1PGTA

Crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pgtA01
2HE3A 3TKSE 1X0RA 3LYPA 4X1UA 1DSBA 3HXSA 5AN1A 2C8UA 3HY2A 2CX4A 2GQLA 3FK8A 2B5YA 4V2MA 3IC8A 4MF6A 2ZUPA 3KZQA 1GL8A 4LA1A 4BVYB 1TU8A 2WJUA 1XFLA 3IK9A 5D9TA 4OFNA 2HFDA 2H6ZA 5COHA 2B6MA 4L8EA 3CXGA 2HRAA 1XZOA 5IM9A 1KBNA 4HEA2 4K9ZA 1AAZA 5DVBA 1SL1B 3L78A 1K0NA 1ZL9A 1VRSD 1GSYA 1X9WB 1TU7A 3O6TA 4Q5FA 1KNGA 2F8AA 1LJRA 3ZYWA 3TUEA 2P31A 5AISA 1ZZYA 6GSYA 2K8SA 3TRPA 4RI7A 1NSWA 2H1BA 1A8LA 4MA9A 1Z3EA 2I9HA 5J9BA 5CRDA 5HQPA 1KTEA 4ACSA 3APSA 1SK2A 5IQYA 3UBLA 22GSA 2YWOA 4O92A 4WEYA 4PURA 1XWAA 1XOBA 4TKYA 3IPZA 1XPVA 4TN8A 3GX0A 4X0XA 3TJJA 2XPEA 3DMLA 2H71A 1G6WA 4JR4A 5CP1A 2VL9A 1M2BA 3EYTA 3UOMA 2JADA 3CBUA 3E3EA 14GSA 2FWFA 2YV7A 3KM6A 3BCKA 2YN1A 4YQUA 1ST9A 5D9WA 4N11A 1HQOA 5D73A 3D22A 4MH2A 4OMVA 4HI7A 2IPAA 1EV4A 4JU5A 3GYKA 2YOIA 3DGQA 2YJ7A 3BCIA 3EURA 2VCTA 5H5SA 2IMKA 2VCXA 2TRCP 4TRXA 3WGXA 3EU4A 4EF0A 2XC2A 2KLXA 4GWRA 3GRXA 1Z7RA 1FB6A 5GSSA 5D9VA 3F63A 1XW6A 4BVXB 1QXHA 3VI5A 5HR0A 1R26A 2CV4A 4PUFC 2YWMA 3F9UA 1RW1A 1TTZA 5G5EA 3P2AA 3D6IA 3VI7A 16GSA 1GSFA 4X43A 4YQMA 4MJCA 4LL1B 2FWEA 4KX4A 2NVLA 4WBJA 2DSAA 5DQYA 1GSSA 4EDZA 3MAKA 1R5PA 5B8BA 2CQ9A 3UEMA 2GZZA 3OR5A 1EEJA 1O8WA 3TKSA 2WULA 2FY6A 1X9MB 1JZDA 4N30A 4DSSB 2H70A 5BMUA 1GSQA 2N5FA 2JSYA 4J2FA 1ERWA 3DD3A 4IQ1A 2HQTA 2FWGA 1CQGA 4EUYA 4K8MA 3CTGA 4ULXA 2MYGA 4BVXA 5F0GA 1EWXA 1SK0A 1SJ6A 2H74A 2VCQA 1JZOA 4KE3A 4TW5A 4Q5NA 2CVBA 1Z6MA 1GSUA 2V2GA 2EIRA 3WD6A 4IW9A 3QCPA 4ZILA 2KOKA 2PU9C 2FHEA 3GL5A 3SBCA 4E8HA 5ECMB 4WETA 2HT9A 5FT3A 5B8AA 3HJPA 1A0RP 3HA9A 4PQIA 5F8BA 1K0MA 4OCEA 2GVPA 2GQKA 1Z6NA 4DSSA 2HRNA 4TR3A 4KDXA 2JZTA 1MD4A 3R2QA 3HHVA 2JU5A 2HNLA 3HYPA 5ECNB 2HSHA 1AC1A 1BEDA 1PA3A 6GSVA 2G0FA 1PN9A 1F6MC 3I9V2 2H73A 4KDUA 2K6VA 1JHBA 1VGLA 3P8WA 4JBBA 3TOTA 3PR8A 5JCGA 1OC8A 1N8JA 2EIQA 2CVKA 5HR3A 2B1LA 3GKXA 2KP1A 2V41A 4EL1A 5B6MA 1GSDA 2CVDA 1SJZA 3QMXA 2IMFA 3VLNA 1SJIA 1Q4JA 2D2ZA 4IHUA 3GN3A 2CAQA 2HLSA 1TK0B 4XS6A 1B4QA 3LORA 4NV2A 2G2QA 1G0TA 2AV4A 3KCMA 3LQ7A 10GSA 2L6DA 4KSOA 1F3AA 1B9YC 2VL2C 1SKWB 3S9FA 1W89A 4ZL8A 2VLVA 5ELGA 1EOHA 2FNOA 5CREA 2HYXA 3UBKA 3UIWA 4GXZA 4JR6A 1NM3A 3TRXA 4IKHA 4K6XA 1SENA 1T00A 3IRAA 3WGDA 1B8XA 2AJQB 1OKDA 5DBQA 2DLXA 2X99A 1C72A 5GSTA 1AQXA 3GKMA 1PGTA 3C1SA 1Z9HA 4K0GA 5D9XA 5D96A 18GSA 2VL3A 1JLWA 4V2NA 3RHBA 1I9DA 4BWSA 2DIZA 3D5JA 1XWCA 1ZOFA 2AYTA 5IOXA 1MD3A 3QR6A 4ML6A 3V1WA 4AF2A 3M9JA 5ABRA 1YDKA 1XIYA 3TJFA 3LFLA 3HKRA 1R4WA 1YQ1A 3US3A 1YJ6A 1V58A 5G31A 1PX6A 4PTSA 2VLTA 2V6OA 1O6JA 3UAPA 1XW5A 3FR9A 2CX3A 4ZB9A 2IMIA 1VF3A 2QGVA 1GUHA 2WGRA 4D73B 2O8VB 1PQNA 3HDCA 4N0ZA 3FYGA 2PWJA 2O87A 2PMTA 4MDCA 5H5QA 2I4AA 1SYXA 2AHEA 5CO3A 2VLUA 4ZIJA 1G6YA 1X9SB 1T1VA 3RBTA 4IQAA 2DJKA 1TDIA 1HNBA 4MF5A 4JRRA 1SL0B 3CRTA 4NPBA 4O5RA 1FB0A 2EIOA 4F2IA 4G0IA 4MZWA 3C7MA 1PX7A 2YZUA 2B3SA 3DXBA 2C4JA 2DJ0A 3TRQA 1TJDA 4XTSA 4EDYA 4BPYA 4G9HA 5J3RA 1SD9A 1TK5B 4IELA 1PRXA 4ISDA 1SU9A 3F4SA 1CQHA 1JZRA 3TKQA 5CAXA 2FUG2 2GQMA 7GSSA 1TW9A 1SL2B 5JWOB 4D73A 3D4MA 4PUAA 5CNWA 3CSIA 4KF9A 1OYJA 3L9SA 3GKKA 1A0FA 4FO5A 1E2YA 3G7YA 4WXTA 5CRWA 1BYEA 4DEJA 1EP7A 1ERTA 2RUEA 4L0WA 5HFGA 1H75A 3LYKA 1UVZA 3VFIA 3KTLA 2C80A 4HZ4A 5F05A 3FZAA 3TOUA 1B4PA 5DDLA 3AY8A 3F3QA 4IJ3A 5ECQB 4OD7A 4KCAA 3N5OA 1U87A 2B1KA 1M9BA 1VF4A 3EC3A 1XW9A 3ZIVA 2H6XA 1M0UA 3NIVA 1QK8A 1JLVA 1DE2A 1Z5YE 4MZCA 3CRUA 3ERWA 2A2SA 1TI1A 4TXVA 2IL3A 4HUAA 1K3OA 2VUPA 1TRSA 5FHIA 1ON4A 3ZRDA 5INYA 2LNSA 4N0VA 4JEDA 4L0UA 2RLIA 3DRNA 3G7JA 3IR4A 4G0LA 1EZKA 2I3YA 2NBSA 2LJKA 5J5NA 4MF7A 2X8GA 2R3XA 1UN2A 1GLQA 2R2JA 1WE0A 4K7NA 1M2DA 4PNGA 2GZPA 2K9FA 2RM6A 4MABA 4IN0A 4CDOA 3LG6A 4HZ2A 2C3QA 1Y6EA 2VM1A 4HJMA 1WMJA 1QFNA 3C71A 3GH9A 1Z7PA 2C3TA 5IOWA 3W8JA 3O3TA 5CYYA 3LXZA 2B7JA 3LWAA 3EMPA 3TB2A 5A4WA 3MNGA 2BTOT 2RIIA 4MH3A 4KA0A 3U5RE 3I69A 3IE3A 2VD1A 2UZ8A 1TI3A 4WR5A 1V2AA 3F4RA 3Q74A 3LEFA 5J9CA 4HS1A 4PXOA 4J57E 1HNAA 3C1RA 3FZ4A 5C00A 4K1FA 3FHKA 2JZRA 4O32A 4EXJA 4RUVA 4TVEA 5ELAA 5J41A 2YNXA 2MZCA 5G5FA 3IOSA 2MMAA 2I81A 3VPQA 2GSTA 3O76A 3JCML 3M1GA 5GZZB 3GIXA 3TCOA 2WRTA 1G7OA 1RK4A 5DCGA 4G19A 2FCHA 1ZMAA 3IDVA 4OWYA 4AJ7A 2E2GA 5GAPD 1XWKA 4OO5A 3J7Yb 4EO3A 1TRVA 3ZITA 3TJBA 2WCIA 2N5BA 1XXUA 2A2RA 1WRYA 1WWJA 4AGSA 1AIUA 1AW9A 1GTAA 3NZNA 5ID2A 4ZB8A 3ERFA 3TJKA 3L4NA 3ME7A 1FW1A 1PKWA 1J08A 3FY7A 3F0IA 5DQSA 4LLRA 1O85A 4EVMA 4XHMA 2YZHA 6GSUA 2DJ3A 4XCSA 5IMDA 4FH8A 4IJIA 4E8EA 1THOA 2MMNA 5CRGA 4O7HA 5EVOA 2CZ3A 3HZ8A 2X8HA 3EE2A 3CMIA 2R4VA 2GSQA 4OCFA 2FA8A 2OKAA 5EPFA 1JZWA 2B7KA 3H8QA 1OC9B 4GSTA 4OO4A 2LJAA 4NWYA 3C73A 5ECKB 4TR4A 5J4UA 5CRHA 5DCHA 1MDKA 2PGTA 2GTUA 1QQ2A 1QGVA 4F0BA 1T4YA 3H1NA 2GT6A 2LRTA 1GULA 2OE0A 3HCZA 3DKSA 1K3YA 2AUVA 3MWHA 5DALB 2DJ2A 2DBCA 1EOGA 2MBSA 2L5OA 2DIYA 4BA7A 2P5QA 4YQVA 1O81A 3ZREA 1K0CA 1GTUA 17GSA 1XOAA 2GSSA 1WP0A 2VAFA 3HJMA 4NMUA 3RPNA 5IO2A 3M9KA 4RQXA 2YCDA 1HYUA 5E4WA 4I8BA 4XIHA 3I43A 4Z7XA 4FQUA 4GSNA 3P90A 3RAZA 3ED3A 1OC9A 2H0IA 3ZL5A 3GV1A 2LRNA 3IAM2 1IYHA 4IGJA 4H86A 5LCZA 3KH9A 3KJYA 4KCEA 4KUNA 2ES7A 1GH2A 4HDEA 2IMEA 3CSHA 2C0FA 1S3AA 2LS5A 1FOVA 3K8NA 3VWXA 5F07A 3W8SA 3TDGA 5DALA 5LD0A 1FHEA 1EGOA 3ZVJA 1YEPA 1HD2A 1SKSB 1FG4A 2E2MA 1GTIA 1A23A 1PD21 1NHOA 2O85A 5HR1A 4PGTA 2R37A 2H75A 3UVTA 5DJMA 3E9JB 3QAGA 1BX9A 2J23A 1PMTA 3KMOA 3VK9A 1TXXA 3U6VA 2NDOA 4ZL9A 4K7OA 2B5XA 3APOA 3IA1A 3ZZXA 3DYRA 1V98A 3HVXA 3HVSA 3HD5A 3FKFA 2IIYA 4NHZA 4MPGA 1HNCA 3LXTA 3HVVA 1X5CA 2BJXA 2FA4A 20GSA 1GUMA 2XBQA 2IFQB 4ECBA 1XWBA 2CA8A 4V1Ap 2C0EA 5KN0A 1RQMA 4XRDA 5AIVA 3M8NA 1K3LA 4ECCA 4HOJA 1F37A 1ABAA 3PPUA 4KH7A 3VPTA 2L6CA 3QOUA 3TJGA 1TP9A 4WKWA 3Q19A 5JCWA 4NAXA 3VWUA 2A4VA 1J9BA 3PINA 2LQOA 4K0NA 3GX8A 1OAZA 1U3IA 3QPMA 3CSJA 1N2AA 5ECIB 4GQFA 3A2XA 4HU7A 2WB9A 5D8IA 2IFQA 3F6DA 1WJKA 5ECOB 1EGRA 4I2TA 4MZBA 1TK8B 1M2AA 1FAAA 4IP6A 3EINA 1BAYA 4HQSA 3TKRA 3PGTA 5B6NA 2VCWA 2YWNA 2OE3A 2OADA 1F3BA 5IO0A 5D93A 3FEUA 1XCCA 2V1MA 3HZ4A 5EY6A 1FVKA 2V6KA 1W4VA 1YF0A 3KP8A 2E0QA 4TXOB 1U88A 5G2ZA 2K18A 3ZMLA 4RI6A 1XWGA 6GSTA 1S3DA 3L9UA 2ON5A 4DSRA 4ZBBA 1SKRB 5ECLB 3HJOA 1T7PB 2XHFA 3D4TA 2CAIA 4OFMA 1M9AA 1GRXA 2IN3A 4FIWA 1PSQA 2K8VA 3KEBA 5GAND 1SK1A 4ECJA 2FWHA 4ZL7A 3M0FA 4EE0A 3G9BA 1ACVA 5A4UA 5IMVA 1AUCA 2H30A 4GRFA 2L4CA 3FZ5A 2OACA 4I97A 3A5WA 3RDWA 4MPFA 3WT1A 3A3TA 3F6FA 2GZYA 2WZ9A 1TKDB 4MK3A 3DVWA 2JSZA 2F9SA 3L9VA 6GSWA 2QSIA 3UVHA 3GTUB 1T8EB 2H76A 4GSSA 4NXIA 3C8EA 2BMXA 4KW6A 4TXOA 5IIZA 4WBRD 1VF2A 3D0ZA 4FYCA 4GTUA 3UL3A 2REMA 4TR1B 3VWWA 2HZEB 1V9WA 1WPIA 1PL1A 2ZCTA 1GP1A 5IPHA 4LMVA 2AAWA 2C0DA 2JL4A 1GWCA 4YAPA 5ECPB 3QFAC 1FVJA 4I6XA 2M80A 2H1AA 2MMZA 5F06A 3TGZA 2B5EA 3BJ5A 3CYNA 1LU4A 2PBJA 9GSSA 5HR2A 2C1YA 3APQA 1I5GA 4WR4A 1AQWA 4G0KA 5IPGA 3BOAA 1MTCA 4JE1A 4K7IA 4K2DA 1YEXA 5H5RA 5KN1A 4DSQA 2DJ1A 4IP1A 4WF4A 2LV3A 3GSTA 4BL7B 5IMFA 4IVFA 3GTUA 2H0GA 1YKCA 2YV9A 2H0HA 3WYWA 1ZCPA 1AXDA 1G7EA 1BJXA 4TR1A 2HZEA 3J7Yk 4KDYA 5HFKA 5ID2B 1NW2A 3KMNA 2OA7A 2HSMB 4ZBAA 4KNDA 4Q5QA 1WOUA 4QL7A 3GNJA 2E7PA 3EVIA 2H1DA 4BVYA 5IMZA 1TRWA 1PL2A 1H4OA 2LRCA 3GUSA 1THXA 4J56E 2LUSA 2TIRA 2F51A 2AB6A 4MP4A 4ID0A 1F2EA 4XS1A 4JZQA 2X64A 2L57A 1SD8A 1U6TA 3RPPA 2X8CA 4FYUA 1MDJA 1LBKA 4KAEA 5C04A 3H79A 2ZNMA 3KH7A 3IHQA 2HRFA 4BL7A 1BQ7A 3DWVA 4PQ1A 4TOPA 4I2UA 1XVQA 6GSSA 2VM2A 1PKZA 2LSTA 3WT2A 5KN3A 2IJYA 4ZB6A 1YF1A 1GUKA 3EU3A 1OE8A 3FR3A 5ECRB 1GSEA 2F8FA 1Q98A 11GSA 3F8UA 4F0CA 1EEMA 2VL2A 2HSMA 3ZFBA 4V2LA 4AJ6A 4FYBA 4POLA 4LMWA 3F4TA 19GSA 4IBPA 2VIMA 2JACA 3ZIJA 5IMAA 2MBTA 1F9MA 4G2EA 4Q5RA 3VURA 1A2MA 5AGYA 4EKZA 1DBYA 1BG5A 4YH2A 2HSNB 1ML6A 2LEGA 2OJLA 4POBA 1A2LA 1EV9A 1B9XC 3H93A 2L4QA 3IAS2 1USBA 5JWQB 2YJHA 2WFCA 4DVCA 1YY7A 2RM5A 1WIKA 5ENUA 1K0AA 5KN2A 1ERUA 3LGCA 1FO5A 3QD9A 1OKTA 2ALBA 3ZFLA 2J9HA 2OBIA 1ZYEA 5A5KA 2H1GA 1ZYQB 5A4VA 2IWTA 5LNKe 2GS3A 2MMOA 2OE1A 2I1UA 2LJRA 3QFBC 1O73A 2TRXA 5KEJA 4POKA 2FD3A 3GA4A 4NV5A 2XPDA 3KGKA 2R6KA 3GFKA 2GGTA 3E0UA 3IC4A 3A2VA 2HSYA 3ISOA 3FRCA 1XVWA 2H8LA 3BD2A 2LQQA 4RQRA 2VO4A 3WGEA 1A24A 1R7HA 4QL9A 1R5AA 2Z9SA 2GSRA 3MSZA 4G10A 3KXOA 4XRAA 1OE7A 2VCVA 3ERGA 2F3MA 1X5DA 2JZSA 1K0DA 2N5AA 3IV4A 5HFIA 1DE1A 3DIEA 3KP9A 4HJ2A 3W6GA 4KB3A 2KHPA 4BWQA 5E59A 3QAWA 2PVQA 3VWVA 3KTBA 1M99A 2VD0A 3FR6A 3P7XA 2QC7A 3GH6A 4KSMA 4MJEA 4XS4B 12GSA 4GCIA 2DJJA 3FW2A 2M46A 4ZBDA 2YPMA 3DVXA 3GSSA 2GDRA 3D21A 3CTFA 2P0GA 5IMCA 5L71A 2HRKB 1M7TA 4AJ8A 4P3YB 4MCUA 2FGXA 3UJ1A 4MLYA 4NHWA 2C0GA 2CZ2A 1TRUA 4KGIA 3TKPA 1OVNA 2O7KA 4I5QA 4MJBA 1J0FA 3R3EA 2EC4A 1MEKA 3A2WA 2WDUA 4LL4B 3GURA 4ZXGA 1NHYA 5JCUA 2LTKA 1GTBA 2PUKC 3GMFA 1ZGNA 3IK7A 2M72A 1OC3A 4L5LA 1SYRA 5ECSA 3TKSC 4F03A 1A2JA 1JFUA 4CW9A 2LKUA 1B48A 4N10A 5G1KA 2PPTA 2H19A 3ZLPA 2IMDA 3Q18A 2GT5A 3I6AA 4PX1A 3H4KA 4POMA 1S3CA 4XS4A 3NOFA 2ON7A 3ZTLA 2VOCA 5DAKB 1V57A 1KEBA 1DUGA 1QMVA 1K0BA 3UARA 1ERVA 1V40A 2HRKA 3IBHA 2HI7A 2YANA 2L59A 2WS2A 4WF5A 2YP6A 2L5LA 1O8XA 2OBKA 4V1Ag 4GF0A 2R5GA 4MMMA 4ILFA 5G1LA 1U3AA 2H72A 1K0OA 2YWIA 3FZ9A 2DMMA 3BBYA 4CHSA 3QDNA 2PN8A 4USSA 1UA5A 2LNTA 2DMLA 1E6BA 3RHCA 1QUWA 3SWLA 2GLRA 3LSZA 4GLTA 1T4ZA 2XBIA 5G30A 2H66A 1GLPA 5FWGA 4F82A 2RUFA 3DEXA 1GNEA 1GNWA 2HXKA 3GHAA 4YAVA 1A8YA 2P5RA 5DAKA 4PQHA 1EP8A 2PVOC 4ECIA 1TOFA 2PERA 3F3RA 2C3NA 1IYIA 2CT6A 5B7CA 1X5EA 4QQ7A 5ECHB 3G7IA 2FLSA 3ZMKA 2O89A 1Y25A 4HQZA 3KIJA 4EC0A 1URMA 4F9ZA 3Q6OA 3QAVA 3EMXA 2NPBA 4MJAA 2KP2A 2H01A 3IXRA 3N9JA 4ML1A 1UC7A 2DC5A 5JWRB 3L0HA 3M3MA 1T3BA 1O7UA 4TR0A 1YZXA 5AIXA 1ILOA 2V32A 2NTOA 13GSA 1YKAA 2H6YA 3ME8A 1MDIA 3ZVJD 3PH9A 1XBSA 3EWLA 6GSXA 5EL8A 2KUCA 2VCZA 2QKEA 1AQVA 4OFTA 2HZFA 4HU9A 8GSSA 3KD0A 4GQCA 3UMAA 3GKNA 3MDKA 1VF1A 4L5OA 3LJRA 4PNFA 5DJLA 3GL3A 4IS0A
