5BMUB

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
166
structure length
166
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/ligase
total genus 50
structure length 166
sequence length 166
chains with identical sequence D, F, H
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuB00
4AI6A 5A34A 5BMUB 4AKIA 5A1NB 5A1NA 4AKGA 4ZB7A 5A5HA 4W66A 5A5HB 4AKHA 5A34B
chains in the Genus database with same CATH superfamily
4YQUA 5BMUA 1NHYA 3TOUA 5GZZB 3CRTA 3Q74A 3IK9A 4MF7A 2EFEA 2O3EA 3M8NA 2CA8A 1TU8A 1GSYA 2ON7A 2A2SA 1K0CA 3ERFA 3U6VA 3D0ZA 4IKHA 10GSA 5J5NA 4G0IA 4GSNA 1HNCA 3G7IA 4IW9A 4O7HA 1B4PA 1TU7A 1GNWA 1JLWA 3KMOA 3MAKA 5F07A 2VO4A 4GLTA 1EV9A 5LCZA 2C3QA 4MK3A 3CBUA 4K0NA 2GSSA 4ECCA 4F0BA 4EE0A 3PPUA 3IR4A 2F3MA 1XW6A 3CHXC 3FR6A 4YAPA 1GSFA 17GSA 4KF9A 5D9WA 2YCDA 3Q19A 2GDRA 4IBPA 4WR5A 1PKWA 6GSUA 5D73A 4DEJA 5F8BA 4E8HA 4AI6A 3ISOA 2R3XA 5JCUA 4GSTA 4ZB8A 3LYKA 1IYHA 1V40A 4LMVA 4IS0A 4ZBDA 2N5FA 1YY7A 3M1GA 5ECNB 1B8XA 2GSTA 1PMTA 5F05A 2HQTA 5DJMA 9GSSA 3P90A 3CRUA 5AIVA 2VD1A 4KE3A 2VD0A 2PERA 1S4BP 1FW1A 1FHEA 2OACA 3R3EA 2HSNA 1MTCA 4YAVA 1IYIA 1GLQA 1GSDA 1SVOA 4FQUA 4G19A 3GSTA 2C80A 4PQHA 1EV4A 1GNEA 4USSA 3UVHA 4JBBA 4PHZC 1M0UA 2DSAA 5GSSA 4PXOA 4E8EA 1YJ6A 4PUAA 2PGTA 5J40A 3VPQA 5ECMB 1M9AA 5GSTA 1U3IA 4W66A 2A2RA 1ZGNA 4ID0A 3TGZA 6GSSA 5KEJA 4J2FA 3L0HA 3TU3B 1DUGA 1K0AA 4NAXA 2WVZA 1Q4JA 4G10A 5A5HA 4IJIA 2WW1A 4JZQA 2YV7A 4IGJA 1F3AA 3TOTA 1R5AA 5IQYA 2WVYA 1AXDA 2VCQA 6GSXA 4KSMA 1BAYA 2CVDA 1V2AA 1VF1A 2EFCA 2GLRA 1VF3A 3VLNA 4ISDA 1K0OA 3CWGA 1Y1UA 1UA5A 2AHEA 4G0LA 1YKCA 4GTUA 1YVLA 4HI7A 4ZB7A 3N5OA 20GSA 2HSMB 2VCVA 19GSA 3N9JA 4HZ4A 3O3TA 4I97A 5ECPB 1AQWA 1HNAA 4KDXA 3DD3A 3GUSA 4G01A 1YDKA 2C3TA 3F63A 3GSSA 3QAVA 4IELA 3GH6A 1K0DA 3DGQA 2CZ3A 3FY7A 5A34B 3EE2A 3SWLA 1ZL9A 4YQVA 1Y6EA 3KM6A 2D2ZA 4ECBA 1SVLA 1M9BA 3VI7A 4YQMA 3ZFBA 4AKXB 2UV8G 4IVFA 4KGIA 5EVOA 3KJYA 2HSMA 5F06A 4HOJA 3KTLA 1EEMA 2GSQA 5EL8A 3IBHA 4MP4A 4ZB9A 2HSNB 3IE3A 1USBA 4AKHA 1VF2A 4G9HA 3P8WA 6GSWA 3FR3A 4QQ7A 2DC5A 5AN1A 5D9XA 1Z9HA 2O36A 1GSQA 1N25A 4Q5RA 3LG6A 1G7OA 3FR9A 5A34A 3HKRA 2IL3A 3NIVA 2CAQA 4F0CA 4BVXA 5FT3A 3HJMA 3LXZA 3CSIA 3GX0A 4F03A 13GSA 4N0VA 2GTUA 3PGTA 1GUHA 5ECKB 4MF6A 5A5HB 1K3OA 1GTIA 4PX1A 5J41A 4ZB6A 4OFTA 2JL4A 2HRKA 5FHIA 3UBLA 1OE7A 2H1LA 1F2EA 1PX6A 4PI2C 5DCGA 4BL7B 8GSSA 1N2AA 2WDUA 1BX9A 4Q5FA 3F6FA 3IC8A 4Q5QA 1PKZA 3LSZA 2PMTA 