3RGBC

Crystal structure of particulate methane monooxygenase from methylococcus capsulatus (bath)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
242
structure length
213
Chain Sequence
LLDKKWLTFALAIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGYLWKTRDRNLAALTPREELRRNFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYIITGFAAFIYAKTRLPFFAKGISLPYLVLVVGPFMILPNVLALAVMGTLTQTFYSFAQGGLGQSLCEAVDEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase subunit B2
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 73
structure length 213
sequence length 242
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3rgbC00
3CHXC 1YEWC 3RFRC 4PHZC 4PI0C 4PI2C 3RGBC
chains in the Genus database with same CATH superfamily
1VF1A 3CBUA 2OACA 1VF3A 1YKCA 12GSA 1EOGA 5DALB 3W8SA 4MF6A 4K0GA 3KTLA 3C8EA 3KMNA 2FNOA 5ECNB 3CSJA 1JLVA 3H1NA 4KE3A 1Y6EA 1GSSA 4KDXA 2YV7A 3GSSA 1YEWC 5JCUA 5A4VA 2WW3A 11GSA 3VPTA 1NHYA 2HRAA 2VCXA 4HOJA 2VCZA 5DAKB 5FHIA 1FHEA 1GSYA 1YY7A 2C8UA 2PMTA 4HJ2A 4LMVA 2R6KA 4JEDA 2PERA 4MDCA 2WRTA 4GDFA 4JBBA 2O5VA 4EXJA 4O7HA 4NHWA 4IELA 3UBLA 1FW1A 4CHSA 2IMKA 2HSMB 1GULA 2WJUA 2WW2A 2EFCA 4MF5A 1USBA 5EL8A 1XW6A 5D9VA 5F8BA 1PX7A 4Q5QA 1PL1A 4KH7A 3VI5A 4F0CA 20GSA 1AQWA 4YAPA 5A4UA 3VK9A 3N5OA 1HNAA 3QR6A 5AIXA 3CSIA 3RFRC 2VD1A 4FXYP 1TXUA 4PNFA 5FWGA 4OFMA 4ACSA 4PURA 3ISOA 4IKHA 5D9XA 2A2RA 3LFLA 1GWCA 1GNEA 4HZ4A 3WYWA 3M8NA 3QAGA 3VURA 3IK9A 2AAWA 4YH2A 3KJYA 1OKTA 4L5LA 3G7JA 4AGSA 2WVYA 1GUMA 1YVLA 3QAWA 3LQ7A 2D2ZA 17GSA 1GSUA 4RI7A 1GSQA 4EDZA 4HI7A 1PMTA 1K3OA 4PI2C 3F63A 2VCWA 4GCIA 1XWGA 4BVXB 1N25A 2PVQA 3PR8A 1SVOA 1SVLA 1HNCA 2YV9A 5J47A 6GSUA 1K0OA 3KMOA 4YQMA 5J41A 3M1GA 3RGBC 2WZSA 1K0AA 4PXOA 1U88A 2C3TA 2GLRA 3ERGA 2V6KA 4IBPA 1K3LA 2C80A 5FT3A 3NIVA 1ZL9A 2WVXB 4GSSA 4EC0A 3GTUA 3LJRA 1PKWA 5ECQB 5JCWA 5ECOB 3ZFBA 1GTAA 1LBKA 5IQYA 2OT3A 3LYPA 1MTCA 5D9WA 1PL2A 2VO4A 6GSYA 4PHZC 2N5FA 4RI6A 1RK4A 2LJRA 3GTUB 1TW9A 4G9HA 1OE8A 2ON7A 4AKHA 4ECBA 5A34A 1BG1A 4PQIA 1U3IA 1OE7A 3TGZA 5D73A 5A5HB 2GSTA 5ECKB 5J4UA 1M9BA 5DAKA 3VI7A 3ZMLA 3G7IA 5J5NA 4PQHA 5F0GA 3I69A 1XW5A 