chains in the Genus database with same CATH superfamily
2HE3A 3TKSE 1X0RA 3LYPA 4X1UA 4BIKA 1DSBA 3HXSA 5AN1A 2C8UA 3HY2A 2CX4A 2GQLA 3FK8A 2B5YA 4V2MA 3IC8A 2EFDA 4MF6A 2ZUPA 3KZQA 1GL8A 4LA1A 4BVYB 1TU8A 4GDFA 2WJUA 1XFLA 3IK9A 5D9TA 4OFNA 2HFDA 2H6ZA 5COHA 2B6MA 4L8EA 3CXGA 2HRAA 1XZOA 3LW9A 5IM9A 1KBNA 4HEA2 4K9ZA 1AAZA 5DVBA 1SL1B 3L78A 1K0NA 1ZL9A 1VRSD 1GSYA 1X9WB 1TU7A 3O6TA 4Q5FA 1KNGA 2F8AA 1LJRA 3ZYWA 3TUEA 2P31A 5AISA 1ZZYA 6GSYA 2K8SA 3TRPA 4RI7A 3HVNA 1NSWA 2H1BA 1A8LA 4MA9A 1Z3EA 2I9HA 5J9BA 5CRDA 5HQPA 1KTEA 4ACSA 3APSA 1SK2A 5IQYA 3UBLA 22GSA 2YWOA 4O92A 4WEYA 4PURA 1XWAA 1XOBA 4TKYA 3IPZA 1XPVA 4TN8A 3GX0A 4AKXB 4X0XA 3TJJA 2XPEA 3DMLA 2H71A 1G6WA 4JR4A 5CP1A 4G01A 2VL9A 1M2BA 3EYTA 3UOMA 2JADA 3CBUA 3E3EA 14GSA 2FWFA 2YV7A 3KM6A 3BCKA 2YN1A 4YQUA 1ST9A 5D9WA 4N11A 1HQOA 5D73A 3D22A 4MH2A 4OMVA 4HI7A 2IPAA 1EV4A 4JU5A 3GYKA 1SVOA 2YOIA 3DGQA 2YJ7A 3BCIA 3EURA 2VCTA 5BMUB 5H5SA 2IMKA 2VCXA 2TRCP 4TRXA 3WGXA 3EU4A 4EF0A 2XC2A 2KLXA 4GWRA 3GRXA 1Z7RA 1FB6A 5GSSA 5D9VA 3F63A 1XW6A 4BVXB 1QXHA 3VI5A 4Z2UA 1R26A 2CV4A 5HR0A 4PUFC 2YWMA 3F9UA 1RW1A 1TTZA 5G5EA 3P2AA 3D6IA 3VI7A 16GSA 1GSFA 4X43A 4YQMA 2WW0A 4MJCA 4LL1B 2FWEA 4KX4A 2NVLA 4WBJA 2DSAA 5DQYA 1GSSA 4EDZA 3MAKA 1R5PA 5B8BA 2CQ9A 3UEMA 2GZZA 3OR5A 1EEJA 1O8WA 3TKSA 2WULA 2FY6A 1X9MB 1JZDA 4N30A 4DSSB 2H70A 5BMUA 1GSQA 2N5FA 2JSYA 3CQFA 2VKZG 4J2FA 1ERWA 3DD3A 2EFEA 4IQ1A 2HQTA 2FWGA 1CQGA 4EUYA 4K8MA 3CTGA 4ULXA 2MYGA 4BVXA 5F0GA 1EWXA 1SK0A 1SJ6A 2H74A 2VCQA 1JZOA 4KE3A 4TW5A 4Q5NA 2CVBA 3A5IA 1Z6MA 1GSUA 2V2GA 2EIRA 3WD6A 4IW9A 3QCPA 4ZILA 2KOKA 2PU9C 2FHEA 3GL5A 3SBCA 4E8HA 5ECMB 4WETA 2HT9A 5FT3A 5B8AA 2WVXB 3HJPA 1A0RP 3HA9A 4PQIA 5F8BA 1K0MA 4OCEA 2GVPA 2H1LA 2GQKA 1Z6NA 4DSSA 2HRNA 4TR3A 4KDXA 2JZTA 1MD4A 3R2QA 3HHVA 2JU5A 2HNLA 3HYPA 5ECNB 2HSHA 1AC1A 1BEDA 1PA3A 6GSVA 2G0FA 1PN9A 1F6MC 4K5SA 3I9V2 2H73A 4KDUA 2K6VA 1JHBA 1VGLA 3P8WA 4JBBA 3TOTA 3PR8A 5JCGA 1OC8A 1N8JA 2EIQA 2CVKA 5HR3A 2B1LA 3GKXA 2KP1A 2V41A 4EL1A 5B6MA 1GSDA 2CVDA 1SJZA 3QMXA 2IMFA 2WVXA 3VLNA 1SJIA 1Q4JA 2D2ZA 4IHUA 3GN3A 2CAQA 2HLSA 1TK0B 4XS6A 1B4QA 3LORA 4NV2A 2G2QA 1G0TA 2AV4A 3KCMA 3LQ7A 10GSA 2L6DA 4KSOA 1F3AA 1B9YC 2VL2C 1SKWB 3S9FA 1W89A 4ZL8A 2VLVA 5ELGA 1EOHA 2FNOA 5CREA 2HYXA 3UBKA 3UIWA 4GXZA 4JR6A 1NM3A 3TRXA 4IKHA 4K6XA 1SENA 4AKIA 1T00A 3IRAA 3WGDA 1B8XA 2AJQB 1OKDA 5DBQA 2DLXA 2X99A 1C72A 5GSTA 1AQXA 3GKMA 1PGTA 3C1SA 1Z9HA 4K0GA 5D9XA 5D96A 18GSA 2VL3A 1JLWA 4V2NA 3RHBA 1I9DA 4BWSA 2DIZA 3D5JA 1XWCA 1ZOFA 2AYTA 5IOXA 1MD3A 3QR6A 5J4VA 4ML6A 3V1WA 4AF2A 3M9JA 5ABRA 1YDKA 1XIYA 3TJFA 3LFLA 3HKRA 1R4WA 1YQ1A 3RGBC 3US3A 1YJ6A 1V58A 5G31A 1PX6A 4PTSA 2VLTA 2V6OA 1O6JA 4EIPA 3UAPA 1XW5A 3FR9A 2CX3A 2O5VA 4ZB9A 2IMIA 1VF3A 2QGVA 1GUHA 2WGRA 4D73B 2O8VB 1PQNA 3HDCA 4N0ZA 3FYGA 2PWJA 2O87A 2PMTA 4MDCA 5H5QA 2I4AA 1SYXA 2AHEA 5CO3A 2VLUA 4ZIJA 1G6YA 1X9SB 1T1VA 3RBTA 4IQAA 2DJKA 1TDIA 1HNBA 4MF5A 4JRRA 1SL0B 3CRTA 4NPBA 4O5RA 1FB0A 2EIOA 4F2IA 4G0IA 4MZWA 3C7MA 1PX7A 2YZUA 2B3SA 3DXBA 2C4JA 2DJ0A 3TRQA 1TJDA 4XTSA 4EDYA 1S4BP 4G9HA 4BPYA 5J3RA 1SD9A 1TK5B 4IELA 1PRXA 4ISDA 1SU9A 3F4SA 1CQHA 1JZRA 3TKQA 5CAXA 2FUG2 2GQMA 7GSSA 4K5RA 4K2XA 1TW9A 1SL2B 5JWOB 4D73A 3D4MA 4PUAA 5CNWA 3CSIA 2WVZA 4KF9A 1OYJA 3L9SA 3GKKA 1A0FA 4FO5A 1E2YA 3G7YA 4WXTA 5CRWA 1BYEA 4DEJA 1EP7A 1ERTA 2RUEA 4L0WA 5HFGA 1H75A 3LYKA 1UVZA 3VFIA 3KTLA 4YKGA 2C80A 4HZ4A 5F05A 3FZAA 3TOUA 1B4PA 5DDLA 3AY8A 3F3QA 4IJ3A 5ECQB 4OD7A 4KCAA 3N5OA 1U87A 2B1KA 1M9BA 1VF4A 3EC3A 1XW9A 3ZIVA 2H6XA 1M0UA 3NIVA 1QK8A 1JLVA 1DE2A 1Z5YE 4MZCA 3CRUA 3ERWA 2A2SA 1TI1A 4TXVA 2IL3A 4HUAA 1K3OA 2VUPA 1TRSA 5FHIA 1ON4A 3ZRDA 5INYA 2LNSA 4N0VA 4JEDA 1S3RA 4L0UA 2RLIA 3DRNA 3G7JA 3IR4A 4G0LA 1EZKA 2I3YA 2NBSA 2LJKA 5J5NA 4MF7A 2X8GA 2R3XA 1UN2A 1GLQA 2R2JA 1WE0A 4K7NA 1M2DA 4PNGA 2GZPA 2K9FA 2RM6A 4MABA 4IN0A 3CWGA 4CDOA 4X4JA 3LG6A 4HZ2A 2C3QA 1Y6EA 5J47A 2VM1A 4HJMA 1WMJA 1QFNA 3C71A 3GH9A 1Z7PA 2C3TA 5IOWA 3W8JA 3O3TA 5CYYA 3LXZA 2B7JA 3LWAA 3EMPA 4CY6A 3TB2A 5A4WA 3MNGA 2BTOT 2RIIA 4MH3A 4KA0A 3U5RE 3I69A 3IE3A 2VD1A 2UZ8A 1TI3A 4WR5A 1V2AA 3F4RA 3Q74A 3LEFA 5J9CA 4HS1A 4PXOA 4J57E 1M3JA 1HNAA 3C1RA 3FZ4A 5C00A 4K1FA 3FHKA 2JZRA 4O32A 4EXJA 4RUVA 4TVEA 5ELAA 5J41A 2YNXA 2MZCA 5G5FA 3IOSA 2MMAA 2I81A 3VPQA 2GSTA 3O76A 3JCML 3M1GA 5GZZB 1PFOA 4O5QA 3GIXA 3TCOA 2WRTA 1G7OA 1RK4A 5DCGA 4G19A 4MNNA 2FCHA 5A1NB 1ZMAA 3IDVA 4OWYA 4AJ7A 2E2GA 3HMJG 5GAPD 1I1IP 1XWKA 4OO5A 3J7Yb 4EO3A 1TRVA 3ZITA 3TJBA 2WCIA 2N5BA 1XXUA 2A2RA 1WRYA 1PN0A 1WWJA 4AGSA 1AIUA 1AW9A 1GTAA 4ZB7A 3NZNA 4ZB8A 5ID2A 3ERFA 3TJKA 3L4NA 4ICYA 3ME7A 4A5PA 1FW1A 1PKWA 1J08A 3FY7A 3F0IA 5DQSA 4LLRA 1O85A 4EVMA 4XHMA 2YZHA 6GSUA 2DJ3A 4XCSA 5IMDA 4FH8A 4IJIA 4E8EA 1THOA 2MMNA 3RFRC 5CRGA 4O7HA 5EVOA 2CZ3A 3HZ8A 2X8HA 3EE2A 3CMIA 2R4VA 2GSQA 4OCFA 5A1NA 2FA8A 2OKAA 5EPFA 1JZWA 2B7KA 3H8QA 1OC9B 4GSTA 4OO4A 2LJAA 4NWYA 3C73A 5ECKB 4TR4A 5J4UA 5CRHA 5DCHA 1MDKA 2PGTA 2GTUA 1QQ2A 1QGVA 4F0BA 1T4YA 3H1NA 2GT6A 2LRTA 1GULA 2OE0A 3HCZA 3DKSA 1K3YA 2AUVA 2OT3A 3MWHA 5DALB 2A4HA 2DJ2A 2DBCA 1EOGA 2MBSA 2L5OA 2DIYA 4BA7A 2P5QA 4YQVA 1O81A 3ZREA 1K0CA 1GTUA 17GSA 1XOAA 2GSSA 1WP0A 2VAFA 3HJMA 4NMUA 3RPNA 5IO2A 3M9KA 4RQXA 2YCDA 1HYUA 4W66A 5E4WA 4I8BA 4XIHA 3I43A 4Z7XA 4FQUA 2WW2A 2O3EA 4GSNA 3P90A 3RAZA 2R0CA 3ED3A 1OC9A 2H0IA 3ZL5A 4Z2RA 3GV1A 2LRNA 3IAM2 1IYHA 4IGJA 4H86A 5LCZA 3KH9A 3KJYA 4KCEA 4O5UA 4E68A 4KUNA 2ES7A 1GH2A 4HDEA 2IMEA 3CSHA 2C0FA 1S3AA 2LS5A 1FOVA 1YVLA 3K8NA 3VWXA 5F07A 4EIQA 3W8SA 3TDGA 5DALA 2O36A 5LD0A 1FHEA 3MYDA 1EGOA 3ZVJA 1YEPA 1HD2A 3TU3B 3IHGA 1SKSB 1FG4A 2E2MA 1GTIA 1A23A 1PD21 1NHOA 2O85A 5HR1A 4PGTA 2R37A 2H75A 3UVTA 5DJMA 3E9JB 3QAGA 1BX9A 2J23A 1PMTA 3KMOA 3VK9A 1TXXA 3U6VA 2NDOA 4ZL9A 4K7OA 2B5XA 3APOA 3IA1A 3ZZXA 3DYRA 1V98A 3HVXA 4HSCX 3HVSA 3HD5A 3FKFA 2IIYA 4NHZA 4MPGA 1HNCA 3LXTA 3HVVA 5A34B 1X5CA 2BJXA 2FA4A 20GSA 4AI6A 2QA1A 4YKFA 5A5HB 1GUMA 2XBQA 2IFQB 4ECBA 1XWBA 2CA8A 2DKHA 4V1Ap 2C0EA 5KN0A 1RQMA 4XRDA 5AIVA 3M8NA 1K3LA 4ECCA 4HOJA 1F37A 1ABAA 3PPUA 4KH7A 3VPTA 1SVLA 2L6CA 3QOUA 3TJGA 1TP9A 4PI0C 4WKWA 3Q19A 5JCWA 4NAXA 3VWUA 2A4VA 1J9BA 5A34A 3PINA 2LQOA 4K0NA 3GX8A 1OAZA 1U3IA 3QPMA 3CSJA 5A5HA 1N2AA 5ECIB 4GQFA 3A2XA 4HU7A 2WB9A 5D8IA 2IFQA 3F6DA 1WJKA 5ECOB 3FMWA 1EGRA 4I2TA 4MZBA 1TK8B 1M2AA 1FAAA 4IP6A 3EINA 1BAYA 4HQSA 3TKRA 3PGTA 5B6NA 2VCWA 2YWNA 2OE3A 2OADA 1F3BA 4QMKA 5IO0A 5D93A 3FEUA 1XCCA 2V1MA 3HZ4A 5EY6A 1FVKA 2V6KA 1W4VA 1YF0A 3KP8A 2E0QA 4TXOB 1U88A 5G2ZA 2K18A 3ZMLA 4RI6A 1XWGA 6GSTA 1S3DA 3L9UA 2ON5A 4DSRA 4ZBBA 1SKRB 5ECLB 3HJOA 1T7PB 1TXUA 2XHFA 3D4TA 2CAIA 4OFMA 1M9AA 1GRXA 2IN3A 4FIWA 1PSQA 2K8VA 3KEBA 5GAND 1SK1A 4ECJA 2FWHA 4ZL7A 3M0FA 4EE0A 3G9BA 1ACVA 5A4UA 5IMVA 1AUCA 2H30A 4GRFA 2L4CA 3FZ5A 2OACA 4I97A 3A5WA 3RDWA 2R0PA 4MPFA 3WT1A 3A3TA 3F6FA 2GZYA 2WZ9A 1TKDB 4MK3A 3DVWA 2JSZA 2F9SA 3L9VA 6GSWA 2QSIA 3UVHA 3GTUB 1T8EB 2H76A 1XG8A 4GSSA 4NXIA 3C8EA 2BMXA 4KW6A 1M3IA 4TXOA 5IIZA 4WBRD 1VF2A 3D0ZA 4FYCA 2DKIA 4GTUA 1FOHA 3UL3A 2REMA 4TR1B 3VWWA 2HZEB 2WZSA 1V9WA 1WPIA 1PL1A 2ZCTA 1GP1A 5IPHA 4LMVA 2AAWA 2C0DA 2JL4A 1GWCA 4YAPA 5ECPB 3QFAC 1FVJA 4I6XA 2M80A 2H1AA 2MMZA 5F06A 5J40A 3TGZA 2B5EA 3BJ5A 3CYNA 1LU4A 2PBJA 9GSSA 5HR2A 2C1YA 3APQA 1I5GA 4WR4A 1AQWA 4G0KA 5IPGA 3BOAA 1MTCA 4JE1A 4K7IA 4K2DA 1YEXA 5H5RA 5KN1A 4DSQA 2DJ1A 4IP1A 4WF4A 2LV3A 3GSTA 4BL7B 5IMFA 4IVFA 3GTUA 2H0GA 1YKCA 2YV9A 2H0HA 3WYWA 1ZCPA 1AXDA 1G7EA 1BJXA 4TR1A 2HZEA 3J7Yk 4KDYA 5HFKA 5ID2B 1NW2A 3KMNA 2OA7A 2HSMB 4ZBAA 4KNDA 4Q5QA 1WOUA 4QL7A 3GNJA 2E7PA 3EVIA 2H1DA 4BVYA 2A2PA 5IMZA 1TRWA 1PL2A 1H4OA 2LRCA 3GUSA 1THXA 4J56E 2LUSA 2TIRA 2F51A 2AB6A 4MP4A 4ID0A 1F2EA 2UV8G 4XS1A 2EFCA 4JZQA 2X64A 2L57A 5KOWA 1SD8A 1U6TA 3RPPA 3CHXC 2X8CA 4FYUA 1MDJA 1LBKA 4KAEA 5C04A 3H79A 2ZNMA 3KH7A 1ZYNA 3IHQA 2HRFA 4BL7A 3MIXA 1BQ7A 3DWVA 4PQ1A 4TOPA 4I2UA 1XVQA 6GSSA 2VM2A 1PKZA 2LSTA 3WT2A 5KN3A 4CY8A 2IJYA 4ZB6A 1YF1A 1GUKA 3EU3A 1OE8A 3FR3A 5ECRB 1GSEA 2F8FA 1Q98A 11GSA 3F8UA 4F0CA 1EEMA 2VL2A 2HSMA 3ZFBA 4V2LA 4AJ6A 4FYBA 4POLA 4LMWA 3F4TA 19GSA 4IBPA 2VIMA 2JACA 3ZIJA 5IMAA 2MBTA 1F9MA 4G2EA 4Q5RA 3VURA 1A2MA 2WW1A 5AGYA 4EKZA 1DBYA 1BG5A 4YH2A 2HSNB 1ML6A 2LEGA 2OJLA 4POBA 1A2LA 1EV9A 1B9XC 3H93A 2L4QA 3IAS2 1USBA 5JWQB 1BG1A 2YJHA 2WFCA 4DVCA 1YY7A 2RM5A 1WIKA 5ENUA 1K0AA 2X4AA 5KN2A 1ERUA 3LGCA 1FO5A 2EFHA 3QD9A 1OKTA 2ALBA 3ZFLA 2J9HA 2OBIA 1ZYEA 5A5KA 2H1GA 1ZYQB 5A4VA 4N3ZA 2IWTA 5LNKe 2GS3A 2MMOA 2OE1A 2I1UA 2LJRA 3QFBC 1O73A 2TRXA 5KEJA 4POKA 2FD3A 2WW3A 3GA4A 4FXYP 4NV5A 2XPDA 3KGKA 2R6KA 3GFKA 3EPTA 2GGTA 3E0UA 3IC4A 3A2VA 2HSYA 3ISOA 3FRCA 2HSNA 1XVWA 2H8LA 3BD2A 2LQQA 1SVMA 4RQRA 2VO4A 3WGEA 1A24A 1R7HA 4QL9A 1R5AA 2Z9SA 2GSRA 3MSZA 4G10A 3KXOA 4XRAA 1OE7A 2VCVA 3ERGA 2F3MA 1X5DA 2JZSA 1K0DA 2N5AA 5J4YA 3IV4A 5HFIA 1DE1A 3DIEA 3KP9A 1ZYPA 4HJ2A 3W6GA 4KB3A 2KHPA 4BWQA 5E59A 3QAWA 2PVQA 3VWVA 3KTBA 1M99A 2VD0A 3FR6A 3P7XA 2QC7A 3GH6A 4KSMA 4MJEA 4XS4B 12GSA 4GCIA 2DJJA 3FW2A 2M46A 4ZBDA 2YPMA 3DVXA 3GSSA 2GDRA 3D21A 3CTFA 2P0GA 5IMCA 5L71A 2HRKB 1M7TA 4AJ8A 4P3YB 4MCUA 2FGXA 3UJ1A 4MLYA 4NHWA 2C0GA 2CZ2A 1TRUA 4KGIA 3TKPA 1OVNA 2O7KA 4I5QA 4MJBA 1J0FA 3R3EA 2EC4A 1MEKA 3A2WA 1BF5A 2WDUA 4LL4B 3GURA 4ZXGA 4PHZC 1NHYA 5JCUA 2LTKA 1GTBA 2PUKC 3GMFA 1ZGNA 3IK7A 2M72A 4AKHA 4Z2TA 1OC3A 4L5LA 1SYRA 5ECSA 3TKSC 4F03A 1A2JA 1JFUA 4CW9A 2LKUA 1B48A 4N10A 5G1KA 2PPTA 2H19A 3ZLPA 2IMDA 3Q18A 2GT5A 3I6AA 4PX1A 3H4KA 4POMA 1S3CA 4XS4A 3NOFA 2ON7A 3ZTLA 2VOCA 5DAKB 1V57A 1KEBA 1DUGA 1QMVA 1K0BA 3UARA 1ERVA 1V40A 2HRKA 3IBHA 2HI7A 2YANA 2L59A 2WS2A 4WF5A 2YP6A 2L5LA 1O8XA 2OBKA 2R0GA 4V1Ag 4GF0A 2R5GA 4MMMA 4ILFA 5KOXA 5G1LA 1U3AA 2H72A 1K0OA 2YWIA 3FZ9A 2DMMA 3BBYA 1YEWC 4CHSA 3QDNA 2PN8A 4USSA 2DMLA 2LNTA 1UA5A 2WVYA 1E6BA 3RHCA 1QUWA 3SWLA 2GLRA 3LSZA 4GLTA 1T4ZA 2XBIA 5G30A 2H66A 1GLPA 5FWGA 4F82A 2RUFA 3DEXA 1GNEA 1GNWA 2HXKA 3GHAA 4YAVA 1A8YA 2P5RA 5DAKA 4PQHA 1EP8A 2PVOC 4ECIA 1TOFA 2PERA 3F3RA 2C3NA 1IYIA 2CT6A 5B7CA 1X5EA 4QQ7A 5ECHB 3G7IA 2FLSA 3ZMKA 2O89A 1Y25A 4HQZA 3KIJA 4EC0A 1URMA 4F9ZA 3Q6OA 3QAVA 3EMXA 2NPBA 2X49A 4MJAA 2KP2A 2H01A 3IXRA 4AKGA 3N9JA 4ML1A 5BRTA 1UC7A 1N25A 2DC5A 5JWRB 3L0HA 3M3MA 1T3BA 4PI2C 1O7UA 1Y1UA 4TR0A 1YZXA 5AIXA 1ILOA 2V32A 2NTOA 13GSA 1YKAA 2H6YA 3ME8A 1MDIA 3ZVJD 3PH9A 1XBSA 3EWLA 2QA2A 6GSXA 5EL8A 2KUCA 2VCZA 2QKEA 1AQVA 4OFTA 2HZFA 4HU9A 8GSSA 3KD0A 4GQCA 3UMAA 3GKNA 3MDKA 1VF1A 4L5OA 3LJRA 4PNFA 5DJLA 3GL3A 4IS0A
