3NIVA

The crystal structure of glutathione s-transferase from legionella pneumophila
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
191
Chain Sequence
ILYDYFRSTACYRVRIALNLKKIAYEKIEVHLLVPSLDINGQILSQSMAIIDYLEEIHPEMPLLPKDPFMKATLKSMALIVACDMHPLNNLRVLNRLKEQFNANEEQVLEWYHHWLKTGFDAFEEKLGALERDKPVCFGSEVGLADVCLIPQVYNAHRFHFDMASYPIINEINEYCLTLPAFHDAAPEAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glutathione S-transferase
publication title The crystal structure of Glutathione S-transferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
total genus 59
structure length 191
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.2: Maleylacetoacetate isomerase.
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3nivA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3nivA01
1ERVA 3TJBA 2V6KA 5DVBA 3ZVJA 3KMOA 2CA8A 4NV2A 5HR1A 3R2QA 2G2QA 1MD3A 2PU9C 3BBYA 2F8AA 2OE0A 4ECJA 3JCML 2B5YA 3I43A 5ENUA 3I9V2 3FZ5A 3TKRA 2FNOA 4Q5FA 2OACA 2CVKA 3UMAA 2H73A 3ZL5A 3IK9A 2HSHA 6GSYA 2B1KA 4HJMA 1FB6A 1YEPA 3ZFLA 3C8EA 4AJ8A 3Q19A 2KP2A 2HT9A 3C1SA 3NIVA 3K8NA 1SJIA 5E4WA 4KA0A 4XHMA 4MABA 1GULA 2ON7A 2XBIA 4G9HA 4GLTA 1T1VA 4OFTA 1NSWA 3UVTA 2HXKA 2REMA 2VL9A 1K0DA 2I81A 4KCAA 2QGVA 5EY6A 1FB0A 2GLRA 2MMOA 2H74A 1Z9HA 4Q5QA 1HD2A 4IP1A 2LQQA 4MJAA 2A4VA 5J9CA 3HJOA 4V2LA 4X1UA 5G31A 4IKHA 4ZL7A 5B7CA 4F03A 5IOXA 2L4QA 4O5RA 4MK3A 2WFCA 2XHFA 1DBYA 1XBSA 1EP7A 1ML6A 1OC9A 1OYJA 3CBUA 1MEKA 2DJ3A 3FR6A 2NBSA 4EC0A 3BOAA 5F8BA 3F3RA 2C80A 4YH2A 1G6YA 4EVMA 3KZQA 1SJZA 1SKSB 3QD9A 3WGEA 4G0KA 1ILOA 1WMJA 1J9BA 2RUEA 3TKPA 2WS2A 3M0FA 3I69A 1ON4A 5H5SA 3Q18A 3F6DA 1ZYEA 4J56E 5G1LA 2WULA 1AW9A 3P90A 4IGJA 3UVHA 3CRUA 3QFAC 2GSSA 1ABAA 2YV7A 6GSWA 3HD5A 2HRFA 4QL7A 2DMLA 1NHYA 3G9BA 1C72A 4HDEA 3LXZA 2D2ZA 3LYPA 3MDKA 2E7PA 2QKEA 1GSEA 3VWUA 2CZ2A 4FIWA 1SYRA 5G30A 1Z5YE 1GSSA 2OE3A 2LNTA 6GSVA 1QMVA 4BVXA 4KH7A 2GZPA 4KNDA 4X0XA 2PWJA 4WXTA 2AV4A 1YY7A 4BWQA 1R4WA 2OKAA 2H6XA 2YJ7A 1OC8A 2FWFA 3HVXA 3DWVA 5J3RA 4G10A 1XWBA 3N9JA 1TRSA 2JU5A 3US3A 3GL3A 2C3TA 3D5JA 4EO3A 3ME7A 1BYEA 3KD0A 1V9WA 1JLWA 4KDYA 5DQYA 4AGSA 5DJMA 2H6YA 4DSSA 4TR1A 2LV3A 3TRQA 3RHCA 4HQZA 2DJJA 4K1FA 4ZL8A 1SK0A 3D0ZA 2GSQA 1TKDB 5C04A 1GRXA 2MBSA 1VGLA 4MLYA 2C3QA 3ZIJA 1TU7A 4E8HA 3GN3A 2X8CA 3GFKA 1Y25A 1WRYA 4RUVA 3L78A 3I6AA 1OKTA 5CNWA 5DJLA 3TJGA 1PX7A 4HOJA 1OVNA 2H30A 1S3DA 4POBA 4GSTA 2X8GA 1PMTA 2XBQA 3TB2A 1THXA 2HYXA 4OD7A 1MTCA 2AUVA 5L71A 4O7HA 1T7PB 4IW9A 5IPHA 3HDCA 2DJ2A 1A24A 1EGRA 2YCDA 1H75A 5J4UA 2VCQA 3GKMA 1SL2B 2N5FA 2AAWA 3KM6A 3ZREA 4XS6A 1AQVA 2KUCA 1KNGA 3KEBA 4MMMA 4PTSA 3QMXA 4RQXA 3IAS2 4PQIA 3PPUA 1WPIA 4JE1A 4GQCA 1GSUA 3FZAA 1GLQA 1J0FA 2IMKA 4XRDA 3HA9A 3LJRA 5AGYA 2I4AA 6GSXA 2B7KA 2VL2A 1U88A 2VCXA 1ZGNA 3GSTA 2C0EA 3IBHA 1E6BA 1SL1B 1DUGA 4K7OA 1XW5A 1XWCA 2B5EA 1JHBA 10GSA 1VF4A 2O89A 1TI3A 4WF5A 2HRNA 2H19A 4GF0A 2C4JA 1YF1A 4XIHA 1PQNA 1B9YC 3EU3A 1XWAA 3WT2A 4AJ7A 2HZFA 2BTOT 1K3YA 4L5LA 2RLIA 5CYYA 1Z7PA 1XXUA 3DGQA 4AF2A 1WWJA 3EMXA 2MZCA 1MDKA 3LQ7A 2FWGA 5KN1A 1G7EA 1AQXA 1X5DA 4IELA 1R5AA 5IOWA 3DEXA 4L5OA 2LJKA 3IAM2 5IMVA 1BG5A 4FO5A 4I8BA 4G0IA 5GSTA 4GXZA 4Z7XA 4IP6A 4J2FA 5IPGA 1PN9A 2R6KA 5A4WA 3W6GA 1UVZA 3TRPA 3EE2A 4BPYA 2O8VB 13GSA 5AN1A 3FK8A 3HJPA 5FWGA 4YQVA 1WOUA 2AJQB 1SK2A 4HZ4A 2HE3A 3ZITA 2H1DA 3E0UA 4N0VA 2MYGA 5D8IA 5EL8A 2LRTA 4ZB9A 1GUKA 1WJKA 2QSIA 3A5WA 4TXOB 1I5GA 2YV9A 3ZMKA 2OBIA 3F4RA 3HZ8A 3ZMLA 4FYCA 3V1WA 4Q5RA 7GSSA 4PXOA 2JZRA 1B8XA 2WB9A 1W89A 1AC1A 3D21A 3EVIA 3SBCA 4GQFA 3LGCA 1GTIA 1PX6A 5ECLB 4MA9A 2MMNA 1HNBA 2DLXA 1F9MA 4N11A 2V2GA 4N0ZA 5HFIA 1ERUA 3VPQA 2FWEA 2B5XA 5G5FA 1CQGA 1XVQA 4RI6A 2FA8A 5LD0A 2TRXA 4TR0A 3L4NA 4HI7A 5HR3A 3NOFA 1O85A 4QL9A 2PBJA 3GX0A 1J08A 2JADA 1TW9A 3GL5A 1ZOFA 4LA1A 1KEBA 4ZXGA 2CVBA 1SKWB 1XWGA 3P8WA 2GTUA 2JSZA 4GTUA 1EGOA 1QFNA 3Q6OA 1DE1A 4MJCA 3HJMA 1WIKA 3CSIA 3M3MA 4RQRA 2DJKA 1K3OA 1XZOA 3A3TA 3HXSA 4K0GA 2LJAA 2A2SA 3J7Yk 3IXRA 3W8JA 3DVXA 3APOA 4PURA 5A4UA 1AAZA 1VF1A 1Z7RA 2GQKA 3EURA 4OO4A 3TRXA 1XPVA 2X99A 3D4MA 2HZEB 5AIXA 2H1GA 3KP9A 1QGVA 12GSA 2H71A 1X9WB 3A2WA 1GSQA 1V40A 2J23A 2DMMA 3KXOA 4I6XA 4JRRA 4LL1B 2LSTA 2VCZA 4KCEA 2IMEA 3TOUA 3EU4A 5KEJA 4WF4A 1K0BA 1F37A 8GSSA 4OMVA 4IBPA 1OE7A 3ME8A 4G19A 4FYUA 1VF3A 3F0IA 3UBLA 2LRNA 5ECOB 4KUNA 2O7KA 5FHIA 2CVDA 3WD6A 1SD9A 3VWWA 3E9JB 3Q74A 2LJRA 2H1BA 2F51A 4JU5A 2HRKA 4HUAA 3KH9A 1W4VA 2H6ZA 5CP1A 1O8XA 4NWYA 3F4SA 2DBCA 4D73B 3P7XA 4MJEA 2PMTA 1DSBA 5IMAA 2DC5A 2VO4A 4KF9A 4NHWA 3EC3A 2CT6A 3L0HA 4FH8A 2M80A 5IMDA 3IR4A 4H86A 4MH2A 2NTOA 5ECMB 2GVPA 2LEGA 2HNLA 3TDGA 3DD3A 2M46A 4ML6A 2J9HA 4POMA 1TP9A 2CAIA 3GUSA 2RM5A 1Q98A 5G1KA 4EXJA 1O73A 5INYA 1OAZA 3R3EA 4BWSA 3HZ4A 4DVCA 4WR5A 1B9XC 2GQMA 1XW6A 2H0GA 2R5GA 1GSFA 3GKNA 1GNEA 1LJRA 3FR3A 1K0NA 1EOHA 4ZB8A 5H5QA 4KX4A 3GV1A 1WP0A 2B3SA 1EV9A 4LLRA 2OE1A 2R4VA 4G0LA 1ZYQB 5D73A 2WGRA 4TXOA 1K0CA 5KN3A 3C1RA 4ML1A 4MJBA 1XOBA 1FVJA 1LBKA 3H93A 2JL4A 4TN8A 2C3NA 3VK9A 3TUEA 5D9XA 4ECCA 2FCHA 1BEDA 1KTEA 2FHEA 3RHBA 2L5LA 2OADA 3GKXA 2VOCA 3G7YA 4L0UA 3O76A 1ACVA 5CREA 2P31A 2H72A 2G0FA 2H0HA 1RK4A 4LMVA 1URMA 3G7JA 5ID2B 2GDRA 1R7HA 1V57A 2TIRA 2C0FA 4PQHA 2H76A 3GH6A 3UARA 3LWAA 2MBTA 4XS1A 4EE0A 5BMUA 3FRCA 3EYTA 3GTUB 4ZILA 3IRAA 3L9SA 4F2IA 2VLUA 3EMPA 4GSSA 3VI5A 4DSRA 4IJIA 1XIYA 3ERGA 3DRNA 3LXTA 4WBJA 1O6JA 2C1YA 1BX9A 1TU8A 4I5QA 2IFQB 4RI7A 1PL2A 2YWOA 5DALB 2VL2C 2N5BA 3FZ4A 1YF0A 2GT6A 5ECPB 1GH2A 3H8QA 2VD1A 1N2AA 4TXVA 2ON5A 2CV4A 3HCZA 2DIZA 1OE8A 1BAYA 5JWOB 1YJ6A 3QCPA 4XS4B 1ERWA 5J5NA 2HZEA 2YN1A 2IWTA 2ES7A 1AQWA 1F3BA 3U6VA 5IMZA 4ZBBA 3GX8A 1GTAA 4CHSA 2PVQA 3VLNA 4QQ7A 4PGTA 5HFGA 3QPMA 3DYRA 3VFIA 3LG6A 5IQYA 3O6TA 3FYGA 1NM3A 2HFDA 1FVKA 4MZCA 3CTFA 1GSYA 1T00A 3VWVA 4HS1A 2GT5A 4PUFC 2H0IA 2PPTA 4E8EA 1TK8B 1R26A 3MNGA 1SK1A 3AY8A 1AIUA 1PGTA 1FW1A 2DIYA 6GSTA 3MAKA 2RUFA 3CSHA 2YWIA 5IM9A 4JEDA 5CO3A 1VRSD 1JZOA 4GRFA 2H1AA 3H79A 4TVEA 1EZKA 5ECHB 3F63A 1N8JA 4IJ3A 1PSQA 1RQMA 1MDIA 4IHUA 2WDUA 2M72A 2VLTA 4N10A 5LCZA 3QAVA 1B48A 4TW5A 3VWXA 3GRXA 1XWKA 4ID0A 3M8NA 3IPZA 2RIIA 4D73A 4YQUA 3ZFBA 3QAGA 2O85A 1JLVA 3ZZXA 1A2JA 2P5RA 4YAPA 3QR6A 2L5OA 2YANA 2UZ8A 5HFKA 1YEXA 5COHA 5B8AA 4MZWA 4K8MA 3CXGA 5CRWA 5D96A 1YDKA 1FOVA 5ECNB 4OO5A 3FR9A 4ZIJA 1U6TA 3FEUA 3IV4A 1LU4A 4CDOA 4IQ1A 1EP8A 1UC7A 3DIEA 3N5OA 2E2MA 4F0BA 2AHEA 2EIOA 1BQ7A 3QAWA 5ABRA 3J7Yb 3GIXA 2CX3A 1JZDA 1PRXA 3M9KA 2R3XA 3TKSA 3UL3A 3WGXA 3G7IA 4MF7A 1SYXA 2IL3A 1HYUA 2YNXA 4TR3A 5CRHA 4P3YB 5CAXA 4O92A 1WE0A 1XVWA 5GSSA 3GH9A 2PUKC 2VLVA 1FO5A 1A8LA 2KOKA 4X43A 2YP6A 3KJYA 3DMLA 5GAPD 4YAVA 4BVYB 2H8LA 4ECBA 1EOGA 3H4KA 2I9HA 5IMCA 2N5AA 3UOMA 2WCIA 4MDCA 4I2UA 3IDVA 1G0TA 5IMFA 3QFBC 4BVXB 2VM2A 5ID2A 3UIWA 2C8UA 1AUCA 4ZBAA 1OC3A 2KHPA 4JR4A 5C00A 1TRUA 4KE3A 4TRXA 2L4CA 5A4VA 1T8EB 3D6IA 3GTUA 2K6VA 4PX1A 2C0DA 1Z3EA 2H66A 2C0GA 6GSSA 1ZCPA 1TI1A 4MP4A 3ERWA 3KIJA 2VCTA 5F0GA 4KSOA 5D93A 3H1NA 5F07A 2IFQA 3U5RE 2JSYA 5DALA 2H75A 3E3EA 3TJJA 18GSA 2H70A 1G7OA 4EUYA 4IN0A 1EV4A 2LUSA 3WYWA 1SU9A 2LKUA 2XPEA 14GSA 2MMZA 3F9UA 3FY7A 2B6MA 4XS4A 3PGTA 1SD8A 2ZNMA 4JR6A 1ZMAA 4ZB6A 4XRAA 3KCMA 1OKDA 2HSYA 4KW6A 2K8VA 3LFLA 4NV5A 1AXDA 4KDXA 5DAKB 3GKKA 3KTLA 4G2EA 3APSA 1SJ6A 3UEMA 5FT3A 4EF0A 1EEJA 3D22A 5JWQB 3M1GA 2LQOA 4ECIA 3BD2A 2R37A 1IYIA 4ISDA 2L57A 3SWLA 1SENA 4NXIA 2B7JA 2K18A 1NW2A 4N30A 4J57E 4DEJA 1TK0B 3VPTA 4JZQA 1TTZA 3HHVA 4TKYA 2AB6A 2Z9SA 2RM6A 2PERA 3ZTLA 3GHAA 3HVVA 2WZ9A 5IO0A 3GURA 2P5QA 4BA7A 5F05A 5CRGA 2VL3A 2GSRA 1M0UA 2CAQA 1F2EA 1K0AA 4YQMA 1ZZYA 1A23A 3DVWA 3IC4A 2KLXA 3MWHA 2L59A 1GSDA 1YKCA 1X5CA 1TK5B 3KGKA 4EDZA 2VIMA 1F6MC 1O81A 1XW9A 3APQA 1HQOA 5DBQA 2DJ1A 4I2TA 2O87A 1VF2A 1B4QA 3UAPA 2LTKA 1GTBA 1EEMA 2CZ3A 1U3AA 5HR0A 3C71A 3QOUA 4HJ2A 4XTSA 4OFMA 1E2YA 4POLA 5D9WA 5DCHA 2HI7A 1T4YA 5CRDA 5G2ZA 2R2JA 4GCIA 1M7TA 3F8UA 2DJ0A 3HKRA 5HR2A 1NHOA 3TKSE 1GNWA 5DQSA 2WRTA 2EIRA 2K9FA 5GZZB 3IOSA 3TGZA 2OJLA 3HVSA 4OCFA 1A2LA 19GSA 1H4OA 1G6WA 4K2DA 1FHEA 5B8BA 1PA3A 3HY2A 1XCCA 4PNFA 4OWYA 1SKRB 5JWRB 2IIYA 4WEYA 1Z6MA 3RAZA 2FGXA 1V98A 4NAXA 4K9ZA 3KMNA 3CTGA 3ZLPA 2PN8A 1TJDA 3A2VA 1HNCA 9GSSA 3LEFA 3P2AA 5F06A 4MF6A 4NPBA 2FA4A 4BL7B 2ALBA 5ELAA 3IHQA 4LMWA 2LS5A 2IMDA 1M2AA 2NPBA 4BVYA 3CRTA 2FD3A 1GP1A 2GSTA 3PH9A 1O8WA 1BJXA 2X64A 1X9SB 1USBA 3ED3A 5H5RA 3KH7A 5JCWA 1XOAA 3IC8A 1S3CA 2K8SA 3ZYWA 2GZYA 4EDYA 3RBTA 1I9DA 2I1UA 3F6FA 1GTUA 4WKWA 3ZRDA 1R5PA 4F82A 4HU7A 1A8YA 2NVLA 1QUWA 5DCGA 4WETA 3IA1A 5JCUA 3FHKA 3L9VA 1XFLA 5B6MA 1YZXA 2IJYA 5EPFA 5D9TA 3DXBA 3RPNA 4POKA 3TJFA 2F3MA 2IN3A 4L8EA 1ST9A 1A2MA 5ECSA 2BMXA 3C73A 4OFNA 2HSMB 5LNKe 1IYHA 1KBNA 2KP1A 4JBBA 20GSA 22GSA 3EWLA 1M2DA 1Z6NA 2V1MA 4GSNA 2MMAA 4K7IA 2H01A 2YWMA 3FZ9A 2XPDA 2OBKA 4FYBA 4XCSA 3ZVJD 4CW9A 3F4TA 4KGIA 1MDJA 5DAKA 4KB3A 1FAAA 4MCUA 4TOPA 4O32A 2ZCTA 2GQLA 3TJKA 1K0MA 3IK7A 1V2AA 2LRCA 4MZBA 4K7NA 2PGTA 4PUAA 2OA7A 2FLSA 1JZWA 5ECKB 4K6XA 4HZ2A 5ECQB 3LYKA 1SL0B 1Y6EA 2L6CA 3TCOA 3KP8A 3CSJA 3TKQA 2F9SA 1S3AA 3MSZA 3UJ1A 5G5EA 2IPAA 2A2RA 4ULXA 2FWHA 1GUHA 2BJXA 4ILFA 3TKSC 1K0OA 3W8SA 2JZTA 1ERTA 5GAND 2HRKB 5B6NA 2GGTA 1A0FA 2LNSA 3LORA 3A2XA 3GYKA 1THOA 4DSQA 1TDIA 4ZBDA 1CQHA 2GZZA 3OR5A 2PVOC 1V58A 4PQ1A 2YPMA 2VCWA 1X0RA 2HSNB 2JACA 4IVFA 5JCGA 3HYPA 2YWNA 3O3TA 2XC2A 3IE3A 2JZSA 1QQ2A 2WJUA 4IS0A 2YZUA 3VURA 3GNJA 1PKZA 1X5EA 1ZL9A 5ECRB 1M9BA 2ZUPA 4K0NA 5EVOA 2X8HA 2L6DA 1UA5A 11GSA 1M9AA 3GMFA 4I97A 3S9FA 3NZNA 1K3LA 4V1Ag 2E2GA 3F3QA 4USSA 1PD21 1QXHA 2CQ9A 1OC9B 4HU9A 4MF5A 3C7MA 2HRAA 3BCKA 3TOTA 1TRVA 3WT1A 3UBKA 1JFUA 4V2MA 1YQ1A 1MD4A 2DSAA 4EL1A 4NHZA 1T4ZA 3RPPA 1GLPA 2TRCP 4WBRD 3D4TA 4KDUA 2FY6A 2FUG2 2VD0A 2VCVA 4EKZA 2E0QA 4GWRA 4OCEA 4MPGA 4PNGA 4FQUA 3QDNA 2IMFA 4ZL9A 1RW1A 2VM1A 1GL8A 3L9UA 5AISA 4BL7A 3M9JA 1HNAA 3FW2A 1U3IA 1GWCA 4NMUA 5KN2A 3CYNA 1O7UA 6GSUA 5D9VA 3LSZA 2CX4A 16GSA 5AIVA 5HQPA 2GS3A 3GSSA 5IIZA 1PL1A 4WR4A 1TRWA 1TXXA 2F8FA 2QC7A 3PR8A 1M2BA 4MH3A 1JZRA 5J9BA 2YZHA 1U87A 2EIQA 2HQTA 5A5KA 5E59A 4HQSA 2V41A 4V1Ap 1YKAA 3KTBA 3ISOA 3DKSA 1QK8A 2VUPA 1TOFA 3CMIA 4KAEA 2NDOA 1M99A 1Q4JA 5J41A 4F9ZA 4IQAA 1PKWA 3BJ5A 2AYTA 4ACSA 3GA4A 5DDLA 3BCIA 2EC4A 3VI7A 4LL4B 4DSSB 2B1LA 4AJ6A 4TR1B 4TR4A 4KSMA 2V6OA 2HLSA 3ZIVA 1FG4A 1DE2A 1A0RP 3EINA 3WGDA 2HSMA 4V2NA 1X9MB 2I3YA 3FKFA 5IO2A 4L0WA 3ERFA 4HEA2 1GUMA 4MPFA 3PINA 2IMIA 2V32A 2YJHA 2YOIA 17GSA 5ECIB 1T3BA 4Q5NA 1UN2A 1B4PA 1F3AA 5KN0A 5ELGA 4F0CA 2P0GA 3RDWA 1EWXA 2VAFA
