1PGTA

Crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
210
structure length
210
Chain Sequence
b'MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pgtA01
4PNGA 5E59A 2AUVA 1BQ7A 3H1NA 3APOA 3BCIA 1Z6NA 2VAFA 1M2BA 1HNBA 1EOGA 2H30A 3HVVA 3VLNA 1BEDA 3IC4A 2R4VA 2OBKA 2EIOA 4JZQA 2VD1A 1QQ2A 4I6XA 1A23A 3KP8A 5HR3A 3H79A 1GULA 3IDVA 2LTKA 2YNXA 1FOVA 2DC5A 5GZZB 1XOAA 2FUG2 2JSZA 4PNFA 2L5OA 1IYHA 1SJ6A 3WD6A 1XOBA 4ZBBA 4Q5RA 5A4UA 2GGTA 4EDZA 4YQUA 1VGLA 6GSUA 1UN2A 3GKXA 2L6DA 2HYXA 3F6FA 4MJEA 4TVEA 1OE8A 4KA0A 3C1SA 3C8EA 3MAKA 2AB6A 2FA8A 4YAVA 5ECLB 4Q5QA 5J9BA 3BBYA 4USSA 5ABRA 3ERGA 3VPTA 2OJLA 4MF6A 5B6MA 3ZREA 2GQKA 3EINA 1K3LA 2LUSA 5IPHA 4IJ3A 3ZL5A 3RBTA 5C04A 3E3EA 1U3AA 2VL3A 5IMDA 3I6AA 2OACA 1YF0A 1GRXA 1BJXA 2WFCA 1A0FA 2NVLA 1AXDA 3P7XA 1PQNA 1JZDA 3KCMA 3LORA 3ZFBA 4MH3A 1GSYA 3MNGA 5D9WA 1URMA 4TKYA 1EOHA 2ON5A 5J4UA 4XRDA 1B4PA 3ZRDA 4ZBDA 3A2XA 3M9JA 3HVXA 2PBJA 4HZ2A 3O76A 3D6IA 1AUCA 4MMMA 2BTOT 2P0GA 1QGVA 2CVDA 2O85A 2B1KA 3CRUA 1TKDB 4L5OA 1FW1A 3FZ4A 2DJKA 3IE3A 2OKAA 3P2AA 1O6JA 4PUAA 6GSVA 4AJ8A 1SYXA 1TRUA 1A8YA 2VIMA 2JZSA 1QFNA 4MCUA 2CZ2A 4E8HA 5AGYA 2B5YA 4BWQA 5IMVA 1PMTA 4EF0A 1SL2B 4PTSA 3F4RA 4ZIJA 2NDOA 2VLUA 4IVFA 2HZFA 17GSA 1G7OA 1XW6A 1RQMA 4Q5FA 2VL2C 4HS1A 3QPMA 2E0QA 2GTUA 3ZZXA 22GSA 2GSSA 3VURA 1GSDA 2MMZA 2H1AA 1FG4A 3KH9A 5COHA 1TK8B 4GLTA 1T1VA 1UVZA 4EKZA 4ZB9A 3EMPA 3HY2A 2DBCA 4BL7B 1WIKA 5CREA 3GTUA 1Z6MA 3WGXA 2TRXA 3Q19A 3FKFA 4O32A 3RHBA 1ERVA 2DJ1A 3EURA 4BWSA 3ED3A 1QXHA 3VI5A 1XW9A 3F3RA 4PX1A 2J23A 2ZCTA 1YEXA 4DSSB 3ZVJD 5B8AA 1BAYA 3F4SA 3H93A 2E2MA 1CQHA 1GWCA 4HU9A 2VL2A 2NBSA 1PX6A 2HZEA 4WKWA 2VLVA 3EVIA 2PWJA 2CAIA 4NPBA 1SKSB 5ECRB 2JADA 3GA4A 3VWVA 2MMAA 1XVQA 3UBKA 4BVYB 1GTUA 3FR3A 2IMKA 2H0IA 2YWMA 1FHEA 4O92A 5G5FA 4LL1B 2KP2A 4KDXA 4OFMA 5D8IA 3C1RA 1K0BA 3J7Yb 1TOFA 4EE0A 1ZMAA 1WJKA 4IGJA 1FVKA 5DJLA 5ECHB 4JBBA 2HRFA 3LEFA 5ECNB 3QMXA 2LQOA 1OE7A 5CYYA 4PGTA 4HOJA 5KN2A 1N8JA 1DUGA 3IV4A 4Q5NA 1NW2A 1USBA 1K0NA 4ML1A 2WRTA 3ZLPA 2AJQB 2CX4A 2GSRA 5CO3A 2XPEA 4K6XA 1O8XA 2KOKA 2GS3A 20GSA 2AAWA 3KIJA 2AYTA 5EVOA 1M2DA 2L4CA 2OE0A 2OBIA 1XWGA 4GCIA 3RPPA 5J3RA 1K0OA 4K0NA 2H1GA 4HU7A 2H01A 5H5QA 3C7MA 2C4JA 4PQHA 2FCHA 3FZ5A 4HI7A 1KTEA 3KTLA 5E4WA 3O3TA 4MZWA 5JWOB 1XWAA 3I69A 5GSSA 2XHFA 4X43A 4ZBAA 5A4VA 5KN1A 1M0UA 2K8VA 3GH6A 4TOPA 4RUVA 2LEGA 4N0VA 4YAPA 1SENA 1O73A 2KLXA 4ACSA 1ABAA 2DSAA 2C80A 1GTAA 1X9WB 2H8LA 2H75A 1HQOA 4KW6A 3DRNA 4HJ2A 4WXTA 1PL2A 5ELGA 3CTGA 2IN3A 3TJFA 2JL4A 2B1LA 3C71A 1XWCA 3DYRA 2YN1A 1TRVA 1CQGA 4ISDA 1Q98A 2FY6A 1Z3EA 2C0DA 1X5CA 2H1BA 4YH2A 3UVTA 4ZL8A 5ECKB 3ZFLA 1MTCA 2PPTA 3TRQA 1S3DA 4AGSA 1V98A 1WRYA 2X8GA 3GMFA 3TRXA 2V6OA 1TK0B 4TR0A 5C00A 1E6BA 3DIEA 2YWIA 4IKHA 4MF7A 3HKRA 1K0MA 1W89A 3JCML 1ZL9A 3Q74A 4PQIA 1U87A 4MA9A 3Q6OA 4GXZA 1A2JA 3ZIVA 3NIVA 3G7JA 1ZGNA 2FWHA 4GQCA 1AIUA 3RPNA 2QKEA 1OC9A 2VLTA 2AHEA 4ECCA 5ECPB 5F0GA 4ZL7A 2KP1A 5EL8A 4XS1A 1Z9HA 1XCCA 1RW1A 2VM1A 3EU4A 4OWYA 1THXA 5G1LA 3TGZA 3KGKA 2I1UA 1V40A 4GSNA 1M9BA 4I97A 2O89A 4MJBA 1DBYA 1TTZA 2VO4A 3EC3A 3D5JA 1TI1A 4KUNA 1A24A 1EEJA 2CAQA 3IAS2 2ON7A 1TP9A 1SL0B 4XS4A 2DIYA 13GSA 3IK7A 3LSZA 2YP6A 2LSTA 1DE1A 2IWTA 3TJGA 4EO3A 2HT9A 5DQYA 3DVWA 1H75A 4MZCA 4IQ1A 1DE2A 4D73A 5B6NA 1BYEA 4V2MA 2R5GA 1U3IA 2HSNB 4KSOA 2GT5A 18GSA 1K3YA 3K8NA 1Z7RA 1GSUA 2YZUA 3GIXA 4MF5A 3EE2A 12GSA 2VCTA 1PL1A 1MDJA 1YF1A 1X9SB 3QAVA 4N10A 5IMZA 2GZPA 5DAKB 2B7KA 4ZB6A 4TN8A 4WF4A 3OR5A 1ZZYA 1B9XC 2C3NA 3GURA 4KCAA 2LNSA 4X1UA 5DBQA 4KCEA 3I9V2 2C3QA 2IJYA 1ACVA 2IFQA 1YKCA 3GSSA 4IW9A 5G5EA 1ERTA 3BCKA 4I5QA 1K0CA 3HJMA 5AIVA 1F37A 3CRTA 4ECBA 4WEYA 3HZ8A 5DCHA 2HRNA 5A4WA 3O6TA 3IA1A 4NAXA 3S9FA 5LNKe 3GYKA 3GX8A 3H4KA 4CW9A 5HFIA 2LJAA 4K1FA 2ALBA 5ENUA 4KSMA 2P5QA 3TKPA 5CAXA 4TXOB 1ST9A 3EYTA 1J0FA 1M7TA 3N5OA 4FYCA 4MLYA 5F06A 4MDCA 1XW5A 3KEBA 4HQZA 2H0GA 4G10A 4EVMA 2X99A 1EP8A 1PSQA 4V2LA 4POLA 4JE1A 4F0CA 3VK9A 5ECQB 1A2MA 3CSIA 1BX9A 1EZKA 2EC4A 1ZYEA 3US3A 5IOXA 1JHBA 5ID2B 5D9TA 2QC7A 3VPQA 3L9VA 4BVXA 2J9HA 5CRGA 1V57A 1T4ZA 2BJXA 4ILFA 4HEA2 3KMOA 3F63A 6GSXA 4K9ZA 3M1GA 1ERUA 2A2SA 1Z5YE 4CDOA 2B6MA 1VF3A 4F0BA 2DJ0A 1RK4A 3ZMLA 1THOA 2LKUA 5IM9A 1FAAA 4N0ZA 2JZRA 1GSSA 1UC7A 3FHKA 2I9HA 4IBPA 2X8CA 2LRNA 2LRCA 5H5RA 4K0GA 4RI6A 5IIZA 2GT6A 3L78A 2L57A 1WOUA 3HDCA 2PU9C 1G7EA 2V1MA 1PGTA 1HYUA 2IMDA 2FWFA 1TW9A 4PURA 4L0WA 4OO5A 4MP4A 3BOAA 4XTSA 1T7PB 3W8JA 2MMNA 4JU5A 3TKQA 4IQAA 5DCGA 5IMFA 5JCUA 5G30A 3GSTA 2LV3A 1XWKA 1IYIA 1XVWA 4N11A 2P5RA 3A5WA 4IP1A 3GHAA 2DMLA 5INYA 1N2AA 4O5RA 2HSHA 3MWHA 1PA3A 5JWQB 4ML6A 3LGCA 3GRXA 2YJ7A 2WZ9A 4J57E 3IRAA 3EMXA 4KDUA 2K6VA 2EIQA 4IP6A 2B5XA 1TDIA 5ECOB 4ZXGA 4F03A 4MZBA 2CV4A 4DSQA 1HNAA 1JZWA 4HZ4A 1VF1A 4ID0A 3IOSA 5EY6A 1SK1A 1ZOFA 4K7OA 1AQVA 3TJKA 4ZL9A 3DKSA 3ISOA 1GSFA 1ERWA 2RM5A 4HDEA 2RUEA 1QMVA 2C3TA 1B8XA 4I8BA 2K8SA 3GNJA 1GP1A 6GSYA 4GRFA 1X5EA 1ML6A 3LQ7A 2VL9A 4L8EA 3MSZA 2X8HA 3HZ4A 3EWLA 1X9MB 4F2IA 3KTBA 2YOIA 3PPUA 1A0RP 4H86A 3H8QA 1K0DA 1LU4A 2HRKA 1OVNA 2HLSA 2LJRA 3F0IA 3IC8A 2A4VA 3SWLA 5B8BA 2F9SA 1G6WA 1PD21 3F3QA 3APSA 3QFBC 3UJ1A 4OD7A 3DEXA 6GSSA 2FWEA 3WT1A 2JSYA 19GSA 2UZ8A 1WPIA 3TJJA 4KNDA 3CYNA 1LJRA 2L59A 4FYBA 4TR1A 2HSMA 4FH8A 4TRXA 1MDKA 3F8UA 1R4WA 3R2QA 3KP9A 2VCQA 4AJ7A 4MH2A 3J7Yk 1R26A 3A2VA 3CXGA 1GLPA 5CP1A 5JWRB 2K9FA 4K7IA 2WDUA 1QUWA 4TR3A 5D96A 4KE3A 5IMCA 4K7NA 2DJ2A 1GTBA 1Y25A 2DLXA 3GTUB 5IO2A 3QCPA 3FR9A 3UL3A 1PN9A 4X0XA 4XIHA 5CNWA 4G9HA 2JACA 3N9JA 3LYPA 2K18A 2M80A 2G2QA 1JZOA 2L6CA 2MBTA 3G7YA 2LNTA 2TRCP 5B7CA 2O8VB 1GUMA 2MMOA 2GZZA 3KZQA 4MJAA 1O85A 3FW2A 3LXZA 2L5LA 3GX0A 2H72A 2H6YA 2OA7A 3CSHA 1V58A 2H1DA 2H0HA 2C0FA 2H76A 3LG6A 4NV2A 1GH2A 2HZEB 3LFLA 4AJ6A 1PKWA 2MBSA 4IELA 3LWAA 3VWWA 2GSTA 3ERFA 3E9JB 3RAZA 3GV1A 2YV9A 2WB9A 4F9ZA 3CTFA 3HYPA 2H6ZA 4MJCA 3UIWA 2H71A 2YWNA 1F3AA 1V2AA 3BJ5A 2N5FA 5H5SA 1SJZA 2XBQA 4EDYA 2D2ZA 1V9WA 2WGRA 3D4TA 4POBA 5HQPA 2HXKA 3GFKA 3GL5A 3KXOA 1E2YA 3W6GA 4QL9A 2VCWA 1SKRB 1F6MC 2FNOA 2O87A 2ZUPA 3MDKA 3QOUA 1R7HA 4IHUA 1YEPA 1XBSA 2CX3A 4XHMA 2KHPA 1I9DA 3DXBA 1VRSD 1T00A 3KH7A 1YZXA 5GAND 4NHZA 1FVJA 2DJJA 5G1KA 3UAPA 4IN0A 3QR6A 2G0FA 1TU8A 4DVCA 4MABA 1Z7PA 4WR4A 5D73A 4FO5A 4L5LA 2E7PA 2TIRA 6GSTA 5HFGA 1F3BA 3IR4A 2YWOA 4G0LA 2F8AA 4N30A 1QK8A 2IPAA 2YJHA 2WCIA 5AIXA 3PH9A 2H70A 3RDWA 1R5AA 3FR6A 3QD9A 3IPZA 1YKAA 14GSA 1AAZA 4JRRA 1PX7A 5IOWA 4IS0A 3TKSE 2OE1A 1SK2A 4TR4A 1DSBA 2WULA 2KUCA 5HR2A 4KX4A 2GDRA 5CRWA 1AC1A 2YV7A 1EGOA 5D9VA 1OYJA 1S3CA 3FRCA 4MPGA 2OE3A 5F07A 2CQ9A 2PUKC 2IIYA 4LMWA 1LBKA 5JCGA 3C73A 3ZYWA 1O81A 4F82A 5F8BA 1FO5A 1XXUA 4OFNA 4MPFA 4YQMA 2MYGA 1I5GA 4BL7A 1O8WA 1TJDA 5KN3A 3HD5A 1GNWA 2H66A 2AV4A 1XFLA 5DALB 4ZB8A 1B48A 4HJMA 3BD2A 4CHSA 10GSA 4G2EA 3HA9A 4K2DA 1NHYA 2B3SA 5HR1A 2VUPA 2C1YA 4DSSA 5A5KA 5HFKA 4LLRA 1OC9B 2RIIA 2NTOA 2PGTA 2F51A 3GUSA 2XBIA 3GKMA 4POMA 5ELAA 2LRTA 2MZCA 2GQLA 3QFAC 1OKTA 1M99A 3TOUA 3D4MA 3UEMA 2WJUA 1XIYA 1TRSA 4BVYA 4KF9A 5L71A 3FEUA 5D9XA 2XC2A 1FB0A 2GQMA 2PERA 3PGTA 2C0EA 3ERWA 1HD2A 1R5PA 4XS4B 1GSQA 5ECIB 2R37A 1M2AA 4DSRA 1YDKA 4LL4B 3L9UA 1KBNA 4D73B 2V6KA 3LJRA 2FA4A 1TI3A 3GL3A 2F8FA 2A2RA 5J41A 1EWXA 2DIZA 4PXOA 3WYWA 5AISA 5KN0A 3IHQA 4NXIA 4ECJA 2OADA 4J56E 1G6YA 1JZRA 5FWGA 2PVOC 5IQYA 1SU9A 3M9KA 2YANA 4FIWA 3CMIA 1B9YC 5CRDA 2NPBA 4I2UA 2R2JA 3DWVA 2GVPA 2CA8A 2HI7A 1F2EA 1OC8A 1U6TA 1O7UA 1T3BA 2IFQB 2DJ3A 1MDIA 4P3YB 1EEMA 4OFTA 1VF4A 4RQRA 4EXJA 1EV9A 2R6KA 3WGDA 2LQQA 3VWXA 3W8SA 4NV5A 3AY8A 4KB3A 3PINA 4G19A 1HNCA 3TRPA 2IMFA 3VFIA 1EP7A 3HJPA 3QDNA 9GSSA 1WP0A 1WWJA 4KDYA 3HXSA 4WR5A 1TK5B 3UMAA 5IO0A 2XPDA 2YPMA 5DQSA 1FB6A 1JLWA 4LA1A 3TOTA 1GNEA 2I81A 3APQA 2QSIA 2CVKA 2VM2A 3GKKA 4WBRD 3ZMKA 4GSSA 4GWRA 4JR6A 2C8UA 2N5BA 4JEDA 4EC0A 3DD3A 2V2GA 4MK3A 1SK0A 1EGRA 1JLVA 2ZNMA 3GKNA 1KEBA 3M8NA 4E8EA 1F9MA 3M3MA 2M46A 4WETA 1GL8A 1K0AA 5AN1A 5LCZA 3P8WA 4OMVA 6GSWA 4K8MA 1XPVA 3ZTLA 4BVXB 1Q4JA 1AW9A 3G9BA 3HVSA 4DEJA 4QL7A 1AQWA 2O7KA 1ON4A 3ME8A 4PUFC 5J5NA 4FQUA 1SKWB 4XS6A 4L0UA 2VOCA 1C72A 1H4OA 2VCXA 3G7IA 2I4AA 1VF2A 3LYKA 2GSQA 2HSYA 11GSA 1SJIA 2L4QA 3D0ZA 3KJYA 2H73A 2P31A 3ZITA 1TU7A 3NZNA 1U88A 1NSWA 1MD4A 3L4NA 3HHVA 4FYUA 1SD9A 3Q18A 5DVBA 1TXXA 5G31A 5JCWA 2WS2A 4WBJA 4XRAA 5DDLA 2F3MA 5ECSA 2EIRA 4ECIA 1T4YA 2H19A 1SL1B 1OAZA 2IMIA 1SYRA 2VCVA 3A3TA 5D93A 2YCDA 3FK8A 2I3YA 3U6VA 1UA5A 4Z7XA 3IAM2 4GF0A 5FT3A 1K3OA 2X64A 1X5DA 4GTUA 4POKA 4AF2A 1YY7A 2CT6A 4KH7A 1J9BA 1OKDA 1GUHA 3TCOA 1A8LA 1J08A 1NM3A 3PR8A 2FHEA 1SD8A 3TUEA 1EV4A 4TW5A 2PVQA 2HE3A 2LJKA 3A2WA 2JZTA 4ZILA 2JU5A 1GLQA 3WT2A 2FD3A 1PKZA 1NHOA 4OCFA 3V1WA 7GSSA 4V2NA 2PMTA 1GSEA 3KM6A 4ULXA 3IK9A 2GLRA 2IMEA 4HUAA 1X0RA 5DAKA 4TXVA 1MD3A 4J2FA 4QQ7A 1YQ1A 3E0UA 5IPGA 3KMNA 1T8EB 3CBUA 3ME7A 4O7HA 1XWBA 2GZYA 4JR4A 4OO4A 5KEJA 3U5RE 3FYGA 3KD0A 3WGEA 2H74A 1Y6EA 2HFDA 2REMA 2PN8A 3GN3A 5IMAA 4BA7A 3L0HA 4KGIA 4OCEA 1GTIA 4KAEA 3M0FA 3IBHA 3R3EA 3RHCA 2LS5A 3HJOA 2CVBA 3D21A 3UARA 3DMLA 4GQFA 3QAGA 5FHIA 4EL1A 3TDGA 2YZHA 1KNGA 3P90A 1AQXA 1ZYQB 4XCSA 3TKSC 3FZAA 4PQ1A 3L9SA 3I43A 1ZCPA 5J9CA 2VD0A 1ILOA 3FZ9A 5F05A 3DGQA 2CZ3A 5CRHA 2HRKB 2FWGA 3ZVJA 3IXRA 4TXOA 1JFUA 1WE0A 5DALA 3FY7A 2HNLA 3F9UA 4RI7A 4EUYA 3F4TA 4RQXA 4WF5A 5DJMA 5G2ZA 2Z9SA 2R3XA 3TKRA 1PRXA 4V1Ap 1M9AA 2E2GA 4V1Ag 2HQTA 1TRWA 3UOMA 1MEKA 2BMXA 2B7JA 1XZOA 3DVXA 4TR1B 2HSMB 3QAWA 5HR0A 4IJIA 4I2TA 3TKSA 3EU3A 3D22A 2VCZA 4YQVA 3SBCA 2FLSA 2C0GA 2ES7A 2RM6A 5ID2A 3LXTA 1G0TA 2H6XA 4HQSA 3F6DA 3VWUA 3GH9A 5EPFA 5BMUA 2V32A 2B5EA 4NWYA 2RUFA 1YJ6A 1BG5A 3UBLA 1W4VA 5ECMB 3UVHA 4BPYA 3CSJA 2DMMA 3NOFA 2QGVA 4GSTA 2V41A 3ZIJA 4G0IA 1WMJA 3VI7A 3HCZA 1OC3A 3TJBA 3TB2A 2HRAA 2M72A 1S3AA 1B4QA 8GSSA 2RLIA 5GSTA 4LMVA 4NMUA 16GSA 1A2LA 2N5AA 4NHWA 5GAPD 5LD0A 2FGXA 2IL3A 4G0KA 1GUKA
