3KJYA

Crystal structure of reduced homo sapiens clic3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
223
Chain Sequence
LEVLFQTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 3
publication title Structure of human CLIC3 at 2 A resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 223
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kjyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kjyA01
1XW6A 3HJPA 4LA1A 4MMMA 2VAFA 3D21A 3VWVA 1PX6A 5ECQB 1ZZYA 5AISA 1AQVA 2GTUA 20GSA 2QSIA 2GVPA 2WULA 2FY6A 3WGXA 4G0LA 1QGVA 3S9FA 2GT5A 3ZMLA 3APOA 2ZNMA 4HI7A 3H4KA 2C3TA 1YF1A 5IM9A 5FT3A 2HLSA 4MZWA 4JU5A 1GSUA 4PUAA 3DYRA 4YQMA 1C72A 2H0GA 1ZL9A 2D2ZA 3LWAA 2PVQA 1MDKA 1WJKA 1XOBA 4V2LA 2CAIA 2C80A 2L5OA 4Z7XA 2CAQA 1HYUA 3UJ1A 1HQOA 1EP8A 4TR1A 3F4SA 2H8LA 5IMCA 4KW6A 5IMFA 1ILOA 2N5BA 5CRWA 2BJXA 1LBKA 4XS6A 3D6IA 2CT6A 5KEJA 1F3AA 1X9MB 1U3IA 4IP6A 4N0VA 5ECLB 2LSTA 4HEA2 4NPBA 4F0BA 3W6GA 1YY7A 5CRGA 3TRQA 1EEMA 2DJKA 2WS2A 4IN0A 4I6XA 4WXTA 2C3QA 3GX8A 1Z6MA 1WP0A 3CRTA 1GULA 3ZIJA 4WBRD 3BOAA 3L9UA 4POLA 4NXIA 3I69A 3UBKA 1A23A 3GH9A 1VF4A 2RM6A 2L59A 1WPIA 3ZLPA 2O7KA 3ZRDA 2LTKA 1B4QA 3TDGA 1AQWA 1Z3EA 4MDCA 1HNCA 1B9XC 3DRNA 2C0GA 5JCGA 4L0UA 2ALBA 2HRFA 4PXOA 2FHEA 4F2IA 3CTGA 4E8HA 3N9JA 1XW5A 3IPZA 2OE1A 4I5QA 3VPTA 2OACA 4POKA 2TRCP 3Q18A 5JWRB 4EVMA 3TJBA 1UN2A 4L8EA 13GSA 4IGJA 2YZHA 2GZPA 1XZOA 4DVCA 4EC0A 2VL3A 2F51A 5HFIA 1H75A 2YN1A 3ME7A 2ON5A 1X9SB 4Q5QA 16GSA 3HHVA 1A2JA 1UC7A 1K0CA 4IQ1A 2P5RA 2VD1A 1Z7RA 2IJYA 3F4TA 2LUSA 2B6MA 1AXDA 3WT1A 1PRXA 1JLWA 1VF2A 3FR6A 3FY7A 4GRFA 5HQPA 1BAYA 2H1DA 4K7OA 2AJQB 1K0NA 2V6KA 3KP9A 3FEUA 3HY2A 2YWNA 4ZL7A 3LXTA 2H71A 1R5PA 1OKDA 5KN3A 1MD3A 3IXRA 3O76A 4IVFA 2O85A 5ID2B 1SK2A 2GLRA 3ME8A 3AY8A 4ISDA 4X1UA 1GLQA 5GAPD 5F06A 5IIZA 9GSSA 2OBKA 3UEMA 4TR1B 4IS0A 3NZNA 1BQ7A 3IAM2 1ZMAA 1TK8B 4KAEA 4MPGA 2VLUA 3LORA 3A3TA 4XS4B 1PSQA 5CRDA 3LFLA 5IOWA 4V1Ag 2RIIA 1DBYA 3VFIA 3R2QA 3DVWA 4IJ3A 1TDIA 4K8MA 2MBSA 2DJ1A 5J9BA 1DUGA 4GXZA 4PUFC 2V2GA 1K0OA 2RUEA 2YWOA 1OVNA 3HZ8A 4HZ4A 4NHWA 1XWAA 2B3SA 4ZB6A 1G7OA 1MDJA 1A0FA 1ON4A 2B7KA 4D73A 1PL2A 3KM6A 1XWBA 4N30A 1FOVA 2O89A 4FYBA 3IK9A 3TOTA 4LMVA 2YWIA 3GTUB 3RBTA 5DQYA 1N2AA 2WJUA 5ECHB 3TKSE 2HRKA 4HQSA 4POBA 3QDNA 2C3NA 2YJ7A 4JBBA 4IBPA 4WR4A 5DJLA 3FHKA 4FO5A 1U88A 3A5WA 3GNJA 3ERGA 3SWLA 5B8AA 3KGKA 2Z9SA 2IWTA 1SD9A 2ON7A 1XBSA 5F05A 2KHPA 2PUKC 3C1RA 4AJ6A 1B8XA 2RLIA 1SKSB 3QR6A 2A2RA 3F6FA 1GP1A 5DCHA 5G2ZA 5D93A 2B1KA 3FYGA 2OBIA 4PQIA 3EC3A 3CXGA 1SYRA 5C04A 4TXOB 2DIZA 2PWJA 4LLRA 17GSA 4ZL9A 3RHBA 2KUCA 1V57A 5IO2A 1VGLA 1SL2B 3BD2A 3A2XA 2F3MA 3ZFBA 3DMLA 4WF4A 2NBSA 4OWYA 4K0NA 4K7IA 4EUYA 5HFKA 1H4OA 4FYCA 5KN1A 3TKQA 2VM1A 3MSZA 3GV1A 2K8SA 5GSTA 4BVXB 2K8VA 2JZSA 1HD2A 4KX4A 14GSA 1SK0A 3UVHA 2FGXA 3TKSC 4LMWA 1TRSA 2YZUA 1Z6NA 1N8JA 4XRAA 2PU9C 1R26A 4BPYA 3PGTA 2M80A 1CQGA 4HZ2A 3DKSA 4MJCA 2FNOA 1TI3A 1XWCA 3U5RE 4TXVA 3EU4A 1V40A 2YJHA 2L4QA 11GSA 2VL2C 5IPHA 1V98A 1OC8A 3PH9A 1SD8A 3FR3A 3D22A 5B6NA 2KOKA 4YQVA 1PD21 2FD3A 2K18A 1USBA 1THOA 3IDVA 1OC3A 5AIXA 1JZOA 3HXSA 2MMOA 5IOXA 2HSHA 1NHYA 3F63A 4ZB8A 4NMUA 2HE3A 5D8IA 1PX7A 2LJKA 3PINA 2X99A 2FWFA 3UMAA 4PGTA 4ID0A 4YH2A 2GSRA 2PMTA 3LJRA 4RQXA 4MZBA 4V2NA 1TW9A 22GSA 4G19A 5D9WA 3HCZA 2VUPA 2CX4A 2GT6A 3EU3A 1AIUA 4ACSA 1PMTA 4XS1A 2R6KA 1BJXA 5DBQA 4ML1A 2WB9A 2V41A 4CHSA 5DALB 3IRAA 1OYJA 2DJ0A 2DJ2A 2WRTA 2CVKA 3ZMKA 3ZL5A 2VOCA 3HYPA 4YAVA 4BWSA 4KF9A 1TTZA 4GQFA 1F9MA 1JZWA 1EWXA 1Z7PA 1Z9HA 1MDIA 1T3BA 4FH8A 4ZL8A 4GCIA 4DSQA 3E3EA 2P5QA 3QD9A 3H93A 4OD7A 1EOHA 4K1FA 1E6BA 1B4PA 2XBQA 1EV9A 1SKWB 5J4UA 6GSUA 3TGZA 2CZ3A 4I97A 3QFBC 1XCCA 2DLXA 2HRNA 2V1MA 2GS3A 5FHIA 4YQUA 2EIRA 5ID2A 3P8WA 4Q5RA 2JL4A 3KCMA 3D4MA 1THXA 2YP6A 5D9TA 3IA1A 1FB6A 1O7UA 2KP2A 4G0IA 1SL0B 2CQ9A 2O87A 1GTAA 2LJRA 3ISOA 4OCEA 3Q6OA 4O92A 5JCUA 2L57A 3LQ7A 4IHUA 4MPFA 5COHA 3HVSA 1XPVA 4ECIA 4EO3A 1R5AA 3BJ5A 4XS4A 4BVYB 4TN8A 2PPTA 3MAKA 3G7IA 3UIWA 4KSMA 2OJLA 4ZIJA 2HT9A 3M0FA 3N5OA 4O5RA 2IPAA 1PN9A 2VCVA 1IYHA 2C0DA 1GSSA 3BBYA 1NHOA 1GSFA 2NPBA 1GTUA 4I2UA 1PGTA 2LQOA 3GTUA 2YANA 4EL1A 1BEDA 2E7PA 1Q98A 4MLYA 1TU8A 1GUMA 2VCQA 2CZ2A 4K2DA 2E2GA 2I9HA 5J3RA 1GTBA 2JADA 3ZTLA 2H6XA 3HDCA 1GLPA 3ZITA 1YEXA 4XRDA 1S3AA 3IE3A 2MMNA 2YPMA 1U6TA 2LV3A 5AGYA 2MBTA 3V1WA 4F82A 3WD6A 1QQ2A 1LU4A 4WKWA 2AAWA 1TK5B 2M46A 4JEDA 3H8QA 4K7NA 5F8BA 3TJGA 2DJ3A 1FG4A 2ES7A 3IR4A 1O85A 1GSQA 4TXOA 3CSJA 1GNWA 1S3DA 3ERFA 5EVOA 5IMVA 4NWYA 1XWGA 3CYNA 1XXUA 2YCDA 2VLVA 4K6XA 3KZQA 3UVTA 3M8NA 3C73A 4EF0A 5JCWA 3GMFA 1XVWA 3KMNA 19GSA 4KDXA 2AV4A 1K0BA 4TW5A 1ERWA 2MMZA 2OA7A 1ERUA 1T8EB 5A5KA 2GSSA 4IJIA 4KNDA 18GSA 4JR4A 3I9V2 5E59A 5B8BA 6GSVA 2HRAA 2CVBA 4HDEA 2GZZA 1SYXA 2H0HA 4TR0A 1Y25A 4AF2A 4BVXA 3UAPA 2FA8A 2R3XA 1Y6EA 4MH3A 5CNWA 2HZFA 5C00A 1OKTA 1VF3A 4JRRA 2LJAA 1Q4JA 1Z5YE 2GSQA 3GL3A 3HJMA 1OE7A 5F07A 2VL9A 3E0UA 5D73A 4EDZA 3FZ9A 7GSSA 2HYXA 2YV9A 4MA9A 1T7PB 2JACA 4PQ1A 2I3YA 3Q19A 2JSYA 1B9YC 4RUVA 2MYGA 1GUHA 2EIOA 5ECNB 2FWHA 1SKRB 1TRUA 1ZYQB 5ABRA 1K0DA 5LD0A 3L0HA 5GZZB 4KE3A 5H5SA 2H6ZA 1JZRA 5HFGA 5B7CA 2YV7A 5G5FA 2CVDA 3I43A 1PKWA 1O8XA 4OO5A 1A0RP 3GFKA 2B5EA 1AAZA 1R4WA 2H73A 4L5LA 4HJMA 4KB3A 1WOUA 3P2AA 2F8AA 4K0GA 1DE2A 3QAGA 3H1NA 3HKRA 2H66A 3KXOA 3EYTA 2YNXA 3F3QA 4P3YB 4FQUA 4DEJA 3FZ5A 3LYPA 4BL7A 4TR3A 3TKRA 5IMAA 1U87A 1J9BA 3KTLA 5F0GA 3IAS2 12GSA 4Q5NA 5DALA 2K9FA 1XWKA 4POMA 3HVXA 4XTSA 8GSSA 4JE1A 3GHAA 5ECPB 3HZ4A 2DJJA 2V32A 1T00A 1XFLA 3KD0A 2I1UA 1CQHA 3IBHA 3Q74A 5L71A 1YKAA 4J57E 4XHMA 5KN0A 3DEXA 3KTBA 3CMIA 2DMMA 3KH7A 4L0WA 3ZIVA 4QL9A 4MJAA 4GSNA 2KP1A 2H30A 1O73A 1NSWA 2OE0A 4MF6A 4PNFA 2PERA 3ERWA 4V1Ap 3VWUA 1DE1A 1M2DA 1F2EA 3TUEA 4PURA 3GYKA 3IHQA 1GSYA 2H70A 1OC9B 4PNGA 4X0XA 4KCEA 2VCWA 2K6VA 4TR4A 5ECSA 1WMJA 1GSDA 1K0MA 1TJDA 4X43A 4L5OA 5DDLA 3GKMA 4EKZA 1B48A 2RUFA 4GF0A 3EWLA 2A2SA 3IOSA 5IO0A 4OFMA 2I4AA 4RI6A 4OMVA 3O6TA 2R2JA 4BVYA 3CSIA 2RM5A 2DIYA 3GUSA 4MK3A 4EE0A 4ECJA 2PVOC 3KJYA 2FA4A 3E9JB 3EVIA 1TOFA 2IFQB 1TK0B 1BYEA 2VD0A 5HR0A 1EV4A 4G2EA 3A2VA 2X8HA 5HR3A 1GNEA 3ZVJD 1X5DA 2GQLA 1EOGA 2AHEA 4HU7A 3QAWA 5JWOB 4GLTA 2P31A 2MMAA 1LJRA 2OADA 1JLVA 3F4RA 2B7JA 1FO5A 4MH2A 5D96A 5KN2A 2H1GA 3DWVA 2VIMA 3O3TA 1KTEA 2PN8A 2VLTA 2LRTA 3RDWA 5AIVA 4ZXGA 3ZFLA 2VM2A 3U6VA 3FK8A 3IC8A 4KDUA 3RHCA 4HQZA 2IN3A 3EINA 4USSA 3KMOA 2HSNB 3M9KA 2JSZA 2LS5A 2HZEB 3EMXA 2H74A 2HSYA 4KA0A 4H86A 3FRCA 4KCAA 3VI5A 1X0RA 1FAAA 3GIXA 1T4YA 2E0QA 4PQHA 1GH2A 1G6YA 1SJ6A 2HI7A 2TIRA 4BL7B 4MF5A 3WGDA 1ERTA 3TRPA 2G2QA 3US3A 5EY6A 5A4WA 2PBJA 2DSAA 4WETA 2XBIA 4ZBDA 3D4TA 2X8CA 4AJ7A 4ZILA 1GUKA 3WT2A 1YKCA 2WCIA 6GSXA 2G0FA 5LCZA 3NIVA 5J5NA 4MF7A 3OR5A 1A8YA 1ZOFA 2QKEA 5CO3A 1GRXA 2AB6A 4JR6A 2FWGA 3F6DA 3DD3A 3LXZA 2XC2A 3WGEA 3FKFA 2CV4A 6GSTA 2FCHA 5E4WA 4GSSA 3LGCA 1QMVA 3TOUA 5LNKe 3RPPA 5AN1A 3L9VA 1FW1A 3SBCA 3HA9A 1T4ZA 1AUCA 3D5JA 1WE0A 4NV5A 3HD5A 3VLNA 3GRXA 1YEPA 3J7Yb 1SL1B 2IMFA 3PPUA 1TXXA 2WZ9A 1S3CA 3ZYWA 3EE2A 1G0TA 3LG6A 2IL3A 4TKYA 3TKPA 1WIKA 2I81A 2H6YA 2H76A 1TP9A 5IPGA 1K0AA 4TRXA 2XPEA 3QAVA 4N0ZA 1ML6A 2HSMA 2LEGA 1YF0A 1WWJA 1I9DA 3GURA 4N10A 2GZYA 3VWWA 3C1SA 3L9SA 3LEFA 3LYKA 3A2WA 1M2AA 1M9BA 3CTFA 2V6OA 1V9WA 3QPMA 1M99A 3DXBA 1YZXA 2AYTA 4ECCA 2OKAA 3C8EA 2VCZA 3MNGA 5ECOB 1UVZA 2H01A 2IIYA 5EL8A 2IMEA 2B5YA 1A8LA 1MTCA 2P0GA 1NM3A 3APQA 5HR1A 5A4VA 4O7HA 1G6WA 3CSHA 1XOAA 4KH7A 1GSEA 2WDUA 2XPDA 4F03A 4G10A 4ILFA 1VRSD 1VF1A 3MDKA 5G30A 4F0CA 1O81A 3VPQA 5DAKB 2F9SA 2IMKA 2EIQA 1TKDB 1O6JA 3TJKA 2HFDA 3DGQA 5A4UA 1A2LA 4N11A 1AW9A 3D0ZA 1KNGA 4LL1B 4I8BA 1RW1A 5HR2A 4WF5A 4MABA 2EC4A 2DC5A 5G1KA 4I2TA 1M2BA 1SU9A 1PA3A 5G1LA 3IV4A 4ZB9A 5DCGA 1OC9A 2REMA 3G7JA 3F3RA 4CDOA 5ENUA 3JCML 2L6CA 3GH6A 4HS1A 1SJIA 4MCUA 1K3LA 1TI1A 4EXJA 5ELGA 3I6AA 1NW2A 2VCXA 5B6MA 3G7YA 3KIJA 1ACVA 1JZDA 5DJMA 4ML6A 5H5QA 4ULXA 5FWGA 1FVJA 4DSSA 1FB0A 3W8JA 1OAZA 1XVQA 2GSTA 5JWQB 3UOMA 2LKUA 1EGOA 4F9ZA 2E2MA 1X9WB 4LL4B 2GDRA 2PGTA 4OFTA 3L4NA 1GTIA 3H79A 3HVVA 2WFCA 3TRXA 4NHZA 3CRUA 1RK4A 4OCFA 3F8UA 4G9HA 5J9CA 3M1GA 3VWXA 1K3OA 2L4CA 5DVBA 1RQMA 4RI7A 2IFQA 4YAPA 3GSTA 2NVLA 1FHEA 4HOJA 2N5AA 3RAZA 1TRWA 3QMXA 2CA8A 4IW9A 1PQNA 3GSSA 1ERVA 2R5GA 4FYUA 4JZQA 3ZZXA 1TRVA 5IMDA 2H0IA 4HJ2A 2WGRA 1MEKA 2ZCTA 2GGTA 3CBUA 1T1VA 2H19A 1J08A 2LNSA 1E2YA 3F0IA 3BCKA 4GWRA 2HQTA 1EP7A 4IELA 1BX9A 2HSMB 1PKZA 3VI7A 4J56E 3P7XA 1ZYEA 6GSSA 3F9UA 2C0EA 2R4VA 1U3AA 1XW9A 4OFNA 3TKSA 5D9XA 2HXKA 1QFNA 2HZEA 4IP1A 2NTOA 2B5XA 3G9BA 4AJ8A 4MP4A 2LRNA 1V2AA 1EEJA 1G7EA 3QOUA 1ZGNA 2C4JA 4OO4A 1X5CA 4KDYA 5BMUA 1MD4A 1ST9A 3L78A 2XHFA 2H1AA 5G5EA 2J23A 3KEBA 4XCSA 2JZRA 2O8VB 1I5GA 2VCTA 3PR8A 5GAND 1GWCA 2C0FA 4GQCA 2VL2A 3FZ4A 4DSRA 3HJOA 3FZAA 2AUVA 3VURA 1AC1A 2JU5A 5CYYA 1F37A 5GSSA 3GKXA 3MWHA 2C1YA 4ECBA 4PX1A 1OE8A 1SK1A 3ED3A 2L5LA 1ABAA 4WEYA 3R3EA 3EMPA 2H1BA 1ZCPA 2GQKA 10GSA 3IK7A 3GL5A 3FW2A 2YWMA 2TRXA 2H72A 2IMDA 3J7Yk 4J2FA 6GSYA 3ZVJA 4TOPA 4E8EA 1JHBA 2LRCA 3UL3A 4XIHA 4O32A 5CAXA 1IYIA 2LQQA 1R7HA 2BMXA 5CREA 4Q5FA 2L6DA 1M0UA 1M7TA 5CP1A 3DVXA 2HNLA 1XIYA 3DIEA 4ZBAA 1QUWA 2J9HA 2LNTA 2X8GA 1O8WA 3P90A 3W8SA 1PL1A 2ZUPA 4MJEA 4DSSB 1QK8A 2C8UA 3M9JA 4MJBA 5ECKB 3IC4A 1HNAA 3TJFA 4RQRA 2F8FA 5H5RA 2FWEA 4KUNA 4KGIA 2IMIA 3WYWA 4HUAA 2NDOA 1A2MA 3NOFA 3BCIA 4TVEA 4BA7A 5CRHA 1UA5A 1A24A 4WR5A 5ECIB 4GTUA 4WBJA 5DQSA 2BTOT 4MZCA 5D9VA 1WRYA 1J0FA 4G0KA 3QFAC 1SJZA 2X64A 4NAXA 6GSWA 1F6MC 2N5FA 5IQYA 2QC7A 3GKKA 4FIWA 2A4VA 4K9ZA 4V2MA 2JZTA 1W89A 5G31A 4ZBBA 1GL8A 4BWQA 2OE3A 5IMZA 3RPNA 3M3MA 4GSTA 1URMA 3LSZA 3EURA 3KP8A 2CX3A 1F3BA 4PTSA 2DMLA 4NV2A 2M72A 4QL7A 2DBCA 1AQXA 1FVKA 1YJ6A 1DSBA 2FLSA 3TJJA 5DAKA 1SENA 2GQMA 3FR9A 3APSA 4HU9A 3GX0A 4QQ7A 2FUG2 3GKNA 2R37A 3K8NA 1K3YA 1M9AA 3TB2A 5EPFA 1TU7A 1YQ1A 5ECRB 1V58A 3TCOA 3C71A 3UBLA 2VO4A 3GN3A 3GA4A 4KSOA 3QCPA 5INYA 4IQAA 3VK9A 1YDKA 3ZREA 5J41A 4D73B 1X5EA 5ELAA 1HNBA 2H75A 1EGRA 4AGSA 1JFUA 1BG5A 2MZCA 3KH9A 3C7MA 2UZ8A 2HRKB 1EZKA 2B1LA 3UARA 4EDYA 1KBNA 1W4VA 4IKHA 5ECMB 1QXHA 2YOIA 1KEBA 2KLXA 2QGVA 4CW9A