3MAKA 1PGTA 4ECCA 1XWKA 5A34B 3GH6A 3GX0A 1BX9A 3P90A 1M99A 3CSHA 2GSSA 1B8XA 3AY8A 2NTOA 1GTIA 1B48A 4PNGA 3UBKA 5GSTA 4PI0C 4KSMA 1R5AA 2HSMA 1N2AA 3RBTA 3WD6A 2IL3A 1GSEA 2CAQA 1IYHA 13GSA 2C4JA 4E8EA 3GUSA 8GSSA 3VLNA 3P8WA 1G7OA 2WDUA 5KEJA 4PTSA 1BYEA 3Q18A 4GSNA 1AXDA 2ON5A 5BMUB 2J9HA 3DGQA 18GSA 1B4PA 1F3AA 2JL4A 5ELGA 16GSA 4W66A 5DJLA 4AKIA 1BF5A 1I1IP 1K0BA 2GSRA 3GSTA 4IQAA 6GSTA 3LXZA 2DSAA 3LSZA 4OMVA 5ECRB 4GF0A 1GTUA 3F6FA 1IYIA 1BG5A 4FQUA 1S4BP 3TOTA 1VF4A 2HSNA 1K0NA 4Q5FA 2C3QA 3HMJG 1GSFA 4OFTA 2CZ2A 5F06A 1U87A 3LG6A 3O3TA 4BVXA 4IGJA 4GTUA 2F8FA 2HSNB 4G10A 3IE3A 6GSXA 4N0VA 1KBNA 4ZBAA 5G5FA 6GSVA 1G6WA 2CA8A 3HJMA 3UAPA 1Z9HA 10GSA 5A5KA 4PUAA 19GSA 5DCGA 5A1NA 1K0CA 1VF2A 4MP4A 1YQ1A 4MF7A 4E8HA 3CHXC 3R3EA 5ECIB 2WVXA 1GTBA 1A0FA 4TOPA 3UARA 5GSSA 4MPFA 1V40A 3I6AA 2WW1A 4QMKA 5A1NB 5DQSA 1K0MA 3FYGA 1EEMA 5F07A 4ZB7A 4F03A 3SWLA 5G5EA 2A2SA 1LJRA 2C3NA 3F6DA 2O3EA 4EE0A 3VWXA 4KGIA 4BL7A 2CZ3A 3CRUA 4PX1A 14GSA 1GUHA 1TU8A 5A5HA 5LCZA 2CAIA 4IQ1A 2HNLA 4G0KA 5DDLA 4BL7B 9GSSA 2DC5A 4QQ7A 3UVHA 3TOUA 1Q4JA 2OADA 2GTUA 3ZMKA 5HFKA 1MD4A 2IMIA 1HQOA 2PBJA 5J40A 1YJ6A 4HZ2A 4KF9A 2O36A 4KDYA 5D9TA 4ECIA 1GLQA 2PGTA 4K0NA 1F2EA 3FRCA 3FR3A 4BVYB 5ECLB 1C72A 3CWGA 1AW9A 1ML6A 2WB9A 4ID0A 4ZB9A 1GSDA 3TU3B 1PN9A 1PX6A 3ERFA 4GSTA 5J4YA 5BMUA 2R4VA 1DUGA 1TDIA 4DEJA 5EY6A 1K3YA 1GNWA 5F05A 2VKZG 4WR5A 4LMWA 4JZQA 4ZBBA 3KM6A 4WR4A 2R3XA 3FY7A 4AKXB 5ECPB 3EINA 4AKGA 2CVDA 3MDKA 1Y1UA 1M9AA 3R2QA 2WS2A 4EDYA 5EVOA 5ELAA 3HKRA 6GSWA 1M0UA 2EFEA 2EFDA 4ZB6A 5B7CA 4E68A 2HRKA 2VD0A 4G0IA 2VCQA 1AQVA 1YDKA 3GURA 3VPQA 3EE2A 4O92A 4IVFA 2AB6A 4MK3A 5AISA 1V2AA 1OYJA 3IBHA 2HQTA 3PPUA 3U6VA 3Q74A 1JZRA 1MD3A 4ZBDA 3ZFLA 2HRKB 1EV4A 4ISDA 4KX4A 6GSSA 4IS0A 2FHEA 4Q5RA 3PGTA 4OFNA 5ECMB 1E6BA 4J2FA 4G01A 4ZXGA 1AQXA 2OA7A 1G6YA 5DJMA 4YQVA 2R5GA 4N3ZA 4IW9A 3N9JA 5GZZB 4I97A 5AGYA 4ECJA 4AI6A 3QAVA 2YCDA 3BBYA 3LYKA 22GSA 5LD0A 3DD3A 3FR9A 4L5OA 3LXTA 1GUKA 2GDRA 3M0FA 4MZWA 1EOHA 2UZ8A 3Q19A 2WVZA 3M3MA 4IJIA 4KAEA 4G19A 4GLTA 4L8EA 5ECSA 2UV8G 2F3MA 3FR6A 1PKZA 1EV9A 1F3BA 2VCTA 2AHEA 1SVMA 4Q5NA 4USSA 4NAXA 2X64A 7GSSA 1GLPA 2H1LA 2GSQA 4YQUA 1JLWA 3KXOA 2WW0A 5ECHB 1K0DA 3IR4A 4F0BA 1UA5A 3O76A 4PGTA 3IC8A 1HNBA 3HJOA 1PA3A 4MPGA 5A4WA 3L0HA 1PD21 4NHZA 3D0ZA 2EFHA 5J4VA 3IK7A 4KDUA 2VCVA 5DALA 5AIVA 4BVYA 4G0LA 1TU7A 3CRTA 1BAYA 4ZB8A 5AN1A 4YAVA 1ZGNA
