1PGTA

Crystal structure of human glutathione s-transferase p1-1[v104] complexed with s-hexylglutathione
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
210
structure length
210
Chain Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Structure and function of the xenobiotic substrate-binding site and location of a potential non-substrate-binding site in a class pi glutathione S-transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pgtA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pgtA01
2QC7A 2VL9A 2B1KA 1MDJA 1FW1A 5DBQA 1GTBA 1R7HA 2B1LA 2YWIA 4MZWA 3C8EA 1OE8A 2ZCTA 3BCKA 2CQ9A 1JHBA 3NIVA 2J23A 1AW9A 4TXOB 2CAIA 2PGTA 4KDXA 3WD6A 3O3TA 1F3AA 1TXXA 3TDGA 1XOBA 1ZCPA 1GSDA 4BL7A 4MJAA 3JCML 4OFNA 3TRXA 20GSA 1PRXA 3KD0A 3F4SA 4KSOA 2JZTA 2F9SA 3HJOA 3BJ5A 4O5RA 2L5OA 4ZL9A 2GDRA 4BVYB 2LJKA 2R5GA 1Q98A 1YDKA 3F9UA 4JE1A 5IOWA 2PVQA 2XPEA 1GSEA 1ILOA 2H30A 2PUKC 2L5LA 1KNGA 1OC3A 1EV4A 2R3XA 4I6XA 4IS0A 1U3IA 1MD4A 2FWHA 5ECRB 4QL9A 3ZIJA 4ILFA 5GSTA 4N10A 3G7JA 2IMKA 2VOCA 3H4KA 4GWRA 3FEUA 3NOFA 4G19A 2LJRA 4ZILA 4KUNA 2D2ZA 3IOSA 1OAZA 4IGJA 4PXOA 3QPMA 3F0IA 5CRHA 4IELA 3TJFA 2VCZA 3FZ5A 3F3RA 4IQ1A 4JBBA 3Q19A 4YQUA 3Q6OA 2CVDA 1F37A 4EL1A 4TR1B 2Z9SA 3RPNA 5D9VA 4MPFA 1F6MC 2F3MA 2HRNA 1A8LA 3DEXA 1GRXA 4G0IA 2ALBA 2G2QA 3M0FA 2C3TA 2QKEA 1UN2A 1M9AA 2E0QA 3ME8A 3A2XA 3H79A 1NHOA 5JCGA 3FW2A 1TK0B 2R6KA 3WYWA 4IVFA 4IHUA 1FB6A 2VCXA 3VURA 5A4VA 5IPHA 3CSJA 2V6OA 4Q5FA 3KM6A 4WF5A 3DMLA 2PU9C 4XRAA 3IAS2 1T3BA 1PX6A 3IK9A 4BVXB 3F3QA 2XC2A 5E4WA 1UC7A 1TKDB 3UBLA 4L8EA 3GKNA 1GTUA 4TRXA 4HS1A 3KIJA 1AAZA 1R26A 5GSSA 2IWTA 4OO4A 1GSYA 4KCEA 2TRXA 1QFNA 4AF2A 2RM5A 3ZREA 1SL2B 4K8MA 3DVWA 1G6WA 2JU5A 2M80A 4E8HA 3TJBA 5ID2A 1F3BA 6GSUA 2C3NA 2OBKA 3QMXA 1K0OA 3N9JA 1X9WB 1T7PB 3H93A 1OC9B 4L5LA 5CREA 5ELGA 3A2VA 2HQTA 2H66A 3GSTA 2WB9A 2RIIA 1CQGA 1XVWA 1B4PA 3LXZA 1EP7A 3PR8A 3GMFA 5HR3A 5IPGA 2N5BA 4IBPA 3EU4A 3EU3A 3FZ9A 4O7HA 1SK1A 2DJ3A 2K8VA 2ZUPA 3GKMA 2DJKA 1ERVA 4I2UA 4KF9A 3SWLA 1CQHA 4TR0A 4LL1B 2PN8A 5G1LA 2GQKA 3ERWA 3UAPA 2JACA 2GLRA 3GURA 1RW1A 1EGOA 4DSRA 2IN3A 4KSMA 4L0WA 1F2EA 1O7UA 3LYKA 3GH9A 1XOAA 3ZFBA 2B6MA 4ID0A 2JSZA 3GSSA 4PTSA 1PQNA 4F2IA 5ECMB 3MSZA 2NPBA 1YF1A 2RM6A 1O8WA 1RQMA 3EYTA 4MZCA 1WE0A 1WMJA 1QMVA 2AB6A 5DVBA 3F6FA 2H0GA 4X43A 2YZHA 5DQYA 5JWOB 3R3EA 2C0GA 4IQAA 1XWAA 2WRTA 1TRWA 3FZ4A 2YJHA 1GUKA 5H5RA 1QXHA 1HNBA 2VL2C 2AUVA 3GL5A 1PD21 1BQ7A 4IP6A 4HOJA 1SU9A 2L6DA 14GSA 1XIYA 4HQZA 1LBKA 1EOHA 4L0UA 5CO3A 1RK4A 4KNDA 4MZBA 1Z6NA 3TJGA 2H1DA 2QSIA 9GSSA 3D4MA 4MABA 3TGZA 1KEBA 2CVKA 3DD3A 1TDIA 1O81A 2H72A 5A5KA 4L5OA 19GSA 5AIVA 4FO5A 4TR4A 2DJ1A 4GXZA 2MBSA 1OC9A 2ON5A 4F82A 4ACSA 3J7Yb 2KUCA 3ME7A 3E9JB 2ZNMA 3ERFA 3TOTA 1K0CA 4PQIA 4CW9A 4K0NA 2VM2A 4MLYA 2LS5A 3TJKA 4DSSA 3M1GA 2HSMA 4LMVA 4XS4B 4TR3A 3V1WA 4GSTA 1SYXA 3KMOA 4JRRA 2LRNA 2HLSA 1FOVA 3IR4A 5IMCA 4ZL8A 4IJ3A 4G10A 3CRUA 1Z5YE 3G7IA 3BCIA 3LSZA 6GSXA 1MDIA 2C0EA 1EV9A 1V98A 5G5EA 2VAFA 5B6MA 4OFTA 1TOFA 3L0HA 2I81A 2PERA 5ELAA 4JEDA 1ZL9A 3GA4A 3IE3A 1A2JA 1E2YA 1U3AA 1G6YA 3DXBA 3GX0A 2N5FA 4PQ1A 3M9JA 3D6IA 1SJZA 2OE3A 3D21A 4BWQA 4PNGA 3FY7A 1M2DA 5JWQB 1K0MA 3G9BA 1AXDA 5GZZB 1TU8A 4LMWA 2GT5A 1BX9A 3TJJA 5B8AA 3BD2A 3C7MA 1R5PA 4ECIA 4J57E 3ZTLA 1SKRB 1FVJA 2R37A 2H74A 1M99A 2OACA 5IMFA 3BBYA 1TK8B 2VCVA 4O32A 4N30A 3KMNA 2OBIA 1MTCA 2JSYA 4HU9A 4F03A 3LG6A 4MH3A 4POBA 3MDKA 4TVEA 4D73A 1OC8A 2DIYA 3HJPA 4FYBA 4ZL7A 3PINA 3TRQA 4WBJA 5IO2A 1FB0A 4EVMA 4HJMA 3F63A 1S3DA 2FWFA 3CXGA 4NV2A 3H1NA 2GTUA 3VWVA 4EUYA 2LNTA 2YPMA 3RHBA 3HDCA 4YQMA 2YN1A 5ECIB 3GV1A 2IIYA 2CVBA 3NZNA 1X5CA 2GZZA 2OA7A 1XVQA 4NXIA 3ZVJD 2GSRA 1SJIA 1TW9A 4WR5A 1UVZA 3P2AA 1XWKA 3ZL5A 3QD9A 2LKUA 3QFBC 5B6NA 1SK0A 1XW9A 1W89A 2HYXA 3DGQA 3VPQA 2I9HA 2GSQA 1Y25A 5FHIA 4NHZA 1O6JA 2FHEA 5EVOA 3ZZXA 2EC4A 1J9BA 3MNGA 1YKCA 2CX4A 1YF0A 2AV4A 2DJJA 2VLUA 1Z7PA 4MF7A 5JWRB 4XS6A 2KP2A 2WS2A 2YZUA 4WKWA 4FQUA 1AQVA 2VCWA 1JFUA 2B7JA 2HSYA 5J4UA 1A8YA 3UOMA 3QCPA 2LSTA 3KTBA 1BJXA 4KB3A 2H0HA 4KA0A 4NMUA 3TKSC 2IFQA 4OMVA 4ULXA 2V41A 2FA8A 1YQ1A 1O8XA 2VM1A 2PBJA 2LEGA 3UEMA 2P31A 5ECLB 2C0FA 4ZB6A 3W8SA 22GSA 3FKFA 3HY2A 1BEDA 2H75A 4XIHA 3EWLA 1V9WA 2V1MA 1W4VA 1JZOA 4H86A 1R5AA 3RBTA 2FD3A 1WJKA 3G7YA 3F8UA 2H71A 2AAWA 2FY6A 3FHKA 1ERWA 2I1UA 2H0IA 3UBKA 3PGTA 3HXSA 4JR6A 2TIRA 3LWAA 5DCGA 2MYGA 1B9YC 1ACVA 7GSSA 2VIMA 1EP8A 4ZIJA 5DAKB 3UVHA 1Q4JA 1K3OA 3MAKA 4IN0A 5HFIA 3ZFLA 1K0DA 3OR5A 4N0VA 5D9TA 2H8LA 3A5WA 3ERGA 4MH2A 2YOIA 2K9FA 1EOGA 4OFMA 3LORA 4K6XA 2XHFA 2HSNB 2LRCA 3RDWA 5COHA 3EC3A 4TXOA 1M9BA 3GKXA 4AJ8A 1H4OA 1OVNA 2HRKB 2VCTA 1HNCA 4ECBA 2A2SA 5D73A 1ERTA 3QDNA 2HE3A 3GHAA 4CDOA 2UZ8A 3WT2A 2I3YA 4K7NA 2F8FA 2CZ2A 4N0ZA 5LD0A 5HR1A 4MA9A 4BVYA 3VLNA 2LRTA 1SL0B 1H75A 2IMFA 2AYTA 2DMLA 1YEXA 5IIZA 2VL3A 3IPZA 4GLTA 5H5SA 2ES7A 2MMZA 2LJAA 3QR6A 4XRDA 4BA7A 2RUEA 1V40A 5ECOB 1GTIA 3K8NA 2H70A 4ISDA 1XWCA 4V2NA 2DBCA 4I8BA 6GSTA 2H6YA 1XZOA 1EGRA 4CHSA 2V32A 4OD7A 1PL2A 1J0FA 4FIWA 5AIXA 2B5YA 2O89A 3GIXA 3IC4A 2HRAA 3I69A 2WDUA 4JU5A 1MEKA 2RLIA 3DWVA 4FYUA 1YJ6A 5HQPA 2VLTA 5ENUA 5ECNB 5J5NA 3QFAC 3LJRA 4TR1A 5J9BA 5LCZA 3EE2A 1A2LA 1WIKA 2CZ3A 5DALB 1PA3A 2EIOA 3HA9A 4KH7A 1ZOFA 2GGTA 4MPGA 5BMUA 3GRXA 5HR0A 4WF4A 2YV7A 4NHWA 3APQA 5F05A 1THXA 3IC8A 3GUSA 1GUHA 3HJMA 2JADA 3HD5A 4KDUA 16GSA 2KP1A 1KBNA 4JR4A 3VFIA 1A23A 3IXRA 2YWMA 4RQXA 3GTUB 3ZVJA 5EPFA 5G5FA 4E8EA 1B4QA 4TXVA 1FHEA 4BVXA 3MWHA 2X8CA 2O87A 4KDYA 5J9CA 2L59A 1K0AA 2WFCA 3BOAA 2C1YA 2LQQA 2EIRA 12GSA 4OO5A 5CRDA 2MMAA 4ZBAA 1AIUA 1IYHA 2IJYA 4WXTA 4I97A 1M2AA 1TRUA 3F4TA 2E7PA 1GP1A 3WT1A 4EXJA 1LJRA 3ZMKA 6GSSA 1OE7A 5GAPD 1PL1A 5EL8A 1V2AA 2FGXA 1NSWA 4MJEA 3KZQA 5L71A 2CV4A 4PNFA 3ED3A 4K1FA 3QAWA 1JZWA 2VD1A 2L6CA 2HZEB 5CAXA 4N11A 4RQRA 18GSA 1MDKA 4NPBA 5DCHA 4RI7A 2B5XA 3VWUA 4XCSA 2B5EA 2GSTA 2GQMA 4OCEA 3CYNA 2C80A 4DSQA 2V6KA 5LNKe 2F8AA 5HR2A 2MMOA 1TI3A 5KN0A 4HZ4A 4HI7A 2PVOC 2VLVA 3KH9A 3C73A 1DBYA 3HCZA 3RHCA 2YJ7A 4X1UA 1TTZA 3P90A 1K3LA 2R4VA 4BL7B 1NW2A 3IHQA 4NAXA 1VF4A 5DQSA 2F51A 1PKZA 1SD9A 3EMXA 1YKAA 4HDEA 4JZQA 3U5RE 5JCUA 1TJDA 1U87A 2J9HA 4I5QA 1U88A 4Q5NA 2WULA 4AGSA 2H1BA 4ML6A 2G0FA 1TP9A 3HVXA 4V2MA 4V1Ap 3FZAA 3C1SA 3TKSE 1YY7A 1TI1A 1ZZYA 4LA1A 3UVTA 4TKYA 4IP1A 1AQXA 3TCOA 4MJCA 1KTEA 2DJ2A 2FUG2 1NM3A 2HRFA 3W8JA 3VWWA 1JLWA 2VO4A 1URMA 3GNJA 5IMDA 2NVLA 2ON7A 1GTAA 3QOUA 2DMMA 10GSA 5ABRA 3L9VA 1X5DA 4KW6A 2YWOA 3QAGA 2CT6A 1J08A 4J2FA 1QUWA 1O85A 3J7Yk 2GVPA 4EF0A 3L78A 3ZIVA 1USBA 2VUPA 2RUFA 11GSA 1V58A 3CSHA 3LEFA 3VI7A 3CBUA 4I2TA 4ECJA 3HYPA 2LUSA 3GN3A 1K3YA 2VCQA 4GQCA 2V2GA 5A4UA 3ZITA 2FWGA 4G9HA 3KCMA 1A24A 1ZYEA 1HYUA 1X5EA 5AISA 2IMEA 1WRYA 4PQHA 4EDYA 3F6DA 1ZMAA 1PGTA 2HZEA 1QK8A 1EWXA 3EMPA 3TRPA 1VF1A 1PX7A 3M8NA 3D22A 3FR6A 4NV5A 2BJXA 1T8EB 3TB2A 2K8SA 8GSSA 3I43A 1FG4A 2B3SA 3IA1A 4XS4A 5HFGA 1UA5A 2HFDA 4K0GA 3APSA 4MK3A 5DJLA 4POMA 5CRWA 2IMIA 1XW5A 5DDLA 3KGKA 3EINA 5IOXA 2GSSA 3GX8A 4YAVA 4TOPA 2OADA 1S3AA 4ZB9A 3A2WA 2X8HA 1BAYA 2IMDA 3WGEA 4F0CA 5G2ZA 1SL1B 1VGLA 2M72A 4RI6A 1Y6EA 4HZ2A 1HNAA 2LV3A 2MMNA 1WOUA 4RUVA 3H8QA 3CMIA 1T4ZA 2H76A 1C72A 5J41A 1XPVA 3TUEA 2WGRA 4K7OA 1VF3A 1VF2A 3N5OA 4PGTA 2PPTA 5ID2B 1XWGA 2K18A 1AUCA 3TKRA 1I9DA 5A4WA 5CP1A 4AJ7A 1Z7RA 3TKPA 3D5JA 5CNWA 3D0ZA 6GSYA 4HUAA 5IMAA 1ABAA 3VI5A 3EVIA 2HXKA 2L4CA 3TKSA 4G0LA 2H19A 3PPUA 1XXUA 2LQOA 5KN2A 3IRAA 3M9KA 4ZXGA 2YWNA 3FR9A 4PURA 5KN3A 3SBCA 1PN9A 3O76A 4ML1A 3IK7A 4V2LA 1G7EA 4PUFC 2NBSA 5ECSA 5ECPB 4TN8A 1ZYQB 3M3MA 1I5GA 1Z9HA 1VRSD 2O8VB 5GAND 1G0TA 4KAEA 1T4YA 3P7XA 2C4JA 1XBSA 1X9MB 2A4VA 2HZFA 3HHVA 2H1GA 1JZDA 3CTFA 2KLXA 3CTGA 3ZLPA 1GL8A 1X0RA 1PMTA 3GYKA 3FRCA 4K9ZA 2YV9A 1TRVA 2HI7A 2H1AA 5KEJA 5EY6A 2H01A 4KCAA 2YNXA 2WJUA 5F8BA 2P5QA 2A2RA 2MBTA 3L4NA 4FH8A 2JL4A 4KGIA 2CX3A 1SKSB 4XHMA 3GKKA 3LQ7A 2X99A 3HZ4A 5DJMA 1ST9A 2LNSA 3UMAA 3DKSA 4MMMA 1WP0A 1MD3A 4WEYA 3LGCA 5B8BA 1ON4A 3IV4A 5INYA 1GULA 4K7IA 3ZYWA 1HD2A 3D4TA 3IAM2 1N8JA 3DVXA 4LL4B 2QGVA 3DYRA 5D9WA 1B8XA 3S9FA 3HZ8A 1GH2A 1GUMA 2OE0A 3GFKA 5ECHB 1EEMA 2YCDA 3WGXA 4O92A 4ECCA 2HSHA 4WR4A 1R4WA 3FK8A 13GSA 3PH9A 3HVSA 1B48A 3W6GA 1THOA 2I4AA 1AQWA 1M7TA 2PMTA 2LTKA 1XWBA 4F9ZA 1OYJA 1FAAA 1GNWA 1G7OA 1DSBA 1GSFA 2R2JA 5IMZA 3UIWA 2XPDA 3KP9A 2FA4A 4GSSA 5C04A 4MJBA 5IM9A 2OE1A 3GH6A 2C3QA 2X8GA 3F4RA 2XBIA 5D8IA 4DSSB 4POLA 1BYEA 2HSMB 4J56E 4XS1A 4USSA 4TW5A 3IBHA 5FWGA 3KP8A 4DVCA 3DIEA 1QQ2A 4OCFA 5J3RA 5KN1A 1BG5A 5AN1A 1K0NA 2MZCA 3VPTA 4IKHA 4MF6A 5G1KA 1TU7A 2FCHA 5DAKA 4GRFA 1FO5A 2CA8A 3TKQA 4HEA2 4IW9A 1XW6A 2H73A 5FT3A 1U6TA 4KE3A 1YEPA 2KHPA 5F06A 3R2QA 5B7CA 4GTUA 1F9MA 3I6AA 1M0UA 3HVVA 5AGYA 2DJ0A 2REMA 4V1Ag 3GL3A 2C8UA 2L4QA 4QL7A 1DE2A 2DC5A 3UARA 5G31A 3L9SA 1EEJA 4PUAA 3Q74A 4DEJA 1TRSA 1HQOA 2HRKA 1E6BA 4KX4A 4EKZA 2PWJA 2GZYA 4HJ2A 1OKDA 1GWCA 2VL2A 4BWSA 2L57A 1WPIA 1O73A 5H5QA 4GF0A 1FVKA 2N5AA 2O85A 1S3CA 5CYYA 2FNOA 4Q5RA 5HFKA 4MP4A 3TOUA 3LXTA 3L9UA 4HU7A 1A0RP 1Z3EA 1A2MA 2FWEA 4D73B 5D93A 4GQFA 6GSWA 3LFLA 1NHYA 4YH2A 2VD0A 5F07A 1SYRA 4MCUA 4XTSA 2P5RA 1PSQA 4EE0A 3ISOA 1GSUA 1T00A 1AC1A 2AHEA 3FR3A 2FLSA 3U6VA 4Z7XA 3O6TA 2GQLA 3HKRA 5IO0A 1WWJA 5F0GA 2DSAA 1SKWB 3KEBA 2P0GA 2IPAA 1GSQA 5IQYA 2JZSA 1DE1A 5D96A 4QQ7A 4NWYA 1ZGNA 1V57A 2WZ9A 4IJIA 1GNEA 3LYPA 3EURA 4GCIA 2EIQA 3KJYA 5E59A 4K2DA 1TK5B 4ZBDA 2YP6A 4EO3A 4OWYA 1YZXA 5DALA 4MF5A 2GT6A 1SK2A 1ML6A 3I9V2 2GS3A 3RPPA 1DUGA 1XCCA 3IDVA 5G30A 1PKWA 4ZBBA 2JZRA 5ECQB 3Q18A 3ZRDA 4P3YB 3E0UA 5D9XA 2KOKA 3E3EA 17GSA 4PX1A 3UJ1A 3CRTA 1T1VA 1N2AA 2HNLA 3C71A 4FYCA 2E2MA 4ZB8A 3DRNA 4Q5QA 2B7KA 1EZKA 2K6VA 3US3A 4HQSA 2AJQB 5C00A 3C1RA 4WBRD 3GTUA 1A0FA 2M46A 2IFQB 1GSSA 2OJLA 2E2GA 4F0BA 1ERUA 4YAPA 4G2EA 2NDOA 1X9SB 2HT9A 2TRCP 3KTLA 2O7KA 2NTOA 5ECKB 3FYGA 3APOA 3UL3A 3KH7A 3QAVA 3VWXA 4EC0A 4YQVA 3AY8A 1M2BA 2GZPA 1IYIA 3KXOA 2C0DA 2XBQA 4G0KA 4EDZA 2YANA 2CAQA 1SENA 2IL3A 1GLQA 5CRGA 1OKTA 1JZRA 4WETA 2BMXA 1SD8A 3P8WA 3A3TA 1QGVA 4X0XA 3RAZA 1XFLA 1LU4A 4AJ6A 3CSIA 4POKA 1GLPA 3WGDA 1B9XC 1K0BA 2H6XA 1JLVA 2DLXA 5JCWA 1SJ6A 4LLRA 2OKAA 6GSVA 2WCIA 4BPYA 2BTOT 2DIZA 4GSNA 1Z6MA 2X64A 4MDCA 3ZMLA 5IMVA 3VK9A 2H6ZA
