3KJYA

Crystal structure of reduced homo sapiens clic3
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
239
structure length
223
Chain Sequence
LEVLFQTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 3
publication title Structure of human CLIC3 at 2 A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 71
structure length 223
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kjyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kjyA01
2WRTA 3PPUA 3C1SA 4NWYA 4K9ZA 3MSZA 2RM5A 1PKZA 2H75A 1H4OA 4ML6A 3I43A 5JWRB 1SL0B 2QGVA 1NSWA 5GSTA 4MP4A 2B5XA 3DRNA 1TU7A 1LBKA 1OAZA 1AAZA 5G5FA 1SKWB 4KH7A 3TB2A 3I69A 1M2BA 2B5YA 4QL7A 4XS4B 4OO5A 4MK3A 4YH2A 3WGDA 6GSSA 5D8IA 5B6NA 5IPHA 3KM6A 1F9MA 3KTLA 1OC9A 6GSWA 1PX7A 3EU4A 4MZWA 3HCZA 2YWOA 3GTUA 1F2EA 4HJMA 4J56E 3Q74A 1WOUA 2OACA 1SJIA 2IWTA 3L78A 3HYPA 2ALBA 4XIHA 2GSQA 1G7OA 3TRPA 2F9SA 2YV9A 3L4NA 3WT1A 3FKFA 4WXTA 4ZL8A 5G31A 1TK5B 3FZ4A 2YNXA 4I2TA 4NV5A 3N5OA 1PL1A 1B4QA 5COHA 1YZXA 3KH9A 3VFIA 1R4WA 2V6OA 1LJRA 3FEUA 3GV1A 1EZKA 1LU4A 1K0OA 1W4VA 3QOUA 2CVDA 1TOFA 4N0VA 3O76A 4HQSA 2VL3A 3D4MA 5G1KA 2H71A 20GSA 3F4RA 4XCSA 4BVXA 5GSSA 5DAKA 2H6YA 4EDZA 4KUNA 2F8FA 6GSXA 5ELGA 4ULXA 1KTEA 4RI7A 2WZ9A 1J9BA 4PX1A 5DJLA 1GSYA 1BJXA 4MMMA 3APSA 5GAND 4F2IA 2HT9A 1J0FA 4WF4A 1B48A 3VWVA 1M99A 2HSNB 3QFAC 4HI7A 4CDOA 4CHSA 2G2QA 2LEGA 1G6WA 2ZUPA 5IQYA 4Q5QA 2IN3A 2C0FA 3UOMA 2UZ8A 1JZRA 5LD0A 3DIEA 4ZBBA 1K3YA 1A0FA 2PPTA 4MJBA 2AYTA 4KAEA 3E9JB 4XTSA 3IK9A 4GCIA 3FRCA 1A2LA 5KN2A 4PGTA 1SU9A 2AB6A 3KTBA 2DJ2A 1YKAA 2CT6A 4HZ2A 5ECNB 3BCIA 4HEA2 22GSA 3ME8A 3LORA 1PSQA 4PTSA 5AIXA 4KE3A 2M80A 5ECHB 3ZL5A 12GSA 1ZMAA 4TOPA 4X0XA 1ZYQB 4POBA 2VO4A 3APQA 4OD7A 4TXOA 1WWJA 1AQXA 3TKSA 1SD9A 4IP1A 2H74A 14GSA 4MJEA 2HLSA 2XPDA 3TKPA 4JEDA 1EP8A 1VF3A 3P7XA 5IIZA 1O85A 4ZL9A 5EL8A 4IQ1A 5A5KA 3RPNA 1J08A 4IELA 1XPVA 1FB6A 1IYIA 1XCCA 4HU7A 4TRXA 1SL2B 2FA4A 2HQTA 3MAKA 1BEDA 4F0BA 1M9AA 1ML6A 1GWCA 2DJ3A 4MA9A 3ZITA 2LJKA 3KH7A 2H72A 1V58A 3TKSE 1WRYA 2GSTA 1UVZA 4N0ZA 2IMKA 4MH2A 2VCXA 2VD1A 2MMNA 3H79A 2NVLA 3HY2A 2V6KA 3GURA 2IFQB 3QFBC 2C3QA 4OFMA 4HOJA 4OFNA 2H1DA 2H73A 5DALA 5J3RA 4JR6A 2JZRA 5D9TA 1TI3A 3GRXA 4RI6A 2LSTA 4IGJA 5ECRB 4WEYA 2P0GA 1GTUA 1NM3A 1WJKA 2L59A 8GSSA 2R37A 2VAFA 2CAIA 3SBCA 3M1GA 1T3BA 3TRQA 2VL2A 2E0QA 1YJ6A 4KDUA 1B4PA 3BBYA 3U6VA 3DVWA 4POKA 2X8CA 1TRVA 2AHEA 1YKCA 1HNCA 4N30A 1M2DA 4WR4A 1SK2A 1SD8A 5INYA 4IS0A 4E8HA 3LWAA 4PXOA 2YN1A 1T7PB 1OE8A 2DSAA 5L71A 2F3MA 1XZOA 1OE7A 5JCWA 3APOA 2LQQA 4TR1A 3GX8A 2YJHA 4Q5RA 3FK8A 1XFLA 1NHYA 2CV4A 3A5WA 2FY6A 4K7NA 4BPYA 1AXDA 1GLQA 3ZRDA 3IAM2 4BL7A 2C3NA 1QK8A 3Q18A 3GA4A 1BQ7A 3VI7A 2H0GA 3QD9A 4JBBA 1XBSA 3Q6OA 1HNBA 4TW5A 3LG6A 3QAVA 1JFUA 4JR4A 3KP8A 2FD3A 5HR2A 1EEMA 5B6MA 5IMFA 2E2MA 3FR6A 1GSQA 1AQWA 2XPEA 1ZL9A 3G7JA 4EF0A 2PN8A 3TJKA 2JL4A 3QDNA 4K6XA 1JLVA 4PURA 2HRAA 4WETA 3LFLA 5GAPD 1V2AA 1WPIA 4HZ4A 5LCZA 2K6VA 5IMZA 3QMXA 3CSHA 1TKDB 5B8BA 1PGTA 1ST9A 4D73B 3UEMA 4ZBDA 1C72A 1YDKA 2C3TA 4L8EA 2KOKA 4EKZA 2F8AA 2B6MA 1JZOA 4ECBA 2G0FA 3IC4A 5IO2A 4LMVA 5AISA 1AIUA 3UAPA 1GSUA 1V57A 2V2GA 4L0WA 3GSTA 2C1YA 4TN8A 2R2JA 2HSHA 2OADA 1A8LA 2JSYA 1JLWA 1TDIA 5AN1A 5CRGA 4KW6A 5C04A 1FG4A 4Q5FA 1TTZA 2IFQA 1AW9A 1A0RP 2FGXA 2VD0A 1Z9HA 2A2SA 2HNLA 4ZB9A 5HR1A 1FOVA 5J5NA 5ECPB 4HU9A 2VLUA 4G0IA 2FWEA 1AQVA 4FQUA 2JZTA 2WB9A 3ERFA 10GSA 5IMAA 2HXKA 4XS6A 4K0NA 2O85A 2REMA 2AUVA 3HA9A 1EOHA 2DJJA 4BWQA 3F8UA 2M72A 2C80A 3IPZA 3D6IA 4ZB8A 1EV4A 2JU5A 2C0DA 1ZZYA 1RK4A 1QGVA 3VWUA 4O5RA 3KGKA 4X1UA 1GULA 1AUCA 5CO3A 3GNJA 1GH2A 2BTOT 4PQIA 1G0TA 5G30A 1QMVA 1TW9A 3LSZA 2HSYA 2H70A 2YOIA 3NIVA 1EV9A 2MMZA 4LA1A 3G7YA 4ZIJA 2BJXA 3O6TA 2DBCA 4HJ2A 2DMLA 3V1WA 1JZWA 3P2AA 3FZAA 5B8AA 2OE1A 3DXBA 1SK0A 5FT3A 3GKNA 4MCUA 1O8XA 2IMFA 3F4TA 4H86A 5IMDA 3FHKA 3RAZA 2L5OA 3GUSA 3F4SA 4K8MA 3ZFLA 2EIQA 3KJYA 2O8VB 2WFCA 3GX0A 3ZFBA 1YF1A 1HNAA 1TP9A 2K9FA 1ERWA 2GQKA 3ZVJA 1WMJA 1GP1A 3UBKA 16GSA 3D21A 1F3BA 2GQMA 5DCGA 1EEJA 3GFKA 1URMA 3IK7A 3M8NA 3D5JA 2XHFA 1X9SB 2GT5A 3C7MA 2LRTA 2L57A 3UIWA 2C0EA 2KP2A 2TRXA 4FYBA 2NDOA 1FHEA 2ZCTA 2GZPA 2HZEB 4EVMA 2MMAA 1GNWA 1K0BA 4USSA 2V32A 3KD0A 3KEBA 3DEXA 2GT6A 17GSA 2H1AA 3AY8A 2PUKC 3GIXA 4EXJA 5F06A 3LYKA 2VOCA 1X0RA 2KHPA 5F07A 3GYKA 3S9FA 2L6CA 1GRXA 3F6DA 1EOGA 3VURA 1GNEA 3UVHA 3GN3A 1VRSD 2VUPA 1XVWA 2J9HA 2YANA 2PVOC 3F6FA 5JWQB 2X64A 4AGSA 2VCZA 4J2FA 1B9XC 4POLA 3A2XA 5HR3A 2KLXA 1V98A 1EGOA 2OBIA 4DVCA 2X99A 2DJ1A 4NMUA 2HFDA 2YZHA 3US3A 4KDYA 2WGRA 4XHMA 2GZZA 4RQXA 3H8QA 3TUEA 3D0ZA 3ZYWA 3TDGA 3KP9A 5IMCA 2DMMA 1S3AA 3A2VA 2DJKA 3L0HA 2HE3A 3UARA 1EP7A 1WE0A 5DQSA 4IJ3A 4K7OA 1G7EA 3P90A 2GLRA 4YAVA 2GDRA 1G6YA 1GTAA 5G5EA 1K0AA 3LEFA 2QC7A 2WDUA 1VGLA 4HDEA 2LS5A 4EUYA 5CRHA 1E2YA 1O81A 4G10A 3NZNA 2XBQA 5D93A 1A24A 4ECJA 1PQNA 2C0GA 1THXA 3L9UA 4JRRA 4AJ8A 3SWLA 4NV2A 1JZDA 4XS4A 3VWWA 4G9HA 3Q19A 2M46A 4V1Ag 3K8NA 3EMXA 3ZREA 3TOTA 3HVVA 1SKRB 1YY7A 5ID2B 4X43A 1BAYA 5DQYA 4FIWA 3FYGA 4EL1A 5DCHA 4MF6A 3WGXA 1DUGA 4L5OA 3JCML 2IL3A 2AAWA 2TIRA 1V40A 1U6TA 1XW9A 2OBKA 3H4KA 3L9VA 1QXHA 3M9KA 1RQMA 1W89A 3FZ9A 2L5LA 5H5RA 1A2JA 3KMOA 2PBJA 1WP0A 1XIYA 1YQ1A 1Y25A 1B8XA 3LXTA 3HDCA 1CQHA 1Z5YE 5HFGA 4FYCA 1TRUA 4YAPA 1XWGA 2KP1A 3CTGA 2JSZA 2MBTA 3GHAA 4HQZA 2EC4A 4XS1A 1BX9A 4EC0A 2H1GA 1GUHA 5F0GA 2WCIA 4JZQA 3DMLA 4LLRA 4P3YB 1F3AA 1XWAA 1PA3A 2NPBA 2QKEA 1ERVA 5F8BA 1QUWA 1OC8A 4PUAA 5CP1A 5KEJA 1RW1A 3VPQA 1U87A 2OKAA 4XRAA 2HRKB 2YV7A 2B1KA 1F37A 1X5DA 2DIZA 4NXIA 3CSIA 3KIJA 2CX3A 3GMFA 3TCOA 5C00A 3WT2A 1GSEA 1GSSA 3VK9A 2H66A 2DIYA 3WYWA 3C1RA 2FUG2 2LJRA 3GKMA 3R3EA 3L9SA 4GQFA 3CRTA 3N9JA 3ISOA 2PGTA 5D9VA 4TVEA 2RM6A 5HFKA 5CAXA 3ZMLA 4KSMA 1ERTA 2CZ2A 3TJBA 1FAAA 2B7JA 3PR8A 5FWGA 2H6XA 2GQLA 2GS3A 2LQOA 4JU5A 4RUVA 2LRNA 4CW9A 4OCFA 4LMWA 2R6KA 2N5AA 4FYUA 3WGEA 3TJJA 2IMDA 2X8GA 2HI7A 5IOWA 1T1VA 1XWCA 2L4QA 5CYYA 3EC3A 3RHBA 3F3QA 1OVNA 1YEXA 3UJ1A 5DVBA 1U3AA 3GL3A 1Z3EA 5DJMA 4ILFA 3QPMA 2E2GA 4I5QA 3F0IA 1OC9B 4WF5A 2FHEA 4MABA 1MEKA 3TJGA 4POMA 3FZ5A 5ELAA 3CTFA 2VM2A 3EYTA 1XVQA 2H19A 3GTUB 5ECOB 3TRXA 3IC8A 3IDVA 4EO3A 1QQ2A 2HSMB 2AV4A 3GH6A 2FLSA 3MDKA 2K8SA 3TKSC 4TR0A 3CSJA 5ECLB 2WS2A 2FWGA 2HZFA 2VCTA 3HVXA 3IXRA 2GSSA 2CVBA 4QQ7A 5E4WA 2YWIA 5J9CA 3KCMA 5ECIB 3C73A 3QAWA 1DE1A 3H93A 1HYUA 3LGCA 2ZNMA 2H6ZA 1ZOFA 2H30A 2I1UA 4MZCA 4KSOA 4AJ6A 2AJQB 1FB0A 3F3RA 5KN3A 2NTOA 3TJFA 3HJMA 4I97A 5B7CA 1M9BA 2LV3A 4PUFC 1TU8A 2CQ9A 4BVXB 5DAKB 2QSIA 1K3LA 2IMEA 2K8VA 1OYJA 3EURA 3EINA 2H8LA 4PQ1A 1A2MA 3HXSA 4EE0A 4KNDA 1O73A 4NAXA 3ZVJD 1MDKA 4N11A 3UBLA 1TK8B 4FO5A 4O32A 1EWXA 2PERA 1O7UA 1ZYEA 2DLXA 1DSBA 3EWLA 3HHVA 2VL9A 1IYHA 1R7HA 3DYRA 2OA7A 1TI1A 1TK0B 1ZGNA 1S3CA 1GTBA 5IMVA 11GSA 5CREA 1H75A 4K1FA 3D4TA 2CVKA 3FY7A 2VIMA 3CYNA 1GTIA 2VL2C 2XC2A 2LJAA 1X9WB 5H5QA 3ME7A 2TRCP 1FVKA 4ML1A 4MF7A 3W6GA 3IA1A 2CX4A 2RUFA 3P8WA 4DSSB 3DGQA 1GL8A 2B5EA 2O87A 3PH9A 4TXOB 4ZBAA 4YQMA 3IV4A 2ON7A 5IOXA 2YCDA 1X5EA 4WBRD 2VCWA 7GSSA 3M9JA 2EIOA 3H1NA 3RHCA 2D2ZA 2HRFA 3DKSA 1XW6A 1R5PA 3ED3A 3EE2A 1USBA 2CA8A 3CXGA 3EVIA 4D73A 3BJ5A 6GSTA 2I4AA 1SENA 5D9WA 3G9BA 5A4VA 3IE3A 1FW1A 2R3XA 1PL2A 3F9UA 5DDLA 1E6BA 5AIVA 4BVYB 1MDIA 5KN1A 3BCKA 3CMIA 3LJRA 3GH9A 4L5LA 1ILOA 5F05A 5CNWA 2PU9C 4MPFA 2V41A 1YF0A 2HSMA 3E0UA 3BD2A 4ZB6A 4GXZA 2A4VA 4NHZA 19GSA 1EGRA 1KEBA 3OR5A 4KCAA 2N5FA 4JE1A 2K18A 3FR3A 3CRUA 2FWFA 2IJYA 5DALB 2FNOA 3U5RE 2H0HA 1F6MC 3LQ7A 2VLTA 4AJ7A 1VF2A 4GTUA 5AGYA 4MH3A 4MJCA 4HS1A 3HZ8A 1OKTA 4KGIA 2GZYA 5D9XA 2FWHA 3VLNA 3HD5A 3PGTA 4I6XA 2LNSA 3TGZA 1PMTA 3HZ4A 2F51A 3FR9A 3HJOA 4GF0A 3ZTLA 3UMAA 4XRDA 5BMUA 2V1MA 4OFTA 6GSVA 1Y6EA 3IR4A 4TKYA 2B1LA 2YWMA 4GSTA 2OJLA 1FO5A 3TKQA 4PQHA 1T4ZA 4KB3A 4NHWA 2P5QA 4WR5A 3ZZXA 2DC5A 4G0KA 13GSA 4TR1B 5HFIA 1U88A 2E7PA 2O89A 4ACSA 6GSYA 2MYGA 3RDWA 3ZMKA 5J4UA 1MTCA 1SYRA 3I6AA 4BL7B 1HQOA 2CZ3A 2PMTA 2GGTA 1A23A 1XWKA 4ECIA 5H5SA 3W8SA 4ID0A 2JACA 3D22A 2VCQA 2A2RA 4OMVA 4Q5NA 2L4CA 3DD3A 4MF5A 2RLIA 3MNGA 4TR3A 3G7IA 4PNGA 1PX6A 1M7TA 1ON4A 1Q4JA 1OC3A 3EMPA 4V2NA 4OO4A 1Z7PA 2PVQA 2DJ0A 4DSSA 1SJZA 2MZCA 5ECKB 1A8YA 3C71A 3LXZA 2RUEA 4TXVA 4YQVA 2KUCA 3CBUA 3HJPA 2JZSA 4L0UA 3VWXA 1FVJA 1KNGA 2P5RA 5ENUA 3DWVA 3IOSA 4EDYA 4IVFA 2X8HA 4OCEA 3O3TA 5A4UA 4WBJA 1XOBA 2ON5A 1QFNA 5DBQA 1CQGA 2HYXA 4ZL7A 4GWRA 4BVYA 3IAS2 1V9WA 2HZEA 3TKRA 3FW2A 1PKWA 5D96A 1GUMA 5CRDA 1XXUA 3VPTA 3M0FA 4ZILA 3IBHA 3ZLPA 4GLTA 2IMIA 3KZQA 3UVTA 1K0DA 3E3EA 3M3MA 1PRXA 2GTUA 2IIYA 3WD6A 2N5BA 4GRFA 1YEPA 2I81A 2GVPA 4MZBA 3W8JA 1AC1A 2L6DA 1ERUA 4F03A 1T4YA 5IM9A 6GSUA 1SKSB 2WULA 5LNKe 1XOAA 1KBNA 1M0UA 3GKKA 1S3DA 5ECMB 2I9HA 4KDXA 4QL9A 2WJUA 2YJ7A 4WKWA 3A2WA 5IO0A 5IPGA 1O8WA 4MLYA 3TOUA 4LL4B 1TRWA 1HD2A 1OKDA 1PD21 2R5GA 3GSSA 2I3YA 4G2EA 4F0CA 5G2ZA 3KXOA 1XW5A 4IQAA 4DEJA 4PNFA 2BMXA 1DE2A 1M2AA 1I9DA 3GL5A 4LL1B 1XWBA 2H01A 1Z6MA 3MWHA 3QCPA 1JHBA 2LRCA 5EY6A 2HRNA 5A4WA 3IHQA 5GZZB 4G0LA 2LNTA 4V2MA 1K3OA 3ERGA 3DVXA 2YPMA 2LUSA 4N10A 4RQRA 4TR4A 5HR0A 4IP6A 2O7KA 1SYXA 3KMNA 1U3IA 2YWNA 4F82A 3RPPA 2MBSA 1GSDA 2ES7A 4DSQA 1K0NA 5ECQB 2B3SA 4BWSA 4K0GA 4O7HA 1WIKA 2RIIA 1GUKA 3I9V2 1R5AA 3VI5A 1MDJA 1GSFA 1ZCPA 3A3TA 3J7Yk 5JCUA 4FH8A 4V2LA 3R2QA 5E59A 5ID2A 3PINA 18GSA 3BOAA 3IRAA 1ACVA 5G1LA 2C8UA 1BG5A 4DSRA 3NOFA 3ZIJA 1SK1A 2H0IA 2PWJA 4IJIA 1R26A 3ERWA 1Q98A 1K0CA 3QAGA 2P31A 4BA7A 1T00A 2H76A 4OWYA 1Z6NA 5JCGA 1O6JA 2FA8A 4F9ZA 5FHIA 3HKRA 2JADA 4MPGA 4GSNA 4MJAA 5HQPA 1Z7RA 5D73A 1T8EB 2H1BA 3LYPA 1K0MA 1VF1A 2YP6A 4IW9A 4O92A 2OE0A 4J57E 4NPBA 3J7Yb 1X9MB 1MD4A 2VLVA 5J9BA 5CRWA 5EVOA 1I5GA 2NBSA 1GLPA 4MDCA 1UN2A 3HVSA 4KF9A 3C8EA 1UC7A 4GQCA 2C4JA 1N8JA 3ZIVA 1MD3A 4IBPA 2LTKA 1UA5A 4KCEA 2HRKA 4KX4A 4I8BA 3F63A 2GSRA 2YZUA 2J23A 4IHUA 2R4VA 5JWOB 4AF2A 1ABAA 2CAQA 4E8EA 5EPFA 9GSSA 1SJ6A 1THOA 5KN0A 4I2UA 4V1Ap 4HUAA 4G19A 4K2DA 4GSSA 4ECCA 4IN0A 2VM1A 2IPAA 1PN9A 2EIRA 5J41A 1SL1B 5ABRA 5ECSA 3RBTA 1DBYA 2B7KA 1TJDA 1BYEA 4ZXGA 1X5CA 1N2AA 4ISDA 4Z7XA 1VF4A 2FCHA 3UL3A 1NW2A 2XBIA 1NHOA 2LKUA 1TRSA 1TXXA 4K7IA 2Z9SA 3QR6A 4IKHA 2OE3A 3EU3A 1B9YC 2MMOA 3GKXA 4YQUA 2VCVA 4KA0A