chains in the Genus database with same CATH superfamily
1ERVA 3TJBA 2V6KA 5DVBA 3ZVJA 3KMOA 2CA8A 4NV2A 5HR1A 3R2QA 2G2QA 1MD3A 4AKGA 2PU9C 1YEWC 3BBYA 2F8AA 2OE0A 4ECJA 3JCML 2B5YA 3I43A 5ENUA 3I9V2 3FZ5A 3TKRA 2FNOA 4Q5FA 2OACA 2CVKA 3UMAA 4Z2TA 2H73A 2WW2A 3ZL5A 3IK9A 2HSHA 6GSYA 2B1KA 4HJMA 1FB6A 1YEPA 3ZFLA 3C8EA 4AJ8A 3Q19A 2KP2A 2HT9A 3C1SA 3NIVA 3K8NA 1SJIA 5E4WA 4KA0A 4XHMA 4MABA 1GULA 2ON7A 2XBIA 4G9HA 4GLTA 1T1VA 4OFTA 1NSWA 3UVTA 2HXKA 2REMA 2VL9A 1K0DA 2HSNA 2I81A 4KCAA 2QGVA 2R0CA 5EY6A 1FB0A 2GLRA 2MMOA 2O3EA 2H74A 1Z9HA 4Q5QA 5KOXA 1HD2A 4IP1A 2LQQA 4MJAA 2A4VA 5J9CA 3HJOA 4V2LA 4X1UA 5G31A 4IKHA 4ZL7A 5B7CA 4F03A 5IOXA 2L4QA 4O5RA 4MK3A 2WFCA 2XHFA 1DBYA 1XBSA 1EP7A 4ICYA 1ML6A 1OC9A 1OYJA 3CBUA 1MEKA 2DJ3A 3FR6A 2NBSA 4EC0A 3BOAA 5F8BA 3F3RA 2C80A 4YH2A 1G6YA 4EVMA 3KZQA 1SJZA 1SKSB 3QD9A 3WGEA 4Z2RA 4G0KA 1ILOA 1WMJA 1J9BA 2RUEA 3TKPA 2WS2A 3M0FA 2O5VA 1BG1A 3I69A 1ON4A 5H5SA 3Q18A 3F6DA 1ZYEA 4J56E 5G1LA 2WULA 1AW9A 3P90A 4IGJA 3UVHA 3CRUA 3QFAC 2GSSA 1ABAA 2YV7A 6GSWA 3HD5A 2HRFA 4QL7A 2DMLA 1NHYA 3G9BA 1C72A 4HDEA 3LXZA 2D2ZA 3LYPA 3MDKA 2E7PA 2QKEA 1GSEA 3VWUA 2CZ2A 4FIWA 1SYRA 5G30A 1Z5YE 1GSSA 2OE3A 2LNTA 6GSVA 1QMVA 4BVXA 4KH7A 2GZPA 4KNDA 4X0XA 2PWJA 4WXTA 2AV4A 1YY7A 4BWQA 1R4WA 2OKAA 2H6XA 2YJ7A 1OC8A 2FWFA 3HVXA 3DWVA 5J3RA 4G10A 1XWBA 3A5IA 3N9JA 1TRSA 2JU5A 3US3A 3GL3A 2C3TA 3D5JA 4EO3A 3ME7A 1BYEA 3KD0A 1V9WA 1JLWA 4KDYA 5DQYA 4AGSA 5DJMA 2H6YA 4DSSA 4TR1A 2LV3A 3TRQA 3RHCA 4HQZA 2DJJA 4K1FA 4ZL8A 1SK0A 3D0ZA 4EIQA 2GSQA 1TKDB 5C04A 1GRXA 2MBSA 1VGLA 4MLYA 2C3QA 4AKXB 3ZIJA 1TU7A 4E8HA 3GN3A 2X8CA 3GFKA 1Y25A 1WRYA 4RUVA 3L78A 3I6AA 1OKTA 5CNWA 5DJLA 3TJGA 1PX7A 4HOJA 1OVNA 2H30A 1S3DA 4POBA 1FOHA 4GSTA 2X8GA 1PMTA 2XBQA 3TB2A 1THXA 2HYXA 3CQFA 4OD7A 1MTCA 2AUVA 5L71A 4O7HA 1T7PB 4IW9A 5IPHA 3HDCA 2DJ2A 1A24A 1EGRA 2YCDA 1H75A 5J4UA 2VCQA 3GKMA 1SL2B 2N5FA 2AAWA 3KM6A 3ZREA 4XS6A 1AQVA 2KUCA 1KNGA 3KEBA 2X49A 4MMMA 4PTSA 3QMXA 4RQXA 3IAS2 4PQIA 3PPUA 1WPIA 4JE1A 4GQCA 1GSUA 3FZAA 1GLQA 1J0FA 2IMKA 4XRDA 3HA9A 3LJRA 5AGYA 2I4AA 6GSXA 2B7KA 2VL2A 1U88A 2VCXA 1ZGNA 3GSTA 2C0EA 3IBHA 1E6BA 1SL1B 1DUGA 4K7OA 1XW5A 1XWCA 2B5EA 1JHBA 10GSA 1VF4A 2O89A 1TI3A 4WF5A 2HRNA 2H19A 4GF0A 2C4JA 1YF1A 4XIHA 1PQNA 1B9YC 5J4YA 3EU3A 1XWAA 3WT2A 4AJ7A 2HZFA 2BTOT 4AI6A 3IHGA 1K3YA 4L5LA 2RLIA 5CYYA 1Z7PA 1XXUA 3DGQA 4AF2A 1WWJA 3EMXA 2MZCA 1MDKA 3LQ7A 2FWGA 5KN1A 1G7EA 1AQXA 1X5DA 4IELA 1R5AA 5IOWA 3DEXA 4L5OA 4E68A 2LJKA 3IAM2 5IMVA 1BG5A 4FO5A 4I8BA 4G0IA 5GSTA 4GXZA 4Z7XA 4IP6A 4J2FA 5IPGA 1PN9A 2R6KA 5A4WA 3W6GA 1UVZA 3EPTA 3TRPA 3EE2A 4BPYA 2O8VB 13GSA 5AN1A 3FK8A 3HJPA 5FWGA 4YQVA 1WOUA 5BRTA 4N3ZA 2AJQB 1SK2A 4HZ4A 2HE3A 3ZITA 2H1DA 3E0UA 4N0VA 2MYGA 5D8IA 5EL8A 2LRTA 4ZB9A 1GUKA 1WJKA 4PI0C 2QSIA 3A5WA 4TXOB 1I5GA 2YV9A 3ZMKA 2OBIA 3F4RA 1ZYNA 3HZ8A 3ZMLA 4FYCA 3V1WA 4Q5RA 7GSSA 4PXOA 1ZYPA 2JZRA 1B8XA 2WB9A 1W89A 1AC1A 3D21A 3EVIA 3SBCA 4GQFA 3LW9A 3LGCA 1GTIA 1PX6A 5ECLB 4MA9A 2MMNA 1HNBA 2DLXA 1F9MA 4N11A 2V2GA 4N0ZA 5HFIA 1ERUA 3VPQA 2FWEA 2B5XA 5G5FA 1CQGA 1XVQA 4RI6A 2FA8A 5LD0A 2TRXA 4TR0A 2UV8G 3L4NA 4HI7A 5HR3A 3NOFA 1O85A 4QL9A 2PBJA 3GX0A 5BMUB 1J08A 4YKGA 2JADA 1TW9A 3GL5A 1ZOFA 4LA1A 1KEBA 4ZXGA 2CVBA 1SKWB 1XWGA 3RGBC 3P8WA 2GTUA 2JSZA 4GTUA 1EGOA 1QFNA 3Q6OA 2R0PA 1DE1A 4MJCA 3HJMA 1WIKA 3CSIA 3M3MA 4RQRA 2DJKA 1BF5A 1K3OA 1XZOA 3A3TA 3HXSA 4K0GA 2LJAA 2A2SA 3J7Yk 1PFOA 3IXRA 3W8JA 3DVXA 3APOA 4PURA 1M3JA 5A4UA 1AAZA 1VF1A 1Z7RA 2GQKA 3EURA 4OO4A 3TRXA 1XPVA 2X99A 3D4MA 2HZEB 5AIXA 2H1GA 3KP9A 4W66A 1QGVA 12GSA 2H71A 1X9WB 3A2WA 1GSQA 1V40A 2J23A 2DMMA 3KXOA 4I6XA 4JRRA 4LL1B 2LSTA 2VCZA 4KCEA 2IMEA 3TOUA 3EU4A 5KEJA 4WF4A 1K0BA 1F37A 8GSSA 4OMVA 4IBPA 1OE7A 3ME8A 4G19A 4FYUA 1VF3A 3F0IA 3UBLA 2LRNA 5ECOB 4KUNA 2O7KA 2EFHA 5FHIA 2CVDA 3WD6A 1SD9A 3VWWA 3E9JB 3Q74A 2LJRA 1YVLA 2H1BA 2F51A 4JU5A 2HRKA 4HUAA 3KH9A 2WW0A 3MIXA 1W4VA 2H6ZA 5CP1A 1O8XA 4NWYA 3F4SA 2DBCA 4K5SA 4D73B 3P7XA 4MJEA 2PMTA 1DSBA 4PI2C 1SVMA 5IMAA 2DC5A 2VO4A 4KF9A 4NHWA 3EC3A 2CT6A 3L0HA 4FH8A 2M80A 5IMDA 3IR4A 4H86A 4MH2A 2NTOA 5ECMB 2GVPA 2LEGA 2HNLA 2DKHA 3TDGA 3DD3A 2M46A 4ML6A 2J9HA 4POMA 1TP9A 2CAIA 3GUSA 2RM5A 1Q98A 5G1KA 4EXJA 1O73A 5INYA 4YKFA 1OAZA 3R3EA 4BWSA 3HZ4A 4DVCA 2WVZA 4WR5A 1B9XC 2GQMA 1XW6A 2H0GA 2R5GA 1GSFA 3GKNA 1GNEA 1LJRA 3FR3A 1K0NA 1EOHA 4ZB8A 5H5QA 3MYDA 4KX4A 3GV1A 5KOWA 1WP0A 2B3SA 4CY6A 3HVNA 1EV9A 4LLRA 2OE1A 2R4VA 4G0LA 1ZYQB 5D73A 2WGRA 4TXOA 1K0CA 5KN3A 3C1RA 4ML1A 4MJBA 1XOBA 1FVJA 1LBKA 3H93A 2JL4A 4TN8A 2C3NA 3VK9A 3TUEA 5D9XA 4ECCA 2FCHA 1BEDA 1KTEA 2FHEA 3RHBA 2L5LA 2OADA 3GKXA 2VOCA 3G7YA 4L0UA 3O76A 1ACVA 5CREA 2P31A 2H72A 2G0FA 2H0HA 1RK4A 4LMVA 1URMA 3G7JA 5ID2B 2GDRA 1R7HA 1V57A 2TIRA 2C0FA 4PQHA 2H76A 3GH6A 3UARA 3LWAA 2MBTA 4XS1A 4EE0A 5BMUA 3FRCA 3EYTA 3GTUB 4ZILA 3IRAA 3L9SA 4F2IA 2VLUA 3EMPA 1S4BP 1I1IP 4GSSA 3VI5A 4DSRA 4IJIA 3RFRC 1XIYA 3ERGA 3DRNA 3LXTA 4WBJA 1O6JA 2C1YA 1BX9A 1TU8A 4I5QA 2IFQB 4RI7A 1PL2A 2YWOA 5DALB 2VL2C 2N5BA 3FZ4A 1YF0A 2GT6A 5ECPB 1GH2A 3H8QA 2VD1A 1N2AA 4TXVA 2ON5A 2CV4A 3HCZA 2DIZA 1OE8A 1BAYA 5JWOB 1YJ6A 3QCPA 4X4JA 2R0GA 5A5HA 4XS4B 1ERWA 5J5NA 2HZEA 2YN1A 2IWTA 2ES7A 1AQWA 1F3BA 3U6VA 5IMZA 4ZBBA 3GX8A 1GTAA 4CHSA 2PVQA 3VLNA 4QQ7A 4PGTA 5HFGA 3QPMA 3DYRA 3VFIA 3LG6A 5IQYA 3O6TA 3FYGA 1NM3A 4PHZC 2HFDA 1FVKA 4MZCA 3CTFA 1GSYA 1T00A 3VWVA 4HS1A 2GT5A 4PUFC 2H0IA 2PPTA 4E8EA 1TK8B 1R26A 3MNGA 1SK1A 3AY8A 1AIUA 1PGTA 1FW1A 2DIYA 6GSTA 3MAKA 2RUFA 3CSHA 2YWIA 5IM9A 4JEDA 5CO3A 1VRSD 1JZOA 4GRFA 2H1AA 3H79A 4TVEA 1EZKA 5ECHB 3F63A 1N8JA 4IJ3A 1PSQA 1RQMA 1MDIA 5A34B 4IHUA 2WDUA 2M72A 2VLTA 1SVLA 4N10A 5LCZA 3QAVA 1B48A 4TW5A 3VWXA 3GRXA 1XWKA 4ID0A 3M8NA 3IPZA 2RIIA 4D73A 4YQUA 3ZFBA 3QAGA 2O85A 1JLVA 4QMKA 3ZZXA 1A2JA 2EFCA 2P5RA 4YAPA 3QR6A 2QA1A 2L5OA 2YANA 4A5PA 2UZ8A 5HFKA 1YEXA 5COHA 5B8AA 4MZWA 4K8MA 3CXGA 5CRWA 5D96A 1YDKA 1FOVA 5ECNB 4OO5A 3FR9A 4ZIJA 1U6TA 3FEUA 3IV4A 1LU4A 4CDOA 4IQ1A 1EP8A 1UC7A 3DIEA 3N5OA 2E2MA 4F0BA 2AHEA 2EIOA 1BQ7A 3QAWA 5ABRA 3J7Yb 3GIXA 2CX3A 1JZDA 1PRXA 3M9KA 2R3XA 3TKSA 3UL3A 3WGXA 3G7IA 4MF7A 1SYXA 2DKIA 2IL3A 1HYUA 2YNXA 4TR3A 5CRHA 2WVYA 4P3YB 5CAXA 4O92A 1WE0A 1XVWA 5GSSA 3GH9A 2PUKC 2VLVA 1FO5A 1A8LA 2KOKA 4EIPA 4X43A 2YP6A 3KJYA 3DMLA 5GAPD 4YAVA 4BVYB 2WVXB 2H8LA 4ECBA 1EOGA 3H4KA 2I9HA 5IMCA 2N5AA 3UOMA 2WCIA 4MDCA 4I2UA 3IDVA 1G0TA 5IMFA 3QFBC 4BVXB 2VM2A 5ID2A 3UIWA 4Z2UA 2C8UA 1AUCA 4ZBAA 1OC3A 2KHPA 4JR4A 5C00A 1TRUA 4KE3A 4TRXA 2L4CA 5A4VA 1T8EB 3D6IA 3GTUA 2K6VA 4PX1A 2C0DA 1Z3EA 2H66A 2C0GA 6GSSA 1ZCPA 4O5QA 1TI1A 4MP4A 3ERWA 3KIJA 2VCTA 5F0GA 4KSOA 5D93A 3H1NA 5F07A 2IFQA 3U5RE 2JSYA 5DALA 4MNNA 2H75A 3E3EA 3TJJA 5J47A 18GSA 2H70A 1G7OA 4EUYA 4IN0A 1EV4A 2LUSA 4AKIA 3WYWA 1SU9A 2LKUA 2XPEA 14GSA 2MMZA 3F9UA 3FY7A 2B6MA 4XS4A 3PGTA 1SD8A 2ZNMA 4JR6A 1ZMAA 4ZB6A 4XRAA 3KCMA 1OKDA 2HSYA 4KW6A 3CHXC 2QA2A 2K8VA 3LFLA 4G01A 4NV5A 1AXDA 4KDXA 5DAKB 3GKKA 3KTLA 4G2EA 3APSA 1SJ6A 3UEMA 5FT3A 4EF0A 1EEJA 3D22A 5JWQB 3M1GA 2LQOA 4ECIA 3BD2A 2R37A 1IYIA 4ISDA 2L57A 3SWLA 1SENA 4NXIA 2B7JA 2K18A 1NW2A 4N30A 4J57E 4DEJA 2H1LA 1TK0B 3VPTA 4JZQA 1TTZA 3HHVA 4TKYA 2AB6A 2Z9SA 2RM6A 2PERA 3ZTLA 3GHAA 3HVVA 2WZ9A 5IO0A 3GURA 2P5QA 4BA7A 5A34A 5F05A 5CRGA 2VL3A 2GSRA 2EFEA 1M0UA 2CAQA 1F2EA 1K0AA 4YQMA 1ZZYA 1A23A 3DVWA 3IC4A 2KLXA 3MWHA 2L59A 1GSDA 1YKCA 1X5CA 1TK5B 3KGKA 4EDZA 2VIMA 1F6MC 1O81A 1XW9A 3APQA 1HQOA 5DBQA 2DJ1A 4I2TA 2O87A 1VF2A 1B4QA 3UAPA 2LTKA 1GTBA 1EEMA 2CZ3A 1U3AA 5HR0A 1SVOA 3TU3B 3C71A 3QOUA 4HJ2A 4XTSA 4OFMA 1E2YA 4POLA 5D9WA 5DCHA 3CWGA 2HI7A 1T4YA 5CRDA 5G2ZA 2R2JA 4GCIA 1M7TA 3F8UA 2DJ0A 3HKRA 5HR2A 1NHOA 3TKSE 1GNWA 5DQSA 2WRTA 2EIRA 2K9FA 5GZZB 3IOSA 3TGZA 2O36A 2OJLA 3HVSA 4OCFA 1A2LA 19GSA 1H4OA 1G6WA 4K2DA 1FHEA 5B8BA 1PA3A 3HY2A 1XCCA 4PNFA 4K2XA 4OWYA 1SKRB 5JWRB 2IIYA 4WEYA 1Z6MA 3RAZA 2FGXA 1V98A 2A2PA 4NAXA 4K9ZA 3KMNA 3CTGA 3ZLPA 2PN8A 1TJDA 3A2VA 1HNCA 9GSSA 3LEFA 3P2AA 5F06A 4MF6A 4NPBA 2FA4A 5J4VA 4BL7B 2ALBA 5ELAA 3IHQA 4LMWA 2LS5A 2IMDA 1M2AA 2NPBA 4BVYA 3CRTA 2WVXA 2FD3A 1GP1A 2GSTA 3PH9A 1O8WA 1BJXA 2X64A 1X9SB 1USBA 3ED3A 5H5RA 3KH7A 5JCWA 1XOAA 3IC8A 1S3CA 2K8SA 3ZYWA 2GZYA 4EDYA 3RBTA 1I9DA 2I1UA 3F6FA 1GTUA 4WKWA 3ZRDA 1R5PA 4F82A 4HU7A 1A8YA 2NVLA 1QUWA 5DCGA 4WETA 3IA1A 3HMJG 5JCUA 3FHKA 3L9VA 1XFLA 5B6MA 1YZXA 2IJYA 5EPFA 5D9TA 3DXBA 3RPNA 4POKA 3TJFA 2F3MA 2IN3A 4L8EA 1ST9A 1A2MA 5ECSA 2BMXA 3C73A 4OFNA 2HSMB 5LNKe 1IYHA 1KBNA 5A1NB 2KP1A 4JBBA 20GSA 22GSA 3EWLA 4FXYP 1M2DA 1Z6NA 2V1MA 4GSNA 2MMAA 4K7IA 2H01A 2YWMA 3FZ9A 2XPDA 2OBKA 4FYBA 4XCSA 3ZVJD 4CW9A 3F4TA 4KGIA 1MDJA 5DAKA 4KB3A 1FAAA 4MCUA 4TOPA 4O32A 2ZCTA 4CY8A 2GQLA 3TJKA 1K0MA 3IK7A 4HSCX 1V2AA 2LRCA 4MZBA 