4GSSA 2WRTA 4ECIA 3LQ7A 2F8FA 1PN9A 4RI6A 1I1IP 4WR4A 3VURA 4IQAA 1TDIA 2PVQA 3Q18A 4TOPA 5HFKA 1GLPA 1MD4A 3GTUB 3ZMKA 14GSA 4EDYA 4PNGA 6GSYA 5AIXA 4JEDA 2AB6A 4PURA 4PI0C 1XWGA 3RGBC 4G0KA 1K0NA 4AGSA 5DJLA 4BL7A 1BG1A 4MZWA 5DDLA 2CAIA 3LYPA 5J47A 6GSTA 2ON5A 1PA3A 1E6BA 12GSA 1K0MA 2WVXB 2VKZG 3MDKA 5ECSA 4QMKA 2EFDA 3GTUA 3GURA 1GSEA 2J9HA 2WB9A 3H1NA 5DAKB 2NTOA 1ML6A 2C8UA 3FRCA 5AISA 4NHWA 4RI7A 1BG5A 5JCWA 1PL2A 3QAGA 2C3NA 5ECOB 5LD0A 7GSSA 3QR6A 1GSSA 4ACSA 1EOGA 1F3BA 2EFHA 3ZFLA 5A4VA 5J4UA 5EY6A 2IMKA 4EDZA 2FNOA 4OFMA 1B48A 4HJ2A 4GDFA 4FXYP 5F0GA 4BVXB 5A5KA 5ECRB 4BVYB 2AAWA 2UZ8A 1AW9A 2WJUA 3CSHA 3WYWA 1PX7A 2WW2A 2OT3A 3I6AA 3KXOA 1K3LA 2WVXA 5A4UA 1SVMA 2CZ2A 5A4WA 3M3MA 5FWGA 1AQVA 4L5LA 4ZXGA 3VI5A 1OE8A 2HRKB 5DAKA 3CSJA 3AY8A 4ZBBA 2R4VA 5ECQB 1JLVA 3KMNA 1YEWC 3EINA 1G6YA 5D9TA 2X64A 1GUMA 2O5VA 1KBNA 1TW9A 2WS2A 5ELAA 1PD21 1GSUA 2HRAA 3I69A 5DALB 4OFNA 5ECHB 3RBTA 5ECLB 1LJRA 1PL1A 4BVYA 4GF0A 4OMVA 1C72A 2LJRA 2PBJA 2IMIA 4ZBAA 4PQIA 5D9VA 1VF4A 3F6DA 3ERGA 3UBKA 5ECIB 11GSA 16GSA 1PGTA 2R5GA 3UARA 1HNBA 1YQ1A 3RFRC 4KDUA 4MF5A 5ELGA 4MPFA 3HMJG 4O92A 2VCZA 1OKTA 4LMWA 3M0FA 1MD3A 3UAPA 1XW5A 2FHEA 3W8SA 5AGYA 4E68A 3O76A 3IK7A 4AKIA 1AQXA 1GWCA 2C4JA 3LJRA 4KH7A 4ECJA 5DALA 18GSA 3BBYA 4PGTA 4K0GA 2WZSA 4PNFA 1XWKA 3HJOA 2GSRA 4KDYA 4MDCA 2HNLA 4MPGA 1A0FA 3VPTA 1BYEA 2V6KA 1LBKA 4L5OA 4YH2A 4Q5NA 4EC0A 1M99A 3LFLA 3R2QA 1BF5A 5G5EA 2OADA 3C8EA 4PTSA 4CHSA 1K3YA 1RK4A 4L8EA 2WW0A 5A1NB 1G6WA 1HQOA 2OA7A 3VWXA 4EXJA 1K0BA 2WW3A 5BMUB 3FYGA 3ZMLA 4KX4A 3LXTA 1U88A 1GULA 3G7JA 6GSVA 1U87A 2YV9A 4NHZA 1GUKA 1GTAA 5G5FA 22GSA 4KAEA 4IQ1A 3WD6A 1GTBA 5J4YA 4N3ZA 2VCTA 2VCWA 4AKGA 2VCXA 1TXUA 4GCIA 3VK9A 4HZ2A 5J4VA 1EOHA 3PR8A 1GTUA 1OYJA 2R6KA 5A1NA 1JZRA 5DQSA 5B7CA 3QAWA
chains in the Genus database with same CATH topology
4YQUA 5BMUA 1NHYA 3TOUA 5GZZB 3CRTA 3Q74A 3IK9A 4MF7A 2EFEA 3M8NA 2CA8A 1TU8A 1GSYA 2ON7A 2A2SA 1K0CA 3ERFA 3U6VA 3D0ZA 4IKHA 10GSA 5J5NA 4G0IA 4GSNA 1HNCA 3G7IA 4IW9A 4O7HA 1B4PA 1TU7A 1GNWA 1JLWA 3KMOA 3MAKA 5F07A 2VO4A 4GLTA 1EV9A 5LCZA 2C3QA 4MK3A 3CBUA 4K0NA 2GSSA 4ECCA 4F0BA 4EE0A 3PPUA 3IR4A 2F3MA 1XW6A 3FR6A 4YAPA 1GSFA 17GSA 4KF9A 5D9WA 2YCDA 3Q19A 2GDRA 4IBPA 4WR5A 1PKWA 6GSUA 5D73A 4DEJA 5F8BA 4E8HA 4AI6A 3ISOA 2R3XA 5JCUA 4GSTA 4ZB8A 3LYKA 1IYHA 1V40A 4LMVA 4IS0A 4ZBDA 2N5FA 1YY7A 3M1GA 5ECNB 1B8XA 2GSTA 1PMTA 5F05A 2HQTA 5DJMA 