5A1NA

The crystal structure of the gst-like domains complex of eprs-aimp2 mutant s156d
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
TLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLARVATTAGLYGSNLMEHTEIDHWLEFSATKLSSSDSFTSTINELNHSLSLRTYLVGNSLSLADLSVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL GLUTAMATE/PROLINE--TRNA LIGASE
publication title The Crystal Structure of the Gst-Like Domains Complex of Eprs-Aimp2 Mutant S156D
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 58
structure length 167
sequence length 167
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2015-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.130 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5a1nA00
5A1NB 4AI6A 5A5HB 4AKGA 4ZB7A 4AKIA 5A1NA 5A34A 4W66A 5A5HA 5BMUB 5A34B 4AKHA
chains in the Genus database with same CATH superfamily
2ON5A 1Q4JA 1BAYA 1MTCA 2A2RA 2AB6A 1YDKA 4K0NA 3C8EA 4CHSA 1AXDA 1VF1A 2VKZG 7GSSA 1TU8A 3NIVA 2IMKA 3FRCA 13GSA 4ISDA 3O3TA 5DALB 2OT3A 3F63A 3ZMLA 2O3EA 2WDUA 3CHXC 2CA8A 4MF5A 6GSWA 3PPUA 4NAXA 1VF2A 3M3MA 5F0GA 5EY6A 3ZMKA 5A1NA 5F8BA 4RI6A 6GSTA 5A34B 3FY7A 3VI7A 3GURA 3UAPA 3MAKA 4MF7A 4G0KA 4G0LA 1E6BA 4OFNA 2WVXA 2EFHA 2R6KA 1F2EA 1MD4A 1GWCA 3RFRC 1ZGNA 3G7IA 4KGIA 3QAWA 1YEWC 5FWGA 1SVOA 1M0UA 5FT3A 1A0FA 8GSSA 1NHYA 5ECIB 2C3TA 5HFKA 6GSXA 1M9BA 3LG6A 3FR9A 4USSA 1EV4A 1K0CA 3LXZA 4IBPA 4IJIA 5A5HA 4TOPA 1YVLA 1G6WA 5EVOA 5G5EA 1K0DA 2WW0A 5BMUA 4F0BA 3IK9A 1BG5A 4IKHA 4G10A 4WR5A 2GSQA 2PMTA 5ECMB 1F3BA 5GSTA 4AKHA 1VF4A 4FXYP 5AGYA 2N5FA 3VI5A 1AQXA 4BVXA 4E8EA 2PERA 4EC0A 3RGBC 1B48A 1F3AA 1BG1A 3HMJG 5ECOB 3ZFBA 3LXTA 4GSTA 17GSA 4WR4A 1N2AA 1VF3A 3TGZA 4MPFA 4Q5QA 5AN1A 4ACSA 5D9TA 18GSA 5A4UA 1GTBA 1EEMA 4QQ7A 5JCWA 1K3YA 1K0NA 3CBUA 2EFDA 5ECNB 2CVDA 2OADA 1YKCA 1OKTA 2GTUA 1K0AA 4N3ZA 1PN9A 3UBLA 4N0VA 1GSUA 1OE7A 4ZBAA 4PGTA 2HSNB 2HRAA 5AISA 4PQIA 2CAIA 3KJYA 2WW1A 3IE3A 4QMKA 1TU7A 5J4YA 3EINA 1PL1A 2VCTA 3CRTA 3FYGA 2VCQA 3DGQA 4PI0C 5GZZB 4ECBA 1HQOA 1GNWA 3LQ7A 3GTUB 1PX6A 1K0MA 5ECRB 6GSUA 2AHEA 1K0OA 1LJRA 1ML6A 1GUMA 4G9HA 5D9XA 5ELAA 2FNOA 5LD0A 4L5LA 1XW6A 4KX4A 3RBTA 3ISOA 1BYEA 2YV9A 4MDCA 1TW9A 4AKXB 1EV9A 2HQTA 3H1NA 4IS0A 2YV7A 3WD6A 3CSJA 1Y1UA 4BVYA 4J2FA 1PX7A 1M99A 5DJLA 2YCDA 4AGSA 4HZ2A 2VD0A 1GSEA 4L8EA 16GSA 3Q74A 1S4BP 1PA3A 22GSA 4GF0A 2VD1A 2WW3A 2F3MA 1ZL9A 5D9WA 4ZBBA 2WB9A 4PURA 5DAKB 2WJUA 5J4VA 4G0IA 3GSSA 5DALA 4IQAA 4EDYA 3EE2A 4HZ4A 4YH2A 1HNAA 