1F2EA

Structure of sphingomonad, glutathione s-transferase complexed with glutathione
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
201
Chain Sequence
MKLFISPGACSLAPHIALRETGADFEAVKVDLAVRKTEAGEDFLTVNPSGKVPALTLDSGETLTENPAILLYIADQNPASGLAPAEGSLDRYRLLSRLSFLGSEFHKAFVPLFAPATSDEAKAAAAESVKNHLAALDKELAGRDHYAGNAFSVADIYLYVMLGWPAYVGIDMAAYPALGAYAGKIAQRPAVGAALKAEGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Properties of a Sphingomonad and Marine Bacterium Beta-Class Glutathione S-Transferases and Crystal Structure of the Former Complex with Glutathione
rcsb
source organism Sphingomonas paucimobilis
total genus 64
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2000-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1f2eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f2eA01
3APQA 3TRPA 2PBJA 5JCUA 2TIRA 4USSA 2VOCA 3W8SA 2LRNA 4Q5RA 5DJLA 3TRQA 4WF5A 1SKRB 1AAZA 3BD2A 2JZSA 10GSA 1WWJA 2FWEA 4KH7A 1XOAA 5DALA 1EOGA 3GL5A 2P31A 1HD2A 1FHEA 4TR4A 2RIIA 2WDUA 2MYGA 3GNJA 5A4UA 5GAPD 4MDCA 4D73A 4G0IA 3KEBA 3F4RA 1SK0A 2F51A 1URMA 2YWOA 3HJMA 5CNWA 5INYA 2MZCA 4TVEA 4KSMA 2NBSA 3I43A 1V2AA 2ZUPA 1ERTA 3BBYA 3MAKA 2X8HA 3LJRA 2XPEA 4HZ2A 1DUGA 3E9JB 4G0LA 3JCML 2B5YA 2DJJA 1XOBA 4PUAA 2LRTA 3TKSA 4IHUA 5DJMA 2L59A 1CQGA 1SK2A 3UVTA 2K8VA 1AC1A 2Z9SA 3LEFA 1YEPA 4TXOB 2GZYA 3F6FA 2HSMA 1X0RA 2C1YA 1JHBA 3HZ8A 2CAQA 4D73B 1TKDB 1EEJA 4OO5A 3TKQA 2H66A 5IO0A 1EGOA 4AJ7A 3KP8A 2OBKA 1U3AA 1GUKA 3CSJA 3G7YA 4HU9A 1EV4A 2EIQA 1GSDA 6GSUA 3HCZA 2LJKA 3RHCA 4BPYA 5D9VA 3F4TA 4MK3A 1TP9A 2LUSA 4K7IA 4OO4A 1X5EA 5GAND 3FW2A 3TJFA 1XW9A 1GSSA 5F0GA 1A0RP 2E2MA 4NHZA 4IGJA 1OC9A 3DGQA 4DSSA 2C0DA 4ISDA 2MBSA 2PPTA 5DVBA 1ERWA 4LMWA 1JZDA 2VCTA 3TKRA 3UMAA 2YOIA 3DVXA 2HSMB 3GKKA 1DE1A 1PSQA 5IOWA 1SJ6A 1T1VA 2GQMA 4HI7A 5ECRB 2C0EA 2AV4A 4ACSA 2CVBA 2H8LA 2H30A 3DKSA 4X0XA 1GSEA 1VGLA 5CRWA 3DWVA 3FZ5A 1GNWA 2IWTA 4KNDA 1XWAA 4GQCA 3F63A 4AGSA 1OKTA 3MWHA 1TTZA 2LNTA 8GSSA 4POMA 2FHEA 2A4VA 1YF0A 5F07A 1VF1A 4HJ2A 4PURA 4POLA 4L5OA 3GH6A 5GSSA 2XBQA 1E2YA 4DSSB 1F37A 2YNXA 5KN1A 5IMVA 3OR5A 4DSRA 1F2EA 5GSTA 1JZWA 5JWQB 1EV9A 1GWCA 3TRXA 1PMTA 3I9V2 2HRNA 2VCXA 1OVNA 1X5DA 1LJRA 4OMVA 4F2IA 2YN1A 3ZTLA 2MMAA 2H0IA 4LL1B 3M3MA 5ID2A 2DC5A 2DBCA 4ZB6A 1F6MC 2I3YA 3M9JA 5ELAA 4DVCA 1QK8A 1UVZA 6GSSA 1SYRA 3GKMA 2HSNB 3UBLA 1Z9HA 1N8JA 4N11A 2RM5A 3CRUA 1A2LA 5CREA 3CTFA 4OCEA 3IV4A 3FYGA 1O81A 2H76A 3VWVA 4N0VA 3FRCA 1ST9A 1FVKA 1RK4A 4MF6A 4KX4A 3KXOA 1OAZA 4J57E 3H79A 1XPVA 4PQIA 2WFCA 2C0FA 3FR6A 4MA9A 2HNLA 1THOA 2V32A 4PQHA 1UN2A 1F3BA 3A5WA 4EC0A 4F9ZA 2WRTA 4HZ4A 1VF3A 12GSA 4BWSA 3IA1A 2GQLA 2WCIA 3HJPA 4FO5A 1YY7A 3NIVA 1SD8A 2RM6A 1XBSA 4N0ZA 4KA0A 4G19A 2H6ZA 2TRXA 5DAKB 2XPDA 2LQQA 2H71A 2XBIA 3FZAA 1S3AA 3D6IA 4KSOA 4OFMA 1HNAA 4I6XA 2H74A 4G10A 3H8QA 1A24A 1BYEA 3H93A 1M0UA 3EURA 3L9SA 5IMFA 3A2XA 2CX3A 5AIVA 4EF0A 1K0BA 2YPMA 4LLRA 3VI5A 3NOFA 3IE3A 2P0GA 2IIYA 1EEMA 3HHVA 3QAVA 1ABAA 3GIXA 1R5AA 1TRUA 3ERWA 4BVYB 2XC2A 2AAWA 3DEXA 3J7Yb 3DD3A 3P8WA 4QL9A 2ZCTA 3GFKA 2A2RA 1SKWB 5CAXA 4OCFA 4V2NA 2IFQA 2IMFA 1F9MA 2HRFA 3GTUA 5G1LA 1GTBA 4XHMA 5DBQA 2C8UA 4DSQA 3ZVJD 1XWBA 2IMDA 2N5FA 3WGXA 2FCHA 3ERFA 1UC7A 2FA8A 2WGRA 2AUVA 1V57A 2VL9A 4F0CA 2HZEA 1AIUA 3LQ7A 3N9JA 3BCKA 4CDOA 4P3YB 1V98A 1A23A 2YANA 2VCVA 2LKUA 4ZL9A 