chains in the Genus database with same CATH topology
2HE3A 3TKSE 1X0RA 3LYPA 4X1UA 1DSBA 3HXSA 5AN1A 2C8UA 3HY2A 2CX4A 2GQLA 3FK8A 2B5YA 4V2MA 3IC8A 2EFDA 4MF6A 2ZUPA 3KZQA 1GL8A 4LA1A 4BVYB 1TU8A 4GDFA 2WJUA 1XFLA 3IK9A 5D9TA 4OFNA 2HFDA 2H6ZA 5COHA 2B6MA 4L8EA 3LW9A 2HRAA 1XZOA 3CXGA 5IM9A 1KBNA 4HEA2 4K9ZA 1AAZA 5DVBA 1SL1B 3L78A 1K0NA 1ZL9A 1VRSD 1GSYA 1X9WB 1TU7A 3O6TA 4Q5FA 1KNGA 2F8AA 1LJRA 3ZYWA 3TUEA 2P31A 5AISA 1ZZYA 6GSYA 2K8SA 3TRPA 4RI7A 1NSWA 2H1BA 1A8LA 4MA9A 1Z3EA 2I9HA 5J9BA 5CRDA 5HQPA 1KTEA 4ACSA 3APSA 1SK2A 5IQYA 3UBLA 22GSA 2YWOA 4O92A 4WEYA 4PURA 1XWAA 1XOBA 4TKYA 3IPZA 1XPVA 4TN8A 3GX0A 4AKXB 4X0XA 3TJJA 2XPEA 3DMLA 2H71A 1G6WA 4JR4A 5CP1A 4G01A 2VL9A 1M2BA 3EYTA 3UOMA 2JADA 3CBUA 3E3EA 14GSA 2FWFA 2YV7A 3KM6A 3BCKA 2YN1A 4YQUA 1ST9A 5D9WA 4N11A 1HQOA 5D73A 3D22A 4MH2A 4OMVA 4HI7A 2IPAA 1EV4A 4JU5A 3GYKA 1SVOA 2YOIA 3DGQA 2YJ7A 3BCIA 3EURA 2VCTA 5BMUB 5H5SA 2IMKA 2VCXA 2TRCP 4TRXA 3WGXA 3EU4A 4EF0A 2XC2A 2KLXA 4GWRA 3GRXA 1Z7RA 1FB6A 5GSSA 5D9VA 3F63A 1XW6A 4BVXB 1QXHA 3VI5A 4Z2UA 1R26A 2CV4A 5HR0A 4PUFC 2YWMA 3F9UA 1RW1A 1TTZA 5G5EA 3P2AA 3D6IA 3VI7A 16GSA 1GSFA 4X43A 4YQMA 4MJCA 4LL1B 2FWEA 4KX4A 2NVLA 4WBJA 2DSAA 5DQYA 1GSSA 4EDZA 3MAKA 1R5PA 5B8BA 2CQ9A 3UEMA 2GZZA 3OR5A 1EEJA 1O8WA 3TKSA 2WULA 2FY6A 1X9MB 1JZDA 4N30A 4DSSB 2H70A 5BMUA 1GSQA 2N5FA 2JSYA 2VKZG 4J2FA 1ERWA 3DD3A 2EFEA 4IQ1A 2HQTA 2FWGA 1CQGA 4EUYA 4K8MA 3CTGA 4ULXA 2MYGA 4BVXA 5F0GA 1EWXA 1SK0A 1SJ6A 2H74A 2VCQA 1JZOA 4KE3A 4TW5A 4Q5NA 2CVBA 3A5IA 1Z6MA 1GSUA 2V2GA 2EIRA 3WD6A 4IW9A 3QCPA 4ZILA 2KOKA 2PU9C 2FHEA 3GL5A 3SBCA 4E8HA 5ECMB 4WETA 2HT9A 5FT3A 5B8AA 3HJPA 1A0RP 3HA9A 4PQIA 5F8BA 1K0MA 4OCEA 2GVPA 2H1LA 2GQKA 1Z6NA 4DSSA 2HRNA 4TR3A 4KDXA 2JZTA 1MD4A 3R2QA 3HHVA 2JU5A 2HNLA 3HYPA 5ECNB 2HSHA 1AC1A 1BEDA 1PA3A 6GSVA 2G0FA 1PN9A 1F6MC 4K5SA 3I9V2 2H73A 4KDUA 2K6VA 1JHBA 1VGLA 3P8WA 4JBBA 3TOTA 3PR8A 5JCGA 1OC8A 1N8JA 2EIQA 2CVKA 5HR3A 2B1LA 3GKXA 2KP1A 2V41A 4EL1A 5B6MA 1GSDA 2CVDA 1SJZA 3QMXA 2IMFA 3VLNA 1SJIA 1Q4JA 2D2ZA 4IHUA 3GN3A 2CAQA 2HLSA 1TK0B 4XS6A 1B4QA 3LORA 4NV2A 2G2QA 1G0TA 2AV4A 3KCMA 3LQ7A 10GSA 2L6DA 4KSOA 1F3AA 1B9YC 2VL2C 1SKWB 3S9FA 1W89A 4ZL8A 2VLVA 5ELGA 1EOHA 2FNOA 5CREA 2HYXA 3UBKA 3UIWA 4GXZA 4JR6A 1NM3A 3TRXA 4IKHA 4K6XA 1SENA 4AKIA 1T00A 3IRAA 3WGDA 1B8XA 2AJQB 1OKDA 5DBQA 2DLXA 2X99A 1C72A 5GSTA 1AQXA 3GKMA 1PGTA 3C1SA 1Z9HA 4K0GA 5D9XA 5D96A 18GSA 2VL3A 1JLWA 4V2NA 3RHBA 1I9DA 4BWSA 2DIZA 3D5JA 1XWCA 1ZOFA 2AYTA 5IOXA 1MD3A 3QR6A 5J4VA 4ML6A 3V1WA 4AF2A 3M9JA 5ABRA 1YDKA 1XIYA 3TJFA 3LFLA 3HKRA 1R4WA 1YQ1A 3US3A 1YJ6A 1V58A 5G31A 1PX6A 4PTSA 2VLTA 2V6OA 1O6JA 4EIPA 3UAPA 1XW5A 3FR9A 2CX3A 2O5VA 4ZB9A 2IMIA 1VF3A 2QGVA 1GUHA 2WGRA 4D73B 2O8VB 1PQNA 3HDCA 4N0ZA 3FYGA 2PWJA 2O87A 2PMTA 4MDCA 5H5QA 2I4AA 1SYXA 2AHEA 5CO3A 2VLUA 4ZIJA 1G6YA 1X9SB 1T1VA 3RBTA 4IQAA 2DJKA 1TDIA 1HNBA 4MF5A 4JRRA 1SL0B 3CRTA 4NPBA 4O5RA 1FB0A 2EIOA 4F2IA 4G0IA 4MZWA 3C7MA 1PX7A 2YZUA 2B3SA 3DXBA 2C4JA 2DJ0A 3TRQA 1TJDA 4XTSA 4EDYA 4BPYA 4G9HA 5J3RA 1SD9A 1TK5B 4IELA 1PRXA 4ISDA 1SU9A 3F4SA 1CQHA 1JZRA 3TKQA 5CAXA 2FUG2 2GQMA 7GSSA 4K5RA 4K2XA 1TW9A 1SL2B 5JWOB 4D73A 3D4MA 4PUAA 5CNWA 3CSIA 4KF9A 1OYJA 3L9SA 3GKKA 1A0FA 4FO5A 1E2YA 3G7YA 4WXTA 5CRWA 1BYEA 4DEJA 1EP7A 1ERTA 2RUEA 4L0WA 5HFGA 1H75A 3LYKA 1UVZA 3VFIA 3KTLA 4YKGA 2C80A 4HZ4A 5F05A 3FZAA 3TOUA 1B4PA 5DDLA 3AY8A 3F3QA 4IJ3A 5ECQB 4OD7A 4KCAA 3N5OA 1U87A 2B1KA 1M9BA 1VF4A 3EC3A 1XW9A 3ZIVA 2H6XA 1M0UA 3NIVA 1QK8A 1JLVA 1DE2A 1Z5YE 4MZCA 3CRUA 3ERWA 2A2SA 1TI1A 4TXVA 2IL3A 4HUAA 1K3OA 2VUPA 1TRSA 5FHIA 1ON4A 3ZRDA 5INYA 2LNSA 4N0VA 4JEDA 4L0UA 2RLIA 3DRNA 3G7JA 3IR4A 4G0LA 1EZKA 2I3YA 2NBSA 2LJKA 5J5NA 4MF7A 2X8GA 2R3XA 1UN2A 1GLQA 2R2JA 1WE0A 4K7NA 1M2DA 4PNGA 2GZPA 2K9FA 2RM6A 4MABA 4IN0A 3CWGA 4CDOA 4X4JA 3LG6A 4HZ2A 2C3QA 1Y6EA 5J47A 2VM1A 4HJMA 1WMJA 1QFNA 3C71A 3GH9A 1Z7PA 2C3TA 5IOWA 3W8JA 3O3TA 5CYYA 3LXZA 2B7JA 3LWAA 3EMPA 4CY6A 3TB2A 5A4WA 3MNGA 2BTOT 2RIIA 4MH3A 4KA0A 3U5RE 3I69A 3IE3A 2VD1A 2UZ8A 1TI3A 4WR5A 1V2AA 3F4RA 3Q74A 3LEFA 5J9CA 4HS1A 4PXOA 4J57E 1HNAA 3C1RA 3FZ4A 5C00A 4K1FA 3FHKA 2JZRA 4O32A 4EXJA 4RUVA 4TVEA 5ELAA 5J41A 2YNXA 2MZCA 5G5FA 3IOSA 2MMAA 2I81A 3VPQA 2GSTA 3O76A 3JCML 3M1GA 5GZZB 4O5QA 3GIXA 3TCOA 2WRTA 1G7OA 1RK4A 5DCGA 4G19A 4MNNA 2FCHA 5A1NB 1ZMAA 3IDVA 4OWYA 4AJ7A 2E2GA 3HMJG 5GAPD 1XWKA 4OO5A 3J7Yb 4EO3A 1TRVA 3ZITA 3TJBA 2WCIA 2N5BA 1XXUA 2A2RA 1WRYA 1PN0A 1WWJA 4AGSA 1AIUA 1AW9A 1GTAA 4ZB7A 3NZNA 4ZB8A 5ID2A 3ERFA 3TJKA 3L4NA 4ICYA 3ME7A 4A5PA 1FW1A 1PKWA 1J08A 3FY7A 3F0IA 5DQSA 4LLRA 1O85A 4EVMA 4XHMA 2YZHA 6GSUA 2DJ3A 4XCSA 5IMDA 4FH8A 4IJIA 4E8EA 1THOA 2MMNA 5CRGA 4O7HA 5EVOA 2CZ3A 3HZ8A 2X8HA 3EE2A 3CMIA 2R4VA 2GSQA 4OCFA 5A1NA 2FA8A 2OKAA 5EPFA 1JZWA 2B7KA 3H8QA 1OC9B 4GSTA 4OO4A 2LJAA 4NWYA 3C73A 5ECKB 4TR4A 5J4UA 5CRHA 5DCHA 1MDKA 2PGTA 2GTUA 1QQ2A 1QGVA 4F0BA 1T4YA 3H1NA 2GT6A 2LRTA 1GULA 2OE0A 3HCZA 3DKSA 1K3YA 2AUVA 2OT3A 3MWHA 5DALB 2A4HA 2DJ2A 2DBCA 1EOGA 2MBSA 2L5OA 2DIYA 4BA7A 2P5QA 4YQVA 1O81A 3ZREA 1K0CA 1GTUA 17GSA 1XOAA 2GSSA 1WP0A 2VAFA 3HJMA 4NMUA 3RPNA 5IO2A 3M9KA 4RQXA 2YCDA 1HYUA 4W66A 5E4WA 4I8BA 4XIHA 3I43A 4Z7XA 4FQUA 4GSNA 3P90A 3RAZA 2R0CA 3ED3A 1OC9A 2H0IA 3ZL5A 4Z2RA 3GV1A 2LRNA 3IAM2 1IYHA 4IGJA 4H86A 5LCZA 3KH9A 3KJYA 4KCEA 4O5UA 4E68A 4KUNA 2ES7A 1GH2A 4HDEA 2IMEA 3CSHA 2C0FA 1S3AA 2LS5A 1FOVA 1YVLA 3K8NA 3VWXA 5F07A 4EIQA 3W8SA 3TDGA 5DALA 5LD0A 1FHEA 3MYDA 1EGOA 3ZVJA 1YEPA 1HD2A 3TU3B 3IHGA 1SKSB 1FG4A 2E2MA 1GTIA 1A23A 1PD21 1NHOA 2O85A 5HR1A 4PGTA 2R37A 2H75A 3UVTA 5DJMA 3E9JB 3QAGA 1BX9A 2J23A 1PMTA 3KMOA 3VK9A 1TXXA 3U6VA 2NDOA 4ZL9A 4K7OA 2B5XA 3APOA 3IA1A 3ZZXA 3DYRA 1V98A 3HVXA 3HVSA 3HD5A 3FKFA 2IIYA 4NHZA 4MPGA 1HNCA 3LXTA 3HVVA 5A34B 1X5CA 2BJXA 2FA4A 20GSA 4AI6A 2QA1A 4YKFA 5A5HB 1GUMA 2XBQA 2IFQB 4ECBA 1XWBA 2CA8A 2DKHA 4V1Ap 2C0EA 5KN0A 1RQMA 4XRDA 5AIVA 3M8NA 1K3LA 4ECCA 4HOJA 1F37A 1ABAA 3PPUA 4KH7A 3VPTA 1SVLA 2L6CA 3QOUA 3TJGA 1TP9A 4WKWA 3Q19A 5JCWA 4NAXA 3VWUA 2A4VA 1J9BA 5A34A 3PINA 2LQOA 4K0NA 3GX8A 1OAZA 1U3IA 3QPMA 3CSJA 5A5HA 1N2AA 5ECIB 4GQFA 3A2XA 4HU7A 2WB9A 5D8IA 2IFQA 3F6DA 1WJKA 5ECOB 3FMWA 1EGRA 4I2TA 4MZBA 1TK8B 1M2AA 1FAAA 4IP6A 3EINA 1BAYA 4HQSA 3TKRA 3PGTA 5B6NA 2VCWA 2YWNA 2OE3A 2OADA 1F3BA 4QMKA 5IO0A 5D93A 3FEUA 1XCCA 2V1MA 3HZ4A 5EY6A 1FVKA 2V6KA 1W4VA 1YF0A 3KP8A 2E0QA 4TXOB 1U88A 5G2ZA 2K18A 3ZMLA 4RI6A 1XWGA 6GSTA 1S3DA 3L9UA 2ON5A 4DSRA 4ZBBA 1SKRB 5ECLB 3HJOA 1T7PB 1TXUA 2XHFA 3D4TA 2CAIA 4OFMA 1M9AA 1GRXA 2IN3A 4FIWA 1PSQA 2K8VA 3KEBA 5GAND 1SK1A 4ECJA 2FWHA 4ZL7A 3M0FA 4EE0A 3G9BA 1ACVA 5A4UA 5IMVA 1AUCA 2H30A 4GRFA 2L4CA 3FZ5A 2OACA 4I97A 3A5WA 3RDWA 2R0PA 4MPFA 3WT1A 3A3TA 3F6FA 2GZYA 2WZ9A 1TKDB 4MK3A 3DVWA 2JSZA 2F9SA 3L9VA 6GSWA 2QSIA 3UVHA 3GTUB 1T8EB 2H76A 4GSSA 4NXIA 3C8EA 2BMXA 4KW6A 4TXOA 5IIZA 4WBRD 1VF2A 3D0ZA 4FYCA 2DKIA 4GTUA 1FOHA 3UL3A 2REMA 4TR1B 3VWWA 2HZEB 1V9WA 1WPIA 1PL1A 2ZCTA 1GP1A 5IPHA 4LMVA 2AAWA 2C0DA 2JL4A 1GWCA 4YAPA 5ECPB 3QFAC 1FVJA 4I6XA 2M80A 2H1AA 2MMZA 5F06A 5J40A 3TGZA 2B5EA 3BJ5A 3CYNA 1LU4A 2PBJA 9GSSA 5HR2A 2C1YA 3APQA 1I5GA 4WR4A 1AQWA 4G0KA 5IPGA 3BOAA 1MTCA 4JE1A 4K7IA 4K2DA 1YEXA 5H5RA 5KN1A 4DSQA 2DJ1A 4IP1A 4WF4A 2LV3A 3GSTA 4BL7B 5IMFA 4IVFA 3GTUA 2H0GA 1YKCA 2YV9A 2H0HA 3WYWA 1ZCPA 1AXDA 1G7EA 1BJXA 4TR1A 2HZEA 3J7Yk 4KDYA 5HFKA 5ID2B 1NW2A 3KMNA 2OA7A 2HSMB 4ZBAA 4KNDA 4Q5QA 1WOUA 4QL7A 3GNJA 2E7PA 3EVIA 2H1DA 4BVYA 2A2PA 5IMZA 1TRWA 1PL2A 1H4OA 2LRCA 3GUSA 1THXA 4J56E 2LUSA 2TIRA 2F51A 2AB6A 4MP4A 4ID0A 1F2EA 2UV8G 4XS1A 2EFCA 4JZQA 2X64A 2L57A 5KOWA 1SD8A 1U6TA 3RPPA 2X8CA 4FYUA 1MDJA 1LBKA 4KAEA 5C04A 3H79A 2ZNMA 3KH7A 1ZYNA 3IHQA 2HRFA 4BL7A 3MIXA 1BQ7A 3DWVA 4PQ1A 4TOPA 4I2UA 1XVQA 6GSSA 2VM2A 1PKZA 2LSTA 3WT2A 5KN3A 4CY8A 2IJYA 4ZB6A 1YF1A 1GUKA 3EU3A 1OE8A 3FR3A 5ECRB 1GSEA 2F8FA 1Q98A 11GSA 3F8UA 4F0CA 1EEMA 2VL2A 2HSMA 3ZFBA 4V2LA 4AJ6A 4FYBA 4POLA 4LMWA 3F4TA 19GSA 4IBPA 2VIMA 2JACA 3ZIJA 5IMAA 2MBTA 1F9MA 4G2EA 4Q5RA 3VURA 1A2MA 5AGYA 4EKZA 1DBYA 1BG5A 4YH2A 2HSNB 1ML6A 2LEGA 2OJLA 4POBA 1A2LA 1EV9A 1B9XC 3H93A 2L4QA 3IAS2 1USBA 5JWQB 1BG1A 2YJHA 2WFCA 4DVCA 1YY7A 2RM5A 1WIKA 5ENUA 1K0AA 2X4AA 5KN2A 1ERUA 3LGCA 1FO5A 2EFHA 3QD9A 1OKTA 2ALBA 3ZFLA 2J9HA 2OBIA 1ZYEA 5A5KA 2H1GA 1ZYQB 5A4VA 4N3ZA 2IWTA 5LNKe 2GS3A 2MMOA 2OE1A 2I1UA 2LJRA 3QFBC 