5BMUB

The crystal structure of the gst-like domains complex of aimp3-eprs mutant c92sc105sc123s
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
166
structure length
166
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/ligase
molecule keywords Eukaryotic translation elongation factor 1 epsilon-1
publication title Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 166
sequence length 166
chains with identical sequence D, F, H
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5bmuB00
5BMUB 5A1NA 5A1NB 4AKHA 4AKIA 5A5HA 5A5HB 4W66A 4AI6A 4AKGA 4ZB7A 5A34A 5A34B
chains in the Genus database with same CATH superfamily
3GSTA 3R3EA 4G0KA 1EEMA 5F8BA 4KDUA 1MD4A 3KMOA 1GNEA 4MDCA 1N2AA 2WDUA 3PR8A 3VPTA 1GSUA 1AW9A 4G0LA 3WYWA 3M8NA 3CRTA 2V6KA 4K0GA 6GSXA 1ZL9A 5A5HB 1HNAA 4PHZC 2HRKB 4BVYB 4ECJA 3UBLA 4YQUA 1OYJA 5LCZA 3CBUA 4ZB6A 4AKGA 4QMKA 5J47A 3KJYA 3LXZA 3LYKA 2CVDA 4F0CA 4EE0A 4PI2C 5GSSA 1PA3A 4O7HA 3P8WA 2GSTA 4IGJA 4GTUA 3CSHA 3M0FA 5GZZB 5ECSA 2R3XA 1Y1UA 3KXOA 3HMJG 5J41A 2VKZG 1FW1A 2WW3A 2VD0A 4ZBAA 4NHWA 4KE3A 1BG1A 2VCWA 4EXJA 2CAQA 1I1IP 2CZ2A 4YQVA 2YCDA 4CHSA 2DC5A 3ERGA 3IK9A 2F3MA 4G19A 3FR3A 2LJRA 2WJUA 4AI6A 4HOJA 4IS0A 2C3NA 1SVMA 2IL3A 3VI7A 9GSSA 5DDLA 4FXYP 4HZ4A 3LQ7A 4IJIA 3ZMLA 1GUKA 1N25A 2WVZA 4Q5QA 1EOHA 1UA5A 2CA8A 3LXTA 2AAWA 5DALA 3TU3B 5AIVA 1K3YA 20GSA 2WS2A 3GTUA 1V2AA 1GTAA 4JZQA 4KGIA 1GUHA 2WW2A 5A4UA 1MD3A 3QR6A 4RI6A 1K0NA 5A1NA 1PD21 1GSFA 4HZ2A 5AN1A 3IE3A 3Q19A 6GSVA 1PX6A 1K0BA 2WVXA 4LMVA 5ECPB 1F3BA 1M0UA 3CRUA 1XW5A 5BMUA 1K0MA 1BX9A 4HJ2A 2GLRA 1OKTA 4HI7A 1USBA 1V40A 1PKWA 4E8HA 4MK3A 1YVLA 1PN9A 3PPUA 1GSSA 1VF3A 4MZWA 2NTOA 2HSNA 2AB6A 6GSWA 2PMTA 5A34A 5DAKA 2IMKA 4G10A 1PMTA 2O5VA 13GSA 3LJRA 5FT3A 3IK7A 4ECIA 19GSA 4ECCA 4ZBBA 1OE7A 1GLQA 4IVFA 3GUSA 5F05A 1TU7A 4AKHA 5D9VA 4ID0A 1PL2A 3VWXA 5ECKB 3O76A 4YH2A 3CWGA 2OADA 3GTUB 3I6AA 14GSA 3LG6A 5ELAA 3P90A 4IQAA 3DD3A 1G6WA 22GSA 1AXDA 1GTIA 5A1NB 1YKCA 3QAWA 4GCIA 2R4VA 2PERA 2VCZA 4MP4A 1LBKA 3SWLA 1TU8A 2VCQA 2WVXB 3F63A 2FHEA 1YY7A 2HQTA 3RGBC 2OT3A 3D0ZA 3M1GA 4LMWA 5BMUB 4KX4A 4FQUA 5AISA 1PL1A 2H1LA 3R2QA 5ECHB 4L5OA 4F03A 1S4BP 4GDFA 1U87A 3DGQA 3M3MA 18GSA 1K3LA 4EDYA 4RI7A 4K0NA 2DSAA 4N0VA 3TGZA 2ON5A 1HNCA 3N5OA 1ML6A 5ELGA 12GSA 1GTBA 1M9BA 5A34B 17GSA 5DAKB 4O92A 1VF1A 3BBYA 3WD6A 5JCWA 2EFHA 4NHZA 1BYEA 5DJMA 4ZB7A 4L8EA 4Q5FA 2JL4A 3LFLA 1XW6A 3GH6A 3LSZA 4GLTA 5EL8A 2CAIA 2UZ8A 