1MD3A 2UV8G 3QAVA 5LCZA 2JL4A 4ZB6A 1U88A 4HI7A 4PI2C 5DCGA 11GSA 3Q19A 3IC8A 4JBBA 1K3LA 4ID0A 3TOTA 3D0ZA 4PX1A 4KDXA 1GSFA 6GSVA 1EOGA 1KBNA 1K0BA 2CZ2A 3P90A 1K3OA 1YJ6A 5A4WA 3CRUA 1EOHA 5ECHB 3I6AA 5J41A 4G19A 4GTUA 5A4VA 3IR4A 5F05A 2A2SA 2HSMA 1GUHA 3I69A 2EFCA 1I1IP 4PTSA 3ERGA 4Q5RA 10GSA 4L5OA 3M8NA 3R3EA 2UZ8A 4GDFA 3KTLA 1FW1A 3CSIA 5AIXA 2FHEA 4AKIA 3M1GA 2O36A 3KMOA 1OYJA 4IELA 4MP4A 3MDKA 2C8UA 5IQYA 4YQVA 4LMWA 3CSHA 4BL7B 3UARA 2WW2A 1GLPA 9GSSA 1LBKA 2WZSA 4PNGA 2HRKA 4IQ1A 12GSA 3O76A 3VLNA 2OACA 4OFTA 3GUSA 5ECSA 2VO4A 4MK3A 5J40A 4GCIA 1USBA 3TOUA 4FQUA 4MPGA 3KMNA 2C3QA 4KAEA 1C72A 5A5KA 5B7CA 3ZFLA 5J47A 4HJ2A 1G6YA 2X64A 5FHIA 3Q18A 3LJRA 2C3NA 3HJMA 3L0HA 2IMIA 4Q5NA 3F6DA 5ECKB 4Q5FA 6GSYA 3KM6A 1HNBA 2GLRA 4G01A 4PUAA 3CWGA 4JZQA 1B4PA 3IBHA 1M9AA 4EE0A 1AW9A 2HSNA 1R5AA 5DDLA 4AI6A 2CAQA 3AY8A 3VWXA 4E8HA 3P8WA 1GULA 3VPTA 3GH6A 1TDIA 4KDYA 2R3XA 4JEDA 4BVYB 3LSZA 14GSA 4YAVA 1V40A 2AAWA 3FR6A 1RK4A 1XWKA 1GTAA 1GUKA 4YAPA 1BX9A 2J9HA 4E68A 1SVLA 5A1NB 4RI7A 2VCWA 5KEJA 3N9JA 4KDUA 1JZRA 19GSA 4K0GA 4ZB9A 4O92A 5F07A 1JLWA 3LFLA 2PVQA 5D9VA 2V6KA 3LYPA 2H1LA 4KH7A 1AQVA 2VCXA 1GTIA 2WS2A 4KE3A 1SVMA 1IYIA 2WVXB 4F03A 3W8SA 1PGTA 4NHZA 2WVZA 5AIVA 3ERFA 1Z9HA 5G5FA 5J4UA 3PR8A 4IW9A 4ZB7A 3HJOA 1UA5A 5A34A 4KF9A 1PKWA 3QR6A 2PGTA 1GSQA 4GSSA 5DAKA 2ON7A 3U6VA 3N5OA 1PKZA 4GLTA 1GSSA 1U3IA 5A5HB 2NTOA 4ECJA 4PHZC 5F06A 2C4JA 1DUGA 5BMUB 1YY7A 1PMTA 5EL8A 4DEJA 3GX0A 3TU3B 3PGTA 5DQSA 2R5GA 4ZB8A 4IVFA 1TXUA 4GSNA 2HSMB 4MF6A 4ZXGA 1GTUA 4LMVA 5ECPB 3DD3A 2LJRA 4BVXB 4YQMA 3QAGA 4O7HA 3UBKA 3G7JA 1G7OA 2O5VA 3IK7A 5JCUA 1OE8A 4EXJA 1HNCA 1N25A 1XWGA 5ELGA 2PBJA 3WYWA 3VURA 2WVYA 1PL2A 2GSTA 1GLQA 1GSDA 2GDRA 3VK9A 2IL3A 6GSSA 1IYHA 3M0FA 4PXOA 2R4VA 2HRKB 4EDZA 2OA7A 2DSAA 3UVHA 1Y6EA 3GSTA 3VPQA 1BF5A 1PD21 4OMVA 1U87A 2EFEA 4HOJA 1AQWA 2VCZA 3FR3A 4MZWA 4ECIA 5GSSA 1GSYA 5DJMA 4YQUA 4PNFA 4BL7A 3LYKA 2GSSA 2D2ZA 2F8FA 4ECCA 4NHWA 1YQ1A 1FHEA 2WRTA 5J5NA 4OFMA 3R2QA 1GNEA 2C80A 5ECLB 3SWLA 4IGJA 20GSA 1B8XA 1JLVA 5D73A 4I97A 4AKGA 2HNLA 1V2AA 3BBYA 5ECQB 2GSRA 4ZBDA 4F0CA 1XW5A 2CZ3A 3HKRA 4PQHA 4KSMA 3F6FA 2DC5A 2VCVA 3KXOA 4W66A 3GTUA
chains in the Genus database with same CATH topology