chains in the Genus database with same CATH superfamily
3HMJG 2WRTA 1M3JA 3PPUA 3C1SA 4NWYA 4K9ZA 3MSZA 2RM5A 1PKZA 2H75A 1H4OA 4ML6A 3I43A 5JWRB 1SL0B 2QGVA 1NSWA 5GSTA 4MP4A 2B5XA 3DRNA 1TU7A 1LBKA 1OAZA 1AAZA 5A34A 5G5FA 1SKWB 4KH7A 3TB2A 3I69A 1M2BA 2B5YA 4QL7A 4XS4B 4OO5A 4MK3A 4YH2A 3WGDA 6GSSA 1FOHA 5D8IA 5B6NA 5IPHA 3KM6A 4AKGA 1F9MA 3KTLA 2WW1A 1OC9A 6GSWA 1PX7A 3EU4A 4MZWA 3HCZA 2YWOA 3GTUA 1F2EA 4HJMA 4J56E 3Q74A 1WOUA 2OACA 1SJIA 2IWTA 3L78A 3HYPA 2ALBA 4XIHA 2GSQA 2EFCA 1G7OA 3TRPA 2F9SA 2YV9A 3L4NA 3WT1A 3FKFA 4WXTA 2WW2A 4ZL8A 5G31A 1TK5B 3FZ4A 2YNXA 4I2TA 4NV5A 3N5OA 1PL1A 1B4QA 5COHA 1YZXA 3KH9A 3VFIA 1R4WA 2V6OA 5KOWA 1LJRA 3FEUA 3GV1A 1EZKA 1LU4A 1K0OA 1W4VA 3QOUA 4A5PA 2CVDA 1TOFA 4N0VA 3O76A 4HQSA 2VL3A 3D4MA 5G1KA 2H71A 20GSA 3F4RA 4XCSA 4BVXA 5GSSA 5DAKA 2H6YA 4EDZA 4KUNA 2F8FA 6GSXA 5ELGA 4ULXA 1KTEA 4RI7A 2WZ9A 1J9BA 4PX1A 5DJLA 1GSYA 1BJXA 4MMMA 3APSA 5GAND 4F2IA 2HT9A 1J0FA 4WF4A 1B48A 3VWVA 1M99A 2HSNB 3QFAC 4HI7A 4CDOA 4CHSA 2G2QA 2LEGA 1G6WA 2ZUPA 5IQYA 4Q5QA 2IN3A 2C0FA 3UOMA 2EFDA 2UZ8A 1JZRA 5LD0A 3DIEA 4ZBBA 1K3YA 1A0FA 2PPTA 4MJBA 2AYTA 4KAEA 3E9JB 4XTSA 3IK9A 4GCIA 3FRCA 1A2LA 5KN2A 4PGTA 1SU9A 2AB6A 3KTBA 2DJ2A 1YKAA 2CT6A 4HZ2A 5ECNB 2X49A 3BCIA 4HEA2 22GSA 3ME8A 3LORA 1PSQA 4PTSA 5AIXA 4KE3A 2M80A 5ECHB 3ZL5A 12GSA 1ZMAA 4TOPA 4X0XA 1ZYQB 4POBA 2VO4A 3APQA 4OD7A 4TXOA 1WWJA 1AQXA 3TKSA 1SD9A 5BRTA 4IP1A 4BIKA 2H74A 14GSA 4MJEA 2HLSA 2XPDA 3TKPA 4JEDA 1EP8A 1VF3A 3P7XA 5IIZA 1O85A 4ZL9A 5EL8A 4IQ1A 4FXYP 1XG8A 5A5KA 3RPNA 1J08A 4IELA 1XPVA 1FB6A 1IYIA 1XCCA 4HU7A 4TRXA 1SL2B 2FA4A 2HQTA 2QA2A 3MAKA 1BEDA 4F0BA 1M9AA 1ML6A 1GWCA 2DJ3A 4MA9A 4Z2UA 3ZITA 2LJKA 3KH7A 2H72A 1V58A 3TKSE 1WRYA 2GSTA 1UVZA 4N0ZA 2IMKA 4MH2A 2VCXA 3CWGA 2VD1A 2MMNA 3H79A 2NVLA 3HY2A 2V6KA 3GURA 2IFQB 3QFBC 2C3QA 4OFMA 4HSCX 4HOJA 5J40A 4OFNA 2H1DA 2H73A 5DALA 5J3RA 4JR6A 2JZRA 5D9TA 1TI3A 3GRXA 4O5QA 4RI6A 2LSTA 4IGJA 5ECRB 4WEYA 2P0GA 1GTUA 4E68A 1NM3A 1WJKA 2L59A 8GSSA 2R37A 2VAFA 2CAIA 3SBCA 3M1GA 1T3BA 3TRQA 2VL2A 2E0QA 1YJ6A 4KDUA 1B4PA 3BBYA 3U6VA 3DVWA 4POKA 2X8CA 1TRVA 2AHEA 1YKCA 1HNCA 4N30A 1M2DA 4WR4A 1SK2A 1SD8A 5INYA 4IS0A 4E8HA 3LWAA 4PXOA 2YN1A 1M3IA 1OE8A 1T7PB 2DSAA 5L71A 2F3MA 1XZOA 1OE7A 5JCWA 3APOA 2LQQA 4TR1A 3GX8A 2YJHA 4Q5RA 3FK8A 1XFLA 1NHYA 2CV4A 3A5WA 2FY6A 4K7NA 4BPYA 4Z2TA 1AXDA 1GLQA 3ZRDA 3IAM2 4BL7A 2C3NA 1QK8A 2WW3A 3Q18A 3GA4A 1BQ7A 3VI7A 2H0GA 3QD9A 4JBBA 1XBSA 3Q6OA 1HNBA 4TW5A 3LG6A 3QAVA 1JFUA 2EFEA 1SVMA 4JR4A 3KP8A 2FD3A 5HR2A 1EEMA 5B6MA 5IMFA 2E2MA 3FR6A 2R0CA 1GSQA 1AQWA 2XPEA 1ZL9A 3G7JA 4EF0A 2PN8A 3TJKA 2JL4A 3QDNA 4K6XA 1JLVA 4PURA 2HRAA 4WETA 3LFLA 5GAPD 1V2AA 1WPIA 4HZ4A 5LCZA 2K6VA 5IMZA 2X4AA 3QMXA 3CSHA 1TKDB 5B8BA 1PGTA 1ST9A 4D73B 1BG1A 3UEMA 4ZBDA 1C72A 1YDKA 2C3TA 4L8EA 2KOKA 4EKZA 2F8AA 1I1IP 2B6MA 1JZOA 4ECBA 2G0FA 3IC4A 5IO2A 4LMVA 5AISA 1AIUA 3UAPA 1GSUA 1V57A 2V2GA 4L0WA 3GSTA 2C1YA 4TN8A 2R2JA 2HSHA 2OADA 1A8LA 2JSYA 1JLWA 1TDIA 5AN1A 5CRGA 4KW6A 5C04A 1FG4A 4Q5FA 1TTZA 2IFQA 1S4BP 1AW9A 1A0RP 4AKIA 2FGXA 2VD0A 1Z9HA 2A2SA 2HNLA 4ZB9A 5HR1A 1FOVA 5J5NA 5ECPB 4HU9A 2VLUA 4G0IA 2FWEA 1AQVA 4FQUA 2JZTA 2WB9A 4PI0C 3ERFA 10GSA 5IMAA 4YKFA 2HXKA 4XS6A 4K0NA 2O85A 2REMA 5BMUB 2AUVA 3HA9A 1EOHA 2DJJA 4BWQA 3F8UA 2M72A 4K5RA 2C80A 3IPZA 3D6IA 4ZB8A 1EV4A 2JU5A 2C0DA 1ZZYA 1RK4A 1QGVA 3VWUA 4O5RA 3KGKA 4X1UA 1GULA 1AUCA 5CO3A 3GNJA 1GH2A 2BTOT 4PQIA 3TU3B 1G0TA 5G30A 1QMVA 1TW9A 3LSZA 2HSYA 2H70A 2YOIA 3NIVA 1EV9A 3RFRC 2MMZA 4LA1A 4GDFA 3G7YA 4ZIJA 3FMWA 2BJXA 2OT3A 3O6TA 2DBCA 4HJ2A 2DMLA 3V1WA 1JZWA 3P2AA 3FZAA 5B8AA 2OE1A 3DXBA 1SK0A 5FT3A 3GKNA 4MCUA 1O8XA 2IMFA 3F4TA 4H86A 5IMDA 3FHKA 3RAZA 2L5OA 3IHGA 2QA1A 3GUSA 3F4SA 4K8MA 3ZFLA 2EIQA 3KJYA 2O8VB 1S3RA 2WFCA 3GX0A 3ZFBA 1YF1A 1HNAA 1TP9A 1TXUA 2K9FA 1ERWA 2GQKA 3ZVJA 1WMJA 1GP1A 3UBKA 16GSA 3D21A 1F3BA 2GQMA 5DCGA 1EEJA 3GFKA 1URMA 3IK7A 3M8NA 3D5JA 2XHFA 1X9SB 2GT5A 3C7MA 2LRTA 2L57A 3UIWA 2C0EA 2KP2A 2TRXA 4FYBA 2NDOA 1FHEA 2ZCTA 2GZPA 2HZEB 4EVMA 2MMAA 1GNWA 1K0BA 4USSA 2V32A 3KD0A 3KEBA 3DEXA 2GT6A 17GSA 2H1AA 3AY8A 2PUKC 3GIXA 4EXJA 5F06A 3LYKA 2VOCA 1X0RA 2KHPA 5F07A 3GYKA 3S9FA 2L6CA 1GRXA 2A4HA 3F6DA 1EOGA 3VURA 1GNEA 3UVHA 3GN3A 1VRSD 2VUPA 1XVWA 2J9HA 2YANA 2PVOC 3F6FA 5JWQB 2X64A 4AGSA 2VCZA 4G01A 4J2FA 1B9XC 4POLA 3A2XA 5HR3A 2KLXA 1V98A 3EPTA 1EGOA 2OBIA 4DVCA 3CQFA 2X99A 2DJ1A 3MIXA 4NMUA 2HFDA 2YZHA 4EIQA 3US3A 4KDYA 2WGRA 4XHMA 2GZZA 4RQXA 3H8QA 3TUEA 3D0ZA 3ZYWA 2DKHA 3TDGA 3KP9A 5IMCA 2DMMA 1S3AA 3A2VA 3A5IA 2DJKA 3L0HA 2HE3A 3UARA 1EP7A 1WE0A 5DQSA 4IJ3A 4K7OA 1G7EA 3P90A 2GLRA 4YAVA 2GDRA 3RGBC 1G6YA 1GTAA 5G5EA 1K0AA 3LEFA 2QC7A 2WDUA 1VGLA 4HDEA 2LS5A 5KOXA 4EUYA 5CRHA 1E2YA 1O81A 4G10A 3NZNA 2XBQA 5D93A 1A24A 4ECJA 1PQNA 2C0GA 1THXA 3L9UA 4JRRA 4AJ8A 3SWLA 4NV2A 1JZDA 4XS4A 3VWWA 4G9HA 3Q19A 2M46A 4V1Ag 3K8NA 3EMXA 3ZREA 3TOTA 3HVVA 1SKRB 1YY7A 5ID2B 4X43A 2O36A 1BAYA 5DQYA 3FYGA 4FIWA 4EL1A 5DCHA 4MF6A 3WGXA 1DUGA 4L5OA 3JCML 2IL3A 2AAWA 2TIRA 1V40A 1YEWC 1U6TA 1XW9A 2OBKA 3H4KA 3L9VA 1QXHA 3M9KA 3HVNA 1RQMA 1W89A 3FZ9A 2L5LA 5H5RA 1A2JA 3KMOA 2PBJA 1WP0A 1XIYA 1YQ1A 1Y25A 1B8XA 3LXTA 3HDCA 1CQHA 1Z5YE 5HFGA 4FYCA 1TRUA 4YAPA 1XWGA 2KP1A 3CTGA 2JSZA 2MBTA 3GHAA 4HQZA 2EC4A 4XS1A 1BX9A 4EC0A 2H1GA 1GUHA 5F0GA 2WCIA 4JZQA 3DMLA 4LLRA 4P3YB 1F3AA 1XWAA 1PA3A 2NPBA 2QKEA 1ERVA 5F8BA 1QUWA 1OC8A 4PUAA 5CP1A 5KEJA 1RW1A 3VPQA 1U87A 2WVXB 2OKAA 4XRAA 2HRKB 2YV7A 2B1KA 1F37A 1X5DA 2DIZA 4NXIA 3CSIA 3KIJA 2CX3A 3GMFA 3TCOA 5C00A 2HSNA 3WT2A 1GSEA 1GSSA 3VK9A 2H66A 2DIYA 3WYWA 3C1RA 2FUG2 2LJRA 3GKMA 3R3EA 3L9SA 4GQFA 3CRTA 3N9JA 3ISOA 2PGTA 5D9VA 4TVEA 2RM6A 5HFKA 5CAXA 3ZMLA 4KSMA 1ERTA 2CZ2A 3TJBA 1FAAA 2B7JA 3PR8A 5FWGA 2H6XA 2GQLA 2GS3A 2LQOA 4JU5A 4RUVA 2LRNA 4CW9A 4CY6A 4OCFA 4LMWA 4AI6A 2R6KA 2N5AA 4FYUA 3WGEA 3TJJA 2IMDA 2X8GA 2HI7A 5IOWA 1T1VA 2VKZG 4QMKA 1BF5A 1XWCA 2L4QA 5CYYA 3EC3A 3RHBA 3F3QA 1OVNA 1YEXA 3UJ1A 5DVBA 1U3AA 3GL3A 1Z3EA 5DJMA 4ILFA 3QPMA 2E2GA 4I5QA 3F0IA 1OC9B 4WF5A 2WW0A 2FHEA 4MABA 1MEKA 3TJGA 4POMA 3FZ5A 5ELAA 3CTFA 2VM2A 3EYTA 1XVQA 2H19A 3GTUB 5ECOB 3TRXA 3IC8A 3IDVA 4EO3A 1QQ2A 2HSMB 5A5HB 2AV4A 3GH6A 2FLSA 3MDKA 2K8SA 3TKSC 4TR0A 3CSJA 5ECLB 2WS2A 2FWGA 2HZFA 2VCTA 3HVXA 3IXRA 2GSSA 2CVBA 4QQ7A 5E4WA 2YWIA 4YKGA 5J9CA 3KCMA 5ECIB 3C73A 3QAWA 1DE1A 3H93A 2R0GA 1HYUA 3LGCA 2ZNMA 2H6ZA 1ZOFA 2H30A 2I1UA 4MZCA 4KSOA 4AJ6A 2AJQB 1FB0A 3F3RA 5KN3A 2NTOA 3TJFA 3HJMA 4I97A 5B7CA 1M9BA 4EIPA 2LV3A 4PUFC 1TU8A 2CQ9A 4BVXB 5DAKB 2QSIA 1K3LA 2IMEA 2K8VA 1OYJA 3EURA 3EINA 2H8LA 4PQ1A 1A2MA 3HXSA 4EE0A 4KNDA 1O73A 4NAXA 3ZVJD 1MDKA 4N11A 3UBLA 1TK8B 4FO5A 4O32A 1EWXA 2PERA 1O7UA 1ZYEA 2DLXA 1DSBA 3EWLA 3HHVA 5J4VA 2VL9A 1IYHA 1R7HA 3DYRA 2OA7A 1TI1A 1TK0B 1ZGNA 1S3CA 4ZB7A 1GTBA 5IMVA 11GSA 2WZSA 5CREA 1H75A 4K1FA 3D4TA 2CVKA 3FY7A 2VIMA 3CYNA 1GTIA 2VL2C 2XC2A 2LJAA 1X9WB 5H5QA 3ME7A 2TRCP 1FVKA 4ML1A 4MF7A 3W6GA 3IA1A 2CX4A 2RUFA 3P8WA 4K5SA 4DSSB 3DGQA 1GL8A 2B5EA 2O87A 3PH9A 4TXOB 4ZBAA 4YQMA 3IV4A 2ON7A 5IOXA 2YCDA 1X5EA 4WBRD 2VCWA 7GSSA 3M9JA 2EIOA 3H1NA 3RHCA 2D2ZA 2HRFA 3DKSA 1XW6A 2H1LA 1R5PA 2UV8G 3ED3A 3EE2A 1USBA 2CA8A 3CXGA 3EVIA 4D73A 3BJ5A 6GSTA 2I4AA 1SENA 5D9WA 3G9BA 5A4VA 4CY8A 3IE3A 1FW1A 1Y1UA 2R3XA 1PL2A 3F9UA 5DDLA 1E6BA 4K2XA 2DKIA 5AIVA 4BVYB 1MDIA 5KN1A 3BCKA 3CMIA 3LJRA 3GH9A 4L5LA 1ILOA 5F05A 5CNWA 2PU9C 4MPFA 2V41A 1YF0A 2HSMA 5A5HA 3E0UA 3BD2A 4ZB6A 4GXZA 2A4VA 4NHZA 19GSA 1EGRA 1KEBA 3OR5A 4KCAA 2N5FA 4JE1A 2K18A 3FR3A 3CRUA 2FWFA 5A1NB 2IJYA 5DALB 2FNOA 3U5RE 2H0HA 1F6MC 3LQ7A 2VLTA 4AJ7A 1VF2A 4GTUA 5AGYA 4MH3A 4MJCA 4HS1A 3HZ8A 1OKTA 4KGIA 2GZYA 5D9XA 2FWHA 3VLNA 3HD5A 3PGTA 4I6XA 2LNSA 3TGZA 1PMTA 3HZ4A 2F51A 3FR9A 3HJOA 4GF0A 3ZTLA 3UMAA 4XRDA 5BMUA 2V1MA 4OFTA 6GSVA 1Y6EA 3IR4A 4TKYA 2B1LA 2YWMA 4GSTA 2OJLA 1FO5A 3TKQA 4PQHA 1T4ZA 4KB3A 4NHWA 2P5QA 2EFHA 4WR5A 3ZZXA 2DC5A 4G0KA 13GSA 4TR1B 5HFIA 1U88A 2E7PA 2O89A 4ACSA 6GSYA 2MYGA 3RDWA 3ZMKA 5J4UA 1MTCA 1SYRA 3I6AA 4BL7B 1HQOA 2CZ3A 4W66A 2PMTA 2GGTA 1A23A 1XWKA 4ECIA 4N3ZA 5H5SA 3W8SA 1SVLA 4ID0A 2JACA 3D22A 2VCQA 2WVZA 2A2RA 4OMVA 4Q5NA 2L4CA 3DD3A 4MF5A 2RLIA 3MNGA 4TR3A 3G7IA 4PNGA 1PX6A 1M7TA 1ON4A 1Q4JA 1OC3A 3EMPA 4V2NA 1PN0A 4OO4A 1Z7PA 2PVQA 2DJ0A 4DSSA 1SJZA 2MZCA 5J47A 5ECKB 1A8YA 3C71A 3LXZA 2RUEA 4TXVA 4YQVA 1N25A 2KUCA 3CBUA 3HJPA 2JZSA 4L0UA 3VWXA 1FVJA 1KNGA 2P5RA 5ENUA 3DWVA 3IOSA 4EDYA 1SVOA 4IVFA 4Z2RA 3MYDA 2X8HA 4OCEA 3O3TA 5A4UA 4WBJA 1XOBA 2ON5A 1QFNA 5DBQA 1CQGA 2HYXA 5J4YA 1ZYPA 4ZL7A 4GWRA 4BVYA 3IAS2 1V9WA 2HZEA 3TKRA 3FW2A 1PKWA 5D96A 1GUMA 5CRDA 1XXUA 3VPTA 3M0FA 4ZILA 3IBHA 3ZLPA 4GLTA 2IMIA 3KZQA 3UVTA 4PI2C 1K0DA 3E3EA 3M3MA 1PRXA 4MNNA 2A2PA 2GTUA 2IIYA 3WD6A 2N5BA 4GRFA 5A1NA 1YEPA 2I81A 2GVPA 4MZBA 3W8JA 1AC1A 2L6DA 1ERUA 4F03A 1T4YA 3CHXC 5IM9A 6GSUA 1PFOA 1SKSB 2WULA 5LNKe 1XOAA 1KBNA 1M0UA 3GKKA 1S3DA 5ECMB 2I9HA 4KDXA 4QL9A 2WJUA 2YJ7A 4WKWA 3A2WA 5IO0A 5IPGA 1O8WA 4MLYA 3TOUA 4LL4B 1TRWA 1HD2A 1OKDA 