5A1NA

The crystal structure of the gst-like domains complex of eprs-aimp2 mutant s156d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs-Aimp2 Mutant S156D
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 58
structure length 167
sequence length 167
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a1nA00
5A5HA 4AKIA 5A5HB 4AI6A 5A34A 4AKHA 5A34B 4AKGA 4W66A 5BMUB 4ZB7A 5A1NB 5A1NA
chains in the Genus database with same CATH superfamily
2OA7A 5F07A 4KE3A 3DGQA 1GLQA 5A4VA 1OYJA 2HSMA 1U3IA 4KDXA 4HJ2A 3LG6A 3KTLA 4DEJA 1HNBA 3TGZA 4F0CA 4Q5FA 1GULA 2VCVA 5AIXA 1SVOA 1FW1A 3VPTA 3GTUB 1K0DA 4RI7A 4Q5RA 1GUKA 2WS2A 1E6BA 1B48A 3U6VA 3D0ZA 4CHSA 3Q74A 1BF5A 2PMTA 5HFKA 4AI6A 3CBUA 3EINA 4PX1A 1JLVA 1K0OA 3HJMA 4G19A 3VK9A 1AQXA 1GSFA 4PTSA 2HRAA 2VD1A 4GF0A 1S4BP 3QAGA 1EV4A 2FHEA 1A0FA 2VCTA 1SVMA 4PGTA 4YH2A 3DD3A 2HRKB 5EVOA 5A5HB 1YY7A 3I69A 1AW9A 1K0MA 7GSSA 4IQ1A 1PX6A 5J5NA 2R6KA 5D9TA 2UV8G 3Q18A 1XWGA 1MTCA 5B7CA 4BVXA 2AB6A 4IS0A 5AGYA 4Q5NA 4ZBDA 2O36A 2DC5A 1YJ6A 1M9AA 2C80A 4HZ2A 3HMJG 5A34B 4PURA 2WB9A 1K3YA 4YQMA 3C8EA 3ZMKA 4MPGA 2WVYA 3VURA 3KMOA 3ERFA 5ECSA 4HOJA 1GNWA 5DJMA 1GTUA 4K0GA 5DQSA 5A5KA 18GSA 13GSA 5J4YA 2HSMB 1BYEA 1GTBA 4KDUA 3GURA 2WVXA 2IL3A 2FNOA 1G6WA 4L5LA 4EDYA 5DAKA 2CVDA 1KBNA 2CZ3A 1XW6A 2WW1A 1F3AA 2VKZG 1EEMA 4MF6A 4N3ZA 1BG5A 2WDUA 4KX4A 4Q5QA 1PGTA 3GUSA 2D2ZA 3FY7A 1B8XA 2HRKA 3WD6A 3UARA 2CA8A 1MD4A 2X64A 1B4PA 2VD0A 4MPFA 9GSSA 5IQYA 4PUAA 3CHXC 4JBBA 4G0LA 3P8WA 1BG1A 3FR6A 5GSSA 1GUHA 1YKCA 1GTIA 1PD21 4MP4A 1PA3A 2YV9A 1LJRA 4RI6A 4BVXB 3R2QA 2EFEA 3KM6A 3H1NA 2EFHA 4AKHA 6GSWA 1K0AA 3VWXA 4ECIA 3TU3B 3VI7A 1U87A 1N2AA 6GSXA 1HNAA 1JZRA 3TOUA 1SVLA 3RBTA 3LQ7A 3IC8A 3L0HA 1PN9A 4GCIA 1R5AA 4YAVA 2PERA 3LYKA 4GDFA 2GTUA 2OACA 4NHWA 1DUGA 4PQIA 5DDLA 5A4UA 4OMVA 4ECBA 4AKGA 2O3EA 5D73A 1M9BA 5ECNB 1I1IP 3CSIA 4PHZC 1VF3A 1PX7A 1Y1UA 4PQHA 4NAXA 2WVXB 3WYWA 3O76A 4W66A 5BMUA 8GSSA 1GSEA 4ID0A 4MDCA 5DAKB 4OFMA 2N5FA 4GTUA 2UZ8A 1Y6EA 5DJLA 3GSTA 2GSSA 1K3LA 3F63A 1GNEA 3LYPA 4IKHA 5ECKB 2F3MA 1PKWA 3F6FA 5D9WA 4NHZA 3TOTA 5ECLB 1V2AA 1GLPA 3Q19A 5JCUA 3F6DA 3BBYA 1AXDA 2C3TA 2H1LA 4MF5A 5G5EA 16GSA 5ECQB 1BAYA 6GSYA 4ZB6A 4O7HA 2GSQA 1C72A 1EOHA 4PI0C 4IJIA 4OFNA 3IE3A 2A2RA 2WVZA 1USBA 4K0NA 4LMWA 2PGTA 4YQVA 4G10A 4EDZA 1GSUA 6GSTA 3IK9A 1ZGNA 2GSRA 3HJOA 5EL8A 5J4UA 1EOGA 1TU7A 3CRTA 4E8EA 1PL1A 3I6AA 3RFRC 5EY6A 4G01A 2IMKA 10GSA 