9GSSA 3P90A 3CRUA 5AIVA 2VD1A 4KE3A 2VD0A 2PERA 1FW1A 1FHEA 2OACA 3R3EA 2HSNA 1MTCA 4YAVA 1IYIA 1GLQA 1GSDA 1SVOA 4FQUA 4G19A 3GSTA 2C80A 4PQHA 1EV4A 1GNEA 4USSA 3UVHA 4JBBA 1M0UA 2DSAA 5GSSA 4PXOA 4E8EA 1YJ6A 4PUAA 2PGTA 5J40A 3VPQA 5ECMB 1M9AA 5GSTA 1U3IA 4W66A 2A2RA 1ZGNA 4ID0A 3TGZA 6GSSA 5KEJA 4J2FA 3L0HA 3TU3B 1DUGA 1K0AA 4NAXA 1Q4JA 4G10A 5A5HA 4IJIA 4JZQA 2YV7A 4IGJA 1F3AA 3TOTA 1R5AA 5IQYA 1AXDA 2VCQA 6GSXA 4KSMA 1BAYA 2CVDA 1V2AA 1VF1A 2EFCA 2GLRA 1VF3A 3VLNA 4ISDA 1K0OA 3CWGA 1Y1UA 1UA5A 2AHEA 4G0LA 1YKCA 4GTUA 1YVLA 4HI7A 4ZB7A 3N5OA 20GSA 2HSMB 2VCVA 19GSA 3N9JA 4HZ4A 3O3TA 4I97A 5ECPB 1AQWA 1HNAA 4KDXA 3DD3A 3GUSA 4G01A 1YDKA 2C3TA 3F63A 3GSSA 3QAVA 4IELA 3GH6A 1K0DA 3DGQA 2CZ3A 3FY7A 5A34B 3EE2A 3SWLA 1ZL9A 4YQVA 1Y6EA 3KM6A 2D2ZA 4ECBA 1SVLA 1M9BA 3VI7A 4YQMA 3ZFBA 4AKXB 2UV8G 4IVFA 4KGIA 5EVOA 3KJYA 2HSMA 5F06A 4HOJA 3KTLA 1EEMA 2GSQA 5EL8A 3IBHA 4MP4A 4ZB9A 2HSNB 3IE3A 1USBA 4AKHA 1VF2A 4G9HA 3P8WA 6GSWA 3FR3A 4QQ7A 2DC5A 5AN1A 5D9XA 1Z9HA 1GSQA 1N25A 4Q5RA 3LG6A 1G7OA 3FR9A 5A34A 3HKRA 2IL3A 3NIVA 2CAQA 4F0CA 4BVXA 5FT3A 3HJMA 3LXZA 3CSIA 3GX0A 4F03A 13GSA 4N0VA 2GTUA 3PGTA 1GUHA 5ECKB 4MF6A 5A5HB 1K3OA 1GTIA 4PX1A 5J41A 4ZB6A 4OFTA 2JL4A 2HRKA 5FHIA 3UBLA 1OE7A 2H1LA 1F2EA 1PX6A 5DCGA 4BL7B 8GSSA 1N2AA 2WDUA 1BX9A 4Q5FA 3F6FA 3IC8A 4Q5QA 1PKZA 3LSZA 2PMTA 4GSSA 2WRTA 4ECIA 3LQ7A 2F8FA 1PN9A 4RI6A 4WR4A 3VURA 4IQAA 1TDIA 2PVQA 3Q18A 4TOPA 5HFKA 1GLPA 1MD4A 3GTUB 3ZMKA 14GSA 4EDYA 4PNGA 6GSYA 5AIXA 4JEDA 2AB6A 4PURA 1XWGA 4G0KA 1K0NA 4AGSA 5DJLA 4BL7A 1BG1A 4MZWA 5DDLA 2CAIA 3LYPA 5J47A 6GSTA 2ON5A 1PA3A 1E6BA 12GSA 1K0MA 2VKZG 3MDKA 5ECSA 4QMKA 2EFDA 3GTUA 3GURA 1GSEA 2J9HA 2WB9A 3H1NA 5DAKB 2NTOA 1ML6A 2C8UA 3FRCA 5AISA 4NHWA 4RI7A 1BG5A 5JCWA 1PL2A 3QAGA 2C3NA 5ECOB 5LD0A 7GSSA 3QR6A 1GSSA 4ACSA 1EOGA 1F3BA 2EFHA 3ZFLA 5A4VA 5J4UA 5EY6A 2IMKA 4EDZA 2FNOA 4OFMA 1B48A 4HJ2A 4GDFA 5F0GA 4BVXB 5A5KA 5ECRB 4BVYB 2AAWA 2UZ8A 1AW9A 2WJUA 3CSHA 3WYWA 1PX7A 2OT3A 3I6AA 3KXOA 1K3LA 5A4UA 1SVMA 2CZ2A 5A4WA 3M3MA 5FWGA 1AQVA 4L5LA 4ZXGA 3VI5A 1OE8A 2HRKB 5DAKA 3CSJA 3AY8A 4ZBBA 2R4VA 5ECQB 1JLVA 3KMNA 3EINA 1G6YA 5D9TA 2X64A 1GUMA 2O5VA 1KBNA 1TW9A 2WS2A 5ELAA 1PD21 1GSUA 2HRAA 3I69A 5DALB 4OFNA 5ECHB 3RBTA 5ECLB 1LJRA 1PL1A 4BVYA 4GF0A 4OMVA 1C72A 2LJRA 2PBJA 2IMIA 4ZBAA 4PQIA 5D9VA 1VF4A 3F6DA 3ERGA 3UBKA 5ECIB 11GSA 16GSA 1PGTA 2R5GA 3UARA 1HNBA 1YQ1A 4KDUA 4MF5A 5ELGA 