B 4K8MA 7GSSA 1K0NA 2A2PA 4OCFA 3HA9A 1R5PA 5DCHA 4L0UA 4MJAA 1O81A 3FRCA 3F3RA 1PN9A 2A2SA 2HRNA 2OBIA 3IBHA 3CBUA 1SKWB 4AJ6A 4AGSA 5EPFA 4ZILA 2GSRA 3ZFBA 1JLVA 4YQVA 3GN3A 1G6WA 4GRFA 1C72A 4HQSA 4TXOB 3GH9A 2DSAA 2N5AA 4POKA 2YWNA 2I4AA 3LGCA 3WD6A 5AGYA 2A2RA 4OFNA 3LYPA 5FHIA 4K0NA 1SD8A 1M3IA 1OC3A 2GVPA 4E8HA 3W6GA 4EKZA 2C0FA 4RQXA 3HHVA 2B3SA 4NPBA 3GRXA 3VWVA 2CAIA 1SJIA 5HFGA 3ZIJA 1K3YA 5IOXA 2H73A 3HDCA 1O6JA 3OR5A 3VWXA 3BCIA 2LEGA 1FHEA 1EZKA 1R5AA 2WS2A 5J41A 2HNLA 1F3AA 2CAQA 1ZYPA 2HRFA 2LS5A 4XS4A 2YJ7A 2HT9A 1TJDA 3FZAA 1GSEA 1O8XA 3C1RA 1VF4A 3DKSA 2LQQA 4MABA 5D8IA 2GQLA 2XPDA 3F6DA 1THOA 4L5OA 4L8EA 1GSSA 2VL9A 1SKRB 2HRKB 1J9BA 1TK5B 3DXBA 3M1GA 3FR9A 2VL3A 3IAS2 2JADA 4V1Ag 1PL1A 4OCEA 4TRXA 5BRTA 1K3OA 3ZYWA 1A0RP 1GTIA 1ZL9A 1YKAA 3HJOA 1TOFA 19GSA 3QPMA 4BL7A 4WXTA 3RGBC 2PWJA 4RUVA 1QFNA 4IBPA 4ACSA 3UBLA 2HYXA 3HJPA 3IK7A 2JSZA 2VOCA 1WWJA 1U3IA 1YVLA 3HKRA 4E8EA 1B9YC 4X1UA 5B7CA 1ILOA 4YAVA 3EC3A 3TGZA 1V40A 3P90A 5AIVA 5F07A 4EDZA 5ECHB 5ECMB 1XW5A 2EIOA 2DJ2A 2I3YA 9GSSA 3ZREA 2YV9A 1ERTA 5KOXA 4PQ1A 4JR6A 3F6FA 4KSMA 5J4UA 1N2AA 4BVXA 2HLSA 3UMAA 3M3MA 1IYIA 2REMA 3GNJA 1T7PB 1TP9A 1WP0A 2WVZA 4NV5A 1X5CA 2A4HA 2HI7A 3IC4A 1N8JA 4N30A 3ME7A 1EOHA 4YKFA 4TOPA 1V9WA 2I9HA 2IMKA 4WR5A 3DGQA 4HZ4A 2V2GA 1K3LA 2O89A 2WDUA 3IAM2 3APQA 1Y6EA 1BAYA 1FO5A 4F82A 3RFRC 1M7TA 3L0HA 3KJYA 4RI6A 5AISA 4IQAA 1U6TA 4GSSA 1USBA 2RLIA 1MDKA 1PX7A 2BMXA 1TXXA 2WFCA 5BMUA 3FZ9A 1NW2A 3CRTA 3FYGA 2C3QA 4D73B 2HFDA 1W4VA 3ED3A 2VLUA 2GSQA 2H01A 1XG8A 4L0WA 2NVLA 2F3MA 2I81A 2YANA 2EIQA 3ERGA 4MMMA 3MNGA 1EV9A 2TRXA 1XBSA 1B8XA 1M2BA 4HI7A 2AV4A 5JWOB 2DLXA 5G30A 1E6BA 3UEMA 5ECSA 1FOHA 1A2LA 4EO3A 3WGXA 1F2EA 3HCZA 3G7YA 1SENA 2K18A 4HSCX 2GGTA 3F3QA 1M2AA 3IRAA 3M8NA 2LSTA 3F4RA 1ZYEA 3EU3A 4FYCA 1KBNA 3I43A 3H4KA 4V1Ap 1SKSB 1F37A 4BVYA 2DBCA 3CWGA 2DIZA 1SJ6A 1YEXA 3H1NA 4IS0A 4CDOA 1LU4A 1A24A 3GL3A 1I5GA 4YQMA 4GF0A 2FCHA 3L9UA 4O5QA 4ECCA 2PUKC 3KD0A 3TUEA 1V98A 3CSIA 1XOAA 4KUNA
chains in the Genus database with same CATH topology
1S3DA 11GSA 2GTUA 1AQXA 4XHMA 3GSTA 3C8EA 5IMFA 4XRDA 1Z6MA 5AIXA 4EC0A 4QMKA 3MSZA 5E4WA 1X5DA 3DWVA 5A4VA 2H6XA 4KDYA 3L9VA 1SL2B 1ERWA 2YV7A 4DSRA 4HOJA 1GTAA 2NPBA 2V6OA 5JCUA 1GNWA 3MDKA 2L57A 5ECNB 2IJYA 1YY7A 4DSQA 5GAPD 1A0FA 5AN1A 4KCAA 5HQPA 4POMA 3M0FA 1T3BA 4AJ7A 5C04A 2VM2A 3QOUA 1Y1UA 5CAXA 4W66A 1TW9A 5ELGA 4I2UA 2KLXA 1GLPA 4OMVA 2R0PA 3DMLA 3EU4A 5KN3A 1DE1A 3H93A 1TKDB 4PUFC 4MJBA 5D9TA 3QAGA 5E59A 2L6DA 1A8LA 2QC7A 22GSA 2BTOT 5A1NA 1OC9B 2ON7A 2OA7A 1OYJA 2FWGA 3L4NA 2Z9SA 2NBSA 1EV4A 3L9SA 4FH8A 2EFDA 4EUYA 4JR4A 2GZYA 2K8VA 4TR1B 3EWLA 5EL8A 1QUWA 2GS3A 4HEA2 3TRQA 2VL2A 2L59A 1OKDA 2WB9A 3GKNA 3CRUA 6GSYA 4KGIA 4JRRA 1PSQA 5J47A 2HE3A 4Z7XA 2AHEA 2KP2A 2H0HA 5IM9A 3HVSA 5CRHA 3G9BA 1U88A 3LJRA 2MZCA 4G19A 1ACVA 2AJQB 3H79A 3GV1A 5EY6A 5ID2B 5GSTA 4TVEA 3D22A 4I2TA 3APSA 4F0BA 3KZQA 1HNCA 3IK9A 2OBKA 5CP1A 2M72A 2OJLA 2B1LA 3GX0A 2HSNB 4IELA 3C7MA 3FZ5A 4MA9A 5DCGA 3GKXA 3TJGA 4N11A 4MLYA 2X49A 4EDYA 3GHAA 5ECLB 1M9AA 3WT1A 1BQ7A 1O7UA 4NHWA 4ZIJA 1FOVA 4XS6A 5CRGA 1K0DA 2JSYA 5JWQB 1MEKA 3UIWA 3VWWA 2DJ1A 5FWGA 14GSA 3RHBA 2C8UA 5D9VA 2RUEA 6GSWA 4KDXA 3WYWA 2YNXA 1Q98A 3IA1A 2EIRA 2FNOA 4XS4B 2J9HA 4KDUA 3KTBA 2EFEA 4RQRA 6GSUA 4IJIA 2X8GA 4NV2A 4RI7A 3TKRA 2LNSA 5FT3A 4KNDA 4IQ1A 5JCWA 2MYGA 4PQHA 2VLTA 2DIYA 2HQTA 4HDEA 1HD2A 2LNTA 1EEMA 2E2MA 2C4JA 3IOSA 2X8CA 4PQIA 4YQUA 2PMTA 1AAZA 4AJ8A 2O85A 1OAZA 2R0CA 4BL7B 3KTLA 2AUVA 1FW1A 3EVIA 2PPTA 2DJJA 2H76A 3TDGA 1J0FA 3APOA 4TKYA 3JCML 3CSHA 4OFTA 4WF4A 2VCTA 3RBTA 1YJ6A 2ZCTA 2VLVA 1YF1A 3UAPA 3VURA 2H6ZA 1XWCA 4IHUA 4V2MA 4ZB9A 4WR4A 2D2ZA 2GSSA 3TU3B 2FWFA 5ELAA 3DVWA 3GL5A 1K0AA 2GSTA 5JWRB 3WT2A 3FEUA 3TJFA 3HVXA 3A2WA 3TJBA 1AXDA 2QSIA 3DYRA 2RIIA 1SU9A 3MAKA 1HQOA 4LL4B 2GZZA 1J08A 1XWBA 1U3AA 1SK2A 4ML6A 2C80A 4Z2RA 3QAVA 2C0EA 1PKZA 3EMXA 3TJKA 4K2XA 2YZUA 3TKPA 2VCQA 3UVHA 4OWYA 4N10A 1SVMA 3E0UA 2VUPA 2FWHA 2F9SA 2V1MA 17GSA 2C3NA 2FUG2 4Q5FA 1BYEA 2GLRA 1KEBA 3GTUA 5J4YA 3EMPA 1G0TA 2NTOA 1YZXA 5J3RA 4BWQA 5J4VA 2H66A 1VF3A 4IP6A 4ML1A 3AY8A 2H1LA 4POLA 3J7Yb 3IDVA 2IFQB 3HMJG 4X43A 3BCKA 5D93A 3FW2A 2PERA 2O5VA 2R3XA 5INYA 4XRAA 4AF2A 2XC2A 1LBKA 4H86A 4ULXA 5A34A 1R4WA 2OE0A 1EGRA 4G0LA 2H1BA 2OT3A 4GLTA 3GURA 3ISOA 1WOUA 3CXGA 4YH2A 5ENUA 4Q5RA 3PGTA 4XTSA 3UARA 4KF9A 2O7KA 2P0GA 2AAWA 4KAEA 2JZSA 1K0CA 1TXUA 3W8SA 2CV4A 2HSHA 4JEDA 3TOTA 2OACA 4TXOA 4O32A 1FVJA 2VCWA 3O76A 3KEBA 5GZZB 4MNNA 5HR0A 4N3ZA 3FMWA 1TDIA 3SWLA 4GCIA 3D4TA 3ERFA 1Z5YE 2H30A 2XPEA 1R26A 4GWRA 2PBJA 1B4QA 1NSWA 2X8HA 3TJJA 2DKHA 3KGKA 4G9HA 1XVQA 3NOFA 3WGDA 2P5RA 5CRDA 5B6NA 3RPPA 2B7JA 2VCZA 4HUAA 5HR2A 1YQ1A 4PTSA 1ML6A 4ILFA 3TKSE 1T4YA 4AKXB 1UC7A 1SJZA 1BJXA 3HZ8A 1XOBA 5F8BA 3IR4A 1G7EA 1F9MA 2L4CA 2WCIA 1XFLA 3DIEA 2C3TA 1GSFA 6GSVA 4PNFA 2R2JA 2VM1A 2H1GA 1PRXA 4HJ2A 5DJMA 5LCZA 1EWXA 5IOWA 4JE1A 2QA1A 3ME8A 1A2MA 1GTUA 2H72A 2X99A 1ZMAA 2FY6A 2PU9C 4K1FA 4ECJA 2EC4A 3CTFA 2C0GA 1O8WA 4WKWA 3KMOA 2N5BA 2L4QA 4BPYA 3N9JA 1ABAA 6GSTA 4FQUA 1XIYA 1JZDA 1WPIA 3FZ4A 1GRXA 3TOUA 4O5RA 1K0OA 4NMUA 2YCDA 2DJ3A 2WULA 2K6VA 2CZ2A 2JZRA 5DVBA 2XHFA 4N0ZA 4ZBBA 2P31A 1M0UA 2LV3A 5A5HA 3RDWA 3LSZA 4KSOA 3ZITA 2LUSA 2L5LA 5A1NB 4ID0A 6GSXA 2CX4A 1XWGA 2B6MA 3VK9A 5KEJA 1S3CA 4TXVA 1TRUA 4PGTA 2WJUA 4HQZA 3Q19A 4K5SA 4K7NA 1BEDA 3GX8A 3E9JB 2IMEA 2R0GA 2GDRA 5EVOA 3HVVA 4MF7A 5ECOB 5CNWA 4O92A 3UVTA 4ZB6A 2R6KA 3HZ4A 1KNGA 2CQ9A 1TK0B 5IO2A 5F05A 2VCVA 1AUCA 2H71A 2PVOC 4K0GA 3ZTLA 2RUFA 1NHYA 2IPAA 1Z9HA 1SL0B 2HSYA 4KB3A 2V32A 2HRAA 1B9XC 1JLWA 3KH9A 1PA3A 5JCGA 4DEJA 1TK8B 1GWCA 4ECBA 5J9CA 1SK0A 3R2QA 5HFIA 1ST9A 4K9ZA 4IKHA 2H70A 2NDOA 4KCEA 3Q74A 2CZ3A 1AIUA 1HNBA 4KE3A 2B5XA 4MZCA 3HXSA 5A5KA 5DALA 1OE7A 3TCOA 4D73A 3TB2A 4IP1A 2RM6A 1JZWA 2CVDA 5G5FA 3HJMA 5CO3A 12GSA 2E2GA 3LG6A 3GKKA 3IHQA 1U87A 1W89A 2MBSA 4IGJA 4F03A 2G2QA 4MZWA 2VL2C 2HZEA 4Q5NA 4JU5A 4BWSA 1VF2A 1MDIA 3TRPA 4GSTA 1MD4A 1AQVA 1QQ2A 4EE0A 2QA2A 3GH6A 2VAFA 1GL8A 1DSBA 4MH3A 2WRTA 5KN2A 4DSSB 3ZFLA 2IMFA 4NHZA 3C73A 3LFLA 4IVFA 1F3BA 3QD9A 2VD0A 1PL2A 1TRWA 3TKSC 1YDKA 2B1KA 4PURA 4ICYA 1X9SB 2YWOA 4Z2UA 4EF0A 1SK1A 3UBKA 1TRVA 1A23A 3BD2A 2H6YA 2L5OA 4G0KA 20GSA 3D5JA 3VPTA 3IC8A 5IMZA 1DE2A 1ZGNA 5DAKB 4ZXGA 4J56E 2R5GA 2HSMB 3DRNA 3QFBC 1TU8A 1XXUA 2UZ8A 1VGLA 4FIWA 4TW5A 1YF0A 1GTBA 4K7OA 1T8EB 4HS1A 1OVNA 4G01A 1TI1A 6GSSA 4TR0A 3PINA 4WBJA 5LD0A 1NHOA 3TKSA 1K0BA 2H74A 3CYNA 16GSA 4PX1A 1FAAA 2DKIA 2JU5A 3FHKA 1V58A 4G2EA 1RW1A 2DJ0A 5KN1A 3MIXA 1EP8A 2P5QA 4LL1B 2E0QA 3F63A 1WMJA 5ECPB 4ZB8A 3F4SA 3I9V2 2GT6A 3EE2A 3D21A 3BJ5A 5KOWA 1ZYNA 2MMNA 2MBTA 4MK3A 2IMIA 3ZMLA 3EURA 1GLQA 5J5NA 1GUHA 4AKHA 3VPQA 2I1UA 2YZHA 2K8SA 3A2VA 4EIPA 1XVWA 2LJKA 5IMDA 4LMVA 18GSA 2YN1A 3C71A 5DQYA 1UA5A 1ERUA 1K0MA 1BX9A 4OFMA 4I6XA 1B48A 1O85A 3UJ1A 4MP4A 4MZBA 5ECQB 3S9FA 2R4VA 2XBQA 2FWEA 5G31A 4EVMA 4FYBA 5CRWA 1OC9A 3KMNA 1HYUA 3RAZA 1Z6NA 4XIHA 1JZRA 2X64A 1PN0A 1TTZA 5G5EA 4WEYA 4MPFA 4FYUA 1THXA 1WJKA 4OD7A 5LNKe 1GUMA 1F6MC 2XBIA 4KA0A 4TR1A 2O8VB 3IXRA 5IPHA 5B8BA 2ALBA 4G0IA 1EOGA 1EGOA 2GQMA 3LWAA 4X4JA 2KHPA 3C1SA 4KH7A 3VLNA 3ZMKA 1SL1B 1AW9A 2N5FA 4E68A 5D9XA 1FB6A 