1O73A 2TRXA 5KEJA 4POKA 2FD3A 3GA4A 4NV5A 2XPDA 3KGKA 2R6KA 3GFKA 3EPTA 2GGTA 3E0UA 3IC4A 3A2VA 2HSYA 3ISOA 3FRCA 2HSNA 1XVWA 2H8LA 3BD2A 2LQQA 1SVMA 4RQRA 2VO4A 3WGEA 1A24A 1R7HA 4QL9A 1R5AA 2Z9SA 2GSRA 3MSZA 4G10A 3KXOA 4XRAA 1OE7A 2VCVA 3ERGA 2F3MA 1X5DA 2JZSA 1K0DA 2N5AA 5J4YA 3IV4A 5HFIA 1DE1A 3DIEA 3KP9A 1ZYPA 4HJ2A 3W6GA 4KB3A 2KHPA 4BWQA 5E59A 3QAWA 2PVQA 3VWVA 3KTBA 1M99A 2VD0A 3FR6A 3P7XA 2QC7A 3GH6A 4KSMA 4MJEA 4XS4B 12GSA 4GCIA 2DJJA 3FW2A 2M46A 4ZBDA 2YPMA 3DVXA 3GSSA 2GDRA 3D21A 3CTFA 2P0GA 5IMCA 5L71A 2HRKB 1M7TA 4AJ8A 4P3YB 4MCUA 2FGXA 3UJ1A 4MLYA 4NHWA 2C0GA 2CZ2A 1TRUA 4KGIA 3TKPA 1OVNA 2O7KA 4I5QA 4MJBA 1J0FA 3R3EA 2EC4A 1MEKA 3A2WA 1BF5A 2WDUA 4LL4B 3GURA 4ZXGA 1NHYA 5JCUA 2LTKA 1GTBA 2PUKC 3GMFA 1ZGNA 3IK7A 2M72A 4AKHA 4Z2TA 1OC3A 4L5LA 1SYRA 5ECSA 3TKSC 4F03A 1A2JA 1JFUA 4CW9A 2LKUA 1B48A 4N10A 5G1KA 2PPTA 2H19A 3ZLPA 2IMDA 3Q18A 2GT5A 3I6AA 4PX1A 3H4KA 4POMA 1S3CA 4XS4A 3NOFA 2ON7A 3ZTLA 2VOCA 5DAKB 1V57A 1KEBA 1DUGA 1QMVA 1K0BA 3UARA 1ERVA 1V40A 2HRKA 3IBHA 2HI7A 2YANA 2L59A 2WS2A 4WF5A 2YP6A 2L5LA 1O8XA 2OBKA 2R0GA 4V1Ag 4GF0A 2R5GA 4MMMA 4ILFA 5KOXA 5G1LA 1U3AA 2H72A 1K0OA 2YWIA 3FZ9A 2DMMA 3BBYA 4CHSA 3QDNA 2PN8A 4USSA 2DMLA 2LNTA 1UA5A 1E6BA 3RHCA 1QUWA 3SWLA 2GLRA 3LSZA 4GLTA 1T4ZA 2XBIA 5G30A 2H66A 1GLPA 5FWGA 4F82A 2RUFA 3DEXA 1GNEA 1GNWA 2HXKA 3GHAA 4YAVA 1A8YA 2P5RA 5DAKA 4PQHA 1EP8A 2PVOC 4ECIA 1TOFA 2PERA 3F3RA 2C3NA 1IYIA 2CT6A 5B7CA 1X5EA 4QQ7A 5ECHB 3G7IA 2FLSA 3ZMKA 2O89A 1Y25A 4HQZA 3KIJA 4EC0A 1URMA 4F9ZA 3Q6OA 3QAVA 3EMXA 2NPBA 2X49A 4MJAA 2KP2A 2H01A 3IXRA 4AKGA 3N9JA 4ML1A 5BRTA 1UC7A 1N25A 2DC5A 5JWRB 3L0HA 3M3MA 1T3BA 1O7UA 1Y1UA 4TR0A 1YZXA 5AIXA 1ILOA 2V32A 2NTOA 13GSA 1YKAA 2H6YA 3ME8A 1MDIA 3ZVJD 3PH9A 1XBSA 3EWLA 2QA2A 6GSXA 5EL8A 2KUCA 2VCZA 2QKEA 1AQVA 4OFTA 2HZFA 4HU9A 8GSSA 3KD0A 4GQCA 3UMAA 3GKNA 3MDKA 1VF1A 4L5OA 3LJRA 4PNFA 5DJLA 3GL3A 4IS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HE3 A;  3TKS E;  1X0R A;  3LYP A;  4X1U A;  1DSB A;  3HXS A;  5AN1 A;  2C8U A;  3HY2 A;  2CX4 A;  2GQL A;  3FK8 A;  2B5Y A;  4V2M A;  3IC8 A;  4MF6 A;  2ZUP A;  3KZQ A;  1GL8 A;  4LA1 A;  4BVY B;  1TU8 A;  2WJU A;  1XFL A;  3IK9 A;  5D9T A;  4OFN A;  2HFD A;  2H6Z A;  5COH A;  2B6M A;  4L8E A;  3CXG A;  2HRA A;  1XZO A;  5IM9 A;  1KBN A;  4HEA 2;  4K9Z A;  1AAZ A;  5DVB A;  1SL1 B;  3L78 A;  1K0N A;  1ZL9 A;  1VRS D;  1GSY A;  1X9W B;  1TU7 A;  3O6T A;  4Q5F A;  1KNG A;  2F8A A;  1LJR A;  3ZYW A;  3TUE A;  2P31 A;  5AIS A;  1ZZY A;  6GSY A;  2K8S A;  3TRP A;  4RI7 A;  1NSW A;  2H1B A;  1A8L A;  4MA9 A;  1Z3E A;  2I9H A;  5J9B A;  5CRD A;  5HQP A;  1KTE A;  4ACS A;  3APS A;  1SK2 A;  5IQY A;  3UBL A;  22GS A;  2YWO A;  4O92 A;  4WEY A;  4PUR A;  1XWA A;  1XOB A;  4TKY A;  3IPZ A;  1XPV A;  4TN8 A;  3GX0 A;  4X0X A;  3TJJ A;  2XPE A;  3DML A;  2H71 A;  1G6W A;  4JR4 A;  5CP1 A;  2VL9 A;  1M2B A;  3EYT A;  3UOM A;  2JAD A;  3CBU A;  3E3E A;  14GS A;  2FWF A;  2YV7 A;  3KM6 A;  3BCK A;  2YN1 A;  4YQU A;  1ST9 A;  5D9W A;  4N11 A;  1HQO A;  5D73 A;  3D22 A;  4MH2 A;  4OMV A;  4HI7 A;  2IPA A;  1EV4 A;  4JU5 A;  3GYK A;  2YOI A;  3DGQ A;  2YJ7 A;  3BCI A;  3EUR A;  2VCT A;  5H5S A;  2IMK A;  2VCX A;  2TRC P;  4TRX A;  3WGX A;  3EU4 A;  4EF0 A;  2XC2 A;  2KLX A;  4GWR A;  3GRX A;  1Z7R A;  1FB6 A;  5GSS A;  5D9V A;  3F63 A;  1XW6 A;  4BVX B;  1QXH A;  3VI5 A;  5HR0 A;  1R26 A;  2CV4 A;  4PUF C;  2YWM A;  3F9U A;  1RW1 A;  1TTZ A;  5G5E A;  3P2A A;  3D6I A;  3VI7 A;  16GS A;  1GSF A;  4X43 A;  4YQM A;  4MJC A;  4LL1 B;  2FWE A;  4KX4 A;  2NVL A;  4WBJ A;  2DSA A;  5DQY A;  1GSS A;  4EDZ A;  3MAK A;  1R5P A;  5B8B A;  2CQ9 A;  3UEM A;  2GZZ A;  3OR5 A;  1EEJ A;  1O8W A;  3TKS A;  2WUL A;  2FY6 A;  1X9M B;  1JZD A;  4N30 A;  4DSS B;  2H70 A;  5BMU A;  1GSQ A;  2N5F A;  2JSY A;  4J2F A;  1ERW A;  3DD3 A;  4IQ1 A;  2HQT A;  2FWG A;  1CQG A;  4EUY A;  4K8M A;  3CTG A;  4ULX A;  2MYG A;  4BVX A;  5F0G A;  1EWX A;  1SK0 A;  1SJ6 A;  2H74 A;  2VCQ A;  1JZO A;  4KE3 A;  4TW5 A;  4Q5N A;  2CVB A;  1Z6M A;  1GSU A;  2V2G A;  2EIR A;  3WD6 A;  4IW9 A;  3QCP A;  4ZIL A;  2KOK A;  2PU9 C;  2FHE A;  3GL5 A;  3SBC A;  4E8H A;  5ECM B;  4WET A;  2HT9 A;  5FT3 A;  5B8A A;  3HJP A;  1A0R P;  3HA9 A;  4PQI A;  5F8B A;  1K0M A;  4OCE A;  2GVP A;  2GQK A;  1Z6N A;  4DSS A;  2HRN A;  4TR3 A;  4KDX A;  2JZT A;  1MD4 A;  3R2Q A;  3HHV A;  2JU5 A;  2HNL A;  3HYP A;  5ECN B;  2HSH A;  1AC1 A;  1BED A;  1PA3 A;  6GSV A;  2G0F A;  1PN9 A;  1F6M C;  3I9V 2;  2H73 A;  4KDU A;  2K6V A;  1JHB A;  1VGL A;  3P8W A;  4JBB A;  3TOT A;  3PR8 A;  5JCG A;  1OC8 A;  1N8J A;  2EIQ A;  2CVK A;  5HR3 A;  2B1L A;  3GKX A;  2KP1 A;  2V41 A;  4EL1 A;  5B6M A;  1GSD A;  2CVD A;  1SJZ A;  3QMX A;  2IMF A;  3VLN A;  1SJI A;  1Q4J A;  2D2Z A;  4IHU A;  3GN3 A;  2CAQ A;  2HLS A;  1TK0 B;  4XS6 A;  1B4Q A;  3LOR A;  4NV2 A;  2G2Q A;  1G0T A;  2AV4 A;  3KCM A;  3LQ7 A;  10GS A;  2L6D A;  4KSO A;  1F3A A;  1B9Y C;  2VL2 C;  1SKW B;  3S9F A;  1W89 A;  4ZL8 A;  2VLV A;  5ELG A;  1EOH A;  2FNO A;  5CRE A;  2HYX A;  3UBK A;  3UIW A;  4GXZ A;  4JR6 A;  1NM3 A;  3TRX A;  4IKH A;  4K6X A;  1SEN A;  1T00 A;  3IRA A;  3WGD A;  1B8X A;  2AJQ B;  1OKD A;  5DBQ A;  2DLX A;  2X99 A;  1C72 A;  5GST A;  1AQX A;  3GKM A;  1PGT A;  3C1S A;  1Z9H A;  4K0G A;  5D9X A;  5D96 A;  18GS A;  2VL3 A;  1JLW A;  4V2N A;  3RHB A;  1I9D A;  4BWS A;  2DIZ A;  3D5J A;  1XWC A;  1ZOF A;  2AYT A;  5IOX A;  1MD3 A;  3QR6 A;  4ML6 A;  3V1W A;  4AF2 A;  3M9J A;  5ABR A;  1YDK A;  1XIY A;  3TJF A;  3LFL A;  3HKR A;  1R4W A;  1YQ1 A;  3US3 A;  1YJ6 A;  1V58 A;  5G31 A;  1PX6 A;  4PTS A;  2VLT A;  2V6O A;  1O6J A;  3UAP A;  1XW5 A;  3FR9 A;  2CX3 A;  4ZB9 A;  2IMI A;  1VF3 A;  2QGV A;  1GUH A;  2WGR A;  4D73 B;  2O8V B;  1PQN A;  3HDC A;  4N0Z A;  3FYG A;  2PWJ A;  2O87 A;  2PMT A;  4MDC A;  5H5Q A;  2I4A A;  1SYX A;  2AHE A;  5CO3 A;  2VLU A;  4ZIJ A;  1G6Y A;  1X9S B;  1T1V A;  3RBT A;  4IQA A;  2DJK A;  1TDI A;  1HNB A;  4MF5 A;  4JRR A;  1SL0 B;  3CRT A;  4NPB A;  4O5R A;  1FB0 A;  2EIO A;  4F2I A;  4G0I A;  4MZW A;  3C7M A;  1PX7 A;  2YZU A;  2B3S A;  3DXB A;  2C4J A;  2DJ0 A;  3TRQ A;  1TJD A;  4XTS A;  4EDY A;  4BPY A;  4G9H A;  5J3R A;  1SD9 A;  1TK5 B;  4IEL A;  1PRX A;  4ISD A;  1SU9 A;  3F4S A;  1CQH A;  1JZR A;  3TKQ A;  5CAX A;  2FUG 2;  2GQM A;  7GSS A;  1TW9 A;  1SL2 B;  5JWO B;  4D73 A;  3D4M A;  4PUA A;  5CNW A;  3CSI A;  4KF9 A;  1OYJ A;  3L9S A;  3GKK A;  1A0F A;  4FO5 A;  1E2Y A;  3G7Y A;  4WXT A;  5CRW A;  1BYE A;  4DEJ A;  1EP7 A;  1ERT A;  2RUE A;  4L0W A;  5HFG A;  1H75 A;  3LYK A;  1UVZ A;  3VFI A;  3KTL A;  2C80 A;  4HZ4 A;  5F05 A;  3FZA A;  3TOU A;  1B4P A;  5DDL A;  3AY8 A;  3F3Q A;  4IJ3 A;  5ECQ B;  4OD7 A;  4KCA A;  3N5O A;  1U87 A;  2B1K A;  1M9B A;  1VF4 A;  3EC3 A;  1XW9 A;  3ZIV A;  2H6X A;  1M0U A;  3NIV A;  1QK8 A;  1JLV A;  1DE2 A;  1Z5Y E;  4MZC A;  3CRU A;  3ERW A;  2A2S A;  1TI1 A;  4TXV A;  2IL3 A;  4HUA A;  1K3O A;  2VUP A;  1TRS A;  5FHI A;  1ON4 A;  3ZRD A;  5INY A;  2LNS A;  4N0V A;  4JED A;  4L0U A;  2RLI A;  3DRN A;  3G7J A;  3IR4 A;  4G0L A;  1EZK A;  2I3Y A;  2NBS A;  2LJK A;  5J5N A;  4MF7 A;  2X8G A;  2R3X A;  1UN2 A;  1GLQ A;  2R2J A;  1WE0 A;  4K7N A;  1M2D A;  4PNG A;  2GZP A;  2K9F A;  2RM6 A;  4MAB A;  4IN0 A;  4CDO A;  3LG6 A;  4HZ2 A;  2C3Q A;  1Y6E A;  2VM1 A;  4HJM A;  1WMJ A;  1QFN A;  3C71 A;  3GH9 A;  1Z7P A;  2C3T A;  5IOW A;  3W8J A;  3O3T A;  5CYY A;  3LXZ A;  2B7J A;  3LWA A;  3EMP A;  3TB2 A;  5A4W A;  3MNG A;  2BTO T;  2RII A;  4MH3 A;  4KA0 A;  3U5R E;  3I69 A;  3IE3 A;  2VD1 A;  2UZ8 A;  1TI3 A;  4WR5 A;  1V2A A;  3F4R A;  3Q74 A;  3LEF A;  5J9C A;  4HS1 A;  4PXO A;  4J57 E;  1HNA A;  3C1R A;  3FZ4 A;  5C00 A;  4K1F A;  3FHK A;  2JZR A;  4O32 A;  4EXJ A;  4RUV A;  4TVE A;  5ELA A;  5J41 A;  2YNX A;  2MZC A;  5G5F A;  3IOS A;  2MMA A;  2I81 A;  3VPQ A;  2GST A;  3O76 A;  3JCM L;  3M1G A;  5GZZ B;  3GIX A;  3TCO A;  2WRT A;  1G7O A;  1RK4 A;  5DCG A;  4G19 A;  2FCH A;  1ZMA A;  3IDV A;  4OWY A;  4AJ7 A;  2E2G A;  5GAP D;  1XWK A;  4OO5 A;  3J7Y b;  4EO3 A;  1TRV A;  3ZIT A;  3TJB A;  2WCI A;  2N5B A;  1XXU A;  2A2R A;  1WRY A;  1WWJ A;  4AGS A;  1AIU A;  1AW9 A;  1GTA A;  3NZN A;  5ID2 A;  4ZB8 A;  3ERF A;  3TJK A;  3L4N A;  3ME7 A;  1FW1 A;  1PKW A;  1J08 A;  3FY7 A;  3F0I A;  5DQS A;  4LLR A;  1O85 A;  4EVM A;  4XHM A;  2YZH A;  6GSU A;  2DJ3 A;  4XCS A;  5IMD A;  4FH8 A;  4IJI A;  4E8E A;  1THO A;  2MMN A;  5CRG A;  4O7H A;  5EVO A;  2CZ3 A;  3HZ8 A;  2X8H A;  3EE2 A;  3CMI A;  2R4V A;  2GSQ A;  4OCF A;  2FA8 A;  2OKA A;  5EPF A;  1JZW A;  2B7K A;  3H8Q A;  1OC9 B;  4GST A;  4OO4 A;  2LJA A;  4NWY A;  3C73 A;  5ECK B;  4TR4 A;  5J4U A;  5CRH A;  5DCH A;  1MDK A;  2PGT A;  2GTU A;  1QQ2 A;  1QGV A;  4F0B A;  1T4Y A;  3H1N A;  2GT6 A;  2LRT A;  1GUL A;  2OE0 A;  3HCZ A;  3DKS A;  1K3Y A;  2AUV A;  3MWH A;  5DAL B;  2DJ2 A;  2DBC A;  1EOG A;  2MBS A;  2L5O A;  2DIY A;  4BA7 A;  2P5Q A;  4YQV A;  1O81 A;  3ZRE A;  1K0C A;  1GTU A;  17GS A;  1XOA A;  2GSS A;  1WP0 A;  2VAF A;  3HJM A;  4NMU A;  3RPN A;  5IO2 A;  3M9K A;  4RQX A;  2YCD A;  1HYU A;  5E4W A;  4I8B A;  4XIH A;  3I43 A;  4Z7X A;  4FQU A;  4GSN A;  3P90 A;  3RAZ A;  3ED3 A;  1OC9 A;  2H0I A;  3ZL5 A;  3GV1 A;  2LRN A;  3IAM 2;  1IYH A;  4IGJ A;  4H86 A;  5LCZ A;  3KH9 A;  3KJY A;  4KCE A;  4KUN