4MPFA 3HMJG 4O92A 2VCZA 1OKTA 4LMWA 3M0FA 1MD3A 3UAPA 1XW5A 2FHEA 3W8SA 5AGYA 4E68A 3O76A 3IK7A 4AKIA 1AQXA 1GWCA 2C4JA 3LJRA 4KH7A 4ECJA 5DALA 18GSA 3BBYA 4PGTA 4K0GA 4PNFA 1XWKA 3HJOA 2GSRA 4KDYA 4MDCA 2HNLA 4MPGA 1A0FA 3VPTA 1BYEA 2V6KA 1LBKA 4L5OA 4YH2A 4Q5NA 4EC0A 1M99A 3LFLA 3R2QA 1BF5A 5G5EA 2OADA 3C8EA 4PTSA 4CHSA 1K3YA 1RK4A 4L8EA 5A1NB 1G6WA 1HQOA 2OA7A 3VWXA 4EXJA 1K0BA 5BMUB 3FYGA 3ZMLA 4KX4A 3LXTA 1U88A 1GULA 3G7JA 6GSVA 1U87A 2YV9A 4NHZA 1GUKA 1GTAA 5G5FA 22GSA 4KAEA 4IQ1A 3WD6A 1GTBA 5J4YA 4N3ZA 2VCTA 2VCWA 4AKGA 2VCXA 1TXUA 4GCIA 3VK9A 4HZ2A 5J4VA 1EOHA 3PR8A 1GTUA 1OYJA 2R6KA 5A1NA 1JZRA 5DQSA 5B7CA 3QAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AI6 A;  5A34 A;  5BMU B;  4AKI A;  5A1N B;  5A1N A;  4AKG A;  4ZB7 A;  5A5H A;  4W66 A;  5A5H B;  4AKH A;  5A34 B; 
#chains in the Genus database with same CATH topology
 4YQU A;  5BMU A;  1NHY A;  3TOU A;  5GZZ B;  3CRT A;  3Q74 A;  3IK9 A;  4MF7 A;  2EFE A;  2O3E A;  3M8N A;  2CA8 A;  1TU8 A;  1GSY A;  2ON7 A;  2A2S A;  1K0C A;  3ERF A;  3U6V A;  3D0Z A;  4IKH A;  10GS A;  5J5N A;  4G0I A;  4GSN A;  1HNC A;  3G7I A;  4IW9 A;  4O7H A;  1B4P A;  1TU7 A;  1GNW A;  1JLW A;  3KMO A;  3MAK A;  5F07 A;  2VO4 A;  4GLT A;  1EV9 A;  5LCZ A;  2C3Q A;  4MK3 A;  3CBU A;  4K0N A;  2GSS A;  4ECC A;  4F0B A;  4EE0 A;  3PPU A;  3IR4 A;  2F3M A;  1XW6 A;  3CHX C;  3FR6 A;  4YAP A;  1GSF A;  17GS A;  4KF9 A;  5D9W A;  2YCD A;  3Q19 A;  2GDR A;  4IBP A;  4WR5 A;  1PKW A;  6GSU A;  5D73 A;  4DEJ A;  5F8B A;  4E8H A;  4AI6 A;  3ISO A;  2R3X A;  5JCU A;  4GST A;  4ZB8 A;  3LYK A;  1IYH A;  1V40 A;  4LMV A;  4IS0 A;  4ZBD A;  2N5F A;  1YY7 A;  3M1G A;  5ECN B;  1B8X A;  2GST A;  1PMT A;  5F05 A;  2HQT A;  5DJM A;  9GSS A;  3P90 A;  3CRU A;  5AIV A;  2VD1 A;  4KE3 A;  2VD0 A;  2PER A;  1S4B P;  1FW1 A;  1FHE A;  2OAC A;  3R3E A;  2HSN A;  1MTC A;  4YAV A;  1IYI A;  1GLQ A;  1GSD A;  1SVO A;  4FQU A;  4G19 A;  3GST A;  2C80 A;  4PQH A;  1EV4 A;  1GNE A;  4USS A;  3UVH A;  4JBB A;  4PHZ C;  1M0U A;  2DSA A;  5GSS A;  4PXO A;  4E8E A;  1YJ6 A;  4PUA A;  2PGT A;  5J40 A;  3VPQ A;  5ECM B;  1M9A A;  5GST A;  1U3I A;  4W66 A;  2A2R A;  1ZGN A;  4ID0 A;  3TGZ A;  6GSS A;  5KEJ A;  4J2F A;  3L0H A;  3TU3 B;  1DUG A;  1K0A A;  4NAX A;  2WVZ A;  1Q4J A;  4G10 A;  5A5H A;  4IJI A;  2WW1 A;  4JZQ A;  2YV7 A;  4IGJ A;  1F3A A;  3TOT A;  1R5A A;  5IQY A;  2WVY