chains in the Genus database with same CATH superfamily
1XW6A 3HJPA 4LA1A 4MMMA 2VAFA 4E68A 3D21A 3VWVA 1PX6A 5ECQB 1ZZYA 5AISA 1AQVA 2GTUA 3HMJG 20GSA 2QSIA 2GVPA 2WULA 2FY6A 3WGXA 4CY6A 4G0LA 1QGVA 3S9FA 2GT5A 3ZMLA 3APOA 2ZNMA 4HI7A 3H4KA 2C3TA 1YF1A 5IM9A 5FT3A 2HLSA 4MZWA 4JU5A 1GSUA 4PUAA 3DYRA 4YQMA 1C72A 2H0GA 1ZL9A 2D2ZA 3LWAA 2PVQA 1MDKA 1WJKA 1XOBA 4V2LA 2CAIA 2C80A 2L5OA 4Z7XA 2CAQA 1HYUA 3UJ1A 1HQOA 3CHXC 1EP8A 4TR1A 3F4SA 2H8LA 5IMCA 4KW6A 5IMFA 1ILOA 2N5BA 5CRWA 2BJXA 1LBKA 4XS6A 3D6IA 2CT6A 5KEJA 1F3AA 1X9MB 1U3IA 4IP6A 4N0VA 5ECLB 2LSTA 4HEA2 4NPBA 4F0BA 3W6GA 1YY7A 5CRGA 3TRQA 1EEMA 2DJKA 2WS2A 4IN0A 4I6XA 4WXTA 2C3QA 3GX8A 4QMKA 1Z6MA 1WP0A 3CRTA 1GULA 3ZIJA 4WBRD 3BOAA 3L9UA 4POLA 3MIXA 4NXIA 3I69A 3UBKA 1A23A 4X4JA 3GH9A 1VF4A 2RM6A 2L59A 4K5SA 1WPIA 3ZLPA 2O7KA 3ZRDA 2LTKA 1B4QA 3TDGA 1AQWA 1Z3EA 4MDCA 1HNCA 1B9XC 3DRNA 2C0GA 5JCGA 4L0UA 2ALBA 2HRFA 4PXOA 2FHEA 4F2IA 3CTGA 4E8HA 3N9JA 1XW5A 3IPZA 2OE1A 4I5QA 3VPTA 2OT3A 2OACA 4POKA 2TRCP 3Q18A 5JWRB 4EVMA 3TJBA 1UN2A 4L8EA 13GSA 4IGJA 2YZHA 2GZPA 4AI6A 1XZOA 4DVCA 4EC0A 2VL3A 2F51A 5HFIA 1H75A 2YN1A 3ME7A 2ON5A 1X9SB 4Q5QA 16GSA 3HHVA 1A2JA 1UC7A 1K0CA 4IQ1A 2P5RA 2VD1A 3IHGA 1Z7RA 4Z2RA 2IJYA 3F4TA 2LUSA 2B6MA 1AXDA 4N3ZA 3WT1A 1PRXA 1JLWA 1VF2A 3FR6A 3FY7A 4GRFA 5HQPA 1N25A 1BAYA 2H1DA 4K7OA 2AJQB 1K0NA 4ZB7A 2V6KA 3KP9A 3FEUA 3HY2A 2YWNA 4ZL7A 3LXTA 2H71A 1R5PA 4G01A 1OKDA 5KN3A 1MD3A 3IXRA 3O76A 4IVFA 2O85A 5ID2B 2EFCA 2X49A 1SK2A 2GLRA 3CWGA 3ME8A 3AY8A 4ISDA 4X1UA 4O5UA 1GLQA 5GAPD 2UV8G 1YVLA 5F06A 5IIZA 9GSSA 2OBKA 3UEMA 4TR1B 4IS0A 3NZNA 1BQ7A 4O5QA 3IAM2 1ZMAA 1TK8B 4KAEA 4MPGA 2VLUA 3LORA 3A3TA 4XS4B 1PSQA 5CRDA 3LFLA 5IOWA 4V1Ag 2RIIA 1DBYA 3VFIA 3R2QA 3DVWA 4IJ3A 1ZYNA 1TDIA 4K8MA 2MBSA 2DJ1A 5J9BA 1DUGA 4GXZA 4PUFC 2R0PA 2V2GA 1K0OA 2RUEA 2YWOA 1OVNA 3HZ8A 4HZ4A 4NHWA 1XWAA 2B3SA 4ZB6A 1G7OA 1MDJA 1A0FA 1ON4A 2B7KA 4D73A 1PL2A 3KM6A 1XWBA 4N30A 1FOVA 2O89A 4FYBA 3IK9A 3TOTA 4LMVA 2YWIA 3GTUB 3RBTA 5DQYA 1N2AA 2WJUA 5ECHB 3TKSE 2HRKA 4HQSA 4POBA 3QDNA 2C3NA 2YJ7A 4JBBA 4IBPA 4WR4A 5DJLA 3FHKA 4FO5A 1U88A 3A5WA 3GNJA 3ERGA 3SWLA 5B8AA 3KGKA 2Z9SA 2IWTA 1SD9A 2ON7A 1XBSA 5F05A 2KHPA 4EIQA 2PUKC 3C1RA 4AJ6A 1B8XA 1BG1A 2RLIA 1SKSB 3QR6A 2A2RA 3F6FA 1GP1A 5DCHA 5G2ZA 5D93A 2B1KA 3FYGA 2OBIA 2WZSA 4PQIA 3EC3A 3CXGA 1SYRA 5C04A 4TXOB 2DIZA 2PWJA 4LLRA 17GSA 4ZL9A 3RHBA 2KUCA 1V57A 3MYDA 5IO2A 1VGLA 1SL2B 3BD2A 3A2XA 2F3MA 3ZFBA 3DMLA 1S4BP 4WF4A 2NBSA 4OWYA 4K0NA 4K7IA 4EUYA 5HFKA 1H4OA 4FYCA 5KN1A 3TKQA 2VM1A 3MSZA 3GV1A 2K8SA 5GSTA 4BVXB 2K8VA 5KOWA 2JZSA 1HD2A 4KX4A 14GSA 1SK0A 3UVHA 2FGXA 3TKSC 4LMWA 1TRSA 2YZUA 1Z6NA 4AKIA 1N8JA 1SVLA 4XRAA 2PU9C 1R26A 4BPYA 3PGTA 2M80A 2WW1A 1CQGA 4HZ2A 3DKSA 4MJCA 2FNOA 1TI3A 1XWCA 3U5RE 4TXVA 3EU4A 1V40A 2YJHA 2L4QA 11GSA 4PHZC 2VL2C 5IPHA 1V98A 1OC8A 3PH9A 1SD8A 3FR3A 3D22A 5B6NA 2KOKA 4YQVA 1PD21 2FD3A 2K18A 1USBA 1THOA 3IDVA 1OC3A 5AIXA 1JZOA 3HXSA 1M3IA 2MMOA 5IOXA 2HSHA 1NHYA 3F63A 4ZB8A 4NMUA 2HE3A 5D8IA 1PX7A 2LJKA 3PINA 1S3RA 2X99A 2FWFA 3UMAA 4PGTA 4ID0A 4YH2A 2GSRA 2PMTA 3LJRA 4RQXA 4MZBA 4V2NA 1TW9A 22GSA 4G19A 5D9WA 3HCZA 2VUPA 2CX4A 2GT6A 3EU3A 1AIUA 4ACSA 1PMTA 4XS1A 2R6KA 1BJXA 5DBQA 4ML1A 2WB9A 2V41A 4CHSA 5DALB 3IRAA 1OYJA 2DJ0A 2DJ2A 2WRTA 2CVKA 3ZMKA 3ZL5A 2VOCA 3HYPA 4YAVA 4BWSA 4KF9A 1TTZA 4GQFA 1F9MA 1JZWA 1EWXA 1Z7PA 1Z9HA 1MDIA 1T3BA 4FH8A 4ZL8A 4GCIA 4DSQA 3E3EA 2P5QA 3QD9A 3H93A 4OD7A 1EOHA 4K1FA 1SVMA 5J47A 1E6BA 1B4PA 2XBQA 1EV9A 1SKWB 5J4UA 6GSUA 3TGZA 2CZ3A 4I97A 3QFBC 1XCCA 2DLXA 4Z2TA 2HRNA 2V1MA 2GS3A 5FHIA 4YQUA 2EIRA 5ID2A 3P8WA 5J4VA 4Q5RA 2JL4A 3KCMA 3D4MA 1THXA 2YP6A 5D9TA 3IA1A 1FB6A 1ZYPA 1O7UA 2KP2A 4G0IA 1SL0B 2CQ9A 2O87A 1GTAA 2LJRA 3ISOA 4OCEA 3Q6OA 4O92A 5JCUA 2L57A 3LQ7A 4IHUA 4MPFA 5COHA 3HVSA 1XPVA 4ECIA 4EO3A 1R5AA 3BJ5A 4XS4A 4BVYB 4TN8A 2PPTA 3MAKA 3G7IA 3UIWA 4KSMA 2OJLA 4ZIJA 2HT9A 3M0FA 2R0GA 3N5OA 4O5RA 2IPAA 1PN9A 4A5PA 2VCVA 1IYHA 2C0DA 1GSSA 3BBYA 2R0CA 1NHOA 1GSFA 2NPBA 1GTUA 4I2UA 1PGTA 2LQOA 3GTUA 2YANA 4EL1A 1BEDA 2E7PA 1Q98A 4MLYA 1TU8A 1GUMA 2WW2A 3RFRC 2VCQA 2CZ2A 4K2DA 2E2GA 4CY8A 2I9HA 5J3RA 1FOHA 1GTBA 2JADA 3ZTLA 2H6XA 3HDCA 1GLPA 3ZITA 1YEXA 4XRDA 1S3AA 3IE3A 2MMNA 2A2PA 2YPMA 1U6TA 2LV3A 5A34B 5AGYA 2MBTA 3V1WA 4F82A 3WD6A 2QA2A 1QQ2A 1LU4A 4WKWA 2AAWA 1TK5B 2M46A 4JEDA 5A5HB 3H8QA 4K7NA 5F8BA 3TJGA 2DJ3A 1FG4A 2ES7A 3IR4A 1O85A 1GSQA 4TXOA 3CSJA 1GNWA 1S3DA 3ERFA 5EVOA 5IMVA 4NWYA 1XWGA 3CYNA 1XXUA 2YCDA 2VLVA 4K6XA 3KZQA 3UVTA 3M8NA 3C73A 4EF0A 5JCWA 3GMFA 1XVWA 3KMNA 19GSA 4KDXA 2AV4A 1K0BA 4PI0C 4TW5A 1ERWA 2MMZA 2OA7A 1ERUA 1T8EB 5A5KA 2GSSA 4IJIA 4KNDA 18GSA 3EPTA 4JR4A 3I9V2 5E59A 5B8BA 6GSVA 2HRAA 2CVBA 4HDEA 2GZZA 1SYXA 2H0HA 4TR0A 1Y25A 4AF2A 4BVXA 3UAPA 2EFHA 2FA8A 2R3XA 1Y6EA 4MH3A 5CNWA 2HZFA 5C00A 1OKTA 1VF3A 2LJAA 4JRRA 1Q4JA 1Z5YE 2GSQA 3GL3A 2O3EA 3HJMA 1OE7A 5F07A 2VL9A 3E0UA 5D73A 4EDZA 3FZ9A 7GSSA 2HYXA 2YV9A 4MA9A 1T7PB 2JACA 4PQ1A 2I3YA 3Q19A 2JSYA 1B9YC 4RUVA 2MYGA 1GUHA 2EIOA 5ECNB 2FWHA 1SKRB 1TRUA 1ZYQB 5ABRA 1K0DA 5LD0A 3L0HA 5GZZB 4KE3A 5H5SA 2H6ZA 1JZRA 5HFGA 5B7CA 2YV7A 5G5FA 2QA1A 2CVDA 3I43A 1PKWA 1O8XA 4OO5A 1A0RP 3GFKA 2O5VA 2B5EA 1AAZA 4FXYP 1R4WA 2H73A 4L5LA 4HJMA 4KB3A 1WOUA 3P2AA 2F8AA 4K0GA 1DE2A 3QAGA 3H1NA 3HKRA 2H66A 3KXOA 3A5IA 3EYTA 2YNXA 3F3QA 4P3YB 4FQUA 4DEJA 3FZ5A 3LYPA 4BL7A 4TR3A 3TKRA 5IMAA 1U87A 1J9BA 3KTLA 5F0GA 3IAS2 12GSA 4Q5NA 5DALA 2K9FA 1XWKA 4POMA 3HVXA 4XTSA 2WW0A 8GSSA 4JE1A 3GHAA 5ECPB 3HZ4A 2DJJA 2V32A 1T00A 1XFLA 4AKHA 3KD0A 2I1UA 1CQHA 5BRTA 3IBHA 3Q74A 5L71A 1YKAA 4J57E 4XHMA 5KN0A 1Y1UA 3DEXA 3CMIA 3KTBA 2DMMA 3KH7A 4L0WA 3ZIVA 4QL9A 4MJAA 4GSNA 2KP1A 2H30A 1O73A 1NSWA 2OE0A 4MF6A 4PNFA 2PERA 3ERWA 4V1Ap 5J4YA 3VWUA 1DE1A 1M2DA 1F2EA 3TUEA 4PURA 3GYKA 3IHQA 1GSYA 2EFDA 2H70A 1OC9B 4PNGA 4X0XA 4KCEA 2VCWA 2K6VA 4TR4A 5ECSA 1WMJA 1GSDA 1K0MA 1TJDA 4X43A 4L5OA 5DDLA 3GKMA 4EKZA 1B48A 2RUFA 4GF0A 3EWLA 2A2SA 3IOSA 5IO0A 4OFMA 4BIKA 2I4AA 4RI6A 4OMVA 1PN0A 3O6TA 4ICYA 4MNNA 2R2JA 4BVYA 3CSIA 2RM5A 2DIYA 3GUSA 4MK3A 4EE0A 4ECJA 2PVOC 3KJYA 2FA4A 3E9JB 4K2XA 3EVIA 1TOFA 2IFQB 1TK0B 1BYEA 2VD0A 5HR0A 1EV4A 4G2EA 3A2VA 2X8HA 5HR3A 1GNEA 3ZVJD 1X5DA 2GQLA 1EOGA 2AHEA 4HU7A 3QAWA 5JWOB 4GLTA 2P31A 2MMAA 1LJRA 2OADA 1JLVA 3F4RA 2B7JA 1FO5A 4MH2A 5D96A 5KN2A 1BF5A 2H1GA 3DWVA 2VIMA 3O3TA 1KTEA 2PN8A 4W66A 2VLTA 2LRTA 3RDWA 5AIVA 4ZXGA 3ZFLA 2WW3A 5A34A 2VM2A 3U6VA 3FK8A 3IC8A 4KDUA 3RHCA 4HQZA 2IN3A 3EINA 4USSA 3KMOA 2HSNB 3FMWA 3M9KA 2JSZA 2LS5A 5A5HA 2HZEB 3EMXA 2H74A 2HSYA 4KA0A 4H86A 3FRCA 4KCAA 3VI5A 1X0RA 2H1LA 1FAAA 3GIXA 1T4YA 5BMUB 2E0QA 4PQHA 1GH2A 1G6YA 1SJ6A 2HI7A 2TIRA 4BL7B 4MF5A 4HSCX 1ERTA 3WGDA 3TRPA 2G2QA 3US3A 5EY6A 5A4WA 2PBJA 2DSAA 4WETA 2XBIA 4YKFA 4ZBDA 3D4TA 2X8CA 4AJ7A 4ZILA 1GUKA 3WT2A 1YKCA 2WCIA 6GSXA 2G0FA 5LCZA 3NIVA 5J5NA 4MF7A 3OR5A 1A8YA 2WVZA 1ZOFA 2QKEA 5CO3A 1GRXA 2AB6A 4JR6A 2FWGA 3F6DA 3DD3A 3LXZA 2XC2A 3WGEA 3FKFA 3HVNA 2CV4A 6GSTA 2FCHA 5E4WA 4GSSA 3LGCA 4Z2UA 1QMVA 3TOUA 5LNKe 3RPPA 5AN1A 3L9VA 1FW1A 3SBCA 3HA9A 1T4ZA 1AUCA 3D5JA 1WE0A 4NV5A 3HD5A 3VLNA 3GRXA 1YEPA 3J7Yb 1SL1B 2IMFA 3PPUA 1TXXA 2WZ9A 2WVXB 1S3CA 3ZYWA 3EE2A 1G0TA 3LG6A 2IL3A 4TKYA 3TKPA 1WIKA 2I81A 2H6YA 2H76A 1TP9A 5IPGA 1K0AA 4TRXA 2XPEA 3QAVA 4N0ZA 1ML6A 2HSMA 2LEGA 1YF0A 1WWJA 1I9DA 3GURA 4N10A 2GZYA 3VWWA 2A4HA 3C1SA 3L9SA 3LW9A 3LEFA 3LYKA 3A2WA 1M2AA 1M9BA 3CTFA 2V6OA 1V9WA 3QPMA 1M99A 3DXBA 1YZXA 2AYTA 4ECCA 2OKAA 3C8EA 2VCZA 3MNGA 5ECOB 5A1NA 1UVZA 2H01A 2IIYA 5EL8A 2IMEA 2B5YA 1A8LA 1MTCA 2P0GA 1NM3A 1XG8A 3APQA 5HR1A 5A4VA 4O7HA 1G6WA 3CSHA 1XOAA 4KH7A 1GSEA 2WDUA 2XPDA 4F03A 4G10A 4ILFA 1VRSD 1VF1A 3MDKA 5G30A 4F0CA 1O81A 3VPQA 5DAKB 2F9SA 2IMKA 2EIQA 1TKDB 1O6JA 3TJKA 4YKGA 2HFDA 3DGQA 5A4UA 1A2LA 4N11A 1AW9A 3D0ZA 1KNGA 4LL1B 4I8BA 1RW1A 5HR2A 4WF5A 4MABA 2EC4A 2DC5A 5G1KA 4I2TA 1M2BA 1SU9A 1PA3A 5G1LA 3CQFA 2VKZG 3IV4A 4ZB9A 5DCGA 1OC9A 2REMA 3G7JA 3F3RA 4CDOA 5ENUA 3JCML 2L6CA 3GH6A 4HS1A 1SJIA 4MCUA 1K3LA 1TI1A 4EXJA 2WVYA 5ELGA 3I6AA 1NW2A 2VCXA 5B6MA 2DKHA 3G7YA 3KIJA 1ACVA 1JZDA 5DJMA 4ML6A 5H5QA 4ULXA 5FWGA 1FVJA 4DSSA 1FB0A 3W8JA 1OAZA 1XVQA 2GSTA 5JWQB 3UOMA 2LKUA 1EGOA 4F9ZA 2E2MA 5KOXA 1X9WB 4LL4B 2GDRA 2PGTA 4OFTA 3L4NA 1GTIA 3H79A 3HVVA 2WFCA 3TRXA 1TXUA 1M3JA 4NHZA 3CRUA 1RK4A 4OCFA 3F8UA 4G9HA 5J9CA 3M1GA 3VWXA 1K3OA 2L4CA 5DVBA 1RQMA 4RI7A 2IFQA 4PI2C 4YAPA 3GSTA 2NVLA 1FHEA 4HOJA 2N5AA 3RAZA 1TRWA 3QMXA 2DKIA 2CA8A 4IW9A 1PQNA 3GSSA 1ERVA 2R5GA 4FYUA 4JZQA 3ZZXA 1TRVA 5IMDA 2H0IA 4HJ2A 2WGRA 1MEKA 2ZCTA 2GGTA 3CBUA 1T1VA 2H19A 1J08A 2LNSA 1E2YA 3F0IA 3BCKA 4GWRA 2HQTA 1EP7A 4IELA 1BX9A 2HSMB 1PKZA 3VI7A 4J56E 3P7XA 1ZYEA 6GSSA 3F9UA 2C0EA 2R4VA 1U3AA 1XW9A 4OFNA 3TKSA 5D9XA 2HSNA 2HXKA 1QFNA 2HZEA 4IP1A 2NTOA 2B5XA 3G9BA 4AJ8A 5A1NB 4MP4A 2LRNA 1V2AA 1EEJA 1G7EA 4GDFA 3QOUA 1ZGNA 2C4JA 4OO4A 1X5CA 4KDYA 5BMUA 1MD4A 1ST9A 3L78A 2XHFA 2H1AA 5G5EA 2J23A 3KEBA 4XCSA 2JZRA 2O8VB 1I5GA 2VCTA 3PR8A 5GAND 1GWCA 2C0FA 4GQCA 2VL2A 3FZ4A 