1ERUA 1E6BA 4IKHA 1PGTA 1ZGNA 1V9WA 2DSAA 2IFQB 2WB9A 20GSA 3QCPA 3FR3A 3ZFBA 1PQNA 4KDYA 4XS4B 3KGKA 3IAM2 3I69A 3GH9A 2NDOA 1TXXA 3PGTA 1THXA 4KW6A 2GQKA 1QUWA 2HRKB 4O5RA 2I4AA 2IN3A 2E2GA 3W8JA 2EIRA 3KZQA 4JU5A 4L0UA 2HZEB 4KCEA 1KNGA 1K0AA 4X1UA 2YJ7A 2OACA 5EL8A 4MH2A 1TU7A 4IJ3A 1M2BA 2MMZA 2NVLA 4N30A 1TRWA 1GL8A 5HFKA 4IW9A 6GSYA 3VI7A 5G5EA 3QMXA 2QGVA 4EL1A 17GSA 1TK5B 4GSSA 3PR8A 2CA8A 2BMXA 3LORA 1M99A 2C80A 3FY7A 3G7JA 2CX4A 4V2MA 2I1UA 1XXUA 4JZQA 2M46A 1SU9A 3N5OA 1QGVA 1G6WA 2YV7A 4EUYA 1U6TA 3V1WA 2KOKA 4IQAA 1Z5YE 2HYXA 5DDLA 3ZRDA 2IMEA 3GURA 3BJ5A 4GRFA 4POKA 4K0GA 2DIZA 5ABRA 3M8NA 3UEMA 3WD6A 3AY8A 3F3QA 19GSA 4IVFA 1I5GA 2H0HA 2G2QA 2L6CA 2CT6A 4X43A 4RQXA 3UJ1A 1DE2A 2JACA 2PU9C 5A5KA 5ECPB 2LV3A 3ME8A 3GKXA 2V41A 4CW9A 4TN8A 5FWGA 4WBJA 2KP2A 5IMZA 1Z3EA 1XWKA 1FOVA 5KEJA 1PL1A 2H1GA 2CV4A 3GHAA 4ZXGA 1PD21 1GUHA 3M1GA 2E0QA 2K9FA 1T4YA 4MJEA 5EY6A 4V2LA 1K0CA 2C3NA 1NM3A 4JRRA 2DJKA 4HS1A 3ERGA 1TI3A 3C1SA 1MD3A 5ECSA 4XIHA 3MSZA 5ECOB 1ZZYA 3KTBA 4MMMA 4PGTA 3IHQA 4TXVA 3LG6A 2IPAA 2FWFA 4Q5NA 5IIZA 4YAPA 3DVWA 2OBIA 1YDKA 5DALB 1QFNA 2JADA 1J9BA 4Z7XA 3GX8A 2X99A 1FB0A 2PWJA 1LU4A 3CMIA 4TR3A 4ULXA 4IBPA 1W4VA 2VLUA 4PNFA 1NSWA 3IOSA 2RUEA 2I9HA 6GSXA 5AISA 4MZCA 1WRYA 4LMVA 1X9MB 4YAVA 2QKEA 3IAS2 2BJXA 1GNEA 4ZIJA 3KTLA 1XVQA 3IC8A 5B6MA 2LS5A 4GF0A 2L5LA 2B7JA 2KP1A 1QMVA 5JCWA 2L4CA 1H4OA 3W6GA 4OWYA 4ZBDA 1WPIA 1O8XA 2IJYA 1XIYA 5IOXA 1G6YA 2BTOT 4F03A 3BCIA 2YWNA 2QSIA 14GSA 2FWGA 3LFLA 3GMFA 4WR5A 4GTUA 4O7HA 4JE1A 2WJUA 2EC4A 1SKSB 5HQPA 2N5AA 4PTSA 1PKZA 3D21A 3FZ4A 2F8FA 3GA4A 4DEJA 1AXDA 3QDNA 1RW1A 1WIKA 2H75A 3VK9A 4E8EA 4JBBA 1G0TA 11GSA 3LYPA 3IDVA 3IRAA 4MF5A 4WF4A 4NV2A 1IYHA 2WS2A 3HY2A 4IN0A 3DRNA 1J08A 3LYKA 4EVMA 2YWIA 2VCWA 5IO2A 1BG5A 2F8AA 2PMTA 1JZOA 3RBTA 1OC8A 3L4NA 5JCGA 4GWRA 16GSA 2HLSA 4XTSA 1BQ7A 1Z7PA 3TOUA 3O3TA 2VM2A 3G7IA 4BVXA 1OC9B 3IR4A 5CO3A 3TB2A 2LTKA 1R5PA 4BA7A 3EC3A 3C7MA 2B7KA 2GSRA 2GTUA 5HFIA 2MBTA 4HUAA 3CXGA 2B5EA 1SL0B 1SK1A 3D5JA 4XS1A 2CVDA 3QAGA 3IBHA 1RQMA 4KB3A 4JR4A 1GSUA 4QL7A 5ECLB 22GSA 4ZB8A 3HVXA 4TW5A 2JL4A 3D4TA 4TR1A 3SBCA 2CVKA 1GRXA 3ZVJA 3APSA 2RLIA 2ZNMA 4FIWA 5ENUA 4EKZA 1XCCA 5JWRB 5B7CA 5F8BA 2L6DA 2LRCA 4KAEA 3LWAA 1M2AA 3QPMA 2CZ2A 3G9BA 3EMXA 2HXKA 5E4WA 3FKFA 4OFNA 4ECJA 4K7OA 1WJKA 1QQ2A 2GS3A 3UIWA 9GSSA 3SWLA 6GSVA 4KDUA 1K0OA 3ZITA 3M0FA 2VL2C 3GX0A 1U3IA 5ECQB 2AHEA 2FNOA 2AYTA 3C73A 5ID2B 1Z7RA 2B6MA 1IYIA 4F82A 2V6KA 3UAPA 5HR3A 1GP1A 2GVPA 2LSTA 1EOHA 3CBUA 2G0FA 4WKWA 1JLVA 3HYPA 4HU7A 4WETA 1B4PA 3C8EA 3IC4A 5GZZB 4RUVA 4EDZA 2KLXA 3WT1A 3VFIA 4IS0A 2FGXA 1SENA 4F0BA 2VCQA 1MDIA 2PUKC 4QQ7A 2K8SA 4MF7A 5CYYA 4MABA 3A2VA 1XWCA 2GLRA 4PNGA 4HOJA 1BX9A 1GLQA 4MCUA 3KH9A 2FA4A 1TK0B 2H6XA 2B3SA 1TW9A 3FHKA 3PINA 1G7OA 2DMLA 1Q98A 3KM6A 5EVOA 1DSBA 1R26A 5IPGA 4RI6A 3HVSA 4ECCA 4IP1A 4RI7A 3UBKA 2JZRA 2NPBA 1ZCPA 2GZPA 1O7UA 1OE7A 2XHFA 3VLNA 4I2TA 3CSHA 4K6XA 1T3BA 1K3YA 1JLWA 3P90A 3DXBA 4TOPA 4OD7A 1NW2A 1TRVA 1YF1A 2R2JA 2JSZA 3QD9A 1YZXA 1MEKA 4IQ1A 1DBYA 3ZMKA 4HDEA 4NAXA 3RPPA 1K0DA 1H75A 2HE3A 4GXZA 3US3A 2CZ3A 3CRTA 3GN3A 2LJAA 4JR6A 2VL3A 4I5QA 5G2ZA 1EWXA 3KIJA 6GSTA 3EMPA 1O6JA 4V1Ap 1V40A 1EP8A 1K0NA 5J41A 3GTUB 4PX1A 1SL2B 5KN2A 1KBNA 4ZBBA 1NHYA 4N10A 2LEGA 1K3OA 1SL1B 3IPZA 5CRGA 4GLTA 4HQZA 5HFGA 