2PVQA 1MD3A 3ZFBA 4ZXGA 5J47A 2CZ2A 2R5GA 1GSYA 5BMUB 3IK7A 2EFCA 4ZB9A 2HSNA 2R3XA 4KDYA 4PXOA 5ECIB 20GSA 3VPQA 4ZBBA 1K0BA 3QAVA 4GSSA 3W8SA 2VCXA 4EE0A 2ON5A 1BX9A 2O5VA 1EV9A 4F0BA 3M8NA 6GSSA 3KXOA 11GSA 4KAEA 4ZBAA 3FR3A 4G0IA 14GSA 1F3BA 2WZSA 3ISOA 1VF1A 3LJRA 19GSA 5ECHB 5F8BA 3IR4A 4IVFA 2C3NA 1GWCA 3LXTA 3M1GA 1UA5A 5ELAA 4QMKA 1GTAA 1XWKA 5F05A 3P90A 3FR9A 2IMIA 1PMTA 5F0GA 5AN1A 1Z9HA 3PGTA 4KGIA 2R4VA 2DSAA 3N9JA 5LD0A 4EXJA 4LMVA 1YVLA 4PNGA 2J9HA 1IYHA 4HI7A 4IW9A 2C8UA 1K0CA 1YDKA 4TOPA 6GSVA 3MDKA 3CRUA 5F06A 3PPUA 5DALA 3ZFLA 3ERGA 4L5OA 5DCGA 4JZQA 4MF7A 3ZMLA 2WJUA 4FXYP 3VLNA 3G7IA 4ISDA 5LCZA 3N5OA 3MAKA 22GSA 4IBPA 1PKZA 6GSUA 3CWGA 1M99A 5FHIA 2HSNB 3RGBC 4USSA 5ECRB 4BVYB 4KH7A 4YQUA 2PBJA 2GSTA 2V6KA 2AHEA 1RK4A 3UVHA 3EE2A 2ON7A 3UAPA 4G9HA 5A4WA 1TXUA 4J2FA 5GSTA 3M3MA 4L8EA 12GSA 2C3QA 3QAWA 3M0FA 5J40A 3FRCA 1HNCA 3KMNA 1XW5A 1K0NA 2HQTA 4BL7A 5A1NB 1ZL9A 4AGSA 2CAIA 1U88A 3GX0A 2OADA 3LFLA 4ECCA 1NHYA 1AQVA 4PI2C 1GSQA 1HQOA 2WRTA 3HKRA 4JEDA 2YV7A 1AQWA 4E68A 4IQAA 2A2SA 1OE8A 1VF4A 4IGJA 4KSMA 3CSHA 17GSA 1IYIA 5ECOB 3R3EA 3LXZA 1V40A 4ZB8A 3SWLA 4ZB7A 4G0KA 1N25A 2YCDA 3AY8A 4FQUA 1YQ1A 4ECJA 3PR8A 5JCWA 3LSZA 1LBKA 5GZZB 3CSJA 3FYGA 1K3OA 2CAQA 4E8HA 5J41A 2EFDA 1G7OA 4WR5A 5G5FA 5DALB 3GTUA 3VI5A 4MZWA 1GSDA 3UBLA 3O3TA 4BVYA 1GUMA 4WR4A 1TDIA 2JL4A 5J4VA 1Q4JA 4GSNA 2HNLA 1GSSA 1PL2A 2WW0A 4AKIA 5D9VA 4GLTA 1G6YA 1M0UA 2VCQA 4AKXB 4OFTA 2VCWA 5FWGA 1JLWA 4ACSA 3NIVA 1TW9A 5A1NA 3GH6A 5D9XA 5A5HA 3KJYA 4GSTA 4PNFA 1ML6A 2AAWA 2VCZA 3G7JA 1OKTA 5KEJA 4EC0A 4N0VA 4BL7B 4YAPA 3UBKA 2F8FA 1TU8A 2LJRA 5FT3A 3GSSA 2GLRA 4F03A 1VF2A 3IBHA 5ECMB 1FHEA 4I97A 4MK3A 5AISA 5A34A 4KF9A 4O92A 1OE7A 2WW3A 2GDRA 4QQ7A 5AIVA 1F2EA 2OT3A 3QR6A 4HZ4A 4IELA 2WW2A 2NTOA 1YEWC 5ELGA 2C4JA 2VO4A 5ECPB
chains in the Genus database with same CATH topology
2OA7A 5F07A 4KE3A 3DGQA 1GLQA 5A4VA 1OYJA 2HSMA 1U3IA 4KDXA 4HJ2A 3LG6A 3KTLA 4DEJA 1HNBA 3TGZA 4F0CA 4Q5FA 1GULA 2VCVA 5AIXA 1SVOA 1FW1A 3VPTA 3GTUB 1K0DA 4RI7A 4Q5RA 1GUKA 2WS2A 1E6BA 1B48A 3U6VA 3D0ZA 4CHSA 3Q74A 1BF5A 2PMTA 5HFKA 4AI6A 3CBUA 3EINA 4PX1A 1JLVA 1K0OA 3HJMA 4G19A 3VK9A 1AQXA 1GSFA 4PTSA 2HRAA 2VD1A 4GF0A 3QAGA 1EV4A 2FHEA 1A0FA 2VCTA 1SVMA 4PGTA 4YH2A 3DD3A 2HRKB 5EVOA 5A5HB 1YY7A 3I69A 1AW9A 1K0MA 7GSSA 4IQ1A 1PX6A 5J5NA 2R6KA 5D9TA 2UV8G 3Q18A 1XWGA 1MTCA 5B7CA 4BVXA 2AB6A 4IS0A 5AGYA 4Q5NA 4ZBDA 2DC5A 