chains in the Genus database with same CATH superfamily
2QC7A 2VL9A 2B1KA 1MDJA 1FW1A 5DBQA 1GTBA 1R7HA 2B1LA 2YWIA 4MZWA 3C8EA 1OE8A 2ZCTA 3BCKA 2CQ9A 1JHBA 3NIVA 2J23A 1AW9A 4TXOB 2CAIA 2PGTA 4KDXA 3WD6A 3RFRC 3O3TA 1F3AA 1TXXA 3TDGA 1XOBA 1ZCPA 1GSDA 4BL7A 4MJAA 3JCML 1S4BP 4OFNA 3TRXA 20GSA 1ZYPA 1PRXA 3KD0A 3F4SA 4KSOA 2JZTA 5A34B 2F9SA 3HJOA 3BJ5A 4O5RA 2L5OA 4ZL9A 2GDRA 4BVYB 2LJKA 2R5GA 1Q98A 1YDKA 3F9UA 4JE1A 5IOWA 2PVQA 2XPEA 4K5RA 1GSEA 1ILOA 2H30A 2PUKC 2L5LA 4YKGA 1KNGA 2UV8G 1OC3A 1EV4A 2R3XA 4I6XA 4IS0A 5A5HB 1U3IA 1MD4A 2FWHA 5ECRB 4QL9A 3ZIJA 4ILFA 5GSTA 4N10A 3G7JA 2IMKA 2VOCA 3H4KA 4GWRA 4AKGA 3FEUA 3NOFA 4G19A 2LJRA 4ZILA 4KUNA 2D2ZA 3IOSA 1OAZA 4IGJA 4PXOA 3QPMA 3F0IA 5CRHA 4IELA 3TJFA 2VCZA 3FZ5A 3F3RA 4IQ1A 4JBBA 3Q19A 4YQUA 3Q6OA 2O5VA 2CVDA 1F37A 4EL1A 4TR1B 2Z9SA 3RPNA 5D9VA 4MPFA 1F6MC 2F3MA 2HRNA 1A8LA 3DEXA 4G01A 3IHGA 1GRXA 4G0IA 5J4YA 2ALBA 2G2QA 3M0FA 2C3TA 2QKEA 1UN2A 1M9AA 5BMUB 2E0QA 3ME8A 3A2XA 3H79A 1NHOA 5JCGA 3FW2A 1TK0B 2R6KA 3WYWA 4IVFA 4IHUA 1FB6A 2VCXA 3VURA 5A4VA 5IPHA 3CSJA 4O5QA 2V6OA 4EIQA 4Q5FA 3KM6A 4WF5A 3DMLA 2PU9C 4XRAA 1XG8A 3IAS2 1T3BA 1PX6A 3IK9A 4BVXB 3F3QA 2XC2A 5E4WA 1UC7A 1TKDB 3UBLA 4L8EA 3GKNA 1GTUA 4Z2UA 4TRXA 4HS1A 3KIJA 1AAZA 1R26A 5GSSA 2IWTA 4OO4A 5A34A 1GSYA 4KCEA 2TRXA 1QFNA 4AF2A 2RM5A 3ZREA 1SL2B 4K8MA 3DVWA 1G6WA 2JU5A 2M80A 4E8HA 3TJBA 5ID2A 1F3BA 6GSUA 2C3NA 2OBKA 3QMXA 1K0OA 3N9JA 1X9WB 4K5SA 1T7PB 3H93A 1OC9B 4L5LA 5CREA 5ELGA 3A2VA 2HQTA 2H66A 3GSTA 2WB9A 2RIIA 1CQGA 1XVWA 1B4PA 3LXZA 1EP7A 3PR8A 3GMFA 5HR3A 1FOHA 5IPGA 2N5BA 4IBPA 3EU4A 3EU3A 2EFEA 3FZ9A 4O7HA 1SK1A 2DJ3A 2K8VA 2ZUPA 3GKMA 2DJKA 1ERVA 4I2UA 4KF9A 3SWLA 1CQHA 4TR0A 4LL1B 2WVYA 2PN8A 5G1LA 2GQKA 3ERWA 3UAPA 2JACA 2GLRA 3GURA 1RW1A 1EGOA 4DSRA 2IN3A 4KSMA 4L0WA 1F2EA 1O7UA 3LYKA 3GH9A 1XOAA 3ZFBA 2B6MA 4ID0A 2JSZA 4BIKA 3GSSA 4PTSA 1PQNA 4F2IA 5ECMB 3MSZA 2WVXB 2NPBA 1YF1A 2RM6A 1O8WA 1RQMA 3EYTA 4MZCA 1WE0A 1WMJA 1QMVA 5A1NA 2AB6A 5DVBA 3F6FA 2H0GA 4X43A 2YZHA 5DQYA 5JWOB 3R3EA 2C0GA 4IQAA 1XWAA 2WRTA 1TRWA 3FZ4A 2YJHA 3TU3B 1GUKA 5H5RA 1QXHA 1HNBA 2VL2C 2AUVA 3GL5A 1PD21 1BQ7A 4IP6A 4HOJA 1SU9A 2L6DA 14GSA 1XIYA 4HQZA 1LBKA 1EOHA 4L0UA 5CO3A 1RK4A 4KNDA 4MZBA 1Z6NA 3TJGA 2H1DA 2QSIA 9GSSA 3D4MA 4MABA 3TGZA 1KEBA 2CVKA 3DD3A 1TDIA 1O81A 2H72A 5A5KA 4L5OA 19GSA 5AIVA 4FO5A 4TR4A 2DJ1A 4GXZA 2MBSA 1OC9A 2ON5A 4F82A 4ACSA 3J7Yb 2KUCA 3ME7A 3E9JB 2ZNMA 3ERFA 3TOTA 1K0CA 4PQIA 4CW9A 4K0NA 2VM2A 4MLYA 2LS5A 3TJKA 4DSSA 3M1GA 2HSMA 4LMVA 4XS4B 4TR3A 3V1WA 4GSTA 1SYXA 3KMOA 4JRRA 2LRNA 2EFDA 2HLSA 1FOVA 3IR4A 5IMCA 4ZL8A 4IJ3A 4G10A 3CRUA 1Z5YE 3G7IA 3BCIA 3LSZA 6GSXA 1MDIA 2C0EA 1EV9A 1V98A 1M3IA 5G5EA 5KOWA 5J47A 2VAFA 5B6MA 4OFTA 1TOFA 3L0HA 2I81A 2PERA 5ELAA 4JEDA 1ZL9A 3GA4A 3IE3A 1A2JA 1E2YA 1SVOA 1G6YA 1U3AA 3DXBA 3GX0A 4AKIA 2N5FA 4PQ1A 3M9JA 3D6IA 1SJZA 2OE3A 3D21A 4BWQA 4PNGA 3FY7A 1M2DA 5JWQB 1K0MA 3G9BA 1AXDA 5GZZB 1TU8A 4LMWA 2GT5A 1BX9A 3TJJA 5B8AA 3BD2A 3C7MA 4ICYA 1R5PA 4ECIA 4J57E 3ZTLA 1SKRB 1FVJA 2R37A 2H74A 1M99A 2OACA 5IMFA 3BBYA 1TK8B 4FXYP 2VCVA 4O32A 4N30A 3KMNA 2OBIA 1MTCA 2JSYA 4HU9A 4F03A 3LG6A 4MH3A 4POBA 3MDKA 4TVEA 4D73A 1OC8A 2DIYA 3HJPA 4FYBA 4ZL7A 3PINA 3TRQA 4WBJA 5IO2A 1FB0A 4EVMA 4HJMA 3F63A 1S3DA 2FWFA 3CXGA 4NV2A 3H1NA 2GTUA 3VWVA 4EUYA 2LNTA 2YPMA 3RHBA 3HDCA 4YQMA 2YN1A 5ECIB 3GV1A 2IIYA 2CVBA 3NZNA 1X5CA 2GZZA 2OA7A 1XVQA 4NXIA 3ZVJD 2GSRA 1SJIA 1TW9A 4WR5A 1UVZA 3P2AA 4AKXB 1XWKA 3ZL5A 3QD9A 2LKUA 3QFBC 5B6NA 1SK0A 1XW9A 1W89A 1N25A 2HYXA 3DGQA 3VPQA 2I9HA 2GSQA 1Y25A 5FHIA 4NHZA 1O6JA 2FHEA 5EVOA 3ZZXA 2EC4A 1J9BA 3MNGA 1YKCA 2CX4A 1YF0A 2AV4A 2DJJA 2VLUA 1Z7PA 4MF7A 5JWRB 4XS6A 2KP2A 4CY8A 2WS2A 2YZUA 4WKWA 4FQUA 1AQVA 2VCWA 1S3RA 1JFUA 2B7JA 2HSYA 5J4UA 1A8YA 3UOMA 3QCPA 2LSTA 3KTBA 1BJXA 4W66A 4KB3A 2H0HA 4KA0A 4NMUA 3TKSC 2IFQA 4PI0C 4OMVA 4ULXA 2V41A 2FA8A 1YQ1A 1O8XA 2VM1A 2PBJA 2LEGA 3UEMA 2P31A 5ECLB 2C0FA 4ZB6A 3W8SA 22GSA 3FKFA 3HY2A 1BEDA 2H75A 4XIHA 3EWLA 1V9WA 2V1MA 1W4VA 1JZOA 4H86A 1R5AA 3RBTA 2FD3A 4PHZC 1WJKA 3G7YA 3F8UA 2H71A 4ZB7A 2AAWA 2FY6A 3FHKA 1ERWA 2I1UA 4AI6A 2H0IA 3UBKA 3PGTA 3HXSA 4JR6A 2TIRA 3LWAA 5DCGA 2MYGA 1B9YC 1ACVA 7GSSA 2VIMA 1EP8A 4ZIJA 5DAKB 3UVHA 1Q4JA 1K3OA 3MAKA 4IN0A 5HFIA 3ZFLA 2O36A 1K0DA 3OR5A 4N0VA 5D9TA 2H8LA 3A5WA 3ERGA 4MH2A 2YOIA 2K9FA 3LW9A 1EOGA 4OFMA 3LORA 2QA2A 4K6XA 2XHFA 2HSNB 2LRCA 3RDWA 1PFOA 5COHA 3EC3A 4TXOA 1M9BA 3GKXA 4AJ8A 1H4OA 1OVNA 2HRKB 2VCTA 1HNCA 4ECBA 2A2SA 5D73A 1ERTA 3QDNA 2HE3A 3GHAA 4CDOA 2UZ8A 3WT2A 2I3YA 4K7NA 2F8FA 2CZ2A 4N0ZA 5LD0A 5HR1A 4MA9A 4BVYA 3VLNA 2LRTA 1SL0B 1H75A 2IMFA 2AYTA 2DMLA 1YEXA 5IIZA 2VL3A 3IPZA 4GLTA 5H5SA 2ES7A 2MMZA 2LJAA 3QR6A 4XRDA 4BA7A 2RUEA 5A5HA 1V40A 5ECOB 1GTIA 3K8NA 2H70A 2DKIA 4ISDA 1XWCA 4V2NA 1SVMA 2DBCA 4I8BA 6GSTA 2H6YA 4X4JA 1XZOA 3A5IA 4CHSA 1BG1A 2V32A 1EGRA 4OD7A 1PL2A 1J0FA 4FIWA 5AIXA 2B5YA 2O89A 3GIXA 3IC4A 2HRAA 3I69A 4QMKA 2WDUA 4JU5A 1MEKA 2RLIA 3DWVA 4FYUA 4E68A 1YJ6A 5HQPA 2VLTA 5ENUA 5ECNB 5J5NA 3QFAC 3LJRA 4TR1A 5J9BA 5LCZA 3EE2A 1A2LA 1WIKA 2CZ3A 5J4VA 5DALB 1PA3A 2EIOA 3HA9A 4KH7A 1ZOFA 2GGTA 4MPGA 5BMUA 3GRXA 5HR0A 1TXUA 2EFHA 4WF4A 2YV7A 4NHWA 3APQA 5F05A 2WW3A 1THXA 3IC8A 3GUSA 1GUHA 3HJMA 2JADA 3HD5A 4KDUA 16GSA 1YVLA 2KP1A 3CQFA 3RGBC 1KBNA 4JR4A 3VFIA 1A23A 3IXRA 2YWMA 4RQXA 3GTUB 3ZVJA 5EPFA 5G5FA 4E8EA 1B4QA 4TXVA 1FHEA 4BVXA 3MWHA 2X8CA 2O87A 4KDYA 5J9CA 2L59A 1K0AA 2WFCA 3BOAA 2C1YA 2LQQA 2EIRA 3CHXC 12GSA 4OO5A 3EPTA 5CRDA 2MMAA 4ZBAA 1AIUA 1IYHA 2IJYA 4WXTA 4I97A 1M2AA 1TRUA 3F4TA 2E7PA 1GP1A 3WT1A 4HSCX 4EXJA 1LJRA 3ZMKA 6GSSA 1OE7A 5GAPD 1PL1A 5EL8A 1V2AA 2FGXA 1NSWA 4MJEA 3KZQA 5L71A 2CV4A 4PNFA 3ED3A 4K1FA 3QAWA 1JZWA 2VD1A 2L6CA 2HZEB 5CAXA 4N11A 4RQRA 18GSA 1MDKA 4NPBA 5DCHA 4RI7A 2B5XA 3VWUA 4XCSA 2B5EA 1BF5A 2GSTA 2GQMA 4OCEA 3CYNA 2C80A 4DSQA 2V6KA 5LNKe 2F8AA 5HR2A 2MMOA 1TI3A 5KN0A 4HZ4A 4HI7A 2PVOC 2VLVA 3KH9A 3C73A 4EIPA 1DBYA 3HCZA 3RHCA 2YJ7A 4X1UA 1TTZA 3P90A 1K3LA 2R4VA 4BL7B 1NW2A 3IHQA 4NAXA 1VF4A 5DQSA 2F51A 1PKZA 1SD9A 3EMXA 1YKAA 4HDEA 4JZQA 3U5RE 5JCUA 1TJDA 1U87A 2J9HA 1YEWC 2WW0A 4I5QA 1U88A 4Q5NA 2WULA 4AGSA 2H1BA 4ML6A 2G0FA 2WVXA 1TP9A 3HVXA 4V2MA 3FZAA 4V1Ap 3C1SA 3TKSE 1YY7A 1TI1A 2X49A 1ZZYA 4LA1A 3UVTA 4TKYA 4IP1A 1AQXA 3TCOA 4MJCA 1KTEA 2DJ2A 2FUG2 1NM3A 2HRFA 3W8JA 3VWWA 1JLWA 2VO4A 1URMA 3GNJA 5IMDA 2NVLA 2ON7A 1GTAA 3QOUA 2DMMA 10GSA 5ABRA 3L9VA 1X5DA 4KW6A 2YWOA 3QAGA 2CT6A 1J08A 4J2FA 1QUWA 1O85A 3J7Yk 2GVPA 4EF0A 4Z2TA 3L78A 3ZIVA 1USBA 2VUPA 2RUFA 11GSA 1V58A 3CSHA 3LEFA 5J40A 3CBUA 3VI7A 4ECJA 4I2TA 3HYPA 2LUSA 3GN3A 2R0PA 1K3YA 2VCQA 4GQCA 2V2GA 5A4UA 3ZITA 2FWGA 4G9HA 3KCMA 1A24A 1ZYEA 1HYUA 1X5EA 5AISA 2IMEA 1WRYA 4PQHA 4EDYA 3F6DA 1ZMAA 4O5UA 1PGTA 2HZEA 1QK8A 1EWXA 3EMPA 3TRPA 1VF1A 1PX7A 3M8NA 3D22A 3FR6A 4NV5A 2BJXA 1T8EB 3TB2A 2K8SA 8GSSA 3I43A 1FG4A 2B3SA 3IA1A 4XS4A 5HFGA 3HMJG 3APSA 1UA5A 2HFDA 4K0GA 2O3EA 4MK3A 5DJLA 4POMA 5CRWA 2IMIA 1XW5A 5DDLA 3KGKA 3EINA 5IOXA 2GSSA 3GX8A 4YAVA 4Z2RA 2DKHA 4TOPA 2OADA 1S3AA 4ZB9A 3A2WA 2X8HA 1BAYA 2IMDA 3WGEA 4F0CA 5G2ZA 1SL1B 1VGLA 2M72A 4RI6A 1Y6EA 4HZ2A 1HNAA 2LV3A 2MMNA 1WOUA 4RUVA 3H8QA 3CMIA 1Y1UA 1T4ZA 2H76A 1C72A 5J41A 1XPVA 3TUEA 2WGRA 4K7OA 1VF3A 1VF2A 3N5OA 4PGTA 2PPTA 5ID2B 1XWGA 2K18A 1AUCA 3TKRA 1I9DA 5A4WA 5CP1A 4AJ7A 1Z7RA 3TKPA 3D5JA 4PI2C 5CNWA 3D0ZA 6GSYA 4HUAA 5IMAA 1ABAA 3VI5A 3EVIA 2HXKA 2L4CA 3TKSA 4G0LA 2H19A 3PPUA 1XXUA 2LQOA 5KN2A 3IRAA 2H1LA 3M9KA 4ZXGA 2YWNA 3FR9A 4PURA 5KN3A 3SBCA 1PN9A 3O76A 4ML1A 3IK7A 4V2LA 1G7EA 4PUFC 2NBSA 5ECSA 5ECPB 4TN8A 1ZYQB 3M3MA 1I5GA 1Z9HA 1VRSD 2O8VB 5GAND 1G0TA 4KAEA 1T4YA 3P7XA 2C4JA 1XBSA 1X9MB 2A4VA 2VKZG 2HZFA 3HHVA 1I1IP 2H1GA 1JZDA 2OT3A 3CTFA 2X4AA 2KLXA 3CTGA 3ZLPA 1GL8A 1X0RA 1PMTA 3GYKA 3FRCA 4K9ZA 2YV9A 1TRVA 2HI7A 2H1AA 5KEJA 5EY6A 2H01A 4KCAA 2YNXA 2WJUA 5F8BA 2P5QA 2A2RA 4A5PA 5BRTA 2MBTA 3L4NA 4FH8A 2JL4A 4KGIA 2CX3A 1SKSB 4XHMA 5A1NB 3GKKA 3LQ7A 2X99A 3HZ4A 5DJMA 1ST9A 2LNSA 3UMAA 3DKSA 4MMMA 1WP0A 1MD3A 4WEYA 1SVLA 3LGCA 5B8BA 1ON4A 3IV4A 5INYA 1GULA 4K7IA 3ZYWA 1HD2A 3D4TA 3IAM2 1N8JA 3DVXA 4LL4B 2QGVA 3DYRA 5D9WA 1B8XA 3S9FA 2WZSA 3HZ8A 1GH2A 1GUMA 4N3ZA 2OE0A 3GFKA 5ECHB 1EEMA 2YCDA 3WGXA 4O92A 4ECCA 2HSHA 4AKHA 4WR4A 1R4WA 3FK8A 13GSA 3PH9A 3HVSA 1B48A 3W6GA 1THOA 2I4AA 1AQWA 1M7TA 2PMTA 2LTKA 1XWBA 4F9ZA 1OYJA 1FAAA 1GNWA 1G7OA 1DSBA 1GSFA 2R2JA 5IMZA 3UIWA 2XPDA 3KP9A 2FA4A 4GSSA 5C04A 4MJBA 5IM9A 2OE1A 3GH6A 2C3QA 2X8GA 3F4RA 2XBIA 5D8IA 4DSSB 4POLA 1BYEA 2HSMB 4J56E 4XS1A 3FMWA 4USSA 4TW5A 3IBHA 5FWGA 3KP8A 4DVCA 3DIEA 1QQ2A 4OCFA 5J3RA 5KN1A 1BG5A 5AN1A 1K0NA 1M3JA 3MYDA 2MZCA 3VPTA 3HVNA 4IKHA 4MF6A 2WW1A 4CY6A 2A4HA 5G1KA 1TU7A 2FCHA 5DAKA 4GRFA 1FO5A 2CA8A 3TKQA 4HEA2 4IW9A 1XW6A 2H73A 5FT3A 1U6TA 4KE3A 1YEPA 2KHPA 5F06A 3R2QA 5B7CA 4GTUA 1F9MA 3I6AA 1M0UA 3HVVA 5AGYA 2HSNA 2DJ0A 2REMA 4V1Ag 3GL3A 2EFCA 2C8UA 2L4QA 4QL7A 2QA1A 1DE2A 2DC5A 3UARA 