1M2DA 1SYXA 3IXRA 1A2JA 5IMCA 3VWUA 4KUNA 1PL2A 4POBA 5B6NA 2O87A 4Q5QA 3WGDA 4H86A 1U88A 3H1NA 2M80A 3TOTA 4I2UA 2PGTA 4NWYA 5G1KA 1FO5A 4PXOA 2H1AA 2OA7A 3ED3A 3KH7A 4L0WA 2LNSA 2DJ1A 2FWHA 1B8XA 3U5RE 3ZLPA 5ECHB 3KCMA 4PQ1A 1YQ1A 2VLTA 2FLSA 3CYNA 2X8CA 2HQTA 1FAAA 4J2FA 3TJJA 3ZZXA 4TKYA 2YP6A 5C00A 4WXTA 3UOMA 5CP1A 1M9AA 4ECIA 3HDCA 4ML1A 1GTIA 3Q18A 3L0HA 1R7HA 5IQYA 5EPFA 4FYUA 1A2MA 5ECMB 5DCGA 1K0MA 3D0ZA 4KGIA 2YJHA 2FUG2 1GTAA 4ZBAA 1WMJA 1ZYEA 3WGEA 3J7Yk 2M72A 2YZHA 3CTGA 5C04A 3ZREA 3C71A 1O73A 3TJKA 4K0NA 3APOA 2HSHA 3E0UA 2DMMA 2VM1A 5A4VA 1X5CA 1FB6A 5KN3A 1BAYA 1GUMA 4MJCA 5F06A 4PUFC 4K9ZA 2ON5A 1ILOA 1PX6A 5ECKB 4MZBA 4I97A 4HEA2 4RQRA 2VAFA 2H73A 3NZNA 4WR4A 3WT2A 4MJAA 3HKRA 2K6VA 1FVJA 2JSYA 1MD4A 1ERVA 5LD0A 1AW9A 1TI1A 3O76A 1OYJA 3RPNA 2A2SA 4TXOA 2PN8A 2O8VB 1KEBA 1B4QA 4ZL8A 2ON7A 4BL7A 3HVVA 3ZFLA 2H01A 1HNBA 3MNGA 3Q74A 3F9UA 1USBA 4ID0A 4ML6A 5FHIA 1GLPA 3VWXA 2NTOA 1YKCA 2X64A 4KF9A 1MDJA 4O92A 1XFLA 3ZIVA 3HZ4A 1Q4JA 3GV1A 1GH2A 4K7NA 5HR2A 1B48A 1W89A 3WYWA 3R2QA 3EINA 5BMUA 3VURA 2H1BA 3ZIJA 3RHBA 2E7PA 1J0FA 1HNCA 2KUCA 2FD3A 3IK9A 2IL3A 18GSA 2DJ3A 5J9BA 5HR1A 1JZRA 4ZILA 5AIXA 2B5XA 5HR0A 2L57A 1ZOFA 3L78A 2KHPA 2V1MA 3EE2A 3UARA 5A4WA 4G2EA 1XWGA 1AQVA 1WOUA 5J4UA 3FR9A 4BL7B 1AQXA 4NPBA 2HRAA 4MH3A 1T7PB 1SD9A 3LXZA 3ISOA 2VD0A 2VD1A 2UZ8A 1PN9A 3VPQA 3R3EA 2P5RA 13GSA 1XW5A 4L5LA 4IELA 2YWMA 1BJXA 1B9XC 1WP0A 2X8GA 3L9VA 5J5NA 1FW1A 3QFBC 2LJRA 5H5RA 4WEYA 3TUEA 3GSTA 2HZFA 5D73A 1AQWA 3EWLA 3F3RA 3FK8A 4NHWA 1V58A 1NHOA 1LBKA 1M9BA 4HQSA 2WZ9A 3EU4A 1OE8A 2REMA 2MMNA 3QR6A 4YQMA 2EIOA 2HT9A 1TJDA 5IPHA 3GSSA 3H4KA 3D22A 1OKDA 4J56E 1M7TA 1T4ZA 4L8EA 2J9HA 5D8IA 3Q6OA 5DQYA 2YZUA 5LCZA 2WULA 3ZL5A 2R3XA 3TKSE 1T00A 2RUFA 3F6DA 1PX7A 2H0GA 3L9UA 3I6AA 5E59A 3TKPA 4MP4A 1TOFA 5L71A 2N5BA 4IJIA 2VUPA 3DIEA 4HJMA 4EO3A 3HD5A 5J9CA 3RAZA 1VF4A 4K1FA 3EYTA 4WBRD 3HA9A 4LL4B 4GSNA 1PA3A 4AJ6A 1XW6A 1PKWA 1PRXA 2H6YA 1EZKA 5IM9A 2C3TA 2OE3A 2JU5A 4XRAA 1JFUA 5LNKe 4E8HA 3ME7A 4TRXA 2O85A 1S3DA 1TDIA 2F9SA 4IP6A 1EGRA 4EDYA 5DAKA 5FT3A 2C4JA 5AGYA 5F05A 4BVXB 5D9WA 5ECNB 6GSWA 4G0KA 2GSQA 5D93A 3IK7A 4GCIA 2CQ9A 4NMUA 5H5QA 4AJ8A 1CQHA 5B8AA 4YH2A 5COHA 1MDKA 2TRCP 2O7KA 2B1KA 2CAIA 1B9YC 1HQOA 2B1LA 2HFDA 4ECBA 3C1RA 3DMLA 5D96A 2OKAA 3FEUA 1SJIA 2FY6A 1GULA 3GRXA 4TR1B 2K18A 2VLVA 2YCDA 3UL3A 4BVYA 3F0IA 1FG4A 3MDKA 2R5GA 4GQFA 5IMDA 1TU8A 2OE1A 5B8BA 1Z6NA 4XRDA 2QC7A 1ZMAA 3CSIA 3D4MA 5DQSA 4NXIA 1F3AA 1VRSD 4AF2A 2GT6A 2AB6A 5CRDA 2MMOA 3S9FA 4O32A 1A0FA 5DCHA 1YKAA 2R4VA 3Q19A 4CHSA 3TDGA 3LSZA 1QXHA 3BOAA 3P2AA 1GSFA 4G9HA 4JEDA 2L5OA 1GSQA 3GL3A 2PVOC 3FZ9A 2HSYA 4FYCA 2VIMA 4FH8A 5G31A 3P7XA 2C0GA 1AUCA 3KD0A 3GYKA 2DJ0A 1BEDA 2VCZA 3M9KA 4KDXA 1SJZA 5CRHA 3TCOA 5KN0A 1KTEA 2GZZA 4GSTA 4MPFA 4LA1A 1ZL9A 2YV9A 4BWQA 1HYUA 3PH9A 5D9TA 4XS6A 2GT5A 4XS4A 4EE0A 2H1DA 3ZYWA 3F8UA 5D9XA 1N2AA 1S3CA 3TKSC 3TJGA 2HRKA 4NV5A 1EP7A 2GGTA 4FYBA 3A2WA 1XZOA 5H5SA 4EXJA 3PPUA 2F3MA 2H19A 2DLXA 2O89A 3HJOA 3VWWA 4XCSA 3GKNA 2I81A 3LGCA 5G5FA 2C3QA 4MJBA 1WE0A 1U87A 1R4WA 1OC3A 1ML6A 2JZTA 3E3EA 2J23A 2P5QA 1YJ6A 1T8EB 4ILFA 1TRSA 1UA5A 3LXTA 2R37A 1X9SB 1K3LA 5G30A 1GTUA 4MLYA 1ON4A 4I8BA 2ALBA 3GUSA 4OFTA 1YEXA 3EVIA 5ECIB 5J3RA 4ZB9A 2V6OA 3F4SA 1XVWA 4YQVA 3KMNA 3QFAC 2OE0A 1Z6MA 1A8YA 4K8MA 2LQOA 3K8NA 4FQUA 4ZL7A 3QAWA 2H72A 1ACVA 1I9DA 2OADA 3EU3A 1GSYA 3U6VA 4TR0A 4Q5FA 3KJYA 4KCAA 4KE3A 4YQUA 5IMAA 1X9WB 3HXSA 7GSSA 2DIYA 3VPTA 1O85A 2D2ZA 2AJQB 1Y6EA 3KMOA 2OJLA 2VL2A 4K2DA 1MTCA 2HI7A 1Y25A 2H70A 2GDRA 1ZYQB 4MPGA 2PVQA 1VF2A 3TJBA 4V1Ag 2DJ2A 3A3TA 1TK8B 3O6TA 3RDWA 5ELGA 2R6KA 5AN1A 2V2GA 3UVHA 1G7EA 2PERA 2IMIA 3KP9A 1C72A 1O8WA 1A8LA 2ES7A 2L4QA 3ZMLA 2IMKA 4MZWA 3QOUA 2VO4A 2GSSA 3DYRA 3TGZA 2GSTA 5JWOB