4TR4A 1JHBA 2KUCA 1GNEA 3HY2A 4I8BA 1DBYA 2A4VA 1I9DA 1QK8A 5ID2A 1PKWA 3KP8A 4JBBA 1QMVA 4J2FA 4K2DA 2H75A 1SVLA 4J57E 3WGEA 2HSNA 4BVXB 5HR1A 5HR3A 1PX6A 1CQGA 2LJAA 3RHCA 5G2ZA 2JL4A 4EIQA 5IIZA 5IO0A 5DJLA 2CT6A 3DVXA 3GIXA 4V2NA 2UV8G 4USSA 4HZ2A 1GSYA 3O6TA 4OO5A 1A8YA 3EYTA 1BF5A 4DVCA 4Z2TA 3VI7A 2IMDA 4LLRA 1BG5A 4LA1A 1IYHA 2MMOA 1Z7RA 4O5UA 2H19A 5BMUB 3FR3A 2O87A 2TRCP 3BOAA 2OE3A 3KM6A 1X5EA 5KN0A 4GTUA 2LRTA 3EINA 1B4PA 2MMAA 4NWYA 4PXOA 4F0CA 4EL1A 2VIMA 4I97A 1SD9A 3LXZA 1HNAA 5D73A 3GKMA 4CY8A 4OO4A 2IIYA 3LW9A 1XW9A 1N25A 4V2LA 1T4ZA 2L6CA 1MD3A 3ZIVA 1X9MB 1SVOA 2HXKA 1YEPA 4ZL7A 1AQWA 4ECIA 3RPNA 4GQFA 3ZVJD 2H0GA 2FD3A 4I5QA 2DMMA 2WZ9A 4P3YB 2LTKA 5COHA 4BVYB 5GSSA 5A5HB 4HU7A 4MPGA 2QGVA 4AKIA 4A5PA 1JZOA 2F8AA 5J9BA 4K7IA 5L71A 5CYYA 3KP9A 1GP1A 3Q18A 2LRNA 4CHSA 1GSUA 3VFIA 3DD3A 2GT5A 3A5IA 4N0VA 1WRYA 5ABRA 3A5WA 4HJMA 8GSSA 3A2XA 2X4AA 5F0GA 1H75A 4KX4A 4PNGA 2CX3A 2YPMA 4IN0A 2GQKA 1V57A 1YKCA 2KP1A 3IPZA 1PMTA 4ISDA 2E7PA 4QQ7A 2VO4A 4FO5A 1JFUA 3K8NA 3DEXA 5H5SA 1XWAA 5ECKB 4IW9A 2J23A 3P2AA 1PD21 3FR6A 1KTEA 1WE0A 3LQ7A 1ZZYA 2HRKA 1NM3A 2YWIA 3IV4A 3HYPA 3QR6A 1UN2A 4YAPA 5DALB 4ZBAA 2IWTA 1OE8A 4MF6A 3LYKA 1LJRA 3F4TA 1M9BA 1VRSD 2LKUA 1FB0A 4JZQA 3L78A 2HZEB 3P8WA 1FG4A 2IFQA 1ZOFA 4YKGA 1GSQA 1Q4JA 5ECIB 3E3EA 1GH2A 1GUKA 2ES7A 2OADA 1XWKA 2QKEA 3QCPA 3SBCA 5IMAA 4X0XA 1G7OA 3A3TA 4GXZA 3G7JA 2H8LA 3GMFA 3NIVA 1URMA 1WIKA 2C1YA 4TN8A 2YJHA 3H8QA 2F8FA 1TI3A 2AYTA 5G1KA 2KOKA 4CW9A 5DQSA 2JACA 2VKZG 2WGRA 3GUSA 5ECRB 2AB6A 2V41A 4PUAA 2F51A 3ZZXA 4EXJA 2YP6A 4AKGA 1ZCPA 3CMIA 2H0IA 3M9JA 3FY7A 3PH9A 1XZOA 2H1AA 2B7KA 1TU7A 1Z7PA 2B5YA 1X9WB 4Q5QA 2C0DA 1M2DA 3VWUA 3MYDA 5D96A 1MDJA 4MJCA 4GQCA 3U5RE 1TRSA 5IQYA 1Z3EA 1UVZA 3PPUA 4K6XA 1GSDA 3KH7A 3TKQA 4K5RA 3CTGA 3IHGA 5B6MA 1T1VA 1AC1A 1SYXA 2PGTA 2LQOA 2TIRA 3J7Yk 4MH2A 4O7HA 1PGTA 4AI6A 2V6KA 2PN8A 1X0RA 2RM5A 1VF1A 3QDNA 2VD1A 4BA7A 1ERVA 3F8UA 2DC5A 5B8AA 1GULA 1XW6A 2CVBA 4XCSA 2DMLA 5C00A 4F2IA 2LRCA 1EP7A 4WF5A 3GFKA 3FKFA 2VCXA 4ZB7A 1M99A 4HU9A 3D4MA 3R3EA 3QMXA 1XCCA 4WETA 3F9UA 1XPVA 4QL9A 1BG1A 3P7XA 1ZYQB 5DBQA 2YOIA 1T00A 1O73A 4MF5A 2FLSA 1RQMA 2JZTA 3KIJA 1H4OA 3I6AA 3QFAC 3ZRDA 1R7HA 4QL7A 2H1DA 2YWMA 3HD5A 2ZUPA 1EEJA 2K9FA 3LORA 4IJ3A 5G1LA 2FGXA 3D6IA 4G10A 4TR3A 4L5LA 2CA8A 3TRXA 2BJXA 3LXTA 2FHEA 3W8JA 1MTCA 3FK8A 3GSSA 2LJRA 2GZPA 2R37A 3ZVJA 5HFKA 3UL3A 5J40A 3F0IA 1S3AA 2B5EA 5H5RA 3CSJA 3QAWA 1E2YA 2ZNMA 2MMZA 1FVKA 3IE3A 3UOMA 5DDLA 4POBA 3V1WA 2HZFA 5GAND 4ZL8A 5CREA 4ZBDA 3KCMA 2EFHA 2OE1A 3GA4A 4MDCA 3G7IA 1SYRA 2G0FA 1G6YA 4KW6A 4WBRD 2M80A 2M46A 4XS1A 5A4UA 1RK4A 3VI5A 5H5QA 3PR8A 4MCUA 2PVQA 3KXOA 3M9KA 3ERWA 4GDFA 3ZL5A 3LEFA 2CVKA 1Y25A 2FA4A 1ON4A 3GYKA 2FA8A 1PQNA 4ZL9A 3ZLPA 2IL3A 3EPTA 2DJKA 3Q6OA 3NZNA 3U6VA 2EFCA 4DSSA 3GTUB 1OC8A 4MJEA 1DUGA 1OKTA 3I69A 1QGVA 3O3TA 3D0ZA 2OKAA 5IMCA 13GSA 2IN3A 3MWHA 4CY6A 5D9WA 2ON5A 1QXHA 5IPGA 4NXIA 10GSA 5DAKA 3N5OA 4LMWA 3US3A 4NAXA 5A4WA 2HSMA 5IMVA 1A2JA 4GSNA 4F9ZA 1V2AA 5F06A 1CQHA 3BBYA 5A34B 4K8MA 7GSSA 1K0NA 2A2PA 4OCFA 3HA9A 1R5PA 5DCHA 4L0UA 4MJAA 1O81A 3FRCA 3F3RA 1PN9A 2A2SA 2HRNA 2OBIA 3IBHA 3CBUA 1SKWB 4AJ6A 4AGSA 5EPFA 4ZILA 2GSRA 3ZFBA 1JLVA 4YQVA 3GN3A 1G6WA 4GRFA 1C72A 4HQSA 4TXOB 3GH9A 2DSAA 2N5AA 4POKA 2YWNA 2I4AA 3LGCA 3WD6A 5AGYA 2A2RA 4OFNA 3LYPA 5FHIA 4K0NA 1SD8A 1OC3A 2GVPA 4E8HA 3W6GA 4EKZA 2C0FA 4RQXA 3HHVA 2B3SA 4NPBA 3GRXA 3VWVA 2CAIA 1SJIA 5HFGA 3ZIJA 1K3YA 5IOXA 2H73A 3HDCA 1O6JA 3OR5A 3VWXA 3BCIA 2LEGA 1FHEA 1EZKA 1R5AA 2WS2A 5J41A 2HNLA 1F3AA 2CAQA 1ZYPA 2HRFA 2LS5A 4XS4A 2YJ7A 2HT9A 1TJDA 3FZAA 1GSEA 1O8XA 3C1RA 1VF4A 3DKSA 2LQQA 4MABA 5D8IA 2GQLA 2XPDA 3F6DA 1THOA 4L5OA 4L8EA 1GSSA 2VL9A 1SKRB 2HRKB 1J9BA 1TK5B 3DXBA 3M1GA 3FR9A 2VL3A 3IAS2 2JADA 4V1Ag 1PL1A 4OCEA 4TRXA 5BRTA 1K3OA 3ZYWA 1A0RP 1GTIA 1ZL9A 1YKAA 3HJOA 1TOFA 19GSA 3QPMA 4BL7A 4WXTA 2PWJA 4RUVA 1QFNA 4IBPA 4ACSA 3UBLA 2HYXA 3HJPA 3IK7A 2JSZA 2VOCA 1WWJA 1U3IA 1YVLA 3HKRA 4E8EA 1B9YC 4X1UA 5B7CA 1ILOA 4YAVA 3EC3A 3TGZA 1V40A 3P90A 5AIVA 5F07A 4EDZA 5ECHB 5ECMB 1XW5A 2EIOA 2DJ2A 2I3YA 9GSSA 3ZREA 2YV9A 1ERTA 5KOXA 4PQ1A 4JR6A 3F6FA 4KSMA 5J4UA 1N2AA 4BVXA 2HLSA 3UMAA 3M3MA 1IYIA 2REMA 3GNJA 1T7PB 1TP9A 1WP0A 4NV5A 1X5CA 2A4HA 2HI7A 3IC4A 1N8JA 4N30A 3ME7A 1EOHA 4YKFA 4TOPA 1V9WA 2I9HA 2IMKA 4WR5A 3DGQA 4HZ4A 2V2GA 1K3LA 2O89A 2WDUA 3IAM2 3APQA 1Y6EA 1BAYA 1FO5A 4F82A 1M7TA 3L0HA 3KJYA 4RI6A 5AISA 4IQAA 1U6TA 4GSSA 1USBA 2RLIA 1MDKA 1PX7A 2BMXA 1TXXA 2WFCA 5BMUA 3FZ9A 1NW2A 3CRTA 3FYGA 2C3QA 4D73B 2HFDA 1W4VA 3ED3A 2VLUA 2GSQA 2H01A 4L0WA 2NVLA 2F3MA 2I81A 2YANA 2EIQA 3ERGA 4MMMA 3MNGA 1EV9A 2TRXA 1XBSA 1B8XA 1M2BA 4HI7A 2AV4A 5JWOB 2DLXA 5G30A 1E6BA 3UEMA 5ECSA 1FOHA 1A2LA 4EO3A 3WGXA 1F2EA 3HCZA 3G7YA 1SENA 2K18A 2GGTA 3F3QA 1M2AA 3IRAA 3M8NA 2LSTA 3F4RA 1ZYEA 3EU3A 4FYCA 1KBNA 3I43A 3H4KA 4V1Ap 1SKSB 1F37A 4BVYA 2DBCA 3CWGA 2DIZA 1SJ6A 1YEXA 3H1NA 4IS0A 4CDOA 1LU4A 1A24A 3GL3A 1I5GA 4YQMA 4GF0A 2FCHA 3L9UA 4O5QA 4ECCA 2PUKC 3KD0A 3TUEA 1V98A 3CSIA 1XOAA 4KUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3D A;  11GS A;  2GTU A;  1AQX A;  4XHM A;  3GST A;  3C8E A;  5IMF A;  4XRD A;  1Z6M A;  5AIX A;  4EC0 A;  3MSZ A;  5E4W A;  1X5D A;  3DWV A;  5A4V A;  2H6X A;  4KDY A;  3L9V A;  1SL2 B;  1ERW A;  2YV7 A;  4DSR A;  4HOJ A;  1GTA A;  2NPB A;  2V6O A;  5JCU A;  1GNW A;  3MDK A;  2L57 A;  5ECN B;  2IJY A;  1YY7 A;  4DSQ A;  5GAP D;  1A0F A;  5AN1 A;  4KCA A;  5HQP A;  4POM A;  3M0F A;  1T3B A;  4AJ7 A;  5C04 A;  2VM2 A;  3QOU A;  5CAX A;  1TW9 A;  5ELG A;  4I2U A;  2KLX A;  1GLP A;  4OMV A;  3DML A;  3EU4 A;  5KN3 A;  1DE1 A;  3H93 A;  1TKD B;  4PUF C;  4MJB A;  5D9T A;  3QAG A;  5E59 A;  2L6D A;  1A8L A;  2QC7 A;  22GS A;  2BTO T;  1OC9 B;  2ON7 A;  2OA7 A;  1OYJ A;  2FWG A;  3L4N A;  2Z9S A;  2NBS A;  1EV4 A;  3L9S A;  4FH8 A;  4EUY A;  4JR4 A;  2GZY A;  2K8V A;  4TR1 B;  3EWL A;  5EL8 A;  1QUW A;  2GS3 A;  4HEA 2;  3TRQ A;  2VL2 A;  2L59 A;  1OKD A;  2WB9 A;  3GKN A;  3CRU A;  6GSY A;  4KGI A;  4JRR A;  1PSQ A;  2HE3 A;  4Z7X A;  2AHE A;  2KP2 A;  2H0H A;  5IM9 A;  3HVS A;  5CRH A;  3G9B A;  1U88 A;  3LJR A;  2MZC A;  4G19 A;  1ACV A;  2AJQ B;  3H79 A;  3GV1 A;  5EY6 A;  5ID2 B;  5GST A;  4TVE A;  3D22 A;  4I2T A;  3APS A;  4F0B A;  3KZQ A;  1HNC A;  3IK9 A;  2OBK A;  5CP1 A;  2M72 A;  2OJL A;  2B1L A;  3GX0 A;  2HSN B;  4IEL A;  3C7M A;  3FZ5 A;  4MA9 A;  5DCG A;  3GKX A;  3TJG A;  4N11 A;  4MLY A;  4EDY A;  3GHA A;  5ECL B;  1M9A A;  3WT1 A;  1BQ7 A;  1O7U A;  4NHW A;  4ZIJ A;  1FOV A;  4XS6 A;  5CRG A;  1K0D A;  2JSY A;  5JWQ B;  1MEK A;  3UIW A;  3VWW A;  2DJ1 A;  5FWG A;  14GS A;  3RHB A;  2C8U A;  5D9V A;  2RUE A;  6GSW A;  4KDX A;  3WYW A;  2YNX A;  1Q98 A;  3IA1 A;  2EIR A;  2FNO A;  4XS4 B;  2J9H A;  4KDU A;  3KTB A;  4RQR A;  6GSU A;  4IJI A;  2X8G A;  4NV2 A;  4RI7 A;  3TKR A;  2LNS A;  5FT3 A;  4KND A;  4IQ1 A;  5JCW A;  2MYG A;  4PQH A;  2VLT A;  2DIY A;  2HQT A;  4HDE A;  1HD2 A;  2LNT A;  1EEM A;  2E2M A;  2C4J A;  3IOS A;  2X8C A;  4PQI A;  4YQU A;  2PMT A;  1AAZ A;  4AJ8 A;  2O85 A;  1OAZ A;  4BL7 B;  3KTL A;  2AUV A;  1FW1 A;  3EVI A;  2PPT A;  2DJJ A;  2H76 A;  3TDG A;  