2ON5A 1Q4JA 1BAYA 1MTCA 2A2RA 2AB6A 1YDKA 4K0NA 3C8EA 4CHSA 1AXDA 1VF1A 2VKZG 7GSSA 1TU8A 3NIVA 2IMKA 3FRCA 13GSA 4ISDA 3O3TA 5DALB 2OT3A 3F63A 3ZMLA 2WDUA 2CA8A 4MF5A 6GSWA 3PPUA 4NAXA 1VF2A 3M3MA 5F0GA 5EY6A 3ZMKA 5A1NA 5F8BA 4RI6A 6GSTA 5A34B 3FY7A 3VI7A 3GURA 3UAPA 3MAKA 4MF7A 4G0KA 4G0LA 1E6BA 4OFNA 2EFHA 2R6KA 1F2EA 1MD4A 1GWCA 1ZGNA 3G7IA 4KGIA 3QAWA 5FWGA 1SVOA 1M0UA 5FT3A 1A0FA 8GSSA 1NHYA 5ECIB 2C3TA 5HFKA 6GSXA 1M9BA 3LG6A 3FR9A 4USSA 1EV4A 1K0CA 3LXZA 4IBPA 4IJIA 5A5HA 4TOPA 1YVLA 1G6WA 5EVOA 5G5EA 1K0DA 5BMUA 4F0BA 3IK9A 1BG5A 4IKHA 4G10A 4WR5A 2GSQA 2PMTA 5ECMB 1F3BA 5GSTA 4AKHA 1VF4A 5AGYA 2N5FA 3VI5A 1AQXA 4BVXA 4E8EA 2PERA 4EC0A 1B48A 1F3AA 1BG1A 3HMJG 5ECOB 3ZFBA 3LXTA 4GSTA 17GSA 4WR4A 1N2AA 1VF3A 3TGZA 4MPFA 4Q5QA 5AN1A 4ACSA 5D9TA 18GSA 5A4UA 1GTBA 1EEMA 4QQ7A 5JCWA 1K3YA 1K0NA 3CBUA 2EFDA 5ECNB 2CVDA 2OADA 1YKCA 1OKTA 2GTUA 1K0AA 4N3ZA 1PN9A 3UBLA 4N0VA 1GSUA 1OE7A 4ZBAA 4PGTA 2HSNB 2HRAA 5AISA 4PQIA 2CAIA 3KJYA 3IE3A 4QMKA 1TU7A 5J4YA 3EINA 1PL1A 2VCTA 3CRTA 3FYGA 2VCQA 3DGQA 5GZZB 4ECBA 1HQOA 1GNWA 3LQ7A 3GTUB 1PX6A 1K0MA 5ECRB 6GSUA 2AHEA 1K0OA 1LJRA 1ML6A 1GUMA 4G9HA 5D9XA 5ELAA 2FNOA 5LD0A 4L5LA 1XW6A 4KX4A 3RBTA 3ISOA 1BYEA 2YV9A 4MDCA 1TW9A 4AKXB 1EV9A 2HQTA 3H1NA 4IS0A 2YV7A 3WD6A 3CSJA 1Y1UA 4BVYA 4J2FA 1PX7A 1M99A 5DJLA 2YCDA 4AGSA 4HZ2A 2VD0A 1GSEA 4L8EA 16GSA 3Q74A 1PA3A 22GSA 4GF0A 2VD1A 2F3MA 1ZL9A 5D9WA 4ZBBA 2WB9A 4PURA 5DAKB 2WJUA 5J4VA 4G0IA 3GSSA 5DALA 4IQAA 4EDYA 3EE2A 4HZ4A 4YH2A 1HNAA 1MD3A 2UV8G 3QAVA 5LCZA 2JL4A 4ZB6A 1U88A 4HI7A 5DCGA 11GSA 3Q19A 3IC8A 4JBBA 1K3LA 4ID0A 3TOTA 3D0ZA 4PX1A 4KDXA 1GSFA 6GSVA 1EOGA 1KBNA 1K0BA 2CZ2A 3P90A 1K3OA 1YJ6A 5A4WA 3CRUA 1EOHA 5ECHB 3I6AA 5J41A 4G19A 4GTUA 5A4VA 3IR4A 5F05A 2A2SA 2HSMA 1GUHA 3I69A 2EFCA 4PTSA 3ERGA 4Q5RA 10GSA 4L5OA 3M8NA 3R3EA 2UZ8A 4GDFA 3KTLA 1FW1A 3CSIA 5AIXA 2FHEA 4AKIA 3M1GA 3KMOA 1OYJA 4IELA 4MP4A 3MDKA 2C8UA 5IQYA 4YQVA 4LMWA 3CSHA 4BL7B 3UARA 1GLPA 9GSSA 1LBKA 4PNGA 2HRKA 4IQ1A 12GSA 3O76A 3VLNA 2OACA 4OFTA 3GUSA 5ECSA 2VO4A 4MK3A 5J40A 4GCIA 1USBA 3TOUA 4FQUA 4MPGA 3KMNA 2C3QA 4KAEA 1C72A 5A5KA 5B7CA 3ZFLA 5J47A 4HJ2A 1G6YA 2X64A 5FHIA 3Q18A 3LJRA 2C3NA 3HJMA 3L0HA 2IMIA 4Q5NA 3F6DA 5ECKB 4Q5FA 6GSYA 3KM6A 1HNBA 2GLRA 4G01A 4PUAA 3CWGA 4JZQA 1B4PA 3IBHA 1M9AA 4EE0A 1AW9A 2HSNA 1R5AA 5DDLA 4AI6A 2CAQA 3AY8A 3VWXA 4E8HA 3P8WA 1GULA 3VPTA 3GH6A 1TDIA 4KDYA 2R3XA 4JEDA 4BVYB 3LSZA 14GSA 4YAVA 1V40A 2AAWA 3FR6A 1RK4A 1XWKA 1GTAA 1GUKA 4YAPA 1BX9A 2J9HA 4E68A 1SVLA 5A1NB 4RI7A 2VCWA 5KEJA 3N9JA 4KDUA 1JZRA 19GSA 4K0GA 4ZB9A 4O92A 5F07A 1JLWA 3LFLA 2PVQA 5D9VA 2V6KA 3LYPA 2H1LA 4KH7A 1AQVA 2VCXA 1GTIA 2WS2A 4KE3A 1SVMA 1IYIA 4F03A 3W8SA 1PGTA 4NHZA 5AIVA 