3NIVA

The crystal structure of glutathione s-transferase from legionella pneumophila
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
191
Chain Sequence
ILYDYFRSTACYRVRIALNLKKIAYEKIEVHLLVPSLDINGQILSQSMAIIDYLEEIHPEMPLLPKDPFMKATLKSMALIVACDMHPLNNLRVLNRLKEQFNANEEQVLEWYHHWLKTGFDAFEEKLGALERDKPVCFGSEVGLADVCLIPQVYNAHRFHFDMASYPIINEINEYCLTLPAFHDAAPEAIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title The crystal structure of Glutathione S-transferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Isomerase
total genus 59
structure length 191
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.2: Maleylacetoacetate isomerase.
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3nivA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3nivA01
2WZ9A 3QAVA 3A5WA 3UJ1A 2GZZA 4CW9A 4Q5NA 3HA9A 1T4ZA 3LXZA 3PR8A 3ZIJA 5HR2A 2YZHA 3GYKA 5B8AA 3EINA 2MZCA 3WGDA 2HT9A 1U6TA 3IK7A 3D4TA 4X0XA 2VCXA 3FY7A 4EF0A 3F4TA 2I81A 1X9WB 1O6JA 3W6GA 2IIYA 4KDXA 2VM2A 2AV4A 4I2UA 2GZPA 3IE3A 5HFKA 1GSDA 2DIYA 3DVWA 3UEMA 4N11A 4FH8A 1PL2A 2P0GA 4IGJA 5AGYA 4DSSB 4AJ8A 4XIHA 3MNGA 1XOBA 2LV3A 2HRKA 1GL8A 5ECIB 3RPNA 3VWVA 3IAM2 2C0FA 4ML1A 6GSVA 2PWJA 4ZL8A 3F3RA 1TU8A 2Z9SA 4V1Ag 1EGRA 2DMLA 3H1NA 5IM9A 1ZOFA 3ME7A 1A2LA 1K0NA 1DSBA 4WR5A 2O8VB 2VIMA 1ACVA 1F2EA 3WT2A 4NV5A 14GSA 4L0UA 2IN3A 3TCOA 4KE3A 3A2VA 5D93A 3H8QA 5CRGA 1AQXA 1SD9A 1TRSA 3TKSC 2JL4A 2IMDA 1BEDA 4HJ2A 4BVXB 5B6MA 2X8HA 3LYPA 1BX9A 1EP8A 1RK4A 1A8LA 3FHKA 3NOFA 1YKCA 12GSA 4MJBA 3P8WA 3IK9A 3W8JA 5H5RA 1XVWA 4J2FA 1GULA 3UAPA 1WJKA 3ZLPA 3HJMA 4MJAA 10GSA 2FLSA 2OBIA 4KH7A 4Z7XA 11GSA 2PVOC 5IMVA 1GP1A 3O3TA 4MPFA 3GURA 2H75A 4KNDA 1S3DA 4EXJA 3KEBA 3RPPA 5JCUA 3J7Yb 3AY8A 1O8WA 1M2AA 1TK8B 2MBSA 1B9XC 3ERFA 2F3MA 2QGVA 4YAPA 4J57E 5HQPA 6GSXA 1TRVA 3DWVA 1I5GA 1AUCA 3TB2A 3L4NA 4G0LA 1M99A 4ZXGA 4K7OA 4POBA 3VK9A 1YZXA 4BVYB 1EOHA 1BYEA 3CSJA 4LL1B 4YQUA 2RM6A 1HYUA 2C1YA 1E6BA 3FZAA 2CT6A 5AIXA 1WPIA 4FYCA 3DYRA 3TRQA 3Q19A 2L59A 3WYWA 2HZEA 2DJKA 5DALA 2VL9A 4TXOA 3M3MA 1T00A 3D0ZA 5F05A 2MMAA 3RHBA 2GSRA 4WR4A 4P3YB 5CRWA 1FOVA 3TOTA 2F8FA 2MYGA 4YQVA 2GTUA 4PX1A 4K1FA 2NVLA 1I9DA 4I8BA 4IBPA 4G19A 4YAVA 1NHYA 3ZVJD 1Y6EA 2DJJA 2WULA 1FVJA 3LWAA 3IOSA 3HCZA 1TK0B 5CAXA 1K0AA 1QFNA 4XS6A 3HZ8A 3CRTA 1H75A 3LFLA 4L5LA 5JCGA 2IFQA 4LA1A 2QSIA 4KGIA 1B48A 3L0HA 1GUMA 2CZ2A 4JU5A 1GNWA 5G30A 3D6IA 2GGTA 2WFCA 2OE1A 5D73A 4FO5A 4OWYA 3ZFLA 1WMJA 1T7PB 4TVEA 2O89A 5IMDA 2HRKB 2FA4A 3BOAA 1PKWA 4TR4A 2PN8A 1U88A 2B3SA 1KBNA 3I69A 1EZKA 3DKSA 2MMNA 5J9CA 3C7MA 5LCZA 4F0CA 1U87A 4NMUA 4NWYA 4PUAA 3RAZA 2A2RA 2PU9C 2H6YA 4GCIA 3IPZA 1X5DA 5A5KA 4L5OA 1KTEA 4HEA2 3IR4A 4IHUA 4K2DA 1SJIA 5ELAA 1O85A 1N2AA 4KX4A 4KSMA 2PERA 4ZIJA 1XPVA 4GSSA 2B1KA 5CRHA 3D22A 4NV2A 4JEDA 1DUGA 1O8XA 3ZZXA 3GA4A 3MAKA 2LJKA 1ERWA 3HJPA 2FCHA 3GKKA 4GQFA 1XVQA 4ZB8A 1J9BA 3WT1A 1K0BA 3QMXA 2PMTA 2C8UA 3FZ4A 4ID0A 1QK8A 2GS3A 2HI7A 3LGCA 2K6VA 2V1MA 2L5LA 2F8AA 1MEKA 3IAS2 17GSA 4MMMA 2MMOA 2X99A 4O32A 4NHWA 4MJEA 1T1VA 5KN1A 4IVFA 3TDGA 4O7HA 4F2IA 3ZIVA 3TKSE 3E0UA 3GL3A 1X5CA 2LSTA 4NPBA 5CRDA 3ME8A 1MDIA 3FW2A 4AF2A 3ED3A 4XS1A 2OA7A 5KN0A 2H1AA 4LL4B 4WF5A 1XWAA 4TR3A 18GSA 2GDRA 1R7HA 4X43A 2GSSA 16GSA 4MP4A 5IMAA 3EU3A 2BMXA 4K7NA 5G31A 2WJUA 5DCGA 1BQ7A 2K8SA 2L6CA 3HD5A 2X64A 3LJRA 2H0IA 2YWOA 4HJMA 1T3BA 3I43A 4HZ2A 2HZEB 3SWLA 1E2YA 1GTUA 1PGTA 1TOFA 1OKTA 2CAIA 5CYYA 5KEJA 4DSRA 3TRXA 4ISDA 3KH7A 1SJ6A 1VF3A 4LMVA 4GRFA 4POLA 3TKSA 2AB6A 4NHZA 5E4WA 2DLXA 2YPMA 1TI3A 2FWGA 1FO5A 3DD3A 4EDYA 1V9WA 2I3YA 1OKDA 4Q5QA 5AISA 5CREA 4KDYA 2CX3A 4WBJA 3O76A 3UARA 6GSUA 4GF0A 3KJYA 1SL0B 1N8JA 1IYIA 4KA0A 4TN8A 3KMNA 2IFQB 2XC2A 2J9HA 1M2BA 3APOA 1AXDA 3M9KA 2ES7A 2VOCA 4MZCA 5GAND 3M1GA 4JRRA 3J7Yk 5GZZB 1UVZA 1R4WA 2XPDA 3LQ7A 1SK2A 4MH2A 9GSSA 2V6OA 1USBA 1B8XA 3LYKA 1A8YA 4WF4A 3CSIA 4ECJA 3IA1A 2M72A 2JADA 2ZUPA 1CQGA 2H76A 3QCPA 4MJCA 3E9JB 6GSYA 4G0IA 1B4PA 3P7XA 2YANA 1NSWA 4EDZA 2N5BA 1KEBA 1GSFA 1YY7A 1EOGA 3F8UA 1JZRA 3VURA 3HVSA 2UZ8A 3C8EA 2B5EA 2VO4A 1PD21 2OBKA 5EPFA 3OR5A 2H6XA 1FB0A 1A2MA 3G9BA 2CQ9A 4HOJA 3QD9A 3US3A 1LBKA 1XCCA 4AJ6A 1DE2A 4XTSA 4N10A 5JWOB 2JZTA 4ZB9A 2V6KA 4KDUA 3IHQA 1EV4A 2C3TA 1SU9A 2XBQA 4LMWA 5ECQB 3QAGA 2PPTA 1G7OA 3VPQA 5AN1A 5HFGA 1OE7A 1EP7A 3KIJA 4Q5FA 20GSA 1YQ1A 2B7JA 1ST9A 2LJAA 2IMIA 3GKMA 2NDOA 4YH2A 1K0CA 3IV4A 3L9SA 1K3LA 2OJLA 4IN0A 2K8VA 4IQAA 2LNSA 5JWQB 4OFNA 3R2QA 5CNWA 2JZSA 4ML6A 1GSYA 4F82A 3P90A 1ZYEA 3UVTA 2TIRA 5HR1A 3VI5A 5IOWA 2XPEA 1JZDA 5G1KA 1W89A 1ZYQB 3GN3A 1Z5YE 2GLRA 1XIYA 2HRAA 1ERTA 1V57A 5HR3A 5J3RA 2LRTA 3ZTLA 1PX6A 2VLTA 3IDVA 3WD6A 2GZYA 3TJKA 1GTIA 2CZ3A 1YEXA 5DAKA 4XS4A 3GL5A 3TOUA 2L6DA 5J9BA 4ECIA 1VGLA 2F9SA 1K0OA 2FA8A 2H74A 1MTCA 3GX8A 2G2QA 5EY6A 2B5XA 2H70A 1J08A 2A4VA 2H1BA 2H8LA 5IMFA 4K9ZA 1CQHA 4PNFA 3VWUA 1VF4A 4G9HA 2WB9A 3PH9A 1WIKA 1JFUA 1SD8A 4FQUA 1ABAA 2MBTA 2N5AA 1SKSB 2I1UA 4PGTA 2AHEA 1TRWA 2EIQA 2VUPA 4ZBBA 2BJXA 4G2EA 2LQOA 5HR0A 3DEXA 2CVKA 1WRYA 4KW6A 5DQSA 1R5PA 1K3OA 3KM6A 4KCAA 1FG4A 2RM5A 4MPGA 1QXHA 1VRSD 4HZ4A 5DBQA 3RHCA 1WOUA 2LNTA 3TKRA 1C72A 4MF6A 2IPAA 2X8GA 4WEYA 1X9MB 2LRCA 4JE1A 3V1WA 3FEUA 4KUNA 4EC0A 1YF0A 2HLSA 3ZMKA 4MA9A 2OACA 1AQVA 4GSTA 5D9XA 1J0FA 5GSTA 7GSSA 3CSHA 3TKQA 1YJ6A 4EO3A 2VD1A 4IS0A 2DMMA 1OE8A 4HDEA 1OAZA 1AW9A 1LU4A 5DDLA 2L4QA 1OC9A 5G5EA 5D96A 3LXTA 4RI7A 2KOKA 3K8NA 3GH6A 3APQA 3C1SA 1M0UA 3QAWA 1NHOA 1GLPA 3UBLA 3HY2A 3WGEA 3CTGA 4PTSA 19GSA 2PUKC 1Q98A 2RUEA 4J56E 4TR1A 2JSZA 2R2JA 5H5SA 1ZZYA 2PVQA 1XWGA 3IC4A 3LG6A 4I5QA 3ZL5A 2HXKA 3A3TA 3PPUA 1M9BA 2H1GA 2P5RA 2LJRA 3F3QA 1JZOA 2HYXA 4GXZA 2CV4A 2M80A 1GRXA 4OO4A 3JCML 1U3IA 1G0TA 1S3AA 5ECPB 4KSOA 3ERWA 4GLTA 5D8IA 4GQCA 2GVPA 4E8EA 1Z7PA 1OYJA 2DJ2A 2I4AA 2YOIA 2YZUA 3HDCA 4WBRD 1PKZA 13GSA 5L71A 1YF1A 4WETA 2DSAA 2VL2C 1F3AA 1YKAA 1OVNA 4IELA 4KB3A 1NM3A 5BMUA 1ZMAA 3L9UA 2H73A 2RIIA 2WRTA 3F6DA 2VCTA 2V2GA 2WDUA 1TP9A 3FYGA 2FHEA 2FD3A 1QMVA 2FGXA 3EYTA 2GT6A 5DJMA 4ZL9A 4PUFC 2E2GA 4K0GA 3E3EA 4ECBA 1PQNA 5FT3A 3RDWA 3KP8A 1XW6A 3TJGA 1Q4JA 2LRNA 2YJHA 5E59A 3GV1A 4PURA 5DAKB 4XS4B 4N0VA 3R3EA 1UN2A 1TJDA 2LTKA 3DXBA 2IJYA 1GSQA 1TTZA 4USSA 1KNGA 3HZ4A 5G1LA 3O6TA 4E8HA 1V98A 2OKAA 4HU7A 2CAQA 1TDIA 3EURA 4MF7A 1RW1A 4O5RA 4BA7A 4MZBA 1HNCA 3W8SA 3DRNA 4FIWA 1SYXA 5FHIA 4TXVA 1TK5B 3SBCA 1QUWA 3G7YA 4RQXA 4OFMA 4GSNA 1TI1A 3EVIA 3C73A 4EE0A 2XHFA 5IPGA 2G0FA 3HHVA 4IJIA 2C3NA 4DSQA 2DC5A 5IMCA 3KGKA 1TW9A 4TKYA 4BPYA 3H4KA 2F51A 4O92A 1YDKA 2RLIA 4EVMA 3DMLA 1O73A 1XWCA 4TW5A 3GRXA 2KP1A 1JLWA 2ON5A 2OE3A 1G6YA 5FWGA 1HQOA 2IMKA 5ECKB 5GAPD 2C0GA 5DCHA 1K0DA 3CXGA 2V41A 4ZL7A 4MABA 1ML6A 3Q6OA 2FY6A 3M9JA 3IC8A 3ZYWA 4MK3A 2HSHA 1VF2A 1SYRA 3A2XA 2WS2A 3BBYA 1OC9B 3U5RE 1G6WA 4X1UA 5IMZA 3ERGA 3FR9A 5ECMB 1GSSA 2H0GA 1GTAA 1GLQA 4PXOA 4I6XA 3GUSA 1UC7A 4PQIA 3FZ9A 4OCEA 4HI7A 1GWCA 4TR0A 2HE3A 4TR1B 1GSEA 2GQMA 2VCWA 1SKWB 4RI6A 5A4VA 2FWHA 1XZOA 2TRCP 1GNEA 3GMFA 1F9MA 4YQMA 1X9SB 1WE0A 2IMFA 2HSYA 5F8BA 2D2ZA 3QR6A 2P31A 1GUHA 2N5FA 4ZBAA 2KP2A 2DJ1A 2WGRA 3VWWA 3I6AA 2H71A 2C80A 2E0QA 2YV9A 1PL1A 3N5OA 2B7KA 4IJ3A 1MD3A 4KF9A 2GQLA 3ZFBA 2CX4A 1A0FA 3EE2A 3F0IA 2KUCA 4TOPA 3DIEA 4AGSA 3MDKA 2C4JA 3VLNA 4HS1A 3TJFA 3UMAA 4ZB6A 4QL9A 2HFDA 1SK1A 3GTUA 1G7EA 1SJZA 1XWBA 1HNAA 1AC1A 4POKA 3GNJA 5ABRA 1K3YA 5COHA 3G7IA 2L5OA 3TRPA 3EU4A 3TJBA 1PSQA 2DJ3A 1ZL9A 4QQ7A 3HVXA 3ZRDA 3UBKA 4BL7A 1V2AA 5INYA 2VLUA 3D5JA 4XRAA 1ILOA 3CTFA 1GSUA 2QC7A 3GH9A 3EWLA 5LD0A 3FR3A 5B8BA 2RUFA 2CVDA 1QGVA 1XOAA 4K6XA 3FKFA 3EMXA 2B1LA 1TRUA 3KZQA 3CRUA 2AYTA 4IW9A 1SL1B 1PX7A 2XBIA 1WWJA 3FRCA 1URMA 1B4QA 5AIVA 5CO3A 1T8EB 2O87A 2O85A 3P2AA 1M7TA 4MF5A 2IL3A 4K7IA 3VFIA 4FYBA 4K0NA 4Q5RA 22GSA 5DQYA 1XXUA 3F6FA 5GSSA 3ZREA 4D73A 1Z6NA 5IOXA 1TKDB 3C71A 2GSTA 3F4SA 2R3XA 4L0WA 3F9UA 5IQYA 1LJRA 2JACA 2ALBA 2H66A 3KD0A 3VI7A 3WGXA 2VAFA 3BJ5A 2YWMA 1A23A 2HRFA 4MZWA 3I9V2 1WP0A 1H4OA 3KTLA 2AUVA 4FYUA 4DEJA 5ID2B 4CHSA 3BCKA 3A2WA 5ECHB 2VL2A 2PBJA 2H0HA 4I2TA 1AAZA 2HQTA 2ZCTA 1SKRB 3GHAA 2YV7A 3KCMA 2E7PA 6GSTA 1ZGNA 1SL2B 3N9JA 2HSMA 3ISOA 1OC8A 5DJLA 2HNLA 3CBUA 1ZCPA 2R6KA 5J41A 3QDNA 2C0EA 3KMOA 4HQZA 3PINA 4WKWA 3F63A 2FUG2 2H1DA 1DE1A 4PQHA 4PQ1A 1PRXA 4OFTA 3TGZA 2IMEA 1HNBA 5A4WA 5CP1A 1U3AA 2YCDA 1FW1A 3NIVA 4MDCA 2H01A 1AIUA 2KHPA 1HD2A 3KH9A 2VCQA 3D21A 2LKUA 3KXOA 3APSA 2JZRA 2B5YA 4XRDA 5F0GA 4WXTA 5KN3A 1A24A 1XWKA 3PGTA 3GIXA 3DGQA 4BWQA 3MSZA 4POMA 3Q18A 1GH2A 4IP1A 1VF1A 4G0KA 1F37A 1B9YC 2GT5A 3QFAC 2HZFA 2LS5A 3EMPA 3QOUA 2R37A 4OCFA 1ON4A 2DBCA 1JLVA 1MDJA 3GFKA 4OD7A 2H72A 1O81A 2J23A 5EVOA 3S9FA 4ULXA 1M9AA 2VCVA 2VD0A 3TKPA 3FR6A 5EL8A 2LUSA 3VPTA 2KLXA 2EC4A 1A0RP 4BWSA 4IQ1A 3IBHA 1XW5A 2OE0A 5B7CA 4K8MA 3VWXA 2H6ZA 2JU5A 3GKNA 4RQRA 1EWXA 1YEPA 5C00A 3GTUB 2VM1A 4EUYA 1Z3EA 4KCEA 3U6VA 1Z7RA 1F6MC 2AAWA 4V2NA 1XBSA 3UL3A 5IO2A 6GSSA 2C3QA 2YWIA 4HQSA 3L9VA 4V2MA 1SENA 3QFBC 4BL7B 4KAEA 5LNKe 4RUVA 3L78A 3FK8A 4N0ZA 2CVBA 5J4UA 3IRAA 1EGOA 1M2DA 4DVCA 3ZVJA 4AJ7A 4F0BA 5ECSA 2H19A 3RBTA 5G2ZA 1F3BA 1FHEA 3GKXA 2VCZA 1AQWA 2LEGA 3H93A 2YNXA 1FAAA 2H30A 3UVHA 2LQQA 1EV9A 1UA5A 4ZBDA 5A4UA 1A2JA 4ZILA 4MLYA 5IIZA 2NBSA 2NTOA 1EEMA 1R26A 3MWHA 5KN2A 5H5QA 5DVBA 2FWEA 2TRXA 4V1Ap 4D73B 4LLRA 4F03A 2ZNMA 3GX0A 2R5GA 1K0MA 2FWFA 3DVXA 3F4RA 4ILFA 2MMZA 5ENUA 3ZITA 1QQ2A 1Z6MA 4QL7A 4V2LA 2X8CA 8GSSA 4ACSA 3KTBA 1PN9A 3IXRA 3M0FA 4G10A 4DSSA 1X0RA 1O7UA 1THOA 4H86A 1ERVA 2GSQA 4OO5A 3HXSA 4MH3A 4F9ZA 2IWTA 4MCUA 4IKHA 3C1RA 4GWRA 1GTBA 1BJXA 3CMIA 1W4VA 2HSNB 3HYPA 1S3CA 5F06A 5D9WA 1PMTA 2YN1A 1BAYA 1RQMA 1OC3A 2B6MA 2HSMB 1FVKA 2L57A 4I97A 3QPMA 5ECLB 5ELGA 1IYHA 2DIZA 4TRXA 5D9VA 2O7KA 4ECCA 2R4VA 1ERUA 2A2SA 3UOMA 2C0DA 5J5NA 2FNOA 1T4YA 1Z9HA 2OADA 1GUKA 1R5AA 2VLVA 2EIRA 2PGTA 1JHBA 4GTUA 5G5FA 3UIWA 1FB6A 6GSWA 2EIOA 2I9HA 5ID2A 2AJQB 2E2MA 2NPBA 3CYNA 2REMA 4BVXA 5D9TA 3TJJA 4JZQA 4HU9A 3BCIA 3NZNA 4NXIA 4XHMA 4OMVA 3TUEA 1DBYA 4HUAA 2V32A 1V58A 1JZWA 1TXXA 1PA3A 2ON7A 2VL3A 2BTOT 1MDKA 4NAXA 1MD4A 1THXA 2L4CA 3FZ5A 4JR4A 3HKRA 5F07A 5DALB 5ECOB 1X5EA 1TU7A 4TXOB 1BG5A 3BD2A 3HVVA 2K18A 3KP9A 4N30A 2DJ0A 2QKEA 2YP6A 4XCSA 2JSYA 5HFIA 5JWRB 2GQKA 4L8EA 3M8NA 3GSSA 2K9FA 3H79A 4IP6A 5JCWA 2P5QA 2WCIA 5C04A 2CA8A 5ECNB 2YWNA 5IPHA 3D4MA 4BVYA 3LORA 3ZMLA 3EC3A 2YJ7A 2M46A 5B6NA 1SK0A 5ECRB 3LSZA 3Q74A 5IO0A 2HRNA 1XFLA 3LEFA 1EEJA 1NW2A 4JR6A 4EKZA 1XW9A 4CDOA 4EL1A 3HJOA 1Y25A 1V40A 4PNGA 3GSTA 3G7JA 4JBBA