1J0F A;  3APO A;  4TKY A;  3JCM L;  3CSH A;  4OFT A;  4WF4 A;  2VCT A;  3RBT A;  1YJ6 A;  2ZCT A;  2VLV A;  1YF1 A;  3UAP A;  3VUR A;  2H6Z A;  1XWC A;  4IHU A;  4V2M A;  4ZB9 A;  4WR4 A;  2D2Z A;  2GSS A;  2FWF A;  5ELA A;  3DVW A;  3GL5 A;  1K0A A;  2GST A;  5JWR B;  3WT2 A;  3FEU A;  3TJF A;  3HVX A;  3A2W A;  3TJB A;  1AXD A;  2QSI A;  3DYR A;  2RII A;  1SU9 A;  3MAK A;  1HQO A;  4LL4 B;  2GZZ A;  1J08 A;  1XWB A;  1U3A A;  1SK2 A;  4ML6 A;  2C80 A;  3QAV A;  2C0E A;  1PKZ A;  3EMX A;  3TJK A;  2YZU A;  3TKP A;  2VCQ A;  3UVH A;  4OWY A;  4N10 A;  3E0U A;  2VUP A;  2FWH A;  2F9S A;  2V1M A;  17GS A;  2C3N A;  2FUG 2;  4Q5F A;  1BYE A;  2GLR A;  1KEB A;  3GTU A;  3EMP A;  1G0T A;  2NTO A;  1YZX A;  5J3R A;  4BWQ A;  2H66 A;  1VF3 A;  4IP6 A;  4ML1 A;  3AY8 A;  4POL A;  3J7Y b;  3IDV A;  2IFQ B;  4X43 A;  3BCK A;  5D93 A;  3FW2 A;  2PER A;  2R3X A;  5INY A;  4XRA A;  4AF2 A;  2XC2 A;  1LBK A;  4H86 A;  4ULX A;  1R4W A;  2OE0 A;  1EGR A;  4G0L A;  2H1B A;  4GLT A;  3GUR A;  3ISO A;  1WOU A;  3CXG A;  4YH2 A;  5ENU A;  4Q5R A;  3PGT A;  4XTS A;  3UAR A;  4KF9 A;  2O7K A;  2P0G A;  2AAW A;  4KAE A;  2JZS A;  1K0C A;  3W8S A;  2CV4 A;  2HSH A;  4JED A;  3TOT A;  2OAC A;  4TXO A;  4O32 A;  1FVJ A;  2VCW A;  3O76 A;  3KEB A;  5GZZ B;  5HR0 A;  1TDI A;  3SWL A;  4GCI A;  3D4T A;  3ERF A;  1Z5Y E;  2H30 A;  2XPE A;  1R26 A;  4GWR A;  2PBJ A;  1B4Q A;  1NSW A;  2X8H A;  3TJJ A;  3KGK A;  4G9H A;  1XVQ A;  3NOF A;  3WGD A;  2P5R A;  5CRD A;  5B6N A;  3RPP A;  2B7J A;  2VCZ A;  4HUA A;  5HR2 A;  1YQ1 A;  4PTS A;  1ML6 A;  4ILF A;  3TKS E;  1T4Y A;  1UC7 A;  1SJZ A;  1BJX A;  3HZ8 A;  1XOB A;  5F8B A;  3IR4 A;  1G7E A;  1F9M A;  2L4C A;  2WCI A;  1XFL A;  3DIE A;  2C3T A;  1GSF A;  6GSV A;  4PNF A;  2R2J A;  2VM1 A;  2H1G A;  1PRX A;  4HJ2 A;  5DJM A;  5LCZ A;  1EWX A;  5IOW A;  4JE1 A;  3ME8 A;  1A2M A;  1GTU A;  2H72 A;  2X99 A;  1ZMA A;  2FY6 A;  2PU9 C;  4K1F A;  4ECJ A;  2EC4 A;  3CTF A;  2C0G A;  1O8W A;  4WKW A;  3KMO A;  2N5B A;  2L4Q A;  4BPY A;  3N9J A;  1ABA A;  6GST A;  4FQU A;  1XIY A;  1JZD A;  1WPI A;  3FZ4 A;  1GRX A;  3TOU A;  4O5R A;  1K0O A;  4NMU A;  2YCD A;  2DJ3 A;  2WUL A;  2K6V A;  2CZ2 A;  2JZR A;  5DVB A;  2XHF A;  4N0Z A;  4ZBB A;  2P31 A;  1M0U A;  2LV3 A;  3RDW A;  3LSZ A;  4KSO A;  3ZIT A;  2LUS A;  2L5L A;  4ID0 A;  6GSX A;  2CX4 A;  1XWG A;  2B6M A;  3VK9 A;  5KEJ A;  1S3C A;  4TXV A;  1TRU A;  4PGT A;  2WJU A;  4HQZ A;  3Q19 A;  4K7N A;  1BED A;  3GX8 A;  3E9J B;  2IME A;  2GDR A;  5EVO A;  3HVV A;  4MF7 A;  5ECO B;  5CNW A;  4O92 A;  3UVT A;  4ZB6 A;  2R6K A;  3HZ4 A;  1KNG A;  2CQ9 A;  1TK0 B;  5IO2 A;  5F05 A;  2VCV A;  1AUC A;  2H71 A;  2PVO C;  4K0G A;  3ZTL A;  2RUF A;  1NHY A;  2IPA A;  1Z9H A;  1SL0 B;  2HSY A;  4KB3 A;  2V32 A;  2HRA A;  1B9X C;  1JLW A;  3KH9 A;  1PA3 A;  5JCG A;  4DEJ A;  1TK8 B;  1GWC A;  4ECB A;  5J9C A;  1SK0 A;  3R2Q A;  5HFI A;  1ST9 A;  4K9Z A;  4IKH A;  2H70 A;  2NDO A;  4KCE A;  3Q74 A;  2CZ3 A;  1AIU A;  1HNB A;  4KE3 A;  2B5X A;  4MZC A;  3HXS A;  5A5K A;  5DAL A;  1OE7 A;  3TCO A;  4D73 A;  3TB2 A;  4IP1 A;  2RM6 A;  1JZW A;  2CVD A;  5G5F A;  3HJM A;  5CO3 A;  12GS A;  2E2G A;  3LG6 A;  3GKK A;  3IHQ A;  1U87 A;  1W89 A;  2MBS A;  4IGJ A;  4F03 A;  2G2Q A;  4MZW A;  2VL2 C;  2HZE A;  4Q5N A;  4JU5 A;  4BWS A;  1VF2 A;  1MDI A;  3TRP A;  4GST A;  1MD4 A;  1AQV A;  1QQ2 A;  4EE0 A;  3GH6 A;  2VAF A;  1GL8 A;  1DSB A;  4MH3 A;  2WRT A;  5KN2 A;  4DSS B;  3ZFL A;  2IMF A;  4NHZ A;  3C73 A;  3LFL A;  4IVF A;  1F3B A;  3QD9 A;  2VD0 A;  1PL2 A;  1TRW A;  3TKS C;  1YDK A;  2B1K A;  4PUR A;  1X9S B;  2YWO A;  4EF0 A;  1SK1 A;  3UBK A;  1TRV A;  1A23 A;  3BD2 A;  2H6Y A;  2L5O A;  4G0K A;  20GS A;  3D5J A;  3VPT A;  3IC8 A;  5IMZ A;  1DE2 A;  1ZGN A;  5DAK B;  4ZXG A;  4J56 E;  2R5G A;  2HSM B;  3DRN A;  3QFB C;  1TU8 A;  1XXU A;  2UZ8 A;  1VGL A;  4FIW A;  4TW5 A;  1YF0 A;  1GTB A;  4K7O A;  1T8E B;  4HS1 A;  1OVN A;  1TI1 A;  6GSS A;  4TR0 A;  3PIN A;  4WBJ A;  5LD0 A;  1NHO A;  3TKS A;  1K0B A;  2H74 A;  3CYN A;  16GS A;  4PX1 A;  1FAA A;  2JU5 A;  3FHK A;  1V58 A;  4G2E A;  1RW1 A;  2DJ0 A;  5KN1 A;  1EP8 A;  2P5Q A;  4LL1 B;  2E0Q A;  3F63 A;  1WMJ A;  5ECP B;  4ZB8 A;  3F4S A;  3I9V 2;  2GT6 A;  3EE2 A;  3D21 A;  3BJ5 A;  2MMN A;  2MBT A;  4MK3 A;  2IMI A;  3ZML A;  3EUR A;  1GLQ A;  5J5N A;  1GUH A;  3VPQ A;  2I1U A;  2YZH A;  2K8S A;  3A2V A;  1XVW A;  2LJK A;  5IMD A;  4LMV A;  18GS A;  2YN1 A;  3C71 A;  5DQY A;  1UA5 A;  1ERU A;  1K0M A;  1BX9 A;  4OFM A;  4I6X A;  1B48 A;  1O85 A;  3UJ1 A;  4MP4 A;  4MZB A;  5ECQ B;  3S9F A;  2R4V A;  2XBQ A;  2FWE A;  5G31 A;  4EVM A;  4FYB A;  5CRW A;  1OC9 A;  3KMN A;  1HYU A;  3RAZ A;  1Z6N A;  4XIH A;  1JZR A;  2X64 A;  1TTZ A;  5G5E A;  4WEY A;  4MPF A;  4FYU A;  1THX A;  1WJK A;  4OD7 A;  5LNK e;  1GUM A;  1F6M C;  2XBI A;  4KA0 A;  4TR1 A;  2O8V B;  3IXR A;  5IPH A;  5B8B A;  2ALB A;  4G0I A;  1EOG A;  1EGO A;  2GQM A;  3LWA A;  2KHP A;  3C1S A;  4KH7 A;  3VLN A;  3ZMK A;  1SL1 B;  1AW9 A;  2N5F A;  5D9X A;  1FB6 A;  4TR4 A;  1JHB A;  2KUC A;  1GNE A;  3HY2 A;  4I8B A;  1DBY A;  2A4V A;  1I9D A;  1QK8 A;  5ID2 A;  1PKW A;  3KP8 A;  4JBB A;  1QMV A;  4J2F A;  4K2D A;  2H75 A;  4J57 E;  3WGE A;  5HR1 A;  4BVX B;  5HR3 A;  1PX6 A;  1CQG A;  2LJA A;  3RHC A;  5G2Z A;  2JL4 A;  5IIZ A;  5IO0 A;  5DJL A;  2CT6 A;  3DVX A;  3GIX A;  4V2N A;  4USS A;  4HZ2 A;  1GSY A;  3O6T A;  4OO5 A;  1A8Y A;  3EYT A;  4DVC A;  3VI7 A;  2IMD A;  4LLR A;  1BG5 A;  4LA1 A;  1IYH A;  2MMO A;  1Z7R A;  2H19 A;  3FR3 A;  2O87 A;  2TRC P;  3BOA A;  2OE3 A;  3KM6 A;  1X5E A;  5KN0 A;  4GTU A;  2LRT A;  3EIN A;  1B4P A;  2MMA A;  4NWY A;  4PXO A;  4F0C A;  4EL1 A;  2VIM A;  4I97 A;  1SD9 A;  3LXZ A;  1HNA A;  5D73 A;  3GKM A;  4OO4 A;  2IIY A;  1XW9 A;  4V2L A;  1T4Z A;  2L6C A;  1MD3 A;  3ZIV A;  1X9M B;  2HXK A;  1YEP A;  4ZL7 A;  1AQW A;  4ECI A;  3RPN A;  4GQF A;  3ZVJ D;  2H0G A;  2FD3 A;  4I5Q A;  2DMM A;  2WZ9 A;  4P3Y B;  2LTK A;  5COH A;  4BVY B;  5GSS A;  4HU7 A;  4MPG A;  2QGV A;  1JZO A;  2F8A A;  5J9B A;  4K7I A;  5L71 A;  5CYY A;  3KP9 A;  1GP1 A;  3Q18 A;  2LRN A;  4CHS A;  1GSU A;  3VFI A;  3DD3 A;  2GT5 A;  4N0V A;  1WRY A;  5ABR A;  3A5W A;  4HJM A;  8GSS A;  3A2X A;  5F0G A;  1H75 A;  4KX4 A;  4PNG A;  2CX3 A;  2YPM A;  4IN0 A;  2GQK A;  1V57 A;  1YKC A;  2KP1 A;  3IPZ A;  1PMT A;  4ISD A;  2E7P A;  4QQ7 A;  2VO4 A;  4FO5 A;  1JFU A;  3K8N A;  3DEX A;  5H5S A;  1XWA A;  5ECK B;  4IW9 A;  2J23 A;  3P2A A;  1PD2 1;  3FR6 A;  1KTE A;  1WE0 A;  3LQ7 A;  1ZZY A;  2HRK A;  1NM3 A;  2YWI A;  3IV4 A;  3HYP A;  3QR6 A;  1UN2 A;  4YAP A;  5DAL B;  4ZBA A;  2IWT A;  1OE8 A;  4MF6 A;  3LYK A;  1LJR A;  3F4T A;  1M9B A;  1VRS D;  2LKU A;  1FB0 A;  4JZQ A;  3L78 A;  2HZE B;  3P8W A;  1FG4 A;  2IFQ A;  1ZOF A;  1GSQ A;  1Q4J A;  5ECI B;  3E3E A;  1GH2 A;  1GUK A;  2ES7 A;  2OAD A;  1XWK A;  2QKE A;  3QCP A;  3SBC A;  5IMA A;  4X0X A;  1G7O A;  3A3T A;  4GXZ A;  3G7J A;  2H8L A;  3GMF A;  3NIV A;  1URM A;  1WIK A;  2C1Y A;  4TN8 A;  2YJH A;  3H8Q A;  2F8F A;  1TI3 A;  2AYT