1YJ6A 1M9AA 2C80A 4HZ2A 3HMJG 5A34B 4PURA 2WB9A 1K3YA 4YQMA 3C8EA 3ZMKA 4MPGA 3VURA 3KMOA 3ERFA 5ECSA 4HOJA 1GNWA 5DJMA 1GTUA 4K0GA 5DQSA 5A5KA 18GSA 13GSA 5J4YA 2HSMB 1BYEA 1GTBA 4KDUA 3GURA 2IL3A 2FNOA 1G6WA 4L5LA 4EDYA 5DAKA 2CVDA 1KBNA 2CZ3A 1XW6A 1F3AA 2VKZG 1EEMA 4MF6A 4N3ZA 1BG5A 2WDUA 4KX4A 4Q5QA 1PGTA 3GUSA 2D2ZA 3FY7A 1B8XA 2HRKA 3WD6A 3UARA 2CA8A 1MD4A 2X64A 1B4PA 2VD0A 4MPFA 9GSSA 5IQYA 4PUAA 4JBBA 4G0LA 3P8WA 1BG1A 3FR6A 5GSSA 1GUHA 1YKCA 1GTIA 1PD21 4MP4A 1PA3A 2YV9A 1LJRA 4RI6A 4BVXB 3R2QA 2EFEA 3KM6A 3H1NA 2EFHA 4AKHA 6GSWA 1K0AA 3VWXA 4ECIA 3TU3B 3VI7A 1U87A 1N2AA 6GSXA 1HNAA 1JZRA 3TOUA 1SVLA 3RBTA 3LQ7A 3IC8A 3L0HA 1PN9A 4GCIA 1R5AA 4YAVA 2PERA 3LYKA 4GDFA 2GTUA 2OACA 4NHWA 1DUGA 4PQIA 5DDLA 5A4UA 4OMVA 4ECBA 4AKGA 5D73A 1M9BA 5ECNB 3CSIA 1VF3A 1PX7A 1Y1UA 4PQHA 4NAXA 3WYWA 3O76A 4W66A 5BMUA 8GSSA 1GSEA 4ID0A 4MDCA 5DAKB 4OFMA 2N5FA 4GTUA 2UZ8A 1Y6EA 5DJLA 3GSTA 2GSSA 1K3LA 3F63A 1GNEA 3LYPA 4IKHA 5ECKB 2F3MA 1PKWA 3F6FA 5D9WA 4NHZA 3TOTA 5ECLB 1V2AA 1GLPA 3Q19A 5JCUA 3F6DA 3BBYA 1AXDA 2C3TA 2H1LA 4MF5A 5G5EA 16GSA 5ECQB 1BAYA 6GSYA 4ZB6A 4O7HA 2GSQA 1C72A 1EOHA 4IJIA 4OFNA 3IE3A 2A2RA 1USBA 4K0NA 4LMWA 2PGTA 4YQVA 4G10A 4EDZA 1GSUA 6GSTA 3IK9A 1ZGNA 2GSRA 3HJOA 5EL8A 5J4UA 1EOGA 1TU7A 3CRTA 4E8EA 1PL1A 3I6AA 5EY6A 4G01A 2IMKA 10GSA 2PVQA 1MD3A 3ZFBA 4ZXGA 5J47A 2CZ2A 2R5GA 1GSYA 5BMUB 3IK7A 2EFCA 4ZB9A 2HSNA 2R3XA 4KDYA 4PXOA 5ECIB 20GSA 3VPQA 4ZBBA 1K0BA 3QAVA 4GSSA 3W8SA 2VCXA 4EE0A 2ON5A 1BX9A 2O5VA 1EV9A 4F0BA 3M8NA 6GSSA 3KXOA 11GSA 4KAEA 4ZBAA 3FR3A 4G0IA 14GSA 1F3BA 3ISOA 1VF1A 3LJRA 19GSA 5ECHB 5F8BA 3IR4A 4IVFA 2C3NA 1GWCA 3LXTA 3M1GA 1UA5A 5ELAA 4QMKA 1GTAA 1XWKA 5F05A 3P90A 3FR9A 2IMIA 1PMTA 5F0GA 5AN1A 1Z9HA 3PGTA 4KGIA 2R4VA 2DSAA 3N9JA 5LD0A 4EXJA 4LMVA 1YVLA 4PNGA 2J9HA 1IYHA 4HI7A 4IW9A 2C8UA 1K0CA 1YDKA 4TOPA 6GSVA 3MDKA 3CRUA 5F06A 3PPUA 5DALA 3ZFLA 3ERGA 4L5OA 5DCGA 4JZQA 4MF7A 3ZMLA 2WJUA 3VLNA 3G7IA 4ISDA 5LCZA 3N5OA 3MAKA 22GSA 4IBPA 1PKZA 6GSUA 3CWGA 1M99A 5FHIA 2HSNB 4USSA 5ECRB 4BVYB 4KH7A 4YQUA 2PBJA 2GSTA 2V6KA 2AHEA 1RK4A 3UVHA 3EE2A 2ON7A 3UAPA 4G9HA 5A4WA 1TXUA 4J2FA 5GSTA 3M3MA 4L8EA 12GSA 2C3QA 3QAWA 3M0FA 5J40A 3FRCA 1HNCA 3KMNA 1XW5A 1K0NA 2HQTA 4BL7A 5A1NB 1ZL9A 4AGSA 2CAIA 1U88A 3GX0A 2OADA 3LFLA 4ECCA 1NHYA 1AQVA 1GSQA 1HQOA 2WRTA 3HKRA 4JEDA 2YV7A 1AQWA 4E68A 4IQAA 2A2SA 1OE8A 1VF4A 4IGJA 4KSMA 3CSHA 17GSA 1IYIA 5ECOB 3R3EA 3LXZA 1V40A 