chains in the Genus database with same CATH superfamily
2WZ9A 3QAVA 3A5WA 3UJ1A 2GZZA 4CW9A 4Q5NA 3HA9A 1T4ZA 3LXZA 3PR8A 3ZIJA 5HR2A 2YZHA 3GYKA 5B8AA 3EINA 2MZCA 3WGDA 2HT9A 4FXYP 4YKGA 4Z2TA 1U6TA 3IK7A 3D4TA 4X0XA 2VCXA 3FY7A 4EF0A 3F4TA 2I81A 1X9WB 1O6JA 3W6GA 2IIYA 4KDXA 2VM2A 2AV4A 4I2UA 2GZPA 3IE3A 5HFKA 1GSDA 2DIYA 3DVWA 3UEMA 4N11A 4FH8A 1PL2A 2P0GA 4IGJA 5AGYA 4DSSB 4AJ8A 3IHGA 4XIHA 3MNGA 1XOBA 2LV3A 2HRKA 1GL8A 5ECIB 3RPNA 4O5QA 3VWVA 3IAM2 2C0FA 4ML1A 6GSVA 2PWJA 4ZL8A 3F3RA 1TU8A 2Z9SA 5J40A 4V1Ag 1EGRA 2DMLA 3H1NA 5IM9A 1ZOFA 3ME7A 1A2LA 1K0NA 1DSBA 4PHZC 4WR5A 2O8VB 2VIMA 1ACVA 1F2EA 3WT2A 4NV5A 14GSA 4L0UA 2IN3A 3TCOA 4KE3A 3A2VA 5D93A 3H8QA 5CRGA 1AQXA 1SD9A 1TRSA 3TKSC 2JL4A 2IMDA 4Z2RA 1BEDA 4HJ2A 4BVXB 5B6MA 2X8HA 3LYPA 1BX9A 1EP8A 1RK4A 1A8LA 3FHKA 3NOFA 1YKCA 12GSA 4MJBA 4N3ZA 3P8WA 3IK9A 3W8JA 5H5RA 1XVWA 4QMKA 4J2FA 1GULA 3UAPA 1WJKA 3ZLPA 3HJMA 4MJAA 10GSA 2FLSA 2OBIA 4KH7A 4Z7XA 11GSA 2PVOC 5IMVA 1GP1A 3O3TA 4MPFA 3GURA 2H75A 4KNDA 5KOWA 1S3DA 4EXJA 3KEBA 3RPPA 5JCUA 3J7Yb 3AY8A 1O8WA 1M2AA 1TK8B 2MBSA 4O5UA 1B9XC 3ERFA 2F3MA 2QGVA 4YAPA 4J57E 5HQPA 3MIXA 6GSXA 1TRVA 3DWVA 1I5GA 1AUCA 3TB2A 3L4NA 4G0LA 1M99A 4ZXGA 4K7OA 2WVXB 4POBA 3VK9A 1YZXA 4BVYB 1EOHA 1BYEA 3CSJA 4LL1B 4YQUA 4K5SA 2RM6A 1HYUA 2C1YA 1E6BA 3FZAA 2CT6A 1S3RA 2QA1A 1Y1UA 5AIXA 1WPIA 4FYCA 3DYRA 3TRQA 3Q19A 2L59A 3WYWA 2HZEA 2DJKA 5DALA 2VL9A 4TXOA 3M3MA 1T00A 3D0ZA 5F05A 2MMAA 3RHBA 2GSRA 4WR4A 4P3YB 5CRWA 1FOVA 3TOTA 2F8FA 2MYGA 4YQVA 2GTUA 4PX1A 4K1FA 2NVLA 1I9DA 4I8BA 4IBPA 4G19A 4YAVA 1NHYA 3ZVJD 1Y6EA 2DJJA 2WULA 1FVJA 3LWAA 3IOSA 3HCZA 2EFHA 1TK0B 5CAXA 1K0AA 1QFNA 4XS6A 3HZ8A 3CRTA 1H75A 3LFLA 4L5LA 5JCGA 2IFQA 4LA1A 2QSIA 4KGIA 1B48A 3L0HA 1GUMA 2CZ2A 4JU5A 1GNWA 5G30A 3D6IA 2GGTA 2WFCA 2OE1A 5D73A 4FO5A 4OWYA 3ZFLA 1WMJA 4AKXB 1T7PB 4TVEA 2O89A 5IMDA 2HRKB 2FA4A 3BOAA 1PKWA 4TR4A 2PN8A 1U88A 2B3SA 1KBNA 3I69A 1EZKA 3DKSA 2MMNA 5J9CA 3C7MA 5LCZA 4F0CA 1U87A 4NMUA 1TXUA 4NWYA 4PUAA 3RAZA 2A2RA 2PU9C 2H6YA 4GCIA 3IPZA 1X5DA 5A5KA 4L5OA 1KTEA 4AKIA 3IR4A 4HEA2 4IHUA 4K2DA 1SJIA 5ELAA 1O85A 1N2AA 4KX4A 4KSMA 2PERA 4ZIJA 1XPVA 4GSSA 2B1KA 5CRHA 3D22A 4NV2A 4JEDA 1DUGA 1O8XA 3ZZXA 3GA4A 3MAKA 2LJKA 1ERWA 3HJPA 2FCHA 3GKKA 4GQFA 1XVQA 4ZB8A 1J9BA 3WT1A 1K0BA 2EFEA 3QMXA 2PMTA 2C8UA 3FZ4A 4ID0A 1QK8A 2GS3A 2HI7A 3LGCA 2K6VA 2V1MA 1M3JA 2L5LA 2F8AA 1MEKA 3IAS2 17GSA 4MMMA 2MMOA 2X99A 4O32A 4NHWA 4MJEA 1T1VA 5KN1A 4IVFA 1XG8A 3TDGA 4O7HA 4F2IA 3ZIVA 3TKSE 3E0UA 3GL3A 1X5CA 2LSTA 4NPBA 4HSCX 5CRDA 3ME8A 1MDIA 3CWGA 3FW2A 4AF2A 3ED3A 4XS1A 2OA7A 5KN0A 2H1AA 4LL4B 4WF5A 1XWAA 4TR3A 18GSA 2GDRA 1R7HA 4X43A 2GSSA 16GSA 4MP4A 5IMAA 3EU3A 2BMXA 4K7NA 1M3IA 2WJUA 5G31A 5DCGA 1BQ7A 2K8SA 2L6CA 3HD5A 2X64A 3LJRA 2H0IA 2YWOA 4HJMA 1T3BA 3I43A 4HZ2A 2HZEB 3SWLA 1E2YA 1GTUA 1PGTA 1TOFA 1OKTA 2CAIA 5CYYA 5KEJA 4DSRA 3TRXA 4ISDA 3KH7A 1SJ6A 1VF3A 4LMVA 2O36A 4GRFA 4POLA 3TKSA 2AB6A 4NHZA 5E4WA 2DLXA 2YPMA 1TI3A 2FWGA 1FO5A 3DD3A 4EDYA 1V9WA 2I3YA 1OKDA 2WW3A 4Q5QA 5AISA 3HMJG 5CREA 4KDYA 2CX3A 4WBJA 3O76A 3UARA 6GSUA 4GF0A 3KJYA 1SL0B 1N8JA 1IYIA 4KA0A 4TN8A 3KMNA 2IFQB 2XC2A 2J9HA 1M2BA 3APOA 1AXDA 3M9KA 2ES7A 2VOCA 4MZCA 5GAND 3M1GA 4JRRA 3J7Yk 5GZZB 1UVZA 1R4WA 2XPDA 3LQ7A 1SK2A 4MH2A 9GSSA 2V6OA 1USBA 1YVLA 1B8XA 3LYKA 1A8YA 4WF4A 3CSIA 4ECJA 3IA1A 2M72A 2JADA 2ZUPA 1CQGA 2H76A 3QCPA 4MJCA 3E9JB 6GSYA 4G0IA 1B4PA 3P7XA 2YANA 1NSWA 4EDZA 2N5BA 1KEBA 1GSFA 1YY7A 4PI2C 1EOGA 3F8UA 1JZRA 3VURA 3HVSA 2UZ8A 3C8EA 2B5EA 2VO4A 1PD21 2OBKA 5EPFA 3OR5A 2H6XA 3MYDA 4ICYA 1FB0A 1A2MA 3G9BA 2CQ9A 4HOJA 3QD9A 3US3A 1LBKA 1XCCA 4AJ6A 1DE2A 4XTSA 4N10A 5JWOB 2JZTA 4ZB9A 2V6KA 4KDUA 3IHQA 1EV4A 2C3TA 1SU9A 2XBQA 2R0GA 4LMWA 5ECQB 3QAGA 2PPTA 1G7OA 3VPQA 5AN1A 5HFGA 1OE7A 1EP7A 3KIJA 2A4HA 4Q5FA 20GSA 1YQ1A 2B7JA 1ST9A 2LJAA 2IMIA 3GKMA 2NDOA 4YH2A 1K0CA 3IV4A 3L9SA 1K3LA 2OJLA 4IN0A 2K8VA 4IQAA 2LNSA 5JWQB 4OFNA 3R2QA 5CNWA 2JZSA 4ML6A 1GSYA 4F82A 3P90A 1ZYEA 3UVTA 2TIRA 5HR1A 3VI5A 5IOWA 2XPEA 1JZDA 5G1KA 1W89A 1ZYQB 3GN3A 1Z5YE 2GLRA 1XIYA 2HRAA 1ERTA 1I1IP 1V57A 5HR3A 5J3RA 2LRTA 3ZTLA 1PX6A 2VLTA 3IDVA 3WD6A 2GZYA 3TJKA 1GTIA 4G01A 2CZ3A 1YEXA 5DAKA 4XS4A 3GL5A 3TOUA 2L6DA 5J9BA 4ECIA 1VGLA 2F9SA 1K0OA 2FA8A 2H74A 1MTCA 3GX8A 2G2QA 5EY6A 2B5XA 2H70A 1J08A 2A4VA 2H1BA 2H8LA 5IMFA 4K9ZA 1CQHA 4PNFA 3VWUA 1VF4A 4G9HA 2WB9A 3PH9A 1WIKA 1JFUA 3RGBC 1SD8A 4FQUA 1ABAA 2MBTA 2N5AA 1SKSB 2I1UA 4PGTA 2AHEA 1TRWA 2EIQA 2VUPA 4ZBBA 2BJXA 4G2EA 2LQOA 4AKGA 5HR0A 3DEXA 2OT3A 2CVKA 1WRYA 4KW6A 5DQSA 1R5PA 1K3OA 3KM6A 4KCAA 1FG4A 2RM5A 4MPGA 2O3EA 1QXHA 1VRSD 4HZ4A 5DBQA 3RHCA 1WOUA 2LNTA 3TKRA 1C72A 4MF6A 2IPAA 2X8GA 4WEYA 1X9MB 2LRCA 4JE1A 3V1WA 3FEUA 4KUNA 4EC0A 1YF0A 2HLSA 3ZMKA 5BRTA 4MA9A 2OACA 1AQVA 4GSTA 5D9XA 1J0FA 5GSTA 7GSSA 3CSHA 3TKQA 1YJ6A 4EO3A 2VD1A 4IS0A 2DMMA 1OE8A 4HDEA 1OAZA 1AW9A 1LU4A 5DDLA 2L4QA 1OC9A 5G5EA 5D96A 3LXTA 4RI7A 2KOKA 3K8NA 3GH6A 3APQA 3C1SA 1M0UA 3QAWA 1NHOA 1GLPA 3UBLA 3HY2A 2R0CA 1BF5A 3WGEA 3CTGA 4PTSA 19GSA 2PUKC 1Q98A 2RUEA 4J56E 4TR1A 2JSZA 1SVLA 2R2JA 5H5SA 1ZZYA 2PVQA 4CY8A 1XWGA 3IC4A 3LG6A 4I5QA 3ZL5A 2HXKA 3A3TA 3PPUA 1M9BA 2H1GA 2P5RA 2LJRA 3F3QA 1JZOA 2HYXA 4GXZA 2CV4A 4W66A 3FMWA 2M80A 1GRXA 4OO4A 3JCML 1U3IA 1G0TA 1S3AA 5ECPB 4KSOA 3ERWA 4GLTA 5D8IA 4GQCA 2GVPA 2QA2A 4E8EA 1Z7PA 1OYJA 2DJ2A 2I4AA 2YOIA 2YZUA 3HDCA 4WBRD 1PKZA 13GSA 5L71A 1YF1A 4WETA 2DSAA 2VL2C 1F3AA 1YKAA 1OVNA 4IELA 4KB3A 1NM3A 5BMUA 1ZMAA 3L9UA 2H73A 2RIIA 2WRTA 3F6DA 2VCTA 2V2GA 2WDUA 1TP9A 3FYGA 2FHEA 2FD3A 1QMVA 2FGXA 3EYTA 2GT6A 5DJMA 4ZL9A 4PUFC 2E2GA 4K0GA 3E3EA 4ECBA 1PQNA 5FT3A 3RDWA 3KP8A 1XW6A 3TJGA 1Q4JA 4A5PA 4PI0C 1ZYPA 2LRNA 2YJHA 5E59A 3GV1A 4PURA 5DAKB 4XS4B 4N0VA 3R3EA 1UN2A 1TJDA 2LTKA 3DXBA 2IJYA 1GSQA 1TTZA 4USSA 1KNGA 3HZ4A 5G1LA 3O6TA 4E8HA 1V98A 2OKAA 4HU7A 2CAQA 1TDIA 3EURA 4MF7A 1RW1A 3A5IA 4O5RA 4BA7A 4MZBA 1HNCA 3W8SA 3DRNA 4FIWA 1SYXA 5FHIA 5J4YA 2DKIA 4TXVA 1TK5B 3SBCA 1QUWA 3G7YA 4RQXA 4OFMA 4AKHA 4GSNA 1TI1A 4E68A 3EVIA 3C73A 4EE0A 2WW0A 2XHFA 5IPGA 2G0FA 1PFOA 3HHVA 4IJIA 2UV8G 2C3NA 4DSQA 2DC5A 5IMCA 3KGKA 1TW9A 4TKYA 5J4VA 4BPYA 3H4KA 2F51A 4O92A 1YDKA 2RLIA 4EVMA 3DMLA 1O73A 1XWCA 4TW5A 3GRXA 2KP1A 1JLWA 2ON5A 2OE3A 1G6YA 5FWGA 1HQOA 2IMKA 5ECKB 5GAPD 2C0GA 5DCHA 1K0DA 3CXGA 2V41A 4ZL7A 1ZYNA 4MABA 1ML6A 3Q6OA 2FY6A 3M9JA 3IC8A 3ZYWA 4MK3A 2HSHA 1VF2A 3CHXC 1SYRA 3A2XA 2WS2A 3BBYA 1OC9B 3U5RE 1G6WA 4X1UA 5A1NA 3ERGA 3FR9A 5ECMB 1GSSA 2H0GA 1GTAA 5IMZA 1GLQA 4PXOA 4I6XA 3GUSA 1UC7A 1S4BP 4PQIA 3FZ9A 4OCEA 4HI7A 1GWCA 4TR0A 2HE3A 4TR1B 1GSEA 2GQMA 2VCWA 1SKWB 4RI6A 5A4VA 2FWHA 1XZOA 2TRCP 1GNEA 3GMFA 1F9MA 4YQMA 1X9SB 1WE0A 2IMFA 2HSYA 5F8BA 2D2ZA 3QR6A 2P31A 5A5HA 1GUHA 2N5FA 4ZBAA 2KP2A 2DJ1A 2WGRA 3VWWA 2A2PA 3I6AA 2H71A 2C80A 2E0QA 2YV9A 1PL1A 3N5OA 2B7KA 4IJ3A 1MD3A 4KF9A 2GQLA 3ZFBA 2CX4A 4Z2UA 1A0FA 3EE2A 3F0IA 2KUCA 4TOPA 3DIEA 4AGSA 3MDKA 2C4JA 3VLNA 3LW9A 4HS1A 3TJFA 3UMAA 4ZB6A 5KOXA 4QL9A 2HFDA 1SK1A 3GTUA 5BMUB 1G7EA 1SJZA 1XWBA 1HNAA 1AC1A 4POKA 3GNJA 5ABRA 1K3YA 5COHA 3G7IA 2L5OA 3TRPA 3EU4A 3TJBA 1PSQA 2DJ3A 2WZSA 1ZL9A 4QQ7A 3HVXA 3ZRDA 3UBKA 4BL7A 1V2AA 5INYA 2VLUA 3D5JA 4XRAA 1ILOA 3CTFA 1GSUA 5J47A 2QC7A 3GH9A 3EWLA 5LD0A 3FR3A 5B8BA 2RUFA 2CVDA 1QGVA 1XOAA 4K6XA 4AI6A 3FKFA 3EMXA 2B1LA 1TRUA 3KZQA 3CRUA 2AYTA 4IW9A 1SL1B 1PX7A 2XBIA 1WWJA 3FRCA 1URMA 1B4QA 5AIVA 5CO3A 1T8EB 2O87A 2O85A 3P2AA 1M7TA 4MF5A 2IL3A 4K7IA 3VFIA 4FYBA 4K0NA 4Q5RA 22GSA 5DQYA 1XXUA 3F6FA 5GSSA 3ZREA 4D73A 1Z6NA 5IOXA 1TKDB 3C71A 2GSTA 3F4SA 2R3XA 4L0WA 3F9UA 5IQYA 1LJRA 2JACA 2ALBA 2H66A 3KD0A 3VI7A 3WGXA 2VAFA 3BJ5A 2YWMA 1A23A 2HRFA 4MZWA 3I9V2 1WP0A 1H4OA 3KTLA 2AUVA 4FYUA 4DEJA 5ID2B 4CHSA 3BCKA 3A2WA 5ECHB 2VL2A 2PBJA 2H0HA 4I2TA 1AAZA 2HQTA 2HSNA 2ZCTA 1SKRB 3GHAA 2YV7A 3KCMA 2E7PA 6GSTA 1SVOA 1ZGNA 2R0PA 1SL2B 3N9JA 2HSMA 3ISOA 1OC8A 5DJLA 2HNLA 3CBUA 1ZCPA 2R6KA 5J41A 4EIQA 3QDNA 2C0EA 3KMOA 4HQZA 3PINA 2X49A 4WKWA 3F63A 2FUG2 2H1DA 1DE1A 4PQHA 4PQ1A 1PRXA 4OFTA 3TGZA 2IMEA 1HNBA 5A1NB 5A4WA 5CP1A 1U3AA 2YCDA 1FW1A 3NIVA 4MDCA 2H01A 1AIUA 2KHPA 1HD2A 3KH9A 2VCQA 3D21A 2LKUA 3KXOA 2EFCA 3APSA 2JZRA 2B5YA 4XRDA 5F0GA 4WXTA 4MNNA 5KN3A 1A24A 1XWKA 3PGTA 3GIXA 3DGQA 4BWQA 3MSZA 2X4AA 3Q18A 4POMA 1GH2A 2WW2A 4IP1A 1VF1A 4G0KA 1F37A 1B9YC 2GT5A 3QFAC 2HZFA 2LS5A 3EMPA 3QOUA 4K2XA 2R37A 4OCFA 5A5HB 1ON4A 2DBCA 1JLVA 1MDJA 3EPTA 3GFKA 4OD7A 2H72A 1O81A 2J23A 5EVOA 3S9FA 4ULXA 1M9AA 2VCVA 2VD0A 3TKPA 3FR6A 5EL8A 2LUSA 3VPTA 2KLXA 2EC4A 1A0RP 4CY6A 4BWSA 4IQ1A 3IBHA 5A34A 1XW5A 2OE0A 5B7CA 4K8MA 3VWXA 2H6ZA 2JU5A 3GKNA 4RQRA 1EWXA 1YEPA 5C00A 3GTUB 4GDFA 2VM1A 1PN0A 4EUYA 1Z3EA 4KCEA 3HVNA 3U6VA 1Z7RA 1F6MC 2AAWA 4V2NA 1XBSA 3UL3A 5IO2A 6GSSA 2C3QA 2YWIA 