3F6DA

Crystal structure of a genetically modified delta class gst (adgstd4-4) from anopheles dirus, f123a, in complex with s-hexyl glutathione
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCIPTLVDEDGFVLWESRAIQIYLVEKYGAHDADLAERLYPSDPRRRAVVHQRLFFDVAVLYQRFAEYYYPQIAGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILATIATYEVAGYDLRRYENVQRWYERTSAIVPGADKNVEGAKVFGRYFTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase GST1-4
publication title Structural contributions of delta class glutathione transferase active-site residues to catalysis
pubmed doi rcsb
source organism Anopheles dirus
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3f6dA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f6dA01
2E7PA 2DJ0A 2IMDA 3LG6A 4ZB6A 5DQSA 1X9MB 1O8XA 4TR1B 2WCIA 2R37A 3GN3A 2REMA 2RIIA 4FIWA 4ILFA 5KN3A 3ERGA 1J08A 4EXJA 3GV1A 1TXXA 1EWXA 2P5QA 4IELA 4GQFA 2C0EA 5JCUA 4MABA 2CAIA 3GH6A 4MP4A 4J2FA 4IBPA 5IPHA 4MJBA 4Q5NA 3GA4A 2C3QA 5IO2A 4Q5QA 3UL3A 2JZRA 1QXHA 1OKTA 5B8AA 4GSSA 4TXVA 4NV5A 4KF9A 3C7MA 3KZQA 4EVMA 4Q5RA 5DQYA 3EMXA 2HSNB 2CAQA 4PTSA 6GSYA 3DGQA 1XVWA 2CVDA 2PVQA 5CAXA 4K0GA 3VLNA 2RM5A 1WMJA 4G2EA 2L5OA 4HQSA 2AYTA 1QGVA 3EU3A 3HVVA 1T3BA 2VL3A 4ACSA 4MF6A 3KH9A 3QD9A 1Y25A 2ON7A 1R5PA 3VWVA 5FWGA 2K8SA 4G19A 2X8HA 4I5QA 5CREA 1M7TA 2LS5A 4F03A 2VCTA 4N10A 2QC7A 20GSA 4IQAA 1M2AA 1XPVA 2RM6A 5HR0A 2LJAA 2WFCA 3D4TA 4TW5A 1PKWA 1GULA 1A0RP 4PXOA 1SK0A 2LUSA 1JZDA 3ERWA 3VI5A 4PUAA 2Z9SA 1A24A 1F9MA 5IOWA 3M1GA 3IA1A 3ZMKA 1F2EA 3EE2A 5D9VA 4F9ZA 1M0UA 4EDZA 2K18A 2WB9A 2QKEA 1OC9A 2I81A 1N8JA 5EL8A 3LGCA 1DE1A 3KP8A 1QMVA 3P8WA 5EPFA 5BMUA 4QL7A 3GRXA 3PPUA 1DBYA 4BVYB 3QMXA 4KDYA 4RI6A 1TRSA 2FUG2 2KP2A 1K3YA 3LXZA 2LJKA 3H8QA 9GSSA 2K9FA 4O5RA 5LCZA 5ECMB 4ISDA 4BVXB 1SYRA 6GSSA 2GGTA 4MPFA 3IBHA 1GTUA 3C1RA 4MJAA 3NZNA 2O7KA 1ZZYA 1ZOFA 4I2TA 4K0NA 5KN0A 4MA9A 3J7Yk 4JZQA 4HJMA 1T00A 1SU9A 1R4WA 2VD0A 3TGZA 2DJ2A 3IDVA 3KM6A 2N5BA 1X9SB 3APSA 2PVOC 1TRWA 1O8WA 2TIRA 2ZNMA 1GTBA 5JCWA 1GWCA 3D21A 3GURA 4I2UA 2IN3A 4I97A 4GLTA 3HHVA 2JZSA 2DMLA 3LORA 1O7UA 1FHEA 1S3AA 1OC3A 4WBJA 3FR9A 1BQ7A 3LWAA 2B6MA 1WJKA 17GSA 1SKWB 1NM3A 2BJXA 2F51A 1K0CA 1OAZA 2H0HA 5D9TA 2MZCA 1YEXA 3HKRA 2OBKA 3QOUA 4AJ7A 2YV9A 4HQZA 3US3A 1HNBA 3RPPA 11GSA 5G5FA 1V9WA 3KH7A 4J56E 10GSA 3ME7A 3GH9A 2RUEA 3EVIA 3GKXA 1ERVA 3OR5A 3QDNA 2PU9C 2ON5A 1RK4A 1G6WA 1O6JA 4L5LA 3WGEA 2HSMB 1K0BA 1SKSB 1M9BA 3D5JA 4PQIA 5IMVA 4K9ZA 2H72A 5GSTA 2GSRA 5INYA 4GTUA 1YKCA 5G2ZA 1TW9A 1ZYEA 3ZFLA 1B9YC 3LXTA 3TOTA 1OYJA 2V41A 2B3SA 4HS1A 4XHMA 3ZVJA 3ZZXA 2NPBA 2NBSA 4N0ZA 4IS0A 2HSMA 2ZUPA 2CA8A 5IQYA 4NHZA 1A8LA 3O76A 2C1YA 2OKAA 3U6VA 1U88A 5CP1A 2LTKA 2YWMA 4HOJA 2KHPA 1FAAA 4IP1A 2QGVA 3GNJA 5DALB 1UC7A 5JWRB 3I69A 2PWJA 2R6KA 2JACA 3O6TA 4IJIA 4L0WA 6GSUA 2YWIA 4KGIA 2I1UA 4I8BA 3QFAC 4Q5FA 1U3AA 2GVPA 3L9UA 4ZXGA 4G0KA 3TKPA 5ID2B 1KBNA 2H74A 5DAKA 2CZ3A 2VLUA 2DIYA 4MDCA 2AB6A 2YOIA 1CQGA 1USBA 2XBQA 5D93A 3TJJA 4IN0A 4PNFA 5J9CA 2CVBA 5A4WA 2D2ZA 3LYPA 2YPMA 4KH7A 3KMNA 2DC5A 3FHKA 1JZRA 2IFQB 2I3YA 1PX6A 4KA0A 5HR3A 1MTCA 1HQOA 1WE0A 3DKSA 4EUYA 3VPTA 3KCMA 3IR4A 2LNSA 1TI3A 1QUWA 1V58A 2PUKC 2B1LA 3I43A 3DYRA 1SYXA 3BCIA 5GAPD 5AN1A 2FY6A 3G9BA 4K1FA 4TR0A 3IC8A 2PGTA 2IFQA 3FZ9A 4HZ2A 3DEXA 2JL4A 3GSTA 2H1GA 2LKUA 2AV4A 2OBIA 3R3EA 3DMLA 1XWCA 12GSA 1XXUA 2YWNA 4KDUA 1E2YA 3IK7A 3GKKA 3IRAA 1PN9A 4OFMA 4BPYA 1Z6NA 2OACA 3GMFA 4X43A 4XS4A 2L6DA 3HXSA 4JU5A 19GSA 3FKFA 5IMZA 3BJ5A 1VF1A 1LJRA 1RW1A 2M80A 4Z7XA 4H86A 1SK2A 1V2AA 4DSSA 1ZL9A 3ZFBA 4ZL9A 2E2GA 1GTAA 4GCIA 3JCML 4V2LA 1YEPA 3IK9A 3EWLA 4CDOA 1GSQA 1EEJA 2XPDA 1JLWA 1X0RA 1ON4A 1VF3A 2HSYA 5LD0A 2PBJA 1O85A 3I9V2 4HU7A 4XTSA 2YNXA 2YN1A 4EDYA 4JR4A 1PRXA 3IPZA 4PX1A 5KEJA 2XHFA 1ERUA 1JZOA 5ECIB 1CQHA 3MSZA 4K7NA 4GF0A 1I5GA 1YJ6A 2CT6A 1TRUA 2C3NA 1XWBA 5F05A 5ABRA 4MH3A 1XWGA 4RQRA 1XBSA 1K0MA 1K0NA 3RBTA 2CV4A 3C71A 3UOMA 2VUPA 2PPTA 4NAXA 4JE1A 2LNTA 5GZZB 5D9WA 3TJKA 2AUVA 4X1UA 4JR6A 4PQ1A 1XZOA 3P2AA 2K8VA 4KUNA 2DJ1A 1TU7A 4E8HA 2VL9A 3SWLA 3RPNA 2WULA 4XRAA 1ERWA 4E8EA 2M46A 2V1MA 2R3XA 2MYGA 1GSFA 4HUAA 3WYWA 2HXKA 1DSBA 1GP1A 2P31A 3NOFA 2KP1A 4DSRA 1TTZA 2C0DA 3UARA 4OCFA 3FY7A 1F37A 4WF4A 2CZ2A 3HYPA 4EF0A 1TK0B 4TR1A 2ZCTA 3A2VA 1PQNA 7GSSA 3ZLPA 2H19A 2ALBA 2A2RA 5H5SA 2EC4A 4NHWA 3IXRA 2H66A 3VFIA 3FR6A 1THOA 1B4QA 5IM9A 1PKZA 3N5OA 4ZILA 3KD0A 2TRCP 2HZFA 5DBQA 2YZUA 1XW6A 1T4ZA 2O89A 4IJ3A 1HD2A 3IAS2 3TRXA 3EYTA 1UA5A 2B7JA 2FA8A 2H76A 2FWGA 2YV7A 5JWOB 2YJ7A 4OWYA 3WGDA 3QAVA 4XCSA 1SKRB 5G5EA 4POBA 2OE0A 1GRXA 4XRDA 4L8EA 3WD6A 1PX7A 2FCHA 1VF2A 2VCWA 1SENA 3C8EA 4OO4A 1YKAA 3TOUA 2HSHA 1TDIA 2L59A 1RQMA 6GSXA 3F4SA 4K7OA 4ZL8A 3L4NA 2FGXA 1MD3A 2H71A 3HZ4A 2OE1A 3LSZA 2CX3A 4G0IA 1SK1A 2VCQA 1M9AA 2H73A 4V2NA 4ZBBA 5ENUA 3F8UA 3CMIA 2H6YA 3FZ5A 4WETA 4KE3A 1SL2B 4TXOB 2WJUA 3DD3A 1JHBA 2OA7A 3GTUB 3ZREA 4KW6A 2X99A 1A8YA 2YZHA 3QPMA 2R5GA 3HJPA 5F07A 4NV2A 2VCVA 2CVKA 5G31A 3IE3A 2GT5A 1TOFA 3HY2A 3HCZA 2HI7A 1T4YA 1JZWA 2I9HA 4DSQA 5H5QA 3TJGA 2VCZA 2O85A 5HFIA 1ZCPA 2H1BA 4OMVA 1BAYA 4MJCA 4POLA 5JCGA 2YCDA 2KUCA 2CQ9A 4GQCA 4BVYA 1M2BA 1EZKA 2IIYA 1A2JA 3J7Yb 3KTLA 4EKZA 1OVNA 1THXA 3KIJA 3TKSC 3PINA 3CBUA 2EIQA 4ZIJA 1N2AA 3G7JA 3M9JA 4BVXA 4ZB9A 3TCOA 4ML6A 4OO5A 5B7CA 2MBTA 2FLSA 3ZRDA 2H6ZA 2IMEA 3GIXA 3F9UA 4BL7B 2GQMA 3KTBA 3L78A 1A23A 5F8BA 1Z6MA 4FO5A 1GSUA 1DUGA 6GSVA 1NSWA 2F9SA 2GT6A 3FRCA 4EE0A 1EEMA 2JSYA 2WZ9A 2E0QA 1XW9A 2GQKA 1JFUA 4GWRA 1EOGA 2GQLA 2PN8A 2A2SA 1TJDA 3K8NA 4HDEA 1GNEA 1B4PA 4ZBDA 2HE3A 1YDKA 2C8UA 5DVBA 1WOUA 1QK8A 2LSTA 1TU8A 1G7EA 4YQMA 1TRVA 4EL1A 3SBCA 1ILOA 4HEA2 2X8GA 2VCXA 2DMMA 3O3TA 3NIVA 3W8JA 4OFTA 5B6NA 3PGTA 1FW1A 5IMAA 4ZBAA 1SD9A 1VGLA 2B1KA 4MH2A 2KLXA 3TJBA 2H01A 2BMXA 2HRAA 2F8FA 4L5OA 2FWHA 4BWSA 2DIZA 5CYYA 2H1DA 4PQHA 2VL2A 4FH8A 3RHCA 1S3DA 5E4WA 5HR1A 1AQVA 3GL3A 4OFNA 3TKRA 3H1NA 4IP6A 1UVZA 3UBLA 5J4UA 1TP9A 2A4VA 2VIMA 1FVJA 1M99A 1XOAA 2H0IA 4CHSA 5IMFA 2VO4A 3Q74A 4LMWA 3W6GA 4G10A 1KEBA 3UVHA 5DALA 1LBKA 3GKMA 3VWXA 3TUEA 1AXDA 2C4JA 2PMTA 2QSIA 1IYHA 3CSJA 3F6DA 1KNGA 1K0OA 1Q4JA 5IMCA 3GFKA 1QFNA 2VM1A 1G6YA 5ECOB 4POMA 5AGYA 2YJHA 1XVQA 5AIXA 2H75A 4RUVA 5CRDA 5ID2A 4F0BA 5ELAA 5ECPB 2H0GA 2WRTA 1A2LA 4LLRA 2VLVA 1Z5YE 3KGKA 1BX9A 1YY7A 2X8CA 3ZIJA 1B48A 1MEKA 1H4OA 2B5YA 1K0DA 1FO5A 3EINA 5ELGA 4XS1A 2YP6A 3QR6A 4NMUA 22GSA 2MMZA 4TRXA 1C72A 2IMFA 3QCPA 1GUMA 4MF5A 3IOSA 1NW2A 3VWUA 1PMTA 5HFGA 2P0GA 2PERA 4IVFA 4POKA 4JEDA 1GSDA 4LL4B 2HNLA 1Z9HA 3ZITA 4I6XA 1PGTA 3GKNA 4KCEA 6GSWA 3A3TA 3RDWA 1GSEA 4GSTA 2H30A 2B5EA 4CW9A 2IPAA 3CTFA 1K3LA 2HT9A 4KAEA 2IJYA 4PGTA 3HJOA 4G9HA 4DEJA 2EIRA 1BJXA 2OE3A 3Q6OA 5J3RA 4TKYA 3PR8A 2L6CA 2C0GA 2H8LA 2AAWA 2V6OA 5E59A 2DJJA 1OE8A 1B8XA 1R5AA 5HQPA 2YWOA 2V6KA 3EU4A 3UBKA 3CXGA 2HYXA 2EIOA 3KEBA 2JU5A 5DCHA 1V57A 4WEYA 2B7KA 6GSTA 3LJRA 5LNKe 4O7HA 2LV3A 4MF7A 2MMNA 4AF2A 3WGXA 1YQ1A 1PL1A 4PUFC 2MBSA 4K2DA 1BYEA 3CSIA 3VWWA 5B8BA 4EC0A 1GLQA 3F4RA 4LA1A 4MZCA 4NXIA 1LU4A 4MPGA 3DWVA 5CNWA 5ECLB 3VI7A 4LMVA 5JWQB 4ECJA 2JZTA 1X9WB 3R2QA 2LRNA 3BOAA 1FB0A 4K6XA 4D73B 3DRNA 4TR4A 4ZL7A 1GLPA 3LEFA 3KMOA 3GL5A 1Y6EA 4QL9A 1QQ2A 4KNDA 5AIVA 3E9JB 3UMAA 3W8SA 2C0FA 2GZZA 4ECBA 1ZMAA 5EVOA 3FK8A 1XWAA 1HNAA 1NHOA 3ZL5A 3ZTLA 1XOBA 5GSSA 1TI1A 3CRUA 3C1SA 4D73A 1V40A 3V1WA 1GSYA 1U3IA 1SJ6A 2GLRA 2JADA 1OE7A 4JBBA 3E3EA 2P5RA 4KX4A 3BCKA 3M9KA 3CRTA 4G0LA 1EP7A 1Z3EA 5ECRB 5D96A 4FYBA 1V98A 3U5RE 3QFBC 2E2MA 2L4QA 4V1Ag 4F2IA 2XBIA 4FYUA 3H79A 2H1AA 2XPEA 3RHBA 4MK3A 3HD5A 3UIWA 2WS2A 3FW2A 18GSA 3WT2A 2N5AA 3TKSA 3L0HA 1YZXA 1MD4A 3CYNA 1GUKA 2MMOA 1M2DA 3D4MA 3P7XA 2IMIA 3DVXA 3AY8A 3DVWA 5IIZA 3LQ7A 2VM2A 2WGRA 4GXZA 4WR4A 3C73A 4DVCA 1YF0A 1J9BA 2GSTA 4HZ4A 1IYIA 4XS6A 5COHA 2B5XA 2LJRA 1VF4A 1WPIA 3ISOA 1OC9B 1T8EB 3F6FA 4XIHA 1HYUA 1S3CA 3H4KA 2FWEA 4HI7A 1EGOA 3GYKA 3APQA 1E6BA 8GSSA 1BG5A 2GTUA 3UAPA 5FT3A 1JLVA 3WT1A 1I9DA 4YH2A 1YF1A 4F82A 3FYGA 1Z7RA 5J41A 2O8VB 3ZMLA 4NPBA 3TJFA 1W89A 2VLTA 5G30A 4OD7A 2BTOT 1AC1A 4IGJA 5ECKB 1W4VA 2G0FA 5J9BA 1EOHA 1AUCA 3H93A 1SL0B 5KN1A 1XIYA 1DE2A 5B6MA 3I6AA 4TXOA 4MCUA 4IQ1A 2FWFA 2N5FA 1X5CA 3GTUA 5HR2A 2J23A 3MDKA 3HVXA 5DCGA 4AGSA 3VPQA 1AQWA 3P90A 1K3OA 1WWJA 4HJ2A 1B9XC 1J0FA 4GRFA 1EP8A 4PURA 4TR3A 5IPGA 4EO3A 5FHIA 4HU9A 3GX8A 4O92A 2R2JA 4BA7A 3M0FA 1WIKA 2HRNA 13GSA 2FHEA 1ST9A 3HJMA 5L71A 1TK5B 3UJ1A 4PNGA 2LQQA 2VAFA 1GNWA 5CRGA 4YAPA 4K7IA 3PH9A 4L0UA 4ML1A 3APOA 1OC8A 4WF5A 1U87A 3EURA 3MNGA 5IOXA 4YQVA 16GSA 3QAWA 3GHAA 4BWQA 2L4CA 4LL1B 3KP9A 2AJQB 4RQXA 3D22A 3E0UA 5A4VA 3GX0A 5D9XA 4BL7A 5D73A 1O81A 3A2XA 3Q19A 1PA3A 3ZVJD 3TKSE 5A5KA 2AHEA 2RUFA 4QQ7A 1WP0A 4FYCA 3F3QA 2UZ8A 1GUHA 4P3YB 1T1VA 4IW9A 1XFLA 2RLIA 5CRHA 2DBCA 2F8AA 2L57A 3N9JA 2V2GA 5H5RA 2XC2A 3D0ZA 1VRSD 4MLYA 2HRKB 2NTOA 3D6IA 2J9HA 4F0CA 5F06A 1EV9A 3F63A 3IV4A 3G7YA 4MZBA 1ABAA 1GSSA 4IKHA 4WXTA 2DLXA 1Q98A 2H6XA 4AJ6A 3ERFA 1BEDA 2ES7A 3VK9A 5DJLA 1GH2A 4KSOA 1GTIA 3FZ4A 1T7PB 3VURA 2DJ3A 1WRYA 5EY6A 4KCAA 1X5DA 1G7OA 2HRKA 5F0GA 4X0XA 2K6VA 3TRQA 4YQUA 4YAVA 2GS3A 2FD3A 3HDCA 1ML6A 5IMDA 2WDUA 5J5NA 3RAZA 5C00A 3A2WA 3CSHA 5ECQB 1A0FA 5DAKB 2C3TA 1F3BA 2F3MA 4TOPA 5ECNB 1AAZA 5HFKA 1XW5A 4USSA 1GL8A 1G0TA 1URMA 2GZYA 5C04A 5CO3A 4ULXA 2TRXA 3CTGA 4WR5A 3BBYA 1SL1B 3HZ8A 1ZYQB 3M8NA 2IL3A 1A2MA 1AIUA 2C80A 1TKDB 4IHUA 3F4TA 1MDJA 1FOVA 5A4UA 2NDOA 3DIEA 1HNCA 3M3MA 4KSMA 4RI7A 5AISA 3MWHA 1O73A 3A5WA 2LRTA 5GAND 1R26A 2GSSA 2OJLA 3GSSA 3IAM2 1MDKA 4V1Ap 3TB2A 4KDXA 3IC4A 5DJMA 1TK8B 2X64A 3KXOA 2LQOA 14GSA 3LFLA 4TVEA 2OADA 3HA9A 3BD2A 3TDGA 3L9VA 4MMMA 3TKQA 3ZIVA 3QAGA 2CX4A 2GZPA 1PSQA 2GSQA 4XS4B 3HVSA 2KOKA 5CRWA 3S9FA 1NHYA 3GUSA 3IHQA 1OKDA 4DSSB 1ZGNA 2NVLA 2G2QA 1AW9A 4ECCA 1U6TA 5G1KA 2I4AA 3UEMA 1UN2A 2IWTA 1K0AA 2R4VA 3Q18A 1ACVA 4MZWA 5ECHB 1PL2A 3MAKA 5DDLA 2H70A 3KJYA 4ZB8A 2VL2C 3L9SA 4J57E 4OCEA 1SD8A 4JRRA 1XWKA 4TN8A 3G7IA 1R7HA 4NWYA 2L5LA 3FR3A 4WBRD 3F0IA 1FVKA 3UVTA 2VD1A 5KN2A 2IMKA 2HQTA 3ED3A 4ECIA 2DSAA 2V32A 2VOCA 2HRFA 4N0VA 1EV4A 4K8MA 1EGRA 4WKWA 5G1LA 4N30A 2HZEB 4KB3A 2MMAA 5ECSA 1F6MC 1FG4A 2FA4A 3DXBA 4N11A 1F3AA 5IO0A 2HLSA 1XCCA 2O87A 4ID0A 1FB6A 4MJEA 1KTEA 4FQUA 1H75A 1SJIA 2JSZA 1X5EA 3EC3A 4V2MA 1SJZA 2LEGA 3FEUA 2LRCA 4GSNA 4AJ8A 2GDRA 2HZEA 3ME8A 4O32A 1PD21 2YANA 2FNOA 1MDIA 3F3RA 1Z7PA 3EMPA 3ZYWA 3FZAA 5D8IA 1ERTA 2HFDA 2DJKA 3LYKA 3TRPA 2M72A 1AQXA