4ZB8A 3SWLA 4ZB7A 4G0KA 1N25A 2YCDA 3AY8A 4FQUA 1YQ1A 4ECJA 3PR8A 5JCWA 3LSZA 1LBKA 5GZZB 3CSJA 3FYGA 1K3OA 2CAQA 4E8HA 5J41A 2EFDA 1G7OA 4WR5A 5G5FA 5DALB 3GTUA 3VI5A 4MZWA 1GSDA 3UBLA 3O3TA 4BVYA 1GUMA 4WR4A 1TDIA 2JL4A 5J4VA 1Q4JA 4GSNA 2HNLA 1GSSA 1PL2A 4AKIA 5D9VA 4GLTA 1G6YA 1M0UA 2VCQA 4AKXB 4OFTA 2VCWA 5FWGA 1JLWA 4ACSA 3NIVA 1TW9A 5A1NA 3GH6A 5D9XA 5A5HA 3KJYA 4GSTA 4PNFA 1ML6A 2AAWA 2VCZA 3G7JA 1OKTA 5KEJA 4EC0A 4N0VA 4BL7B 4YAPA 3UBKA 2F8FA 1TU8A 2LJRA 5FT3A 3GSSA 2GLRA 4F03A 1VF2A 3IBHA 5ECMB 1FHEA 4I97A 4MK3A 5AISA 5A34A 4KF9A 4O92A 1OE7A 2GDRA 4QQ7A 5AIVA 1F2EA 2OT3A 3QR6A 4HZ4A 4IELA 2NTOA 5ELGA 2C4JA 2VO4A 5ECPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A5H A;  4AKI A;  5A5H B;  4AI6 A;  5A34 A;  4AKH A;  5A34 B;  4AKG A;  4W66 A;  5BMU B;  4ZB7 A;  5A1N B;  5A1N A; 
#chains in the Genus database with same CATH topology
 2OA7 A;  5F07 A;  4KE3 A;  3DGQ A;  1GLQ A;  5A4V A;  1OYJ A;  2HSM A;  1U3I A;  4KDX A;  4HJ2 A;  3LG6 A;  3KTL A;  4DEJ A;  1HNB A;  3TGZ A;  4F0C A;  4Q5F A;  1GUL A;  2VCV A;  5AIX A;  1SVO A;  1FW1 A;  3VPT A;  3GTU B;  1K0D A;  4RI7 A;  4Q5R A;  1GUK A;  2WS2 A;  1E6B A;  1B48 A;  3U6V A;  3D0Z A;  4CHS A;  3Q74 A;  1BF5 A;  2PMT A;  5HFK A;  4AI6 A;  3CBU A;  3EIN A;  4PX1 A;  1JLV A;  1K0O A;  3HJM A;  4G19 A;  3VK9 A;  1AQX A;  1GSF A;  4PTS A;  2HRA A;  2VD1 A;  4GF0 A;  1S4B P;  3QAG A;  1EV4 A;  2FHE A;  1A0F A;  2VCT A;  1SVM A;  4PGT A;  4YH2 A;  3DD3 A;  2HRK B;  5EVO A;  5A5H B;  1YY7 A;  3I69 A;  1AW9 A;  1K0M A;  7GSS A;  4IQ1 A;  1PX6 A;  5J5N A;  2R6K A;  5D9T A;  2UV8 G;  3Q18 A;  1XWG A;  1MTC A;  5B7C A;  4BVX A;  2AB6 A;  4IS0 A;  5AGY A;  4Q5N A;  4ZBD A;  2O36 A;  2DC5 A;  1YJ6 A;  1M9A A;  2C80 A;  4HZ2 A;  3HMJ G;  5A34 B;  4PUR A;  2WB9 A;  1K3Y A;  4YQM A;  3C8E A;  3ZMK A;  4MPG A;  2WVY A;  3VUR A;  3KMO A;  3ERF A;  5ECS A;  4HOJ A;  1GNW A;  5DJM A;  1GTU A;  4K0G A;  5DQS A;  5A5K A;  18GS A;  13GS A;  5J4Y A;  2HSM B;  1BYE A;  1GTB A;  4KDU A;  3GUR A;  2WVX A;  2IL3 A;  2FNO A;  1G6W A;  4L5L A;  4EDY A;  5DAK A;  2CVD A;  1KBN A;  2CZ3 A;  1XW6 A;  2WW1 A;  1F3A A;  2VKZ G;  1EEM A;  4MF6 A;  4N3Z A;  1BG5 A;  2WDU A;  4KX4 A;  4Q5Q A;  1PGT A;  3GUS A;  2D2Z A;  3FY7 A;  1B8X A;  2HRK A;  3WD6 A;  3UAR A;  2CA8 A;  1MD4 A;  2X64 A;  1B4P A;  2VD0 A;  4MPF A;  9GSS A;  5IQY A;  4PUA A;  3CHX C;  4JBB A;  