A;  5G1K A;  2KOK A;  4CW9 A;  5DQS A;  2JAC A;  2WGR A;  3GUS A;  5ECR B;  2AB6 A;  2V41 A;  4PUA A;  2F51 A;  3ZZX A;  4EXJ A;  2YP6 A;  1ZCP A;  3CMI A;  2H0I A;  3M9J A;  3FY7 A;  3PH9 A;  1XZO A;  2H1A A;  2B7K A;  1TU7 A;  1Z7P A;  2B5Y A;  1X9W B;  4Q5Q A;  2C0D A;  1M2D A;  3VWU A;  5D96 A;  1MDJ A;  4MJC A;  4GQC A;  3U5R E;  1TRS A;  5IQY A;  1Z3E A;  1UVZ A;  3PPU A;  4K6X A;  1GSD A;  3KH7 A;  3TKQ A;  3CTG A;  5B6M A;  1T1V A;  1AC1 A;  1SYX A;  2PGT A;  2LQO A;  2TIR A;  3J7Y k;  4MH2 A;  4O7H A;  1PGT A;  2V6K A;  2PN8 A;  1X0R A;  2RM5 A;  1VF1 A;  3QDN A;  2VD1 A;  4BA7 A;  1ERV A;  3F8U A;  2DC5 A;  5B8A A;  1GUL A;  1XW6 A;  2CVB A;  4XCS A;  2DML A;  5C00 A;  4F2I A;  2LRC A;  1EP7 A;  4WF5 A;  3GFK A;  3FKF A;  2VCX A;  1M99 A;  4HU9 A;  3D4M A;  3R3E A;  3QMX A;  1XCC A;  4WET A;  3F9U A;  1XPV A;  4QL9 A;  3P7X A;  1ZYQ B;  5DBQ A;  2YOI A;  1T00 A;  1O73 A;  4MF5 A;  2FLS A;  1RQM A;  2JZT A;  3KIJ A;  1H4O A;  3I6A A;  3QFA C;  3ZRD A;  1R7H A;  4QL7 A;  2H1D A;  2YWM A;  3HD5 A;  2ZUP A;  1EEJ A;  2K9F A;  3LOR A;  4IJ3 A;  5G1L A;  2FGX A;  3D6I A;  4G10 A;  4TR3 A;  4L5L A;  2CA8 A;  3TRX A;  2BJX A;  3LXT A;  2FHE A;  3W8J A;  1MTC A;  3FK8 A;  3GSS A;  2LJR A;  2GZP A;  2R37 A;  3ZVJ A;  5HFK A;  3UL3 A;  3F0I A;  1S3A A;  2B5E A;  5H5R A;  3CSJ A;  3QAW A;  1E2Y A;  2ZNM A;  2MMZ A;  1FVK A;  3IE3 A;  3UOM A;  5DDL A;  4POB A;  3V1W A;  2HZF A;  5GAN D;  4ZL8 A;  5CRE A;  4ZBD A;  3KCM A;  2OE1 A;  3GA4 A;  4MDC A;  3G7I A;  1SYR A;  2G0F A;  1G6Y A;  4KW6 A;  4WBR D;  2M80 A;  2M46 A;  4XS1 A;  5A4U A;  1RK4 A;  3VI5 A;  5H5Q A;  3PR8 A;  4MCU A;  2PVQ A;  3KXO A;  3M9K A;  3ERW A;  3ZL5 A;  3LEF A;  2CVK A;  1Y25 A;  2FA4 A;  1ON4 A;  3GYK A;  2FA8 A;  1PQN A;  4ZL9 A;  3ZLP A;  2IL3 A;  2DJK A;  3Q6O A;  3NZN A;  3U6V A;  4DSS A;  3GTU B;  1OC8 A;  4MJE A;  1DUG A;  1OKT A;  3I69 A;  1QGV A;  3O3T A;  3D0Z A;  2OKA A;  5IMC A;  13GS A;  2IN3 A;  3MWH A;  5D9W A;  2ON5 A;  1QXH A;  5IPG A;  4NXI A;  10GS A;  5DAK A;  3N5O A;  4LMW A;  3US3 A;  4NAX A;  5A4W A;  2HSM A;  5IMV A;  1A2J A;  4GSN A;  4F9Z A;  1V2A A;  5F06 A;  1CQH A;  3BBY A;  4K8M A;  7GSS A;  1K0N A;  4OCF A;  3HA9 A;  1R5P A;  5DCH A;  4L0U A;  4MJA A;  1O81 A;  3FRC A;  3F3R A;  1PN9 A;  2A2S A;  2HRN A;  2OBI A;  3IBH A;  3CBU A;  1SKW B;  4AJ6 A;  4AGS A;  5EPF A;  4ZIL A;  2GSR A;  3ZFB A;  1JLV A;  4YQV A;  3GN3 A;  1G6W A;  4GRF A;  1C72 A;  4HQS A;  4TXO B;  3GH9 A;  2DSA A;  2N5A A;  4POK A;  2YWN A;  2I4A A;  3LGC A;  3WD6 A;  5AGY A;  2A2R A;  4OFN A;  3LYP A;  5FHI A;  4K0N A;  1SD8 A;  1OC3 A;  2GVP A;  4E8H A;  3W6G A;  4EKZ A;  2C0F A;  4RQX A;  3HHV A;  2B3S A;  4NPB A;  3GRX A;  3VWV A;  2CAI A;  1SJI A;  5HFG A;  3ZIJ A;  1K3Y A;  5IOX A;  2H73 A;  3HDC A;  1O6J A;  3OR5 A;  3VWX A;  3BCI A;  2LEG A;  1FHE A;  1EZK A;  1R5A A;  2WS2 A;  5J41 A;  2HNL A;  1F3A A;  2CAQ A;  2HRF A;  2LS5 A;  4XS4 A;  2YJ7 A;  2HT9 A;  1TJD A;  3FZA A;  1GSE A;  1O8X A;  3C1R A;  1VF4 A;  3DKS A;  2LQQ A;  4MAB A;  5D8I A;  2GQL A;  2XPD A;  3F6D A;  1THO A;  4L5O A;  4L8E A;  1GSS A;  2VL9 A;  1SKR B;  2HRK B;  1J9B A;  1TK5 B;  3DXB A;  3M1G A;  3FR9 A;  2VL3 A;  3IAS 2;  2JAD A;  4V1A g;  1PL1 A;  4OCE A;  4TRX A;  1K3O A;  3ZYW A;  1A0R P;  1GTI A;  1ZL9 A;  1YKA A;  3HJO A;  1TOF A;  19GS A;  3QPM A;  4BL7 A;  4WXT A;  2PWJ A;  4RUV A;  1QFN A;  4IBP A;  4ACS A;  3UBL A;  2HYX A;  3HJP A;  3IK7 A;  2JSZ A;  2VOC A;  1WWJ A;  1U3I A;  3HKR A;  4E8E A;  1B9Y C;  4X1U A;  5B7C A;  1ILO A;  4YAV A;  3EC3 A;  3TGZ A;  1V40 A;  3P90 A;  5AIV A;  5F07 A;  4EDZ A;  5ECH B;  5ECM B;  1XW5 A;  2EIO A;  2DJ2 A;  2I3Y A;  9GSS A;  3ZRE A;  2YV9 A;  1ERT A;  4PQ1 A;  4JR6 A;  3F6F A;  4KSM A;  5J4U A;  1N2A A;  4BVX A;  2HLS A;  3UMA A;  3M3M A;  1IYI A;  2REM A;  3GNJ A;  1T7P B;  1TP9 A;  1WP0 A;  4NV5 A;  1X5C A;  2HI7 A;  3IC4 A;  1N8J A;  4N30 A;  3ME7 A;  1EOH A;  4TOP A;  1V9W A;  2I9H A;  2IMK A;  4WR5 A;  3DGQ A;  4HZ4 A;  2V2G A;  1K3L A;  2O89 A;  2WDU A;  3IAM 2;  3APQ A;  1Y6E A;  1BAY A;  1FO5 A;  4F82 A;  1M7T A;  3L0H A;  3KJY A;  4RI6 A;  5AIS A;  4IQA A;  1U6T A;  4GSS A;  1USB A;  2RLI A;  1MDK A;  1PX7 A;  2BMX A;  1TXX A;  2WFC A;  5BMU A;  3FZ9 A;  1NW2 A;  3CRT A;  3FYG A;  2C3Q A;  4D73 B;  2HFD A;  1W4V A;  3ED3 A;  2VLU A;  2GSQ A;  2H01 A;  4L0W A;  2NVL A;  2F3M A;  2I81 A;  2YAN A;  2EIQ A;  3ERG A;  4MMM A;  3MNG A;  1EV9 A;  2TRX A;  1XBS A;  1B8X A;  1M2B A;  4HI7 A;  2AV4 A;  5JWO B;  2DLX A;  5G30 A;  1E6B A;  3UEM A;  5ECS A;  1A2L A;  4EO3 A;  3WGX A;  1F2E A;  3HCZ A;  3G7Y A;  1SEN A;  2K18 A;  2GGT A;  3F3Q A;  1M2A A;  3IRA A;  3M8N A;  2LST A;  3F4R A;  1ZYE A;  3EU3 A;  4FYC A;  1KBN A;  3I43 A;  3H4K A;  4V1A p;  1SKS B;  1F37 A;  4BVY A;  2DBC A;  2DIZ A;  1SJ6 A;  1YEX A;  3H1N A;  4IS0 A;  4CDO A;  1LU4 A;  1A24 A;  3GL3 A;  1I5G A;  4YQM A;  4GF0 A;  2FCH A;  3L9U A;  4ECC A;  2PUK C;  3KD0 A;  3TUE A;  1V98 A;  3CSI A;  1XOA A;  4KUN A; 
#chains in the Genus database with same CATH topology
 2WW1 A;  1S3D A;  11GS A;  2GTU A;  1AQX A;  4XHM A;  3GST A;  3C8E A;  5IMF A;  4XRD A;  1Z6M A;  5AIX A;  4EC0 A;  4QMK A;  3MSZ A;  5E4W A;  1X5D A;  3DWV A;  5A4V A;  2H6X A;  4KDY A;  3L9V A;  1SL2 B;  1ERW A;  2YV7 A;  4DSR A;  4HOJ A;  1GTA A;  2NPB A;  2V6O A;  5JCU A;  1GNW A;  3MDK A;  2L57 A;  5ECN B;  2IJY A;  1YY7 A;  4DSQ A;  5GAP D;  1A0F A;  5AN1 A;  4KCA A;  5HQP A;  4POM A;  3M0F A;  1T3B A;  4AJ7 A;  5C04 A;  2VM2 A;  3QOU A;  1Y1U A;  5CAX A;  4W66 A;  1TW9 A;  5ELG A;  4I2U A;  2KLX A;  1GLP A;  4OMV A;  2R0P A;  3DML A;  3EU4 A;  5KN3 A;  1DE1 A;  3H93 A;  1TKD B;  4PUF C;  4MJB A;  5D9T A;  3QAG A;  5E59 A;  2L6D A;  1A8L A;  2QC7 A;  22GS A;  2BTO T;  5A1N A;  1OC9 B;  2ON7 A;  2OA7 A;  1OYJ A;  2FWG A;  3L4N A;  2Z9S A;  2NBS A;  1EV4 A;  3L9S A;  4FH8 A;  2EFD A;  4EUY A;  4JR4 A;  2GZY A;  2K8V A;  4TR1 B;  3EWL A;  5EL8 A;  1QUW A;  2GS3 A;  4HEA 2;  3TRQ A;  2VL2 A;  2L59 A;  1OKD A;  2WB9 A;  3GKN A;  3CRU A;  6GSY A;  4BIK A;  4KGI A;  4JRR A;  1PSQ A;  5J47 A;  2HE3 A;  4Z7X A;  2AHE A;  2KP2 A;  2H0H A;  5IM9 A;  3HVS A;  5CRH A;  3G9B A;  1U88 A;  3LJR A;  2MZC A;  4G19 A;  1ACV A;  2AJQ B;  3H79 A;  3GV1 A;  5EY6 A;  3CHX C;  5ID2 B;  5GST A;  4TVE A;  3D22 A;  4I2T A;  3APS A;  4F0B A;  3KZQ A;  1HNC A;  3IK9 A;  2OBK A;  5CP1 A;  2M72 A;  2OJL A;  2B1L A;  3GX0 A;  2HSN B;  4IEL A;  3C7M A;  3FZ5 A;  4MA9 A;  1S4B P;  5DCG A;  3GKX A;  3TJG A;  4N11 A;  4MLY A;  2X49 A;  4EDY A;  3GHA A;  5ECL B;  1M9A A;  3WT1 A;  1BQ7 A;  1O7U A;  4NHW A;  4ZIJ A;  1FOV A;  4XS6 A;  5CRG A;  1K0D A;  2JSY A;  5JWQ B;  1MEK A;  3UIW A;  3VWW A;  2DJ1 A;  5FWG A;  14GS A;  3RHB A;  2C8U A;  5D9V A;  2RUE A;  6GSW A;  4KDX A;  3WYW A;  2YNX A;  1Q98 A;  3IA1 A;  2EIR A;  2FNO A;  4XS4 B;  2J9H A;  4KDU A;  3KTB A;  2EFE A;  4RQR A;  6GSU A;  4IJI A;  2X8G A;  4NV2 A;  4RI7 A;  3TKR A;  2LNS A;  5FT3 A;  4KND A;  4IQ1 A;  5JCW A;  2MYG A;  4PQH A;  2VLT A;  2DIY A;  2HQT A;  4HDE A;  1HD2 A;  2LNT A;  1EEM A;  2E2M