A;  2ES7 A;  1GH2 A;  4HDE A;  2IME A;  3CSH A;  2C0F A;  1S3A A;  2LS5 A;  1FOV A;  3K8N A;  3VWX A;  5F07 A;  3W8S A;  3TDG A;  5DAL A;  5LD0 A;  1FHE A;  1EGO A;  3ZVJ A;  1YEP A;  1HD2 A;  1SKS B;  1FG4 A;  2E2M A;  1GTI A;  1A23 A;  1PD2 1;  1NHO A;  2O85 A;  5HR1 A;  4PGT A;  2R37 A;  2H75 A;  3UVT A;  5DJM A;  3E9J B;  3QAG A;  1BX9 A;  2J23 A;  1PMT A;  3KMO A;  3VK9 A;  1TXX A;  3U6V A;  2NDO A;  4ZL9 A;  4K7O A;  2B5X A;  3APO A;  3IA1 A;  3ZZX A;  3DYR A;  1V98 A;  3HVX A;  3HVS A;  3HD5 A;  3FKF A;  2IIY A;  4NHZ A;  4MPG A;  1HNC A;  3LXT A;  3HVV A;  1X5C A;  2BJX A;  2FA4 A;  20GS A;  1GUM A;  2XBQ A;  2IFQ B;  4ECB A;  1XWB A;  2CA8 A;  4V1A p;  2C0E A;  5KN0 A;  1RQM A;  4XRD A;  5AIV A;  3M8N A;  1K3L A;  4ECC A;  4HOJ A;  1F37 A;  1ABA A;  3PPU A;  4KH7 A;  3VPT A;  2L6C A;  3QOU A;  3TJG A;  1TP9 A;  4WKW A;  3Q19 A;  5JCW A;  4NAX A;  3VWU A;  2A4V A;  1J9B A;  3PIN A;  2LQO A;  4K0N A;  3GX8 A;  1OAZ A;  1U3I A;  3QPM A;  3CSJ A;  1N2A A;  5ECI B;  4GQF A;  3A2X A;  4HU7 A;  2WB9 A;  5D8I A;  2IFQ A;  3F6D A;  1WJK A;  5ECO B;  1EGR A;  4I2T A;  4MZB A;  1TK8 B;  1M2A A;  1FAA A;  4IP6 A;  3EIN A;  1BAY A;  4HQS A;  3TKR A;  3PGT A;  5B6N A;  2VCW A;  2YWN A;  2OE3 A;  2OAD A;  1F3B A;  5IO0 A;  5D93 A;  3FEU A;  1XCC A;  2V1M A;  3HZ4 A;  5EY6 A;  1FVK A;  2V6K A;  1W4V A;  1YF0 A;  3KP8 A;  2E0Q A;  4TXO B;  1U88 A;  5G2Z A;  2K18 A;  3ZML A;  4RI6 A;  1XWG A;  6GST A;  1S3D A;  3L9U A;  2ON5 A;  4DSR A;  4ZBB A;  1SKR B;  5ECL B;  3HJO A;  1T7P B;  2XHF A;  3D4T A;  2CAI A;  4OFM A;  1M9A A;  1GRX A;  2IN3 A;  4FIW A;  1PSQ A;  2K8V A;  3KEB A;  5GAN D;  1SK1 A;  4ECJ A;  2FWH A;  4ZL7 A;  3M0F A;  4EE0 A;  3G9B A;  1ACV A;  5A4U A;  5IMV A;  1AUC A;  2H30 A;  4GRF A;  2L4C A;  3FZ5 A;  2OAC A;  4I97 A;  3A5W A;  3RDW A;  4MPF A;  3WT1 A;  3A3T A;  3F6F A;  2GZY A;  2WZ9 A;  1TKD B;  4MK3 A;  3DVW A;  2JSZ A;  2F9S A;  3L9V A;  6GSW A;  2QSI A;  3UVH A;  3GTU B;  1T8E B;  2H76 A;  4GSS A;  4NXI A;  3C8E A;  2BMX A;  4KW6 A;  4TXO A;  5IIZ A;  4WBR D;  1VF2 A;  3D0Z A;  4FYC A;  4GTU A;  3UL3 A;  2REM A;  4TR1 B;  3VWW A;  2HZE B;  1V9W A;  1WPI A;  1PL1 A;  2ZCT A;  1GP1 A;  5IPH A;  4LMV A;  2AAW A;  2C0D A;  2JL4 A;  1GWC A;  4YAP A;  5ECP B;  3QFA C;  1FVJ A;  4I6X A;  2M80 A;  2H1A A;  2MMZ A;  5F06 A;  3TGZ A;  2B5E A;  3BJ5 A;  3CYN A;  1LU4 A;  2PBJ A;  9GSS A;  5HR2 A;  2C1Y A;  3APQ A;  1I5G A;  4WR4 A;  1AQW A;  4G0K A;  5IPG A;  3BOA A;  1MTC A;  4JE1 A;  4K7I A;  4K2D A;  1YEX A;  5H5R A;  5KN1 A;  4DSQ A;  2DJ1 A;  4IP1 A;  4WF4 A;  2LV3 A;  3GST A;  4BL7 B;  5IMF A;  4IVF A;  3GTU A;  2H0G A;  1YKC A;  2YV9 A;  2H0H A;  3WYW A;  1ZCP A;  1AXD A;  1G7E A;  1BJX A;  4TR1 A;  2HZE A;  3J7Y k;  4KDY A;  5HFK A;  5ID2 B;  1NW2 A;  3KMN A;  2OA7 A;  2HSM B;  4ZBA A;  4KND A;  4Q5Q A;  1WOU A;  4QL7 A;  3GNJ A;  2E7P A;  3EVI A;  2H1D A;  4BVY A;  5IMZ A;  1TRW A;  1PL2 A;  1H4O A;  2LRC A;  3GUS A;  1THX A;  4J56 E;  2LUS A;  2TIR A;  2F51 A;  2AB6 A;  4MP4 A;  4ID0 A;  1F2E A;  4XS1 A;  4JZQ A;  2X64 A;  2L57 A;  1SD8 A;  1U6T A;  3RPP A;  2X8C A;  4FYU A;  1MDJ A;  1LBK A;  4KAE A;  5C04 A;  3H79 A;  2ZNM A;  3KH7 A;  3IHQ A;  2HRF A;  4BL7 A;  1BQ7 A;  3DWV A;  4PQ1 A;  4TOP A;  4I2U A;  1XVQ A;  6GSS A;  2VM2 A;  1PKZ A;  2LST A;  3WT2 A;  5KN3 A;  2IJY A;  4ZB6 A;  1YF1 A;  1GUK A;  3EU3 A;  1OE8 A;  3FR3 A;  5ECR B;  1GSE A;  2F8F A;  1Q98 A;  11GS A;  3F8U A;  4F0C A;  1EEM A;  2VL2 A;  2HSM A;  3ZFB A;  4V2L A;  4AJ6 A;  4FYB A;  4POL A;  4LMW A;  3F4T A;  19GS A;  4IBP A;  2VIM A;  2JAC A;  3ZIJ A;  5IMA A;  2MBT A;  1F9M A;  4G2E A;  4Q5R A;  3VUR A;  1A2M A;  5AGY A;  4EKZ A;  1DBY A;  1BG5 A;  4YH2 A;  2HSN B;  1ML6 A;  2LEG A;  2OJL A;  4POB A;  1A2L A;  1EV9 A;  1B9X C;  3H93 A;  2L4Q A;  3IAS 2;  1USB A;  5JWQ B;  2YJH A;  2WFC A;  4DVC A;  1YY7 A;  2RM5 A;  1WIK A;  5ENU A;  1K0A A;  5KN2 A;  1ERU A;  3LGC A;  1FO5 A;  3QD9 A;  1OKT A;  2ALB A;  3ZFL A;  2J9H A;  2OBI A;  1ZYE A;  5A5K A;  2H1G A;  1ZYQ B;  5A4V A;  2IWT A;  5LNK e;  2GS3 A;  2MMO A;  2OE1 A;  2I1U A;  2LJR A;  3QFB C;  1O73 A;  2TRX A;  5KEJ A;  4POK A;  2FD3 A;  3GA4 A;  4NV5 A;  2XPD A;  3KGK A;  2R6K A;  3GFK A;  2GGT A;  3E0U A;  3IC4 A;  3A2V A;  2HSY A;  3ISO A;  3FRC A;  1XVW A;  2H8L A;  3BD2 A;  2LQQ A;  4RQR A;  2VO4 A;  3WGE A;  1A24 A;  1R7H A;  4QL9 A;  1R5A A;  2Z9S A;  2GSR A;  3MSZ A;  4G10 A;  3KXO A;  4XRA A;  1OE7 A;  2VCV A;  3ERG A;  2F3M A;  1X5D A;  2JZS A;  1K0D A;  2N5A A;  3IV4 A;  5HFI A;  1DE1 A;  3DIE A;  3KP9 A;  4HJ2 A;  3W6G A;  4KB3 A;  2KHP A;  4BWQ A;  5E59 A;  3QAW A;  2PVQ A;  3VWV A;  3KTB A;  1M99 A;  2VD0 A;  3FR6 A;  3P7X A;  2QC7 A;  3GH6 A;  4KSM A;  4MJE A;  4XS4 B;  12GS A;  4GCI A;  2DJJ A;  3FW2 A;  2M46 A;  4ZBD A;  2YPM A;  3DVX A;  3GSS A;  2GDR A;  3D21 A;  3CTF A;  2P0G A;  5IMC A;  5L71 A;  2HRK B;  1M7T A;  4AJ8 A;  4P3Y B;  4MCU A;  2FGX A;  3UJ1 A;  4MLY A;  4NHW A;  2C0G A;  2CZ2 A;  1TRU A;  4KGI A;  3TKP A;  1OVN A;  2O7K A;  4I5Q A;  4MJB A;  1J0F A;  3R3E A;  2EC4 A;  1MEK A;  3A2W A;  2WDU A;  4LL4 B;  3GUR A;  4ZXG A;  1NHY A;  5JCU A;  2LTK A;  1GTB A;  2PUK C;  3GMF A;  1ZGN A;  3IK7 A;  2M72 A;  1OC3 A;  4L5L A;  1SYR A;  5ECS A;  3TKS C;  4F03 A;  1A2J A;  1JFU A;  4CW9 A;  2LKU A;  1B48 A;  4N10 A;  5G1K A;  2PPT A;  2H19 A;  3ZLP A;  2IMD A;  3Q18 A;  2GT5 A;  3I6A A;  4PX1 A;  3H4K A;  4POM A;  1S3C A;  4XS4 A;  3NOF A;  2ON7 A;  3ZTL A;  2VOC A;  5DAK B;  1V57 A;  1KEB A;  1DUG A;  1QMV A;  1K0B A;  3UAR A;  1ERV A;  1V40 A;  2HRK A;  3IBH A;  2HI7 A;  2YAN A;  2L59 A;  2WS2 A;  4WF5 A;  2YP6 A;  2L5L A;  1O8X A;  2OBK A;  4V1A g;  4GF0 A;  2R5G A;  4MMM A;  4ILF A;  5G1L A;  1U3A A;  2H72 A;  1K0O A;  2YWI A;  3FZ9 A;  2DMM A;  3BBY A;  4CHS A;  3QDN A;  2PN8 A;  4USS A;  1UA5 A;  2LNT A;  2DML A;  1E6B A;  3RHC A;  1QUW A;  3SWL A;  2GLR A;  3LSZ A;  4GLT A;  1T4Z A;  2XBI A;  5G30 A;  2H66 A;  1GLP A;  5FWG A;  4F82 A;  2RUF A;  3DEX A;  1GNE A;  1GNW A;  2HXK A;  3GHA A;  4YAV A;  1A8Y A;  2P5R A;  5DAK A;  4PQH A;  1EP8 A;  2PVO C;  4ECI A;  1TOF A;  2PER A;  3F3R A;  2C3N A;  1IYI A;  2CT6 A;  5B7C A;  1X5E A;  4QQ7 A;  5ECH B;  3G7I A;  2FLS A;  3ZMK A;  2O89 A;  1Y25 A;  4HQZ A;  3KIJ A;  4EC0 A;  1URM A;  4F9Z A;  3Q6O A;  3QAV A;  3EMX A;  2NPB A;  4MJA A;  2KP2 A;  2H01 A;  3IXR A;  3N9J A;  4ML1 A;  1UC7 A;  2DC5 A;  5JWR B;  3L0H A;  3M3M A;  1T3B A;  1O7U A;  4TR0 A;  1YZX A;  5AIX A;  1ILO A;  2V32 A;  2NTO A;  13GS A;  1YKA A;  2H6Y A;  3ME8 A;  1MDI A;  3ZVJ D;  3PH9 A;  1XBS A;  3EWL A;  6GSX A;  5EL8 A;  2KUC A;  2VCZ A;  2QKE A;  1AQV A;  4OFT A;  2HZF A;  4HU9 A;  8GSS A;  3KD0 A;  4GQC A;  3UMA A;  3GKN A;  3MDK A;  1VF1 A;  4L5O A;  3LJR A;  4PNF A;  5DJL A;  3GL3 A;  4IS0 A; 
#chains in the Genus database with same CATH topology
 2HE3 A;  3TKS E;  1X0R A;  3LYP A;  4X1U A;  4BIK A;  1DSB A;  3HXS A;  5AN1 A;  2C8U A;  3HY2 A;  2CX4 A;  2GQL A;  3FK8 A;  2B5Y A;  4V2M A;  3IC8 A;  2EFD A;  4MF6 A;  2ZUP A;  3KZQ A;  1GL8 A;  4LA1 A;  4BVY B;  1TU8 A;  4GDF A;  2WJU A;  1XFL A;  3IK9 A;  5D9T A;  4OFN A;  2HFD A;  2H6Z A;  5COH A;  2B6M A;  4L8E A;  3CXG A;  2HRA A;  1XZO A;  3LW9 A;  5IM9 A;  1KBN A;  4HEA 2;  4K9Z A;  1AAZ A;  5DVB A;  1SL1 B;  3L78 A;  1K0N A;  1ZL9 A;  1VRS D;  1GSY A;  1X9W B;  1TU7 A;  3O6T A;  4Q5F A;  1KNG A;  2F8A A;  1LJR A;  3ZYW A;  3TUE A;  2P31 A;  5AIS A;  1ZZY A;  6GSY A;  2K8S A;  3TRP A;  4RI7 A;  3HVN A;  1NSW A;  2H1B A;  1A8L A;  4MA9 A;  1Z3E A;  2I9H A;  5J9B A;  5CRD A;  5HQP A;  1KTE A;  4ACS A;  3APS A;  1SK2 A;  5IQY A;  3UBL A;  22GS A;  2YWO A;  4O92 A;  4WEY A;  4PUR A;  1XWA A;  1XOB A;  4TKY A;  3IPZ A;  1XPV A;  4TN8 A;  3GX0 A;  4AKX B;  4X0X A;  3TJJ A;  2XPE A;  3DML A;  2H71 A;  1G6W A;  4JR4 A;  5CP1 A;  4G01 A;  2VL9 A;  1M2B A;  3EYT A;  3UOM A;  2JAD A;  3CBU A;  3E3E A;  14GS A;  2FWF A;  2YV7 A;  3KM6 A;  3BCK A;  2YN1 A;  4YQU A;  1ST9 A;  5D9W A;  4N11 A;  1HQO A;  5D73 A;  3D22 A;  4MH2 A;  4OMV A;  4HI7 A;  2IPA A;  1EV4 A;  4JU5 A;  3GYK A;  1SVO A;  2YOI A;  3DGQ A;  2YJ7 A;  3BCI A;  3EUR A;  2VCT A;  5BMU B;  5H5S A;  2IMK A;  2VCX A;  2TRC P;  4TRX A;  3WGX A;  3EU4 A;  4EF0 A;  2XC2 A;  2KLX A;  4GWR A;  3GRX A;  1Z7R A;  1FB6 A;  5GSS A;  5D9V A;  3F63 A;  1XW6 A;  4BVX B;  1QXH A;  3VI5 A;  4Z2U A;  1R26 A;  2CV4 A;  5HR0 A;  4PUF C;  2YWM A;  3F9U A;  1RW1 A;  1TTZ A;  5G5E A;  3P2A A;  3D6I A;  3VI7 A;  16GS A;  1GSF A;  4X43 A;  4YQM A;  2WW0 A;  4MJC A;  4LL1 B;  2FWE A;  4KX4 A;  2NVL A;  4WBJ A;  2DSA A;  5DQY A;  1GSS A;  4EDZ A;  3MAK A;  1R5P A;  5B8B A;  2CQ9 A;  3UEM A;  2GZZ A;  3OR5 A;  1EEJ A;  1O8W A;  3TKS A;  2WUL A;  2FY6 A;  1X9M B;  1JZD A;  4N30 A;  4DSS B;  2H70 A;  5BMU A;  1GSQ A;  2N5F A;  2JSY A;  3CQF A;  2VKZ G;  4J2F A;  1ERW A;  3DD3 A;  2EFE A;  4IQ1 A;  2HQT A;  2FWG A;  1CQG A;  4EUY A;  4K8M A;  3CTG A;  4ULX A;  2MYG A;  4BVX A;  5F0G A;  1EWX A;  1SK0 A;  1SJ6 A;  2H74 A;  2VCQ A;  1JZO A;  4KE3 A;  4TW5 A;  4Q5N A;  2CVB A;  3A5I A;  1Z6M A;  1GSU A;  2V2G A;  2EIR A;  3WD6 A;  4IW9 A;  3QCP A;  4ZIL A;  2KOK A;  2PU9 C;  2FHE A;  3GL5 A;  3SBC A;  4E8H A;  5ECM B;  4WET A;  2HT9 A;  5FT3 A;  5B8A A;  2WVX B;  3HJP A;  1A0R P;  3HA9 A;  4PQI A;  5F8B A;  