chains in the Genus database with same CATH topology
3CHXC 1YEWC 3RFRC 4PHZC 4PI0C 4PI2C 3RGBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CHX C;  1YEW C;  3RFR C;  4PHZ C;  4PI0 C;  4PI2 C;  3RGB C; 
#chains in the Genus database with same CATH topology
 1VF1 A;  3CBU A;  2OAC A;  1VF3 A;  1YKC A;  12GS A;  1EOG A;  5DAL B;  3W8S A;  4MF6 A;  4K0G A;  3KTL A;  3C8E A;  3KMN A;  2FNO A;  5ECN B;  3CSJ A;  1JLV A;  3H1N A;  4KE3 A;  1Y6E A;  1GSS A;  4KDX A;  2YV7 A;  3GSS A;  1YEW C;  5JCU A;  5A4V A;  2WW3 A;  11GS A;  3VPT A;  1NHY A;  2HRA A;  2VCX A;  4HOJ A;  2VCZ A;  5DAK B;  5FHI A;  1FHE A;  1GSY A;  1YY7 A;  2C8U A;  2PMT A;  4HJ2 A;  4LMV A;  2R6K A;  4JED A;  2PER A;  4MDC A;  2WRT A;  4GDF A;  4JBB A;  2O5V A;  4EXJ A;  4O7H A;  4NHW A;  4IEL A;  3UBL A;  1FW1 A;  4CHS A;  2IMK A;  2HSM B;  1GUL A;  2WJU A;  2WW2 A;  2EFC A;  4MF5 A;  1USB A;  5EL8 A;  1XW6 A;  5D9V A;  5F8B A;  1PX7 A;  4Q5Q A;  1PL1 A;  4KH7 A;  3VI5 A;  4F0C A;  20GS A;  1AQW A;  4YAP A;  5A4U A;  3VK9 A;  3N5O A;  1HNA A;  3QR6 A;  5AIX A;  3CSI A;  3RFR C;  2VD1 A;  4FXY P;  1TXU A;  4PNF A;  5FWG A;  4OFM A;  4ACS A;  4PUR A;  3ISO A;  4IKH A;  5D9X A;  2A2R A;  3LFL A;  1GWC A;  1GNE A;  4HZ4 A;  3WYW A;  3M8N A;  3QAG A;  3VUR A;  3IK9 A;  2AAW A;  4YH2 A;  3KJY A;  1OKT A;  4L5L A;  3G7J A;  4AGS A;  2WVY A;  1GUM A;  1YVL A;  3QAW A;  3LQ7 A;  2D2Z A;  17GS A;  1GSU A;  4RI7 A;  1GSQ A;  4EDZ A;  4HI7 A;  1PMT A;  1K3O A;  4PI2 C;  3F63 A;  2VCW A;  4GCI A;  1XWG A;  4BVX B;  1N25 A;  2PVQ A;  3PR8 A;  1SVO A;  1SVL A;  1HNC A;  2YV9 A;  5J47 A;  6GSU A;  1K0O A;  3KMO A;  4YQM A;  5J41 A;  3M1G A;  3RGB C;  2WZS A;  1K0A A;  4PXO A;  1U88 A;  2C3T A;  2GLR A;  3ERG A;  2V6K A;  4IBP A;  1K3L A;  2C80 A;  5FT3 A;  3NIV A;  1ZL9 A;  2WVX B;  4GSS A;  4EC0 