A;  1AXD A;  2VCQ A;  6GSX A;  4KSM A;  1BAY A;  2CVD A;  1V2A A;  1VF1 A;  2EFC A;  2GLR A;  1VF3 A;  3VLN A;  4ISD A;  1K0O A;  3CWG A;  1Y1U A;  1UA5 A;  2AHE A;  4G0L A;  1YKC A;  4GTU A;  1YVL A;  4HI7 A;  4ZB7 A;  3N5O A;  20GS A;  2HSM B;  2VCV A;  19GS A;  3N9J A;  4HZ4 A;  3O3T A;  4I97 A;  5ECP B;  1AQW A;  1HNA A;  4KDX A;  3DD3 A;  3GUS A;  4G01 A;  1YDK A;  2C3T A;  3F63 A;  3GSS A;  3QAV A;  4IEL A;  3GH6 A;  1K0D A;  3DGQ A;  2CZ3 A;  3FY7 A;  5A34 B;  3EE2 A;  3SWL A;  1ZL9 A;  4YQV A;  1Y6E A;  3KM6 A;  2D2Z A;  4ECB A;  1SVL A;  1M9B A;  3VI7 A;  4YQM A;  3ZFB A;  4AKX B;  2UV8 G;  4IVF A;  4KGI A;  5EVO A;  3KJY A;  2HSM A;  5F06 A;  4HOJ A;  3KTL A;  1EEM A;  2GSQ A;  5EL8 A;  3IBH A;  4MP4 A;  4ZB9 A;  2HSN B;  3IE3 A;  1USB A;  4AKH A;  1VF2 A;  4G9H A;  3P8W A;  6GSW A;  3FR3 A;  4QQ7 A;  2DC5 A;  5AN1 A;  5D9X A;  1Z9H A;  2O36 A;  1GSQ A;  1N25 A;  4Q5R A;  3LG6 A;  1G7O A;  3FR9 A;  5A34 A;  3HKR A;  2IL3 A;  3NIV A;  2CAQ A;  4F0C A;  4BVX A;  5FT3 A;  3HJM A;  3LXZ A;  3CSI A;  3GX0 A;  4F03 A;  13GS A;  4N0V A;  2GTU A;  3PGT A;  1GUH A;  5ECK B;  4MF6 A;  5A5H B;  1K3O A;  1GTI A;  4PX1 A;  5J41 A;  4ZB6 A;  4OFT A;  2JL4 A;  2HRK A;  5FHI A;  3UBL A;  1OE7 A;  2H1L A;  1F2E A;  1PX6 A;  4PI2 C;  5DCG A;  4BL7 B;  8GSS A;  1N2A A;  2WDU A;  1BX9 A;  4Q5F A;  3F6F A;  3IC8 A;  4Q5Q A;  1PKZ A;  3LSZ A;  2PMT A;  4GSS A;  2WRT A;  4ECI A;  3LQ7 A;  2F8F A;  1PN9 A;  4RI6 A;  1I1I P;  4WR4 A;  3VUR A;  4IQA A;  1TDI A;  2PVQ A;  3Q18 A;  4TOP A;  5HFK A;  1GLP A;  1MD4 A;  3GTU B;  3ZMK A;  14GS A;  4EDY A;  4PNG A;  6GSY A;  5AIX A;  4JED A;  2AB6 A;  4PUR A;  4PI0 C;  1XWG A;  3RGB C;  4G0K A;  1K0N A;  4AGS A;  5DJL A;  4BL7 A;  1BG1 A;  4MZW A;  5DDL A;  2CAI A;  3LYP A;  5J47 A;  6GST A;  2ON5 A;  1PA3 A;  1E6B A;  12GS A;  1K0M A;  2WVX B;  2VKZ G;  3MDK A;  5ECS A;  4QMK A;  2EFD A;  3GTU A;  3GUR A;  1GSE A;  2J9H A;  2WB9 A;  3H1N A;  5DAK B;  2NTO A;  1ML6 A;  2C8U A;  3FRC A;  5AIS A;  4NHW A;  4RI7 A;  1BG5 A;  5JCW A;  1PL2 A;  3QAG A;  2C3N A;  5ECO B;  5LD0 A;  7GSS A;  3QR6 A;  1GSS A;  4ACS A;  1EOG A;  1F3B A;  2EFH A;  3ZFL A;  5A4V A;  5J4U A;  5EY6 A;  2IMK A;  4EDZ A;  2FNO A;  4OFM A;  1B48 A;  4HJ2 A;  4GDF A;  4FXY P;  5F0G A;  4BVX B;  5A5K A;  5ECR B;  4BVY B;  2AAW A;  2UZ8 A;  1AW9 A;  2WJU A;  3CSH A;  3WYW A;  1PX7 A;  2WW2 A;  