chains in the Genus database with same CATH superfamily
4PNGA 5E59A 2AUVA 1BQ7A 3H1NA 3APOA 3BCIA 1Z6NA 2VAFA 1M2BA 1HNBA 1EOGA 2H30A 3HVVA 3VLNA 1BEDA 3IC4A 2R4VA 2OBKA 2EIOA 4JZQA 2VD1A 1QQ2A 4I6XA 1A23A 3KP8A 5HR3A 3H79A 1GULA 3IDVA 2LTKA 2YNXA 1FOVA 2DC5A 5GZZB 1XOAA 2FUG2 2JSZA 1N25A 4PNFA 2L5OA 1IYHA 1SJ6A 3WD6A 1XOBA 4ZBBA 4Q5RA 5A4UA 2GGTA 4EDZA 4YQUA 1VGLA 6GSUA 1UN2A 3GKXA 2L6DA 2HYXA 3F6FA 4MJEA 4TVEA 1OE8A 4KA0A 3C1SA 3C8EA 3MAKA 2AB6A 2FA8A 2WW0A 4YAVA 5ECLB 4Q5QA 5J9BA 3BBYA 4USSA 5ABRA 2O3EA 3ERGA 3VPTA 2OJLA 4MF6A 5B6MA 3ZREA 2GQKA 3EINA 1K3LA 2LUSA 5IPHA 4IJ3A 3ZL5A 3RBTA 5C04A 3E3EA 1U3AA 2VL3A 5IMDA 3I6AA 2OACA 1YF0A 1GRXA 1BF5A 1BJXA 1SVMA 2WFCA 1A0FA 2NVLA 1AXDA 3P7XA 1PQNA 1JZDA 3KCMA 2WW3A 3LORA 3ZFBA 4MH3A 1GSYA 3MNGA 5D9WA 1URMA 4TKYA 1EOHA 2ON5A 5J4UA 4AKIA 4XRDA 1B4PA 3ZRDA 4ZBDA 2WZSA 3A2XA 3M9JA 3HVXA 2PBJA 4HZ2A 3O76A 3D6IA 1AUCA 4MMMA 2EFHA 2BTOT 2P0GA 1QGVA 2CVDA 2O85A 2B1KA 3CRUA 1TKDB 4L5OA 1FW1A 3FZ4A 2DJKA 3IE3A 5J47A 2OKAA 3P2AA 1O6JA 4PUAA 6GSVA 4AJ8A 1SYXA 1TRUA 1A8YA 2VIMA 2JZSA 1QFNA 4MCUA 2CZ2A 4E8HA 5AGYA 2B5YA 4PI0C 4BWQA 5IMVA 1PMTA 4EF0A 1SL2B 4PTSA 3F4RA 4ZIJA 2NDOA 2VLUA 4IVFA 2HZFA 17GSA 1G7OA 1XW6A 3TU3B 1RQMA 4Q5FA 2VL2C 4HS1A 3QPMA 2E0QA 2GTUA 3ZZXA 22GSA 2GSSA 3VURA 1GSDA 2MMZA 2H1AA 1FG4A 3KH9A 5COHA 1TK8B 4GLTA 1T1VA 1UVZA 4EKZA 4ZB9A 3EMPA 3HY2A 2DBCA 4BL7B 1WIKA 5CREA 3GTUA 1Z6MA 3WGXA 2TRXA 3Q19A 2A4HA 3FKFA 4O32A 2VKZG 3RHBA 1ERVA 2DJ1A 3EURA 4AKXB 4BWSA 3ED3A 1QXHA 3VI5A 1XW9A 3F3RA 4PX1A 2J23A 2ZCTA 1YEXA 4DSSB 3ZVJD 5B8AA 1BAYA 3F4SA 3H93A 2E2MA 1CQHA 1GWCA 4HU9A 2VL2A 2NBSA 1PX6A 2HZEA 4WKWA 2VLVA 3EVIA 2PWJA 2CAIA 2O36A 4NPBA 1SKSB 5ECRB 2JADA 3GA4A 3VWVA 2MMAA 1XVQA 3UBKA 1SVOA 4BVYB 1GTUA 3FR3A 2IMKA 2H0IA 2YWMA 1FHEA 4O92A 5G5FA 4LL1B 2KP2A 4KDXA 4OFMA 5D8IA 3C1RA 1K0BA 3J7Yb 1TOFA 4CY6A 4EE0A 1ZMAA 1WJKA 4IGJA 1FVKA 5DJLA 5A5HA 5ECHB 4JBBA 2HRFA 3LEFA 5ECNB 3QMXA 2LQOA 1OE7A 5CYYA 4PGTA 4HOJA 5KN2A 1N8JA 1DUGA 3IV4A 4Q5NA 1NW2A 1USBA 1K0NA 4ML1A 2WRTA 3ZLPA 2AJQB 4W66A 2CX4A 2GSRA 5CO3A 2XPEA 4K6XA 1O8XA 2KOKA 2GS3A 20GSA 3CWGA 2AAWA 2DKHA 3KIJA 2AYTA 5EVOA 1M2DA 2L4CA 2OE0A 2OBIA 1XWGA 4GCIA 3RPPA 5J3RA 1K0OA 4K0NA 2H1GA 4HU7A 2H01A 5H5QA 3C7MA 4ICYA 2C4JA 4PQHA 2FCHA 3FZ5A 4HI7A 1KTEA 3KTLA 5E4WA 3O3TA 4MZWA 5JWOB 1XWAA 3I69A 5GSSA 2XHFA 4X43A 4ZBAA 5A4VA 5KN1A 4K5RA 1M0UA 2K8VA 3GH6A 4TOPA 4RUVA 2LEGA 4N0VA 4YAPA 1SENA 1O73A 2KLXA 4ACSA 1ABAA 2DSAA 2C80A 1GTAA 1X9WB 4YKGA 2H8LA 2H75A 1HQOA 4KW6A 3DRNA 4HJ2A 4WXTA 1PL2A 5ELGA 3CTGA 2IN3A 3TJFA 3C71A 2JL4A 2B1LA 2QA1A 1XWCA 3DYRA 2YN1A 1TRVA 1CQGA 4ISDA 1Q98A 5A34A 2FY6A 4X4JA 1Z3EA 2C0DA 1X5CA 2H1BA 4YH2A 3UVTA 4ZL8A 5ECKB 3ZFLA 1MTCA 2PPTA 3TRQA 1S3DA 4AGSA 1V98A 1WRYA 2X8GA 3GMFA 5A1NA 3TRXA 2V6OA 1TK0B 4TR0A 5C00A 1E6BA 3DIEA 2YWIA 4IKHA 4MF7A 3HKRA 1K0MA 1W89A 3JCML 1ZL9A 3Q74A 4PQIA 1U87A 4MA9A 3Q6OA 4GXZA 1A2JA 3ZIVA 3NIVA 3G7JA 1ZGNA 2FWHA 4GQCA 1AIUA 3RPNA 2QKEA 1OC9A 2VLTA 2AHEA 4ECCA 5ECPB 5F0GA 4ZL7A 2KP1A 4FXYP 5EL8A 4XS1A 1Z9HA 1XCCA 1RW1A 2VM1A 3EU4A 4OWYA 1THXA 5G1LA 3TGZA 3KGKA 2I1UA 1V40A 4GSNA 1S4BP 1M9BA 4I97A 4N3ZA 2O89A 4MJBA 1DBYA 1TTZA 2VO4A 3EC3A 3D5JA 1TI1A 4KUNA 1A24A 1EEJA 2CAQA 3IAS2 2ON7A 1TP9A 1SL0B 4XS4A 2DIYA 4QMKA 13GSA 3IK7A 3LSZA 2YP6A 2LSTA 1DE1A 2IWTA 3TJGA 4EO3A 2HT9A 5DQYA 3DVWA 1H75A 4MZCA 4ZB7A 4IQ1A 1DE2A 4D73A 5B6NA 1BYEA 4V2MA 2R5GA 1U3IA 2HSNB 4KSOA 2GT5A 18GSA 1K3YA 3K8NA 1Z7RA 1GSUA 2YZUA 3GIXA 4MF5A 3EE2A 12GSA 2VCTA 1PL1A 1MDJA 1YF1A 1X9SB 3QAVA 4N10A 5IMZA 2GZPA 5DAKB 2B7KA 4ZB6A 4TN8A 4A5PA 4EIQA 4WF4A 3OR5A 1ZZYA 1B9XC 2C3NA 3GURA 4KCAA 2LNSA 4X1UA 5DBQA 4KCEA 3I9V2 2C3QA 2IJYA 1ACVA 2IFQA 1YKCA 3GSSA 2WVYA 4IW9A 5G5EA 1ERTA 1PFOA 3BCKA 4I5QA 1K0CA 3HJMA 5AIVA 1F37A 3CRTA 4ECBA 4WEYA 3HZ8A 5DCHA 2HRNA 5A4WA 3O6TA 3IA1A 4NAXA 3S9FA 5LNKe 3GYKA 3GX8A 3H4KA 4CW9A 5HFIA 2LJAA 4K1FA 2ALBA 5ENUA 4KSMA 2P5QA 3TKPA 5CAXA 4TXOB 1ST9A 3EYTA 1J0FA 1M7TA 3N5OA 4FYCA 4MLYA 5F06A 4MDCA 1I1IP 1XW5A 3KEBA 4HQZA 2H0GA 4G10A 4EVMA 2X99A 1EP8A 1PSQA 4V2LA 2R0CA 4POLA 2UV8G 4JE1A 4F0CA 3VK9A 5ECQB 1A2MA 3HMJG 3CSIA 1BX9A 1EZKA 2EC4A 1ZYEA 3US3A 5IOXA 1JHBA 5ID2B 5D9TA 2QC7A 3VPQA 3L9VA 4BVXA 2J9HA 5CRGA 1V57A 1T4ZA 5BMUB 2BJXA 4ILFA 4HEA2 3KMOA 3F63A 6GSXA 4K9ZA 3M1GA 1ERUA 2A2SA 1Z5YE 4CDOA 2B6MA 1VF3A 4F0BA 2DJ0A 1RK4A 3ZMLA 1THOA 2WVXA 2LKUA 5IM9A 1FAAA 4N0ZA 2JZRA 1GSSA 1UC7A 3FHKA 2I9HA 4IBPA 2X8CA 2LRNA 2LRCA 5H5RA 4K0GA 4RI6A 5IIZA 2GT6A 3L78A 2L57A 4CY8A 1WOUA 3HDCA 2PU9C 1G7EA 2V1MA 1PGTA 1HYUA 2IMDA 2FWFA 1TW9A 4PURA 4L0WA 4OO5A 4MP4A 3BOAA 4XTSA 1T7PB 5J4YA 3W8JA 2MMNA 4JU5A 3TKQA 4IQAA 5DCGA 5IMFA 5JCUA 5G30A 3GSTA 2LV3A 1XWKA 1IYIA 1XVWA 4N11A 2P5RA 3A5WA 4IP1A 3GHAA 2DMLA 4AKGA 5INYA 1N2AA 4O5RA 2HSHA 3MWHA 1PA3A 5JWQB 4ML6A 3LGCA 3GRXA 2YJ7A 2WZ9A 4J57E 3IRAA 3EMXA 4KDUA 2K6VA 2EIQA 2B5XA 4IP6A 3CHXC 1TDIA 5ECOB 4ZXGA 4F03A 4HSCX 4MZBA 2CV4A 4DSQA 1HNAA 1JZWA 4HZ4A 1VF1A 4ID0A 3IOSA 5EY6A 1SK1A 1ZOFA 4K7OA 1AQVA 2DKIA 3TJKA 4ZL9A 3DKSA 3ISOA 1GSFA 1ERWA 2RM5A 4HDEA 2RUEA 1QMVA 2C3TA 1B8XA 4I8BA 2K8SA 3GNJA 1GP1A 6GSYA 4GRFA 1X5EA 1ML6A 3LQ7A 2VL9A 4L8EA 3MSZA 2X8HA 3HZ4A 3EWLA 1X9MB 4F2IA 3KTBA 2YOIA 3PPUA 1A0RP 4H86A 3H8QA 1K0DA 1LU4A 2HRKA 1OVNA 2HLSA 2LJRA 3F0IA 3IC8A 2A4VA 3SWLA 5B8BA 2F9SA 1G6WA 1PD21 3F3QA 3APSA 3QFBC 2O5VA 3UJ1A 4K2XA 4OD7A 3DEXA 6GSSA 2FWEA 3WT1A 2JSYA 19GSA 2UZ8A 1WPIA 3TJJA 4KNDA 2R0PA 3CYNA 1LJRA 2L59A 4FYBA 4TR1A 2HSMA 4FH8A 4TRXA 1MDKA 3F8UA 1R4WA 3R2QA 3KP9A 2VCQA 4AJ7A 4MH2A 3J7Yk 1S3RA 1R26A 3A2VA 3CXGA 1GLPA 5CP1A 4EIPA 5JWRB 2OT3A 2K9FA 4K7IA 2WDUA 1QUWA 4TR3A 5D96A 4KE3A 5IMCA 4K7NA 2DJ2A 4E68A 1GTBA 1Y25A 2DLXA 3GTUB 5IO2A 3QCPA 1M3JA 3FR9A 4Z2TA 3UL3A 1PN9A 4X0XA 4XIHA 5CNWA 4GDFA 4G9HA 2JACA 3N9JA 1YVLA 3LYPA 2K18A 2M80A 2G2QA 1JZOA 2L6CA 2MBTA 3G7YA 2LNTA 2TRCP 5B7CA 2O8VB 1GUMA 2MMOA 2GZZA 3KZQA 4MJAA 1O85A 3FW2A 4Z2RA 3LXZA 2L5LA 3GX0A 2H72A 2H6YA 2OA7A 3CSHA 1V58A 2H1DA 2H0HA 2C0FA 2H76A 3LG6A 4NV2A 1GH2A 2HZEB 3LFLA 4AJ6A 1PKWA 2MBSA 4IELA 3LWAA 3VWWA 2GSTA 3ERFA 3E9JB 3RAZA 3GV1A 2YV9A 2WB9A 4F9ZA 3CTFA 3HYPA 2H6ZA 4MJCA 3UIWA 2H71A 2YWNA 1F3AA 1V2AA 3BJ5A 2N5FA 5H5SA 5A5HB 1SJZA 2XBQA 4EDYA 2D2ZA 1V9WA 2WGRA 3MIXA 4PI2C 3D4TA 4POBA 1Y1UA 5HQPA 2X4AA 2HXKA 3GFKA 3GL5A 3KXOA 1E2YA 3W6GA 4QL9A 2VCWA 1SKRB 1F6MC 2FNOA 2O87A 2ZUPA 3MDKA 3QOUA 1R7HA 4IHUA 1YEPA 4G01A 1XBSA 2CX3A 4XHMA 2KHPA 1I9DA 3DXBA 1VRSD 1T00A 3KH7A 1YZXA 5GAND 4NHZA 1FVJA 2DJJA 5G1KA 3UAPA 4IN0A 5BRTA 3QR6A 2G0FA 2EFDA 1TU8A 4DVCA 1PN0A 4MABA 1Z7PA 4WR4A 5D73A 4FO5A 4L5LA 2E7PA 2TIRA 2R0GA 6GSTA 5HFGA 1F3BA 1YEWC 3IR4A 2YWOA 4G0LA 2F8AA 4N30A 1QK8A 2IPAA 2YJHA 2WCIA 5AIXA 3PH9A 2H70A 3RDWA 1R5AA 3FR6A 3QD9A 3IPZA 1YKAA 14GSA 1AAZA 4JRRA 1PX7A 5IOWA 4IS0A 3TKSE 2OE1A 1SK2A 5J4VA 4TR4A 1DSBA 2WULA 2KUCA 5HR2A 4KX4A 2GDRA 5CRWA 1AC1A 2YV7A 1EGOA 5D9VA 1OYJA 1S3CA 3FRCA 4MPGA 2OE3A 5F07A 2CQ9A 2PUKC 2IIYA 4LMWA 4PHZC 1LBKA 5A34B 3C73A 5JCGA 3ZYWA 2EFEA 1O81A 2QA2A 3LW9A 4F82A 5F8BA 1FO5A 1XXUA 4OFNA 4MPFA 4YQMA 2H1LA 2MYGA 1I5GA 4BL7A 5A1NB 1O8WA 1TJDA 5KN3A 3HD5A 1GNWA 2H66A 2AV4A 1XFLA 5DALB 4ZB8A 5KOWA 1B48A 4HJMA 3BD2A 4CHSA 10GSA 4G2EA 3HA9A 1SVLA 4K5SA 4K2DA 1NHYA 2B3SA 5HR1A 2VUPA 2C1YA 4DSSA 5A5KA 5HFKA 4LLRA 1OC9B 2RIIA 2NTOA 2PGTA 2F51A 3GUSA 2XBIA 3GKMA 2A2PA 4POMA 5ELAA 2EFCA 2LRTA 2MZCA 2GQLA 3D4MA 1OKTA 1M99A 3TOUA 3QFAC 3UEMA 2WJUA 1XIYA 1TRSA 4BVYA 4KF9A 5L71A 3FEUA 3EPTA 5D9XA 2XC2A 1FB0A 2GQMA 2PERA 3PGTA 2C0EA 3ERWA 1HD2A 1TXUA 1R5PA 4XS4B 4BIKA 3MYDA 2WVZA 1GSQA 5ECIB 2R37A 1M2AA 4DSRA 1XG8A 3RGBC 1YDKA 4LL4B 3L9UA 1KBNA 4D73B 2V6KA 3LJRA 3IHGA 2FA4A 1TI3A 1ZYNA 3GL3A 2F8FA 2A2RA 5J41A 1EWXA 2DIZA 4PXOA 3WYWA 5AISA 5KN0A 3IHQA 4NXIA 4ECJA 4O5QA 2OADA 4J56E 1G6YA 1JZRA 5FWGA 2PVOC 5IQYA 1SU9A 3M9KA 2YANA 4FIWA 3CMIA 4YKFA 1B9YC 5CRDA 2NPBA 4I2UA 1ZYPA 2R2JA 3DWVA 2GVPA 2CA8A 2HI7A 1F2EA 1OC8A 4AKHA 1U6TA 3HVNA 2WW1A 1O7UA 1T3BA 2IFQB 2X49A 2DJ3A 1MDIA 4P3YB 3CQFA 1EEMA 4OFTA 1VF4A 4RQRA 4EXJA 1EV9A 2R6KA 3WGDA 2LQQA 3VWXA 3W8SA 4NV5A 3AY8A 4KB3A 3PINA 4G19A 1HNCA 3TRPA 2IMFA 3VFIA 1EP7A 3HJPA 3QDNA 9GSSA 1WP0A 1WWJA 4KDYA 3HXSA 4WR5A 1TK5B 3UMAA 5IO0A 2XPDA 2YPMA 5DQSA 1FB6A 1JLWA 4LA1A 3TOTA 1GNEA 2I81A 3APQA 2QSIA 2CVKA 2VM2A 3GKKA 4WBRD 3ZMKA 4GSSA 4GWRA 4JR6A 2C8UA 2N5BA 4JEDA 4EC0A 3DD3A 2WW2A 2V2GA 4MK3A 1SK0A 1EGRA 1JLVA 2ZNMA 3GKNA 1KEBA 3M8NA 4E8EA 1F9MA 3M3MA 2M46A 4WETA 1GL8A 1K0AA 5AN1A 5LCZA 3P8WA 4OMVA 6GSWA 4K8MA 1XPVA 3ZTLA 4BVXB 1Q4JA 1AW9A 3G9BA 3HVSA 4DEJA 4QL7A 1AQWA 2O7KA 1ON4A 3ME8A 4PUFC 5J5NA 4FQUA 1SKWB 4XS6A 4L0UA 2VOCA 1C72A 1H4OA 2VCXA 3G7IA 2I4AA 1VF2A 2WVXB 3LYKA 2GSQA 2HSYA 11GSA 1SJIA 2L4QA 3D0ZA 3KJYA 2H73A 2P31A 3ZITA 1TU7A 3NZNA 1U88A 1NSWA 1MD4A 3L4NA 3HHVA 4FYUA 1SD9A 3Q18A 5DVBA 1TXXA 5G31A 5JCWA 2WS2A 4WBJA 4XRAA 5DDLA 2F3MA 5ECSA 2EIRA 4ECIA 1T4YA 2H19A 1SL1B 1OAZA 2IMIA 1SYRA 2VCVA 3A3TA 5D93A 2YCDA 3FK8A 2I3YA 3U6VA 1UA5A 4Z7XA 3IAM2 4GF0A 4O5UA 5FT3A 1K3OA 2X64A 1X5DA 4GTUA 4POKA 3A5IA 4AF2A 1YY7A 2CT6A 4KH7A 1J9BA 1OKDA 1GUHA 3TCOA 1A8LA 1J08A 1NM3A 3PR8A 2FHEA 1SD8A 3TUEA 1EV4A 4TW5A 2HSNA 2PVQA 2HE3A 2LJKA 3A2WA 2JZTA 4ZILA 2JU5A 1GLQA 3WT2A 2FD3A 1PKZA 1NHOA 4OCFA 3V1WA 7GSSA 4V2NA 2PMTA 1GSEA 3KM6A 4ULXA 3IK9A 2GLRA 2IMEA 4HUAA 1X0RA 5DAKA 4TXVA 1MD3A 4J2FA 4QQ7A 1YQ1A 3E0UA 5IPGA 3KMNA 1T8EB 3CBUA 3ME7A 4O7HA 1XWBA 3FMWA 2GZYA 4JR4A 4OO4A 5KEJA 3U5RE 3FYGA 3KD0A 3WGEA 2H74A 1Y6EA 2HFDA 2REMA 2PN8A 3GN3A 5IMAA 4BA7A 3L0HA 4KGIA 4OCEA 1GTIA 4KAEA 3M0FA 3IBHA 3R3EA 3RHCA 2LS5A 3HJOA 2CVBA 3D21A 3UARA 3DMLA 4GQFA 3QAGA 5FHIA 4EL1A 3TDGA 2YZHA 1KNGA 3P90A 1AQXA 1ZYQB 4XCSA 3TKSC 3FZAA 4PQ1A 3L9SA 3I43A 1ZCPA 5J9CA 2VD0A 1ILOA 3FZ9A 5F05A 3DGQA 2CZ3A 5CRHA 2HRKB 2FWGA 3ZVJA 3IXRA 4TXOA 1JFUA 1WE0A 5DALA 3FY7A 2HNLA 3F9UA 4RI7A 4EUYA 4Z2UA 3F4TA 4RQXA 4WF5A 5DJMA 5G2ZA 2Z9SA 2R3XA 3TKRA 4MNNA 1PRXA 4V1Ap 1M9AA 2E2GA 5KOXA 4V1Ag 2HQTA 5J40A 1TRWA 4AI6A 3UOMA 3RFRC 1MEKA 2BMXA 1BG1A 2B7JA 1XZOA 3DVXA 4TR1B 2HSMB 3QAWA 5HR0A 4IJIA 4I2TA 3TKSA 3EU3A 1FOHA 2VCZA 4YQVA 3D22A 3SBCA 2FLSA 2C0GA 2ES7A 2RM6A 5ID2A 3LXTA 1G0TA 2H6XA 1M3IA 4HQSA 3F6DA 3VWUA 3GH9A 5EPFA 5BMUA 2V32A 2B5EA 4NWYA 2RUFA 1YJ6A 1BG5A 3UBLA 1W4VA 5ECMB 3UVHA 4BPYA 3CSJA 2DMMA 3NOFA 2QGVA 4GSTA 2V41A 3ZIJA 4G0IA 1WMJA 3VI7A 3HCZA 1OC3A 3TJBA 3TB2A 2HRAA 2M72A 1S3AA 1B4QA 8GSSA 2RLIA 5GSTA 4LMVA 4NMUA 16GSA 1A2LA 2N5AA 4NHWA 5GAPD 5LD0A 2FGXA 2IL3A 4G0KA 1GUKA