4G0L A;  3P8W A;  1BG1 A;  3FR6 A;  5GSS A;  1GUH A;  1YKC A;  1GTI A;  1PD2 1;  4MP4 A;  1PA3 A;  2YV9 A;  1LJR A;  4RI6 A;  4BVX B;  3R2Q A;  2EFE A;  3KM6 A;  3H1N A;  2EFH A;  4AKH A;  6GSW A;  1K0A A;  3VWX A;  4ECI A;  3TU3 B;  3VI7 A;  1U87 A;  1N2A A;  6GSX A;  1HNA A;  1JZR A;  3TOU A;  1SVL A;  3RBT A;  3LQ7 A;  3IC8 A;  3L0H A;  1PN9 A;  4GCI A;  1R5A A;  4YAV A;  2PER A;  3LYK A;  4GDF A;  2GTU A;  2OAC A;  4NHW A;  1DUG A;  4PQI A;  5DDL A;  5A4U A;  4OMV A;  4ECB A;  4AKG A;  2O3E A;  5D73 A;  1M9B A;  5ECN B;  1I1I P;  3CSI A;  4PHZ C;  1VF3 A;  1PX7 A;  1Y1U A;  4PQH A;  4NAX A;  2WVX B;  3WYW A;  3O76 A;  4W66 A;  5BMU A;  8GSS A;  1GSE A;  4ID0 A;  4MDC A;  5DAK B;  4OFM A;  2N5F A;  4GTU A;  2UZ8 A;  1Y6E A;  5DJL A;  3GST A;  2GSS A;  1K3L A;  3F63 A;  1GNE A;  3LYP A;  4IKH A;  5ECK B;  2F3M A;  1PKW A;  3F6F A;  5D9W A;  4NHZ A;  3TOT A;  5ECL B;  1V2A A;  1GLP A;  3Q19 A;  5JCU A;  3F6D A;  3BBY A;  1AXD A;  2C3T A;  2H1L A;  4MF5 A;  5G5E A;  16GS A;  5ECQ B;  1BAY A;  6GSY A;  4ZB6 A;  4O7H A;  2GSQ A;  1C72 A;  1EOH A;  4PI0 C;  4IJI A;  4OFN A;  3IE3 A;  2A2R A;  2WVZ A;  1USB A;  4K0N A;  4LMW A;  2PGT A;  4YQV A;  4G10 A;  4EDZ A;  1GSU A;  6GST A;  3IK9 A;  1ZGN A;  2GSR A;  3HJO A;  5EL8 A;  5J4U A;  1EOG A;  1TU7 A;  3CRT A;  4E8E A;  1PL1 A;  3I6A A;  3RFR C;  5EY6 A;  4G01 A;  2IMK A;  10GS A;  2PVQ A;  1MD3 A;  3ZFB A;  4ZXG A;  5J47 A;  2CZ2 A;  2R5G A;  1GSY A;  5BMU B;  3IK7 A;  2EFC A;  4ZB9 A;  2HSN A;  2R3X A;  4KDY A;  4PXO A;  5ECI B;  20GS A;  3VPQ A;  4ZBB A;  1K0B A;  3QAV A;  4GSS A;  3W8S A;  2VCX A;  4EE0 A;  2ON5 A;  1BX9 A;  2O5V A;  1EV9 A;  4F0B A;  3M8N A;  6GSS A;  3KXO A;  11GS A;  4KAE A;  4ZBA A;  3FR3 A;  4G0I A;  14GS A;  1F3B A;  2WZS A;  3ISO A;  1VF1 A;  3LJR A;  19GS A;  5ECH B;  5F8B A;  3IR4 A;  4IVF A;  2C3N A;  1GWC A;  3LXT A;  3M1G A;  1UA5 A;  5ELA A;  4QMK A;  1GTA A;  1XWK A;  5F05 A;  3P90 A;  3FR9 A;  2IMI A;  1PMT A;  5F0G A;  5AN1 A;  1Z9H A;  3PGT A;  4KGI A;  2R4V A;  2DSA A;  3N9J A;  5LD0 A;  4EXJ A;  4LMV A;  1YVL A;  4PNG A;  2J9H A;  1IYH A;  4HI7 A;  4IW9 A;  2C8U A;  1K0C A;  1YDK A;  4TOP A;  6GSV A;  3MDK A;  3CRU A;  5F06 A;  3PPU A;  5DAL A;  3ZFL A;  3ERG A;  4L5O A;  5DCG A;  4JZQ A;  4MF7 A;  3ZML A;  2WJU A;  4FXY P;  3VLN A;  3G7I A;  4ISD A;  5LCZ A;  3N5O A;  3MAK A;  22GS A;  4IBP A;  1PKZ A;  