A;  2C4J A;  3IOS A;  2X8C A;  4PQI A;  4YQU A;  2PMT A;  1AAZ A;  4AJ8 A;  2O85 A;  1OAZ A;  2R0C A;  4BL7 B;  3KTL A;  2AUV A;  1FW1 A;  3EVI A;  2PPT A;  2DJJ A;  2H76 A;  3TDG A;  1J0F A;  3APO A;  4TKY A;  3JCM L;  3CSH A;  4OFT A;  4WF4 A;  2VCT A;  2WVX B;  3RBT A;  1YJ6 A;  2ZCT A;  2VLV A;  1YF1 A;  3UAP A;  3VUR A;  2H6Z A;  1XWC A;  4IHU A;  4V2M A;  4ZB9 A;  4WR4 A;  2D2Z A;  2GSS A;  3TU3 B;  2FWF A;  5ELA A;  3DVW A;  3GL5 A;  1K0A A;  2GST A;  5JWR B;  1PFO A;  3WT2 A;  3FEU A;  3TJF A;  3HVX A;  3A2W A;  3TJB A;  1AXD A;  2QSI A;  3DYR A;  2RII A;  1SU9 A;  3MAK A;  1YEW C;  1HQO A;  4LL4 B;  2GZZ A;  1J08 A;  1XWB A;  1U3A A;  1SK2 A;  4ML6 A;  2C80 A;  4Z2R A;  3QAV A;  2C0E A;  1PKZ A;  3EMX A;  3TJK A;  4K2X A;  2YZU A;  3TKP A;  2VCQ A;  3UVH A;  4OWY A;  4N10 A;  1SVM A;  3E0U A;  2VUP A;  2FWH A;  2F9S A;  2V1M A;  17GS A;  2C3N A;  2FUG 2;  4Q5F A;  1BYE A;  2GLR A;  1KEB A;  3GTU A;  5J4Y A;  3EMP A;  1G0T A;  2NTO A;  1YZX A;  5J3R A;  4BWQ A;  5J4V A;  2H66 A;  1VF3 A;  4IP6 A;  4ML1 A;  3AY8 A;  2H1L A;  4POL A;  3J7Y b;  3IDV A;  2IFQ B;  3HMJ G;  4X43 A;  3BCK A;  5D93 A;  3FW2 A;  2PER A;  2O5V A;  2R3X A;  5INY A;  4XRA A;  4AF2 A;  2XC2 A;  1LBK A;  4H86 A;  4ULX A;  5A34 A;  1R4W A;  2OE0 A;  1EGR A;  4G0L A;  2H1B A;  2OT3 A;  4GLT A;  3GUR A;  3ISO A;  1WOU A;  3CXG A;  4YH2 A;  5ENU A;  1I1I P;  4Q5R A;  3PGT A;  4XTS A;  3UAR A;  4KF9 A;  2O7K A;  2P0G A;  2AAW A;  4KAE A;  2JZS A;  1K0C A;  1TXU A;  3W8S A;  2CV4 A;  2HSH A;  4JED A;  3TOT A;  2OAC A;  4TXO A;  4O32 A;  1FVJ A;  2VCW A;  3O76 A;  3KEB A;  5GZZ B;  4MNN A;  5HR0 A;  4N3Z A;  3FMW A;  1TDI A;  3SWL A;  4GCI A;  3D4T A;  3ERF A;  1Z5Y E;  2H30 A;  2XPE A;  1R26 A;  4GWR A;  2PBJ A;  1B4Q A;  1NSW A;  2X8H A;  3TJJ A;  2DKH A;  3KGK A;  4G9H A;  1XVQ A;  3NOF A;  3WGD A;  2P5R A;  5CRD A;  5B6N A;  3RPP A;  2B7J A;  2VCZ A;  4HUA A;  5HR2 A;  1YQ1 A;  4PTS A;  1ML6 A;  4ILF A;  3TKS E;  1T4Y A;  4AKX B;  1UC7 A;  1SJZ A;  1BJX A;  3HZ8 A;  1XOB A;  5F8B A;  3IR4 A;  1G7E A;  1F9M A;  2L4C A;  2WCI A;  1XFL A;  3DIE A;  2C3T A;  1GSF A;  6GSV A;  4PNF A;  2R2J A;  2VM1 A;  2H1G A;  1PRX A;  4HJ2 A;  5DJM A;  5LCZ A;  1EWX A;  5IOW A;  4JE1 A;  2QA1 A;  3ME8 A;  1A2M A;  3HVN A;  1GTU A;  2H72 A;  2X99 A;  1ZMA A;  2O3E A;  2FY6 A;  2PU9 C;  4K1F A;  4ECJ A;  2EC4 A;  3CTF A;  2C0G A;  1O8W A;  4WKW A;  3KMO A;  2N5B A;  2L4Q A;  4BPY A;  3N9J A;  1ABA A;  6GST A;  4FQU A;  1XIY A;  1JZD A;  1WPI A;  3FZ4 A;  1GRX A;  3TOU A;  4O5R A;  1K0O A;  4NMU A;  2YCD A;  2DJ3 A;  2WUL A;  2K6V A;  2CZ2 A;  2JZR A;  5DVB A;  2XHF A;  4N0Z A;  4ZBB A;  2P31 A;  1M0U A;  2LV3 A;  5A5H A;  3RDW A;  3LSZ A;  4KSO A;  3ZIT A;  2LUS A;  2L5L A;  5A1N B;  4ID0 A;  6GSX A;  2CX4 A;  1XWG A;  2B6M A;  3VK9 A;  5KEJ A;  1S3C A;  4TXV A;  1TRU A;  4PGT A;  2WJU A;  4HQZ A;  3Q19 A;  4K5S A;  4K7N A;  1BED A;  3GX8 A;  3E9J B;  2IME A;  2R0G A;  2GDR A;  5EVO A;  3HVV A;  4MF7 A;  5ECO B;  5CNW A;  4O92 A;  3UVT A;  4ZB6 A;  2R6K A;  3HZ4 A;  1KNG A;  2CQ9 A;  1TK0 B;  5IO2 A;  5F05 A;  2VCV A;  1AUC A;  2H71 A;  2PVO C;  4K0G A;  4PI2 C;  3ZTL A;  2RUF A;  1NHY A;  2IPA A;  1Z9H A;  1SL0 B;  2HSY A;  4KB3 A;  2V32 A;  2HRA A;  1B9X C;  1JLW A;  3KH9 A;  1PA3 A;  5JCG A;  4DEJ A;  1TK8 B;  1GWC A;  4ECB A;  5J9C A;  1SK0 A;  3R2Q A;  5HFI A;  1ST9 A;  4K9Z A;  4IKH A;  2H70 A;  2NDO A;  4KCE A;  3Q74 A;  2CZ3 A;  1AIU A;  1HNB A;  4KE3 A;  2B5X A;  4MZC A;  3HXS A;  5A5K A;  5DAL A;  1OE7 A;  3TCO A;  4D73 A;  3TB2 A;  4IP1 A;  2RM6 A;  1JZW A;  2CVD A;  5G5F A;  3HJM A;  5CO3 A;  12GS A;  2E2G A;  3LG6 A;  3GKK A;  3IHQ A;  1U87 A;  1W89 A;  2MBS A;  4IGJ A;  4F03 A;  2G2Q A;  4MZW A;  2VL2 C;  2HZE A;  4Q5N A;  4JU5 A;  4BWS A;  1VF2 A;  1MDI A;  3TRP A;  4GST A;  1MD4 A;  1AQV A;  1QQ2 A;  4EE0 A;  2QA2 A;  3GH6 A;  2VAF A;  1GL8 A;  1DSB A;  4MH3 A;  2WRT A;  5KN2 A;  4DSS B;  3ZFL A;  2IMF A;  4NHZ A;  3C73 A;  3LFL A;  4IVF A;  1F3B A;  3QD9 A;  2VD0 A;  1PL2 A;  1TRW A;  3TKS C;  1YDK A;  2B1K A;  4PUR A;  4ICY A;  1X9S B;  2YWO A;  4Z2U A;  4EF0 A;  1SK1 A;  3UBK A;  1TRV A;  1A23 A;  3BD2 A;  2H6Y A;  2L5O A;  4G0K A;  20GS A;  3D5J A;  3VPT A;  3IC8 A;  5IMZ A;  1DE2 A;  1ZGN A;  5DAK B;  4ZXG A;  4J56 E;  2R5G A;  2HSM B;  3DRN A;  3QFB C;  1TU8 A;  1XXU A;  2UZ8 A;  1VGL A;  4FIW A;  4TW5 A;  1YF0 A;  1GTB A;  4K7O A;  1T8E B;  4HS1 A;  1OVN A;  4G01 A;  1TI1 A;  6GSS A;  4TR0 A;  3PIN A;  4WBJ A;  5LD0 A;  1NHO A;  3TKS A;  1K0B A;  2H74 A;  3CYN A;  16GS A;  4PX1 A;  1FAA A;  2DKI A;  2JU5 A;  3FHK A;  1V58 A;  4G2E A;  1RW1 A;  2DJ0 A;  5KN1 A;  3MIX A;  1EP8 A;  2P5Q A;  4LL1 B;  2E0Q A;  3F63 A;  1WMJ A;  5ECP B;  4PHZ C;  4ZB8 A;  3F4S A;  3I9V 2;  2GT6 A;  3EE2 A;  3D21 A;  3BJ5 A;  5KOW A;  1ZYN A;  2MMN A;  2MBT A;  4MK3 A;  2IMI A;  3ZML A;  3EUR A;  1GLQ A;  5J5N A;  1GUH A;  4AKH A;  3VPQ A;  2I1U A;  2YZH A;  2K8S A;  3A2V A;  4EIP A;  1XVW A;  2LJK A;  5IMD A;  4LMV A;  18GS A;  2YN1 A;  3C71 A;  5DQY A;  1UA5 A;  1ERU A;  1K0M A;  1BX9 A;  4OFM A;  4I6X A;  1B48 A;  1O85 A;  3UJ1 A;  4MP4 A;  4MZB A;  5ECQ B;  1S3R A;  3S9F A;  2R4V A;  2XBQ A;  2FWE A;  5G31 A;  4EVM A;  4FYB A;  5CRW A;  1OC9 A;  3KMN A;  1HYU A;  3RAZ A;  1Z6N A;  4XIH A;  1JZR A;  2X64 A;  1PN0 A;  1TTZ A;  5G5E A;  4WEY A;  4MPF A;  4FYU A;  1THX A;  1WJK A;  4OD7 A;  5LNK e;  1GUM A;  1F6M C;  2XBI A;  4KA0 A;  4TR1 A;  2O8V B;  3IXR A;  5IPH A;  5B8B A;  2ALB A;  4G0I A;  1EOG A;  1EGO A;  2GQM A;  3LWA A;  4X4J A;  2KHP A;  3C1S A;  4KH7 A;  3VLN A;  3ZMK A;  1SL1 B;  1AW9 A;  2N5F A;  4E68 A;  5D9X A;  1FB6 A;  4TR4 A;  1JHB A;  2KUC A;  1GNE A;  3HY2 A;  4I8B A;  1DBY A;  2A4V A;  1I9D A;  1QK8 A;  5ID2 A;  1PKW A;  3KP8 A;  4JBB A;  1QMV A;  4J2F A;  4K2D A;  2H75 A;  1SVL A;  4J57 E;  3WGE A;  2HSN A;  4BVX B;  5HR1 A;  5HR3 A;  1PX6 A;  1CQG A;  2LJA A;  3RHC A;  5G2Z A;  2JL4 A;  4EIQ A;  5IIZ A;  5IO0 A;  5DJL A;  2CT6 A;  3DVX A;  3GIX A;  4V2N A;  2UV8 G;  4USS A;  4HZ2 A;  1GSY A;  3O6T A;  4OO5 A;  1A8Y A;  3EYT A;  1BF5 A;  4DVC A;  4Z2T A;  3VI7 A;  2IMD A;  4LLR A;  1BG5 A;  4LA1 A;  1IYH A;  2MMO A;  1Z7R A;  4O5U A;  2H19 A;  5BMU B;  3FR3 A;  2O87 A;  2TRC P;  3BOA A;  2OE3 A;  3KM6 A;  1X5E A;  5KN0 A;  4GTU A;  2LRT A;  3EIN A;  1B4P A;  2MMA A;  4NWY A;  4PXO A;  4F0C A;  4EL1 A;  2VIM A;  4I97 A;  1SD9 A;  3LXZ A;  1HNA A;  5D73 A;  3GKM A;  4CY8 A;  4OO4 A;  2IIY A;  3LW9 A;  1XW9 A;  1N25 A;  4V2L A;  1T4Z A;  2L6C A;  1MD3 A;  3ZIV A;  1X9M B;  1SVO A;  2HXK A;  1YEP A;  2WW2 A;  4ZL7 A;  1AQW A;  4ECI A;  3RPN A;  4GQF A;  3ZVJ D;  2H0G A;  2FD3 A;  4I5Q A;  2DMM A;  2WZS A;  2WZ9 A;  4P3Y B;  2LTK A;  4PI0 C;  5COH A;  4BVY B;  2WVX A;  5GSS A;  5A5H B;  4HU7 A;  4MPG A;  2QGV A;  4AKI A;  4A5P A;  1JZO A;  2F8A A;  5J9B A;  4K7I A;  5L71 A;  5CYY A;  3KP9 A;  1GP1 A;  3Q18 A;  2LRN A;  4CHS A;  1GSU A;  3VFI A;  3DD3 A;  2GT5 A;  3A5I A;  4N0V A;  1WRY A;  5ABR A;  3A5W A;  4HJM A;  8GSS A;  3A2X A;  2X4A A;  5F0G A;  1H75 A;  4KX4 A;  4PNG A;  