4DSRA 3HJOA 3FZAA 2AUVA 3VURA 2O36A 1AC1A 2JU5A 5CYYA 1F37A 5GSSA 3GKXA 3MWHA 2C1YA 4ECBA 4PX1A 1OE8A 1SK1A 3ED3A 2L5LA 1SVOA 1ABAA 4WEYA 3R3EA 3EMPA 2H1BA 1ZCPA 2EFEA 1I1IP 2GQKA 10GSA 3IK7A 3GL5A 3FW2A 2YWMA 2TRXA 2H72A 2IMDA 3J7Yk 4J2FA 4K5RA 6GSYA 3ZVJA 4TOPA 4E8EA 1JHBA 2LRCA 3UL3A 4XIHA 4O32A 5CAXA 1IYIA 2LQQA 1R7HA 2BMXA 5CREA 4Q5FA 2L6DA 1M0UA 1M7TA 5CP1A 3DVXA 2HNLA 1XIYA 3DIEA 4ZBAA 1QUWA 2J9HA 2LNTA 2X8GA 1O8WA 3P90A 2WVXA 3W8SA 1PL1A 2ZUPA 4MJEA 4DSSB 1QK8A 2C8UA 3M9JA 4MJBA 5ECKB 3IC4A 1HNAA 3TJFA 4RQRA 2F8FA 5H5RA 2FWEA 4KUNA 4KGIA 2IMIA 3WYWA 4HUAA 4AKXB 1PFOA 2NDOA 1A2MA 3NOFA 3BCIA 4TVEA 4BA7A 5CRHA 1UA5A 1A24A 4WR5A 5ECIB 4GTUA 4WBJA 5DQSA 2BTOT 4MZCA 5D9VA 1WRYA 1J0FA 4G0KA 3QFAC 1SJZA 2X64A 4NAXA 6GSWA 1F6MC 2N5FA 3TU3B 5IQYA 2QC7A 3GKKA 4FIWA 2A4VA 4K9ZA 4V2MA 2JZTA 1W89A 5G31A 4ZBBA 1GL8A 4BWQA 2OE3A 5IMZA 3RPNA 3M3MA 4GSTA 1URMA 3LSZA 3EURA 3KP8A 2CX3A 1F3BA 4PTSA 4EIPA 2DMLA 4NV2A 2M72A 4QL7A 2DBCA 1AQXA 1FVKA 4AKGA 1YJ6A 1DSBA 2FLSA 3TJJA 5DAKA 1SENA 2GQMA 3FR9A 3APSA 4HU9A 3GX0A 4QQ7A 2FUG2 3GKNA 2R37A 3K8NA 1K3YA 1M9AA 3TB2A 5EPFA 1TU7A 1YQ1A 5ECRB 1V58A 5J40A 3TCOA 3C71A 3UBLA 2VO4A 3GN3A 3GA4A 4KSOA 3QCPA 5INYA 4IQAA 1YEWC 3VK9A 1YDKA 3ZREA 3RGBC 5J41A 4D73B 1X5EA 5ELAA 1HNBA 2H75A 2X4AA 1EGRA 4AGSA 1JFUA 1BG5A 2MZCA 3KH9A 3C7MA 2UZ8A 2HRKB 1EZKA 2B1LA 3UARA 4EDYA 1KBNA 1W4VA 4IKHA 5ECMB 1QXHA 2YOIA 1KEBA 2KLXA 2QGVA 4CW9A
chains in the Genus database with same CATH topology
1XW6A 3HJPA 4LA1A 4MMMA 2VAFA 4E68A 3D21A 3VWVA 1PX6A 5ECQB 1ZZYA 5AISA 1AQVA 2GTUA 3HMJG 20GSA 2QSIA 2GVPA 2WULA 2FY6A 3WGXA 4CY6A 4G0LA 1QGVA 3S9FA 2GT5A 3ZMLA 3APOA 2ZNMA 4HI7A 3H4KA 2C3TA 1YF1A 5IM9A 5FT3A 2HLSA 4MZWA 4JU5A 1GSUA 4PUAA 3DYRA 4YQMA 1C72A 2H0GA 1ZL9A 2D2ZA 3LWAA 2PVQA 1MDKA 1WJKA 1XOBA 4V2LA 2CAIA 2C80A 2L5OA 4Z7XA 2CAQA 1HYUA 3UJ1A 1HQOA 1EP8A 4TR1A 3F4SA 2H8LA 5IMCA 4KW6A 5IMFA 1ILOA 2N5BA 5CRWA 2BJXA 1LBKA 4XS6A 3D6IA 2CT6A 5KEJA 1F3AA 1X9MB 1U3IA 4IP6A 4N0VA 5ECLB 2LSTA 4HEA2 4NPBA 4F0BA 3W6GA 1YY7A 5CRGA 3TRQA 1EEMA 2DJKA 2WS2A 4IN0A 4I6XA 4WXTA 2C3QA 3GX8A 4QMKA 1Z6MA 1WP0A 3CRTA 1GULA 3ZIJA 4WBRD 3BOAA 3L9UA 4POLA 3MIXA 4NXIA 3I69A 3UBKA 1A23A 4X4JA 3GH9A 1VF4A 2RM6A 2L59A 4K5SA 1WPIA 3ZLPA 2O7KA 3ZRDA 2LTKA 1B4QA 3TDGA 1AQWA 1Z3EA 4MDCA 1HNCA 1B9XC 3DRNA 2C0GA 5JCGA 4L0UA 2ALBA 2HRFA 4PXOA 2FHEA 4F2IA 3CTGA 4E8HA 3N9JA 1XW5A 3IPZA 2OE1A 4I5QA 3VPTA 2OT3A 2OACA 4POKA 2TRCP 3Q18A 5JWRB 4EVMA 3TJBA 1UN2A 4L8EA 13GSA 4IGJA 2YZHA 2GZPA 4AI6A 1XZOA 4DVCA 4EC0A 2VL3A 2F51A 5HFIA 1H75A 2YN1A 3ME7A 2ON5A 1X9SB 4Q5QA 16GSA 3HHVA 1A2JA 1UC7A 1K0CA 4IQ1A 2P5RA 2VD1A 3IHGA 1Z7RA 4Z2RA 2IJYA 3F4TA 2LUSA 2B6MA 1AXDA 4N3ZA 3WT1A 1PRXA 1JLWA 1VF2A 3FR6A 3FY7A 4GRFA 5HQPA 1N25A 1BAYA 2H1DA 4K7OA 2AJQB 1K0NA 4ZB7A 2V6KA 3KP9A 3FEUA 3HY2A 2YWNA 4ZL7A 3LXTA 2H71A 1R5PA 4G01A 1OKDA 5KN3A 1MD3A 3IXRA 3O76A 4IVFA 2O85A 5ID2B 2EFCA 2X49A 1SK2A 2GLRA 3CWGA 3ME8A 3AY8A 4ISDA 4X1UA 4O5UA 1GLQA 5GAPD 2UV8G 1YVLA 5F06A 5IIZA 9GSSA 2OBKA 3UEMA 4TR1B 4IS0A 3NZNA 1BQ7A 4O5QA 3IAM2 1ZMAA 1TK8B 4KAEA 4MPGA 2VLUA 3LORA 3A3TA 4XS4B 1PSQA 5CRDA 3LFLA 5IOWA 4V1Ag 2RIIA 1DBYA 3VFIA 3R2QA 3DVWA 4IJ3A 1ZYNA 1TDIA 4K8MA 2MBSA 2DJ1A 5J9BA 1DUGA 4GXZA 4PUFC 2R0PA 2V2GA 1K0OA 2RUEA 2YWOA 1OVNA 3HZ8A 4HZ4A 4NHWA 1XWAA 2B3SA 4ZB6A 1G7OA 1MDJA 1A0FA 1ON4A 2B7KA 4D73A 1PL2A 3KM6A 1XWBA 4N30A 1FOVA 2O89A 4FYBA 3IK9A 3TOTA 4LMVA 2YWIA 3GTUB 3RBTA 5DQYA 1N2AA 2WJUA 5ECHB 3TKSE 2HRKA 4HQSA 4POBA 3QDNA 2C3NA 2YJ7A 4JBBA 4IBPA 4WR4A 5DJLA 3FHKA 4FO5A 1U88A 3A5WA 3GNJA 3ERGA 3SWLA 5B8AA 3KGKA 2Z9SA 2IWTA 1SD9A 2ON7A 1XBSA 5F05A 2KHPA 4EIQA 2PUKC 3C1RA 4AJ6A 1B8XA 1BG1A 2RLIA 1SKSB 3QR6A 2A2RA 3F6FA 1GP1A 5DCHA 5G2ZA 5D93A 2B1KA 3FYGA 2OBIA 4PQIA 3EC3A 3CXGA 1SYRA 5C04A 4TXOB 2DIZA 2PWJA 4LLRA 17GSA 4ZL9A 3RHBA 2KUCA 1V57A 3MYDA 5IO2A 1VGLA 1SL2B 3BD2A 3A2XA 2F3MA 3ZFBA 3DMLA 4WF4A 2NBSA 4OWYA 4K0NA 4K7IA 4EUYA 5HFKA 1H4OA 4FYCA 5KN1A 3TKQA 2VM1A 3MSZA 3GV1A 2K8SA 5GSTA 4BVXB 2K8VA 5KOWA 2JZSA 1HD2A 4KX4A 14GSA 1SK0A 3UVHA 2FGXA 3TKSC 4LMWA 1TRSA 2YZUA 1Z6NA 4AKIA 1N8JA 1SVLA 4XRAA 2PU9C 1R26A 4BPYA 3PGTA 2M80A 1CQGA 4HZ2A 3DKSA 4MJCA 2FNOA 1TI3A 1XWCA 3U5RE 4TXVA 3EU4A 1V40A 2YJHA 2L4QA 11GSA 2VL2C 5IPHA 1V98A 1OC8A 3PH9A 1SD8A 3FR3A 3D22A 5B6NA 2KOKA 4YQVA 1PD21 2FD3A 2K18A 1USBA 1THOA 3IDVA 1OC3A 5AIXA 1JZOA 3HXSA 2MMOA 5IOXA 2HSHA 1NHYA 3F63A 4ZB8A 4NMUA 2HE3A 5D8IA 1PX7A 2LJKA 3PINA 2X99A 2FWFA 3UMAA 4PGTA 4ID0A 4YH2A 2GSRA 2PMTA 3LJRA 4RQXA 4MZBA 4V2NA 1TW9A 22GSA 4G19A 5D9WA 3HCZA 2VUPA 2CX4A 2GT6A 3EU3A 1AIUA 4ACSA 1PMTA 4XS1A 2R6KA 1BJXA 5DBQA 4ML1A 2WB9A 2V41A 4CHSA 5DALB 3IRAA 1OYJA 2DJ0A 2DJ2A 2WRTA 2CVKA 3ZMKA 3ZL5A 2VOCA 3HYPA 4YAVA 4BWSA 4KF9A 1TTZA 4GQFA 1F9MA 1JZWA 1EWXA 1Z7PA 1Z9HA 1MDIA 1T3BA 4FH8A 4ZL8A 4GCIA 4DSQA 3E3EA 2P5QA 3QD9A 3H93A 4OD7A 1EOHA 4K1FA 1SVMA 5J47A 1E6BA 1B4PA 2XBQA 1EV9A 1SKWB 5J4UA 6GSUA 3TGZA 2CZ3A 4I97A 3QFBC 1XCCA 2DLXA 4Z2TA 2HRNA 2V1MA 2GS3A 5FHIA 4YQUA 2EIRA 5ID2A 3P8WA 5J4VA 4Q5RA 2JL4A 3KCMA 3D4MA 1THXA 2YP6A 5D9TA 3IA1A 1FB6A 1ZYPA 1O7UA 2KP2A 4G0IA 1SL0B 2CQ9A 2O87A 1GTAA 2LJRA 3ISOA 4OCEA 3Q6OA 4O92A 5JCUA 2L57A 3LQ7A 4IHUA 4MPFA 5COHA 3HVSA 1XPVA 4ECIA 4EO3A 1R5AA 3BJ5A 4XS4A 4BVYB 4TN8A 2PPTA 3MAKA 3G7IA 3UIWA 4KSMA 2OJLA 4ZIJA 2HT9A 3M0FA 2R0GA 3N5OA 4O5RA 2IPAA 1PN9A 4A5PA 2VCVA 1IYHA 2C0DA 1GSSA 3BBYA 2R0CA 1NHOA 1GSFA 2NPBA 1GTUA 4I2UA 1PGTA 2LQOA 3GTUA 2YANA 4EL1A 1BEDA 2E7PA 1Q98A 4MLYA 1TU8A 1GUMA 2VCQA 2CZ2A 4K2DA 2E2GA 4CY8A 2I9HA 5J3RA 1FOHA 1GTBA 2JADA 3ZTLA 2H6XA 3HDCA 1GLPA 3ZITA 1YEXA 4XRDA 1S3AA 3IE3A 2MMNA 2A2PA 2YPMA 1U6TA 2LV3A 5A34B 5AGYA 2MBTA 3V1WA 4F82A 3WD6A 2QA2A 1QQ2A 1LU4A 4WKWA 2AAWA 1TK5B 2M46A 4JEDA 5A5HB 3H8QA 4K7NA 5F8BA 3TJGA 2DJ3A 1FG4A 2ES7A 3IR4A 1O85A 1GSQA 4TXOA 3CSJA 1GNWA 1S3DA 3ERFA 5EVOA 5IMVA 4NWYA 1XWGA 3CYNA 1XXUA 2YCDA 2VLVA 4K6XA 3KZQA 3UVTA 3M8NA 3C73A 4EF0A 5JCWA 3GMFA 1XVWA 3KMNA 19GSA 4KDXA 2AV4A 1K0BA 4TW5A 1ERWA 2MMZA 2OA7A 1ERUA 1T8EB 5A5KA 2GSSA 4IJIA 4KNDA 18GSA 3EPTA 4JR4A 3I9V2 5E59A 5B8BA 6GSVA 2HRAA 2CVBA 4HDEA 2GZZA 1SYXA 2H0HA 4TR0A 1Y25A 4AF2A 4BVXA 3UAPA 2EFHA 2FA8A 2R3XA 1Y6EA 4MH3A 5CNWA 2HZFA 5C00A 1OKTA 1VF3A 2LJAA 4JRRA 1Q4JA 1Z5YE 2GSQA 3GL3A 3HJMA 1OE7A 5F07A 2VL9A 3E0UA 5D73A 4EDZA 3FZ9A 7GSSA 2HYXA 2YV9A 4MA9A 1T7PB 2JACA 4PQ1A 2I3YA 3Q19A 2JSYA 1B9YC 4RUVA 2MYGA 1GUHA 2EIOA 5ECNB 2FWHA 1SKRB 1TRUA 1ZYQB 5ABRA 1K0DA 5LD0A 3L0HA 5GZZB 4KE3A 5H5SA 2H6ZA 1JZRA 5HFGA 5B7CA 2YV7A 5G5FA 2QA1A 2CVDA 3I43A 1PKWA 1O8XA 4OO5A 1A0RP 3GFKA 2O5VA 2B5EA 1AAZA 1R4WA 2H73A 4L5LA 4HJMA 4KB3A 1WOUA 3P2AA 2F8AA 4K0GA 1DE2A 3QAGA 3H1NA 3HKRA 2H66A 3KXOA 3A5IA 3EYTA 2YNXA 3F3QA 4P3YB 4FQUA 4DEJA 3FZ5A 3LYPA 4BL7A 4TR3A 3TKRA 5IMAA 1U87A 1J9BA 3KTLA 5F0GA 3IAS2 12GSA 4Q5NA 5DALA 2K9FA 1XWKA 4POMA 3HVXA 4XTSA 8GSSA 4JE1A 3GHAA 5ECPB 3HZ4A 2DJJA 2V32A 1T00A 1XFLA 4AKHA 3KD0A 2I1UA 1CQHA 5BRTA 3IBHA 3Q74A 5L71A 1YKAA 4J57E 4XHMA 5KN0A 1Y1UA 3DEXA 3KTBA 3CMIA 2DMMA 3KH7A 4L0WA 3ZIVA 4QL9A 4MJAA 4GSNA 2KP1A 2H30A 1O73A 1NSWA 2OE0A 4MF6A 4PNFA 2PERA 3ERWA 4V1Ap 5J4YA 3VWUA 1DE1A 1M2DA 1F2EA 3TUEA 4PURA 3GYKA 3IHQA 1GSYA 2EFDA 2H70A 1OC9B 4PNGA 4X0XA 4KCEA 2VCWA 2K6VA 4TR4A 5ECSA 1WMJA 1GSDA 1K0MA 1TJDA 4X43A 4L5OA 5DDLA 3GKMA 4EKZA 1B48A 2RUFA 4GF0A 3EWLA 2A2SA 3IOSA 5IO0A 4OFMA 2I4AA 4RI6A 4OMVA 1PN0A 3O6TA 4ICYA 4MNNA 2R2JA 4BVYA 3CSIA 2RM5A 2DIYA 3GUSA 4MK3A 4EE0A 4ECJA 2PVOC 3KJYA 2FA4A 3E9JB 4K2XA 3EVIA 1TOFA 2IFQB 1TK0B 1BYEA 2VD0A 5HR0A 1EV4A 4G2EA 3A2VA 2X8HA 5HR3A 1GNEA 3ZVJD 1X5DA 2GQLA 1EOGA 2AHEA 4HU7A 3QAWA 5JWOB 4GLTA 2P31A 2MMAA 1LJRA 2OADA 1JLVA 3F4RA 2B7JA 1FO5A 4MH2A 5D96A 5KN2A 1BF5A 2H1GA 3DWVA 2VIMA 3O3TA 1KTEA 2PN8A 4W66A 2VLTA 2LRTA 3RDWA 5AIVA 4ZXGA 3ZFLA 5A34A 2VM2A 3U6VA 3FK8A 3IC8A 4KDUA 3RHCA 4HQZA 2IN3A 3EINA 4USSA 3KMOA 2HSNB 3FMWA 3M9KA 2JSZA 2LS5A 5A5HA 2HZEB 3EMXA 2H74A 2HSYA 4KA0A 4H86A 3FRCA 4KCAA 3VI5A 1X0RA 2H1LA 1FAAA 3GIXA 1T4YA 5BMUB 2E0QA 4PQHA 1GH2A 1G6YA 1SJ6A 2HI7A 2TIRA 4BL7B 4MF5A 3WGDA 1ERTA 3TRPA 2G2QA 3US3A 5EY6A 5A4WA 2PBJA 2DSAA 4WETA 2XBIA 4YKFA 4ZBDA 3D4TA 2X8CA 4AJ7A 4ZILA 1GUKA 3WT2A 1YKCA 2WCIA 6GSXA 2G0FA 5LCZA 3NIVA 5J5NA 4MF7A 3OR5A 1A8YA 1ZOFA 2QKEA 5CO3A 1GRXA 2AB6A 4JR6A 2FWGA 3F6DA 3DD3A 3LXZA 2XC2A 3WGEA 3FKFA 2CV4A 6GSTA 2FCHA 5E4WA 4GSSA 3LGCA 4Z2UA 1QMVA 3TOUA 5LNKe 3RPPA 5AN1A 3L9VA 1FW1A 3SBCA 3HA9A 1T4ZA 1AUCA 3D5JA 1WE0A 4NV5A 3HD5A 3VLNA 3GRXA 1YEPA 3J7Yb 1SL1B 2IMFA 3PPUA 1TXXA 2WZ9A 1S3CA 3ZYWA 3EE2A 1G0TA 3LG6A 2IL3A 4TKYA 3TKPA 1WIKA 2I81A 2H6YA 2H76A 1TP9A 5IPGA 1K0AA 4TRXA 2XPEA 3QAVA 4N0ZA 1ML6A 2HSMA 2LEGA 1YF0A 1WWJA 1I9DA 3GURA 4N10A 2GZYA 3VWWA 2A4HA 3C1SA 3LW9A 3L9SA 3LEFA 3LYKA 3A2WA 1M2AA 1M9BA 3CTFA 2V6OA 1V9WA 3QPMA 1M99A 3DXBA 1YZXA 2AYTA 4ECCA 2OKAA 3C8EA 2VCZA 3MNGA 5ECOB 5A1NA 1UVZA 2H01A 2IIYA 5EL8A 2IMEA 2B5YA 1A8LA 1MTCA 2P0GA 1NM3A 3APQA 5HR1A 5A4VA 4O7HA 1G6WA 3CSHA 1XOAA 4KH7A 1GSEA 2WDUA 2XPDA 4F03A 4G10A 4ILFA 1VRSD 1VF1A 3MDKA 5G30A 4F0CA 1O81A 3VPQA 5DAKB 2F9SA 2IMKA 2EIQA 1TKDB 1O6JA 3TJKA 4YKGA 2HFDA 3DGQA 5A4UA 1A2LA 4N11A 1AW9A 3D0ZA 1KNGA 4LL1B 4I8BA 1RW1A 5HR2A 4WF5A 4MABA 2EC4A 2DC5A 5G1KA 4I2TA 1M2BA 1SU9A 1PA3A 5G1LA 2VKZG 3IV4A 4ZB9A 5DCGA 1OC9A 2REMA 3G7JA 3F3RA 4CDOA 5ENUA 3JCML 2L6CA 3GH6A 4HS1A 1SJIA 4MCUA 1K3LA 1TI1A 4EXJA 5ELGA 3I6AA 1NW2A 2VCXA 5B6MA 2DKHA 3G7YA 3KIJA 1ACVA 1JZDA 5DJMA 4ML6A 5H5QA 4ULXA 5FWGA 1FVJA 4DSSA 1FB0A 3W8JA 1OAZA 1XVQA 2GSTA 5JWQB 3UOMA 2LKUA 1EGOA 4F9ZA 2E2MA 5KOXA 1X9WB 4LL4B 2GDRA 2PGTA 4OFTA 3L4NA 1GTIA 