A;  3GTU A;  3LJR A;  1PKW A;  5ECQ B;  5JCW A;  5ECO B;  3ZFB A;  1GTA A;  1LBK A;  5IQY A;  2OT3 A;  3LYP A;  1MTC A;  5D9W A;  1PL2 A;  2VO4 A;  6GSY A;  4PHZ C;  2N5F A;  4RI6 A;  1RK4 A;  2LJR A;  3GTU B;  1TW9 A;  4G9H A;  1OE8 A;  2ON7 A;  4AKH A;  4ECB A;  5A34 A;  1BG1 A;  4PQI A;  1U3I A;  1OE7 A;  3TGZ A;  5D73 A;  5A5H B;  2GST A;  5ECK B;  5J4U A;  1M9B A;  5DAK A;  3VI7 A;  3ZML A;  3G7I A;  5J5N A;  4PQH A;  5F0G A;  3I69 A;  1XW5 A;  3MAK A;  1PGT A;  4ECC A;  1XWK A;  5A34 B;  3GH6 A;  3GX0 A;  1BX9 A;  3P90 A;  1M99 A;  3CSH A;  2GSS A;  1B8X A;  3AY8 A;  2NTO A;  1GTI A;  1B48 A;  4PNG A;  3UBK A;  5GST A;  4PI0 C;  4KSM A;  1R5A A;  2HSM A;  1N2A A;  3RBT A;  3WD6 A;  2IL3 A;  1GSE A;  2CAQ A;  1IYH A;  13GS A;  2C4J A;  4E8E A;  3GUS A;  8GSS A;  3VLN A;  3P8W A;  1G7O A;  2WDU A;  5KEJ A;  4PTS A;  1BYE A;  3Q18 A;  4GSN A;  1AXD A;  2ON5 A;  5BMU B;  2J9H A;  3DGQ A;  18GS A;  1B4P A;  1F3A A;  2JL4 A;  5ELG A;  16GS A;  4W66 A;  5DJL A;  4AKI A;  1BF5 A;  1I1I P;  1K0B A;  2GSR A;  3GST A;  4IQA A;  6GST A;  3LXZ A;  2DSA A;  3LSZ A;  4OMV A;  5ECR B;  4GF0 A;  1GTU A;  3F6F A;  1IYI A;  1BG5 A;  4FQU A;  1S4B P;  3TOT A;  1VF4 A;  2HSN A;  1K0N A;  4Q5F A;  2C3Q A;  3HMJ G;  1GSF A;  4OFT A;  2CZ2 A;  5F06 A;  1U87 A;  3LG6 A;  3O3T A;  4BVX A;  4IGJ A;  4GTU A;  2F8F A;  2HSN B;  4G10 A;  3IE3 A;  6GSX A;  4N0V A;  1KBN A;  4ZBA A;  5G5F A;  6GSV A;  1G6W A;  2CA8 A;  3HJM A;  3UAP A;  1Z9H A;  10GS A;  5A5K A;  4PUA A;  19GS A;  5DCG A;  5A1N A;  1K0C A;  1VF2 A;  4MP4 A;  1YQ1 A;  4MF7 A;  4E8H A;  3CHX C;  3R3E A;  5ECI B;  2WVX A;  1GTB A;  1A0F A;  4TOP A;  3UAR A;  5GSS A;  4MPF A;  1V40 A;  3I6A A;  2WW1 A;  4QMK A;  5A1N B;  5DQS A;  1K0M A;  3FYG A;  1EEM A;  5F07 A;  4ZB7 A;  4F03 A;  3SWL A;  5G5E A;  2A2S A;  1LJR A;  2C3N A;  3F6D A;  2O3E A;  4EE0 A;  3VWX A;  4KGI A;  4BL7 A;  2CZ3 A;  3CRU A;  4PX1 A;  14GS A;  1GUH A;  1TU8 A;  5A5H A;  5LCZ A;  2CAI A;  4IQ1 A;  2HNL A;  4G0K A;  5DDL A;  4BL7 B;  9GSS A;  2DC5 A;  4QQ7 A;  3UVH A;  3TOU A;  1Q4J A;  2OAD A;  2GTU