5G31A 3L9SA 1EEJA 4PUAA 2R0CA 3Q74A 4DEJA 1TRSA 1HQOA 2HRKA 1E6BA 4KX4A 4EKZA 2PWJA 2GZYA 4HJ2A 1OKDA 1GWCA 2VL2A 4BWSA 2L57A 1WPIA 1O73A 5H5QA 4GF0A 1FVKA 1ZYNA 2N5AA 2O85A 1S3CA 5CYYA 2FNOA 4Q5RA 5HFKA 4MP4A 3TOUA 3LXTA 3L9UA 4HU7A 1A0RP 1Z3EA 1A2MA 2FWEA 4D73B 5D93A 4GQFA 6GSWA 4K2XA 3LFLA 4YKFA 1NHYA 4YH2A 2VD0A 5F07A 1SYRA 2WVZA 4MCUA 4XTSA 2P5RA 1PSQA 4EE0A 3ISOA 1GSUA 1T00A 1AC1A 2R0GA 2AHEA 3FR3A 2FLSA 3U6VA 4Z7XA 3O6TA 2GQLA 3HKRA 5IO0A 1WWJA 5F0GA 2DSAA 4MNNA 1SKWB 3KEBA 2P0GA 2IPAA 1GSQA 5IQYA 2JZSA 1DE1A 5D96A 4QQ7A 4NWYA 1ZGNA 1V57A 2WZ9A 4IJIA 1GNEA 3LYPA 3EURA 4GCIA 2EIQA 3KJYA 5E59A 4K2DA 1TK5B 4ZBDA 2YP6A 4EO3A 4OWYA 1YZXA 5DALA 4MF5A 2GT6A 3CWGA 1SK2A 1ML6A 3I9V2 2GS3A 3RPPA 1DUGA 1XCCA 3IDVA 5G30A 1PKWA 4ZBBA 2JZRA 5ECQB 3Q18A 3ZRDA 4P3YB 3E0UA 5D9XA 2KOKA 3E3EA 17GSA 4PX1A 3UJ1A 3CRTA 1T1VA 1N2AA 2HNLA 3C71A 4FYCA 2E2MA 4ZB8A 3DRNA 4Q5QA 2B7KA 1EZKA 2K6VA 3US3A 4HQSA 2AJQB 5C00A 3C1RA 4WBRD 3GTUA 1A0FA 2M46A 2IFQB 1GSSA 2OJLA 2E2GA 4F0BA 3MIXA 1ERUA 4YAPA 4G2EA 2NDOA 1X9SB 2HT9A 2TRCP 3KTLA 2O7KA 2NTOA 5ECKB 3FYGA 3APOA 4GDFA 3UL3A 3KH7A 3QAVA 3VWXA 4EC0A 4YQVA 3AY8A 1M2BA 2GZPA 1IYIA 3KXOA 2C0DA 2XBQA 4G0KA 4EDZA 2YANA 2CAQA 1SENA 2IL3A 1GLQA 5CRGA 1OKTA 1JZRA 4WETA 2BMXA 1SD8A 3P8WA 5KOXA 3A3TA 1QGVA 2A2PA 4X0XA 3RAZA 1XFLA 1LU4A 4AJ6A 3CSIA 4POKA 1PN0A 1GLPA 3WGDA 1B9XC 1K0BA 2WW2A 2H6XA 1JLVA 2DLXA 5JCWA 1SJ6A 4LLRA 2OKAA 6GSVA 2WCIA 4BPYA 2BTOT 2DIZA 4GSNA 1Z6MA 2X64A 4MDCA 3ZMLA 5IMVA 3VK9A 2H6ZA
chains in the Genus database with same CATH topology
2QC7A 2VL9A 2B1KA 1MDJA 1FW1A 5DBQA 1GTBA 1R7HA 2B1LA 2YWIA 4MZWA 3C8EA 1OE8A 2ZCTA 3BCKA 2CQ9A 1JHBA 3NIVA 2J23A 1AW9A 4TXOB 2CAIA 2PGTA 4KDXA 3WD6A 3O3TA 1F3AA 1TXXA 3TDGA 1XOBA 1ZCPA 1GSDA 4BL7A 4MJAA 3JCML 4OFNA 3TRXA 20GSA 1ZYPA 1PRXA 3KD0A 3F4SA 4KSOA 2JZTA 5A34B 2F9SA 3HJOA 3BJ5A 4O5RA 2L5OA 4ZL9A 2GDRA 4BVYB 2LJKA 2R5GA 1Q98A 1YDKA 3F9UA 4JE1A 5IOWA 2PVQA 2XPEA 4K5RA 1GSEA 1ILOA 2H30A 2PUKC 2L5LA 4YKGA 1KNGA 2UV8G 1OC3A 1EV4A 2R3XA 4I6XA 4IS0A 5A5HB 1U3IA 1MD4A 2FWHA 5ECRB 4QL9A 3ZIJA 4ILFA 5GSTA 4N10A 3G7JA 2IMKA 2VOCA 3H4KA 4GWRA 4AKGA 3FEUA 3NOFA 4G19A 2LJRA 4ZILA 4KUNA 2D2ZA 3IOSA 1OAZA 4IGJA 4PXOA 3QPMA 3F0IA 5CRHA 4IELA 3TJFA 2VCZA 3FZ5A 3F3RA 4IQ1A 4JBBA 3Q19A 4YQUA 3Q6OA 2O5VA 2CVDA 1F37A 4EL1A 4TR1B 2Z9SA 3RPNA 5D9VA 4MPFA 1F6MC 2F3MA 2HRNA 1A8LA 3DEXA 4G01A 3IHGA 1GRXA 4G0IA 5J4YA 2ALBA 2G2QA 3M0FA 2C3TA 2QKEA 1UN2A 1M9AA 5BMUB 2E0QA 3ME8A 3A2XA 3H79A 1NHOA 5JCGA 3FW2A 1TK0B 2R6KA 3WYWA 4IVFA 4IHUA 1FB6A 2VCXA 3VURA 5A4VA 5IPHA 3CSJA 4O5QA 2V6OA 4EIQA 4Q5FA 3KM6A 4WF5A 3DMLA 2PU9C 4XRAA 3IAS2 1T3BA 1PX6A 3IK9A 4BVXB 3F3QA 2XC2A 5E4WA 1UC7A 1TKDB 3UBLA 4L8EA 3GKNA 1GTUA 4Z2UA 4TRXA 4HS1A 3KIJA 1AAZA 1R26A 5GSSA 2IWTA 4OO4A 5A34A 1GSYA 4KCEA 2TRXA 1QFNA 4AF2A 2RM5A 3ZREA 1SL2B 4K8MA 3DVWA 1G6WA 2JU5A 2M80A 4E8HA 3TJBA 5ID2A 1F3BA 6GSUA 2C3NA 2OBKA 3QMXA 1K0OA 3N9JA 1X9WB 4K5SA 1T7PB 3H93A 1OC9B 4L5LA 5CREA 5ELGA 3A2VA 2HQTA 2H66A 3GSTA 2WB9A 2RIIA 1CQGA 1XVWA 1B4PA 3LXZA 1EP7A 3PR8A 3GMFA 5HR3A 1FOHA 5IPGA 2N5BA 4IBPA 3EU4A 3EU3A 2EFEA 3FZ9A 4O7HA 1SK1A 2DJ3A 2K8VA 2ZUPA 3GKMA 2DJKA 1ERVA 4I2UA 4KF9A 3SWLA 1CQHA 4TR0A 4LL1B 2PN8A 5G1LA 2GQKA 3ERWA 3UAPA 2JACA 2GLRA 3GURA 1RW1A 1EGOA 4DSRA 2IN3A 4KSMA 4L0WA 1F2EA 1O7UA 3LYKA 3GH9A 1XOAA 3ZFBA 2B6MA 4ID0A 2JSZA 3GSSA 4PTSA 1PQNA 4F2IA 5ECMB 3MSZA 2NPBA 1YF1A 2RM6A 1O8WA 1RQMA 3EYTA 4MZCA 1WE0A 1WMJA 1QMVA 5A1NA 2AB6A 5DVBA 3F6FA 2H0GA 4X43A 2YZHA 5DQYA 5JWOB 3R3EA 2C0GA 4IQAA 1XWAA 2WRTA 1TRWA 3FZ4A 2YJHA 3TU3B 1GUKA 5H5RA 1QXHA 1HNBA 2VL2C 2AUVA 3GL5A 1PD21 1BQ7A 4IP6A 4HOJA 1SU9A 2L6DA 14GSA 1XIYA 4HQZA 1LBKA 1EOHA 4L0UA 5CO3A 1RK4A 4KNDA 4MZBA 1Z6NA 3TJGA 2H1DA 2QSIA 9GSSA 3D4MA 4MABA 3TGZA 1KEBA 2CVKA 3DD3A 1TDIA 1O81A 2H72A 5A5KA 4L5OA 19GSA 5AIVA 4FO5A 4TR4A 2DJ1A 4GXZA 2MBSA 1OC9A 2ON5A 4F82A 4ACSA 3J7Yb 2KUCA 3ME7A 3E9JB 2ZNMA 3ERFA 3TOTA 1K0CA 4PQIA 4CW9A 4K0NA 2VM2A 4MLYA 2LS5A 3TJKA 4DSSA 3M1GA 2HSMA 4LMVA 4XS4B 4TR3A 3V1WA 4GSTA 1SYXA 3KMOA 4JRRA 2LRNA 2EFDA 2HLSA 1FOVA 3IR4A 5IMCA 4ZL8A 4IJ3A 4G10A 3CRUA 1Z5YE 3G7IA 3BCIA 3LSZA 6GSXA 1MDIA 2C0EA 1EV9A 1V98A 5G5EA 5KOWA 5J47A 2VAFA 5B6MA 4OFTA 1TOFA 3L0HA 2I81A 2PERA 5ELAA 4JEDA 1ZL9A 3GA4A 3IE3A 1A2JA 1E2YA 1SVOA 1G6YA 1U3AA 3DXBA 3GX0A 4AKIA 2N5FA 4PQ1A 3M9JA 3D6IA 1SJZA 2OE3A 3D21A 4BWQA 4PNGA 3FY7A 1M2DA 5JWQB 1K0MA 3G9BA 1AXDA 5GZZB 1TU8A 4LMWA 2GT5A 1BX9A 3TJJA 5B8AA 3BD2A 3C7MA 4ICYA 1R5PA 4ECIA 4J57E 3ZTLA 1SKRB 1FVJA 2R37A 2H74A 1M99A 2OACA 5IMFA 3BBYA 1TK8B 2VCVA 4O32A 4N30A 3KMNA 2OBIA 1MTCA 2JSYA 4HU9A 4F03A 3LG6A 4MH3A 4POBA 3MDKA 4TVEA 4D73A 1OC8A 2DIYA 3HJPA 4FYBA 4ZL7A 3PINA 3TRQA 4WBJA 5IO2A 1FB0A 4EVMA 4HJMA 3F63A 1S3DA 2FWFA 3CXGA 4NV2A 3H1NA 2GTUA 3VWVA 4EUYA 2LNTA 2YPMA 3RHBA 3HDCA 4YQMA 2YN1A 5ECIB 3GV1A 2IIYA 2CVBA 3NZNA 1X5CA 2GZZA 2OA7A 1XVQA 4NXIA 3ZVJD 2GSRA 1SJIA 1TW9A 4WR5A 1UVZA 3P2AA 4AKXB 1XWKA 3ZL5A 3QD9A 2LKUA 3QFBC 5B6NA 1SK0A 1XW9A 1W89A 1N25A 2HYXA 3DGQA 3VPQA 2I9HA 2GSQA 1Y25A 5FHIA 4NHZA 1O6JA 2FHEA 5EVOA 3ZZXA 2EC4A 1J9BA 3MNGA 1YKCA 2CX4A 1YF0A 2AV4A 2DJJA 2VLUA 1Z7PA 4MF7A 5JWRB 4XS6A 2KP2A 4CY8A 2WS2A 2YZUA 4WKWA 4FQUA 1AQVA 2VCWA 1JFUA 2B7JA 2HSYA 5J4UA 1A8YA 3UOMA 3QCPA 2LSTA 3KTBA 1BJXA 4W66A 4KB3A 2H0HA 4KA0A 4NMUA 3TKSC 2IFQA 4OMVA 4ULXA 2V41A 2FA8A 1YQ1A 1O8XA 2VM1A 2PBJA 2LEGA 3UEMA 2P31A 5ECLB 2C0FA 4ZB6A 3W8SA 22GSA 3FKFA 3HY2A 1BEDA 2H75A 4XIHA 3EWLA 1V9WA 2V1MA 1W4VA 1JZOA 4H86A 1R5AA 3RBTA 2FD3A 1WJKA 3G7YA 3F8UA 2H71A 4ZB7A 2AAWA 2FY6A 3FHKA 1ERWA 2I1UA 4AI6A 2H0IA 3UBKA 3PGTA 3HXSA 4JR6A 2TIRA 3LWAA 5DCGA 2MYGA 1B9YC 1ACVA 7GSSA 2VIMA 1EP8A 4ZIJA 5DAKB 3UVHA 1Q4JA 1K3OA 3MAKA 4IN0A 5HFIA 3ZFLA 1K0DA 3OR5A 4N0VA 5D9TA 2H8LA 3A5WA 3ERGA 4MH2A 2YOIA 2K9FA 3LW9A 1EOGA 4OFMA 3LORA 2QA2A 4K6XA 2XHFA 2HSNB 2LRCA 3RDWA 5COHA 3EC3A 4TXOA 1M9BA 3GKXA 4AJ8A 1H4OA 1OVNA 2HRKB 2VCTA 1HNCA 4ECBA 2A2SA 5D73A 1ERTA 3QDNA 2HE3A 3GHAA 4CDOA 2UZ8A 3WT2A 2I3YA 4K7NA 2F8FA 2CZ2A 4N0ZA 5LD0A 5HR1A 4MA9A 4BVYA 3VLNA 2LRTA 1SL0B 1H75A 2IMFA 2AYTA 2DMLA 1YEXA 5IIZA 2VL3A 3IPZA 4GLTA 5H5SA 2ES7A 2MMZA 2LJAA 3QR6A 4XRDA 4BA7A 2RUEA 5A5HA 1V40A 5ECOB 1GTIA 3K8NA 2H70A 2DKIA 4ISDA 1XWCA 4V2NA 1SVMA 2DBCA 4I8BA 6GSTA 2H6YA 4X4JA 1XZOA 3A5IA 4CHSA 1BG1A 2V32A 1EGRA 4OD7A 1PL2A 1J0FA 4FIWA 5AIXA 2B5YA 2O89A 3GIXA 3IC4A 2HRAA 3I69A 4QMKA 2WDUA 4JU5A 1MEKA 2RLIA 3DWVA 4FYUA 4E68A 1YJ6A 5HQPA 2VLTA 5ENUA 5ECNB 5J5NA 3QFAC 3LJRA 4TR1A 5J9BA 5LCZA 3EE2A 1A2LA 1WIKA 2CZ3A 5J4VA 5DALB 1PA3A 2EIOA 3HA9A 4KH7A 1ZOFA 2GGTA 4MPGA 5BMUA 3GRXA 5HR0A 1TXUA 2EFHA 4WF4A 2YV7A 4NHWA 3APQA 5F05A 1THXA 3IC8A 3GUSA 1GUHA 3HJMA 2JADA 3HD5A 4KDUA 16GSA 1YVLA 2KP1A 1KBNA 4JR4A 3VFIA 1A23A 3IXRA 2YWMA 4RQXA 3GTUB 3ZVJA 5EPFA 5G5FA 4E8EA 1B4QA 4TXVA 1FHEA 4BVXA 3MWHA 2X8CA 2O87A 4KDYA 5J9CA 2L59A 1K0AA 2WFCA 3BOAA 2C1YA 2LQQA 2EIRA 12GSA 4OO5A 3EPTA 5CRDA 2MMAA 4ZBAA 1AIUA 1IYHA 2IJYA 4WXTA 4I97A 1M2AA 1TRUA 3F4TA 2E7PA 1GP1A 3WT1A 4EXJA 1LJRA 3ZMKA 6GSSA 1OE7A 5GAPD 1PL1A 5EL8A 1V2AA 2FGXA 1NSWA 4MJEA 3KZQA 5L71A 2CV4A 4PNFA 3ED3A 4K1FA 3QAWA 1JZWA 2VD1A 2L6CA 2HZEB 5CAXA 4N11A 4RQRA 18GSA 1MDKA 4NPBA 5DCHA 4RI7A 2B5XA 3VWUA 4XCSA 2B5EA 1BF5A 2GSTA 2GQMA 4OCEA 3CYNA 2C80A 4DSQA 2V6KA 5LNKe 2F8AA 5HR2A 2MMOA 1TI3A 5KN0A 4HZ4A 4HI7A 2PVOC 2VLVA 3KH9A 3C73A 4EIPA 1DBYA 3HCZA 3RHCA 2YJ7A 4X1UA 1TTZA 3P90A 1K3LA 2R4VA 4BL7B 1NW2A 3IHQA 4NAXA 1VF4A 5DQSA 2F51A 1PKZA 1SD9A 3EMXA 1YKAA 4HDEA 4JZQA 3U5RE 5JCUA 1TJDA 1U87A 2J9HA 4I5QA 1U88A 4Q5NA 2WULA 4AGSA 2H1BA 4ML6A 2G0FA 1TP9A 3HVXA 4V2MA 4V1Ap 3FZAA 3C1SA 3TKSE 1YY7A 1TI1A 2X49A 1ZZYA 4LA1A 3UVTA 4TKYA 4IP1A 1AQXA 3TCOA 4MJCA 1KTEA 2DJ2A 2FUG2 1NM3A 2HRFA 3W8JA 3VWWA 1JLWA 2VO4A 1URMA 3GNJA 5IMDA 2NVLA 2ON7A 1GTAA 3QOUA 2DMMA 10GSA 5ABRA 3L9VA 1X5DA 4KW6A 2YWOA 3QAGA 2CT6A 1J08A 4J2FA 1QUWA 1O85A 3J7Yk 2GVPA 4EF0A 4Z2TA 3L78A 3ZIVA 1USBA 2VUPA 2RUFA 11GSA 1V58A 3CSHA 3LEFA 5J40A 3CBUA 3VI7A 4ECJA 4I2TA 3HYPA 2LUSA 3GN3A 2R0PA 1K3YA 2VCQA 4GQCA 2V2GA 5A4UA 3ZITA 2FWGA 4G9HA 3KCMA 1A24A 1ZYEA 1HYUA 1X5EA 5AISA 2IMEA 1WRYA 4PQHA 4EDYA 3F6DA 1ZMAA 4O5UA 1PGTA 2HZEA 1QK8A 1EWXA 3EMPA 3TRPA 1VF1A 1PX7A 3M8NA 3D22A 3FR6A 4NV5A 2BJXA 1T8EB 3TB2A 2K8SA 8GSSA 3I43A 1FG4A 2B3SA 3IA1A 4XS4A 5HFGA 3HMJG 1UA5A 2HFDA 4K0GA 3APSA 4MK3A 5DJLA 4POMA 5CRWA 2IMIA 1XW5A 5DDLA 3KGKA 3EINA 5IOXA 2GSSA 3GX8A 4YAVA 4Z2RA 2DKHA 4TOPA 2OADA 1S3AA 4ZB9A 3A2WA 2X8HA 1BAYA 2IMDA 3WGEA 4F0CA 5G2ZA 1SL1B 1VGLA 2M72A 4RI6A 1Y6EA 4HZ2A 1HNAA 2LV3A 2MMNA 1WOUA 4RUVA 3H8QA 3CMIA 1Y1UA 1T4ZA 2H76A 1C72A 5J41A 1XPVA 3TUEA 2WGRA 4K7OA 1VF3A 1VF2A 3N5OA 4PGTA 2PPTA 5ID2B 1XWGA 2K18A 1AUCA 3TKRA 1I9DA 5A4WA 5CP1A 4AJ7A 1Z7RA 3TKPA 3D5JA 5CNWA 3D0ZA 6GSYA 4HUAA 5IMAA 1ABAA 3VI5A 3EVIA 2HXKA 2L4CA 3TKSA 4G0LA 2H19A 3PPUA 1XXUA 2LQOA 5KN2A 3IRAA 2H1LA 3M9KA 4ZXGA 2YWNA 3FR9A 4PURA 5KN3A 3SBCA 1PN9A 3O76A 4ML1A 3IK7A 4V2LA 1G7EA 4PUFC 2NBSA 5ECSA 5ECPB 4TN8A 1ZYQB 3M3MA 1I5GA 1Z9HA 1VRSD 2O8VB 5GAND 1G0TA 4KAEA 1T4YA 3P7XA 2C4JA 1XBSA 1X9MB 2A4VA 2VKZG 2HZFA 3HHVA 2H1GA 1JZDA 2OT3A 3CTFA 2X4AA 2KLXA 3CTGA 3ZLPA 1GL8A 1X0RA 1PMTA 3GYKA 3FRCA 4K9ZA 2YV9A 1TRVA 2HI7A 2H1AA 5KEJA 5EY6A 2H01A 4KCAA 2YNXA 2WJUA 5F8BA 2P5QA 2A2RA 4A5PA 5BRTA 2MBTA 3L4NA 4FH8A 2JL4A 4KGIA 2CX3A 1SKSB 4XHMA 5A1NB 3GKKA 3LQ7A 2X99A 3HZ4A 5DJMA 1ST9A 2LNSA 3UMAA 3DKSA 4MMMA 1WP0A 1MD3A 4WEYA 1SVLA 3LGCA 5B8BA 1ON4A 3IV4A 5INYA 1GULA 4K7IA 3ZYWA 1HD2A 3D4TA 3IAM2 1N8JA 3DVXA 4LL4B 2QGVA 3DYRA 5D9WA 1B8XA 3S9FA 3HZ8A 1GH2A 1GUMA 4N3ZA 2OE0A 3GFKA 5ECHB 1EEMA 