1K0M A;  4OCE A;  2GVP A;  2H1L A;  2GQK A;  1Z6N A;  4DSS A;  2HRN A;  4TR3 A;  4KDX A;  2JZT A;  1MD4 A;  3R2Q A;  3HHV A;  2JU5 A;  2HNL A;  3HYP A;  5ECN B;  2HSH A;  1AC1 A;  1BED A;  1PA3 A;  6GSV A;  2G0F A;  1PN9 A;  1F6M C;  4K5S A;  3I9V 2;  2H73 A;  4KDU A;  2K6V A;  1JHB A;  1VGL A;  3P8W A;  4JBB A;  3TOT A;  3PR8 A;  5JCG A;  1OC8 A;  1N8J A;  2EIQ A;  2CVK A;  5HR3 A;  2B1L A;  3GKX A;  2KP1 A;  2V41 A;  4EL1 A;  5B6M A;  1GSD A;  2CVD A;  1SJZ A;  3QMX A;  2IMF A;  2WVX A;  3VLN A;  1SJI A;  1Q4J A;  2D2Z A;  4IHU A;  3GN3 A;  2CAQ A;  2HLS A;  1TK0 B;  4XS6 A;  1B4Q A;  3LOR A;  4NV2 A;  2G2Q A;  1G0T A;  2AV4 A;  3KCM A;  3LQ7 A;  10GS A;  2L6D A;  4KSO A;  1F3A A;  1B9Y C;  2VL2 C;  1SKW B;  3S9F A;  1W89 A;  4ZL8 A;  2VLV A;  5ELG A;  1EOH A;  2FNO A;  5CRE A;  2HYX A;  3UBK A;  3UIW A;  4GXZ A;  4JR6 A;  1NM3 A;  3TRX A;  4IKH A;  4K6X A;  1SEN A;  4AKI A;  1T00 A;  3IRA A;  3WGD A;  1B8X A;  2AJQ B;  1OKD A;  5DBQ A;  2DLX A;  2X99 A;  1C72 A;  5GST A;  1AQX A;  3GKM A;  1PGT A;  3C1S A;  1Z9H A;  4K0G A;  5D9X A;  5D96 A;  18GS A;  2VL3 A;  1JLW A;  4V2N A;  3RHB A;  1I9D A;  4BWS A;  2DIZ A;  3D5J A;  1XWC A;  1ZOF A;  2AYT A;  5IOX A;  1MD3 A;  3QR6 A;  5J4V A;  4ML6 A;  3V1W A;  4AF2 A;  3M9J A;  5ABR A;  1YDK A;  1XIY A;  3TJF A;  3LFL A;  3HKR A;  1R4W A;  1YQ1 A;  3RGB C;  3US3 A;  1YJ6 A;  1V58 A;  5G31 A;  1PX6 A;  4PTS A;  2VLT A;  2V6O A;  1O6J A;  4EIP A;  3UAP A;  1XW5 A;  3FR9 A;  2CX3 A;  2O5V A;  4ZB9 A;  2IMI A;  1VF3 A;  2QGV A;  1GUH A;  2WGR A;  4D73 B;  2O8V B;  1PQN A;  3HDC A;  4N0Z A;  3FYG A;  2PWJ A;  2O87 A;  2PMT A;  4MDC A;  5H5Q A;  2I4A A;  1SYX A;  2AHE A;  5CO3 A;  2VLU A;  4ZIJ A;  1G6Y A;  1X9S B;  1T1V A;  3RBT A;  4IQA A;  2DJK A;  1TDI A;  1HNB A;  4MF5 A;  4JRR A;  1SL0 B;  3CRT A;  4NPB A;  4O5R A;  1FB0 A;  2EIO A;  4F2I A;  4G0I A;  4MZW A;  3C7M A;  1PX7 A;  2YZU A;  2B3S A;  3DXB A;  2C4J A;  2DJ0 A;  3TRQ A;  1TJD A;  4XTS A;  4EDY A;  1S4B P;  4G9H A;  4BPY A;  5J3R A;  1SD9 A;  1TK5 B;  4IEL A;  1PRX A;  4ISD A;  1SU9 A;  3F4S A;  1CQH A;  1JZR A;  3TKQ A;  5CAX A;  2FUG 2;  2GQM A;  7GSS A;  4K5R A;  4K2X A;  1TW9 A;  1SL2 B;  5JWO B;  4D73 A;  3D4M A;  4PUA A;  5CNW A;  3CSI A;  2WVZ A;  4KF9 A;  1OYJ A;  3L9S A;  3GKK A;  1A0F A;  4FO5 A;  1E2Y A;  3G7Y A;  4WXT A;  5CRW A;  1BYE A;  4DEJ A;  1EP7 A;  1ERT A;  2RUE A;  4L0W A;  5HFG A;  1H75 A;  3LYK A;  1UVZ A;  3VFI A;  3KTL A;  4YKG A;  2C80 A;  4HZ4 A;  5F05 A;  3FZA A;  3TOU A;  1B4P A;  5DDL A;  3AY8 A;  3F3Q A;  4IJ3 A;  5ECQ B;  4OD7 A;  4KCA A;  3N5O A;  1U87 A;  2B1K A;  1M9B A;  1VF4 A;  3EC3 A;  1XW9 A;  3ZIV A;  2H6X A;  1M0U A;  3NIV A;  1QK8 A;  1JLV A;  1DE2 A;  1Z5Y E;  4MZC A;  3CRU A;  3ERW A;  2A2S A;  1TI1 A;  4TXV A;  2IL3 A;  4HUA A;  1K3O A;  2VUP A;  1TRS A;  5FHI A;  1ON4 A;  3ZRD A;  5INY A;  2LNS A;  4N0V A;  4JED A;  1S3R A;  4L0U A;  2RLI A;  3DRN A;  3G7J A;  3IR4 A;  4G0L A;  1EZK A;  2I3Y A;  2NBS A;  2LJK A;  5J5N A;  4MF7 A;  2X8G A;  2R3X A;  1UN2 A;  1GLQ A;  2R2J A;  1WE0 A;  4K7N A;  1M2D A;  4PNG A;  2GZP A;  2K9F A;  2RM6 A;  4MAB A;  4IN0 A;  3CWG A;  4CDO A;  4X4J A;  3LG6 A;  4HZ2 A;  2C3Q A;  1Y6E A;  5J47 A;  2VM1 A;  4HJM A;  1WMJ A;  1QFN A;  3C71 A;  3GH9 A;  1Z7P A;  2C3T A;  5IOW A;  3W8J A;  3O3T A;  5CYY A;  3LXZ A;  2B7J A;  3LWA A;  3EMP A;  4CY6 A;  3TB2 A;  5A4W A;  3MNG A;  2BTO T;  2RII A;  4MH3 A;  4KA0 A;  3U5R E;  3I69 A;  3IE3 A;  2VD1 A;  2UZ8 A;  1TI3 A;  4WR5 A;  1V2A A;  3F4R A;  3Q74 A;  3LEF A;  5J9C A;  4HS1 A;  4PXO A;  4J57 E;  1M3J A;  1HNA A;  3C1R A;  3FZ4 A;  5C00 A;  4K1F A;  3FHK A;  2JZR A;  4O32 A;  4EXJ A;  4RUV A;  4TVE A;  5ELA A;  5J41 A;  2YNX A;  2MZC A;  5G5F A;  3IOS A;  2MMA A;  2I81 A;  3VPQ A;  2GST A;  3O76 A;  3JCM L;  3M1G A;  5GZZ B;  1PFO A;  4O5Q A;  3GIX A;  3TCO A;  2WRT A;  1G7O A;  1RK4 A;  5DCG A;  4G19 A;  4MNN A;  2FCH A;  5A1N B;  1ZMA A;  3IDV A;  4OWY A;  4AJ7 A;  2E2G A;  3HMJ G;  5GAP D;  1I1I P;  1XWK A;  4OO5 A;  3J7Y b;  4EO3 A;  1TRV A;  3ZIT A;  3TJB A;  2WCI A;  2N5B A;  1XXU A;  2A2R A;  1WRY A;  1PN0 A;  1WWJ A;  4AGS A;  1AIU A;  1AW9 A;  1GTA A;  4ZB7 A;  3NZN A;  4ZB8 A;  5ID2 A;  3ERF A;  3TJK A;  3L4N A;  4ICY A;  3ME7 A;  4A5P A;  1FW1 A;  1PKW A;  1J08 A;  3FY7 A;  3F0I A;  5DQS A;  4LLR A;  1O85 A;  4EVM A;  4XHM A;  2YZH A;  6GSU A;  2DJ3 A;  4XCS A;  5IMD A;  4FH8 A;  4IJI A;  4E8E A;  1THO A;  2MMN A;  3RFR C;  5CRG A;  4O7H A;  5EVO A;  2CZ3 A;  3HZ8 A;  2X8H A;  3EE2 A;  3CMI A;  2R4V A;  2GSQ A;  4OCF A;  5A1N A;  2FA8 A;  2OKA A;  5EPF A;  1JZW A;  2B7K A;  3H8Q A;  1OC9 B;  4GST A;  4OO4 A;  2LJA A;  4NWY A;  3C73 A;  5ECK B;  4TR4 A;  5J4U A;  5CRH A;  5DCH A;  1MDK A;  2PGT A;  2GTU A;  1QQ2 A;  1QGV A;  4F0B A;  1T4Y A;  3H1N A;  2GT6 A;  2LRT A;  1GUL A;  2OE0 A;  3HCZ A;  3DKS A;  1K3Y A;  2AUV A;  2OT3 A;  3MWH A;  5DAL B;  2A4H A;  2DJ2 A;  2DBC A;  1EOG A;  2MBS A;  2L5O A;  2DIY A;  4BA7 A;  2P5Q A;  4YQV A;  1O81 A;  3ZRE A;  1K0C A;  1GTU A;  17GS A;  1XOA A;  2GSS A;  1WP0 A;  2VAF A;  3HJM A;  4NMU A;  3RPN A;  5IO2 A;  3M9K A;  4RQX A;  2YCD A;  1HYU A;  4W66 A;  5E4W A;  4I8B A;  4XIH A;  3I43 A;  4Z7X A;  4FQU A;  2WW2 A;  2O3E A;  4GSN A;  3P90 A;  3RAZ A;  2R0C A;  3ED3 A;  1OC9 A;  2H0I A;  3ZL5 A;  4Z2R A;  3GV1 A;  2LRN A;  3IAM 2;  1IYH A;  4IGJ A;  4H86 A;  5LCZ A;  3KH9 A;  3KJY A;  4KCE A;  4O5U A;  4E68 A;  4KUN A;  2ES7 A;  1GH2 A;  4HDE A;  2IME A;  3CSH A;  2C0F A;  1S3A A;  2LS5 A;  1FOV A;  1YVL A;  3K8N A;  3VWX A;  5F07 A;  4EIQ A;  3W8S A;  3TDG A;  5DAL A;  2O36 A;  5LD0 A;  1FHE A;  3MYD A;  1EGO A;  3ZVJ A;  1YEP A;  1HD2 A;  3TU3 B;  3IHG A;  1SKS B;  1FG4 A;  2E2M A;  1GTI A;  1A23 A;  1PD2 1;  1NHO A;  2O85 A;  5HR1 A;  4PGT A;  2R37 A;  2H75 A;  3UVT A;  5DJM A;  3E9J B;  3QAG A;  1BX9 A;  2J23 A;  1PMT A;  3KMO A;  3VK9 A;  1TXX A;  3U6V A;  2NDO A;  4ZL9 A;  4K7O A;  2B5X A;  3APO A;  3IA1 A;  3ZZX A;  3DYR A;  1V98 A;  3HVX A;  4HSC X;  3HVS A;  3HD5 A;  3FKF A;  2IIY A;  4NHZ A;  4MPG A;  1HNC A;  3LXT A;  3HVV A;  5A34 B;  1X5C A;  2BJX A;  2FA4 A;  20GS A;  4AI6 A;  2QA1 A;  4YKF A;  5A5H B;  1GUM A;  2XBQ A;  2IFQ B;  4ECB A;  1XWB A;  2CA8 A;  2DKH A;  4V1A p;  2C0E A;  5KN0 A;  1RQM A;  4XRD A;  5AIV A;  3M8N A;  1K3L A;  4ECC A;  4HOJ A;  1F37 A;  1ABA A;  3PPU A;  4KH7 A;  3VPT A;  1SVL A;  2L6C A;  3QOU A;  3TJG A;  1TP9 A;  4PI0 C;  4WKW A;  3Q19 A;  5JCW A;  4NAX A;  3VWU A;  2A4V A;  1J9B A;  5A34 A;  3PIN A;  2LQO A;  4K0N A;  3GX8 A;  1OAZ A;  1U3I A;  3QPM A;  3CSJ A;  5A5H A;  1N2A A;  5ECI B;  4GQF A;  3A2X A;  4HU7 A;  2WB9 A;  5D8I A;  2IFQ A;  3F6D A;  1WJK A;  5ECO B;  3FMW A;  1EGR A;  4I2T A;  4MZB A;  1TK8 B;  1M2A A;  1FAA A;  4IP6 A;  3EIN A;  1BAY A;  4HQS A;  3TKR A;  3PGT A;  5B6N A;  2VCW A;  2YWN A;  2OE3 A;  2OAD A;  1F3B A;  4QMK A;  5IO0 A;  5D93 A;  3FEU A;  1XCC A;  2V1M A;  3HZ4 A;  5EY6 A;  1FVK A;  2V6K A;  1W4V A;  1YF0 A;  3KP8 A;  2E0Q A;  4TXO B;  1U88 A;  5G2Z A;  2K18 A;  3ZML A;  4RI6 A;  1XWG A;  6GST A;  1S3D A;  3L9U A;  2ON5 A;  4DSR A;  4ZBB A;  1SKR B;  5ECL B;  3HJO A;  1T7P B;  1TXU A;  2XHF A;  3D4T A;  2CAI A;  4OFM A;  1M9A A;  1GRX A;  2IN3 A;  4FIW A;  1PSQ A;  2K8V A;  3KEB A;  5GAN D;  1SK1 A;  4ECJ A;  2FWH A;  4ZL7 A;  3M0F A;  4EE0 A;  3G9B A;  1ACV A;  5A4U A;  5IMV A;  1AUC A;  2H30 A;  4GRF A;  2L4C A;  3FZ5 A;  2OAC A;  4I97 A;  3A5W A;  3RDW A;  2R0P A;  4MPF A;  3WT1 A;  3A3T A;  3F6F A;  2GZY A;  2WZ9 A;  1TKD B;  4MK3 A;  3DVW A;  2JSZ A;  2F9S A;  3L9V A;  6GSW A;  2QSI A;  3UVH A;  3GTU B;  1T8E B;  2H76 A;  1XG8 A;  4GSS A;  4NXI A;  3C8E A;  2BMX A;  4KW6 A;  1M3I A;  4TXO A;  5IIZ A;  4WBR D;  1VF2 A;  3D0Z A;  4FYC A;  2DKI A;  4GTU A;  1FOH A;  3UL3 A;  2REM A;  4TR1 B;  3VWW A;  2HZE B;  2WZS A;  1V9W A;  1WPI A;  1PL1 A;  2ZCT A;  1GP1 A;  5IPH A;  4LMV A;  2AAW A;  2C0D A;  2JL4 A;  1GWC A;  4YAP A;  5ECP B;  3QFA C;  1FVJ A;  4I6X A;  2M80 A;  2H1A A;  2MMZ A;  5F06 A;  5J40 A;  3TGZ A;  2B5E A;  3BJ5 A;  3CYN A;  1LU4 A;  2PBJ A;  9GSS A;  5HR2 A;  2C1Y A;  3APQ A;  1I5G A;  4WR4 A;  1AQW A;  4G0K A;  5IPG A;  3BOA A;  1MTC A;  4JE1 A;  4K7I A;  4K2D A;  1YEX A;  5H5R A;  5KN1 A;  4DSQ A;  2DJ1 A;  4IP1 A;  4WF4 A;  2LV3 A;  3GST A;  4BL7 B;  5IMF A;  4IVF A;  3GTU A;  2H0G A;  1YKC A;  2YV9 A;  2H0H A;  3WYW A;  1ZCP A;  1AXD A;  1G7E A;  1BJX A;  4TR1 A;  2HZE A;  3J7Y k;  4KDY A;  5HFK A;  5ID2 B;  1NW2 A;  3KMN A;  2OA7 A;  2HSM B;  4ZBA A;  4KND A;  4Q5Q A;  1WOU A;  4QL7 A;  3GNJ A;  2E7P A;  3EVI A;  2H1D A;  4BVY A;  2A2P A;  5IMZ A;  1TRW A;  1PL2 A;  1H4O A;  2LRC A;  3GUS A;  1THX A;  4J56 E;  2LUS A;  2TIR A;  2F51 A;  2AB6 A;  4MP4 A;  4ID0 A;  1F2E A;  2UV8 G;  4XS1 A;  2EFC A;  4JZQ A;  2X64 A;  2L57 A;  5KOW A;  1SD8 A;  1U6T A;  3RPP A;  3CHX C;  2X8C A;  4FYU A;  1MDJ A;  1LBK A;  4KAE A;  5C04 A;  3H79 A;  2ZNM A;  3KH7 A;  1ZYN A;  3IHQ A;  2HRF A;  4BL7 A;  3MIX A;  1BQ7 A;  3DWV A;  4PQ1 A;  4TOP A;  4I2U A;  1XVQ A;  6GSS A;  2VM2 A;  1PKZ A;  2LST A;  3WT2 A;  5KN3 A;  4CY8 A;  2IJY A;  4ZB6 A;  1YF1 A;  1GUK A;  3EU3 A;  1OE8 A;  3FR3 A;  5ECR B;  1GSE A;  2F8F A;  1Q98 A;  11GS A;  3F8U A;  4F0C A;  1EEM A;  2VL2 A;  2HSM A;  3ZFB A;  4V2L A;  4AJ6 A;  4FYB A;  4POL