2OT3 A;  3I6A A;  3KXO A;  1K3L A;  2WVX A;  5A4U A;  1SVM A;  2CZ2 A;  5A4W A;  3M3M A;  5FWG A;  1AQV A;  4L5L A;  4ZXG A;  3VI5 A;  1OE8 A;  2HRK B;  5DAK A;  3CSJ A;  3AY8 A;  4ZBB A;  2R4V A;  5ECQ B;  1JLV A;  3KMN A;  1YEW C;  3EIN A;  1G6Y A;  5D9T A;  2X64 A;  1GUM A;  2O5V A;  1KBN A;  1TW9 A;  2WS2 A;  5ELA A;  1PD2 1;  1GSU A;  2HRA A;  3I69 A;  5DAL B;  4OFN A;  5ECH B;  3RBT A;  5ECL B;  1LJR A;  1PL1 A;  4BVY A;  4GF0 A;  4OMV A;  1C72 A;  2LJR A;  2PBJ A;  2IMI A;  4ZBA A;  4PQI A;  5D9V A;  1VF4 A;  3F6D A;  3ERG A;  3UBK A;  5ECI B;  11GS A;  16GS A;  1PGT A;  2R5G A;  3UAR A;  1HNB A;  1YQ1 A;  3RFR C;  4KDU A;  4MF5 A;  5ELG A;  4MPF A;  3HMJ G;  4O92 A;  2VCZ A;  1OKT A;  4LMW A;  3M0F A;  1MD3 A;  3UAP A;  1XW5 A;  2FHE A;  3W8S A;  5AGY A;  4E68 A;  3O76 A;  3IK7 A;  4AKI A;  1AQX A;  1GWC A;  2C4J A;  3LJR A;  4KH7 A;  4ECJ A;  5DAL A;  18GS A;  3BBY A;  4PGT A;  4K0G A;  2WZS A;  4PNF A;  1XWK A;  3HJO A;  2GSR A;  4KDY A;  4MDC A;  2HNL A;  4MPG A;  1A0F A;  3VPT A;  1BYE A;  2V6K A;  1LBK A;  4L5O A;  4YH2 A;  4Q5N A;  4EC0 A;  1M99 A;  3LFL A;  3R2Q A;  1BF5 A;  5G5E A;  2OAD A;  3C8E A;  4PTS A;  4CHS A;  1K3Y A;  1RK4 A;  4L8E A;  2WW0 A;  5A1N B;  1G6W A;  1HQO A;  2OA7 A;  3VWX A;  4EXJ A;  1K0B A;  2WW3 A;  5BMU B;  3FYG A;  3ZML A;  4KX4 A;  3LXT A;  1U88 A;  1GUL A;  3G7J A;  6GSV A;  1U87 A;  2YV9 A;  4NHZ A;  1GUK A;  1GTA A;  5G5F A;  22GS A;  4KAE A;  4IQ1 A;  3WD6 A;  1GTB A;  5J4Y A;  4N3Z A;  2VCT A;  2VCW A;  4AKG A;  2VCX A;  1TXU A;  4GCI A;  3VK9 A;  4HZ2 A;  5J4V A;  1EOH A;  3PR8 A;  1GTU A;  1OYJ A;  2R6K A;  5A1N A;  1JZR A;  5DQS A;  5B7C A;  3QAW A; 
#chains in the Genus database with same CATH homology
 4YQU A;  5BMU A;  1NHY A;  3TOU A;  5GZZ B;  3CRT A;  3Q74 A;  3IK9 A;  4MF7 A;  2EFE A;  3M8N A;  2CA8 A;  1TU8 A;  1GSY A;  2ON7 A;  2A2S A;  1K0C A;  3ERF A;  3U6V A;  3D0Z A;  4IKH A;  10GS A;  5J5N A;  4G0I A;  4GSN A;  1HNC A;  3G7I A;  4IW9 A;  4O7H A;  1B4P A;  1TU7 A;  1GNW A;  1JLW A;  3KMO A;  3MAK A;  5F07 A;  2VO4 A;  4GLT A;  1EV9 A;  5LCZ A;  2C3Q A;  4MK3 A;  3CBU A;  4K0N A;  2GSS A;  4ECC A;  4F0B A;  4EE0 A;  3PPU A;  3IR4 A;  2F3M A;  1XW6 A;  3FR6 A;  4YAP A;  1GSF A;  17GS A;  4KF9 A;  5D9W A;  2YCD A;  3Q19 A;  2GDR A;  4IBP A;  4WR5 A;  1PKW A;  6GSU A;  5D73 A;  4DEJ A;  5F8B A;  4E8H A;  4AI6 A;  3ISO A;  2R3X