1PD21 2R5GA 3GSSA 2I3YA 4G2EA 4F0CA 5G2ZA 3KXOA 1XW5A 4AKHA 4IQAA 4DEJA 4PNFA 4X4JA 2BMXA 1DE2A 1M2AA 1I9DA 3GL5A 4LL1B 1XWBA 2H01A 1Z6MA 3MWHA 3QCPA 1JHBA 2LRCA 5EY6A 2HRNA 5A4WA 3IHQA 5GZZB 4G0LA 2LNTA 1ZYNA 2O3EA 4V2MA 1K3OA 3ERGA 3DVXA 2YPMA 2LUSA 4N10A 4RQRA 4TR4A 5HR0A 4IP6A 2O7KA 1SYXA 3KMNA 1U3IA 2YWNA 4F82A 3RPPA 2MBSA 1GSDA 2ES7A 4DSQA 1K0NA 5ECQB 2B3SA 4BWSA 4K0GA 4O7HA 1WIKA 2RIIA 1GUKA 3I9V2 1R5AA 3VI5A 1MDJA 1GSFA 5A34B 1ZCPA 3A3TA 3J7Yk 5JCUA 4FH8A 4V2LA 3R2QA 5E59A 5ID2A 3PINA 18GSA 3BOAA 3IRAA 1ACVA 5G1LA 2C8UA 4PHZC 1BG5A 1YVLA 4DSRA 3NOFA 3ZIJA 1SK1A 2H0IA 2PWJA 4IJIA 1R26A 3ERWA 1Q98A 1K0CA 3QAGA 2P31A 4BA7A 1T00A 2H76A 4O5UA 4OWYA 1Z6NA 5JCGA 1O6JA 2FA8A 4F9ZA 5FHIA 3HKRA 2JADA 2WVYA 4MPGA 4GSNA 2R0PA 4MJAA 5HQPA 1Z7RA 5D73A 1T8EB 4AKXB 3LYPA 2H1BA 1K0MA 1VF1A 2YP6A 4IW9A 4O92A 2OE0A 4J57E 4NPBA 3J7Yb 1X9MB 1MD4A 2VLVA 5J9BA 2O5VA 5CRWA 5EVOA 1I5GA 2NBSA 1GLPA 4MDCA 1UN2A 3HVSA 4KF9A 3C8EA 1UC7A 4GQCA 2C4JA 1N8JA 3ZIVA 1MD3A 2WVXA 4IBPA 2LTKA 1UA5A 4KCEA 2HRKA 4KX4A 4I8BA 3F63A 2GSRA 2YZUA 2J23A 4IHUA 2R4VA 5JWOB 4AF2A 1ABAA 2CAQA 4E8EA 5EPFA 9GSSA 1SJ6A 1THOA 5KN0A 4I2UA 4V1Ap 4HUAA 4G19A 4K2DA 4GSSA 4ECCA 4IN0A 4ICYA 2VM1A 2IPAA 1PN9A 2EIRA 5J41A 1SL1B 5ABRA 5ECSA 3RBTA 1DBYA 2B7KA 1TJDA 1BYEA 4ZXGA 1X5CA 1N2AA 4ISDA 4Z7XA 1VF4A 2FCHA 3UL3A 3LW9A 1NW2A 2XBIA 1NHOA 2LKUA 1TRSA 1TXXA 4K7IA 2Z9SA 3QR6A 4IKHA 2OE3A 3EU3A 1B9YC 2MMOA 3GKXA 4YQUA 2VCVA 4KA0A
chains in the Genus database with same CATH topology
3HMJG 2WRTA 3PPUA 3C1SA 4NWYA 4K9ZA 3MSZA 2RM5A 1PKZA 2H75A 1H4OA 4ML6A 3I43A 5JWRB 1SL0B 2QGVA 1NSWA 5GSTA 4MP4A 2B5XA 3DRNA 1TU7A 1LBKA 1OAZA 1AAZA 5A34A 5G5FA 1SKWB 4KH7A 3TB2A 3I69A 1M2BA 2B5YA 4QL7A 4XS4B 4OO5A 4MK3A 4YH2A 3WGDA 6GSSA 1FOHA 5D8IA 5B6NA 5IPHA 3KM6A 4AKGA 1F9MA 3KTLA 1OC9A 6GSWA 1PX7A 3EU4A 4MZWA 3HCZA 2YWOA 3GTUA 1F2EA 4HJMA 4J56E 3Q74A 1WOUA 2OACA 1SJIA 2IWTA 3L78A 3HYPA 2ALBA 4XIHA 2GSQA 2EFCA 1G7OA 3TRPA 2F9SA 2YV9A 3L4NA 3WT1A 3FKFA 4WXTA 4ZL8A 5G31A 1TK5B 3FZ4A 2YNXA 4I2TA 4NV5A 3N5OA 1PL1A 1B4QA 5COHA 1YZXA 3KH9A 3VFIA 1R4WA 2V6OA 5KOWA 1LJRA 3FEUA 3GV1A 1EZKA 1LU4A 1K0OA 1W4VA 3QOUA 4A5PA 2CVDA 1TOFA 4N0VA 3O76A 4HQSA 2VL3A 3D4MA 5G1KA 2H71A 20GSA 3F4RA 4XCSA 4BVXA 5GSSA 5DAKA 2H6YA 4EDZA 4KUNA 2F8FA 6GSXA 5ELGA 4ULXA 1KTEA 4RI7A 2WZ9A 1J9BA 4PX1A 5DJLA 1GSYA 1BJXA 4MMMA 3APSA 5GAND 4F2IA 2HT9A 1J0FA 4WF4A 1B48A 3VWVA 1M99A 2HSNB 3QFAC 4HI7A 4CDOA 4CHSA 2G2QA 2LEGA 1G6WA 2ZUPA 5IQYA 4Q5QA 2IN3A 2C0FA 3UOMA 2EFDA 2UZ8A 1JZRA 5LD0A 3DIEA 4ZBBA 1K3YA 1A0FA 2PPTA 4MJBA 2AYTA 4KAEA 3E9JB 4XTSA 3IK9A 4GCIA 3FRCA 1A2LA 5KN2A 4PGTA 1SU9A 2AB6A 3KTBA 2DJ2A 1YKAA 2CT6A 4HZ2A 5ECNB 2X49A 3BCIA 4HEA2 22GSA 3ME8A 3LORA 1PSQA 4PTSA 5AIXA 4KE3A 2M80A 5ECHB 3ZL5A 12GSA 1ZMAA 4TOPA 4X0XA 1ZYQB 4POBA 2VO4A 3APQA 4OD7A 4TXOA 1WWJA 1AQXA 3TKSA 1SD9A 5BRTA 4IP1A 2H74A 14GSA 4MJEA 2HLSA 2XPDA 3TKPA 4JEDA 1EP8A 1VF3A 3P7XA 5IIZA 1O85A 4ZL9A 5EL8A 4IQ1A 5A5KA 3RPNA 1J08A 4IELA 1XPVA 1FB6A 1IYIA 1XCCA 4HU7A 4TRXA 1SL2B 2FA4A 2HQTA 2QA2A 3MAKA 1BEDA 4F0BA 1M9AA 1ML6A 1GWCA 2DJ3A 4MA9A 4Z2UA 3ZITA 2LJKA 3KH7A 2H72A 1V58A 3TKSE 1WRYA 2GSTA 1UVZA 4N0ZA 2IMKA 4MH2A 2VCXA 3CWGA 2VD1A 2MMNA 3H79A 2NVLA 3HY2A 2V6KA 3GURA 2IFQB 3QFBC 2C3QA 4OFMA 4HOJA 5J40A 4OFNA 2H1DA 2H73A 5DALA 5J3RA 4JR6A 2JZRA 5D9TA 1TI3A 3GRXA 4O5QA 4RI6A 2LSTA 4IGJA 5ECRB 4WEYA 2P0GA 1GTUA 4E68A 1NM3A 1WJKA 2L59A 8GSSA 2R37A 2VAFA 2CAIA 3SBCA 3M1GA 1T3BA 3TRQA 2VL2A 2E0QA 1YJ6A 4KDUA 1B4PA 3BBYA 3U6VA 3DVWA 4POKA 2X8CA 1TRVA 2AHEA 1YKCA 1HNCA 4N30A 1M2DA 4WR4A 1SK2A 1SD8A 5INYA 4IS0A 4E8HA 3LWAA 4PXOA 2YN1A 1T7PB 1OE8A 2DSAA 5L71A 2F3MA 1XZOA 1OE7A 5JCWA 3APOA 2LQQA 4TR1A 3GX8A 2YJHA 4Q5RA 3FK8A 1XFLA 1NHYA 2CV4A 3A5WA 2FY6A 4K7NA 4BPYA 4Z2TA 1AXDA 1GLQA 3ZRDA 3IAM2 4BL7A 2C3NA 1QK8A 3Q18A 3GA4A 1BQ7A 3VI7A 2H0GA 3QD9A 4JBBA 1XBSA 3Q6OA 1HNBA 4TW5A 3LG6A 3QAVA 1JFUA 2EFEA 1SVMA 4JR4A 3KP8A 2FD3A 5HR2A 1EEMA 5B6MA 5IMFA 2E2MA 3FR6A 2R0CA 1GSQA 1AQWA 2XPEA 1ZL9A 3G7JA 4EF0A 2PN8A 3TJKA 2JL4A 3QDNA 4K6XA 1JLVA 4PURA 2HRAA 4WETA 3LFLA 5GAPD 1V2AA 1WPIA 4HZ4A 5LCZA 2K6VA 5IMZA 2X4AA 3QMXA 3CSHA 1TKDB 5B8BA 1PGTA 1ST9A 4D73B 1BG1A 3UEMA 4ZBDA 1C72A 1YDKA 2C3TA 4L8EA 2KOKA 4EKZA 2F8AA 2B6MA 1JZOA 4ECBA 2G0FA 3IC4A 5IO2A 4LMVA 5AISA 1AIUA 3UAPA 1GSUA 1V57A 2V2GA 4L0WA 3GSTA 2C1YA 4TN8A 2R2JA 2HSHA 2OADA 1A8LA 2JSYA 1JLWA 1TDIA 5AN1A 5CRGA 4KW6A 5C04A 1FG4A 4Q5FA 1TTZA 2IFQA 1AW9A 1A0RP 4AKIA 2FGXA 2VD0A 1Z9HA 2A2SA 2HNLA 4ZB9A 5HR1A 1FOVA 5J5NA 5ECPB 4HU9A 2VLUA 4G0IA 2FWEA 1AQVA 4FQUA 2JZTA 2WB9A 3ERFA 10GSA 5IMAA 4YKFA 2HXKA 4XS6A 4K0NA 2O85A 2REMA 5BMUB 2AUVA 3HA9A 1EOHA 2DJJA 4BWQA 3F8UA 2M72A 4K5RA 2C80A 3IPZA 3D6IA 4ZB8A 1EV4A 2JU5A 2C0DA 1ZZYA 1RK4A 1QGVA 3VWUA 4O5RA 3KGKA 4X1UA 1GULA 1AUCA 5CO3A 3GNJA 1GH2A 2BTOT 4PQIA 3TU3B 1G0TA 5G30A 1QMVA 1TW9A 3LSZA 2HSYA 2H70A 2YOIA 3NIVA 1EV9A 2MMZA 4LA1A 4GDFA 3G7YA 4ZIJA 3FMWA 2BJXA 2OT3A 3O6TA 2DBCA 4HJ2A 2DMLA 3V1WA 1JZWA 3P2AA 3FZAA 5B8AA 2OE1A 3DXBA 1SK0A 5FT3A 3GKNA 4MCUA 1O8XA 2IMFA 3F4TA 4H86A 5IMDA 3FHKA 3RAZA 2L5OA 3IHGA 2QA1A 3GUSA 3F4SA 4K8MA 3ZFLA 2EIQA 3KJYA 2O8VB 2WFCA 3GX0A 3ZFBA 1YF1A 1HNAA 1TP9A 1TXUA 2K9FA 1ERWA 2GQKA 3ZVJA 1WMJA 1GP1A 3UBKA 16GSA 3D21A 1F3BA 2GQMA 5DCGA 1EEJA 3GFKA 1URMA 3IK7A 3M8NA 3D5JA 2XHFA 1X9SB 2GT5A 3C7MA 2LRTA 2L57A 3UIWA 2C0EA 2KP2A 2TRXA 4FYBA 2NDOA 1FHEA 2ZCTA 2GZPA 2HZEB 4EVMA 2MMAA 1GNWA 1K0BA 4USSA 2V32A 3KD0A 3KEBA 3DEXA 2GT6A 17GSA 2H1AA 3AY8A 2PUKC 3GIXA 4EXJA 5F06A 3LYKA 2VOCA 1X0RA 2KHPA 5F07A 3GYKA 3S9FA 2L6CA 1GRXA 2A4HA 3F6DA 1EOGA 3VURA 1GNEA 3UVHA 3GN3A 1VRSD 2VUPA 1XVWA 2J9HA 2YANA 2PVOC 3F6FA 5JWQB 2X64A 4AGSA 2VCZA 4G01A 4J2FA 1B9XC 4POLA 3A2XA 5HR3A 2KLXA 1V98A 3EPTA 1EGOA 2OBIA 4DVCA 2X99A 2DJ1A 3MIXA 4NMUA 2HFDA 2YZHA 4EIQA 3US3A 4KDYA 2WGRA 4XHMA 2GZZA 4RQXA 3H8QA 3TUEA 3D0ZA 3ZYWA 2DKHA 3TDGA 3KP9A 5IMCA 2DMMA 1S3AA 3A2VA 3A5IA 2DJKA 3L0HA 2HE3A 3UARA 1EP7A 1WE0A 5DQSA 4IJ3A 4K7OA 1G7EA 3P90A 2GLRA 4YAVA 2GDRA 1G6YA 1GTAA 5G5EA 1K0AA 3LEFA 2QC7A 2WDUA 1VGLA 4HDEA 2LS5A 5KOXA 4EUYA 5CRHA 1E2YA 1O81A 4G10A 3NZNA 2XBQA 5D93A 1A24A 4ECJA 1PQNA 2C0GA 1THXA 3L9UA 4JRRA 4AJ8A 3SWLA 4NV2A 1JZDA 4XS4A 3VWWA 4G9HA 3Q19A 2M46A 4V1Ag 3K8NA 3EMXA 3ZREA 3TOTA 3HVVA 1SKRB 1YY7A 5ID2B 4X43A 1BAYA 5DQYA 3FYGA 4FIWA 4EL1A 5DCHA 4MF6A 3WGXA 1DUGA 4L5OA 3JCML 2IL3A 2AAWA 2TIRA 1V40A 1U6TA 1XW9A 2OBKA 3H4KA 3L9VA 1QXHA 3M9KA 1RQMA 1W89A 3FZ9A 2L5LA 5H5RA 1A2JA 3KMOA 2PBJA 1WP0A 1XIYA 1YQ1A 1Y25A 1B8XA 3LXTA 3HDCA 1CQHA 1Z5YE 5HFGA 4FYCA 1TRUA 4YAPA 1XWGA 2KP1A 3CTGA 2JSZA 2MBTA 3GHAA 4HQZA 2EC4A 4XS1A 1BX9A 4EC0A 2H1GA 1GUHA 5F0GA 2WCIA 4JZQA 3DMLA 4LLRA 4P3YB 1F3AA 1XWAA 1PA3A 2NPBA 2QKEA 1ERVA 5F8BA 1QUWA 1OC8A 4PUAA 5CP1A 5KEJA 1RW1A 3VPQA 1U87A 2OKAA 4XRAA 2HRKB 2YV7A 2B1KA 1F37A 1X5DA 2DIZA 4NXIA 3CSIA 3KIJA 2CX3A 3GMFA 3TCOA 5C00A 2HSNA 3WT2A 1GSEA 1GSSA 3VK9A 2H66A 2DIYA 3WYWA 3C1RA 2FUG2 2LJRA 3GKMA 3R3EA 3L9SA 4GQFA 3CRTA 3N9JA 3ISOA 2PGTA 5D9VA 4TVEA 2RM6A 5HFKA 5CAXA 3ZMLA 4KSMA 1ERTA 2CZ2A 3TJBA 1FAAA 2B7JA 3PR8A 5FWGA 2H6XA 2GQLA 2GS3A 2LQOA 4JU5A 4RUVA 2LRNA 4CW9A 4CY6A 4OCFA 4LMWA 4AI6A 2R6KA 2N5AA 4FYUA 3WGEA 3TJJA 2IMDA 2X8GA 2HI7A 5IOWA 1T1VA 2VKZG 4QMKA 1BF5A 1XWCA 2L4QA 5CYYA 3EC3A 3RHBA 3F3QA 1OVNA 1YEXA 3UJ1A 5DVBA 1U3AA 3GL3A 1Z3EA 5DJMA 4ILFA 3QPMA 2E2GA 4I5QA 3F0IA 1OC9B 4WF5A 2FHEA 4MABA 1MEKA 3TJGA 4POMA 3FZ5A 5ELAA 3CTFA 2VM2A 3EYTA 1XVQA 2H19A 3GTUB 5ECOB 3TRXA 3IC8A 3IDVA 4EO3A 1QQ2A 2HSMB 5A5HB 2AV4A 3GH6A 2FLSA 3MDKA 2K8SA 3TKSC 4TR0A 3CSJA 5ECLB 2WS2A 2FWGA 2HZFA 2VCTA 3HVXA 3IXRA 2GSSA 2CVBA 4QQ7A 5E4WA 2YWIA 4YKGA 5J9CA 3KCMA 5ECIB 3C73A 3QAWA 1DE1A 3H93A 2R0GA 1HYUA 3LGCA 2ZNMA 2H6ZA 1ZOFA 2H30A 2I1UA 4MZCA 4KSOA 4AJ6A 2AJQB 1FB0A 3F3RA 5KN3A 2NTOA 3TJFA 3HJMA 4I97A 5B7CA 1M9BA 4EIPA 2LV3A 4PUFC 1TU8A 2CQ9A 4BVXB 5DAKB 2QSIA 1K3LA 2IMEA 2K8VA 1OYJA 3EURA 3EINA 2H8LA 4PQ1A 1A2MA 3HXSA 4EE0A 4KNDA 1O73A 4NAXA 3ZVJD 1MDKA 4N11A 3UBLA 1TK8B 4FO5A 4O32A 1EWXA 2PERA 1O7UA 1ZYEA 2DLXA 1DSBA 3EWLA 3HHVA 5J4VA 2VL9A 1IYHA 1R7HA 3DYRA 2OA7A 1TI1A 1TK0B 1ZGNA 1S3CA 4ZB7A 1GTBA 5IMVA 11GSA 5CREA 1H75A 4K1FA 3D4TA 2CVKA 3FY7A 2VIMA 3CYNA 1GTIA 2VL2C 2XC2A 2LJAA 1X9WB 5H5QA 3ME7A 2TRCP 1FVKA 4ML1A 4MF7A 3W6GA 3IA1A 2CX4A 2RUFA 3P8WA 4K5SA 4DSSB 3DGQA 1GL8A 2B5EA 2O87A 3PH9A 4TXOB 4ZBAA 4YQMA 3IV4A 2ON7A 5IOXA 2YCDA 1X5EA 4WBRD 2VCWA 7GSSA 3M9JA 2EIOA 3H1NA 3RHCA 2D2ZA 2HRFA 3DKSA 1XW6A 2H1LA 1R5PA 2UV8G 3ED3A 3EE2A 1USBA 2CA8A 3CXGA 3EVIA 4D73A 3BJ5A 6GSTA 2I4AA 1SENA 5D9WA 3G9BA 5A4VA 4CY8A 3IE3A 1FW1A 1Y1UA 2R3XA 1PL2A 3F9UA 5DDLA 1E6BA 4K2XA 2DKIA 5AIVA 4BVYB 1MDIA 5KN1A 3BCKA 3CMIA 3LJRA 3GH9A 4L5LA 1ILOA 5F05A 5CNWA 2PU9C 4MPFA 2V41A 1YF0A 2HSMA 5A5HA 3E0UA 3BD2A 4ZB6A 4GXZA 2A4VA 4NHZA 19GSA 1EGRA 1KEBA 3OR5A 4KCAA 2N5FA 4JE1A 2K18A 3FR3A 3CRUA 2FWFA 5A1NB 2IJYA 5DALB 2FNOA 3U5RE 2H0HA 1F6MC 3LQ7A 2VLTA 4AJ7A 1VF2A 4GTUA 5AGYA 4MH3A 4MJCA 4HS1A 3HZ8A 1OKTA 4KGIA 2GZYA 5D9XA 2FWHA 3VLNA 3HD5A 3PGTA 4I6XA 2LNSA 3TGZA 1PMTA 3HZ4A 2F51A 3FR9A 3HJOA 4GF0A 3ZTLA 3UMAA 4XRDA 5BMUA 2V1MA 4OFTA 6GSVA 1Y6EA 3IR4A 4TKYA 2B1LA 2YWMA 4GSTA 2OJLA 1FO5A 3TKQA 4PQHA 1T4ZA 4KB3A 4NHWA 2P5QA 2EFHA 4WR5A 3ZZXA 2DC5A 4G0KA 13GSA 4TR1B 5HFIA 1U88A 2E7PA 2O89A 4ACSA 6GSYA 2MYGA 3RDWA 3ZMKA 5J4UA 1MTCA 1SYRA 3I6AA 4BL7B 1HQOA 2CZ3A 4W66A 2PMTA 2GGTA 1A23A 1XWKA 4ECIA 4N3ZA 5H5SA 3W8SA 1SVLA 4ID0A 2JACA 3D22A 2VCQA 2A2RA 4OMVA 4Q5NA 2L4CA 3DD3A 4MF5A 2RLIA 3MNGA 4TR3A 3G7IA 4PNGA 1PX6A 1M7TA 1ON4A 1Q4JA 1OC3A 3EMPA 4V2NA 1PN0A 4OO4A 