3H79A 3HVVA 2WFCA 3TRXA 1TXUA 4NHZA 3CRUA 1RK4A 4OCFA 3F8UA 4G9HA 5J9CA 3M1GA 3VWXA 1K3OA 2L4CA 5DVBA 1RQMA 4RI7A 2IFQA 4YAPA 3GSTA 2NVLA 1FHEA 4HOJA 2N5AA 3RAZA 1TRWA 3QMXA 2DKIA 2CA8A 4IW9A 1PQNA 3GSSA 1ERVA 2R5GA 4FYUA 4JZQA 3ZZXA 1TRVA 5IMDA 2H0IA 4HJ2A 2WGRA 1MEKA 2ZCTA 2GGTA 3CBUA 1T1VA 2H19A 1J08A 2LNSA 1E2YA 3F0IA 3BCKA 4GWRA 2HQTA 1EP7A 4IELA 1BX9A 2HSMB 1PKZA 3VI7A 4J56E 3P7XA 1ZYEA 6GSSA 3F9UA 2C0EA 2R4VA 1U3AA 1XW9A 4OFNA 3TKSA 5D9XA 2HSNA 2HXKA 1QFNA 2HZEA 4IP1A 2NTOA 2B5XA 3G9BA 4AJ8A 5A1NB 4MP4A 2LRNA 1V2AA 1EEJA 1G7EA 4GDFA 3QOUA 1ZGNA 2C4JA 4OO4A 1X5CA 4KDYA 5BMUA 1MD4A 1ST9A 3L78A 2XHFA 2H1AA 5G5EA 2J23A 3KEBA 4XCSA 2JZRA 2O8VB 1I5GA 2VCTA 3PR8A 5GAND 1GWCA 2C0FA 4GQCA 2VL2A 3FZ4A 4DSRA 3HJOA 3FZAA 2AUVA 3VURA 1AC1A 2JU5A 5CYYA 1F37A 5GSSA 3GKXA 3MWHA 2C1YA 4ECBA 4PX1A 1OE8A 1SK1A 3ED3A 2L5LA 1SVOA 1ABAA 4WEYA 3R3EA 3EMPA 2H1BA 1ZCPA 2EFEA 2GQKA 10GSA 3IK7A 3GL5A 3FW2A 2YWMA 2TRXA 2H72A 2IMDA 3J7Yk 4J2FA 4K5RA 6GSYA 3ZVJA 4TOPA 4E8EA 1JHBA 2LRCA 3UL3A 4XIHA 4O32A 5CAXA 1IYIA 2LQQA 1R7HA 2BMXA 5CREA 4Q5FA 2L6DA 1M0UA 1M7TA 5CP1A 3DVXA 2HNLA 1XIYA 3DIEA 4ZBAA 1QUWA 2J9HA 2LNTA 2X8GA 1O8WA 3P90A 3W8SA 1PL1A 2ZUPA 4MJEA 4DSSB 1QK8A 2C8UA 3M9JA 4MJBA 5ECKB 3IC4A 1HNAA 3TJFA 4RQRA 2F8FA 5H5RA 2FWEA 4KUNA 4KGIA 2IMIA 3WYWA 4HUAA 4AKXB 2NDOA 1A2MA 3NOFA 3BCIA 4TVEA 4BA7A 5CRHA 1UA5A 1A24A 4WR5A 5ECIB 4GTUA 4WBJA 5DQSA 2BTOT 4MZCA 5D9VA 1WRYA 1J0FA 4G0KA 3QFAC 1SJZA 2X64A 4NAXA 6GSWA 1F6MC 2N5FA 3TU3B 5IQYA 2QC7A 3GKKA 4FIWA 2A4VA 4K9ZA 4V2MA 2JZTA 1W89A 5G31A 4ZBBA 1GL8A 4BWQA 2OE3A 5IMZA 3RPNA 3M3MA 4GSTA 1URMA 3LSZA 3EURA 3KP8A 2CX3A 1F3BA 4PTSA 4EIPA 2DMLA 4NV2A 2M72A 4QL7A 2DBCA 1AQXA 1FVKA 4AKGA 1YJ6A 1DSBA 2FLSA 3TJJA 5DAKA 1SENA 2GQMA 3FR9A 3APSA 4HU9A 3GX0A 4QQ7A 2FUG2 3GKNA 2R37A 3K8NA 1K3YA 1M9AA 3TB2A 5EPFA 1TU7A 1YQ1A 5ECRB 1V58A 5J40A 3TCOA 3C71A 3UBLA 2VO4A 3GN3A 3GA4A 4KSOA 3QCPA 5INYA 4IQAA 3VK9A 1YDKA 3ZREA 5J41A 4D73B 1X5EA 5ELAA 1HNBA 2H75A 2X4AA 1EGRA 4AGSA 1JFUA 1BG5A 2MZCA 3KH9A 3C7MA 2UZ8A 2HRKB 1EZKA 2B1LA 3UARA 4EDYA 1KBNA 1W4VA 4IKHA 5ECMB 1QXHA 2YOIA 1KEBA 2KLXA 2QGVA 4CW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XW6 A;  3HJP A;  4LA1 A;  4MMM A;  2VAF A;  3D21 A;  3VWV A;  1PX6 A;  5ECQ B;  1ZZY A;  5AIS A;  1AQV A;  2GTU A;  20GS A;  2QSI A;  2GVP A;  2WUL A;  2FY6 A;  3WGX A;  4G0L A;  1QGV A;  3S9F A;  2GT5 A;  3ZML A;  3APO A;  2ZNM A;  4HI7 A;  3H4K A;  2C3T A;  1YF1 A;  5IM9 A;  5FT3 A;  2HLS A;  4MZW A;  4JU5 A;  1GSU A;  4PUA A;  3DYR A;  4YQM A;  1C72 A;  2H0G A;  1ZL9 A;  2D2Z A;  3LWA A;  2PVQ A;  1MDK A;  1WJK A;  1XOB A;  4V2L A;  2CAI A;  2C80 A;  2L5O A;  4Z7X A;  2CAQ A;  1HYU A;  3UJ1 A;  1HQO A;  1EP8 A;  4TR1 A;  3F4S A;  2H8L A;  5IMC A;  4KW6 A;  5IMF A;  1ILO A;  2N5B A;  5CRW A;  2BJX A;  1LBK A;  4XS6 A;  3D6I A;  2CT6 A;  5KEJ A;  1F3A A;  1X9M B;  1U3I A;  4IP6 A;  4N0V A;  5ECL B;  2LST A;  4HEA 2;  4NPB A;  4F0B A;  3W6G A;  1YY7 A;  5CRG A;  3TRQ A;  1EEM A;  2DJK A;  2WS2 A;  4IN0 A;  4I6X A;  4WXT A;  2C3Q A;  3GX8 A;  1Z6M A;  1WP0 A;  3CRT A;  1GUL A;  3ZIJ A;  4WBR D;  3BOA A;  3L9U A;  4POL A;  4NXI A;  3I69 A;  3UBK A;  1A23 A;  3GH9 A;  1VF4 A;  2RM6 A;  2L59 A;  1WPI A;  3ZLP A;  2O7K A;  3ZRD A;  2LTK A;  1B4Q A;  3TDG A;  1AQW A;  1Z3E A;  4MDC A;  1HNC A;  1B9X C;  3DRN A;  2C0G A;  5JCG A;  4L0U A;  2ALB A;  2HRF A;  4PXO A;  2FHE A;  4F2I A;  3CTG A;  4E8H A;  3N9J A;  1XW5 A;  3IPZ A;  2OE1 A;  4I5Q A;  3VPT A;  2OAC A;  4POK A;  2TRC P;  3Q18 A;  5JWR B;  4EVM A;  3TJB A;  1UN2 A;  4L8E A;  13GS A;  4IGJ A;  2YZH A;  2GZP A;  1XZO A;  4DVC A;  4EC0 A;  2VL3 A;  2F51 A;  5HFI A;  1H75 A;  2YN1 A;  3ME7 A;  2ON5 A;  1X9S B;  4Q5Q A;  16GS A;  3HHV A;  1A2J A;  1UC7 A;  1K0C A;  4IQ1 A;  2P5R A;  2VD1 A;  1Z7R A;  2IJY A;  3F4T A;  2LUS A;  2B6M A;  1AXD A;  3WT1 A;  1PRX A;  1JLW A;  1VF2 A;  3FR6 A;  3FY7 A;  4GRF A;  5HQP A;  1BAY A;  2H1D A;  4K7O A;  2AJQ B;  1K0N A;  2V6K A;  3KP9 A;  3FEU A;  3HY2 A;  2YWN A;  4ZL7 A;  3LXT A;  2H71 A;  1R5P A;  1OKD A;  5KN3 A;  1MD3 A;  3IXR A;  3O76 A;  4IVF A;  2O85 A;  5ID2 B;  1SK2 A;  2GLR A;  3ME8 A;  3AY8 A;  4ISD A;  4X1U A;  1GLQ A;  5GAP D;  5F06 A;  5IIZ A;  9GSS A;  2OBK A;  3UEM A;  4TR1 B;  4IS0 A;  3NZN A;  1BQ7 A;  3IAM 2;  1ZMA A;  1TK8 B;  4KAE A;  4MPG A;  2VLU A;  3LOR A;  3A3T A;  4XS4 B;  1PSQ A;  5CRD A;  3LFL A;  5IOW A;  4V1A g;  2RII A;  1DBY A;  3VFI A;  3R2Q A;  3DVW A;  4IJ3 A;  1TDI A;  4K8M A;  2MBS A;  2DJ1 A;  5J9B A;  1DUG A;  4GXZ A;  4PUF C;  2V2G A;  1K0O A;  2RUE A;  2YWO A;  1OVN A;  3HZ8 A;  4HZ4 A;  4NHW A;  1XWA A;  2B3S A;  4ZB6 A;  1G7O A;  1MDJ A;  1A0F A;  1ON4 A;  2B7K A;  4D73 A;  1PL2 A;  3KM6 A;  1XWB A;  4N30 A;  1FOV A;  2O89 A;  4FYB A;  3IK9 A;  3TOT A;  4LMV A;  2YWI A;  3GTU B;  3RBT A;  5DQY A;  1N2A A;  2WJU A;  5ECH B;  3TKS E;  2HRK A;  4HQS A;  4POB A;  3QDN A;  2C3N A;  2YJ7 A;  4JBB A;  4IBP A;  4WR4 A;  5DJL A;  3FHK A;  4FO5 A;  1U88 A;  3A5W A;  3GNJ A;  3ERG A;  3SWL A;  5B8A A;  3KGK A;  2Z9S A;  2IWT A;  1SD9 A;  2ON7 A;  1XBS A;  5F05 A;  2KHP A;  2PUK C;  3C1R A;  4AJ6 A;  1B8X A;  2RLI A;  1SKS B;  3QR6 A;  2A2R A;  3F6F A;  1GP1 A;  5DCH A;  5G2Z A;  5D93 A;  2B1K A;  3FYG A;  2OBI A;  4PQI A;  3EC3 A;  3CXG A;  1SYR A;  5C04 A;  4TXO B;  2DIZ A;  2PWJ A;  4LLR A;  17GS A;  4ZL9 A;  3RHB A;  2KUC A;  1V57 A;  5IO2 A;  1VGL A;  1SL2 B;  3BD2 A;  3A2X A;  2F3M A;  3ZFB A;  3DML A;  4WF4 A;  2NBS A;  4OWY A;  4K0N A;  4K7I A;  4EUY A;  5HFK A;  1H4O A;  4FYC A;  5KN1 A;  3TKQ A;  2VM1 A;  3MSZ A;  3GV1 A;  2K8S A;  5GST A;  4BVX B;  2K8V A;  2JZS A;  1HD2 A;  4KX4 A;  14GS A;  1SK0 A;  3UVH A;  2FGX A;  3TKS C;  4LMW A;  1TRS A;  2YZU A;  1Z6N A;  1N8J A;  4XRA A;  2PU9 C;  1R26 A;  4BPY A;  3PGT A;  2M80 A;  1CQG A;  4HZ2 A;  3DKS A;  4MJC A;  2FNO A;  1TI3 A;  1XWC A;  3U5R E;  4TXV A;  3EU4 A;  1V40 A;  2YJH A;  2L4Q A;  11GS A;  2VL2 C;  5IPH A;  1V98 A;  1OC8 A;  3PH9 A;  1SD8 A;  3FR3 A;  3D22 A;  5B6N A;  2KOK A;  4YQV A;  1PD2 1;  2FD3 A;  2K18 A;  1USB A;  1THO A;  3IDV A;  1OC3 A;  5AIX A;  1JZO A;  3HXS A;  2MMO A;  5IOX A;  2HSH A;  1NHY A;  3F63 A;  4ZB8 A;  4NMU A;  2HE3 A;  5D8I A;  1PX7 A;  2LJK A;  3PIN A;  2X99 A;  2FWF A;  3UMA A;  4PGT A;  4ID0 A;  4YH2 A;  2GSR A;  2PMT A;  3LJR A;  4RQX A;  4MZB A;  4V2N A;  1TW9 A;  22GS A;  4G19 A;  5D9W A;  3HCZ A;  2VUP A;  2CX4 A;  2GT6 A;  3EU3 A;  1AIU A;  4ACS A;  1PMT A;  4XS1 A;  2R6K A;  1BJX A;  5DBQ A;  4ML1 A;  2WB9 A;  2V41 A;  4CHS A;  5DAL B;  3IRA A;  1OYJ A;  2DJ0 A;  2DJ2 A;  2WRT A;  2CVK A;  3ZMK A;  3ZL5 A;  2VOC A;  3HYP A;  4YAV A;  4BWS A;  4KF9 A;  1TTZ A;  4GQF A;  1F9M A;  1JZW A;  1EWX A;  1Z7P A;  1Z9H A;  1MDI A;  1T3B A;  4FH8 A;  4ZL8 A;  4GCI A;  4DSQ A;  3E3E A;  2P5Q A;  3QD9 A;  3H93 A;  4OD7 A;  1EOH A;  4K1F A;  1E6B A;  1B4P A;  2XBQ A;  1EV9 A;  1SKW B;  5J4U A;  6GSU A;  3TGZ A;  2CZ3 A;  4I97 A;  3QFB C;  1XCC A;  2DLX A;  2HRN A;  2V1M A;  2GS3 A;  5FHI A;  4YQU A;  2EIR A;  5ID2 A;  3P8W A;  4Q5R A;  2JL4 A;  3KCM A;  3D4M A;  1THX A;  2YP6 A;  5D9T A;  3IA1 A;  1FB6 A;  1O7U A;  2KP2 A;  4G0I A;  1SL0 B;  2CQ9 A;  2O87 A;  1GTA A;  2LJR A;  3ISO A;  4OCE A;  3Q6O A;  4O92 A;  5JCU A;  2L57 A;  3LQ7 A;  4IHU A;  4MPF A;  5COH A;  3HVS A;  1XPV A;  4ECI A;  4EO3 A;  1R5A A;  3BJ5 A;  4XS4 A;  4BVY B;  4TN8 A;  2PPT A;  3MAK A;  3G7I A;  3UIW A;  4KSM A;  2OJL A;  4ZIJ A;  2HT9 A;  3M0F A;  3N5O A;  4O5R A;  2IPA A;  1PN9 A;  2VCV A;  1IYH A;  2C0D A;  1GSS A;  3BBY A;  1NHO A;  1GSF A;  2NPB A;  1GTU A;  4I2U A;  1PGT A;  2LQO A;  3GTU A;  2YAN A;  4EL1 A;  1BED A;  2E7P A;  1Q98 A;  4MLY A;  1TU8 A;  1GUM A;  2VCQ A;  2CZ2 A;  4K2D A;  2E2G A;  2I9H A;  5J3R A;  1GTB A;  2JAD A;  3ZTL A;  2H6X A;  3HDC A;  1GLP A;  3ZIT A;  1YEX A;  4XRD A;  1S3A A;  3IE3 A;  2MMN A;  2YPM A;  1U6T A;  2LV3 A;  5AGY A;  2MBT A;  3V1W A;  4F82 A;  3WD6 A;  1QQ2 A;  1LU4 A;  4WKW A;  2AAW A;  1TK5 B;  2M46 A;  4JED A;  3H8Q A;  4K7N A;  5F8B A;  3TJG A;  2DJ3 A;  1FG4 A;  2ES7 A;  3IR4 A;  1O85 A;  1GSQ A;  4TXO A;  3CSJ A;  1GNW A;  1S3D A;  3ERF A;  5EVO A;  5IMV A;  4NWY A;  1XWG A;  3CYN A;  1XXU A;  2YCD A;  2VLV A;  4K6X A;  3KZQ A;  3UVT A;  3M8N A;  3C73 A;  4EF0 A;  5JCW A;  3GMF A;  1XVW A;  3KMN A;  19GS A;  4KDX A;  2AV4 A;  1K0B A;  4TW5 A;  1ERW A;  2MMZ A;  2OA7 A;  1ERU A;  1T8E B;  5A5K A;  2GSS A;  4IJI A;  4KND A;  18GS A;  4JR4 A;  3I9V 2;  5E59 A;  5B8B A;  6GSV A;  2HRA A;  2CVB A;  4HDE A;  2GZZ A;  1SYX A;  2H0H A;  4TR0 A;  1Y25 A;  4AF2 A;  4BVX A;  3UAP A;  2FA8 A;  2R3X A;  1Y6E A;  4MH3 A;  5CNW A;  2HZF A;  5C00 A;  1OKT A;  1VF3 A;  4JRR A;  2LJA A;  1Q4J A;  1Z5Y E;  2GSQ A;  3GL3 A;  3HJM A;  1OE7 A;  5F07 A;  2VL9 A;  3E0U A;  5D73 A;  4EDZ A;  3FZ9 A;  7GSS A;  2HYX A;  2YV9 A;  4MA9 A;  1T7P B;  2JAC A;  4PQ1 A;  2I3Y A;  3Q19 A;  2JSY A;  1B9Y C;  4RUV A;  2MYG A;  1GUH A;  2EIO A;  5ECN B;  2FWH A;  1SKR B;  1TRU A;  1ZYQ B;  5ABR A;  1K0D A;  5LD0 A;  3L0H A;  5GZZ B;  4KE3 A;  5H5S A;  2H6Z A;  1JZR A;  5HFG A;  5B7C A;  2YV7 A;  5G5F A;  2CVD A;  3I43 A;  1PKW A;  1O8X A;  4OO5 A;  1A0R P;  3GFK A;  2B5E A;  1AAZ A;  1R4W A;  2H73 A;  4L5L A;  4HJM A;  4KB3 A;  1WOU A;  3P2A A;  2F8A A;  4K0G A;  1DE2 A;  3QAG A;  3H1N A;  3HKR A;  2H66 A;  3KXO A;  3EYT A;  2YNX A;  3F3Q A;  4P3Y B;  