3ERFA 1Z9HA 5G5FA 5J4UA 3PR8A 4IW9A 4ZB7A 3HJOA 1UA5A 5A34A 4KF9A 1PKWA 3QR6A 2PGTA 1GSQA 4GSSA 5DAKA 2ON7A 3U6VA 3N5OA 1PKZA 4GLTA 1GSSA 1U3IA 5A5HB 2NTOA 4ECJA 5F06A 2C4JA 1DUGA 5BMUB 1YY7A 1PMTA 5EL8A 4DEJA 3GX0A 3TU3B 3PGTA 5DQSA 2R5GA 4ZB8A 4IVFA 1TXUA 4GSNA 2HSMB 4MF6A 4ZXGA 1GTUA 4LMVA 5ECPB 3DD3A 2LJRA 4BVXB 4YQMA 3QAGA 4O7HA 3UBKA 3G7JA 1G7OA 2O5VA 3IK7A 5JCUA 1OE8A 4EXJA 1HNCA 1N25A 1XWGA 5ELGA 2PBJA 3WYWA 3VURA 1PL2A 2GSTA 1GLQA 1GSDA 2GDRA 3VK9A 2IL3A 6GSSA 1IYHA 3M0FA 4PXOA 2R4VA 2HRKB 4EDZA 2OA7A 2DSAA 3UVHA 1Y6EA 3GSTA 3VPQA 1BF5A 1PD21 4OMVA 1U87A 2EFEA 4HOJA 1AQWA 2VCZA 3FR3A 4MZWA 4ECIA 5GSSA 1GSYA 5DJMA 4YQUA 4PNFA 4BL7A 3LYKA 2GSSA 2D2ZA 2F8FA 4ECCA 4NHWA 1YQ1A 1FHEA 2WRTA 5J5NA 4OFMA 3R2QA 1GNEA 2C80A 5ECLB 3SWLA 4IGJA 20GSA 1B8XA 1JLVA 5D73A 4I97A 4AKGA 2HNLA 1V2AA 3BBYA 5ECQB 2GSRA 4ZBDA 4F0CA 1XW5A 2CZ3A 3HKRA 4PQHA 4KSMA 3F6FA 2DC5A 2VCVA 3KXOA 4W66A 3GTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1N B;  4AI6 A;  5A5H B;  4AKG A;  4ZB7 A;  4AKI A;  5A1N A;  5A34 A;  4W66 A;  5A5H A;  5BMU B;  5A34 B;  4AKH A; 
#chains in the Genus database with same CATH topology
 2ON5 A;  1Q4J A;  1BAY A;  1MTC A;  2A2R A;  2AB6 A;  1YDK A;  4K0N A;  3C8E A;  4CHS A;  1AXD A;  1VF1 A;  2VKZ G;  7GSS A;  1TU8 A;  3NIV A;  2IMK A;  3FRC A;  13GS A;  4ISD A;  3O3T A;  5DAL B;  2OT3 A;  3F63 A;  3ZML A;  2O3E A;  2WDU A;  3CHX C;  2CA8 A;  4MF5 A;  6GSW A;  3PPU A;  4NAX A;  1VF2 A;  3M3M A;  5F0G A;  5EY6 A;  3ZMK A;  5A1N A;  5F8B A;  4RI6 A;  6GST A;  5A34 B;  3FY7 A;  3VI7 A;  3GUR A;  3UAP A;  3MAK A;  4MF7 A;  4G0K A;  4G0L A;  1E6B A;  4OFN A;  2WVX A;  2EFH A;  2R6K A;  1F2E A;  1MD4 A;  1GWC A;  3RFR C;  1ZGN A;  3G7I A;  4KGI A;  3QAW A;  1YEW C;  5FWG A;  1SVO A;  1M0U A;  5FT3 A;  1A0F A;  8GSS A;  1NHY A;  5ECI B;  2C3T A;  5HFK A;  6GSX A;  1M9B A;  3LG6 A;  3FR9 A;  4USS A;  1EV4 A;  1K0C A;  3LXZ A;  4IBP A;  4IJI A;  5A5H A;  4TOP A;  1YVL A;  1G6W A;  5EVO A;  5G5E A;  1K0D A;  2WW0 A;  5BMU A;  4F0B A;  3IK9 A;  1BG5 A;  4IKH A;  4G10 A;  4WR5 A;  2GSQ A;  2PMT A;  5ECM B;  1F3B A;  5GST A;  4AKH A;  1VF4 A;  4FXY P;  5AGY A;  2N5F A;  3VI5 A;  1AQX A;  4BVX A;  4E8E A;  2PER A;  4EC0 A;  3RGB C;  1B48 A;  1F3A A;  1BG1 A;  3HMJ G;  5ECO B;  3ZFB A;  3LXT A;  4GST A;  17GS A;  4WR4 A;  1N2A A;  1VF3 A;  3TGZ A;  4MPF A;  4Q5Q A;  5AN1 A;  4ACS A;  5D9T A;  18GS A;  5A4U A;  1GTB A;  1EEM A;  4QQ7 A;  5JCW A;  