1Z7PA 2PVQA 2DJ0A 4DSSA 1SJZA 2MZCA 5J47A 5ECKB 1A8YA 3C71A 3LXZA 2RUEA 4TXVA 4YQVA 1N25A 2KUCA 3CBUA 3HJPA 2JZSA 4L0UA 3VWXA 1FVJA 1KNGA 2P5RA 5ENUA 3DWVA 3IOSA 4EDYA 1SVOA 4IVFA 4Z2RA 3MYDA 2X8HA 4OCEA 3O3TA 5A4UA 4WBJA 1XOBA 2ON5A 1QFNA 5DBQA 1CQGA 2HYXA 5J4YA 1ZYPA 4ZL7A 4GWRA 4BVYA 3IAS2 1V9WA 2HZEA 3TKRA 3FW2A 1PKWA 5D96A 1GUMA 5CRDA 1XXUA 3VPTA 3M0FA 4ZILA 3IBHA 3ZLPA 4GLTA 2IMIA 3KZQA 3UVTA 1K0DA 3E3EA 3M3MA 1PRXA 4MNNA 2A2PA 2GTUA 2IIYA 3WD6A 2N5BA 4GRFA 5A1NA 1YEPA 2I81A 2GVPA 4MZBA 3W8JA 1AC1A 2L6DA 1ERUA 4F03A 1T4YA 5IM9A 6GSUA 1SKSB 2WULA 5LNKe 1XOAA 1KBNA 1M0UA 3GKKA 1S3DA 5ECMB 2I9HA 4KDXA 4QL9A 2WJUA 2YJ7A 4WKWA 3A2WA 5IO0A 5IPGA 1O8WA 4MLYA 3TOUA 4LL4B 1TRWA 1HD2A 1OKDA 1PD21 2R5GA 3GSSA 2I3YA 4G2EA 4F0CA 5G2ZA 3KXOA 1XW5A 4AKHA 4IQAA 4DEJA 4PNFA 4X4JA 2BMXA 1DE2A 1M2AA 1I9DA 3GL5A 4LL1B 1XWBA 2H01A 1Z6MA 3MWHA 3QCPA 1JHBA 2LRCA 5EY6A 2HRNA 5A4WA 3IHQA 5GZZB 4G0LA 2LNTA 1ZYNA 4V2MA 1K3OA 3ERGA 3DVXA 2YPMA 2LUSA 4N10A 4RQRA 4TR4A 5HR0A 4IP6A 2O7KA 1SYXA 3KMNA 1U3IA 2YWNA 4F82A 3RPPA 2MBSA 1GSDA 2ES7A 4DSQA 1K0NA 5ECQB 2B3SA 4BWSA 4K0GA 4O7HA 1WIKA 2RIIA 1GUKA 3I9V2 1R5AA 3VI5A 1MDJA 1GSFA 5A34B 1ZCPA 3A3TA 3J7Yk 5JCUA 4FH8A 4V2LA 3R2QA 5E59A 5ID2A 3PINA 18GSA 3BOAA 3IRAA 1ACVA 5G1LA 2C8UA 1BG5A 1YVLA 4DSRA 3NOFA 3ZIJA 1SK1A 2H0IA 2PWJA 4IJIA 1R26A 3ERWA 1Q98A 1K0CA 3QAGA 2P31A 4BA7A 1T00A 2H76A 4O5UA 4OWYA 1Z6NA 5JCGA 1O6JA 2FA8A 4F9ZA 5FHIA 3HKRA 2JADA 4MPGA 4GSNA 2R0PA 4MJAA 5HQPA 1Z7RA 5D73A 1T8EB 4AKXB 3LYPA 2H1BA 1K0MA 1VF1A 2YP6A 4IW9A 4O92A 2OE0A 4J57E 4NPBA 3J7Yb 1X9MB 1MD4A 2VLVA 5J9BA 2O5VA 5CRWA 5EVOA 1I5GA 2NBSA 1GLPA 4MDCA 1UN2A 3HVSA 4KF9A 3C8EA 1UC7A 4GQCA 2C4JA 1N8JA 3ZIVA 1MD3A 4IBPA 2LTKA 1UA5A 4KCEA 2HRKA 4KX4A 4I8BA 3F63A 2GSRA 2YZUA 2J23A 4IHUA 2R4VA 5JWOB 4AF2A 1ABAA 2CAQA 4E8EA 5EPFA 9GSSA 1SJ6A 1THOA 5KN0A 4I2UA 4V1Ap 4HUAA 4G19A 4K2DA 4GSSA 4ECCA 4IN0A 4ICYA 2VM1A 2IPAA 1PN9A 2EIRA 5J41A 1SL1B 5ABRA 5ECSA 3RBTA 1DBYA 2B7KA 1TJDA 1BYEA 4ZXGA 1X5CA 1N2AA 4ISDA 4Z7XA 1VF4A 2FCHA 3UL3A 3LW9A 1NW2A 2XBIA 1NHOA 2LKUA 1TRSA 1TXXA 4K7IA 2Z9SA 3QR6A 4IKHA 2OE3A 3EU3A 1B9YC 2MMOA 3GKXA 4YQUA 2VCVA 4KA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WRT A;  3PPU A;  3C1S A;  4NWY A;  4K9Z A;  3MSZ A;  2RM5 A;  1PKZ A;  2H75 A;  1H4O A;  4ML6 A;  3I43 A;  5JWR B;  1SL0 B;  2QGV A;  1NSW A;  5GST A;  4MP4 A;  2B5X A;  3DRN A;  1TU7 A;  1LBK A;  1OAZ A;  1AAZ A;  5G5F A;  1SKW B;  4KH7 A;  3TB2 A;  3I69 A;  1M2B A;  2B5Y A;  4QL7 A;  4XS4 B;  4OO5 A;  4MK3 A;  4YH2 A;  3WGD A;  6GSS A;  5D8I A;  5B6N A;  5IPH A;  3KM6 A;  1F9M A;  3KTL A;  1OC9 A;  6GSW A;  1PX7 A;  3EU4 A;  4MZW A;  3HCZ A;  2YWO A;  3GTU A;  1F2E A;  4HJM A;  4J56 E;  3Q74 A;  1WOU A;  2OAC A;  1SJI A;  2IWT A;  3L78 A;  3HYP A;  2ALB A;  4XIH A;  2GSQ A;  1G7O A;  3TRP A;  2F9S A;  2YV9 A;  3L4N A;  3WT1 A;  3FKF A;  4WXT A;  4ZL8 A;  5G31 A;  1TK5 B;  3FZ4 A;  2YNX A;  4I2T A;  4NV5 A;  3N5O A;  1PL1 A;  1B4Q A;  5COH A;  1YZX A;  3KH9 A;  3VFI A;  1R4W A;  2V6O A;  1LJR A;  3FEU A;  3GV1 A;  1EZK A;  1LU4 A;  1K0O A;  1W4V A;  3QOU A;  2CVD A;  1TOF A;  4N0V A;  3O76 A;  4HQS A;  2VL3 A;  3D4M A;  5G1K A;  2H71 A;  20GS A;  3F4R A;  4XCS A;  4BVX A;  5GSS A;  5DAK A;  2H6Y A;  4EDZ A;  4KUN A;  2F8F A;  6GSX A;  5ELG A;  4ULX A;  1KTE A;  4RI7 A;  2WZ9 A;  1J9B A;  4PX1 A;  5DJL A;  1GSY A;  1BJX A;  4MMM A;  3APS A;  5GAN D;  4F2I A;  2HT9 A;  1J0F A;  4WF4 A;  1B48 A;  3VWV A;  1M99 A;  2HSN B;  3QFA C;  4HI7 A;  4CDO A;  4CHS A;  2G2Q A;  2LEG A;  1G6W A;  2ZUP A;  5IQY A;  4Q5Q A;  2IN3 A;  2C0F A;  3UOM A;  2UZ8 A;  1JZR A;  5LD0 A;  3DIE A;  4ZBB A;  1K3Y A;  1A0F A;  2PPT A;  4MJB A;  2AYT A;  4KAE A;  3E9J B;  4XTS A;  3IK9 A;  4GCI A;  3FRC A;  1A2L A;  5KN2 A;  4PGT A;  1SU9 A;  2AB6 A;  3KTB A;  2DJ2 A;  1YKA A;  2CT6 A;  4HZ2 A;  5ECN B;  3BCI A;  4HEA 2;  22GS A;  3ME8 A;  3LOR A;  1PSQ A;  4PTS A;  5AIX A;  4KE3 A;  2M80 A;  5ECH B;  3ZL5 A;  12GS A;  1ZMA A;  4TOP A;  4X0X A;  1ZYQ B;  4POB A;  2VO4 A;  3APQ A;  4OD7 A;  4TXO A;  1WWJ A;  1AQX A;  3TKS A;  1SD9 A;  4IP1 A;  2H74 A;  14GS A;  4MJE A;  2HLS A;  2XPD A;  3TKP A;  4JED A;  1EP8 A;  1VF3 A;  3P7X A;  5IIZ A;  1O85 A;  4ZL9 A;  5EL8 A;  4IQ1 A;  5A5K A;  3RPN A;  1J08 A;  4IEL A;  1XPV A;  1FB6 A;  1IYI A;  1XCC A;  4HU7 A;  4TRX A;  1SL2 B;  2FA4 A;  2HQT A;  3MAK A;  1BED A;  4F0B A;  1M9A A;  1ML6 A;  1GWC A;  2DJ3 A;  4MA9 A;  3ZIT A;  2LJK A;  3KH7 A;  2H72 A;  1V58 A;  3TKS E;  1WRY A;  2GST A;  1UVZ A;  4N0Z A;  2IMK A;  4MH2 A;  2VCX A;  2VD1 A;  2MMN A;  3H79 A;  2NVL A;  3HY2 A;  2V6K A;  3GUR A;  2IFQ B;  3QFB C;  2C3Q A;  4OFM A;  4HOJ A;  4OFN A;  2H1D A;  2H73 A;  5DAL A;  5J3R A;  4JR6 A;  2JZR A;  5D9T A;  1TI3 A;  3GRX A;  4RI6 A;  2LST A;  4IGJ A;  5ECR B;  4WEY A;  2P0G A;  1GTU A;  1NM3 A;  1WJK A;  2L59 A;  8GSS A;  2R37 A;  2VAF A;  2CAI A;  3SBC A;  3M1G A;  1T3B A;  3TRQ A;  2VL2 A;  2E0Q A;  1YJ6 A;  4KDU A;  1B4P A;  3BBY A;  3U6V A;  3DVW A;  4POK A;  2X8C A;  1TRV A;  2AHE A;  1YKC A;  1HNC A;  4N30 A;  1M2D A;  4WR4 A;  1SK2 A;  1SD8 A;  5INY A;  4IS0 A;  4E8H A;  3LWA A;  4PXO A;  2YN1 A;  1T7P B;  1OE8 A;  2DSA A;  5L71 A;  2F3M A;  1XZO A;  1OE7 A;  5JCW A;  3APO A;  2LQQ A;  4TR1 A;  3GX8 A;  2YJH A;  4Q5R A;  3FK8 A;  1XFL A;  1NHY A;  2CV4 A;  3A5W A;  2FY6 A;  4K7N A;  4BPY A;  1AXD A;  1GLQ A;  3ZRD A;  3IAM 2;  4BL7 A;  2C3N A;  1QK8 A;  3Q18 A;  3GA4 A;  1BQ7 A;  3VI7 A;  2H0G A;  3QD9 A;  4JBB A;  1XBS A;  3Q6O A;  1HNB A;  4TW5 A;  3LG6 A;  3QAV A;  1JFU A;  4JR4 A;  3KP8 A;  2FD3 A;  5HR2 A;  1EEM A;  5B6M A;  5IMF A;  2E2M A;  3FR6 A;  1GSQ A;  1AQW A;  2XPE A;  1ZL9 A;  3G7J A;  4EF0 A;  2PN8 A;  3TJK A;  2JL4 A;  3QDN A;  4K6X A;  1JLV A;  4PUR A;  2HRA A;  4WET A;  3LFL A;  5GAP D;  1V2A A;  1WPI A;  4HZ4 A;  5LCZ A;  2K6V A;  5IMZ A;  3QMX A;  3CSH A;  1TKD B;  5B8B A;  1PGT A;  1ST9 A;  4D73 B;  3UEM A;  4ZBD A;  1C72 A;  1YDK A;  2C3T A;  4L8E A;  2KOK A;  4EKZ A;  2F8A A;  2B6M A;  1JZO A;  4ECB A;  2G0F A;  3IC4 A;  5IO2 A;  4LMV A;  5AIS A;  1AIU A;  3UAP A;  1GSU A;  1V57 A;  2V2G A;  4L0W A;  3GST A;  2C1Y A;  4TN8 A;  2R2J A;  2HSH A;  2OAD A;  1A8L A;  2JSY A;  1JLW A;  1TDI A;  5AN1 A;  5CRG A;  4KW6 A;  5C04 A;  1FG4 A;  4Q5F A;  1TTZ A;  2IFQ A;  1AW9 A;  1A0R P;  2FGX A;  2VD0 A;  1Z9H A;  2A2S A;  2HNL A;  4ZB9 A;  5HR1 A;  1FOV A;  5J5N A;  5ECP B;  4HU9 A;  2VLU A;  4G0I A;  2FWE A;  1AQV A;  4FQU A;  2JZT A;  2WB9 A;  3ERF A;  10GS A;  5IMA A;  2HXK A;  4XS6 A;  4K0N A;  2O85 A;  2REM A;  2AUV A;  3HA9 A;  1EOH A;  2DJJ A;  4BWQ A;  3F8U A;  2M72 A;  2C80 A;  3IPZ A;  3D6I A;  4ZB8 A;  1EV4 A;  2JU5 A;  2C0D A;  1ZZY A;  1RK4 A;  1QGV A;  3VWU A;  4O5R A;  3KGK A;  4X1U A;  1GUL A;  1AUC A;  5CO3 A;  3GNJ A;  1GH2 A;  2BTO T;  4PQI A;  1G0T A;  5G30 A;  1QMV A;  1TW9 A;  3LSZ A;  2HSY A;  2H70 A;  2YOI A;  3NIV A;  1EV9 A;  2MMZ A;  4LA1 A;  3G7Y A;  4ZIJ A;  2BJX A;  3O6T A;  2DBC A;  4HJ2 A;  2DML A;  3V1W A;  1JZW A;  3P2A A;  3FZA A;  5B8A A;  2OE1 A;  3DXB A;  1SK0 A;  5FT3 A;  3GKN A;  4MCU A;  1O8X A;  2IMF A;  3F4T A;  4H86 A;  5IMD A;  3FHK A;  3RAZ A;  2L5O A;  3GUS A;  3F4S A;  4K8M A;  3ZFL A;  2EIQ A;  3KJY A;  2O8V B;  2WFC A;  3GX0 A;  3ZFB A;  1YF1 A;  1HNA A;  1TP9 A;  2K9F A;  1ERW A;  2GQK A;  3ZVJ A;  1WMJ A;  1GP1 A;  3UBK A;  16GS A;  3D21 A;  1F3B A;  2GQM A;  5DCG A;  1EEJ A;  3GFK A;  1URM A;  3IK7 A;  3M8N A;  3D5J A;  2XHF A;  1X9S B;  2GT5 A;  3C7M A;  2LRT A;  2L57 A;  3UIW A;  2C0E A;  2KP2 A;  2TRX A;  4FYB A;  2NDO A;  1FHE A;  2ZCT A;  2GZP A;  2HZE B;  4EVM A;  2MMA A;  1GNW A;  1K0B A;  4USS A;  2V32 A;  3KD0 A;  3KEB A;  3DEX A;  2GT6 A;  17GS A;  2H1A A;  3AY8 A;  2PUK C;  3GIX A;  4EXJ A;  5F06 A;  3LYK A;  2VOC A;  1X0R A;  2KHP A;  5F07 A;  3GYK A;  3S9F A;  2L6C A;  1GRX A;  3F6D A;  1EOG A;  3VUR A;  1GNE A;  3UVH A;  3GN3 A;  1VRS D;  2VUP A;  1XVW A;  2J9H A;  2YAN A;  2PVO C;  3F6F A;  5JWQ B;  2X64 A;  4AGS A;  2VCZ A;  4J2F A;  1B9X C;  4POL A;  3A2X A;  5HR3 A;  2KLX A;  1V98 A;  1EGO A;  2OBI A;  4DVC A;  2X99 A;  2DJ1 A;  4NMU A;  2HFD A;  2YZH A;  3US3 A;  4KDY A;  2WGR A;  4XHM A;  2GZZ A;  4RQX A;  3H8Q A;  3TUE A;  3D0Z A;  3ZYW A;  3TDG A;  3KP9 A;  5IMC A;  2DMM A;  1S3A A;  3A2V A;  2DJK A;  3L0H A;  2HE3 A;  3UAR A;  1EP7 A;  1WE0 A;  5DQS A;  4IJ3 A;  4K7O A;  1G7E A;  3P90 A;  2GLR A;  4YAV A;  2GDR A;  1G6Y A;  1GTA A;  5G5E A;  1K0A A;  3LEF A;  2QC7 A;  2WDU A;  1VGL A;  4HDE A;  2LS5 A;  4EUY A;  5CRH A;  1E2Y A;  1O81 A;  4G10 A;  3NZN A;  2XBQ A;  5D93 A;  1A24 A;  4ECJ A;  1PQN A;  2C0G A;  1THX A;  3L9U A;  4JRR A;  4AJ8 A;  3SWL A;  4NV2 A;  1JZD A;  4XS4 A;  3VWW A;  4G9H A;  3Q19 A;  2M46 A;  4V1A g;  3K8N A;  3EMX A;  3ZRE A;  3TOT A;  3HVV A;  1SKR B;  1YY7 A;  5ID2 B;  4X43 A;  1BAY A;  5DQY A;  4FIW A;  3FYG A;  4EL1 A;  5DCH A;  4MF6 A;  3WGX A;  1DUG A;  4L5O A;  3JCM L;  2IL3 A;  2AAW A;  2TIR A;  1V40 A;  1U6T A;  1XW9 A;  2OBK A;  3H4K A;  3L9V A;  1QXH A;  3M9K A;  1RQM A;  1W89 A;  3FZ9 A;  2L5L A;  5H5R A;  1A2J A;  3KMO A;  2PBJ A;  1WP0 A;  1XIY A;  1YQ1 A;  1Y25 A;  1B8X A;  3LXT A;  3HDC A;  1CQH A;  1Z5Y E;  5HFG A;  4FYC A;  1TRU A;  4YAP A;  1XWG A;  2KP1 A;  3CTG A;  2JSZ A;  2MBT A;  3GHA A;  4HQZ A;  2EC4 A;  4XS1 A;  1BX9 A;  4EC0 A;  2H1G A;  1GUH A;  5F0G A;  2WCI A;  4JZQ A;  