chains in the Genus database with same CATH superfamily
3APQA 1S3RA 3HMJG 3TRPA 2PBJA 5JCUA 2TIRA 4USSA 2VOCA 3W8SA 2LRNA 4Q5RA 5DJLA 3TRQA 4WF5A 1SKRB 1AAZA 3BD2A 2JZSA 10GSA 1WWJA 2FWEA 4KH7A 1XOAA 5DALA 1EOGA 3GL5A 2WW0A 2P31A 1HD2A 1FHEA 4TR4A 2RIIA 2WDUA 2MYGA 3GNJA 5A4UA 5GAPD 4MDCA 4D73A 4G0IA 3KEBA 3F4RA 1SK0A 2F51A 1URMA 2YWOA 3HJMA 5CNWA 5INYA 2MZCA 4TVEA 4KSMA 2NBSA 3I43A 1V2AA 2O3EA 2O5VA 2ZUPA 1ERTA 3BBYA 3MAKA 1M3IA 2X8HA 3LJRA 2XPEA 4HZ2A 1DUGA 3E9JB 4G0LA 3JCML 2B5YA 2DJJA 1XOBA 4PUAA 2LRTA 3TKSA 4IHUA 5DJMA 1S4BP 2L59A 1CQGA 1SK2A 3UVTA 2K8VA 1AC1A 2Z9SA 3LEFA 1YEPA 4TXOB 2GZYA 3F6FA 2HSMA 1X0RA 2C1YA 1JHBA 3HZ8A 2CAQA 4D73B 1TKDB 1EEJA 4OO5A 3TKQA 2H66A 5IO0A 1EGOA 4AJ7A 3KP8A 2OBKA 1U3AA 1GUKA 3CSJA 3G7YA 4HU9A 1EV4A 2EIQA 1GSDA 6GSUA 3HCZA 2LJKA 3CHXC 3RHCA 4BPYA 5D9VA 2A2PA 3F4TA 4MK3A 1TP9A 2LUSA 5A5HB 4K7IA 4OO4A 1X5EA 5GAND 3FW2A 3TJFA 1XW9A 5BRTA 1GSSA 5F0GA 1A0RP 2E2MA 4NHZA 4IGJA 1OC9A 3DGQA 4DSSA 2C0DA 4ISDA 2MBSA 2PPTA 5DVBA 1ERWA 4LMWA 1JZDA 2VCTA 3TKRA 3UMAA 2YOIA 3DVXA 2HSMB 3GKKA 1DE1A 1PSQA 5IOWA 1SJ6A 1T1VA 2GQMA 4HI7A 5ECRB 2C0EA 2AV4A 4ACSA 2CVBA 2H8LA 2H30A 3DKSA 4X0XA 1GSEA 1VGLA 5CRWA 3DWVA 3FZ5A 1GNWA 2IWTA 2R0PA 4KNDA 1XWAA 2HSNA 4GQCA 3F63A 4AGSA 1OKTA 3MWHA 1TTZA 3MYDA 2LNTA 8GSSA 4POMA 2FHEA 2A4VA 1YF0A 5F07A 1VF1A 4HJ2A 4PURA 4POLA 4L5OA 3GH6A 5GSSA 2XBQA 1E2YA 4DSSB 1F37A 2YNXA 5KN1A 5IMVA 3OR5A 4DSRA 1F2EA 5GSTA 1JZWA 5JWQB 1EV9A 1GWCA 3TRXA 1PMTA 3I9V2 2HRNA 2R0GA 2VCXA 1OVNA 1X5DA 1LJRA 4OMVA 1Y1UA 4F2IA 2YN1A 3ZTLA 2MMAA 2H0IA 4LL1B 3M3MA 5ID2A 2DC5A 2DBCA 4ZB6A 1F6MC 2I3YA 3M9JA 5ELAA 4DVCA 4E68A 1QK8A 1UVZA 6GSSA 5J47A 1SYRA 3GKMA 4YKGA 2HSNB 3UBLA 1Z9HA 1N8JA 4N11A 2RM5A 3CRUA 1SVMA 1A2LA 5CREA 3CTFA 4OCEA 3IV4A 3FYGA 1O81A 2H76A 3VWVA 4N0VA 3FRCA 1ST9A 1FVKA 1RK4A 4MF6A 4KX4A 3KXOA 4CY6A 1OAZA 4J57E 3H79A 1XPVA 4PQIA 2WFCA 2C0FA 3FR6A 4MA9A 2HNLA 1THOA 2V32A 4PQHA 1UN2A 1F3BA 3A5WA 4HSCX 4EC0A 2EFHA 4F9ZA 2WRTA 4HZ4A 4PI0C 1VF3A 12GSA 4BWSA 3IA1A 2GQLA 2WCIA 3HJPA 4FO5A 1YY7A 3NIVA 1SD8A 2RM6A 1XBSA 4N0ZA 4KA0A 4G19A 2H6ZA 2TRXA 5DAKB 2XPDA 2LQQA 2H71A 2XBIA 3FZAA 1S3AA 3D6IA 4KSOA 4OFMA 1HNAA 4I6XA 2H74A 4G10A 3H8QA 1A24A 1BYEA 3H93A 1M0UA 3EURA 3L9SA 5IMFA 3A2XA 2CX3A 5AIVA 4EF0A 1K0BA 2YPMA 4LLRA 3VI5A 3NOFA 3IE3A 2P0GA 4BIKA 2IIYA 5KOWA 1EEMA 3HHVA 3QAVA 1ABAA 3GIXA 1R5AA 1TRUA 3ERWA 4BVYB 2XC2A 2AAWA 3DEXA 3J7Yb 3DD3A 3P8WA 4EIPA 4QL9A 2ZCTA 3GFKA 2A2RA 1SKWB 5CAXA 4OCFA 4V2NA 2IFQA 2IMFA 1F9MA 2HRFA 3GTUA 5G1LA 1GTBA 4XHMA 5DBQA 2C8UA 4DSQA 3ZVJD 1XWBA 2IMDA 2N5FA 3WGXA 2FCHA 3ERFA 1UC7A 2FA8A 2WGRA 2AUVA 1V57A 2VL9A 4O5UA 4F0CA 4ICYA 2HZEA 1AIUA 3LQ7A 3N9JA 3BCKA 4CDOA 4P3YB 1V98A 1A23A 2YANA 2VCVA 2LKUA 4ZL9A 1ERUA 1E6BA 4IKHA 1PGTA 1ZGNA 1V9WA 2DSAA 2WVYA 2IFQB 2WB9A 20GSA 3QCPA 3FR3A 3ZFBA 1PQNA 4KDYA 4XS4B 2WW2A 3KGKA 3IAM2 3I69A 3GH9A 2NDOA 