2CX3 A;  2YPM A;  4IN0 A;  2GQK A;  1V57 A;  1YKC A;  2KP1 A;  3IPZ A;  1PMT A;  4ISD A;  2E7P A;  4QQ7 A;  2VO4 A;  4FO5 A;  1JFU A;  3K8N A;  3DEX A;  5H5S A;  1XWA A;  5ECK B;  4IW9 A;  2J23 A;  3P2A A;  1PD2 1;  3FR6 A;  1KTE A;  1WE0 A;  3LQ7 A;  1ZZY A;  2HRK A;  1NM3 A;  2YWI A;  3IV4 A;  3HYP A;  3QR6 A;  1UN2 A;  4YAP A;  5DAL B;  4ZBA A;  2IWT A;  1OE8 A;  4MF6 A;  3LYK A;  1LJR A;  3F4T A;  1M9B A;  1VRS D;  2LKU A;  1FB0 A;  4JZQ A;  3L78 A;  2HZE B;  3P8W A;  1FG4 A;  2IFQ A;  1ZOF A;  4YKG A;  1GSQ A;  1Q4J A;  2WVY A;  5ECI B;  3E3E A;  1GH2 A;  1GUK A;  2ES7 A;  2OAD A;  1XWK A;  2QKE A;  3QCP A;  3SBC A;  5IMA A;  4X0X A;  1G7O A;  3A3T A;  4GXZ A;  3G7J A;  2H8L A;  3GMF A;  3NIV A;  1URM A;  1WIK A;  2WW0 A;  2C1Y A;  4TN8 A;  2YJH A;  3H8Q A;  2F8F A;  1TI3 A;  2AYT A;  5G1K A;  2KOK A;  4CW9 A;  5DQS A;  2JAC A;  2VKZ G;  2WGR A;  3GUS A;  5ECR B;  2AB6 A;  2V41 A;  4PUA A;  2F51 A;  3ZZX A;  4EXJ A;  2YP6 A;  4AKG A;  1ZCP A;  3CMI A;  2H0I A;  3M9J A;  3FY7 A;  3PH9 A;  1XZO A;  2H1A A;  2B7K A;  1TU7 A;  1Z7P A;  2B5Y A;  1X9W B;  4Q5Q A;  2C0D A;  1M2D A;  3VWU A;  3MYD A;  5D96 A;  1MDJ A;  4MJC A;  4GQC A;  4FXY P;  3U5R E;  1TRS A;  5IQY A;  1Z3E A;  1UVZ A;  3PPU A;  4K6X A;  1GSD A;  3KH7 A;  3TKQ A;  4K5R A;  3CTG A;  3IHG A;  5B6M A;  1T1V A;  1AC1 A;  1SYX A;  2PGT A;  2LQO A;  2TIR A;  3J7Y k;  4MH2 A;  4O7H A;  1PGT A;  4AI6 A;  2V6K A;  2PN8 A;  1X0R A;  2RM5 A;  1VF1 A;  3QDN A;  2VD1 A;  4BA7 A;  1ERV A;  3F8U A;  2DC5 A;  5B8A A;  1GUL A;  1XW6 A;  2CVB A;  4XCS A;  2DML A;  5C00 A;  4F2I A;  2LRC A;  1EP7 A;  4WF5 A;  3GFK A;  3FKF A;  2VCX A;  4ZB7 A;  1M99 A;  4HU9 A;  3D4M A;  2WW3 A;  3R3E A;  3QMX A;  1XCC A;  4WET A;  3F9U A;  1XPV A;  4QL9 A;  1BG1 A;  3P7X A;  1ZYQ B;  5DBQ A;  2YOI A;  1T00 A;  1O73 A;  4MF5 A;  2FLS A;  1RQM A;  2JZT A;  3KIJ A;  1H4O A;  3I6A A;  3QFA C;  3ZRD A;  1R7H A;  4QL7 A;  2H1D A;  2YWM A;  3HD5 A;  2ZUP A;  1EEJ A;  2K9F A;  3LOR A;  4IJ3 A;  5G1L A;  2FGX A;  3D6I A;  4G10 A;  4TR3 A;  4L5L A;  2CA8 A;  3TRX A;  2BJX A;  3LXT A;  2FHE A;  3W8J A;  1MTC A;  3FK8 A;  3GSS A;  2LJR A;  2GZP A;  3CQF A;  2R37 A;  3ZVJ A;  5HFK A;  3UL3 A;  5J40 A;  3F0I A;  1S3A A;  2B5E A;  5H5R A;  3CSJ A;  3QAW A;  1E2Y A;  2ZNM A;  2MMZ A;  1FVK A;  3IE3 A;  3UOM A;  5DDL A;  4POB A;  3V1W A;  2HZF A;  5GAN D;  4ZL8 A;  5CRE A;  4ZBD A;  3KCM A;  2EFH A;  2OE1 A;  3GA4 A;  4MDC A;  3G7I A;  1SYR A;  2G0F A;  1G6Y A;  4KW6 A;  4WBR D;  2M80 A;  2M46 A;  4XS1 A;  5A4U A;  2O36 A;  1RK4 A;  3VI5 A;  5H5Q A;  3PR8 A;  4MCU A;  2PVQ A;  3KXO A;  3M9K A;  3ERW A;  4GDF A;  3ZL5 A;  3LEF A;  2CVK A;  1Y25 A;  2FA4 A;  1ON4 A;  3GYK A;  2FA8 A;  1PQN A;  4ZL9 A;  3ZLP A;  2IL3 A;  3EPT A;  2DJK A;  3Q6O A;  3NZN A;  3U6V A;  2EFC A;  4DSS A;  3GTU B;  1OC8 A;  4MJE A;  1DUG A;  1OKT A;  3I69 A;  1QGV A;  3O3T A;  3D0Z A;  2OKA A;  5IMC A;  13GS A;  2IN3 A;  3MWH A;  4CY6 A;  5D9W A;  2ON5 A;  1QXH A;  5IPG A;  4NXI A;  10GS A;  1M3J A;  5DAK A;  3N5O A;  4LMW A;  3US3 A;  4NAX A;  5A4W A;  2HSM A;  5IMV A;  1A2J A;  4GSN A;  4F9Z A;  1V2A A;  5F06 A;  1CQH A;  3BBY A;  5A34 B;  4K8M A;  7GSS A;  1K0N A;  2A2P A;  4OCF A;  3HA9 A;  1R5P A;  5DCH A;  4L0U A;  4MJA A;  1O81 A;  3FRC A;  3F3R A;  1PN9 A;  2A2S A;  2HRN A;  2OBI A;  3IBH A;  3CBU A;  1SKW B;  4AJ6 A;  4AGS A;  5EPF A;  4ZIL A;  2GSR A;  3ZFB A;  1JLV A;  4YQV A;  3GN3 A;  1G6W A;  4GRF A;  1C72 A;  4HQS A;  4TXO B;  3GH9 A;  2DSA A;  2N5A A;  4POK A;  2YWN A;  2I4A A;  3LGC A;  3WD6 A;  5AGY A;  2A2R A;  4OFN A;  3LYP A;  5FHI A;  4K0N A;  1SD8 A;  1M3I A;  1OC3 A;  2GVP A;  4E8H A;  3W6G A;  4EKZ A;  2C0F A;  4RQX A;  3HHV A;  2B3S A;  4NPB A;  3GRX A;  3VWV A;  2CAI A;  1SJI A;  5HFG A;  3ZIJ A;  1K3Y A;  5IOX A;  2H73 A;  3HDC A;  1O6J A;  3OR5 A;  3VWX A;  3BCI A;  2LEG A;  1FHE A;  1EZK A;  1R5A A;  2WS2 A;  5J41 A;  2HNL A;  1F3A A;  2CAQ A;  1ZYP A;  2HRF A;  2LS5 A;  4XS4 A;  2YJ7 A;  2HT9 A;  1TJD A;  3FZA A;  1GSE A;  1O8X A;  3C1R A;  1VF4 A;  3DKS A;  2LQQ A;  4MAB A;  5D8I A;  2GQL A;  2XPD A;  3F6D A;  1THO A;  4L5O A;  4L8E A;  1GSS A;  2VL9 A;  1SKR B;  2HRK B;  1J9B A;  1TK5 B;  3DXB A;  3M1G A;  3FR9 A;  2VL3 A;  3IAS 2;  2JAD A;  4V1A g;  1PL1 A;  4OCE A;  4TRX A;  5BRT A;  1K3O A;  3ZYW A;  1A0R P;  1GTI A;  1ZL9 A;  1YKA A;  3HJO A;  1TOF A;  19GS A;  3QPM A;  4BL7 A;  4WXT A;  3RGB C;  2PWJ A;  4RUV A;  1QFN A;  4IBP A;  4ACS A;  3UBL A;  2HYX A;  3HJP A;  3IK7 A;  2JSZ A;  2VOC A;  1WWJ A;  1U3I A;  1YVL A;  3HKR A;  4E8E A;  1B9Y C;  4X1U A;  5B7C A;  1ILO A;  4YAV A;  3EC3 A;  3TGZ A;  1V40 A;  3P90 A;  5AIV A;  5F07 A;  4EDZ A;  5ECH B;  5ECM B;  1XW5 A;  2EIO A;  2DJ2 A;  2I3Y A;  9GSS A;  3ZRE A;  2YV9 A;  1ERT A;  5KOX A;  4PQ1 A;  4JR6 A;  3F6F A;  4KSM A;  5J4U A;  1N2A A;  4BVX A;  2HLS A;  3UMA A;  3M3M A;  1IYI A;  2REM A;  3GNJ A;  1T7P B;  1TP9 A;  1WP0 A;  2WVZ A;  4NV5 A;  1X5C A;  2A4H A;  2HI7 A;  3IC4 A;  1N8J A;  4N30 A;  3ME7 A;  1EOH A;  4YKF A;  4TOP A;  1V9W A;  2I9H A;  2IMK A;  4WR5 A;  3DGQ A;  4HZ4 A;  2V2G A;  1K3L A;  2O89 A;  2WDU A;  3IAM 2;  3APQ A;  1Y6E A;  1BAY A;  1FO5 A;  4F82 A;  3RFR C;  1M7T A;  3L0H A;  3KJY A;  4RI6 A;  5AIS A;  4IQA A;  1U6T A;  4GSS A;  1USB A;  2RLI A;  1MDK A;  1PX7 A;  2BMX A;  1TXX A;  2WFC A;  5BMU A;  3FZ9 A;  1NW2 A;  3CRT A;  3FYG A;  2C3Q A;  4D73 B;  2HFD A;  1W4V A;  3ED3 A;  2VLU A;  2GSQ A;  2H01 A;  1XG8 A;  4L0W A;  2NVL A;  2F3M A;  2I81 A;  2YAN A;  2EIQ A;  3ERG A;  4MMM A;  3MNG A;  1EV9 A;  2TRX A;  1XBS A;  1B8X A;  1M2B A;  4HI7 A;  2AV4 A;  5JWO B;  2DLX A;  5G30 A;  1E6B A;  3UEM A;  5ECS A;  1FOH A;  1A2L A;  4EO3 A;  3WGX A;  1F2E A;  3HCZ A;  3G7Y A;  1SEN A;  2K18 A;  4HSC X;  2GGT A;  3F3Q A;  1M2A A;  3IRA A;  3M8N A;  2LST A;  3F4R A;  1ZYE A;  3EU3 A;  4FYC A;  1KBN A;  3I43 A;  3H4K A;  4V1A p;  1SKS B;  1F37 A;  4BVY A;  2DBC A;  3CWG A;  2DIZ A;  1SJ6 A;  1YEX A;  3H1N A;  4IS0 A;  4CDO A;  1LU4 A;  1A24 A;  3GL3 A;  1I5G A;  4YQM A;  4GF0 A;  2FCH A;  3L9U A;  4O5Q A;  4ECC A;  2PUK C;  3KD0 A;  3TUE A;  1V98 A;  3CSI A;  1XOA A;  4KUN A; 
#chains in the Genus database with same CATH homology