1K3Y A;  1K0N A;  3CBU A;  2EFD A;  5ECN B;  2CVD A;  2OAD A;  1YKC A;  1OKT A;  2GTU A;  1K0A A;  4N3Z A;  1PN9 A;  3UBL A;  4N0V A;  1GSU A;  1OE7 A;  4ZBA A;  4PGT A;  2HSN B;  2HRA A;  5AIS A;  4PQI A;  2CAI A;  3KJY A;  2WW1 A;  3IE3 A;  4QMK A;  1TU7 A;  5J4Y A;  3EIN A;  1PL1 A;  2VCT A;  3CRT A;  3FYG A;  2VCQ A;  3DGQ A;  4PI0 C;  5GZZ B;  4ECB A;  1HQO A;  1GNW A;  3LQ7 A;  3GTU B;  1PX6 A;  1K0M A;  5ECR B;  6GSU A;  2AHE A;  1K0O A;  1LJR A;  1ML6 A;  1GUM A;  4G9H A;  5D9X A;  5ELA A;  2FNO A;  5LD0 A;  4L5L A;  1XW6 A;  4KX4 A;  3RBT A;  3ISO A;  1BYE A;  2YV9 A;  4MDC A;  1TW9 A;  4AKX B;  1EV9 A;  2HQT A;  3H1N A;  4IS0 A;  2YV7 A;  3WD6 A;  3CSJ A;  1Y1U A;  4BVY A;  4J2F A;  1PX7 A;  1M99 A;  5DJL A;  2YCD A;  4AGS A;  4HZ2 A;  2VD0 A;  1GSE A;  4L8E A;  16GS A;  3Q74 A;  1S4B P;  1PA3 A;  22GS A;  4GF0 A;  2VD1 A;  2WW3 A;  2F3M A;  1ZL9 A;  5D9W A;  4ZBB A;  2WB9 A;  4PUR A;  5DAK B;  2WJU A;  5J4V A;  4G0I A;  3GSS A;  5DAL A;  4IQA A;  4EDY A;  3EE2 A;  4HZ4 A;  4YH2 A;  1HNA A;  1MD3 A;  2UV8 G;  3QAV A;  5LCZ A;  2JL4 A;  4ZB6 A;  1U88 A;  4HI7 A;  4PI2 C;  5DCG A;  11GS A;  3Q19 A;  3IC8 A;  4JBB A;  1K3L A;  4ID0 A;  3TOT A;  3D0Z A;  4PX1 A;  4KDX A;  1GSF A;  6GSV A;  1EOG A;  1KBN A;  1K0B A;  2CZ2 A;  3P90 A;  1K3O A;  1YJ6 A;  5A4W A;  3CRU A;  1EOH A;  5ECH B;  3I6A A;  5J41 A;  4G19 A;  4GTU A;  5A4V A;  3IR4 A;  5F05 A;  2A2S A;  2HSM A;  1GUH A;  3I69 A;  2EFC A;  1I1I P;  4PTS A;  3ERG A;  4Q5R A;  10GS A;  4L5O A;  3M8N A;  3R3E A;  2UZ8 A;  4GDF A;  3KTL A;  1FW1 A;  3CSI A;  5AIX A;  2FHE A;  4AKI A;  3M1G A;  2O36 A;  3KMO A;  1OYJ A;  4IEL A;  4MP4 A;  3MDK A;  2C8U A;  5IQY A;  4YQV A;  4LMW A;  3CSH A;  4BL7 B;  3UAR A;  2WW2 A;  1GLP A;  9GSS A;  1LBK A;  2WZS A;  4PNG A;  2HRK A;  4IQ1 A;  12GS A;  3O76 A;  3VLN A;  2OAC A;  4OFT A;  3GUS A;  5ECS A;  2VO4 A;  4MK3 A;  5J40 A;  4GCI A;  1USB A;  3TOU A;  4FQU A;  4MPG A;  3KMN A;  2C3Q A;  4KAE A;  1C72 A;  5A5K A;  5B7C A;  3ZFL A;  5J47 A;  4HJ2 A;  1G6Y A;  2X64 A;  5FHI A;  3Q18 A;  3LJR A;  2C3N A;  3HJM A;  3L0H A;  2IMI A;  4Q5N A;  3F6D A;  5ECK B;  4Q5F A;  6GSY A;  3KM6 A;  1HNB A;  2GLR A;  4G01 A;  4PUA A;  3CWG A;  4JZQ A;  1B4P A;  3IBH A;  1M9A A;  4EE0 A;  1AW9 A;  2HSN A;  1R5A A;  5DDL A;  4AI6 A;  2CAQ A;  3AY8 A;  3VWX A;  4E8H A;  3P8W A;  1GUL A;  3VPT A;  3GH6 A;  1TDI A;  4KDY A;  2R3X A;  4JED A;  4BVY B;  3LSZ A;  14GS