1TXXA 3PGTA 1THXA 4KW6A 2GQKA 1QUWA 2HRKB 4O5RA 2I4AA 2IN3A 2E2GA 2EFCA 3W8JA 2EIRA 3KZQA 4JU5A 4L0UA 2HZEB 4KCEA 1KNGA 1K0AA 4X1UA 2YJ7A 2OACA 5EL8A 4G01A 4MH2A 1TU7A 4IJ3A 1M2BA 2MMZA 2NVLA 4N30A 1TRWA 1GL8A 5HFKA 4IW9A 6GSYA 3VI7A 5G5EA 3QMXA 2QGVA 4EL1A 17GSA 1TK5B 4GSSA 3PR8A 2CA8A 2BMXA 3LORA 1M99A 2C80A 3FY7A 3G7JA 2CX4A 4V2MA 2I1UA 1XXUA 4JZQA 2M46A 1SU9A 3N5OA 4ZB7A 1QGVA 1G6WA 2YV7A 4EUYA 1U6TA 3V1WA 2KOKA 4IQAA 4Z2TA 1Z5YE 2HYXA 5DDLA 3ZRDA 2IMEA 3GURA 3BJ5A 4GRFA 2WZSA 4POKA 4K0GA 2DIZA 5ABRA 3M8NA 3UEMA 4W66A 3WD6A 3AY8A 3F3QA 1SVOA 19GSA 4IVFA 1I5GA 2H0HA 2G2QA 2L6CA 2CT6A 4X43A 4RQXA 3UJ1A 1DE2A 2JACA 2PU9C 5A5KA 5ECPB 2LV3A 3ME8A 3GKXA 2V41A 4CW9A 4TN8A 5FWGA 4WBJA 2KP2A 5IMZA 1Z3EA 1XWKA 1FOVA 5KEJA 2OT3A 1PL1A 2H1GA 2CV4A 3GHAA 4ZXGA 1PD21 1GUHA 3M1GA 2E0QA 2EFDA 2K9FA 1T4YA 4MJEA 5EY6A 4V2LA 4AKXB 1K0CA 2C3NA 1NM3A 4JRRA 4X4JA 2DJKA 4HS1A 3ERGA 1TI3A 3C1SA 1MD3A 5ECSA 4XIHA 3MSZA 5ECOB 1ZZYA 3KTBA 4MMMA 4PGTA 3IHQA 4TXVA 3LG6A 2IPAA 2FWFA 4Q5NA 5IIZA 1BG1A 5A1NA 4YAPA 2VKZG 3DVWA 2OBIA 1YDKA 5DALB 1QFNA 2JADA 1J9BA 4Z7XA 3GX8A 2X99A 1FB0A 2PWJA 1LU4A 3CMIA 4TR3A 4ULXA 4IBPA 1W4VA 2VLUA 4PNFA 3IOSA 1NSWA 2RUEA 2I9HA 6GSXA 5AISA 4MZCA 1WRYA 4LMVA 1X9MB 4YAVA 2QKEA 3IAS2 2BJXA 1GNEA 4ZIJA 3KTLA 4AKHA 1XVQA 3IC8A 5B6MA 2LS5A 4GF0A 2L5LA 2B7JA 2KP1A 1QMVA 5JCWA 2L4CA 1H4OA 3W6GA 4OWYA 4ZBDA 1WPIA 1O8XA 2IJYA 1XIYA 5IOXA 1G6YA 2BTOT 4F03A 3BCIA 2YWNA 2QSIA 14GSA 2FWGA 3LFLA 3GMFA 4WR5A 4GTUA 4O7HA 4JE1A 2WJUA 2EC4A 1SKSB 5HQPA 2N5AA 4PTSA 1PKZA 3D21A 3FZ4A 2F8FA 3GA4A 4DEJA 3HVNA 1AXDA 3QDNA 1RW1A 1WIKA 2H75A 3VK9A 2DKHA 4E8EA 4JBBA 1G0TA 11GSA 3LYPA 1N25A 3TU3B 3IDVA 3IRAA 4MF5A 4WF4A 4NV2A 1IYHA 2WS2A 3HY2A 4IN0A 3DRNA 1J08A 3LYKA 4AI6A 4EVMA 2YWIA 2VCWA 5IO2A 1BG5A 4MNNA 2F8AA 2PMTA 1JZOA 3RBTA 1OC8A 3L4NA 5JCGA 4GWRA 16GSA 2HLSA 4XTSA 1BQ7A 1Z7PA 3TOUA 3O3TA 2VM2A 3G7IA 4BVXA 1OC9B 3IR4A 5CO3A 3TB2A 2LTKA 1R5PA 4BA7A 3EC3A 3C7MA 2B7KA 2GSRA 2GTUA 5HFIA 2MBTA 1YVLA 4HUAA 3CXGA 2B5EA 1SL0B 1SK1A 3D5JA 4XS1A 2CVDA 3QAGA 3IBHA 1RQMA 4KB3A 4Z2RA 4JR4A 1GSUA 4QL7A 5ECLB 22GSA 4ZB8A 3HVXA 4TW5A 2JL4A 5A34A 3D4TA 4TR1A 3SBCA 2CVKA 1GRXA 3ZVJA 3APSA 2RLIA 2ZNMA 4FIWA 5ENUA 4EKZA 1XCCA 5JWRB 5B7CA 5F8BA 2L6DA 2LRCA 4KAEA 3LWAA 1M2AA 3QPMA 2CZ2A 3G9BA 3EMXA 2HXKA 5E4WA 3FKFA 4EIQA 4OFNA 4ECJA 4K7OA 4PHZC 1WJKA 1QQ2A 2GS3A 3UIWA 9GSSA 3SWLA 6GSVA 4KDUA 1K0OA 3ZITA 3M0FA 2VL2C 3GX0A 1U3IA 5ECQB 2AHEA 2FNOA 2AYTA 3C73A 4CY8A 5ID2B 1Z7RA 2B6MA 3CWGA 1IYIA 5A34B 4F82A 2V6KA 3UAPA 5HR3A 1GP1A 2GVPA 2LSTA 2WVXA 1EOHA 3CBUA 2G0FA 4WKWA 1JLVA 3HYPA 4HU7A 4WETA 1B4PA 3C8EA 3IC4A 5GZZB 4RUVA 4EDZA 2KLXA 3WT1A 3VFIA 4IS0A 2FGXA 1SENA 4F0BA 2VCQA 1MDIA 2PUKC 4QQ7A 2K8SA 4MF7A 5CYYA 4MABA 3A2VA 2X49A 2A4HA 1XWCA 2GLRA 4PNGA 4HOJA 1BX9A 1GLQA 3CQFA 4MCUA 3KH9A 3MIXA 2FA4A 1TK0B 2H6XA 2B3SA 1TW9A 3FHKA 3PINA 1G7OA 2DMLA 1Q98A 3KM6A 5EVOA 1DSBA 1R26A 5IPGA 4RI6A 3HVSA 4ECCA 4N3ZA 4IP1A 4RI7A 3UBKA 2JZRA 2NPBA 1ZCPA 2GZPA 1O7UA 1OE7A 2XHFA 2WVXB 3VLNA 4I2TA 4GDFA 3CSHA 4K6XA 1T3BA 1K3YA 1JLWA 3P90A 4K2XA 3DXBA 4TOPA 4OD7A 1NW2A 1TRVA 1YF1A 2R2JA 2JSZA 3QD9A 4FXYP 1YZXA 1MEKA 4YKFA 4IQ1A 2UV8G 1DBYA 3ZMKA 4HDEA 4NAXA 3RPPA 1K0DA 1H75A 2HE3A 4GXZA 3US3A 2CZ3A 3CRTA 3GN3A 2LJAA 4JR6A 2VL3A 4I5QA 5G2ZA 1EWXA 3KIJA 6GSTA 3EMPA 1O6JA 4V1Ap 