6GSU A;  3CWG A;  1M99 A;  5FHI A;  2HSN B;  3RGB C;  4USS A;  5ECR B;  4BVY B;  4KH7 A;  4YQU A;  2PBJ A;  2GST A;  2V6K A;  2AHE A;  1RK4 A;  3UVH A;  3EE2 A;  2ON7 A;  3UAP A;  4G9H A;  5A4W A;  1TXU A;  4J2F A;  5GST A;  3M3M A;  4L8E A;  12GS A;  2C3Q A;  3QAW A;  3M0F A;  5J40 A;  3FRC A;  1HNC A;  3KMN A;  1XW5 A;  1K0N A;  2HQT A;  4BL7 A;  5A1N B;  1ZL9 A;  4AGS A;  2CAI A;  1U88 A;  3GX0 A;  2OAD A;  3LFL A;  4ECC A;  1NHY A;  1AQV A;  4PI2 C;  1GSQ A;  1HQO A;  2WRT A;  3HKR A;  4JED A;  2YV7 A;  1AQW A;  4E68 A;  4IQA A;  2A2S A;  1OE8 A;  1VF4 A;  4IGJ A;  4KSM A;  3CSH A;  17GS A;  1IYI A;  5ECO B;  3R3E A;  3LXZ A;  1V40 A;  4ZB8 A;  3SWL A;  4ZB7 A;  4G0K A;  1N25 A;  2YCD A;  3AY8 A;  4FQU A;  1YQ1 A;  4ECJ A;  3PR8 A;  5JCW A;  3LSZ A;  1LBK A;  5GZZ B;  3CSJ A;  3FYG A;  1K3O A;  2CAQ A;  4E8H A;  5J41 A;  2EFD A;  1G7O A;  4WR5 A;  5G5F A;  5DAL B;  3GTU A;  3VI5 A;  4MZW A;  1GSD A;  3UBL A;  3O3T A;  4BVY A;  1GUM A;  4WR4 A;  1TDI A;  2JL4 A;  5J4V A;  1Q4J A;  4GSN A;  2HNL A;  1GSS A;  1PL2 A;  2WW0 A;  4AKI A;  5D9V A;  4GLT A;  1G6Y A;  1M0U A;  2VCQ A;  4AKX B;  4OFT A;  2VCW A;  5FWG A;  1JLW A;  4ACS A;  3NIV A;  1TW9 A;  5A1N A;  3GH6 A;  5D9X A;  5A5H A;  3KJY A;  4GST A;  4PNF A;  1ML6 A;  2AAW A;  2VCZ A;  3G7J A;  1OKT A;  5KEJ A;  4EC0 A;  4N0V A;  4BL7 B;  4YAP A;  3UBK A;  2F8F A;  1TU8 A;  2LJR A;  5FT3 A;  3GSS A;  2GLR A;  4F03 A;  1VF2 A;  3IBH A;  5ECM B;  1FHE A;  4I97 A;  4MK3 A;  5AIS A;  5A34 A;  4KF9 A;  4O92 A;  1OE7 A;  2WW3 A;  2GDR A;  4QQ7 A;  5AIV A;  1F2E A;  2OT3 A;  3QR6 A;  4HZ4 A;  4IEL A;  2WW2 A;  2NTO A;  1YEW C;  5ELG A;  2C4J A;  2VO4 A;  5ECP B; 
#chains in the Genus database with same CATH homology
 2OA7 A;  5F07 A;  4KE3 A;  3DGQ A;  1GLQ A;  5A4V A;  1OYJ A;  2HSM A;  1U3I A;  4KDX A;  4HJ2 A;  3LG6 A;  3KTL A;  4DEJ A;  1HNB A;  3TGZ A;  4F0C A;  4Q5F A;  1GUL A;  2VCV A;  5AIX A;  1SVO A;  1FW1 A;  3VPT A;  3GTU B;  1K0D A;  4RI7 A;  4Q5R A;  1GUK A;  2WS2 A;  1E6B A;  1B48 A;  3U6V A;  3D0Z A;  4CHS A;  3Q74 A;  1BF5 A;  2PMT A;  5HFK A;  4AI6 A;  3CBU A;  3EIN A;  4PX1 A;  1JLV A;  1K0O A;  3HJM A;  4G19 A;  3VK9 A;  1AQX A;  1GSF A;  4PTS A;  2HRA A;  2VD1 A;  4GF0 A;  3QAG A;  1EV4 A;  2FHE A;  1A0F A;  2VCT A;  1SVM A;  4PGT A;  4YH2 A;  3DD3 A;  2HRK B;  5EVO A;  5A5H B;  1YY7 A;  3I69 A;  1AW9 A;  1K0M A;  7GSS A;  