chains in the Genus database with same CATH superfamily
2E7PA 2DJ0A 2IMDA 3LG6A 4ZB6A 5DQSA 1X9MB 1O8XA 4TR1B 2WCIA 2WVYA 2R37A 3GN3A 2REMA 5A34A 2RIIA 4FIWA 4ILFA 5KN3A 3ERGA 1J08A 4EXJA 3GV1A 1TXXA 1EWXA 2P5QA 4IELA 4GQFA 2C0EA 5JCUA 4MABA 2CAIA 3GH6A 4MP4A 4J2FA 2WZSA 1S3RA 4IBPA 5IPHA 1XG8A 4MJBA 4Q5NA 4O5QA 3GA4A 2C3QA 5IO2A 4Q5QA 3UL3A 2JZRA 4AI6A 1QXHA 1OKTA 5B8AA 4GSSA 4TXVA 4NV5A 4KF9A 3C7MA 3KZQA 4EVMA 4Q5RA 5DQYA 3EMXA 2HSNB 2CAQA 4PTSA 6GSYA 3DGQA 1XVWA 2CVDA 2EFEA 2PVQA 5CAXA 4K0GA 3VLNA 2RM5A 1WMJA 4G2EA 2L5OA 4HQSA 2AYTA 1QGVA 3EU3A 3HVVA 1T3BA 2VL3A 4ACSA 4MF6A 3KH9A 3QD9A 1Y25A 2ON7A 1R5PA 3VWVA 5FWGA 2K8SA 4G19A 2HSNA 2X8HA 4I5QA 5CREA 1M7TA 2LS5A 4F03A 2VCTA 4N10A 2QC7A 20GSA 4IQAA 1M2AA 1XPVA 2RM6A 5HR0A 2LJAA 2WFCA 3D4TA 4TW5A 1PKWA 1GULA 1A0RP 4PXOA 1SK0A 2LUSA 1JZDA 3ERWA 3VI5A 4PUAA 1TXUA 2EFDA 1F9MA 2Z9SA 5IOWA 1A24A 3M1GA 3IA1A 2WW0A 3ZMKA 1F2EA 3EE2A 5D9VA 4F9ZA 1M0UA 4EDZA 2K18A 2WB9A 2QKEA 1OC9A 2I81A 1N8JA 5EL8A 3LGCA 1DE1A 3KP8A 4N3ZA 1QMVA 3P8WA 5EPFA 5BMUA 4QL7A 3GRXA 3PPUA 1DBYA 4BVYB 3QMXA 4KDYA 4RI6A 1TRSA 2FUG2 2KP2A 1K3YA 3LXZA 2LJKA 3H8QA 9GSSA 2K9FA 4O5RA 5LCZA 5ECMB 4ISDA 4BVXB 1SYRA 6GSSA 2GGTA 4MPFA 3IBHA 1GTUA 3C1RA 4MJAA 3NZNA 2O7KA 1ZZYA 1ZOFA 4I2TA 4K0NA 5KN0A 4MA9A 3J7Yk 4JZQA 4HJMA 1T00A 1SU9A 1R4WA 2VD0A 3TGZA 2DJ2A 3IDVA 3KM6A 2N5BA 1X9SB 3APSA 2PVOC 1TRWA 1O8WA 2X49A 2TIRA 2ZNMA 1GTBA 5JCWA 1GWCA 3D21A 3GURA 4I2UA 2IN3A 4I97A 4GLTA 3HHVA 2JZSA 2DMLA 3LORA 1O7UA 2WVXB 1FHEA 4G01A 1S3AA 1OC3A 4WBJA 3FR9A 1BQ7A 3LWAA 2B6MA 1WJKA 17GSA 1SKWB 1NM3A 2BJXA 2F51A 1K0CA 1OAZA 2H0HA 5D9TA 2MZCA 4W66A 1YEXA 3HKRA 2OBKA 3QOUA 4AJ7A 2YV9A 4HQZA 3US3A 1HNBA 3RPPA 11GSA 5G5FA 1YVLA 1V9WA 3KH7A 2VKZG 4J56E 10GSA 3ME7A 3GH9A 2RUEA 3EVIA 3GKXA 2WW1A 1ERVA 3OR5A 2WVXA 3QDNA 2PU9C 2ON5A 1RK4A 1G6WA 1O6JA 4L5LA 3WGEA 2HSMB 1K0BA 1SKSB 1M9BA 3D5JA 4PQIA 5IMVA 4K9ZA 2H72A 5GSTA 2GSRA 4AKGA 5INYA 4GTUA 1YKCA 5G2ZA 1TW9A 2WVZA 1ZYEA 3ZFLA 1B9YC 3LXTA 1S4BP 3TOTA 1OYJA 2V41A 2B3SA 4HS1A 4XHMA 3ZVJA 3ZZXA 2NPBA 2NBSA 3A5IA 4N0ZA 4IS0A 2HSMA 2ZUPA 2CA8A 5IQYA 4NHZA 1A8LA 3O76A 4AKIA 2C1YA 2OKAA 3U6VA 1U88A 5CP1A 2LTKA 2YWMA 4HOJA 2KHPA 1FAAA 2QGVA 3GNJA 4IP1A 5DALB 1UC7A 5JWRB 3I69A 2PWJA 2R6KA 2JACA 3O6TA 4IJIA 4L0WA 6GSUA 2YWIA 4KGIA 2I1UA 4I8BA 3QFAC 4Q5FA 1U3AA 2GVPA 3L9UA 5KOXA 4ZXGA 4G0KA 3TKPA 5ID2B 1KBNA 2H74A 5DAKA 2CZ3A 2VLUA 2DIYA 4MDCA 3CHXC 2AB6A 2YOIA 1CQGA 1USBA 2XBQA 5D93A 3TJJA 4IN0A 4PNFA 5J9CA 2CVBA 5A4WA 2D2ZA 3LYPA 2YPMA 4KH7A 3KMNA 2DC5A 3FHKA 1JZRA 2R0CA 2IFQB 2I3YA 1PX6A 4KA0A 5HR3A 1MTCA 1HQOA 2WW3A 1WE0A 3DKSA 4EUYA 3VPTA 3KCMA 3IR4A 2LNSA 1TI3A 1QUWA 1V58A 2PUKC 2B1LA 3I43A 3DYRA 4ICYA 1SYXA 3BCIA 5GAPD 5AN1A 2FY6A 3G9BA 4K1FA 4TR0A 3IC8A 2PGTA 2IFQA 3FZ9A 4HZ2A 3DEXA 2JL4A 3GSTA 2H1GA 2LKUA 2AV4A 2OBIA 3R3EA 4PI2C 3DMLA 1XWCA 12GSA 3CWGA 1XXUA 4CY8A 2YWNA 1SVMA 4KDUA 1E2YA 3IK7A 4K2XA 3GKKA 3IRAA 1PN9A 1Y1UA 4OFMA 4BPYA 1Z6NA 2OACA 3GMFA 4X43A 4XS4A 2L6DA 3HXSA 4JU5A 19GSA 3FKFA 5IMZA 3BJ5A 1VF1A 1LJRA 1RW1A 2M80A 4Z7XA 4H86A 1SK2A 1V2AA 4DSSA 1ZL9A 3ZFBA 4ZL9A 2E2GA 1GTAA 4GCIA 3JCML 4V2LA 1YEPA 3IK9A 3EWLA 4CDOA 1GSQA 1EEJA 2XPDA 1JLWA 4YKFA 1X0RA 1ON4A 1VF3A 2HSYA 5LD0A 2PBJA 1SVOA 1O85A 3I9V2 4HU7A 4XTSA 2YNXA 2YN1A 4EDYA 4JR4A 1PRXA 3IPZA 4PX1A 5KEJA 2XHFA 1ERUA 1JZOA 5ECIB 1CQHA 3MSZA 4K7NA 4GF0A 1I5GA 1YJ6A 2CT6A 1TRUA 2C3NA 1XWBA 5F05A 5ABRA 4MH3A 1XWGA 4RQRA 1XBSA 1K0MA 1K0NA 3RBTA 2CV4A 3C71A 3UOMA 2VUPA 2PPTA 4NAXA 4JE1A 2LNTA 5GZZB 5D9WA 3TJKA 2AUVA 4X1UA 4JR6A 4PQ1A 1XZOA 3P2AA 2K8VA 4KUNA 2DJ1A 1TU7A 4E8HA 2VL9A 3SWLA 3RPNA 1SVLA 2WULA 4XRAA 1ERWA 4E8EA 2M46A 2V1MA 2R3XA 2MYGA 1GSFA 4HUAA 3WYWA 2HXKA 1DSBA 1GP1A 2P31A 3NOFA 2KP1A 4DSRA 1TTZA 2C0DA 3UARA 2QA2A 4OCFA 3FY7A 1F37A 4WF4A 2CZ2A 3HYPA 4EF0A 1TK0B 4TR1A 2ZCTA 3A2VA 1PQNA 7GSSA 3ZLPA 2H19A 2ALBA 2A2RA 5H5SA 2EC4A 4NHWA 3IXRA 2H66A 3VFIA 3FR6A 1THOA 1B4QA 5IM9A 1PKZA 3N5OA 4ZILA 3KD0A 2TRCP 2HZFA 5DBQA 2YZUA 1YEWC 4QMKA 1XW6A 1T4ZA 2O89A 4IJ3A 1HD2A 3IAS2 3TRXA 4Z2RA 3EYTA 1UA5A 2B7JA 2FA8A 2H76A 3RGBC 2FWGA 2YV7A 5JWOB 2YJ7A 4OWYA 3WGDA 4ZB7A 3QAVA 4XCSA 1SKRB 5G5EA 4POBA 2OE0A 1GRXA 4XRDA 4L8EA 3WD6A 1PX7A 2FCHA 1VF2A 2VCWA 1SENA 3C8EA 4OO4A 1YKAA 3TOUA 2HSHA 1TDIA 2L59A 1RQMA 6GSXA 3F4SA 4K7OA 4PI0C 4ZL8A 3L4NA 2FGXA 1MD3A 2H71A 3HZ4A 3LW9A 2OE1A 3LSZA 2CX3A 4G0IA 1SK1A 2VCQA 2DKIA 1M9AA 2H73A 4V2NA 4ZBBA 5J4YA 5ENUA 3F8UA 3CMIA 2H6YA 3FZ5A 4WETA 4KE3A 1SL2B 4TXOB 2WJUA 3DD3A 4EIPA 1JHBA 2OA7A 3GTUB 3ZREA 4KW6A 2X99A 1FOHA 1A8YA 2YZHA 1I1IP 2R5GA 3QPMA 3HJPA 5F07A 4NV2A 2VCVA 2CVKA 5G31A 3IE3A 2GT5A 1TOFA 3HY2A 3HCZA 2HI7A 1T4YA 1JZWA 2OT3A 2I9HA 4DSQA 5H5QA 3HVNA 3TJGA 4CY6A 2VCZA 2O85A 5HFIA 1ZCPA 2H1BA 4OMVA 1BAYA 4MJCA 4POLA 5JCGA 4AKHA 2YCDA 2KUCA 2CQ9A 4GQCA 4BVYA 1M2BA 5J40A 1EZKA 2IIYA 1A2JA 3J7Yb 3KTLA 4EKZA 1OVNA 1THXA 3KIJA 3TKSC 3PINA 3CBUA 2EIQA 4ZIJA 3MIXA 5BRTA 1N2AA 3G7JA 3M9JA 4BVXA 4ZB9A 3TCOA 4ML6A 4OO5A 5B7CA 2MBTA 2FLSA 3ZRDA 2H6ZA 2IMEA 3GIXA 3F9UA 4BL7B 2GQMA 3KTBA 3L78A 1A23A 5F8BA 1Z6MA 4FO5A 1GSUA 1DUGA 6GSVA 1NSWA 2F9SA 2GT6A 3FRCA 4EE0A 1EEMA 2JSYA 2WZ9A 2E0QA 1XW9A 2GQKA 1JFUA 4GWRA 1EOGA 2GQLA 2PN8A 2A2SA 1TJDA 3K8NA 4HDEA 1GNEA 1B4PA 4ZBDA 2HE3A 1YDKA 2C8UA 5DVBA 1WOUA 1QK8A 2LSTA 5A5HB 1TU8A 1G7EA 4YQMA 3CQFA 1TRVA 4EL1A 3SBCA 1ILOA 4HEA2 2X8GA 2VCXA 2DMMA 3O3TA 3NIVA 3W8JA 4OFTA 5B6NA 3PGTA 1FW1A 5IMAA 2O3EA 4ZBAA 4Z2UA 1SD9A 4K5RA 1VGLA 2B1KA 4MH2A 5A5HA 2KLXA 3TJBA 2H01A 2BMXA 2HRAA 2F8FA 4L5OA 2FWHA 4BWSA 2DIZA 5CYYA 2H1DA 4PQHA 2VL2A 4FH8A 3RHCA 4GDFA 4EIQA 1S3DA 5E4WA 5HR1A 1BF5A 1AQVA 3GL3A 4OFNA 3TKRA 3H1NA 4IP6A 1UVZA 3UBLA 5J4UA 1TP9A 2A4VA 2VIMA 1FVJA 1M99A 1XOAA 2H0IA 4CHSA 5IMFA 2VO4A 3Q74A 4LMWA 3W6GA 4G10A 2O36A 1KEBA 3UVHA 5DALA 1LBKA 3GKMA 3VWXA 3TUEA 1AXDA 2A4HA 2C4JA 2PMTA 2QSIA 1IYHA 3CSJA 3F6DA 1KNGA 1K0OA 1Q4JA 5IMCA 3GFKA 1QFNA 2VM1A 1G6YA 5ECOB 4POMA 5AGYA 2YJHA 1XVQA 5AIXA 2H75A 4RUVA 5CRDA 5ID2A 4F0BA 5ELAA 4YKGA 5ECPB 2H0GA 2WRTA 1A2LA 4LLRA 2VLVA 1Z5YE 3KGKA 1BX9A 1YY7A 2H1LA 2X8CA 3ZIJA 1B48A 1MEKA 1H4OA 1N25A 2B5YA 1K0DA 1FO5A 3EINA 5ELGA 1PN0A 4XS1A 2YP6A 3QR6A 4NMUA 22GSA 2MMZA 4TRXA 1C72A 2IMFA 3QCPA 1GUMA 4MF5A 3IOSA 1NW2A 1BG1A 3VWUA 1PMTA 5HFGA 2P0GA 2PERA 4IVFA 4POKA 4JEDA 1GSDA 4LL4B 2HNLA 1Z9HA 3ZITA 4I6XA 1PGTA 3GKNA 4KCEA 6GSWA 3A3TA 3RDWA 1GSEA 4GSTA 2H30A 2B5EA 4CW9A 2IPAA 3CTFA 1K3LA 2HT9A 4KAEA 2IJYA 4PGTA 1ZYPA 3HJOA 4G9HA 4DEJA 2EIRA 1BJXA 2OE3A 3Q6OA 5J3RA 4TKYA 3PR8A 2L6CA 2C0GA 2H8LA 4X4JA 2AAWA 2V6OA 5E59A 2DJJA 1OE8A 1B8XA 1R5AA 4PHZC 5HQPA 2YWOA 2V6KA 3EU4A 3UBKA 3CXGA 2HYXA 3RFRC 2EIOA 3KEBA 2JU5A 5DCHA 1V57A 4WEYA 2B7KA 6GSTA 3LJRA 5LNKe 4O7HA 2LV3A 4MF7A 2MMNA 4AF2A 3WGXA 1YQ1A 1PL1A 4PUFC 2MBSA 4K2DA 1BYEA 3CSIA 3VWWA 5B8BA 4EC0A 1GLQA 3F4RA 4LA1A 4MZCA 4NXIA 1LU4A 4MPGA 3DWVA 5CNWA 5ECLB 3VI7A 4LMVA 5JWQB 4ECJA 2R0GA 2JZTA 1X9WB 3R2QA 2LRNA 3BOAA 1FB0A 4K6XA 5A34B 4D73B 3DRNA 4TR4A 4ZL7A 1GLPA 3LEFA 3KMOA 3GL5A 1Y6EA 4QL9A 1QQ2A 4KNDA 5AIVA 3E9JB 3UMAA 3MYDA 3W8SA 2C0FA 2GZZA 4ECBA 1ZMAA 5EVOA 3FK8A 1XWAA 1HNAA 4MNNA 1NHOA 3ZL5A 3ZTLA 1XOBA 5GSSA 1TI1A 3CRUA 3C1SA 4D73A 1V40A 3V1WA 1GSYA 1U3IA 1SJ6A 2GLRA 2JADA 1OE7A 4JBBA 3E3EA 2P5RA 4KX4A 3BCKA 3M9KA 3CRTA 4G0LA 1EP7A 3HMJG 1Z3EA 5ECRB 5D96A 4FYBA 1V98A 4O5UA 3U5RE 3QFBC 2E2MA 2L4QA 4V1Ag 4F2IA 2XBIA 4BIKA 4FYUA 3H79A 2H1AA 2XPEA 3RHBA 4MK3A 3HD5A 3UIWA 2WS2A 3FW2A 18GSA 3WT2A 2N5AA 3TKSA 3L0HA 1YZXA 1MD4A 3CYNA 1GUKA 2MMOA 1M2DA 3D4MA 3P7XA 2IMIA 3DVXA 3AY8A 3DVWA 5IIZA 3LQ7A 2VM2A 2WGRA 4GXZA 4WR4A 3C73A 4DVCA 1YF0A 1J9BA 2GSTA 4HZ4A 1IYIA 3IHGA 4XS6A 5COHA 2B5XA 2LJRA 4AKXB 1VF4A 2DKHA 1WPIA 3ISOA 1OC9B 1T8EB 2EFHA 4HSCX 3F6FA 4XIHA 1HYUA 1S3CA 3H4KA 2FWEA 4E68A 4HI7A 1EGOA 3GYKA 4FXYP 3APQA 5BMUB 1E6BA 8GSSA 1BG5A 2GTUA 3UAPA 2WW2A 5FT3A 1JLVA 3WT1A 1I9DA 4YH2A 1YF1A 4F82A 3TU3B 3FYGA 1Z7RA 5J41A 2O8VB 3ZMLA 4NPBA 3TJFA 1W89A 2VLTA 5G30A 4OD7A 2BTOT 1AC1A 4IGJA 5ECKB 1W4VA 2G0FA 5J9BA 1EOHA 1AUCA 3H93A 1SL0B 5KN1A 1XIYA 1DE2A 5B6MA 3I6AA 4TXOA 4MCUA 4IQ1A 2FWFA 2N5FA 1X5CA 3GTUA 5HR2A 2J23A 3MDKA 3HVXA 5DCGA 4AGSA 3VPQA 1AQWA 3P90A 1K3OA 1WWJA 4HJ2A 1B9XC 1PFOA 1J0FA 1M3JA 4GRFA 1EP8A 4PURA 4TR3A 5IPGA 4EO3A 5FHIA 4HU9A 3GX8A 4O92A 2R2JA 4BA7A 3M0FA 1WIKA 2HRNA 13GSA 2FHEA 1ST9A 3HJMA 4Z2TA 5L71A 2UV8G 1TK5B 2X4AA 3UJ1A 4PNGA 2LQQA 2VAFA 1GNWA 5CRGA 4YAPA 4K7IA 3PH9A 4L0UA 4ML1A 3APOA 5J4VA 1OC8A 4WF5A 1U87A 3EURA 3MNGA 5IOXA 4YQVA 16GSA 3QAWA 3GHAA 4BWQA 2L4CA 4LL1B 3KP9A 2AJQB 2QA1A 4RQXA 3D22A 3E0UA 5A4VA 3GX0A 5D9XA 4BL7A 5D73A 1O81A 3A2XA 3Q19A 1PA3A 3ZVJD 3TKSE 5A5KA 2AHEA 2RUFA 4QQ7A 1WP0A 4FYCA 3F3QA 2UZ8A 1GUHA 4P3YB 1T1VA 4IW9A 1XFLA 2RLIA 5CRHA 2DBCA 2F8AA 2L57A 2R0PA 3N9JA 2V2GA 5J47A 5H5RA 2XC2A 3D0ZA 