1GUMA 4IQ1A 5J4VA 3N9JA 3QAGA 4PNFA 1K3OA 3UARA 5FHIA 16GSA 3LYPA 1TXUA 4Q5NA 4ZBDA 4GSSA 4NAXA 5F0GA 1M9AA 3VI5A 1B48A 5J40A 4KDXA 1GSEA 2VCVA 2HRAA 4PGTA 1EOGA 2A2SA 4L5LA 2R6KA 3MAKA 2HNLA 1TW9A 1AQVA 3UVHA 3VK9A 5J5NA 3VURA 5AIXA 1G6YA 1DUGA 6GSTA 4G0IA 4JBBA 1OE8A 4PXOA 3G7IA 4BL7A 1MTCA 3KTLA 2AHEA 4GSNA 1BAYA 5DQSA 2C80A 4PNGA 4ECBA 2WB9A 2YV9A 2GDRA 3F6FA 4G9HA 4I97A 1YQ1A 4IKHA 3MDKA 5EVOA 5G5FA 2C3TA 3H1NA 5FWGA 10GSA 2PBJA 3RFRC 5A4VA 3Q18A 1K0OA 5D9TA 3FYGA 2X64A 5ECNB 4OFNA 4PQHA 1KBNA 2IMIA 4GSTA 5ECOB 3IC8A 5ECIB 3VLNA 3UBKA 5LD0A 5ECQB 4ZB9A 3KM6A 3EINA 1F3AA 2F8FA 1U3IA 1JZRA 3W8SA 4IW9A 2CZ3A 3ISOA 5DALB 8GSSA 1GSDA 1PKZA 1BF5A 1GSQA 1GSYA 3GX0A 4IELA 5ECMB 3ZFLA 2O3EA 4W66A 3ZMKA 4ACSA 3AY8A 2WW1A 7GSSA 4JEDA 1R5AA 1Q4JA 3GSSA 1SVOA 1YJ6A 1B8XA 1M99A 1VF2A 1JLWA 1EV4A 3KMNA 5ECLB 5DCGA 1GWCA 2N5FA 5J4UA 5G5EA 4KSMA 5IQYA 3FR6A 1YEWC 4OMVA 3TOUA 2WVYA 3FR9A 2C8UA 4BL7B 6GSSA 6GSUA 2C4JA 5HFKA 4F0BA 3HKRA 2ON7A 4J2FA 4OFMA 3L0HA 4BVXA 3RBTA 2GSSA 1A0FA 3IBHA 4YAVA 5DJLA 1TDIA 1U88A 3EE2A 3F6DA 3O3TA 4YAPA 4AKXB 1XWGA 3CHXC 2HSNB 2EFDA 11GSA 4IBPA 3FRCA 5D73A 1NHYA 5AGYA 5J4YA 3G7JA 3NIVA 3CSIA 1YDKA 2HSMA 3C8EA 2J9HA 4MPGA 5D9WA 5EY6A 4TOPA 4PURA 1IYIA 4USSA 4EC0A 4N3ZA 4OFTA 4E8EA 1AQWA 2FNOA 1FHEA 5KEJA 5F07A 4PUAA 2VCTA 3HJOA 4MPFA 1E6BA 2WW0A 1G7OA 6GSYA 5F06A 2R5GA 2PGTA 1HNBA 2WZSA 1JLVA 2GSRA 3QAVA 4MF5A 1B4PA 4KF9A 3TOTA 4PQIA 1Z9HA 1GLPA 4PI0C 4PTSA 1PX7A 1SVLA 2YV7A 1ZGNA 3U6VA 2OACA 1IYHA 1C72A 1K0DA 5GSTA 2VCXA 1F2EA 2GSQA 3GURA 4AGSA 4KAEA 4E68A 4ZB8A 5JCUA 4YQMA 1HQOA 5D9XA 4BVXB 3UAPA 1RK4A 4WR4A 1GULA 2A2RA 4AKIA 5A5HA 1VF4A 1Y6EA 4QQ7A 1BG5A 2GTUA 2HRKA 1GTUA 1PGTA 4BVYA 3HJMA 1K0AA 4DEJA 3PGTA 3Q74A 3ZFBA 4Q5RA 5A4WA 5A5KA 2C3QA 4G01A 1K0CA 3VPQA 2HSMB 2O36A 2EFCA 2WRTA 4EDZA 5ECRB 4ISDA 4ZXGA 4KDYA 2UV8G 3I69A 2OA7A 4GF0A 2D2ZA 3FY7A 4MF7A 2PVQA 1LJRA 2EFEA 4WR5A 3IR4A 1EV9A 2VO4A 4MF6A 1XWKA 1AQXA 4PX1A 5B7CA 3CSJA 3ERFA 1GNWA 2VD1A 4KH7A
chains in the Genus database with same CATH topology
3GSTA 3R3EA 4G0KA 1EEMA 5F8BA 4KDUA 1MD4A 3KMOA 1GNEA 4MDCA 1N2AA 2WDUA 3PR8A 3VPTA 1GSUA 1AW9A 4G0LA 3WYWA 3M8NA 3CRTA 2V6KA 4K0GA 6GSXA 1ZL9A 5A5HB 1HNAA 2HRKB 4BVYB 4ECJA 3UBLA 4YQUA 1OYJA 5LCZA 3CBUA 4ZB6A 4AKGA 4QMKA 5J47A 3KJYA 3LXZA 3LYKA 2CVDA 4F0CA 4EE0A 5GSSA 1PA3A 4O7HA 3P8WA 2GSTA 4IGJA 4GTUA 3CSHA 3M0FA 5GZZB 5ECSA 2R3XA 1Y1UA 3KXOA 3HMJG 5J41A 2VKZG 1FW1A 2VD0A 4ZBAA 4NHWA 