3DML A;  4LLR A;  4P3Y B;  1F3A A;  1XWA A;  1PA3 A;  2NPB A;  2QKE A;  1ERV A;  5F8B A;  1QUW A;  1OC8 A;  4PUA A;  5CP1 A;  5KEJ A;  1RW1 A;  3VPQ A;  1U87 A;  2OKA A;  4XRA A;  2HRK B;  2YV7 A;  2B1K A;  1F37 A;  1X5D A;  2DIZ A;  4NXI A;  3CSI A;  3KIJ A;  2CX3 A;  3GMF A;  3TCO A;  5C00 A;  3WT2 A;  1GSE A;  1GSS A;  3VK9 A;  2H66 A;  2DIY A;  3WYW A;  3C1R A;  2FUG 2;  2LJR A;  3GKM A;  3R3E A;  3L9S A;  4GQF A;  3CRT A;  3N9J A;  3ISO A;  2PGT A;  5D9V A;  4TVE A;  2RM6 A;  5HFK A;  5CAX A;  3ZML A;  4KSM A;  1ERT A;  2CZ2 A;  3TJB A;  1FAA A;  2B7J A;  3PR8 A;  5FWG A;  2H6X A;  2GQL A;  2GS3 A;  2LQO A;  4JU5 A;  4RUV A;  2LRN A;  4CW9 A;  4OCF A;  4LMW A;  2R6K A;  2N5A A;  4FYU A;  3WGE A;  3TJJ A;  2IMD A;  2X8G A;  2HI7 A;  5IOW A;  1T1V A;  1XWC A;  2L4Q A;  5CYY A;  3EC3 A;  3RHB A;  3F3Q A;  1OVN A;  1YEX A;  3UJ1 A;  5DVB A;  1U3A A;  3GL3 A;  1Z3E A;  5DJM A;  4ILF A;  3QPM A;  2E2G A;  4I5Q A;  3F0I A;  1OC9 B;  4WF5 A;  2FHE A;  4MAB A;  1MEK A;  3TJG A;  4POM A;  3FZ5 A;  5ELA A;  3CTF A;  2VM2 A;  3EYT A;  1XVQ A;  2H19 A;  3GTU B;  5ECO B;  3TRX A;  3IC8 A;  3IDV A;  4EO3 A;  1QQ2 A;  2HSM B;  2AV4 A;  3GH6 A;  2FLS A;  3MDK A;  2K8S A;  3TKS C;  4TR0 A;  3CSJ A;  5ECL B;  2WS2 A;  2FWG A;  2HZF A;  2VCT A;  3HVX A;  3IXR A;  2GSS A;  2CVB A;  4QQ7 A;  5E4W A;  2YWI A;  5J9C A;  3KCM A;  5ECI B;  3C73 A;  3QAW A;  1DE1 A;  3H93 A;  1HYU A;  3LGC A;  2ZNM A;  2H6Z A;  1ZOF A;  2H30 A;  2I1U A;  4MZC A;  4KSO A;  4AJ6 A;  2AJQ B;  1FB0 A;  3F3R A;  5KN3 A;  2NTO A;  3TJF A;  3HJM A;  4I97 A;  5B7C A;  1M9B A;  2LV3 A;  4PUF C;  1TU8 A;  2CQ9 A;  4BVX B;  5DAK B;  2QSI A;  1K3L A;  2IME A;  2K8V A;  1OYJ A;  3EUR A;  3EIN A;  2H8L A;  4PQ1 A;  1A2M A;  3HXS A;  4EE0 A;  4KND A;  1O73 A;  4NAX A;  3ZVJ D;  1MDK A;  4N11 A;  3UBL A;  1TK8 B;  4FO5 A;  4O32 A;  1EWX A;  2PER A;  1O7U A;  1ZYE A;  2DLX A;  1DSB A;  3EWL A;  3HHV A;  2VL9 A;  1IYH A;  1R7H A;  3DYR A;  2OA7 A;  1TI1 A;  1TK0 B;  1ZGN A;  1S3C A;  1GTB A;  5IMV A;  11GS A;  5CRE A;  1H75 A;  4K1F A;  3D4T A;  2CVK A;  3FY7 A;  2VIM A;  3CYN A;  1GTI A;  2VL2 C;  2XC2 A;  2LJA A;  1X9W B;  5H5Q A;  3ME7 A;  2TRC P;  1FVK A;  4ML1 A;  4MF7 A;  3W6G A;  3IA1 A;  2CX4 A;  2RUF A;  3P8W A;  4DSS B;  3DGQ A;  1GL8 A;  2B5E A;  2O87 A;  3PH9 A;  4TXO B;  4ZBA A;  4YQM A;  3IV4 A;  2ON7 A;  5IOX A;  2YCD A;  1X5E A;  4WBR D;  2VCW A;  7GSS A;  3M9J A;  2EIO A;  3H1N A;  3RHC A;  2D2Z A;  2HRF A;  3DKS A;  1XW6 A;  1R5P A;  3ED3 A;  3EE2 A;  1USB A;  2CA8 A;  3CXG A;  3EVI A;  4D73 A;  3BJ5 A;  6GST A;  2I4A A;  1SEN A;  5D9W A;  3G9B A;  5A4V A;  3IE3 A;  1FW1 A;  2R3X A;  1PL2 A;  3F9U A;  5DDL A;  1E6B A;  5AIV A;  4BVY B;  1MDI A;  5KN1 A;  3BCK A;  3CMI A;  3LJR A;  3GH9 A;  4L5L A;  1ILO A;  5F05 A;  5CNW A;  2PU9 C;  4MPF A;  2V41 A;  1YF0 A;  2HSM A;  3E0U A;  3BD2 A;  4ZB6 A;  4GXZ A;  2A4V A;  4NHZ A;  19GS A;  1EGR A;  1KEB A;  3OR5 A;  4KCA A;  2N5F A;  4JE1 A;  2K18 A;  3FR3 A;  3CRU A;  2FWF A;  2IJY A;  5DAL B;  2FNO A;  3U5R E;  2H0H A;  1F6M C;  3LQ7 A;  2VLT A;  4AJ7 A;  1VF2 A;  4GTU A;  5AGY A;  4MH3 A;  4MJC A;  4HS1 A;  3HZ8 A;  1OKT A;  4KGI A;  2GZY A;  5D9X A;  2FWH A;  3VLN A;  3HD5 A;  3PGT A;  4I6X A;  2LNS A;  3TGZ A;  1PMT A;  3HZ4 A;  2F51 A;  3FR9 A;  3HJO A;  4GF0 A;  3ZTL A;  3UMA A;  4XRD A;  5BMU A;  2V1M A;  4OFT A;  6GSV A;  1Y6E A;  3IR4 A;  4TKY A;  2B1L A;  2YWM A;  4GST A;  2OJL A;  1FO5 A;  3TKQ A;  4PQH A;  1T4Z A;  4KB3 A;  4NHW A;  2P5Q A;  4WR5 A;  3ZZX A;  2DC5 A;  4G0K A;  13GS A;  4TR1 B;  5HFI A;  1U88 A;  2E7P A;  2O89 A;  4ACS A;  6GSY A;  2MYG A;  3RDW A;  3ZMK A;  5J4U A;  1MTC A;  1SYR A;  3I6A A;  4BL7 B;  1HQO A;  2CZ3 A;  2PMT A;  2GGT A;  1A23 A;  1XWK A;  4ECI A;  5H5S A;  3W8S A;  4ID0 A;  2JAC A;  3D22 A;  2VCQ A;  2A2R A;  4OMV A;  4Q5N A;  2L4C A;  3DD3 A;  4MF5 A;  2RLI A;  3MNG A;  4TR3 A;  3G7I A;  4PNG A;  1PX6 A;  1M7T A;  1ON4 A;  1Q4J A;  1OC3 A;  3EMP A;  4V2N A;  4OO4 A;  1Z7P A;  2PVQ A;  2DJ0 A;  4DSS A;  1SJZ A;  2MZC A;  5ECK B;  1A8Y A;  3C71 A;  3LXZ A;  2RUE A;  4TXV A;  4YQV A;  2KUC A;  3CBU A;  3HJP A;  2JZS A;  4L0U A;  3VWX A;  1FVJ A;  1KNG A;  2P5R A;  5ENU A;  3DWV A;  3IOS A;  4EDY A;  4IVF A;  2X8H A;  4OCE A;  3O3T A;  5A4U A;  4WBJ A;  1XOB A;  2ON5 A;  1QFN A;  5DBQ A;  1CQG A;  2HYX A;  4ZL7 A;  4GWR A;  4BVY A;  3IAS 2;  1V9W A;  2HZE A;  3TKR A;  3FW2 A;  1PKW A;  5D96 A;  1GUM A;  5CRD A;  1XXU A;  3VPT A;  3M0F A;  4ZIL A;  3IBH A;  3ZLP A;  4GLT A;  2IMI A;  3KZQ A;  3UVT A;  1K0D A;  3E3E A;  3M3M A;  1PRX A;  2GTU A;  2IIY A;  3WD6 A;  2N5B A;  4GRF A;  1YEP A;  2I81 A;  2GVP A;  4MZB A;  3W8J A;  1AC1 A;  2L6D A;  1ERU A;  4F03 A;  1T4Y A;  5IM9 A;  6GSU A;  1SKS B;  2WUL A;  5LNK e;  1XOA A;  1KBN A;  1M0U A;  3GKK A;  1S3D A;  5ECM B;  2I9H A;  4KDX A;  4QL9 A;  2WJU A;  2YJ7 A;  4WKW A;  3A2W A;  5IO0 A;  5IPG A;  1O8W A;  4MLY A;  3TOU A;  4LL4 B;  1TRW A;  1HD2 A;  1OKD A;  1PD2 1;  2R5G A;  3GSS A;  2I3Y A;  4G2E A;  4F0C A;  5G2Z A;  3KXO A;  1XW5 A;  4IQA A;  4DEJ A;  4PNF A;  2BMX A;  1DE2 A;  1M2A A;  1I9D A;  3GL5 A;  4LL1 B;  1XWB A;  2H01 A;  1Z6M A;  3MWH A;  3QCP A;  1JHB A;  2LRC A;  5EY6 A;  2HRN A;  5A4W A;  3IHQ A;  5GZZ B;  4G0L A;  2LNT A;  4V2M A;  1K3O A;  3ERG A;  3DVX A;  2YPM A;  2LUS A;  4N10 A;  4RQR A;  4TR4 A;  5HR0 A;  4IP6 A;  2O7K A;  1SYX A;  3KMN A;  1U3I A;  2YWN A;  4F82 A;  3RPP A;  2MBS A;  1GSD A;  2ES7 A;  4DSQ A;  1K0N A;  5ECQ B;  2B3S A;  4BWS A;  4K0G A;  4O7H A;  1WIK A;  2RII A;  1GUK A;  3I9V 2;  1R5A A;  3VI5 A;  1MDJ A;  1GSF A;  1ZCP A;  3A3T A;  3J7Y k;  5JCU A;  4FH8 A;  4V2L A;  3R2Q A;  5E59 A;  5ID2 A;  3PIN A;  18GS A;  3BOA A;  3IRA A;  1ACV A;  5G1L A;  2C8U A;  1BG5 A;  4DSR A;  3NOF A;  3ZIJ A;  1SK1 A;  2H0I A;  2PWJ A;  4IJI A;  1R26 A;  3ERW A;  1Q98 A;  1K0C A;  3QAG A;  2P31 A;  4BA7 A;  1T00 A;  2H76 A;  4OWY A;  1Z6N A;  5JCG A;  1O6J A;  2FA8 A;  4F9Z A;  5FHI A;  3HKR A;  2JAD A;  4MPG A;  4GSN A;  4MJA A;  5HQP A;  1Z7R A;  5D73 A;  1T8E B;  2H1B A;  3LYP A;  1K0M A;  1VF1 A;  2YP6 A;  4IW9 A;  4O92 A;  2OE0 A;  4J57 E;  4NPB A;  3J7Y b;  1X9M B;  1MD4 A;  2VLV A;  5J9B A;  5CRW A;  5EVO A;  1I5G A;  2NBS A;  1GLP A;  4MDC A;  1UN2 A;  3HVS A;  4KF9 A;  3C8E A;  1UC7 A;  4GQC A;  2C4J A;  1N8J A;  3ZIV A;  1MD3 A;  4IBP A;  2LTK A;  1UA5 A;  4KCE A;  2HRK A;  4KX4 A;  4I8B A;  3F63 A;  2GSR A;  2YZU A;  2J23 A;  4IHU A;  2R4V A;  5JWO B;  4AF2 A;  1ABA A;  2CAQ A;  4E8E A;  5EPF A;  9GSS A;  1SJ6 A;  1THO A;  5KN0 A;  4I2U A;  4V1A p;  4HUA A;  4G19 A;  4K2D A;  4GSS A;  4ECC A;  4IN0 A;  2VM1 A;  2IPA A;  1PN9 A;  2EIR A;  5J41 A;  1SL1 B;  5ABR A;  5ECS A;  3RBT A;  1DBY A;  2B7K A;  1TJD A;  1BYE A;  4ZXG A;  1X5C A;  1N2A A;  4ISD A;  4Z7X A;  1VF4 A;  2FCH A;  3UL3 A;  1NW2 A;  2XBI A;  1NHO A;  2LKU A;  1TRS A;  1TXX A;  4K7I A;  2Z9S A;  3QR6 A;  4IKH A;  2OE3 A;  3EU3 A;  1B9Y C;  2MMO A;  3GKX A;  4YQU A;  2VCV A;  4KA0 A; 
#chains in the Genus database with same CATH topology
 3HMJ G;  2WRT A;  1M3J A;  3PPU A;  3C1S A;  4NWY A;  4K9Z A;  3MSZ A;  2RM5 A;  1PKZ A;  2H75 A;  1H4O A;  4ML6 A;  3I43 A;  5JWR B;  1SL0 B;  2QGV A;  1NSW A;  5GST A;  4MP4 A;  2B5X A;  3DRN A;  1TU7 A;  1LBK A;  1OAZ A;  1AAZ A;  5A34 A;  5G5F A;  1SKW B;  4KH7 A;  3TB2 A;  3I69 A;  1M2B A;  2B5Y A;  4QL7 A;  4XS4 B;  4OO5 A;  4MK3 A;  4YH2 A;  3WGD A;  6GSS A;  1FOH A;  5D8I A;  5B6N A;  5IPH A;  3KM6 A;  4AKG A;  1F9M A;  3KTL A;  2WW1 A;  1OC9 A;  6GSW A;  1PX7 A;  3EU4 A;  4MZW A;  3HCZ A;  2YWO A;  3GTU A;  1F2E A;  4HJM A;  4J56 E;  3Q74 A;  1WOU A;  2OAC A;  1SJI A;  2IWT A;  3L78 A;  3HYP A;  2ALB A;  4XIH A;  2GSQ A;  2EFC A;  1G7O A;  3TRP A;  2F9S A;  2YV9 A;  3L4N A;  3WT1 A;  3FKF A;  4WXT A;  2WW2 A;  4ZL8 A;  5G31 A;  1TK5 B;  3FZ4 A;  2YNX A;  4I2T A;  4NV5 A;  3N5O A;  1PL1 A;  1B4Q A;  5COH A;  1YZX A;  3KH9 A;  3VFI A;  1R4W A;  2V6O A;  5KOW A;  1LJR A;  3FEU A;  3GV1 A;  1EZK A;  1LU4 A;  1K0O A;  1W4V A;  3QOU A;  4A5P A;  2CVD A;  1TOF A;  4N0V A;  3O76 A;  4HQS A;  2VL3 A;  3D4M A;  5G1K A;  2H71 A;  20GS A;  3F4R A;  4XCS A;  4BVX A;  5GSS A;  5DAK A;  2H6Y A;  4EDZ A;  4KUN A;  2F8F A;  6GSX A;  5ELG A;  4ULX A;  1KTE A;  4RI7 A;  2WZ9 A;  1J9B A;  4PX1 A;  5DJL A;  1GSY A;  1BJX A;  4MMM A;  3APS A;  5GAN D;  4F2I A;  2HT9 A;  1J0F A;  4WF4 A;  1B48 A;  3VWV A;  1M99 A;  2HSN B;  3QFA C;  4HI7 A;  4CDO A;  4CHS A;  2G2Q A;  2LEG A;  1G6W A;  2ZUP A;  5IQY A;  4Q5Q A;  2IN3 A;  2C0F A;  3UOM A;  2EFD A;  2UZ8 A;  1JZR A;  5LD0 A;  3DIE A;  4ZBB A;  1K3Y A;  1A0F A;  2PPT A;  4MJB A;  2AYT A;  4KAE A;  3E9J B;  4XTS A;  3IK9 A;  4GCI A;  3FRC A;  1A2L A;  5KN2 A;  4PGT A;  1SU9 A;  2AB6 A;  3KTB A;  2DJ2 A;  1YKA A;  2CT6 A;  4HZ2 A;  5ECN B;  2X49 A;  3BCI A;  4HEA 2;  22GS A;  3ME8 A;  3LOR A;  1PSQ A;  4PTS A;  5AIX A;  4KE3 A;  2M80 A;  5ECH B;  3ZL5 A;  12GS A;  1ZMA A;  4TOP A;  4X0X A;  1ZYQ B;  4POB A;  2VO4 A;  3APQ A;  4OD7 A;  4TXO A;  1WWJ A;  1AQX A;  3TKS A;  1SD9 A;  5BRT A;  4IP1 A;  4BIK A;  2H74 A;  14GS A;  4MJE A;  2HLS A;  2XPD A;  3TKP A;  4JED A;  1EP8 A;  1VF3 A;  3P7X A;  5IIZ A;  1O85 A;  4ZL9 A;  5EL8 A;  4IQ1 A;  4FXY P;  1XG8 A;  5A5K A;  3RPN A;  1J08 A;  4IEL A;  1XPV A;  1FB6 A;  1IYI A;  1XCC A;  4HU7 A;  4TRX A;  1SL2 B;  2FA4 A;  