1VRSD 4MLYA 2HRKB 2NTOA 3D6IA 2J9HA 4F0CA 5F06A 1EV9A 3F63A 3IV4A 3G7YA 4MZBA 1ABAA 1GSSA 4IKHA 4WXTA 2DLXA 1Q98A 2H6XA 4AJ6A 3ERFA 1BEDA 2ES7A 3VK9A 5DJLA 1GH2A 4KSOA 1GTIA 3FZ4A 1T7PB 3VURA 2DJ3A 1WRYA 5EY6A 4KCAA 1X5DA 1G7OA 2HRKA 5F0GA 4X0XA 4A5PA 2EFCA 2K6VA 3TRQA 4YQUA 4YAVA 2GS3A 2FD3A 3HDCA 1ML6A 5IMDA 2O5VA 2WDUA 5J5NA 3RAZA 5C00A 3A2WA 3CSHA 5ECQB 1A0FA 5DAKB 2C3TA 1F3BA 2F3MA 4TOPA 5ECNB 1AAZA 5HFKA 1XW5A 4USSA 1GL8A 1G0TA 1URMA 2GZYA 5C04A 5CO3A 4ULXA 2TRXA 3CTGA 4WR5A 3BBYA 1SL1B 3HZ8A 1ZYQB 3M8NA 2IL3A 1A2MA 1AIUA 2C80A 1TKDB 4IHUA 3F4TA 1MDJA 1FOVA 5A4UA 2NDOA 3DIEA 1HNCA 3M3MA 4KSMA 4RI7A 5AISA 3MWHA 1O73A 3A5WA 2LRTA 5GAND 1R26A 2GSSA 2OJLA 3GSSA 3IAM2 1MDKA 4V1Ap 3TB2A 4KDXA 3IC4A 5DJMA 1TK8B 2X64A 3KXOA 2LQOA 14GSA 3EPTA 3LFLA 4TVEA 2OADA 3HA9A 3BD2A 3TDGA 4K5SA 5A1NB 3L9VA 4MMMA 3TKQA 3ZIVA 3QAGA 2CX4A 2GZPA 1PSQA 2GSQA 2A2PA 4XS4B 3HVSA 2KOKA 5CRWA 3S9FA 1NHYA 1ZYNA 1M3IA 3GUSA 3IHQA 1OKDA 4DSSB 5KOWA 1ZGNA 2NVLA 2G2QA 1AW9A 4ECCA 1U6TA 5G1KA 2I4AA 3UEMA 1UN2A 2IWTA 1K0AA 2R4VA 3Q18A 1ACVA 4MZWA 5ECHB 5A1NA 1PL2A 3MAKA 5DDLA 2H70A 3KJYA 4ZB8A 2VL2C 3L9SA 4J57E 4OCEA 1SD8A 4JRRA 1XWKA 4TN8A 3G7IA 1R7HA 4NWYA 2L5LA 3FR3A 4WBRD 3F0IA 1FVKA 3UVTA 2VD1A 5KN2A 2IMKA 2HQTA 3ED3A 4ECIA 2DSAA 2V32A 2VOCA 2HRFA 4N0VA 1EV4A 4K8MA 1EGRA 4WKWA 5G1LA 4N30A 2HZEB 4KB3A 2MMAA 5ECSA 1F6MC 1FG4A 2FA4A 3DXBA 4N11A 1F3AA 5IO0A 2HLSA 1XCCA 2O87A 4ID0A 1FB6A 4MJEA 1KTEA 4FQUA 3FMWA 1H75A 1SJIA 2JSZA 1X5EA 3EC3A 4V2MA 1SJZA 2LEGA 3FEUA 2LRCA 4GSNA 4AJ8A 2GDRA 2HZEA 3ME8A 4O32A 1PD21 2YANA 2FNOA 1MDIA 3F3RA 1Z7PA 3EMPA 3ZYWA 3FZAA 5D8IA 1ERTA 2HFDA 2DJKA 3LYKA 3TRPA 2M72A 1AQXA
chains in the Genus database with same CATH topology
2E7PA 2DJ0A 2IMDA 3LG6A 4ZB6A 5DQSA 1X9MB 1O8XA 4TR1B 2WCIA 2R37A 3GN3A 2REMA 5A34A 2RIIA 4FIWA 4ILFA 5KN3A 3ERGA 1J08A 4EXJA 3GV1A 1TXXA 1EWXA 2P5QA 4IELA 4GQFA 2C0EA 5JCUA 4MABA 2CAIA 3GH6A 4MP4A 4J2FA 4IBPA 5IPHA 4MJBA 4Q5NA 4O5QA 3GA4A 2C3QA 5IO2A 4Q5QA 3UL3A 2JZRA 4AI6A 1QXHA 1OKTA 5B8AA 4GSSA 4TXVA 4NV5A 4KF9A 3C7MA 3KZQA 4EVMA 4Q5RA 5DQYA 3EMXA 2HSNB 2CAQA 4PTSA 6GSYA 3DGQA 1XVWA 2CVDA 2EFEA 2PVQA 5CAXA 4K0GA 3VLNA 2RM5A 1WMJA 4G2EA 2L5OA 4HQSA 2AYTA 1QGVA 3EU3A 3HVVA 1T3BA 2VL3A 4ACSA 4MF6A 3KH9A 3QD9A 1Y25A 2ON7A 1R5PA 3VWVA 5FWGA 2K8SA 4G19A 2HSNA 2X8HA 4I5QA 5CREA 1M7TA 2LS5A 4F03A 2VCTA 4N10A 2QC7A 20GSA 4IQAA 1M2AA 1XPVA 2RM6A 5HR0A 2LJAA 2WFCA 3D4TA 4TW5A 1PKWA 1GULA 1A0RP 4PXOA 1SK0A 2LUSA 1JZDA 3ERWA 3VI5A 4PUAA 1TXUA 2EFDA 1F9MA 2Z9SA 5IOWA 1A24A 3M1GA 3IA1A 3ZMKA 1F2EA 3EE2A 5D9VA 4F9ZA 1M0UA 4EDZA 2K18A 2WB9A 2QKEA 1OC9A 2I81A 1N8JA 5EL8A 3LGCA 1DE1A 3KP8A 4N3ZA 1QMVA 3P8WA 5EPFA 5BMUA 4QL7A 3GRXA 3PPUA 1DBYA 4BVYB 3QMXA 4KDYA 4RI6A 1TRSA 2FUG2 2KP2A 1K3YA 3LXZA 2LJKA 3H8QA 9GSSA 2K9FA 4O5RA 5LCZA 5ECMB 4ISDA 4BVXB 1SYRA 6GSSA 2GGTA 4MPFA 3IBHA 1GTUA 3C1RA 4MJAA 3NZNA 2O7KA 1ZZYA 1ZOFA 4I2TA 4K0NA 5KN0A 4MA9A 3J7Yk 4JZQA 4HJMA 1T00A 1SU9A 1R4WA 2VD0A 3TGZA 2DJ2A 3IDVA 3KM6A 2N5BA 1X9SB 3APSA 2PVOC 1TRWA 1O8WA 2X49A 2TIRA 2ZNMA 1GTBA 5JCWA 1GWCA 3D21A 3GURA 4I2UA 2IN3A 4I97A 4GLTA 3HHVA 2JZSA 2DMLA 3LORA 1O7UA 1FHEA 4G01A 1S3AA 1OC3A 4WBJA 3FR9A 1BQ7A 3LWAA 2B6MA 1WJKA 17GSA 1SKWB 1NM3A 2BJXA 2F51A 1K0CA 1OAZA 2H0HA 5D9TA 2MZCA 4W66A 1YEXA 3HKRA 2OBKA 3QOUA 4AJ7A 2YV9A 4HQZA 3US3A 1HNBA 3RPPA 11GSA 5G5FA 1YVLA 1V9WA 3KH7A 2VKZG 4J56E 10GSA 3ME7A 3GH9A 2RUEA 3EVIA 3GKXA 1ERVA 3OR5A 3QDNA 2PU9C 2ON5A 1RK4A 1G6WA 1O6JA 4L5LA 3WGEA 2HSMB 1K0BA 1SKSB 1M9BA 3D5JA 4PQIA 5IMVA 4K9ZA 2H72A 5GSTA 2GSRA 4AKGA 5INYA 4GTUA 1YKCA 5G2ZA 1TW9A 1ZYEA 3ZFLA 1B9YC 3LXTA 3TOTA 1OYJA 2V41A 2B3SA 4HS1A 4XHMA 3ZVJA 3ZZXA 2NPBA 2NBSA 3A5IA 4N0ZA 4IS0A 2HSMA 2ZUPA 2CA8A 5IQYA 4NHZA 1A8LA 3O76A 4AKIA 2C1YA 2OKAA 3U6VA 1U88A 5CP1A 2LTKA 2YWMA 4HOJA 2KHPA 1FAAA 2QGVA 3GNJA 4IP1A 5DALB 1UC7A 5JWRB 3I69A 2PWJA 2R6KA 2JACA 3O6TA 4IJIA 4L0WA 6GSUA 2YWIA 4KGIA 2I1UA 4I8BA 3QFAC 4Q5FA 1U3AA 2GVPA 3L9UA 5KOXA 4ZXGA 4G0KA 3TKPA 5ID2B 1KBNA 2H74A 5DAKA 2CZ3A 2VLUA 2DIYA 4MDCA 2AB6A 2YOIA 1CQGA 1USBA 2XBQA 5D93A 3TJJA 4IN0A 4PNFA 5J9CA 2CVBA 5A4WA 2D2ZA 3LYPA 2YPMA 4KH7A 3KMNA 2DC5A 3FHKA 1JZRA 2R0CA 2IFQB 2I3YA 1PX6A 4KA0A 5HR3A 1MTCA 1HQOA 1WE0A 3DKSA 4EUYA 3VPTA 3KCMA 3IR4A 2LNSA 1TI3A 1QUWA 1V58A 2PUKC 2B1LA 3I43A 3DYRA 4ICYA 1SYXA 3BCIA 5GAPD 5AN1A 2FY6A 3G9BA 4K1FA 4TR0A 3IC8A 2PGTA 2IFQA 3FZ9A 4HZ2A 3DEXA 2JL4A 3GSTA 2H1GA 2LKUA 2AV4A 2OBIA 3R3EA 3DMLA 1XWCA 12GSA 3CWGA 1XXUA 4CY8A 2YWNA 1SVMA 4KDUA 1E2YA 3IK7A 4K2XA 3GKKA 3IRAA 1PN9A 1Y1UA 4OFMA 4BPYA 1Z6NA 2OACA 3GMFA 4X43A 4XS4A 2L6DA 3HXSA 4JU5A 19GSA 3FKFA 5IMZA 3BJ5A 1VF1A 1LJRA 1RW1A 2M80A 4Z7XA 4H86A 1SK2A 1V2AA 4DSSA 1ZL9A 3ZFBA 4ZL9A 2E2GA 1GTAA 4GCIA 3JCML 4V2LA 1YEPA 3IK9A 3EWLA 4CDOA 1GSQA 1EEJA 2XPDA 1JLWA 4YKFA 1X0RA 1ON4A 1VF3A 2HSYA 5LD0A 2PBJA 1SVOA 1O85A 3I9V2 4HU7A 4XTSA 2YNXA 2YN1A 4EDYA 4JR4A 1PRXA 3IPZA 4PX1A 5KEJA 2XHFA 1ERUA 1JZOA 5ECIB 1CQHA 3MSZA 4K7NA 4GF0A 1I5GA 1YJ6A 2CT6A 1TRUA 2C3NA 1XWBA 5F05A 5ABRA 4MH3A 1XWGA 4RQRA 1XBSA 1K0MA 1K0NA 3RBTA 2CV4A 3C71A 3UOMA 2VUPA 2PPTA 4NAXA 4JE1A 2LNTA 5GZZB 5D9WA 3TJKA 2AUVA 4X1UA 4JR6A 4PQ1A 1XZOA 3P2AA 2K8VA 4KUNA 2DJ1A 1TU7A 4E8HA 2VL9A 3SWLA 3RPNA 1SVLA 2WULA 4XRAA 1ERWA 4E8EA 2M46A 2V1MA 2R3XA 2MYGA 1GSFA 4HUAA 3WYWA 2HXKA 1DSBA 1GP1A 2P31A 3NOFA 2KP1A 4DSRA 1TTZA 2C0DA 3UARA 2QA2A 4OCFA 3FY7A 1F37A 4WF4A 2CZ2A 3HYPA 4EF0A 1TK0B 4TR1A 2ZCTA 3A2VA 1PQNA 7GSSA 3ZLPA 2H19A 2ALBA 2A2RA 5H5SA 2EC4A 4NHWA 3IXRA 2H66A 3VFIA 3FR6A 1THOA 1B4QA 5IM9A 1PKZA 3N5OA 4ZILA 3KD0A 2TRCP 2HZFA 5DBQA 2YZUA 4QMKA 1XW6A 1T4ZA 2O89A 4IJ3A 1HD2A 3IAS2 3TRXA 4Z2RA 3EYTA 1UA5A 2B7JA 2FA8A 2H76A 2FWGA 2YV7A 5JWOB 2YJ7A 4OWYA 3WGDA 4ZB7A 3QAVA 4XCSA 1SKRB 5G5EA 4POBA 2OE0A 1GRXA 4XRDA 4L8EA 3WD6A 1PX7A 2FCHA 1VF2A 2VCWA 1SENA 3C8EA 4OO4A 1YKAA 3TOUA 2HSHA 1TDIA 2L59A 1RQMA 6GSXA 3F4SA 4K7OA 4ZL8A 3L4NA 2FGXA 1MD3A 2H71A 3HZ4A 3LW9A 2OE1A 3LSZA 2CX3A 4G0IA 1SK1A 2VCQA 2DKIA 1M9AA 2H73A 4V2NA 4ZBBA 5J4YA 5ENUA 3F8UA 3CMIA 2H6YA 3FZ5A 4WETA 4KE3A 1SL2B 4TXOB 2WJUA 3DD3A 4EIPA 1JHBA 2OA7A 3GTUB 3ZREA 4KW6A 2X99A 1FOHA 1A8YA 2YZHA 3QPMA 2R5GA 3HJPA 5F07A 4NV2A 2VCVA 2CVKA 5G31A 3IE3A 2GT5A 1TOFA 3HY2A 3HCZA 2HI7A 1T4YA 1JZWA 2OT3A 2I9HA 4DSQA 5H5QA 3TJGA 4CY6A 2VCZA 2O85A 5HFIA 1ZCPA 2H1BA 4OMVA 1BAYA 4MJCA 4POLA 5JCGA 4AKHA 2YCDA 2KUCA 2CQ9A 4GQCA 4BVYA 1M2BA 5J40A 1EZKA 2IIYA 1A2JA 3J7Yb 3KTLA 4EKZA 1OVNA 1THXA 3KIJA 3TKSC 3PINA 3CBUA 2EIQA 4ZIJA 3MIXA 5BRTA 1N2AA 3G7JA 3M9JA 4BVXA 4ZB9A 3TCOA 4ML6A 4OO5A 5B7CA 2MBTA 2FLSA 3ZRDA 2H6ZA 2IMEA 3GIXA 3F9UA 4BL7B 2GQMA 3KTBA 3L78A 1A23A 5F8BA 1Z6MA 4FO5A 1GSUA 1DUGA 6GSVA 1NSWA 2F9SA 2GT6A 3FRCA 4EE0A 1EEMA 2JSYA 2WZ9A 2E0QA 1XW9A 2GQKA 1JFUA 4GWRA 1EOGA 2GQLA 2PN8A 2A2SA 1TJDA 3K8NA 4HDEA 1GNEA 1B4PA 4ZBDA 2HE3A 1YDKA 2C8UA 5DVBA 1WOUA 1QK8A 2LSTA 5A5HB 1TU8A 1G7EA 4YQMA 1TRVA 4EL1A 3SBCA 1ILOA 4HEA2 2X8GA 2VCXA 2DMMA 3O3TA 3NIVA 3W8JA 4OFTA 5B6NA 3PGTA 1FW1A 5IMAA 4ZBAA 4Z2UA 1SD9A 4K5RA 1VGLA 2B1KA 4MH2A 5A5HA 2KLXA 3TJBA 2H01A 2BMXA 2HRAA 2F8FA 4L5OA 2FWHA 4BWSA 2DIZA 5CYYA 2H1DA 4PQHA 2VL2A 4FH8A 3RHCA 4GDFA 4EIQA 1S3DA 5E4WA 5HR1A 1BF5A 1AQVA 3GL3A 4OFNA 3TKRA 3H1NA 4IP6A 1UVZA 3UBLA 5J4UA 1TP9A 2A4VA 2VIMA 1FVJA 1M99A 1XOAA 2H0IA 4CHSA 5IMFA 2VO4A 3Q74A 4LMWA 3W6GA 4G10A 1KEBA 3UVHA 5DALA 1LBKA 3GKMA 3VWXA 3TUEA 1AXDA 2A4HA 2C4JA 2PMTA 2QSIA 1IYHA 3CSJA 3F6DA 1KNGA 1K0OA 1Q4JA 5IMCA 3GFKA 1QFNA 2VM1A 1G6YA 5ECOB 4POMA 5AGYA 2YJHA 1XVQA 5AIXA 2H75A 4RUVA 5CRDA 5ID2A 4F0BA 5ELAA 4YKGA 5ECPB 2H0GA 2WRTA 1A2LA 4LLRA 2VLVA 1Z5YE 3KGKA 1BX9A 1YY7A 2H1LA 2X8CA 3ZIJA 1B48A 1MEKA 1H4OA 1N25A 2B5YA 1K0DA 1FO5A 3EINA 5ELGA 1PN0A 4XS1A 2YP6A 3QR6A 4NMUA 22GSA 2MMZA 4TRXA 1C72A 2IMFA 3QCPA 1GUMA 4MF5A 3IOSA 1NW2A 1BG1A 3VWUA 1PMTA 5HFGA 2P0GA 2PERA 4IVFA 4POKA 4JEDA 1GSDA 4LL4B 2HNLA 1Z9HA 3ZITA 4I6XA 1PGTA 3GKNA 4KCEA 6GSWA 3A3TA 3RDWA 1GSEA 4GSTA 2H30A 2B5EA 4CW9A 2IPAA 3CTFA 1K3LA 2HT9A 4KAEA 2IJYA 4PGTA 1ZYPA 3HJOA 4G9HA 4DEJA 2EIRA 1BJXA 2OE3A 3Q6OA 5J3RA 4TKYA 3PR8A 2L6CA 2C0GA 2H8LA 4X4JA 2AAWA 2V6OA 5E59A 2DJJA 1OE8A 1B8XA 1R5AA 5HQPA 2YWOA 2V6KA 3EU4A 3UBKA 3CXGA 2HYXA 2EIOA 3KEBA 2JU5A 5DCHA 1V57A 4WEYA 2B7KA 6GSTA 3LJRA 5LNKe 4O7HA 2LV3A 4MF7A 2MMNA 4AF2A 3WGXA 1YQ1A 1PL1A 4PUFC 2MBSA 4K2DA 1BYEA 3CSIA 3VWWA 5B8BA 4EC0A 1GLQA 3F4RA 4LA1A 4MZCA 4NXIA 1LU4A 4MPGA 3DWVA 5CNWA 5ECLB 3VI7A 4LMVA 5JWQB 4ECJA 2R0GA 2JZTA 1X9WB 3R2QA 2LRNA 3BOAA 1FB0A 4K6XA 5A34B 4D73B 3DRNA 4TR4A 4ZL7A 1GLPA 3LEFA 3KMOA 3GL5A 1Y6EA 4QL9A 1QQ2A 4KNDA 5AIVA 3E9JB 3UMAA 3MYDA 3W8SA 2C0FA 2GZZA 4ECBA 1ZMAA 5EVOA 3FK8A 1XWAA 1HNAA 4MNNA 1NHOA 3ZL5A 3ZTLA 1XOBA 5GSSA 1TI1A 3CRUA 3C1SA 4D73A 1V40A 3V1WA 1GSYA 1U3IA 1SJ6A 2GLRA 2JADA 1OE7A 4JBBA 3E3EA 2P5RA 4KX4A 3BCKA 3M9KA 3CRTA 4G0LA 1EP7A 3HMJG 1Z3EA 5ECRB 5D96A 4FYBA 1V98A 4O5UA 3U5RE 3QFBC 2E2MA 2L4QA 4V1Ag 4F2IA 2XBIA 4FYUA 3H79A 2H1AA 2XPEA 3RHBA 4MK3A 3HD5A 3UIWA 2WS2A 3FW2A 18GSA 3WT2A 2N5AA 3TKSA 3L0HA 1YZXA 1MD4A 3CYNA 1GUKA 2MMOA 1M2DA 3D4MA 3P7XA 2IMIA 3DVXA 3AY8A 3DVWA 5IIZA 3LQ7A 2VM2A 2WGRA 4GXZA 4WR4A 3C73A 4DVCA 1YF0A 1J9BA 2GSTA 4HZ4A 1IYIA 3IHGA 4XS6A 5COHA 2B5XA 2LJRA 4AKXB 1VF4A 2DKHA 1WPIA 3ISOA 1OC9B 1T8EB 2EFHA 3F6FA 4XIHA 1HYUA 1S3CA 3H4KA 2FWEA 4E68A 4HI7A 1EGOA 3GYKA 3APQA 5BMUB 1E6BA 8GSSA 1BG5A 2GTUA 3UAPA 5FT3A 1JLVA 3WT1A 1I9DA 4YH2A 1YF1A 4F82A 3TU3B 3FYGA 1Z7RA 5J41A 2O8VB 3ZMLA 4NPBA 3TJFA 1W89A 2VLTA 5G30A 4OD7A 2BTOT 1AC1A 4IGJA 5ECKB 1W4VA 2G0FA 5J9BA 1EOHA 1AUCA 3H93A 1SL0B 5KN1A 1XIYA 1DE2A 5B6MA 3I6AA 4TXOA 4MCUA 4IQ1A 2FWFA 2N5FA 1X5CA 