 1S3D A;  11GS A;  2GTU A;  1AQX A;  4XHM A;  3GST A;  3C8E A;  5IMF A;  4XRD A;  1Z6M A;  5AIX A;  4EC0 A;  4QMK A;  3MSZ A;  5E4W A;  1X5D A;  3DWV A;  5A4V A;  2H6X A;  4KDY A;  3L9V A;  1SL2 B;  1ERW A;  2YV7 A;  4DSR A;  4HOJ A;  1GTA A;  2NPB A;  2V6O A;  5JCU A;  1GNW A;  3MDK A;  2L57 A;  5ECN B;  2IJY A;  1YY7 A;  4DSQ A;  5GAP D;  1A0F A;  5AN1 A;  4KCA A;  5HQP A;  4POM A;  3M0F A;  1T3B A;  4AJ7 A;  5C04 A;  2VM2 A;  3QOU A;  1Y1U A;  5CAX A;  4W66 A;  1TW9 A;  5ELG A;  4I2U A;  2KLX A;  1GLP A;  4OMV A;  2R0P A;  3DML A;  3EU4 A;  5KN3 A;  1DE1 A;  3H93 A;  1TKD B;  4PUF C;  4MJB A;  5D9T A;  3QAG A;  5E59 A;  2L6D A;  1A8L A;  2QC7 A;  22GS A;  2BTO T;  5A1N A;  1OC9 B;  2ON7 A;  2OA7 A;  1OYJ A;  2FWG A;  3L4N A;  2Z9S A;  2NBS A;  1EV4 A;  3L9S A;  4FH8 A;  2EFD A;  4EUY A;  4JR4 A;  2GZY A;  2K8V A;  4TR1 B;  3EWL A;  5EL8 A;  1QUW A;  2GS3 A;  4HEA 2;  3TRQ A;  2VL2 A;  2L59 A;  1OKD A;  2WB9 A;  3GKN A;  3CRU A;  6GSY A;  4KGI A;  4JRR A;  1PSQ A;  5J47 A;  2HE3 A;  4Z7X A;  2AHE A;  2KP2 A;  2H0H A;  5IM9 A;  3HVS A;  5CRH A;  3G9B A;  1U88 A;  3LJR A;  2MZC A;  4G19 A;  1ACV A;  2AJQ B;  3H79 A;  3GV1 A;  5EY6 A;  5ID2 B;  5GST A;  4TVE A;  3D22 A;  4I2T A;  3APS A;  4F0B A;  3KZQ A;  1HNC A;  3IK9 A;  2OBK A;  5CP1 A;  2M72 A;  2OJL A;  2B1L A;  3GX0 A;  2HSN B;  4IEL A;  3C7M A;  3FZ5 A;  4MA9 A;  5DCG A;  3GKX A;  3TJG A;  4N11 A;  4MLY A;  2X49 A;  4EDY A;  3GHA A;  5ECL B;  1M9A A;  3WT1 A;  1BQ7 A;  1O7U A;  4NHW A;  4ZIJ A;  1FOV A;  4XS6 A;  5CRG A;  1K0D A;  2JSY A;  5JWQ B;  1MEK A;  3UIW A;  3VWW A;  2DJ1 A;  5FWG A;  14GS A;  3RHB A;  2C8U A;  5D9V A;  2RUE A;  6GSW A;  4KDX A;  3WYW A;  2YNX A;  1Q98 A;  3IA1 A;  2EIR A;  2FNO A;  4XS4 B;  2J9H A;  4KDU A;  3KTB A;  2EFE A;  4RQR A;  6GSU A;  4IJI A;  2X8G A;  4NV2 A;  4RI7 A;  3TKR A;  2LNS A;  5FT3 A;  4KND A;  4IQ1 A;  5JCW A;  2MYG A;  4PQH A;  2VLT A;  2DIY A;  2HQT A;  4HDE A;  1HD2 A;  2LNT A;  1EEM A;  2E2M A;  2C4J A;  3IOS A;  2X8C A;  4PQI A;  4YQU A;  2PMT A;  1AAZ A;  4AJ8 A;  2O85 A;  1OAZ A;  2R0C A;  4BL7 B;  3KTL A;  2AUV A;  1FW1 A;  3EVI A;  2PPT A;  2DJJ A;  2H76 A;  3TDG A;  1J0F A;  3APO A;  4TKY A;  3JCM L;  3CSH A;  4OFT A;  4WF4 A;  2VCT A;  3RBT A;  1YJ6 A;  2ZCT A;  2VLV A;  1YF1 A;  3UAP A;  3VUR A;  2H6Z A;  1XWC A;  4IHU A;  4V2M A;  4ZB9 A;  4WR4 A;  2D2Z A;  2GSS A;  3TU3 B;  2FWF A;  5ELA A;  3DVW A;  3GL5 A;  1K0A A;  2GST A;  5JWR B;  3WT2 A;  3FEU A;  3TJF A;  3HVX A;  3A2W A;  3TJB A;  1AXD A;  2QSI A;  3DYR A;  2RII A;  1SU9 A;  3MAK A;  1HQO A;  4LL4 B;  2GZZ A;  1J08 A;  1XWB A;  1U3A A;  1SK2 A;  4ML6 A;  2C80 A;  4Z2R A;  3QAV A;  2C0E A;  1PKZ A;  3EMX A;  3TJK A;  4K2X A;  2YZU A;  3TKP A;  2VCQ A;  3UVH A;  4OWY A;  4N10 A;  1SVM A;  3E0U A;  2VUP A;  2FWH A;  2F9S A;  2V1M A;  17GS A;  2C3N A;  2FUG 2;  4Q5F A;  1BYE A;  2GLR A;  1KEB A;  3GTU A;  5J4Y A;  3EMP A;  1G0T A;  2NTO A;  1YZX A;  5J3R A;  4BWQ A;  5J4V A;  2H66 A;  1VF3 A;  4IP6 A;  4ML1 A;  3AY8 A;  2H1L A;  4POL A;  3J7Y b;  3IDV A;  2IFQ B;  3HMJ G;  4X43 A;  3BCK A;  5D93 A;  3FW2 A;  2PER A;  2O5V A;  2R3X A;  5INY A;  4XRA A;  4AF2 A;  2XC2 A;  1LBK A;  4H86 A;  4ULX A;  5A34 A;  1R4W A;  2OE0 A;  1EGR A;  4G0L A;  2H1B A;  2OT3 A;  4GLT A;  3GUR A;  3ISO A;  1WOU A;  3CXG A;  4YH2 A;  5ENU A;  4Q5R A;  3PGT A;  4XTS A;  3UAR A;  4KF9 A;  2O7K A;  2P0G A;  2AAW A;  4KAE A;  2JZS A;  1K0C A;  1TXU A;  3W8S A;  2CV4 A;  2HSH A;  4JED A;  3TOT A;  2OAC A;  4TXO A;  4O32 A;  1FVJ A;  2VCW A;  3O76 A;  3KEB A;  5GZZ B;  4MNN A;  5HR0 A;  4N3Z A;  3FMW A;  1TDI A;  3SWL A;  4GCI A;  3D4T A;  3ERF A;  1Z5Y E;  2H30 A;  2XPE A;  1R26 A;  4GWR A;  2PBJ A;  1B4Q A;  1NSW A;  2X8H A;  3TJJ A;  2DKH A;  3KGK A;  4G9H A;  1XVQ A;  3NOF A;  3WGD A;  2P5R A;  5CRD A;  5B6N A;  3RPP A;  2B7J A;  2VCZ A;  4HUA A;  5HR2 A;  1YQ1 A;  4PTS A;  1ML6 A;  4ILF A;  3TKS E;  1T4Y A;  4AKX B;  1UC7 A;  1SJZ A;  1BJX A;  3HZ8 A;  1XOB A;  5F8B A;  3IR4 A;  1G7E A;  1F9M A;  2L4C A;  2WCI A;  1XFL A;  3DIE A;  2C3T A;  1GSF A;  6GSV A;  4PNF A;  2R2J A;  2VM1 A;  2H1G A;  1PRX A;  4HJ2 A;  5DJM A;  5LCZ A;  1EWX A;  5IOW A;  4JE1 A;  2QA1 A;  3ME8 A;  1A2M A;  1GTU A;  2H72 A;  2X99 A;  1ZMA A;  2FY6 A;  2PU9 C;  4K1F A;  4ECJ A;  2EC4 A;  3CTF A;  2C0G A;  1O8W A;  4WKW A;  3KMO A;  2N5B A;  2L4Q A;  4BPY A;  3N9J A;  1ABA A;  6GST A;  4FQU A;  1XIY A;  1JZD A;  1WPI A;  3FZ4 A;  1GRX A;  3TOU A;  4O5R A;  1K0O A;  4NMU A;  2YCD A;  2DJ3 A;  2WUL A;  2K6V A;  2CZ2 A;  2JZR A;  5DVB A;  2XHF A;  4N0Z A;  4ZBB A;  2P31 A;  1M0U A;  2LV3 A;  5A5H A;  3RDW A;  3LSZ A;  4KSO A;  3ZIT A;  2LUS A;  2L5L A;  5A1N B;  4ID0 A;  6GSX A;  2CX4 A;  1XWG A;  2B6M A;  3VK9 A;  5KEJ A;  1S3C A;  4TXV A;  1TRU A;  4PGT A;  2WJU A;  4HQZ A;  3Q19 A;  4K5S A;  4K7N A;  1BED A;  3GX8 A;  3E9J B;  2IME A;  2R0G A;  2GDR A;  5EVO A;  3HVV A;  4MF7 A;  5ECO B;  5CNW A;  4O92 A;  3UVT A;  4ZB6 A;  2R6K A;  3HZ4 A;  1KNG A;  2CQ9 A;  1TK0 B;  5IO2 A;  5F05 A;  2VCV A;  1AUC A;  2H71 A;  2PVO C;  4K0G A;  3ZTL A;  2RUF A;  1NHY A;  2IPA A;  1Z9H A;  1SL0 B;  2HSY A;  4KB3 A;  2V32 A;  2HRA A;  1B9X C;  1JLW A;  3KH9 A;  1PA3 A;  5JCG A;  4DEJ A;  1TK8 B;  1GWC A;  4ECB A;  5J9C A;  1SK0 A;  3R2Q A;  5HFI A;  1ST9 A;  4K9Z A;  4IKH A;  2H70 A;  2NDO A;  4KCE A;  3Q74 A;  2CZ3 A;  1AIU A;  1HNB A;  4KE3 A;  2B5X A;  4MZC A;  3HXS A;  5A5K A;  5DAL A;  1OE7 A;  3TCO A;  4D73 A;  3TB2 A;  4IP1 A;  2RM6 A;  1JZW A;  2CVD A;  5G5F A;  3HJM A;  5CO3 A;  12GS A;  2E2G A;  3LG6 A;  3GKK A;  3IHQ A;  1U87 A;  1W89 A;  2MBS A;  4IGJ A;  4F03 A;  2G2Q A;  4MZW A;  2VL2 C;  2HZE A;  4Q5N A;  4JU5 A;  4BWS A;  1VF2 A;  1MDI A;  3TRP A;  4GST A;  1MD4 A;  1AQV A;  1QQ2 A;  4EE0 A;  2QA2 A;  3GH6 A;  2VAF A;  1GL8 A;  1DSB A;  4MH3 A;  2WRT A;  5KN2 A;  4DSS B;  3ZFL A;  2IMF A;  4NHZ A;  3C73 A;  3LFL A;  4IVF A;  1F3B A;  3QD9 A;  2VD0 A;  1PL2 A;  1TRW A;  3TKS C;  1YDK A;  2B1K A;  4PUR A;  4ICY A;  1X9S B;  2YWO A;  4Z2U A;  4EF0 A;  1SK1 A;  3UBK A;  1TRV A;  1A23 A;  3BD2 A;  2H6Y A;  2L5O A;  4G0K A;  20GS A;  3D5J A;  3VPT A;  3IC8 A;  5IMZ A;  1DE2 A;  1ZGN A;  5DAK B;  4ZXG A;  4J56 E;  2R5G A;  2HSM B;  3DRN A;  3QFB C;  1TU8 A;  1XXU A;  2UZ8 A;  1VGL A;  4FIW A;  4TW5 A;  1YF0 A;  1GTB A;  4K7O A;  1T8E B;  4HS1 A;  1OVN A;  4G01 A;  1TI1 A;  6GSS A;  4TR0 A;  3PIN A;  4WBJ A;  5LD0 A;  1NHO A;  3TKS A;  1K0B A;  2H74 A;  3CYN A;  16GS A;  4PX1 A;  1FAA A;  2DKI A;  2JU5 A;  3FHK A;  1V58 A;  4G2E A;  1RW1 A;  2DJ0 A;  5KN1 A;  3MIX A;  1EP8 A;  2P5Q A;  4LL1 B;  2E0Q A;  3F63 A;  1WMJ A;  5ECP B;  4ZB8 A;  3F4S A;  3I9V 2;  2GT6 A;  3EE2 A;  3D21 A;  3BJ5 A;  5KOW A;  1ZYN A;  2MMN A;  2MBT A;  4MK3 A;  2IMI A;  3ZML A;  3EUR A;  1GLQ A;  5J5N A;  1GUH A;  4AKH A;  3VPQ A;  2I1U A;  2YZH A;  2K8S A;  3A2V A;  4EIP A;  1XVW A;  2LJK A;  5IMD A;  4LMV A;  18GS A;  2YN1 A;  3C71 A;  5DQY A;  1UA5 A;  1ERU A;  1K0M A;  1BX9 A;  4OFM A;  4I6X A;  1B48 A;  1O85 A;  3UJ1 A;  4MP4 A;  4MZB A;  5ECQ B;  3S9F A;  2R4V A;  2XBQ A;  2FWE A;  5G31 A;  4EVM A;  4FYB A;  5CRW A;  1OC9 A;  3KMN A;  1HYU A;  3RAZ A;  1Z6N A;  4XIH A;  1JZR A;  2X64 A;  1PN0 A;  1TTZ A;  5G5E A;  4WEY A;  4MPF A;  4FYU A;  1THX A;  1WJK A;  4OD7 A;  5LNK e;  1GUM A;  1F6M C;  2XBI A;  4KA0 A;  4TR1 A;  2O8V B;  3IXR A;  5IPH A;  5B8B A;  2ALB A;  4G0I A;  1EOG A;  1EGO A;  2GQM A;  3LWA A;  4X4J A;  2KHP A;  3C1S A;  4KH7 A;  3VLN A;  3ZMK A;  1SL1 B;  1AW9 A;  2N5F A;  4E68 A;  5D9X A;  1FB6 A;  4TR4 A;  1JHB A;  2KUC A;  1GNE A;  3HY2 A;  4I8B A;  1DBY A;  2A4V A;  1I9D A;  1QK8 A;  5ID2 A;  1PKW A;  3KP8 A;  4JBB A;  1QMV A;  4J2F A;  4K2D A;  2H75 A;  1SVL A;  4J57 E;  3WGE A;  2HSN A;  4BVX B;  5HR1 A;  5HR3 A;  1PX6 A;  1CQG A;  2LJA A;  3RHC A;  5G2Z A;  2JL4 A;  4EIQ A;  5IIZ A;  5IO0 A;  5DJL A;  2CT6 A;  3DVX A;  3GIX A;  4V2N A;  2UV8 G;  4USS A;  4HZ2 A;  1GSY