2DKHA 1YEWC 4HQSA 3L9VA 4V2MA 2EFDA 1SENA 3QFBC 4BL7B 4KAEA 5LNKe 4RUVA 3L78A 3FK8A 4N0ZA 2CVBA 5J4UA 3IRAA 1EGOA 1M2DA 4DVCA 3ZVJA 4AJ7A 4F0BA 5ECSA 2O5VA 2H19A 3RBTA 5G2ZA 1F3BA 1FHEA 3GKXA 2VCZA 1AQWA 2LEGA 3H93A 2YNXA 1FAAA 2H30A 3UVHA 2LQQA 1EV9A 1UA5A 4EIPA 4ZBDA 5A4UA 1A2JA 4ZILA 4MLYA 5IIZA 2NBSA 2VKZG 2NTOA 4ZB7A 1EEMA 1R26A 3MWHA 5KN2A 5H5QA 5DVBA 2FWEA 2TRXA 4V1Ap 4D73B 4LLRA 4F03A 4YKFA 2ZNMA 3GX0A 2R5GA 1K0MA 2FWFA 3DVXA 3F4RA 4ILFA 2MMZA 5ENUA 3ZITA 1QQ2A 1Z6MA 4QL7A 4V2LA 2X8CA 8GSSA 4ACSA 3KTBA 1PN9A 3IXRA 2WVZA 3M0FA 4G10A 4DSSA 1X0RA 1O7UA 1THOA 4H86A 1ERVA 2GSQA 4OO5A 3HXSA 1SVMA 4MH3A 4F9ZA 3RFRC 2IWTA 4MCUA 4IKHA 3C1RA 4GWRA 1GTBA 2WVYA 1BJXA 3CMIA 1W4VA 2HSNB 3HYPA 1S3CA 5F06A 5D9WA 1PMTA 2YN1A 1BAYA 1RQMA 1OC3A 2B6MA 2HSMB 1FVKA 2L57A 4I97A 3QPMA 5ECLB 5ELGA 1IYHA 2DIZA 4TRXA 5D9VA 3TU3B 2O7KA 4ECCA 2R4VA 1ERUA 2A2SA 3UOMA 2C0DA 5J5NA 2FNOA 1T4YA 1Z9HA 2OADA 1FOHA 1GUKA 1R5AA 2VLVA 2EIRA 2PGTA 1JHBA 4GTUA 5G5FA 3UIWA 1FB6A 6GSWA 2EIOA 2I9HA 5ID2A 2AJQB 2NPBA 2E2MA 3CYNA 2REMA 4BVXA 5D9TA 3TJJA 4JZQA 4BIKA 4HU9A 3BCIA 3NZNA 4NXIA 4XHMA 4OMVA 3TUEA 1DBYA 4HUAA 2V32A 1V58A 1JZWA 1TXXA 1PA3A 2ON7A 2VL3A 2BTOT 1MDKA 4NAXA 1MD4A 1THXA 2L4CA 3FZ5A 4JR4A 3HKRA 5F07A 5DALB 5ECOB 1X5EA 1TU7A 4TXOB 1N25A 1BG5A 3BD2A 3HVVA 2K18A 3KP9A 4N30A 5A34B 2DJ0A 2QKEA 2YP6A 4XCSA 2JSYA 5HFIA 5JWRB 2GQKA 4K5RA 4L8EA 3M8NA 3GSSA 2K9FA 3H79A 4IP6A 5JCWA 2P5QA 2WCIA 5C04A 2CA8A 5ECNB 3CQFA 2WVXA 2YWNA 5IPHA 3D4MA 4BVYA 3LORA 3ZMLA 3EC3A 2YJ7A 1BG1A 2M46A 4X4JA 5B6NA 1SK0A 5ECRB 3LSZA 3Q74A 5IO0A 2HRNA 2WW1A 1XFLA 3LEFA 1EEJA 1NW2A 4JR6A 4EKZA 1XW9A 4CDOA 4EL1A 3HJOA 1Y25A 1V40A 4PNGA 3GSTA 3G7JA 4JBBA 2H1LA
chains in the Genus database with same CATH topology
2WZ9A 3QAVA 3A5WA 3UJ1A 2GZZA 4CW9A 4Q5NA 3HA9A 1T4ZA 3LXZA 3PR8A 3ZIJA 5HR2A 2YZHA 3GYKA 5B8AA 3EINA 2MZCA 3WGDA 2HT9A 4YKGA 4Z2TA 1U6TA 3IK7A 3D4TA 4X0XA 2VCXA 3FY7A 4EF0A 3F4TA 2I81A 1X9WB 1O6JA 3W6GA 2IIYA 4KDXA 2VM2A 2AV4A 4I2UA 2GZPA 3IE3A 5HFKA 1GSDA 2DIYA 3DVWA 3UEMA 4N11A 4FH8A 1PL2A 2P0GA 4IGJA 5AGYA 4DSSB 4AJ8A 3IHGA 4XIHA 3MNGA 1XOBA 2LV3A 2HRKA 1GL8A 5ECIB 3RPNA 4O5QA 3VWVA 3IAM2 2C0FA 4ML1A 6GSVA 2PWJA 4ZL8A 3F3RA 1TU8A 2Z9SA 5J40A 4V1Ag 1EGRA 2DMLA 3H1NA 5IM9A 1ZOFA 3ME7A 1A2LA 1K0NA 1DSBA 4WR5A 2O8VB 2VIMA 1ACVA 1F2EA 3WT2A 4NV5A 14GSA 4L0UA 2IN3A 3TCOA 4KE3A 3A2VA 5D93A 3H8QA 5CRGA 1AQXA 1SD9A 1TRSA 3TKSC 2JL4A 2IMDA 4Z2RA 1BEDA 4HJ2A 4BVXB 5B6MA 2X8HA 3LYPA 1BX9A 1EP8A 1RK4A 1A8LA 3FHKA 3NOFA 1YKCA 12GSA 4MJBA 4N3ZA 3P8WA 3IK9A 3W8JA 5H5RA 1XVWA 4QMKA 4J2FA 1GULA 3UAPA 1WJKA 3ZLPA 3HJMA 4MJAA 10GSA 2FLSA 2OBIA 4KH7A 4Z7XA 11GSA 2PVOC 5IMVA 1GP1A 3O3TA 4MPFA 3GURA 2H75A 4KNDA 5KOWA 1S3DA 4EXJA 3KEBA 3RPPA 5JCUA 3J7Yb 3AY8A 1O8WA 1M2AA 1TK8B 2MBSA 4O5UA 1B9XC 3ERFA 2F3MA 2QGVA 4YAPA 4J57E 5HQPA 3MIXA 6GSXA 1TRVA 3DWVA 1I5GA 1AUCA 3TB2A 3L4NA 4G0LA 1M99A 4ZXGA 4K7OA 4POBA 3VK9A 1YZXA 4BVYB 1EOHA 1BYEA 3CSJA 4LL1B 4YQUA 4K5SA 2RM6A 1HYUA 2C1YA 1E6BA 3FZAA 2CT6A 2QA1A 1Y1UA 5AIXA 1WPIA 4FYCA 3DYRA 3TRQA 3Q19A 2L59A 3WYWA 2HZEA 2DJKA 5DALA 2VL9A 4TXOA 3M3MA 1T00A 3D0ZA 5F05A 2MMAA 3RHBA 2GSRA 4WR4A 4P3YB 5CRWA 1FOVA 3TOTA 2F8FA 2MYGA 4YQVA 2GTUA 4PX1A 4K1FA 2NVLA 1I9DA 4I8BA 4IBPA 4G19A 4YAVA 1NHYA 3ZVJD 1Y6EA 2DJJA 2WULA 1FVJA 3LWAA 3IOSA 3HCZA 2EFHA 1TK0B 5CAXA 1K0AA 1QFNA 4XS6A 3HZ8A 3CRTA 1H75A 3LFLA 4L5LA 5JCGA 2IFQA 4LA1A 2QSIA 4KGIA 1B48A 3L0HA 1GUMA 2CZ2A 4JU5A 1GNWA 5G30A 3D6IA 2GGTA 2WFCA 2OE1A 5D73A 4FO5A 4OWYA 3ZFLA 1WMJA 4AKXB 1T7PB 4TVEA 2O89A 5IMDA 2HRKB 2FA4A 3BOAA 1PKWA 4TR4A 2PN8A 1U88A 2B3SA 1KBNA 3I69A 1EZKA 3DKSA 2MMNA 5J9CA 3C7MA 5LCZA 4F0CA 1U87A 4NMUA 1TXUA 4NWYA 4PUAA 3RAZA 2A2RA 2PU9C 2H6YA 4GCIA 3IPZA 1X5DA 5A5KA 4L5OA 1KTEA 4AKIA 3IR4A 4HEA2 4IHUA 4K2DA 1SJIA 5ELAA 1O85A 1N2AA 4KX4A 4KSMA 2PERA 4ZIJA 1XPVA 4GSSA 2B1KA 5CRHA 3D22A 4NV2A 4JEDA 1DUGA 1O8XA 3ZZXA 3GA4A 3MAKA 2LJKA 1ERWA 3HJPA 2FCHA 3GKKA 4GQFA 1XVQA 4ZB8A 1J9BA 3WT1A 1K0BA 2EFEA 3QMXA 2PMTA 2C8UA 3FZ4A 4ID0A 1QK8A 2GS3A 2HI7A 3LGCA 2K6VA 2V1MA 2L5LA 2F8AA 1MEKA 3IAS2 17GSA 4MMMA 2MMOA 2X99A 4O32A 4NHWA 4MJEA 1T1VA 5KN1A 4IVFA 3TDGA 4O7HA 4F2IA 3ZIVA 3TKSE 3E0UA 3GL3A 1X5CA 2LSTA 4NPBA 5CRDA 3ME8A 1MDIA 3CWGA 3FW2A 4AF2A 3ED3A 4XS1A 2OA7A 5KN0A 2H1AA 4LL4B 4WF5A 1XWAA 4TR3A 18GSA 2GDRA 1R7HA 4X43A 2GSSA 16GSA 4MP4A 5IMAA 3EU3A 2BMXA 4K7NA 5G31A 2WJUA 5DCGA 1BQ7A 2K8SA 2L6CA 3HD5A 2X64A 3LJRA 2H0IA 2YWOA 4HJMA 1T3BA 3I43A 4HZ2A 2HZEB 3SWLA 1E2YA 1GTUA 1PGTA 1TOFA 1OKTA 2CAIA 5CYYA 5KEJA 4DSRA 3TRXA 4ISDA 3KH7A 1SJ6A 1VF3A 4LMVA 4GRFA 4POLA 3TKSA 2AB6A 4NHZA 5E4WA 2DLXA 2YPMA 1TI3A 2FWGA 1FO5A 3DD3A 4EDYA 1V9WA 2I3YA 1OKDA 4Q5QA 5AISA 3HMJG 5CREA 4KDYA 2CX3A 4WBJA 3O76A 3UARA 6GSUA 4GF0A 3KJYA 1SL0B 1N8JA 1IYIA 4KA0A 4TN8A 3KMNA 2IFQB 2XC2A 2J9HA 1M2BA 3APOA 1AXDA 3M9KA 2ES7A 2VOCA 4MZCA 5GAND 3M1GA 4JRRA 3J7Yk 5GZZB 1UVZA 1R4WA 2XPDA 3LQ7A 1SK2A 4MH2A 9GSSA 2V6OA 1USBA 1YVLA 1B8XA 3LYKA 1A8YA 4WF4A 3CSIA 4ECJA 3IA1A 2M72A 2JADA 2ZUPA 1CQGA 2H76A 3QCPA 4MJCA 3E9JB 6GSYA 4G0IA 1B4PA 3P7XA 2YANA 1NSWA 4EDZA 2N5BA 1KEBA 1GSFA 1YY7A 1EOGA 3F8UA 1JZRA 3VURA 3HVSA 2UZ8A 3C8EA 2B5EA 2VO4A 1PD21 2OBKA 5EPFA 3OR5A 2H6XA 3MYDA 4ICYA 1FB0A 1A2MA 3G9BA 2CQ9A 4HOJA 3QD9A 3US3A 1LBKA 1XCCA 4AJ6A 1DE2A 4XTSA 4N10A 5JWOB 2JZTA 4ZB9A 2V6KA 4KDUA 3IHQA 1EV4A 2C3TA 1SU9A 2XBQA 2R0GA 4LMWA 5ECQB 3QAGA 2PPTA 1G7OA 3VPQA 5AN1A 5HFGA 1OE7A 1EP7A 3KIJA 2A4HA 4Q5FA 20GSA 1YQ1A 2B7JA 1ST9A 2LJAA 2IMIA 3GKMA 2NDOA 4YH2A 1K0CA 3IV4A 3L9SA 1K3LA 2OJLA 4IN0A 2K8VA 4IQAA 2LNSA 5JWQB 4OFNA 3R2QA 5CNWA 2JZSA 4ML6A 1GSYA 4F82A 3P90A 1ZYEA 3UVTA 2TIRA 5HR1A 3VI5A 5IOWA 2XPEA 1JZDA 5G1KA 1W89A 1ZYQB 3GN3A 1Z5YE 2GLRA 1XIYA 2HRAA 1ERTA 1V57A 5HR3A 5J3RA 2LRTA 3ZTLA 1PX6A 2VLTA 3IDVA 3WD6A 2GZYA 3TJKA 1GTIA 4G01A 2CZ3A 1YEXA 5DAKA 4XS4A 3GL5A 3TOUA 2L6DA 5J9BA 4ECIA 1VGLA 2F9SA 1K0OA 2FA8A 2H74A 1MTCA 3GX8A 2G2QA 5EY6A 2B5XA 2H70A 1J08A 2A4VA 2H1BA 2H8LA 5IMFA 4K9ZA 1CQHA 4PNFA 3VWUA 1VF4A 4G9HA 2WB9A 3PH9A 1WIKA 1JFUA 1SD8A 4FQUA 1ABAA 2MBTA 2N5AA 1SKSB 2I1UA 4PGTA 2AHEA 1TRWA 2EIQA 2VUPA 4ZBBA 2BJXA 4G2EA 2LQOA 4AKGA 5HR0A 3DEXA 2OT3A 2CVKA 1WRYA 4KW6A 5DQSA 1R5PA 1K3OA 3KM6A 4KCAA 1FG4A 2RM5A 4MPGA 1QXHA 1VRSD 4HZ4A 5DBQA 3RHCA 1WOUA 2LNTA 3TKRA 1C72A 4MF6A 2IPAA 2X8GA 4WEYA 1X9MB 2LRCA 4JE1A 3V1WA 3FEUA 4KUNA 4EC0A 1YF0A 2HLSA 3ZMKA 5BRTA 4MA9A 2OACA 1AQVA 4GSTA 5D9XA 1J0FA 5GSTA 7GSSA 3CSHA 3TKQA 1YJ6A 4EO3A 2VD1A 4IS0A 2DMMA 1OE8A 4HDEA 1OAZA 1AW9A 1LU4A 5DDLA 2L4QA 1OC9A 5G5EA 5D96A 3LXTA 4RI7A 2KOKA 3K8NA 3GH6A 3APQA 3C1SA 1M0UA 3QAWA 1NHOA 1GLPA 3UBLA 3HY2A 2R0CA 1BF5A 3WGEA 3CTGA 4PTSA 19GSA 2PUKC 1Q98A 2RUEA 4J56E 4TR1A 2JSZA 1SVLA 2R2JA 5H5SA 1ZZYA 2PVQA 4CY8A 1XWGA 3IC4A 3LG6A 4I5QA 3ZL5A 2HXKA 3A3TA 3PPUA 1M9BA 2H1GA 2P5RA 2LJRA 3F3QA 1JZOA 2HYXA 4GXZA 2CV4A 4W66A 3FMWA 2M80A 1GRXA 4OO4A 3JCML 1U3IA 1G0TA 1S3AA 5ECPB 4KSOA 3ERWA 4GLTA 5D8IA 4GQCA 2GVPA 2QA2A 4E8EA 1Z7PA 1OYJA 2DJ2A 2I4AA 2YOIA 2YZUA 3HDCA 4WBRD 1PKZA 13GSA 5L71A 1YF1A 4WETA 2DSAA 2VL2C 1F3AA 1YKAA 1OVNA 4IELA 4KB3A 1NM3A 5BMUA 1ZMAA 3L9UA 2H73A 2RIIA 2WRTA 3F6DA 2VCTA 2V2GA 2WDUA 1TP9A 3FYGA 2FHEA 2FD3A 1QMVA 2FGXA 3EYTA 2GT6A 5DJMA 4ZL9A 4PUFC 2E2GA 4K0GA 3E3EA 4ECBA 1PQNA 5FT3A 3RDWA 3KP8A 1XW6A 3TJGA 1Q4JA 4A5PA 1ZYPA 2LRNA 2YJHA 5E59A 3GV1A 4PURA 5DAKB 4XS4B 4N0VA 3R3EA 1UN2A 1TJDA 2LTKA 3DXBA 2IJYA 1GSQA 1TTZA 4USSA 1KNGA 3HZ4A 5G1LA 3O6TA 4E8HA 1V98A 2OKAA 4HU7A 2CAQA 1TDIA 3EURA 4MF7A 1RW1A 3A5IA 4O5RA 4BA7A 4MZBA 1HNCA 3W8SA 3DRNA 4FIWA 1SYXA 5FHIA 5J4YA 2DKIA 4TXVA 1TK5B 3SBCA 1QUWA 3G7YA 4RQXA 4OFMA 4AKHA 4GSNA 1TI1A 4E68A 3EVIA 3C73A 4EE0A 2XHFA 5IPGA 2G0FA 3HHVA 4IJIA 2UV8G 2C3NA 4DSQA 2DC5A 5IMCA 3KGKA 1TW9A 4TKYA 5J4VA 4BPYA 3H4KA 2F51A 4O92A 1YDKA 2RLIA 4EVMA 3DMLA 1O73A 1XWCA 4TW5A 3GRXA 2KP1A 1JLWA 2ON5A 2OE3A 1G6YA 5FWGA 1HQOA 2IMKA 5ECKB 5GAPD 2C0GA 5DCHA 1K0DA 3CXGA 2V41A 4ZL7A 1ZYNA 4MABA 1ML6A 3Q6OA 2FY6A 3M9JA 3IC8A 3ZYWA 4MK3A 2HSHA 1VF2A 1SYRA 3A2XA 2WS2A 3BBYA 1OC9B 3U5RE 1G6WA 4X1UA 5A1NA 3ERGA 3FR9A 5ECMB 1GSSA 2H0GA 1GTAA 5IMZA 1GLQA 4PXOA 4I6XA 3GUSA 1UC7A 4PQIA 3FZ9A 4OCEA 4HI7A 1GWCA 4TR0A 2HE3A 4TR1B 1GSEA 2GQMA 2VCWA 1SKWB 4RI6A 5A4VA 2FWHA 1XZOA 2TRCP 1GNEA 3GMFA 1F9MA 4YQMA 1X9SB 1WE0A 2IMFA 2HSYA 5F8BA 2D2ZA 3QR6A 2P31A 5A5HA 1GUHA 2N5FA 4ZBAA 2KP2A 2DJ1A 2WGRA 3VWWA 2A2PA 3I6AA 2H71A 2C80A 2E0QA 2YV9A 1PL1A 3N5OA 2B7KA 4IJ3A 1MD3A 4KF9A 2GQLA 3ZFBA 2CX4A 4Z2UA 1A0FA 3EE2A 3F0IA 2KUCA 4TOPA 3DIEA 4AGSA 3MDKA 2C4JA 3VLNA 3LW9A 4HS1A 3TJFA 3UMAA 4ZB6A 5KOXA 4QL9A 2HFDA 1SK1A 3GTUA 5BMUB 1G7EA 1SJZA 1XWBA 1HNAA 1AC1A 4POKA 3GNJA 5ABRA 1K3YA 5COHA 3G7IA 2L5OA 3TRPA 3EU4A 3TJBA 1PSQA 2DJ3A 1ZL9A 4QQ7A 3HVXA 3ZRDA 3UBKA 4BL7A 1V2AA 5INYA 2VLUA 3D5JA 4XRAA 1ILOA 3CTFA 1GSUA 5J47A 2QC7A 3GH9A 3EWLA 5LD0A 3FR3A 5B8BA 2RUFA 2CVDA 1QGVA 1XOAA 4K6XA 4AI6A 3FKFA 3EMXA 2B1LA 1TRUA 3KZQA 3CRUA 2AYTA 4IW9A 1SL1B 1PX7A 2XBIA 1WWJA 3FRCA 1URMA 1B4QA 5AIVA 5CO3A 1T8EB 2O87A 2O85A 3P2AA 1M7TA 4MF5A 2IL3A 4K7IA 3VFIA 4FYBA 4K0NA 4Q5RA 22GSA 5DQYA 1XXUA 3F6FA 5GSSA 3ZREA 4D73A 1Z6NA 5IOXA 1TKDB 3C71A 2GSTA 3F4SA 2R3XA 4L0WA 3F9UA 5IQYA 1LJRA 2JACA 2ALBA 2H66A 3KD0A 3VI7A 3WGXA 2VAFA 3BJ5A 2YWMA 1A23A 2HRFA 4MZWA 3I9V2 1WP0A 1H4OA 3KTLA 2AUVA 4FYUA 4DEJA 5ID2B 4CHSA 3BCKA 3A2WA 5ECHB 2VL2A 2PBJA 2H0HA 4I2TA 1AAZA 2HQTA 2HSNA 2ZCTA 1SKRB 3GHAA 2YV7A 3KCMA 2E7PA 6GSTA 1SVOA 1ZGNA 2R0PA 1SL2B 3N9JA 2HSMA 3ISOA 1OC8A 5DJLA 2HNLA 3CBUA 1ZCPA 2R6KA 5J41A 4EIQA 3QDNA 2C0EA 3KMOA 4HQZA 3PINA 2X49A 4WKWA 3F63A 2FUG2 2H1DA 1DE1A 4PQHA 4PQ1A 1PRXA 4OFTA 3TGZA 