chains in the Genus database with same CATH topology
4PNGA 5E59A 2AUVA 1BQ7A 3H1NA 3APOA 3BCIA 1Z6NA 2VAFA 1M2BA 1HNBA 1EOGA 2H30A 3HVVA 3VLNA 1BEDA 3IC4A 2R4VA 2OBKA 2EIOA 4JZQA 2VD1A 1QQ2A 4I6XA 1A23A 3KP8A 5HR3A 3H79A 1GULA 3IDVA 2LTKA 2YNXA 1FOVA 2DC5A 5GZZB 1XOAA 2FUG2 2JSZA 1N25A 4PNFA 2L5OA 1IYHA 1SJ6A 3WD6A 1XOBA 4ZBBA 4Q5RA 5A4UA 2GGTA 4EDZA 4YQUA 1VGLA 6GSUA 1UN2A 3GKXA 2L6DA 2HYXA 3F6FA 4MJEA 4TVEA 1OE8A 4KA0A 3C1SA 3C8EA 3MAKA 2AB6A 2FA8A 4YAVA 5ECLB 4Q5QA 5J9BA 3BBYA 4USSA 5ABRA 3ERGA 3VPTA 2OJLA 4MF6A 5B6MA 3ZREA 2GQKA 3EINA 1K3LA 2LUSA 5IPHA 4IJ3A 3ZL5A 3RBTA 5C04A 3E3EA 1U3AA 2VL3A 5IMDA 3I6AA 2OACA 1YF0A 1GRXA 1BF5A 1BJXA 1SVMA 2WFCA 1A0FA 2NVLA 1AXDA 3P7XA 1PQNA 1JZDA 3KCMA 3LORA 3ZFBA 4MH3A 1GSYA 3MNGA 5D9WA 1URMA 4TKYA 1EOHA 2ON5A 5J4UA 4AKIA 4XRDA 1B4PA 3ZRDA 4ZBDA 3A2XA 3M9JA 3HVXA 2PBJA 4HZ2A 3O76A 3D6IA 1AUCA 4MMMA 2EFHA 2BTOT 2P0GA 1QGVA 2CVDA 2O85A 2B1KA 3CRUA 1TKDB 4L5OA 1FW1A 3FZ4A 2DJKA 3IE3A 5J47A 2OKAA 3P2AA 1O6JA 4PUAA 6GSVA 4AJ8A 1SYXA 1TRUA 1A8YA 2VIMA 2JZSA 1QFNA 4MCUA 2CZ2A 4E8HA 5AGYA 2B5YA 4BWQA 5IMVA 1PMTA 4EF0A 1SL2B 4PTSA 3F4RA 4ZIJA 2NDOA 2VLUA 4IVFA 2HZFA 17GSA 1G7OA 1XW6A 3TU3B 1RQMA 4Q5FA 2VL2C 4HS1A 3QPMA 2E0QA 2GTUA 3ZZXA 22GSA 2GSSA 3VURA 1GSDA 2MMZA 2H1AA 1FG4A 3KH9A 5COHA 1TK8B 4GLTA 1T1VA 1UVZA 4EKZA 4ZB9A 3EMPA 3HY2A 2DBCA 4BL7B 1WIKA 5CREA 3GTUA 1Z6MA 3WGXA 2TRXA 3Q19A 2A4HA 3FKFA 4O32A 2VKZG 3RHBA 1ERVA 2DJ1A 3EURA 4AKXB 4BWSA 3ED3A 1QXHA 3VI5A 1XW9A 3F3RA 4PX1A 2J23A 2ZCTA 1YEXA 4DSSB 3ZVJD 5B8AA 1BAYA 3F4SA 3H93A 2E2MA 1CQHA 1GWCA 4HU9A 2VL2A 2NBSA 1PX6A 2HZEA 4WKWA 2VLVA 3EVIA 2PWJA 2CAIA 4NPBA 1SKSB 5ECRB 2JADA 3GA4A 3VWVA 2MMAA 1XVQA 3UBKA 1SVOA 4BVYB 1GTUA 3FR3A 2IMKA 2H0IA 2YWMA 1FHEA 4O92A 5G5FA 4LL1B 2KP2A 4KDXA 4OFMA 5D8IA 3C1RA 1K0BA 3J7Yb 1TOFA 4CY6A 4EE0A 1ZMAA 1WJKA 4IGJA 1FVKA 5DJLA 5A5HA 5ECHB 4JBBA 2HRFA 3LEFA 5ECNB 3QMXA 2LQOA 1OE7A 5CYYA 4PGTA 4HOJA 5KN2A 1N8JA 1DUGA 3IV4A 4Q5NA 1NW2A 1USBA 1K0NA 4ML1A 2WRTA 3ZLPA 2AJQB 4W66A 2CX4A 2GSRA 5CO3A 2XPEA 4K6XA 1O8XA 2KOKA 2GS3A 20GSA 3CWGA 2AAWA 2DKHA 3KIJA 2AYTA 5EVOA 1M2DA 2L4CA 2OE0A 2OBIA 1XWGA 4GCIA 3RPPA 5J3RA 1K0OA 4K0NA 2H1GA 4HU7A 2H01A 5H5QA 3C7MA 4ICYA 2C4JA 4PQHA 2FCHA 3FZ5A 4HI7A 1KTEA 3KTLA 5E4WA 3O3TA 4MZWA 5JWOB 1XWAA 3I69A 5GSSA 2XHFA 4X43A 4ZBAA 5A4VA 5KN1A 4K5RA 1M0UA 2K8VA 3GH6A 4TOPA 4RUVA 2LEGA 4N0VA 4YAPA 1SENA 1O73A 2KLXA 4ACSA 1ABAA 2DSAA 2C80A 1GTAA 1X9WB 4YKGA 2H8LA 2H75A 1HQOA 4KW6A 3DRNA 4HJ2A 4WXTA 1PL2A 5ELGA 3CTGA 2IN3A 3TJFA 3C71A 2JL4A 2B1LA 2QA1A 1XWCA 3DYRA 2YN1A 1TRVA 1CQGA 4ISDA 1Q98A 5A34A 2FY6A 4X4JA 1Z3EA 2C0DA 1X5CA 2H1BA 4YH2A 3UVTA 4ZL8A 5ECKB 3ZFLA 1MTCA 2PPTA 3TRQA 1S3DA 4AGSA 1V98A 1WRYA 2X8GA 3GMFA 5A1NA 3TRXA 2V6OA 1TK0B 4TR0A 5C00A 1E6BA 3DIEA 2YWIA 4IKHA 4MF7A 3HKRA 1K0MA 1W89A 3JCML 1ZL9A 3Q74A 4PQIA 1U87A 4MA9A 3Q6OA 4GXZA 1A2JA 3ZIVA 3NIVA 3G7JA 1ZGNA 2FWHA 4GQCA 1AIUA 3RPNA 2QKEA 1OC9A 2VLTA 2AHEA 4ECCA 5ECPB 5F0GA 4ZL7A 2KP1A 5EL8A 4XS1A 1Z9HA 1XCCA 1RW1A 2VM1A 3EU4A 4OWYA 1THXA 5G1LA 3TGZA 3KGKA 2I1UA 1V40A 4GSNA 1M9BA 4I97A 4N3ZA 2O89A 4MJBA 1DBYA 1TTZA 2VO4A 3EC3A 3D5JA 1TI1A 4KUNA 1A24A 1EEJA 2CAQA 3IAS2 2ON7A 1TP9A 1SL0B 4XS4A 2DIYA 4QMKA 13GSA 3IK7A 3LSZA 2YP6A 2LSTA 1DE1A 2IWTA 3TJGA 4EO3A 2HT9A 5DQYA 3DVWA 1H75A 4MZCA 4ZB7A 4IQ1A 1DE2A 4D73A 5B6NA 1BYEA 4V2MA 2R5GA 1U3IA 2HSNB 4KSOA 2GT5A 18GSA 1K3YA 3K8NA 1Z7RA 1GSUA 2YZUA 3GIXA 4MF5A 3EE2A 12GSA 2VCTA 1PL1A 1MDJA 1YF1A 1X9SB 3QAVA 4N10A 5IMZA 2GZPA 5DAKB 2B7KA 4ZB6A 4TN8A 4A5PA 4EIQA 4WF4A 3OR5A 1ZZYA 1B9XC 2C3NA 3GURA 4KCAA 2LNSA 4X1UA 5DBQA 4KCEA 3I9V2 2C3QA 2IJYA 1ACVA 2IFQA 1YKCA 3GSSA 4IW9A 5G5EA 1ERTA 3BCKA 4I5QA 1K0CA 3HJMA 5AIVA 1F37A 3CRTA 4ECBA 4WEYA 3HZ8A 5DCHA 2HRNA 5A4WA 3O6TA 3IA1A 4NAXA 3S9FA 5LNKe 3GYKA 3GX8A 3H4KA 4CW9A 5HFIA 2LJAA 4K1FA 2ALBA 5ENUA 4KSMA 2P5QA 3TKPA 5CAXA 4TXOB 1ST9A 3EYTA 1J0FA 1M7TA 3N5OA 4FYCA 4MLYA 5F06A 4MDCA 1XW5A 3KEBA 4HQZA 2H0GA 4G10A 4EVMA 2X99A 1EP8A 1PSQA 4V2LA 2R0CA 4POLA 2UV8G 4JE1A 4F0CA 3VK9A 5ECQB 1A2MA 3HMJG 3CSIA 1BX9A 1EZKA 2EC4A 1ZYEA 3US3A 5IOXA 1JHBA 5ID2B 5D9TA 2QC7A 3VPQA 3L9VA 4BVXA 2J9HA 5CRGA 1V57A 1T4ZA 5BMUB 2BJXA 4ILFA 4HEA2 3KMOA 3F63A 6GSXA 4K9ZA 3M1GA 1ERUA 2A2SA 1Z5YE 4CDOA 2B6MA 1VF3A 4F0BA 2DJ0A 1RK4A 3ZMLA 1THOA 2LKUA 5IM9A 1FAAA 4N0ZA 2JZRA 1GSSA 1UC7A 3FHKA 2I9HA 4IBPA 2X8CA 2LRNA 2LRCA 5H5RA 4K0GA 4RI6A 5IIZA 2GT6A 3L78A 2L57A 4CY8A 1WOUA 3HDCA 2PU9C 1G7EA 2V1MA 1PGTA 1HYUA 2IMDA 2FWFA 1TW9A 4PURA 4L0WA 4OO5A 4MP4A 3BOAA 4XTSA 1T7PB 5J4YA 3W8JA 2MMNA 4JU5A 3TKQA 4IQAA 5DCGA 5IMFA 5JCUA 5G30A 3GSTA 2LV3A 1XWKA 1IYIA 1XVWA 4N11A 2P5RA 3A5WA 4IP1A 3GHAA 2DMLA 4AKGA 5INYA 1N2AA 4O5RA 2HSHA 3MWHA 1PA3A 5JWQB 4ML6A 3LGCA 3GRXA 2YJ7A 2WZ9A 4J57E 3IRAA 3EMXA 4KDUA 2K6VA 2EIQA 2B5XA 4IP6A 1TDIA 5ECOB 4ZXGA 4F03A 4MZBA 2CV4A 4DSQA 1HNAA 1JZWA 4HZ4A 1VF1A 4ID0A 3IOSA 5EY6A 1SK1A 1ZOFA 4K7OA 1AQVA 2DKIA 3TJKA 4ZL9A 3DKSA 3ISOA 1GSFA 1ERWA 2RM5A 4HDEA 2RUEA 1QMVA 2C3TA 1B8XA 4I8BA 2K8SA 3GNJA 1GP1A 6GSYA 4GRFA 1X5EA 1ML6A 3LQ7A 2VL9A 4L8EA 3MSZA 2X8HA 3HZ4A 3EWLA 1X9MB 4F2IA 3KTBA 2YOIA 3PPUA 1A0RP 4H86A 3H8QA 1K0DA 1LU4A 2HRKA 1OVNA 2HLSA 2LJRA 3F0IA 3IC8A 2A4VA 3SWLA 5B8BA 2F9SA 1G6WA 1PD21 3F3QA 3APSA 3QFBC 2O5VA 3UJ1A 4K2XA 4OD7A 3DEXA 6GSSA 2FWEA 3WT1A 2JSYA 19GSA 2UZ8A 1WPIA 3TJJA 4KNDA 2R0PA 3CYNA 1LJRA 2L59A 4FYBA 4TR1A 2HSMA 4FH8A 4TRXA 1MDKA 3F8UA 1R4WA 3R2QA 3KP9A 2VCQA 4AJ7A 4MH2A 3J7Yk 1R26A 3A2VA 3CXGA 1GLPA 5CP1A 4EIPA 5JWRB 2OT3A 2K9FA 4K7IA 2WDUA 1QUWA 4TR3A 5D96A 4KE3A 5IMCA 4K7NA 2DJ2A 4E68A 1GTBA 1Y25A 2DLXA 3GTUB 5IO2A 3QCPA 3FR9A 4Z2TA 3UL3A 1PN9A 4X0XA 4XIHA 5CNWA 4GDFA 4G9HA 2JACA 3N9JA 1YVLA 3LYPA 2K18A 2M80A 2G2QA 1JZOA 2L6CA 2MBTA 3G7YA 2LNTA 2TRCP 5B7CA 2O8VB 1GUMA 2MMOA 2GZZA 3KZQA 4MJAA 1O85A 3FW2A 4Z2RA 3LXZA 2L5LA 3GX0A 2H72A 2H6YA 2OA7A 3CSHA 1V58A 2H1DA 2H0HA 2C0FA 2H76A 3LG6A 4NV2A 1GH2A 2HZEB 3LFLA 4AJ6A 1PKWA 2MBSA 4IELA 3LWAA 3VWWA 2GSTA 3ERFA 3E9JB 3RAZA 3GV1A 2YV9A 2WB9A 4F9ZA 3CTFA 3HYPA 2H6ZA 4MJCA 3UIWA 2H71A 2YWNA 1F3AA 1V2AA 3BJ5A 2N5FA 5H5SA 5A5HB 1SJZA 2XBQA 4EDYA 2D2ZA 1V9WA 2WGRA 3MIXA 3D4TA 4POBA 1Y1UA 5HQPA 2X4AA 2HXKA 3GFKA 3GL5A 3KXOA 1E2YA 3W6GA 4QL9A 2VCWA 1SKRB 1F6MC 2FNOA 2O87A 2ZUPA 3MDKA 3QOUA 1R7HA 4IHUA 1YEPA 4G01A 1XBSA 2CX3A 4XHMA 2KHPA 1I9DA 3DXBA 1VRSD 1T00A 3KH7A 1YZXA 5GAND 4NHZA 1FVJA 2DJJA 5G1KA 3UAPA 4IN0A 5BRTA 3QR6A 2G0FA 2EFDA 1TU8A 4DVCA 1PN0A 4MABA 1Z7PA 4WR4A 5D73A 4FO5A 4L5LA 2E7PA 2TIRA 2R0GA 6GSTA 5HFGA 1F3BA 3IR4A 2YWOA 4G0LA 2F8AA 4N30A 1QK8A 2IPAA 2YJHA 2WCIA 5AIXA 3PH9A 2H70A 3RDWA 1R5AA 3FR6A 3QD9A 3IPZA 1YKAA 14GSA 1AAZA 4JRRA 1PX7A 5IOWA 4IS0A 3TKSE 2OE1A 1SK2A 5J4VA 4TR4A 1DSBA 2WULA 2KUCA 5HR2A 4KX4A 2GDRA 5CRWA 1AC1A 2YV7A 1EGOA 5D9VA 1OYJA 1S3CA 3FRCA 4MPGA 2OE3A 5F07A 2CQ9A 2PUKC 2IIYA 4LMWA 1LBKA 5A34B 3C73A 5JCGA 3ZYWA 2EFEA 1O81A 2QA2A 3LW9A 4F82A 5F8BA 1FO5A 1XXUA 4OFNA 4MPFA 4YQMA 2H1LA 2MYGA 1I5GA 4BL7A 5A1NB 1O8WA 1TJDA 5KN3A 3HD5A 1GNWA 2H66A 2AV4A 1XFLA 5DALB 4ZB8A 5KOWA 1B48A 4HJMA 3BD2A 4CHSA 10GSA 4G2EA 3HA9A 1SVLA 4K5SA 4K2DA 1NHYA 2B3SA 5HR1A 2VUPA 2C1YA 4DSSA 5A5KA 5HFKA 4LLRA 1OC9B 2RIIA 2NTOA 2PGTA 2F51A 3GUSA 2XBIA 3GKMA 2A2PA 4POMA 5ELAA 2EFCA 2LRTA 2MZCA 2GQLA 3D4MA 1OKTA 1M99A 3TOUA 3QFAC 3UEMA 2WJUA 1XIYA 1TRSA 4BVYA 4KF9A 5L71A 3FEUA 3EPTA 5D9XA 2XC2A 1FB0A 2GQMA 2PERA 3PGTA 2C0EA 3ERWA 1HD2A 1TXUA 1R5PA 4XS4B 3MYDA 1GSQA 5ECIB 2R37A 1M2AA 4DSRA 1YDKA 4LL4B 3L9UA 1KBNA 4D73B 2V6KA 3LJRA 3IHGA 2FA4A 1TI3A 1ZYNA 3GL3A 2F8FA 2A2RA 5J41A 1EWXA 2DIZA 4PXOA 3WYWA 5AISA 5KN0A 3IHQA 4NXIA 4ECJA 4O5QA 2OADA 4J56E 1G6YA 1JZRA 5FWGA 2PVOC 5IQYA 1SU9A 3M9KA 2YANA 4FIWA 3CMIA 4YKFA 1B9YC 5CRDA 2NPBA 4I2UA 1ZYPA 2R2JA 3DWVA 2GVPA 2CA8A 2HI7A 1F2EA 1OC8A 4AKHA 1U6TA 1O7UA 1T3BA 2IFQB 2X49A 2DJ3A 1MDIA 4P3YB 1EEMA 4OFTA 1VF4A 4RQRA 4EXJA 1EV9A 2R6KA 3WGDA 2LQQA 3VWXA 3W8SA 4NV5A 3AY8A 4KB3A 3PINA 4G19A 1HNCA 3TRPA 2IMFA 3VFIA 1EP7A 3HJPA 3QDNA 9GSSA 1WP0A 1WWJA 4KDYA 3HXSA 4WR5A 1TK5B 3UMAA 5IO0A 2XPDA 2YPMA 5DQSA 1FB6A 1JLWA 4LA1A 3TOTA 1GNEA 2I81A 3APQA 2QSIA 2CVKA 2VM2A 3GKKA 4WBRD 3ZMKA 4GSSA 4GWRA 4JR6A 2C8UA 2N5BA 4JEDA 4EC0A 3DD3A 2V2GA 4MK3A 1SK0A 1EGRA 1JLVA 2ZNMA 3GKNA 1KEBA 3M8NA 4E8EA 1F9MA 3M3MA 2M46A 4WETA 1GL8A 1K0AA 