3GTUA 5HR2A 2J23A 3MDKA 3HVXA 5DCGA 4AGSA 3VPQA 1AQWA 3P90A 1K3OA 1WWJA 4HJ2A 1B9XC 1J0FA 4GRFA 1EP8A 4PURA 4TR3A 5IPGA 4EO3A 5FHIA 4HU9A 3GX8A 4O92A 2R2JA 4BA7A 3M0FA 1WIKA 2HRNA 13GSA 2FHEA 1ST9A 3HJMA 4Z2TA 5L71A 2UV8G 1TK5B 2X4AA 3UJ1A 4PNGA 2LQQA 2VAFA 1GNWA 5CRGA 4YAPA 4K7IA 3PH9A 4L0UA 4ML1A 3APOA 5J4VA 1OC8A 4WF5A 1U87A 3EURA 3MNGA 5IOXA 4YQVA 16GSA 3QAWA 3GHAA 4BWQA 2L4CA 4LL1B 3KP9A 2AJQB 2QA1A 4RQXA 3D22A 3E0UA 5A4VA 3GX0A 5D9XA 4BL7A 5D73A 1O81A 3A2XA 3Q19A 1PA3A 3ZVJD 3TKSE 5A5KA 2AHEA 2RUFA 4QQ7A 1WP0A 4FYCA 3F3QA 2UZ8A 1GUHA 4P3YB 1T1VA 4IW9A 1XFLA 2RLIA 5CRHA 2DBCA 2F8AA 2L57A 2R0PA 3N9JA 2V2GA 5J47A 5H5RA 2XC2A 3D0ZA 1VRSD 4MLYA 2HRKB 2NTOA 3D6IA 2J9HA 4F0CA 5F06A 1EV9A 3F63A 3IV4A 3G7YA 4MZBA 1ABAA 1GSSA 4IKHA 4WXTA 2DLXA 1Q98A 2H6XA 4AJ6A 3ERFA 1BEDA 2ES7A 3VK9A 5DJLA 1GH2A 4KSOA 1GTIA 3FZ4A 1T7PB 3VURA 2DJ3A 1WRYA 5EY6A 4KCAA 1X5DA 1G7OA 2HRKA 5F0GA 4X0XA 4A5PA 2EFCA 2K6VA 3TRQA 4YQUA 4YAVA 2GS3A 2FD3A 3HDCA 1ML6A 5IMDA 2O5VA 2WDUA 5J5NA 3RAZA 5C00A 3A2WA 3CSHA 5ECQB 1A0FA 5DAKB 2C3TA 1F3BA 2F3MA 4TOPA 5ECNB 1AAZA 5HFKA 1XW5A 4USSA 1GL8A 1G0TA 1URMA 2GZYA 5C04A 5CO3A 4ULXA 2TRXA 3CTGA 4WR5A 3BBYA 1SL1B 3HZ8A 1ZYQB 3M8NA 2IL3A 1A2MA 1AIUA 2C80A 1TKDB 4IHUA 3F4TA 1MDJA 1FOVA 5A4UA 2NDOA 3DIEA 1HNCA 3M3MA 4KSMA 4RI7A 5AISA 3MWHA 1O73A 3A5WA 2LRTA 5GAND 1R26A 2GSSA 2OJLA 3GSSA 3IAM2 1MDKA 4V1Ap 3TB2A 4KDXA 3IC4A 5DJMA 1TK8B 2X64A 3KXOA 2LQOA 14GSA 3EPTA 3LFLA 4TVEA 2OADA 3HA9A 3BD2A 3TDGA 4K5SA 5A1NB 3L9VA 4MMMA 3TKQA 3ZIVA 3QAGA 2CX4A 2GZPA 1PSQA 2GSQA 2A2PA 4XS4B 3HVSA 2KOKA 5CRWA 3S9FA 1NHYA 1ZYNA 3GUSA 3IHQA 1OKDA 4DSSB 5KOWA 1ZGNA 2NVLA 2G2QA 1AW9A 4ECCA 1U6TA 5G1KA 2I4AA 3UEMA 1UN2A 2IWTA 1K0AA 2R4VA 3Q18A 1ACVA 4MZWA 5ECHB 5A1NA 1PL2A 3MAKA 5DDLA 2H70A 3KJYA 4ZB8A 2VL2C 3L9SA 4J57E 4OCEA 1SD8A 4JRRA 1XWKA 4TN8A 3G7IA 1R7HA 4NWYA 2L5LA 3FR3A 4WBRD 3F0IA 1FVKA 3UVTA 2VD1A 5KN2A 2IMKA 2HQTA 3ED3A 4ECIA 2DSAA 2V32A 2VOCA 2HRFA 4N0VA 1EV4A 4K8MA 1EGRA 4WKWA 5G1LA 4N30A 2HZEB 4KB3A 2MMAA 5ECSA 1F6MC 1FG4A 2FA4A 3DXBA 4N11A 1F3AA 5IO0A 2HLSA 1XCCA 2O87A 4ID0A 1FB6A 4MJEA 1KTEA 4FQUA 3FMWA 1H75A 1SJIA 2JSZA 1X5EA 3EC3A 4V2MA 1SJZA 2LEGA 3FEUA 2LRCA 4GSNA 4AJ8A 2GDRA 2HZEA 3ME8A 4O32A 1PD21 2YANA 2FNOA 1MDIA 3F3RA 1Z7PA 3EMPA 3ZYWA 3FZAA 5D8IA 1ERTA 2HFDA 2DJKA 3LYKA 3TRPA 2M72A 1AQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7P A;  2DJ0 A;  2IMD A;  3LG6 A;  4ZB6 A;  5DQS A;  1X9M B;  1O8X A;  4TR1 B;  2WCI A;  2R37 A;  3GN3 A;  2REM A;  2RII A;  4FIW A;  4ILF A;  5KN3 A;  3ERG A;  1J08 A;  4EXJ A;  3GV1 A;  1TXX A;  1EWX A;  2P5Q A;  4IEL A;  4GQF A;  2C0E A;  5JCU A;  4MAB A;  2CAI A;  3GH6 A;  4MP4 A;  4J2F A;  4IBP A;  5IPH A;  4MJB A;  4Q5N A;  3GA4 A;  2C3Q A;  5IO2 A;  4Q5Q A;  3UL3 A;  2JZR A;  1QXH A;  1OKT A;  5B8A A;  4GSS A;  4TXV A;  4NV5 A;  4KF9 A;  3C7M A;  3KZQ A;  4EVM A;  4Q5R A;  5DQY A;  3EMX A;  2HSN B;  2CAQ A;  4PTS A;  6GSY A;  3DGQ A;  1XVW A;  2CVD A;  2PVQ A;  5CAX A;  4K0G A;  3VLN A;  2RM5 A;  1WMJ A;  4G2E A;  2L5O A;  4HQS A;  2AYT A;  1QGV A;  3EU3 A;  3HVV A;  1T3B A;  2VL3 A;  4ACS A;  4MF6 A;  3KH9 A;  3QD9 A;  1Y25 A;  2ON7 A;  1R5P A;  3VWV A;  5FWG A;  2K8S A;  4G19 A;  2X8H A;  4I5Q A;  5CRE A;  1M7T A;  2LS5 A;  4F03 A;  2VCT A;  4N10 A;  2QC7 A;  20GS A;  4IQA A;  1M2A A;  1XPV A;  2RM6 A;  5HR0 A;  2LJA A;  2WFC A;  3D4T A;  4TW5 A;  1PKW A;  1GUL A;  1A0R P;  4PXO A;  1SK0 A;  2LUS A;  1JZD A;  3ERW A;  3VI5 A;  4PUA A;  2Z9S A;  1A24 A;  1F9M A;  5IOW A;  3M1G A;  3IA1 A;  3ZMK A;  1F2E A;  3EE2 A;  5D9V A;  4F9Z A;  1M0U A;  4EDZ A;  2K18 A;  2WB9 A;  2QKE A;  1OC9 A;  2I81 A;  1N8J A;  5EL8 A;  3LGC A;  1DE1 A;  3KP8 A;  1QMV A;  3P8W A;  5EPF A;  5BMU A;  4QL7 A;  3GRX A;  3PPU A;  1DBY A;  4BVY B;  3QMX A;  4KDY A;  4RI6 A;  1TRS A;  2FUG 2;  2KP2 A;  1K3Y A;  3LXZ A;  2LJK A;  3H8Q A;  9GSS A;  2K9F A;  4O5R A;  5LCZ A;  5ECM B;  4ISD A;  4BVX B;  1SYR A;  6GSS A;  2GGT A;  4MPF A;  3IBH A;  1GTU A;  3C1R A;  4MJA A;  3NZN A;  2O7K A;  1ZZY A;  1ZOF A;  4I2T A;  4K0N A;  5KN0 A;  4MA9 A;  3J7Y k;  4JZQ A;  4HJM A;  1T00 A;  1SU9 A;  1R4W A;  2VD0 A;  3TGZ A;  2DJ2 A;  3IDV A;  3KM6 A;  2N5B A;  1X9S B;  3APS A;  2PVO C;  1TRW A;  1O8W A;  2TIR A;  2ZNM A;  1GTB A;  5JCW A;  1GWC A;  3D21 A;  3GUR A;  4I2U A;  2IN3 A;  4I97 A;  4GLT A;  3HHV A;  2JZS A;  2DML A;  3LOR A;  1O7U A;  1FHE A;  1S3A A;  1OC3 A;  4WBJ A;  3FR9 A;  1BQ7 A;  3LWA A;  2B6M A;  1WJK A;  17GS A;  1SKW B;  1NM3 A;  2BJX A;  2F51 A;  1K0C A;  1OAZ A;  2H0H A;  5D9T A;  2MZC A;  1YEX A;  3HKR A;  2OBK A;  3QOU A;  4AJ7 A;  2YV9 A;  4HQZ A;  3US3 A;  1HNB A;  3RPP A;  11GS A;  5G5F A;  1V9W A;  3KH7 A;  4J56 E;  10GS A;  3ME7 A;  3GH9 A;  2RUE A;  3EVI A;  3GKX A;  1ERV A;  3OR5 A;  3QDN A;  2PU9 C;  2ON5 A;  1RK4 A;  1G6W A;  1O6J A;  4L5L A;  3WGE A;  2HSM B;  1K0B A;  1SKS B;  1M9B A;  3D5J A;  4PQI A;  5IMV A;  4K9Z A;  2H72 A;  5GST A;  2GSR A;  5INY A;  4GTU A;  1YKC A;  5G2Z A;  1TW9 A;  1ZYE A;  3ZFL A;  1B9Y C;  3LXT A;  3TOT A;  1OYJ A;  2V41 A;  2B3S A;  4HS1 A;  4XHM A;  3ZVJ A;  3ZZX A;  2NPB A;  2NBS A;  4N0Z A;  4IS0 A;  2HSM A;  2ZUP A;  2CA8 A;  5IQY A;  4NHZ A;  1A8L A;  3O76 A;  2C1Y A;  2OKA A;  3U6V A;  1U88 A;  5CP1 A;  2LTK A;  2YWM A;  4HOJ A;  2KHP A;  1FAA A;  4IP1 A;  2QGV A;  3GNJ A;  5DAL B;  1UC7 A;  5JWR B;  3I69 A;  2PWJ A;  2R6K A;  2JAC A;  3O6T A;  4IJI A;  4L0W A;  6GSU A;  2YWI A;  4KGI A;  2I1U A;  4I8B A;  3QFA C;  4Q5F A;  1U3A A;  2GVP A;  3L9U A;  4ZXG A;  4G0K A;  3TKP A;  5ID2 B;  1KBN A;  2H74 A;  5DAK A;  2CZ3 A;  2VLU A;  2DIY A;  4MDC A;  2AB6 A;  2YOI A;  1CQG A;  1USB A;  2XBQ A;  5D93 A;  3TJJ A;  4IN0 A;  4PNF A;  5J9C A;  2CVB A;  5A4W A;  2D2Z A;  3LYP A;  2YPM A;  4KH7 A;  3KMN A;  2DC5 A;  3FHK A;  1JZR A;  2IFQ B;  2I3Y A;  1PX6 A;  4KA0 A;  5HR3 A;  1MTC A;  1HQO A;  1WE0 A;  3DKS A;  4EUY A;  3VPT A;  3KCM A;  3IR4 A;  2LNS A;  1TI3 A;  1QUW A;  1V58 A;  2PUK C;  2B1L A;  3I43 A;  3DYR A;  1SYX A;  3BCI A;  5GAP D;  5AN1 A;  2FY6 A;  3G9B A;  4K1F A;  4TR0 A;  3IC8 A;  2PGT A;  2IFQ A;  3FZ9 A;  4HZ2 A;  3DEX A;  2JL4 A;  3GST A;  2H1G A;  2LKU A;  2AV4 A;  2OBI A;  3R3E A;  3DML A;  1XWC A;  12GS A;  1XXU A;  2YWN A;  4KDU A;  1E2Y A;  3IK7 A;  3GKK A;  3IRA A;  1PN9 A;  4OFM A;  4BPY A;  1Z6N A;  2OAC A;  3GMF A;  4X43 A;  4XS4 A;  2L6D A;  3HXS A;  4JU5 A;  19GS A;  3FKF A;  5IMZ A;  3BJ5 A;  1VF1 A;  1LJR A;  1RW1 A;  2M80 A;  4Z7X A;  4H86 A;  1SK2 A;  1V2A A;  4DSS A;  1ZL9 A;  3ZFB A;  4ZL9 A;  2E2G A;  1GTA A;  4GCI A;  3JCM L;  4V2L A;  1YEP A;  3IK9 A;  3EWL A;  4CDO A;  1GSQ A;  1EEJ A;  2XPD A;  1JLW A;  1X0R A;  1ON4 A;  1VF3 A;  2HSY A;  5LD0 A;  2PBJ A;  1O85 A;  3I9V 2;  4HU7 A;  4XTS A;  2YNX A;  2YN1 A;  4EDY A;  4JR4 A;  1PRX A;  3IPZ A;  4PX1 A;  5KEJ A;  2XHF A;  1ERU A;  1JZO A;  5ECI B;  1CQH A;  3MSZ A;  4K7N A;  4GF0 A;  1I5G A;  1YJ6 A;  2CT6 A;  1TRU A;  2C3N A;  1XWB A;  5F05 A;  5ABR A;  4MH3 A;  1XWG A;  4RQR A;  1XBS A;  1K0M A;  1K0N A;  3RBT A;  2CV4 A;  3C71 A;  3UOM A;  2VUP A;  2PPT A;  4NAX A;  4JE1 A;  2LNT A;  5GZZ B;  5D9W A;  3TJK A;  2AUV A;  4X1U A;  4JR6 A;  4PQ1 A;  1XZO A;  3P2A A;  2K8V A;  4KUN A;  2DJ1 A;  1TU7 A;  4E8H A;  2VL9 A;  3SWL A;  3RPN A;  2WUL A;  4XRA A;  1ERW A;  4E8E A;  2M46 A;  2V1M A;  2R3X A;  2MYG A;  1GSF A;  4HUA A;  3WYW A;  2HXK A;  1DSB A;  1GP1 A;  2P31 A;  3NOF A;  2KP1 A;  4DSR A;  1TTZ A;  2C0D A;  3UAR A;  4OCF A;  3FY7 A;  1F37 A;  4WF4 A;  2CZ2 A;  3HYP A;  4EF0 A;  1TK0 B;  4TR1 A;  2ZCT A;  3A2V A;  1PQN A;  7GSS A;  3ZLP A;  2H19 A;  2ALB A;  2A2R A;  5H5S A;  2EC4 A;  4NHW A;  3IXR A;  2H66 A;  3VFI A;  3FR6 A;  1THO A;  1B4Q A;  5IM9 A;  1PKZ A;  3N5O A;  4ZIL A;  3KD0 A;  2TRC P;  2HZF A;  5DBQ A;  2YZU A;  1XW6 A;  1T4Z A;  2O89 A;  4IJ3 A;  1HD2 A;  3IAS 2;  3TRX A;  3EYT A;  1UA5 A;  2B7J A;  2FA8 A;  2H76 A;  2FWG A;  2YV7 A;  5JWO B;  2YJ7 A;  4OWY A;  3WGD A;  3QAV A;  4XCS A;  1SKR B;  5G5E A;  4POB A;  2OE0 A;  1GRX A;  4XRD A;  4L8E A;  3WD6 A;  1PX7 A;  2FCH A;  1VF2 A;  2VCW A;  1SEN A;  3C8E A;  4OO4 A;  1YKA A;  3TOU A;  2HSH A;  1TDI A;  2L59 A;  1RQM A;  6GSX A;  3F4S A;  4K7O A;  4ZL8 A;  3L4N A;  2FGX A;  1MD3 A;  2H71 A;  3HZ4 A;  2OE1 A;  3LSZ A;  2CX3 A;  4G0I A;  1SK1 A;  2VCQ A;  1M9A A;  2H73 A;  4V2N A;  4ZBB A;  5ENU A;  3F8U A;  3CMI A;  2H6Y A;  3FZ5 A;  4WET A;  4KE3 A;  1SL2 B;  4TXO B;  2WJU A;  3DD3 A;  1JHB A;  2OA7 A;  3GTU B;  3ZRE A;  4KW6 A;  2X99 A;  1A8Y A;  2YZH A;  3QPM A;  2R5G A;  3HJP A;  5F07 A;  4NV2 A;  2VCV A;  2CVK A;  5G31 A;  3IE3 A;  2GT5 A;  1TOF A;  3HY2 A;  3HCZ A;  2HI7 A;  1T4Y A;  1JZW A;  2I9H A;  4DSQ A;  5H5Q A;  3TJG A;  2VCZ A;  2O85 A;  5HFI A;  1ZCP A;  2H1B A;  4OMV A;  1BAY A;  4MJC A;  4POL A;  5JCG A;  2YCD A;  2KUC A;  2CQ9 A;  4GQC A;  4BVY A;  1M2B A;  1EZK A;  2IIY A;  1A2J A;  3J7Y b;  3KTL A;  4EKZ A;  1OVN A;  1THX A;  3KIJ A;  3TKS C;  3PIN A;  3CBU A;  2EIQ A;  4ZIJ A;  1N2A A;  3G7J A;  3M9J A;  4BVX A;  4ZB9 A;  3TCO A;  4ML6 A;  4OO5 A;  5B7C A;  2MBT A;  2FLS A;  3ZRD A;  2H6Z A;  2IME A;  3GIX A;  3F9U A;  4BL7 B;  2GQM A;  3KTB A;  3L78 A;  1A23 A;  5F8B A;  1Z6M A;  4FO5 A;  1GSU A;  1DUG A;  6GSV A;  1NSW A;  2F9S A;  2GT6 A;  3FRC A;  4EE0 A;  1EEM A;  2JSY A;  2WZ9 A;  2E0Q A;  1XW9 A;  2GQK A;  1JFU A;  4GWR A;  1EOG A;  2GQL A;  2PN8 A;  2A2S A;  1TJD A;  3K8N A;  4HDE A;  1GNE