2YCDA 3WGXA 4O92A 4ECCA 2HSHA 4AKHA 4WR4A 1R4WA 3FK8A 13GSA 3PH9A 3HVSA 1B48A 3W6GA 1THOA 2I4AA 1AQWA 1M7TA 2PMTA 2LTKA 1XWBA 4F9ZA 1OYJA 1FAAA 1GNWA 1G7OA 1DSBA 1GSFA 2R2JA 5IMZA 3UIWA 2XPDA 3KP9A 2FA4A 4GSSA 5C04A 4MJBA 5IM9A 2OE1A 3GH6A 2C3QA 2X8GA 3F4RA 2XBIA 5D8IA 4DSSB 4POLA 1BYEA 2HSMB 4J56E 4XS1A 3FMWA 4USSA 4TW5A 3IBHA 5FWGA 3KP8A 4DVCA 3DIEA 1QQ2A 4OCFA 5J3RA 5KN1A 1BG5A 5AN1A 1K0NA 3MYDA 2MZCA 3VPTA 4IKHA 4MF6A 4CY6A 2A4HA 5G1KA 1TU7A 2FCHA 5DAKA 4GRFA 1FO5A 2CA8A 3TKQA 4HEA2 4IW9A 1XW6A 2H73A 5FT3A 1U6TA 4KE3A 1YEPA 2KHPA 5F06A 3R2QA 5B7CA 4GTUA 1F9MA 3I6AA 1M0UA 3HVVA 5AGYA 2HSNA 2DJ0A 2REMA 4V1Ag 3GL3A 2EFCA 2C8UA 2L4QA 4QL7A 2QA1A 1DE2A 2DC5A 3UARA 5G31A 3L9SA 1EEJA 4PUAA 2R0CA 3Q74A 4DEJA 1TRSA 1HQOA 2HRKA 1E6BA 4KX4A 4EKZA 2PWJA 2GZYA 4HJ2A 1OKDA 1GWCA 2VL2A 4BWSA 2L57A 1WPIA 1O73A 5H5QA 4GF0A 1FVKA 1ZYNA 2N5AA 2O85A 1S3CA 5CYYA 2FNOA 4Q5RA 5HFKA 4MP4A 3TOUA 3LXTA 3L9UA 4HU7A 1A0RP 1Z3EA 1A2MA 2FWEA 4D73B 5D93A 4GQFA 6GSWA 4K2XA 3LFLA 4YKFA 1NHYA 4YH2A 2VD0A 5F07A 1SYRA 4MCUA 4XTSA 2P5RA 1PSQA 4EE0A 3ISOA 1GSUA 1T00A 1AC1A 2R0GA 2AHEA 3FR3A 2FLSA 3U6VA 4Z7XA 3O6TA 2GQLA 3HKRA 5IO0A 1WWJA 5F0GA 2DSAA 4MNNA 1SKWB 3KEBA 2P0GA 2IPAA 1GSQA 5IQYA 2JZSA 1DE1A 5D96A 4QQ7A 4NWYA 1ZGNA 1V57A 2WZ9A 4IJIA 1GNEA 3LYPA 3EURA 4GCIA 2EIQA 3KJYA 5E59A 4K2DA 1TK5B 4ZBDA 2YP6A 4EO3A 4OWYA 1YZXA 5DALA 4MF5A 2GT6A 3CWGA 1SK2A 1ML6A 3I9V2 2GS3A 3RPPA 1DUGA 1XCCA 3IDVA 5G30A 1PKWA 4ZBBA 2JZRA 5ECQB 3Q18A 3ZRDA 4P3YB 3E0UA 5D9XA 2KOKA 3E3EA 17GSA 4PX1A 3UJ1A 3CRTA 1T1VA 1N2AA 2HNLA 3C71A 4FYCA 2E2MA 4ZB8A 3DRNA 4Q5QA 2B7KA 1EZKA 2K6VA 3US3A 4HQSA 2AJQB 5C00A 3C1RA 4WBRD 3GTUA 1A0FA 2M46A 2IFQB 1GSSA 2OJLA 2E2GA 4F0BA 3MIXA 1ERUA 4YAPA 4G2EA 2NDOA 1X9SB 2HT9A 2TRCP 3KTLA 2O7KA 2NTOA 5ECKB 3FYGA 3APOA 4GDFA 3UL3A 3KH7A 3QAVA 3VWXA 4EC0A 4YQVA 3AY8A 1M2BA 2GZPA 1IYIA 3KXOA 2C0DA 2XBQA 4G0KA 4EDZA 2YANA 2CAQA 1SENA 2IL3A 1GLQA 5CRGA 1OKTA 1JZRA 4WETA 2BMXA 1SD8A 3P8WA 5KOXA 3A3TA 1QGVA 2A2PA 4X0XA 3RAZA 1XFLA 1LU4A 4AJ6A 3CSIA 4POKA 1PN0A 1GLPA 3WGDA 1B9XC 1K0BA 2H6XA 1JLVA 2DLXA 5JCWA 1SJ6A 4LLRA 2OKAA 6GSVA 2WCIA 4BPYA 2BTOT 2DIZA 4GSNA 1Z6MA 2X64A 4MDCA 3ZMLA 5IMVA 3VK9A 2H6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC7 A;  2VL9 A;  2B1K A;  1MDJ A;  1FW1 A;  5DBQ A;  1GTB A;  1R7H A;  2B1L A;  2YWI A;  4MZW A;  3C8E A;  1OE8 A;  2ZCT A;  3BCK A;  2CQ9 A;  1JHB A;  3NIV A;  2J23 A;  1AW9 A;  4TXO B;  2CAI A;  2PGT A;  4KDX A;  3WD6 A;  3O3T A;  1F3A A;  1TXX A;  3TDG A;  1XOB A;  1ZCP A;  1GSD A;  4BL7 A;  4MJA A;  3JCM L;  4OFN A;  3TRX A;  20GS A;  1PRX A;  3KD0 A;  3F4S A;  4KSO A;  2JZT A;  2F9S A;  3HJO A;  3BJ5 A;  4O5R A;  2L5O A;  4ZL9 A;  2GDR A;  4BVY B;  2LJK A;  2R5G A;  1Q98 A;  1YDK A;  3F9U A;  4JE1 A;  5IOW A;  2PVQ A;  2XPE A;  1GSE A;  1ILO A;  2H30 A;  2PUK C;  2L5L A;  1KNG A;  1OC3 A;  1EV4 A;  2R3X A;  4I6X A;  4IS0 A;  1U3I A;  1MD4 A;  2FWH A;  5ECR B;  4QL9 A;  3ZIJ A;  4ILF A;  5GST A;  4N10 A;  3G7J A;  2IMK A;  2VOC A;  3H4K A;  4GWR A;  3FEU A;  3NOF A;  4G19 A;  2LJR A;  4ZIL A;  4KUN A;  2D2Z A;  3IOS A;  1OAZ A;  4IGJ A;  4PXO A;  3QPM A;  3F0I A;  5CRH A;  4IEL A;  3TJF A;  2VCZ A;  3FZ5 A;  3F3R A;  4IQ1 A;  4JBB A;  3Q19 A;  4YQU A;  3Q6O A;  2CVD A;  1F37 A;  4EL1 A;  4TR1 B;  2Z9S A;  3RPN A;  5D9V A;  4MPF A;  1F6M C;  2F3M A;  2HRN A;  1A8L A;  3DEX A;  1GRX A;  4G0I A;  2ALB A;  2G2Q A;  3M0F A;  2C3T A;  2QKE A;  1UN2 A;  1M9A A;  2E0Q A;  3ME8 A;  3A2X A;  3H79 A;  1NHO A;  5JCG A;  3FW2 A;  1TK0 B;  2R6K A;  3WYW A;  4IVF A;  4IHU A;  1FB6 A;  2VCX A;  3VUR A;  5A4V A;  5IPH A;  3CSJ A;  2V6O A;  4Q5F A;  3KM6 A;  4WF5 A;  3DML A;  2PU9 C;  4XRA A;  3IAS 2;  1T3B A;  1PX6 A;  3IK9 A;  4BVX B;  3F3Q A;  2XC2 A;  5E4W A;  1UC7 A;  1TKD B;  3UBL A;  4L8E A;  3GKN A;  1GTU A;  4TRX A;  4HS1 A;  3KIJ A;  1AAZ A;  1R26 A;  5GSS A;  2IWT A;  4OO4 A;  1GSY A;  4KCE A;  2TRX A;  1QFN A;  4AF2 A;  2RM5 A;  3ZRE A;  1SL2 B;  4K8M A;  3DVW A;  1G6W A;  2JU5 A;  2M80 A;  4E8H A;  3TJB A;  5ID2 A;  1F3B A;  6GSU A;  2C3N A;  2OBK A;  3QMX A;  1K0O A;  3N9J A;  1X9W B;  1T7P B;  3H93 A;  1OC9 B;  4L5L A;  5CRE A;  5ELG A;  3A2V A;  2HQT A;  2H66 A;  3GST A;  2WB9 A;  2RII A;  1CQG A;  1XVW A;  1B4P A;  3LXZ A;  1EP7 A;  3PR8 A;  3GMF A;  5HR3 A;  5IPG A;  2N5B A;  4IBP A;  3EU4 A;  3EU3 A;  3FZ9 A;  4O7H A;  1SK1 A;  2DJ3 A;  2K8V A;  2ZUP A;  3GKM A;  2DJK A;  1ERV A;  4I2U A;  4KF9 A;  3SWL A;  1CQH A;  4TR0 A;  4LL1 B;  2PN8 A;  5G1L A;  2GQK A;  3ERW A;  3UAP A;  2JAC A;  2GLR A;  3GUR A;  1RW1 A;  1EGO A;  4DSR A;  2IN3 A;  4KSM A;  4L0W A;  1F2E A;  1O7U A;  3LYK A;  3GH9 A;  1XOA A;  3ZFB A;  2B6M A;  4ID0 A;  2JSZ A;  3GSS A;  4PTS A;  1PQN A;  4F2I A;  5ECM B;  3MSZ A;  2NPB A;  1YF1 A;  2RM6 A;  1O8W A;  1RQM A;  3EYT A;  4MZC A;  1WE0 A;  1WMJ A;  1QMV A;  2AB6 A;  5DVB A;  3F6F A;  2H0G A;  4X43 A;  2YZH A;  5DQY A;  5JWO B;  3R3E A;  2C0G A;  4IQA A;  1XWA A;  2WRT A;  1TRW A;  3FZ4 A;  2YJH A;  1GUK A;  5H5R A;  1QXH A;  1HNB A;  2VL2 C;  2AUV A;  3GL5 A;  1PD2 1;  1BQ7 A;  4IP6 A;  4HOJ A;  1SU9 A;  2L6D A;  14GS A;  1XIY A;  4HQZ A;  1LBK A;  1EOH A;  4L0U A;  5CO3 A;  1RK4 A;  4KND A;  4MZB A;  1Z6N A;  3TJG A;  2H1D A;  2QSI A;  9GSS A;  3D4M A;  4MAB A;  3TGZ A;  1KEB A;  2CVK A;  3DD3 A;  1TDI A;  1O81 A;  2H72 A;  5A5K A;  4L5O A;  19GS A;  5AIV A;  4FO5 A;  4TR4 A;  2DJ1 A;  4GXZ A;  2MBS A;  1OC9 A;  2ON5 A;  4F82 A;  4ACS A;  3J7Y b;  2KUC A;  3ME7 A;  3E9J B;  2ZNM A;  3ERF A;  3TOT A;  1K0C A;  4PQI A;  4CW9 A;  4K0N A;  2VM2 A;  4MLY A;  2LS5 A;  3TJK A;  4DSS A;  3M1G A;  2HSM A;  4LMV A;  4XS4 B;  4TR3 A;  3V1W A;  4GST A;  1SYX A;  3KMO A;  4JRR A;  2LRN A;  2HLS A;  1FOV A;  3IR4 A;  5IMC A;  4ZL8 A;  4IJ3 A;  4G10 A;  3CRU A;  1Z5Y E;  3G7I A;  3BCI A;  3LSZ A;  6GSX A;  1MDI A;  2C0E A;  1EV9 A;  1V98 A;  5G5E A;  2VAF A;  5B6M A;  4OFT A;  1TOF A;  3L0H A;  2I81 A;  2PER A;  5ELA A;  4JED A;  1ZL9 A;  3GA4 A;  3IE3 A;  1A2J A;  1E2Y A;  1U3A A;  1G6Y A;  3DXB A;  3GX0 A;  2N5F A;  4PQ1 A;  3M9J A;  3D6I A;  1SJZ A;  2OE3 A;  3D21 A;  4BWQ A;  4PNG A;  3FY7 A;  1M2D A;  5JWQ B;  1K0M A;  3G9B A;  1AXD A;  5GZZ B;  1TU8 A;  4LMW A;  2GT5 A;  1BX9 A;  3TJJ A;  5B8A A;  3BD2 A;  3C7M A;  1R5P A;  4ECI A;  4J57 E;  3ZTL A;  1SKR B;  1FVJ A;  2R37 A;  2H74 A;  1M99 A;  2OAC A;  5IMF A;  3BBY A;  1TK8 B;  2VCV A;  4O32 A;  4N30 A;  3KMN A;  2OBI A;  1MTC A;  2JSY A;  4HU9 A;  4F03 A;  3LG6 A;  4MH3 A;  4POB A;  3MDK A;  4TVE A;  4D73 A;  1OC8 A;  2DIY A;  3HJP A;  4FYB A;  4ZL7 A;  3PIN A;  3TRQ A;  4WBJ A;  5IO2 A;  1FB0 A;  4EVM A;  4HJM A;  3F63 A;  1S3D A;  2FWF A;  3CXG A;  4NV2 A;  3H1N A;  2GTU A;  3VWV A;  4EUY A;  2LNT A;  2YPM A;  3RHB A;  3HDC A;  4YQM A;  2YN1 A;  5ECI B;  3GV1 A;  2IIY A;  2CVB A;  3NZN A;  1X5C A;  2GZZ A;  2OA7 A;  1XVQ A;  4NXI A;  3ZVJ D;  2GSR A;  1SJI A;  1TW9 A;  4WR5 A;  1UVZ A;  3P2A A;  1XWK A;  3ZL5 A;  3QD9 A;  2LKU A;  3QFB C;  5B6N A;  1SK0 A;  1XW9 A;  1W89 A;  2HYX A;  3DGQ A;  3VPQ A;  2I9H A;  2GSQ A;  1Y25 A;  5FHI A;  4NHZ A;  1O6J A;  2FHE A;  5EVO A;  3ZZX A;  2EC4 A;  1J9B A;  3MNG A;  1YKC A;  2CX4 A;  1YF0 A;  2AV4 A;  2DJJ A;  2VLU A;  1Z7P A;  4MF7 A;  5JWR B;  4XS6 A;  2KP2 A;  2WS2 A;  2YZU A;  4WKW A;  4FQU A;  1AQV A;  2VCW A;  1JFU A;  2B7J A;  2HSY A;  5J4U A;  1A8Y A;  3UOM A;  3QCP A;  2LST A;  3KTB A;  1BJX A;  4KB3 A;  2H0H A;  4KA0 A;  4NMU A;  3TKS C;  2IFQ A;  4OMV A;  4ULX A;  2V41 A;  2FA8 A;  1YQ1 A;  1O8X A;  2VM1 A;  2PBJ A;  2LEG A;  3UEM A;  2P31 A;  5ECL B;  2C0F A;  4ZB6 A;  3W8S A;  22GS A;  3FKF A;  3HY2 A;  1BED A;  2H75 A;  4XIH A;  3EWL A;  1V9W A;  2V1M A;  1W4V A;  1JZO A;  4H86 A;  1R5A A;  3RBT A;  2FD3 A;  1WJK A;  3G7Y A;  3F8U A;  2H71 A;  2AAW A;  2FY6 A;  3FHK A;  1ERW A;  2I1U A;  2H0I A;  3UBK A;  3PGT A;  3HXS A;  4JR6 A;  2TIR A;  3LWA A;  5DCG A;  2MYG A;  1B9Y C;  1ACV A;  7GSS A;  2VIM A;  1EP8 A;  4ZIJ A;  5DAK B;  3UVH A;  1Q4J A;  1K3O A;  3MAK A;  4IN0 A;  5HFI A;  3ZFL A;  1K0D A;  3OR5 A;  4N0V A;  5D9T A;  2H8L A;  3A5W A;  3ERG A;  4MH2 A;  2YOI A;  2K9F A;  1EOG A;  4OFM A;  3LOR A;  4K6X A;  2XHF A;  2HSN B;  2LRC A;  3RDW A;  5COH A;  3EC3 A;  4TXO A;  1M9B A;  3GKX A;  4AJ8 A;  1H4O A;  1OVN A;  2HRK B;  2VCT A;  1HNC A;  4ECB A;  2A2S A;  5D73 A;  1ERT A;  3QDN A;  2HE3 A;  3GHA A;  4CDO A;  2UZ8 A;  3WT2 A;  2I3Y A;  4K7N A;  2F8F A;  2CZ2 A;  4N0Z A;  5LD0 A;  5HR1 A;  4MA9 A;  4BVY A;  3VLN A;  2LRT A;  1SL0 B;  1H75 A;  2IMF A;  2AYT A;  2DML A;  1YEX A;  5IIZ A;  2VL3 A;  3IPZ A;  4GLT A;  5H5S A;  2ES7 A;  2MMZ A;  2LJA A;  3QR6 A;  4XRD A;  4BA7 A;  2RUE A;  1V40 A;  5ECO B;  1GTI A;  3K8N A;  2H70 A;  4ISD A;  1XWC A;  4V2N A;  2DBC A;  4I8B A;  6GST A;  2H6Y A;  1XZO A;  1EGR A;  4CHS A;  2V32 A;  4OD7 A;  1PL2 A;  1J0F A;  4FIW A;  5AIX A;  2B5Y A;  2O89 A;  3GIX A;  3IC4 A;  2HRA A;  3I69 A;  2WDU A;  4JU5 A;  1MEK A;  2RLI A;  3DWV A;  4FYU A;  1YJ6 A;  5HQP A;  2VLT A;  5ENU A;  5ECN B;  5J5N A;  3QFA C;  3LJR A;  4TR1 A;  5J9B A;  5LCZ A;  3EE2 A;  1A2L A;  1WIK A;  2CZ3 A;  5DAL B;  1PA3 A;  2EIO A;  3HA9 A;  4KH7 A;  1ZOF A;  2GGT A;  4MPG A;  5BMU A;  3GRX A;  5HR0 A;  4WF4 A;  2YV7 A;  4NHW A;  3APQ A;  5F05 A;  1THX A;  3IC8 A;  3GUS A;  1GUH A;  3HJM A;  2JAD A;  3HD5 A;  4KDU A;  16GS A;  2KP1 A;  1KBN A;  4JR4 A;  3VFI A;  1A23 A;  