4IQ1 A;  1PX6 A;  5J5N A;  2R6K A;  5D9T A;  2UV8 G;  3Q18 A;  1XWG A;  1MTC A;  5B7C A;  4BVX A;  2AB6 A;  4IS0 A;  5AGY A;  4Q5N A;  4ZBD A;  2DC5 A;  1YJ6 A;  1M9A A;  2C80 A;  4HZ2 A;  3HMJ G;  5A34 B;  4PUR A;  2WB9 A;  1K3Y A;  4YQM A;  3C8E A;  3ZMK A;  4MPG A;  3VUR A;  3KMO A;  3ERF A;  5ECS A;  4HOJ A;  1GNW A;  5DJM A;  1GTU A;  4K0G A;  5DQS A;  5A5K A;  18GS A;  13GS A;  5J4Y A;  2HSM B;  1BYE A;  1GTB A;  4KDU A;  3GUR A;  2IL3 A;  2FNO A;  1G6W A;  4L5L A;  4EDY A;  5DAK A;  2CVD A;  1KBN A;  2CZ3 A;  1XW6 A;  1F3A A;  2VKZ G;  1EEM A;  4MF6 A;  4N3Z A;  1BG5 A;  2WDU A;  4KX4 A;  4Q5Q A;  1PGT A;  3GUS A;  2D2Z A;  3FY7 A;  1B8X A;  2HRK A;  3WD6 A;  3UAR A;  2CA8 A;  1MD4 A;  2X64 A;  1B4P A;  2VD0 A;  4MPF A;  9GSS A;  5IQY A;  4PUA A;  4JBB A;  4G0L A;  3P8W A;  1BG1 A;  3FR6 A;  5GSS A;  1GUH A;  1YKC A;  1GTI A;  1PD2 1;  4MP4 A;  1PA3 A;  2YV9 A;  1LJR A;  4RI6 A;  4BVX B;  3R2Q A;  2EFE A;  3KM6 A;  3H1N A;  2EFH A;  4AKH A;  6GSW A;  1K0A A;  3VWX A;  4ECI A;  3TU3 B;  3VI7 A;  1U87 A;  1N2A A;  6GSX A;  1HNA A;  1JZR A;  3TOU A;  1SVL A;  3RBT A;  3LQ7 A;  3IC8 A;  3L0H A;  1PN9 A;  4GCI A;  1R5A A;  4YAV A;  2PER A;  3LYK A;  4GDF A;  2GTU A;  2OAC A;  4NHW A;  1DUG A;  4PQI A;  5DDL A;  5A4U A;  4OMV A;  4ECB A;  4AKG A;  5D73 A;  1M9B A;  5ECN B;  3CSI A;  1VF3 A;  1PX7 A;  1Y1U A;  4PQH A;  4NAX A;  3WYW A;  3O76 A;  4W66 A;  5BMU A;  8GSS A;  1GSE A;  4ID0 A;  4MDC A;  5DAK B;  4OFM A;  2N5F A;  4GTU A;  2UZ8 A;  1Y6E A;  5DJL A;  3GST A;  2GSS A;  1K3L A;  3F63 A;  1GNE A;  3LYP A;  4IKH A;  5ECK B;  2F3M A;  1PKW A;  3F6F A;  5D9W A;  4NHZ A;  3TOT A;  5ECL B;  1V2A A;  1GLP A;  3Q19 A;  5JCU A;  3F6D A;  3BBY A;  1AXD A;  2C3T A;  2H1L A;  4MF5 A;  5G5E A;  16GS A;  5ECQ B;  1BAY A;  6GSY A;  4ZB6 A;  4O7H A;  2GSQ A;  1C72 A;  1EOH A;  4IJI A;  4OFN A;  3IE3 A;  2A2R A;  1USB A;  4K0N A;  4LMW A;  2PGT A;  4YQV A;  4G10 A;  4EDZ A;  1GSU A;  6GST A;  3IK9 A;  1ZGN A;  2GSR A;  3HJO A;  5EL8 A;  5J4U A;  1EOG A;  1TU7 A;  3CRT A;  4E8E A;  1PL1 A;  3I6A A;  5EY6 A;  4G01 A;  2IMK A;  10GS A;  2PVQ A;  1MD3 A;  3ZFB A;  4ZXG A;  5J47 A;  2CZ2 A;  2R5G A;  1GSY A;  5BMU B;  3IK7 A;  2EFC A;  4ZB9 A;  2HSN A;  2R3X A;  4KDY A;  4PXO A;  5ECI B;  20GS A;  3VPQ A;  4ZBB A;  1K0B A;  3QAV A;  4GSS A;  3W8S A;  2VCX A;  4EE0 A;  2ON5 A;  1BX9 A;  2O5V A;  1EV9 A;  