A;  1B4P A;  4ZBD A;  2HE3 A;  1YDK A;  2C8U A;  5DVB A;  1WOU A;  1QK8 A;  2LST A;  1TU8 A;  1G7E A;  4YQM A;  1TRV A;  4EL1 A;  3SBC A;  1ILO A;  4HEA 2;  2X8G A;  2VCX A;  2DMM A;  3O3T A;  3NIV A;  3W8J A;  4OFT A;  5B6N A;  3PGT A;  1FW1 A;  5IMA A;  4ZBA A;  1SD9 A;  1VGL A;  2B1K A;  4MH2 A;  2KLX A;  3TJB A;  2H01 A;  2BMX A;  2HRA A;  2F8F A;  4L5O A;  2FWH A;  4BWS A;  2DIZ A;  5CYY A;  2H1D A;  4PQH A;  2VL2 A;  4FH8 A;  3RHC A;  1S3D A;  5E4W A;  5HR1 A;  1AQV A;  3GL3 A;  4OFN A;  3TKR A;  3H1N A;  4IP6 A;  1UVZ A;  3UBL A;  5J4U A;  1TP9 A;  2A4V A;  2VIM A;  1FVJ A;  1M99 A;  1XOA A;  2H0I A;  4CHS A;  5IMF A;  2VO4 A;  3Q74 A;  4LMW A;  3W6G A;  4G10 A;  1KEB A;  3UVH A;  5DAL A;  1LBK A;  3GKM A;  3VWX A;  3TUE A;  1AXD A;  2C4J A;  2PMT A;  2QSI A;  1IYH A;  3CSJ A;  3F6D A;  1KNG A;  1K0O A;  1Q4J A;  5IMC A;  3GFK A;  1QFN A;  2VM1 A;  1G6Y A;  5ECO B;  4POM A;  5AGY A;  2YJH A;  1XVQ A;  5AIX A;  2H75 A;  4RUV A;  5CRD A;  5ID2 A;  4F0B A;  5ELA A;  5ECP B;  2H0G A;  2WRT A;  1A2L A;  4LLR A;  2VLV A;  1Z5Y E;  3KGK A;  1BX9 A;  1YY7 A;  2X8C A;  3ZIJ A;  1B48 A;  1MEK A;  1H4O A;  2B5Y A;  1K0D A;  1FO5 A;  3EIN A;  5ELG A;  4XS1 A;  2YP6 A;  3QR6 A;  4NMU A;  22GS A;  2MMZ A;  4TRX A;  1C72 A;  2IMF A;  3QCP A;  1GUM A;  4MF5 A;  3IOS A;  1NW2 A;  3VWU A;  1PMT A;  5HFG A;  2P0G A;  2PER A;  4IVF A;  4POK A;  4JED A;  1GSD A;  4LL4 B;  2HNL A;  1Z9H A;  3ZIT A;  4I6X A;  1PGT A;  3GKN A;  4KCE A;  6GSW A;  3A3T A;  3RDW A;  1GSE A;  4GST A;  2H30 A;  2B5E A;  4CW9 A;  2IPA A;  3CTF A;  1K3L A;  2HT9 A;  4KAE A;  2IJY A;  4PGT A;  3HJO A;  4G9H A;  4DEJ A;  2EIR A;  1BJX A;  2OE3 A;  3Q6O A;  5J3R A;  4TKY A;  3PR8 A;  2L6C A;  2C0G A;  2H8L A;  2AAW A;  2V6O A;  5E59 A;  2DJJ A;  1OE8 A;  1B8X A;  1R5A A;  5HQP A;  2YWO A;  2V6K A;  3EU4 A;  3UBK A;  3CXG A;  2HYX A;  2EIO A;  3KEB A;  2JU5 A;  5DCH A;  1V57 A;  4WEY A;  2B7K A;  6GST A;  3LJR A;  5LNK e;  4O7H A;  2LV3 A;  4MF7 A;  2MMN A;  4AF2 A;  3WGX A;  1YQ1 A;  1PL1 A;  4PUF C;  2MBS A;  4K2D A;  1BYE A;  3CSI A;  3VWW A;  5B8B A;  4EC0 A;  1GLQ A;  3F4R A;  4LA1 A;  4MZC A;  4NXI A;  1LU4 A;  4MPG A;  3DWV A;  5CNW A;  5ECL B;  3VI7 A;  4LMV A;  5JWQ B;  4ECJ A;  2JZT A;  1X9W B;  3R2Q A;  2LRN A;  3BOA A;  1FB0 A;  4K6X A;  4D73 B;  3DRN A;  4TR4 A;  4ZL7 A;  1GLP A;  3LEF A;  3KMO A;  3GL5 A;  1Y6E A;  4QL9 A;  1QQ2 A;  4KND A;  5AIV A;  3E9J B;  3UMA A;  3W8S A;  2C0F A;  2GZZ A;  4ECB A;  1ZMA A;  5EVO A;  3FK8 A;  1XWA A;  1HNA A;  1NHO A;  3ZL5 A;  3ZTL A;  1XOB A;  5GSS A;  1TI1 A;  3CRU A;  3C1S A;  4D73 A;  1V40 A;  3V1W A;  1GSY A;  1U3I A;  1SJ6 A;  2GLR A;  2JAD A;  1OE7 A;  4JBB A;  3E3E A;  2P5R A;  4KX4 A;  3BCK A;  3M9K A;  3CRT A;  4G0L A;  1EP7 A;  1Z3E A;  5ECR B;  5D96 A;  4FYB A;  1V98 A;  3U5R E;  3QFB C;  2E2M A;  2L4Q A;  4V1A g;  4F2I A;  2XBI A;  4FYU A;  3H79 A;  2H1A A;  2XPE A;  3RHB A;  4MK3 A;  3HD5 A;  3UIW A;  2WS2 A;  3FW2 A;  18GS A;  3WT2 A;  2N5A A;  3TKS A;  3L0H A;  1YZX A;  1MD4 A;  3CYN A;  1GUK A;  2MMO A;  1M2D A;  3D4M A;  3P7X A;  2IMI A;  3DVX A;  3AY8 A;  3DVW A;  5IIZ A;  3LQ7 A;  2VM2 A;  2WGR A;  4GXZ A;  4WR4 A;  3C73 A;  4DVC A;  1YF0 A;  1J9B A;  2GST A;  4HZ4 A;  1IYI A;  4XS6 A;  5COH A;  2B5X A;  2LJR A;  1VF4 A;  1WPI A;  3ISO A;  1OC9 B;  1T8E B;  3F6F A;  4XIH A;  1HYU A;  1S3C A;  3H4K A;  2FWE A;  4HI7 A;  1EGO A;  3GYK A;  3APQ A;  1E6B A;  8GSS A;  1BG5 A;  2GTU A;  3UAP A;  5FT3 A;  1JLV A;  3WT1 A;  1I9D A;  4YH2 A;  1YF1 A;  4F82 A;  3FYG A;  1Z7R A;  5J41 A;  2O8V B;  3ZML A;  4NPB A;  3TJF A;  1W89 A;  2VLT A;  5G30 A;  4OD7 A;  2BTO T;  1AC1 A;  4IGJ A;  5ECK B;  1W4V A;  2G0F A;  5J9B A;  1EOH A;  1AUC A;  3H93 A;  1SL0 B;  5KN1 A;  1XIY A;  1DE2 A;  5B6M A;  3I6A A;  4TXO A;  4MCU A;  4IQ1 A;  2FWF A;  2N5F A;  1X5C A;  3GTU A;  5HR2 A;  2J23 A;  3MDK A;  3HVX A;  5DCG A;  4AGS A;  3VPQ A;  1AQW A;  3P90 A;  1K3O A;  1WWJ A;  4HJ2 A;  1B9X C;  1J0F A;  4GRF A;  1EP8 A;  4PUR A;  4TR3 A;  5IPG A;  4EO3 A;  5FHI A;  4HU9 A;  3GX8 A;  4O92 A;  2R2J A;  4BA7 A;  3M0F A;  1WIK A;  2HRN A;  13GS A;  2FHE A;  1ST9 A;  3HJM A;  5L71 A;  1TK5 B;  3UJ1 A;  4PNG A;  2LQQ A;  2VAF A;  1GNW A;  5CRG A;  4YAP A;  4K7I A;  3PH9 A;  4L0U A;  4ML1 A;  3APO A;  1OC8 A;  4WF5 A;  1U87 A;  3EUR A;  3MNG A;  5IOX A;  4YQV A;  16GS A;  3QAW A;  3GHA A;  4BWQ A;  2L4C A;  4LL1 B;  3KP9 A;  2AJQ B;  4RQX A;  3D22 A;  3E0U A;  5A4V A;  3GX0 A;  5D9X A;  4BL7 A;  5D73 A;  1O81 A;  3A2X A;  3Q19 A;  1PA3 A;  3ZVJ D;  3TKS E;  5A5K A;  2AHE A;  2RUF A;  4QQ7 A;  1WP0 A;  4FYC A;  3F3Q A;  2UZ8 A;  1GUH A;  4P3Y B;  1T1V A;  4IW9 A;  1XFL A;  2RLI A;  5CRH A;  2DBC A;  2F8A A;  2L57 A;  3N9J A;  2V2G A;  5H5R A;  2XC2 A;  3D0Z A;  1VRS D;  4MLY A;  2HRK B;  2NTO A;  3D6I A;  2J9H A;  4F0C A;  5F06 A;  1EV9 A;  3F63 A;  3IV4 A;  3G7Y A;  4MZB A;  1ABA A;  1GSS A;  4IKH A;  4WXT A;  2DLX A;  1Q98 A;  2H6X A;  4AJ6 A;  3ERF A;  1BED A;  2ES7 A;  3VK9 A;  5DJL A;  1GH2 A;  4KSO A;  1GTI A;  3FZ4 A;  1T7P B;  3VUR A;  2DJ3 A;  1WRY A;  5EY6 A;  4KCA A;  1X5D A;  1G7O A;  2HRK A;  5F0G A;  4X0X A;  2K6V A;  3TRQ A;  4YQU A;  4YAV A;  2GS3 A;  2FD3 A;  3HDC A;  1ML6 A;  5IMD A;  2WDU A;  5J5N A;  3RAZ A;  5C00 A;  3A2W A;  3CSH A;  5ECQ B;  1A0F A;  5DAK B;  2C3T A;  1F3B A;  2F3M A;  4TOP A;  5ECN B;  1AAZ A;  5HFK A;  1XW5 A;  4USS A;  1GL8 A;  1G0T A;  1URM A;  2GZY A;  5C04 A;  5CO3 A;  4ULX A;  2TRX A;  3CTG A;  4WR5 A;  3BBY A;  1SL1 B;  3HZ8 A;  1ZYQ B;  3M8N A;  2IL3 A;  1A2M A;  1AIU A;  2C80 A;  1TKD B;  4IHU A;  3F4T A;  1MDJ A;  1FOV A;  5A4U A;  2NDO A;  3DIE A;  1HNC A;  3M3M A;  4KSM A;  4RI7 A;  5AIS A;  3MWH A;  1O73 A;  3A5W A;  2LRT A;  5GAN D;  1R26 A;  2GSS A;  2OJL A;  3GSS A;  3IAM 2;  1MDK A;  4V1A p;  3TB2 A;  4KDX A;  3IC4 A;  5DJM A;  1TK8 B;  2X64 A;  3KXO A;  2LQO A;  14GS A;  3LFL A;  4TVE A;  2OAD A;  3HA9 A;  3BD2 A;  3TDG A;  3L9V A;  4MMM A;  3TKQ A;  3ZIV A;  3QAG A;  2CX4 A;  2GZP A;  1PSQ A;  2GSQ A;  4XS4 B;  3HVS A;  2KOK A;  5CRW A;  3S9F A;  1NHY A;  3GUS A;  3IHQ A;  1OKD A;  4DSS B;  1ZGN A;  2NVL A;  2G2Q A;  1AW9 A;  4ECC A;  1U6T A;  5G1K A;  2I4A A;  3UEM A;  1UN2 A;  2IWT A;  1K0A A;  2R4V A;  3Q18 A;  1ACV A;  4MZW A;  5ECH B;  1PL2 A;  3MAK A;  5DDL A;  2H70 A;  3KJY A;  4ZB8 A;  2VL2 C;  3L9S A;  4J57 E;  4OCE A;  1SD8 A;  4JRR A;  1XWK A;  4TN8 A;  3G7I A;  1R7H A;  4NWY A;  2L5L A;  3FR3 A;  4WBR D;  3F0I A;  1FVK A;  3UVT A;  2VD1 A;  5KN2 A;  2IMK A;  2HQT A;  3ED3 A;  4ECI A;  2DSA A;  2V32 A;  2VOC A;  2HRF A;  4N0V A;  1EV4 A;  4K8M A;  1EGR A;  4WKW A;  5G1L A;  4N30 A;  2HZE B;  4KB3 A;  2MMA A;  5ECS A;  1F6M C;  1FG4 A;  2FA4 A;  3DXB A;  4N11 A;  1F3A A;  5IO0 A;  2HLS A;  1XCC A;  2O87 A;  4ID0 A;  1FB6 A;  4MJE A;  1KTE A;  4FQU A;  1H75 A;  1SJI A;  2JSZ A;  1X5E A;  3EC3 A;  4V2M A;  1SJZ A;  2LEG A;  3FEU A;  2LRC A;  4GSN A;  4AJ8 A;  2GDR A;  2HZE A;  3ME8 A;  4O32 A;  1PD2 1;  2YAN A;  2FNO A;  1MDI A;  3F3R A;  1Z7P A;  3EMP A;  3ZYW A;  3FZA A;  5D8I A;  1ERT A;  2HFD A;  2DJK A;  3LYK A;  3TRP A;  2M72 A;  1AQX A; 
#chains in the Genus database with same CATH topology
 2E7P A;  2DJ0 A;  2IMD A;  3LG6 A;  4ZB6 A;  5DQS A;  1X9M B;  1O8X A;  4TR1 B;  2WCI A;  2WVY A;  2R37 A;  3GN3 A;  2REM A;  5A34 A;  2RII A;  4FIW A;  4ILF A;  5KN3 A;  3ERG A;  1J08 A;  4EXJ A;  3GV1 A;  1TXX A;  1EWX A;  2P5Q A;  4IEL A;  4GQF A;  2C0E A;  5JCU A;  4MAB A;  2CAI A;  3GH6 A;  4MP4 A;  4J2F A;  2WZS A;  1S3R A;  4IBP A;  5IPH A;  1XG8 A;  4MJB A;  4Q5N A;  4O5Q A;  3GA4 A;  2C3Q A;  5IO2 A;  4Q5Q A;  3UL3 A;  2JZR A;  4AI6 A;  1QXH A;  1OKT A;  5B8A A;  4GSS A;  4TXV A;  4NV5 A;  4KF9 A;  3C7M A;  3KZQ A;  4EVM A;  4Q5R A;  5DQY A;  3EMX A;  2HSN B;  2CAQ A;  4PTS A;  6GSY A;  3DGQ A;  1XVW A;  2CVD A;  2EFE A;  2PVQ A;  5CAX A;  4K0G A;  3VLN A;  2RM5 A;  1WMJ A;  4G2E A;  2L5O A;  4HQS A;  2AYT A;  1QGV A;  3EU3 A;  3HVV A;  1T3B A;  2VL3 A;  4ACS A;  4MF6 A;  3KH9 A;  3QD9 A;  1Y25 A;  2ON7 A;  1R5P A;  3VWV A;  5FWG A;  2K8S A;  4G19 A;  2HSN A;  2X8H A;  4I5Q A;  5CRE A;  1M7T A;  2LS5 A;  4F03 A;  2VCT A;  4N10 A;  2QC7 A;  20GS A;  4IQA A;  1M2A A;  1XPV A;  2RM6 A;  5HR0 A;  2LJA A;  2WFC A;  3D4T A;  4TW5 A;  1PKW A;  1GUL A;  1A0R P;  4PXO A;  1SK0 A;  2LUS A;  1JZD A;  3ERW A;  3VI5 A;  4PUA A;  1TXU A;  2EFD A;  1F9M A;  2Z9S A;  5IOW A;  1A24 A;  3M1G A;  3IA1 A;  2WW0 A;  3ZMK A;  1F2E A;  3EE2 A;  5D9V A;  4F9Z A;  1M0U A;  4EDZ A;  2K18 A;  2WB9 A;  2QKE A;  1OC9 A;  2I81 A;  1N8J A;  5EL8 A;  3LGC A;  1DE1 A;  3KP8 A;  4N3Z A;  1QMV A;  3P8W A;  5EPF A;  5BMU A;  4QL7 A;  3GRX A;  3PPU A;  1DBY A;  4BVY B;  3QMX A;  4KDY A;  4RI6 A;  1TRS A;  2FUG 2;  2KP2 A;  1K3Y A;  3LXZ A;  2LJK A;  3H8Q A;  9GSS A;  2K9F A;  4O5R A;  5LCZ A;  5ECM B;  4ISD A;  4BVX B;  1SYR A;  6GSS A;  2GGT A;  4MPF A;  3IBH A;  1GTU A;  3C1R A;  4MJA A;  3NZN A;  2O7K A;  1ZZY A;  1ZOF A;  4I2T A;  4K0N A;  5KN0 A;  4MA9 A;  3J7Y k;  4JZQ A;  4HJM A;  1T00 A;  1SU9 A;  1R4W A;  2VD0 A;  3TGZ A;  2DJ2 A;  3IDV A;  3KM6 A;  2N5B A;  1X9S B;  3APS A;  2PVO C;  1TRW A;  1O8W A;  2X49 A;  2TIR A;  2ZNM A;  1GTB A;  5JCW A;  1GWC A;  3D21 A;  3GUR A;  4I2U A;  2IN3 A;  4I97 A;  4GLT A;  3HHV A;  2JZS A;  2DML A;  3LOR A;  1O7U A;  2WVX B;  1FHE A;  4G01 A;  1S3A A;  1OC3 A;  4WBJ A;  3FR9 A;  