4KE3A 1BG1A 2VCWA 4EXJA 2CAQA 2CZ2A 4YQVA 2YCDA 4CHSA 2DC5A 3ERGA 3IK9A 2F3MA 4G19A 3FR3A 2LJRA 2WJUA 4AI6A 4HOJA 4IS0A 2C3NA 1SVMA 2IL3A 3VI7A 9GSSA 5DDLA 4HZ4A 3LQ7A 4IJIA 3ZMLA 1GUKA 1N25A 4Q5QA 5DALA 1EOHA 1UA5A 2CA8A 3LXTA 2AAWA 3TU3B 5AIVA 1K3YA 20GSA 2WS2A 3GTUA 1V2AA 1GTAA 4JZQA 4KGIA 1GUHA 5A4UA 1MD3A 3QR6A 4RI6A 1K0NA 5A1NA 1PD21 1GSFA 4HZ2A 5AN1A 3IE3A 3Q19A 6GSVA 1PX6A 1K0BA 4LMVA 5ECPB 1F3BA 1M0UA 3CRUA 1XW5A 5BMUA 1K0MA 1BX9A 4HJ2A 2GLRA 1OKTA 4HI7A 1USBA 1V40A 1PKWA 4E8HA 4MK3A 1YVLA 1PN9A 3PPUA 1GSSA 1VF3A 4MZWA 2NTOA 2HSNA 2AB6A 6GSWA 2PMTA 5A34A 5DAKA 2IMKA 4G10A 1PMTA 2O5VA 13GSA 3LJRA 5FT3A 3IK7A 4ECIA 19GSA 4ECCA 4ZBBA 1OE7A 1GLQA 4IVFA 3GUSA 5F05A 1TU7A 4AKHA 5D9VA 4ID0A 1PL2A 3VWXA 5ECKB 3O76A 4YH2A 3CWGA 2OADA 3GTUB 3I6AA 14GSA 3LG6A 5ELAA 3P90A 4IQAA 3DD3A 1G6WA 22GSA 1AXDA 1GTIA 5A1NB 1YKCA 3QAWA 4GCIA 2R4VA 2PERA 2VCZA 4MP4A 1LBKA 3SWLA 1TU8A 2VCQA 3F63A 2FHEA 1YY7A 2HQTA 2OT3A 3D0ZA 3M1GA 4LMWA 5BMUB 4KX4A 4FQUA 5AISA 1PL1A 2H1LA 3R2QA 5ECHB 4L5OA 4F03A 4GDFA 1U87A 3DGQA 3M3MA 18GSA 1K3LA 4EDYA 4RI7A 4K0NA 2DSAA 4N0VA 3TGZA 2ON5A 1HNCA 3N5OA 1ML6A 5ELGA 12GSA 1GTBA 1M9BA 5A34B 17GSA 5DAKB 4O92A 1VF1A 3BBYA 3WD6A 5JCWA 2EFHA 4NHZA 1BYEA 5DJMA 4ZB7A 4L8EA 4Q5FA 2JL4A 3LFLA 1XW6A 3GH6A 3LSZA 4GLTA 5EL8A 2CAIA 2UZ8A 1GUMA 4IQ1A 5J4VA 3N9JA 3QAGA 4PNFA 1K3OA 3UARA 5FHIA 16GSA 3LYPA 1TXUA 4Q5NA 4ZBDA 4GSSA 4NAXA 5F0GA 1M9AA 3VI5A 1B48A 5J40A 4KDXA 1GSEA 2VCVA 2HRAA 4PGTA 1EOGA 2A2SA 4L5LA 2R6KA 3MAKA 2HNLA 1TW9A 1AQVA 3UVHA 3VK9A 5J5NA 3VURA 5AIXA 1G6YA 1DUGA 6GSTA 4G0IA 4JBBA 1OE8A 4PXOA 3G7IA 4BL7A 1MTCA 3KTLA 2AHEA 4GSNA 1BAYA 5DQSA 2C80A 4PNGA 4ECBA 2WB9A 2YV9A 2GDRA 3F6FA 4G9HA 4I97A 1YQ1A 4IKHA 3MDKA 5EVOA 5G5FA 2C3TA 3H1NA 5FWGA 10GSA 2PBJA 5A4VA 3Q18A 1K0OA 5D9TA 3FYGA 2X64A 5ECNB 4OFNA 4PQHA 1KBNA 2IMIA 4GSTA 5ECOB 3IC8A 5ECIB 3VLNA 3UBKA 5LD0A 5ECQB 4ZB9A 3KM6A 3EINA 1F3AA 2F8FA 1U3IA 1JZRA 3W8SA 4IW9A 2CZ3A 3ISOA 5DALB 8GSSA 1GSDA 1PKZA 1BF5A 1GSQA 1GSYA 3GX0A 4IELA 5ECMB 3ZFLA 4W66A 3ZMKA 4ACSA 3AY8A 7GSSA 4JEDA 1R5AA 1Q4JA 3GSSA 1SVOA 1YJ6A 1B8XA 1M99A 1VF2A 1JLWA 1EV4A 3KMNA 5ECLB 5DCGA 1GWCA 2N5FA 5J4UA 5G5EA 4KSMA 5IQYA 3FR6A 4OMVA 3TOUA 3FR9A 2C8UA 4BL7B 6GSSA 6GSUA 2C4JA 5HFKA 4F0BA 3HKRA 2ON7A 4J2FA 4OFMA 3L0HA 4BVXA 3RBTA 2GSSA 1A0FA 3IBHA 4YAVA 5DJLA 1TDIA 1U88A 3EE2A 3O3TA 3F6DA 4YAPA 4AKXB 1XWGA 2HSNB 2EFDA 11GSA 4IBPA 3FRCA 5D73A 1NHYA 5AGYA 5J4YA 3G7JA 3NIVA 3CSIA 