4FQU A;  4DEJ A;  3FZ5 A;  3LYP A;  4BL7 A;  4TR3 A;  3TKR A;  5IMA A;  1U87 A;  1J9B A;  3KTL A;  5F0G A;  3IAS 2;  12GS A;  4Q5N A;  5DAL A;  2K9F A;  1XWK A;  4POM A;  3HVX A;  4XTS A;  8GSS A;  4JE1 A;  3GHA A;  5ECP B;  3HZ4 A;  2DJJ A;  2V32 A;  1T00 A;  1XFL A;  3KD0 A;  2I1U A;  1CQH A;  3IBH A;  3Q74 A;  5L71 A;  1YKA A;  4J57 E;  4XHM A;  5KN0 A;  3DEX A;  3KTB A;  3CMI A;  2DMM A;  3KH7 A;  4L0W A;  3ZIV A;  4QL9 A;  4MJA A;  4GSN A;  2KP1 A;  2H30 A;  1O73 A;  1NSW A;  2OE0 A;  4MF6 A;  4PNF A;  2PER A;  3ERW A;  4V1A p;  3VWU A;  1DE1 A;  1M2D A;  1F2E A;  3TUE A;  4PUR A;  3GYK A;  3IHQ A;  1GSY A;  2H70 A;  1OC9 B;  4PNG A;  4X0X A;  4KCE A;  2VCW A;  2K6V A;  4TR4 A;  5ECS A;  1WMJ A;  1GSD A;  1K0M A;  1TJD A;  4X43 A;  4L5O A;  5DDL A;  3GKM A;  4EKZ A;  1B48 A;  2RUF A;  4GF0 A;  3EWL A;  2A2S A;  3IOS A;  5IO0 A;  4OFM A;  2I4A A;  4RI6 A;  4OMV A;  3O6T A;  2R2J A;  4BVY A;  3CSI A;  2RM5 A;  2DIY A;  3GUS A;  4MK3 A;  4EE0 A;  4ECJ A;  2PVO C;  3KJY A;  2FA4 A;  3E9J B;  3EVI A;  1TOF A;  2IFQ B;  1TK0 B;  1BYE A;  2VD0 A;  5HR0 A;  1EV4 A;  4G2E A;  3A2V A;  2X8H A;  5HR3 A;  1GNE A;  3ZVJ D;  1X5D A;  2GQL A;  1EOG A;  2AHE A;  4HU7 A;  3QAW A;  5JWO B;  4GLT A;  2P31 A;  2MMA A;  1LJR A;  2OAD A;  1JLV A;  3F4R A;  2B7J A;  1FO5 A;  4MH2 A;  5D96 A;  5KN2 A;  2H1G A;  3DWV A;  2VIM A;  3O3T A;  1KTE A;  2PN8 A;  2VLT A;  2LRT A;  3RDW A;  5AIV A;  4ZXG A;  3ZFL A;  2VM2 A;  3U6V A;  3FK8 A;  3IC8 A;  4KDU A;  3RHC A;  4HQZ A;  2IN3 A;  3EIN A;  4USS A;  3KMO A;  2HSN B;  3M9K A;  2JSZ A;  2LS5 A;  2HZE B;  3EMX A;  2H74 A;  2HSY A;  4KA0 A;  4H86 A;  3FRC A;  4KCA A;  3VI5 A;  1X0R A;  1FAA A;  3GIX A;  1T4Y A;  2E0Q A;  4PQH A;  1GH2 A;  1G6Y A;  1SJ6 A;  2HI7 A;  2TIR A;  4BL7 B;  4MF5 A;  3WGD A;  1ERT A;  3TRP A;  2G2Q A;  3US3 A;  5EY6 A;  5A4W A;  2PBJ A;  2DSA A;  4WET A;  2XBI A;  4ZBD A;  3D4T A;  2X8C A;  4AJ7 A;  4ZIL A;  1GUK A;  3WT2 A;  1YKC A;  2WCI A;  6GSX A;  2G0F A;  5LCZ A;  3NIV A;  5J5N A;  4MF7 A;  3OR5 A;  1A8Y A;  1ZOF A;  2QKE A;  5CO3 A;  1GRX A;  2AB6 A;  4JR6 A;  2FWG A;  3F6D A;  3DD3 A;  3LXZ A;  2XC2 A;  3WGE A;  3FKF A;  2CV4 A;  6GST A;  2FCH A;  5E4W A;  4GSS A;  3LGC A;  1QMV A;  3TOU A;  5LNK e;  3RPP A;  5AN1 A;  3L9V A;  1FW1 A;  3SBC A;  3HA9 A;  1T4Z A;  1AUC A;  3D5J A;  1WE0 A;  4NV5 A;  3HD5 A;  3VLN A;  3GRX A;  1YEP A;  3J7Y b;  1SL1 B;  2IMF A;  3PPU A;  1TXX A;  2WZ9 A;  1S3C A;  3ZYW A;  3EE2 A;  1G0T A;  3LG6 A;  2IL3 A;  4TKY A;  3TKP A;  1WIK A;  2I81 A;  2H6Y A;  2H76 A;  1TP9 A;  5IPG A;  1K0A A;  4TRX A;  2XPE A;  3QAV A;  4N0Z A;  1ML6 A;  2HSM A;  2LEG A;  1YF0 A;  1WWJ A;  1I9D A;  3GUR A;  4N10 A;  2GZY A;  3VWW A;  3C1S A;  3L9S A;  3LEF A;  3LYK A;  3A2W A;  1M2A A;  1M9B A;  3CTF A;  2V6O A;  1V9W A;  3QPM A;  1M99 A;  3DXB A;  1YZX A;  2AYT A;  4ECC A;  2OKA A;  3C8E A;  2VCZ A;  3MNG A;  5ECO B;  1UVZ A;  2H01 A;  2IIY A;  5EL8 A;  2IME A;  2B5Y A;  1A8L A;  1MTC A;  2P0G A;  1NM3 A;  3APQ A;  5HR1 A;  5A4V A;  4O7H A;  1G6W A;  3CSH A;  1XOA A;  4KH7 A;  1GSE A;  2WDU A;  2XPD A;  4F03 A;  4G10 A;  4ILF A;  1VRS D;  1VF1 A;  3MDK A;  5G30 A;  4F0C A;  1O81 A;  3VPQ A;  5DAK B;  2F9S A;  2IMK A;  2EIQ A;  1TKD B;  1O6J A;  3TJK A;  2HFD A;  3DGQ A;  5A4U A;  1A2L A;  4N11 A;  1AW9 A;  3D0Z A;  1KNG A;  4LL1 B;  4I8B A;  1RW1 A;  5HR2 A;  4WF5 A;  4MAB A;  2EC4 A;  2DC5 A;  5G1K A;  4I2T A;  1M2B A;  1SU9 A;  1PA3 A;  5G1L A;  3IV4 A;  4ZB9 A;  5DCG A;  1OC9 A;  2REM A;  3G7J A;  3F3R A;  4CDO A;  5ENU A;  3JCM L;  2L6C A;  3GH6 A;  4HS1 A;  1SJI A;  4MCU A;  1K3L A;  1TI1 A;  4EXJ A;  5ELG A;  3I6A A;  1NW2 A;  2VCX A;  5B6M A;  3G7Y A;  3KIJ A;  1ACV A;  1JZD A;  5DJM A;  4ML6 A;  5H5Q A;  4ULX A;  5FWG A;  1FVJ A;  4DSS A;  1FB0 A;  3W8J A;  1OAZ A;  1XVQ A;  2GST A;  5JWQ B;  3UOM A;  2LKU A;  1EGO A;  4F9Z A;  2E2M A;  1X9W B;  4LL4 B;  2GDR A;  2PGT A;  4OFT A;  3L4N A;  1GTI A;  3H79 A;  3HVV A;  2WFC A;  3TRX A;  4NHZ A;  3CRU A;  1RK4 A;  4OCF A;  3F8U A;  4G9H A;  5J9C A;  3M1G A;  3VWX A;  1K3O A;  2L4C A;  5DVB A;  1RQM A;  4RI7 A;  2IFQ A;  4YAP A;  3GST A;  2NVL A;  1FHE A;  4HOJ A;  2N5A A;  3RAZ A;  1TRW A;  3QMX A;  2CA8 A;  4IW9 A;  1PQN A;  3GSS A;  1ERV A;  2R5G A;  4FYU A;  4JZQ A;  3ZZX A;  1TRV A;  5IMD A;  2H0I A;  4HJ2 A;  2WGR A;  1MEK A;  2ZCT A;  2GGT A;  3CBU A;  1T1V A;  2H19 A;  1J08 A;  2LNS A;  1E2Y A;  3F0I A;  3BCK A;  4GWR A;  2HQT A;  1EP7 A;  4IEL A;  1BX9 A;  2HSM B;  1PKZ A;  3VI7 A;  4J56 E;  3P7X A;  1ZYE A;  6GSS A;  3F9U A;  2C0E A;  2R4V A;  1U3A A;  1XW9 A;  4OFN A;  3TKS A;  5D9X A;  2HXK A;  1QFN A;  2HZE A;  4IP1 A;  2NTO A;  2B5X A;  3G9B A;  4AJ8 A;  4MP4 A;  2LRN A;  1V2A A;  1EEJ A;  1G7E A;  3QOU A;  1ZGN A;  2C4J A;  4OO4 A;  1X5C A;  4KDY A;  5BMU A;  1MD4 A;  1ST9 A;  3L78 A;  2XHF A;  2H1A A;  5G5E A;  2J23 A;  3KEB A;  4XCS A;  2JZR A;  2O8V B;  1I5G A;  2VCT A;  3PR8 A;  5GAN D;  1GWC A;  2C0F A;  4GQC A;  2VL2 A;  3FZ4 A;  4DSR A;  3HJO A;  3FZA A;  2AUV A;  3VUR A;  1AC1 A;  2JU5 A;  5CYY A;  1F37 A;  5GSS A;  3GKX A;  3MWH A;  2C1Y A;  4ECB A;  4PX1 A;  1OE8 A;  1SK1 A;  3ED3 A;  2L5L A;  1ABA A;  4WEY A;  3R3E A;  3EMP A;  2H1B A;  1ZCP A;  2GQK A;  10GS A;  3IK7 A;  3GL5 A;  3FW2 A;  2YWM A;  2TRX A;  2H72 A;  2IMD A;  3J7Y k;  4J2F A;  6GSY A;  3ZVJ A;  4TOP A;  4E8E A;  1JHB A;  2LRC A;  3UL3 A;  4XIH A;  4O32 A;  5CAX A;  1IYI A;  2LQQ A;  1R7H A;  2BMX A;  5CRE A;  4Q5F A;  2L6D A;  1M0U A;  1M7T A;  5CP1 A;  3DVX A;  2HNL A;  1XIY A;  3DIE A;  4ZBA A;  1QUW A;  2J9H A;  2LNT A;  2X8G A;  1O8W A;  3P90 A;  3W8S A;  1PL1 A;  2ZUP A;  4MJE A;  4DSS B;  1QK8 A;  2C8U A;  3M9J A;  4MJB A;  5ECK B;  3IC4 A;  1HNA A;  3TJF A;  4RQR A;  2F8F A;  5H5R A;  2FWE A;  4KUN A;  4KGI A;  2IMI A;  3WYW A;  4HUA A;  2NDO A;  1A2M A;  3NOF A;  3BCI A;  4TVE A;  4BA7 A;  5CRH A;  1UA5 A;  1A24 A;  4WR5 A;  5ECI B;  4GTU A;  4WBJ A;  5DQS A;  2BTO T;  4MZC A;  5D9V A;  1WRY A;  1J0F A;  4G0K A;  3QFA C;  1SJZ A;  2X64 A;  4NAX A;  6GSW A;  1F6M C;  2N5F A;  5IQY A;  2QC7 A;  3GKK A;  4FIW A;  2A4V A;  4K9Z A;  4V2M A;  2JZT A;  1W89 A;  5G31 A;  4ZBB A;  1GL8 A;  4BWQ A;  2OE3 A;  5IMZ A;  3RPN A;  3M3M A;  4GST A;  1URM A;  3LSZ A;  3EUR A;  3KP8 A;  2CX3 A;  1F3B A;  4PTS A;  2DML A;  4NV2 A;  2M72 A;  4QL7 A;  2DBC A;  1AQX A;  1FVK A;  1YJ6 A;  1DSB A;  2FLS A;  3TJJ A;  5DAK A;  1SEN A;  2GQM A;  3FR9 A;  3APS A;  4HU9 A;  3GX0 A;  4QQ7 A;  2FUG 2;  3GKN A;  2R37 A;  3K8N A;  1K3Y A;  1M9A A;  3TB2 A;  5EPF A;  1TU7 A;  1YQ1 A;  5ECR B;  1V58 A;  3TCO A;  3C71 A;  3UBL A;  2VO4 A;  3GN3 A;  3GA4 A;  4KSO A;  3QCP A;  5INY A;  4IQA A;  3VK9 A;  1YDK A;  3ZRE A;  5J41 A;  4D73 B;  1X5E A;  5ELA A;  1HNB A;  2H75 A;  1EGR A;  4AGS A;  1JFU A;  1BG5 A;  2MZC A;  3KH9 A;  3C7M A;  2UZ8 A;  2HRK B;  1EZK A;  2B1L A;  3UAR A;  4EDY A;  1KBN A;  1W4V A;  4IKH A;  5ECM B;  1QXH A;  2YOI A;  1KEB A;  2KLX A;  2QGV A;  4CW9 A; 
#chains in the Genus database with same CATH topology
 1XW6 A;  3HJP A;  4LA1 A;  4MMM A;  2VAF A;  4E68 A;  3D21 A;  3VWV A;  1PX6 A;  5ECQ B;  1ZZY A;  5AIS A;  1AQV A;  2GTU A;  3HMJ G;  20GS A;  2QSI A;  2GVP A;  2WUL A;  2FY6 A;  3WGX A;  4CY6 A;  4G0L A;  1QGV A;  3S9F A;  2GT5 A;  3ZML A;  3APO A;  2ZNM A;  4HI7 A;  3H4K A;  2C3T A;  1YF1 A;  5IM9 A;  5FT3 A;  2HLS A;  4MZW A;  4JU5 A;  1GSU A;  4PUA A;  3DYR A;  4YQM A;  1C72 A;  2H0G A;  1ZL9 A;  2D2Z A;  3LWA A;  2PVQ A;  1MDK A;  1WJK A;  1XOB A;  4V2L A;  2CAI A;  2C80 A;  2L5O A;  4Z7X A;  2CAQ A;  1HYU A;  3UJ1 A;  1HQO A;  3CHX C;  1EP8 A;  4TR1 A;  3F4S A;  2H8L A;  5IMC A;  4KW6 A;  5IMF A;  1ILO A;  2N5B A;  5CRW A;  2BJX A;  1LBK A;  4XS6 A;  3D6I A;  2CT6 A;  5KEJ A;  1F3A A;  1X9M B;  1U3I A;  4IP6 A;  4N0V A;  5ECL B;  2LST A;  4HEA 2;  4NPB A;  4F0B A;  3W6G A;  1YY7 A;  5CRG A;  3TRQ A;  1EEM A;  2DJK A;  2WS2 A;  4IN0 A;  4I6X A;  4WXT A;  2C3Q A;  3GX8 A;  4QMK A;  1Z6M A;  1WP0 A;  3CRT A;  1GUL A;  3ZIJ A;  4WBR D;  3BOA A;  3L9U A;  4POL A;  3MIX A;  4NXI A;  3I69 A;  3UBK A;  1A23 A;  4X4J A;  3GH9 A;  1VF4 A;  2RM6 A;  2L59 A;  4K5S A;  1WPI A;  3ZLP A;  2O7K A;  3ZRD A;  2LTK A;  1B4Q A;  3TDG A;  1AQW A;  1Z3E A;  4MDC A;  1HNC A;  1B9X C;  3DRN A;  2C0G A;  5JCG A;  4L0U A;  2ALB A;  2HRF A;  4PXO A;  2FHE A;  4F2I A;  3CTG A;  4E8H A;  3N9J A;  1XW5 A;  3IPZ A;  2OE1 A;  4I5Q A;  3VPT A;  2OT3 A;  2OAC A;  4POK A;  2TRC P;  3Q18 A;  5JWR B;  4EVM A;  3TJB A;  1UN2 A;  4L8E A;  13GS A;  4IGJ A;  2YZH A;  2GZP A;  4AI6 A;  1XZO A;  4DVC A;  4EC0 A;  2VL3 A;  2F51 A;  5HFI A;  1H75 A;  2YN1 A;  3ME7 A;  2ON5 A;  1X9S B;  4Q5Q A;  16GS A;  3HHV A;  1A2J A;  1UC7 A;  1K0C A;  4IQ1 A;  2P5R A;  2VD1 A;  3IHG A;  1Z7R A;  4Z2R A;  2IJY A;  3F4T A;  2LUS A;  2B6M A;  1AXD A;  4N3Z A;  3WT1 A;  1PRX A;  1JLW A;  1VF2 A;  3FR6 A;  3FY7 A;  4GRF A;  5HQP A;  1N25 A;  1BAY A;  2H1D A;  4K7O A;  2AJQ B;  1K0N A;  4ZB7 A;  2V6K A;  3KP9 A;  3FEU A;  3HY2 A;  2YWN A;  4ZL7 A;  3LXT A;  2H71 A;  1R5P A;  4G01 A;  1OKD A;  5KN3 A;  1MD3 A;  3IXR A;  3O76 A;  4IVF A;  2O85 A;  5ID2 B;  2EFC A;  2X49 A;  1SK2 A;  2GLR A;  3CWG A;  3ME8 A;  3AY8 A;  4ISD A;  4X1U A;  4O5U A;  1GLQ A;  5GAP D;  2UV8 G;  1YVL A;  5F06 A;  5IIZ A;  9GSS A;  2OBK A;  3UEM A;  4TR1 B;  4IS0 A;  3NZN A;  1BQ7 A;  4O5Q