4K7NA 2VKZG 2PGTA 4PUAA 2OA7A 2FLSA 1JZWA 5ECKB 4K6XA 4HZ2A 5ECQB 4K5RA 3LYKA 1SL0B 2X4AA 1Y6EA 2L6CA 3TCOA 3KP8A 3CSJA 3TKQA 4ZB7A 2F9SA 1Y1UA 1S3AA 3MSZA 3UJ1A 5G5EA 2IPAA 2A2RA 4ULXA 2FWHA 1GUHA 2BJXA 4ILFA 3TKSC 4O5UA 1K0OA 3W8SA 2JZTA 1ERTA 5GAND 2HRKB 5B6NA 2GGTA 4GDFA 1A0FA 2LNSA 3LORA 2EFDA 3A2XA 3GYKA 1THOA 4DSQA 2WZSA 1TDIA 4ZBDA 1CQHA 2GZZA 3OR5A 2PVOC 1V58A 4PQ1A 2YPMA 2VCWA 1X0RA 2HSNB 2WW3A 2JACA 4IVFA 5JCGA 3HYPA 2YWNA 3O3TA 2XC2A 3IE3A 2JZSA 1QQ2A 2WJUA 4IS0A 2YZUA 3VURA 3GNJA 1PKZA 1X5EA 1S3RA 1ZL9A 5ECRB 1TXUA 1M9BA 2ZUPA 4K0NA 5EVOA 2X8HA 2L6DA 1UA5A 11GSA 1M9AA 3GMFA 4I97A 2OT3A 3S9FA 3NZNA 1K3LA 4V1Ag 2E2GA 3F3QA 4USSA 1PD21 1QXHA 2CQ9A 1OC9B 4HU9A 4MF5A 3C7MA 2HRAA 3BCKA 3TOTA 1TRVA 3WT1A 3UBKA 1JFUA 4V2MA 1YQ1A 1MD4A 2DSAA 1N25A 2WW1A 4EL1A 4NHZA 1T4ZA 3RPPA 1GLPA 2TRCP 4WBRD 3D4TA 4KDUA 2FY6A 2FUG2 2VD0A 2VCVA 4EKZA 2E0QA 4GWRA 4OCEA 4MPGA 4PNGA 4FQUA 3QDNA 2IMFA 4ZL9A 1RW1A 2VM1A 1GL8A 3L9UA 5AISA 4BL7A 1PN0A 3M9JA 1HNAA 3FW2A 1U3IA 1GWCA 4NMUA 5KN2A 3FMWA 3CYNA 1O7UA 6GSUA 5D9VA 3LSZA 2CX4A 16GSA 5AIVA 5HQPA 2GS3A 3GSSA 5IIZA 1PL1A 4WR4A 1TRWA 1TXXA 2F8FA 2QC7A 3PR8A 1M2BA 4MH3A 1JZRA 5J9BA 2YZHA 1U87A 2EIQA 2HQTA 5A5KA 5E59A 4HQSA 2V41A 4V1Ap 1YKAA 5J40A 3KTBA 3ISOA 3DKSA 4AKHA 1QK8A 2VUPA 1TOFA 3CMIA 4KAEA 2NDOA 1M99A 1Q4JA 5J41A 4F9ZA 4IQAA 1PKWA 3BJ5A 2AYTA 4ACSA 3GA4A 5DDLA 3BCIA 2EC4A 3VI7A 4LL4B 4DSSB 2B1LA 4AJ6A 4TR1B 4TR4A 4KSMA 2V6OA 2HLSA 4BIKA 3ZIVA 1FG4A 1DE2A 1XG8A 1A0RP 3EINA 2A4HA 3WGDA 2HSMA 5A1NA 4V2NA 1X9MB 2I3YA 1M3IA 3FKFA 5IO2A 4L0WA 5A5HB 3ERFA 4HEA2 1GUMA 4MPFA 3PINA 2IMIA 2V32A 2YJHA 2YOIA 17GSA 5ECIB 1T3BA 4Q5NA 1UN2A 1B4PA 1F3AA 5KN0A 5ELGA 4F0CA 2P0GA 3RDWA 1EWXA 2VAFA
chains in the Genus database with same CATH topology
1ERVA 3TJBA 2V6KA 5DVBA 3ZVJA 3KMOA 2CA8A 4NV2A 5HR1A 3R2QA 2G2QA 1MD3A 4AKGA 2PU9C 3BBYA 2F8AA 2OE0A 4ECJA 3JCML 2B5YA 3I43A 5ENUA 3I9V2 3FZ5A 3TKRA 2FNOA 4Q5FA 2OACA 2CVKA 3UMAA 4Z2TA 2H73A 3ZL5A 3IK9A 2HSHA 6GSYA 2B1KA 4HJMA 1FB6A 1YEPA 3ZFLA 3C8EA 4AJ8A 3Q19A 2KP2A 2HT9A 3C1SA 3NIVA 3K8NA 1SJIA 5E4WA 4KA0A 4XHMA 4MABA 1GULA 2ON7A 2XBIA 4G9HA 4GLTA 1T1VA 4OFTA 1NSWA 3UVTA 2HXKA 2REMA 2VL9A 1K0DA 2HSNA 2I81A 4KCAA 2QGVA 2R0CA 5EY6A 1FB0A 2GLRA 2MMOA 2H74A 1Z9HA 4Q5QA 5KOXA 1HD2A 4IP1A 2LQQA 4MJAA 2A4VA 5J9CA 3HJOA 4V2LA 4X1UA 5G31A 4IKHA 4ZL7A 5B7CA 4F03A 5IOXA 2L4QA 4O5RA 4MK3A 2WFCA 2XHFA 1DBYA 1XBSA 1EP7A 4ICYA 1ML6A 1OC9A 1OYJA 3CBUA 1MEKA 2DJ3A 3FR6A 2NBSA 4EC0A 3BOAA 5F8BA 3F3RA 2C80A 4YH2A 1G6YA 4EVMA 3KZQA 1SJZA 1SKSB 3QD9A 3WGEA 4Z2RA 4G0KA 1ILOA 1WMJA 1J9BA 2RUEA 3TKPA 2WS2A 3M0FA 2O5VA 1BG1A 3I69A 1ON4A 5H5SA 3Q18A 3F6DA 1ZYEA 4J56E 5G1LA 2WULA 1AW9A 3P90A 4IGJA 3UVHA 3CRUA 3QFAC 2GSSA 1ABAA 2YV7A 6GSWA 3HD5A 2HRFA 4QL7A 2DMLA 1NHYA 3G9BA 1C72A 4HDEA 3LXZA 2D2ZA 3LYPA 3MDKA 2E7PA 2QKEA 1GSEA 3VWUA 2CZ2A 4FIWA 1SYRA 5G30A 1Z5YE 1GSSA 2OE3A 2LNTA 6GSVA 1QMVA 4BVXA 4KH7A 2GZPA 4KNDA 4X0XA 2PWJA 4WXTA 2AV4A 1YY7A 4BWQA 1R4WA 2OKAA 2H6XA 2YJ7A 1OC8A 2FWFA 3HVXA 3DWVA 5J3RA 4G10A 1XWBA 3A5IA 3N9JA 1TRSA 2JU5A 3US3A 3GL3A 2C3TA 3D5JA 4EO3A 3ME7A 1BYEA 3KD0A 1V9WA 1JLWA 4KDYA 5DQYA 4AGSA 5DJMA 2H6YA 4DSSA 4TR1A 2LV3A 3TRQA 3RHCA 4HQZA 2DJJA 4K1FA 4ZL8A 1SK0A 3D0ZA 4EIQA 2GSQA 1TKDB 5C04A 1GRXA 2MBSA 1VGLA 4MLYA 2C3QA 4AKXB 3ZIJA 1TU7A 4E8HA 3GN3A 2X8CA 3GFKA 1Y25A 1WRYA 4RUVA 3L78A 3I6AA 1OKTA 5CNWA 5DJLA 3TJGA 1PX7A 4HOJA 1OVNA 2H30A 1S3DA 4POBA 1FOHA 4GSTA 2X8GA 1PMTA 2XBQA 3TB2A 1THXA 2HYXA 4OD7A 1MTCA 2AUVA 5L71A 4O7HA 1T7PB 4IW9A 5IPHA 3HDCA 2DJ2A 1A24A 1EGRA 2YCDA 1H75A 5J4UA 2VCQA 3GKMA 1SL2B 2N5FA 2AAWA 3KM6A 3ZREA 4XS6A 1AQVA 2KUCA 1KNGA 3KEBA 2X49A 4MMMA 4PTSA 3QMXA 4RQXA 3IAS2 4PQIA 3PPUA 1WPIA 4JE1A 4GQCA 1GSUA 3FZAA 1GLQA 1J0FA 2IMKA 4XRDA 3HA9A 3LJRA 5AGYA 2I4AA 6GSXA 2B7KA 2VL2A 1U88A 2VCXA 1ZGNA 3GSTA 2C0EA 3IBHA 1E6BA 1SL1B 1DUGA 4K7OA 1XW5A 1XWCA 2B5EA 1JHBA 10GSA 1VF4A 2O89A 1TI3A 4WF5A 2HRNA 2H19A 4GF0A 2C4JA 1YF1A 4XIHA 1PQNA 1B9YC 5J4YA 3EU3A 1XWAA 3WT2A 4AJ7A 2HZFA 2BTOT 4AI6A 3IHGA 1K3YA 4L5LA 2RLIA 5CYYA 1Z7PA 1XXUA 3DGQA 4AF2A 1WWJA 3EMXA 2MZCA 1MDKA 3LQ7A 2FWGA 5KN1A 1G7EA 1AQXA 1X5DA 4IELA 1R5AA 5IOWA 3DEXA 4L5OA 4E68A 2LJKA 3IAM2 5IMVA 1BG5A 4FO5A 4I8BA 4G0IA 5GSTA 4GXZA 4Z7XA 4IP6A 4J2FA 5IPGA 1PN9A 2R6KA 5A4WA 3W6GA 1UVZA 3EPTA 3TRPA 3EE2A 4BPYA 2O8VB 13GSA 5AN1A 3FK8A 3HJPA 5FWGA 4YQVA 1WOUA 5BRTA 4N3ZA 2AJQB 1SK2A 4HZ4A 2HE3A 3ZITA 2H1DA 3E0UA 4N0VA 2MYGA 5D8IA 5EL8A 2LRTA 4ZB9A 1GUKA 1WJKA 2QSIA 3A5WA 4TXOB 1I5GA 2YV9A 3ZMKA 2OBIA 3F4RA 1ZYNA 3HZ8A 3ZMLA 4FYCA 3V1WA 4Q5RA 7GSSA 4PXOA 1ZYPA 2JZRA 1B8XA 2WB9A 1W89A 1AC1A 3D21A 3EVIA 3SBCA 4GQFA 3LW9A 3LGCA 1GTIA 1PX6A 5ECLB 4MA9A 2MMNA 1HNBA 2DLXA 1F9MA 4N11A 2V2GA 4N0ZA 5HFIA 1ERUA 3VPQA 2FWEA 2B5XA 5G5FA 1CQGA 1XVQA 4RI6A 2FA8A 5LD0A 2TRXA 4TR0A 2UV8G 3L4NA 4HI7A 5HR3A 3NOFA 1O85A 4QL9A 2PBJA 3GX0A 5BMUB 1J08A 4YKGA 2JADA 1TW9A 3GL5A 1ZOFA 4LA1A 1KEBA 4ZXGA 2CVBA 1SKWB 1XWGA 3P8WA 2GTUA 2JSZA 4GTUA 1EGOA 1QFNA 3Q6OA 2R0PA 1DE1A 4MJCA 3HJMA 1WIKA 3CSIA 3M3MA 4RQRA 2DJKA 1BF5A 1K3OA 1XZOA 3A3TA 3HXSA 4K0GA 2LJAA 2A2SA 3J7Yk 3IXRA 3W8JA 3DVXA 3APOA 4PURA 5A4UA 1AAZA 1VF1A 1Z7RA 2GQKA 3EURA 4OO4A 3TRXA 1XPVA 2X99A 3D4MA 2HZEB 5AIXA 2H1GA 3KP9A 4W66A 1QGVA 12GSA 2H71A 1X9WB 3A2WA 1GSQA 1V40A 2J23A 2DMMA 3KXOA 4I6XA 4JRRA 4LL1B 2LSTA 2VCZA 4KCEA 2IMEA 3TOUA 3EU4A 5KEJA 4WF4A 1K0BA 1F37A 8GSSA 4OMVA 4IBPA 1OE7A 3ME8A 4G19A 4FYUA 1VF3A 3F0IA 3UBLA 2LRNA 5ECOB 4KUNA 2O7KA 2EFHA 5FHIA 2CVDA 3WD6A 1SD9A 3VWWA 3E9JB 3Q74A 2LJRA 1YVLA 2H1BA 2F51A 4JU5A 2HRKA 4HUAA 3KH9A 3MIXA 1W4VA 2H6ZA 5CP1A 1O8XA 4NWYA 3F4SA 2DBCA 4K5SA 4D73B 3P7XA 4MJEA 2PMTA 1DSBA 1SVMA 5IMAA 2DC5A 2VO4A 4KF9A 4NHWA 3EC3A 2CT6A 3L0HA 4FH8A 2M80A 5IMDA 3IR4A 4H86A 4MH2A 2NTOA 5ECMB 2GVPA 2LEGA 2HNLA 2DKHA 3TDGA 3DD3A 2M46A 4ML6A 2J9HA 4POMA 1TP9A 2CAIA 3GUSA 2RM5A 1Q98A 5G1KA 4EXJA 1O73A 5INYA 4YKFA 1OAZA 3R3EA 4BWSA 3HZ4A 4DVCA 4WR5A 1B9XC 2GQMA 1XW6A 2H0GA 2R5GA 1GSFA 3GKNA 1GNEA 1LJRA 3FR3A 1K0NA 1EOHA 4ZB8A 5H5QA 3MYDA 4KX4A 3GV1A 5KOWA 1WP0A 2B3SA 4CY6A 1EV9A 4LLRA 2OE1A 2R4VA 4G0LA 1ZYQB 5D73A 2WGRA 4TXOA 1K0CA 5KN3A 3C1RA 4ML1A 4MJBA 1XOBA 1FVJA 1LBKA 3H93A 2JL4A 4TN8A 2C3NA 3VK9A 3TUEA 5D9XA 4ECCA 2FCHA 1BEDA 1KTEA 2FHEA 3RHBA 2L5LA 2OADA 3GKXA 2VOCA 3G7YA 4L0UA 3O76A 1ACVA 5CREA 2P31A 2H72A 2G0FA 2H0HA 1RK4A 4LMVA 1URMA 3G7JA 5ID2B 2GDRA 1R7HA 1V57A 2TIRA 2C0FA 4PQHA 2H76A 3GH6A 3UARA 3LWAA 2MBTA 4XS1A 4EE0A 5BMUA 3FRCA 3EYTA 3GTUB 4ZILA 3IRAA 3L9SA 4F2IA 2VLUA 3EMPA 4GSSA 3VI5A 4DSRA 4IJIA 1XIYA 3ERGA 3DRNA 3LXTA 4WBJA 1O6JA 2C1YA 1BX9A 1TU8A 4I5QA 2IFQB 4RI7A 1PL2A 2YWOA 5DALB 2VL2C 2N5BA 3FZ4A 1YF0A 2GT6A 5ECPB 1GH2A 3H8QA 2VD1A 1N2AA 4TXVA 2ON5A 2CV4A 3HCZA 2DIZA 1OE8A 1BAYA 5JWOB 1YJ6A 3QCPA 4X4JA 2R0GA 5A5HA 4XS4B 1ERWA 5J5NA 2HZEA 2YN1A 2IWTA 2ES7A 1AQWA 1F3BA 3U6VA 5IMZA 4ZBBA 3GX8A 1GTAA 4CHSA 2PVQA 3VLNA 4QQ7A 4PGTA 5HFGA 3QPMA 3DYRA 3VFIA 3LG6A 5IQYA 3O6TA 3FYGA 1NM3A 2HFDA 1FVKA 4MZCA 3CTFA 1GSYA 1T00A 3VWVA 4HS1A 2GT5A 4PUFC 2H0IA 2PPTA 4E8EA 1TK8B 1R26A 3MNGA 1SK1A 3AY8A 1AIUA 1PGTA 1FW1A 2DIYA 6GSTA 3MAKA 2RUFA 3CSHA 2YWIA 5IM9A 4JEDA 5CO3A 1VRSD 1JZOA 4GRFA 2H1AA 3H79A 4TVEA 1EZKA 5ECHB 3F63A 1N8JA 4IJ3A 1PSQA 1RQMA 1MDIA 5A34B 4IHUA 2WDUA 2M72A 2VLTA 1SVLA 4N10A 5LCZA 3QAVA 1B48A 4TW5A 3VWXA 3GRXA 1XWKA 4ID0A 3M8NA 3IPZA 2RIIA 4D73A 4YQUA 3ZFBA 3QAGA 2O85A 1JLVA 4QMKA 3ZZXA 1A2JA 2EFCA 2P5RA 4YAPA 3QR6A 2QA1A 2L5OA 2YANA 4A5PA 2UZ8A 5HFKA 1YEXA 5COHA 5B8AA 4MZWA 4K8MA 3CXGA 5CRWA 5D96A 1YDKA 1FOVA 5ECNB 4OO5A 3FR9A 4ZIJA 1U6TA 3FEUA 3IV4A 1LU4A 4CDOA 4IQ1A 1EP8A 1UC7A 3DIEA 3N5OA 2E2MA 4F0BA 2AHEA 2EIOA 1BQ7A 3QAWA 5ABRA 3J7Yb 3GIXA 2CX3A 1JZDA 1PRXA 3M9KA 2R3XA 3TKSA 3UL3A 3WGXA 3G7IA 4MF7A 1SYXA 2DKIA 2IL3A 1HYUA 2YNXA 4TR3A 5CRHA 4P3YB 5CAXA 4O92A 1WE0A 1XVWA 5GSSA 3GH9A 2PUKC 2VLVA 1FO5A 1A8LA 2KOKA 4EIPA 4X43A 2YP6A 3KJYA 3DMLA 5GAPD 4YAVA 4BVYB 2H8LA 4ECBA 1EOGA 3H4KA 2I9HA 5IMCA 2N5AA 3UOMA 2WCIA 4MDCA 4I2UA 3IDVA 1G0TA 5IMFA 3QFBC 4BVXB 2VM2A 5ID2A 3UIWA 4Z2UA 2C8UA 1AUCA 4ZBAA 1OC3A 2KHPA 4JR4A 5C00A 1TRUA 4KE3A 4TRXA 2L4CA 5A4VA 1T8EB 3D6IA 3GTUA 2K6VA 4PX1A 2C0DA 1Z3EA 2H66A 2C0GA 6GSSA 1ZCPA 4O5QA 1TI1A 4MP4A 3ERWA 3KIJA 2VCTA 5F0GA 4KSOA 5D93A 3H1NA 5F07A 2IFQA 3U5RE 2JSYA 5DALA 4MNNA 2H75A 3E3EA 3TJJA 5J47A 18GSA 2H70A 1G7OA 4EUYA 4IN0A 1EV4A 2LUSA 4AKIA 3WYWA 1SU9A 2LKUA 2XPEA 14GSA 2MMZA 3F9UA 3FY7A 2B6MA 4XS4A 3PGTA 1SD8A 2ZNMA 4JR6A 1ZMAA 4ZB6A 4XRAA 3KCMA 1OKDA 2HSYA 4KW6A 2QA2A 2K8VA 3LFLA 4G01A 4NV5A 1AXDA 4KDXA 5DAKB 3GKKA 3KTLA 4G2EA 3APSA 1SJ6A 3UEMA 5FT3A 4EF0A 1EEJA 3D22A 5JWQB 3M1GA 2LQOA 4ECIA 3BD2A 2R37A 1IYIA 4ISDA 2L57A 3SWLA 1SENA 4NXIA 2B7JA 2K18A 1NW2A 4N30A 4J57E 4DEJA 2H1LA 1TK0B 3VPTA 4JZQA 1TTZA 3HHVA 4TKYA 2AB6A 2Z9SA 2RM6A 2PERA 3ZTLA 3GHAA 3HVVA 2WZ9A 5IO0A 3GURA 2P5QA 4BA7A 5A34A 5F05A 5CRGA 2VL3A 2GSRA 2EFEA 1M0UA 2CAQA 1F2EA 1K0AA 4YQMA 1ZZYA 1A23A 3DVWA 3IC4A 2KLXA 3MWHA 2L59A 1GSDA 1YKCA 1X5CA 1TK5B 3KGKA 4EDZA 2VIMA 1F6MC 1O81A 1XW9A 3APQA 1HQOA 5DBQA 2DJ1A 4I2TA 2O87A 1VF2A 1B4QA 3UAPA 2LTKA 1GTBA 1EEMA 2CZ3A 1U3AA 5HR0A 1SVOA 3TU3B 3C71A 3QOUA 4HJ2A 4XTSA 4OFMA 1E2YA 4POLA 5D9WA 5DCHA 3CWGA 2HI7A 1T4YA 5CRDA 5G2ZA 2R2JA 4GCIA 1M7TA 3F8UA 2DJ0A 3HKRA 5HR2A 1NHOA 3TKSE 1GNWA 5DQSA 2WRTA 2EIRA 2K9FA 5GZZB 3IOSA 3TGZA 2OJLA 3HVSA 4OCFA 1A2LA 19GSA 1H4OA 1G6WA 4K2DA 1FHEA 5B8BA 1PA3A 3HY2A 1XCCA 4PNFA 4K2XA 4OWYA 1SKRB 5JWRB 2IIYA 4WEYA 1Z6MA 3RAZA 2FGXA 1V98A 2A2PA 4NAXA 4K9ZA 3KMNA 3CTGA 3ZLPA 2PN8A 1TJDA 3A2VA 1HNCA 9GSSA 3LEFA 3P2AA 5F06A 4MF6A 4NPBA 2FA4A 5J4VA 4BL7B 