1V40A 1EP8A 1K0NA 5J41A 3GTUB 4PX1A 1SL2B 5KN2A 1KBNA 4ZBBA 1NHYA 4N10A 2LEGA 1K3OA 1SL1B 3IPZA 5CRGA 4GLTA 4HQZA 5HFGA 1M2DA 1SYXA 5J4YA 3IXRA 1A2JA 5IMCA 3VWUA 4KUNA 1PL2A 4POBA 5B6NA 2O87A 4Q5QA 3WGDA 4H86A 1U88A 3H1NA 2M80A 4Z2UA 3TOTA 4I2UA 2PGTA 4NWYA 5G1KA 1FO5A 2QA1A 4PXOA 2H1AA 2OA7A 3ED3A 4AKGA 3KH7A 4L0WA 1M3JA 2LNSA 2DJ1A 2FWHA 1B8XA 3U5RE 3ZLPA 5ECHB 3KCMA 4PQ1A 1YQ1A 2VLTA 2FLSA 3CYNA 2X8CA 2DKIA 2HQTA 1FAAA 4J2FA 3TJJA 3ZZXA 4TKYA 2YP6A 5C00A 4WXTA 3UOMA 5CP1A 1M9AA 4ECIA 3HDCA 4ML1A 4K5SA 1GTIA 1PFOA 3Q18A 3L0HA 1R7HA 5IQYA 5EPFA 4FYUA 1A2MA 5J40A 1TXUA 5ECMB 5DCGA 1K0MA 3D0ZA 4KGIA 2YJHA 2FUG2 1GTAA 4ZBAA 1WMJA 1ZYEA 3WGEA 3J7Yk 2M72A 2YZHA 3CTGA 5C04A 3ZREA 3C71A 1O73A 3TJKA 4K0NA 3APOA 2HSHA 3EPTA 3E0UA 2DMMA 2VM1A 5A4VA 1X5CA 1FB6A 5KN3A 1BAYA 1GUMA 4MJCA 5F06A 4PUFC 4K9ZA 2ON5A 1ILOA 1PX6A 5ECKB 4MZBA 4I97A 4HEA2 4RQRA 2VAFA 2H73A 3NZNA 4WR4A 3WT2A 4MJAA 3HKRA 2K6VA 1FVJA 2JSYA 1MD4A 1ERVA 5LD0A 1AW9A 1TI1A 3O76A 1OYJA 3RPNA 2A2SA 4TXOA 2PN8A 2O8VB 1KEBA 1B4QA 4ZL8A 2ON7A 2WW3A 2EFEA 4BL7A 3HVVA 3ZFLA 2H01A 1HNBA 3MNGA 3Q74A 3F9UA 1USBA 4ID0A 4ML6A 5FHIA 1GLPA 3VWXA 2NTOA 1YKCA 2X64A 4KF9A 2WW1A 1MDJA 4O92A 1XFLA 3RFRC 3HZ4A 3ZIVA 1Q4JA 5A5HA 1GH2A 3GV1A 4K7NA 5HR2A 1B48A 1W89A 3WYWA 3R2QA 3EINA 5BMUA 3VURA 2H1BA 3ZIJA 3RHBA 2E7PA 1J0FA 1HNCA 2KUCA 2FD3A 3IK9A 2IL3A 18GSA 2DJ3A 5J9BA 5HR1A 1JZRA 4ZILA 5AIXA 2B5XA 5HR0A 2L57A 1ZOFA 3L78A 2KHPA 3FMWA 2V1MA 3EE2A 3UARA 5A4WA 4G2EA 1XWGA 1AQVA 1WOUA 5J4UA 3FR9A 4BL7B 1AQXA 4NPBA 2HRAA 4MH3A 1T7PB 1SD9A 3LXZA 3ISOA 2VD0A 2VD1A 2WVZA 2UZ8A 1PN9A 3VPQA 3R3EA 2P5RA 13GSA 5A1NB 1XW5A 4L5LA 4IELA 2YWMA 1BJXA 1B9XC 5KOXA 1WP0A 2X8GA 3L9VA 5J5NA 5BMUB 1FW1A 3QFBC 2LJRA 5H5RA 4WEYA 3TUEA 3GSTA 2HZFA 5D73A 1AQWA 3EWLA 3F3RA 3FK8A 4NHWA 1V58A 1NHOA 1LBKA 1M9BA 4HQSA 2WZ9A 3EU4A 1OE8A 2REMA 2MMNA 3QR6A 4YQMA 2EIOA 2HT9A 1TJDA 5IPHA 3GSSA 3H4KA 3D22A 1OKDA 4J56E 1M7TA 1T4ZA 4L8EA 2J9HA 5D8IA 3Q6OA 5DQYA 2YZUA 5LCZA 2WULA 3ZL5A 2R3XA 3TKSE 2X4AA 1T00A 2RUFA 3F6DA 1PX7A 2H0GA 3L9UA 3I6AA 5E59A 3TKPA 4MP4A 1TOFA 5L71A 2N5BA 4IJIA 2QA2A 2VUPA 3DIEA 4HJMA 4EO3A 3HD5A 5J9CA 3RAZA 1VF4A 1BF5A 4K1FA 3EYTA 4WBRD 3HA9A 4LL4B 4GSNA 1PA3A 4AJ6A 1XW6A 1ZYPA 1PKWA 1PRXA 2H6YA 1EZKA 5IM9A 2C3TA 2OE3A 2JU5A 4XRAA 1JFUA 5LNKe 4E8HA 3ME7A 4TRXA 2O85A 1S3DA 1TDIA 3LW9A 2F9SA 4IP6A 1EGRA 4EDYA 5DAKA 5FT3A 2C4JA 5AGYA 5F05A 4BVXB 5D9WA 5ECNB 6GSWA 4G0KA 2GSQA 5D93A 3IK7A 4GCIA 2CQ9A 4NMUA 1SVLA 5H5QA 4AJ8A 1CQHA 5B8AA 1ZYNA 4YH2A 5COHA 1MDKA 2TRCP 2O7KA 2B1KA 2CAIA 1B9YC 1HQOA 2B1LA 2HFDA 4ECBA 3C1RA 3DMLA 5D96A 2OKAA 3FEUA 1SJIA 2FY6A 1GULA 3GRXA 4TR1B 2K18A 2VLVA 2YCDA 1I1IP 3UL3A 4BVYA 3F0IA 1FG4A 3MDKA 2R5GA 4GQFA 5IMDA 1TU8A 2OE1A 5B8BA 2H1LA 1Z6NA 4XRDA 2QC7A 4AKIA 1ZMAA 3CSIA 3D4MA 5DQSA 4NXIA 1F3AA 1VRSD 4AF2A 2GT6A 2AB6A 5CRDA 2MMOA 3IHGA 3S9FA 4O32A 1A0FA 5DCHA 1YKAA 2R4VA 3Q19A 4CHSA 3TDGA 3LSZA 1QXHA 3BOAA 3P2AA 1GSFA 4G9HA 4JEDA 2L5OA 1GSQA 3GL3A 2PVOC 3FZ9A 2HSYA 4FYCA 2VIMA 2O36A 4FH8A 5G31A 1YEWC 3P7XA 2C0GA 1AUCA 3KD0A 3RGBC 2DJ0A 3GYKA 1BEDA 2VCZA 3M9KA 4KDXA 1SJZA 5CRHA 4QMKA 3TCOA 5KN0A 1KTEA 2GZZA 5J4VA 4GSTA 4MPFA 4LA1A 1ZL9A 2YV9A 4BWQA 1XG8A 1HYUA 3PH9A 5D9TA 4XS6A 2GT5A 4XS4A 4EE0A 2H1DA 3ZYWA 3F8UA 4O5QA 5D9XA 1N2AA 1S3CA 3TKSC 3TJGA 2HRKA 4NV5A 1EP7A 2GGTA 4FYBA 1PN0A 