A;  3IAM 2;  1ZMA A;  1TK8 B;  4KAE A;  4MPG A;  2VLU A;  3LOR A;  3A3T A;  4XS4 B;  1PSQ A;  5CRD A;  3LFL A;  5IOW A;  4V1A g;  2RII A;  1DBY A;  3VFI A;  3R2Q A;  3DVW A;  4IJ3 A;  1ZYN A;  1TDI A;  4K8M A;  2MBS A;  2DJ1 A;  5J9B A;  1DUG A;  4GXZ A;  4PUF C;  2R0P A;  2V2G A;  1K0O A;  2RUE A;  2YWO A;  1OVN A;  3HZ8 A;  4HZ4 A;  4NHW A;  1XWA A;  2B3S A;  4ZB6 A;  1G7O A;  1MDJ A;  1A0F A;  1ON4 A;  2B7K A;  4D73 A;  1PL2 A;  3KM6 A;  1XWB A;  4N30 A;  1FOV A;  2O89 A;  4FYB A;  3IK9 A;  3TOT A;  4LMV A;  2YWI A;  3GTU B;  3RBT A;  5DQY A;  1N2A A;  2WJU A;  5ECH B;  3TKS E;  2HRK A;  4HQS A;  4POB A;  3QDN A;  2C3N A;  2YJ7 A;  4JBB A;  4IBP A;  4WR4 A;  5DJL A;  3FHK A;  4FO5 A;  1U88 A;  3A5W A;  3GNJ A;  3ERG A;  3SWL A;  5B8A A;  3KGK A;  2Z9S A;  2IWT A;  1SD9 A;  2ON7 A;  1XBS A;  5F05 A;  2KHP A;  4EIQ A;  2PUK C;  3C1R A;  4AJ6 A;  1B8X A;  1BG1 A;  2RLI A;  1SKS B;  3QR6 A;  2A2R A;  3F6F A;  1GP1 A;  5DCH A;  5G2Z A;  5D93 A;  2B1K A;  3FYG A;  2OBI A;  2WZS A;  4PQI A;  3EC3 A;  3CXG A;  1SYR A;  5C04 A;  4TXO B;  2DIZ A;  2PWJ A;  4LLR A;  17GS A;  4ZL9 A;  3RHB A;  2KUC A;  1V57 A;  3MYD A;  5IO2 A;  1VGL A;  1SL2 B;  3BD2 A;  3A2X A;  2F3M A;  3ZFB A;  3DML A;  1S4B P;  4WF4 A;  2NBS A;  4OWY A;  4K0N A;  4K7I A;  4EUY A;  5HFK A;  1H4O A;  4FYC A;  5KN1 A;  3TKQ A;  2VM1 A;  3MSZ A;  3GV1 A;  2K8S A;  5GST A;  4BVX B;  2K8V A;  5KOW A;  2JZS A;  1HD2 A;  4KX4 A;  14GS A;  1SK0 A;  3UVH A;  2FGX A;  3TKS C;  4LMW A;  1TRS A;  2YZU A;  1Z6N A;  4AKI A;  1N8J A;  1SVL A;  4XRA A;  2PU9 C;  1R26 A;  4BPY A;  3PGT A;  2M80 A;  2WW1 A;  1CQG A;  4HZ2 A;  3DKS A;  4MJC A;  2FNO A;  1TI3 A;  1XWC A;  3U5R E;  4TXV A;  3EU4 A;  1V40 A;  2YJH A;  2L4Q A;  11GS A;  4PHZ C;  2VL2 C;  5IPH A;  1V98 A;  1OC8 A;  3PH9 A;  1SD8 A;  3FR3 A;  3D22 A;  5B6N A;  2KOK A;  4YQV A;  1PD2 1;  2FD3 A;  2K18 A;  1USB A;  1THO A;  3IDV A;  1OC3 A;  5AIX A;  1JZO A;  3HXS A;  1M3I A;  2MMO A;  5IOX A;  2HSH A;  1NHY A;  3F63 A;  4ZB8 A;  4NMU A;  2HE3 A;  5D8I A;  1PX7 A;  2LJK A;  3PIN A;  1S3R A;  2X99 A;  2FWF A;  3UMA A;  4PGT A;  4ID0 A;  4YH2 A;  2GSR A;  2PMT A;  3LJR A;  4RQX A;  4MZB A;  4V2N A;  1TW9 A;  22GS A;  4G19 A;  5D9W A;  3HCZ A;  2VUP A;  2CX4 A;  2GT6 A;  3EU3 A;  1AIU A;  4ACS A;  1PMT A;  4XS1 A;  2R6K A;  1BJX A;  5DBQ A;  4ML1 A;  2WB9 A;  2V41 A;  4CHS A;  5DAL B;  3IRA A;  1OYJ A;  2DJ0 A;  2DJ2 A;  2WRT A;  2CVK A;  3ZMK A;  3ZL5 A;  2VOC A;  3HYP A;  4YAV A;  4BWS A;  4KF9 A;  1TTZ A;  4GQF A;  1F9M A;  1JZW A;  1EWX A;  1Z7P A;  1Z9H A;  1MDI A;  1T3B A;  4FH8 A;  4ZL8 A;  4GCI A;  4DSQ A;  3E3E A;  2P5Q A;  3QD9 A;  3H93 A;  4OD7 A;  1EOH A;  4K1F A;  1SVM A;  5J47 A;  1E6B A;  1B4P A;  2XBQ A;  1EV9 A;  1SKW B;  5J4U A;  6GSU A;  3TGZ A;  2CZ3 A;  4I97 A;  3QFB C;  1XCC A;  2DLX A;  4Z2T A;  2HRN A;  2V1M A;  2GS3 A;  5FHI A;  4YQU A;  2EIR A;  5ID2 A;  3P8W A;  5J4V A;  4Q5R A;  2JL4 A;  3KCM A;  3D4M A;  1THX A;  2YP6 A;  5D9T A;  3IA1 A;  1FB6 A;  1ZYP A;  1O7U A;  2KP2 A;  4G0I A;  1SL0 B;  2CQ9 A;  2O87 A;  1GTA A;  2LJR A;  3ISO A;  4OCE A;  3Q6O A;  4O92 A;  5JCU A;  2L57 A;  3LQ7 A;  4IHU A;  4MPF A;  5COH A;  3HVS A;  1XPV A;  4ECI A;  4EO3 A;  1R5A A;  3BJ5 A;  4XS4 A;  4BVY B;  4TN8 A;  2PPT A;  3MAK A;  3G7I A;  3UIW A;  4KSM A;  2OJL A;  4ZIJ A;  2HT9 A;  3M0F A;  2R0G A;  3N5O A;  4O5R A;  2IPA A;  1PN9 A;  4A5P A;  2VCV A;  1IYH A;  2C0D A;  1GSS A;  3BBY A;  2R0C A;  1NHO A;  1GSF A;  2NPB A;  1GTU A;  4I2U A;  1PGT A;  2LQO A;  3GTU A;  2YAN A;  4EL1 A;  1BED A;  2E7P A;  1Q98 A;  4MLY A;  1TU8 A;  1GUM A;  2WW2 A;  3RFR C;  2VCQ A;  2CZ2 A;  4K2D A;  2E2G A;  4CY8 A;  2I9H A;  5J3R A;  1FOH A;  1GTB A;  2JAD A;  3ZTL A;  2H6X A;  3HDC A;  1GLP A;  3ZIT A;  1YEX A;  4XRD A;  1S3A A;  3IE3 A;  2MMN A;  2A2P A;  2YPM A;  1U6T A;  2LV3 A;  5A34 B;  5AGY A;  2MBT A;  3V1W A;  4F82 A;  3WD6 A;  2QA2 A;  1QQ2 A;  1LU4 A;  4WKW A;  2AAW A;  1TK5 B;  2M46 A;  4JED A;  5A5H B;  3H8Q A;  4K7N A;  5F8B A;  3TJG A;  2DJ3 A;  1FG4 A;  2ES7 A;  3IR4 A;  1O85 A;  1GSQ A;  4TXO A;  3CSJ A;  1GNW A;  1S3D A;  3ERF A;  5EVO A;  5IMV A;  4NWY A;  1XWG A;  3CYN A;  1XXU A;  2YCD A;  2VLV A;  4K6X A;  3KZQ A;  3UVT A;  3M8N A;  3C73 A;  4EF0 A;  5JCW A;  3GMF A;  1XVW A;  3KMN A;  19GS A;  4KDX A;  2AV4 A;  1K0B A;  4PI0 C;  4TW5 A;  1ERW A;  2MMZ A;  2OA7 A;  1ERU A;  1T8E B;  5A5K A;  2GSS A;  4IJI A;  4KND A;  18GS A;  3EPT A;  4JR4 A;  3I9V 2;  5E59 A;  5B8B A;  6GSV A;  2HRA A;  2CVB A;  4HDE A;  2GZZ A;  1SYX A;  2H0H A;  4TR0 A;  1Y25 A;  4AF2 A;  4BVX A;  3UAP A;  2EFH A;  2FA8 A;  2R3X A;  1Y6E A;  4MH3 A;  5CNW A;  2HZF A;  5C00 A;  1OKT A;  1VF3 A;  2LJA A;  4JRR A;  1Q4J A;  1Z5Y E;  2GSQ A;  3GL3 A;  2O3E A;  3HJM A;  1OE7 A;  5F07 A;  2VL9 A;  3E0U A;  5D73 A;  4EDZ A;  3FZ9 A;  7GSS A;  2HYX A;  2YV9 A;  4MA9 A;  1T7P B;  2JAC A;  4PQ1 A;  2I3Y A;  3Q19 A;  2JSY A;  1B9Y C;  4RUV A;  2MYG A;  1GUH A;  2EIO A;  5ECN B;  2FWH A;  1SKR B;  1TRU A;  1ZYQ B;  5ABR A;  1K0D A;  5LD0 A;  3L0H A;  5GZZ B;  4KE3 A;  5H5S A;  2H6Z A;  1JZR A;  5HFG A;  5B7C A;  2YV7 A;  5G5F A;  2QA1 A;  2CVD A;  3I43 A;  1PKW A;  1O8X A;  4OO5 A;  1A0R P;  3GFK A;  2O5V A;  2B5E A;  1AAZ A;  4FXY P;  1R4W A;  2H73 A;  4L5L A;  4HJM A;  4KB3 A;  1WOU A;  3P2A A;  2F8A A;  4K0G A;  1DE2 A;  3QAG A;  3H1N A;  3HKR A;  2H66 A;  3KXO A;  3A5I A;  3EYT A;  2YNX A;  3F3Q A;  4P3Y B;  4FQU A;  4DEJ A;  3FZ5 A;  3LYP A;  4BL7 A;  4TR3 A;  3TKR A;  5IMA A;  1U87 A;  1J9B A;  3KTL A;  5F0G A;  3IAS 2;  12GS A;  4Q5N A;  5DAL A;  2K9F A;  1XWK A;  4POM A;  3HVX A;  4XTS A;  2WW0 A;  8GSS A;  4JE1 A;  3GHA A;  5ECP B;  3HZ4 A;  2DJJ A;  2V32 A;  1T00 A;  1XFL A;  4AKH A;  3KD0 A;  2I1U A;  1CQH A;  5BRT A;  3IBH A;  3Q74 A;  5L71 A;  1YKA A;  4J57 E;  4XHM A;  5KN0 A;  1Y1U A;  3DEX A;  3CMI A;  3KTB A;  2DMM A;  3KH7 A;  4L0W A;  3ZIV A;  4QL9 A;  4MJA A;  4GSN A;  2KP1 A;  2H30 A;  1O73 A;  1NSW A;  2OE0 A;  4MF6 A;  4PNF A;  2PER A;  3ERW A;  4V1A p;  5J4Y A;  3VWU A;  1DE1 A;  1M2D A;  1F2E A;  3TUE A;  4PUR A;  3GYK A;  3IHQ A;  1GSY A;  2EFD A;  2H70 A;  1OC9 B;  4PNG A;  4X0X A;  4KCE A;  2VCW A;  2K6V A;  4TR4 A;  5ECS A;  1WMJ A;  1GSD A;  1K0M A;  1TJD A;  4X43 A;  4L5O A;  5DDL A;  3GKM A;  4EKZ A;  1B48 A;  2RUF A;  4GF0 A;  3EWL A;  2A2S A;  3IOS A;  5IO0 A;  4OFM A;  4BIK A;  2I4A A;  4RI6 A;  4OMV A;  1PN0 A;  3O6T A;  4ICY A;  4MNN A;  2R2J A;  4BVY A;  3CSI A;  2RM5 A;  2DIY A;  3GUS A;  4MK3 A;  4EE0 A;  4ECJ A;  2PVO C;  3KJY A;  2FA4 A;  3E9J B;  4K2X A;  3EVI A;  1TOF A;  2IFQ B;  1TK0 B;  1BYE A;  2VD0 A;  5HR0 A;  1EV4 A;  4G2E A;  3A2V A;  2X8H A;  5HR3 A;  1GNE A;  3ZVJ D;  1X5D A;  2GQL A;  1EOG A;  2AHE A;  4HU7 A;  3QAW A;  5JWO B;  4GLT A;  2P31 A;  2MMA A;  1LJR A;  2OAD A;  1JLV A;  3F4R A;  2B7J A;  1FO5 A;  4MH2 A;  5D96 A;  5KN2 A;  1BF5 A;  2H1G A;  3DWV A;  2VIM A;  3O3T A;  1KTE A;  2PN8 A;  4W66 A;  2VLT A;  2LRT A;  3RDW A;  5AIV A;  4ZXG A;  3ZFL A;  2WW3 A;  5A34 A;  2VM2 A;  3U6V A;  3FK8 A;  3IC8 A;  4KDU A;  3RHC A;  4HQZ A;  2IN3 A;  3EIN A;  4USS A;  3KMO A;  2HSN B;  3FMW A;  3M9K A;  2JSZ A;  2LS5 A;  5A5H A;  2HZE B;  3EMX A;  2H74 A;  2HSY A;  4KA0 A;  4H86 A;  3FRC A;  4KCA A;  3VI5 A;  1X0R A;  2H1L A;  1FAA A;  3GIX A;  1T4Y A;  5BMU B;  2E0Q A;  4PQH A;  1GH2 A;  1G6Y A;  1SJ6 A;  2HI7 A;  2TIR A;  4BL7 B;  4MF5 A;  4HSC X;  1ERT A;  3WGD A;  3TRP A;  2G2Q A;  3US3 A;  5EY6 A;  5A4W A;  2PBJ A;  2DSA A;  4WET A;  2XBI A;  4YKF A;  4ZBD A;  3D4T A;  2X8C A;  4AJ7 A;  4ZIL A;  1GUK A;  3WT2 A;  1YKC A;  2WCI A;  6GSX A;  2G0F A;  5LCZ A;  3NIV A;  5J5N A;  4MF7 A;  3OR5 A;  1A8Y A;  2WVZ A;  1ZOF A;  2QKE A;  5CO3 A;  1GRX A;  2AB6 A;  4JR6 A;  2FWG A;  3F6D A;  3DD3 A;  3LXZ A;  2XC2 A;  3WGE A;  3FKF A;  3HVN A;  2CV4 A;  6GST A;  2FCH A;  5E4W A;  4GSS A;  3LGC A;  4Z2U A;  1QMV A;  3TOU A;  5LNK e;  3RPP A;  5AN1 A;  3L9V A;  1FW1 A;  3SBC A;  3HA9 A;  1T4Z A;  1AUC A;  3D5J A;  1WE0 A;  4NV5 A;  3HD5 A;  3VLN A;  3GRX A;  1YEP A;  3J7Y b;  1SL1 B;  2IMF A;  3PPU A;  1TXX A;  2WZ9 A;  2WVX B;  1S3C A;  3ZYW A;  3EE2 A;  1G0T A;  3LG6 A;  2IL3 A;  4TKY A;  3TKP A;  1WIK A;  2I81 A;  2H6Y A;  2H76 A;  1TP9 A;  5IPG A;  1K0A A;  4TRX A;  2XPE A;  3QAV A;  4N0Z A;  1ML6 A;  2HSM A;  2LEG A;  1YF0 A;  1WWJ A;  1I9D A;  3GUR A;  4N10 A;  2GZY A;  3VWW A;  2A4H A;  3C1S A;  3L9S A;  3LW9 A;  3LEF A;  3LYK A;  3A2W A;  1M2A A;  1M9B A;  3CTF A;  2V6O A;  1V9W A;  3QPM A;  1M99 A;  3DXB A;  1YZX A;  2AYT A;  4ECC A;  2OKA A;  3C8E A;  2VCZ A;  3MNG A;  5ECO B;  5A1N A;  1UVZ A;  2H01 A;  2IIY A;  5EL8 A;  2IME A;  2B5Y A;  1A8L A;  1MTC A;  2P0G A;  1NM3 A;  1XG8 A;  3APQ A;  5HR1 A;  5A4V A;  4O7H A;  1G6W A;  3CSH A;  1XOA A;  4KH7 A;  1GSE A;  2WDU A;  2XPD A;  4F03 A;  4G10 A;  4ILF A;  1VRS D;  1VF1 A;  3MDK A;  5G30 A;  4F0C A;  1O81 A;  3VPQ A;  5DAK B;  2F9S A;  2IMK A;  2EIQ A;  1TKD B;  1O6J A;  3TJK A;  4YKG A;  2HFD A;  3DGQ A;  5A4U A;  1A2L A;  4N11 A;  1AW9 A;  3D0Z A;  1KNG A;  4LL1 B;  4I8B A;  1RW1 A;  5HR2 A;  4WF5 A;  4MAB A;  2EC4 A;  2DC5 A;  5G1K A;  4I2T A;  1M2B A;  1SU9 A;  1PA3 A;  5G1L A;  3CQF A;  2VKZ G;  3IV4 A;  4ZB9 A;  5DCG A;  1OC9 A;  2REM A;  3G7J A;  3F3R A;  4CDO A;  5ENU A;  3JCM L;  2L6C A;  3GH6 A;  4HS1 A;  1SJI A;  4MCU A;  