A;  4YAV A;  1V40 A;  2AAW A;  3FR6 A;  1RK4 A;  1XWK A;  1GTA A;  1GUK A;  4YAP A;  1BX9 A;  2J9H A;  4E68 A;  1SVL A;  5A1N B;  4RI7 A;  2VCW A;  5KEJ A;  3N9J A;  4KDU A;  1JZR A;  19GS A;  4K0G A;  4ZB9 A;  4O92 A;  5F07 A;  1JLW A;  3LFL A;  2PVQ A;  5D9V A;  2V6K A;  3LYP A;  2H1L A;  4KH7 A;  1AQV A;  2VCX A;  1GTI A;  2WS2 A;  4KE3 A;  1SVM A;  1IYI A;  2WVX B;  4F03 A;  3W8S A;  1PGT A;  4NHZ A;  2WVZ A;  5AIV A;  3ERF A;  1Z9H A;  5G5F A;  5J4U A;  3PR8 A;  4IW9 A;  4ZB7 A;  3HJO A;  1UA5 A;  5A34 A;  4KF9 A;  1PKW A;  3QR6 A;  2PGT A;  1GSQ A;  4GSS A;  5DAK A;  2ON7 A;  3U6V A;  3N5O A;  1PKZ A;  4GLT A;  1GSS A;  1U3I A;  5A5H B;  2NTO A;  4ECJ A;  4PHZ C;  5F06 A;  2C4J A;  1DUG A;  5BMU B;  1YY7 A;  1PMT A;  5EL8 A;  4DEJ A;  3GX0 A;  3TU3 B;  3PGT A;  5DQS A;  2R5G A;  4ZB8 A;  4IVF A;  1TXU A;  4GSN A;  2HSM B;  4MF6 A;  4ZXG A;  1GTU A;  4LMV A;  5ECP B;  3DD3 A;  2LJR A;  4BVX B;  4YQM A;  3QAG A;  4O7H A;  3UBK A;  3G7J A;  1G7O A;  2O5V A;  3IK7 A;  5JCU A;  1OE8 A;  4EXJ A;  1HNC A;  1N25 A;  1XWG A;  5ELG A;  2PBJ A;  3WYW A;  3VUR A;  2WVY A;  1PL2 A;  2GST A;  1GLQ A;  1GSD A;  2GDR A;  3VK9 A;  2IL3 A;  6GSS A;  1IYH A;  3M0F A;  4PXO A;  2R4V A;  2HRK B;  4EDZ A;  2OA7 A;  2DSA A;  3UVH A;  1Y6E A;  3GST A;  3VPQ A;  1BF5 A;  1PD2 1;  4OMV A;  1U87 A;  2EFE A;  4HOJ A;  1AQW A;  2VCZ A;  3FR3 A;  4MZW A;  4ECI A;  5GSS A;  1GSY A;  5DJM A;  4YQU A;  4PNF A;  4BL7 A;  3LYK A;  2GSS A;  2D2Z A;  2F8F A;  4ECC A;  4NHW A;  1YQ1 A;  1FHE A;  2WRT A;  5J5N A;  4OFM A;  3R2Q A;  1GNE A;  2C80 A;  5ECL B;  3SWL A;  4IGJ A;  20GS A;  1B8X A;  1JLV A;  5D73 A;  4I97 A;  4AKG A;  2HNL A;  1V2A A;  3BBY A;  5ECQ B;  2GSR A;  4ZBD A;  4F0C A;  1XW5 A;  2CZ3 A;  3HKR A;  4PQH A;  4KSM A;  3F6F A;  2DC5 A;  2VCV A;  3KXO A;  4W66 A;  3GTU A; 
#chains in the Genus database with same CATH homology
 2ON5 A;  1Q4J A;  1BAY A;  1MTC A;  2A2R A;  2AB6 A;  1YDK A;  4K0N A;  3C8E A;  4CHS A;  1AXD A;  1VF1 A;  2VKZ G;  7GSS A;  1TU8 A;  3NIV A;  2IMK A;  3FRC A;  13GS A;  4ISD A;  3O3T A;  5DAL B;  2OT3 A;  3F63 A;  3ZML A;  2WDU A;  2CA8 A;  4MF5 A;  6GSW A;  3PPU A;  4NAX A;  1VF2 A;  3M3M A;  5F0G A;  5EY6 A;  3ZMK A;  5A1N A;  5F8B A;  4RI6 A;  6GST A;  5A34 B;  3FY7 A;  3VI7 A;  3GUR A;  3UAP A;  3MAK A;  4MF7 A;  4G0K A;  4G0L A;  1E6B A;  4OFN A;  2EFH A;  2R6K A;  1F2E A;  1MD4 A;  1GWC A;  1ZGN A;  3G7I A;  4KGI A;  3QAW