A;  3ZMK A;  5HFK A;  1MD4 A;  2IMI A;  1HQO A;  2PBJ A;  5J40 A;  1YJ6 A;  4HZ2 A;  4KF9 A;  2O36 A;  4KDY A;  5D9T A;  4ECI A;  1GLQ A;  2PGT A;  4K0N A;  1F2E A;  3FRC A;  3FR3 A;  4BVY B;  5ECL B;  1C72 A;  3CWG A;  1AW9 A;  1ML6 A;  2WB9 A;  4ID0 A;  4ZB9 A;  1GSD A;  3TU3 B;  1PN9 A;  1PX6 A;  3ERF A;  4GST A;  5J4Y A;  5BMU A;  2R4V A;  1DUG A;  1TDI A;  4DEJ A;  5EY6 A;  1K3Y A;  1GNW A;  5F05 A;  2VKZ G;  4WR5 A;  4LMW A;  4JZQ A;  4ZBB A;  3KM6 A;  4WR4 A;  2R3X A;  3FY7 A;  4AKX B;  5ECP B;  3EIN A;  4AKG A;  2CVD A;  3MDK A;  1Y1U A;  1M9A A;  3R2Q A;  2WS2 A;  4EDY A;  5EVO A;  5ELA A;  3HKR A;  6GSW A;  1M0U A;  2EFE A;  2EFD A;  4ZB6 A;  5B7C A;  4E68 A;  2HRK A;  2VD0 A;  4G0I A;  2VCQ A;  1AQV A;  1YDK A;  3GUR A;  3VPQ A;  3EE2 A;  4O92 A;  4IVF A;  2AB6 A;  4MK3 A;  5AIS A;  1V2A A;  1OYJ A;  3IBH A;  2HQT A;  3PPU A;  3U6V A;  3Q74 A;  1JZR A;  1MD3 A;  4ZBD A;  3ZFL A;  2HRK B;  1EV4 A;  4ISD A;  4KX4 A;  6GSS A;  4IS0 A;  2FHE A;  4Q5R A;  3PGT A;  4OFN A;  5ECM B;  1E6B A;  4J2F A;  4G01 A;  4ZXG A;  1AQX A;  2OA7 A;  1G6Y A;  5DJM A;  4YQV A;  2R5G A;  4N3Z A;  4IW9 A;  3N9J A;  5GZZ B;  4I97 A;  5AGY A;  4ECJ A;  4AI6 A;  3QAV A;  2YCD A;  3BBY A;  3LYK A;  22GS A;  5LD0 A;  3DD3 A;  3FR9 A;  4L5O A;  3LXT A;  1GUK A;  2GDR A;  3M0F A;  4MZW A;  1EOH A;  2UZ8 A;  3Q19 A;  2WVZ A;  3M3M A;  4IJI A;  4KAE A;  4G19 A;  4GLT A;  4L8E A;  5ECS A;  2UV8 G;  2F3M A;  3FR6 A;  1PKZ A;  1EV9 A;  1F3B A;  2VCT A;  2AHE A;  1SVM A;  4Q5N A;  4USS A;  4NAX A;  2X64 A;  7GSS A;  1GLP A;  2H1L A;  2GSQ A;  4YQU A;  1JLW A;  3KXO A;  2WW0 A;  5ECH B;  1K0D A;  3IR4 A;  4F0B A;  1UA5 A;  3O76 A;  4PGT A;  3IC8 A;  1HNB A;  3HJO A;  1PA3 A;  4MPG A;  5A4W A;  3L0H A;  1PD2 1;  4NHZ A;  3D0Z A;  2EFH A;  5J4V A;  3IK7 A;  4KDU A;  2VCV A;  5DAL A;  5AIV A;  4BVY A;  4G0L A;  1TU7 A;  3CRT A;  1BAY A;  4ZB8 A;  5AN1 A;  4YAV A;  1ZGN A; 
#chains in the Genus database with same CATH homology
 3CHX C;  1YEW C;  3RFR C;  4PHZ C;  4PI0 C;  4PI2 C;  3RGB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...