2HQT A;  2QA2 A;  3MAK A;  1BED A;  4F0B A;  1M9A A;  1ML6 A;  1GWC A;  2DJ3 A;  4MA9 A;  4Z2U A;  3ZIT A;  2LJK A;  3KH7 A;  2H72 A;  1V58 A;  3TKS E;  1WRY A;  2GST A;  1UVZ A;  4N0Z A;  2IMK A;  4MH2 A;  2VCX A;  3CWG A;  2VD1 A;  2MMN A;  3H79 A;  2NVL A;  3HY2 A;  2V6K A;  3GUR A;  2IFQ B;  3QFB C;  2C3Q A;  4OFM A;  4HSC X;  4HOJ A;  5J40 A;  4OFN A;  2H1D A;  2H73 A;  5DAL A;  5J3R A;  4JR6 A;  2JZR A;  5D9T A;  1TI3 A;  3GRX A;  4O5Q A;  4RI6 A;  2LST A;  4IGJ A;  5ECR B;  4WEY A;  2P0G A;  1GTU A;  4E68 A;  1NM3 A;  1WJK A;  2L59 A;  8GSS A;  2R37 A;  2VAF A;  2CAI A;  3SBC A;  3M1G A;  1T3B A;  3TRQ A;  2VL2 A;  2E0Q A;  1YJ6 A;  4KDU A;  1B4P A;  3BBY A;  3U6V A;  3DVW A;  4POK A;  2X8C A;  1TRV A;  2AHE A;  1YKC A;  1HNC A;  4N30 A;  1M2D A;  4WR4 A;  1SK2 A;  1SD8 A;  5INY A;  4IS0 A;  4E8H A;  3LWA A;  4PXO A;  2YN1 A;  1M3I A;  1OE8 A;  1T7P B;  2DSA A;  5L71 A;  2F3M A;  1XZO A;  1OE7 A;  5JCW A;  3APO A;  2LQQ A;  4TR1 A;  3GX8 A;  2YJH A;  4Q5R A;  3FK8 A;  1XFL A;  1NHY A;  2CV4 A;  3A5W A;  2FY6 A;  4K7N A;  4BPY A;  4Z2T A;  1AXD A;  1GLQ A;  3ZRD A;  3IAM 2;  4BL7 A;  2C3N A;  1QK8 A;  2WW3 A;  3Q18 A;  3GA4 A;  1BQ7 A;  3VI7 A;  2H0G A;  3QD9 A;  4JBB A;  1XBS A;  3Q6O A;  1HNB A;  4TW5 A;  3LG6 A;  3QAV A;  1JFU A;  2EFE A;  1SVM A;  4JR4 A;  3KP8 A;  2FD3 A;  5HR2 A;  1EEM A;  5B6M A;  5IMF A;  2E2M A;  3FR6 A;  2R0C A;  1GSQ A;  1AQW A;  2XPE A;  1ZL9 A;  3G7J A;  4EF0 A;  2PN8 A;  3TJK A;  2JL4 A;  3QDN A;  4K6X A;  1JLV A;  4PUR A;  2HRA A;  4WET A;  3LFL A;  5GAP D;  1V2A A;  1WPI A;  4HZ4 A;  5LCZ A;  2K6V A;  5IMZ A;  2X4A A;  3QMX A;  3CSH A;  1TKD B;  5B8B A;  1PGT A;  1ST9 A;  4D73 B;  1BG1 A;  3UEM A;  4ZBD A;  1C72 A;  1YDK A;  2C3T A;  4L8E A;  2KOK A;  4EKZ A;  2F8A A;  1I1I P;  2B6M A;  1JZO A;  4ECB A;  2G0F A;  3IC4 A;  5IO2 A;  4LMV A;  5AIS A;  1AIU A;  3UAP A;  1GSU A;  1V57 A;  2V2G A;  4L0W A;  3GST A;  2C1Y A;  4TN8 A;  2R2J A;  2HSH A;  2OAD A;  1A8L A;  2JSY A;  1JLW A;  1TDI A;  5AN1 A;  5CRG A;  4KW6 A;  5C04 A;  1FG4 A;  4Q5F A;  1TTZ A;  2IFQ A;  1S4B P;  1AW9 A;  1A0R P;  4AKI A;  2FGX A;  2VD0 A;  1Z9H A;  2A2S A;  2HNL A;  4ZB9 A;  5HR1 A;  1FOV A;  5J5N A;  5ECP B;  4HU9 A;  2VLU A;  4G0I A;  2FWE A;  1AQV A;  4FQU A;  2JZT A;  2WB9 A;  4PI0 C;  3ERF A;  10GS A;  5IMA A;  4YKF A;  2HXK A;  4XS6 A;  4K0N A;  2O85 A;  2REM A;  5BMU B;  2AUV A;  3HA9 A;  1EOH A;  2DJJ A;  4BWQ A;  3F8U A;  2M72 A;  4K5R A;  2C80 A;  3IPZ A;  3D6I A;  4ZB8 A;  1EV4 A;  2JU5 A;  2C0D A;  1ZZY A;  1RK4 A;  1QGV A;  3VWU A;  4O5R A;  3KGK A;  4X1U A;  1GUL A;  1AUC A;  5CO3 A;  3GNJ A;  1GH2 A;  2BTO T;  4PQI A;  3TU3 B;  1G0T A;  5G30 A;  1QMV A;  1TW9 A;  3LSZ A;  2HSY A;  2H70 A;  2YOI A;  3NIV A;  1EV9 A;  3RFR C;  2MMZ A;  4LA1 A;  4GDF A;  3G7Y A;  4ZIJ A;  3FMW A;  2BJX A;  2OT3 A;  3O6T A;  2DBC A;  4HJ2 A;  2DML A;  3V1W A;  1JZW A;  3P2A A;  3FZA A;  5B8A A;  2OE1 A;  3DXB A;  1SK0 A;  5FT3 A;  3GKN A;  4MCU A;  1O8X A;  2IMF A;  3F4T A;  4H86 A;  5IMD A;  3FHK A;  3RAZ A;  2L5O A;  3IHG A;  2QA1 A;  3GUS A;  3F4S A;  4K8M A;  3ZFL A;  2EIQ A;  3KJY A;  2O8V B;  1S3R A;  2WFC A;  3GX0 A;  3ZFB A;  1YF1 A;  1HNA A;  1TP9 A;  1TXU A;  2K9F A;  1ERW A;  2GQK A;  3ZVJ A;  1WMJ A;  1GP1 A;  3UBK A;  16GS A;  3D21 A;  1F3B A;  2GQM A;  5DCG A;  1EEJ A;  3GFK A;  1URM A;  3IK7 A;  3M8N A;  3D5J A;  2XHF A;  1X9S B;  2GT5 A;  3C7M A;  2LRT A;  2L57 A;  3UIW A;  2C0E A;  2KP2 A;  2TRX A;  4FYB A;  2NDO A;  1FHE A;  2ZCT A;  2GZP A;  2HZE B;  4EVM A;  2MMA A;  1GNW A;  1K0B A;  4USS A;  2V32 A;  3KD0 A;  3KEB A;  3DEX A;  2GT6 A;  17GS A;  2H1A A;  3AY8 A;  2PUK C;  3GIX A;  4EXJ A;  5F06 A;  3LYK A;  2VOC A;  1X0R A;  2KHP A;  5F07 A;  3GYK A;  3S9F A;  2L6C A;  1GRX A;  2A4H A;  3F6D A;  1EOG A;  3VUR A;  1GNE A;  3UVH A;  3GN3 A;  1VRS D;  2VUP A;  1XVW A;  2J9H A;  2YAN A;  2PVO C;  3F6F A;  5JWQ B;  2X64 A;  4AGS A;  2VCZ A;  4G01 A;  4J2F A;  1B9X C;  4POL A;  3A2X A;  5HR3 A;  2KLX A;  1V98 A;  3EPT A;  1EGO A;  2OBI A;  4DVC A;  3CQF A;  2X99 A;  2DJ1 A;  3MIX A;  4NMU A;  2HFD A;  2YZH A;  4EIQ A;  3US3 A;  4KDY A;  2WGR A;  4XHM A;  2GZZ A;  4RQX A;  3H8Q A;  3TUE A;  3D0Z A;  3ZYW A;  2DKH A;  3TDG A;  3KP9 A;  5IMC A;  2DMM A;  1S3A A;  3A2V A;  3A5I A;  2DJK A;  3L0H A;  2HE3 A;  3UAR A;  1EP7 A;  1WE0 A;  5DQS A;  4IJ3 A;  4K7O A;  1G7E A;  3P90 A;  2GLR A;  4YAV A;  2GDR A;  3RGB C;  1G6Y A;  1GTA A;  5G5E A;  1K0A A;  3LEF A;  2QC7 A;  2WDU A;  1VGL A;  4HDE A;  2LS5 A;  5KOX A;  4EUY A;  5CRH A;  1E2Y A;  1O81 A;  4G10 A;  3NZN A;  2XBQ A;  5D93 A;  1A24 A;  4ECJ A;  1PQN A;  2C0G A;  1THX A;  3L9U A;  4JRR A;  4AJ8 A;  3SWL A;  4NV2 A;  1JZD A;  4XS4 A;  3VWW A;  4G9H A;  3Q19 A;  2M46 A;  4V1A g;  3K8N A;  3EMX A;  3ZRE A;  3TOT A;  3HVV A;  1SKR B;  1YY7 A;  5ID2 B;  4X43 A;  2O36 A;  1BAY A;  5DQY A;  3FYG A;  4FIW A;  4EL1 A;  5DCH A;  4MF6 A;  3WGX A;  1DUG A;  4L5O A;  3JCM L;  2IL3 A;  2AAW A;  2TIR A;  1V40 A;  1YEW C;  1U6T A;  1XW9 A;  2OBK A;  3H4K A;  3L9V A;  1QXH A;  3M9K A;  3HVN A;  1RQM A;  1W89 A;  3FZ9 A;  2L5L A;  5H5R A;  1A2J A;  3KMO A;  2PBJ A;  1WP0 A;  1XIY A;  1YQ1 A;  1Y25 A;  1B8X A;  3LXT A;  3HDC A;  1CQH A;  1Z5Y E;  5HFG A;  4FYC A;  1TRU A;  4YAP A;  1XWG A;  2KP1 A;  3CTG A;  2JSZ A;  2MBT A;  3GHA A;  4HQZ A;  2EC4 A;  4XS1 A;  1BX9 A;  4EC0 A;  2H1G A;  1GUH A;  5F0G A;  2WCI A;  4JZQ A;  3DML A;  4LLR A;  4P3Y B;  1F3A A;  1XWA A;  1PA3 A;  2NPB A;  2QKE A;  1ERV A;  5F8B A;  1QUW A;  1OC8 A;  4PUA A;  5CP1 A;  5KEJ A;  1RW1 A;  3VPQ A;  1U87 A;  2WVX B;  2OKA A;  4XRA A;  2HRK B;  2YV7 A;  2B1K A;  1F37 A;  1X5D A;  2DIZ A;  4NXI A;  3CSI A;  3KIJ A;  2CX3 A;  3GMF A;  3TCO A;  5C00 A;  2HSN A;  3WT2 A;  1GSE A;  1GSS A;  3VK9 A;  2H66 A;  2DIY A;  3WYW A;  3C1R A;  2FUG 2;  2LJR A;  3GKM A;  3R3E A;  3L9S A;  4GQF A;  3CRT A;  3N9J A;  3ISO A;  2PGT A;  5D9V A;  4TVE A;  2RM6 A;  5HFK A;  5CAX A;  3ZML A;  4KSM A;  1ERT A;  2CZ2 A;  3TJB A;  1FAA A;  2B7J A;  3PR8 A;  5FWG A;  2H6X A;  2GQL A;  2GS3 A;  2LQO A;  4JU5 A;  4RUV A;  2LRN A;  4CW9 A;  4CY6 A;  4OCF A;  4LMW A;  4AI6 A;  2R6K A;  2N5A A;  4FYU A;  3WGE A;  3TJJ A;  2IMD A;  2X8G A;  2HI7 A;  5IOW A;  1T1V A;  2VKZ G;  4QMK A;  1BF5 A;  1XWC A;  2L4Q A;  5CYY A;  3EC3 A;  3RHB A;  3F3Q A;  1OVN A;  1YEX A;  3UJ1 A;  5DVB A;  1U3A A;  3GL3 A;  1Z3E A;  5DJM A;  4ILF A;  3QPM A;  2E2G A;  4I5Q A;  3F0I A;  1OC9 B;  4WF5 A;  2WW0 A;  2FHE A;  4MAB A;  1MEK A;  3TJG A;  4POM A;  3FZ5 A;  5ELA A;  3CTF A;  2VM2 A;  3EYT A;  1XVQ A;  2H19 A;  3GTU B;  5ECO B;  3TRX A;  3IC8 A;  3IDV A;  4EO3 A;  1QQ2 A;  2HSM B;  5A5H B;  2AV4 A;  3GH6 A;  2FLS A;  3MDK A;  2K8S A;  3TKS C;  4TR0 A;  3CSJ A;  5ECL B;  2WS2 A;  2FWG A;  2HZF A;  2VCT A;  3HVX A;  3IXR A;  2GSS A;  2CVB A;  4QQ7 A;  5E4W A;  2YWI A;  4YKG A;  5J9C A;  3KCM A;  5ECI B;  3C73 A;  3QAW A;  1DE1 A;  3H93 A;  2R0G A;  1HYU A;  3LGC A;  2ZNM A;  2H6Z A;  1ZOF A;  2H30 A;  2I1U A;  4MZC A;  4KSO A;  4AJ6 A;  2AJQ B;  1FB0 A;  3F3R A;  5KN3 A;  2NTO A;  3TJF A;  3HJM A;  4I97 A;  5B7C A;  1M9B A;  4EIP A;  2LV3 A;  4PUF C;  1TU8 A;  2CQ9 A;  4BVX B;  5DAK B;  2QSI A;  1K3L A;  2IME A;  2K8V A;  1OYJ A;  3EUR A;  3EIN A;  2H8L A;  4PQ1 A;  1A2M A;  3HXS A;  4EE0 A;  4KND A;  1O73 A;  4NAX A;  3ZVJ D;  1MDK A;  4N11 A;  3UBL A;  1TK8 B;  4FO5 A;  4O32 A;  1EWX A;  2PER A;  1O7U A;  1ZYE A;  2DLX A;  1DSB A;  3EWL A;  3HHV A;  5J4V A;  2VL9 A;  1IYH A;  1R7H A;  3DYR A;  2OA7 A;  1TI1 A;  1TK0 B;  1ZGN A;  1S3C A;  4ZB7 A;  1GTB A;  5IMV A;  11GS A;  2WZS A;  5CRE A;  1H75 A;  4K1F A;  3D4T A;  2CVK A;  3FY7 A;  2VIM A;  3CYN A;  1GTI A;  2VL2 C;  2XC2 A;  2LJA A;  1X9W B;  5H5Q A;  3ME7 A;  2TRC P;  1FVK A;  4ML1 A;  4MF7 A;  3W6G A;  3IA1 A;  2CX4 A;  2RUF A;  3P8W A;  4K5S A;  4DSS B;  3DGQ A;  1GL8 A;  2B5E A;  2O87 A;  3PH9 A;  4TXO B;  4ZBA A;  4YQM A;  3IV4 A;  2ON7 A;  5IOX A;  2YCD A;  1X5E A;  4WBR D;  2VCW A;  7GSS A;  3M9J A;  2EIO A;  3H1N A;  3RHC A;  2D2Z A;  2HRF A;  3DKS A;  1XW6 A;  2H1L A;  1R5P A;  2UV8 G;  3ED3 A;  3EE2 A;  1USB A;  2CA8 A;  3CXG A;  3EVI A;  4D73 A;  3BJ5 A;  6GST A;  2I4A A;  1SEN A;  5D9W A;  3G9B A;  5A4V A;  4CY8 A;  3IE3 A;  1FW1 A;  1Y1U A;  2R3X A;  1PL2 A;  3F9U A;  5DDL A;  1E6B A;  4K2X A;  2DKI A;  5AIV A;  4BVY B;  1MDI A;  5KN1 A;  3BCK A;  3CMI A;  3LJR A;  3GH9 A;  4L5L A;  1ILO A;  5F05 A;  5CNW A;  2PU9 C;  4MPF A;  2V41 A;  1YF0 A;  2HSM A;  5A5H A;  3E0U A;  3BD2 A;  4ZB6 A;  4GXZ A;  2A4V A;  4NHZ A;  19GS A;  1EGR A;  1KEB A;  3OR5 A;  4KCA A;  2N5F A;  4JE1 A;  2K18 A;  3FR3 A;  3CRU A;  2FWF A;  5A1N B;  2IJY A;  5DAL B;  2FNO A;  3U5R E;  2H0H A;  1F6M C;  3LQ7 A;  2VLT A;  4AJ7 A;  1VF2 A;  4GTU A;  5AGY A;  4MH3 A;  4MJC A;  4HS1 A;  3HZ8 A;  1OKT A;  4KGI A;  2GZY A;  5D9X A;  2FWH A;  3VLN A;  3HD5 A;  3PGT A;  4I6X A;  2LNS A;  3TGZ A;  1PMT A;  3HZ4 A;  2F51 A;  3FR9 A;  3HJO A;  4GF0 A;  3ZTL A;  3UMA A;  4XRD A;  5BMU A;  2V1M A;  4OFT A;  6GSV A;  1Y6E A;  3IR4 A;  4TKY A;  2B1L A;  2YWM A;  4GST A;  2OJL A;  1FO5 A;  3TKQ A;  4PQH A;  1T4Z A;  4KB3 A;  4NHW A;  2P5Q A;  2EFH A;  4WR5 A;  3ZZX A;  2DC5 A;  4G0K A;  13GS A;  4TR1 B;  5HFI A;  1U88 A;  2E7P A;  2O89 A;  4ACS A;  6GSY A;  2MYG A;  3RDW A;  3ZMK A;  5J4U A;  1MTC A;  1SYR A;  3I6A A;  