1YDKA 2HSMA 3C8EA 2J9HA 4MPGA 5D9WA 5EY6A 4TOPA 4PURA 1IYIA 4USSA 4EC0A 4N3ZA 4OFTA 4E8EA 1AQWA 2FNOA 1FHEA 5KEJA 5F07A 4PUAA 2VCTA 3HJOA 4MPFA 1E6BA 1G7OA 6GSYA 5F06A 2R5GA 2PGTA 1HNBA 1JLVA 2GSRA 3QAVA 4MF5A 1B4PA 4KF9A 3TOTA 4PQIA 1Z9HA 1GLPA 4PTSA 1PX7A 1SVLA 2YV7A 1ZGNA 3U6VA 2OACA 1IYHA 1C72A 1K0DA 5GSTA 2VCXA 1F2EA 2GSQA 3GURA 4AGSA 4KAEA 4E68A 4ZB8A 5JCUA 4YQMA 1HQOA 5D9XA 4BVXB 3UAPA 1RK4A 4WR4A 1GULA 2A2RA 4AKIA 5A5HA 1VF4A 1Y6EA 4QQ7A 1BG5A 2GTUA 2HRKA 1GTUA 1PGTA 4BVYA 3HJMA 1K0AA 4DEJA 3PGTA 3Q74A 3ZFBA 4Q5RA 5A4WA 5A5KA 2C3QA 4G01A 1K0CA 3VPQA 2HSMB 2EFCA 2WRTA 4EDZA 5ECRB 4ISDA 4ZXGA 4KDYA 2UV8G 3I69A 2OA7A 4GF0A 2D2ZA 3FY7A 4MF7A 2PVQA 1LJRA 2EFEA 4WR5A 3IR4A 1EV9A 2VO4A 4MF6A 1XWKA 1AQXA 4PX1A 5B7CA 3CSJA 3ERFA 1GNWA 2VD1A 4KH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BMU B;  5A1N A;  5A1N B;  4AKH A;  4AKI A;  5A5H A;  5A5H B;  4W66 A;  4AI6 A;  4AKG A;  4ZB7 A;  5A34 A;  5A34 B; 
#chains in the Genus database with same CATH topology
 3GST A;  3R3E A;  4G0K A;  1EEM A;  5F8B A;  4KDU A;  1MD4 A;  3KMO A;  1GNE A;  4MDC A;  1N2A A;  2WDU A;  3PR8 A;  3VPT A;  1GSU A;  1AW9 A;  4G0L A;  3WYW A;  3M8N A;  3CRT A;  2V6K A;  4K0G A;  6GSX A;  1ZL9 A;  5A5H B;  1HNA A;  4PHZ C;  2HRK B;  4BVY B;  4ECJ A;  3UBL A;  4YQU A;  1OYJ A;  5LCZ A;  3CBU A;  4ZB6 A;  4AKG A;  4QMK A;  5J47 A;  3KJY A;  3LXZ A;  3LYK A;  2CVD A;  4F0C A;  4EE0 A;  4PI2 C;  5GSS A;  1PA3 A;  4O7H A;  3P8W A;  2GST A;  4IGJ A;  4GTU A;  3CSH A;  3M0F A;  5GZZ B;  5ECS A;  2R3X A;  1Y1U A;  3KXO A;  3HMJ G;  5J41 A;  2VKZ G;  1FW1 A;  2WW3 A;  2VD0 A;  4ZBA A;  4NHW A;  4KE3 A;  1BG1 A;  2VCW A;  4EXJ A;  2CAQ A;  1I1I P;  2CZ2 A;  4YQV A;  2YCD A;  4CHS A;  2DC5 A;  3ERG A;  3IK9 A;  2F3M A;  4G19 A;  3FR3 A;  2LJR A;  2WJU A;  4AI6 A;  4HOJ A;  4IS0 A;  2C3N A;  1SVM A;  2IL3 A;  3VI7 A;  9GSS A;  5DDL A;  4FXY P;  4HZ4 A;  3LQ7 A;  4IJI A;  3ZML A;  1GUK A;  1N25 A;  2WVZ A;  4Q5Q A;  1EOH A;  1UA5 A;  2CA8 A;  3LXT A;  2AAW A;  5DAL A;  3TU3 B;  5AIV A;  1K3Y A;  20GS A;  2WS2 A;  3GTU A;  1V2A A;  1GTA A;  4JZQ A;  4KGI A;  1GUH A;  2WW2 A;  5A4U A;  1MD3 A;  3QR6 A;  4RI6 A;  1K0N A;  5A1N A;  1PD2 1;  1GSF A;  4HZ2 A;  5AN1 A;  3IE3 A;  3Q19 A;  6GSV A;  1PX6 A;  1K0B A;  2WVX A;  4LMV A;  5ECP B;  1F3B A;  1M0U A;  3CRU A;  1XW5 A;  5BMU A;  1K0M A;  1BX9 A;  4HJ2 A;  2GLR A;  1OKT A;  4HI7 A;  1USB A;  1V40 A;  