A;  5JCU A;  4GST A;  4ZB8 A;  3LYK A;  1IYH A;  1V40 A;  4LMV A;  4IS0 A;  4ZBD A;  2N5F A;  1YY7 A;  3M1G A;  5ECN B;  1B8X A;  2GST A;  1PMT A;  5F05 A;  2HQT A;  5DJM A;  9GSS A;  3P90 A;  3CRU A;  5AIV A;  2VD1 A;  4KE3 A;  2VD0 A;  2PER A;  1FW1 A;  1FHE A;  2OAC A;  3R3E A;  2HSN A;  1MTC A;  4YAV A;  1IYI A;  1GLQ A;  1GSD A;  1SVO A;  4FQU A;  4G19 A;  3GST A;  2C80 A;  4PQH A;  1EV4 A;  1GNE A;  4USS A;  3UVH A;  4JBB A;  1M0U A;  2DSA A;  5GSS A;  4PXO A;  4E8E A;  1YJ6 A;  4PUA A;  2PGT A;  5J40 A;  3VPQ A;  5ECM B;  1M9A A;  5GST A;  1U3I A;  4W66 A;  2A2R A;  1ZGN A;  4ID0 A;  3TGZ A;  6GSS A;  5KEJ A;  4J2F A;  3L0H A;  3TU3 B;  1DUG A;  1K0A A;  4NAX A;  1Q4J A;  4G10 A;  5A5H A;  4IJI A;  4JZQ A;  2YV7 A;  4IGJ A;  1F3A A;  3TOT A;  1R5A A;  5IQY A;  1AXD A;  2VCQ A;  6GSX A;  4KSM A;  1BAY A;  2CVD A;  1V2A A;  1VF1 A;  2EFC A;  2GLR A;  1VF3 A;  3VLN A;  4ISD A;  1K0O A;  3CWG A;  1Y1U A;  1UA5 A;  2AHE A;  4G0L A;  1YKC A;  4GTU A;  1YVL A;  4HI7 A;  4ZB7 A;  3N5O A;  20GS A;  2HSM B;  2VCV A;  19GS A;  3N9J A;  4HZ4 A;  3O3T A;  4I97 A;  5ECP B;  1AQW A;  1HNA A;  4KDX A;  3DD3 A;  3GUS A;  4G01 A;  1YDK A;  2C3T A;  3F63 A;  3GSS A;  3QAV A;  4IEL A;  3GH6 A;  1K0D A;  3DGQ A;  2CZ3 A;  3FY7 A;  5A34 B;  3EE2 A;  3SWL A;  1ZL9 A;  4YQV A;  1Y6E A;  3KM6 A;  2D2Z A;  4ECB A;  1SVL A;  1M9B A;  3VI7 A;  4YQM A;  3ZFB A;  4AKX B;  2UV8 G;  4IVF A;  4KGI A;  5EVO A;  3KJY A;  2HSM A;  5F06 A;  4HOJ A;  3KTL A;  1EEM A;  2GSQ A;  5EL8 A;  3IBH A;  4MP4 A;  4ZB9 A;  2HSN B;  3IE3 A;  1USB A;  4AKH A;  1VF2 A;  4G9H A;  3P8W A;  6GSW A;  3FR3 A;  4QQ7 A;  2DC5 A;  5AN1 A;  5D9X A;  1Z9H A;  1GSQ A;  1N25 A;  4Q5R A;  3LG6 A;  1G7O A;  3FR9 A;  5A34 A;  3HKR A;  2IL3 A;  3NIV A;  2CAQ A;  4F0C A;  4BVX A;  5FT3 A;  3HJM A;  3LXZ A;  3CSI A;  3GX0 A;  4F03 A;  13GS A;  4N0V A;  2GTU A;  3PGT A;  1GUH A;  5ECK B;  4MF6 A;  5A5H B;  1K3O A;  1GTI A;  4PX1 A;  5J41 A;  4ZB6 A;  4OFT A;  2JL4 A;  2HRK A;  5FHI A;  3UBL A;  1OE7 A;  2H1L A;  1F2E A;  1PX6 A;  5DCG A;  4BL7 B;  8GSS A;  1N2A A;  2WDU A;  1BX9 A;  4Q5F A;  3F6F A;  3IC8 A;  4Q5Q A;  1PKZ A;  3LSZ A;  2PMT A;  4GSS A;  2WRT A;  4ECI A;  3LQ7 A;  2F8F A;  1PN9 A;  4RI6 A;  4WR4 A;  3VUR A;  4IQA A;  1TDI A;  2PVQ A;  3Q18 A;  4TOP A;  5HFK A;  1GLP A;  1MD4 A;  3GTU B;  3ZMK A;  14GS A;  4EDY A;  4PNG A;  6GSY A;  