5AN1A 5LCZA 3P8WA 4OMVA 6GSWA 4K8MA 1XPVA 3ZTLA 4BVXB 1Q4JA 1AW9A 3G9BA 3HVSA 4DEJA 4QL7A 1AQWA 2O7KA 1ON4A 3ME8A 4PUFC 5J5NA 4FQUA 1SKWB 4XS6A 4L0UA 2VOCA 1C72A 1H4OA 2VCXA 3G7IA 2I4AA 1VF2A 3LYKA 2GSQA 2HSYA 11GSA 1SJIA 2L4QA 3D0ZA 3KJYA 2H73A 2P31A 3ZITA 1TU7A 3NZNA 1U88A 1NSWA 1MD4A 3L4NA 3HHVA 4FYUA 1SD9A 3Q18A 5DVBA 1TXXA 5G31A 5JCWA 2WS2A 4WBJA 4XRAA 5DDLA 2F3MA 5ECSA 2EIRA 4ECIA 1T4YA 2H19A 1SL1B 1OAZA 2IMIA 1SYRA 2VCVA 3A3TA 5D93A 2YCDA 3FK8A 2I3YA 3U6VA 1UA5A 4Z7XA 3IAM2 4GF0A 4O5UA 5FT3A 1K3OA 2X64A 1X5DA 4GTUA 4POKA 3A5IA 4AF2A 1YY7A 2CT6A 4KH7A 1J9BA 1OKDA 1GUHA 3TCOA 1A8LA 1J08A 1NM3A 3PR8A 2FHEA 1SD8A 3TUEA 1EV4A 4TW5A 2HSNA 2PVQA 2HE3A 2LJKA 3A2WA 2JZTA 4ZILA 2JU5A 1GLQA 3WT2A 2FD3A 1PKZA 1NHOA 4OCFA 3V1WA 7GSSA 4V2NA 2PMTA 1GSEA 3KM6A 4ULXA 3IK9A 2GLRA 2IMEA 4HUAA 1X0RA 5DAKA 4TXVA 1MD3A 4J2FA 4QQ7A 1YQ1A 3E0UA 5IPGA 3KMNA 1T8EB 3CBUA 3ME7A 4O7HA 1XWBA 3FMWA 2GZYA 4JR4A 4OO4A 5KEJA 3U5RE 3FYGA 3KD0A 3WGEA 2H74A 1Y6EA 2HFDA 2REMA 2PN8A 3GN3A 5IMAA 4BA7A 3L0HA 4KGIA 4OCEA 1GTIA 4KAEA 3M0FA 3IBHA 3R3EA 3RHCA 2LS5A 3HJOA 2CVBA 3D21A 3UARA 3DMLA 4GQFA 3QAGA 5FHIA 4EL1A 3TDGA 2YZHA 1KNGA 3P90A 1AQXA 1ZYQB 4XCSA 3TKSC 3FZAA 4PQ1A 3L9SA 3I43A 1ZCPA 5J9CA 2VD0A 1ILOA 3FZ9A 5F05A 3DGQA 2CZ3A 5CRHA 2HRKB 2FWGA 3ZVJA 3IXRA 4TXOA 1JFUA 1WE0A 5DALA 3FY7A 2HNLA 3F9UA 4RI7A 4EUYA 4Z2UA 3F4TA 4RQXA 4WF5A 5DJMA 5G2ZA 2Z9SA 2R3XA 3TKRA 4MNNA 1PRXA 4V1Ap 1M9AA 2E2GA 5KOXA 4V1Ag 2HQTA 5J40A 1TRWA 4AI6A 3UOMA 1MEKA 2BMXA 1BG1A 2B7JA 1XZOA 3DVXA 4TR1B 2HSMB 3QAWA 5HR0A 4IJIA 4I2TA 3TKSA 3EU3A 1FOHA 2VCZA 4YQVA 3D22A 3SBCA 2FLSA 2C0GA 2ES7A 2RM6A 5ID2A 3LXTA 1G0TA 2H6XA 4HQSA 3F6DA 3VWUA 3GH9A 5EPFA 5BMUA 2V32A 2B5EA 4NWYA 2RUFA 1YJ6A 1BG5A 3UBLA 1W4VA 5ECMB 3UVHA 4BPYA 3CSJA 2DMMA 3NOFA 2QGVA 4GSTA 2V41A 3ZIJA 4G0IA 1WMJA 3VI7A 3HCZA 1OC3A 3TJBA 3TB2A 2HRAA 2M72A 1S3AA 1B4QA 8GSSA 2RLIA 5GSTA 4LMVA 4NMUA 16GSA 1A2LA 2N5AA 4NHWA 5GAPD 5LD0A 2FGXA 2IL3A 4G0KA 1GUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNG A;  5E59 A;  2AUV A;  1BQ7 A;  3H1N A;  3APO A;  3BCI A;  1Z6N A;  2VAF A;  1M2B A;  1HNB A;  1EOG A;  2H30 A;  3HVV A;  3VLN A;  1BED A;  3IC4 A;  2R4V A;  2OBK A;  2EIO A;  4JZQ A;  2VD1 A;  1QQ2 A;  4I6X A;  1A23 A;  3KP8 A;  5HR3 A;  3H79 A;  1GUL A;  3IDV A;  2LTK A;  2YNX A;  1FOV A;  2DC5 A;  5GZZ B;  1XOA A;  2FUG 2;  2JSZ A;  4PNF A;  2L5O A;  1IYH A;  1SJ6 A;  3WD6 A;  1XOB A;  4ZBB A;  4Q5R A;  5A4U A;  2GGT A;  4EDZ A;  4YQU A;  1VGL A;  6GSU A;  1UN2 A;  3GKX A;  2L6D A;  2HYX A;  3F6F A;  4MJE A;  4TVE A;  1OE8 A;  4KA0 A;  3C1S A;  3C8E A;  3MAK A;  2AB6 A;  2FA8 A;  4YAV A;  5ECL B;  4Q5Q A;  5J9B A;  3BBY A;  4USS A;  5ABR A;  3ERG A;  3VPT A;  2OJL A;  4MF6 A;  5B6M A;  3ZRE A;  2GQK A;  3EIN A;  1K3L A;  2LUS A;  5IPH A;  4IJ3 A;  3ZL5 A;  3RBT A;  5C04 A;  3E3E A;  1U3A A;  2VL3 A;  5IMD A;  3I6A A;  2OAC A;  1YF0 A;  1GRX A;  1BJX A;  2WFC A;  1A0F A;  2NVL A;  1AXD A;  3P7X A;  1PQN A;  1JZD A;  3KCM A;  3LOR A;  3ZFB A;  4MH3 A;  1GSY A;  3MNG A;  5D9W A;  1URM A;  4TKY A;  1EOH A;  2ON5 A;  5J4U A;  4XRD A;  1B4P A;  3ZRD A;  4ZBD A;  3A2X A;  3M9J A;  3HVX A;  2PBJ A;  4HZ2 A;  3O76 A;  3D6I A;  1AUC A;  4MMM A;  2BTO T;  2P0G A;  1QGV A;  2CVD A;  2O85 A;  2B1K A;  3CRU A;  1TKD B;  4L5O A;  1FW1 A;  3FZ4 A;  2DJK A;  3IE3 A;  2OKA A;  3P2A A;  1O6J A;  4PUA A;  6GSV A;  4AJ8 A;  1SYX A;  1TRU A;  1A8Y A;  2VIM A;  2JZS A;  1QFN A;  4MCU A;  2CZ2 A;  4E8H A;  5AGY A;  2B5Y A;  4BWQ A;  5IMV A;  1PMT A;  4EF0 A;  1SL2 B;  4PTS A;  3F4R A;  4ZIJ A;  2NDO A;  2VLU A;  4IVF A;  2HZF A;  17GS A;  1G7O A;  1XW6 A;  1RQM A;  4Q5F A;  2VL2 C;  4HS1 A;  3QPM A;  2E0Q A;  2GTU A;  3ZZX A;  22GS A;  2GSS A;  3VUR A;  1GSD A;  2MMZ A;  2H1A A;  1FG4 A;  3KH9 A;  5COH A;  1TK8 B;  4GLT A;  1T1V A;  1UVZ A;  4EKZ A;  4ZB9 A;  3EMP A;  3HY2 A;  2DBC A;  4BL7 B;  1WIK A;  5CRE A;  3GTU A;  1Z6M A;  3WGX A;  2TRX A;  3Q19 A;  3FKF A;  4O32 A;  3RHB A;  1ERV A;  2DJ1 A;  3EUR A;  4BWS A;  3ED3 A;  1QXH A;  3VI5 A;  1XW9 A;  3F3R A;  4PX1 A;  2J23 A;  2ZCT A;  1YEX A;  4DSS B;  3ZVJ D;  5B8A A;  1BAY A;  3F4S A;  3H93 A;  2E2M A;  1CQH A;  1GWC A;  4HU9 A;  2VL2 A;  2NBS A;  1PX6 A;  2HZE A;  4WKW A;  2VLV A;  3EVI A;  2PWJ A;  2CAI A;  4NPB A;  1SKS B;  5ECR B;  2JAD A;  3GA4 A;  3VWV A;  2MMA A;  1XVQ A;  3UBK A;  4BVY B;  1GTU A;  3FR3 A;  2IMK A;  2H0I A;  2YWM A;  1FHE A;  4O92 A;  5G5F A;  4LL1 B;  2KP2 A;  4KDX A;  4OFM A;  5D8I A;  3C1R A;  1K0B A;  3J7Y b;  1TOF A;  4EE0 A;  1ZMA A;  1WJK A;  4IGJ A;  1FVK A;  5DJL A;  5ECH B;  4JBB A;  2HRF A;  3LEF A;  5ECN B;  3QMX A;  2LQO A;  1OE7 A;  5CYY A;  4PGT A;  4HOJ A;  5KN2 A;  1N8J A;  1DUG A;  3IV4 A;  4Q5N A;  1NW2 A;  1USB A;  1K0N A;  4ML1 A;  2WRT A;  3ZLP A;  2AJQ B;  2CX4 A;  2GSR A;  5CO3 A;  2XPE A;  4K6X A;  1O8X A;  2KOK A;  2GS3 A;  20GS A;  2AAW A;  3KIJ A;  2AYT A;  5EVO A;  1M2D A;  2L4C A;  2OE0 A;  2OBI A;  1XWG A;  4GCI A;  3RPP A;  5J3R A;  1K0O A;  4K0N A;  2H1G A;  4HU7 A;  2H01 A;  5H5Q A;  3C7M A;  2C4J A;  4PQH A;  2FCH A;  3FZ5 A;  4HI7 A;  1KTE A;  3KTL A;  5E4W A;  3O3T A;  4MZW A;  5JWO B;  1XWA A;  3I69 A;  5GSS A;  2XHF A;  4X43 A;  4ZBA A;  5A4V A;  5KN1 A;  1M0U A;  2K8V A;  3GH6 A;  4TOP A;  4RUV A;  2LEG A;  4N0V A;  4YAP A;  1SEN A;  1O73 A;  2KLX A;  4ACS A;  1ABA A;  2DSA A;  2C80 A;  1GTA A;  1X9W B;  2H8L A;  2H75 A;  1HQO A;  4KW6 A;  3DRN A;  4HJ2 A;  4WXT A;  1PL2 A;  5ELG A;  3CTG A;  2IN3 A;  3TJF A;  2JL4 A;  2B1L A;  3C71 A;  1XWC A;  3DYR A;  2YN1 A;  1TRV A;  1CQG A;  4ISD A;  1Q98 A;  2FY6 A;  1Z3E A;  2C0D A;  1X5C A;  2H1B A;  4YH2 A;  3UVT A;  4ZL8 A;  5ECK B;  3ZFL A;  1MTC A;  2PPT A;  3TRQ A;  1S3D A;  4AGS A;  1V98 A;  1WRY A;  2X8G A;  3GMF A;  3TRX A;  2V6O A;  1TK0 B;  4TR0 A;  5C00 A;  1E6B A;  3DIE A;  2YWI A;  4IKH A;  4MF7 A;  3HKR A;  1K0M A;  1W89 A;  3JCM L;  1ZL9 A;  3Q74 A;  4PQI A;  1U87 A;  4MA9 A;  3Q6O A;  4GXZ A;  1A2J A;  3ZIV A;  3NIV A;  3G7J A;  1ZGN A;  2FWH A;  4GQC A;  1AIU A;  3RPN A;  2QKE A;  1OC9 A;  2VLT A;  2AHE A;  4ECC A;  5ECP B;  5F0G A;  4ZL7 A;  2KP1 A;  5EL8 A;  4XS1 A;  1Z9H A;  1XCC A;  1RW1 A;  2VM1 A;  3EU4 A;  4OWY A;  1THX A;  5G1L A;  3TGZ A;  3KGK A;  2I1U A;  1V40 A;  4GSN A;  1M9B A;  4I97 A;  2O89 A;  4MJB A;  1DBY A;  1TTZ A;  2VO4 A;  3EC3 A;  3D5J A;  1TI1 A;  4KUN A;  1A24 A;  1EEJ A;  2CAQ A;  3IAS 2;  2ON7 A;  1TP9 A;  1SL0 B;  4XS4 A;  2DIY A;  13GS A;  3IK7 A;  3LSZ A;  2YP6 A;  2LST A;  1DE1 A;  2IWT A;  3TJG A;  4EO3 A;  2HT9 A;  5DQY A;  3DVW A;  1H75 A;  4MZC A;  4IQ1 A;  1DE2 A;  4D73 A;  5B6N A;  1BYE A;  4V2M A;  2R5G A;  1U3I A;  2HSN B;  4KSO A;  2GT5 A;  18GS A;  1K3Y A;  3K8N A;  1Z7R A;  1GSU A;  2YZU A;  3GIX A;  4MF5 A;  3EE2 A;  12GS A;  2VCT A;  1PL1 A;  1MDJ A;  1YF1 A;  1X9S B;  3QAV A;  4N10 A;  5IMZ A;  2GZP A;  5DAK B;  2B7K A;  4ZB6 A;  4TN8 A;  4WF4 A;  3OR5 A;  1ZZY A;  1B9X C;  2C3N A;  3GUR A;  4KCA A;  2LNS A;  4X1U A;  5DBQ A;  4KCE A;  3I9V 2;  2C3Q A;  2IJY A;  1ACV A;  2IFQ A;  1YKC A;  3GSS A;  4IW9 A;  5G5E A;  1ERT A;  3BCK A;  4I5Q A;  1K0C A;  3HJM A;  5AIV A;  1F37 A;  3CRT A;  4ECB A;  4WEY A;  3HZ8 A;  5DCH A;  2HRN A;  5A4W A;  3O6T A;  3IA1 A;  4NAX A;  3S9F A;  5LNK e;  3GYK A;  3GX8 A;  3H4K A;  4CW9 A;  5HFI A;  2LJA A;  4K1F A;  2ALB A;  5ENU A;  4KSM A;  2P5Q A;  3TKP A;  5CAX A;  4TXO B;  1ST9 A;  3EYT A;  1J0F A;  1M7T A;  3N5O A;  4FYC A;  4MLY A;  5F06 A;  4MDC A;  1XW5 A;  3KEB A;  4HQZ A;  2H0G A;  4G10 A;  4EVM A;  2X99 A;  1EP8 A;  1PSQ A;  4V2L A;  4POL A;  4JE1 A;  4F0C A;  3VK9 A;  5ECQ B;  1A2M A;  3CSI A;  1BX9 A;  1EZK A;  2EC4 A;  1ZYE A;  3US3 A;  5IOX A;  1JHB A;  5ID2 B;  5D9T A;  2QC7 A;  3VPQ A;  3L9V A;  4BVX A;  2J9H A;  5CRG A;  1V57 A;  1T4Z A;  2BJX A;  4ILF A;  4HEA 2;  3KMO A;  3F63 A;  6GSX A;  4K9Z A;  3M1G A;  1ERU A;  2A2S A;  1Z5Y E;  4CDO A;  2B6M A;  1VF3 A;  4F0B A;  2DJ0 A;  1RK4 A;  3ZML A;  1THO A;  2LKU A;  5IM9 A;  1FAA A;  4N0Z A;  2JZR A;  1GSS A;  1UC7 A;  3FHK A;  2I9H A;  4IBP A;  2X8C A;  2LRN A;  2LRC A;  5H5R A;  4K0G A;  4RI6 A;  5IIZ A;  2GT6 A;  3L78 A;  2L57 A;  1WOU A;  3HDC A;  2PU9 C;  1G7E A;  2V1M A;  1PGT A;  1HYU A;  2IMD A;  2FWF A;  1TW9 A;  4PUR A;  4L0W A;  4OO5 A;  4MP4 A;  3BOA A;  4XTS A;  1T7P B;  3W8J A;  2MMN A;  4JU5 A;  3TKQ A;  4IQA A;  5DCG A;  5IMF A;  5JCU A;  5G30 A;  3GST A;  2LV3 A;  1XWK A;  1IYI A;  1XVW A;  4N11 A;  2P5R A;  3A5W A;  4IP1 A;  3GHA A;  2DML A;  5INY A;  1N2A A;  4O5R A;  2HSH A;  3MWH A;  1PA3 A;  5JWQ B;  4ML6 A;  3LGC A;  3GRX A;  2YJ7 A;  2WZ9 A;  4J57 E;  3IRA A;  3EMX A;  4KDU A;  2K6V A;  2EIQ A;  4IP6 A;  2B5X A;  1TDI A;  5ECO B;  4ZXG A;  4F03 A;  4MZB A;  2CV4 A;  4DSQ A;  1HNA A;  1JZW A;  4HZ4 A;  1VF1 A;  4ID0 A;  3IOS A;  5EY6 A;  1SK1 A;  1ZOF A;  4K7O A;  1AQV A;  3TJK A;  4ZL9 A;  3DKS A;  3ISO A;  1GSF A;  1ERW A;  2RM5 A;  4HDE A;  2RUE A;  1QMV A;  2C3T A;  1B8X A;  4I8B A;  2K8S A;  3GNJ A;  1GP1 A;  6GSY A;  4GRF A;  1X5E A;  1ML6 A;  3LQ7 A;  2VL9 A;  4L8E A;  3MSZ A;  2X8H A;  3HZ4 A;  3EWL A;  1X9M B;  4F2I A;  3KTB A;  2YOI A;  3PPU A;  1A0R P;  4H86 A;  3H8Q A;  1K0D A;  1LU4 A;  2HRK A;  1OVN A;  2HLS A;  2LJR A;  3F0I A;  3IC8 A;  2A4V A;  3SWL A;  5B8B A;  2F9S A;  1G6W A;  1PD2 1;  3F3Q A;  3APS A;  3QFB C;  3UJ1 A;  4OD7 A;  