1PKW A;  4E8H A;  4MK3 A;  1YVL A;  1PN9 A;  3PPU A;  1GSS A;  1VF3 A;  4MZW A;  2NTO A;  2HSN A;  2AB6 A;  6GSW A;  2PMT A;  5A34 A;  5DAK A;  2IMK A;  4G10 A;  1PMT A;  2O5V A;  13GS A;  3LJR A;  5FT3 A;  3IK7 A;  4ECI A;  19GS A;  4ECC A;  4ZBB A;  1OE7 A;  1GLQ A;  4IVF A;  3GUS A;  5F05 A;  1TU7 A;  4AKH A;  5D9V A;  4ID0 A;  1PL2 A;  3VWX A;  5ECK B;  3O76 A;  4YH2 A;  3CWG A;  2OAD A;  3GTU B;  3I6A A;  14GS A;  3LG6 A;  5ELA A;  3P90 A;  4IQA A;  3DD3 A;  1G6W A;  22GS A;  1AXD A;  1GTI A;  5A1N B;  1YKC A;  3QAW A;  4GCI A;  2R4V A;  2PER A;  2VCZ A;  4MP4 A;  1LBK A;  3SWL A;  1TU8 A;  2VCQ A;  2WVX B;  3F63 A;  2FHE A;  1YY7 A;  2HQT A;  3RGB C;  2OT3 A;  3D0Z A;  3M1G A;  4LMW A;  5BMU B;  4KX4 A;  4FQU A;  5AIS A;  1PL1 A;  2H1L A;  3R2Q A;  5ECH B;  4L5O A;  4F03 A;  1S4B P;  4GDF A;  1U87 A;  3DGQ A;  3M3M A;  18GS A;  1K3L A;  4EDY A;  4RI7 A;  4K0N A;  2DSA A;  4N0V A;  3TGZ A;  2ON5 A;  1HNC A;  3N5O A;  1ML6 A;  5ELG A;  12GS A;  1GTB A;  1M9B A;  5A34 B;  17GS A;  5DAK B;  4O92 A;  1VF1 A;  3BBY A;  3WD6 A;  5JCW A;  2EFH A;  4NHZ A;  1BYE A;  5DJM A;  4ZB7 A;  4L8E A;  4Q5F A;  2JL4 A;  3LFL A;  1XW6 A;  3GH6 A;  3LSZ A;  4GLT A;  5EL8 A;  2CAI A;  2UZ8 A;  1GUM A;  4IQ1 A;  5J4V A;  3N9J A;  3QAG A;  4PNF A;  1K3O A;  3UAR A;  5FHI A;  16GS A;  3LYP A;  1TXU A;  4Q5N A;  4ZBD A;  4GSS A;  4NAX A;  5F0G A;  1M9A A;  3VI5 A;  1B48 A;  5J40 A;  4KDX A;  1GSE A;  2VCV A;  2HRA A;  4PGT A;  1EOG A;  2A2S A;  4L5L A;  2R6K A;  3MAK A;  2HNL A;  1TW9 A;  1AQV A;  3UVH A;  3VK9 A;  5J5N A;  3VUR A;  5AIX A;  1G6Y A;  1DUG A;  6GST A;  4G0I A;  4JBB A;  1OE8 A;  4PXO A;  3G7I A;  4BL7 A;  1MTC A;  3KTL A;  2AHE A;  4GSN A;  1BAY A;  5DQS A;  2C80 A;  4PNG A;  4ECB A;  2WB9 A;  2YV9 A;  2GDR A;  3F6F A;  4G9H A;  4I97 A;  1YQ1 A;  4IKH A;  3MDK A;  5EVO A;  5G5F A;  2C3T A;  3H1N A;  5FWG A;  10GS A;  2PBJ A;  3RFR C;  5A4V A;  3Q18 A;  1K0O A;  5D9T A;  3FYG A;  2X64 A;  5ECN B;  4OFN A;  4PQH A;  1KBN A;  2IMI A;  4GST A;  5ECO B;  3IC8 A;  5ECI B;  3VLN A;  3UBK A;  5LD0 A;  5ECQ B;  4ZB9 A;  3KM6 A;  3EIN A;  1F3A A;  2F8F A;  1U3I A;  1JZR A;  3W8S A;  4IW9 A;  2CZ3 A;  3ISO A;  5DAL B;  8GSS A;  1GSD A;  1PKZ A;  1BF5 A;  1GSQ A;  1GSY A;  3GX0 A;  4IEL A;  5ECM B;  3ZFL A;  2O3E A;  4W66 A;  3ZMK A;  4ACS A;  3AY8 A;  2WW1 A;  7GSS A;  4JED A;  1R5A A;  1Q4J A;  3GSS A;  1SVO A;  1YJ6 A;  1B8X