2IMEA 1HNBA 5A1NB 5A4WA 5CP1A 1U3AA 2YCDA 1FW1A 3NIVA 4MDCA 2H01A 1AIUA 2KHPA 1HD2A 3KH9A 2VCQA 3D21A 2LKUA 3KXOA 2EFCA 3APSA 2JZRA 2B5YA 4XRDA 5F0GA 4WXTA 4MNNA 5KN3A 1A24A 1XWKA 3PGTA 3GIXA 3DGQA 4BWQA 3MSZA 2X4AA 3Q18A 4POMA 1GH2A 4IP1A 1VF1A 4G0KA 1F37A 1B9YC 2GT5A 3QFAC 2HZFA 2LS5A 3EMPA 3QOUA 4K2XA 2R37A 4OCFA 5A5HB 1ON4A 2DBCA 1JLVA 1MDJA 3EPTA 3GFKA 4OD7A 2H72A 1O81A 2J23A 5EVOA 3S9FA 4ULXA 1M9AA 2VCVA 2VD0A 3TKPA 3FR6A 5EL8A 2LUSA 3VPTA 2KLXA 2EC4A 1A0RP 4CY6A 4BWSA 4IQ1A 3IBHA 5A34A 1XW5A 2OE0A 5B7CA 4K8MA 3VWXA 2H6ZA 2JU5A 3GKNA 4RQRA 1EWXA 1YEPA 5C00A 3GTUB 4GDFA 2VM1A 1PN0A 4EUYA 1Z3EA 4KCEA 3U6VA 1Z7RA 1F6MC 2AAWA 4V2NA 1XBSA 3UL3A 5IO2A 6GSSA 2C3QA 2YWIA 2DKHA 4HQSA 3L9VA 4V2MA 2EFDA 1SENA 3QFBC 4BL7B 4KAEA 5LNKe 4RUVA 3L78A 3FK8A 4N0ZA 2CVBA 5J4UA 3IRAA 1EGOA 1M2DA 4DVCA 3ZVJA 4AJ7A 4F0BA 5ECSA 2O5VA 2H19A 3RBTA 5G2ZA 1F3BA 1FHEA 3GKXA 2VCZA 1AQWA 2LEGA 3H93A 2YNXA 1FAAA 2H30A 3UVHA 2LQQA 1EV9A 1UA5A 4EIPA 4ZBDA 5A4UA 1A2JA 4ZILA 4MLYA 5IIZA 2NBSA 2VKZG 2NTOA 4ZB7A 1EEMA 1R26A 3MWHA 5KN2A 5H5QA 5DVBA 2FWEA 2TRXA 4V1Ap 4D73B 4LLRA 4F03A 4YKFA 2ZNMA 3GX0A 2R5GA 1K0MA 2FWFA 3DVXA 3F4RA 4ILFA 2MMZA 5ENUA 3ZITA 1QQ2A 1Z6MA 4QL7A 4V2LA 2X8CA 8GSSA 4ACSA 3KTBA 1PN9A 3IXRA 3M0FA 4G10A 4DSSA 1X0RA 1O7UA 1THOA 4H86A 1ERVA 2GSQA 4OO5A 3HXSA 1SVMA 4MH3A 4F9ZA 2IWTA 4MCUA 4IKHA 3C1RA 4GWRA 1GTBA 1BJXA 3CMIA 1W4VA 2HSNB 3HYPA 1S3CA 5F06A 5D9WA 1PMTA 2YN1A 1BAYA 1RQMA 1OC3A 2B6MA 2HSMB 1FVKA 2L57A 4I97A 3QPMA 5ECLB 5ELGA 1IYHA 2DIZA 4TRXA 5D9VA 3TU3B 2O7KA 4ECCA 2R4VA 1ERUA 2A2SA 3UOMA 2C0DA 5J5NA 2FNOA 1T4YA 1Z9HA 2OADA 1FOHA 1GUKA 1R5AA 2VLVA 2EIRA 2PGTA 1JHBA 4GTUA 5G5FA 3UIWA 1FB6A 6GSWA 2EIOA 2I9HA 5ID2A 2AJQB 2E2MA 2NPBA 3CYNA 2REMA 4BVXA 5D9TA 3TJJA 4JZQA 4HU9A 3BCIA 3NZNA 4NXIA 4XHMA 4OMVA 3TUEA 1DBYA 4HUAA 2V32A 1V58A 1JZWA 1TXXA 1PA3A 2ON7A 2VL3A 2BTOT 1MDKA 4NAXA 1MD4A 1THXA 2L4CA 3FZ5A 4JR4A 3HKRA 5F07A 5DALB 5ECOB 1X5EA 1TU7A 4TXOB 1N25A 1BG5A 3BD2A 3HVVA 2K18A 3KP9A 4N30A 5A34B 2DJ0A 2QKEA 2YP6A 4XCSA 2JSYA 5HFIA 5JWRB 2GQKA 4K5RA 4L8EA 3M8NA 3GSSA 2K9FA 3H79A 4IP6A 5JCWA 2P5QA 2WCIA 5C04A 2CA8A 5ECNB 2YWNA 5IPHA 3D4MA 4BVYA 3LORA 3ZMLA 3EC3A 2YJ7A 1BG1A 2M46A 4X4JA 5B6NA 1SK0A 5ECRB 3LSZA 3Q74A 5IO0A 2HRNA 1XFLA 3LEFA 1EEJA 1NW2A 4JR6A 4EKZA 1XW9A 4CDOA 4EL1A 3HJOA 1Y25A 1V40A 4PNGA 3GSTA 3G7JA 4JBBA 2H1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZ9 A;  3QAV A;  3A5W A;  3UJ1 A;  2GZZ A;  4CW9 A;  4Q5N A;  3HA9 A;  1T4Z A;  3LXZ A;  3PR8 A;  3ZIJ A;  5HR2 A;  2YZH A;  3GYK A;  5B8A A;  3EIN A;  2MZC A;  3WGD A;  2HT9 A;  1U6T A;  3IK7 A;  3D4T A;  4X0X A;  2VCX A;  3FY7 A;  4EF0 A;  3F4T A;  2I81 A;  1X9W B;  1O6J A;  3W6G A;  2IIY A;  4KDX A;  2VM2 A;  2AV4 A;  4I2U A;  2GZP A;  3IE3 A;  5HFK A;  1GSD A;  2DIY A;  3DVW A;  3UEM A;  4N11 A;  4FH8 A;  1PL2 A;  2P0G A;  4IGJ A;  5AGY A;  4DSS B;  4AJ8 A;  4XIH A;  3MNG A;  1XOB A;  2LV3 A;  2HRK A;  1GL8 A;  5ECI B;  3RPN A;  3VWV A;  3IAM 2;  2C0F A;  4ML1 A;  6GSV A;  2PWJ A;  4ZL8 A;  3F3R A;  1TU8 A;  2Z9S A;  4V1A g;  1EGR A;  2DML A;  3H1N A;  5IM9 A;  1ZOF A;  3ME7 A;  1A2L A;  1K0N A;  1DSB A;  4WR5 A;  2O8V B;  2VIM A;  1ACV A;  1F2E A;  3WT2 A;  4NV5 A;  14GS A;  4L0U A;  2IN3 A;  3TCO A;  4KE3 A;  3A2V A;  5D93 A;  3H8Q A;  5CRG A;  1AQX A;  1SD9 A;  1TRS A;  3TKS C;  2JL4 A;  2IMD A;  1BED A;  4HJ2 A;  4BVX B;  5B6M A;  2X8H A;  3LYP A;  1BX9 A;  1EP8 A;  1RK4 A;  1A8L A;  3FHK A;  3NOF A;  1YKC A;  12GS A;  4MJB A;  3P8W A;  3IK9 A;  3W8J A;  5H5R A;  1XVW A;  4J2F A;  1GUL A;  3UAP A;  1WJK A;  3ZLP A;  3HJM A;  4MJA A;  10GS A;  2FLS A;  2OBI A;  4KH7 A;  4Z7X A;  11GS A;  2PVO C;  5IMV A;  1GP1 A;  3O3T A;  4MPF A;  3GUR A;  2H75 A;  4KND A;  1S3D A;  4EXJ A;  3KEB A;  3RPP A;  5JCU A;  3J7Y b;  3AY8 A;  1O8W A;  1M2A A;  1TK8 B;  2MBS A;  1B9X C;  3ERF A;  2F3M A;  2QGV A;  4YAP A;  4J57 E;  5HQP A;  6GSX A;  1TRV A;  3DWV A;  1I5G A;  1AUC A;  3TB2 A;  3L4N A;  4G0L A;  1M99 A;  4ZXG A;  4K7O A;  4POB A;  3VK9 A;  1YZX A;  4BVY B;  1EOH A;  1BYE A;  3CSJ A;  4LL1 B;  4YQU A;  2RM6 A;  1HYU A;  2C1Y A;  1E6B A;  3FZA A;  2CT6 A;  5AIX A;  1WPI A;  4FYC A;  3DYR A;  3TRQ A;  3Q19 A;  2L59 A;  3WYW A;  2HZE A;  2DJK A;  5DAL A;  2VL9 A;  4TXO A;  3M3M A;  1T00 A;  3D0Z A;  5F05 A;  2MMA A;  3RHB A;  2GSR A;  4WR4 A;  4P3Y B;  5CRW A;  1FOV A;  3TOT A;  2F8F A;  2MYG A;  4YQV A;  2GTU A;  4PX1 A;  4K1F A;  2NVL A;  1I9D A;  4I8B A;  4IBP A;  4G19 A;  4YAV A;  1NHY A;  3ZVJ D;  1Y6E A;  2DJJ A;  2WUL A;  1FVJ A;  3LWA A;  3IOS A;  3HCZ A;  1TK0 B;  5CAX A;  1K0A A;  1QFN A;  4XS6 A;  3HZ8 A;  3CRT A;  1H75 A;  3LFL A;  4L5L A;  5JCG A;  2IFQ A;  4LA1 A;  2QSI A;  4KGI A;  1B48 A;  3L0H A;  1GUM A;  2CZ2 A;  4JU5 A;  1GNW A;  5G30 A;  3D6I A;  2GGT A;  2WFC A;  2OE1 A;  5D73 A;  4FO5 A;  4OWY A;  3ZFL A;  1WMJ A;  1T7P B;  4TVE A;  2O89 A;  5IMD A;  2HRK B;  2FA4 A;  3BOA A;  1PKW A;  4TR4 A;  2PN8 A;  1U88 A;  2B3S A;  1KBN A;  3I69 A;  1EZK A;  3DKS A;  2MMN A;  5J9C A;  3C7M A;  5LCZ A;  4F0C A;  1U87 A;  4NMU A;  4NWY A;  4PUA A;  3RAZ A;  2A2R A;  2PU9 C;  2H6Y A;  4GCI A;  3IPZ A;  1X5D A;  5A5K A;  4L5O A;  1KTE A;  4HEA 2;  3IR4 A;  4IHU A;  4K2D A;  1SJI A;  5ELA A;  1O85 A;  1N2A A;  4KX4 A;  4KSM A;  2PER A;  4ZIJ A;  1XPV A;  4GSS A;  2B1K A;  5CRH A;  3D22 A;  4NV2 A;  4JED A;  1DUG A;  1O8X A;  3ZZX A;  3GA4 A;  3MAK A;  2LJK A;  1ERW A;  3HJP A;  2FCH A;  3GKK A;  4GQF A;  1XVQ A;  4ZB8 A;  1J9B A;  3WT1 A;  1K0B A;  3QMX A;  2PMT A;  2C8U A;  3FZ4 A;  4ID0 A;  1QK8 A;  2GS3 A;  2HI7 A;  3LGC A;  2K6V A;  2V1M A;  2L5L A;  2F8A A;  1MEK A;  3IAS 2;  17GS A;  4MMM A;  2MMO A;  2X99 A;  4O32 A;  4NHW A;  4MJE A;  1T1V A;  5KN1 A;  4IVF A;  3TDG A;  4O7H A;  4F2I A;  3ZIV A;  3TKS E;  3E0U A;  3GL3 A;  1X5C A;  2LST A;  4NPB A;  5CRD A;  3ME8 A;  1MDI A;  3FW2 A;  4AF2 A;  3ED3 A;  4XS1 A;  2OA7 A;  5KN0 A;  2H1A A;  4LL4 B;  4WF5 A;  1XWA A;  4TR3 A;  18GS A;  2GDR A;  1R7H A;  4X43 A;  2GSS A;  16GS A;  4MP4 A;  5IMA A;  3EU3 A;  2BMX A;  4K7N A;  5G31 A;  2WJU A;  5DCG A;  1BQ7 A;  2K8S A;  2L6C A;  3HD5 A;  2X64 A;  3LJR A;  2H0I A;  2YWO A;  4HJM A;  1T3B A;  3I43 A;  4HZ2 A;  2HZE B;  3SWL A;  1E2Y A;  1GTU A;  1PGT A;  1TOF A;  1OKT A;  2CAI A;  5CYY A;  5KEJ A;  4DSR A;  3TRX A;  4ISD A;  3KH7 A;  1SJ6 A;  1VF3 A;  4LMV A;  4GRF A;  4POL A;  3TKS A;  2AB6 A;  4NHZ A;  5E4W A;  2DLX A;  2YPM A;  1TI3 A;  2FWG A;  1FO5 A;  3DD3 A;  4EDY A;  1V9W A;  2I3Y A;  1OKD A;  4Q5Q A;  5AIS A;  5CRE A;  4KDY A;  2CX3 A;  4WBJ A;  3O76 A;  3UAR A;  6GSU A;  4GF0 A;  3KJY A;  1SL0 B;  1N8J A;  1IYI A;  4KA0 A;  4TN8 A;  3KMN A;  2IFQ B;  2XC2 A;  2J9H A;  1M2B A;  3APO A;  1AXD A;  3M9K A;  2ES7 A;  2VOC A;  4MZC A;  5GAN D;  3M1G A;  4JRR A;  3J7Y k;  5GZZ B;  1UVZ A;  1R4W A;  2XPD A;  3LQ7 A;  1SK2 A;  4MH2 A;  9GSS A;  2V6O A;  1USB A;  1B8X A;  3LYK A;  1A8Y A;  4WF4 A;  3CSI A;  4ECJ A;  3IA1 A;  2M72 A;  2JAD A;  2ZUP A;  1CQG A;  2H76 A;  3QCP A;  4MJC A;  3E9J B;  6GSY A;  4G0I A;  1B4P A;  3P7X A;  2YAN A;  1NSW A;  4EDZ A;  2N5B A;  1KEB A;  1GSF A;  1YY7 A;  1EOG A;  3F8U A;  1JZR A;  3VUR A;  3HVS A;  2UZ8 A;  3C8E A;  2B5E A;  2VO4 A;  1PD2 1;  2OBK A;  5EPF A;  3OR5 A;  2H6X A;  1FB0 A;  1A2M A;  3G9B A;  2CQ9 A;  4HOJ A;  3QD9 A;  3US3 A;  1LBK A;  1XCC A;  4AJ6 A;  1DE2 A;  4XTS A;  4N10 A;  5JWO B;  2JZT A;  4ZB9 A;  2V6K A;  4KDU A;  3IHQ A;  1EV4 A;  2C3T A;  1SU9 A;  2XBQ A;  4LMW A;  5ECQ B;  3QAG A;  2PPT A;  1G7O A;  3VPQ A;  5AN1 A;  5HFG A;  1OE7 A;  1EP7 A;  3KIJ A;  4Q5F A;  20GS A;  1YQ1 A;  2B7J A;  1ST9 A;  2LJA A;  2IMI A;  3GKM A;  2NDO A;  4YH2 A;  1K0C A;  3IV4 A;  3L9S A;  1K3L A;  2OJL A;  4IN0 A;  2K8V A;  4IQA A;  2LNS A;  5JWQ B;  4OFN A;  3R2Q A;  5CNW A;  2JZS A;  4ML6 A;  1GSY A;  4F82 A;  3P90 A;  1ZYE A;  3UVT A;  2TIR A;  5HR1 A;  3VI5 A;  5IOW A;  2XPE A;  1JZD A;  5G1K A;  1W89 A;  1ZYQ B;  3GN3 A;  1Z5Y E;  2GLR A;  1XIY A;  2HRA A;  1ERT A;  1V57 A;  5HR3 A;  5J3R A;  2LRT A;  3ZTL A;  1PX6 A;  2VLT A;  3IDV A;  3WD6 A;  2GZY A;  3TJK A;  1GTI A;  2CZ3 A;  1YEX A;  5DAK A;  4XS4 A;  3GL5 A;  3TOU A;  2L6D A;  5J9B A;  4ECI A;  1VGL A;  2F9S A;  1K0O A;  2FA8 A;  2H74 A;  1MTC A;  3GX8 A;  2G2Q A;  5EY6 A;  2B5X A;  2H70 A;  1J08 A;  2A4V A;  2H1B A;  2H8L A;  5IMF A;  4K9Z A;  1CQH A;  4PNF A;  3VWU A;  1VF4 A;  4G9H A;  2WB9 A;  3PH9 A;  1WIK A;  1JFU A;  1SD8 A;  4FQU A;  1ABA A;  2MBT A;  2N5A A;  1SKS B;  2I1U A;  4PGT A;  2AHE A;  1TRW A;  2EIQ A;  2VUP A;  4ZBB A;  2BJX A;  4G2E A;  2LQO A;  5HR0 A;  3DEX A;  2CVK A;  1WRY A;  4KW6 A;  5DQS A;  1R5P A;  1K3O A;  3KM6 A;  4KCA A;  1FG4 A;  2RM5 A;  4MPG A;  1QXH A;  1VRS D;  4HZ4 A;  5DBQ A;  3RHC A;  1WOU A;  2LNT A;  3TKR A;  1C72 A;  4MF6 A;  2IPA A;  2X8G A;  4WEY A;  1X9M B;  2LRC A;  4JE1 A;  3V1W A;  3FEU A;  4KUN A;  4EC0 A;  1YF0 A;  2HLS A;  3ZMK A;  4MA9 A;  2OAC A;  1AQV A;  4GST A;  5D9X A;  1J0F A;  5GST A;  7GSS A;  3CSH A;  3TKQ A;  1YJ6 A;  4EO3 A;  2VD1 A;  4IS0 A;  2DMM A;  1OE8 A;  4HDE A;  1OAZ A;  1AW9 A;  1LU4 A;  5DDL A;  2L4Q A;  1OC9 A;  5G5E A;  5D96 A;  3LXT A;  4RI7 A;  2KOK A;  3K8N A;  3GH6 A;  3APQ A;  3C1S A;  1M0U A;  3QAW A;  1NHO A;  1GLP A;  3UBL A;  3HY2 A;  3WGE A;  3CTG A;  4PTS A;  19GS A;  2PUK C;  1Q98 A;  2RUE A;  4J56 E;  4TR1 A;  2JSZ A;  2R2J A;  5H5S A;  1ZZY A;  2PVQ A;  1XWG A;  3IC4 A;  3LG6 A;  4I5Q A;  