3DEX A;  6GSS A;  2FWE A;  3WT1 A;  2JSY A;  19GS A;  2UZ8 A;  1WPI A;  3TJJ A;  4KND A;  3CYN A;  1LJR A;  2L59 A;  4FYB A;  4TR1 A;  2HSM A;  4FH8 A;  4TRX A;  1MDK A;  3F8U A;  1R4W A;  3R2Q A;  3KP9 A;  2VCQ A;  4AJ7 A;  4MH2 A;  3J7Y k;  1R26 A;  3A2V A;  3CXG A;  1GLP A;  5CP1 A;  5JWR B;  2K9F A;  4K7I A;  2WDU A;  1QUW A;  4TR3 A;  5D96 A;  4KE3 A;  5IMC A;  4K7N A;  2DJ2 A;  1GTB A;  1Y25 A;  2DLX A;  3GTU B;  5IO2 A;  3QCP A;  3FR9 A;  3UL3 A;  1PN9 A;  4X0X A;  4XIH A;  5CNW A;  4G9H A;  2JAC A;  3N9J A;  3LYP A;  2K18 A;  2M80 A;  2G2Q A;  1JZO A;  2L6C A;  2MBT A;  3G7Y A;  2LNT A;  2TRC P;  5B7C A;  2O8V B;  1GUM A;  2MMO A;  2GZZ A;  3KZQ A;  4MJA A;  1O85 A;  3FW2 A;  3LXZ A;  2L5L A;  3GX0 A;  2H72 A;  2H6Y A;  2OA7 A;  3CSH A;  1V58 A;  2H1D A;  2H0H A;  2C0F A;  2H76 A;  3LG6 A;  4NV2 A;  1GH2 A;  2HZE B;  3LFL A;  4AJ6 A;  1PKW A;  2MBS A;  4IEL A;  3LWA A;  3VWW A;  2GST A;  3ERF A;  3E9J B;  3RAZ A;  3GV1 A;  2YV9 A;  2WB9 A;  4F9Z A;  3CTF A;  3HYP A;  2H6Z A;  4MJC A;  3UIW A;  2H71 A;  2YWN A;  1F3A A;  1V2A A;  3BJ5 A;  2N5F A;  5H5S A;  1SJZ A;  2XBQ A;  4EDY A;  2D2Z A;  1V9W A;  2WGR A;  3D4T A;  4POB A;  5HQP A;  2HXK A;  3GFK A;  3GL5 A;  3KXO A;  1E2Y A;  3W6G A;  4QL9 A;  2VCW A;  1SKR B;  1F6M C;  2FNO A;  2O87 A;  2ZUP A;  3MDK A;  3QOU A;  1R7H A;  4IHU A;  1YEP A;  1XBS A;  2CX3 A;  4XHM A;  2KHP A;  1I9D A;  3DXB A;  1VRS D;  1T00 A;  3KH7 A;  1YZX A;  5GAN D;  4NHZ A;  1FVJ A;  2DJJ A;  5G1K A;  3UAP A;  4IN0 A;  3QR6 A;  2G0F A;  1TU8 A;  4DVC A;  4MAB A;  1Z7P A;  4WR4 A;  5D73 A;  4FO5 A;  4L5L A;  2E7P A;  2TIR A;  6GST A;  5HFG A;  1F3B A;  3IR4 A;  2YWO A;  4G0L A;  2F8A A;  4N30 A;  1QK8 A;  2IPA A;  2YJH A;  2WCI A;  5AIX A;  3PH9 A;  2H70 A;  3RDW A;  1R5A A;  3FR6 A;  3QD9 A;  3IPZ A;  1YKA A;  14GS A;  1AAZ A;  4JRR A;  1PX7 A;  5IOW A;  4IS0 A;  3TKS E;  2OE1 A;  1SK2 A;  4TR4 A;  1DSB A;  2WUL A;  2KUC A;  5HR2 A;  4KX4 A;  2GDR A;  5CRW A;  1AC1 A;  2YV7 A;  1EGO A;  5D9V A;  1OYJ A;  1S3C A;  3FRC A;  4MPG A;  2OE3 A;  5F07 A;  2CQ9 A;  2PUK C;  2IIY A;  4LMW A;  1LBK A;  5JCG A;  3C73 A;  3ZYW A;  1O81 A;  4F82 A;  5F8B A;  1FO5 A;  1XXU A;  4OFN A;  4MPF A;  4YQM A;  2MYG A;  1I5G A;  4BL7 A;  1O8W A;  1TJD A;  5KN3 A;  3HD5 A;  1GNW A;  2H66 A;  2AV4 A;  1XFL A;  5DAL B;  4ZB8 A;  1B48 A;  4HJM A;  3BD2 A;  4CHS A;  10GS A;  4G2E A;  3HA9 A;  4K2D A;  1NHY A;  2B3S A;  5HR1 A;  2VUP A;  2C1Y A;  4DSS A;  5A5K A;  5HFK A;  4LLR A;  1OC9 B;  2RII A;  2NTO A;  2PGT A;  2F51 A;  3GUS A;  2XBI A;  3GKM A;  4POM A;  5ELA A;  2LRT A;  2MZC A;  2GQL A;  3QFA C;  1OKT A;  1M99 A;  3TOU A;  3D4M A;  3UEM A;  2WJU A;  1XIY A;  1TRS A;  4BVY A;  4KF9 A;  5L71 A;  3FEU A;  5D9X A;  2XC2 A;  1FB0 A;  2GQM A;  2PER A;  3PGT A;  2C0E A;  3ERW A;  1HD2 A;  1R5P A;  4XS4 B;  1GSQ A;  5ECI B;  2R37 A;  1M2A A;  4DSR A;  1YDK A;  4LL4 B;  3L9U A;  1KBN A;  4D73 B;  2V6K A;  3LJR A;  2FA4 A;  1TI3 A;  3GL3 A;  2F8F A;  2A2R A;  5J41 A;  1EWX A;  2DIZ A;  4PXO A;  3WYW A;  5AIS A;  5KN0 A;  3IHQ A;  4NXI A;  4ECJ A;  2OAD A;  4J56 E;  1G6Y A;  1JZR A;  5FWG A;  2PVO C;  5IQY A;  1SU9 A;  3M9K A;  2YAN A;  4FIW A;  3CMI A;  1B9Y C;  5CRD A;  2NPB A;  4I2U A;  2R2J A;  3DWV A;  2GVP A;  2CA8 A;  2HI7 A;  1F2E A;  1OC8 A;  1U6T A;  1O7U A;  1T3B A;  2IFQ B;  2DJ3 A;  1MDI A;  4P3Y B;  1EEM A;  4OFT A;  1VF4 A;  4RQR A;  4EXJ A;  1EV9 A;  2R6K A;  3WGD A;  2LQQ A;  3VWX A;  3W8S A;  4NV5 A;  3AY8 A;  4KB3 A;  3PIN A;  4G19 A;  1HNC A;  3TRP A;  2IMF A;  3VFI A;  1EP7 A;  3HJP A;  3QDN A;  9GSS A;  1WP0 A;  1WWJ A;  4KDY A;  3HXS A;  4WR5 A;  1TK5 B;  3UMA A;  5IO0 A;  2XPD A;  2YPM A;  5DQS A;  1FB6 A;  1JLW A;  4LA1 A;  3TOT A;  1GNE A;  2I81 A;  3APQ A;  2QSI A;  2CVK A;  2VM2 A;  3GKK A;  4WBR D;  3ZMK A;  4GSS A;  4GWR A;  4JR6 A;  2C8U A;  2N5B A;  4JED A;  4EC0 A;  3DD3 A;  2V2G A;  4MK3 A;  1SK0 A;  1EGR A;  1JLV A;  2ZNM A;  3GKN A;  1KEB A;  3M8N A;  4E8E A;  1F9M A;  3M3M A;  2M46 A;  4WET A;  1GL8 A;  1K0A A;  5AN1 A;  5LCZ A;  3P8W A;  4OMV A;  6GSW A;  4K8M A;  1XPV A;  3ZTL A;  4BVX B;  1Q4J A;  1AW9 A;  3G9B A;  3HVS A;  4DEJ A;  4QL7 A;  1AQW A;  2O7K A;  1ON4 A;  3ME8 A;  4PUF C;  5J5N A;  4FQU A;  1SKW B;  4XS6 A;  4L0U A;  2VOC A;  1C72 A;  1H4O A;  2VCX A;  3G7I A;  2I4A A;  1VF2 A;  3LYK A;  2GSQ A;  2HSY A;  11GS A;  1SJI A;  2L4Q A;  3D0Z A;  3KJY A;  2H73 A;  2P31 A;  3ZIT A;  1TU7 A;  3NZN A;  1U88 A;  1NSW A;  1MD4 A;  3L4N A;  3HHV A;  4FYU A;  1SD9 A;  3Q18 A;  5DVB A;  1TXX A;  5G31 A;  5JCW A;  2WS2 A;  4WBJ A;  4XRA A;  5DDL A;  2F3M A;  5ECS A;  2EIR A;  4ECI A;  1T4Y A;  2H19 A;  1SL1 B;  1OAZ A;  2IMI A;  1SYR A;  2VCV A;  3A3T A;  5D93 A;  2YCD A;  3FK8 A;  2I3Y A;  3U6V A;  1UA5 A;  4Z7X A;  3IAM 2;  4GF0 A;  5FT3 A;  1K3O A;  2X64 A;  1X5D A;  4GTU A;  4POK A;  4AF2 A;  1YY7 A;  2CT6 A;  4KH7 A;  1J9B A;  1OKD A;  1GUH A;  3TCO A;  1A8L A;  1J08 A;  1NM3 A;  3PR8 A;  2FHE A;  1SD8 A;  3TUE A;  1EV4 A;  4TW5 A;  2PVQ A;  2HE3 A;  2LJK A;  3A2W A;  2JZT A;  4ZIL A;  2JU5 A;  1GLQ A;  3WT2 A;  2FD3 A;  1PKZ A;  1NHO A;  4OCF A;  3V1W A;  7GSS A;  4V2N A;  2PMT A;  1GSE A;  3KM6 A;  4ULX A;  3IK9 A;  2GLR A;  2IME A;  4HUA A;  1X0R A;  5DAK A;  4TXV A;  1MD3 A;  4J2F A;  4QQ7 A;  1YQ1 A;  3E0U A;  5IPG A;  3KMN A;  1T8E B;  3CBU A;  3ME7 A;  4O7H A;  1XWB A;  2GZY A;  4JR4 A;  4OO4 A;  5KEJ A;  3U5R E;  3FYG A;  3KD0 A;  3WGE A;  2H74 A;  1Y6E A;  2HFD A;  2REM A;  2PN8 A;  3GN3 A;  5IMA A;  4BA7 A;  3L0H A;  4KGI A;  4OCE A;  1GTI A;  4KAE A;  3M0F A;  3IBH A;  3R3E A;  3RHC A;  2LS5 A;  3HJO A;  2CVB A;  3D21 A;  3UAR A;  3DML A;  4GQF A;  3QAG A;  5FHI A;  4EL1 A;  3TDG A;  2YZH A;  1KNG A;  3P90 A;  1AQX A;  1ZYQ B;  4XCS A;  3TKS C;  3FZA A;  4PQ1 A;  3L9S A;  3I43 A;  1ZCP A;  5J9C A;  2VD0 A;  1ILO A;  3FZ9 A;  5F05 A;  3DGQ A;  2CZ3 A;  5CRH A;  2HRK B;  2FWG A;  3ZVJ A;  3IXR A;  4TXO A;  1JFU A;  1WE0 A;  5DAL A;  3FY7 A;  2HNL A;  3F9U A;  4RI7 A;  4EUY A;  3F4T A;  4RQX A;  4WF5 A;  5DJM A;  5G2Z A;  2Z9S A;  2R3X A;  3TKR A;  1PRX A;  4V1A p;  1M9A A;  2E2G A;  4V1A g;  2HQT A;  1TRW A;  3UOM A;  1MEK A;  2BMX A;  2B7J A;  1XZO A;  3DVX A;  4TR1 B;  2HSM B;  3QAW A;  5HR0 A;  4IJI A;  4I2T A;  3TKS A;  3EU3 A;  3D22 A;  2VCZ A;  4YQV A;  3SBC A;  2FLS A;  2C0G A;  2ES7 A;  2RM6 A;  5ID2 A;  3LXT A;  1G0T A;  2H6X A;  4HQS A;  3F6D A;  3VWU A;  3GH9 A;  5EPF A;  5BMU A;  2V32 A;  2B5E A;  4NWY A;  2RUF A;  1YJ6 A;  1BG5 A;  3UBL A;  1W4V A;  5ECM B;  3UVH A;  4BPY A;  3CSJ A;  2DMM A;  3NOF A;  2QGV A;  4GST A;  2V41 A;  3ZIJ A;  4G0I A;  1WMJ A;  3VI7 A;  3HCZ A;  1OC3 A;  3TJB A;  3TB2 A;  2HRA A;  2M72 A;  1S3A A;  1B4Q A;  8GSS A;  2RLI A;  5GST A;  4LMV A;  4NMU A;  16GS A;  1A2L A;  2N5A A;  4NHW A;  5GAP D;  5LD0 A;  2FGX A;  2IL3 A;  4G0K A;  1GUK A; 
#chains in the Genus database with same CATH topology
 4PNG A;  5E59 A;  2AUV A;  1BQ7 A;  3H1N A;  3APO A;  3BCI A;  1Z6N A;  2VAF A;  1M2B A;  1HNB A;  1EOG A;  2H30 A;  3HVV A;  3VLN A;  1BED A;  3IC4 A;  2R4V A;  2OBK A;  2EIO A;  4JZQ A;  2VD1 A;  1QQ2 A;  4I6X A;  1A23 A;  3KP8 A;  5HR3 A;  3H79 A;  1GUL A;  3IDV A;  2LTK A;  2YNX A;  1FOV A;  2DC5 A;  5GZZ B;  1XOA A;  2FUG 2;  2JSZ A;  1N25 A;  4PNF A;  2L5O A;  1IYH A;  1SJ6 A;  3WD6 A;  1XOB A;  4ZBB A;  4Q5R A;  5A4U A;  2GGT A;  4EDZ A;  4YQU A;  1VGL A;  6GSU A;  1UN2 A;  3GKX A;  2L6D A;  2HYX A;  3F6F A;  4MJE A;  4TVE A;  1OE8 A;  4KA0 A;  3C1S A;  3C8E A;  3MAK A;  2AB6 A;  2FA8 A;  2WW0 A;  4YAV A;  5ECL B;  4Q5Q A;  5J9B A;  3BBY A;  4USS A;  5ABR A;  2O3E A;  3ERG A;  3VPT A;  2OJL A;  4MF6 A;  5B6M A;  3ZRE A;  2GQK A;  3EIN A;  1K3L A;  2LUS A;  5IPH A;  4IJ3 A;  3ZL5 A;  3RBT A;  5C04 A;  3E3E A;  1U3A A;  2VL3 A;  5IMD A;  3I6A A;  2OAC A;  1YF0 A;  1GRX A;  1BF5 A;  1BJX A;  1SVM A;  2WFC A;  1A0F A;  2NVL A;  1AXD A;  3P7X A;  1PQN A;  1JZD A;  3KCM A;  2WW3 A;  3LOR A;  3ZFB A;  4MH3 A;  1GSY A;  3MNG A;  5D9W A;  1URM A;  4TKY A;  1EOH A;  2ON5 A;  5J4U A;  4AKI A;  4XRD A;  1B4P A;  3ZRD A;  4ZBD A;  2WZS A;  3A2X A;  3M9J A;  3HVX A;  2PBJ A;  4HZ2 A;  3O76 A;  3D6I A;  1AUC A;  4MMM A;  2EFH A;  2BTO T;  2P0G A;  1QGV A;  2CVD A;  2O85 A;  2B1K A;  3CRU A;  1TKD B;  4L5O A;  1FW1 A;  3FZ4 A;  2DJK A;  3IE3 A;  5J47 A;  2OKA A;  3P2A A;  1O6J A;  4PUA A;  6GSV A;  4AJ8 A;  1SYX A;  1TRU A;  1A8Y A;  2VIM A;  2JZS A;  1QFN A;  4MCU A;  2CZ2 A;  4E8H A;  5AGY A;  2B5Y A;  4PI0 C;  4BWQ A;  5IMV A;  1PMT A;  4EF0 A;  1SL2 B;  4PTS A;  3F4R A;  4ZIJ A;  2NDO A;  2VLU A;  4IVF A;  2HZF A;  17GS A;  1G7O A;  1XW6 A;  3TU3 B;  1RQM A;  4Q5F A;  2VL2 C;  4HS1 A;  3QPM A;  2E0Q A;  2GTU A;  3ZZX A;  22GS A;  2GSS A;  3VUR A;  1GSD A;  2MMZ A;  2H1A A;  1FG4 A;  3KH9 A;  5COH A;  1TK8 B;  4GLT A;  1T1V A;  1UVZ A;  4EKZ A;  4ZB9 A;  3EMP A;  3HY2 A;  2DBC A;  4BL7 B;  1WIK A;  5CRE A;  3GTU A;  1Z6M A;  3WGX A;  2TRX A;  3Q19 A;  2A4H A;  3FKF A;  4O32 A;  2VKZ G;  3RHB A;  1ERV A;  2DJ1 A;  3EUR A;  4AKX B;  4BWS A;  3ED3 A;  1QXH A;  3VI5 A;  1XW9 A;  3F3R A;  4PX1 A;  2J23 A;  2ZCT A;  1YEX A;  4DSS B;  3ZVJ D;  5B8A A;  1BAY A;  3F4S A;  3H93 A;  2E2M A;  1CQH A;  1GWC A;  4HU9 A;  2VL2 A;  2NBS A;  1PX6 A;  2HZE A;  4WKW A;  2VLV A;  3EVI A;  2PWJ A;  2CAI A;  2O36 A;  4NPB A;  