1K3L A;  1TI1 A;  4EXJ A;  2WVY A;  5ELG A;  3I6A A;  1NW2 A;  2VCX A;  5B6M A;  2DKH A;  3G7Y A;  3KIJ A;  1ACV A;  1JZD A;  5DJM A;  4ML6 A;  5H5Q A;  4ULX A;  5FWG A;  1FVJ A;  4DSS A;  1FB0 A;  3W8J A;  1OAZ A;  1XVQ A;  2GST A;  5JWQ B;  3UOM A;  2LKU A;  1EGO A;  4F9Z A;  2E2M A;  5KOX A;  1X9W B;  4LL4 B;  2GDR A;  2PGT A;  4OFT A;  3L4N A;  1GTI A;  3H79 A;  3HVV A;  2WFC A;  3TRX A;  1TXU A;  1M3J A;  4NHZ A;  3CRU A;  1RK4 A;  4OCF A;  3F8U A;  4G9H A;  5J9C A;  3M1G A;  3VWX A;  1K3O A;  2L4C A;  5DVB A;  1RQM A;  4RI7 A;  2IFQ A;  4PI2 C;  4YAP A;  3GST A;  2NVL A;  1FHE A;  4HOJ A;  2N5A A;  3RAZ A;  1TRW A;  3QMX A;  2DKI A;  2CA8 A;  4IW9 A;  1PQN A;  3GSS A;  1ERV A;  2R5G A;  4FYU A;  4JZQ A;  3ZZX A;  1TRV A;  5IMD A;  2H0I A;  4HJ2 A;  2WGR A;  1MEK A;  2ZCT A;  2GGT A;  3CBU A;  1T1V A;  2H19 A;  1J08 A;  2LNS A;  1E2Y A;  3F0I A;  3BCK A;  4GWR A;  2HQT A;  1EP7 A;  4IEL A;  1BX9 A;  2HSM B;  1PKZ A;  3VI7 A;  4J56 E;  3P7X A;  1ZYE A;  6GSS A;  3F9U A;  2C0E A;  2R4V A;  1U3A A;  1XW9 A;  4OFN A;  3TKS A;  5D9X A;  2HSN A;  2HXK A;  1QFN A;  2HZE A;  4IP1 A;  2NTO A;  2B5X A;  3G9B A;  4AJ8 A;  5A1N B;  4MP4 A;  2LRN A;  1V2A A;  1EEJ A;  1G7E A;  4GDF A;  3QOU A;  1ZGN A;  2C4J A;  4OO4 A;  1X5C A;  4KDY A;  5BMU A;  1MD4 A;  1ST9 A;  3L78 A;  2XHF A;  2H1A A;  5G5E A;  2J23 A;  3KEB A;  4XCS A;  2JZR A;  2O8V B;  1I5G A;  2VCT A;  3PR8 A;  5GAN D;  1GWC A;  2C0F A;  4GQC A;  2VL2 A;  3FZ4 A;  4DSR A;  3HJO A;  3FZA A;  2AUV A;  3VUR A;  2O36 A;  1AC1 A;  2JU5 A;  5CYY A;  1F37 A;  5GSS A;  3GKX A;  3MWH A;  2C1Y A;  4ECB A;  4PX1 A;  1OE8 A;  1SK1 A;  3ED3 A;  2L5L A;  1SVO A;  1ABA A;  4WEY A;  3R3E A;  3EMP A;  2H1B A;  1ZCP A;  2EFE A;  1I1I P;  2GQK A;  10GS A;  3IK7 A;  3GL5 A;  3FW2 A;  2YWM A;  2TRX A;  2H72 A;  2IMD A;  3J7Y k;  4J2F A;  4K5R A;  6GSY A;  3ZVJ A;  4TOP A;  4E8E A;  1JHB A;  2LRC A;  3UL3 A;  4XIH A;  4O32 A;  5CAX A;  1IYI A;  2LQQ A;  1R7H A;  2BMX A;  5CRE A;  4Q5F A;  2L6D A;  1M0U A;  1M7T A;  5CP1 A;  3DVX A;  2HNL A;  1XIY A;  3DIE A;  4ZBA A;  1QUW A;  2J9H A;  2LNT A;  2X8G A;  1O8W A;  3P90 A;  2WVX A;  3W8S A;  1PL1 A;  2ZUP A;  4MJE A;  4DSS B;  1QK8 A;  2C8U A;  3M9J A;  4MJB A;  5ECK B;  3IC4 A;  1HNA A;  3TJF A;  4RQR A;  2F8F A;  5H5R A;  2FWE A;  4KUN A;  4KGI A;  2IMI A;  3WYW A;  4HUA A;  4AKX B;  1PFO A;  2NDO A;  1A2M A;  3NOF A;  3BCI A;  4TVE A;  4BA7 A;  5CRH A;  1UA5 A;  1A24 A;  4WR5 A;  5ECI B;  4GTU A;  4WBJ A;  5DQS A;  2BTO T;  4MZC A;  5D9V A;  1WRY A;  1J0F A;  4G0K A;  3QFA C;  1SJZ A;  2X64 A;  4NAX A;  6GSW A;  1F6M C;  2N5F A;  3TU3 B;  5IQY A;  2QC7 A;  3GKK A;  4FIW A;  2A4V A;  4K9Z A;  4V2M A;  2JZT A;  1W89 A;  5G31 A;  4ZBB A;  1GL8 A;  4BWQ A;  2OE3 A;  5IMZ A;  3RPN A;  3M3M A;  4GST A;  1URM A;  3LSZ A;  3EUR A;  3KP8 A;  2CX3 A;  1F3B A;  4PTS A;  4EIP A;  2DML A;  4NV2 A;  2M72 A;  4QL7 A;  2DBC A;  1AQX A;  1FVK A;  4AKG A;  1YJ6 A;  1DSB A;  2FLS A;  3TJJ A;  5DAK A;  1SEN A;  2GQM A;  3FR9 A;  3APS A;  4HU9 A;  3GX0 A;  4QQ7 A;  2FUG 2;  3GKN A;  2R37 A;  3K8N A;  1K3Y A;  1M9A A;  3TB2 A;  5EPF A;  1TU7 A;  1YQ1 A;  5ECR B;  1V58 A;  5J40 A;  3TCO A;  3C71 A;  3UBL A;  2VO4 A;  3GN3 A;  3GA4 A;  4KSO A;  3QCP A;  5INY A;  4IQA A;  1YEW C;  3VK9 A;  1YDK A;  3ZRE A;  3RGB C;  5J41 A;  4D73 B;  1X5E A;  5ELA A;  1HNB A;  2H75 A;  2X4A A;  1EGR A;  4AGS A;  1JFU A;  1BG5 A;  2MZC A;  3KH9 A;  3C7M A;  2UZ8 A;  2HRK B;  1EZK A;  2B1L A;  3UAR A;  4EDY A;  1KBN A;  1W4V A;  4IKH A;  5ECM B;  1QXH A;  2YOI A;  1KEB A;  2KLX A;  2QGV A;  4CW9 A; 
#chains in the Genus database with same CATH homology
 1XW6 A;  3HJP A;  4LA1 A;  4MMM A;  2VAF A;  4E68 A;  3D21 A;  3VWV A;  1PX6 A;  5ECQ B;  1ZZY A;  5AIS A;  1AQV A;  2GTU A;  3HMJ G;  20GS A;  2QSI A;  2GVP A;  2WUL A;  2FY6 A;  3WGX A;  4CY6 A;  4G0L A;  1QGV A;  3S9F A;  2GT5 A;  3ZML A;  3APO A;  2ZNM A;  4HI7 A;  3H4K A;  2C3T A;  1YF1 A;  5IM9 A;  5FT3 A;  2HLS A;  4MZW A;  4JU5 A;  1GSU A;  4PUA A;  3DYR A;  4YQM A;  1C72 A;  2H0G A;  1ZL9 A;  2D2Z A;  3LWA A;  2PVQ A;  1MDK A;  1WJK A;  1XOB A;  4V2L A;  2CAI A;  2C80 A;  2L5O A;  4Z7X A;  2CAQ A;  1HYU A;  3UJ1 A;  1HQO A;  1EP8 A;  4TR1 A;  3F4S A;  2H8L A;  5IMC A;  4KW6 A;  5IMF A;  1ILO A;  2N5B A;  5CRW A;  2BJX A;  1LBK A;  4XS6 A;  3D6I A;  2CT6 A;  5KEJ A;  1F3A A;  1X9M B;  1U3I A;  4IP6 A;  4N0V A;  5ECL B;  2LST A;  4HEA 2;  4NPB A;  4F0B A;  3W6G A;  1YY7 A;  5CRG A;  3TRQ A;  1EEM A;  2DJK A;  2WS2 A;  4IN0 A;  4I6X A;  4WXT A;  2C3Q A;  3GX8 A;  4QMK A;  1Z6M A;  1WP0 A;  3CRT A;  1GUL A;  3ZIJ A;  4WBR D;  3BOA A;  3L9U A;  4POL A;  3MIX A;  4NXI A;  3I69 A;  3UBK A;  1A23 A;  4X4J A;  3GH9 A;  1VF4 A;  2RM6 A;  2L59 A;  4K5S A;  1WPI A;  3ZLP A;  2O7K A;  3ZRD A;  2LTK A;  1B4Q A;  3TDG A;  1AQW A;  1Z3E A;  4MDC A;  1HNC A;  1B9X C;  3DRN A;  2C0G A;  5JCG A;  4L0U A;  2ALB A;  2HRF A;  4PXO A;  2FHE A;  4F2I A;  3CTG A;  4E8H A;  3N9J A;  1XW5 A;  3IPZ A;  2OE1 A;  4I5Q A;  3VPT A;  2OT3 A;  2OAC A;  4POK A;  2TRC P;  3Q18 A;  5JWR B;  4EVM A;  3TJB A;  1UN2 A;  4L8E A;  13GS A;  4IGJ A;  2YZH A;  2GZP A;  4AI6 A;  1XZO A;  4DVC A;  4EC0 A;  2VL3 A;  2F51 A;  5HFI A;  1H75 A;  2YN1 A;  3ME7 A;  2ON5 A;  1X9S B;  4Q5Q A;  16GS A;  3HHV A;  1A2J A;  1UC7 A;  1K0C A;  4IQ1 A;  2P5R A;  2VD1 A;  3IHG A;  1Z7R A;  4Z2R A;  2IJY A;  3F4T A;  2LUS A;  2B6M A;  1AXD A;  4N3Z A;  3WT1 A;  1PRX A;  1JLW A;  1VF2 A;  3FR6 A;  3FY7 A;  4GRF A;  5HQP A;  1N25 A;  1BAY A;  2H1D A;  4K7O A;  2AJQ B;  1K0N A;  4ZB7 A;  2V6K A;  3KP9 A;  3FEU A;  3HY2 A;  2YWN A;  4ZL7 A;  3LXT A;  2H71 A;  1R5P A;  4G01 A;  1OKD A;  5KN3 A;  1MD3 A;  3IXR A;  3O76 A;  4IVF A;  2O85 A;  5ID2 B;  2EFC A;  2X49 A;  1SK2 A;  2GLR A;  3CWG A;  3ME8 A;  3AY8 A;  4ISD A;  4X1U A;  4O5U A;  1GLQ A;  5GAP D;  2UV8 G;  1YVL A;  5F06 A;  5IIZ A;  9GSS A;  2OBK A;  3UEM A;  4TR1 B;  4IS0 A;  3NZN A;  1BQ7 A;  4O5Q A;  3IAM 2;  1ZMA A;  1TK8 B;  4KAE A;  4MPG A;  2VLU A;  3LOR A;  3A3T A;  4XS4 B;  1PSQ A;  5CRD A;  3LFL A;  5IOW A;  4V1A g;  2RII A;  1DBY A;  3VFI A;  3R2Q A;  3DVW A;  4IJ3 A;  1ZYN A;  1TDI A;  4K8M A;  2MBS A;  2DJ1 A;  5J9B A;  1DUG A;  4GXZ A;  4PUF C;  2R0P A;  2V2G A;  1K0O A;  2RUE A;  2YWO A;  1OVN A;  3HZ8 A;  4HZ4 A;  4NHW A;  1XWA A;  2B3S A;  4ZB6 A;  1G7O A;  1MDJ A;  1A0F A;  1ON4 A;  2B7K A;  4D73 A;  1PL2 A;  3KM6 A;  1XWB A;  4N30 A;  1FOV A;  2O89 A;  4FYB A;  3IK9 A;  3TOT A;  4LMV A;  2YWI A;  3GTU B;  3RBT A;  5DQY A;  1N2A A;  2WJU A;  5ECH B;  3TKS E;  2HRK A;  4HQS A;  4POB A;  3QDN A;  2C3N A;  2YJ7 A;  4JBB A;  4IBP A;  4WR4 A;  5DJL A;  3FHK A;  4FO5 A;  1U88 A;  3A5W A;  3GNJ A;  3ERG A;  3SWL A;  5B8A A;  3KGK A;  2Z9S A;  2IWT A;  1SD9 A;  2ON7 A;  1XBS A;  5F05 A;  2KHP A;  4EIQ A;  2PUK C;  3C1R A;  4AJ6 A;  1B8X A;  1BG1 A;  2RLI A;  1SKS B;  3QR6 A;  2A2R A;  3F6F A;  1GP1 A;  5DCH A;  5G2Z A;  5D93 A;  2B1K A;  3FYG A;  2OBI A;  4PQI A;  3EC3 A;  3CXG A;  1SYR A;  5C04 A;  4TXO B;  2DIZ A;  2PWJ A;  4LLR A;  17GS A;  4ZL9 A;  3RHB A;  2KUC A;  1V57 A;  3MYD A;  5IO2 A;  1VGL A;  1SL2 B;  3BD2 A;  3A2X A;  2F3M A;  3ZFB A;  3DML A;  4WF4 A;  2NBS A;  4OWY A;  4K0N A;  4K7I A;  4EUY A;  5HFK A;  1H4O A;  4FYC A;  5KN1 A;  3TKQ A;  2VM1 A;  3MSZ A;  3GV1 A;  2K8S A;  5GST A;  4BVX B;  2K8V A;  5KOW A;  2JZS A;  1HD2 A;  4KX4 A;  14GS A;  1SK0 A;  3UVH A;  2FGX A;  3TKS C;  4LMW A;  1TRS A;  2YZU A;  1Z6N A;  4AKI A;  1N8J A;  1SVL A;  4XRA A;  2PU9 C;  1R26 A;  4BPY A;  3PGT A;  2M80 A;  1CQG A;  4HZ2 A;  3DKS A;  4MJC A;  2FNO A;  1TI3 A;  1XWC A;  3U5R E;  4TXV A;  3EU4 A;  1V40 A;  2YJH A;  2L4Q A;  11GS A;  2VL2 C;  5IPH A;  1V98 A;  1OC8 A;  3PH9 A;  1SD8 A;  3FR3 A;  3D22 A;  5B6N A;  2KOK A;  4YQV A;  1PD2 1;  2FD3 A;  2K18 A;  1USB A;  1THO A;  3IDV A;  1OC3 A;  5AIX A;  1JZO A;  3HXS A;  2MMO A;  5IOX A;  2HSH A;  1NHY A;  3F63 A;  4ZB8 A;  4NMU A;  2HE3 A;  5D8I A;  1PX7 A;  2LJK A;  3PIN A;  2X99 A;  2FWF A;  3UMA A;  4PGT A;  4ID0 A;  4YH2 A;  2GSR A;  2PMT A;  3LJR A;  4RQX A;  4MZB A;  4V2N A;  1TW9 A;  22GS A;  4G19 A;  5D9W A;  3HCZ A;  2VUP A;  2CX4 A;  2GT6 A;  3EU3 A;  1AIU A;  4ACS A;  1PMT A;  4XS1 A;  2R6K A;  1BJX A;  5DBQ A;  4ML1 A;  2WB9 A;  2V41 A;  4CHS A;  5DAL B;  3IRA A;  1OYJ A;  2DJ0 A;  2DJ2 A;  2WRT A;  2CVK A;  3ZMK A;  3ZL5 A;  2VOC A;  3HYP A;  4YAV A;  4BWS A;  4KF9 A;  1TTZ A;  4GQF A;  1F9M A;  1JZW A;  1EWX A;  1Z7P A;  1Z9H A;  1MDI A;  1T3B A;  4FH8 A;  4ZL8 A;  4GCI A;  4DSQ A;  3E3E A;  2P5Q A;  3QD9 A;  3H93 A;  4OD7 A;  1EOH A;  4K1F A;  1SVM A;  5J47 A;  1E6B A;  1B4P A;  2XBQ A;  1EV9 A;  1SKW B;  5J4U A;  6GSU A;  3TGZ A;  2CZ3 A;  4I97 A;  3QFB C;  1XCC A;  2DLX A;  4Z2T A;  2HRN A;  2V1M A;  2GS3 A;  5FHI A;  4YQU A;  2EIR A;  5ID2 A;  3P8W A;  5J4V A;  4Q5R A;  2JL4 A;  3KCM A;  3D4M A;  1THX A;  2YP6 A;  5D9T A;  3IA1 A;  1FB6 A;  1ZYP A;  1O7U A;  2KP2 A;  4G0I A;  1SL0 B;  2CQ9 A;  2O87 A;  1GTA A;  2LJR A;  3ISO A;  4OCE A;  3Q6O A;  4O92 A;  5JCU A;  2L57 A;  3LQ7 A;  4IHU A;  4MPF A;  5COH A;  3HVS A;  1XPV A;  4ECI A;  4EO3 A;  1R5A A;  3BJ5 A;  4XS4 A;  4BVY B;  4TN8 A;  2PPT A;  3MAK A;  3G7I A;  3UIW A;  4KSM A;  2OJL A;  4ZIJ A;  2HT9 A;  3M0F A;  2R0G A;  3N5O A;  4O5R A;  2IPA A;  1PN9 A;  4A5P A;  2VCV A;  1IYH A;  2C0D A;  