2ALBA 5ELAA 3IHQA 4LMWA 2LS5A 2IMDA 1M2AA 2NPBA 4BVYA 3CRTA 2FD3A 1GP1A 2GSTA 3PH9A 1O8WA 1BJXA 2X64A 1X9SB 1USBA 3ED3A 5H5RA 3KH7A 5JCWA 1XOAA 3IC8A 1S3CA 2K8SA 3ZYWA 2GZYA 4EDYA 3RBTA 1I9DA 2I1UA 3F6FA 1GTUA 4WKWA 3ZRDA 1R5PA 4F82A 4HU7A 1A8YA 2NVLA 1QUWA 5DCGA 4WETA 3IA1A 3HMJG 5JCUA 3FHKA 3L9VA 1XFLA 5B6MA 1YZXA 2IJYA 5EPFA 5D9TA 3DXBA 3RPNA 4POKA 3TJFA 2F3MA 2IN3A 4L8EA 1ST9A 1A2MA 5ECSA 2BMXA 3C73A 4OFNA 2HSMB 5LNKe 1IYHA 1KBNA 5A1NB 2KP1A 4JBBA 20GSA 22GSA 3EWLA 1M2DA 1Z6NA 2V1MA 4GSNA 2MMAA 4K7IA 2H01A 2YWMA 3FZ9A 2XPDA 2OBKA 4FYBA 4XCSA 3ZVJD 4CW9A 3F4TA 4KGIA 1MDJA 5DAKA 4KB3A 1FAAA 4MCUA 4TOPA 4O32A 2ZCTA 4CY8A 2GQLA 3TJKA 1K0MA 3IK7A 1V2AA 2LRCA 4MZBA 4K7NA 2VKZG 2PGTA 4PUAA 2OA7A 2FLSA 1JZWA 5ECKB 4K6XA 4HZ2A 5ECQB 4K5RA 3LYKA 1SL0B 2X4AA 1Y6EA 2L6CA 3TCOA 3KP8A 3CSJA 3TKQA 4ZB7A 2F9SA 1Y1UA 1S3AA 3MSZA 3UJ1A 5G5EA 2IPAA 2A2RA 4ULXA 2FWHA 1GUHA 2BJXA 4ILFA 3TKSC 4O5UA 1K0OA 3W8SA 2JZTA 1ERTA 5GAND 2HRKB 5B6NA 2GGTA 4GDFA 1A0FA 2LNSA 3LORA 2EFDA 3A2XA 3GYKA 1THOA 4DSQA 1TDIA 4ZBDA 1CQHA 2GZZA 3OR5A 2PVOC 1V58A 4PQ1A 2YPMA 2VCWA 1X0RA 2HSNB 2JACA 4IVFA 5JCGA 3HYPA 2YWNA 3O3TA 2XC2A 3IE3A 2JZSA 1QQ2A 2WJUA 4IS0A 2YZUA 3VURA 3GNJA 1PKZA 1X5EA 1ZL9A 5ECRB 1TXUA 1M9BA 2ZUPA 4K0NA 5EVOA 2X8HA 2L6DA 1UA5A 11GSA 1M9AA 3GMFA 4I97A 2OT3A 3S9FA 3NZNA 1K3LA 4V1Ag 2E2GA 3F3QA 4USSA 1PD21 1QXHA 2CQ9A 1OC9B 4HU9A 4MF5A 3C7MA 2HRAA 3BCKA 3TOTA 1TRVA 3WT1A 3UBKA 1JFUA 4V2MA 1YQ1A 1MD4A 2DSAA 1N25A 4EL1A 4NHZA 1T4ZA 3RPPA 1GLPA 2TRCP 4WBRD 3D4TA 4KDUA 2FY6A 2FUG2 2VD0A 2VCVA 4EKZA 2E0QA 4GWRA 4OCEA 4MPGA 4PNGA 4FQUA 3QDNA 2IMFA 4ZL9A 1RW1A 2VM1A 1GL8A 3L9UA 5AISA 4BL7A 1PN0A 3M9JA 1HNAA 3FW2A 1U3IA 1GWCA 4NMUA 5KN2A 3FMWA 3CYNA 1O7UA 6GSUA 5D9VA 3LSZA 2CX4A 16GSA 5AIVA 5HQPA 2GS3A 3GSSA 5IIZA 1PL1A 4WR4A 1TRWA 1TXXA 2F8FA 2QC7A 3PR8A 1M2BA 4MH3A 1JZRA 5J9BA 2YZHA 1U87A 2EIQA 2HQTA 5A5KA 5E59A 4HQSA 2V41A 4V1Ap 1YKAA 5J40A 3KTBA 3ISOA 3DKSA 4AKHA 1QK8A 2VUPA 1TOFA 3CMIA 4KAEA 2NDOA 1M99A 1Q4JA 5J41A 4F9ZA 4IQAA 1PKWA 3BJ5A 2AYTA 4ACSA 3GA4A 5DDLA 3BCIA 2EC4A 3VI7A 4LL4B 4DSSB 2B1LA 4AJ6A 4TR1B 4TR4A 4KSMA 2V6OA 2HLSA 3ZIVA 1FG4A 1DE2A 1A0RP 3EINA 2A4HA 3WGDA 2HSMA 5A1NA 4V2NA 1X9MB 2I3YA 3FKFA 5IO2A 4L0WA 5A5HB 3ERFA 4HEA2 1GUMA 4MPFA 3PINA 2IMIA 2V32A 2YJHA 2YOIA 17GSA 5ECIB 1T3BA 4Q5NA 1UN2A 1B4PA 1F3AA 5KN0A 5ELGA 4F0CA 2P0GA 3RDWA 1EWXA 2VAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERV A;  3TJB A;  2V6K A;  5DVB A;  3ZVJ A;  3KMO A;  2CA8 A;  4NV2 A;  5HR1 A;  3R2Q A;  2G2Q A;  1MD3 A;  2PU9 C;  3BBY A;  2F8A A;  2OE0 A;  4ECJ A;  3JCM L;  2B5Y A;  3I43 A;  5ENU A;  3I9V 2;  3FZ5 A;  3TKR A;  2FNO A;  4Q5F A;  2OAC A;  2CVK A;  3UMA A;  2H73 A;  3ZL5 A;  3IK9 A;  2HSH A;  6GSY A;  2B1K A;  4HJM A;  1FB6 A;  1YEP A;  3ZFL A;  3C8E A;  4AJ8 A;  3Q19 A;  2KP2 A;  2HT9 A;  3C1S A;  3NIV A;  3K8N A;  1SJI A;  5E4W A;  4KA0 A;  4XHM A;  4MAB A;  1GUL A;  2ON7 A;  2XBI A;  4G9H A;  4GLT A;  1T1V A;  4OFT A;  1NSW A;  3UVT A;  2HXK A;  2REM A;  2VL9 A;  1K0D A;  2I81 A;  4KCA A;  2QGV A;  5EY6 A;  1FB0 A;  2GLR A;  2MMO A;  2H74 A;  1Z9H A;  4Q5Q A;  1HD2 A;  4IP1 A;  2LQQ A;  4MJA A;  2A4V A;  5J9C A;  3HJO A;  4V2L A;  4X1U A;  5G31 A;  4IKH A;  4ZL7 A;  5B7C A;  4F03 A;  5IOX A;  2L4Q A;  4O5R A;  4MK3 A;  2WFC A;  2XHF A;  1DBY A;  1XBS A;  1EP7 A;  1ML6 A;  1OC9 A;  1OYJ A;  3CBU A;  1MEK A;  2DJ3 A;  3FR6 A;  2NBS A;  4EC0 A;  3BOA A;  5F8B A;  3F3R A;  2C80 A;  4YH2 A;  1G6Y A;  4EVM A;  3KZQ A;  1SJZ A;  1SKS B;  3QD9 A;  3WGE A;  4G0K A;  1ILO A;  1WMJ A;  1J9B A;  2RUE A;  3TKP A;  2WS2 A;  3M0F A;  3I69 A;  1ON4 A;  5H5S A;  3Q18 A;  3F6D A;  1ZYE A;  4J56 E;  5G1L A;  2WUL A;  1AW9 A;  3P90 A;  4IGJ A;  3UVH A;  3CRU A;  3QFA C;  2GSS A;  1ABA A;  2YV7 A;  6GSW A;  3HD5 A;  2HRF A;  4QL7 A;  2DML A;  1NHY A;  3G9B A;  1C72 A;  4HDE A;  3LXZ A;  2D2Z A;  3LYP A;  3MDK A;  2E7P A;  2QKE A;  1GSE A;  3VWU A;  2CZ2 A;  4FIW A;  1SYR A;  5G30 A;  1Z5Y E;  1GSS A;  2OE3 A;  2LNT A;  6GSV A;  1QMV A;  4BVX A;  4KH7 A;  2GZP A;  4KND A;  4X0X A;  2PWJ A;  4WXT A;  2AV4 A;  1YY7 A;  4BWQ A;  1R4W A;  2OKA A;  2H6X A;  2YJ7 A;  1OC8 A;  2FWF A;  3HVX A;  3DWV A;  5J3R A;  4G10 A;  1XWB A;  3N9J A;  1TRS A;  2JU5 A;  3US3 A;  3GL3 A;  2C3T A;  3D5J A;  4EO3 A;  3ME7 A;  1BYE A;  3KD0 A;  1V9W A;  1JLW A;  4KDY A;  5DQY A;  4AGS A;  5DJM A;  2H6Y A;  4DSS A;  4TR1 A;  2LV3 A;  3TRQ A;  3RHC A;  4HQZ A;  2DJJ A;  4K1F A;  4ZL8 A;  1SK0 A;  3D0Z A;  2GSQ A;  1TKD B;  5C04 A;  1GRX A;  2MBS A;  1VGL A;  4MLY A;  2C3Q A;  3ZIJ A;  1TU7 A;  4E8H A;  3GN3 A;  2X8C A;  3GFK A;  1Y25 A;  1WRY A;  4RUV A;  3L78 A;  3I6A A;  1OKT A;  5CNW A;  5DJL A;  3TJG A;  1PX7 A;  4HOJ A;  1OVN A;  2H30 A;  1S3D A;  4POB A;  4GST A;  2X8G A;  1PMT A;  2XBQ A;  3TB2 A;  1THX A;  2HYX A;  4OD7 A;  1MTC A;  2AUV A;  5L71 A;  4O7H A;  1T7P B;  4IW9 A;  5IPH A;  3HDC A;  2DJ2 A;  1A24 A;  1EGR A;  2YCD A;  1H75 A;  5J4U A;  2VCQ A;  3GKM A;  1SL2 B;  2N5F A;  2AAW A;  3KM6 A;  3ZRE A;  4XS6 A;  1AQV A;  2KUC A;  1KNG A;  3KEB A;  4MMM A;  4PTS A;  3QMX A;  4RQX A;  3IAS 2;  4PQI A;  3PPU A;  1WPI A;  4JE1 A;  4GQC A;  1GSU A;  3FZA A;  1GLQ A;  1J0F A;  2IMK A;  4XRD A;  3HA9 A;  3LJR A;  5AGY A;  2I4A A;  6GSX A;  2B7K A;  2VL2 A;  1U88 A;  2VCX A;  1ZGN A;  3GST A;  2C0E A;  3IBH A;  1E6B A;  1SL1 B;  1DUG A;  4K7O A;  1XW5 A;  1XWC A;  2B5E A;  1JHB A;  10GS A;  1VF4 A;  2O89 A;  1TI3 A;  4WF5 A;  2HRN A;  2H19 A;  4GF0 A;  2C4J A;  1YF1 A;  4XIH A;  1PQN A;  1B9Y C;  3EU3 A;  1XWA A;  3WT2 A;  4AJ7 A;  2HZF A;  2BTO T;  1K3Y A;  4L5L A;  2RLI A;  5CYY A;  1Z7P A;  1XXU A;  3DGQ A;  4AF2 A;  1WWJ A;  3EMX A;  2MZC A;  1MDK A;  3LQ7 A;  2FWG A;  5KN1 A;  1G7E A;  1AQX A;  1X5D A;  4IEL A;  1R5A A;  5IOW A;  3DEX A;  4L5O A;  2LJK A;  3IAM 2;  5IMV A;  1BG5 A;  4FO5 A;  4I8B A;  4G0I A;  5GST A;  4GXZ A;  4Z7X A;  4IP6 A;  4J2F A;  5IPG A;  1PN9 A;  2R6K A;  5A4W A;  3W6G A;  1UVZ A;  3TRP A;  3EE2 A;  4BPY A;  2O8V B;  13GS A;  5AN1 A;  3FK8 A;  3HJP A;  5FWG A;  4YQV A;  1WOU A;  2AJQ B;  1SK2 A;  4HZ4 A;  2HE3 A;  3ZIT A;  2H1D A;  3E0U A;  4N0V A;  2MYG A;  5D8I A;  5EL8 A;  2LRT A;  4ZB9 A;  1GUK A;  1WJK A;  2QSI A;  3A5W A;  4TXO B;  1I5G A;  2YV9 A;  3ZMK A;  2OBI A;  3F4R A;  3HZ8 A;  3ZML A;  4FYC A;  3V1W A;  4Q5R A;  7GSS A;  4PXO A;  2JZR A;  1B8X A;  2WB9 A;  1W89 A;  1AC1 A;  3D21 A;  3EVI A;  3SBC A;  4GQF A;  3LGC A;  1GTI A;  1PX6 A;  5ECL B;  4MA9 A;  2MMN A;  1HNB A;  2DLX A;  1F9M A;  4N11 A;  2V2G A;  4N0Z A;  5HFI A;  1ERU A;  3VPQ A;  2FWE A;  2B5X A;  5G5F A;  1CQG A;  1XVQ A;  4RI6 A;  2FA8 A;  5LD0 A;  2TRX A;  4TR0 A;  3L4N A;  4HI7 A;  5HR3 A;  3NOF A;  1O85 A;  4QL9 A;  2PBJ A;  3GX0 A;  1J08 A;  2JAD A;  1TW9 A;  3GL5 A;  1ZOF A;  4LA1 A;  1KEB A;  4ZXG A;  2CVB A;  1SKW B;  1XWG A;  3P8W A;  2GTU A;  2JSZ A;  4GTU A;  1EGO A;  1QFN A;  3Q6O A;  1DE1 A;  4MJC A;  3HJM A;  1WIK A;  3CSI A;  3M3M A;  4RQR A;  2DJK A;  1K3O A;  1XZO A;  3A3T A;  3HXS A;  4K0G A;  2LJA A;  2A2S A;  3J7Y k;  3IXR A;  3W8J A;  3DVX A;  3APO A;  4PUR A;  5A4U A;  1AAZ A;  1VF1 A;  1Z7R A;  2GQK A;  3EUR A;  4OO4 A;  3TRX A;  1XPV A;  2X99 A;  3D4M A;  2HZE B;  5AIX A;  2H1G A;  3KP9 A;  1QGV A;  12GS A;  2H71 A;  1X9W B;  3A2W A;  1GSQ A;  1V40 A;  2J23 A;  2DMM A;  3KXO A;  4I6X A;  4JRR A;  4LL1 B;  2LST A;  2VCZ A;  4KCE A;  2IME A;  3TOU A;  3EU4 A;  5KEJ A;  4WF4 A;  1K0B A;  1F37 A;  8GSS A;  4OMV A;  4IBP A;  1OE7 A;  3ME8 A;  4G19 A;  4FYU A;  1VF3 A;  3F0I A;  3UBL A;  2LRN A;  5ECO B;  4KUN A;  2O7K A;  5FHI A;  2CVD A;  3WD6 A;  1SD9 A;  3VWW A;  3E9J B;  3Q74 A;  2LJR A;  2H1B A;  2F51 A;  4JU5 A;  2HRK A;  4HUA A;  3KH9 A;  1W4V A;  2H6Z A;  5CP1 A;  1O8X A;  4NWY A;  3F4S A;  2DBC A;  4D73 B;  3P7X A;  4MJE A;  2PMT A;  1DSB A;  5IMA A;  2DC5 A;  2VO4 A;  4KF9 A;  4NHW A;  3EC3 A;  2CT6 A;  3L0H A;  4FH8 A;  2M80 A;  5IMD A;  3IR4 A;  4H86 A;  4MH2 A;  2NTO A;  5ECM B;  2GVP A;  2LEG A;  2HNL A;  3TDG A;  3DD3 A;  2M46 A;  4ML6 A;  2J9H A;  4POM A;  1TP9 A;  2CAI A;  3GUS A;  2RM5 A;  1Q98 A;  5G1K A;  4EXJ A;  1O73 A;  5INY A;  1OAZ A;  3R3E A;  4BWS A;  3HZ4 A;  4DVC A;  4WR5 A;  1B9X C;  2GQM A;  1XW6 A;  2H0G A;  2R5G A;  1GSF A;  3GKN A;  1GNE A;  1LJR A;  3FR3 A;  1K0N A;  1EOH A;  4ZB8 A;  5H5Q A;  4KX4 A;  3GV1 A;  1WP0 A;  2B3S A;  1EV9 A;  4LLR A;  2OE1 A;  2R4V A;  4G0L A;  1ZYQ B;  5D73 A;  2WGR A;  4TXO A;  1K0C A;  5KN3 A;  3C1R A;  4ML1 A;  4MJB A;  1XOB A;  1FVJ A;  1LBK A;  3H93 A;  2JL4 A;  4TN8 A;  2C3N A;  3VK9 A;  3TUE A;  5D9X A;  4ECC A;  2FCH A;  1BED A;  1KTE A;  2FHE A;  3RHB A;  2L5L A;  2OAD A;  3GKX A;  2VOC A;  3G7Y A;  4L0U A;  3O76 A;  1ACV A;  5CRE A;  2P31 A;  2H72 A;  2G0F A;  2H0H A;  1RK4 A;  4LMV A;  1URM A;  3G7J A;  5ID2 B;  2GDR A;  1R7H A;  1V57 A;  2TIR A;  2C0F A;  4PQH A;  2H76 A;  3GH6 A;  3UAR A;  3LWA A;  2MBT A;  4XS1 A;  4EE0 A;  5BMU A;  3FRC A;  3EYT A;  3GTU B;  4ZIL A;  3IRA A;  3L9S A;  4F2I A;  2VLU A;  3EMP A;  4GSS A;  3VI5 A;  4DSR A;  4IJI A;  1XIY A;  3ERG A;  3DRN A;  3LXT A;  4WBJ A;  1O6J A;  2C1Y A;  1BX9 A;  1TU8 A;  4I5Q A;  2IFQ B;  4RI7 A;  1PL2 A;  2YWO A;  5DAL B;  2VL2 C;  2N5B A;  3FZ4 A;  1YF0 A;  2GT6 A;  5ECP B;  1GH2 A;  3H8Q A;  2VD1 A;  1N2A A;  4TXV A;  2ON5 A;  2CV4 A;  3HCZ A;  2DIZ A;  1OE8 A;  1BAY A;  5JWO B;  1YJ6 A;  3QCP A;  4XS4 B;  1ERW A;  5J5N A;  2HZE A;  2YN1 A;  2IWT