1SKS B;  5ECR B;  2JAD A;  3GA4 A;  3VWV A;  2MMA A;  1XVQ A;  3UBK A;  1SVO A;  4BVY B;  1GTU A;  3FR3 A;  2IMK A;  2H0I A;  2YWM A;  1FHE A;  4O92 A;  5G5F A;  4LL1 B;  2KP2 A;  4KDX A;  4OFM A;  5D8I A;  3C1R A;  1K0B A;  3J7Y b;  1TOF A;  4CY6 A;  4EE0 A;  1ZMA A;  1WJK A;  4IGJ A;  1FVK A;  5DJL A;  5A5H A;  5ECH B;  4JBB A;  2HRF A;  3LEF A;  5ECN B;  3QMX A;  2LQO A;  1OE7 A;  5CYY A;  4PGT A;  4HOJ A;  5KN2 A;  1N8J A;  1DUG A;  3IV4 A;  4Q5N A;  1NW2 A;  1USB A;  1K0N A;  4ML1 A;  2WRT A;  3ZLP A;  2AJQ B;  4W66 A;  2CX4 A;  2GSR A;  5CO3 A;  2XPE A;  4K6X A;  1O8X A;  2KOK A;  2GS3 A;  20GS A;  3CWG A;  2AAW A;  2DKH A;  3KIJ A;  2AYT A;  5EVO A;  1M2D A;  2L4C A;  2OE0 A;  2OBI A;  1XWG A;  4GCI A;  3RPP A;  5J3R A;  1K0O A;  4K0N A;  2H1G A;  4HU7 A;  2H01 A;  5H5Q A;  3C7M A;  4ICY A;  2C4J A;  4PQH A;  2FCH A;  3FZ5 A;  4HI7 A;  1KTE A;  3KTL A;  5E4W A;  3O3T A;  4MZW A;  5JWO B;  1XWA A;  3I69 A;  5GSS A;  2XHF A;  4X43 A;  4ZBA A;  5A4V A;  5KN1 A;  4K5R A;  1M0U A;  2K8V A;  3GH6 A;  4TOP A;  4RUV A;  2LEG A;  4N0V A;  4YAP A;  1SEN A;  1O73 A;  2KLX A;  4ACS A;  1ABA A;  2DSA A;  2C80 A;  1GTA A;  1X9W B;  4YKG A;  2H8L A;  2H75 A;  1HQO A;  4KW6 A;  3DRN A;  4HJ2 A;  4WXT A;  1PL2 A;  5ELG A;  3CTG A;  2IN3 A;  3TJF A;  3C71 A;  2JL4 A;  2B1L A;  2QA1 A;  1XWC A;  3DYR A;  2YN1 A;  1TRV A;  1CQG A;  4ISD A;  1Q98 A;  5A34 A;  2FY6 A;  4X4J A;  1Z3E A;  2C0D A;  1X5C A;  2H1B A;  4YH2 A;  3UVT A;  4ZL8 A;  5ECK B;  3ZFL A;  1MTC A;  2PPT A;  3TRQ A;  1S3D A;  4AGS A;  1V98 A;  1WRY A;  2X8G A;  3GMF A;  5A1N A;  3TRX A;  2V6O A;  1TK0 B;  4TR0 A;  5C00 A;  1E6B A;  3DIE A;  2YWI A;  4IKH A;  4MF7 A;  3HKR A;  1K0M A;  1W89 A;  3JCM L;  1ZL9 A;  3Q74 A;  4PQI A;  1U87 A;  4MA9 A;  3Q6O A;  4GXZ A;  1A2J A;  3ZIV A;  3NIV A;  3G7J A;  1ZGN A;  2FWH A;  4GQC A;  1AIU A;  3RPN A;  2QKE A;  1OC9 A;  2VLT A;  2AHE A;  4ECC A;  5ECP B;  5F0G A;  4ZL7 A;  2KP1 A;  4FXY P;  5EL8 A;  4XS1 A;  1Z9H A;  1XCC A;  1RW1 A;  2VM1 A;  3EU4 A;  4OWY A;  1THX A;  5G1L A;  3TGZ A;  3KGK A;  2I1U A;  1V40 A;  4GSN A;  1S4B P;  1M9B A;  4I97 A;  4N3Z A;  2O89 A;  4MJB A;  1DBY A;  1TTZ A;  2VO4 A;  3EC3 A;  3D5J A;  1TI1 A;  4KUN A;  1A24 A;  1EEJ A;  2CAQ A;  3IAS 2;  2ON7 A;  1TP9 A;  1SL0 B;  4XS4 A;  2DIY A;  4QMK A;  13GS A;  3IK7 A;  3LSZ A;  2YP6 A;  2LST A;  1DE1 A;  2IWT A;  3TJG A;  4EO3 A;  2HT9 A;  5DQY A;  3DVW A;  1H75 A;  4MZC A;  4ZB7 A;  4IQ1 A;  1DE2 A;  4D73 A;  5B6N A;  1BYE A;  4V2M A;  2R5G A;  1U3I A;  2HSN B;  4KSO A;  2GT5 A;  18GS A;  1K3Y A;  3K8N A;  1Z7R A;  1GSU A;  2YZU A;  3GIX A;  4MF5 A;  3EE2 A;  12GS A;  2VCT A;  1PL1 A;  1MDJ A;  1YF1 A;  1X9S B;  3QAV A;  4N10 A;  5IMZ A;  2GZP A;  5DAK B;  2B7K A;  4ZB6 A;  4TN8 A;  4A5P A;  4EIQ A;  4WF4 A;  3OR5 A;  1ZZY A;  1B9X C;  2C3N A;  3GUR A;  4KCA A;  2LNS A;  4X1U A;  5DBQ A;  4KCE A;  3I9V 2;  2C3Q A;  2IJY A;  1ACV A;  2IFQ A;  1YKC A;  3GSS A;  2WVY A;  4IW9 A;  5G5E A;  1ERT A;  1PFO A;  3BCK A;  4I5Q A;  1K0C A;  3HJM A;  5AIV A;  1F37 A;  3CRT A;  4ECB A;  4WEY A;  3HZ8 A;  5DCH A;  2HRN A;  5A4W A;  3O6T A;  3IA1 A;  4NAX A;  3S9F A;  5LNK e;  3GYK A;  3GX8 A;  3H4K A;  4CW9 A;  5HFI A;  2LJA A;  4K1F A;  2ALB A;  5ENU A;  4KSM A;  2P5Q A;  3TKP A;  5CAX A;  4TXO B;  1ST9 A;  3EYT A;  1J0F A;  1M7T A;  3N5O A;  4FYC A;  4MLY A;  5F06 A;  4MDC A;  1I1I P;  1XW5 A;  3KEB A;  4HQZ A;  2H0G A;  4G10 A;  4EVM A;  2X99 A;  1EP8 A;  1PSQ A;  4V2L A;  2R0C A;  4POL A;  2UV8 G;  4JE1 A;  4F0C A;  3VK9 A;  5ECQ B;  1A2M A;  3HMJ G;  3CSI A;  1BX9 A;  1EZK A;  2EC4 A;  1ZYE A;  3US3 A;  5IOX A;  1JHB A;  5ID2 B;  5D9T A;  2QC7 A;  3VPQ A;  3L9V A;  4BVX A;  2J9H A;  5CRG A;  1V57 A;  1T4Z A;  5BMU B;  2BJX A;  4ILF A;  4HEA 2;  3KMO A;  3F63 A;  6GSX A;  4K9Z A;  3M1G A;  1ERU A;  2A2S A;  1Z5Y E;  4CDO A;  2B6M A;  1VF3 A;  4F0B A;  2DJ0 A;  1RK4 A;  3ZML A;  1THO A;  2WVX A;  2LKU A;  5IM9 A;  1FAA A;  4N0Z A;  2JZR A;  1GSS A;  1UC7 A;  3FHK A;  2I9H A;  4IBP A;  2X8C A;  2LRN A;  2LRC A;  5H5R A;  4K0G A;  4RI6 A;  5IIZ A;  2GT6 A;  3L78 A;  2L57 A;  4CY8 A;  1WOU A;  3HDC A;  2PU9 C;  1G7E A;  2V1M A;  1PGT A;  1HYU A;  2IMD A;  2FWF A;  1TW9 A;  4PUR A;  4L0W A;  4OO5 A;  4MP4 A;  3BOA A;  4XTS A;  1T7P B;  5J4Y A;  3W8J A;  2MMN A;  4JU5 A;  3TKQ A;  4IQA A;  5DCG A;  5IMF A;  5JCU A;  5G30 A;  3GST A;  2LV3 A;  1XWK A;  1IYI A;  1XVW A;  4N11 A;  2P5R A;  3A5W A;  4IP1 A;  3GHA A;  2DML A;  4AKG A;  5INY A;  1N2A A;  4O5R A;  2HSH A;  3MWH A;  1PA3 A;  5JWQ B;  4ML6 A;  3LGC A;  3GRX A;  2YJ7 A;  2WZ9 A;  4J57 E;  3IRA A;  3EMX A;  4KDU A;  2K6V A;  2EIQ A;  2B5X A;  4IP6 A;  3CHX C;  1TDI A;  5ECO B;  4ZXG A;  4F03 A;  4HSC X;  4MZB A;  2CV4 A;  4DSQ A;  1HNA A;  1JZW A;  4HZ4 A;  1VF1 A;  4ID0 A;  3IOS A;  5EY6 A;  1SK1 A;  1ZOF A;  4K7O A;  1AQV A;  2DKI A;  3TJK A;  4ZL9 A;  3DKS A;  3ISO A;  1GSF A;  1ERW A;  2RM5 A;  4HDE A;  2RUE A;  1QMV A;  2C3T A;  1B8X A;  4I8B A;  2K8S A;  3GNJ A;  1GP1 A;  6GSY A;  4GRF A;  1X5E A;  1ML6 A;  3LQ7 A;  2VL9 A;  4L8E A;  3MSZ A;  2X8H A;  3HZ4 A;  3EWL A;  1X9M B;  4F2I A;  3KTB A;  2YOI A;  3PPU A;  1A0R P;  4H86 A;  3H8Q A;  1K0D A;  1LU4 A;  2HRK A;  1OVN A;  2HLS A;  2LJR A;  3F0I A;  3IC8 A;  2A4V A;  3SWL A;  5B8B A;  2F9S A;  1G6W A;  1PD2 1;  3F3Q A;  3APS A;  3QFB C;  2O5V A;  3UJ1 A;  4K2X A;  4OD7 A;  3DEX A;  6GSS A;  2FWE A;  3WT1 A;  2JSY A;  19GS A;  2UZ8 A;  1WPI A;  3TJJ A;  4KND A;  2R0P A;  3CYN A;  1LJR A;  2L59 A;  4FYB A;  4TR1 A;  2HSM A;  4FH8 A;  4TRX A;  1MDK A;  3F8U A;  1R4W A;  3R2Q A;  3KP9 A;  2VCQ A;  4AJ7 A;  4MH2 A;  3J7Y k;  1S3R A;  1R26 A;  3A2V A;  3CXG A;  1GLP A;  5CP1 A;  4EIP A;  5JWR B;  2OT3 A;  2K9F A;  4K7I A;  2WDU A;  1QUW A;  4TR3 A;  5D96 A;  4KE3 A;  5IMC A;  4K7N A;  2DJ2 A;  4E68 A;  1GTB A;  1Y25 A;  2DLX A;  3GTU B;  5IO2 A;  3QCP A;  1M3J A;  3FR9 A;  4Z2T A;  3UL3 A;  1PN9 A;  4X0X A;  4XIH A;  5CNW A;  4GDF A;  4G9H A;  2JAC A;  3N9J A;  1YVL A;  3LYP A;  2K18 A;  2M80 A;  2G2Q A;  1JZO A;  2L6C A;  2MBT A;  3G7Y A;  2LNT A;  2TRC P;  5B7C A;  2O8V B;  1GUM A;  2MMO A;  2GZZ A;  3KZQ A;  4MJA A;  1O85 A;  3FW2 A;  4Z2R A;  3LXZ A;  2L5L A;  3GX0 A;  2H72 A;  2H6Y A;  2OA7 A;  3CSH A;  1V58 A;  2H1D A;  2H0H A;  2C0F A;  2H76 A;  3LG6 A;  4NV2 A;  1GH2 A;  2HZE B;  3LFL A;  4AJ6 A;  1PKW A;  2MBS A;  4IEL A;  3LWA A;  3VWW A;  2GST A;  3ERF A;  3E9J B;  3RAZ A;  3GV1 A;  2YV9 A;  2WB9 A;  4F9Z A;  3CTF A;  3HYP A;  2H6Z A;  4MJC A;  3UIW A;  2H71 A;  2YWN A;  1F3A A;  1V2A A;  3BJ5 A;  2N5F A;  5H5S A;  5A5H B;  1SJZ A;  2XBQ A;  4EDY A;  2D2Z A;  1V9W A;  2WGR A;  3MIX A;  4PI2 C;  3D4T A;  4POB A;  1Y1U A;  5HQP A;  2X4A A;  2HXK A;  3GFK A;  3GL5 A;  3KXO A;  1E2Y A;  3W6G A;  4QL9 A;  2VCW A;  1SKR B;  1F6M C;  2FNO A;  2O87 A;  2ZUP A;  3MDK A;  3QOU A;  1R7H A;  4IHU A;  1YEP A;  4G01 A;  1XBS A;  2CX3 A;  4XHM A;  2KHP A;  1I9D A;  3DXB A;  1VRS D;  1T00 A;  3KH7 A;  1YZX A;  5GAN D;  4NHZ A;  1FVJ A;  2DJJ A;  5G1K A;  3UAP A;  4IN0 A;  5BRT A;  3QR6 A;  2G0F A;  2EFD A;  1TU8 A;  4DVC A;  1PN0 A;  4MAB A;  1Z7P A;  4WR4 A;  5D73 A;  4FO5 A;  4L5L A;  2E7P A;  2TIR A;  2R0G A;  6GST A;  5HFG A;  1F3B A;  1YEW C;  3IR4 A;  2YWO A;  4G0L A;  2F8A A;  4N30 A;  1QK8 A;  2IPA A;  2YJH A;  2WCI A;  5AIX A;  3PH9 A;  2H70 A;  3RDW A;  1R5A A;  3FR6 A;  3QD9 A;  3IPZ A;  1YKA A;  14GS A;  1AAZ A;  4JRR A;  1PX7 A;  5IOW A;  4IS0 A;  3TKS E;  2OE1 A;  1SK2 A;  5J4V A;  4TR4 A;  1DSB A;  2WUL A;  2KUC A;  5HR2 A;  4KX4 A;  2GDR A;  5CRW A;  1AC1 A;  2YV7 A;  1EGO A;  5D9V A;  1OYJ A;  1S3C A;  3FRC A;  4MPG A;  2OE3 A;  5F07 A;  2CQ9 A;  2PUK C;  2IIY A;  4LMW A;  4PHZ C;  1LBK A;  5A34 B;  3C73 A;  5JCG A;  3ZYW A;  2EFE A;  1O81 A;  2QA2 A;  3LW9 A;  4F82 A;  5F8B A;  1FO5 A;  1XXU A;  4OFN A;  4MPF A;  4YQM A;  2H1L A;  2MYG A;  1I5G A;  4BL7 A;  5A1N B;  1O8W A;  1TJD A;  5KN3 A;  3HD5 A;  1GNW A;  2H66 A;  2AV4 A;  1XFL A;  5DAL B;  4ZB8 A;  5KOW A;  1B48 A;  4HJM A;  3BD2 A;  4CHS A;  10GS A;  4G2E A;  3HA9 A;  1SVL A;  4K5S A;  4K2D A;  1NHY A;  2B3S A;  5HR1 A;  2VUP A;  2C1Y A;  4DSS A;  5A5K A;  5HFK A;  4LLR A;  1OC9 B;  2RII A;  2NTO A;  2PGT A;  2F51 A;  3GUS A;  2XBI A;  3GKM A;  2A2P A;  4POM A;  5ELA A;  2EFC A;  2LRT A;  2MZC A;  2GQL A;  3D4M A;  1OKT A;  1M99 A;  3TOU A;  3QFA C;  3UEM A;  2WJU A;  1XIY A;  1TRS A;  4BVY A;  4KF9 A;  5L71 A;  3FEU A;  3EPT A;  5D9X A;  2XC2 A;  1FB0 A;  2GQM A;  2PER A;  3PGT A;  2C0E A;  3ERW A;  1HD2 A;  1TXU A;  1R5P A;  4XS4 B;  4BIK A;  3MYD A;  2WVZ A;  1GSQ A;  5ECI B;  2R37 A;  1M2A A;  4DSR A;  1XG8 A;  3RGB C;  1YDK A;  4LL4 B;  3L9U A;  1KBN A;  4D73 B;  2V6K A;  3LJR A;  3IHG A;  2FA4 A;  1TI3 A;  1ZYN A;  3GL3 A;  2F8F A;  2A2R A;  5J41 A;  1EWX A;  2DIZ A;  4PXO A;  3WYW A;  5AIS A;  5KN0 A;  3IHQ A;  4NXI A;  4ECJ A;  4O5Q A;  2OAD A;  4J56 E;  1G6Y A;  1JZR A;  5FWG A;  2PVO C;  5IQY A;  1SU9 A;  3M9K A;  2YAN A;  4FIW A;  3CMI A;  4YKF A;  1B9Y C;  5CRD A;  2NPB A;  4I2U A;  1ZYP A;  2R2J A;  3DWV A;  2GVP A;  2CA8 A;  2HI7 A;  1F2E A;  1OC8 A;  4AKH A;  1U6T A;  3HVN A;  2WW1 A;  1O7U A;  1T3B A;  2IFQ B;  2X49 A;  2DJ3 A;  1MDI A;  4P3Y B;  3CQF A;  1EEM A;  4OFT A;  1VF4 A;  4RQR A;  4EXJ A;  1EV9 A;  2R6K A;  3WGD A;  2LQQ A;  