A;  3O6T A;  4OO5 A;  1A8Y A;  3EYT A;  1BF5 A;  4DVC A;  4Z2T A;  3VI7 A;  2IMD A;  4LLR A;  1BG5 A;  4LA1 A;  1IYH A;  2MMO A;  1Z7R A;  4O5U A;  2H19 A;  5BMU B;  3FR3 A;  2O87 A;  2TRC P;  3BOA A;  2OE3 A;  3KM6 A;  1X5E A;  5KN0 A;  4GTU A;  2LRT A;  3EIN A;  1B4P A;  2MMA A;  4NWY A;  4PXO A;  4F0C A;  4EL1 A;  2VIM A;  4I97 A;  1SD9 A;  3LXZ A;  1HNA A;  5D73 A;  3GKM A;  4CY8 A;  4OO4 A;  2IIY A;  3LW9 A;  1XW9 A;  1N25 A;  4V2L A;  1T4Z A;  2L6C A;  1MD3 A;  3ZIV A;  1X9M B;  1SVO A;  2HXK A;  1YEP A;  4ZL7 A;  1AQW A;  4ECI A;  3RPN A;  4GQF A;  3ZVJ D;  2H0G A;  2FD3 A;  4I5Q A;  2DMM A;  2WZ9 A;  4P3Y B;  2LTK A;  5COH A;  4BVY B;  5GSS A;  5A5H B;  4HU7 A;  4MPG A;  2QGV A;  4AKI A;  4A5P A;  1JZO A;  2F8A A;  5J9B A;  4K7I A;  5L71 A;  5CYY A;  3KP9 A;  1GP1 A;  3Q18 A;  2LRN A;  4CHS A;  1GSU A;  3VFI A;  3DD3 A;  2GT5 A;  3A5I A;  4N0V A;  1WRY A;  5ABR A;  3A5W A;  4HJM A;  8GSS A;  3A2X A;  2X4A A;  5F0G A;  1H75 A;  4KX4 A;  4PNG A;  2CX3 A;  2YPM A;  4IN0 A;  2GQK A;  1V57 A;  1YKC A;  2KP1 A;  3IPZ A;  1PMT A;  4ISD A;  2E7P A;  4QQ7 A;  2VO4 A;  4FO5 A;  1JFU A;  3K8N A;  3DEX A;  5H5S A;  1XWA A;  5ECK B;  4IW9 A;  2J23 A;  3P2A A;  1PD2 1;  3FR6 A;  1KTE A;  1WE0 A;  3LQ7 A;  1ZZY A;  2HRK A;  1NM3 A;  2YWI A;  3IV4 A;  3HYP A;  3QR6 A;  1UN2 A;  4YAP A;  5DAL B;  4ZBA A;  2IWT A;  1OE8 A;  4MF6 A;  3LYK A;  1LJR A;  3F4T A;  1M9B A;  1VRS D;  2LKU A;  1FB0 A;  4JZQ A;  3L78 A;  2HZE B;  3P8W A;  1FG4 A;  2IFQ A;  1ZOF A;  4YKG A;  1GSQ A;  1Q4J A;  5ECI B;  3E3E A;  1GH2 A;  1GUK A;  2ES7 A;  2OAD A;  1XWK A;  2QKE A;  3QCP A;  3SBC A;  5IMA A;  4X0X A;  1G7O A;  3A3T A;  4GXZ A;  3G7J A;  2H8L A;  3GMF A;  3NIV A;  1URM A;  1WIK A;  2C1Y A;  4TN8 A;  2YJH A;  3H8Q A;  2F8F A;  1TI3 A;  2AYT A;  5G1K A;  2KOK A;  4CW9 A;  5DQS A;  2JAC A;  2VKZ G;  2WGR A;  3GUS A;  5ECR B;  2AB6 A;  2V41 A;  4PUA A;  2F51 A;  3ZZX A;  4EXJ A;  2YP6 A;  4AKG A;  1ZCP A;  3CMI A;  2H0I A;  3M9J A;  3FY7 A;  3PH9 A;  1XZO A;  2H1A A;  2B7K A;  1TU7 A;  1Z7P A;  2B5Y A;  1X9W B;  4Q5Q A;  2C0D A;  1M2D A;  3VWU A;  3MYD A;  5D96 A;  1MDJ A;  4MJC A;  4GQC A;  3U5R E;  1TRS A;  5IQY A;  1Z3E A;  1UVZ A;  3PPU A;  4K6X A;  1GSD A;  3KH7 A;  3TKQ A;  4K5R A;  3CTG A;  3IHG A;  5B6M A;  1T1V A;  1AC1 A;  1SYX A;  2PGT A;  2LQO A;  2TIR A;  3J7Y k;  4MH2 A;  4O7H A;  1PGT A;  4AI6 A;  2V6K A;  2PN8 A;  1X0R A;  2RM5 A;  1VF1 A;  3QDN A;  2VD1 A;  4BA7 A;  1ERV A;  3F8U A;  2DC5 A;  5B8A A;  1GUL A;  1XW6 A;  2CVB A;  4XCS A;  2DML A;  5C00 A;  4F2I A;  2LRC A;  1EP7 A;  4WF5 A;  3GFK A;  3FKF A;  2VCX A;  4ZB7 A;  1M99 A;  4HU9 A;  3D4M A;  3R3E A;  3QMX A;  1XCC A;  4WET A;  3F9U A;  1XPV A;  4QL9 A;  1BG1 A;  3P7X A;  1ZYQ B;  5DBQ A;  2YOI A;  1T00 A;  1O73 A;  4MF5 A;  2FLS A;  1RQM A;  2JZT A;  3KIJ A;  1H4O A;  3I6A A;  3QFA C;  3ZRD A;  1R7H A;  4QL7 A;  2H1D A;  2YWM A;  3HD5 A;  2ZUP A;  1EEJ A;  2K9F A;  3LOR A;  4IJ3 A;  5G1L A;  2FGX A;  3D6I A;  4G10 A;  4TR3 A;  4L5L A;  2CA8 A;  3TRX A;  2BJX A;  3LXT A;  2FHE A;  3W8J A;  1MTC A;  3FK8 A;  3GSS A;  2LJR A;  2GZP A;  2R37 A;  3ZVJ A;  5HFK A;  3UL3 A;  5J40 A;  3F0I A;  1S3A A;  2B5E A;  5H5R A;  3CSJ A;  3QAW A;  1E2Y A;  2ZNM A;  2MMZ A;  1FVK A;  3IE3 A;  3UOM A;  5DDL A;  4POB A;  3V1W A;  2HZF A;  5GAN D;  4ZL8 A;  5CRE A;  4ZBD A;  3KCM A;  2EFH A;  2OE1 A;  3GA4 A;  4MDC A;  3G7I A;  1SYR A;  2G0F A;  1G6Y A;  4KW6 A;  4WBR D;  2M80 A;  2M46 A;  4XS1 A;  5A4U A;  1RK4 A;  3VI5 A;  5H5Q A;  3PR8 A;  4MCU A;  2PVQ A;  3KXO A;  3M9K A;  3ERW A;  4GDF A;  3ZL5 A;  3LEF A;  2CVK A;  1Y25 A;  2FA4 A;  1ON4 A;  3GYK A;  2FA8 A;  1PQN A;  4ZL9 A;  3ZLP A;  2IL3 A;  3EPT A;  2DJK A;  3Q6O A;  3NZN A;  3U6V A;  2EFC A;  4DSS A;  3GTU B;  1OC8 A;  4MJE A;  1DUG A;  1OKT A;  3I69 A;  1QGV A;  3O3T A;  3D0Z A;  2OKA A;  5IMC A;  13GS A;  2IN3 A;  3MWH A;  4CY6 A;  5D9W A;  2ON5 A;  1QXH A;  5IPG A;  4NXI A;  10GS A;  5DAK A;  3N5O A;  4LMW A;  3US3 A;  4NAX A;  5A4W A;  2HSM A;  5IMV A;  1A2J A;  4GSN A;  4F9Z A;  1V2A A;  5F06 A;  1CQH A;  3BBY A;  5A34 B;  4K8M A;  7GSS A;  1K0N A;  2A2P A;  4OCF A;  3HA9 A;  1R5P A;  5DCH A;  4L0U A;  4MJA A;  1O81 A;  3FRC A;  3F3R A;  1PN9 A;  2A2S A;  2HRN A;  2OBI A;  3IBH A;  3CBU A;  1SKW B;  4AJ6 A;  4AGS A;  5EPF A;  4ZIL A;  2GSR A;  3ZFB A;  1JLV A;  4YQV A;  3GN3 A;  1G6W A;  4GRF A;  1C72 A;  4HQS A;  4TXO B;  3GH9 A;  2DSA A;  2N5A A;  4POK A;  2YWN A;  2I4A A;  3LGC A;  3WD6 A;  5AGY A;  2A2R A;  4OFN A;  3LYP A;  5FHI A;  4K0N A;  1SD8 A;  1OC3 A;  2GVP A;  4E8H A;  3W6G A;  4EKZ A;  2C0F A;  4RQX A;  3HHV A;  2B3S A;  4NPB A;  3GRX A;  3VWV A;  2CAI A;  1SJI A;  5HFG A;  3ZIJ A;  1K3Y A;  5IOX A;  2H73 A;  3HDC A;  1O6J A;  3OR5 A;  3VWX A;  3BCI A;  2LEG A;  1FHE A;  1EZK A;  1R5A A;  2WS2 A;  5J41 A;  2HNL A;  1F3A A;  2CAQ A;  1ZYP A;  2HRF A;  2LS5 A;  4XS4 A;  2YJ7 A;  2HT9 A;  1TJD A;  3FZA A;  1GSE A;  1O8X A;  3C1R A;  1VF4 A;  3DKS A;  2LQQ A;  4MAB A;  5D8I A;  2GQL A;  2XPD A;  3F6D A;  1THO A;  4L5O A;  4L8E A;  1GSS A;  2VL9 A;  1SKR B;  2HRK B;  1J9B A;  1TK5 B;  3DXB A;  3M1G A;  3FR9 A;  2VL3 A;  3IAS 2;  2JAD A;  4V1A g;  1PL1 A;  4OCE A;  4TRX A;  5BRT A;  1K3O A;  3ZYW A;  1A0R P;  1GTI A;  1ZL9 A;  1YKA A;  3HJO A;  1TOF A;  19GS A;  3QPM A;  4BL7 A;  4WXT A;  2PWJ A;  4RUV A;  1QFN A;  4IBP A;  4ACS A;  3UBL A;  2HYX A;  3HJP A;  3IK7 A;  2JSZ A;  2VOC A;  1WWJ A;  1U3I A;  1YVL A;  3HKR A;  4E8E A;  1B9Y C;  4X1U A;  5B7C A;  1ILO A;  4YAV A;  3EC3 A;  3TGZ A;  1V40 A;  3P90 A;  5AIV A;  5F07 A;  4EDZ A;  5ECH B;  5ECM B;  1XW5 A;  2EIO A;  2DJ2 A;  2I3Y A;  9GSS A;  3ZRE A;  2YV9 A;  1ERT A;  5KOX A;  4PQ1 A;  4JR6 A;  3F6F A;  4KSM A;  5J4U A;  1N2A A;  4BVX A;  2HLS A;  3UMA A;  3M3M A;  1IYI A;  2REM A;  3GNJ A;  1T7P B;  1TP9 A;  1WP0 A;  4NV5 A;  1X5C A;  2A4H A;  2HI7 A;  3IC4 A;  1N8J A;  4N30 A;  3ME7 A;  1EOH A;  4YKF A;  4TOP A;  1V9W A;  2I9H A;  2IMK A;  4WR5 A;  3DGQ A;  4HZ4 A;  2V2G A;  1K3L A;  2O89 A;  2WDU A;  3IAM 2;  3APQ A;  1Y6E A;  1BAY A;  1FO5 A;  4F82 A;  1M7T A;  3L0H A;  3KJY A;  4RI6 A;  5AIS A;  4IQA A;  1U6T A;  4GSS A;  1USB A;  2RLI A;  1MDK A;  1PX7 A;  2BMX A;  1TXX A;  2WFC A;  5BMU A;  3FZ9 A;  1NW2 A;  3CRT A;  3FYG A;  2C3Q A;  4D73 B;  2HFD A;  1W4V A;  3ED3 A;  2VLU A;  2GSQ A;  2H01 A;  4L0W A;  2NVL A;  2F3M A;  2I81 A;  2YAN A;  2EIQ A;  3ERG A;  4MMM A;  3MNG A;  1EV9 A;  2TRX A;  1XBS A;  1B8X A;  1M2B A;  4HI7 A;  2AV4 A;  5JWO B;  2DLX A;  5G30 A;  1E6B A;  3UEM A;  5ECS A;  1FOH A;  1A2L A;  4EO3 A;  3WGX A;  1F2E A;  3HCZ A;  3G7Y A;  1SEN A;  2K18 A;  2GGT A;  3F3Q A;  1M2A A;  3IRA A;  3M8N A;  2LST A;  3F4R A;  1ZYE A;  3EU3 A;  4FYC A;  1KBN A;  3I43 A;  3H4K A;  4V1A p;  1SKS B;  1F37 A;  4BVY A;  2DBC A;  3CWG A;  2DIZ A;  1SJ6 A;  1YEX A;  3H1N A;  4IS0 A;  4CDO A;  1LU4 A;  1A24 A;  3GL3 A;  1I5G A;  4YQM A;  4GF0 A;  2FCH A;  3L9U A;  4O5Q A;  4ECC A;  2PUK C;  3KD0 A;  3TUE A;  1V98 A;  3CSI A;  1XOA A;  4KUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...