A;  1M99 A;  1VF2 A;  1JLW A;  1EV4 A;  3KMN A;  5ECL B;  5DCG A;  1GWC A;  2N5F A;  5J4U A;  5G5E A;  4KSM A;  5IQY A;  3FR6 A;  1YEW C;  4OMV A;  3TOU A;  2WVY A;  3FR9 A;  2C8U A;  4BL7 B;  6GSS A;  6GSU A;  2C4J A;  5HFK A;  4F0B A;  3HKR A;  2ON7 A;  4J2F A;  4OFM A;  3L0H A;  4BVX A;  3RBT A;  2GSS A;  1A0F A;  3IBH A;  4YAV A;  5DJL A;  1TDI A;  1U88 A;  3EE2 A;  3F6D A;  3O3T A;  4YAP A;  4AKX B;  1XWG A;  3CHX C;  2HSN B;  2EFD A;  11GS A;  4IBP A;  3FRC A;  5D73 A;  1NHY A;  5AGY A;  5J4Y A;  3G7J A;  3NIV A;  3CSI A;  1YDK A;  2HSM A;  3C8E A;  2J9H A;  4MPG A;  5D9W A;  5EY6 A;  4TOP A;  4PUR A;  1IYI A;  4USS A;  4EC0 A;  4N3Z A;  4OFT A;  4E8E A;  1AQW A;  2FNO A;  1FHE A;  5KEJ A;  5F07 A;  4PUA A;  2VCT A;  3HJO A;  4MPF A;  1E6B A;  2WW0 A;  1G7O A;  6GSY A;  5F06 A;  2R5G A;  2PGT A;  1HNB A;  2WZS A;  1JLV A;  2GSR A;  3QAV A;  4MF5 A;  1B4P A;  4KF9 A;  3TOT A;  4PQI A;  1Z9H A;  1GLP A;  4PI0 C;  4PTS A;  1PX7 A;  1SVL A;  2YV7 A;  1ZGN A;  3U6V A;  2OAC A;  1IYH A;  1C72 A;  1K0D A;  5GST A;  2VCX A;  1F2E A;  2GSQ A;  3GUR A;  4AGS A;  4KAE A;  4E68 A;  4ZB8 A;  5JCU A;  4YQM A;  1HQO A;  5D9X A;  4BVX B;  3UAP A;  1RK4 A;  4WR4 A;  1GUL A;  2A2R A;  4AKI A;  5A5H A;  1VF4 A;  1Y6E A;  4QQ7 A;  1BG5 A;  2GTU A;  2HRK A;  1GTU A;  1PGT A;  4BVY A;  3HJM A;  1K0A A;  4DEJ A;  3PGT A;  3Q74 A;  3ZFB A;  4Q5R A;  5A4W A;  5A5K A;  2C3Q A;  4G01 A;  1K0C A;  3VPQ A;  2HSM B;  2O36 A;  2EFC A;  2WRT A;  4EDZ A;  5ECR B;  4ISD A;  4ZXG A;  4KDY A;  2UV8 G;  3I69 A;  2OA7 A;  4GF0 A;  2D2Z A;  3FY7 A;  4MF7 A;  2PVQ A;  1LJR A;  2EFE A;  4WR5 A;  3IR4 A;  1EV9 A;  2VO4 A;  4MF6 A;  1XWK A;  1AQX A;  4PX1 A;  5B7C A;  3CSJ A;  3ERF A;  1GNW A;  2VD1 A;  4KH7 A; 
#chains in the Genus database with same CATH homology
 3GST A;  3R3E A;  4G0K A;  1EEM A;  5F8B A;  4KDU A;  1MD4 A;  3KMO A;  1GNE A;  4MDC A;  1N2A A;  2WDU A;  3PR8 A;  3VPT A;  1GSU A;  1AW9 A;  4G0L A;  3WYW A;  3M8N A;  3CRT A;  2V6K A;  4K0G A;  6GSX A;  1ZL9 A;  5A5H B;  1HNA A;  2HRK B;  4BVY B;  4ECJ A;  3UBL A;  4YQU A;  1OYJ A;  5LCZ A;  3CBU A;  4ZB6 A;  4AKG A;  4QMK A;  5J47 A;  3KJY A;  3LXZ A;  3LYK A;  2CVD A;  4F0C A;  4EE0 A;  5GSS A;  1PA3 A;  4O7H A;  3P8W A;  2GST A;  4IGJ A;  4GTU A;  3CSH A;  3M0F A;  5GZZ B;  5ECS A;  2R3X A;  1Y1U A;  3KXO A;  3HMJ G;  5J41 A;  2VKZ G;  1FW1 A;  2VD0 A;  4ZBA A;  4NHW A;  4KE3 