A;  4LMW A;  3F4T A;  19GS A;  4IBP A;  2VIM A;  2JAC A;  3ZIJ A;  5IMA A;  2MBT A;  1F9M A;  4G2E A;  4Q5R A;  3VUR A;  1A2M A;  2WW1 A;  5AGY A;  4EKZ A;  1DBY A;  1BG5 A;  4YH2 A;  2HSN B;  1ML6 A;  2LEG A;  2OJL A;  4POB A;  1A2L A;  1EV9 A;  1B9X C;  3H93 A;  2L4Q A;  3IAS 2;  1USB A;  5JWQ B;  1BG1 A;  2YJH A;  2WFC A;  4DVC A;  1YY7 A;  2RM5 A;  1WIK A;  5ENU A;  1K0A A;  2X4A A;  5KN2 A;  1ERU A;  3LGC A;  1FO5 A;  2EFH A;  3QD9 A;  1OKT A;  2ALB A;  3ZFL A;  2J9H A;  2OBI A;  1ZYE A;  5A5K A;  2H1G A;  1ZYQ B;  5A4V A;  4N3Z A;  2IWT A;  5LNK e;  2GS3 A;  2MMO A;  2OE1 A;  2I1U A;  2LJR A;  3QFB C;  1O73 A;  2TRX A;  5KEJ A;  4POK A;  2FD3 A;  2WW3 A;  3GA4 A;  4FXY P;  4NV5 A;  2XPD A;  3KGK A;  2R6K A;  3GFK A;  3EPT A;  2GGT A;  3E0U A;  3IC4 A;  3A2V A;  2HSY A;  3ISO A;  3FRC A;  2HSN A;  1XVW A;  2H8L A;  3BD2 A;  2LQQ A;  1SVM A;  4RQR A;  2VO4 A;  3WGE A;  1A24 A;  1R7H A;  4QL9 A;  1R5A A;  2Z9S A;  2GSR A;  3MSZ A;  4G10 A;  3KXO A;  4XRA A;  1OE7 A;  2VCV A;  3ERG A;  2F3M A;  1X5D A;  2JZS A;  1K0D A;  2N5A A;  5J4Y A;  3IV4 A;  5HFI A;  1DE1 A;  3DIE A;  3KP9 A;  1ZYP A;  4HJ2 A;  3W6G A;  4KB3 A;  2KHP A;  4BWQ A;  5E59 A;  3QAW A;  2PVQ A;  3VWV A;  3KTB A;  1M99 A;  2VD0 A;  3FR6 A;  3P7X A;  2QC7 A;  3GH6 A;  4KSM A;  4MJE A;  4XS4 B;  12GS A;  4GCI A;  2DJJ A;  3FW2 A;  2M46 A;  4ZBD A;  2YPM A;  3DVX A;  3GSS A;  2GDR A;  3D21 A;  3CTF A;  2P0G A;  5IMC A;  5L71 A;  2HRK B;  1M7T A;  4AJ8 A;  4P3Y B;  4MCU A;  2FGX A;  3UJ1 A;  4MLY A;  4NHW A;  2C0G A;  2CZ2 A;  1TRU A;  4KGI A;  3TKP A;  1OVN A;  2O7K A;  4I5Q A;  4MJB A;  1J0F A;  3R3E A;  2EC4 A;  1MEK A;  3A2W A;  1BF5 A;  2WDU A;  4LL4 B;  3GUR A;  4ZXG A;  4PHZ C;  1NHY A;  5JCU A;  2LTK A;  1GTB A;  2PUK C;  3GMF A;  1ZGN A;  3IK7 A;  2M72 A;  4AKH A;  4Z2T A;  1OC3 A;  4L5L A;  1SYR A;  5ECS A;  3TKS C;  4F03 A;  1A2J A;  1JFU A;  4CW9 A;  2LKU A;  1B48 A;  4N10 A;  5G1K A;  2PPT A;  2H19 A;  3ZLP A;  2IMD A;  3Q18 A;  2GT5 A;  3I6A A;  4PX1 A;  3H4K A;  4POM A;  1S3C A;  4XS4 A;  3NOF A;  2ON7 A;  3ZTL A;  2VOC A;  5DAK B;  1V57 A;  1KEB A;  1DUG A;  1QMV A;  1K0B A;  3UAR A;  1ERV A;  1V40 A;  2HRK A;  3IBH A;  2HI7 A;  2YAN A;  2L59 A;  2WS2 A;  4WF5 A;  2YP6 A;  2L5L A;  1O8X A;  2OBK A;  2R0G A;  4V1A g;  4GF0 A;  2R5G A;  4MMM A;  4ILF A;  5KOX A;  5G1L A;  1U3A A;  2H72 A;  1K0O A;  2YWI A;  3FZ9 A;  2DMM A;  3BBY A;  1YEW C;  4CHS A;  3QDN A;  2PN8 A;  4USS A;  2DML A;  2LNT A;  1UA5 A;  2WVY A;  1E6B A;  3RHC A;  1QUW A;  3SWL A;  2GLR A;  3LSZ A;  4GLT A;  1T4Z A;  2XBI A;  5G30 A;  2H66 A;  1GLP A;  5FWG A;  4F82 A;  2RUF A;  3DEX A;  1GNE A;  1GNW A;  2HXK A;  3GHA A;  4YAV A;  1A8Y A;  2P5R A;  5DAK A;  4PQH A;  1EP8 A;  2PVO C;  4ECI A;  1TOF A;  2PER A;  3F3R A;  2C3N A;  1IYI A;  2CT6 A;  5B7C A;  1X5E A;  4QQ7 A;  5ECH B;  3G7I A;  2FLS A;  3ZMK A;  2O89 A;  1Y25 A;  4HQZ A;  3KIJ A;  4EC0 A;  1URM A;  4F9Z A;  3Q6O A;  3QAV A;  3EMX A;  2NPB A;  2X49 A;  4MJA A;  2KP2 A;  2H01 A;  3IXR A;  4AKG A;  3N9J A;  4ML1 A;  5BRT A;  1UC7 A;  1N25 A;  2DC5 A;  5JWR B;  3L0H A;  3M3M A;  1T3B A;  4PI2 C;  1O7U A;  1Y1U A;  4TR0 A;  1YZX A;  5AIX A;  1ILO A;  2V32 A;  2NTO A;  13GS A;  1YKA A;  2H6Y A;  3ME8 A;  1MDI A;  3ZVJ D;  3PH9 A;  1XBS A;  3EWL A;  2QA2 A;  6GSX A;  5EL8 A;  2KUC A;  2VCZ A;  2QKE A;  1AQV A;  4OFT A;  2HZF A;  4HU9 A;  8GSS A;  3KD0 A;  4GQC A;  3UMA A;  3GKN A;  3MDK A;  1VF1 A;  4L5O A;  3LJR A;  4PNF A;  5DJL A;  3GL3 A;  4IS0 A; 
#chains in the Genus database with same CATH homology
 2HE3 A;  3TKS E;  1X0R A;  3LYP A;  4X1U A;  1DSB A;  3HXS A;  5AN1 A;  2C8U A;  3HY2 A;  2CX4 A;  2GQL A;  3FK8 A;  2B5Y A;  4V2M A;  3IC8 A;  2EFD A;  4MF6 A;  2ZUP A;  3KZQ A;  1GL8 A;  4LA1 A;  4BVY B;  1TU8 A;  4GDF A;  2WJU A;  1XFL A;  3IK9 A;  5D9T A;  4OFN A;  2HFD A;  2H6Z A;  5COH A;  2B6M A;  4L8E A;  3LW9 A;  2HRA A;  1XZO A;  3CXG A;  5IM9 A;  1KBN A;  4HEA 2;  4K9Z A;  1AAZ A;  5DVB A;  1SL1 B;  3L78 A;  1K0N A;  1ZL9 A;  1VRS D;  1GSY A;  1X9W B;  1TU7 A;  3O6T A;  4Q5F A;  1KNG A;  2F8A A;  1LJR A;  3ZYW A;  3TUE A;  2P31 A;  5AIS A;  1ZZY A;  6GSY A;  2K8S A;  3TRP A;  4RI7 A;  1NSW A;  2H1B A;  1A8L A;  4MA9 A;  1Z3E A;  2I9H A;  5J9B A;  5CRD A;  5HQP A;  1KTE A;  4ACS A;  3APS A;  1SK2 A;  5IQY A;  3UBL A;  22GS A;  2YWO A;  4O92 A;  4WEY A;  4PUR A;  1XWA A;  1XOB A;  4TKY A;  3IPZ A;  1XPV A;  4TN8 A;  3GX0 A;  4AKX B;  4X0X A;  3TJJ A;  2XPE A;  3DML A;  2H71 A;  1G6W A;  4JR4 A;  5CP1 A;  4G01 A;  2VL9 A;  1M2B A;  3EYT A;  3UOM A;  2JAD A;  3CBU A;  3E3E A;  14GS A;  2FWF A;  2YV7 A;  3KM6 A;  3BCK A;  2YN1 A;  4YQU A;  1ST9 A;  5D9W A;  4N11 A;  1HQO A;  5D73 A;  3D22 A;  4MH2 A;  4OMV A;  4HI7 A;  2IPA A;  1EV4 A;  4JU5 A;  3GYK A;  1SVO A;  2YOI A;  3DGQ A;  2YJ7 A;  3BCI A;  3EUR A;  2VCT A;  5BMU B;  5H5S A;  2IMK A;  2VCX A;  2TRC P;  4TRX A;  3WGX A;  3EU4 A;  4EF0 A;  2XC2 A;  2KLX A;  4GWR A;  3GRX A;  1Z7R A;  1FB6 A;  5GSS A;  5D9V A;  3F63 A;  1XW6 A;  4BVX B;  1QXH A;  3VI5 A;  4Z2U A;  1R26 A;  2CV4 A;  5HR0 A;  4PUF C;  2YWM A;  3F9U A;  1RW1 A;  1TTZ A;  5G5E A;  3P2A A;  3D6I A;  3VI7 A;  16GS A;  1GSF A;  4X43 A;  4YQM A;  4MJC A;  4LL1 B;  2FWE A;  4KX4 A;  2NVL A;  4WBJ A;  2DSA A;  5DQY A;  1GSS A;  4EDZ A;  3MAK A;  1R5P A;  5B8B A;  2CQ9 A;  3UEM A;  2GZZ A;  3OR5 A;  1EEJ A;  1O8W A;  3TKS A;  2WUL A;  2FY6 A;  1X9M B;  1JZD A;  4N30 A;  4DSS B;  2H70 A;  5BMU A;  1GSQ A;  2N5F A;  2JSY A;  2VKZ G;  4J2F A;  1ERW A;  3DD3 A;  2EFE A;  4IQ1 A;  2HQT A;  2FWG A;  1CQG A;  4EUY A;  4K8M A;  3CTG A;  4ULX A;  2MYG A;  4BVX A;  5F0G A;  1EWX A;  1SK0 A;  1SJ6 A;  2H74 A;  2VCQ A;  1JZO A;  4KE3 A;  4TW5 A;  4Q5N A;  2CVB A;  3A5I A;  1Z6M A;  1GSU A;  2V2G A;  2EIR A;  3WD6 A;  4IW9 A;  3QCP A;  4ZIL A;  2KOK A;  2PU9 C;  2FHE A;  3GL5 A;  3SBC A;  4E8H A;  5ECM B;  4WET A;  2HT9 A;  5FT3 A;  5B8A A;  3HJP A;  1A0R P;  3HA9 A;  4PQI A;  5F8B A;  1K0M A;  4OCE A;  2GVP A;  2H1L A;  2GQK A;  1Z6N A;  4DSS A;  2HRN A;  4TR3 A;  4KDX A;  2JZT A;  1MD4 A;  3R2Q A;  3HHV A;  2JU5 A;  2HNL A;  3HYP A;  5ECN B;  2HSH A;  1AC1 A;  1BED A;  1PA3 A;  6GSV A;  2G0F A;  1PN9 A;  1F6M C;  4K5S A;  3I9V 2;  2H73 A;  4KDU A;  2K6V A;  1JHB A;  1VGL A;  3P8W A;  4JBB A;  3TOT A;  3PR8 A;  5JCG A;  1OC8 A;  1N8J A;  2EIQ A;  2CVK A;  5HR3 A;  2B1L A;  3GKX A;  2KP1 A;  2V41 A;  4EL1 A;  5B6M A;  1GSD A;  2CVD A;  1SJZ A;  3QMX A;  2IMF A;  3VLN A;  1SJI A;  1Q4J A;  2D2Z A;  4IHU A;  3GN3 A;  2CAQ A;  2HLS A;  1TK0 B;  4XS6 A;  1B4Q A;  3LOR A;  4NV2 A;  2G2Q A;  1G0T A;  2AV4 A;  3KCM A;  3LQ7 A;  10GS A;  2L6D A;  4KSO A;  1F3A A;  1B9Y C;  2VL2 C;  1SKW B;  3S9F A;  1W89 A;  4ZL8 A;  2VLV A;  5ELG A;  1EOH A;  2FNO A;  5CRE A;  2HYX A;  3UBK A;  3UIW A;  4GXZ A;  4JR6 A;  1NM3 A;  3TRX A;  4IKH A;  4K6X A;  1SEN A;  4AKI A;  1T00 A;  3IRA A;  3WGD A;  1B8X A;  2AJQ B;  1OKD A;  5DBQ A;  2DLX A;  2X99 A;  1C72 A;  5GST A;  1AQX A;  3GKM A;  1PGT A;  3C1S A;  1Z9H A;  4K0G A;  5D9X A;  5D96 A;  18GS A;  2VL3 A;  1JLW A;  4V2N A;  3RHB A;  1I9D A;  4BWS A;  2DIZ A;  3D5J A;  1XWC A;  1ZOF A;  2AYT A;  5IOX A;  1MD3 A;  3QR6 A;  5J4V A;  4ML6 A;  3V1W A;  4AF2 A;  3M9J A;  5ABR A;  1YDK A;  1XIY A;  3TJF A;  3LFL A;  3HKR A;  1R4W A;  1YQ1 A;  3US3 A;  1YJ6 A;  1V58 A;  5G31 A;  1PX6 A;  4PTS A;  2VLT A;  2V6O A;  1O6J A;  4EIP A;  3UAP A;  1XW5 A;  3FR9 A;  2CX3 A;  2O5V A;  4ZB9 A;  2IMI A;  1VF3 A;  2QGV A;  1GUH A;  2WGR A;  4D73 B;  2O8V B;  1PQN A;  3HDC A;  4N0Z A;  3FYG A;  2PWJ A;  2O87 A;  2PMT A;  4MDC A;  5H5Q A;  2I4A A;  1SYX A;  2AHE A;  5CO3 A;  2VLU A;  4ZIJ A;  1G6Y A;  1X9S B;  1T1V A;  3RBT A;  4IQA A;  2DJK A;  1TDI A;  1HNB A;  4MF5 A;  4JRR A;  1SL0 B;  3CRT A;  4NPB A;  4O5R A;  1FB0 A;  2EIO A;  4F2I A;  4G0I A;  4MZW A;  3C7M A;  1PX7 A;  2YZU A;  2B3S A;  3DXB A;  2C4J A;  2DJ0 A;  3TRQ A;  1TJD A;  4XTS A;  4EDY A;  4BPY A;  4G9H A;  5J3R A;  1SD9 A;  1TK5 B;  4IEL A;  1PRX A;  4ISD A;  1SU9 A;  3F4S A;  1CQH A;  1JZR A;  3TKQ A;  5CAX A;  2FUG 2;  2GQM A;  7GSS A;  4K5R A;  4K2X A;  1TW9 A;  1SL2 B;  5JWO B;  4D73 A;  3D4M A;  4PUA A;  5CNW A;  3CSI A;  4KF9 A;  1OYJ A;  3L9S A;  3GKK A;  1A0F A;  4FO5 A;  1E2Y A;  3G7Y A;  4WXT A;  5CRW A;  1BYE A;  4DEJ A;  1EP7 A;  1ERT A;  2RUE A;  4L0W A;  5HFG A;  1H75 A;  3LYK A;  1UVZ A;  3VFI A;  3KTL A;  4YKG A;  2C80 A;  4HZ4 A;  5F05 A;  3FZA A;  3TOU A;  1B4P A;  5DDL A;  3AY8 A;  3F3Q A;  4IJ3 A;  5ECQ B;  4OD7 A;  4KCA A;  3N5O A;  1U87 A;  2B1K A;  1M9B A;  1VF4 A;  3EC3 A;  1XW9 A;  3ZIV A;  2H6X A;  1M0U A;  3NIV A;  1QK8 A;  1JLV A;  1DE2 A;  1Z5Y E;  4MZC A;  3CRU A;  3ERW A;  2A2S A;  1TI1 A;  4TXV A;  2IL3 A;  4HUA A;  1K3O A;  2VUP A;  1TRS A;  5FHI A;  1ON4 A;  3ZRD A;  5INY A;  2LNS A;  4N0V A;  4JED A;  4L0U A;  2RLI A;  3DRN A;  3G7J A;  3IR4 A;  4G0L A;  1EZK A;  2I3Y A;  2NBS A;  2LJK A;  5J5N A;  4MF7 A;  2X8G A;  2R3X A;  1UN2 A;  1GLQ A;  2R2J A;  1WE0 A;  4K7N A;  1M2D A;  4PNG A;  2GZP A;  2K9F A;  2RM6 A;  4MAB A;  4IN0 A;  3CWG A;  4CDO A;  4X4J A;  3LG6 A;  4HZ2 A;  2C3Q A;  1Y6E A;  5J47 A;  2VM1 A;  4HJM A;  1WMJ A;  1QFN A;  3C71 A;  3GH9 A;  1Z7P A;  2C3T A;  5IOW A;  3W8J A;  3O3T A;  5CYY A;  3LXZ A;  2B7J A;  3LWA A;  3EMP A;  4CY6 A;  