3ZL5 A;  2HXK A;  3A3T A;  3PPU A;  1M9B A;  2H1G A;  2P5R A;  2LJR A;  3F3Q A;  1JZO A;  2HYX A;  4GXZ A;  2CV4 A;  2M80 A;  1GRX A;  4OO4 A;  3JCM L;  1U3I A;  1G0T A;  1S3A A;  5ECP B;  4KSO A;  3ERW A;  4GLT A;  5D8I A;  4GQC A;  2GVP A;  4E8E A;  1Z7P A;  1OYJ A;  2DJ2 A;  2I4A A;  2YOI A;  2YZU A;  3HDC A;  4WBR D;  1PKZ A;  13GS A;  5L71 A;  1YF1 A;  4WET A;  2DSA A;  2VL2 C;  1F3A A;  1YKA A;  1OVN A;  4IEL A;  4KB3 A;  1NM3 A;  5BMU A;  1ZMA A;  3L9U A;  2H73 A;  2RII A;  2WRT A;  3F6D A;  2VCT A;  2V2G A;  2WDU A;  1TP9 A;  3FYG A;  2FHE A;  2FD3 A;  1QMV A;  2FGX A;  3EYT A;  2GT6 A;  5DJM A;  4ZL9 A;  4PUF C;  2E2G A;  4K0G A;  3E3E A;  4ECB A;  1PQN A;  5FT3 A;  3RDW A;  3KP8 A;  1XW6 A;  3TJG A;  1Q4J A;  2LRN A;  2YJH A;  5E59 A;  3GV1 A;  4PUR A;  5DAK B;  4XS4 B;  4N0V A;  3R3E A;  1UN2 A;  1TJD A;  2LTK A;  3DXB A;  2IJY A;  1GSQ A;  1TTZ A;  4USS A;  1KNG A;  3HZ4 A;  5G1L A;  3O6T A;  4E8H A;  1V98 A;  2OKA A;  4HU7 A;  2CAQ A;  1TDI A;  3EUR A;  4MF7 A;  1RW1 A;  4O5R A;  4BA7 A;  4MZB A;  1HNC A;  3W8S A;  3DRN A;  4FIW A;  1SYX A;  5FHI A;  4TXV A;  1TK5 B;  3SBC A;  1QUW A;  3G7Y A;  4RQX A;  4OFM A;  4GSN A;  1TI1 A;  3EVI A;  3C73 A;  4EE0 A;  2XHF A;  5IPG A;  2G0F A;  3HHV A;  4IJI A;  2C3N A;  4DSQ A;  2DC5 A;  5IMC A;  3KGK A;  1TW9 A;  4TKY A;  4BPY A;  3H4K A;  2F51 A;  4O92 A;  1YDK A;  2RLI A;  4EVM A;  3DML A;  1O73 A;  1XWC A;  4TW5 A;  3GRX A;  2KP1 A;  1JLW A;  2ON5 A;  2OE3 A;  1G6Y A;  5FWG A;  1HQO A;  2IMK A;  5ECK B;  5GAP D;  2C0G A;  5DCH A;  1K0D A;  3CXG A;  2V41 A;  4ZL7 A;  4MAB A;  1ML6 A;  3Q6O A;  2FY6 A;  3M9J A;  3IC8 A;  3ZYW A;  4MK3 A;  2HSH A;  1VF2 A;  1SYR A;  3A2X A;  2WS2 A;  3BBY A;  1OC9 B;  3U5R E;  1G6W A;  4X1U A;  5IMZ A;  3ERG A;  3FR9 A;  5ECM B;  1GSS A;  2H0G A;  1GTA A;  1GLQ A;  4PXO A;  4I6X A;  3GUS A;  1UC7 A;  4PQI A;  3FZ9 A;  4OCE A;  4HI7 A;  1GWC A;  4TR0 A;  2HE3 A;  4TR1 B;  1GSE A;  2GQM A;  2VCW A;  1SKW B;  4RI6 A;  5A4V A;  2FWH A;  1XZO A;  2TRC P;  1GNE A;  3GMF A;  1F9M A;  4YQM A;  1X9S B;  1WE0 A;  2IMF A;  2HSY A;  5F8B A;  2D2Z A;  3QR6 A;  2P31 A;  1GUH A;  2N5F A;  4ZBA A;  2KP2 A;  2DJ1 A;  2WGR A;  3VWW A;  3I6A A;  2H71 A;  2C80 A;  2E0Q A;  2YV9 A;  1PL1 A;  3N5O A;  2B7K A;  4IJ3 A;  1MD3 A;  4KF9 A;  2GQL A;  3ZFB A;  2CX4 A;  1A0F A;  3EE2 A;  3F0I A;  2KUC A;  4TOP A;  3DIE A;  4AGS A;  3MDK A;  2C4J A;  3VLN A;  4HS1 A;  3TJF A;  3UMA A;  4ZB6 A;  4QL9 A;  2HFD A;  1SK1 A;  3GTU A;  1G7E A;  1SJZ A;  1XWB A;  1HNA A;  1AC1 A;  4POK A;  3GNJ A;  5ABR A;  1K3Y A;  5COH A;  3G7I A;  2L5O A;  3TRP A;  3EU4 A;  3TJB A;  1PSQ A;  2DJ3 A;  1ZL9 A;  4QQ7 A;  3HVX A;  3ZRD A;  3UBK A;  4BL7 A;  1V2A A;  5INY A;  2VLU A;  3D5J A;  4XRA A;  1ILO A;  3CTF A;  1GSU A;  2QC7 A;  3GH9 A;  3EWL A;  5LD0 A;  3FR3 A;  5B8B A;  2RUF A;  2CVD A;  1QGV A;  1XOA A;  4K6X A;  3FKF A;  3EMX A;  2B1L A;  1TRU A;  3KZQ A;  3CRU A;  2AYT A;  4IW9 A;  1SL1 B;  1PX7 A;  2XBI A;  1WWJ A;  3FRC A;  1URM A;  1B4Q A;  5AIV A;  5CO3 A;  1T8E B;  2O87 A;  2O85 A;  3P2A A;  1M7T A;  4MF5 A;  2IL3 A;  4K7I A;  3VFI A;  4FYB A;  4K0N A;  4Q5R A;  22GS A;  5DQY A;  1XXU A;  3F6F A;  5GSS A;  3ZRE A;  4D73 A;  1Z6N A;  5IOX A;  1TKD B;  3C71 A;  2GST A;  3F4S A;  2R3X A;  4L0W A;  3F9U A;  5IQY A;  1LJR A;  2JAC A;  2ALB A;  2H66 A;  3KD0 A;  3VI7 A;  3WGX A;  2VAF A;  3BJ5 A;  2YWM A;  1A23 A;  2HRF A;  4MZW A;  3I9V 2;  1WP0 A;  1H4O A;  3KTL A;  2AUV A;  4FYU A;  4DEJ A;  5ID2 B;  4CHS A;  3BCK A;  3A2W A;  5ECH B;  2VL2 A;  2PBJ A;  2H0H A;  4I2T A;  1AAZ A;  2HQT A;  2ZCT A;  1SKR B;  3GHA A;  2YV7 A;  3KCM A;  2E7P A;  6GST A;  1ZGN A;  1SL2 B;  3N9J A;  2HSM A;  3ISO A;  1OC8 A;  5DJL A;  2HNL A;  3CBU A;  1ZCP A;  2R6K A;  5J41 A;  3QDN A;  2C0E A;  3KMO A;  4HQZ A;  3PIN A;  4WKW A;  3F63 A;  2FUG 2;  2H1D A;  1DE1 A;  4PQH A;  4PQ1 A;  1PRX A;  4OFT A;  3TGZ A;  2IME A;  1HNB A;  5A4W A;  5CP1 A;  1U3A A;  2YCD A;  1FW1 A;  3NIV A;  4MDC A;  2H01 A;  1AIU A;  2KHP A;  1HD2 A;  3KH9 A;  2VCQ A;  3D21 A;  2LKU A;  3KXO A;  3APS A;  2JZR A;  2B5Y A;  4XRD A;  5F0G A;  4WXT A;  5KN3 A;  1A24 A;  1XWK A;  3PGT A;  3GIX A;  3DGQ A;  4BWQ A;  3MSZ A;  4POM A;  3Q18 A;  1GH2 A;  4IP1 A;  1VF1 A;  4G0K A;  1F37 A;  1B9Y C;  2GT5 A;  3QFA C;  2HZF A;  2LS5 A;  3EMP A;  3QOU A;  2R37 A;  4OCF A;  1ON4 A;  2DBC A;  1JLV A;  1MDJ A;  3GFK A;  4OD7 A;  2H72 A;  1O81 A;  2J23 A;  5EVO A;  3S9F A;  4ULX A;  1M9A A;  2VCV A;  2VD0 A;  3TKP A;  3FR6 A;  5EL8 A;  2LUS A;  3VPT A;  2KLX A;  2EC4 A;  1A0R P;  4BWS A;  4IQ1 A;  3IBH A;  1XW5 A;  2OE0 A;  5B7C A;  4K8M A;  3VWX A;  2H6Z A;  2JU5 A;  3GKN A;  4RQR A;  1EWX A;  1YEP A;  5C00 A;  3GTU B;  2VM1 A;  4EUY A;  1Z3E A;  4KCE A;  3U6V A;  1Z7R A;  1F6M C;  2AAW A;  4V2N A;  1XBS A;  3UL3 A;  5IO2 A;  6GSS A;  2C3Q A;  2YWI A;  4HQS A;  3L9V A;  4V2M A;  1SEN A;  3QFB C;  4BL7 B;  4KAE A;  5LNK e;  4RUV A;  3L78 A;  3FK8 A;  4N0Z A;  2CVB A;  5J4U A;  3IRA A;  1EGO A;  1M2D A;  4DVC A;  3ZVJ A;  4AJ7 A;  4F0B A;  5ECS A;  2H19 A;  3RBT A;  5G2Z A;  1F3B A;  1FHE A;  3GKX A;  2VCZ A;  1AQW A;  2LEG A;  3H93 A;  2YNX A;  1FAA A;  2H30 A;  3UVH A;  2LQQ A;  1EV9 A;  1UA5 A;  4ZBD A;  5A4U A;  1A2J A;  4ZIL A;  4MLY A;  5IIZ A;  2NBS A;  2NTO A;  1EEM A;  1R26 A;  3MWH A;  5KN2 A;  5H5Q A;  5DVB A;  2FWE A;  2TRX A;  4V1A p;  4D73 B;  4LLR A;  4F03 A;  2ZNM A;  3GX0 A;  2R5G A;  1K0M A;  2FWF A;  3DVX A;  3F4R A;  4ILF A;  2MMZ A;  5ENU A;  3ZIT A;  1QQ2 A;  1Z6M A;  4QL7 A;  4V2L A;  2X8C A;  8GSS A;  4ACS A;  3KTB A;  1PN9 A;  3IXR A;  3M0F A;  4G10 A;  4DSS A;  1X0R A;  1O7U A;  1THO A;  4H86 A;  1ERV A;  2GSQ A;  4OO5 A;  3HXS A;  4MH3 A;  4F9Z A;  2IWT A;  4MCU A;  4IKH A;  3C1R A;  4GWR A;  1GTB A;  1BJX A;  3CMI A;  1W4V A;  2HSN B;  3HYP A;  1S3C A;  5F06 A;  5D9W A;  1PMT A;  2YN1 A;  1BAY A;  1RQM A;  1OC3 A;  2B6M A;  2HSM B;  1FVK A;  2L57 A;  4I97 A;  3QPM A;  5ECL B;  5ELG A;  1IYH A;  2DIZ A;  4TRX A;  5D9V A;  2O7K A;  4ECC A;  2R4V A;  1ERU A;  2A2S A;  3UOM A;  2C0D A;  5J5N A;  2FNO A;  1T4Y A;  1Z9H A;  2OAD A;  1GUK A;  1R5A A;  2VLV A;  2EIR A;  2PGT A;  1JHB A;  4GTU A;  5G5F A;  3UIW A;  1FB6 A;  6GSW A;  2EIO A;  2I9H A;  5ID2 A;  2AJQ B;  2E2M A;  2NPB A;  3CYN A;  2REM A;  4BVX A;  5D9T A;  3TJJ A;  4JZQ A;  4HU9 A;  3BCI A;  3NZN A;  4NXI A;  4XHM A;  4OMV A;  3TUE A;  1DBY A;  4HUA A;  2V32 A;  1V58 A;  1JZW A;  1TXX A;  1PA3 A;  2ON7 A;  2VL3 A;  2BTO T;  1MDK A;  4NAX A;  1MD4 A;  1THX A;  2L4C A;  3FZ5 A;  4JR4 A;  3HKR A;  5F07 A;  5DAL B;  5ECO B;  1X5E A;  1TU7 A;  4TXO B;  1BG5 A;  3BD2 A;  3HVV A;  2K18 A;  3KP9 A;  4N30 A;  2DJ0 A;  2QKE A;  2YP6 A;  4XCS A;  2JSY A;  5HFI A;  5JWR B;  2GQK A;  4L8E A;  3M8N A;  3GSS A;  2K9F A;  3H79 A;  4IP6 A;  5JCW A;  2P5Q A;  2WCI A;  5C04 A;  2CA8 A;  5ECN B;  2YWN A;  5IPH A;  3D4M A;  4BVY A;  3LOR A;  3ZML A;  3EC3 A;  2YJ7 A;  2M46 A;  5B6N A;  1SK0 A;  5ECR B;  3LSZ A;  3Q74 A;  5IO0 A;  2HRN A;  1XFL A;  3LEF A;  1EEJ A;  1NW2 A;  4JR6 A;  4EKZ A;  1XW9 A;  4CDO A;  4EL1 A;  3HJO A;  1Y25 A;  1V40 A;  4PNG A;  3GST A;  3G7J A;  4JBB A; 
#chains in the Genus database with same CATH topology
 2WZ9 A;  3QAV A;  3A5W A;  3UJ1 A;  2GZZ A;  4CW9 A;  4Q5N A;  3HA9 A;  1T4Z A;  3LXZ A;  3PR8 A;  3ZIJ A;  5HR2 A;  2YZH A;  3GYK A;  5B8A A;  3EIN A;  2MZC A;  3WGD A;  2HT9 A;  4FXY P;  4YKG A;  4Z2T A;  1U6T A;  3IK7 A;  3D4T A;  4X0X A;  2VCX A;  3FY7 A;  4EF0 A;  3F4T A;  2I81 A;  1X9W B;  1O6J A;  3W6G A;  2IIY A;  4KDX A;  2VM2 A;  2AV4 A;  4I2U A;  2GZP A;  3IE3 A;  5HFK A;  1GSD A;  2DIY A;  3DVW A;  3UEM A;  4N11 A;  4FH8 A;  1PL2 A;  2P0G A;  4IGJ A;  5AGY A;  4DSS B;  4AJ8 A;  3IHG A;  4XIH A;  3MNG A;  1XOB A;  2LV3 A;  2HRK A;  1GL8 A;  5ECI B;  3RPN A;  4O5Q A;  3VWV A;  3IAM 2;  2C0F A;  4ML1 A;  6GSV A;  2PWJ A;  4ZL8 A;  3F3R A;  1TU8 A;  2Z9S A;  5J40 A;  4V1A g;  1EGR A;  2DML A;  3H1N A;  5IM9 A;  1ZOF A;  3ME7 A;  1A2L A;  1K0N A;  1DSB A;  4PHZ C;  4WR5 A;  2O8V B;  2VIM A;  1ACV A;  1F2E A;  3WT2 A;  4NV5 A;  14GS A;  4L0U A;  2IN3 A;  3TCO A;  4KE3 A;  3A2V A;  5D93 A;  3H8Q A;  5CRG A;  1AQX A;  1SD9 A;  1TRS A;  3TKS C;  2JL4 A;  2IMD A;  4Z2R A;  1BED A;  4HJ2 A;  4BVX B;  5B6M A;  2X8H A;  3LYP A;  1BX9 A;  1EP8 A;  1RK4 A;  1A8L A;  3FHK A;  3NOF A;  1YKC A;  12GS A;  4MJB A;  4N3Z A;  3P8W A;  3IK9 A;  3W8J A;  5H5R A;  1XVW A;  4QMK A;  4J2F A;  1GUL A;  3UAP A;  1WJK A;  3ZLP A;  3HJM A;  4MJA A;  10GS A;  2FLS A;  2OBI A;  4KH7 A;  4Z7X A;  11GS A;  2PVO C;  5IMV A;  1GP1 A;  3O3T A;  4MPF A;  3GUR A;  2H75 A;  4KND A;  5KOW A;  1S3D A;  4EXJ A;  3KEB A;  3RPP A;  5JCU A;  3J7Y b;  3AY8 A;  1O8W A;  1M2A A;  1TK8 B;  2MBS A;  4O5U A;  1B9X C;  3ERF A;  2F3M A;  2QGV A;  4YAP A;  4J57 E;  5HQP A;  3MIX A;  6GSX A;  1TRV A;  3DWV A;  1I5G A;  1AUC A;  3TB2 A;  3L4N A;  4G0L A;  1M99 A;  4ZXG A;  4K7O A;  2WVX B;  4POB A;  3VK9 A;  1YZX A;  4BVY B;  1EOH A;  1BYE A;  3CSJ A;  4LL1 B;  4YQU A;  4K5S A;  2RM6 A;  1HYU A;  2C1Y A;  1E6B A;  3FZA A;  2CT6 A;  1S3R A;  2QA1 A;  1Y1U A;  5AIX A;  1WPI A;  4FYC A;  3DYR A;  3TRQ A;  3Q19 A;  2L59 A;  3WYW A;  2HZE A;  2DJK A;  5DAL A;  2VL9 A;  4TXO A;  3M3M A;  1T00 A;  3D0Z A;  5F05 A;  2MMA A;  3RHB A;  2GSR A;  4WR4 A;  4P3Y B;  5CRW A;  1FOV A;  3TOT A;  2F8F A;  2MYG A;  4YQV A;  2GTU A;  4PX1 A;  4K1F