A;  1BG1 A;  2VCW A;  4EXJ A;  2CAQ A;  2CZ2 A;  4YQV A;  2YCD A;  4CHS A;  2DC5 A;  3ERG A;  3IK9 A;  2F3M A;  4G19 A;  3FR3 A;  2LJR A;  2WJU A;  4AI6 A;  4HOJ A;  4IS0 A;  2C3N A;  1SVM A;  2IL3 A;  3VI7 A;  9GSS A;  5DDL A;  4HZ4 A;  3LQ7 A;  4IJI A;  3ZML A;  1GUK A;  1N25 A;  4Q5Q A;  5DAL A;  1EOH A;  1UA5 A;  2CA8 A;  3LXT A;  2AAW A;  3TU3 B;  5AIV A;  1K3Y A;  20GS A;  2WS2 A;  3GTU A;  1V2A A;  1GTA A;  4JZQ A;  4KGI A;  1GUH A;  5A4U A;  1MD3 A;  3QR6 A;  4RI6 A;  1K0N A;  5A1N A;  1PD2 1;  1GSF A;  4HZ2 A;  5AN1 A;  3IE3 A;  3Q19 A;  6GSV A;  1PX6 A;  1K0B A;  4LMV A;  5ECP B;  1F3B A;  1M0U A;  3CRU A;  1XW5 A;  5BMU A;  1K0M A;  1BX9 A;  4HJ2 A;  2GLR A;  1OKT A;  4HI7 A;  1USB A;  1V40 A;  1PKW A;  4E8H A;  4MK3 A;  1YVL A;  1PN9 A;  3PPU A;  1GSS A;  1VF3 A;  4MZW A;  2NTO A;  2HSN A;  2AB6 A;  6GSW A;  2PMT A;  5A34 A;  5DAK A;  2IMK A;  4G10 A;  1PMT A;  2O5V A;  13GS A;  3LJR A;  5FT3 A;  3IK7 A;  4ECI A;  19GS A;  4ECC A;  4ZBB A;  1OE7 A;  1GLQ A;  4IVF A;  3GUS A;  5F05 A;  1TU7 A;  4AKH A;  5D9V A;  4ID0 A;  1PL2 A;  3VWX A;  5ECK B;  3O76 A;  4YH2 A;  3CWG A;  2OAD A;  3GTU B;  3I6A A;  14GS A;  3LG6 A;  5ELA A;  3P90 A;  4IQA A;  3DD3 A;  1G6W A;  22GS A;  1AXD A;  1GTI A;  5A1N B;  1YKC A;  3QAW A;  4GCI A;  2R4V A;  2PER A;  2VCZ A;  4MP4 A;  1LBK A;  3SWL A;  1TU8 A;  2VCQ A;  3F63 A;  2FHE A;  1YY7 A;  2HQT A;  2OT3 A;  3D0Z A;  3M1G A;  4LMW A;  5BMU B;  4KX4 A;  4FQU A;  5AIS A;  1PL1 A;  2H1L A;  3R2Q A;  5ECH B;  4L5O A;  4F03 A;  4GDF A;  1U87 A;  3DGQ A;  3M3M A;  18GS A;  1K3L A;  4EDY A;  4RI7 A;  4K0N A;  2DSA A;  4N0V A;  3TGZ A;  2ON5 A;  1HNC A;  3N5O A;  1ML6 A;  5ELG A;  12GS A;  1GTB A;  1M9B A;  5A34 B;  17GS A;  5DAK B;  4O92 A;  1VF1 A;  3BBY A;  3WD6 A;  5JCW A;  2EFH A;  4NHZ A;  1BYE A;  5DJM A;  4ZB7 A;  4L8E A;  4Q5F A;  2JL4 A;  3LFL A;  1XW6 A;  3GH6 A;  3LSZ A;  4GLT A;  5EL8 A;  2CAI A;  2UZ8 A;  1GUM A;  4IQ1 A;  5J4V A;  3N9J A;  3QAG A;  4PNF A;  1K3O A;  3UAR A;  5FHI A;  16GS A;  3LYP A;  1TXU A;  4Q5N A;  4ZBD A;  4GSS A;  4NAX A;  5F0G A;  1M9A A;  3VI5 A;  1B48 A;  5J40 A;  4KDX A;  1GSE A;  2VCV A;  2HRA A;  4PGT A;  1EOG A;  2A2S A;  4L5L A;  2R6K A;  3MAK A;  2HNL A;  1TW9 A;  1AQV A;  3UVH A;  3VK9 A;  5J5N A;  3VUR A;  5AIX A;  1G6Y A;  1DUG A;  6GST A;  4G0I A;  4JBB A;  1OE8 A;  4PXO A;  3G7I A;  4BL7 A;  1MTC A;  3KTL A;  2AHE A;  4GSN A;  