3A2WA 1XZOA 5H5SA 4EXJA 3PPUA 2F3MA 2H19A 2DLXA 2O89A 3HJOA 3VWWA 4XCSA 3GKNA 2I81A 3LGCA 5G5FA 2C3QA 4MJBA 1WE0A 1U87A 1R4WA 1OC3A 1ML6A 2JZTA 3E3EA 2J23A 2P5QA 1YJ6A 1T8EB 4ILFA 1TRSA 1UA5A 3LXTA 2R37A 1X9SB 1K3LA 5G30A 1GTUA 4MLYA 1ON4A 4I8BA 2ALBA 3GUSA 4OFTA 1YEXA 3EVIA 5ECIB 5J3RA 4ZB9A 2V6OA 3F4SA 1XVWA 4YQVA 3KMNA 3QFAC 2OE0A 4K5RA 1Z6MA 1A8YA 4A5PA 4K8MA 2LQOA 3K8NA 4FQUA 4ZL7A 3QAWA 2H72A 1ACVA 1I9DA 2OADA 3EU3A 1GSYA 3U6VA 4TR0A 4Q5FA 3KJYA 4KCAA 4KE3A 4YQUA 5IMAA 1X9WB 3HXSA 7GSSA 2DIYA 3VPTA 1O85A 4PI2C 1FOHA 2D2ZA 2AJQB 1Y6EA 3KMOA 2OJLA 2VL2A 4K2DA 1MTCA 2HI7A 3A5IA 1Y25A 2H70A 2GDRA 1ZYQB 4MPGA 2PVQA 1VF2A 3TJBA 4V1Ag 2DJ2A 3A3TA 1TK8B 3O6TA 3RDWA 5ELGA 2R6KA 5AN1A 2V2GA 3UVHA 2R0CA 1G7EA 2PERA 2IMIA 3KP9A 1C72A 1O8WA 1A8LA 2ES7A 2L4QA 3ZMLA 2IMKA 4MZWA 3QOUA 2VO4A 2GSSA 3DYRA 3TGZA 2GSTA 5JWOB
chains in the Genus database with same CATH topology
3APQA 3HMJG 3TRPA 2PBJA 5JCUA 2TIRA 4USSA 2VOCA 3W8SA 2LRNA 4Q5RA 5DJLA 3TRQA 4WF5A 1SKRB 1AAZA 3BD2A 2JZSA 10GSA 1WWJA 2FWEA 4KH7A 1XOAA 5DALA 1EOGA 3GL5A 2P31A 1HD2A 1FHEA 4TR4A 2RIIA 2WDUA 2MYGA 3GNJA 5A4UA 5GAPD 4MDCA 4D73A 4G0IA 3KEBA 3F4RA 1SK0A 2F51A 1URMA 2YWOA 3HJMA 5CNWA 5INYA 2MZCA 4TVEA 4KSMA 2NBSA 3I43A 1V2AA 2O5VA 2ZUPA 1ERTA 3BBYA 3MAKA 2X8HA 3LJRA 2XPEA 4HZ2A 1DUGA 3E9JB 4G0LA 3JCML 2B5YA 2DJJA 1XOBA 4PUAA 2LRTA 3TKSA 4IHUA 5DJMA 2L59A 1CQGA 1SK2A 3UVTA 2K8VA 1AC1A 2Z9SA 3LEFA 1YEPA 4TXOB 2GZYA 3F6FA 2HSMA 1X0RA 2C1YA 1JHBA 3HZ8A 2CAQA 4D73B 1TKDB 1EEJA 4OO5A 3TKQA 2H66A 5IO0A 1EGOA 4AJ7A 3KP8A 2OBKA 1U3AA 1GUKA 3CSJA 3G7YA 4HU9A 1EV4A 2EIQA 1GSDA 6GSUA 3HCZA 2LJKA 3RHCA 4BPYA 5D9VA 2A2PA 3F4TA 4MK3A 1TP9A 2LUSA 5A5HB 4K7IA 4OO4A 1X5EA 5GAND 3FW2A 3TJFA 1XW9A 5BRTA 1GSSA 5F0GA 1A0RP 2E2MA 4NHZA 4IGJA 1OC9A 3DGQA 4DSSA 2C0DA 4ISDA 2MBSA 2PPTA 5DVBA 1ERWA 4LMWA 1JZDA 2VCTA 3TKRA 3UMAA 2YOIA 3DVXA 2HSMB 3GKKA 1DE1A 1PSQA 5IOWA 1SJ6A 1T1VA 2GQMA 4HI7A 5ECRB 2C0EA 2AV4A 4ACSA 2CVBA 2H8LA 2H30A 3DKSA 4X0XA 1GSEA 1VGLA 5CRWA 3DWVA 3FZ5A 1GNWA 2IWTA 2R0PA 4KNDA 1XWAA 2HSNA 4GQCA 3F63A 4AGSA 1OKTA 3MWHA 1TTZA 3MYDA 2LNTA 8GSSA 4POMA 2FHEA 2A4VA 1YF0A 5F07A 1VF1A 4HJ2A 4PURA 4POLA 4L5OA 3GH6A 5GSSA 2XBQA 1E2YA 4DSSB 1F37A 2YNXA 5KN1A 5IMVA 3OR5A 4DSRA 1F2EA 5GSTA 1JZWA 5JWQB 1EV9A 1GWCA 3TRXA 1PMTA 3I9V2 2HRNA 2R0GA 2VCXA 1OVNA 1X5DA 1LJRA 4OMVA 1Y1UA 4F2IA 2YN1A 3ZTLA 2MMAA 2H0IA 4LL1B 3M3MA 5ID2A 2DC5A 2DBCA 4ZB6A 1F6MC 2I3YA 3M9JA 5ELAA 4DVCA 4E68A 1QK8A 1UVZA 6GSSA 5J47A 1SYRA 3GKMA 4YKGA 2HSNB 3UBLA 1Z9HA 1N8JA 4N11A 2RM5A 3CRUA 1SVMA 1A2LA 5CREA 3CTFA 4OCEA 3IV4A 3FYGA 1O81A 2H76A 3VWVA 4N0VA 3FRCA 1ST9A 1FVKA 1RK4A 4MF6A 4KX4A 3KXOA 4CY6A 1OAZA 4J57E 3H79A 1XPVA 4PQIA 2WFCA 2C0FA 3FR6A 4MA9A 2HNLA 1THOA 2V32A 4PQHA 1UN2A 1F3BA 3A5WA 4EC0A 2EFHA 4F9ZA 2WRTA 4HZ4A 1VF3A 12GSA 4BWSA 3IA1A 2GQLA 2WCIA 3HJPA 4FO5A 1YY7A 3NIVA 1SD8A 2RM6A 1XBSA 4N0ZA 4KA0A 4G19A 2H6ZA 2TRXA 5DAKB 2XPDA 2LQQA 2H71A 2XBIA 3FZAA 1S3AA 3D6IA 4KSOA 4OFMA 1HNAA 4I6XA 2H74A 4G10A 3H8QA 1A24A 1BYEA 3H93A 1M0UA 3EURA 3L9SA 5IMFA 3A2XA 2CX3A 5AIVA 4EF0A 1K0BA 2YPMA 4LLRA 3VI5A 3NOFA 3IE3A 2P0GA 2IIYA 5KOWA 1EEMA 3HHVA 3QAVA 1ABAA 3GIXA 1R5AA 1TRUA 3ERWA 4BVYB 2XC2A 2AAWA 3DEXA 3J7Yb 3DD3A 3P8WA 4EIPA 4QL9A 2ZCTA 3GFKA 2A2RA 1SKWB 5CAXA 4OCFA 4V2NA 2IFQA 2IMFA 1F9MA 2HRFA 3GTUA 5G1LA 1GTBA 