A;  2ES7 A;  1AQW A;  1F3B A;  3U6V A;  5IMZ A;  4ZBB A;  3GX8 A;  1GTA A;  4CHS A;  2PVQ A;  3VLN A;  4QQ7 A;  4PGT A;  5HFG A;  3QPM A;  3DYR A;  3VFI A;  3LG6 A;  5IQY A;  3O6T A;  3FYG A;  1NM3 A;  2HFD A;  1FVK A;  4MZC A;  3CTF A;  1GSY A;  1T00 A;  3VWV A;  4HS1 A;  2GT5 A;  4PUF C;  2H0I A;  2PPT A;  4E8E A;  1TK8 B;  1R26 A;  3MNG A;  1SK1 A;  3AY8 A;  1AIU A;  1PGT A;  1FW1 A;  2DIY A;  6GST A;  3MAK A;  2RUF A;  3CSH A;  2YWI A;  5IM9 A;  4JED A;  5CO3 A;  1VRS D;  1JZO A;  4GRF A;  2H1A A;  3H79 A;  4TVE A;  1EZK A;  5ECH B;  3F63 A;  1N8J A;  4IJ3 A;  1PSQ A;  1RQM A;  1MDI A;  4IHU A;  2WDU A;  2M72 A;  2VLT A;  4N10 A;  5LCZ A;  3QAV A;  1B48 A;  4TW5 A;  3VWX A;  3GRX A;  1XWK A;  4ID0 A;  3M8N A;  3IPZ A;  2RII A;  4D73 A;  4YQU A;  3ZFB A;  3QAG A;  2O85 A;  1JLV A;  3ZZX A;  1A2J A;  2P5R A;  4YAP A;  3QR6 A;  2L5O A;  2YAN A;  2UZ8 A;  5HFK A;  1YEX A;  5COH A;  5B8A A;  4MZW A;  4K8M A;  3CXG A;  5CRW A;  5D96 A;  1YDK A;  1FOV A;  5ECN B;  4OO5 A;  3FR9 A;  4ZIJ A;  1U6T A;  3FEU A;  3IV4 A;  1LU4 A;  4CDO A;  4IQ1 A;  1EP8 A;  1UC7 A;  3DIE A;  3N5O A;  2E2M A;  4F0B A;  2AHE A;  2EIO A;  1BQ7 A;  3QAW A;  5ABR A;  3J7Y b;  3GIX A;  2CX3 A;  1JZD A;  1PRX A;  3M9K A;  2R3X A;  3TKS A;  3UL3 A;  3WGX A;  3G7I A;  4MF7 A;  1SYX A;  2IL3 A;  1HYU A;  2YNX A;  4TR3 A;  5CRH A;  4P3Y B;  5CAX A;  4O92 A;  1WE0 A;  1XVW A;  5GSS A;  3GH9 A;  2PUK C;  2VLV A;  1FO5 A;  1A8L A;  2KOK A;  4X43 A;  2YP6 A;  3KJY A;  3DML A;  5GAP D;  4YAV A;  4BVY B;  2H8L A;  4ECB A;  1EOG A;  3H4K A;  2I9H A;  5IMC A;  2N5A A;  3UOM A;  2WCI A;  4MDC A;  4I2U A;  3IDV A;  1G0T A;  5IMF A;  3QFB C;  4BVX B;  2VM2 A;  5ID2 A;  3UIW A;  2C8U A;  1AUC A;  4ZBA A;  1OC3 A;  2KHP A;  4JR4 A;  5C00 A;  1TRU A;  4KE3 A;  4TRX A;  2L4C A;  5A4V A;  1T8E B;  3D6I A;  3GTU A;  2K6V A;  4PX1 A;  2C0D A;  1Z3E A;  2H66 A;  2C0G A;  6GSS A;  1ZCP A;  1TI1 A;  4MP4 A;  3ERW A;  3KIJ A;  2VCT A;  5F0G A;  4KSO A;  5D93 A;  3H1N A;  5F07 A;  2IFQ A;  3U5R E;  2JSY A;  5DAL A;  2H75 A;  3E3E A;  3TJJ A;  18GS A;  2H70 A;  1G7O A;  4EUY A;  4IN0 A;  1EV4 A;  2LUS A;  3WYW A;  1SU9 A;  2LKU A;  2XPE A;  14GS A;  2MMZ A;  3F9U A;  3FY7 A;  2B6M A;  4XS4 A;  3PGT A;  1SD8 A;  2ZNM A;  4JR6 A;  1ZMA A;  4ZB6 A;  4XRA A;  3KCM A;  1OKD A;  2HSY A;  4KW6 A;  2K8V A;  3LFL A;  4NV5 A;  1AXD A;  4KDX A;  5DAK B;  3GKK A;  3KTL A;  4G2E A;  3APS A;  1SJ6 A;  3UEM A;  5FT3 A;  4EF0 A;  1EEJ A;  3D22 A;  5JWQ B;  3M1G A;  2LQO A;  4ECI A;  3BD2 A;  2R37 A;  1IYI A;  4ISD A;  2L57 A;  3SWL A;  1SEN A;  4NXI A;  2B7J A;  2K18 A;  1NW2 A;  4N30 A;  4J57 E;  4DEJ A;  1TK0 B;  3VPT A;  4JZQ A;  1TTZ A;  3HHV A;  4TKY A;  2AB6 A;  2Z9S A;  2RM6 A;  2PER A;  3ZTL A;  3GHA A;  3HVV A;  2WZ9 A;  5IO0 A;  3GUR A;  2P5Q A;  4BA7 A;  5F05 A;  5CRG A;  2VL3 A;  2GSR A;  1M0U A;  2CAQ A;  1F2E A;  1K0A A;  4YQM A;  1ZZY A;  1A23 A;  3DVW A;  3IC4 A;  2KLX A;  3MWH A;  2L59 A;  1GSD A;  1YKC A;  1X5C A;  1TK5 B;  3KGK A;  4EDZ A;  2VIM A;  1F6M C;  1O81 A;  1XW9 A;  3APQ A;  1HQO A;  5DBQ A;  2DJ1 A;  4I2T A;  2O87 A;  1VF2 A;  1B4Q A;  3UAP A;  2LTK A;  1GTB A;  1EEM A;  2CZ3 A;  1U3A A;  5HR0 A;  3C71 A;  3QOU A;  4HJ2 A;  4XTS A;  4OFM A;  1E2Y A;  4POL A;  5D9W A;  5DCH A;  2HI7 A;  1T4Y A;  5CRD A;  5G2Z A;  2R2J A;  4GCI A;  1M7T A;  3F8U A;  2DJ0 A;  3HKR A;  5HR2 A;  1NHO A;  3TKS E;  1GNW A;  5DQS A;  2WRT A;  2EIR A;  2K9F A;  5GZZ B;  3IOS A;  3TGZ A;  2OJL A;  3HVS A;  4OCF A;  1A2L A;  19GS A;  1H4O A;  1G6W A;  4K2D A;  1FHE A;  5B8B A;  1PA3 A;  3HY2 A;  1XCC A;  4PNF A;  4OWY A;  1SKR B;  5JWR B;  2IIY A;  4WEY A;  1Z6M A;  3RAZ A;  2FGX A;  1V98 A;  4NAX A;  4K9Z A;  3KMN A;  3CTG A;  3ZLP A;  2PN8 A;  1TJD A;  3A2V A;  1HNC A;  9GSS A;  3LEF A;  3P2A A;  5F06 A;  4MF6 A;  4NPB A;  2FA4 A;  4BL7 B;  2ALB A;  5ELA A;  3IHQ A;  4LMW A;  2LS5 A;  2IMD A;  1M2A A;  2NPB A;  4BVY A;  3CRT A;  2FD3 A;  1GP1 A;  2GST A;  3PH9 A;  1O8W A;  1BJX A;  2X64 A;  1X9S B;  1USB A;  3ED3 A;  5H5R A;  3KH7 A;  5JCW A;  1XOA A;  3IC8 A;  1S3C A;  2K8S A;  3ZYW A;  2GZY A;  4EDY A;  3RBT A;  1I9D A;  2I1U A;  3F6F A;  1GTU A;  4WKW A;  3ZRD A;  1R5P A;  4F82 A;  4HU7 A;  1A8Y A;  2NVL A;  1QUW A;  5DCG A;  4WET A;  3IA1 A;  5JCU A;  3FHK A;  3L9V A;  1XFL A;  5B6M A;  1YZX A;  2IJY A;  5EPF A;  5D9T A;  3DXB A;  3RPN A;  4POK A;  3TJF A;  2F3M A;  2IN3 A;  4L8E A;  1ST9 A;  1A2M A;  5ECS A;  2BMX A;  3C73 A;  4OFN A;  2HSM B;  5LNK e;  1IYH A;  1KBN A;  2KP1 A;  4JBB A;  20GS A;  22GS A;  3EWL A;  1M2D A;  1Z6N A;  2V1M A;  4GSN A;  2MMA A;  4K7I A;  2H01 A;  2YWM A;  3FZ9 A;  2XPD A;  2OBK A;  4FYB A;  4XCS A;  3ZVJ D;  4CW9 A;  3F4T A;  4KGI A;  1MDJ A;  5DAK A;  4KB3 A;  1FAA A;  4MCU A;  4TOP A;  4O32 A;  2ZCT A;  2GQL A;  3TJK A;  1K0M A;  3IK7 A;  1V2A A;  2LRC A;  4MZB A;  4K7N A;  2PGT A;  4PUA A;  2OA7 A;  2FLS A;  1JZW A;  5ECK B;  4K6X A;  4HZ2 A;  5ECQ B;  3LYK A;  1SL0 B;  1Y6E A;  2L6C A;  3TCO A;  3KP8 A;  3CSJ A;  3TKQ A;  2F9S A;  1S3A A;  3MSZ A;  3UJ1 A;  5G5E A;  2IPA A;  2A2R A;  4ULX A;  2FWH A;  1GUH A;  2BJX A;  4ILF A;  3TKS C;  1K0O A;  3W8S A;  2JZT A;  1ERT A;  5GAN D;  2HRK B;  5B6N A;  2GGT A;  1A0F A;  2LNS A;  3LOR A;  3A2X A;  3GYK A;  1THO A;  4DSQ A;  1TDI A;  4ZBD A;  1CQH A;  2GZZ A;  3OR5 A;  2PVO C;  1V58 A;  4PQ1 A;  2YPM A;  2VCW A;  1X0R A;  2HSN B;  2JAC A;  4IVF A;  5JCG A;  3HYP A;  2YWN A;  3O3T A;  2XC2 A;  3IE3 A;  2JZS A;  1QQ2 A;  2WJU A;  4IS0 A;  2YZU A;  3VUR A;  3GNJ A;  1PKZ A;  1X5E A;  1ZL9 A;  5ECR B;  1M9B A;  2ZUP A;  4K0N A;  5EVO A;  2X8H A;  2L6D A;  1UA5 A;  11GS A;  1M9A A;  3GMF A;  4I97 A;  3S9F A;  3NZN A;  1K3L A;  4V1A g;  2E2G A;  3F3Q A;  4USS A;  1PD2 1;  1QXH A;  2CQ9 A;  1OC9 B;  4HU9 A;  4MF5 A;  3C7M A;  2HRA A;  3BCK A;  3TOT A;  1TRV A;  3WT1 A;  3UBK A;  1JFU A;  4V2M A;  1YQ1 A;  1MD4 A;  2DSA A;  4EL1 A;  4NHZ A;  1T4Z A;  3RPP A;  1GLP A;  2TRC P;  4WBR D;  3D4T A;  4KDU A;  2FY6 A;  2FUG 2;  2VD0 A;  2VCV A;  4EKZ A;  2E0Q A;  4GWR A;  4OCE A;  4MPG A;  4PNG A;  4FQU A;  3QDN A;  2IMF A;  4ZL9 A;  1RW1 A;  2VM1 A;  1GL8 A;  3L9U A;  5AIS A;  4BL7 A;  3M9J A;  1HNA A;  3FW2 A;  1U3I A;  1GWC A;  4NMU A;  5KN2 A;  3CYN A;  1O7U A;  6GSU A;  5D9V A;  3LSZ A;  2CX4 A;  16GS A;  5AIV A;  5HQP A;  2GS3 A;  3GSS A;  5IIZ A;  1PL1 A;  4WR4 A;  1TRW A;  1TXX A;  2F8F A;  2QC7 A;  3PR8 A;  1M2B A;  4MH3 A;  1JZR A;  5J9B A;  2YZH A;  1U87 A;  2EIQ A;  2HQT A;  5A5K A;  5E59 A;  4HQS A;  2V41 A;  4V1A p;  1YKA A;  3KTB A;  3ISO A;  3DKS A;  1QK8 A;  2VUP A;  1TOF A;  3CMI A;  4KAE A;  2NDO A;  1M99 A;  1Q4J A;  5J41 A;  4F9Z A;  4IQA A;  1PKW A;  3BJ5 A;  2AYT A;  4ACS A;  3GA4 A;  5DDL A;  3BCI A;  2EC4 A;  3VI7 A;  4LL4 B;  4DSS B;  2B1L A;  4AJ6 A;  4TR1 B;  4TR4 A;  4KSM A;  2V6O A;  2HLS A;  3ZIV A;  1FG4 A;  1DE2 A;  1A0R P;  3EIN A;  3WGD A;  2HSM A;  4V2N A;  1X9M B;  2I3Y A;  3FKF A;  5IO2 A;  4L0W A;  3ERF A;  4HEA 2;  1GUM A;  4MPF A;  3PIN A;  2IMI A;  2V32 A;  2YJH A;  2YOI A;  17GS A;  5ECI B;  1T3B A;  4Q5N A;  1UN2 A;  1B4P A;  1F3A A;  5KN0 A;  5ELG A;  4F0C A;  2P0G A;  3RDW A;  1EWX A;  2VAF A; 
#chains in the Genus database with same CATH topology
 1ERV A;  3TJB A;  2V6K A;  5DVB A;  3ZVJ A;  3KMO A;  2CA8 A;  4NV2 A;  5HR1 A;  3R2Q A;  2G2Q A;  1MD3 A;  4AKG A;  2PU9 C;  1YEW C;  3BBY A;  2F8A A;  2OE0 A;  4ECJ A;  3JCM L;  2B5Y A;  3I43 A;  5ENU A;  3I9V 2;  3FZ5 A;  3TKR A;  2FNO A;  4Q5F A;  2OAC A;  2CVK A;  3UMA A;  4Z2T A;  2H73 A;  2WW2 A;  3ZL5 A;  3IK9 A;  2HSH A;  6GSY A;  2B1K A;  4HJM A;  1FB6 A;  1YEP A;  3ZFL A;  3C8E A;  4AJ8 A;  3Q19 A;  2KP2 A;  2HT9 A;  3C1S A;  3NIV A;  3K8N A;  1SJI A;  5E4W A;  4KA0 A;  4XHM A;  4MAB A;  1GUL A;  2ON7 A;  2XBI A;  4G9H A;  4GLT A;  1T1V A;  4OFT A;  1NSW A;  3UVT A;  2HXK A;  2REM A;  2VL9 A;  1K0D A;  2HSN A;  2I81 A;  4KCA A;  2QGV A;  2R0C A;  5EY6 A;  1FB0 A;  2GLR A;  2MMO A;  2O3E A;  2H74 A;  1Z9H A;  4Q5Q A;  5KOX A;  1HD2 A;  4IP1 A;  2LQQ A;  4MJA A;  2A4V A;  5J9C A;  3HJO A;  4V2L A;  4X1U A;  5G31 A;  4IKH A;  4ZL7 A;  5B7C A;  4F03 A;  5IOX A;  2L4Q A;  4O5R A;  4MK3 A;  2WFC A;  2XHF A;  1DBY A;  1XBS A;  1EP7 A;  4ICY A;  1ML6 A;  1OC9 A;  1OYJ A;  3CBU A;  1MEK A;  2DJ3 A;  3FR6 A;  2NBS A;  4EC0 A;  3BOA A;  5F8B A;  3F3R A;  2C80 A;  4YH2 A;  1G6Y A;  4EVM A;  3KZQ A;  1SJZ A;  1SKS B;  3QD9 A;  3WGE A;  4Z2R A;  4G0K A;  1ILO A;  1WMJ A;  1J9B A;  2RUE A;  3TKP A;  2WS2 A;  3M0F A;  2O5V A;  1BG1 A;  3I69 A;  1ON4 A;  5H5S A;  3Q18 A;  3F6D A;  1ZYE A;  4J56 E;  5G1L A;  2WUL A;  1AW9 A;  3P90 A;  4IGJ A;  3UVH A;  3CRU A;  3QFA C;  2GSS A;  1ABA A;  2YV7 A;  6GSW A;  3HD5 A;  2HRF A;  4QL7 A;  2DML A;  1NHY A;  3G9B A;  1C72 A;  4HDE A;  3LXZ A;  2D2Z A;  3LYP A;  3MDK A;  2E7P A;  2QKE A;  1GSE A;  3VWU A;  2CZ2 A;  4FIW A;  1SYR A;  5G30 A;  1Z5Y E;  1GSS A;  2OE3 A;  2LNT A;  6GSV A;  1QMV A;  4BVX A;  4KH7 A;  2GZP A;  4KND A;  4X0X A;  2PWJ A;  4WXT A;  2AV4 A;  1YY7 A;  4BWQ A;  1R4W A;  2OKA A;  2H6X A;  2YJ7 A;  1OC8 A;  2FWF A;  3HVX A;  3DWV A;  5J3R A;  4G10 A;  1XWB A;  3A5I A;  3N9J A;  1TRS A;  2JU5 A;  3US3 A;  3GL3 A;  2C3T A;  3D5J A;  4EO3 A;  3ME7 A;  1BYE A;  3KD0 A;  1V9W A;  1JLW A;  4KDY A;  5DQY A;  4AGS A;  5DJM A;  2H6Y A;  4DSS A;  4TR1 A;  2LV3 A;  3TRQ A;  3RHC A;  4HQZ A;  2DJJ A;  4K1F A;  4ZL8 A;  1SK0 A;  