3IXR A;  2YWM A;  4RQX A;  3GTU B;  3ZVJ A;  5EPF A;  5G5F A;  4E8E A;  1B4Q A;  4TXV A;  1FHE A;  4BVX A;  3MWH A;  2X8C A;  2O87 A;  4KDY A;  5J9C A;  2L59 A;  1K0A A;  2WFC A;  3BOA A;  2C1Y A;  2LQQ A;  2EIR A;  12GS A;  4OO5 A;  5CRD A;  2MMA A;  4ZBA A;  1AIU A;  1IYH A;  2IJY A;  4WXT A;  4I97 A;  1M2A A;  1TRU A;  3F4T A;  2E7P A;  1GP1 A;  3WT1 A;  4EXJ A;  1LJR A;  3ZMK A;  6GSS A;  1OE7 A;  5GAP D;  1PL1 A;  5EL8 A;  1V2A A;  2FGX A;  1NSW A;  4MJE A;  3KZQ A;  5L71 A;  2CV4 A;  4PNF A;  3ED3 A;  4K1F A;  3QAW A;  1JZW A;  2VD1 A;  2L6C A;  2HZE B;  5CAX A;  4N11 A;  4RQR A;  18GS A;  1MDK A;  4NPB A;  5DCH A;  4RI7 A;  2B5X A;  3VWU A;  4XCS A;  2B5E A;  2GST A;  2GQM A;  4OCE A;  3CYN A;  2C80 A;  4DSQ A;  2V6K A;  5LNK e;  2F8A A;  5HR2 A;  2MMO A;  1TI3 A;  5KN0 A;  4HZ4 A;  4HI7 A;  2PVO C;  2VLV A;  3KH9 A;  3C73 A;  1DBY A;  3HCZ A;  3RHC A;  2YJ7 A;  4X1U A;  1TTZ A;  3P90 A;  1K3L A;  2R4V A;  4BL7 B;  1NW2 A;  3IHQ A;  4NAX A;  1VF4 A;  5DQS A;  2F51 A;  1PKZ A;  1SD9 A;  3EMX A;  1YKA A;  4HDE A;  4JZQ A;  3U5R E;  5JCU A;  1TJD A;  1U87 A;  2J9H A;  4I5Q A;  1U88 A;  4Q5N A;  2WUL A;  4AGS A;  2H1B A;  4ML6 A;  2G0F A;  1TP9 A;  3HVX A;  4V2M A;  4V1A p;  3FZA A;  3C1S A;  3TKS E;  1YY7 A;  1TI1 A;  1ZZY A;  4LA1 A;  3UVT A;  4TKY A;  4IP1 A;  1AQX A;  3TCO A;  4MJC A;  1KTE A;  2DJ2 A;  2FUG 2;  1NM3 A;  2HRF A;  3W8J A;  3VWW A;  1JLW A;  2VO4 A;  1URM A;  3GNJ A;  5IMD A;  2NVL A;  2ON7 A;  1GTA A;  3QOU A;  2DMM A;  10GS A;  5ABR A;  3L9V A;  1X5D A;  4KW6 A;  2YWO A;  3QAG A;  2CT6 A;  1J08 A;  4J2F A;  1QUW A;  1O85 A;  3J7Y k;  2GVP A;  4EF0 A;  3L78 A;  3ZIV A;  1USB A;  2VUP A;  2RUF A;  11GS A;  1V58 A;  3CSH A;  3LEF A;  3VI7 A;  3CBU A;  4I2T A;  4ECJ A;  3HYP A;  2LUS A;  3GN3 A;  1K3Y A;  2VCQ A;  4GQC A;  2V2G A;  5A4U A;  3ZIT A;  2FWG A;  4G9H A;  3KCM A;  1A24 A;  1ZYE A;  1HYU A;  1X5E A;  5AIS A;  2IME A;  1WRY A;  4PQH A;  4EDY A;  3F6D A;  1ZMA A;  1PGT A;  2HZE A;  1QK8 A;  1EWX A;  3EMP A;  3TRP A;  1VF1 A;  1PX7 A;  3M8N A;  3D22 A;  3FR6 A;  4NV5 A;  2BJX A;  1T8E B;  3TB2 A;  2K8S A;  8GSS A;  3I43 A;  1FG4 A;  2B3S A;  3IA1 A;  4XS4 A;  5HFG A;  1UA5 A;  2HFD A;  4K0G A;  3APS A;  4MK3 A;  5DJL A;  4POM A;  5CRW A;  2IMI A;  1XW5 A;  5DDL A;  3KGK A;  3EIN A;  5IOX A;  2GSS A;  3GX8 A;  4YAV A;  4TOP A;  2OAD A;  1S3A A;  4ZB9 A;  3A2W A;  2X8H A;  1BAY A;  2IMD A;  3WGE A;  4F0C A;  5G2Z A;  1SL1 B;  1VGL A;  2M72 A;  4RI6 A;  1Y6E A;  4HZ2 A;  1HNA A;  2LV3 A;  2MMN A;  1WOU A;  4RUV A;  3H8Q A;  3CMI A;  1T4Z A;  2H76 A;  1C72 A;  5J41 A;  1XPV A;  3TUE A;  2WGR A;  4K7O A;  1VF3 A;  1VF2 A;  3N5O A;  4PGT A;  2PPT A;  5ID2 B;  1XWG A;  2K18 A;  1AUC A;  3TKR A;  1I9D A;  5A4W A;  5CP1 A;  4AJ7 A;  1Z7R A;  3TKP A;  3D5J A;  5CNW A;  3D0Z A;  6GSY A;  4HUA A;  5IMA A;  1ABA A;  3VI5 A;  3EVI A;  2HXK A;  2L4C A;  3TKS A;  4G0L A;  2H19 A;  3PPU A;  1XXU A;  2LQO A;  5KN2 A;  3IRA A;  3M9K A;  4ZXG A;  2YWN A;  3FR9 A;  4PUR A;  5KN3 A;  3SBC A;  1PN9 A;  3O76 A;  4ML1 A;  3IK7 A;  4V2L A;  1G7E A;  4PUF C;  2NBS A;  5ECS A;  5ECP B;  4TN8 A;  1ZYQ B;  3M3M A;  1I5G A;  1Z9H A;  1VRS D;  2O8V B;  5GAN D;  1G0T A;  4KAE A;  1T4Y A;  3P7X A;  2C4J A;  1XBS A;  1X9M B;  2A4V A;  2HZF A;  3HHV A;  2H1G A;  1JZD A;  3CTF A;  2KLX A;  3CTG A;  3ZLP A;  1GL8 A;  1X0R A;  1PMT A;  3GYK A;  3FRC A;  4K9Z A;  2YV9 A;  1TRV A;  2HI7 A;  2H1A A;  5KEJ A;  5EY6 A;  2H01 A;  4KCA A;  2YNX A;  2WJU A;  5F8B A;  2P5Q A;  2A2R A;  2MBT A;  3L4N A;  4FH8 A;  2JL4 A;  4KGI A;  2CX3 A;  1SKS B;  4XHM A;  3GKK A;  3LQ7 A;  2X99 A;  3HZ4 A;  5DJM A;  1ST9 A;  2LNS A;  3UMA A;  3DKS A;  4MMM A;  1WP0 A;  1MD3 A;  4WEY A;  3LGC A;  5B8B A;  1ON4 A;  3IV4 A;  5INY A;  1GUL A;  4K7I A;  3ZYW A;  1HD2 A;  3D4T A;  3IAM 2;  1N8J A;  3DVX A;  4LL4 B;  2QGV A;  3DYR A;  5D9W A;  1B8X A;  3S9F A;  3HZ8 A;  1GH2 A;  1GUM A;  2OE0 A;  3GFK A;  5ECH B;  1EEM A;  2YCD A;  3WGX A;  4O92 A;  4ECC A;  2HSH A;  4WR4 A;  1R4W A;  3FK8 A;  13GS A;  3PH9 A;  3HVS A;  1B48 A;  3W6G A;  1THO A;  2I4A A;  1AQW A;  1M7T A;  2PMT A;  2LTK A;  1XWB A;  4F9Z A;  1OYJ A;  1FAA A;  1GNW A;  1G7O A;  1DSB A;  1GSF A;  2R2J A;  5IMZ A;  3UIW A;  2XPD A;  3KP9 A;  2FA4 A;  4GSS A;  5C04 A;  4MJB A;  5IM9 A;  2OE1 A;  3GH6 A;  2C3Q A;  2X8G A;  3F4R A;  2XBI A;  5D8I A;  4DSS B;  4POL A;  1BYE A;  2HSM B;  4J56 E;  4XS1 A;  4USS A;  4TW5 A;  3IBH A;  5FWG A;  3KP8 A;  4DVC A;  3DIE A;  1QQ2 A;  4OCF A;  5J3R A;  5KN1 A;  1BG5 A;  5AN1 A;  1K0N A;  2MZC A;  3VPT A;  4IKH A;  4MF6 A;  5G1K A;  1TU7 A;  2FCH A;  5DAK A;  4GRF A;  1FO5 A;  2CA8 A;  3TKQ A;  4HEA 2;  4IW9 A;  1XW6 A;  2H73 A;  5FT3 A;  1U6T A;  4KE3 A;  1YEP A;  2KHP A;  5F06 A;  3R2Q A;  5B7C A;  4GTU A;  1F9M A;  3I6A A;  1M0U A;  3HVV A;  5AGY A;  2DJ0 A;  2REM A;  4V1A g;  3GL3 A;  2C8U A;  2L4Q A;  4QL7 A;  1DE2 A;  2DC5 A;  3UAR A;  5G31 A;  3L9S A;  1EEJ A;  4PUA A;  3Q74 A;  4DEJ A;  1TRS A;  1HQO A;  2HRK A;  1E6B A;  4KX4 A;  4EKZ A;  2PWJ A;  2GZY A;  4HJ2 A;  1OKD A;  1GWC A;  2VL2 A;  4BWS A;  2L57 A;  1WPI A;  1O73 A;  5H5Q A;  4GF0 A;  1FVK A;  2N5A A;  2O85 A;  1S3C A;  5CYY A;  2FNO A;  4Q5R A;  5HFK A;  4MP4 A;  3TOU A;  3LXT A;  3L9U A;  4HU7 A;  1A0R P;  1Z3E A;  1A2M A;  2FWE A;  4D73 B;  5D93 A;  4GQF A;  6GSW A;  3LFL A;  1NHY A;  4YH2 A;  2VD0 A;  5F07 A;  1SYR A;  4MCU A;  4XTS A;  2P5R A;  1PSQ A;  4EE0 A;  3ISO A;  1GSU A;  1T00 A;  1AC1 A;  2AHE A;  3FR3 A;  2FLS A;  3U6V A;  4Z7X A;  3O6T A;  2GQL A;  3HKR A;  5IO0 A;  1WWJ A;  5F0G A;  2DSA A;  1SKW B;  3KEB A;  2P0G A;  2IPA A;  1GSQ A;  5IQY A;  2JZS A;  1DE1 A;  5D96 A;  4QQ7 A;  4NWY A;  1ZGN A;  1V57 A;  2WZ9 A;  4IJI A;  1GNE A;  3LYP A;  3EUR A;  4GCI A;  2EIQ A;  3KJY A;  5E59 A;  4K2D A;  1TK5 B;  4ZBD A;  2YP6 A;  4EO3 A;  4OWY A;  1YZX A;  5DAL A;  4MF5 A;  2GT6 A;  1SK2 A;  1ML6 A;  3I9V 2;  2GS3 A;  3RPP A;  1DUG A;  1XCC A;  3IDV A;  5G30 A;  1PKW A;  4ZBB A;  2JZR A;  5ECQ B;  3Q18 A;  3ZRD A;  4P3Y B;  3E0U A;  5D9X A;  2KOK A;  3E3E A;  17GS A;  4PX1 A;  3UJ1 A;  3CRT A;  1T1V A;  1N2A A;  2HNL A;  3C71 A;  4FYC A;  2E2M A;  4ZB8 A;  3DRN A;  4Q5Q A;  2B7K A;  1EZK A;  2K6V A;  3US3 A;  4HQS A;  2AJQ B;  5C00 A;  3C1R A;  4WBR D;  3GTU A;  1A0F A;  2M46 A;  2IFQ B;  1GSS A;  2OJL A;  2E2G A;  4F0B A;  1ERU A;  4YAP A;  4G2E A;  2NDO A;  1X9S B;  2HT9 A;  2TRC P;  3KTL A;  2O7K A;  2NTO A;  5ECK B;  3FYG A;  3APO A;  3UL3 A;  3KH7 A;  3QAV A;  3VWX A;  4EC0 A;  4YQV A;  3AY8 A;  1M2B A;  2GZP A;  1IYI A;  3KXO A;  2C0D A;  2XBQ A;  4G0K A;  4EDZ A;  2YAN A;  2CAQ A;  1SEN A;  2IL3 A;  1GLQ A;  5CRG A;  1OKT A;  1JZR A;  4WET A;  2BMX A;  1SD8 A;  3P8W A;  3A3T A;  1QGV A;  4X0X A;  3RAZ A;  1XFL A;  1LU4 A;  4AJ6 A;  3CSI A;  4POK A;  1GLP A;  3WGD A;  1B9X C;  1K0B A;  2H6X A;  1JLV A;  2DLX A;  5JCW A;  1SJ6 A;  4LLR A;  2OKA A;  6GSV A;  2WCI A;  4BPY A;  2BTO T;  2DIZ A;  4GSN A;  1Z6M A;  2X64 A;  4MDC A;  3ZML A;  5IMV A;  3VK9 A;  2H6Z A; 
#chains in the Genus database with same CATH topology
 2QC7 A;  2VL9 A;  2B1K A;  1MDJ A;  1FW1 A;  5DBQ A;  1GTB A;  1R7H A;  2B1L A;  2YWI A;  4MZW A;  3C8E A;  1OE8 A;  2ZCT A;  3BCK A;  2CQ9 A;  1JHB A;  3NIV A;  2J23 A;  1AW9 A;  4TXO B;  2CAI A;  2PGT A;  4KDX A;  3WD6 A;  3RFR C;  3O3T A;  1F3A A;  1TXX A;  3TDG A;  1XOB A;  1ZCP A;  1GSD A;  4BL7 A;  4MJA A;  3JCM L;  1S4B P;  4OFN A;  3TRX A;  20GS A;  1ZYP A;  1PRX A;  3KD0 A;  3F4S A;  4KSO A;  2JZT A;  5A34 B;  2F9S A;  3HJO A;  3BJ5 A;  4O5R A;  2L5O A;  4ZL9 A;  2GDR A;  4BVY B;  2LJK A;  2R5G A;  1Q98 A;  1YDK A;  3F9U A;  4JE1 A;  5IOW A;  2PVQ A;  2XPE A;  4K5R A;  1GSE A;  1ILO A;  2H30 A;  2PUK C;  2L5L A;  4YKG A;  1KNG A;  2UV8 G;  1OC3 A;  1EV4 A;  2R3X A;  4I6X A;  4IS0 A;  5A5H B;  1U3I A;  1MD4 A;  2FWH A;  5ECR B;  4QL9 A;  3ZIJ A;  4ILF A;  5GST A;  4N10 A;  3G7J A;  2IMK A;  2VOC A;  3H4K A;  4GWR A;  4AKG A;  3FEU A;  3NOF A;  4G19 A;  2LJR A;  4ZIL A;  4KUN A;  2D2Z A;  3IOS A;  1OAZ A;  4IGJ A;  4PXO A;  3QPM A;  3F0I A;  5CRH A;  4IEL A;  3TJF A;  2VCZ A;  3FZ5 A;  3F3R A;  4IQ1 A;  4JBB A;  3Q19 A;  4YQU A;  3Q6O A;  2O5V A;  2CVD A;  1F37 A;  4EL1 A;  4TR1 B;  2Z9S A;  3RPN A;  5D9V A;  4MPF A;  1F6M C;  2F3M A;  2HRN A;  1A8L A;  3DEX A;  4G01 A;  3IHG A;  1GRX A;  4G0I A;  5J4Y A;  2ALB A;  2G2Q A;  3M0F A;  2C3T A;  2QKE A;  1UN2 A;  1M9A A;  5BMU B;  2E0Q A;  3ME8 A;  3A2X A;  3H79 A;  1NHO A;  5JCG A;  3FW2 A;  1TK0 B;  2R6K A;  3WYW A;  4IVF A;  4IHU A;  1FB6 A;  2VCX A;  3VUR A;  5A4V A;  5IPH A;  3CSJ A;  4O5Q A;  2V6O A;  4EIQ A;  4Q5F A;  3KM6 A;  4WF5 A;  3DML A;  2PU9 C;  4XRA A;  1XG8 A;  3IAS 2;  1T3B A;  1PX6 A;  3IK9 A;  4BVX B;  3F3Q A;  2XC2 A;  5E4W A;  1UC7 A;  1TKD B;  3UBL A;  4L8E A;  3GKN A;  1GTU A;  4Z2U A;  4TRX A;  4HS1 A;  3KIJ A;  1AAZ A;  1R26 A;  5GSS A;  2IWT A;  4OO4 A;  5A34 A;  1GSY A;  4KCE A;  2TRX A;  1QFN A;  4AF2 A;  2RM5 A;  3ZRE A;  1SL2 B;  4K8M A;  3DVW A;  1G6W A;  2JU5 A;  2M80 A;  4E8H A;  3TJB A;  5ID2 A;  1F3B A;  6GSU A;  2C3N A;  2OBK A;  3QMX A;  1K0O A;  3N9J A;  1X9W B;  4K5S A;  1T7P B;  3H93 A;  1OC9 B;  4L5L A;  5CRE A;  5ELG A;  3A2V A;  2HQT A;  2H66 A;  3GST A;  2WB9 A;  2RII A;  1CQG A;  1XVW A;  1B4P A;  3LXZ A;  1EP7 A;  3PR8 A;  3GMF A;  5HR3 A;  1FOH A;  5IPG A;  2N5B A;  4IBP