A;  2NVL A;  1I9D A;  4I8B A;  4IBP A;  4G19 A;  4YAV A;  1NHY A;  3ZVJ D;  1Y6E A;  2DJJ A;  2WUL A;  1FVJ A;  3LWA A;  3IOS A;  3HCZ A;  2EFH A;  1TK0 B;  5CAX A;  1K0A A;  1QFN A;  4XS6 A;  3HZ8 A;  3CRT A;  1H75 A;  3LFL A;  4L5L A;  5JCG A;  2IFQ A;  4LA1 A;  2QSI A;  4KGI A;  1B48 A;  3L0H A;  1GUM A;  2CZ2 A;  4JU5 A;  1GNW A;  5G30 A;  3D6I A;  2GGT A;  2WFC A;  2OE1 A;  5D73 A;  4FO5 A;  4OWY A;  3ZFL A;  1WMJ A;  4AKX B;  1T7P B;  4TVE A;  2O89 A;  5IMD A;  2HRK B;  2FA4 A;  3BOA A;  1PKW A;  4TR4 A;  2PN8 A;  1U88 A;  2B3S A;  1KBN A;  3I69 A;  1EZK A;  3DKS A;  2MMN A;  5J9C A;  3C7M A;  5LCZ A;  4F0C A;  1U87 A;  4NMU A;  1TXU A;  4NWY A;  4PUA A;  3RAZ A;  2A2R A;  2PU9 C;  2H6Y A;  4GCI A;  3IPZ A;  1X5D A;  5A5K A;  4L5O A;  1KTE A;  4AKI A;  3IR4 A;  4HEA 2;  4IHU A;  4K2D A;  1SJI A;  5ELA A;  1O85 A;  1N2A A;  4KX4 A;  4KSM A;  2PER A;  4ZIJ A;  1XPV A;  4GSS A;  2B1K A;  5CRH A;  3D22 A;  4NV2 A;  4JED A;  1DUG A;  1O8X A;  3ZZX A;  3GA4 A;  3MAK A;  2LJK A;  1ERW A;  3HJP A;  2FCH A;  3GKK A;  4GQF A;  1XVQ A;  4ZB8 A;  1J9B A;  3WT1 A;  1K0B A;  2EFE A;  3QMX A;  2PMT A;  2C8U A;  3FZ4 A;  4ID0 A;  1QK8 A;  2GS3 A;  2HI7 A;  3LGC A;  2K6V A;  2V1M A;  1M3J A;  2L5L A;  2F8A A;  1MEK A;  3IAS 2;  17GS A;  4MMM A;  2MMO A;  2X99 A;  4O32 A;  4NHW A;  4MJE A;  1T1V A;  5KN1 A;  4IVF A;  1XG8 A;  3TDG A;  4O7H A;  4F2I A;  3ZIV A;  3TKS E;  3E0U A;  3GL3 A;  1X5C A;  2LST A;  4NPB A;  4HSC X;  5CRD A;  3ME8 A;  1MDI A;  3CWG A;  3FW2 A;  4AF2 A;  3ED3 A;  4XS1 A;  2OA7 A;  5KN0 A;  2H1A A;  4LL4 B;  4WF5 A;  1XWA A;  4TR3 A;  18GS A;  2GDR A;  1R7H A;  4X43 A;  2GSS A;  16GS A;  4MP4 A;  5IMA A;  3EU3 A;  2BMX A;  4K7N A;  1M3I A;  2WJU A;  5G31 A;  5DCG A;  1BQ7 A;  2K8S A;  2L6C A;  3HD5 A;  2X64 A;  3LJR A;  2H0I A;  2YWO A;  4HJM A;  1T3B A;  3I43 A;  4HZ2 A;  2HZE B;  3SWL A;  1E2Y A;  1GTU A;  1PGT A;  1TOF A;  1OKT A;  2CAI A;  5CYY A;  5KEJ A;  4DSR A;  3TRX A;  4ISD A;  3KH7 A;  1SJ6 A;  1VF3 A;  4LMV A;  2O36 A;  4GRF A;  4POL A;  3TKS A;  2AB6 A;  4NHZ A;  5E4W A;  2DLX A;  2YPM A;  1TI3 A;  2FWG A;  1FO5 A;  3DD3 A;  4EDY A;  1V9W A;  2I3Y A;  1OKD A;  2WW3 A;  4Q5Q A;  5AIS A;  3HMJ G;  5CRE A;  4KDY A;  2CX3 A;  4WBJ A;  3O76 A;  3UAR A;  6GSU A;  4GF0 A;  3KJY A;  1SL0 B;  1N8J A;  1IYI A;  4KA0 A;  4TN8 A;  3KMN A;  2IFQ B;  2XC2 A;  2J9H A;  1M2B A;  3APO A;  1AXD A;  3M9K A;  2ES7 A;  2VOC A;  4MZC A;  5GAN D;  3M1G A;  4JRR A;  3J7Y k;  5GZZ B;  1UVZ A;  1R4W A;  2XPD A;  3LQ7 A;  1SK2 A;  4MH2 A;  9GSS A;  2V6O A;  1USB A;  1YVL A;  1B8X A;  3LYK A;  1A8Y A;  4WF4 A;  3CSI A;  4ECJ A;  3IA1 A;  2M72 A;  2JAD A;  2ZUP A;  1CQG A;  2H76 A;  3QCP A;  4MJC A;  3E9J B;  6GSY A;  4G0I A;  1B4P A;  3P7X A;  2YAN A;  1NSW A;  4EDZ A;  2N5B A;  1KEB A;  1GSF A;  1YY7 A;  4PI2 C;  1EOG A;  3F8U A;  1JZR A;  3VUR A;  3HVS A;  2UZ8 A;  3C8E A;  2B5E A;  2VO4 A;  1PD2 1;  2OBK A;  5EPF A;  3OR5 A;  2H6X A;  3MYD A;  4ICY A;  1FB0 A;  1A2M A;  3G9B A;  2CQ9 A;  4HOJ A;  3QD9 A;  3US3 A;  1LBK A;  1XCC A;  4AJ6 A;  1DE2 A;  4XTS A;  4N10 A;  5JWO B;  2JZT A;  4ZB9 A;  2V6K A;  4KDU A;  3IHQ A;  1EV4 A;  2C3T A;  1SU9 A;  2XBQ A;  2R0G A;  4LMW A;  5ECQ B;  3QAG A;  2PPT A;  1G7O A;  3VPQ A;  5AN1 A;  5HFG A;  1OE7 A;  1EP7 A;  3KIJ A;  2A4H A;  4Q5F A;  20GS A;  1YQ1 A;  2B7J A;  1ST9 A;  2LJA A;  2IMI A;  3GKM A;  2NDO A;  4YH2 A;  1K0C A;  3IV4 A;  3L9S A;  1K3L A;  2OJL A;  4IN0 A;  2K8V A;  4IQA A;  2LNS A;  5JWQ B;  4OFN A;  3R2Q A;  5CNW A;  2JZS A;  4ML6 A;  1GSY A;  4F82 A;  3P90 A;  1ZYE A;  3UVT A;  2TIR A;  5HR1 A;  3VI5 A;  5IOW A;  2XPE A;  1JZD A;  5G1K A;  1W89 A;  1ZYQ B;  3GN3 A;  1Z5Y E;  2GLR A;  1XIY A;  2HRA A;  1ERT A;  1I1I P;  1V57 A;  5HR3 A;  5J3R A;  2LRT A;  3ZTL A;  1PX6 A;  2VLT A;  3IDV A;  3WD6 A;  2GZY A;  3TJK A;  1GTI A;  4G01 A;  2CZ3 A;  1YEX A;  5DAK A;  4XS4 A;  3GL5 A;  3TOU A;  2L6D A;  5J9B A;  4ECI A;  1VGL A;  2F9S A;  1K0O A;  2FA8 A;  2H74 A;  1MTC A;  3GX8 A;  2G2Q A;  5EY6 A;  2B5X A;  2H70 A;  1J08 A;  2A4V A;  2H1B A;  2H8L A;  5IMF A;  4K9Z A;  1CQH A;  4PNF A;  3VWU A;  1VF4 A;  4G9H A;  2WB9 A;  3PH9 A;  1WIK A;  1JFU A;  3RGB C;  1SD8 A;  4FQU A;  1ABA A;  2MBT A;  2N5A A;  1SKS B;  2I1U A;  4PGT A;  2AHE A;  1TRW A;  2EIQ A;  2VUP A;  4ZBB A;  2BJX A;  4G2E A;  2LQO A;  4AKG A;  5HR0 A;  3DEX A;  2OT3 A;  2CVK A;  1WRY A;  4KW6 A;  5DQS A;  1R5P A;  1K3O A;  3KM6 A;  4KCA A;  1FG4 A;  2RM5 A;  4MPG A;  2O3E A;  1QXH A;  1VRS D;  4HZ4 A;  5DBQ A;  3RHC A;  1WOU A;  2LNT A;  3TKR A;  1C72 A;  4MF6 A;  2IPA A;  2X8G A;  4WEY A;  1X9M B;  2LRC A;  4JE1 A;  3V1W A;  3FEU A;  4KUN A;  4EC0 A;  1YF0 A;  2HLS A;  3ZMK A;  5BRT A;  4MA9 A;  2OAC A;  1AQV A;  4GST A;  5D9X A;  1J0F A;  5GST A;  7GSS A;  3CSH A;  3TKQ A;  1YJ6 A;  4EO3 A;  2VD1 A;  4IS0 A;  2DMM A;  1OE8 A;  4HDE A;  1OAZ A;  1AW9 A;  1LU4 A;  5DDL A;  2L4Q A;  1OC9 A;  5G5E A;  5D96 A;  3LXT A;  4RI7 A;  2KOK A;  3K8N A;  3GH6 A;  3APQ A;  3C1S A;  1M0U A;  3QAW A;  1NHO A;  1GLP A;  3UBL A;  3HY2 A;  2R0C A;  1BF5 A;  3WGE A;  3CTG A;  4PTS A;  19GS A;  2PUK C;  1Q98 A;  2RUE A;  4J56 E;  4TR1 A;  2JSZ A;  1SVL A;  2R2J A;  5H5S A;  1ZZY A;  2PVQ A;  4CY8 A;  1XWG A;  3IC4 A;  3LG6 A;  4I5Q A;  3ZL5 A;  2HXK A;  3A3T A;  3PPU A;  1M9B A;  2H1G A;  2P5R A;  2LJR A;  3F3Q A;  1JZO A;  2HYX A;  4GXZ A;  2CV4 A;  4W66 A;  3FMW A;  2M80 A;  1GRX A;  4OO4 A;  3JCM L;  1U3I A;  1G0T A;  1S3A A;  5ECP B;  4KSO A;  3ERW A;  4GLT A;  5D8I A;  4GQC A;  2GVP A;  2QA2 A;  4E8E A;  1Z7P A;  1OYJ A;  2DJ2 A;  2I4A A;  2YOI A;  2YZU A;  3HDC A;  4WBR D;  1PKZ A;  13GS A;  5L71 A;  1YF1 A;  4WET A;  2DSA A;  2VL2 C;  1F3A A;  1YKA A;  1OVN A;  4IEL A;  4KB3 A;  1NM3 A;  5BMU A;  1ZMA A;  3L9U A;  2H73 A;  2RII A;  2WRT A;  3F6D A;  2VCT A;  2V2G A;  2WDU A;  1TP9 A;  3FYG A;  2FHE A;  2FD3 A;  1QMV A;  2FGX A;  3EYT A;  2GT6 A;  5DJM A;  4ZL9 A;  4PUF C;  2E2G A;  4K0G A;  3E3E A;  4ECB A;  1PQN A;  5FT3 A;  3RDW A;  3KP8 A;  1XW6 A;  3TJG A;  1Q4J A;  4A5P A;  4PI0 C;  1ZYP A;  2LRN A;  2YJH A;  5E59 A;  3GV1 A;  4PUR A;  5DAK B;  4XS4 B;  4N0V A;  3R3E A;  1UN2 A;  1TJD A;  2LTK A;  3DXB A;  2IJY A;  1GSQ A;  1TTZ A;  4USS A;  1KNG A;  3HZ4 A;  5G1L A;  3O6T A;  4E8H A;  1V98 A;  2OKA A;  4HU7 A;  2CAQ A;  1TDI A;  3EUR A;  4MF7 A;  1RW1 A;  3A5I A;  4O5R A;  4BA7 A;  4MZB A;  1HNC A;  3W8S A;  3DRN A;  4FIW A;  1SYX A;  5FHI A;  5J4Y A;  2DKI A;  4TXV A;  1TK5 B;  3SBC A;  1QUW A;  3G7Y A;  4RQX A;  4OFM A;  4AKH A;  4GSN A;  1TI1 A;  4E68 A;  3EVI A;  3C73 A;  4EE0 A;  2WW0 A;  2XHF A;  5IPG A;  2G0F A;  1PFO A;  3HHV A;  4IJI A;  2UV8 G;  2C3N A;  4DSQ A;  2DC5 A;  5IMC A;  3KGK A;  1TW9 A;  4TKY A;  5J4V A;  4BPY A;  3H4K A;  2F51 A;  4O92 A;  1YDK A;  2RLI A;  4EVM A;  3DML A;  1O73 A;  1XWC A;  4TW5 A;  3GRX A;  2KP1 A;  1JLW A;  2ON5 A;  2OE3 A;  1G6Y A;  5FWG A;  1HQO A;  2IMK A;  5ECK B;  5GAP D;  2C0G A;  5DCH A;  1K0D A;  3CXG A;  2V41 A;  4ZL7 A;  1ZYN A;  4MAB A;  1ML6 A;  3Q6O A;  2FY6 A;  3M9J A;  3IC8 A;  3ZYW A;  4MK3 A;  2HSH A;  1VF2 A;  3CHX C;  1SYR A;  3A2X A;  2WS2 A;  3BBY A;  1OC9 B;  3U5R E;  1G6W A;  4X1U A;  5A1N A;  3ERG A;  3FR9 A;  5ECM B;  1GSS A;  2H0G A;  1GTA A;  5IMZ A;  1GLQ A;  4PXO A;  4I6X A;  3GUS A;  1UC7 A;  1S4B P;  4PQI A;  3FZ9 A;  4OCE A;  4HI7 A;  1GWC A;  4TR0 A;  2HE3 A;  4TR1 B;  1GSE A;  2GQM A;  2VCW A;  1SKW B;  4RI6 A;  5A4V A;  2FWH A;  1XZO A;  2TRC P;  1GNE A;  3GMF A;  1F9M A;  4YQM A;  1X9S B;  1WE0 A;  2IMF A;  2HSY A;  5F8B A;  2D2Z A;  3QR6 A;  2P31 A;  5A5H A;  1GUH A;  2N5F A;  4ZBA A;  2KP2 A;  2DJ1 A;  2WGR A;  3VWW A;  2A2P A;  3I6A A;  2H71 A;  2C80 A;  2E0Q A;  2YV9 A;  1PL1 A;  3N5O A;  2B7K A;  4IJ3 A;  1MD3 A;  4KF9 A;  2GQL A;  3ZFB A;  2CX4 A;  4Z2U A;  1A0F A;  3EE2 A;  3F0I A;  2KUC A;  4TOP A;  3DIE A;  4AGS A;  3MDK A;  2C4J A;  3VLN A;  3LW9 A;  4HS1 A;  3TJF A;  3UMA A;  4ZB6 A;  5KOX A;  4QL9 A;  2HFD A;  1SK1 A;  3GTU A;  5BMU B;  1G7E A;  1SJZ A;  1XWB A;  1HNA A;  1AC1 A;  4POK A;  3GNJ A;  5ABR A;  1K3Y A;  5COH A;  3G7I A;  2L5O A;  3TRP A;  3EU4 A;  3TJB A;  1PSQ A;  2DJ3 A;  2WZS A;  1ZL9 A;  4QQ7 A;  3HVX A;  3ZRD A;  3UBK A;  4BL7 A;  1V2A A;  5INY A;  2VLU A;  3D5J A;  4XRA A;  1ILO A;  3CTF A;  1GSU A;  5J47 A;  2QC7 A;  3GH9 A;  3EWL A;  5LD0 A;  3FR3 A;  5B8B A;  2RUF A;  2CVD A;  1QGV A;  1XOA A;  4K6X A;  4AI6 A;  3FKF A;  3EMX A;  2B1L A;  1TRU A;  3KZQ A;  3CRU A;  2AYT A;  4IW9 A;  1SL1 B;  1PX7 A;  2XBI A;  1WWJ A;  3FRC A;  1URM A;  1B4Q A;  5AIV A;  5CO3 A;  1T8E B;  2O87 A;  2O85 A;  3P2A A;  1M7T A;  4MF5 A;  2IL3 A;  4K7I A;  3VFI A;  4FYB A;  4K0N A;  4Q5R A;  22GS A;  5DQY A;  1XXU A;  3F6F A;  5GSS A;  3ZRE A;  4D73 A;  1Z6N A;  5IOX A;  1TKD B;  3C71 A;  2GST A;  3F4S A;  2R3X A;  4L0W A;  3F9U A;  5IQY A;  1LJR A;  2JAC A;  2ALB A;  2H66 A;  3KD0 A;  3VI7 A;  3WGX A;  2VAF A;  3BJ5 A;  2YWM A;  1A23 A;  2HRF A;  4MZW A;  3I9V 2;  1WP0 A;  1H4O A;  3KTL A;  2AUV A;  4FYU A;  4DEJ A;  5ID2 B;  4CHS A;  3BCK A;  3A2W A;  5ECH B;  2VL2 A;  2PBJ A;  2H0H A;  4I2T A;  1AAZ A;  2HQT A;  2HSN A;  2ZCT A;  1SKR B;  3GHA A;  2YV7 A;  3KCM A;  2E7P A;  6GST A;  1SVO A;  1ZGN A;  2R0P A;  1SL2 B;  3N9J A;  2HSM A;  3ISO A;  1OC8 A;  5DJL A;  2HNL A;  3CBU A;  1ZCP A;  2R6K A;  5J41 A;  4EIQ A;  3QDN A;  2C0E A;  3KMO A;  4HQZ A;  3PIN