1BQ7 A;  3LWA A;  2B6M A;  1WJK A;  17GS A;  1SKW B;  1NM3 A;  2BJX A;  2F51 A;  1K0C A;  1OAZ A;  2H0H A;  5D9T A;  2MZC A;  4W66 A;  1YEX A;  3HKR A;  2OBK A;  3QOU A;  4AJ7 A;  2YV9 A;  4HQZ A;  3US3 A;  1HNB A;  3RPP A;  11GS A;  5G5F A;  1YVL A;  1V9W A;  3KH7 A;  2VKZ G;  4J56 E;  10GS A;  3ME7 A;  3GH9 A;  2RUE A;  3EVI A;  3GKX A;  2WW1 A;  1ERV A;  3OR5 A;  2WVX A;  3QDN A;  2PU9 C;  2ON5 A;  1RK4 A;  1G6W A;  1O6J A;  4L5L A;  3WGE A;  2HSM B;  1K0B A;  1SKS B;  1M9B A;  3D5J A;  4PQI A;  5IMV A;  4K9Z A;  2H72 A;  5GST A;  2GSR A;  4AKG A;  5INY A;  4GTU A;  1YKC A;  5G2Z A;  1TW9 A;  2WVZ A;  1ZYE A;  3ZFL A;  1B9Y C;  3LXT A;  1S4B P;  3TOT A;  1OYJ A;  2V41 A;  2B3S A;  4HS1 A;  4XHM A;  3ZVJ A;  3ZZX A;  2NPB A;  2NBS A;  3A5I A;  4N0Z A;  4IS0 A;  2HSM A;  2ZUP A;  2CA8 A;  5IQY A;  4NHZ A;  1A8L A;  3O76 A;  4AKI A;  2C1Y A;  2OKA A;  3U6V A;  1U88 A;  5CP1 A;  2LTK A;  2YWM A;  4HOJ A;  2KHP A;  1FAA A;  2QGV A;  3GNJ A;  4IP1 A;  5DAL B;  1UC7 A;  5JWR B;  3I69 A;  2PWJ A;  2R6K A;  2JAC A;  3O6T A;  4IJI A;  4L0W A;  6GSU A;  2YWI A;  4KGI A;  2I1U A;  4I8B A;  3QFA C;  4Q5F A;  1U3A A;  2GVP A;  3L9U A;  5KOX A;  4ZXG A;  4G0K A;  3TKP A;  5ID2 B;  1KBN A;  2H74 A;  5DAK A;  2CZ3 A;  2VLU A;  2DIY A;  4MDC A;  3CHX C;  2AB6 A;  2YOI A;  1CQG A;  1USB A;  2XBQ A;  5D93 A;  3TJJ A;  4IN0 A;  4PNF A;  5J9C A;  2CVB A;  5A4W A;  2D2Z A;  3LYP A;  2YPM A;  4KH7 A;  3KMN A;  2DC5 A;  3FHK A;  1JZR A;  2R0C A;  2IFQ B;  2I3Y A;  1PX6 A;  4KA0 A;  5HR3 A;  1MTC A;  1HQO A;  2WW3 A;  1WE0 A;  3DKS A;  4EUY A;  3VPT A;  3KCM A;  3IR4 A;  2LNS A;  1TI3 A;  1QUW A;  1V58 A;  2PUK C;  2B1L A;  3I43 A;  3DYR A;  4ICY A;  1SYX A;  3BCI A;  5GAP D;  5AN1 A;  2FY6 A;  3G9B A;  4K1F A;  4TR0 A;  3IC8 A;  2PGT A;  2IFQ A;  3FZ9 A;  4HZ2 A;  3DEX A;  2JL4 A;  3GST A;  2H1G A;  2LKU A;  2AV4 A;  2OBI A;  3R3E A;  4PI2 C;  3DML A;  1XWC A;  12GS A;  3CWG A;  1XXU A;  4CY8 A;  2YWN A;  1SVM A;  4KDU A;  1E2Y A;  3IK7 A;  4K2X A;  3GKK A;  3IRA A;  1PN9 A;  1Y1U A;  4OFM A;  4BPY A;  1Z6N A;  2OAC A;  3GMF A;  4X43 A;  4XS4 A;  2L6D A;  3HXS A;  4JU5 A;  19GS A;  3FKF A;  5IMZ A;  3BJ5 A;  1VF1 A;  1LJR A;  1RW1 A;  2M80 A;  4Z7X A;  4H86 A;  1SK2 A;  1V2A A;  4DSS A;  1ZL9 A;  3ZFB A;  4ZL9 A;  2E2G A;  1GTA A;  4GCI A;  3JCM L;  4V2L A;  1YEP A;  3IK9 A;  3EWL A;  4CDO A;  1GSQ A;  1EEJ A;  2XPD A;  1JLW A;  4YKF A;  1X0R A;  1ON4 A;  1VF3 A;  2HSY A;  5LD0 A;  2PBJ A;  1SVO A;  1O85 A;  3I9V 2;  4HU7 A;  4XTS A;  2YNX A;  2YN1 A;  4EDY A;  4JR4 A;  1PRX A;  3IPZ A;  4PX1 A;  5KEJ A;  2XHF A;  1ERU A;  1JZO A;  5ECI B;  1CQH A;  3MSZ A;  4K7N A;  4GF0 A;  1I5G A;  1YJ6 A;  2CT6 A;  1TRU A;  2C3N A;  1XWB A;  5F05 A;  5ABR A;  4MH3 A;  1XWG A;  4RQR A;  1XBS A;  1K0M A;  1K0N A;  3RBT A;  2CV4 A;  3C71 A;  3UOM A;  2VUP A;  2PPT A;  4NAX A;  4JE1 A;  2LNT A;  5GZZ B;  5D9W A;  3TJK A;  2AUV A;  4X1U A;  4JR6 A;  4PQ1 A;  1XZO A;  3P2A A;  2K8V A;  4KUN A;  2DJ1 A;  1TU7 A;  4E8H A;  2VL9 A;  3SWL A;  3RPN A;  1SVL A;  2WUL A;  4XRA A;  1ERW A;  4E8E A;  2M46 A;  2V1M A;  2R3X A;  2MYG A;  1GSF A;  4HUA A;  3WYW A;  2HXK A;  1DSB A;  1GP1 A;  2P31 A;  3NOF A;  2KP1 A;  4DSR A;  1TTZ A;  2C0D A;  3UAR A;  2QA2 A;  4OCF A;  3FY7 A;  1F37 A;  4WF4 A;  2CZ2 A;  3HYP A;  4EF0 A;  1TK0 B;  4TR1 A;  2ZCT A;  3A2V A;  1PQN A;  7GSS A;  3ZLP A;  2H19 A;  2ALB A;  2A2R A;  5H5S A;  2EC4 A;  4NHW A;  3IXR A;  2H66 A;  3VFI A;  3FR6 A;  1THO A;  1B4Q A;  5IM9 A;  1PKZ A;  3N5O A;  4ZIL A;  3KD0 A;  2TRC P;  2HZF A;  5DBQ A;  2YZU A;  1YEW C;  4QMK A;  1XW6 A;  1T4Z A;  2O89 A;  4IJ3 A;  1HD2 A;  3IAS 2;  3TRX A;  4Z2R A;  3EYT A;  1UA5 A;  2B7J A;  2FA8 A;  2H76 A;  3RGB C;  2FWG A;  2YV7 A;  5JWO B;  2YJ7 A;  4OWY A;  3WGD A;  4ZB7 A;  3QAV A;  4XCS A;  1SKR B;  5G5E A;  4POB A;  2OE0 A;  1GRX A;  4XRD A;  4L8E A;  3WD6 A;  1PX7 A;  2FCH A;  1VF2 A;  2VCW A;  1SEN A;  3C8E A;  4OO4 A;  1YKA A;  3TOU A;  2HSH A;  1TDI A;  2L59 A;  1RQM A;  6GSX A;  3F4S A;  4K7O A;  4PI0 C;  4ZL8 A;  3L4N A;  2FGX A;  1MD3 A;  2H71 A;  3HZ4 A;  3LW9 A;  2OE1 A;  3LSZ A;  2CX3 A;  4G0I A;  1SK1 A;  2VCQ A;  2DKI A;  1M9A A;  2H73 A;  4V2N A;  4ZBB A;  5J4Y A;  5ENU A;  3F8U A;  3CMI A;  2H6Y A;  3FZ5 A;  4WET A;  4KE3 A;  1SL2 B;  4TXO B;  2WJU A;  3DD3 A;  4EIP A;  1JHB A;  2OA7 A;  3GTU B;  3ZRE A;  4KW6 A;  2X99 A;  1FOH A;  1A8Y A;  2YZH A;  1I1I P;  2R5G A;  3QPM A;  3HJP A;  5F07 A;  4NV2 A;  2VCV A;  2CVK A;  5G31 A;  3IE3 A;  2GT5 A;  1TOF A;  3HY2 A;  3HCZ A;  2HI7 A;  1T4Y A;  1JZW A;  2OT3 A;  2I9H A;  4DSQ A;  5H5Q A;  3HVN A;  3TJG A;  4CY6 A;  2VCZ A;  2O85 A;  5HFI A;  1ZCP A;  2H1B A;  4OMV A;  1BAY A;  4MJC A;  4POL A;  5JCG A;  4AKH A;  2YCD A;  2KUC A;  2CQ9 A;  4GQC A;  4BVY A;  1M2B A;  5J40 A;  1EZK A;  2IIY A;  1A2J A;  3J7Y b;  3KTL A;  4EKZ A;  1OVN A;  1THX A;  3KIJ A;  3TKS C;  3PIN A;  3CBU A;  2EIQ A;  4ZIJ A;  3MIX A;  5BRT A;  1N2A A;  3G7J A;  3M9J A;  4BVX A;  4ZB9 A;  3TCO A;  4ML6 A;  4OO5 A;  5B7C A;  2MBT A;  2FLS A;  3ZRD A;  2H6Z A;  2IME A;  3GIX A;  3F9U A;  4BL7 B;  2GQM A;  3KTB A;  3L78 A;  1A23 A;  5F8B A;  1Z6M A;  4FO5 A;  1GSU A;  1DUG A;  6GSV A;  1NSW A;  2F9S A;  2GT6 A;  3FRC A;  4EE0 A;  1EEM A;  2JSY A;  2WZ9 A;  2E0Q A;  1XW9 A;  2GQK A;  1JFU A;  4GWR A;  1EOG A;  2GQL A;  2PN8 A;  2A2S A;  1TJD A;  3K8N A;  4HDE A;  1GNE A;  1B4P A;  4ZBD A;  2HE3 A;  1YDK A;  2C8U A;  5DVB A;  1WOU A;  1QK8 A;  2LST A;  5A5H B;  1TU8 A;  1G7E A;  4YQM A;  3CQF A;  1TRV A;  4EL1 A;  3SBC A;  1ILO A;  4HEA 2;  2X8G A;  2VCX A;  2DMM A;  3O3T A;  3NIV A;  3W8J A;  4OFT A;  5B6N A;  3PGT A;  1FW1 A;  5IMA A;  2O3E A;  4ZBA A;  4Z2U A;  1SD9 A;  4K5R A;  1VGL A;  2B1K A;  4MH2 A;  5A5H A;  2KLX A;  3TJB A;  2H01 A;  2BMX A;  2HRA A;  2F8F A;  4L5O A;  2FWH A;  4BWS A;  2DIZ A;  5CYY A;  2H1D A;  4PQH A;  2VL2 A;  4FH8 A;  3RHC A;  4GDF A;  4EIQ A;  1S3D A;  5E4W A;  5HR1 A;  1BF5 A;  1AQV A;  3GL3 A;  4OFN A;  3TKR A;  3H1N A;  4IP6 A;  1UVZ A;  3UBL A;  5J4U A;  1TP9 A;  2A4V A;  2VIM A;  1FVJ A;  1M99 A;  1XOA A;  2H0I A;  4CHS A;  5IMF A;  2VO4 A;  3Q74 A;  4LMW A;  3W6G A;  4G10 A;  2O36 A;  1KEB A;  3UVH A;  5DAL A;  1LBK A;  3GKM A;  3VWX A;  3TUE A;  1AXD A;  2A4H A;  2C4J A;  2PMT A;  2QSI A;  1IYH A;  3CSJ A;  3F6D A;  1KNG A;  1K0O A;  1Q4J A;  5IMC A;  3GFK A;  1QFN A;  2VM1 A;  1G6Y A;  5ECO B;  4POM A;  5AGY A;  2YJH A;  1XVQ A;  5AIX A;  2H75 A;  4RUV A;  5CRD A;  5ID2 A;  4F0B A;  5ELA A;  4YKG A;  5ECP B;  2H0G A;  2WRT A;  1A2L A;  4LLR A;  2VLV A;  1Z5Y E;  3KGK A;  1BX9 A;  1YY7 A;  2H1L A;  2X8C A;  3ZIJ A;  1B48 A;  1MEK A;  1H4O A;  1N25 A;  2B5Y A;  1K0D A;  1FO5 A;  3EIN A;  5ELG A;  1PN0 A;  4XS1 A;  2YP6 A;  3QR6 A;  4NMU A;  22GS A;  2MMZ A;  4TRX A;  1C72 A;  2IMF A;  3QCP A;  1GUM A;  4MF5 A;  3IOS A;  1NW2 A;  1BG1 A;  3VWU A;  1PMT A;  5HFG A;  2P0G A;  2PER A;  4IVF A;  4POK A;  4JED A;  1GSD A;  4LL4 B;  2HNL A;  1Z9H A;  3ZIT A;  4I6X A;  1PGT A;  3GKN A;  4KCE A;  6GSW A;  3A3T A;  3RDW A;  1GSE A;  4GST A;  2H30 A;  2B5E A;  4CW9 A;  2IPA A;  3CTF A;  1K3L A;  2HT9 A;  4KAE A;  2IJY A;  4PGT A;  1ZYP A;  3HJO A;  4G9H A;  4DEJ A;  2EIR A;  1BJX A;  2OE3 A;  3Q6O A;  5J3R A;  4TKY A;  3PR8 A;  2L6C A;  2C0G A;  2H8L A;  4X4J A;  2AAW A;  2V6O A;  5E59 A;  2DJJ A;  1OE8 A;  1B8X A;  1R5A A;  4PHZ C;  5HQP A;  2YWO A;  2V6K A;  3EU4 A;  3UBK A;  3CXG A;  2HYX A;  3RFR C;  2EIO A;  3KEB A;  2JU5 A;  5DCH A;  1V57 A;  4WEY A;  2B7K A;  6GST A;  3LJR A;  5LNK e;  4O7H A;  2LV3 A;  4MF7 A;  2MMN A;  4AF2 A;  3WGX A;  1YQ1 A;  1PL1 A;  4PUF C;  2MBS A;  4K2D A;  1BYE A;  3CSI A;  3VWW A;  5B8B A;  4EC0 A;  1GLQ A;  3F4R A;  4LA1 A;  4MZC A;  4NXI A;  1LU4 A;  4MPG A;  3DWV A;  5CNW A;  5ECL B;  3VI7 A;  4LMV A;  5JWQ B;  4ECJ A;  2R0G A;  2JZT A;  1X9W B;  3R2Q A;  2LRN A;  3BOA A;  1FB0 A;  4K6X A;  5A34 B;  4D73 B;  3DRN A;  4TR4 A;  4ZL7 A;  1GLP A;  3LEF A;  3KMO A;  3GL5 A;  1Y6E A;  4QL9 A;  1QQ2 A;  4KND A;  5AIV A;  3E9J B;  3UMA A;  3MYD A;  3W8S A;  2C0F A;  2GZZ A;  4ECB A;  1ZMA A;  5EVO A;  3FK8 A;  1XWA A;  1HNA A;  4MNN A;  1NHO A;  3ZL5 A;  3ZTL A;  1XOB A;  5GSS A;  1TI1 A;  3CRU A;  3C1S A;  4D73 A;  1V40 A;  3V1W A;  1GSY A;  1U3I A;  1SJ6 A;  2GLR A;  2JAD A;  1OE7 A;  4JBB A;  3E3E A;  2P5R A;  4KX4 A;  3BCK A;  3M9K A;  3CRT A;  4G0L A;  1EP7 A;  3HMJ G;  1Z3E A;  5ECR B;  5D96 A;  4FYB A;  1V98 A;  4O5U A;  3U5R E;  3QFB C;  2E2M A;  2L4Q A;  4V1A g;  4F2I A;  2XBI A;  4BIK A;  4FYU A;  3H79 A;  2H1A A;  2XPE A;  3RHB A;  4MK3 A;  3HD5 A;  3UIW A;  2WS2 A;  3FW2 A;  18GS A;  3WT2 A;  2N5A A;  3TKS A;  3L0H A;  1YZX A;  1MD4 A;  3CYN A;  1GUK A;  2MMO A;  1M2D A;  3D4M A;  3P7X A;  2IMI A;  3DVX A;  3AY8 A;  3DVW A;  5IIZ A;  3LQ7 A;  2VM2 A;  2WGR A;  4GXZ A;  4WR4 A;  3C73 A;  4DVC A;  1YF0 A;  1J9B A;  2GST A;  4HZ4 A;  1IYI A;  3IHG A;  4XS6 A;  5COH A;  2B5X A;  2LJR A;  4AKX B;  1VF4 A;  2DKH A;  1WPI A;  3ISO A;  1OC9 B;  1T8E B;  2EFH A;  4HSC X;  3F6F A;  4XIH A;  1HYU A;  1S3C A;  3H4K A;  2FWE A;  4E68 A;  4HI7 A;  1EGO A;  3GYK A;  4FXY P;  3APQ A;  5BMU B;  1E6B A;  8GSS A;  1BG5 A;  2GTU A;  3UAP A;  2WW2 A;  5FT3 A;  1JLV A;  3WT1 A;  1I9D A;  4YH2 A;  1YF1 A;  4F82 A;  3TU3 B;  3FYG A;  1Z7R A;  5J41 A;  2O8V B;  3ZML A;  4NPB A;  3TJF A;  1W89 A;  2VLT A;  5G30 A;  4OD7 A;  2BTO