A;  3EU4 A;  3EU3 A;  2EFE A;  3FZ9 A;  4O7H A;  1SK1 A;  2DJ3 A;  2K8V A;  2ZUP A;  3GKM A;  2DJK A;  1ERV A;  4I2U A;  4KF9 A;  3SWL A;  1CQH A;  4TR0 A;  4LL1 B;  2WVY A;  2PN8 A;  5G1L A;  2GQK A;  3ERW A;  3UAP A;  2JAC A;  2GLR A;  3GUR A;  1RW1 A;  1EGO A;  4DSR A;  2IN3 A;  4KSM A;  4L0W A;  1F2E A;  1O7U A;  3LYK A;  3GH9 A;  1XOA A;  3ZFB A;  2B6M A;  4ID0 A;  2JSZ A;  4BIK A;  3GSS A;  4PTS A;  1PQN A;  4F2I A;  5ECM B;  3MSZ A;  2WVX B;  2NPB A;  1YF1 A;  2RM6 A;  1O8W A;  1RQM A;  3EYT A;  4MZC A;  1WE0 A;  1WMJ A;  1QMV A;  5A1N A;  2AB6 A;  5DVB A;  3F6F A;  2H0G A;  4X43 A;  2YZH A;  5DQY A;  5JWO B;  3R3E A;  2C0G A;  4IQA A;  1XWA A;  2WRT A;  1TRW A;  3FZ4 A;  2YJH A;  3TU3 B;  1GUK A;  5H5R A;  1QXH A;  1HNB A;  2VL2 C;  2AUV A;  3GL5 A;  1PD2 1;  1BQ7 A;  4IP6 A;  4HOJ A;  1SU9 A;  2L6D A;  14GS A;  1XIY A;  4HQZ A;  1LBK A;  1EOH A;  4L0U A;  5CO3 A;  1RK4 A;  4KND A;  4MZB A;  1Z6N A;  3TJG A;  2H1D A;  2QSI A;  9GSS A;  3D4M A;  4MAB A;  3TGZ A;  1KEB A;  2CVK A;  3DD3 A;  1TDI A;  1O81 A;  2H72 A;  5A5K A;  4L5O A;  19GS A;  5AIV A;  4FO5 A;  4TR4 A;  2DJ1 A;  4GXZ A;  2MBS A;  1OC9 A;  2ON5 A;  4F82 A;  4ACS A;  3J7Y b;  2KUC A;  3ME7 A;  3E9J B;  2ZNM A;  3ERF A;  3TOT A;  1K0C A;  4PQI A;  4CW9 A;  4K0N A;  2VM2 A;  4MLY A;  2LS5 A;  3TJK A;  4DSS A;  3M1G A;  2HSM A;  4LMV A;  4XS4 B;  4TR3 A;  3V1W A;  4GST A;  1SYX A;  3KMO A;  4JRR A;  2LRN A;  2EFD A;  2HLS A;  1FOV A;  3IR4 A;  5IMC A;  4ZL8 A;  4IJ3 A;  4G10 A;  3CRU A;  1Z5Y E;  3G7I A;  3BCI A;  3LSZ A;  6GSX A;  1MDI A;  2C0E A;  1EV9 A;  1V98 A;  1M3I A;  5G5E A;  5KOW A;  5J47 A;  2VAF A;  5B6M A;  4OFT A;  1TOF A;  3L0H A;  2I81 A;  2PER A;  5ELA A;  4JED A;  1ZL9 A;  3GA4 A;  3IE3 A;  1A2J A;  1E2Y A;  1SVO A;  1G6Y A;  1U3A A;  3DXB A;  3GX0 A;  4AKI A;  2N5F A;  4PQ1 A;  3M9J A;  3D6I A;  1SJZ A;  2OE3 A;  3D21 A;  4BWQ A;  4PNG A;  3FY7 A;  1M2D A;  5JWQ B;  1K0M A;  3G9B A;  1AXD A;  5GZZ B;  1TU8 A;  4LMW A;  2GT5 A;  1BX9 A;  3TJJ A;  5B8A A;  3BD2 A;  3C7M A;  4ICY A;  1R5P A;  4ECI A;  4J57 E;  3ZTL A;  1SKR B;  1FVJ A;  2R37 A;  2H74 A;  1M99 A;  2OAC A;  5IMF A;  3BBY A;  1TK8 B;  4FXY P;  2VCV A;  4O32 A;  4N30 A;  3KMN A;  2OBI A;  1MTC A;  2JSY A;  4HU9 A;  4F03 A;  3LG6 A;  4MH3 A;  4POB A;  3MDK A;  4TVE A;  4D73 A;  1OC8 A;  2DIY A;  3HJP A;  4FYB A;  4ZL7 A;  3PIN A;  3TRQ A;  4WBJ A;  5IO2 A;  1FB0 A;  4EVM A;  4HJM A;  3F63 A;  1S3D A;  2FWF A;  3CXG A;  4NV2 A;  3H1N A;  2GTU A;  3VWV A;  4EUY A;  2LNT A;  2YPM A;  3RHB A;  3HDC A;  4YQM A;  2YN1 A;  5ECI B;  3GV1 A;  2IIY A;  2CVB A;  3NZN A;  1X5C A;  2GZZ A;  2OA7 A;  1XVQ A;  4NXI A;  3ZVJ D;  2GSR A;  1SJI A;  1TW9 A;  4WR5 A;  1UVZ A;  3P2A A;  4AKX B;  1XWK A;  3ZL5 A;  3QD9 A;  2LKU A;  3QFB C;  5B6N A;  1SK0 A;  1XW9 A;  1W89 A;  1N25 A;  2HYX A;  3DGQ A;  3VPQ A;  2I9H A;  2GSQ A;  1Y25 A;  5FHI A;  4NHZ A;  1O6J A;  2FHE A;  5EVO A;  3ZZX A;  2EC4 A;  1J9B A;  3MNG A;  1YKC A;  2CX4 A;  1YF0 A;  2AV4 A;  2DJJ A;  2VLU A;  1Z7P A;  4MF7 A;  5JWR B;  4XS6 A;  2KP2 A;  4CY8 A;  2WS2 A;  2YZU A;  4WKW A;  4FQU A;  1AQV A;  2VCW A;  1S3R A;  1JFU A;  2B7J A;  2HSY A;  5J4U A;  1A8Y A;  3UOM A;  3QCP A;  2LST A;  3KTB A;  1BJX A;  4W66 A;  4KB3 A;  2H0H A;  4KA0 A;  4NMU A;  3TKS C;  2IFQ A;  4PI0 C;  4OMV A;  4ULX A;  2V41 A;  2FA8 A;  1YQ1 A;  1O8X A;  2VM1 A;  2PBJ A;  2LEG A;  3UEM A;  2P31 A;  5ECL B;  2C0F A;  4ZB6 A;  3W8S A;  22GS A;  3FKF A;  3HY2 A;  1BED A;  2H75 A;  4XIH A;  3EWL A;  1V9W A;  2V1M A;  1W4V A;  1JZO A;  4H86 A;  1R5A A;  3RBT A;  2FD3 A;  4PHZ C;  1WJK A;  3G7Y A;  3F8U A;  2H71 A;  4ZB7 A;  2AAW A;  2FY6 A;  3FHK A;  1ERW A;  2I1U A;  4AI6 A;  2H0I A;  3UBK A;  3PGT A;  3HXS A;  4JR6 A;  2TIR A;  3LWA A;  5DCG A;  2MYG A;  1B9Y C;  1ACV A;  7GSS A;  2VIM A;  1EP8 A;  4ZIJ A;  5DAK B;  3UVH A;  1Q4J A;  1K3O A;  3MAK A;  4IN0 A;  5HFI A;  3ZFL A;  2O36 A;  1K0D A;  3OR5 A;  4N0V A;  5D9T A;  2H8L A;  3A5W A;  3ERG A;  4MH2 A;  2YOI A;  2K9F A;  3LW9 A;  1EOG A;  4OFM A;  3LOR A;  2QA2 A;  4K6X A;  2XHF A;  2HSN B;  2LRC A;  3RDW A;  1PFO A;  5COH A;  3EC3 A;  4TXO A;  1M9B A;  3GKX A;  4AJ8 A;  1H4O A;  1OVN A;  2HRK B;  2VCT A;  1HNC A;  4ECB A;  2A2S A;  5D73 A;  1ERT A;  3QDN A;  2HE3 A;  3GHA A;  4CDO A;  2UZ8 A;  3WT2 A;  2I3Y A;  4K7N A;  2F8F A;  2CZ2 A;  4N0Z A;  5LD0 A;  5HR1 A;  4MA9 A;  4BVY A;  3VLN A;  2LRT A;  1SL0 B;  1H75 A;  2IMF A;  2AYT A;  2DML A;  1YEX A;  5IIZ A;  2VL3 A;  3IPZ A;  4GLT A;  5H5S A;  2ES7 A;  2MMZ A;  2LJA A;  3QR6 A;  4XRD A;  4BA7 A;  2RUE A;  5A5H A;  1V40 A;  5ECO B;  1GTI A;  3K8N A;  2H70 A;  2DKI A;  4ISD A;  1XWC A;  4V2N A;  1SVM A;  2DBC A;  4I8B A;  6GST A;  2H6Y A;  4X4J A;  1XZO A;  3A5I A;  4CHS A;  1BG1 A;  2V32 A;  1EGR A;  4OD7 A;  1PL2 A;  1J0F A;  4FIW A;  5AIX A;  2B5Y A;  2O89 A;  3GIX A;  3IC4 A;  2HRA A;  3I69 A;  4QMK A;  2WDU A;  4JU5 A;  1MEK A;  2RLI A;  3DWV A;  4FYU A;  4E68 A;  1YJ6 A;  5HQP A;  2VLT A;  5ENU A;  5ECN B;  5J5N A;  3QFA C;  3LJR A;  4TR1 A;  5J9B A;  5LCZ A;  3EE2 A;  1A2L A;  1WIK A;  2CZ3 A;  5J4V A;  5DAL B;  1PA3 A;  2EIO A;  3HA9 A;  4KH7 A;  1ZOF A;  2GGT A;  4MPG A;  5BMU A;  3GRX A;  5HR0 A;  1TXU A;  2EFH A;  4WF4 A;  2YV7 A;  4NHW A;  3APQ A;  5F05 A;  2WW3 A;  1THX A;  3IC8 A;  3GUS A;  1GUH A;  3HJM A;  2JAD A;  3HD5 A;  4KDU A;  16GS A;  1YVL A;  2KP1 A;  3CQF A;  3RGB C;  1KBN A;  4JR4 A;  3VFI A;  1A23 A;  3IXR A;  2YWM A;  4RQX A;  3GTU B;  3ZVJ A;  5EPF A;  5G5F A;  4E8E A;  1B4Q A;  4TXV A;  1FHE A;  4BVX A;  3MWH A;  2X8C A;  2O87 A;  4KDY A;  5J9C A;  2L59 A;  1K0A A;  2WFC A;  3BOA A;  2C1Y A;  2LQQ A;  2EIR A;  3CHX C;  12GS A;  4OO5 A;  3EPT A;  5CRD A;  2MMA A;  4ZBA A;  1AIU A;  1IYH A;  2IJY A;  4WXT A;  4I97 A;  1M2A A;  1TRU A;  3F4T A;  2E7P A;  1GP1 A;  3WT1 A;  4HSC X;  4EXJ A;  1LJR A;  3ZMK A;  6GSS A;  1OE7 A;  5GAP D;  1PL1 A;  5EL8 A;  1V2A A;  2FGX A;  1NSW A;  4MJE A;  3KZQ A;  5L71 A;  2CV4 A;  4PNF A;  3ED3 A;  4K1F A;  3QAW A;  1JZW A;  2VD1 A;  2L6C A;  2HZE B;  5CAX A;  4N11 A;  4RQR A;  18GS A;  1MDK A;  4NPB A;  5DCH A;  4RI7 A;  2B5X A;  3VWU A;  4XCS A;  2B5E A;  1BF5 A;  2GST A;  2GQM A;  4OCE A;  3CYN A;  2C80 A;  4DSQ A;  2V6K A;  5LNK e;  2F8A A;  5HR2 A;  2MMO A;  1TI3 A;  5KN0 A;  4HZ4 A;  4HI7 A;  2PVO C;  2VLV A;  3KH9 A;  3C73 A;  4EIP A;  1DBY A;  3HCZ A;  3RHC A;  2YJ7 A;  4X1U A;  1TTZ A;  3P90 A;  1K3L A;  2R4V A;  4BL7 B;  1NW2 A;  3IHQ A;  4NAX A;  1VF4 A;  5DQS A;  2F51 A;  1PKZ A;  1SD9 A;  3EMX A;  1YKA A;  4HDE A;  4JZQ A;  3U5R E;  5JCU A;  1TJD A;  1U87 A;  2J9H A;  1YEW C;  2WW0 A;  4I5Q A;  1U88 A;  4Q5N A;  2WUL A;  4AGS A;  2H1B A;  4ML6 A;  2G0F A;  2WVX A;  1TP9 A;  3HVX A;  4V2M A;  3FZA A;  4V1A p;  3C1S A;  3TKS E;  1YY7 A;  1TI1 A;  2X49 A;  1ZZY A;  4LA1 A;  3UVT A;  4TKY A;  4IP1 A;  1AQX A;  3TCO A;  4MJC A;  1KTE A;  2DJ2 A;  2FUG 2;  1NM3 A;  2HRF A;  3W8J A;  3VWW A;  1JLW A;  2VO4 A;  1URM A;  3GNJ A;  5IMD A;  2NVL A;  2ON7 A;  1GTA A;  3QOU A;  2DMM A;  10GS A;  5ABR A;  3L9V A;  1X5D A;  4KW6 A;  2YWO A;  3QAG A;  2CT6 A;  1J08 A;  4J2F A;  1QUW A;  1O85 A;  3J7Y k;  2GVP A;  4EF0 A;  4Z2T A;  3L78 A;  3ZIV A;  1USB A;  2VUP A;  2RUF A;  11GS A;  1V58 A;  3CSH A;  3LEF A;  5J40 A;  3CBU A;  3VI7 A;  4ECJ A;  4I2T A;  3HYP A;  2LUS A;  3GN3 A;  2R0P A;  1K3Y A;  2VCQ A;  4GQC A;  2V2G A;  5A4U A;  3ZIT A;  2FWG A;  4G9H A;  3KCM A;  1A24 A;  1ZYE A;  1HYU A;  1X5E A;  5AIS A;  2IME A;  1WRY A;  4PQH A;  4EDY A;  3F6D A;  1ZMA A;  4O5U A;  1PGT A;  2HZE A;  1QK8 A;  1EWX A;  3EMP A;  3TRP A;  1VF1 A;  1PX7 A;  3M8N A;  3D22 A;  3FR6 A;  4NV5 A;  2BJX A;  1T8E B;  3TB2 A;  2K8S A;  8GSS A;  3I43 A;  1FG4 A;  2B3S A;  3IA1 A;  4XS4 A;  5HFG A;  3HMJ G;  3APS A;  1UA5 A;  2HFD A;  4K0G A;  2O3E A;  4MK3 A;  5DJL A;  4POM A;  5CRW A;  2IMI A;  1XW5 A;  5DDL A;  3KGK A;  3EIN A;  5IOX A;  2GSS A;  3GX8 A;  4YAV A;  4Z2R A;  2DKH A;  4TOP A;  2OAD A;  1S3A A;  4ZB9 A;  3A2W A;  2X8H A;  1BAY A;  2IMD A;  3WGE A;  4F0C A;  5G2Z A;  1SL1 B;  1VGL A;  2M72 A;  4RI6 A;  1Y6E A;  4HZ2 A;  1HNA A;  2LV3 A;  2MMN A;  1WOU A;  4RUV A;  3H8Q A;  3CMI A;  1Y1U A;  1T4Z A;  2H76 A;  1C72 A;  5J41 A;  1XPV A;  3TUE A;  2WGR A;  4K7O A;  1VF3 A;  1VF2 A;  3N5O A;  4PGT A;  2PPT A;  5ID2 B;  1XWG A;  2K18 A;  1AUC A;  3TKR A;  1I9D A;  5A4W A;  5CP1 A;  4AJ7 A;  1Z7R A;  3TKP A;  3D5J A;  4PI2 C;  5CNW A;  3D0Z A;  6GSY A;  4HUA A;  5IMA A;  1ABA A;  3VI5 A;  3EVI A;  2HXK A;  2L4C A;  3TKS A;  4G0L A;  2H19 A;  3PPU A;  1XXU A;  2LQO A;  5KN2 A;  3IRA A;  2H1L A;  3M9K A;  4ZXG A;  2YWN A;  3FR9 A;  4PUR A;  5KN3 A;  3SBC A;  1PN9 A;  3O76 A;  4ML1 A;  3IK7 A;  4V2L A;  1G7E A;  4PUF C;  2NBS A;  5ECS A;  5ECP B;  4TN8 A;  1ZYQ B;  3M3M A;  1I5G A;  1Z9H A;  1VRS D;  2O8V B;  5GAN D;  1G0T A;  4KAE A;  1T4Y A;  3P7X A;  2C4J A;  1XBS A;  1X9M B;  2A4V A;  2VKZ G;  2HZF A;  3HHV A;  1I1I P;  2H1G A;  1JZD A;  2OT3 A;  3CTF A;  2X4A A;  2KLX A;  3CTG A;  3ZLP A;  1GL8 A;  1X0R A;  1PMT A;  3GYK A;  3FRC A;  4K9Z A;  2YV9 A;  1TRV A;  2HI7 A;  2H1A A;  5KEJ A;  5EY6 A;  2H01 A;  4KCA A;  2YNX A;  2WJU A;  5F8B A;  2P5Q A;  2A2R A;  4A5P A;  5BRT A;  2MBT A;  3L4N A;  4FH8 A;  2JL4 A;  4KGI A;  2CX3 A;  1SKS B;  4XHM A;  5A1N B;  3GKK A;  3LQ7 A;  2X99 A;  3HZ4 A;  5DJM A;  1ST9 A;  2LNS