3TB2 A;  5A4W A;  3MNG A;  2BTO T;  2RII A;  4MH3 A;  4KA0 A;  3U5R E;  3I69 A;  3IE3 A;  2VD1 A;  2UZ8 A;  1TI3 A;  4WR5 A;  1V2A A;  3F4R A;  3Q74 A;  3LEF A;  5J9C A;  4HS1 A;  4PXO A;  4J57 E;  1HNA A;  3C1R A;  3FZ4 A;  5C00 A;  4K1F A;  3FHK A;  2JZR A;  4O32 A;  4EXJ A;  4RUV A;  4TVE A;  5ELA A;  5J41 A;  2YNX A;  2MZC A;  5G5F A;  3IOS A;  2MMA A;  2I81 A;  3VPQ A;  2GST A;  3O76 A;  3JCM L;  3M1G A;  5GZZ B;  4O5Q A;  3GIX A;  3TCO A;  2WRT A;  1G7O A;  1RK4 A;  5DCG A;  4G19 A;  4MNN A;  2FCH A;  5A1N B;  1ZMA A;  3IDV A;  4OWY A;  4AJ7 A;  2E2G A;  3HMJ G;  5GAP D;  1XWK A;  4OO5 A;  3J7Y b;  4EO3 A;  1TRV A;  3ZIT A;  3TJB A;  2WCI A;  2N5B A;  1XXU A;  2A2R A;  1WRY A;  1PN0 A;  1WWJ A;  4AGS A;  1AIU A;  1AW9 A;  1GTA A;  4ZB7 A;  3NZN A;  4ZB8 A;  5ID2 A;  3ERF A;  3TJK A;  3L4N A;  4ICY A;  3ME7 A;  4A5P A;  1FW1 A;  1PKW A;  1J08 A;  3FY7 A;  3F0I A;  5DQS A;  4LLR A;  1O85 A;  4EVM A;  4XHM A;  2YZH A;  6GSU A;  2DJ3 A;  4XCS A;  5IMD A;  4FH8 A;  4IJI A;  4E8E A;  1THO A;  2MMN A;  5CRG A;  4O7H A;  5EVO A;  2CZ3 A;  3HZ8 A;  2X8H A;  3EE2 A;  3CMI A;  2R4V A;  2GSQ A;  4OCF A;  5A1N A;  2FA8 A;  2OKA A;  5EPF A;  1JZW A;  2B7K A;  3H8Q A;  1OC9 B;  4GST A;  4OO4 A;  2LJA A;  4NWY A;  3C73 A;  5ECK B;  4TR4 A;  5J4U A;  5CRH A;  5DCH A;  1MDK A;  2PGT A;  2GTU A;  1QQ2 A;  1QGV A;  4F0B A;  1T4Y A;  3H1N A;  2GT6 A;  2LRT A;  1GUL A;  2OE0 A;  3HCZ A;  3DKS A;  1K3Y A;  2AUV A;  2OT3 A;  3MWH A;  5DAL B;  2A4H A;  2DJ2 A;  2DBC A;  1EOG A;  2MBS A;  2L5O A;  2DIY A;  4BA7 A;  2P5Q A;  4YQV A;  1O81 A;  3ZRE A;  1K0C A;  1GTU A;  17GS A;  1XOA A;  2GSS A;  1WP0 A;  2VAF A;  3HJM A;  4NMU A;  3RPN A;  5IO2 A;  3M9K A;  4RQX A;  2YCD A;  1HYU A;  4W66 A;  5E4W A;  4I8B A;  4XIH A;  3I43 A;  4Z7X A;  4FQU A;  4GSN A;  3P90 A;  3RAZ A;  2R0C A;  3ED3 A;  1OC9 A;  2H0I A;  3ZL5 A;  4Z2R A;  3GV1 A;  2LRN A;  3IAM 2;  1IYH A;  4IGJ A;  4H86 A;  5LCZ A;  3KH9 A;  3KJY A;  4KCE A;  4O5U A;  4E68 A;  4KUN A;  2ES7 A;  1GH2 A;  4HDE A;  2IME A;  3CSH A;  2C0F A;  1S3A A;  2LS5 A;  1FOV A;  1YVL A;  3K8N A;  3VWX A;  5F07 A;  4EIQ A;  3W8S A;  3TDG A;  5DAL A;  5LD0 A;  1FHE A;  3MYD A;  1EGO A;  3ZVJ A;  1YEP A;  1HD2 A;  3TU3 B;  3IHG A;  1SKS B;  1FG4 A;  2E2M A;  1GTI A;  1A23 A;  1PD2 1;  1NHO A;  2O85 A;  5HR1 A;  4PGT A;  2R37 A;  2H75 A;  3UVT A;  5DJM A;  3E9J B;  3QAG A;  1BX9 A;  2J23 A;  1PMT A;  3KMO A;  3VK9 A;  1TXX A;  3U6V A;  2NDO A;  4ZL9 A;  4K7O A;  2B5X A;  3APO A;  3IA1 A;  3ZZX A;  3DYR A;  1V98 A;  3HVX A;  3HVS A;  3HD5 A;  3FKF A;  2IIY A;  4NHZ A;  4MPG A;  1HNC A;  3LXT A;  3HVV A;  5A34 B;  1X5C A;  2BJX A;  2FA4 A;  20GS A;  4AI6 A;  2QA1 A;  4YKF A;  5A5H B;  1GUM A;  2XBQ A;  2IFQ B;  4ECB A;  1XWB A;  2CA8 A;  2DKH A;  4V1A p;  2C0E A;  5KN0 A;  1RQM A;  4XRD A;  5AIV A;  3M8N A;  1K3L A;  4ECC A;  4HOJ A;  1F37 A;  1ABA A;  3PPU A;  4KH7 A;  3VPT A;  1SVL A;  2L6C A;  3QOU A;  3TJG A;  1TP9 A;  4WKW A;  3Q19 A;  5JCW A;  4NAX A;  3VWU A;  2A4V A;  1J9B A;  5A34 A;  3PIN A;  2LQO A;  4K0N A;  3GX8 A;  1OAZ A;  1U3I A;  3QPM A;  3CSJ A;  5A5H A;  1N2A A;  5ECI B;  4GQF A;  3A2X A;  4HU7 A;  2WB9 A;  5D8I A;  2IFQ A;  3F6D A;  1WJK A;  5ECO B;  3FMW A;  1EGR A;  4I2T A;  4MZB A;  1TK8 B;  1M2A A;  1FAA A;  4IP6 A;  3EIN A;  1BAY A;  4HQS A;  3TKR A;  3PGT A;  5B6N A;  2VCW A;  2YWN A;  2OE3 A;  2OAD A;  1F3B A;  4QMK A;  5IO0 A;  5D93 A;  3FEU A;  1XCC A;  2V1M A;  3HZ4 A;  5EY6 A;  1FVK A;  2V6K A;  1W4V A;  1YF0 A;  3KP8 A;  2E0Q A;  4TXO B;  1U88 A;  5G2Z A;  2K18 A;  3ZML A;  4RI6 A;  1XWG A;  6GST A;  1S3D A;  3L9U A;  2ON5 A;  4DSR A;  4ZBB A;  1SKR B;  5ECL B;  3HJO A;  1T7P B;  1TXU A;  2XHF A;  3D4T A;  2CAI A;  4OFM A;  1M9A A;  1GRX A;  2IN3 A;  4FIW A;  1PSQ A;  2K8V A;  3KEB A;  5GAN D;  1SK1 A;  4ECJ A;  2FWH A;  4ZL7 A;  3M0F A;  4EE0 A;  3G9B A;  1ACV A;  5A4U A;  5IMV A;  1AUC A;  2H30 A;  4GRF A;  2L4C A;  3FZ5 A;  2OAC A;  4I97 A;  3A5W A;  3RDW A;  2R0P A;  4MPF A;  3WT1 A;  3A3T A;  3F6F A;  2GZY A;  2WZ9 A;  1TKD B;  4MK3 A;  3DVW A;  2JSZ A;  2F9S A;  3L9V A;  6GSW A;  2QSI A;  3UVH A;  3GTU B;  1T8E B;  2H76 A;  4GSS A;  4NXI A;  3C8E A;  2BMX A;  4KW6 A;  4TXO A;  5IIZ A;  4WBR D;  1VF2 A;  3D0Z A;  4FYC A;  2DKI A;  4GTU A;  1FOH A;  3UL3 A;  2REM A;  4TR1 B;  3VWW A;  2HZE B;  1V9W A;  1WPI A;  1PL1 A;  2ZCT A;  1GP1 A;  5IPH A;  4LMV A;  2AAW A;  2C0D A;  2JL4 A;  1GWC A;  4YAP A;  5ECP B;  3QFA C;  1FVJ A;  4I6X A;  2M80 A;  2H1A A;  2MMZ A;  5F06 A;  5J40 A;  3TGZ A;  2B5E A;  3BJ5 A;  3CYN A;  1LU4 A;  2PBJ A;  9GSS A;  5HR2 A;  2C1Y A;  3APQ A;  1I5G A;  4WR4 A;  1AQW A;  4G0K A;  5IPG A;  3BOA A;  1MTC A;  4JE1 A;  4K7I A;  4K2D A;  1YEX A;  5H5R A;  5KN1 A;  4DSQ A;  2DJ1 A;  4IP1 A;  4WF4 A;  2LV3 A;  3GST A;  4BL7 B;  5IMF A;  4IVF A;  3GTU A;  2H0G A;  1YKC A;  2YV9 A;  2H0H A;  3WYW A;  1ZCP A;  1AXD A;  1G7E A;  1BJX A;  4TR1 A;  2HZE A;  3J7Y k;  4KDY A;  5HFK A;  5ID2 B;  1NW2 A;  3KMN A;  2OA7 A;  2HSM B;  4ZBA A;  4KND A;  4Q5Q A;  1WOU A;  4QL7 A;  3GNJ A;  2E7P A;  3EVI A;  2H1D A;  4BVY A;  2A2P A;  5IMZ A;  1TRW A;  1PL2 A;  1H4O A;  2LRC A;  3GUS A;  1THX A;  4J56 E;  2LUS A;  2TIR A;  2F51 A;  2AB6 A;  4MP4 A;  4ID0 A;  1F2E A;  2UV8 G;  4XS1 A;  2EFC A;  4JZQ A;  2X64 A;  2L57 A;  5KOW A;  1SD8 A;  1U6T A;  3RPP A;  2X8C A;  4FYU A;  1MDJ A;  1LBK A;  4KAE A;  5C04 A;  3H79 A;  2ZNM A;  3KH7 A;  1ZYN A;  3IHQ A;  2HRF A;  4BL7 A;  3MIX A;  1BQ7 A;  3DWV A;  4PQ1 A;  4TOP A;  4I2U A;  1XVQ A;  6GSS A;  2VM2 A;  1PKZ A;  2LST A;  3WT2 A;  5KN3 A;  4CY8 A;  2IJY A;  4ZB6 A;  1YF1 A;  1GUK A;  3EU3 A;  1OE8 A;  3FR3 A;  5ECR B;  1GSE A;  2F8F A;  1Q98 A;  11GS A;  3F8U A;  4F0C A;  1EEM A;  2VL2 A;  2HSM A;  3ZFB A;  4V2L A;  4AJ6 A;  4FYB A;  4POL A;  4LMW A;  3F4T A;  19GS A;  4IBP A;  2VIM A;  2JAC A;  3ZIJ A;  5IMA A;  2MBT A;  1F9M A;  4G2E A;  4Q5R A;  3VUR A;  1A2M A;  5AGY A;  4EKZ A;  1DBY A;  1BG5 A;  4YH2 A;  2HSN B;  1ML6 A;  2LEG A;  2OJL A;  4POB A;  1A2L A;  1EV9 A;  1B9X C;  3H93 A;  2L4Q A;  3IAS 2;  1USB A;  5JWQ B;  1BG1 A;  2YJH A;  2WFC A;  4DVC A;  1YY7 A;  2RM5 A;  1WIK A;  5ENU A;  1K0A A;  2X4A A;  5KN2 A;  1ERU A;  3LGC A;  1FO5 A;  2EFH A;  3QD9 A;  1OKT A;  2ALB A;  3ZFL A;  2J9H A;  2OBI A;  1ZYE A;  5A5K A;  2H1G A;  1ZYQ B;  5A4V A;  4N3Z A;  2IWT A;  5LNK e;  2GS3 A;  2MMO A;  2OE1 A;  2I1U A;  2LJR A;  3QFB C;  1O73 A;  2TRX A;  5KEJ A;  4POK A;  2FD3 A;  3GA4 A;  4NV5 A;  2XPD A;  3KGK A;  2R6K A;  3GFK A;  3EPT A;  2GGT A;  3E0U A;  3IC4 A;  3A2V A;  2HSY A;  3ISO A;  3FRC A;  2HSN A;  1XVW A;  2H8L A;  3BD2 A;  2LQQ A;  1SVM A;  4RQR A;  2VO4 A;  3WGE A;  1A24 A;  1R7H A;  4QL9 A;  1R5A A;  2Z9S A;  2GSR A;  3MSZ A;  4G10 A;  3KXO A;  4XRA A;  1OE7 A;  2VCV A;  3ERG A;  2F3M A;  1X5D A;  2JZS A;  1K0D A;  2N5A A;  5J4Y A;  3IV4 A;  5HFI A;  1DE1 A;  3DIE A;  3KP9 A;  1ZYP A;  4HJ2 A;  3W6G A;  4KB3 A;  2KHP A;  4BWQ A;  5E59 A;  3QAW A;  2PVQ A;  3VWV A;  3KTB A;  1M99 A;  2VD0 A;  3FR6 A;  3P7X A;  2QC7 A;  3GH6 A;  4KSM A;  4MJE A;  4XS4 B;  12GS A;  4GCI A;  2DJJ A;  3FW2 A;  2M46 A;  4ZBD A;  2YPM A;  3DVX A;  3GSS A;  2GDR A;  3D21 A;  3CTF A;  2P0G A;  5IMC A;  5L71 A;  2HRK B;  1M7T A;  4AJ8 A;  4P3Y B;  4MCU A;  2FGX A;  3UJ1 A;  4MLY A;  4NHW A;  2C0G A;  2CZ2 A;  1TRU A;  4KGI A;  3TKP A;  1OVN A;  2O7K A;  4I5Q A;  4MJB A;  1J0F A;  3R3E A;  2EC4 A;  1MEK A;  3A2W A;  1BF5 A;  2WDU A;  4LL4 B;  3GUR A;  4ZXG A;  1NHY A;  5JCU A;  2LTK A;  1GTB A;  2PUK C;  3GMF A;  1ZGN A;  3IK7 A;  2M72 A;  4AKH A;  4Z2T A;  1OC3 A;  4L5L A;  1SYR A;  5ECS A;  3TKS C;  4F03 A;  1A2J A;  1JFU A;  4CW9 A;  2LKU A;  1B48 A;  4N10 A;  5G1K A;  2PPT A;  2H19 A;  3ZLP A;  2IMD A;  3Q18 A;  2GT5 A;  3I6A A;  4PX1 A;  3H4K A;  4POM A;  1S3C A;  4XS4 A;  3NOF A;  2ON7 A;  3ZTL A;  2VOC A;  5DAK B;  1V57 A;  1KEB A;  1DUG A;  1QMV A;  1K0B A;  3UAR A;  1ERV A;  1V40 A;  2HRK A;  3IBH A;  2HI7 A;  2YAN A;  2L59 A;  2WS2 A;  4WF5 A;  2YP6 A;  2L5L A;  1O8X A;  2OBK A;  2R0G A;  4V1A g;  4GF0 A;  2R5G A;  4MMM A;  4ILF A;  5KOX A;  5G1L A;  1U3A A;  2H72 A;  1K0O A;  2YWI A;  3FZ9 A;  2DMM A;  3BBY A;  4CHS A;  3QDN A;  2PN8 A;  4USS A;  2DML A;  2LNT A;  1UA5 A;  1E6B A;  3RHC A;  1QUW A;  3SWL A;  2GLR A;  3LSZ A;  4GLT A;  1T4Z A;  2XBI A;  5G30 A;  2H66 A;  1GLP A;  5FWG A;  4F82 A;  2RUF A;  3DEX A;  1GNE A;  1GNW A;  2HXK A;  3GHA A;  4YAV A;  1A8Y A;  2P5R A;  5DAK A;  4PQH A;  1EP8 A;  2PVO C;  4ECI A;  1TOF A;  2PER A;  3F3R A;  2C3N A;  1IYI A;  2CT6 A;  5B7C A;  1X5E A;  4QQ7 A;  5ECH B;  3G7I A;  2FLS A;  3ZMK A;  2O89 A;  1Y25 A;  4HQZ A;  3KIJ A;  4EC0 A;  1URM A;  4F9Z A;  3Q6O A;  3QAV A;  3EMX A;  2NPB A;  2X49 A;  4MJA A;  2KP2 A;  2H01 A;  3IXR A;  4AKG A;  3N9J A;  4ML1 A;  5BRT A;  1UC7 A;  1N25 A;  2DC5 A;  5JWR B;  3L0H A;  3M3M A;  1T3B A;  1O7U A;  1Y1U A;  4TR0 A;  1YZX A;  5AIX A;  1ILO A;  2V32 A;  2NTO A;  13GS A;  1YKA A;  2H6Y A;  3ME8 A;  1MDI A;  3ZVJ D;  3PH9 A;  1XBS A;  3EWL A;  2QA2 A;  6GSX A;  5EL8 A;  2KUC A;  2VCZ A;  2QKE A;  1AQV A;  4OFT A;  2HZF A;  4HU9 A;  8GSS A;  3KD0 A;  4GQC A;  3UMA A;  3GKN A;  3MDK A;  1VF1 A;  4L5O A;  3LJR A;  4PNF A;  5DJL A;  3GL3 A;  4IS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...