3D0Z A;  4EIQ A;  2GSQ A;  1TKD B;  5C04 A;  1GRX A;  2MBS A;  1VGL A;  4MLY A;  2C3Q A;  4AKX B;  3ZIJ A;  1TU7 A;  4E8H A;  3GN3 A;  2X8C A;  3GFK A;  1Y25 A;  1WRY A;  4RUV A;  3L78 A;  3I6A A;  1OKT A;  5CNW A;  5DJL A;  3TJG A;  1PX7 A;  4HOJ A;  1OVN A;  2H30 A;  1S3D A;  4POB A;  1FOH A;  4GST A;  2X8G A;  1PMT A;  2XBQ A;  3TB2 A;  1THX A;  2HYX A;  3CQF A;  4OD7 A;  1MTC A;  2AUV A;  5L71 A;  4O7H A;  1T7P B;  4IW9 A;  5IPH A;  3HDC A;  2DJ2 A;  1A24 A;  1EGR A;  2YCD A;  1H75 A;  5J4U A;  2VCQ A;  3GKM A;  1SL2 B;  2N5F A;  2AAW A;  3KM6 A;  3ZRE A;  4XS6 A;  1AQV A;  2KUC A;  1KNG A;  3KEB A;  2X49 A;  4MMM A;  4PTS A;  3QMX A;  4RQX A;  3IAS 2;  4PQI A;  3PPU A;  1WPI A;  4JE1 A;  4GQC A;  1GSU A;  3FZA A;  1GLQ A;  1J0F A;  2IMK A;  4XRD A;  3HA9 A;  3LJR A;  5AGY A;  2I4A A;  6GSX A;  2B7K A;  2VL2 A;  1U88 A;  2VCX A;  1ZGN A;  3GST A;  2C0E A;  3IBH A;  1E6B A;  1SL1 B;  1DUG A;  4K7O A;  1XW5 A;  1XWC A;  2B5E A;  1JHB A;  10GS A;  1VF4 A;  2O89 A;  1TI3 A;  4WF5 A;  2HRN A;  2H19 A;  4GF0 A;  2C4J A;  1YF1 A;  4XIH A;  1PQN A;  1B9Y C;  5J4Y A;  3EU3 A;  1XWA A;  3WT2 A;  4AJ7 A;  2HZF A;  2BTO T;  4AI6 A;  3IHG A;  1K3Y A;  4L5L A;  2RLI A;  5CYY A;  1Z7P A;  1XXU A;  3DGQ A;  4AF2 A;  1WWJ A;  3EMX A;  2MZC A;  1MDK A;  3LQ7 A;  2FWG A;  5KN1 A;  1G7E A;  1AQX A;  1X5D A;  4IEL A;  1R5A A;  5IOW A;  3DEX A;  4L5O A;  4E68 A;  2LJK A;  3IAM 2;  5IMV A;  1BG5 A;  4FO5 A;  4I8B A;  4G0I A;  5GST A;  4GXZ A;  4Z7X A;  4IP6 A;  4J2F A;  5IPG A;  1PN9 A;  2R6K A;  5A4W A;  3W6G A;  1UVZ A;  3EPT A;  3TRP A;  3EE2 A;  4BPY A;  2O8V B;  13GS A;  5AN1 A;  3FK8 A;  3HJP A;  5FWG A;  4YQV A;  1WOU A;  5BRT A;  4N3Z A;  2AJQ B;  1SK2 A;  4HZ4 A;  2HE3 A;  3ZIT A;  2H1D A;  3E0U A;  4N0V A;  2MYG A;  5D8I A;  5EL8 A;  2LRT A;  4ZB9 A;  1GUK A;  1WJK A;  4PI0 C;  2QSI A;  3A5W A;  4TXO B;  1I5G A;  2YV9 A;  3ZMK A;  2OBI A;  3F4R A;  1ZYN A;  3HZ8 A;  3ZML A;  4FYC A;  3V1W A;  4Q5R A;  7GSS A;  4PXO A;  1ZYP A;  2JZR A;  1B8X A;  2WB9 A;  1W89 A;  1AC1 A;  3D21 A;  3EVI A;  3SBC A;  4GQF A;  3LW9 A;  3LGC A;  1GTI A;  1PX6 A;  5ECL B;  4MA9 A;  2MMN A;  1HNB A;  2DLX A;  1F9M A;  4N11 A;  2V2G A;  4N0Z A;  5HFI A;  1ERU A;  3VPQ A;  2FWE A;  2B5X A;  5G5F A;  1CQG A;  1XVQ A;  4RI6 A;  2FA8 A;  5LD0 A;  2TRX A;  4TR0 A;  2UV8 G;  3L4N A;  4HI7 A;  5HR3 A;  3NOF A;  1O85 A;  4QL9 A;  2PBJ A;  3GX0 A;  5BMU B;  1J08 A;  4YKG A;  2JAD A;  1TW9 A;  3GL5 A;  1ZOF A;  4LA1 A;  1KEB A;  4ZXG A;  2CVB A;  1SKW B;  1XWG A;  3RGB C;  3P8W A;  2GTU A;  2JSZ A;  4GTU A;  1EGO A;  1QFN A;  3Q6O A;  2R0P A;  1DE1 A;  4MJC A;  3HJM A;  1WIK A;  3CSI A;  3M3M A;  4RQR A;  2DJK A;  1BF5 A;  1K3O A;  1XZO A;  3A3T A;  3HXS A;  4K0G A;  2LJA A;  2A2S A;  3J7Y k;  1PFO A;  3IXR A;  3W8J A;  3DVX A;  3APO A;  4PUR A;  1M3J A;  5A4U A;  1AAZ A;  1VF1 A;  1Z7R A;  2GQK A;  3EUR A;  4OO4 A;  3TRX A;  1XPV A;  2X99 A;  3D4M A;  2HZE B;  5AIX A;  2H1G A;  3KP9 A;  4W66 A;  1QGV A;  12GS A;  2H71 A;  1X9W B;  3A2W A;  1GSQ A;  1V40 A;  2J23 A;  2DMM A;  3KXO A;  4I6X A;  4JRR A;  4LL1 B;  2LST A;  2VCZ A;  4KCE A;  2IME A;  3TOU A;  3EU4 A;  5KEJ A;  4WF4 A;  1K0B A;  1F37 A;  8GSS A;  4OMV A;  4IBP A;  1OE7 A;  3ME8 A;  4G19 A;  4FYU A;  1VF3 A;  3F0I A;  3UBL A;  2LRN A;  5ECO B;  4KUN A;  2O7K A;  2EFH A;  5FHI A;  2CVD A;  3WD6 A;  1SD9 A;  3VWW A;  3E9J B;  3Q74 A;  2LJR A;  1YVL A;  2H1B A;  2F51 A;  4JU5 A;  2HRK A;  4HUA A;  3KH9 A;  2WW0 A;  3MIX A;  1W4V A;  2H6Z A;  5CP1 A;  1O8X A;  4NWY A;  3F4S A;  2DBC A;  4K5S A;  4D73 B;  3P7X A;  4MJE A;  2PMT A;  1DSB A;  4PI2 C;  1SVM A;  5IMA A;  2DC5 A;  2VO4 A;  4KF9 A;  4NHW A;  3EC3 A;  2CT6 A;  3L0H A;  4FH8 A;  2M80 A;  5IMD A;  3IR4 A;  4H86 A;  4MH2 A;  2NTO A;  5ECM B;  2GVP A;  2LEG A;  2HNL A;  2DKH A;  3TDG A;  3DD3 A;  2M46 A;  4ML6 A;  2J9H A;  4POM A;  1TP9 A;  2CAI A;  3GUS A;  2RM5 A;  1Q98 A;  5G1K A;  4EXJ A;  1O73 A;  5INY A;  4YKF A;  1OAZ A;  3R3E A;  4BWS A;  3HZ4 A;  4DVC A;  2WVZ A;  4WR5 A;  1B9X C;  2GQM A;  1XW6 A;  2H0G A;  2R5G A;  1GSF A;  3GKN A;  1GNE A;  1LJR A;  3FR3 A;  1K0N A;  1EOH A;  4ZB8 A;  5H5Q A;  3MYD A;  4KX4 A;  3GV1 A;  5KOW A;  1WP0 A;  2B3S A;  4CY6 A;  3HVN A;  1EV9 A;  4LLR A;  2OE1 A;  2R4V A;  4G0L A;  1ZYQ B;  5D73 A;  2WGR A;  4TXO A;  1K0C A;  5KN3 A;  3C1R A;  4ML1 A;  4MJB A;  1XOB A;  1FVJ A;  1LBK A;  3H93 A;  2JL4 A;  4TN8 A;  2C3N A;  3VK9 A;  3TUE A;  5D9X A;  4ECC A;  2FCH A;  1BED A;  1KTE A;  2FHE A;  3RHB A;  2L5L A;  2OAD A;  3GKX A;  2VOC A;  3G7Y A;  4L0U A;  3O76 A;  1ACV A;  5CRE A;  2P31 A;  2H72 A;  2G0F A;  2H0H A;  1RK4 A;  4LMV A;  1URM A;  3G7J A;  5ID2 B;  2GDR A;  1R7H A;  1V57 A;  2TIR A;  2C0F A;  4PQH A;  2H76 A;  3GH6 A;  3UAR A;  3LWA A;  2MBT A;  4XS1 A;  4EE0 A;  5BMU A;  3FRC A;  3EYT A;  3GTU B;  4ZIL A;  3IRA A;  3L9S A;  4F2I A;  2VLU A;  3EMP A;  1S4B P;  1I1I P;  4GSS A;  3VI5 A;  4DSR A;  4IJI A;  3RFR C;  1XIY A;  3ERG A;  3DRN A;  3LXT A;  4WBJ A;  1O6J A;  2C1Y A;  1BX9 A;  1TU8 A;  4I5Q A;  2IFQ B;  4RI7 A;  1PL2 A;  2YWO A;  5DAL B;  2VL2 C;  2N5B A;  3FZ4 A;  1YF0 A;  2GT6 A;  5ECP B;  1GH2 A;  3H8Q A;  2VD1 A;  1N2A A;  4TXV A;  2ON5 A;  2CV4 A;  3HCZ A;  2DIZ A;  1OE8 A;  1BAY A;  5JWO B;  1YJ6 A;  3QCP A;  4X4J A;  2R0G A;  5A5H A;  4XS4 B;  1ERW A;  5J5N A;  2HZE A;  2YN1 A;  2IWT A;  2ES7 A;  1AQW A;  1F3B A;  3U6V A;  5IMZ A;  4ZBB A;  3GX8 A;  1GTA A;  4CHS A;  2PVQ A;  3VLN A;  4QQ7 A;  4PGT A;  5HFG A;  3QPM A;  3DYR A;  3VFI A;  3LG6 A;  5IQY A;  3O6T A;  3FYG A;  1NM3 A;  4PHZ C;  2HFD A;  1FVK A;  4MZC A;  3CTF A;  1GSY A;  1T00 A;  3VWV A;  4HS1 A;  2GT5 A;  4PUF C;  2H0I A;  2PPT A;  4E8E A;  1TK8 B;  1R26 A;  3MNG A;  1SK1 A;  3AY8 A;  1AIU A;  1PGT A;  1FW1 A;  2DIY A;  6GST A;  3MAK A;  2RUF A;  3CSH A;  2YWI A;  5IM9 A;  4JED A;  5CO3 A;  1VRS D;  1JZO A;  4GRF A;  2H1A A;  3H79 A;  4TVE A;  1EZK A;  5ECH B;  3F63 A;  1N8J A;  4IJ3 A;  1PSQ A;  1RQM A;  1MDI A;  5A34 B;  4IHU A;  2WDU A;  2M72 A;  2VLT A;  1SVL A;  4N10 A;  5LCZ A;  3QAV A;  1B48 A;  4TW5 A;  3VWX A;  3GRX A;  1XWK A;  4ID0 A;  3M8N A;  3IPZ A;  2RII A;  4D73 A;  4YQU A;  3ZFB A;  3QAG A;  2O85 A;  1JLV A;  4QMK A;  3ZZX A;  1A2J A;  2EFC A;  2P5R A;  4YAP A;  3QR6 A;  2QA1 A;  2L5O A;  2YAN A;  4A5P A;  2UZ8 A;  5HFK A;  1YEX A;  5COH A;  5B8A A;  4MZW A;  4K8M A;  3CXG A;  5CRW A;  5D96 A;  1YDK A;  1FOV A;  5ECN B;  4OO5 A;  3FR9 A;  4ZIJ A;  1U6T A;  3FEU A;  3IV4 A;  1LU4 A;  4CDO A;  4IQ1 A;  1EP8 A;  1UC7 A;  3DIE A;  3N5O A;  2E2M A;  4F0B A;  2AHE A;  2EIO A;  1BQ7 A;  3QAW A;  5ABR A;  3J7Y b;  3GIX A;  2CX3 A;  1JZD A;  1PRX A;  3M9K A;  2R3X A;  3TKS A;  3UL3 A;  3WGX A;  3G7I A;  4MF7 A;  1SYX A;  2DKI A;  2IL3 A;  1HYU A;  2YNX A;  4TR3 A;  5CRH A;  2WVY A;  4P3Y B;  5CAX A;  4O92 A;  1WE0 A;  1XVW A;  5GSS A;  3GH9 A;  2PUK C;  2VLV A;  1FO5 A;  1A8L A;  2KOK A;  4EIP A;  4X43 A;  2YP6 A;  3KJY A;  3DML A;  5GAP D;  4YAV A;  4BVY B;  2WVX B;  2H8L A;  4ECB A;  1EOG A;  3H4K A;  2I9H A;  5IMC A;  2N5A A;  3UOM A;  2WCI A;  4MDC A;  4I2U A;  3IDV A;  1G0T A;  5IMF A;  3QFB C;  4BVX B;  2VM2 A;  5ID2 A;  3UIW A;  4Z2U A;  2C8U A;  1AUC A;  4ZBA A;  1OC3 A;  2KHP A;  4JR4 A;  5C00 A;  1TRU A;  4KE3 A;  4TRX A;  2L4C A;  5A4V A;  1T8E B;  3D6I A;  3GTU A;  2K6V A;  4PX1 A;  2C0D A;  1Z3E A;  2H66 A;  2C0G A;  6GSS A;  1ZCP A;  4O5Q A;  1TI1 A;  4MP4 A;  3ERW A;  3KIJ A;  2VCT A;  5F0G A;  4KSO A;  5D93 A;  3H1N A;  5F07 A;  2IFQ A;  3U5R E;  2JSY A;  5DAL A;  4MNN A;  2H75 A;  3E3E A;  3TJJ A;  5J47 A;  18GS A;  2H70 A;  1G7O A;  4EUY A;  4IN0 A;  1EV4 A;  2LUS A;  4AKI A;  3WYW A;  1SU9 A;  2LKU A;  2XPE A;  14GS A;  2MMZ A;  3F9U A;  3FY7 A;  2B6M A;  4XS4 A;  3PGT A;  1SD8 A;  2ZNM A;  4JR6 A;  1ZMA A;  4ZB6 A;  4XRA A;  3KCM A;  1OKD A;  2HSY A;  4KW6 A;  3CHX C;  2QA2 A;  2K8V A;  3LFL A;  4G01 A;  4NV5 A;  1AXD A;  4KDX A;  5DAK B;  3GKK A;  3KTL A;  4G2E A;  3APS A;  1SJ6 A;  3UEM A;  5FT3 A;  4EF0 A;  1EEJ A;  3D22 A;  5JWQ B;  3M1G A;  2LQO A;  4ECI A;  3BD2 A;  2R37 A;  1IYI A;  4ISD A;  2L57 A;  3SWL A;  1SEN A;  4NXI A;  2B7J A;  2K18 A;  1NW2 A;  4N30 A;  4J57 E;  4DEJ A;  2H1L A;  1TK0 B;  3VPT A;  4JZQ A;  1TTZ A;  3HHV A;  4TKY A;  2AB6 A;  2Z9S A;  2RM6 A;  2PER A;  3ZTL A;  3GHA A;  3HVV A;  2WZ9 A;  5IO0 A;  3GUR A;  2P5Q A;  4BA7 A;  5A34 A;  5F05 A;  5CRG A;  2VL3 A;  2GSR A;  2EFE A;  1M0U A;  2CAQ A;  1F2E A;  1K0A A;  4YQM A;  1ZZY A;  1A23 A;  3DVW A;  3IC4 A;  2KLX A;  3MWH A;  2L59 A;  1GSD A;  1YKC A;  1X5C A;  1TK5 B;  3KGK A;  4EDZ A;  2VIM A;  1F6M C;  1O81 A;  1XW9 A;  3APQ A;  1HQO A;  5DBQ A;  2DJ1 A;  4I2T A;  2O87 A;  1VF2 A;  1B4Q A;  3UAP A;  2LTK A;  1GTB A;  1EEM A;  2CZ3 A;  1U3A A;  5HR0 A;  1SVO A;  3TU3 B;  3C71 A;  3QOU A;  4HJ2 A;  4XTS A;  4OFM A;  1E2Y A;  4POL A;  5D9W A;  5DCH A;  3CWG A;  2HI7 A;  1T4Y A;  5CRD A;  5G2Z A;  2R2J A;  4GCI A;  1M7T A;  3F8U A;  2DJ0 A;  3HKR A;  5HR2 A;  1NHO A;  3TKS E;  1GNW A;  5DQS A;  2WRT A;  2EIR A;  2K9F A;  5GZZ B;  3IOS A;  3TGZ A;  2O36 A;  2OJL A;  3HVS A;  4OCF A;  1A2L A;  19GS A;  1H4O A;  1G6W A;  4K2D A;  1FHE A;  5B8B A;  1PA3 A;  3HY2 A;  1XCC A;  4PNF A;  4K2X A;  4OWY A;  1SKR B;  5JWR B;  2IIY A;  4WEY A;  1Z6M A;  3RAZ A;  2FGX A;  1V98 A;  2A2P A;  4NAX A;  4K9Z A;  3KMN A;  3CTG A;  3ZLP A;  2PN8 A;  1TJD A;  3A2V A;  1HNC