T;  1AC1 A;  4IGJ A;  5ECK B;  1W4V A;  2G0F A;  5J9B A;  1EOH A;  1AUC A;  3H93 A;  1SL0 B;  5KN1 A;  1XIY A;  1DE2 A;  5B6M A;  3I6A A;  4TXO A;  4MCU A;  4IQ1 A;  2FWF A;  2N5F A;  1X5C A;  3GTU A;  5HR2 A;  2J23 A;  3MDK A;  3HVX A;  5DCG A;  4AGS A;  3VPQ A;  1AQW A;  3P90 A;  1K3O A;  1WWJ A;  4HJ2 A;  1B9X C;  1PFO A;  1J0F A;  1M3J A;  4GRF A;  1EP8 A;  4PUR A;  4TR3 A;  5IPG A;  4EO3 A;  5FHI A;  4HU9 A;  3GX8 A;  4O92 A;  2R2J A;  4BA7 A;  3M0F A;  1WIK A;  2HRN A;  13GS A;  2FHE A;  1ST9 A;  3HJM A;  4Z2T A;  5L71 A;  2UV8 G;  1TK5 B;  2X4A A;  3UJ1 A;  4PNG A;  2LQQ A;  2VAF A;  1GNW A;  5CRG A;  4YAP A;  4K7I A;  3PH9 A;  4L0U A;  4ML1 A;  3APO A;  5J4V A;  1OC8 A;  4WF5 A;  1U87 A;  3EUR A;  3MNG A;  5IOX A;  4YQV A;  16GS A;  3QAW A;  3GHA A;  4BWQ A;  2L4C A;  4LL1 B;  3KP9 A;  2AJQ B;  2QA1 A;  4RQX A;  3D22 A;  3E0U A;  5A4V A;  3GX0 A;  5D9X A;  4BL7 A;  5D73 A;  1O81 A;  3A2X A;  3Q19 A;  1PA3 A;  3ZVJ D;  3TKS E;  5A5K A;  2AHE A;  2RUF A;  4QQ7 A;  1WP0 A;  4FYC A;  3F3Q A;  2UZ8 A;  1GUH A;  4P3Y B;  1T1V A;  4IW9 A;  1XFL A;  2RLI A;  5CRH A;  2DBC A;  2F8A A;  2L57 A;  2R0P A;  3N9J A;  2V2G A;  5J47 A;  5H5R A;  2XC2 A;  3D0Z A;  1VRS D;  4MLY A;  2HRK B;  2NTO A;  3D6I A;  2J9H A;  4F0C A;  5F06 A;  1EV9 A;  3F63 A;  3IV4 A;  3G7Y A;  4MZB A;  1ABA A;  1GSS A;  4IKH A;  4WXT A;  2DLX A;  1Q98 A;  2H6X A;  4AJ6 A;  3ERF A;  1BED A;  2ES7 A;  3VK9 A;  5DJL A;  1GH2 A;  4KSO A;  1GTI A;  3FZ4 A;  1T7P B;  3VUR A;  2DJ3 A;  1WRY A;  5EY6 A;  4KCA A;  1X5D A;  1G7O A;  2HRK A;  5F0G A;  4X0X A;  4A5P A;  2EFC A;  2K6V A;  3TRQ A;  4YQU A;  4YAV A;  2GS3 A;  2FD3 A;  3HDC A;  1ML6 A;  5IMD A;  2O5V A;  2WDU A;  5J5N A;  3RAZ A;  5C00 A;  3A2W A;  3CSH A;  5ECQ B;  1A0F A;  5DAK B;  2C3T A;  1F3B A;  2F3M A;  4TOP A;  5ECN B;  1AAZ A;  5HFK A;  1XW5 A;  4USS A;  1GL8 A;  1G0T A;  1URM A;  2GZY A;  5C04 A;  5CO3 A;  4ULX A;  2TRX A;  3CTG A;  4WR5 A;  3BBY A;  1SL1 B;  3HZ8 A;  1ZYQ B;  3M8N A;  2IL3 A;  1A2M A;  1AIU A;  2C80 A;  1TKD B;  4IHU A;  3F4T A;  1MDJ A;  1FOV A;  5A4U A;  2NDO A;  3DIE A;  1HNC A;  3M3M A;  4KSM A;  4RI7 A;  5AIS A;  3MWH A;  1O73 A;  3A5W A;  2LRT A;  5GAN D;  1R26 A;  2GSS A;  2OJL A;  3GSS A;  3IAM 2;  1MDK A;  4V1A p;  3TB2 A;  4KDX A;  3IC4 A;  5DJM A;  1TK8 B;  2X64 A;  3KXO A;  2LQO A;  14GS A;  3EPT A;  3LFL A;  4TVE A;  2OAD A;  3HA9 A;  3BD2 A;  3TDG A;  4K5S A;  5A1N B;  3L9V A;  4MMM A;  3TKQ A;  3ZIV A;  3QAG A;  2CX4 A;  2GZP A;  1PSQ A;  2GSQ A;  2A2P A;  4XS4 B;  3HVS A;  2KOK A;  5CRW A;  3S9F A;  1NHY A;  1ZYN A;  1M3I A;  3GUS A;  3IHQ A;  1OKD A;  4DSS B;  5KOW A;  1ZGN A;  2NVL A;  2G2Q A;  1AW9 A;  4ECC A;  1U6T A;  5G1K A;  2I4A A;  3UEM A;  1UN2 A;  2IWT A;  1K0A A;  2R4V A;  3Q18 A;  1ACV A;  4MZW A;  5ECH B;  5A1N A;  1PL2 A;  3MAK A;  5DDL A;  2H70 A;  3KJY A;  4ZB8 A;  2VL2 C;  3L9S A;  4J57 E;  4OCE A;  1SD8 A;  4JRR A;  1XWK A;  4TN8 A;  3G7I A;  1R7H A;  4NWY A;  2L5L A;  3FR3 A;  4WBR D;  3F0I A;  1FVK A;  3UVT A;  2VD1 A;  5KN2 A;  2IMK A;  2HQT A;  3ED3 A;  4ECI A;  2DSA A;  2V32 A;  2VOC A;  2HRF A;  4N0V A;  1EV4 A;  4K8M A;  1EGR A;  4WKW A;  5G1L A;  4N30 A;  2HZE B;  4KB3 A;  2MMA A;  5ECS A;  1F6M C;  1FG4 A;  2FA4 A;  3DXB A;  4N11 A;  1F3A A;  5IO0 A;  2HLS A;  1XCC A;  2O87 A;  4ID0 A;  1FB6 A;  4MJE A;  1KTE A;  4FQU A;  3FMW A;  1H75 A;  1SJI A;  2JSZ A;  1X5E A;  3EC3 A;  4V2M A;  1SJZ A;  2LEG A;  3FEU A;  2LRC A;  4GSN A;  4AJ8 A;  2GDR A;  2HZE A;  3ME8 A;  4O32 A;  1PD2 1;  2YAN A;  2FNO A;  1MDI A;  3F3R A;  1Z7P A;  3EMP A;  3ZYW A;  3FZA A;  5D8I A;  1ERT A;  2HFD A;  2DJK A;  3LYK A;  3TRP A;  2M72 A;  1AQX A; 
#chains in the Genus database with same CATH homology
 2E7P A;  2DJ0 A;  2IMD A;  3LG6 A;  4ZB6 A;  5DQS A;  1X9M B;  1O8X A;  4TR1 B;  2WCI A;  2R37 A;  3GN3 A;  2REM A;  5A34 A;  2RII A;  4FIW A;  4ILF A;  5KN3 A;  3ERG A;  1J08 A;  4EXJ A;  3GV1 A;  1TXX A;  1EWX A;  2P5Q A;  4IEL A;  4GQF A;  2C0E A;  5JCU A;  4MAB A;  2CAI A;  3GH6 A;  4MP4 A;  4J2F A;  4IBP A;  5IPH A;  4MJB A;  4Q5N A;  4O5Q A;  3GA4 A;  2C3Q A;  5IO2 A;  4Q5Q A;  3UL3 A;  2JZR A;  4AI6 A;  1QXH A;  1OKT A;  5B8A A;  4GSS A;  4TXV A;  4NV5 A;  4KF9 A;  3C7M A;  3KZQ A;  4EVM A;  4Q5R A;  5DQY A;  3EMX A;  2HSN B;  2CAQ A;  4PTS A;  6GSY A;  3DGQ A;  1XVW A;  2CVD A;  2EFE A;  2PVQ A;  5CAX A;  4K0G A;  3VLN A;  2RM5 A;  1WMJ A;  4G2E A;  2L5O A;  4HQS A;  2AYT A;  1QGV A;  3EU3 A;  3HVV A;  1T3B A;  2VL3 A;  4ACS A;  4MF6 A;  3KH9 A;  3QD9 A;  1Y25 A;  2ON7 A;  1R5P A;  3VWV A;  5FWG A;  2K8S A;  4G19 A;  2HSN A;  2X8H A;  4I5Q A;  5CRE A;  1M7T A;  2LS5 A;  4F03 A;  2VCT A;  4N10 A;  2QC7 A;  20GS A;  4IQA A;  1M2A A;  1XPV A;  2RM6 A;  5HR0 A;  2LJA A;  2WFC A;  3D4T A;  4TW5 A;  1PKW A;  1GUL A;  1A0R P;  4PXO A;  1SK0 A;  2LUS A;  1JZD A;  3ERW A;  3VI5 A;  4PUA A;  1TXU A;  2EFD A;  1F9M A;  2Z9S A;  5IOW A;  1A24 A;  3M1G A;  3IA1 A;  3ZMK A;  1F2E A;  3EE2 A;  5D9V A;  4F9Z A;  1M0U A;  4EDZ A;  2K18 A;  2WB9 A;  2QKE A;  1OC9 A;  2I81 A;  1N8J A;  5EL8 A;  3LGC A;  1DE1 A;  3KP8 A;  4N3Z A;  1QMV A;  3P8W A;  5EPF A;  5BMU A;  4QL7 A;  3GRX A;  3PPU A;  1DBY A;  4BVY B;  3QMX A;  4KDY A;  4RI6 A;  1TRS A;  2FUG 2;  2KP2 A;  1K3Y A;  3LXZ A;  2LJK A;  3H8Q A;  9GSS A;  2K9F A;  4O5R A;  5LCZ A;  5ECM B;  4ISD A;  4BVX B;  1SYR A;  6GSS A;  2GGT A;  4MPF A;  3IBH A;  1GTU A;  3C1R A;  4MJA A;  3NZN A;  2O7K A;  1ZZY A;  1ZOF A;  4I2T A;  4K0N A;  5KN0 A;  4MA9 A;  3J7Y k;  4JZQ A;  4HJM A;  1T00 A;  1SU9 A;  1R4W A;  2VD0 A;  3TGZ A;  2DJ2 A;  3IDV A;  3KM6 A;  2N5B A;  1X9S B;  3APS A;  2PVO C;  1TRW A;  1O8W A;  2X49 A;  2TIR A;  2ZNM A;  1GTB A;  5JCW A;  1GWC A;  3D21 A;  3GUR A;  4I2U A;  2IN3 A;  4I97 A;  4GLT A;  3HHV A;  2JZS A;  2DML A;  3LOR A;  1O7U A;  1FHE A;  4G01 A;  1S3A A;  1OC3 A;  4WBJ A;  3FR9 A;  1BQ7 A;  3LWA A;  2B6M A;  1WJK A;  17GS A;  1SKW B;  1NM3 A;  2BJX A;  2F51 A;  1K0C A;  1OAZ A;  2H0H A;  5D9T A;  2MZC A;  4W66 A;  1YEX A;  3HKR A;  2OBK A;  3QOU A;  4AJ7 A;  2YV9 A;  4HQZ A;  3US3 A;  1HNB A;  3RPP A;  11GS A;  5G5F A;  1YVL A;  1V9W A;  3KH7 A;  2VKZ G;  4J56 E;  10GS A;  3ME7 A;  3GH9 A;  2RUE A;  3EVI A;  3GKX A;  1ERV A;  3OR5 A;  3QDN A;  2PU9 C;  2ON5 A;  1RK4 A;  1G6W A;  1O6J A;  4L5L A;  3WGE A;  2HSM B;  1K0B A;  1SKS B;  1M9B A;  3D5J A;  4PQI A;  5IMV A;  4K9Z A;  2H72 A;  5GST A;  2GSR A;  4AKG A;  5INY A;  4GTU A;  1YKC A;  5G2Z A;  1TW9 A;  1ZYE A;  3ZFL A;  1B9Y C;  3LXT A;  3TOT A;  1OYJ A;  2V41 A;  2B3S A;  4HS1 A;  4XHM A;  3ZVJ A;  3ZZX A;  2NPB A;  2NBS A;  3A5I A;  4N0Z A;  4IS0 A;  2HSM A;  2ZUP A;  2CA8 A;  5IQY A;  4NHZ A;  1A8L A;  3O76 A;  4AKI A;  2C1Y A;  2OKA A;  3U6V A;  1U88 A;  5CP1 A;  2LTK A;  2YWM A;  4HOJ A;  2KHP A;  1FAA A;  2QGV A;  3GNJ A;  4IP1 A;  5DAL B;  1UC7 A;  5JWR B;  3I69 A;  2PWJ A;  2R6K A;  2JAC A;  3O6T A;  4IJI A;  4L0W A;  6GSU A;  2YWI A;  4KGI A;  2I1U A;  4I8B A;  3QFA C;  4Q5F A;  1U3A A;  2GVP A;  3L9U A;  5KOX A;  4ZXG A;  4G0K A;  3TKP A;  5ID2 B;  1KBN A;  2H74 A;  5DAK A;  2CZ3 A;  2VLU A;  2DIY A;  4MDC A;  2AB6 A;  2YOI A;  1CQG A;  1USB A;  2XBQ A;  5D93 A;  3TJJ A;  4IN0 A;  4PNF A;  5J9C A;  2CVB A;  5A4W A;  2D2Z A;  3LYP A;  2YPM A;  4KH7 A;  3KMN A;  2DC5 A;  3FHK A;  1JZR A;  2R0C A;  2IFQ B;  2I3Y A;  1PX6 A;  4KA0 A;  5HR3 A;  1MTC A;  1HQO A;  1WE0 A;  3DKS A;  4EUY A;  3VPT A;  3KCM A;  3IR4 A;  2LNS A;  1TI3 A;  1QUW A;  1V58 A;  2PUK C;  2B1L A;  3I43 A;  3DYR A;  4ICY A;  1SYX A;  3BCI A;  5GAP D;  5AN1 A;  2FY6 A;  3G9B A;  4K1F A;  4TR0 A;  3IC8 A;  2PGT A;  2IFQ A;  3FZ9 A;  4HZ2 A;  3DEX A;  2JL4 A;  3GST A;  2H1G A;  2LKU A;  2AV4 A;  2OBI A;  3R3E A;  3DML A;  1XWC A;  12GS A;  3CWG A;  1XXU A;  4CY8 A;  2YWN A;  1SVM A;  4KDU A;  1E2Y A;  3IK7 A;  4K2X A;  3GKK A;  3IRA A;  1PN9 A;  1Y1U A;  4OFM A;  4BPY A;  1Z6N A;  2OAC A;  3GMF A;  4X43 A;  4XS4 A;  2L6D A;  3HXS A;  4JU5 A;  19GS A;  3FKF A;  5IMZ A;  3BJ5 A;  1VF1 A;  1LJR A;  1RW1 A;  2M80 A;  4Z7X A;  4H86 A;  1SK2 A;  1V2A A;  4DSS A;  1ZL9 A;  3ZFB A;  4ZL9 A;  2E2G A;  1GTA A;  4GCI A;  3JCM L;  4V2L A;  1YEP A;  3IK9 A;  3EWL A;  4CDO A;  1GSQ A;  1EEJ A;  2XPD A;  1JLW A;  4YKF A;  1X0R A;  1ON4 A;  1VF3 A;  2HSY A;  5LD0 A;  2PBJ A;  1SVO A;  1O85 A;  3I9V 2;  4HU7 A;  4XTS A;  2YNX A;  2YN1 A;  4EDY A;  4JR4 A;  1PRX A;  3IPZ A;  4PX1 A;  5KEJ A;  2XHF A;  1ERU A;  1JZO A;  5ECI B;  1CQH A;  3MSZ A;  4K7N A;  4GF0 A;  1I5G A;  1YJ6 A;  2CT6 A;  1TRU A;  2C3N A;  1XWB A;  5F05 A;  5ABR A;  4MH3 A;  1XWG A;  4RQR A;  1XBS A;  1K0M A;  1K0N A;  3RBT A;  2CV4 A;  3C71 A;  3UOM A;  2VUP A;  2PPT A;  4NAX A;  4JE1 A;  2LNT A;  5GZZ B;  5D9W A;  3TJK A;  2AUV A;  4X1U A;  4JR6 A;  4PQ1 A;  1XZO A;  3P2A A;  2K8V A;  4KUN A;  2DJ1 A;  1TU7 A;  4E8H A;  2VL9 A;  3SWL A;  3RPN A;  1SVL A;  2WUL A;  4XRA A;  1ERW A;  4E8E A;  2M46 A;  2V1M A;  2R3X A;  2MYG A;  1GSF A;  4HUA A;  3WYW A;  2HXK A;  1DSB A;  1GP1 A;  2P31 A;  3NOF A;  2KP1 A;  4DSR A;  1TTZ A;  2C0D A;  3UAR A;  2QA2 A;  4OCF A;  3FY7 A;  1F37 A;  4WF4 A;  2CZ2 A;  3HYP A;  4EF0 A;  1TK0 B;  4TR1 A;  2ZCT A;  3A2V A;  1PQN A;  7GSS A;  3ZLP A;  2H19 A;  2ALB A;  2A2R A;  5H5S A;  2EC4 A;  4NHW A;  3IXR A;  2H66 A;  3VFI A;  3FR6 A;  1THO A;  1B4Q A;  5IM9 A;  1PKZ A;  3N5O A;  4ZIL A;  3KD0 A;  2TRC P;  2HZF A;  5DBQ A;  