4F0B A;  3M8N A;  6GSS A;  3KXO A;  11GS A;  4KAE A;  4ZBA A;  3FR3 A;  4G0I A;  14GS A;  1F3B A;  3ISO A;  1VF1 A;  3LJR A;  19GS A;  5ECH B;  5F8B A;  3IR4 A;  4IVF A;  2C3N A;  1GWC A;  3LXT A;  3M1G A;  1UA5 A;  5ELA A;  4QMK A;  1GTA A;  1XWK A;  5F05 A;  3P90 A;  3FR9 A;  2IMI A;  1PMT A;  5F0G A;  5AN1 A;  1Z9H A;  3PGT A;  4KGI A;  2R4V A;  2DSA A;  3N9J A;  5LD0 A;  4EXJ A;  4LMV A;  1YVL A;  4PNG A;  2J9H A;  1IYH A;  4HI7 A;  4IW9 A;  2C8U A;  1K0C A;  1YDK A;  4TOP A;  6GSV A;  3MDK A;  3CRU A;  5F06 A;  3PPU A;  5DAL A;  3ZFL A;  3ERG A;  4L5O A;  5DCG A;  4JZQ A;  4MF7 A;  3ZML A;  2WJU A;  3VLN A;  3G7I A;  4ISD A;  5LCZ A;  3N5O A;  3MAK A;  22GS A;  4IBP A;  1PKZ A;  6GSU A;  3CWG A;  1M99 A;  5FHI A;  2HSN B;  4USS A;  5ECR B;  4BVY B;  4KH7 A;  4YQU A;  2PBJ A;  2GST A;  2V6K A;  2AHE A;  1RK4 A;  3UVH A;  3EE2 A;  2ON7 A;  3UAP A;  4G9H A;  5A4W A;  1TXU A;  4J2F A;  5GST A;  3M3M A;  4L8E A;  12GS A;  2C3Q A;  3QAW A;  3M0F A;  5J40 A;  3FRC A;  1HNC A;  3KMN A;  1XW5 A;  1K0N A;  2HQT A;  4BL7 A;  5A1N B;  1ZL9 A;  4AGS A;  2CAI A;  1U88 A;  3GX0 A;  2OAD A;  3LFL A;  4ECC A;  1NHY A;  1AQV A;  1GSQ A;  1HQO A;  2WRT A;  3HKR A;  4JED A;  2YV7 A;  1AQW A;  4E68 A;  4IQA A;  2A2S A;  1OE8 A;  1VF4 A;  4IGJ A;  4KSM A;  3CSH A;  17GS A;  1IYI A;  5ECO B;  3R3E A;  3LXZ A;  1V40 A;  4ZB8 A;  3SWL A;  4ZB7 A;  4G0K A;  1N25 A;  2YCD A;  3AY8 A;  4FQU A;  1YQ1 A;  4ECJ A;  3PR8 A;  5JCW A;  3LSZ A;  1LBK A;  5GZZ B;  3CSJ A;  3FYG A;  1K3O A;  2CAQ A;  4E8H A;  5J41 A;  2EFD A;  1G7O A;  4WR5 A;  5G5F A;  5DAL B;  3GTU A;  3VI5 A;  4MZW A;  1GSD A;  3UBL A;  3O3T A;  4BVY A;  1GUM A;  4WR4 A;  1TDI A;  2JL4 A;  5J4V A;  1Q4J A;  4GSN A;  2HNL A;  1GSS A;  1PL2 A;  4AKI A;  5D9V A;  4GLT A;  1G6Y A;  1M0U A;  2VCQ A;  4AKX B;  4OFT A;  2VCW A;  5FWG A;  1JLW A;  4ACS A;  3NIV A;  1TW9 A;  5A1N A;  3GH6 A;  5D9X A;  5A5H A;  3KJY A;  4GST A;  4PNF A;  1ML6 A;  2AAW A;  2VCZ A;  3G7J A;  1OKT A;  5KEJ A;  4EC0 A;  4N0V A;  4BL7 B;  4YAP A;  3UBK A;  2F8F A;  1TU8 A;  2LJR A;  5FT3 A;  3GSS A;  2GLR A;  4F03 A;  1VF2 A;  3IBH A;  5ECM B;  1FHE A;  4I97 A;  4MK3 A;  5AIS A;  5A34 A;  4KF9 A;  4O92 A;  1OE7 A;  2GDR A;  4QQ7 A;  5AIV A;  1F2E A;  2OT3 A;  3QR6 A;  4HZ4 A;  4IEL A;  2NTO A;  5ELG A;  2C4J A;  2VO4 A;  5ECP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...