A;  9GSS A;  3LEF A;  3P2A A;  5F06 A;  4MF6 A;  4NPB A;  2FA4 A;  5J4V A;  4BL7 B;  2ALB A;  5ELA A;  3IHQ A;  4LMW A;  2LS5 A;  2IMD A;  1M2A A;  2NPB A;  4BVY A;  3CRT A;  2WVX A;  2FD3 A;  1GP1 A;  2GST A;  3PH9 A;  1O8W A;  1BJX A;  2X64 A;  1X9S B;  1USB A;  3ED3 A;  5H5R A;  3KH7 A;  5JCW A;  1XOA A;  3IC8 A;  1S3C A;  2K8S A;  3ZYW A;  2GZY A;  4EDY A;  3RBT A;  1I9D A;  2I1U A;  3F6F A;  1GTU A;  4WKW A;  3ZRD A;  1R5P A;  4F82 A;  4HU7 A;  1A8Y A;  2NVL A;  1QUW A;  5DCG A;  4WET A;  3IA1 A;  3HMJ G;  5JCU A;  3FHK A;  3L9V A;  1XFL A;  5B6M A;  1YZX A;  2IJY A;  5EPF A;  5D9T A;  3DXB A;  3RPN A;  4POK A;  3TJF A;  2F3M A;  2IN3 A;  4L8E A;  1ST9 A;  1A2M A;  5ECS A;  2BMX A;  3C73 A;  4OFN A;  2HSM B;  5LNK e;  1IYH A;  1KBN A;  5A1N B;  2KP1 A;  4JBB A;  20GS A;  22GS A;  3EWL A;  4FXY P;  1M2D A;  1Z6N A;  2V1M A;  4GSN A;  2MMA A;  4K7I A;  2H01 A;  2YWM A;  3FZ9 A;  2XPD A;  2OBK A;  4FYB A;  4XCS A;  3ZVJ D;  4CW9 A;  3F4T A;  4KGI A;  1MDJ A;  5DAK A;  4KB3 A;  1FAA A;  4MCU A;  4TOP A;  4O32 A;  2ZCT A;  4CY8 A;  2GQL A;  3TJK A;  1K0M A;  3IK7 A;  4HSC X;  1V2A A;  2LRC A;  4MZB A;  4K7N A;  2VKZ G;  2PGT A;  4PUA A;  2OA7 A;  2FLS A;  1JZW A;  5ECK B;  4K6X A;  4HZ2 A;  5ECQ B;  4K5R A;  3LYK A;  1SL0 B;  2X4A A;  1Y6E A;  2L6C A;  3TCO A;  3KP8 A;  3CSJ A;  3TKQ A;  4ZB7 A;  2F9S A;  1Y1U A;  1S3A A;  3MSZ A;  3UJ1 A;  5G5E A;  2IPA A;  2A2R A;  4ULX A;  2FWH A;  1GUH A;  2BJX A;  4ILF A;  3TKS C;  4O5U A;  1K0O A;  3W8S A;  2JZT A;  1ERT A;  5GAN D;  2HRK B;  5B6N A;  2GGT A;  4GDF A;  1A0F A;  2LNS A;  3LOR A;  2EFD A;  3A2X A;  3GYK A;  1THO A;  4DSQ A;  2WZS A;  1TDI A;  4ZBD A;  1CQH A;  2GZZ A;  3OR5 A;  2PVO C;  1V58 A;  4PQ1 A;  2YPM A;  2VCW A;  1X0R A;  2HSN B;  2WW3 A;  2JAC A;  4IVF A;  5JCG A;  3HYP A;  2YWN A;  3O3T A;  2XC2 A;  3IE3 A;  2JZS A;  1QQ2 A;  2WJU A;  4IS0 A;  2YZU A;  3VUR A;  3GNJ A;  1PKZ A;  1X5E A;  1S3R A;  1ZL9 A;  5ECR B;  1TXU A;  1M9B A;  2ZUP A;  4K0N A;  5EVO A;  2X8H A;  2L6D A;  1UA5 A;  11GS A;  1M9A A;  3GMF A;  4I97 A;  2OT3 A;  3S9F A;  3NZN A;  1K3L A;  4V1A g;  2E2G A;  3F3Q A;  4USS A;  1PD2 1;  1QXH A;  2CQ9 A;  1OC9 B;  4HU9 A;  4MF5 A;  3C7M A;  2HRA A;  3BCK A;  3TOT A;  1TRV A;  3WT1 A;  3UBK A;  1JFU A;  4V2M A;  1YQ1 A;  1MD4 A;  2DSA A;  1N25 A;  2WW1 A;  4EL1 A;  4NHZ A;  1T4Z A;  3RPP A;  1GLP A;  2TRC P;  4WBR D;  3D4T A;  4KDU A;  2FY6 A;  2FUG 2;  2VD0 A;  2VCV A;  4EKZ A;  2E0Q A;  4GWR A;  4OCE A;  4MPG A;  4PNG A;  4FQU A;  3QDN A;  2IMF A;  4ZL9 A;  1RW1 A;  2VM1 A;  1GL8 A;  3L9U A;  5AIS A;  4BL7 A;  1PN0 A;  3M9J A;  1HNA A;  3FW2 A;  1U3I A;  1GWC A;  4NMU A;  5KN2 A;  3FMW A;  3CYN A;  1O7U A;  6GSU A;  5D9V A;  3LSZ A;  2CX4 A;  16GS A;  5AIV A;  5HQP A;  2GS3 A;  3GSS A;  5IIZ A;  1PL1 A;  4WR4 A;  1TRW A;  1TXX A;  2F8F A;  2QC7 A;  3PR8 A;  1M2B A;  4MH3 A;  1JZR A;  5J9B A;  2YZH A;  1U87 A;  2EIQ A;  2HQT A;  5A5K A;  5E59 A;  4HQS A;  2V41 A;  4V1A p;  1YKA A;  5J40 A;  3KTB A;  3ISO A;  3DKS A;  4AKH A;  1QK8 A;  2VUP A;  1TOF A;  3CMI A;  4KAE A;  2NDO A;  1M99 A;  1Q4J A;  5J41 A;  4F9Z A;  4IQA A;  1PKW A;  3BJ5 A;  2AYT A;  4ACS A;  3GA4 A;  5DDL A;  3BCI A;  2EC4 A;  3VI7 A;  4LL4 B;  4DSS B;  2B1L A;  4AJ6 A;  4TR1 B;  4TR4 A;  4KSM A;  2V6O A;  2HLS A;  4BIK A;  3ZIV A;  1FG4 A;  1DE2 A;  1XG8 A;  1A0R P;  3EIN A;  2A4H A;  3WGD A;  2HSM A;  5A1N A;  4V2N A;  1X9M B;  2I3Y A;  1M3I A;  3FKF A;  5IO2 A;  4L0W A;  5A5H B;  3ERF A;  4HEA 2;  1GUM A;  4MPF A;  3PIN A;  2IMI A;  2V32 A;  2YJH A;  2YOI A;  17GS A;  5ECI B;  1T3B A;  4Q5N A;  1UN2 A;  1B4P A;  1F3A A;  5KN0 A;  5ELG A;  4F0C A;  2P0G A;  3RDW A;  1EWX A;  2VAF A; 
#chains in the Genus database with same CATH homology
 1ERV A;  3TJB A;  2V6K A;  5DVB A;  3ZVJ A;  3KMO A;  2CA8 A;  4NV2 A;  5HR1 A;  3R2Q A;  2G2Q A;  1MD3 A;  4AKG A;  2PU9 C;  3BBY A;  2F8A A;  2OE0 A;  4ECJ A;  3JCM L;  2B5Y A;  3I43 A;  5ENU A;  3I9V 2;  3FZ5 A;  3TKR A;  2FNO A;  4Q5F A;  2OAC A;  2CVK A;  3UMA A;  4Z2T A;  2H73 A;  3ZL5 A;  3IK9 A;  2HSH A;  6GSY A;  2B1K A;  4HJM A;  1FB6 A;  1YEP A;  3ZFL A;  3C8E A;  4AJ8 A;  3Q19 A;  2KP2 A;  2HT9 A;  3C1S A;  3NIV A;  3K8N A;  1SJI A;  5E4W A;  4KA0 A;  4XHM A;  4MAB A;  1GUL A;  2ON7 A;  2XBI A;  4G9H A;  4GLT A;  1T1V A;  4OFT A;  1NSW A;  3UVT A;  2HXK A;  2REM A;  2VL9 A;  1K0D A;  2HSN A;  2I81 A;  4KCA A;  2QGV A;  2R0C A;  5EY6 A;  1FB0 A;  2GLR A;  2MMO A;  2H74 A;  1Z9H A;  4Q5Q A;  5KOX A;  1HD2 A;  4IP1 A;  2LQQ A;  4MJA A;  2A4V A;  5J9C A;  3HJO A;  4V2L A;  4X1U A;  5G31 A;  4IKH A;  4ZL7 A;  5B7C A;  4F03 A;  5IOX A;  2L4Q A;  4O5R A;  4MK3 A;  2WFC A;  2XHF A;  1DBY A;  1XBS A;  1EP7 A;  4ICY A;  1ML6 A;  1OC9 A;  1OYJ A;  3CBU A;  1MEK A;  2DJ3 A;  3FR6 A;  2NBS A;  4EC0 A;  3BOA A;  5F8B A;  3F3R A;  2C80 A;  4YH2 A;  1G6Y A;  4EVM A;  3KZQ A;  1SJZ A;  1SKS B;  3QD9 A;  3WGE A;  4Z2R A;  4G0K A;  1ILO A;  1WMJ A;  1J9B A;  2RUE A;  3TKP A;  2WS2 A;  3M0F A;  2O5V A;  1BG1 A;  3I69 A;  1ON4 A;  5H5S A;  3Q18 A;  3F6D A;  1ZYE A;  4J56 E;  5G1L A;  2WUL A;  1AW9 A;  3P90 A;  4IGJ A;  3UVH A;  3CRU A;  3QFA C;  2GSS A;  1ABA A;  2YV7 A;  6GSW A;  3HD5 A;  2HRF A;  4QL7 A;  2DML A;  1NHY A;  3G9B A;  1C72 A;  4HDE A;  3LXZ A;  2D2Z A;  3LYP A;  3MDK A;  2E7P A;  2QKE A;  1GSE A;  3VWU A;  2CZ2 A;  4FIW A;  1SYR A;  5G30 A;  1Z5Y E;  1GSS A;  2OE3 A;  2LNT A;  6GSV A;  1QMV A;  4BVX A;  4KH7 A;  2GZP A;  4KND A;  4X0X A;  2PWJ A;  4WXT A;  2AV4 A;  1YY7 A;  4BWQ A;  1R4W A;  2OKA A;  2H6X A;  2YJ7 A;  1OC8 A;  2FWF A;  3HVX A;  3DWV A;  5J3R A;  4G10 A;  1XWB A;  3A5I A;  3N9J A;  1TRS A;  2JU5 A;  3US3 A;  3GL3 A;  2C3T A;  3D5J A;  4EO3 A;  3ME7 A;  1BYE A;  3KD0 A;  1V9W A;  1JLW A;  4KDY A;  5DQY A;  4AGS A;  5DJM A;  2H6Y A;  4DSS A;  4TR1 A;  2LV3 A;  3TRQ A;  3RHC A;  4HQZ A;  2DJJ A;  4K1F A;  4ZL8 A;  1SK0 A;  3D0Z A;  4EIQ A;  2GSQ A;  1TKD B;  5C04 A;  1GRX A;  2MBS A;  1VGL A;  4MLY A;  2C3Q A;  4AKX B;  3ZIJ A;  1TU7 A;  4E8H A;  3GN3 A;  2X8C A;  3GFK A;  1Y25 A;  1WRY A;  4RUV A;  3L78 A;  3I6A A;  1OKT A;  5CNW A;  5DJL A;  3TJG A;  1PX7 A;  4HOJ A;  1OVN A;  2H30 A;  1S3D A;  4POB A;  1FOH A;  4GST A;  2X8G A;  1PMT A;  2XBQ A;  3TB2 A;  1THX A;  2HYX A;  4OD7 A;  1MTC A;  2AUV A;  5L71 A;  4O7H A;  1T7P B;  4IW9 A;  5IPH A;  3HDC A;  2DJ2 A;  1A24 A;  1EGR A;  2YCD A;  1H75 A;  5J4U A;  2VCQ A;  3GKM A;  1SL2 B;  2N5F A;  2AAW A;  3KM6 A;  3ZRE A;  4XS6 A;  1AQV A;  2KUC A;  1KNG A;  3KEB A;  2X49 A;  4MMM A;  4PTS A;  3QMX A;  4RQX A;  3IAS 2;  4PQI A;  3PPU A;  1WPI A;  4JE1 A;  4GQC A;  1GSU A;  3FZA A;  1GLQ A;  1J0F A;  2IMK A;  4XRD A;  3HA9 A;  3LJR A;  5AGY A;  2I4A A;  6GSX A;  2B7K A;  2VL2 A;  1U88 A;  2VCX A;  1ZGN A;  3GST A;  2C0E A;  3IBH A;  1E6B A;  1SL1 B;  1DUG A;  4K7O A;  1XW5 A;  1XWC A;  2B5E A;  1JHB A;  10GS A;  1VF4 A;  2O89 A;  1TI3 A;  4WF5 A;  2HRN A;  2H19 A;  4GF0 A;  2C4J A;  1YF1 A;  4XIH A;  1PQN A;  1B9Y C;  5J4Y A;  3EU3 A;  1XWA A;  3WT2 A;  4AJ7 A;  2HZF A;  2BTO T;  4AI6 A;  3IHG A;  1K3Y A;  4L5L A;  2RLI A;  5CYY A;  1Z7P A;  1XXU A;  3DGQ A;  4AF2 A;  1WWJ A;  3EMX A;  2MZC A;  1MDK A;  3LQ7 A;  2FWG A;  5KN1 A;  1G7E A;  1AQX A;  1X5D A;  4IEL A;  1R5A A;  5IOW A;  3DEX A;  4L5O A;  4E68 A;  2LJK A;  3IAM 2;  5IMV A;  1BG5 A;  4FO5 A;  4I8B A;  4G0I A;  5GST A;  4GXZ A;  4Z7X A;  4IP6 A;  4J2F A;  5IPG A;  1PN9 A;  2R6K A;  5A4W A;  3W6G A;  1UVZ A;  3EPT A;  3TRP A;  3EE2 A;  4BPY A;  2O8V B;  13GS A;  5AN1 A;  3FK8 A;  3HJP A;  5FWG A;  4YQV A;  1WOU A;  5BRT A;  4N3Z A;  2AJQ B;  1SK2 A;  4HZ4 A;  2HE3 A;  3ZIT A;  2H1D A;  3E0U A;  4N0V A;  2MYG A;  5D8I A;  5EL8 A;  2LRT A;  4ZB9 A;  1GUK A;  1WJK A;  2QSI A;  3A5W A;  4TXO B;  1I5G A;  2YV9 A;  3ZMK A;  2OBI A;  3F4R A;  1ZYN A;  3HZ8 A;  3ZML A;  4FYC A;  3V1W A;  4Q5R A;  7GSS A;  4PXO A;  1ZYP A;  2JZR A;  1B8X A;  2WB9 A;  1W89 A;  1AC1 A;  3D21 A;  3EVI A;  3SBC A;  4GQF A;  3LW9 A;  3LGC A;  1GTI A;  1PX6 A;  5ECL B;  4MA9 A;  2MMN A;  1HNB A;  2DLX A;  1F9M A;  4N11 A;  2V2G A;  4N0Z A;  5HFI A;  1ERU A;  3VPQ A;  2FWE A;  2B5X A;  5G5F A;  1CQG A;  1XVQ A;  4RI6 A;  2FA8 A;  5LD0 A;  2TRX A;  4TR0 A;  2UV8 G;  3L4N A;  4HI7 A;  5HR3 A;  3NOF A;  1O85 A;  4QL9 A;  2PBJ A;  3GX0 A;  5BMU B;  1J08 A;  4YKG A;  2JAD A;  1TW9 A;  3GL5 A;  1ZOF A;  4LA1 A;  1KEB A;  4ZXG A;  2CVB A;  1SKW B;  1XWG A;  3P8W A;  2GTU A;  2JSZ A;  4GTU A;  1EGO A;  1QFN A;  3Q6O A;  2R0P A;  1DE1 A;  4MJC A;  3HJM A;  1WIK A;  3CSI A;  3M3M A;  4RQR A;  2DJK A;  1BF5 A;  1K3O A;  1XZO A;  3A3T A;  3HXS A;  4K0G A;  2LJA A;  2A2S A;  3J7Y k;  3IXR A;  3W8J A;  3DVX A;  3APO A;  4PUR A;  5A4U A;  1AAZ A;  1VF1 A;  1Z7R A;  2GQK A;  3EUR A;  4OO4 A;  3TRX A;  1XPV A;  2X99 A;  3D4M A;  2HZE B;  5AIX A;  2H1G A;  3KP9 A;  4W66 A;  1QGV A;  12GS A;  2H71 A;  1X9W B;  3A2W A;  1GSQ A;  1V40 A;  2J23 A;  2DMM A;  3KXO A;  4I6X A;  4JRR A;  4LL1 B;  2LST A;  2VCZ A;  4KCE A;  2IME A;  3TOU A;  3EU4 A;  5KEJ A;  4WF4 A;  1K0B A;  1F37 A;  8GSS A;  4OMV A;  4IBP A;  1OE7 A;  3ME8 A;  4G19 A;  4FYU A;  1VF3 A;  3F0I A;  3UBL A;  2LRN A;  5ECO B;  4KUN A;  2O7K A;  2EFH A;  5FHI A;  2CVD A;  3WD6 A;  1SD9 A;  3VWW A;  3E9J B;  3Q74 A;  2LJR A;  1YVL A;  2H1B A;  2F51 A;  4JU5 A;  2HRK A;  4HUA A;  3KH9 A;  3MIX A;  1W4V A;  2H6Z A;  5CP1 A;  1O8X A;  4NWY A;  3F4S A;  