1BAY A;  5DQS A;  2C80 A;  4PNG A;  4ECB A;  2WB9 A;  2YV9 A;  2GDR A;  3F6F A;  4G9H A;  4I97 A;  1YQ1 A;  4IKH A;  3MDK A;  5EVO A;  5G5F A;  2C3T A;  3H1N A;  5FWG A;  10GS A;  2PBJ A;  5A4V A;  3Q18 A;  1K0O A;  5D9T A;  3FYG A;  2X64 A;  5ECN B;  4OFN A;  4PQH A;  1KBN A;  2IMI A;  4GST A;  5ECO B;  3IC8 A;  5ECI B;  3VLN A;  3UBK A;  5LD0 A;  5ECQ B;  4ZB9 A;  3KM6 A;  3EIN A;  1F3A A;  2F8F A;  1U3I A;  1JZR A;  3W8S A;  4IW9 A;  2CZ3 A;  3ISO A;  5DAL B;  8GSS A;  1GSD A;  1PKZ A;  1BF5 A;  1GSQ A;  1GSY A;  3GX0 A;  4IEL A;  5ECM B;  3ZFL A;  4W66 A;  3ZMK A;  4ACS A;  3AY8 A;  7GSS A;  4JED A;  1R5A A;  1Q4J A;  3GSS A;  1SVO A;  1YJ6 A;  1B8X A;  1M99 A;  1VF2 A;  1JLW A;  1EV4 A;  3KMN A;  5ECL B;  5DCG A;  1GWC A;  2N5F A;  5J4U A;  5G5E A;  4KSM A;  5IQY A;  3FR6 A;  4OMV A;  3TOU A;  3FR9 A;  2C8U A;  4BL7 B;  6GSS A;  6GSU A;  2C4J A;  5HFK A;  4F0B A;  3HKR A;  2ON7 A;  4J2F A;  4OFM A;  3L0H A;  4BVX A;  3RBT A;  2GSS A;  1A0F A;  3IBH A;  4YAV A;  5DJL A;  1TDI A;  1U88 A;  3EE2 A;  3O3T A;  3F6D A;  4YAP A;  4AKX B;  1XWG A;  2HSN B;  2EFD A;  11GS A;  4IBP A;  3FRC A;  5D73 A;  1NHY A;  5AGY A;  5J4Y A;  3G7J A;  3NIV A;  3CSI A;  1YDK A;  2HSM A;  3C8E A;  2J9H A;  4MPG A;  5D9W A;  5EY6 A;  4TOP A;  4PUR A;  1IYI A;  4USS A;  4EC0 A;  4N3Z A;  4OFT A;  4E8E A;  1AQW A;  2FNO A;  1FHE A;  5KEJ A;  5F07 A;  4PUA A;  2VCT A;  3HJO A;  4MPF A;  1E6B A;  1G7O A;  6GSY A;  5F06 A;  2R5G A;  2PGT A;  1HNB A;  1JLV A;  2GSR A;  3QAV A;  4MF5 A;  1B4P A;  4KF9 A;  3TOT A;  4PQI A;  1Z9H A;  1GLP A;  4PTS A;  1PX7 A;  1SVL A;  2YV7 A;  1ZGN A;  3U6V A;  2OAC A;  1IYH A;  1C72 A;  1K0D A;  5GST A;  2VCX A;  1F2E A;  2GSQ A;  3GUR A;  4AGS A;  4KAE A;  4E68 A;  4ZB8 A;  5JCU A;  4YQM A;  1HQO A;  5D9X A;  4BVX B;  3UAP A;  1RK4 A;  4WR4 A;  1GUL A;  2A2R A;  4AKI A;  5A5H A;  1VF4 A;  1Y6E A;  4QQ7 A;  1BG5 A;  2GTU A;  2HRK A;  1GTU A;  1PGT A;  4BVY A;  3HJM A;  1K0A A;  4DEJ A;  3PGT A;  3Q74 A;  3ZFB A;  4Q5R A;  5A4W A;  5A5K A;  2C3Q A;  4G01 A;  1K0C A;  3VPQ A;  2HSM B;  2EFC A;  2WRT A;  4EDZ A;  5ECR B;  4ISD A;  4ZXG A;  4KDY A;  2UV8 G;  3I69 A;  2OA7 A;  4GF0 A;  2D2Z A;  3FY7 A;  4MF7 A;  2PVQ A;  1LJR A;  2EFE A;  4WR5 A;  3IR4 A;  1EV9 A;  2VO4 A;  4MF6 A;  1XWK A;  1AQX A;  4PX1 A;  5B7C A;  3CSJ A;  3ERF A;  1GNW A;  2VD1 A;  4KH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...