1GSS A;  3BBY A;  2R0C A;  1NHO A;  1GSF A;  2NPB A;  1GTU A;  4I2U A;  1PGT A;  2LQO A;  3GTU A;  2YAN A;  4EL1 A;  1BED A;  2E7P A;  1Q98 A;  4MLY A;  1TU8 A;  1GUM A;  2VCQ A;  2CZ2 A;  4K2D A;  2E2G A;  4CY8 A;  2I9H A;  5J3R A;  1FOH A;  1GTB A;  2JAD A;  3ZTL A;  2H6X A;  3HDC A;  1GLP A;  3ZIT A;  1YEX A;  4XRD A;  1S3A A;  3IE3 A;  2MMN A;  2A2P A;  2YPM A;  1U6T A;  2LV3 A;  5A34 B;  5AGY A;  2MBT A;  3V1W A;  4F82 A;  3WD6 A;  2QA2 A;  1QQ2 A;  1LU4 A;  4WKW A;  2AAW A;  1TK5 B;  2M46 A;  4JED A;  5A5H B;  3H8Q A;  4K7N A;  5F8B A;  3TJG A;  2DJ3 A;  1FG4 A;  2ES7 A;  3IR4 A;  1O85 A;  1GSQ A;  4TXO A;  3CSJ A;  1GNW A;  1S3D A;  3ERF A;  5EVO A;  5IMV A;  4NWY A;  1XWG A;  3CYN A;  1XXU A;  2YCD A;  2VLV A;  4K6X A;  3KZQ A;  3UVT A;  3M8N A;  3C73 A;  4EF0 A;  5JCW A;  3GMF A;  1XVW A;  3KMN A;  19GS A;  4KDX A;  2AV4 A;  1K0B A;  4TW5 A;  1ERW A;  2MMZ A;  2OA7 A;  1ERU A;  1T8E B;  5A5K A;  2GSS A;  4IJI A;  4KND A;  18GS A;  3EPT A;  4JR4 A;  3I9V 2;  5E59 A;  5B8B A;  6GSV A;  2HRA A;  2CVB A;  4HDE A;  2GZZ A;  1SYX A;  2H0H A;  4TR0 A;  1Y25 A;  4AF2 A;  4BVX A;  3UAP A;  2EFH A;  2FA8 A;  2R3X A;  1Y6E A;  4MH3 A;  5CNW A;  2HZF A;  5C00 A;  1OKT A;  1VF3 A;  2LJA A;  4JRR A;  1Q4J A;  1Z5Y E;  2GSQ A;  3GL3 A;  3HJM A;  1OE7 A;  5F07 A;  2VL9 A;  3E0U A;  5D73 A;  4EDZ A;  3FZ9 A;  7GSS A;  2HYX A;  2YV9 A;  4MA9 A;  1T7P B;  2JAC A;  4PQ1 A;  2I3Y A;  3Q19 A;  2JSY A;  1B9Y C;  4RUV A;  2MYG A;  1GUH A;  2EIO A;  5ECN B;  2FWH A;  1SKR B;  1TRU A;  1ZYQ B;  5ABR A;  1K0D A;  5LD0 A;  3L0H A;  5GZZ B;  4KE3 A;  5H5S A;  2H6Z A;  1JZR A;  5HFG A;  5B7C A;  2YV7 A;  5G5F A;  2QA1 A;  2CVD A;  3I43 A;  1PKW A;  1O8X A;  4OO5 A;  1A0R P;  3GFK A;  2O5V A;  2B5E A;  1AAZ A;  1R4W A;  2H73 A;  4L5L A;  4HJM A;  4KB3 A;  1WOU A;  3P2A A;  2F8A A;  4K0G A;  1DE2 A;  3QAG A;  3H1N A;  3HKR A;  2H66 A;  3KXO A;  3A5I A;  3EYT A;  2YNX A;  3F3Q A;  4P3Y B;  4FQU A;  4DEJ A;  3FZ5 A;  3LYP A;  4BL7 A;  4TR3 A;  3TKR A;  5IMA A;  1U87 A;  1J9B A;  3KTL A;  5F0G A;  3IAS 2;  12GS A;  4Q5N A;  5DAL A;  2K9F A;  1XWK A;  4POM A;  3HVX A;  4XTS A;  8GSS A;  4JE1 A;  3GHA A;  5ECP B;  3HZ4 A;  2DJJ A;  2V32 A;  1T00 A;  1XFL A;  4AKH A;  3KD0 A;  2I1U A;  1CQH A;  5BRT A;  3IBH A;  3Q74 A;  5L71 A;  1YKA A;  4J57 E;  4XHM A;  5KN0 A;  1Y1U A;  3DEX A;  3KTB A;  3CMI A;  2DMM A;  3KH7 A;  4L0W A;  3ZIV A;  4QL9 A;  4MJA A;  4GSN A;  2KP1 A;  2H30 A;  1O73 A;  1NSW A;  2OE0 A;  4MF6 A;  4PNF A;  2PER A;  3ERW A;  4V1A p;  5J4Y A;  3VWU A;  1DE1 A;  1M2D A;  1F2E A;  3TUE A;  4PUR A;  3GYK A;  3IHQ A;  1GSY A;  2EFD A;  2H70 A;  1OC9 B;  4PNG A;  4X0X A;  4KCE A;  2VCW A;  2K6V A;  4TR4 A;  5ECS A;  1WMJ A;  1GSD A;  1K0M A;  1TJD A;  4X43 A;  4L5O A;  5DDL A;  3GKM A;  4EKZ A;  1B48 A;  2RUF A;  4GF0 A;  3EWL A;  2A2S A;  3IOS A;  5IO0 A;  4OFM A;  2I4A A;  4RI6 A;  4OMV A;  1PN0 A;  3O6T A;  4ICY A;  4MNN A;  2R2J A;  4BVY A;  3CSI A;  2RM5 A;  2DIY A;  3GUS A;  4MK3 A;  4EE0 A;  4ECJ A;  2PVO C;  3KJY A;  2FA4 A;  3E9J B;  4K2X A;  3EVI A;  1TOF A;  2IFQ B;  1TK0 B;  1BYE A;  2VD0 A;  5HR0 A;  1EV4 A;  4G2E A;  3A2V A;  2X8H A;  5HR3 A;  1GNE A;  3ZVJ D;  1X5D A;  2GQL A;  1EOG A;  2AHE A;  4HU7 A;  3QAW A;  5JWO B;  4GLT A;  2P31 A;  2MMA A;  1LJR A;  2OAD A;  1JLV A;  3F4R A;  2B7J A;  1FO5 A;  4MH2 A;  5D96 A;  5KN2 A;  1BF5 A;  2H1G A;  3DWV A;  2VIM A;  3O3T A;  1KTE A;  2PN8 A;  4W66 A;  2VLT A;  2LRT A;  3RDW A;  5AIV A;  4ZXG A;  3ZFL A;  5A34 A;  2VM2 A;  3U6V A;  3FK8 A;  3IC8 A;  4KDU A;  3RHC A;  4HQZ A;  2IN3 A;  3EIN A;  4USS A;  3KMO A;  2HSN B;  3FMW A;  3M9K A;  2JSZ A;  2LS5 A;  5A5H A;  2HZE B;  3EMX A;  2H74 A;  2HSY A;  4KA0 A;  4H86 A;  3FRC A;  4KCA A;  3VI5 A;  1X0R A;  2H1L A;  1FAA A;  3GIX A;  1T4Y A;  5BMU B;  2E0Q A;  4PQH A;  1GH2 A;  1G6Y A;  1SJ6 A;  2HI7 A;  2TIR A;  4BL7 B;  4MF5 A;  3WGD A;  1ERT A;  3TRP A;  2G2Q A;  3US3 A;  5EY6 A;  5A4W A;  2PBJ A;  2DSA A;  4WET A;  2XBI A;  4YKF A;  4ZBD A;  3D4T A;  2X8C A;  4AJ7 A;  4ZIL A;  1GUK A;  3WT2 A;  1YKC A;  2WCI A;  6GSX A;  2G0F A;  5LCZ A;  3NIV A;  5J5N A;  4MF7 A;  3OR5 A;  1A8Y A;  1ZOF A;  2QKE A;  5CO3 A;  1GRX A;  2AB6 A;  4JR6 A;  2FWG A;  3F6D A;  3DD3 A;  3LXZ A;  2XC2 A;  3WGE A;  3FKF A;  2CV4 A;  6GST A;  2FCH A;  5E4W A;  4GSS A;  3LGC A;  4Z2U A;  1QMV A;  3TOU A;  5LNK e;  3RPP A;  5AN1 A;  3L9V A;  1FW1 A;  3SBC A;  3HA9 A;  1T4Z A;  1AUC A;  3D5J A;  1WE0 A;  4NV5 A;  3HD5 A;  3VLN A;  3GRX A;  1YEP A;  3J7Y b;  1SL1 B;  2IMF A;  3PPU A;  1TXX A;  2WZ9 A;  1S3C A;  3ZYW A;  3EE2 A;  1G0T A;  3LG6 A;  2IL3 A;  4TKY A;  3TKP A;  1WIK A;  2I81 A;  2H6Y A;  2H76 A;  1TP9 A;  5IPG A;  1K0A A;  4TRX A;  2XPE A;  3QAV A;  4N0Z A;  1ML6 A;  2HSM A;  2LEG A;  1YF0 A;  1WWJ A;  1I9D A;  3GUR A;  4N10 A;  2GZY A;  3VWW A;  2A4H A;  3C1S A;  3LW9 A;  3L9S A;  3LEF A;  3LYK A;  3A2W A;  1M2A A;  1M9B A;  3CTF A;  2V6O A;  1V9W A;  3QPM A;  1M99 A;  3DXB A;  1YZX A;  2AYT A;  4ECC A;  2OKA A;  3C8E A;  2VCZ A;  3MNG A;  5ECO B;  5A1N A;  1UVZ A;  2H01 A;  2IIY A;  5EL8 A;  2IME A;  2B5Y A;  1A8L A;  1MTC A;  2P0G A;  1NM3 A;  3APQ A;  5HR1 A;  5A4V A;  4O7H A;  1G6W A;  3CSH A;  1XOA A;  4KH7 A;  1GSE A;  2WDU A;  2XPD A;  4F03 A;  4G10 A;  4ILF A;  1VRS D;  1VF1 A;  3MDK A;  5G30 A;  4F0C A;  1O81 A;  3VPQ A;  5DAK B;  2F9S A;  2IMK A;  2EIQ A;  1TKD B;  1O6J A;  3TJK A;  4YKG A;  2HFD A;  3DGQ A;  5A4U A;  1A2L A;  4N11 A;  1AW9 A;  3D0Z A;  1KNG A;  4LL1 B;  4I8B A;  1RW1 A;  5HR2 A;  4WF5 A;  4MAB A;  2EC4 A;  2DC5 A;  5G1K A;  4I2T A;  1M2B A;  1SU9 A;  1PA3 A;  5G1L A;  2VKZ G;  3IV4 A;  4ZB9 A;  5DCG A;  1OC9 A;  2REM A;  3G7J A;  3F3R A;  4CDO A;  5ENU A;  3JCM L;  2L6C A;  3GH6 A;  4HS1 A;  1SJI A;  4MCU A;  1K3L A;  1TI1 A;  4EXJ A;  5ELG A;  3I6A A;  1NW2 A;  2VCX A;  5B6M A;  2DKH A;  3G7Y A;  3KIJ A;  1ACV A;  1JZD A;  5DJM A;  4ML6 A;  5H5Q A;  4ULX A;  5FWG A;  1FVJ A;  4DSS A;  1FB0 A;  3W8J A;  1OAZ A;  1XVQ A;  2GST A;  5JWQ B;  3UOM A;  2LKU A;  1EGO A;  4F9Z A;  2E2M A;  5KOX A;  1X9W B;  4LL4 B;  2GDR A;  2PGT A;  4OFT A;  3L4N A;  1GTI A;  3H79 A;  3HVV A;  2WFC A;  3TRX A;  1TXU A;  4NHZ A;  3CRU A;  1RK4 A;  4OCF A;  3F8U A;  4G9H A;  5J9C A;  3M1G A;  3VWX A;  1K3O A;  2L4C A;  5DVB A;  1RQM A;  4RI7 A;  2IFQ A;  4YAP A;  3GST A;  2NVL A;  1FHE A;  4HOJ A;  2N5A A;  3RAZ A;  1TRW A;  3QMX A;  2DKI A;  2CA8 A;  4IW9 A;  1PQN A;  3GSS A;  1ERV A;  2R5G A;  4FYU A;  4JZQ A;  3ZZX A;  1TRV A;  5IMD A;  2H0I A;  4HJ2 A;  2WGR A;  1MEK A;  2ZCT A;  2GGT A;  3CBU A;  1T1V A;  2H19 A;  1J08 A;  2LNS A;  1E2Y A;  3F0I A;  3BCK A;  4GWR A;  2HQT A;  1EP7 A;  4IEL A;  1BX9 A;  2HSM B;  1PKZ A;  3VI7 A;  4J56 E;  3P7X A;  1ZYE A;  6GSS A;  3F9U A;  2C0E A;  2R4V A;  1U3A A;  1XW9 A;  4OFN A;  3TKS A;  5D9X A;  2HSN A;  2HXK A;  1QFN A;  2HZE A;  4IP1 A;  2NTO A;  2B5X A;  3G9B A;  4AJ8 A;  5A1N B;  4MP4 A;  2LRN A;  1V2A A;  1EEJ A;  1G7E A;  4GDF A;  3QOU A;  1ZGN A;  2C4J A;  4OO4 A;  1X5C A;  4KDY A;  5BMU A;  1MD4 A;  1ST9 A;  3L78 A;  2XHF A;  2H1A A;  5G5E A;  2J23 A;  3KEB A;  4XCS A;  2JZR A;  2O8V B;  1I5G A;  2VCT A;  3PR8 A;  5GAN D;  1GWC A;  2C0F A;  4GQC A;  2VL2 A;  3FZ4 A;  4DSR A;  3HJO A;  3FZA A;  2AUV A;  3VUR A;  1AC1 A;  2JU5 A;  5CYY A;  1F37 A;  5GSS A;  3GKX A;  3MWH A;  2C1Y A;  4ECB A;  4PX1 A;  1OE8 A;  1SK1 A;  3ED3 A;  2L5L A;  1SVO A;  1ABA A;  4WEY A;  3R3E A;  3EMP A;  2H1B A;  1ZCP A;  2EFE A;  2GQK A;  10GS A;  3IK7 A;  3GL5 A;  3FW2 A;  2YWM A;  2TRX A;  2H72 A;  2IMD A;  3J7Y k;  4J2F A;  4K5R A;  6GSY A;  3ZVJ A;  4TOP A;  4E8E A;  1JHB A;  2LRC A;  3UL3 A;  4XIH A;  4O32 A;  5CAX A;  1IYI A;  2LQQ A;  1R7H A;  2BMX A;  5CRE A;  4Q5F A;  2L6D A;  1M0U A;  1M7T A;  5CP1 A;  3DVX A;  2HNL A;  1XIY A;  3DIE A;  4ZBA A;  1QUW A;  2J9H A;  2LNT A;  2X8G A;  1O8W A;  3P90 A;  3W8S A;  1PL1 A;  2ZUP A;  4MJE A;  4DSS B;  1QK8 A;  2C8U A;  3M9J A;  4MJB A;  5ECK B;  3IC4 A;  1HNA A;  3TJF A;  4RQR A;  2F8F A;  5H5R A;  2FWE A;  4KUN A;  4KGI A;  2IMI A;  3WYW A;  4HUA A;  4AKX B;  2NDO A;  1A2M A;  3NOF A;  3BCI A;  4TVE A;  4BA7 A;  5CRH A;  1UA5 A;  1A24 A;  4WR5 A;  5ECI B;  4GTU A;  4WBJ A;  5DQS A;  2BTO T;  4MZC A;  5D9V A;  1WRY A;  1J0F A;  4G0K A;  3QFA C;  1SJZ A;  2X64 A;  4NAX A;  6GSW A;  1F6M C;  2N5F A;  3TU3 B;  5IQY A;  2QC7 A;  3GKK A;  4FIW A;  2A4V A;  4K9Z A;  4V2M A;  2JZT A;  1W89 A;  5G31 A;  4ZBB A;  1GL8 A;  4BWQ A;  2OE3 A;  5IMZ A;  3RPN A;  3M3M A;  4GST A;  1URM A;  3LSZ A;  3EUR A;  3KP8 A;  2CX3 A;  1F3B A;  4PTS A;  4EIP A;  2DML A;  4NV2 A;  2M72 A;  4QL7 A;  2DBC A;  1AQX A;  1FVK A;  4AKG A;  1YJ6 A;  1DSB A;  2FLS A;  3TJJ A;  5DAK A;  1SEN A;  2GQM A;  3FR9 A;  3APS A;  4HU9 A;  3GX0 A;  4QQ7 A;  2FUG 2;  3GKN A;  2R37 A;  3K8N A;  1K3Y A;  1M9A A;  3TB2 A;  5EPF A;  1TU7 A;  1YQ1 A;  5ECR B;  1V58 A;  5J40 A;  3TCO A;  3C71 A;  3UBL A;  2VO4 A;  3GN3 A;  3GA4 A;  4KSO A;  3QCP A;  5INY A;  4IQA A;  3VK9 A;  1YDK A;  3ZRE A;  5J41 A;  4D73 B;  1X5E A;  5ELA A;  1HNB A;  2H75 A;  2X4A A;  1EGR A;  4AGS A;  1JFU A;  1BG5 A;  2MZC A;  3KH9 A;  3C7M A;  2UZ8 A;  2HRK B;  1EZK A;  2B1L A;  3UAR A;  4EDY A;  1KBN A;  1W4V A;  4IKH A;  5ECM B;  1QXH A;  2YOI A;  1KEB A;  2KLX A;  2QGV A;  4CW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...