2YZU A;  4QMK A;  1XW6 A;  1T4Z A;  2O89 A;  4IJ3 A;  1HD2 A;  3IAS 2;  3TRX A;  4Z2R A;  3EYT A;  1UA5 A;  2B7J A;  2FA8 A;  2H76 A;  2FWG A;  2YV7 A;  5JWO B;  2YJ7 A;  4OWY A;  3WGD A;  4ZB7 A;  3QAV A;  4XCS A;  1SKR B;  5G5E A;  4POB A;  2OE0 A;  1GRX A;  4XRD A;  4L8E A;  3WD6 A;  1PX7 A;  2FCH A;  1VF2 A;  2VCW A;  1SEN A;  3C8E A;  4OO4 A;  1YKA A;  3TOU A;  2HSH A;  1TDI A;  2L59 A;  1RQM A;  6GSX A;  3F4S A;  4K7O A;  4ZL8 A;  3L4N A;  2FGX A;  1MD3 A;  2H71 A;  3HZ4 A;  3LW9 A;  2OE1 A;  3LSZ A;  2CX3 A;  4G0I A;  1SK1 A;  2VCQ A;  2DKI A;  1M9A A;  2H73 A;  4V2N A;  4ZBB A;  5J4Y A;  5ENU A;  3F8U A;  3CMI A;  2H6Y A;  3FZ5 A;  4WET A;  4KE3 A;  1SL2 B;  4TXO B;  2WJU A;  3DD3 A;  4EIP A;  1JHB A;  2OA7 A;  3GTU B;  3ZRE A;  4KW6 A;  2X99 A;  1FOH A;  1A8Y A;  2YZH A;  3QPM A;  2R5G A;  3HJP A;  5F07 A;  4NV2 A;  2VCV A;  2CVK A;  5G31 A;  3IE3 A;  2GT5 A;  1TOF A;  3HY2 A;  3HCZ A;  2HI7 A;  1T4Y A;  1JZW A;  2OT3 A;  2I9H A;  4DSQ A;  5H5Q A;  3TJG A;  4CY6 A;  2VCZ A;  2O85 A;  5HFI A;  1ZCP A;  2H1B A;  4OMV A;  1BAY A;  4MJC A;  4POL A;  5JCG A;  4AKH A;  2YCD A;  2KUC A;  2CQ9 A;  4GQC A;  4BVY A;  1M2B A;  5J40 A;  1EZK A;  2IIY A;  1A2J A;  3J7Y b;  3KTL A;  4EKZ A;  1OVN A;  1THX A;  3KIJ A;  3TKS C;  3PIN A;  3CBU A;  2EIQ A;  4ZIJ A;  3MIX A;  5BRT A;  1N2A A;  3G7J A;  3M9J A;  4BVX A;  4ZB9 A;  3TCO A;  4ML6 A;  4OO5 A;  5B7C A;  2MBT A;  2FLS A;  3ZRD A;  2H6Z A;  2IME A;  3GIX A;  3F9U A;  4BL7 B;  2GQM A;  3KTB A;  3L78 A;  1A23 A;  5F8B A;  1Z6M A;  4FO5 A;  1GSU A;  1DUG A;  6GSV A;  1NSW A;  2F9S A;  2GT6 A;  3FRC A;  4EE0 A;  1EEM A;  2JSY A;  2WZ9 A;  2E0Q A;  1XW9 A;  2GQK A;  1JFU A;  4GWR A;  1EOG A;  2GQL A;  2PN8 A;  2A2S A;  1TJD A;  3K8N A;  4HDE A;  1GNE A;  1B4P A;  4ZBD A;  2HE3 A;  1YDK A;  2C8U A;  5DVB A;  1WOU A;  1QK8 A;  2LST A;  5A5H B;  1TU8 A;  1G7E A;  4YQM A;  1TRV A;  4EL1 A;  3SBC A;  1ILO A;  4HEA 2;  2X8G A;  2VCX A;  2DMM A;  3O3T A;  3NIV A;  3W8J A;  4OFT A;  5B6N A;  3PGT A;  1FW1 A;  5IMA A;  4ZBA A;  4Z2U A;  1SD9 A;  4K5R A;  1VGL A;  2B1K A;  4MH2 A;  5A5H A;  2KLX A;  3TJB A;  2H01 A;  2BMX A;  2HRA A;  2F8F A;  4L5O A;  2FWH A;  4BWS A;  2DIZ A;  5CYY A;  2H1D A;  4PQH A;  2VL2 A;  4FH8 A;  3RHC A;  4GDF A;  4EIQ A;  1S3D A;  5E4W A;  5HR1 A;  1BF5 A;  1AQV A;  3GL3 A;  4OFN A;  3TKR A;  3H1N A;  4IP6 A;  1UVZ A;  3UBL A;  5J4U A;  1TP9 A;  2A4V A;  2VIM A;  1FVJ A;  1M99 A;  1XOA A;  2H0I A;  4CHS A;  5IMF A;  2VO4 A;  3Q74 A;  4LMW A;  3W6G A;  4G10 A;  1KEB A;  3UVH A;  5DAL A;  1LBK A;  3GKM A;  3VWX A;  3TUE A;  1AXD A;  2A4H A;  2C4J A;  2PMT A;  2QSI A;  1IYH A;  3CSJ A;  3F6D A;  1KNG A;  1K0O A;  1Q4J A;  5IMC A;  3GFK A;  1QFN A;  2VM1 A;  1G6Y A;  5ECO B;  4POM A;  5AGY A;  2YJH A;  1XVQ A;  5AIX A;  2H75 A;  4RUV A;  5CRD A;  5ID2 A;  4F0B A;  5ELA A;  4YKG A;  5ECP B;  2H0G A;  2WRT A;  1A2L A;  4LLR A;  2VLV A;  1Z5Y E;  3KGK A;  1BX9 A;  1YY7 A;  2H1L A;  2X8C A;  3ZIJ A;  1B48 A;  1MEK A;  1H4O A;  1N25 A;  2B5Y A;  1K0D A;  1FO5 A;  3EIN A;  5ELG A;  1PN0 A;  4XS1 A;  2YP6 A;  3QR6 A;  4NMU A;  22GS A;  2MMZ A;  4TRX A;  1C72 A;  2IMF A;  3QCP A;  1GUM A;  4MF5 A;  3IOS A;  1NW2 A;  1BG1 A;  3VWU A;  1PMT A;  5HFG A;  2P0G A;  2PER A;  4IVF A;  4POK A;  4JED A;  1GSD A;  4LL4 B;  2HNL A;  1Z9H A;  3ZIT A;  4I6X A;  1PGT A;  3GKN A;  4KCE A;  6GSW A;  3A3T A;  3RDW A;  1GSE A;  4GST A;  2H30 A;  2B5E A;  4CW9 A;  2IPA A;  3CTF A;  1K3L A;  2HT9 A;  4KAE A;  2IJY A;  4PGT A;  1ZYP A;  3HJO A;  4G9H A;  4DEJ A;  2EIR A;  1BJX A;  2OE3 A;  3Q6O A;  5J3R A;  4TKY A;  3PR8 A;  2L6C A;  2C0G A;  2H8L A;  4X4J A;  2AAW A;  2V6O A;  5E59 A;  2DJJ A;  1OE8 A;  1B8X A;  1R5A A;  5HQP A;  2YWO A;  2V6K A;  3EU4 A;  3UBK A;  3CXG A;  2HYX A;  2EIO A;  3KEB A;  2JU5 A;  5DCH A;  1V57 A;  4WEY A;  2B7K A;  6GST A;  3LJR A;  5LNK e;  4O7H A;  2LV3 A;  4MF7 A;  2MMN A;  4AF2 A;  3WGX A;  1YQ1 A;  1PL1 A;  4PUF C;  2MBS A;  4K2D A;  1BYE A;  3CSI A;  3VWW A;  5B8B A;  4EC0 A;  1GLQ A;  3F4R A;  4LA1 A;  4MZC A;  4NXI A;  1LU4 A;  4MPG A;  3DWV A;  5CNW A;  5ECL B;  3VI7 A;  4LMV A;  5JWQ B;  4ECJ A;  2R0G A;  2JZT A;  1X9W B;  3R2Q A;  2LRN A;  3BOA A;  1FB0 A;  4K6X A;  5A34 B;  4D73 B;  3DRN A;  4TR4 A;  4ZL7 A;  1GLP A;  3LEF A;  3KMO A;  3GL5 A;  1Y6E A;  4QL9 A;  1QQ2 A;  4KND A;  5AIV A;  3E9J B;  3UMA A;  3MYD A;  3W8S A;  2C0F A;  2GZZ A;  4ECB A;  1ZMA A;  5EVO A;  3FK8 A;  1XWA A;  1HNA A;  4MNN A;  1NHO A;  3ZL5 A;  3ZTL A;  1XOB A;  5GSS A;  1TI1 A;  3CRU A;  3C1S A;  4D73 A;  1V40 A;  3V1W A;  1GSY A;  1U3I A;  1SJ6 A;  2GLR A;  2JAD A;  1OE7 A;  4JBB A;  3E3E A;  2P5R A;  4KX4 A;  3BCK A;  3M9K A;  3CRT A;  4G0L A;  1EP7 A;  3HMJ G;  1Z3E A;  5ECR B;  5D96 A;  4FYB A;  1V98 A;  4O5U A;  3U5R E;  3QFB C;  2E2M A;  2L4Q A;  4V1A g;  4F2I A;  2XBI A;  4FYU A;  3H79 A;  2H1A A;  2XPE A;  3RHB A;  4MK3 A;  3HD5 A;  3UIW A;  2WS2 A;  3FW2 A;  18GS A;  3WT2 A;  2N5A A;  3TKS A;  3L0H A;  1YZX A;  1MD4 A;  3CYN A;  1GUK A;  2MMO A;  1M2D A;  3D4M A;  3P7X A;  2IMI A;  3DVX A;  3AY8 A;  3DVW A;  5IIZ A;  3LQ7 A;  2VM2 A;  2WGR A;  4GXZ A;  4WR4 A;  3C73 A;  4DVC A;  1YF0 A;  1J9B A;  2GST A;  4HZ4 A;  1IYI A;  3IHG A;  4XS6 A;  5COH A;  2B5X A;  2LJR A;  4AKX B;  1VF4 A;  2DKH A;  1WPI A;  3ISO A;  1OC9 B;  1T8E B;  2EFH A;  3F6F A;  4XIH A;  1HYU A;  1S3C A;  3H4K A;  2FWE A;  4E68 A;  4HI7 A;  1EGO A;  3GYK A;  3APQ A;  5BMU B;  1E6B A;  8GSS A;  1BG5 A;  2GTU A;  3UAP A;  5FT3 A;  1JLV A;  3WT1 A;  1I9D A;  4YH2 A;  1YF1 A;  4F82 A;  3TU3 B;  3FYG A;  1Z7R A;  5J41 A;  2O8V B;  3ZML A;  4NPB A;  3TJF A;  1W89 A;  2VLT A;  5G30 A;  4OD7 A;  2BTO T;  1AC1 A;  4IGJ A;  5ECK B;  1W4V A;  2G0F A;  5J9B A;  1EOH A;  1AUC A;  3H93 A;  1SL0 B;  5KN1 A;  1XIY A;  1DE2 A;  5B6M A;  3I6A A;  4TXO A;  4MCU A;  4IQ1 A;  2FWF A;  2N5F A;  1X5C A;  3GTU A;  5HR2 A;  2J23 A;  3MDK A;  3HVX A;  5DCG A;  4AGS A;  3VPQ A;  1AQW A;  3P90 A;  1K3O A;  1WWJ A;  4HJ2 A;  1B9X C;  1J0F A;  4GRF A;  1EP8 A;  4PUR A;  4TR3 A;  5IPG A;  4EO3 A;  5FHI A;  4HU9 A;  3GX8 A;  4O92 A;  2R2J A;  4BA7 A;  3M0F A;  1WIK A;  2HRN A;  13GS A;  2FHE A;  1ST9 A;  3HJM A;  4Z2T A;  5L71 A;  2UV8 G;  1TK5 B;  2X4A A;  3UJ1 A;  4PNG A;  2LQQ A;  2VAF A;  1GNW A;  5CRG A;  4YAP A;  4K7I A;  3PH9 A;  4L0U A;  4ML1 A;  3APO A;  5J4V A;  1OC8 A;  4WF5 A;  1U87 A;  3EUR A;  3MNG A;  5IOX A;  4YQV A;  16GS A;  3QAW A;  3GHA A;  4BWQ A;  2L4C A;  4LL1 B;  3KP9 A;  2AJQ B;  2QA1 A;  4RQX A;  3D22 A;  3E0U A;  5A4V A;  3GX0 A;  5D9X A;  4BL7 A;  5D73 A;  1O81 A;  3A2X A;  3Q19 A;  1PA3 A;  3ZVJ D;  3TKS E;  5A5K A;  2AHE A;  2RUF A;  4QQ7 A;  1WP0 A;  4FYC A;  3F3Q A;  2UZ8 A;  1GUH A;  4P3Y B;  1T1V A;  4IW9 A;  1XFL A;  2RLI A;  5CRH A;  2DBC A;  2F8A A;  2L57 A;  2R0P A;  3N9J A;  2V2G A;  5J47 A;  5H5R A;  2XC2 A;  3D0Z A;  1VRS D;  4MLY A;  2HRK B;  2NTO A;  3D6I A;  2J9H A;  4F0C A;  5F06 A;  1EV9 A;  3F63 A;  3IV4 A;  3G7Y A;  4MZB A;  1ABA A;  1GSS A;  4IKH A;  4WXT A;  2DLX A;  1Q98 A;  2H6X A;  4AJ6 A;  3ERF A;  1BED A;  2ES7 A;  3VK9 A;  5DJL A;  1GH2 A;  4KSO A;  1GTI A;  3FZ4 A;  1T7P B;  3VUR A;  2DJ3 A;  1WRY A;  5EY6 A;  4KCA A;  1X5D A;  1G7O A;  2HRK A;  5F0G A;  4X0X A;  4A5P A;  2EFC A;  2K6V A;  3TRQ A;  4YQU A;  4YAV A;  2GS3 A;  2FD3 A;  3HDC A;  1ML6 A;  5IMD A;  2O5V A;  2WDU A;  5J5N A;  3RAZ A;  5C00 A;  3A2W A;  3CSH A;  5ECQ B;  1A0F A;  5DAK B;  2C3T A;  1F3B A;  2F3M A;  4TOP A;  5ECN B;  1AAZ A;  5HFK A;  1XW5 A;  4USS A;  1GL8 A;  1G0T A;  1URM A;  2GZY A;  5C04 A;  5CO3 A;  4ULX A;  2TRX A;  3CTG A;  4WR5 A;  3BBY A;  1SL1 B;  3HZ8 A;  1ZYQ B;  3M8N A;  2IL3 A;  1A2M A;  1AIU A;  2C80 A;  1TKD B;  4IHU A;  3F4T A;  1MDJ A;  1FOV A;  5A4U A;  2NDO A;  3DIE A;  1HNC A;  3M3M A;  4KSM A;  4RI7 A;  5AIS A;  3MWH A;  1O73 A;  3A5W A;  2LRT A;  5GAN D;  1R26 A;  2GSS A;  2OJL A;  3GSS A;  3IAM 2;  1MDK A;  4V1A p;  3TB2 A;  4KDX A;  3IC4 A;  5DJM A;  1TK8 B;  2X64 A;  3KXO A;  2LQO A;  14GS A;  3EPT A;  3LFL A;  4TVE A;  2OAD A;  3HA9 A;  3BD2 A;  3TDG A;  4K5S A;  5A1N B;  3L9V A;  4MMM A;  3TKQ A;  3ZIV A;  3QAG A;  2CX4 A;  2GZP A;  1PSQ A;  2GSQ A;  2A2P A;  4XS4 B;  3HVS A;  2KOK A;  5CRW A;  3S9F A;  1NHY A;  1ZYN A;  3GUS A;  3IHQ A;  1OKD A;  4DSS B;  5KOW A;  1ZGN A;  2NVL A;  2G2Q A;  1AW9 A;  4ECC A;  1U6T A;  5G1K A;  2I4A A;  3UEM A;  1UN2 A;  2IWT A;  1K0A A;  2R4V A;  3Q18 A;  1ACV A;  4MZW A;  5ECH B;  5A1N A;  1PL2 A;  3MAK A;  5DDL A;  2H70 A;  3KJY A;  4ZB8 A;  2VL2 C;  3L9S A;  4J57 E;  4OCE A;  1SD8 A;  4JRR A;  1XWK A;  4TN8 A;  3G7I A;  1R7H A;  4NWY A;  2L5L A;  3FR3 A;  4WBR D;  3F0I A;  1FVK A;  3UVT A;  2VD1 A;  5KN2 A;  2IMK A;  2HQT A;  3ED3 A;  4ECI A;  2DSA A;  2V32 A;  2VOC A;  2HRF A;  4N0V A;  1EV4 A;  4K8M A;  1EGR A;  4WKW A;  5G1L A;  4N30 A;  2HZE B;  4KB3 A;  2MMA A;  5ECS A;  1F6M C;  1FG4 A;  2FA4 A;  3DXB A;  4N11 A;  1F3A A;  5IO0 A;  2HLS A;  1XCC A;  2O87 A;  4ID0 A;  1FB6 A;  4MJE A;  1KTE A;  4FQU A;  3FMW A;  1H75 A;  1SJI A;  2JSZ A;  1X5E A;  3EC3 A;  4V2M A;  1SJZ A;  2LEG A;  3FEU A;  2LRC A;  4GSN A;  4AJ8 A;  2GDR A;  2HZE A;  3ME8 A;  4O32 A;  1PD2 1;  2YAN A;  2FNO A;  1MDI A;  3F3R A;  1Z7P A;  3EMP A;  3ZYW A;  3FZA A;  5D8I A;  1ERT A;  2HFD A;  2DJK A;  3LYK A;  3TRP A;  2M72 A;  1AQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...