4BL7 B;  1HQO A;  2CZ3 A;  4W66 A;  2PMT A;  2GGT A;  1A23 A;  1XWK A;  4ECI A;  4N3Z A;  5H5S A;  3W8S A;  1SVL A;  4ID0 A;  2JAC A;  3D22 A;  2VCQ A;  2WVZ A;  2A2R A;  4OMV A;  4Q5N A;  2L4C A;  3DD3 A;  4MF5 A;  2RLI A;  3MNG A;  4TR3 A;  3G7I A;  4PNG A;  1PX6 A;  1M7T A;  1ON4 A;  1Q4J A;  1OC3 A;  3EMP A;  4V2N A;  1PN0 A;  4OO4 A;  1Z7P A;  2PVQ A;  2DJ0 A;  4DSS A;  1SJZ A;  2MZC A;  5J47 A;  5ECK B;  1A8Y A;  3C71 A;  3LXZ A;  2RUE A;  4TXV A;  4YQV A;  1N25 A;  2KUC A;  3CBU A;  3HJP A;  2JZS A;  4L0U A;  3VWX A;  1FVJ A;  1KNG A;  2P5R A;  5ENU A;  3DWV A;  3IOS A;  4EDY A;  1SVO A;  4IVF A;  4Z2R A;  3MYD A;  2X8H A;  4OCE A;  3O3T A;  5A4U A;  4WBJ A;  1XOB A;  2ON5 A;  1QFN A;  5DBQ A;  1CQG A;  2HYX A;  5J4Y A;  1ZYP A;  4ZL7 A;  4GWR A;  4BVY A;  3IAS 2;  1V9W A;  2HZE A;  3TKR A;  3FW2 A;  1PKW A;  5D96 A;  1GUM A;  5CRD A;  1XXU A;  3VPT A;  3M0F A;  4ZIL A;  3IBH A;  3ZLP A;  4GLT A;  2IMI A;  3KZQ A;  3UVT A;  4PI2 C;  1K0D A;  3E3E A;  3M3M A;  1PRX A;  4MNN A;  2A2P A;  2GTU A;  2IIY A;  3WD6 A;  2N5B A;  4GRF A;  5A1N A;  1YEP A;  2I81 A;  2GVP A;  4MZB A;  3W8J A;  1AC1 A;  2L6D A;  1ERU A;  4F03 A;  1T4Y A;  3CHX C;  5IM9 A;  6GSU A;  1PFO A;  1SKS B;  2WUL A;  5LNK e;  1XOA A;  1KBN A;  1M0U A;  3GKK A;  1S3D A;  5ECM B;  2I9H A;  4KDX A;  4QL9 A;  2WJU A;  2YJ7 A;  4WKW A;  3A2W A;  5IO0 A;  5IPG A;  1O8W A;  4MLY A;  3TOU A;  4LL4 B;  1TRW A;  1HD2 A;  1OKD A;  1PD2 1;  2R5G A;  3GSS A;  2I3Y A;  4G2E A;  4F0C A;  5G2Z A;  3KXO A;  1XW5 A;  4AKH A;  4IQA A;  4DEJ A;  4PNF A;  4X4J A;  2BMX A;  1DE2 A;  1M2A A;  1I9D A;  3GL5 A;  4LL1 B;  1XWB A;  2H01 A;  1Z6M A;  3MWH A;  3QCP A;  1JHB A;  2LRC A;  5EY6 A;  2HRN A;  5A4W A;  3IHQ A;  5GZZ B;  4G0L A;  2LNT A;  1ZYN A;  2O3E A;  4V2M A;  1K3O A;  3ERG A;  3DVX A;  2YPM A;  2LUS A;  4N10 A;  4RQR A;  4TR4 A;  5HR0 A;  4IP6 A;  2O7K A;  1SYX A;  3KMN A;  1U3I A;  2YWN A;  4F82 A;  3RPP A;  2MBS A;  1GSD A;  2ES7 A;  4DSQ A;  1K0N A;  5ECQ B;  2B3S A;  4BWS A;  4K0G A;  4O7H A;  1WIK A;  2RII A;  1GUK A;  3I9V 2;  1R5A A;  3VI5 A;  1MDJ A;  1GSF A;  5A34 B;  1ZCP A;  3A3T A;  3J7Y k;  5JCU A;  4FH8 A;  4V2L A;  3R2Q A;  5E59 A;  5ID2 A;  3PIN A;  18GS A;  3BOA A;  3IRA A;  1ACV A;  5G1L A;  2C8U A;  4PHZ C;  1BG5 A;  1YVL A;  4DSR A;  3NOF A;  3ZIJ A;  1SK1 A;  2H0I A;  2PWJ A;  4IJI A;  1R26 A;  3ERW A;  1Q98 A;  1K0C A;  3QAG A;  2P31 A;  4BA7 A;  1T00 A;  2H76 A;  4O5U A;  4OWY A;  1Z6N A;  5JCG A;  1O6J A;  2FA8 A;  4F9Z A;  5FHI A;  3HKR A;  2JAD A;  2WVY A;  4MPG A;  4GSN A;  2R0P A;  4MJA A;  5HQP A;  1Z7R A;  5D73 A;  1T8E B;  4AKX B;  3LYP A;  2H1B A;  1K0M A;  1VF1 A;  2YP6 A;  4IW9 A;  4O92 A;  2OE0 A;  4J57 E;  4NPB A;  3J7Y b;  1X9M B;  1MD4 A;  2VLV A;  5J9B A;  2O5V A;  5CRW A;  5EVO A;  1I5G A;  2NBS A;  1GLP A;  4MDC A;  1UN2 A;  3HVS A;  4KF9 A;  3C8E A;  1UC7 A;  4GQC A;  2C4J A;  1N8J A;  3ZIV A;  1MD3 A;  2WVX A;  4IBP A;  2LTK A;  1UA5 A;  4KCE A;  2HRK A;  4KX4 A;  4I8B A;  3F63 A;  2GSR A;  2YZU A;  2J23 A;  4IHU A;  2R4V A;  5JWO B;  4AF2 A;  1ABA A;  2CAQ A;  4E8E A;  5EPF A;  9GSS A;  1SJ6 A;  1THO A;  5KN0 A;  4I2U A;  4V1A p;  4HUA A;  4G19 A;  4K2D A;  4GSS A;  4ECC A;  4IN0 A;  4ICY A;  2VM1 A;  2IPA A;  1PN9 A;  2EIR A;  5J41 A;  1SL1 B;  5ABR A;  5ECS A;  3RBT A;  1DBY A;  2B7K A;  1TJD A;  1BYE A;  4ZXG A;  1X5C A;  1N2A A;  4ISD A;  4Z7X A;  1VF4 A;  2FCH A;  3UL3 A;  3LW9 A;  1NW2 A;  2XBI A;  1NHO A;  2LKU A;  1TRS A;  1TXX A;  4K7I A;  2Z9S A;  3QR6 A;  4IKH A;  2OE3 A;  3EU3 A;  1B9Y C;  2MMO A;  3GKX A;  4YQU A;  2VCV A;  4KA0 A; 
#chains in the Genus database with same CATH homology
 3HMJ G;  2WRT A;  3PPU A;  3C1S A;  4NWY A;  4K9Z A;  3MSZ A;  2RM5 A;  1PKZ A;  2H75 A;  1H4O A;  4ML6 A;  3I43 A;  5JWR B;  1SL0 B;  2QGV A;  1NSW A;  5GST A;  4MP4 A;  2B5X A;  3DRN A;  1TU7 A;  1LBK A;  1OAZ A;  1AAZ A;  5A34 A;  5G5F A;  1SKW B;  4KH7 A;  3TB2 A;  3I69 A;  1M2B A;  2B5Y A;  4QL7 A;  4XS4 B;  4OO5 A;  4MK3 A;  4YH2 A;  3WGD A;  6GSS A;  1FOH A;  5D8I A;  5B6N A;  5IPH A;  3KM6 A;  4AKG A;  1F9M A;  3KTL A;  1OC9 A;  6GSW A;  1PX7 A;  3EU4 A;  4MZW A;  3HCZ A;  2YWO A;  3GTU A;  1F2E A;  4HJM A;  4J56 E;  3Q74 A;  1WOU A;  2OAC A;  1SJI A;  2IWT A;  3L78 A;  3HYP A;  2ALB A;  4XIH A;  2GSQ A;  2EFC A;  1G7O A;  3TRP A;  2F9S A;  2YV9 A;  3L4N A;  3WT1 A;  3FKF A;  4WXT A;  4ZL8 A;  5G31 A;  1TK5 B;  3FZ4 A;  2YNX A;  4I2T A;  4NV5 A;  3N5O A;  1PL1 A;  1B4Q A;  5COH A;  1YZX A;  3KH9 A;  3VFI A;  1R4W A;  2V6O A;  5KOW A;  1LJR A;  3FEU A;  3GV1 A;  1EZK A;  1LU4 A;  1K0O A;  1W4V A;  3QOU A;  4A5P A;  2CVD A;  1TOF A;  4N0V A;  3O76 A;  4HQS A;  2VL3 A;  3D4M A;  5G1K A;  2H71 A;  20GS A;  3F4R A;  4XCS A;  4BVX A;  5GSS A;  5DAK A;  2H6Y A;  4EDZ A;  4KUN A;  2F8F A;  6GSX A;  5ELG A;  4ULX A;  1KTE A;  4RI7 A;  2WZ9 A;  1J9B A;  4PX1 A;  5DJL A;  1GSY A;  1BJX A;  4MMM A;  3APS A;  5GAN D;  4F2I A;  2HT9 A;  1J0F A;  4WF4 A;  1B48 A;  3VWV A;  1M99 A;  2HSN B;  3QFA C;  4HI7 A;  4CDO A;  4CHS A;  2G2Q A;  2LEG A;  1G6W A;  2ZUP A;  5IQY A;  4Q5Q A;  2IN3 A;  2C0F A;  3UOM A;  2EFD A;  2UZ8 A;  1JZR A;  5LD0 A;  3DIE A;  4ZBB A;  1K3Y A;  1A0F A;  2PPT A;  4MJB A;  2AYT A;  4KAE A;  3E9J B;  4XTS A;  3IK9 A;  4GCI A;  3FRC A;  1A2L A;  5KN2 A;  4PGT A;  1SU9 A;  2AB6 A;  3KTB A;  2DJ2 A;  1YKA A;  2CT6 A;  4HZ2 A;  5ECN B;  2X49 A;  3BCI A;  4HEA 2;  22GS A;  3ME8 A;  3LOR A;  1PSQ A;  4PTS A;  5AIX A;  4KE3 A;  2M80 A;  5ECH B;  3ZL5 A;  12GS A;  1ZMA A;  4TOP A;  4X0X A;  1ZYQ B;  4POB A;  2VO4 A;  3APQ A;  4OD7 A;  4TXO A;  1WWJ A;  1AQX A;  3TKS A;  1SD9 A;  5BRT A;  4IP1 A;  2H74 A;  14GS A;  4MJE A;  2HLS A;  2XPD A;  3TKP A;  4JED A;  1EP8 A;  1VF3 A;  3P7X A;  5IIZ A;  1O85 A;  4ZL9 A;  5EL8 A;  4IQ1 A;  5A5K A;  3RPN A;  1J08 A;  4IEL A;  1XPV A;  1FB6 A;  1IYI A;  1XCC A;  4HU7 A;  4TRX A;  1SL2 B;  2FA4 A;  2HQT A;  2QA2 A;  3MAK A;  1BED A;  4F0B A;  1M9A A;  1ML6 A;  1GWC A;  2DJ3 A;  4MA9 A;  4Z2U A;  3ZIT A;  2LJK A;  3KH7 A;  2H72 A;  1V58 A;  3TKS E;  1WRY A;  2GST A;  1UVZ A;  4N0Z A;  2IMK A;  4MH2 A;  2VCX A;  3CWG A;  2VD1 A;  2MMN A;  3H79 A;  2NVL A;  3HY2 A;  2V6K A;  3GUR A;  2IFQ B;  3QFB C;  2C3Q A;  4OFM A;  4HOJ A;  5J40 A;  4OFN A;  2H1D A;  2H73 A;  5DAL A;  5J3R A;  4JR6 A;  2JZR A;  5D9T A;  1TI3 A;  3GRX A;  4O5Q A;  4RI6 A;  2LST A;  4IGJ A;  5ECR B;  4WEY A;  2P0G A;  1GTU A;  4E68 A;  1NM3 A;  1WJK A;  2L59 A;  8GSS A;  2R37 A;  2VAF A;  2CAI A;  3SBC A;  3M1G A;  1T3B A;  3TRQ A;  2VL2 A;  2E0Q A;  1YJ6 A;  4KDU A;  1B4P A;  3BBY A;  3U6V A;  3DVW A;  4POK A;  2X8C A;  1TRV A;  2AHE A;  1YKC A;  1HNC A;  4N30 A;  1M2D A;  4WR4 A;  1SK2 A;  1SD8 A;  5INY A;  4IS0 A;  4E8H A;  3LWA A;  4PXO A;  2YN1 A;  1T7P B;  1OE8 A;  2DSA A;  5L71 A;  2F3M A;  1XZO A;  1OE7 A;  5JCW A;  3APO A;  2LQQ A;  4TR1 A;  3GX8 A;  2YJH A;  4Q5R A;  3FK8 A;  1XFL A;  1NHY A;  2CV4 A;  3A5W A;  2FY6 A;  4K7N A;  4BPY A;  4Z2T A;  1AXD A;  1GLQ A;  3ZRD A;  3IAM 2;  4BL7 A;  2C3N A;  1QK8 A;  3Q18 A;  3GA4 A;  1BQ7 A;  3VI7 A;  2H0G A;  3QD9 A;  4JBB A;  1XBS A;  3Q6O A;  1HNB A;  4TW5 A;  3LG6 A;  3QAV A;  1JFU A;  2EFE A;  1SVM A;  4JR4 A;  3KP8 A;  2FD3 A;  5HR2 A;  1EEM A;  5B6M A;  5IMF A;  2E2M A;  3FR6 A;  2R0C A;  1GSQ A;  1AQW A;  2XPE A;  1ZL9 A;  3G7J A;  4EF0 A;  2PN8 A;  3TJK A;  2JL4 A;  3QDN A;  4K6X A;  1JLV A;  4PUR A;  2HRA A;  4WET A;  3LFL A;  5GAP D;  1V2A A;  1WPI A;  4HZ4 A;  5LCZ A;  2K6V A;  5IMZ A;  2X4A A;  3QMX A;  3CSH A;  1TKD B;  5B8B A;  1PGT A;  1ST9 A;  4D73 B;  1BG1 A;  3UEM A;  4ZBD A;  1C72 A;  1YDK A;  2C3T A;  4L8E A;  2KOK A;  4EKZ A;  2F8A A;  2B6M A;  1JZO A;  4ECB A;  2G0F A;  3IC4 A;  5IO2 A;  4LMV A;  5AIS A;  1AIU A;  3UAP A;  1GSU A;  1V57 A;  2V2G A;  4L0W A;  3GST A;  2C1Y A;  4TN8 A;  2R2J A;  2HSH A;  2OAD A;  1A8L A;  2JSY A;  1JLW A;  1TDI A;  5AN1 A;  5CRG A;  4KW6 A;  5C04 A;  1FG4 A;  4Q5F A;  1TTZ A;  2IFQ A;  1AW9 A;  1A0R P;  4AKI A;  2FGX A;  2VD0 A;  1Z9H A;  2A2S A;  2HNL A;  4ZB9 A;  5HR1 A;  1FOV A;  5J5N A;  5ECP B;  4HU9 A;  2VLU A;  4G0I A;  2FWE A;  1AQV A;  4FQU A;  2JZT A;  2WB9 A;  3ERF A;  10GS A;  5IMA A;  4YKF A;  2HXK A;  4XS6 A;  4K0N A;  2O85 A;  2REM A;  5BMU B;  2AUV A;  3HA9 A;  1EOH A;  2DJJ A;  4BWQ A;  3F8U A;  2M72 A;  4K5R A;  2C80 A;  3IPZ A;  3D6I A;  4ZB8 A;  1EV4 A;  2JU5 A;  2C0D A;  1ZZY A;  1RK4 A;  1QGV A;  3VWU A;  4O5R A;  3KGK A;  4X1U A;  1GUL A;  1AUC A;  5CO3 A;  3GNJ A;  1GH2 A;  2BTO T;  4PQI A;  3TU3 B;  1G0T A;  5G30 A;  1QMV A;  1TW9 A;  3LSZ A;  2HSY A;  2H70 A;  2YOI A;  3NIV A;  1EV9 A;  2MMZ A;  4LA1 A;  4GDF A;  3G7Y A;  4ZIJ A;  3FMW A;  2BJX A;  2OT3 A;  3O6T A;  2DBC A;  4HJ2 A;  2DML A;  3V1W A;  1JZW A;  3P2A A;  3FZA A;  5B8A A;  2OE1 A;  3DXB A;  1SK0 A;  5FT3 A;  3GKN A;  4MCU A;  1O8X A;  2IMF A;  3F4T A;  4H86 A;  5IMD A;  3FHK A;  3RAZ A;  2L5O A;  3IHG A;  2QA1 A;  3GUS A;  3F4S A;  4K8M A;  3ZFL A;  2EIQ A;  3KJY A;  2O8V B;  2WFC A;  3GX0 A;  3ZFB A;  1YF1 A;  1HNA A;  1TP9 A;  1TXU A;  2K9F A;  1ERW A;  2GQK A;  3ZVJ A;  1WMJ A;  1GP1 A;  3UBK A;  16GS A;  3D21 A;  1F3B A;  2GQM A;  5DCG A;  1EEJ A;  3GFK A;  1URM A;  3IK7 A;  3M8N A;  3D5J A;  2XHF A;  1X9S B;  2GT5 A;  3C7M A;  2LRT A;  2L57 A;  3UIW A;  2C0E A;  2KP2 A;  2TRX A;  4FYB A;  2NDO A;  1FHE A;  2ZCT