3VWX A;  3W8S A;  4NV5 A;  3AY8 A;  4KB3 A;  3PIN A;  4G19 A;  1HNC A;  3TRP A;  2IMF A;  3VFI A;  1EP7 A;  3HJP A;  3QDN A;  9GSS A;  1WP0 A;  1WWJ A;  4KDY A;  3HXS A;  4WR5 A;  1TK5 B;  3UMA A;  5IO0 A;  2XPD A;  2YPM A;  5DQS A;  1FB6 A;  1JLW A;  4LA1 A;  3TOT A;  1GNE A;  2I81 A;  3APQ A;  2QSI A;  2CVK A;  2VM2 A;  3GKK A;  4WBR D;  3ZMK A;  4GSS A;  4GWR A;  4JR6 A;  2C8U A;  2N5B A;  4JED A;  4EC0 A;  3DD3 A;  2WW2 A;  2V2G A;  4MK3 A;  1SK0 A;  1EGR A;  1JLV A;  2ZNM A;  3GKN A;  1KEB A;  3M8N A;  4E8E A;  1F9M A;  3M3M A;  2M46 A;  4WET A;  1GL8 A;  1K0A A;  5AN1 A;  5LCZ A;  3P8W A;  4OMV A;  6GSW A;  4K8M A;  1XPV A;  3ZTL A;  4BVX B;  1Q4J A;  1AW9 A;  3G9B A;  3HVS A;  4DEJ A;  4QL7 A;  1AQW A;  2O7K A;  1ON4 A;  3ME8 A;  4PUF C;  5J5N A;  4FQU A;  1SKW B;  4XS6 A;  4L0U A;  2VOC A;  1C72 A;  1H4O A;  2VCX A;  3G7I A;  2I4A A;  1VF2 A;  2WVX B;  3LYK A;  2GSQ A;  2HSY A;  11GS A;  1SJI A;  2L4Q A;  3D0Z A;  3KJY A;  2H73 A;  2P31 A;  3ZIT A;  1TU7 A;  3NZN A;  1U88 A;  1NSW A;  1MD4 A;  3L4N A;  3HHV A;  4FYU A;  1SD9 A;  3Q18 A;  5DVB A;  1TXX A;  5G31 A;  5JCW A;  2WS2 A;  4WBJ A;  4XRA A;  5DDL A;  2F3M A;  5ECS A;  2EIR A;  4ECI A;  1T4Y A;  2H19 A;  1SL1 B;  1OAZ A;  2IMI A;  1SYR A;  2VCV A;  3A3T A;  5D93 A;  2YCD A;  3FK8 A;  2I3Y A;  3U6V A;  1UA5 A;  4Z7X A;  3IAM 2;  4GF0 A;  4O5U A;  5FT3 A;  1K3O A;  2X64 A;  1X5D A;  4GTU A;  4POK A;  3A5I A;  4AF2 A;  1YY7 A;  2CT6 A;  4KH7 A;  1J9B A;  1OKD A;  1GUH A;  3TCO A;  1A8L A;  1J08 A;  1NM3 A;  3PR8 A;  2FHE A;  1SD8 A;  3TUE A;  1EV4 A;  4TW5 A;  2HSN A;  2PVQ A;  2HE3 A;  2LJK A;  3A2W A;  2JZT A;  4ZIL A;  2JU5 A;  1GLQ A;  3WT2 A;  2FD3 A;  1PKZ A;  1NHO A;  4OCF A;  3V1W A;  7GSS A;  4V2N A;  2PMT A;  1GSE A;  3KM6 A;  4ULX A;  3IK9 A;  2GLR A;  2IME A;  4HUA A;  1X0R A;  5DAK A;  4TXV A;  1MD3 A;  4J2F A;  4QQ7 A;  1YQ1 A;  3E0U A;  5IPG A;  3KMN A;  1T8E B;  3CBU A;  3ME7 A;  4O7H A;  1XWB A;  3FMW A;  2GZY A;  4JR4 A;  4OO4 A;  5KEJ A;  3U5R E;  3FYG A;  3KD0 A;  3WGE A;  2H74 A;  1Y6E A;  2HFD A;  2REM A;  2PN8 A;  3GN3 A;  5IMA A;  4BA7 A;  3L0H A;  4KGI A;  4OCE A;  1GTI A;  4KAE A;  3M0F A;  3IBH A;  3R3E A;  3RHC A;  2LS5 A;  3HJO A;  2CVB A;  3D21 A;  3UAR A;  3DML A;  4GQF A;  3QAG A;  5FHI A;  4EL1 A;  3TDG A;  2YZH A;  1KNG A;  3P90 A;  1AQX A;  1ZYQ B;  4XCS A;  3TKS C;  3FZA A;  4PQ1 A;  3L9S A;  3I43 A;  1ZCP A;  5J9C A;  2VD0 A;  1ILO A;  3FZ9 A;  5F05 A;  3DGQ A;  2CZ3 A;  5CRH A;  2HRK B;  2FWG A;  3ZVJ A;  3IXR A;  4TXO A;  1JFU A;  1WE0 A;  5DAL A;  3FY7 A;  2HNL A;  3F9U A;  4RI7 A;  4EUY A;  4Z2U A;  3F4T A;  4RQX A;  4WF5 A;  5DJM A;  5G2Z A;  2Z9S A;  2R3X A;  3TKR A;  4MNN A;  1PRX A;  4V1A p;  1M9A A;  2E2G A;  5KOX A;  4V1A g;  2HQT A;  5J40 A;  1TRW A;  4AI6 A;  3UOM A;  3RFR C;  1MEK A;  2BMX A;  1BG1 A;  2B7J A;  1XZO A;  3DVX A;  4TR1 B;  2HSM B;  3QAW A;  5HR0 A;  4IJI A;  4I2T A;  3TKS A;  3EU3 A;  1FOH A;  2VCZ A;  4YQV A;  3D22 A;  3SBC A;  2FLS A;  2C0G A;  2ES7 A;  2RM6 A;  5ID2 A;  3LXT A;  1G0T A;  2H6X A;  1M3I A;  4HQS A;  3F6D A;  3VWU A;  3GH9 A;  5EPF A;  5BMU A;  2V32 A;  2B5E A;  4NWY A;  2RUF A;  1YJ6 A;  1BG5 A;  3UBL A;  1W4V A;  5ECM B;  3UVH A;  4BPY A;  3CSJ A;  2DMM A;  3NOF A;  2QGV A;  4GST A;  2V41 A;  3ZIJ A;  4G0I A;  1WMJ A;  3VI7 A;  3HCZ A;  1OC3 A;  3TJB A;  3TB2 A;  2HRA A;  2M72 A;  1S3A A;  1B4Q A;  8GSS A;  2RLI A;  5GST A;  4LMV A;  4NMU A;  16GS A;  1A2L A;  2N5A A;  4NHW A;  5GAP D;  5LD0 A;  2FGX A;  2IL3 A;  4G0K A;  1GUK A; 
#chains in the Genus database with same CATH homology
 4PNG A;  5E59 A;  2AUV A;  1BQ7 A;  3H1N A;  3APO A;  3BCI A;  1Z6N A;  2VAF A;  1M2B A;  1HNB A;  1EOG A;  2H30 A;  3HVV A;  3VLN A;  1BED A;  3IC4 A;  2R4V A;  2OBK A;  2EIO A;  4JZQ A;  2VD1 A;  1QQ2 A;  4I6X A;  1A23 A;  3KP8 A;  5HR3 A;  3H79 A;  1GUL A;  3IDV A;  2LTK A;  2YNX A;  1FOV A;  2DC5 A;  5GZZ B;  1XOA A;  2FUG 2;  2JSZ A;  1N25 A;  4PNF A;  2L5O A;  1IYH A;  1SJ6 A;  3WD6 A;  1XOB A;  4ZBB A;  4Q5R A;  5A4U A;  2GGT A;  4EDZ A;  4YQU A;  1VGL A;  6GSU A;  1UN2 A;  3GKX A;  2L6D A;  2HYX A;  3F6F A;  4MJE A;  4TVE A;  1OE8 A;  4KA0 A;  3C1S A;  3C8E A;  3MAK A;  2AB6 A;  2FA8 A;  4YAV A;  5ECL B;  4Q5Q A;  5J9B A;  3BBY A;  4USS A;  5ABR A;  3ERG A;  3VPT A;  2OJL A;  4MF6 A;  5B6M A;  3ZRE A;  2GQK A;  3EIN A;  1K3L A;  2LUS A;  5IPH A;  4IJ3 A;  3ZL5 A;  3RBT A;  5C04 A;  3E3E A;  1U3A A;  2VL3 A;  5IMD A;  3I6A A;  2OAC A;  1YF0 A;  1GRX A;  1BF5 A;  1BJX A;  1SVM A;  2WFC A;  1A0F A;  2NVL A;  1AXD A;  3P7X A;  1PQN A;  1JZD A;  3KCM A;  3LOR A;  3ZFB A;  4MH3 A;  1GSY A;  3MNG A;  5D9W A;  1URM A;  4TKY A;  1EOH A;  2ON5 A;  5J4U A;  4AKI A;  4XRD A;  1B4P A;  3ZRD A;  4ZBD A;  3A2X A;  3M9J A;  3HVX A;  2PBJ A;  4HZ2 A;  3O76 A;  3D6I A;  1AUC A;  4MMM A;  2EFH A;  2BTO T;  2P0G A;  1QGV A;  2CVD A;  2O85 A;  2B1K A;  3CRU A;  1TKD B;  4L5O A;  1FW1 A;  3FZ4 A;  2DJK A;  3IE3 A;  5J47 A;  2OKA A;  3P2A A;  1O6J A;  4PUA A;  6GSV A;  4AJ8 A;  1SYX A;  1TRU A;  1A8Y A;  2VIM A;  2JZS A;  1QFN A;  4MCU A;  2CZ2 A;  4E8H A;  5AGY A;  2B5Y A;  4BWQ A;  5IMV A;  1PMT A;  4EF0 A;  1SL2 B;  4PTS A;  3F4R A;  4ZIJ A;  2NDO A;  2VLU A;  4IVF A;  2HZF A;  17GS A;  1G7O A;  1XW6 A;  3TU3 B;  1RQM A;  4Q5F A;  2VL2 C;  4HS1 A;  3QPM A;  2E0Q A;  2GTU A;  3ZZX A;  22GS A;  2GSS A;  3VUR A;  1GSD A;  2MMZ A;  2H1A A;  1FG4 A;  3KH9 A;  5COH A;  1TK8 B;  4GLT A;  1T1V A;  1UVZ A;  4EKZ A;  4ZB9 A;  3EMP A;  3HY2 A;  2DBC A;  4BL7 B;  1WIK A;  5CRE A;  3GTU A;  1Z6M A;  3WGX A;  2TRX A;  3Q19 A;  2A4H A;  3FKF A;  4O32 A;  2VKZ G;  3RHB A;  1ERV A;  2DJ1 A;  3EUR A;  4AKX B;  4BWS A;  3ED3 A;  1QXH A;  3VI5 A;  1XW9 A;  3F3R A;  4PX1 A;  2J23 A;  2ZCT A;  1YEX A;  4DSS B;  3ZVJ D;  5B8A A;  1BAY A;  3F4S A;  3H93 A;  2E2M A;  1CQH A;  1GWC A;  4HU9 A;  2VL2 A;  2NBS A;  1PX6 A;  2HZE A;  4WKW A;  2VLV A;  3EVI A;  2PWJ A;  2CAI A;  4NPB A;  1SKS B;  5ECR B;  2JAD A;  3GA4 A;  3VWV A;  2MMA A;  1XVQ A;  3UBK A;  1SVO A;  4BVY B;  1GTU A;  3FR3 A;  2IMK A;  2H0I A;  2YWM A;  1FHE A;  4O92 A;  5G5F A;  4LL1 B;  2KP2 A;  4KDX A;  4OFM A;  5D8I A;  3C1R A;  1K0B A;  3J7Y b;  1TOF A;  4CY6 A;  4EE0 A;  1ZMA A;  1WJK A;  4IGJ A;  1FVK A;  5DJL A;  5A5H A;  5ECH B;  4JBB A;  2HRF A;  3LEF A;  5ECN B;  3QMX A;  2LQO A;  1OE7 A;  5CYY A;  4PGT A;  4HOJ A;  5KN2 A;  1N8J A;  1DUG A;  3IV4 A;  4Q5N A;  1NW2 A;  1USB A;  1K0N A;  4ML1 A;  2WRT A;  3ZLP A;  2AJQ B;  4W66 A;  2CX4 A;  2GSR A;  5CO3 A;  2XPE A;  4K6X A;  1O8X A;  2KOK A;  2GS3 A;  20GS A;  3CWG A;  2AAW A;  2DKH A;  3KIJ A;  2AYT A;  5EVO A;  1M2D A;  2L4C A;  2OE0 A;  2OBI A;  1XWG A;  4GCI A;  3RPP A;  5J3R A;  1K0O A;  4K0N A;  2H1G A;  4HU7 A;  2H01 A;  5H5Q A;  3C7M A;  4ICY A;  2C4J A;  4PQH A;  2FCH A;  3FZ5 A;  4HI7 A;  1KTE A;  3KTL A;  5E4W A;  3O3T A;  4MZW A;  5JWO B;  1XWA A;  3I69 A;  5GSS A;  2XHF A;  4X43 A;  4ZBA A;  5A4V A;  5KN1 A;  4K5R A;  1M0U A;  2K8V A;  3GH6 A;  4TOP A;  4RUV A;  2LEG A;  4N0V A;  4YAP A;  1SEN A;  1O73 A;  2KLX A;  4ACS A;  1ABA A;  2DSA A;  2C80 A;  1GTA A;  1X9W B;  4YKG A;  2H8L A;  2H75 A;  1HQO A;  4KW6 A;  3DRN A;  4HJ2 A;  4WXT A;  1PL2 A;  5ELG A;  3CTG A;  2IN3 A;  3TJF A;  3C71 A;  2JL4 A;  2B1L A;  2QA1 A;  1XWC A;  3DYR A;  2YN1 A;  1TRV A;  1CQG A;  4ISD A;  1Q98 A;  5A34 A;  2FY6 A;  4X4J A;  1Z3E A;  2C0D A;  1X5C A;  2H1B A;  4YH2 A;  3UVT A;  4ZL8 A;  5ECK B;  3ZFL A;  1MTC A;  2PPT A;  3TRQ A;  1S3D A;  4AGS A;  1V98 A;  1WRY A;  2X8G A;  3GMF A;  5A1N A;  3TRX A;  2V6O A;  1TK0 B;  4TR0 A;  5C00 A;  1E6B A;  3DIE A;  2YWI A;  4IKH A;  4MF7 A;  3HKR A;  1K0M A;  1W89 A;  3JCM L;  1ZL9 A;  3Q74 A;  4PQI A;  1U87 A;  4MA9 A;  3Q6O A;  4GXZ A;  1A2J A;  3ZIV A;  3NIV A;  3G7J A;  1ZGN A;  2FWH A;  4GQC A;  1AIU A;  3RPN A;  2QKE A;  1OC9 A;  2VLT A;  2AHE A;  4ECC A;  5ECP B;  5F0G A;  4ZL7 A;  2KP1 A;  5EL8 A;  4XS1 A;  1Z9H A;  1XCC A;  1RW1 A;  2VM1 A;  3EU4 A;  4OWY A;  1THX A;  5G1L A;  3TGZ A;  3KGK A;  2I1U A;  1V40 A;  4GSN A;  1M9B A;  4I97 A;  4N3Z A;  2O89 A;  4MJB A;  1DBY A;  1TTZ A;  2VO4 A;  3EC3 A;  3D5J A;  1TI1 A;  4KUN A;  1A24 A;  1EEJ A;  2CAQ A;  3IAS 2;  2ON7 A;  1TP9 A;  1SL0 B;  4XS4 A;  2DIY A;  4QMK A;  13GS A;  3IK7 A;  3LSZ A;  2YP6 A;  2LST A;  1DE1 A;  2IWT A;  3TJG A;  4EO3 A;  2HT9 A;  5DQY A;  3DVW A;  1H75 A;  4MZC A;  4ZB7 A;  4IQ1 A;  1DE2 A;  4D73 A;  5B6N A;  1BYE A;  4V2M A;  2R5G A;  1U3I A;  2HSN B;  4KSO A;  2GT5 A;  18GS A;  1K3Y A;  3K8N A;  1Z7R A;  1GSU A;  2YZU A;  3GIX A;  4MF5 A;  3EE2 A;  12GS A;  2VCT A;  1PL1 A;  1MDJ A;  1YF1 A;  1X9S B;  3QAV A;  4N10 A;  5IMZ A;  2GZP A;  5DAK B;  2B7K A;  4ZB6 A;  4TN8 A;  4A5P A;  4EIQ A;  4WF4 A;  3OR5 A;  1ZZY A;  1B9X C;  2C3N A;  3GUR A;  4KCA A;  2LNS A;  4X1U A;  5DBQ A;  4KCE A;  3I9V 2;  2C3Q A;  2IJY A;  1ACV A;  2IFQ A;  1YKC A;  3GSS A;  4IW9 A;  5G5E A;  1ERT A;  3BCK A;  4I5Q A;  1K0C A;  3HJM A;  5AIV A;  1F37 A;  3CRT A;  4ECB A;  4WEY A;  3HZ8 A;  5DCH A;  2HRN A;  5A4W A;  3O6T A;  3IA1 A;  4NAX A;  3S9F A;  5LNK e;  3GYK A;  3GX8 A;  3H4K A;  4CW9 A;  5HFI A;  2LJA A;  4K1F A;  2ALB A;  5ENU A;  4KSM A;  2P5Q A;  3TKP A;  5CAX A;  4TXO B;  1ST9 A;  3EYT A;  1J0F A;  1M7T A;  3N5O A;  4FYC A;  4MLY A;  5F06 A;  4MDC A;  1XW5 A;  3KEB