A;  2X49 A;  4WKW A;  3F63 A;  2FUG 2;  2H1D A;  1DE1 A;  4PQH A;  4PQ1 A;  1PRX A;  4OFT A;  3TGZ A;  2IME A;  1HNB A;  5A1N B;  5A4W A;  5CP1 A;  1U3A A;  2YCD A;  1FW1 A;  3NIV A;  4MDC A;  2H01 A;  1AIU A;  2KHP A;  1HD2 A;  3KH9 A;  2VCQ A;  3D21 A;  2LKU A;  3KXO A;  2EFC A;  3APS A;  2JZR A;  2B5Y A;  4XRD A;  5F0G A;  4WXT A;  4MNN A;  5KN3 A;  1A24 A;  1XWK A;  3PGT A;  3GIX A;  3DGQ A;  4BWQ A;  3MSZ A;  2X4A A;  3Q18 A;  4POM A;  1GH2 A;  2WW2 A;  4IP1 A;  1VF1 A;  4G0K A;  1F37 A;  1B9Y C;  2GT5 A;  3QFA C;  2HZF A;  2LS5 A;  3EMP A;  3QOU A;  4K2X A;  2R37 A;  4OCF A;  5A5H B;  1ON4 A;  2DBC A;  1JLV A;  1MDJ A;  3EPT A;  3GFK A;  4OD7 A;  2H72 A;  1O81 A;  2J23 A;  5EVO A;  3S9F A;  4ULX A;  1M9A A;  2VCV A;  2VD0 A;  3TKP A;  3FR6 A;  5EL8 A;  2LUS A;  3VPT A;  2KLX A;  2EC4 A;  1A0R P;  4CY6 A;  4BWS A;  4IQ1 A;  3IBH A;  5A34 A;  1XW5 A;  2OE0 A;  5B7C A;  4K8M A;  3VWX A;  2H6Z A;  2JU5 A;  3GKN A;  4RQR A;  1EWX A;  1YEP A;  5C00 A;  3GTU B;  4GDF A;  2VM1 A;  1PN0 A;  4EUY A;  1Z3E A;  4KCE A;  3HVN A;  3U6V A;  1Z7R A;  1F6M C;  2AAW A;  4V2N A;  1XBS A;  3UL3 A;  5IO2 A;  6GSS A;  2C3Q A;  2YWI A;  2DKH A;  1YEW C;  4HQS A;  3L9V A;  4V2M A;  2EFD A;  1SEN A;  3QFB C;  4BL7 B;  4KAE A;  5LNK e;  4RUV A;  3L78 A;  3FK8 A;  4N0Z A;  2CVB A;  5J4U A;  3IRA A;  1EGO A;  1M2D A;  4DVC A;  3ZVJ A;  4AJ7 A;  4F0B A;  5ECS A;  2O5V A;  2H19 A;  3RBT A;  5G2Z A;  1F3B A;  1FHE A;  3GKX A;  2VCZ A;  1AQW A;  2LEG A;  3H93 A;  2YNX A;  1FAA A;  2H30 A;  3UVH A;  2LQQ A;  1EV9 A;  1UA5 A;  4EIP A;  4ZBD A;  5A4U A;  1A2J A;  4ZIL A;  4MLY A;  5IIZ A;  2NBS A;  2VKZ G;  2NTO A;  4ZB7 A;  1EEM A;  1R26 A;  3MWH A;  5KN2 A;  5H5Q A;  5DVB A;  2FWE A;  2TRX A;  4V1A p;  4D73 B;  4LLR A;  4F03 A;  4YKF A;  2ZNM A;  3GX0 A;  2R5G A;  1K0M A;  2FWF A;  3DVX A;  3F4R A;  4ILF A;  2MMZ A;  5ENU A;  3ZIT A;  1QQ2 A;  1Z6M A;  4QL7 A;  4V2L A;  2X8C A;  8GSS A;  4ACS A;  3KTB A;  1PN9 A;  3IXR A;  2WVZ A;  3M0F A;  4G10 A;  4DSS A;  1X0R A;  1O7U A;  1THO A;  4H86 A;  1ERV A;  2GSQ A;  4OO5 A;  3HXS A;  1SVM A;  4MH3 A;  4F9Z A;  3RFR C;  2IWT A;  4MCU A;  4IKH A;  3C1R A;  4GWR A;  1GTB A;  2WVY A;  1BJX A;  3CMI A;  1W4V A;  2HSN B;  3HYP A;  1S3C A;  5F06 A;  5D9W A;  1PMT A;  2YN1 A;  1BAY A;  1RQM A;  1OC3 A;  2B6M A;  2HSM B;  1FVK A;  2L57 A;  4I97 A;  3QPM A;  5ECL B;  5ELG A;  1IYH A;  2DIZ A;  4TRX A;  5D9V A;  3TU3 B;  2O7K A;  4ECC A;  2R4V A;  1ERU A;  2A2S A;  3UOM A;  2C0D A;  5J5N A;  2FNO A;  1T4Y A;  1Z9H A;  2OAD A;  1FOH A;  1GUK A;  1R5A A;  2VLV A;  2EIR A;  2PGT A;  1JHB A;  4GTU A;  5G5F A;  3UIW A;  1FB6 A;  6GSW A;  2EIO A;  2I9H A;  5ID2 A;  2AJQ B;  2NPB A;  2E2M A;  3CYN A;  2REM A;  4BVX A;  5D9T A;  3TJJ A;  4JZQ A;  4BIK A;  4HU9 A;  3BCI A;  3NZN A;  4NXI A;  4XHM A;  4OMV A;  3TUE A;  1DBY A;  4HUA A;  2V32 A;  1V58 A;  1JZW A;  1TXX A;  1PA3 A;  2ON7 A;  2VL3 A;  2BTO T;  1MDK A;  4NAX A;  1MD4 A;  1THX A;  2L4C A;  3FZ5 A;  4JR4 A;  3HKR A;  5F07 A;  5DAL B;  5ECO B;  1X5E A;  1TU7 A;  4TXO B;  1N25 A;  1BG5 A;  3BD2 A;  3HVV A;  2K18 A;  3KP9 A;  4N30 A;  5A34 B;  2DJ0 A;  2QKE A;  2YP6 A;  4XCS A;  2JSY A;  5HFI A;  5JWR B;  2GQK A;  4K5R A;  4L8E A;  3M8N A;  3GSS A;  2K9F A;  3H79 A;  4IP6 A;  5JCW A;  2P5Q A;  2WCI A;  5C04 A;  2CA8 A;  5ECN B;  3CQF A;  2WVX A;  2YWN A;  5IPH A;  3D4M A;  4BVY A;  3LOR A;  3ZML A;  3EC3 A;  2YJ7 A;  1BG1 A;  2M46 A;  4X4J A;  5B6N A;  1SK0 A;  5ECR B;  3LSZ A;  3Q74 A;  5IO0 A;  2HRN A;  2WW1 A;  1XFL A;  3LEF A;  1EEJ A;  1NW2 A;  4JR6 A;  4EKZ A;  1XW9 A;  4CDO A;  4EL1 A;  3HJO A;  1Y25 A;  1V40 A;  4PNG A;  3GST A;  3G7J A;  4JBB A;  2H1L A; 
#chains in the Genus database with same CATH homology
 2WZ9 A;  3QAV A;  3A5W A;  3UJ1 A;  2GZZ A;  4CW9 A;  4Q5N A;  3HA9 A;  1T4Z A;  3LXZ A;  3PR8 A;  3ZIJ A;  5HR2 A;  2YZH A;  3GYK A;  5B8A A;  3EIN A;  2MZC A;  3WGD A;  2HT9 A;  4YKG A;  4Z2T A;  1U6T A;  3IK7 A;  3D4T A;  4X0X A;  2VCX A;  3FY7 A;  4EF0 A;  3F4T A;  2I81 A;  1X9W B;  1O6J A;  3W6G A;  2IIY A;  4KDX A;  2VM2 A;  2AV4 A;  4I2U A;  2GZP A;  3IE3 A;  5HFK A;  1GSD A;  2DIY A;  3DVW A;  3UEM A;  4N11 A;  4FH8 A;  1PL2 A;  2P0G A;  4IGJ A;  5AGY A;  4DSS B;  4AJ8 A;  3IHG A;  4XIH A;  3MNG A;  1XOB A;  2LV3 A;  2HRK A;  1GL8 A;  5ECI B;  3RPN A;  4O5Q A;  3VWV A;  3IAM 2;  2C0F A;  4ML1 A;  6GSV A;  2PWJ A;  4ZL8 A;  3F3R A;  1TU8 A;  2Z9S A;  5J40 A;  4V1A g;  1EGR A;  2DML A;  3H1N A;  5IM9 A;  1ZOF A;  3ME7 A;  1A2L A;  1K0N A;  1DSB A;  4WR5 A;  2O8V B;  2VIM A;  1ACV A;  1F2E A;  3WT2 A;  4NV5 A;  14GS A;  4L0U A;  2IN3 A;  3TCO A;  4KE3 A;  3A2V A;  5D93 A;  3H8Q A;  5CRG A;  1AQX A;  1SD9 A;  1TRS A;  3TKS C;  2JL4 A;  2IMD A;  4Z2R A;  1BED A;  4HJ2 A;  4BVX B;  5B6M A;  2X8H A;  3LYP A;  1BX9 A;  1EP8 A;  1RK4 A;  1A8L A;  3FHK A;  3NOF A;  1YKC A;  12GS A;  4MJB A;  4N3Z A;  3P8W A;  3IK9 A;  3W8J A;  5H5R A;  1XVW A;  4QMK A;  4J2F A;  1GUL A;  3UAP A;  1WJK A;  3ZLP A;  3HJM A;  4MJA A;  10GS A;  2FLS A;  2OBI A;  4KH7 A;  4Z7X A;  11GS A;  2PVO C;  5IMV A;  1GP1 A;  3O3T A;  4MPF A;  3GUR A;  2H75 A;  4KND A;  5KOW A;  1S3D A;  4EXJ A;  3KEB A;  3RPP A;  5JCU A;  3J7Y b;  3AY8 A;  1O8W A;  1M2A A;  1TK8 B;  2MBS A;  4O5U A;  1B9X C;  3ERF A;  2F3M A;  2QGV A;  4YAP A;  4J57 E;  5HQP A;  3MIX A;  6GSX A;  1TRV A;  3DWV A;  1I5G A;  1AUC A;  3TB2 A;  3L4N A;  4G0L A;  1M99 A;  4ZXG A;  4K7O A;  4POB A;  3VK9 A;  1YZX A;  4BVY B;  1EOH A;  1BYE A;  3CSJ A;  4LL1 B;  4YQU A;  4K5S A;  2RM6 A;  1HYU A;  2C1Y A;  1E6B A;  3FZA A;  2CT6 A;  2QA1 A;  1Y1U A;  5AIX A;  1WPI A;  4FYC A;  3DYR A;  3TRQ A;  3Q19 A;  2L59 A;  3WYW A;  2HZE A;  2DJK A;  5DAL A;  2VL9 A;  4TXO A;  3M3M A;  1T00 A;  3D0Z A;  5F05 A;  2MMA A;  3RHB A;  2GSR A;  4WR4 A;  4P3Y B;  5CRW A;  1FOV A;  3TOT A;  2F8F A;  2MYG A;  4YQV A;  2GTU A;  4PX1 A;  4K1F A;  2NVL A;  1I9D A;  4I8B A;  4IBP A;  4G19 A;  4YAV A;  1NHY A;  3ZVJ D;  1Y6E A;  2DJJ A;  2WUL A;  1FVJ A;  3LWA A;  3IOS A;  3HCZ A;  2EFH A;  1TK0 B;  5CAX A;  1K0A A;  1QFN A;  4XS6 A;  3HZ8 A;  3CRT A;  1H75 A;  3LFL A;  4L5L A;  5JCG A;  2IFQ A;  4LA1 A;  2QSI A;  4KGI A;  1B48 A;  3L0H A;  1GUM A;  2CZ2 A;  4JU5 A;  1GNW A;  5G30 A;  3D6I A;  2GGT A;  2WFC A;  2OE1 A;  5D73 A;  4FO5 A;  4OWY A;  3ZFL A;  1WMJ A;  4AKX B;  1T7P B;  4TVE A;  2O89 A;  5IMD A;  2HRK B;  2FA4 A;  3BOA A;  1PKW A;  4TR4 A;  2PN8 A;  1U88 A;  2B3S A;  1KBN A;  3I69 A;  1EZK A;  3DKS A;  2MMN A;  5J9C A;  3C7M A;  5LCZ A;  4F0C A;  1U87 A;  4NMU A;  1TXU A;  4NWY A;  4PUA A;  3RAZ A;  2A2R A;  2PU9 C;  2H6Y A;  4GCI A;  3IPZ A;  1X5D A;  5A5K A;  4L5O A;  1KTE A;  4AKI A;  3IR4 A;  4HEA 2;  4IHU A;  4K2D A;  1SJI A;  5ELA A;  1O85 A;  1N2A A;  4KX4 A;  4KSM A;  2PER A;  4ZIJ A;  1XPV A;  4GSS A;  2B1K A;  5CRH A;  3D22 A;  4NV2 A;  4JED A;  1DUG A;  1O8X A;  3ZZX A;  3GA4 A;  3MAK A;  2LJK A;  1ERW A;  3HJP A;  2FCH A;  3GKK A;  4GQF A;  1XVQ A;  4ZB8 A;  1J9B A;  3WT1 A;  1K0B A;  2EFE A;  3QMX A;  2PMT A;  2C8U A;  3FZ4 A;  4ID0 A;  1QK8 A;  2GS3 A;  2HI7 A;  3LGC A;  2K6V A;  2V1M A;  2L5L A;  2F8A A;  1MEK A;  3IAS 2;  17GS A;  4MMM A;  2MMO A;  2X99 A;  4O32 A;  4NHW A;  4MJE A;  1T1V A;  5KN1 A;  4IVF A;  3TDG A;  4O7H A;  4F2I A;  3ZIV A;  3TKS E;  3E0U A;  3GL3 A;  1X5C A;  2LST A;  4NPB A;  5CRD A;  3ME8 A;  1MDI A;  3CWG A;  3FW2 A;  4AF2 A;  3ED3 A;  4XS1 A;  2OA7 A;  5KN0 A;  2H1A A;  4LL4 B;  4WF5 A;  1XWA A;  4TR3 A;  18GS A;  2GDR A;  1R7H A;  4X43 A;  2GSS A;  16GS A;  4MP4 A;  5IMA A;  3EU3 A;  2BMX A;  4K7N A;  5G31 A;  2WJU A;  5DCG A;  1BQ7 A;  2K8S A;  2L6C A;  3HD5 A;  2X64 A;  3LJR A;  2H0I A;  2YWO A;  4HJM A;  1T3B A;  3I43 A;  4HZ2 A;  2HZE B;  3SWL A;  1E2Y A;  1GTU A;  1PGT A;  1TOF A;  1OKT A;  2CAI A;  5CYY A;  5KEJ A;  4DSR A;  3TRX A;  4ISD A;  3KH7 A;  1SJ6 A;  1VF3 A;  4LMV A;  4GRF A;  4POL A;  3TKS A;  2AB6 A;  4NHZ A;  5E4W A;  2DLX A;  2YPM A;  1TI3 A;  2FWG A;  1FO5 A;  3DD3 A;  4EDY A;  1V9W A;  2I3Y A;  1OKD A;  4Q5Q A;  5AIS A;  3HMJ G;  5CRE A;  4KDY A;  2CX3 A;  4WBJ A;  3O76 A;  3UAR A;  6GSU A;  4GF0 A;  3KJY A;  1SL0 B;  1N8J A;  1IYI A;  4KA0 A;  4TN8 A;  3KMN A;  2IFQ B;  2XC2 A;  2J9H A;  1M2B A;  3APO A;  1AXD A;  3M9K A;  2ES7 A;  2VOC A;  4MZC A;  5GAN D;  3M1G A;  4JRR A;  3J7Y k;  5GZZ B;  1UVZ A;  1R4W A;  2XPD A;  3LQ7 A;  1SK2 A;  4MH2 A;  9GSS A;  2V6O A;  1USB A;  1YVL A;  1B8X A;  3LYK A;  1A8Y A;  4WF4 A;  3CSI A;  4ECJ A;  3IA1 A;  2M72 A;  2JAD A;  2ZUP A;  1CQG A;  2H76 A;  3QCP A;  4MJC A;  3E9J B;  6GSY A;  4G0I A;  1B4P A;  3P7X A;  2YAN A;  1NSW A;  4EDZ A;  2N5B A;  1KEB A;  1GSF A;  1YY7 A;  1EOG A;  3F8U A;  1JZR A;  3VUR A;  3HVS A;  2UZ8 A;  3C8E A;  2B5E A;  2VO4 A;  1PD2 1;  2OBK A;  5EPF A;  3OR5 A;  2H6X A;  3MYD A;  4ICY A;  1FB0 A;  1A2M A;  3G9B A;  2CQ9 A;  4HOJ A;  3QD9 A;  3US3 A;  1LBK A;  1XCC A;  4AJ6 A;  1DE2 A;  4XTS A;  4N10 A;  5JWO B;  2JZT A;  4ZB9 A;  2V6K A;  4KDU A;  3IHQ A;  1EV4 A;  2C3T A;  1SU9 A;  2XBQ A;  2R0G A;  4LMW A;  5ECQ B;  3QAG A;  2PPT A;  1G7O A;  3VPQ A;  5AN1 A;  5HFG A;  1OE7 A;  1EP7 A;  3KIJ A;  2A4H A;  4Q5F A;  20GS A;  1YQ1 A;  2B7J A;  1ST9 A;  2LJA A;  2IMI A;  3GKM A;  2NDO A;  4YH2 A;  1K0C A;  3IV4 A;  3L9S A;  1K3L A;  2OJL A;  4IN0 A;  2K8V A;  4IQA A;  2LNS A;  5JWQ B;  4OFN A;  3R2Q A;  5CNW A;  2JZS A;  4ML6 A;  1GSY A;  4F82 