A;  2GZP A;  2HZE B;  4EVM A;  2MMA A;  1GNW A;  1K0B A;  4USS A;  2V32 A;  3KD0 A;  3KEB A;  3DEX A;  2GT6 A;  17GS A;  2H1A A;  3AY8 A;  2PUK C;  3GIX A;  4EXJ A;  5F06 A;  3LYK A;  2VOC A;  1X0R A;  2KHP A;  5F07 A;  3GYK A;  3S9F A;  2L6C A;  1GRX A;  2A4H A;  3F6D A;  1EOG A;  3VUR A;  1GNE A;  3UVH A;  3GN3 A;  1VRS D;  2VUP A;  1XVW A;  2J9H A;  2YAN A;  2PVO C;  3F6F A;  5JWQ B;  2X64 A;  4AGS A;  2VCZ A;  4G01 A;  4J2F A;  1B9X C;  4POL A;  3A2X A;  5HR3 A;  2KLX A;  1V98 A;  3EPT A;  1EGO A;  2OBI A;  4DVC A;  2X99 A;  2DJ1 A;  3MIX A;  4NMU A;  2HFD A;  2YZH A;  4EIQ A;  3US3 A;  4KDY A;  2WGR A;  4XHM A;  2GZZ A;  4RQX A;  3H8Q A;  3TUE A;  3D0Z A;  3ZYW A;  2DKH A;  3TDG A;  3KP9 A;  5IMC A;  2DMM A;  1S3A A;  3A2V A;  3A5I A;  2DJK A;  3L0H A;  2HE3 A;  3UAR A;  1EP7 A;  1WE0 A;  5DQS A;  4IJ3 A;  4K7O A;  1G7E A;  3P90 A;  2GLR A;  4YAV A;  2GDR A;  1G6Y A;  1GTA A;  5G5E A;  1K0A A;  3LEF A;  2QC7 A;  2WDU A;  1VGL A;  4HDE A;  2LS5 A;  5KOX A;  4EUY A;  5CRH A;  1E2Y A;  1O81 A;  4G10 A;  3NZN A;  2XBQ A;  5D93 A;  1A24 A;  4ECJ A;  1PQN A;  2C0G A;  1THX A;  3L9U A;  4JRR A;  4AJ8 A;  3SWL A;  4NV2 A;  1JZD A;  4XS4 A;  3VWW A;  4G9H A;  3Q19 A;  2M46 A;  4V1A g;  3K8N A;  3EMX A;  3ZRE A;  3TOT A;  3HVV A;  1SKR B;  1YY7 A;  5ID2 B;  4X43 A;  1BAY A;  5DQY A;  3FYG A;  4FIW A;  4EL1 A;  5DCH A;  4MF6 A;  3WGX A;  1DUG A;  4L5O A;  3JCM L;  2IL3 A;  2AAW A;  2TIR A;  1V40 A;  1U6T A;  1XW9 A;  2OBK A;  3H4K A;  3L9V A;  1QXH A;  3M9K A;  1RQM A;  1W89 A;  3FZ9 A;  2L5L A;  5H5R A;  1A2J A;  3KMO A;  2PBJ A;  1WP0 A;  1XIY A;  1YQ1 A;  1Y25 A;  1B8X A;  3LXT A;  3HDC A;  1CQH A;  1Z5Y E;  5HFG A;  4FYC A;  1TRU A;  4YAP A;  1XWG A;  2KP1 A;  3CTG A;  2JSZ A;  2MBT A;  3GHA A;  4HQZ A;  2EC4 A;  4XS1 A;  1BX9 A;  4EC0 A;  2H1G A;  1GUH A;  5F0G A;  2WCI A;  4JZQ A;  3DML A;  4LLR A;  4P3Y B;  1F3A A;  1XWA A;  1PA3 A;  2NPB A;  2QKE A;  1ERV A;  5F8B A;  1QUW A;  1OC8 A;  4PUA A;  5CP1 A;  5KEJ A;  1RW1 A;  3VPQ A;  1U87 A;  2OKA A;  4XRA A;  2HRK B;  2YV7 A;  2B1K A;  1F37 A;  1X5D A;  2DIZ A;  4NXI A;  3CSI A;  3KIJ A;  2CX3 A;  3GMF A;  3TCO A;  5C00 A;  2HSN A;  3WT2 A;  1GSE A;  1GSS A;  3VK9 A;  2H66 A;  2DIY A;  3WYW A;  3C1R A;  2FUG 2;  2LJR A;  3GKM A;  3R3E A;  3L9S A;  4GQF A;  3CRT A;  3N9J A;  3ISO A;  2PGT A;  5D9V A;  4TVE A;  2RM6 A;  5HFK A;  5CAX A;  3ZML A;  4KSM A;  1ERT A;  2CZ2 A;  3TJB A;  1FAA A;  2B7J A;  3PR8 A;  5FWG A;  2H6X A;  2GQL A;  2GS3 A;  2LQO A;  4JU5 A;  4RUV A;  2LRN A;  4CW9 A;  4CY6 A;  4OCF A;  4LMW A;  4AI6 A;  2R6K A;  2N5A A;  4FYU A;  3WGE A;  3TJJ A;  2IMD A;  2X8G A;  2HI7 A;  5IOW A;  1T1V A;  2VKZ G;  4QMK A;  1BF5 A;  1XWC A;  2L4Q A;  5CYY A;  3EC3 A;  3RHB A;  3F3Q A;  1OVN A;  1YEX A;  3UJ1 A;  5DVB A;  1U3A A;  3GL3 A;  1Z3E A;  5DJM A;  4ILF A;  3QPM A;  2E2G A;  4I5Q A;  3F0I A;  1OC9 B;  4WF5 A;  2FHE A;  4MAB A;  1MEK A;  3TJG A;  4POM A;  3FZ5 A;  5ELA A;  3CTF A;  2VM2 A;  3EYT A;  1XVQ A;  2H19 A;  3GTU B;  5ECO B;  3TRX A;  3IC8 A;  3IDV A;  4EO3 A;  1QQ2 A;  2HSM B;  5A5H B;  2AV4 A;  3GH6 A;  2FLS A;  3MDK A;  2K8S A;  3TKS C;  4TR0 A;  3CSJ A;  5ECL B;  2WS2 A;  2FWG A;  2HZF A;  2VCT A;  3HVX A;  3IXR A;  2GSS A;  2CVB A;  4QQ7 A;  5E4W A;  2YWI A;  4YKG A;  5J9C A;  3KCM A;  5ECI B;  3C73 A;  3QAW A;  1DE1 A;  3H93 A;  2R0G A;  1HYU A;  3LGC A;  2ZNM A;  2H6Z A;  1ZOF A;  2H30 A;  2I1U A;  4MZC A;  4KSO A;  4AJ6 A;  2AJQ B;  1FB0 A;  3F3R A;  5KN3 A;  2NTO A;  3TJF A;  3HJM A;  4I97 A;  5B7C A;  1M9B A;  4EIP A;  2LV3 A;  4PUF C;  1TU8 A;  2CQ9 A;  4BVX B;  5DAK B;  2QSI A;  1K3L A;  2IME A;  2K8V A;  1OYJ A;  3EUR A;  3EIN A;  2H8L A;  4PQ1 A;  1A2M A;  3HXS A;  4EE0 A;  4KND A;  1O73 A;  4NAX A;  3ZVJ D;  1MDK A;  4N11 A;  3UBL A;  1TK8 B;  4FO5 A;  4O32 A;  1EWX A;  2PER A;  1O7U A;  1ZYE A;  2DLX A;  1DSB A;  3EWL A;  3HHV A;  5J4V A;  2VL9 A;  1IYH A;  1R7H A;  3DYR A;  2OA7 A;  1TI1 A;  1TK0 B;  1ZGN A;  1S3C A;  4ZB7 A;  1GTB A;  5IMV A;  11GS A;  5CRE A;  1H75 A;  4K1F A;  3D4T A;  2CVK A;  3FY7 A;  2VIM A;  3CYN A;  1GTI A;  2VL2 C;  2XC2 A;  2LJA A;  1X9W B;  5H5Q A;  3ME7 A;  2TRC P;  1FVK A;  4ML1 A;  4MF7 A;  3W6G A;  3IA1 A;  2CX4 A;  2RUF A;  3P8W A;  4K5S A;  4DSS B;  3DGQ A;  1GL8 A;  2B5E A;  2O87 A;  3PH9 A;  4TXO B;  4ZBA A;  4YQM A;  3IV4 A;  2ON7 A;  5IOX A;  2YCD A;  1X5E A;  4WBR D;  2VCW A;  7GSS A;  3M9J A;  2EIO A;  3H1N A;  3RHC A;  2D2Z A;  2HRF A;  3DKS A;  1XW6 A;  2H1L A;  1R5P A;  2UV8 G;  3ED3 A;  3EE2 A;  1USB A;  2CA8 A;  3CXG A;  3EVI A;  4D73 A;  3BJ5 A;  6GST A;  2I4A A;  1SEN A;  5D9W A;  3G9B A;  5A4V A;  4CY8 A;  3IE3 A;  1FW1 A;  1Y1U A;  2R3X A;  1PL2 A;  3F9U A;  5DDL A;  1E6B A;  4K2X A;  2DKI A;  5AIV A;  4BVY B;  1MDI A;  5KN1 A;  3BCK A;  3CMI A;  3LJR A;  3GH9 A;  4L5L A;  1ILO A;  5F05 A;  5CNW A;  2PU9 C;  4MPF A;  2V41 A;  1YF0 A;  2HSM A;  5A5H A;  3E0U A;  3BD2 A;  4ZB6 A;  4GXZ A;  2A4V A;  4NHZ A;  19GS A;  1EGR A;  1KEB A;  3OR5 A;  4KCA A;  2N5F A;  4JE1 A;  2K18 A;  3FR3 A;  3CRU A;  2FWF A;  5A1N B;  2IJY A;  5DAL B;  2FNO A;  3U5R E;  2H0H A;  1F6M C;  3LQ7 A;  2VLT A;  4AJ7 A;  1VF2 A;  4GTU A;  5AGY A;  4MH3 A;  4MJC A;  4HS1 A;  3HZ8 A;  1OKT A;  4KGI A;  2GZY A;  5D9X A;  2FWH A;  3VLN A;  3HD5 A;  3PGT A;  4I6X A;  2LNS A;  3TGZ A;  1PMT A;  3HZ4 A;  2F51 A;  3FR9 A;  3HJO A;  4GF0 A;  3ZTL A;  3UMA A;  4XRD A;  5BMU A;  2V1M A;  4OFT A;  6GSV A;  1Y6E A;  3IR4 A;  4TKY A;  2B1L A;  2YWM A;  4GST A;  2OJL A;  1FO5 A;  3TKQ A;  4PQH A;  1T4Z A;  4KB3 A;  4NHW A;  2P5Q A;  2EFH A;  4WR5 A;  3ZZX A;  2DC5 A;  4G0K A;  13GS A;  4TR1 B;  5HFI A;  1U88 A;  2E7P A;  2O89 A;  4ACS A;  6GSY A;  2MYG A;  3RDW A;  3ZMK A;  5J4U A;  1MTC A;  1SYR A;  3I6A A;  4BL7 B;  1HQO A;  2CZ3 A;  4W66 A;  2PMT A;  2GGT A;  1A23 A;  1XWK A;  4ECI A;  4N3Z A;  5H5S A;  3W8S A;  1SVL A;  4ID0 A;  2JAC A;  3D22 A;  2VCQ A;  2A2R A;  4OMV A;  4Q5N A;  2L4C A;  3DD3 A;  4MF5 A;  2RLI A;  3MNG A;  4TR3 A;  3G7I A;  4PNG A;  1PX6 A;  1M7T A;  1ON4 A;  1Q4J A;  1OC3 A;  3EMP A;  4V2N A;  1PN0 A;  4OO4 A;  1Z7P A;  2PVQ A;  2DJ0 A;  4DSS A;  1SJZ A;  2MZC A;  5J47 A;  5ECK B;  1A8Y A;  3C71 A;  3LXZ A;  2RUE A;  4TXV A;  4YQV A;  1N25 A;  2KUC A;  3CBU A;  3HJP A;  2JZS A;  4L0U A;  3VWX A;  1FVJ A;  1KNG A;  2P5R A;  5ENU A;  3DWV A;  3IOS A;  4EDY A;  1SVO A;  4IVF A;  4Z2R A;  3MYD A;  2X8H A;  4OCE A;  3O3T A;  5A4U A;  4WBJ A;  1XOB A;  2ON5 A;  1QFN A;  5DBQ A;  1CQG A;  2HYX A;  5J4Y A;  1ZYP A;  4ZL7 A;  4GWR A;  4BVY A;  3IAS 2;  1V9W A;  2HZE A;  3TKR A;  3FW2 A;  1PKW A;  5D96 A;  1GUM A;  5CRD A;  1XXU A;  3VPT A;  3M0F A;  4ZIL A;  3IBH A;  3ZLP A;  4GLT A;  2IMI A;  3KZQ A;  3UVT A;  1K0D A;  3E3E A;  3M3M A;  1PRX A;  4MNN A;  2A2P A;  2GTU A;  2IIY A;  3WD6 A;  2N5B A;  4GRF A;  5A1N A;  1YEP A;  2I81 A;  2GVP A;  4MZB A;  3W8J A;  1AC1 A;  2L6D A;  1ERU A;  4F03 A;  1T4Y A;  5IM9 A;  6GSU A;  1SKS B;  2WUL A;  5LNK e;  1XOA A;  1KBN A;  1M0U A;  3GKK A;  1S3D A;  5ECM B;  2I9H A;  4KDX A;  4QL9 A;  2WJU A;  2YJ7 A;  4WKW A;  3A2W A;  5IO0 A;  5IPG A;  1O8W A;  4MLY A;  3TOU A;  4LL4 B;  1TRW A;  1HD2 A;  1OKD A;  1PD2 1;  2R5G A;  3GSS A;  2I3Y A;  4G2E A;  4F0C A;  5G2Z A;  3KXO A;  1XW5 A;  4AKH A;  4IQA A;  4DEJ A;  4PNF A;  4X4J A;  2BMX A;  1DE2 A;  1M2A A;  1I9D A;  3GL5 A;  4LL1 B;  1XWB A;  2H01 A;  1Z6M A;  3MWH A;  3QCP A;  1JHB A;  2LRC A;  5EY6 A;  2HRN A;  5A4W A;  3IHQ A;  5GZZ B;  4G0L A;  2LNT A;  1ZYN A;  4V2M A;  1K3O A;  3ERG A;  3DVX A;  2YPM A;  2LUS A;  4N10 A;  4RQR A;  4TR4 A;  5HR0 A;  4IP6 A;  2O7K A;  1SYX A;  3KMN A;  1U3I A;  2YWN A;  4F82 A;  3RPP A;  2MBS A;  1GSD A;  2ES7 A;  4DSQ A;  1K0N A;  5ECQ B;  2B3S A;  4BWS A;  4K0G A;  4O7H A;  1WIK A;  2RII A;  1GUK A;  3I9V 2;  1R5A A;  3VI5 A;  1MDJ A;  1GSF A;  5A34 B;  1ZCP A;  3A3T A;  3J7Y k;  5JCU A;  4FH8 A;  4V2L A;  3R2Q A;  5E59 A;  5ID2 A;  3PIN A;  18GS A;  3BOA A;  3IRA A;  1ACV A;  5G1L A;  2C8U A;  1BG5 A;  1YVL A;  4DSR A;  3NOF A;  3ZIJ A;  1SK1 A;  2H0I A;  2PWJ A;  4IJI A;  1R26 A;  3ERW A;  1Q98 A;  1K0C A;  3QAG A;  2P31 A;  4BA7 A;  1T00 A;  2H76 A;  4O5U A;  4OWY A;  1Z6N A;  5JCG A;  1O6J A;  2FA8 A;  4F9Z A;  5FHI A;  3HKR A;  2JAD A;  4MPG A;  4GSN A;  2R0P A;  4MJA A;  5HQP A;  1Z7R A;  5D73 A;  1T8E B;  4AKX B;  3LYP A;  2H1B A;  1K0M A;  1VF1 A;  2YP6 A;  4IW9 A;  4O92 A;  2OE0 A;  4J57 E;  4NPB A;  3J7Y b;  1X9M B;  1MD4 A;  2VLV A;  5J9B A;  2O5V A;  5CRW A;  5EVO A;  1I5G A;  2NBS A;  1GLP A;  4MDC A;  1UN2 A;  3HVS A;  4KF9 A;  3C8E A;  1UC7 A;  4GQC A;  2C4J A;  1N8J A;  3ZIV A;  1MD3 A;  4IBP A;  2LTK A;  1UA5 A;  4KCE A;  2HRK A;  4KX4 A;  4I8B A;  3F63 A;  2GSR A;  2YZU A;  2J23 A;  4IHU A;  2R4V A;  5JWO B;  4AF2 A;  1ABA A;  2CAQ A;  4E8E A;  5EPF A;  9GSS A;  1SJ6 A;  1THO A;  5KN0 A;  4I2U A;  4V1A p;  4HUA A;  4G19 A;  4K2D A;  4GSS A;  4ECC A;  4IN0 A;  4ICY A;  2VM1 A;  2IPA A;  1PN9 A;  2EIR A;  5J41 A;  1SL1 B;  5ABR A;  5ECS A;  3RBT A;  1DBY A;  2B7K A;  1TJD A;  1BYE A;  4ZXG A;  1X5C A;  1N2A A;  4ISD A;  4Z7X A;  1VF4 A;  2FCH A;  3UL3 A;  3LW9 A;  1NW2 A;  2XBI A;  1NHO A;  2LKU A;  1TRS A;  1TXX A;  4K7I A;  2Z9S A;  3QR6 A;  4IKH A;  2OE3 A;  3EU3 A;  1B9Y C;  2MMO A;  3GKX A;  4YQU A;  2VCV A;  4KA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...