A;  5FWG A;  1SVO A;  1M0U A;  5FT3 A;  1A0F A;  8GSS A;  1NHY A;  5ECI B;  2C3T A;  5HFK A;  6GSX A;  1M9B A;  3LG6 A;  3FR9 A;  4USS A;  1EV4 A;  1K0C A;  3LXZ A;  4IBP A;  4IJI A;  5A5H A;  4TOP A;  1YVL A;  1G6W A;  5EVO A;  5G5E A;  1K0D A;  5BMU A;  4F0B A;  3IK9 A;  1BG5 A;  4IKH A;  4G10 A;  4WR5 A;  2GSQ A;  2PMT A;  5ECM B;  1F3B A;  5GST A;  4AKH A;  1VF4 A;  5AGY A;  2N5F A;  3VI5 A;  1AQX A;  4BVX A;  4E8E A;  2PER A;  4EC0 A;  1B48 A;  1F3A A;  1BG1 A;  3HMJ G;  5ECO B;  3ZFB A;  3LXT A;  4GST A;  17GS A;  4WR4 A;  1N2A A;  1VF3 A;  3TGZ A;  4MPF A;  4Q5Q A;  5AN1 A;  4ACS A;  5D9T A;  18GS A;  5A4U A;  1GTB A;  1EEM A;  4QQ7 A;  5JCW A;  1K3Y A;  1K0N A;  3CBU A;  2EFD A;  5ECN B;  2CVD A;  2OAD A;  1YKC A;  1OKT A;  2GTU A;  1K0A A;  4N3Z A;  1PN9 A;  3UBL A;  4N0V A;  1GSU A;  1OE7 A;  4ZBA A;  4PGT A;  2HSN B;  2HRA A;  5AIS A;  4PQI A;  2CAI A;  3KJY A;  3IE3 A;  4QMK A;  1TU7 A;  5J4Y A;  3EIN A;  1PL1 A;  2VCT A;  3CRT A;  3FYG A;  2VCQ A;  3DGQ A;  5GZZ B;  4ECB A;  1HQO A;  1GNW A;  3LQ7 A;  3GTU B;  1PX6 A;  1K0M A;  5ECR B;  6GSU A;  2AHE A;  1K0O A;  1LJR A;  1ML6 A;  1GUM A;  4G9H A;  5D9X A;  5ELA A;  2FNO A;  5LD0 A;  4L5L A;  1XW6 A;  4KX4 A;  3RBT A;  3ISO A;  1BYE A;  2YV9 A;  4MDC A;  1TW9 A;  4AKX B;  1EV9 A;  2HQT A;  3H1N A;  4IS0 A;  2YV7 A;  3WD6 A;  3CSJ A;  1Y1U A;  4BVY A;  4J2F A;  1PX7 A;  1M99 A;  5DJL A;  2YCD A;  4AGS A;  4HZ2 A;  2VD0 A;  1GSE A;  4L8E A;  16GS A;  3Q74 A;  1PA3 A;  22GS A;  4GF0 A;  2VD1 A;  2F3M A;  1ZL9 A;  5D9W A;  4ZBB A;  2WB9 A;  4PUR A;  5DAK B;  2WJU A;  5J4V A;  4G0I A;  3GSS A;  5DAL A;  4IQA A;  4EDY A;  3EE2 A;  4HZ4 A;  4YH2 A;  1HNA A;  1MD3 A;  2UV8 G;  3QAV A;  5LCZ A;  2JL4 A;  4ZB6 A;  1U88 A;  4HI7 A;  5DCG A;  11GS A;  3Q19 A;  3IC8 A;  4JBB A;  1K3L A;  4ID0 A;  3TOT A;  3D0Z A;  4PX1 A;  4KDX A;  1GSF A;  6GSV A;  1EOG A;  1KBN A;  1K0B A;  2CZ2 A;  3P90 A;  1K3O A;  1YJ6 A;  5A4W A;  3CRU A;  1EOH A;  5ECH B;  3I6A A;  5J41 A;  4G19 A;  4GTU A;  5A4V A;  3IR4 A;  5F05 A;  2A2S A;  2HSM A;  1GUH A;  3I69 A;  2EFC A;  4PTS A;  3ERG A;  4Q5R A;  10GS A;  4L5O A;  3M8N A;  3R3E A;  2UZ8 A;  4GDF A;  3KTL A;  1FW1 A;  3CSI A;  5AIX A;  2FHE A;  4AKI A;  3M1G A;  3KMO A;  1OYJ A;  4IEL A;  4MP4 A;  3MDK A;  2C8U A;  5IQY A;  4YQV A;  4LMW A;  3CSH A;  4BL7 B;  3UAR A;  1GLP A;  9GSS A;  1LBK A;  4PNG A;  2HRK A;  4IQ1 A;  12GS A;  3O76 A;  3VLN A;  2OAC A;  