A;  3UMA A;  3DKS A;  4MMM A;  1WP0 A;  1MD3 A;  4WEY A;  1SVL A;  3LGC A;  5B8B A;  1ON4 A;  3IV4 A;  5INY A;  1GUL A;  4K7I A;  3ZYW A;  1HD2 A;  3D4T A;  3IAM 2;  1N8J A;  3DVX A;  4LL4 B;  2QGV A;  3DYR A;  5D9W A;  1B8X A;  3S9F A;  2WZS A;  3HZ8 A;  1GH2 A;  1GUM A;  4N3Z A;  2OE0 A;  3GFK A;  5ECH B;  1EEM A;  2YCD A;  3WGX A;  4O92 A;  4ECC A;  2HSH A;  4AKH A;  4WR4 A;  1R4W A;  3FK8 A;  13GS A;  3PH9 A;  3HVS A;  1B48 A;  3W6G A;  1THO A;  2I4A A;  1AQW A;  1M7T A;  2PMT A;  2LTK A;  1XWB A;  4F9Z A;  1OYJ A;  1FAA A;  1GNW A;  1G7O A;  1DSB A;  1GSF A;  2R2J A;  5IMZ A;  3UIW A;  2XPD A;  3KP9 A;  2FA4 A;  4GSS A;  5C04 A;  4MJB A;  5IM9 A;  2OE1 A;  3GH6 A;  2C3Q A;  2X8G A;  3F4R A;  2XBI A;  5D8I A;  4DSS B;  4POL A;  1BYE A;  2HSM B;  4J56 E;  4XS1 A;  3FMW A;  4USS A;  4TW5 A;  3IBH A;  5FWG A;  3KP8 A;  4DVC A;  3DIE A;  1QQ2 A;  4OCF A;  5J3R A;  5KN1 A;  1BG5 A;  5AN1 A;  1K0N A;  1M3J A;  3MYD A;  2MZC A;  3VPT A;  3HVN A;  4IKH A;  4MF6 A;  2WW1 A;  4CY6 A;  2A4H A;  5G1K A;  1TU7 A;  2FCH A;  5DAK A;  4GRF A;  1FO5 A;  2CA8 A;  3TKQ A;  4HEA 2;  4IW9 A;  1XW6 A;  2H73 A;  5FT3 A;  1U6T A;  4KE3 A;  1YEP A;  2KHP A;  5F06 A;  3R2Q A;  5B7C A;  4GTU A;  1F9M A;  3I6A A;  1M0U A;  3HVV A;  5AGY A;  2HSN A;  2DJ0 A;  2REM A;  4V1A g;  3GL3 A;  2EFC A;  2C8U A;  2L4Q A;  4QL7 A;  2QA1 A;  1DE2 A;  2DC5 A;  3UAR A;  5G31 A;  3L9S A;  1EEJ A;  4PUA A;  2R0C A;  3Q74 A;  4DEJ A;  1TRS A;  1HQO A;  2HRK A;  1E6B A;  4KX4 A;  4EKZ A;  2PWJ A;  2GZY A;  4HJ2 A;  1OKD A;  1GWC A;  2VL2 A;  4BWS A;  2L57 A;  1WPI A;  1O73 A;  5H5Q A;  4GF0 A;  1FVK A;  1ZYN A;  2N5A A;  2O85 A;  1S3C A;  5CYY A;  2FNO A;  4Q5R A;  5HFK A;  4MP4 A;  3TOU A;  3LXT A;  3L9U A;  4HU7 A;  1A0R P;  1Z3E A;  1A2M A;  2FWE A;  4D73 B;  5D93 A;  4GQF A;  6GSW A;  4K2X A;  3LFL A;  4YKF A;  1NHY A;  4YH2 A;  2VD0 A;  5F07 A;  1SYR A;  2WVZ A;  4MCU A;  4XTS A;  2P5R A;  1PSQ A;  4EE0 A;  3ISO A;  1GSU A;  1T00 A;  1AC1 A;  2R0G A;  2AHE A;  3FR3 A;  2FLS A;  3U6V A;  4Z7X A;  3O6T A;  2GQL A;  3HKR A;  5IO0 A;  1WWJ A;  5F0G A;  2DSA A;  4MNN A;  1SKW B;  3KEB A;  2P0G A;  2IPA A;  1GSQ A;  5IQY A;  2JZS A;  1DE1 A;  5D96 A;  4QQ7 A;  4NWY A;  1ZGN A;  1V57 A;  2WZ9 A;  4IJI A;  1GNE A;  3LYP A;  3EUR A;  4GCI A;  2EIQ A;  3KJY A;  5E59 A;  4K2D A;  1TK5 B;  4ZBD A;  2YP6 A;  4EO3 A;  4OWY A;  1YZX A;  5DAL A;  4MF5 A;  2GT6 A;  3CWG A;  1SK2 A;  1ML6 A;  3I9V 2;  2GS3 A;  3RPP A;  1DUG A;  1XCC A;  3IDV A;  5G30 A;  1PKW A;  4ZBB A;  2JZR A;  5ECQ B;  3Q18 A;  3ZRD A;  4P3Y B;  3E0U A;  5D9X A;  2KOK A;  3E3E A;  17GS A;  4PX1 A;  3UJ1 A;  3CRT A;  1T1V A;  1N2A A;  2HNL A;  3C71 A;  4FYC A;  2E2M A;  4ZB8 A;  3DRN A;  4Q5Q A;  2B7K A;  1EZK A;  2K6V A;  3US3 A;  4HQS A;  2AJQ B;  5C00 A;  3C1R A;  4WBR D;  3GTU A;  1A0F A;  2M46 A;  2IFQ B;  1GSS A;  2OJL A;  2E2G A;  4F0B A;  3MIX A;  1ERU A;  4YAP A;  4G2E A;  2NDO A;  1X9S B;  2HT9 A;  2TRC P;  3KTL A;  2O7K A;  2NTO A;  5ECK B;  3FYG A;  3APO A;  4GDF A;  3UL3 A;  3KH7 A;  3QAV A;  3VWX A;  4EC0 A;  4YQV A;  3AY8 A;  1M2B A;  2GZP A;  1IYI A;  3KXO A;  2C0D A;  2XBQ A;  4G0K A;  4EDZ A;  2YAN A;  2CAQ A;  1SEN A;  2IL3 A;  1GLQ A;  5CRG A;  1OKT A;  1JZR A;  4WET A;  2BMX A;  1SD8 A;  3P8W A;  5KOX A;  3A3T A;  1QGV A;  2A2P A;  4X0X A;  3RAZ A;  1XFL A;  1LU4 A;  4AJ6 A;  3CSI A;  4POK A;  1PN0 A;  1GLP A;  3WGD A;  1B9X C;  1K0B A;  2WW2 A;  2H6X A;  1JLV A;  2DLX A;  5JCW A;  1SJ6 A;  4LLR A;  2OKA A;  6GSV A;  2WCI A;  4BPY A;  2BTO T;  2DIZ A;  4GSN A;  1Z6M A;  2X64 A;  4MDC A;  3ZML A;  5IMV A;  3VK9 A;  2H6Z A; 
#chains in the Genus database with same CATH homology
 2QC7 A;  2VL9 A;  2B1K A;  1MDJ A;  1FW1 A;  5DBQ A;  1GTB A;  1R7H A;  2B1L A;  2YWI A;  4MZW A;  3C8E A;  1OE8 A;  2ZCT A;  3BCK A;  2CQ9 A;  1JHB A;  3NIV A;  2J23 A;  1AW9 A;  4TXO B;  2CAI A;  2PGT A;  4KDX A;  3WD6 A;  3O3T A;  1F3A A;  1TXX A;  3TDG A;  1XOB A;  1ZCP A;  1GSD A;  4BL7 A;  4MJA A;  3JCM L;  4OFN A;  3TRX A;  20GS A;  1ZYP A;  1PRX A;  3KD0 A;  3F4S A;  4KSO A;  2JZT A;  5A34 B;  2F9S A;  3HJO A;  3BJ5 A;  4O5R A;  2L5O A;  4ZL9 A;  2GDR A;  4BVY B;  2LJK A;  2R5G A;  1Q98 A;  1YDK A;  3F9U A;  4JE1 A;  5IOW A;  2PVQ A;  2XPE A;  4K5R A;  1GSE A;  1ILO A;  2H30 A;  2PUK C;  2L5L A;  4YKG A;  1KNG A;  2UV8 G;  1OC3 A;  1EV4 A;  2R3X A;  4I6X A;  4IS0 A;  5A5H B;  1U3I A;  1MD4 A;  2FWH A;  5ECR B;  4QL9 A;  3ZIJ A;  4ILF A;  5GST A;  4N10 A;  3G7J A;  2IMK A;  2VOC A;  3H4K A;  4GWR A;  4AKG A;  3FEU A;  3NOF A;  4G19 A;  2LJR A;  4ZIL A;  4KUN A;  2D2Z A;  3IOS A;  1OAZ A;  4IGJ A;  4PXO A;  3QPM A;  3F0I A;  5CRH A;  4IEL A;  3TJF A;  2VCZ A;  3FZ5 A;  3F3R A;  4IQ1 A;  4JBB A;  3Q19 A;  4YQU A;  3Q6O A;  2O5V A;  2CVD A;  1F37 A;  4EL1 A;  4TR1 B;  2Z9S A;  3RPN A;  5D9V A;  4MPF A;  1F6M C;  2F3M A;  2HRN A;  1A8L A;  3DEX A;  4G01 A;  3IHG A;  1GRX A;  4G0I A;  5J4Y A;  2ALB A;  2G2Q A;  3M0F A;  2C3T A;  2QKE A;  1UN2 A;  1M9A A;  5BMU B;  2E0Q A;  3ME8 A;  3A2X A;  3H79 A;  1NHO A;  5JCG A;  3FW2 A;  1TK0 B;  2R6K A;  3WYW A;  4IVF A;  4IHU A;  1FB6 A;  2VCX A;  3VUR A;  5A4V A;  5IPH A;  3CSJ A;  4O5Q A;  2V6O A;  4EIQ A;  4Q5F A;  3KM6 A;  4WF5 A;  3DML A;  2PU9 C;  4XRA A;  3IAS 2;  1T3B A;  1PX6 A;  3IK9 A;  4BVX B;  3F3Q A;  2XC2 A;  5E4W A;  1UC7 A;  1TKD B;  3UBL A;  4L8E A;  3GKN A;  1GTU A;  4Z2U A;  4TRX A;  4HS1 A;  3KIJ A;  1AAZ A;  1R26 A;  5GSS A;  2IWT A;  4OO4 A;  5A34 A;  1GSY A;  4KCE A;  2TRX A;  1QFN A;  4AF2 A;  2RM5 A;  3ZRE A;  1SL2 B;  4K8M A;  3DVW A;  1G6W A;  2JU5 A;  2M80 A;  4E8H A;  3TJB A;  5ID2 A;  1F3B A;  6GSU A;  2C3N A;  2OBK A;  3QMX A;  1K0O A;  3N9J A;  1X9W B;  4K5S A;  1T7P B;  3H93 A;  1OC9 B;  4L5L A;  5CRE A;  5ELG A;  3A2V A;  2HQT A;  2H66 A;  3GST A;  2WB9 A;  2RII A;  1CQG A;  1XVW A;  1B4P A;  3LXZ A;  1EP7 A;  3PR8 A;  3GMF A;  5HR3 A;  1FOH A;  5IPG A;  2N5B A;  4IBP A;  3EU4 A;  3EU3 A;  2EFE A;  3FZ9 A;  4O7H A;  1SK1 A;  2DJ3 A;  2K8V A;  2ZUP A;  3GKM A;  2DJK A;  1ERV A;  4I2U A;  4KF9 A;  3SWL A;  1CQH A;  4TR0 A;  4LL1 B;  2PN8 A;  5G1L A;  2GQK A;  3ERW A;  3UAP A;  2JAC A;  2GLR A;  3GUR A;  1RW1 A;  1EGO A;  4DSR A;  2IN3 A;  4KSM A;  4L0W A;  1F2E A;  1O7U A;  3LYK A;  3GH9 A;  1XOA A;  3ZFB A;  2B6M A;  4ID0 A;  2JSZ A;  3GSS A;  4PTS A;  1PQN A;  4F2I A;  5ECM B;  3MSZ A;  2NPB A;  1YF1 A;  2RM6 A;  1O8W A;  1RQM A;  3EYT A;  4MZC A;  1WE0 A;  1WMJ A;  1QMV A;  5A1N A;  2AB6 A;  5DVB A;  3F6F A;  2H0G A;  4X43 A;  2YZH A;  5DQY A;  5JWO B;  3R3E A;  2C0G A;  4IQA A;  1XWA A;  2WRT A;  1TRW A;  3FZ4 A;  2YJH A;  3TU3 B;  1GUK A;  5H5R A;  1QXH A;  1HNB A;  2VL2 C;  2AUV A;  3GL5 A;  1PD2 1;  1BQ7 A;  4IP6 A;  4HOJ A;  1SU9 A;  2L6D A;  14GS A;  1XIY A;  4HQZ A;  1LBK A;  1EOH A;  4L0U A;  5CO3 A;  1RK4 A;  4KND A;  4MZB A;  1Z6N A;  3TJG A;  2H1D A;  2QSI A;  9GSS A;  3D4M A;  4MAB A;  3TGZ A;  1KEB A;  2CVK A;  3DD3 A;  1TDI A;  1O81 A;  2H72 A;  5A5K A;  4L5O A;  19GS A;  5AIV A;  4FO5 A;  4TR4 A;  2DJ1 A;  4GXZ A;  2MBS A;  1OC9 A;  2ON5 A;  4F82 A;  4ACS A;  3J7Y b;  2KUC A;  3ME7 A;  3E9J B;  2ZNM A;  3ERF A;  3TOT A;  1K0C A;  4PQI A;  4CW9 A;  4K0N A;  2VM2 A;  4MLY A;  2LS5 A;  3TJK A;  4DSS A;  3M1G A;  2HSM A;  4LMV A;  4XS4 B;  4TR3 A;  3V1W A;  4GST A;  1SYX A;  3KMO A;  4JRR A;  2LRN A;  2EFD A;  2HLS A;  1FOV A;  3IR4 A;  5IMC A;  4ZL8 A;  4IJ3 A;  4G10 A;  3CRU A;  1Z5Y E;  3G7I A;  3BCI A;  3LSZ A;  6GSX A;  1MDI A;  2C0E A;  1EV9 A;  1V98 A;  5G5E A;  5KOW A;  5J47 A;  2VAF A;  5B6M A;  4OFT A;  1TOF A;  3L0H A;  2I81 A;  2PER A;  5ELA A;  4JED A;  1ZL9 A;  3GA4 A;  3IE3 A;  1A2J A;  1E2Y A;  1SVO A;  1G6Y A;  1U3A A;  3DXB A;  3GX0 A;  4AKI A;  2N5F A;  4PQ1 A;  3M9J A;  3D6I A;  1SJZ A;  2OE3 A;  3D21 A;  4BWQ A;  4PNG A;  3FY7 A;  1M2D A;  5JWQ B;  1K0M A;  3G9B A;  1AXD A;  5GZZ B;  1TU8 A;  4LMW A;  2GT5 A;  1BX9 A;  3TJJ A;  5B8A A;  3BD2 A;  3C7M A;  4ICY A;  1R5P A;  4ECI A;  4J57 E;  3ZTL A;  1SKR B;  1FVJ A;  2R37 A;  2H74 A;  1M99 A;  2OAC A;  5IMF A;  3BBY A;  1TK8 B;  2VCV A;  4O32 A;  4N30 A;  3KMN A;  2OBI A;  1MTC A;  2JSY A;  4HU9 A;  4F03 A;  3LG6 A;  4MH3 A;  4POB A;  3MDK A;  4TVE A;  4D73 A;  1OC8 A;  2DIY A;  3HJP A;  4FYB A;  4ZL7 A;  3PIN A;  3TRQ A;  4WBJ A;  5IO2 A;  1FB0 A;  4EVM A;  4HJM A;  3F63 A;  1S3D A;  2FWF A;  3CXG A;  4NV2 A;  3H1N A;  2GTU A;  3VWV A;  4EUY A;  2LNT A;  2YPM A;  3RHB A;  3HDC A;  4YQM A;  2YN1 A;  5ECI B;  3GV1 A;  2IIY A;  2CVB A;  3NZN A;  1X5C A;  2GZZ A;  2OA7 A;  1XVQ A;  4NXI A;  3ZVJ D;  2GSR A;  1SJI A;  1TW9 A;  4WR5 A;  1UVZ A;  3P2A A;  4AKX B;  1XWK A;  3ZL5 A;  3QD9 A;  2LKU A;  3QFB C;  5B6N A;  1SK0 A;  1XW9 A;  1W89 A;  1N25 A;  2HYX A;  3DGQ A;  3VPQ A;  2I9H A;  2GSQ A;  1Y25 A;  5FHI A;  4NHZ A;  1O6J A;  2FHE A;  5EVO A;  3ZZX A;  2EC4 A;  1J9B A;  3MNG A;  1YKC A;  2CX4 A;  1YF0 A;  2AV4 A;  2DJJ A;  2VLU A;  1Z7P A;  4MF7 A;  5JWR B;  4XS6 A;  2KP2 A;  4CY8 A;  2WS2 A;  2YZU A;  4WKW A;  4FQU A;  1AQV A;  2VCW A;  1JFU A;  2B7J A;  2HSY A;  5J4U A;  1A8Y A;  3UOM A;  3QCP A;  2LST A;  3KTB A;  1BJX A;  4W66 A;  4KB3 A;  2H0H A;  4KA0 A;  4NMU A;  3TKS C;  2IFQ A;  4OMV A;  4ULX A;  2V41 A;  2FA8 A;  1YQ1 A;  1O8X A;  2VM1 A;  2PBJ A;  2LEG A;  3UEM A;  2P31 A;  5ECL B;  2C0F A;  4ZB6 A;  3W8S A;  22GS A;  3FKF A;  3HY2 A;  1BED A;  