5AIX A;  4JED A;  2AB6 A;  4PUR A;  1XWG A;  4G0K A;  1K0N A;  4AGS A;  5DJL A;  4BL7 A;  1BG1 A;  4MZW A;  5DDL A;  2CAI A;  3LYP A;  5J47 A;  6GST A;  2ON5 A;  1PA3 A;  1E6B A;  12GS A;  1K0M A;  2VKZ G;  3MDK A;  5ECS A;  4QMK A;  2EFD A;  3GTU A;  3GUR A;  1GSE A;  2J9H A;  2WB9 A;  3H1N A;  5DAK B;  2NTO A;  1ML6 A;  2C8U A;  3FRC A;  5AIS A;  4NHW A;  4RI7 A;  1BG5 A;  5JCW A;  1PL2 A;  3QAG A;  2C3N A;  5ECO B;  5LD0 A;  7GSS A;  3QR6 A;  1GSS A;  4ACS A;  1EOG A;  1F3B A;  2EFH A;  3ZFL A;  5A4V A;  5J4U A;  5EY6 A;  2IMK A;  4EDZ A;  2FNO A;  4OFM A;  1B48 A;  4HJ2 A;  4GDF A;  5F0G A;  4BVX B;  5A5K A;  5ECR B;  4BVY B;  2AAW A;  2UZ8 A;  1AW9 A;  2WJU A;  3CSH A;  3WYW A;  1PX7 A;  2OT3 A;  3I6A A;  3KXO A;  1K3L A;  5A4U A;  1SVM A;  2CZ2 A;  5A4W A;  3M3M A;  5FWG A;  1AQV A;  4L5L A;  4ZXG A;  3VI5 A;  1OE8 A;  2HRK B;  5DAK A;  3CSJ A;  3AY8 A;  4ZBB A;  2R4V A;  5ECQ B;  1JLV A;  3KMN A;  3EIN A;  1G6Y A;  5D9T A;  2X64 A;  1GUM A;  2O5V A;  1KBN A;  1TW9 A;  2WS2 A;  5ELA A;  1PD2 1;  1GSU A;  2HRA A;  3I69 A;  5DAL B;  4OFN A;  5ECH B;  3RBT A;  5ECL B;  1LJR A;  1PL1 A;  4BVY A;  4GF0 A;  4OMV A;  1C72 A;  2LJR A;  2PBJ A;  2IMI A;  4ZBA A;  4PQI A;  5D9V A;  1VF4 A;  3F6D A;  3ERG A;  3UBK A;  5ECI B;  11GS A;  16GS A;  1PGT A;  2R5G A;  3UAR A;  1HNB A;  1YQ1 A;  4KDU A;  4MF5 A;  5ELG A;  4MPF A;  3HMJ G;  4O92 A;  2VCZ A;  1OKT A;  4LMW A;  3M0F A;  1MD3 A;  3UAP A;  1XW5 A;  2FHE A;  3W8S A;  5AGY A;  4E68 A;  3O76 A;  3IK7 A;  4AKI A;  1AQX A;  1GWC A;  2C4J A;  3LJR A;  4KH7 A;  4ECJ A;  5DAL A;  18GS A;  3BBY A;  4PGT A;  4K0G A;  4PNF A;  1XWK A;  3HJO A;  2GSR A;  4KDY A;  4MDC A;  2HNL A;  4MPG A;  1A0F A;  3VPT A;  1BYE A;  2V6K A;  1LBK A;  4L5O A;  4YH2 A;  4Q5N A;  4EC0 A;  1M99 A;  3LFL A;  3R2Q A;  1BF5 A;  5G5E A;  2OAD A;  3C8E A;  4PTS A;  4CHS A;  1K3Y A;  1RK4 A;  4L8E A;  5A1N B;  1G6W A;  1HQO A;  2OA7 A;  3VWX A;  4EXJ A;  1K0B A;  5BMU B;  3FYG A;  3ZML A;  4KX4 A;  3LXT A;  1U88 A;  1GUL A;  3G7J A;  6GSV A;  1U87 A;  2YV9 A;  4NHZ A;  1GUK A;  1GTA A;  5G5F A;  22GS A;  4KAE A;  4IQ1 A;  3WD6 A;  1GTB A;  5J4Y A;  4N3Z A;  2VCT A;  2VCW A;  4AKG A;  2VCX A;  1TXU A;  4GCI A;  3VK9 A;  4HZ2 A;  5J4V A;  1EOH A;  3PR8 A;  1GTU A;  1OYJ A;  2R6K A;  5A1N A;  1JZR A;  5DQS A;  5B7C A;  3QAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...