A;  3P90 A;  1ZYE A;  3UVT A;  2TIR A;  5HR1 A;  3VI5 A;  5IOW A;  2XPE A;  1JZD A;  5G1K A;  1W89 A;  1ZYQ B;  3GN3 A;  1Z5Y E;  2GLR A;  1XIY A;  2HRA A;  1ERT A;  1V57 A;  5HR3 A;  5J3R A;  2LRT A;  3ZTL A;  1PX6 A;  2VLT A;  3IDV A;  3WD6 A;  2GZY A;  3TJK A;  1GTI A;  4G01 A;  2CZ3 A;  1YEX A;  5DAK A;  4XS4 A;  3GL5 A;  3TOU A;  2L6D A;  5J9B A;  4ECI A;  1VGL A;  2F9S A;  1K0O A;  2FA8 A;  2H74 A;  1MTC A;  3GX8 A;  2G2Q A;  5EY6 A;  2B5X A;  2H70 A;  1J08 A;  2A4V A;  2H1B A;  2H8L A;  5IMF A;  4K9Z A;  1CQH A;  4PNF A;  3VWU A;  1VF4 A;  4G9H A;  2WB9 A;  3PH9 A;  1WIK A;  1JFU A;  1SD8 A;  4FQU A;  1ABA A;  2MBT A;  2N5A A;  1SKS B;  2I1U A;  4PGT A;  2AHE A;  1TRW A;  2EIQ A;  2VUP A;  4ZBB A;  2BJX A;  4G2E A;  2LQO A;  4AKG A;  5HR0 A;  3DEX A;  2OT3 A;  2CVK A;  1WRY A;  4KW6 A;  5DQS A;  1R5P A;  1K3O A;  3KM6 A;  4KCA A;  1FG4 A;  2RM5 A;  4MPG A;  1QXH A;  1VRS D;  4HZ4 A;  5DBQ A;  3RHC A;  1WOU A;  2LNT A;  3TKR A;  1C72 A;  4MF6 A;  2IPA A;  2X8G A;  4WEY A;  1X9M B;  2LRC A;  4JE1 A;  3V1W A;  3FEU A;  4KUN A;  4EC0 A;  1YF0 A;  2HLS A;  3ZMK A;  5BRT A;  4MA9 A;  2OAC A;  1AQV A;  4GST A;  5D9X A;  1J0F A;  5GST A;  7GSS A;  3CSH A;  3TKQ A;  1YJ6 A;  4EO3 A;  2VD1 A;  4IS0 A;  2DMM A;  1OE8 A;  4HDE A;  1OAZ A;  1AW9 A;  1LU4 A;  5DDL A;  2L4Q A;  1OC9 A;  5G5E A;  5D96 A;  3LXT A;  4RI7 A;  2KOK A;  3K8N A;  3GH6 A;  3APQ A;  3C1S A;  1M0U A;  3QAW A;  1NHO A;  1GLP A;  3UBL A;  3HY2 A;  2R0C A;  1BF5 A;  3WGE A;  3CTG A;  4PTS A;  19GS A;  2PUK C;  1Q98 A;  2RUE A;  4J56 E;  4TR1 A;  2JSZ A;  1SVL A;  2R2J A;  5H5S A;  1ZZY A;  2PVQ A;  4CY8 A;  1XWG A;  3IC4 A;  3LG6 A;  4I5Q A;  3ZL5 A;  2HXK A;  3A3T A;  3PPU A;  1M9B A;  2H1G A;  2P5R A;  2LJR A;  3F3Q A;  1JZO A;  2HYX A;  4GXZ A;  2CV4 A;  4W66 A;  3FMW A;  2M80 A;  1GRX A;  4OO4 A;  3JCM L;  1U3I A;  1G0T A;  1S3A A;  5ECP B;  4KSO A;  3ERW A;  4GLT A;  5D8I A;  4GQC A;  2GVP A;  2QA2 A;  4E8E A;  1Z7P A;  1OYJ A;  2DJ2 A;  2I4A A;  2YOI A;  2YZU A;  3HDC A;  4WBR D;  1PKZ A;  13GS A;  5L71 A;  1YF1 A;  4WET A;  2DSA A;  2VL2 C;  1F3A A;  1YKA A;  1OVN A;  4IEL A;  4KB3 A;  1NM3 A;  5BMU A;  1ZMA A;  3L9U A;  2H73 A;  2RII A;  2WRT A;  3F6D A;  2VCT A;  2V2G A;  2WDU A;  1TP9 A;  3FYG A;  2FHE A;  2FD3 A;  1QMV A;  2FGX A;  3EYT A;  2GT6 A;  5DJM A;  4ZL9 A;  4PUF C;  2E2G A;  4K0G A;  3E3E A;  4ECB A;  1PQN A;  5FT3 A;  3RDW A;  3KP8 A;  1XW6 A;  3TJG A;  1Q4J A;  4A5P A;  1ZYP A;  2LRN A;  2YJH A;  5E59 A;  3GV1 A;  4PUR A;  5DAK B;  4XS4 B;  4N0V A;  3R3E A;  1UN2 A;  1TJD A;  2LTK A;  3DXB A;  2IJY A;  1GSQ A;  1TTZ A;  4USS A;  1KNG A;  3HZ4 A;  5G1L A;  3O6T A;  4E8H A;  1V98 A;  2OKA A;  4HU7 A;  2CAQ A;  1TDI A;  3EUR A;  4MF7 A;  1RW1 A;  3A5I A;  4O5R A;  4BA7 A;  4MZB A;  1HNC A;  3W8S A;  3DRN A;  4FIW A;  1SYX A;  5FHI A;  5J4Y A;  2DKI A;  4TXV A;  1TK5 B;  3SBC A;  1QUW A;  3G7Y A;  4RQX A;  4OFM A;  4AKH A;  4GSN A;  1TI1 A;  4E68 A;  3EVI A;  3C73 A;  4EE0 A;  2XHF A;  5IPG A;  2G0F A;  3HHV A;  4IJI A;  2UV8 G;  2C3N A;  4DSQ A;  2DC5 A;  5IMC A;  3KGK A;  1TW9 A;  4TKY A;  5J4V A;  4BPY A;  3H4K A;  2F51 A;  4O92 A;  1YDK A;  2RLI A;  4EVM A;  3DML A;  1O73 A;  1XWC A;  4TW5 A;  3GRX A;  2KP1 A;  1JLW A;  2ON5 A;  2OE3 A;  1G6Y A;  5FWG A;  1HQO A;  2IMK A;  5ECK B;  5GAP D;  2C0G A;  5DCH A;  1K0D A;  3CXG A;  2V41 A;  4ZL7 A;  1ZYN A;  4MAB A;  1ML6 A;  3Q6O A;  2FY6 A;  3M9J A;  3IC8 A;  3ZYW A;  4MK3 A;  2HSH A;  1VF2 A;  1SYR A;  3A2X A;  2WS2 A;  3BBY A;  1OC9 B;  3U5R E;  1G6W A;  4X1U A;  5A1N A;  3ERG A;  3FR9 A;  5ECM B;  1GSS A;  2H0G A;  1GTA A;  5IMZ A;  1GLQ A;  4PXO A;  4I6X A;  3GUS A;  1UC7 A;  4PQI A;  3FZ9 A;  4OCE A;  4HI7 A;  1GWC A;  4TR0 A;  2HE3 A;  4TR1 B;  1GSE A;  2GQM A;  2VCW A;  1SKW B;  4RI6 A;  5A4V A;  2FWH A;  1XZO A;  2TRC P;  1GNE A;  3GMF A;  1F9M A;  4YQM A;  1X9S B;  1WE0 A;  2IMF A;  2HSY A;  5F8B A;  2D2Z A;  3QR6 A;  2P31 A;  5A5H A;  1GUH A;  2N5F A;  4ZBA A;  2KP2 A;  2DJ1 A;  2WGR A;  3VWW A;  2A2P A;  3I6A A;  2H71 A;  2C80 A;  2E0Q A;  2YV9 A;  1PL1 A;  3N5O A;  2B7K A;  4IJ3 A;  1MD3 A;  4KF9 A;  2GQL A;  3ZFB A;  2CX4 A;  4Z2U A;  1A0F A;  3EE2 A;  3F0I A;  2KUC A;  4TOP A;  3DIE A;  4AGS A;  3MDK A;  2C4J A;  3VLN A;  3LW9 A;  4HS1 A;  3TJF A;  3UMA A;  4ZB6 A;  5KOX A;  4QL9 A;  2HFD A;  1SK1 A;  3GTU A;  5BMU B;  1G7E A;  1SJZ A;  1XWB A;  1HNA A;  1AC1 A;  4POK A;  3GNJ A;  5ABR A;  1K3Y A;  5COH A;  3G7I A;  2L5O A;  3TRP A;  3EU4 A;  3TJB A;  1PSQ A;  2DJ3 A;  1ZL9 A;  4QQ7 A;  3HVX A;  3ZRD A;  3UBK A;  4BL7 A;  1V2A A;  5INY A;  2VLU A;  3D5J A;  4XRA A;  1ILO A;  3CTF A;  1GSU A;  5J47 A;  2QC7 A;  3GH9 A;  3EWL A;  5LD0 A;  3FR3 A;  5B8B A;  2RUF A;  2CVD A;  1QGV A;  1XOA A;  4K6X A;  4AI6 A;  3FKF A;  3EMX A;  2B1L A;  1TRU A;  3KZQ A;  3CRU A;  2AYT A;  4IW9 A;  1SL1 B;  1PX7 A;  2XBI A;  1WWJ A;  3FRC A;  1URM A;  1B4Q A;  5AIV A;  5CO3 A;  1T8E B;  2O87 A;  2O85 A;  3P2A A;  1M7T A;  4MF5 A;  2IL3 A;  4K7I A;  3VFI A;  4FYB A;  4K0N A;  4Q5R A;  22GS A;  5DQY A;  1XXU A;  3F6F A;  5GSS A;  3ZRE A;  4D73 A;  1Z6N A;  5IOX A;  1TKD B;  3C71 A;  2GST A;  3F4S A;  2R3X A;  4L0W A;  3F9U A;  5IQY A;  1LJR A;  2JAC A;  2ALB A;  2H66 A;  3KD0 A;  3VI7 A;  3WGX A;  2VAF A;  3BJ5 A;  2YWM A;  1A23 A;  2HRF A;  4MZW A;  3I9V 2;  1WP0 A;  1H4O A;  3KTL A;  2AUV A;  4FYU A;  4DEJ A;  5ID2 B;  4CHS A;  3BCK A;  3A2W A;  5ECH B;  2VL2 A;  2PBJ A;  2H0H A;  4I2T A;  1AAZ A;  2HQT A;  2HSN A;  2ZCT A;  1SKR B;  3GHA A;  2YV7 A;  3KCM A;  2E7P A;  6GST A;  1SVO A;  1ZGN A;  2R0P A;  1SL2 B;  3N9J A;  2HSM A;  3ISO A;  1OC8 A;  5DJL A;  2HNL A;  3CBU A;  1ZCP A;  2R6K A;  5J41 A;  4EIQ A;  3QDN A;  2C0E A;  3KMO A;  4HQZ A;  3PIN A;  2X49 A;  4WKW A;  3F63 A;  2FUG 2;  2H1D A;  1DE1 A;  4PQH A;  4PQ1 A;  1PRX A;  4OFT A;  3TGZ A;  2IME A;  1HNB A;  5A1N B;  5A4W A;  5CP1 A;  1U3A A;  2YCD A;  1FW1 A;  3NIV A;  4MDC A;  2H01 A;  1AIU A;  2KHP A;  1HD2 A;  3KH9 A;  2VCQ A;  3D21 A;  2LKU A;  3KXO A;  2EFC A;  3APS A;  2JZR A;  2B5Y A;  4XRD A;  5F0G A;  4WXT A;  4MNN A;  5KN3 A;  1A24 A;  1XWK A;  3PGT A;  3GIX A;  3DGQ A;  4BWQ A;  3MSZ A;  2X4A A;  3Q18 A;  4POM A;  1GH2 A;  4IP1 A;  1VF1 A;  4G0K A;  1F37 A;  1B9Y C;  2GT5 A;  3QFA C;  2HZF A;  2LS5 A;  3EMP A;  3QOU A;  4K2X A;  2R37 A;  4OCF A;  5A5H B;  1ON4 A;  2DBC A;  1JLV A;  1MDJ A;  3EPT A;  3GFK A;  4OD7 A;  2H72 A;  1O81 A;  2J23 A;  5EVO A;  3S9F A;  4ULX A;  1M9A A;  2VCV A;  2VD0 A;  3TKP A;  3FR6 A;  5EL8 A;  2LUS A;  3VPT A;  2KLX A;  2EC4 A;  1A0R P;  4CY6 A;  4BWS A;  4IQ1 A;  3IBH A;  5A34 A;  1XW5 A;  2OE0 A;  5B7C A;  4K8M A;  3VWX A;  2H6Z A;  2JU5 A;  3GKN A;  4RQR A;  1EWX A;  1YEP A;  5C00 A;  3GTU B;  4GDF A;  2VM1 A;  1PN0 A;  4EUY A;  1Z3E A;  4KCE A;  3U6V A;  1Z7R A;  1F6M C;  2AAW A;  4V2N A;  1XBS A;  3UL3 A;  5IO2 A;  6GSS A;  2C3Q A;  2YWI A;  2DKH A;  4HQS A;  3L9V A;  4V2M A;  2EFD A;  1SEN A;  3QFB C;  4BL7 B;  4KAE A;  5LNK e;  4RUV A;  3L78 A;  3FK8 A;  4N0Z A;  2CVB A;  5J4U A;  3IRA A;  1EGO A;  1M2D A;  4DVC A;  3ZVJ A;  4AJ7 A;  4F0B A;  5ECS A;  2O5V A;  2H19 A;  3RBT A;  5G2Z A;  1F3B A;  1FHE A;  3GKX A;  2VCZ A;  1AQW A;  2LEG A;  3H93 A;  2YNX A;  1FAA A;  2H30 A;  3UVH A;  2LQQ A;  1EV9 A;  1UA5 A;  4EIP A;  4ZBD A;  5A4U A;  1A2J A;  4ZIL A;  4MLY A;  5IIZ A;  2NBS A;  2VKZ G;  2NTO A;  4ZB7 A;  1EEM A;  1R26 A;  3MWH A;  5KN2 A;  5H5Q A;  5DVB A;  2FWE A;  2TRX A;  4V1A p;  4D73 B;  4LLR A;  4F03 A;  4YKF A;  2ZNM A;  3GX0 A;  2R5G A;  1K0M A;  2FWF A;  3DVX A;  3F4R A;  4ILF A;  2MMZ A;  5ENU A;  3ZIT A;  1QQ2 A;  1Z6M A;  4QL7 A;  4V2L A;  2X8C A;  8GSS A;  4ACS A;  3KTB A;  1PN9 A;  3IXR A;  3M0F A;  4G10 A;  4DSS A;  1X0R A;  1O7U A;  1THO A;  4H86 A;  1ERV A;  2GSQ A;  4OO5 A;  3HXS A;  1SVM A;  4MH3 A;  4F9Z A;  2IWT A;  4MCU A;  4IKH A;  3C1R A;  4GWR A;  1GTB A;  1BJX A;  3CMI A;  1W4V A;  2HSN B;  3HYP A;  1S3C A;  5F06 A;  5D9W A;  1PMT A;  2YN1 A;  1BAY A;  1RQM A;  1OC3 A;  2B6M A;  2HSM B;  1FVK A;  2L57 A;  4I97 A;  3QPM A;  5ECL B;  5ELG A;  1IYH A;  2DIZ A;  4TRX A;  5D9V A;  3TU3 B;  2O7K A;  4ECC A;  2R4V A;  1ERU A;  2A2S A;  3UOM A;  2C0D A;  5J5N A;  2FNO A;  1T4Y A;  1Z9H A;  2OAD A;  1FOH A;  1GUK A;  1R5A A;  2VLV A;  2EIR A;  2PGT A;  1JHB A;  4GTU A;  5G5F A;  3UIW A;  1FB6 A;  6GSW A;  2EIO A;  2I9H A;  5ID2 A;  2AJQ B;  2E2M A;  2NPB A;  3CYN A;  2REM A;  4BVX A;  5D9T A;  3TJJ A;  4JZQ A;  4HU9 A;  3BCI A;  3NZN A;  4NXI A;  4XHM A;  4OMV A;  3TUE A;  1DBY A;  4HUA A;  2V32 A;  1V58 A;  1JZW A;  1TXX A;  1PA3 A;  2ON7 A;  2VL3 A;  2BTO T;  1MDK A;  4NAX A;  1MD4 A;  1THX A;  2L4C A;  3FZ5 A;  4JR4 A;  3HKR A;  5F07 A;  5DAL B;  5ECO B;  1X5E A;  1TU7 A;  4TXO B;  1N25 A;  1BG5 A;  3BD2 A;  3HVV A;  2K18 A;  3KP9 A;  4N30 A;  5A34 B;  2DJ0 A;  2QKE A;  2YP6 A;  4XCS A;  2JSY A;  5HFI A;  5JWR B;  2GQK A;  4K5R A;  4L8E A;  3M8N A;  3GSS A;  2K9F A;  3H79 A;  4IP6 A;  5JCW A;  2P5Q A;  2WCI A;  5C04 A;  2CA8 A;  5ECN B;  2YWN A;  5IPH A;  3D4M A;  4BVY A;  3LOR A;  3ZML A;  3EC3 A;  2YJ7 A;  1BG1 A;  2M46 A;  4X4J A;  5B6N A;  1SK0 A;  5ECR B;  3LSZ A;  3Q74 A;  5IO0 A;  2HRN A;  1XFL A;  3LEF A;  1EEJ A;  1NW2 A;  4JR6 A;  4EKZ A;  1XW9 A;  4CDO A;  4EL1 A;  3HJO A;  1Y25 A;  1V40 A;  4PNG A;  3GST A;  3G7J A;  4JBB A;  2H1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...