4OFT A;  3GUS A;  5ECS A;  2VO4 A;  4MK3 A;  5J40 A;  4GCI A;  1USB A;  3TOU A;  4FQU A;  4MPG A;  3KMN A;  2C3Q A;  4KAE A;  1C72 A;  5A5K A;  5B7C A;  3ZFL A;  5J47 A;  4HJ2 A;  1G6Y A;  2X64 A;  5FHI A;  3Q18 A;  3LJR A;  2C3N A;  3HJM A;  3L0H A;  2IMI A;  4Q5N A;  3F6D A;  5ECK B;  4Q5F A;  6GSY A;  3KM6 A;  1HNB A;  2GLR A;  4G01 A;  4PUA A;  3CWG A;  4JZQ A;  1B4P A;  3IBH A;  1M9A A;  4EE0 A;  1AW9 A;  2HSN A;  1R5A A;  5DDL A;  4AI6 A;  2CAQ A;  3AY8 A;  3VWX A;  4E8H A;  3P8W A;  1GUL A;  3VPT A;  3GH6 A;  1TDI A;  4KDY A;  2R3X A;  4JED A;  4BVY B;  3LSZ A;  14GS A;  4YAV A;  1V40 A;  2AAW A;  3FR6 A;  1RK4 A;  1XWK A;  1GTA A;  1GUK A;  4YAP A;  1BX9 A;  2J9H A;  4E68 A;  1SVL A;  5A1N B;  4RI7 A;  2VCW A;  5KEJ A;  3N9J A;  4KDU A;  1JZR A;  19GS A;  4K0G A;  4ZB9 A;  4O92 A;  5F07 A;  1JLW A;  3LFL A;  2PVQ A;  5D9V A;  2V6K A;  3LYP A;  2H1L A;  4KH7 A;  1AQV A;  2VCX A;  1GTI A;  2WS2 A;  4KE3 A;  1SVM A;  1IYI A;  4F03 A;  3W8S A;  1PGT A;  4NHZ A;  5AIV A;  3ERF A;  1Z9H A;  5G5F A;  5J4U A;  3PR8 A;  4IW9 A;  4ZB7 A;  3HJO A;  1UA5 A;  5A34 A;  4KF9 A;  1PKW A;  3QR6 A;  2PGT A;  1GSQ A;  4GSS A;  5DAK A;  2ON7 A;  3U6V A;  3N5O A;  1PKZ A;  4GLT A;  1GSS A;  1U3I A;  5A5H B;  2NTO A;  4ECJ A;  5F06 A;  2C4J A;  1DUG A;  5BMU B;  1YY7 A;  1PMT A;  5EL8 A;  4DEJ A;  3GX0 A;  3TU3 B;  3PGT A;  5DQS A;  2R5G A;  4ZB8 A;  4IVF A;  1TXU A;  4GSN A;  2HSM B;  4MF6 A;  4ZXG A;  1GTU A;  4LMV A;  5ECP B;  3DD3 A;  2LJR A;  4BVX B;  4YQM A;  3QAG A;  4O7H A;  3UBK A;  3G7J A;  1G7O A;  2O5V A;  3IK7 A;  5JCU A;  1OE8 A;  4EXJ A;  1HNC A;  1N25 A;  1XWG A;  5ELG A;  2PBJ A;  3WYW A;  3VUR A;  1PL2 A;  2GST A;  1GLQ A;  1GSD A;  2GDR A;  3VK9 A;  2IL3 A;  6GSS A;  1IYH A;  3M0F A;  4PXO A;  2R4V A;  2HRK B;  4EDZ A;  2OA7 A;  2DSA A;  3UVH A;  1Y6E A;  3GST A;  3VPQ A;  1BF5 A;  1PD2 1;  4OMV A;  1U87 A;  2EFE A;  4HOJ A;  1AQW A;  2VCZ A;  3FR3 A;  4MZW A;  4ECI A;  5GSS A;  1GSY A;  5DJM A;  4YQU A;  4PNF A;  4BL7 A;  3LYK A;  2GSS A;  2D2Z A;  2F8F A;  4ECC A;  4NHW A;  1YQ1 A;  1FHE A;  2WRT A;  5J5N A;  4OFM A;  3R2Q A;  1GNE A;  2C80 A;  5ECL B;  3SWL A;  4IGJ A;  20GS A;  1B8X A;  1JLV A;  5D73 A;  4I97 A;  4AKG A;  2HNL A;  1V2A A;  3BBY A;  5ECQ B;  2GSR A;  4ZBD A;  4F0C A;  1XW5 A;  2CZ3 A;  3HKR A;  4PQH A;  4KSM A;  3F6F A;  2DC5 A;  2VCV A;  3KXO A;  4W66 A;  3GTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...