2DBC A;  4K5S A;  4D73 B;  3P7X A;  4MJE A;  2PMT A;  1DSB A;  1SVM A;  5IMA A;  2DC5 A;  2VO4 A;  4KF9 A;  4NHW A;  3EC3 A;  2CT6 A;  3L0H A;  4FH8 A;  2M80 A;  5IMD A;  3IR4 A;  4H86 A;  4MH2 A;  2NTO A;  5ECM B;  2GVP A;  2LEG A;  2HNL A;  2DKH A;  3TDG A;  3DD3 A;  2M46 A;  4ML6 A;  2J9H A;  4POM A;  1TP9 A;  2CAI A;  3GUS A;  2RM5 A;  1Q98 A;  5G1K A;  4EXJ A;  1O73 A;  5INY A;  4YKF A;  1OAZ A;  3R3E A;  4BWS A;  3HZ4 A;  4DVC A;  4WR5 A;  1B9X C;  2GQM A;  1XW6 A;  2H0G A;  2R5G A;  1GSF A;  3GKN A;  1GNE A;  1LJR A;  3FR3 A;  1K0N A;  1EOH A;  4ZB8 A;  5H5Q A;  3MYD A;  4KX4 A;  3GV1 A;  5KOW A;  1WP0 A;  2B3S A;  4CY6 A;  1EV9 A;  4LLR A;  2OE1 A;  2R4V A;  4G0L A;  1ZYQ B;  5D73 A;  2WGR A;  4TXO A;  1K0C A;  5KN3 A;  3C1R A;  4ML1 A;  4MJB A;  1XOB A;  1FVJ A;  1LBK A;  3H93 A;  2JL4 A;  4TN8 A;  2C3N A;  3VK9 A;  3TUE A;  5D9X A;  4ECC A;  2FCH A;  1BED A;  1KTE A;  2FHE A;  3RHB A;  2L5L A;  2OAD A;  3GKX A;  2VOC A;  3G7Y A;  4L0U A;  3O76 A;  1ACV A;  5CRE A;  2P31 A;  2H72 A;  2G0F A;  2H0H A;  1RK4 A;  4LMV A;  1URM A;  3G7J A;  5ID2 B;  2GDR A;  1R7H A;  1V57 A;  2TIR A;  2C0F A;  4PQH A;  2H76 A;  3GH6 A;  3UAR A;  3LWA A;  2MBT A;  4XS1 A;  4EE0 A;  5BMU A;  3FRC A;  3EYT A;  3GTU B;  4ZIL A;  3IRA A;  3L9S A;  4F2I A;  2VLU A;  3EMP A;  4GSS A;  3VI5 A;  4DSR A;  4IJI A;  1XIY A;  3ERG A;  3DRN A;  3LXT A;  4WBJ A;  1O6J A;  2C1Y A;  1BX9 A;  1TU8 A;  4I5Q A;  2IFQ B;  4RI7 A;  1PL2 A;  2YWO A;  5DAL B;  2VL2 C;  2N5B A;  3FZ4 A;  1YF0 A;  2GT6 A;  5ECP B;  1GH2 A;  3H8Q A;  2VD1 A;  1N2A A;  4TXV A;  2ON5 A;  2CV4 A;  3HCZ A;  2DIZ A;  1OE8 A;  1BAY A;  5JWO B;  1YJ6 A;  3QCP A;  4X4J A;  2R0G A;  5A5H A;  4XS4 B;  1ERW A;  5J5N A;  2HZE A;  2YN1 A;  2IWT A;  2ES7 A;  1AQW A;  1F3B A;  3U6V A;  5IMZ A;  4ZBB A;  3GX8 A;  1GTA A;  4CHS A;  2PVQ A;  3VLN A;  4QQ7 A;  4PGT A;  5HFG A;  3QPM A;  3DYR A;  3VFI A;  3LG6 A;  5IQY A;  3O6T A;  3FYG A;  1NM3 A;  2HFD A;  1FVK A;  4MZC A;  3CTF A;  1GSY A;  1T00 A;  3VWV A;  4HS1 A;  2GT5 A;  4PUF C;  2H0I A;  2PPT A;  4E8E A;  1TK8 B;  1R26 A;  3MNG A;  1SK1 A;  3AY8 A;  1AIU A;  1PGT A;  1FW1 A;  2DIY A;  6GST A;  3MAK A;  2RUF A;  3CSH A;  2YWI A;  5IM9 A;  4JED A;  5CO3 A;  1VRS D;  1JZO A;  4GRF A;  2H1A A;  3H79 A;  4TVE A;  1EZK A;  5ECH B;  3F63 A;  1N8J A;  4IJ3 A;  1PSQ A;  1RQM A;  1MDI A;  5A34 B;  4IHU A;  2WDU A;  2M72 A;  2VLT A;  1SVL A;  4N10 A;  5LCZ A;  3QAV A;  1B48 A;  4TW5 A;  3VWX A;  3GRX A;  1XWK A;  4ID0 A;  3M8N A;  3IPZ A;  2RII A;  4D73 A;  4YQU A;  3ZFB A;  3QAG A;  2O85 A;  1JLV A;  4QMK A;  3ZZX A;  1A2J A;  2EFC A;  2P5R A;  4YAP A;  3QR6 A;  2QA1 A;  2L5O A;  2YAN A;  4A5P A;  2UZ8 A;  5HFK A;  1YEX A;  5COH A;  5B8A A;  4MZW A;  4K8M A;  3CXG A;  5CRW A;  5D96 A;  1YDK A;  1FOV A;  5ECN B;  4OO5 A;  3FR9 A;  4ZIJ A;  1U6T A;  3FEU A;  3IV4 A;  1LU4 A;  4CDO A;  4IQ1 A;  1EP8 A;  1UC7 A;  3DIE A;  3N5O A;  2E2M A;  4F0B A;  2AHE A;  2EIO A;  1BQ7 A;  3QAW A;  5ABR A;  3J7Y b;  3GIX A;  2CX3 A;  1JZD A;  1PRX A;  3M9K A;  2R3X A;  3TKS A;  3UL3 A;  3WGX A;  3G7I A;  4MF7 A;  1SYX A;  2DKI A;  2IL3 A;  1HYU A;  2YNX A;  4TR3 A;  5CRH A;  4P3Y B;  5CAX A;  4O92 A;  1WE0 A;  1XVW A;  5GSS A;  3GH9 A;  2PUK C;  2VLV A;  1FO5 A;  1A8L A;  2KOK A;  4EIP A;  4X43 A;  2YP6 A;  3KJY A;  3DML A;  5GAP D;  4YAV A;  4BVY B;  2H8L A;  4ECB A;  1EOG A;  3H4K A;  2I9H A;  5IMC A;  2N5A A;  3UOM A;  2WCI A;  4MDC A;  4I2U A;  3IDV A;  1G0T A;  5IMF A;  3QFB C;  4BVX B;  2VM2 A;  5ID2 A;  3UIW A;  4Z2U A;  2C8U A;  1AUC A;  4ZBA A;  1OC3 A;  2KHP A;  4JR4 A;  5C00 A;  1TRU A;  4KE3 A;  4TRX A;  2L4C A;  5A4V A;  1T8E B;  3D6I A;  3GTU A;  2K6V A;  4PX1 A;  2C0D A;  1Z3E A;  2H66 A;  2C0G A;  6GSS A;  1ZCP A;  4O5Q A;  1TI1 A;  4MP4 A;  3ERW A;  3KIJ A;  2VCT A;  5F0G A;  4KSO A;  5D93 A;  3H1N A;  5F07 A;  2IFQ A;  3U5R E;  2JSY A;  5DAL A;  4MNN A;  2H75 A;  3E3E A;  3TJJ A;  5J47 A;  18GS A;  2H70 A;  1G7O A;  4EUY A;  4IN0 A;  1EV4 A;  2LUS A;  4AKI A;  3WYW A;  1SU9 A;  2LKU A;  2XPE A;  14GS A;  2MMZ A;  3F9U A;  3FY7 A;  2B6M A;  4XS4 A;  3PGT A;  1SD8 A;  2ZNM A;  4JR6 A;  1ZMA A;  4ZB6 A;  4XRA A;  3KCM A;  1OKD A;  2HSY A;  4KW6 A;  2QA2 A;  2K8V A;  3LFL A;  4G01 A;  4NV5 A;  1AXD A;  4KDX A;  5DAK B;  3GKK A;  3KTL A;  4G2E A;  3APS A;  1SJ6 A;  3UEM A;  5FT3 A;  4EF0 A;  1EEJ A;  3D22 A;  5JWQ B;  3M1G A;  2LQO A;  4ECI A;  3BD2 A;  2R37 A;  1IYI A;  4ISD A;  2L57 A;  3SWL A;  1SEN A;  4NXI A;  2B7J A;  2K18 A;  1NW2 A;  4N30 A;  4J57 E;  4DEJ A;  2H1L A;  1TK0 B;  3VPT A;  4JZQ A;  1TTZ A;  3HHV A;  4TKY A;  2AB6 A;  2Z9S A;  2RM6 A;  2PER A;  3ZTL A;  3GHA A;  3HVV A;  2WZ9 A;  5IO0 A;  3GUR A;  2P5Q A;  4BA7 A;  5A34 A;  5F05 A;  5CRG A;  2VL3 A;  2GSR A;  2EFE A;  1M0U A;  2CAQ A;  1F2E A;  1K0A A;  4YQM A;  1ZZY A;  1A23 A;  3DVW A;  3IC4 A;  2KLX A;  3MWH A;  2L59 A;  1GSD A;  1YKC A;  1X5C A;  1TK5 B;  3KGK A;  4EDZ A;  2VIM A;  1F6M C;  1O81 A;  1XW9 A;  3APQ A;  1HQO A;  5DBQ A;  2DJ1 A;  4I2T A;  2O87 A;  1VF2 A;  1B4Q A;  3UAP A;  2LTK A;  1GTB A;  1EEM A;  2CZ3 A;  1U3A A;  5HR0 A;  1SVO A;  3TU3 B;  3C71 A;  3QOU A;  4HJ2 A;  4XTS A;  4OFM A;  1E2Y A;  4POL A;  5D9W A;  5DCH A;  3CWG A;  2HI7 A;  1T4Y A;  5CRD A;  5G2Z A;  2R2J A;  4GCI A;  1M7T A;  3F8U A;  2DJ0 A;  3HKR A;  5HR2 A;  1NHO A;  3TKS E;  1GNW A;  5DQS A;  2WRT A;  2EIR A;  2K9F A;  5GZZ B;  3IOS A;  3TGZ A;  2OJL A;  3HVS A;  4OCF A;  1A2L A;  19GS A;  1H4O A;  1G6W A;  4K2D A;  1FHE A;  5B8B A;  1PA3 A;  3HY2 A;  1XCC A;  4PNF A;  4K2X A;  4OWY A;  1SKR B;  5JWR B;  2IIY A;  4WEY A;  1Z6M A;  3RAZ A;  2FGX A;  1V98 A;  2A2P A;  4NAX A;  4K9Z A;  3KMN A;  3CTG A;  3ZLP A;  2PN8 A;  1TJD A;  3A2V A;  1HNC A;  9GSS A;  3LEF A;  3P2A A;  5F06 A;  4MF6 A;  4NPB A;  2FA4 A;  5J4V A;  4BL7 B;  2ALB A;  5ELA A;  3IHQ A;  4LMW A;  2LS5 A;  2IMD A;  1M2A A;  2NPB A;  4BVY A;  3CRT A;  2FD3 A;  1GP1 A;  2GST A;  3PH9 A;  1O8W A;  1BJX A;  2X64 A;  1X9S B;  1USB A;  3ED3 A;  5H5R A;  3KH7 A;  5JCW A;  1XOA A;  3IC8 A;  1S3C A;  2K8S A;  3ZYW A;  2GZY A;  4EDY A;  3RBT A;  1I9D A;  2I1U A;  3F6F A;  1GTU A;  4WKW A;  3ZRD A;  1R5P A;  4F82 A;  4HU7 A;  1A8Y A;  2NVL A;  1QUW A;  5DCG A;  4WET A;  3IA1 A;  3HMJ G;  5JCU A;  3FHK A;  3L9V A;  1XFL A;  5B6M A;  1YZX A;  2IJY A;  5EPF A;  5D9T A;  3DXB A;  3RPN A;  4POK A;  3TJF A;  2F3M A;  2IN3 A;  4L8E A;  1ST9 A;  1A2M A;  5ECS A;  2BMX A;  3C73 A;  4OFN A;  2HSM B;  5LNK e;  1IYH A;  1KBN A;  5A1N B;  2KP1 A;  4JBB A;  20GS A;  22GS A;  3EWL A;  1M2D A;  1Z6N A;  2V1M A;  4GSN A;  2MMA A;  4K7I A;  2H01 A;  2YWM A;  3FZ9 A;  2XPD A;  2OBK A;  4FYB A;  4XCS A;  3ZVJ D;  4CW9 A;  3F4T A;  4KGI A;  1MDJ A;  5DAK A;  4KB3 A;  1FAA A;  4MCU A;  4TOP A;  4O32 A;  2ZCT A;  4CY8 A;  2GQL A;  3TJK A;  1K0M A;  3IK7 A;  1V2A A;  2LRC A;  4MZB A;  4K7N A;  2VKZ G;  2PGT A;  4PUA A;  2OA7 A;  2FLS A;  1JZW A;  5ECK B;  4K6X A;  4HZ2 A;  5ECQ B;  4K5R A;  3LYK A;  1SL0 B;  2X4A A;  1Y6E A;  2L6C A;  3TCO A;  3KP8 A;  3CSJ A;  3TKQ A;  4ZB7 A;  2F9S A;  1Y1U A;  1S3A A;  3MSZ A;  3UJ1 A;  5G5E A;  2IPA A;  2A2R A;  4ULX A;  2FWH A;  1GUH A;  2BJX A;  4ILF A;  3TKS C;  4O5U A;  1K0O A;  3W8S A;  2JZT A;  1ERT A;  5GAN D;  2HRK B;  5B6N A;  2GGT A;  4GDF A;  1A0F A;  2LNS A;  3LOR A;  2EFD A;  3A2X A;  3GYK A;  1THO A;  4DSQ A;  1TDI A;  4ZBD A;  1CQH A;  2GZZ A;  3OR5 A;  2PVO C;  1V58 A;  4PQ1 A;  2YPM A;  2VCW A;  1X0R A;  2HSN B;  2JAC A;  4IVF A;  5JCG A;  3HYP A;  2YWN A;  3O3T A;  2XC2 A;  3IE3 A;  2JZS A;  1QQ2 A;  2WJU A;  4IS0 A;  2YZU A;  3VUR A;  3GNJ A;  1PKZ A;  1X5E A;  1ZL9 A;  5ECR B;  1TXU A;  1M9B A;  2ZUP A;  4K0N A;  5EVO A;  2X8H A;  2L6D A;  1UA5 A;  11GS A;  1M9A A;  3GMF A;  4I97 A;  2OT3 A;  3S9F A;  3NZN A;  1K3L A;  4V1A g;  2E2G A;  3F3Q A;  4USS A;  1PD2 1;  1QXH A;  2CQ9 A;  1OC9 B;  4HU9 A;  4MF5 A;  3C7M A;  2HRA A;  3BCK A;  3TOT A;  1TRV A;  3WT1 A;  3UBK A;  1JFU A;  4V2M A;  1YQ1 A;  1MD4 A;  2DSA A;  1N25 A;  4EL1 A;  4NHZ A;  1T4Z A;  3RPP A;  1GLP A;  2TRC P;  4WBR D;  3D4T A;  4KDU A;  2FY6 A;  2FUG 2;  2VD0 A;  2VCV A;  4EKZ A;  2E0Q A;  4GWR A;  4OCE A;  4MPG A;  4PNG A;  4FQU A;  3QDN A;  2IMF A;  4ZL9 A;  1RW1 A;  2VM1 A;  1GL8 A;  3L9U A;  5AIS A;  4BL7 A;  1PN0 A;  3M9J A;  1HNA A;  3FW2 A;  1U3I A;  1GWC A;  4NMU A;  5KN2 A;  3FMW A;  3CYN A;  1O7U A;  6GSU A;  5D9V A;  3LSZ A;  2CX4 A;  16GS A;  5AIV A;  5HQP A;  2GS3 A;  3GSS A;  5IIZ A;  1PL1 A;  4WR4 A;  1TRW A;  1TXX A;  2F8F A;  2QC7 A;  3PR8 A;  1M2B A;  4MH3 A;  1JZR A;  5J9B A;  2YZH A;  1U87 A;  2EIQ A;  2HQT A;  5A5K A;  5E59 A;  4HQS A;  2V41 A;  4V1A p;  1YKA A;  5J40 A;  3KTB A;  3ISO A;  3DKS A;  4AKH A;  1QK8 A;  2VUP A;  1TOF A;  3CMI A;  4KAE A;  2NDO A;  1M99 A;  1Q4J A;  5J41 A;  4F9Z A;  4IQA A;  1PKW A;  3BJ5 A;  2AYT A;  4ACS A;  3GA4 A;  5DDL A;  3BCI A;  2EC4 A;  3VI7 A;  4LL4 B;  4DSS B;  2B1L A;  4AJ6 A;  4TR1 B;  4TR4 A;  4KSM A;  2V6O A;  2HLS A;  3ZIV A;  1FG4 A;  1DE2 A;  1A0R P;  3EIN A;  2A4H A;  3WGD A;  2HSM A;  5A1N A;  4V2N A;  1X9M B;  2I3Y A;  3FKF A;  5IO2 A;  4L0W A;  5A5H B;  3ERF A;  4HEA 2;  1GUM A;  4MPF A;  3PIN A;  2IMI A;  2V32 A;  2YJH A;  2YOI A;  17GS A;  5ECI B;  1T3B A;  4Q5N A;  1UN2 A;  1B4P A;  1F3A A;  5KN0 A;  5ELG A;  4F0C A;  2P0G A;  3RDW A;  1EWX A;  2VAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...