A;  4HQZ A;  2H0G A;  4G10 A;  4EVM A;  2X99 A;  1EP8 A;  1PSQ A;  4V2L A;  2R0C A;  4POL A;  2UV8 G;  4JE1 A;  4F0C A;  3VK9 A;  5ECQ B;  1A2M A;  3HMJ G;  3CSI A;  1BX9 A;  1EZK A;  2EC4 A;  1ZYE A;  3US3 A;  5IOX A;  1JHB A;  5ID2 B;  5D9T A;  2QC7 A;  3VPQ A;  3L9V A;  4BVX A;  2J9H A;  5CRG A;  1V57 A;  1T4Z A;  5BMU B;  2BJX A;  4ILF A;  4HEA 2;  3KMO A;  3F63 A;  6GSX A;  4K9Z A;  3M1G A;  1ERU A;  2A2S A;  1Z5Y E;  4CDO A;  2B6M A;  1VF3 A;  4F0B A;  2DJ0 A;  1RK4 A;  3ZML A;  1THO A;  2LKU A;  5IM9 A;  1FAA A;  4N0Z A;  2JZR A;  1GSS A;  1UC7 A;  3FHK A;  2I9H A;  4IBP A;  2X8C A;  2LRN A;  2LRC A;  5H5R A;  4K0G A;  4RI6 A;  5IIZ A;  2GT6 A;  3L78 A;  2L57 A;  4CY8 A;  1WOU A;  3HDC A;  2PU9 C;  1G7E A;  2V1M A;  1PGT A;  1HYU A;  2IMD A;  2FWF A;  1TW9 A;  4PUR A;  4L0W A;  4OO5 A;  4MP4 A;  3BOA A;  4XTS A;  1T7P B;  5J4Y A;  3W8J A;  2MMN A;  4JU5 A;  3TKQ A;  4IQA A;  5DCG A;  5IMF A;  5JCU A;  5G30 A;  3GST A;  2LV3 A;  1XWK A;  1IYI A;  1XVW A;  4N11 A;  2P5R A;  3A5W A;  4IP1 A;  3GHA A;  2DML A;  4AKG A;  5INY A;  1N2A A;  4O5R A;  2HSH A;  3MWH A;  1PA3 A;  5JWQ B;  4ML6 A;  3LGC A;  3GRX A;  2YJ7 A;  2WZ9 A;  4J57 E;  3IRA A;  3EMX A;  4KDU A;  2K6V A;  2EIQ A;  2B5X A;  4IP6 A;  1TDI A;  5ECO B;  4ZXG A;  4F03 A;  4MZB A;  2CV4 A;  4DSQ A;  1HNA A;  1JZW A;  4HZ4 A;  1VF1 A;  4ID0 A;  3IOS A;  5EY6 A;  1SK1 A;  1ZOF A;  4K7O A;  1AQV A;  2DKI A;  3TJK A;  4ZL9 A;  3DKS A;  3ISO A;  1GSF A;  1ERW A;  2RM5 A;  4HDE A;  2RUE A;  1QMV A;  2C3T A;  1B8X A;  4I8B A;  2K8S A;  3GNJ A;  1GP1 A;  6GSY A;  4GRF A;  1X5E A;  1ML6 A;  3LQ7 A;  2VL9 A;  4L8E A;  3MSZ A;  2X8H A;  3HZ4 A;  3EWL A;  1X9M B;  4F2I A;  3KTB A;  2YOI A;  3PPU A;  1A0R P;  4H86 A;  3H8Q A;  1K0D A;  1LU4 A;  2HRK A;  1OVN A;  2HLS A;  2LJR A;  3F0I A;  3IC8 A;  2A4V A;  3SWL A;  5B8B A;  2F9S A;  1G6W A;  1PD2 1;  3F3Q A;  3APS A;  3QFB C;  2O5V A;  3UJ1 A;  4K2X A;  4OD7 A;  3DEX A;  6GSS A;  2FWE A;  3WT1 A;  2JSY A;  19GS A;  2UZ8 A;  1WPI A;  3TJJ A;  4KND A;  2R0P A;  3CYN A;  1LJR A;  2L59 A;  4FYB A;  4TR1 A;  2HSM A;  4FH8 A;  4TRX A;  1MDK A;  3F8U A;  1R4W A;  3R2Q A;  3KP9 A;  2VCQ A;  4AJ7 A;  4MH2 A;  3J7Y k;  1R26 A;  3A2V A;  3CXG A;  1GLP A;  5CP1 A;  4EIP A;  5JWR B;  2OT3 A;  2K9F A;  4K7I A;  2WDU A;  1QUW A;  4TR3 A;  5D96 A;  4KE3 A;  5IMC A;  4K7N A;  2DJ2 A;  4E68 A;  1GTB A;  1Y25 A;  2DLX A;  3GTU B;  5IO2 A;  3QCP A;  3FR9 A;  4Z2T A;  3UL3 A;  1PN9 A;  4X0X A;  4XIH A;  5CNW A;  4GDF A;  4G9H A;  2JAC A;  3N9J A;  1YVL A;  3LYP A;  2K18 A;  2M80 A;  2G2Q A;  1JZO A;  2L6C A;  2MBT A;  3G7Y A;  2LNT A;  2TRC P;  5B7C A;  2O8V B;  1GUM A;  2MMO A;  2GZZ A;  3KZQ A;  4MJA A;  1O85 A;  3FW2 A;  4Z2R A;  3LXZ A;  2L5L A;  3GX0 A;  2H72 A;  2H6Y A;  2OA7 A;  3CSH A;  1V58 A;  2H1D A;  2H0H A;  2C0F A;  2H76 A;  3LG6 A;  4NV2 A;  1GH2 A;  2HZE B;  3LFL A;  4AJ6 A;  1PKW A;  2MBS A;  4IEL A;  3LWA A;  3VWW A;  2GST A;  3ERF A;  3E9J B;  3RAZ A;  3GV1 A;  2YV9 A;  2WB9 A;  4F9Z A;  3CTF A;  3HYP A;  2H6Z A;  4MJC A;  3UIW A;  2H71 A;  2YWN A;  1F3A A;  1V2A A;  3BJ5 A;  2N5F A;  5H5S A;  5A5H B;  1SJZ A;  2XBQ A;  4EDY A;  2D2Z A;  1V9W A;  2WGR A;  3MIX A;  3D4T A;  4POB A;  1Y1U A;  5HQP A;  2X4A A;  2HXK A;  3GFK A;  3GL5 A;  3KXO A;  1E2Y A;  3W6G A;  4QL9 A;  2VCW A;  1SKR B;  1F6M C;  2FNO A;  2O87 A;  2ZUP A;  3MDK A;  3QOU A;  1R7H A;  4IHU A;  1YEP A;  4G01 A;  1XBS A;  2CX3 A;  4XHM A;  2KHP A;  1I9D A;  3DXB A;  1VRS D;  1T00 A;  3KH7 A;  1YZX A;  5GAN D;  4NHZ A;  1FVJ A;  2DJJ A;  5G1K A;  3UAP A;  4IN0 A;  5BRT A;  3QR6 A;  2G0F A;  2EFD A;  1TU8 A;  4DVC A;  1PN0 A;  4MAB A;  1Z7P A;  4WR4 A;  5D73 A;  4FO5 A;  4L5L A;  2E7P A;  2TIR A;  2R0G A;  6GST A;  5HFG A;  1F3B A;  3IR4 A;  2YWO A;  4G0L A;  2F8A A;  4N30 A;  1QK8 A;  2IPA A;  2YJH A;  2WCI A;  5AIX A;  3PH9 A;  2H70 A;  3RDW A;  1R5A A;  3FR6 A;  3QD9 A;  3IPZ A;  1YKA A;  14GS A;  1AAZ A;  4JRR A;  1PX7 A;  5IOW A;  4IS0 A;  3TKS E;  2OE1 A;  1SK2 A;  5J4V A;  4TR4 A;  1DSB A;  2WUL A;  2KUC A;  5HR2 A;  4KX4 A;  2GDR A;  5CRW A;  1AC1 A;  2YV7 A;  1EGO A;  5D9V A;  1OYJ A;  1S3C A;  3FRC A;  4MPG A;  2OE3 A;  5F07 A;  2CQ9 A;  2PUK C;  2IIY A;  4LMW A;  1LBK A;  5A34 B;  3C73 A;  5JCG A;  3ZYW A;  2EFE A;  1O81 A;  2QA2 A;  3LW9 A;  4F82 A;  5F8B A;  1FO5 A;  1XXU A;  4OFN A;  4MPF A;  4YQM A;  2H1L A;  2MYG A;  1I5G A;  4BL7 A;  5A1N B;  1O8W A;  1TJD A;  5KN3 A;  3HD5 A;  1GNW A;  2H66 A;  2AV4 A;  1XFL A;  5DAL B;  4ZB8 A;  5KOW A;  1B48 A;  4HJM A;  3BD2 A;  4CHS A;  10GS A;  4G2E A;  3HA9 A;  1SVL A;  4K5S A;  4K2D A;  1NHY A;  2B3S A;  5HR1 A;  2VUP A;  2C1Y A;  4DSS A;  5A5K A;  5HFK A;  4LLR A;  1OC9 B;  2RII A;  2NTO A;  2PGT A;  2F51 A;  3GUS A;  2XBI A;  3GKM A;  2A2P A;  4POM A;  5ELA A;  2EFC A;  2LRT A;  2MZC A;  2GQL A;  3D4M A;  1OKT A;  1M99 A;  3TOU A;  3QFA C;  3UEM A;  2WJU A;  1XIY A;  1TRS A;  4BVY A;  4KF9 A;  5L71 A;  3FEU A;  3EPT A;  5D9X A;  2XC2 A;  1FB0 A;  2GQM A;  2PER A;  3PGT A;  2C0E A;  3ERW A;  1HD2 A;  1TXU A;  1R5P A;  4XS4 B;  3MYD A;  1GSQ A;  5ECI B;  2R37 A;  1M2A A;  4DSR A;  1YDK A;  4LL4 B;  3L9U A;  1KBN A;  4D73 B;  2V6K A;  3LJR A;  3IHG A;  2FA4 A;  1TI3 A;  1ZYN A;  3GL3 A;  2F8F A;  2A2R A;  5J41 A;  1EWX A;  2DIZ A;  4PXO A;  3WYW A;  5AIS A;  5KN0 A;  3IHQ A;  4NXI A;  4ECJ A;  4O5Q A;  2OAD A;  4J56 E;  1G6Y A;  1JZR A;  5FWG A;  2PVO C;  5IQY A;  1SU9 A;  3M9K A;  2YAN A;  4FIW A;  3CMI A;  4YKF A;  1B9Y C;  5CRD A;  2NPB A;  4I2U A;  1ZYP A;  2R2J A;  3DWV A;  2GVP A;  2CA8 A;  2HI7 A;  1F2E A;  1OC8 A;  4AKH A;  1U6T A;  1O7U A;  1T3B A;  2IFQ B;  2X49 A;  2DJ3 A;  1MDI A;  4P3Y B;  1EEM A;  4OFT A;  1VF4 A;  4RQR A;  4EXJ A;  1EV9 A;  2R6K A;  3WGD A;  2LQQ A;  3VWX A;  3W8S A;  4NV5 A;  3AY8 A;  4KB3 A;  3PIN A;  4G19 A;  1HNC A;  3TRP A;  2IMF A;  3VFI A;  1EP7 A;  3HJP A;  3QDN A;  9GSS A;  1WP0 A;  1WWJ A;  4KDY A;  3HXS A;  4WR5 A;  1TK5 B;  3UMA A;  5IO0 A;  2XPD A;  2YPM A;  5DQS A;  1FB6 A;  1JLW A;  4LA1 A;  3TOT A;  1GNE A;  2I81 A;  3APQ A;  2QSI A;  2CVK A;  2VM2 A;  3GKK A;  4WBR D;  3ZMK A;  4GSS A;  4GWR A;  4JR6 A;  2C8U A;  2N5B A;  4JED A;  4EC0 A;  3DD3 A;  2V2G A;  4MK3 A;  1SK0 A;  1EGR A;  1JLV A;  2ZNM A;  3GKN A;  1KEB A;  3M8N A;  4E8E A;  1F9M A;  3M3M A;  2M46 A;  4WET A;  1GL8 A;  1K0A A;  5AN1 A;  5LCZ A;  3P8W A;  4OMV A;  6GSW A;  4K8M A;  1XPV A;  3ZTL A;  4BVX B;  1Q4J A;  1AW9 A;  3G9B A;  3HVS A;  4DEJ A;  4QL7 A;  1AQW A;  2O7K A;  1ON4 A;  3ME8 A;  4PUF C;  5J5N A;  4FQU A;  1SKW B;  4XS6 A;  4L0U A;  2VOC A;  1C72 A;  1H4O A;  2VCX A;  3G7I A;  2I4A A;  1VF2 A;  3LYK A;  2GSQ A;  2HSY A;  11GS A;  1SJI A;  2L4Q A;  3D0Z A;  3KJY A;  2H73 A;  2P31 A;  3ZIT A;  1TU7 A;  3NZN A;  1U88 A;  1NSW A;  1MD4 A;  3L4N A;  3HHV A;  4FYU A;  1SD9 A;  3Q18 A;  5DVB A;  1TXX A;  5G31 A;  5JCW A;  2WS2 A;  4WBJ A;  4XRA A;  5DDL A;  2F3M A;  5ECS A;  2EIR A;  4ECI A;  1T4Y A;  2H19 A;  1SL1 B;  1OAZ A;  2IMI A;  1SYR A;  2VCV A;  3A3T A;  5D93 A;  2YCD A;  3FK8 A;  2I3Y A;  3U6V A;  1UA5 A;  4Z7X A;  3IAM 2;  4GF0 A;  4O5U A;  5FT3 A;  1K3O A;  2X64 A;  1X5D A;  4GTU A;  4POK A;  3A5I A;  4AF2 A;  1YY7 A;  2CT6 A;  4KH7 A;  1J9B A;  1OKD A;  1GUH A;  3TCO A;  1A8L A;  1J08 A;  1NM3 A;  3PR8 A;  2FHE A;  1SD8 A;  3TUE A;  1EV4 A;  4TW5 A;  2HSN A;  2PVQ A;  2HE3 A;  2LJK A;  3A2W A;  2JZT A;  4ZIL A;  2JU5 A;  1GLQ A;  3WT2 A;  2FD3 A;  1PKZ A;  1NHO A;  4OCF A;  3V1W A;  7GSS A;  4V2N A;  2PMT A;  1GSE A;  3KM6 A;  4ULX A;  3IK9 A;  2GLR A;  2IME A;  4HUA A;  1X0R A;  5DAK A;  4TXV A;  1MD3 A;  4J2F A;  4QQ7 A;  1YQ1 A;  3E0U A;  5IPG A;  3KMN A;  1T8E B;  3CBU A;  3ME7 A;  4O7H A;  1XWB A;  3FMW A;  2GZY A;  4JR4 A;  4OO4 A;  5KEJ A;  3U5R E;  3FYG A;  3KD0 A;  3WGE A;  2H74 A;  1Y6E A;  2HFD A;  2REM A;  2PN8 A;  3GN3 A;  5IMA A;  4BA7 A;  3L0H A;  4KGI A;  4OCE A;  1GTI A;  4KAE A;  3M0F A;  3IBH A;  3R3E A;  3RHC A;  2LS5 A;  3HJO A;  2CVB A;  3D21 A;  3UAR A;  3DML A;  4GQF A;  3QAG A;  5FHI A;  4EL1 A;  3TDG A;  2YZH A;  1KNG A;  3P90 A;  1AQX A;  1ZYQ B;  4XCS A;  3TKS C;  3FZA A;  4PQ1 A;  3L9S A;  3I43 A;  1ZCP A;  5J9C A;  2VD0 A;  1ILO A;  3FZ9 A;  5F05 A;  3DGQ A;  2CZ3 A;  5CRH A;  2HRK B;  2FWG A;  3ZVJ A;  3IXR A;  4TXO A;  1JFU A;  1WE0 A;  5DAL A;  3FY7 A;  2HNL A;  3F9U A;  4RI7 A;  4EUY A;  4Z2U A;  3F4T A;  4RQX A;  4WF5 A;  5DJM A;  5G2Z A;  2Z9S A;  2R3X A;  3TKR A;  4MNN A;  1PRX A;  4V1A p;  1M9A A;  2E2G A;  5KOX A;  4V1A g;  2HQT A;  5J40 A;  1TRW A;  4AI6 A;  3UOM A;  1MEK A;  2BMX A;  1BG1 A;  2B7J A;  1XZO A;  3DVX A;  4TR1 B;  2HSM B;  3QAW A;  5HR0 A;  4IJI A;  4I2T A;  3TKS A;  3EU3 A;  1FOH A;  2VCZ A;  4YQV A;  3D22 A;  3SBC A;  2FLS A;  2C0G A;  2ES7 A;  2RM6 A;  5ID2 A;  3LXT A;  1G0T A;  2H6X A;  4HQS A;  3F6D A;  3VWU A;  3GH9 A;  5EPF A;  5BMU A;  2V32 A;  2B5E A;  4NWY A;  2RUF A;  1YJ6 A;  1BG5 A;  3UBL A;  1W4V A;  5ECM B;  3UVH A;  4BPY A;  3CSJ A;  2DMM A;  3NOF A;  2QGV A;  4GST A;  2V41 A;  3ZIJ A;  4G0I A;  1WMJ A;  3VI7 A;  3HCZ A;  1OC3 A;  3TJB A;  3TB2 A;  2HRA A;  2M72 A;  1S3A A;  1B4Q A;  8GSS A;  2RLI A;  5GST A;  4LMV A;  4NMU A;  16GS A;  1A2L A;  2N5A A;  4NHW A;  5GAP D;  5LD0 A;  2FGX A;  2IL3 A;  4G0K A;  1GUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...