2H75 A;  4XIH A;  3EWL A;  1V9W A;  2V1M A;  1W4V A;  1JZO A;  4H86 A;  1R5A A;  3RBT A;  2FD3 A;  1WJK A;  3G7Y A;  3F8U A;  2H71 A;  4ZB7 A;  2AAW A;  2FY6 A;  3FHK A;  1ERW A;  2I1U A;  4AI6 A;  2H0I A;  3UBK A;  3PGT A;  3HXS A;  4JR6 A;  2TIR A;  3LWA A;  5DCG A;  2MYG A;  1B9Y C;  1ACV A;  7GSS A;  2VIM A;  1EP8 A;  4ZIJ A;  5DAK B;  3UVH A;  1Q4J A;  1K3O A;  3MAK A;  4IN0 A;  5HFI A;  3ZFL A;  1K0D A;  3OR5 A;  4N0V A;  5D9T A;  2H8L A;  3A5W A;  3ERG A;  4MH2 A;  2YOI A;  2K9F A;  3LW9 A;  1EOG A;  4OFM A;  3LOR A;  2QA2 A;  4K6X A;  2XHF A;  2HSN B;  2LRC A;  3RDW A;  5COH A;  3EC3 A;  4TXO A;  1M9B A;  3GKX A;  4AJ8 A;  1H4O A;  1OVN A;  2HRK B;  2VCT A;  1HNC A;  4ECB A;  2A2S A;  5D73 A;  1ERT A;  3QDN A;  2HE3 A;  3GHA A;  4CDO A;  2UZ8 A;  3WT2 A;  2I3Y A;  4K7N A;  2F8F A;  2CZ2 A;  4N0Z A;  5LD0 A;  5HR1 A;  4MA9 A;  4BVY A;  3VLN A;  2LRT A;  1SL0 B;  1H75 A;  2IMF A;  2AYT A;  2DML A;  1YEX A;  5IIZ A;  2VL3 A;  3IPZ A;  4GLT A;  5H5S A;  2ES7 A;  2MMZ A;  2LJA A;  3QR6 A;  4XRD A;  4BA7 A;  2RUE A;  5A5H A;  1V40 A;  5ECO B;  1GTI A;  3K8N A;  2H70 A;  2DKI A;  4ISD A;  1XWC A;  4V2N A;  1SVM A;  2DBC A;  4I8B A;  6GST A;  2H6Y A;  4X4J A;  1XZO A;  3A5I A;  4CHS A;  1BG1 A;  2V32 A;  1EGR A;  4OD7 A;  1PL2 A;  1J0F A;  4FIW A;  5AIX A;  2B5Y A;  2O89 A;  3GIX A;  3IC4 A;  2HRA A;  3I69 A;  4QMK A;  2WDU A;  4JU5 A;  1MEK A;  2RLI A;  3DWV A;  4FYU A;  4E68 A;  1YJ6 A;  5HQP A;  2VLT A;  5ENU A;  5ECN B;  5J5N A;  3QFA C;  3LJR A;  4TR1 A;  5J9B A;  5LCZ A;  3EE2 A;  1A2L A;  1WIK A;  2CZ3 A;  5J4V A;  5DAL B;  1PA3 A;  2EIO A;  3HA9 A;  4KH7 A;  1ZOF A;  2GGT A;  4MPG A;  5BMU A;  3GRX A;  5HR0 A;  1TXU A;  2EFH A;  4WF4 A;  2YV7 A;  4NHW A;  3APQ A;  5F05 A;  1THX A;  3IC8 A;  3GUS A;  1GUH A;  3HJM A;  2JAD A;  3HD5 A;  4KDU A;  16GS A;  1YVL A;  2KP1 A;  1KBN A;  4JR4 A;  3VFI A;  1A23 A;  3IXR A;  2YWM A;  4RQX A;  3GTU B;  3ZVJ A;  5EPF A;  5G5F A;  4E8E A;  1B4Q A;  4TXV A;  1FHE A;  4BVX A;  3MWH A;  2X8C A;  2O87 A;  4KDY A;  5J9C A;  2L59 A;  1K0A A;  2WFC A;  3BOA A;  2C1Y A;  2LQQ A;  2EIR A;  12GS A;  4OO5 A;  3EPT A;  5CRD A;  2MMA A;  4ZBA A;  1AIU A;  1IYH A;  2IJY A;  4WXT A;  4I97 A;  1M2A A;  1TRU A;  3F4T A;  2E7P A;  1GP1 A;  3WT1 A;  4EXJ A;  1LJR A;  3ZMK A;  6GSS A;  1OE7 A;  5GAP D;  1PL1 A;  5EL8 A;  1V2A A;  2FGX A;  1NSW A;  4MJE A;  3KZQ A;  5L71 A;  2CV4 A;  4PNF A;  3ED3 A;  4K1F A;  3QAW A;  1JZW A;  2VD1 A;  2L6C A;  2HZE B;  5CAX A;  4N11 A;  4RQR A;  18GS A;  1MDK A;  4NPB A;  5DCH A;  4RI7 A;  2B5X A;  3VWU A;  4XCS A;  2B5E A;  1BF5 A;  2GST A;  2GQM A;  4OCE A;  3CYN A;  2C80 A;  4DSQ A;  2V6K A;  5LNK e;  2F8A A;  5HR2 A;  2MMO A;  1TI3 A;  5KN0 A;  4HZ4 A;  4HI7 A;  2PVO C;  2VLV A;  3KH9 A;  3C73 A;  4EIP A;  1DBY A;  3HCZ A;  3RHC A;  2YJ7 A;  4X1U A;  1TTZ A;  3P90 A;  1K3L A;  2R4V A;  4BL7 B;  1NW2 A;  3IHQ A;  4NAX A;  1VF4 A;  5DQS A;  2F51 A;  1PKZ A;  1SD9 A;  3EMX A;  1YKA A;  4HDE A;  4JZQ A;  3U5R E;  5JCU A;  1TJD A;  1U87 A;  2J9H A;  4I5Q A;  1U88 A;  4Q5N A;  2WUL A;  4AGS A;  2H1B A;  4ML6 A;  2G0F A;  1TP9 A;  3HVX A;  4V2M A;  4V1A p;  3FZA A;  3C1S A;  3TKS E;  1YY7 A;  1TI1 A;  2X49 A;  1ZZY A;  4LA1 A;  3UVT A;  4TKY A;  4IP1 A;  1AQX A;  3TCO A;  4MJC A;  1KTE A;  2DJ2 A;  2FUG 2;  1NM3 A;  2HRF A;  3W8J A;  3VWW A;  1JLW A;  2VO4 A;  1URM A;  3GNJ A;  5IMD A;  2NVL A;  2ON7 A;  1GTA A;  3QOU A;  2DMM A;  10GS A;  5ABR A;  3L9V A;  1X5D A;  4KW6 A;  2YWO A;  3QAG A;  2CT6 A;  1J08 A;  4J2F A;  1QUW A;  1O85 A;  3J7Y k;  2GVP A;  4EF0 A;  4Z2T A;  3L78 A;  3ZIV A;  1USB A;  2VUP A;  2RUF A;  11GS A;  1V58 A;  3CSH A;  3LEF A;  5J40 A;  3CBU A;  3VI7 A;  4ECJ A;  4I2T A;  3HYP A;  2LUS A;  3GN3 A;  2R0P A;  1K3Y A;  2VCQ A;  4GQC A;  2V2G A;  5A4U A;  3ZIT A;  2FWG A;  4G9H A;  3KCM A;  1A24 A;  1ZYE A;  1HYU A;  1X5E A;  5AIS A;  2IME A;  1WRY A;  4PQH A;  4EDY A;  3F6D A;  1ZMA A;  4O5U A;  1PGT A;  2HZE A;  1QK8 A;  1EWX A;  3EMP A;  3TRP A;  1VF1 A;  1PX7 A;  3M8N A;  3D22 A;  3FR6 A;  4NV5 A;  2BJX A;  1T8E B;  3TB2 A;  2K8S A;  8GSS A;  3I43 A;  1FG4 A;  2B3S A;  3IA1 A;  4XS4 A;  5HFG A;  3HMJ G;  1UA5 A;  2HFD A;  4K0G A;  3APS A;  4MK3 A;  5DJL A;  4POM A;  5CRW A;  2IMI A;  1XW5 A;  5DDL A;  3KGK A;  3EIN A;  5IOX A;  2GSS A;  3GX8 A;  4YAV A;  4Z2R A;  2DKH A;  4TOP A;  2OAD A;  1S3A A;  4ZB9 A;  3A2W A;  2X8H A;  1BAY A;  2IMD A;  3WGE A;  4F0C A;  5G2Z A;  1SL1 B;  1VGL A;  2M72 A;  4RI6 A;  1Y6E A;  4HZ2 A;  1HNA A;  2LV3 A;  2MMN A;  1WOU A;  4RUV A;  3H8Q A;  3CMI A;  1Y1U A;  1T4Z A;  2H76 A;  1C72 A;  5J41 A;  1XPV A;  3TUE A;  2WGR A;  4K7O A;  1VF3 A;  1VF2 A;  3N5O A;  4PGT A;  2PPT A;  5ID2 B;  1XWG A;  2K18 A;  1AUC A;  3TKR A;  1I9D A;  5A4W A;  5CP1 A;  4AJ7 A;  1Z7R A;  3TKP A;  3D5J A;  5CNW A;  3D0Z A;  6GSY A;  4HUA A;  5IMA A;  1ABA A;  3VI5 A;  3EVI A;  2HXK A;  2L4C A;  3TKS A;  4G0L A;  2H19 A;  3PPU A;  1XXU A;  2LQO A;  5KN2 A;  3IRA A;  2H1L A;  3M9K A;  4ZXG A;  2YWN A;  3FR9 A;  4PUR A;  5KN3 A;  3SBC A;  1PN9 A;  3O76 A;  4ML1 A;  3IK7 A;  4V2L A;  1G7E A;  4PUF C;  2NBS A;  5ECS A;  5ECP B;  4TN8 A;  1ZYQ B;  3M3M A;  1I5G A;  1Z9H A;  1VRS D;  2O8V B;  5GAN D;  1G0T A;  4KAE A;  1T4Y A;  3P7X A;  2C4J A;  1XBS A;  1X9M B;  2A4V A;  2VKZ G;  2HZF A;  3HHV A;  2H1G A;  1JZD A;  2OT3 A;  3CTF A;  2X4A A;  2KLX A;  3CTG A;  3ZLP A;  1GL8 A;  1X0R A;  1PMT A;  3GYK A;  3FRC A;  4K9Z A;  2YV9 A;  1TRV A;  2HI7 A;  2H1A A;  5KEJ A;  5EY6 A;  2H01 A;  4KCA A;  2YNX A;  2WJU A;  5F8B A;  2P5Q A;  2A2R A;  4A5P A;  5BRT A;  2MBT A;  3L4N A;  4FH8 A;  2JL4 A;  4KGI A;  2CX3 A;  1SKS B;  4XHM A;  5A1N B;  3GKK A;  3LQ7 A;  2X99 A;  3HZ4 A;  5DJM A;  1ST9 A;  2LNS A;  3UMA A;  3DKS A;  4MMM A;  1WP0 A;  1MD3 A;  4WEY A;  1SVL A;  3LGC A;  5B8B A;  1ON4 A;  3IV4 A;  5INY A;  1GUL A;  4K7I A;  3ZYW A;  1HD2 A;  3D4T A;  3IAM 2;  1N8J A;  3DVX A;  4LL4 B;  2QGV A;  3DYR A;  5D9W A;  1B8X A;  3S9F A;  3HZ8 A;  1GH2 A;  1GUM A;  4N3Z A;  2OE0 A;  3GFK A;  5ECH B;  1EEM A;  2YCD A;  3WGX A;  4O92 A;  4ECC A;  2HSH A;  4AKH A;  4WR4 A;  1R4W A;  3FK8 A;  13GS A;  3PH9 A;  3HVS A;  1B48 A;  3W6G A;  1THO A;  2I4A A;  1AQW A;  1M7T A;  2PMT A;  2LTK A;  1XWB A;  4F9Z A;  1OYJ A;  1FAA A;  1GNW A;  1G7O A;  1DSB A;  1GSF A;  2R2J A;  5IMZ A;  3UIW A;  2XPD A;  3KP9 A;  2FA4 A;  4GSS A;  5C04 A;  4MJB A;  5IM9 A;  2OE1 A;  3GH6 A;  2C3Q A;  2X8G A;  3F4R A;  2XBI A;  5D8I A;  4DSS B;  4POL A;  1BYE A;  2HSM B;  4J56 E;  4XS1 A;  3FMW A;  4USS A;  4TW5 A;  3IBH A;  5FWG A;  3KP8 A;  4DVC A;  3DIE A;  1QQ2 A;  4OCF A;  5J3R A;  5KN1 A;  1BG5 A;  5AN1 A;  1K0N A;  3MYD A;  2MZC A;  3VPT A;  4IKH A;  4MF6 A;  4CY6 A;  2A4H A;  5G1K A;  1TU7 A;  2FCH A;  5DAK A;  4GRF A;  1FO5 A;  2CA8 A;  3TKQ A;  4HEA 2;  4IW9 A;  1XW6 A;  2H73 A;  5FT3 A;  1U6T A;  4KE3 A;  1YEP A;  2KHP A;  5F06 A;  3R2Q A;  5B7C A;  4GTU A;  1F9M A;  3I6A A;  1M0U A;  3HVV A;  5AGY A;  2HSN A;  2DJ0 A;  2REM A;  4V1A g;  3GL3 A;  2EFC A;  2C8U A;  2L4Q A;  4QL7 A;  2QA1 A;  1DE2 A;  2DC5 A;  3UAR A;  5G31 A;  3L9S A;  1EEJ A;  4PUA A;  2R0C A;  3Q74 A;  4DEJ A;  1TRS A;  1HQO A;  2HRK A;  1E6B A;  4KX4 A;  4EKZ A;  2PWJ A;  2GZY A;  4HJ2 A;  1OKD A;  1GWC A;  2VL2 A;  4BWS A;  2L57 A;  1WPI A;  1O73 A;  5H5Q A;  4GF0 A;  1FVK A;  1ZYN A;  2N5A A;  2O85 A;  1S3C A;  5CYY A;  2FNO A;  4Q5R A;  5HFK A;  4MP4 A;  3TOU A;  3LXT A;  3L9U A;  4HU7 A;  1A0R P;  1Z3E A;  1A2M A;  2FWE A;  4D73 B;  5D93 A;  4GQF A;  6GSW A;  4K2X A;  3LFL A;  4YKF A;  1NHY A;  4YH2 A;  2VD0 A;  5F07 A;  1SYR A;  4MCU A;  4XTS A;  2P5R A;  1PSQ A;  4EE0 A;  3ISO A;  1GSU A;  1T00 A;  1AC1 A;  2R0G A;  2AHE A;  3FR3 A;  2FLS A;  3U6V A;  4Z7X A;  3O6T A;  2GQL A;  3HKR A;  5IO0 A;  1WWJ A;  5F0G A;  2DSA A;  4MNN A;  1SKW B;  3KEB A;  2P0G A;  2IPA A;  1GSQ A;  5IQY A;  2JZS A;  1DE1 A;  5D96 A;  4QQ7 A;  4NWY A;  1ZGN A;  1V57 A;  2WZ9 A;  4IJI A;  1GNE A;  3LYP A;  3EUR A;  4GCI A;  2EIQ A;  3KJY A;  5E59 A;  4K2D A;  1TK5 B;  4ZBD A;  2YP6 A;  4EO3 A;  4OWY A;  1YZX A;  5DAL A;  4MF5 A;  2GT6 A;  3CWG A;  1SK2 A;  1ML6 A;  3I9V 2;  2GS3 A;  3RPP A;  1DUG A;  1XCC A;  3IDV A;  5G30 A;  1PKW A;  4ZBB A;  2JZR A;  5ECQ B;  3Q18 A;  3ZRD A;  4P3Y B;  3E0U A;  5D9X A;  2KOK A;  3E3E A;  17GS A;  4PX1 A;  3UJ1 A;  3CRT A;  1T1V A;  1N2A A;  2HNL A;  3C71 A;  4FYC A;  2E2M A;  4ZB8 A;  3DRN A;  4Q5Q A;  2B7K A;  1EZK A;  2K6V A;  3US3 A;  4HQS A;  2AJQ B;  5C00 A;  3C1R A;  4WBR D;  3GTU A;  1A0F A;  2M46 A;  2IFQ B;  1GSS A;  2OJL A;  2E2G A;  4F0B A;  3MIX A;  1ERU A;  4YAP A;  4G2E A;  2NDO A;  1X9S B;  2HT9 A;  2TRC P;  3KTL A;  2O7K A;  2NTO A;  5ECK B;  3FYG A;  3APO A;  4GDF A;  3UL3 A;  3KH7 A;  3QAV A;  3VWX A;  4EC0 A;  4YQV A;  3AY8 A;  1M2B A;  2GZP A;  1IYI A;  3KXO A;  2C0D A;  2XBQ A;  4G0K A;  4EDZ A;  2YAN A;  2CAQ A;  1SEN A;  2IL3 A;  1GLQ A;  5CRG A;  1OKT A;  1JZR A;  4WET A;  2BMX A;  1SD8 A;  3P8W A;  5KOX A;  3A3T A;  1QGV A;  2A2P A;  4X0X A;  3RAZ A;  1XFL A;  1LU4 A;  4AJ6 A;  3CSI A;  4POK A;  1PN0 A;  1GLP A;  3WGD A;  1B9X C;  1K0B A;  2H6X A;  1JLV A;  2DLX A;  5JCW A;  1SJ6 A;  4LLR A;  2OKA A;  6GSV A;  2WCI A;  4BPY A;  2BTO T;  2DIZ A;  4GSN A;  1Z6M A;  2X64 A;  4MDC A;  3ZML A;  5IMV A;  3VK9 A;  2H6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...