4XHMA 5DBQA 2C8UA 4DSQA 3ZVJD 1XWBA 2IMDA 2N5FA 3WGXA 2FCHA 3ERFA 1UC7A 2FA8A 2WGRA 2AUVA 1V57A 2VL9A 4O5UA 4F0CA 4ICYA 2HZEA 1AIUA 3LQ7A 3N9JA 3BCKA 4CDOA 4P3YB 1V98A 1A23A 2YANA 2VCVA 2LKUA 4ZL9A 1ERUA 1E6BA 4IKHA 1PGTA 1ZGNA 1V9WA 2DSAA 2IFQB 2WB9A 20GSA 3QCPA 3FR3A 3ZFBA 1PQNA 4KDYA 4XS4B 3KGKA 3IAM2 3I69A 3GH9A 2NDOA 1TXXA 3PGTA 1THXA 4KW6A 2GQKA 1QUWA 2HRKB 4O5RA 2I4AA 2IN3A 2E2GA 2EFCA 3W8JA 2EIRA 3KZQA 4JU5A 4L0UA 2HZEB 4KCEA 1KNGA 1K0AA 4X1UA 2YJ7A 2OACA 5EL8A 4G01A 4MH2A 1TU7A 4IJ3A 1M2BA 2MMZA 2NVLA 4N30A 1TRWA 1GL8A 5HFKA 4IW9A 6GSYA 3VI7A 5G5EA 3QMXA 2QGVA 4EL1A 17GSA 1TK5B 4GSSA 3PR8A 2CA8A 2BMXA 3LORA 1M99A 2C80A 3FY7A 3G7JA 2CX4A 4V2MA 2I1UA 1XXUA 4JZQA 2M46A 1SU9A 3N5OA 4ZB7A 1QGVA 1G6WA 2YV7A 4EUYA 1U6TA 3V1WA 2KOKA 4IQAA 4Z2TA 1Z5YE 2HYXA 5DDLA 3ZRDA 2IMEA 3GURA 3BJ5A 4GRFA 4POKA 4K0GA 2DIZA 5ABRA 3M8NA 3UEMA 4W66A 3WD6A 3AY8A 3F3QA 1SVOA 19GSA 4IVFA 1I5GA 2H0HA 2G2QA 2L6CA 2CT6A 4X43A 4RQXA 3UJ1A 1DE2A 2JACA 2PU9C 5A5KA 5ECPB 2LV3A 3ME8A 3GKXA 2V41A 4CW9A 4TN8A 5FWGA 4WBJA 2KP2A 5IMZA 1Z3EA 1XWKA 1FOVA 5KEJA 2OT3A 1PL1A 2H1GA 2CV4A 3GHAA 4ZXGA 1PD21 1GUHA 3M1GA 2E0QA 2EFDA 2K9FA 1T4YA 4MJEA 5EY6A 4V2LA 4AKXB 1K0CA 2C3NA 1NM3A 4JRRA 4X4JA 2DJKA 4HS1A 3ERGA 1TI3A 3C1SA 1MD3A 5ECSA 4XIHA 3MSZA 5ECOB 1ZZYA 3KTBA 4MMMA 4PGTA 3IHQA 4TXVA 3LG6A 2IPAA 2FWFA 4Q5NA 5IIZA 1BG1A 5A1NA 4YAPA 2VKZG 3DVWA 2OBIA 1YDKA 5DALB 1QFNA 2JADA 1J9BA 4Z7XA 3GX8A 2X99A 1FB0A 2PWJA 1LU4A 3CMIA 4TR3A 4ULXA 4IBPA 1W4VA 2VLUA 4PNFA 1NSWA 3IOSA 2RUEA 2I9HA 6GSXA 5AISA 4MZCA 1WRYA 4LMVA 1X9MB 4YAVA 2QKEA 3IAS2 2BJXA 1GNEA 4ZIJA 3KTLA 4AKHA 1XVQA 3IC8A 5B6MA 2LS5A 4GF0A 2L5LA 2B7JA 2KP1A 1QMVA 5JCWA 2L4CA 1H4OA 3W6GA 4OWYA 4ZBDA 1WPIA 1O8XA 2IJYA 1XIYA 5IOXA 1G6YA 2BTOT 4F03A 3BCIA 2YWNA 2QSIA 14GSA 2FWGA 3LFLA 3GMFA 4WR5A 4GTUA 4O7HA 4JE1A 2WJUA 2EC4A 1SKSB 5HQPA 2N5AA 4PTSA 1PKZA 3D21A 3FZ4A 2F8FA 3GA4A 4DEJA 1AXDA 3QDNA 1RW1A 1WIKA 2H75A 3VK9A 2DKHA 4E8EA 4JBBA 1G0TA 11GSA 3LYPA 1N25A 3TU3B 3IDVA 3IRAA 4MF5A 4WF4A 4NV2A 1IYHA 2WS2A 3HY2A 4IN0A 3DRNA 1J08A 3LYKA 4AI6A 4EVMA 2YWIA 2VCWA 5IO2A 1BG5A 4MNNA 2F8AA 2PMTA 1JZOA 3RBTA 1OC8A 3L4NA 5JCGA 4GWRA 16GSA 2HLSA 4XTSA 1BQ7A 1Z7PA 3TOUA 3O3TA 2VM2A 3G7IA 4BVXA 1OC9B 3IR4A 5CO3A 3TB2A 2LTKA 1R5PA 4BA7A 3EC3A 3C7MA 2B7KA 2GSRA 2GTUA 5HFIA 2MBTA 1YVLA 4HUAA 3CXGA 2B5EA 1SL0B 1SK1A 3D5JA 4XS1A 2CVDA 3QAGA 3IBHA 1RQMA 4KB3A 4Z2RA 4JR4A 1GSUA 4QL7A 5ECLB 22GSA 4ZB8A 3HVXA 4TW5A 2JL4A 5A34A 3D4TA 4TR1A 3SBCA 2CVKA 1GRXA 3ZVJA 3APSA 2RLIA 2ZNMA 4FIWA 5ENUA 4EKZA 1XCCA 5JWRB 5B7CA 5F8BA 2L6DA 2LRCA 4KAEA 3LWAA 1M2AA 3QPMA 2CZ2A 3G9BA 3EMXA 2HXKA 5E4WA 3FKFA 4EIQA 4OFNA 4ECJA 4K7OA 1WJKA 1QQ2A 2GS3A 3UIWA 9GSSA 3SWLA 6GSVA 4KDUA 1K0OA 3ZITA 3M0FA 2VL2C 3GX0A 1U3IA 5ECQB 2AHEA 2FNOA 2AYTA 3C73A 4CY8A 5ID2B 1Z7RA 2B6MA 3CWGA 1IYIA 5A34B 4F82A 2V6KA 3UAPA 5HR3A 1GP1A 2GVPA 2LSTA 1EOHA 3CBUA 2G0FA 4WKWA 1JLVA 3HYPA 4HU7A 4WETA 1B4PA 3C8EA 3IC4A 5GZZB 4RUVA 4EDZA 2KLXA 3WT1A 3VFIA 4IS0A 2FGXA 1SENA 4F0BA 2VCQA 1MDIA 2PUKC 4QQ7A 2K8SA 4MF7A 5CYYA 4MABA 3A2VA 2X49A 2A4HA 1XWCA 2GLRA 4PNGA 4HOJA 1BX9A 1GLQA 4MCUA 3KH9A 3MIXA 2FA4A 1TK0B 2H6XA 2B3SA 1TW9A 3FHKA 3PINA 1G7OA 2DMLA 1Q98A 3KM6A 5EVOA 1DSBA 1R26A 5IPGA 4RI6A 3HVSA 4ECCA 4N3ZA 4IP1A 4RI7A 3UBKA 2JZRA 2NPBA 1ZCPA 2GZPA 1O7UA 1OE7A 2XHFA 3VLNA 4I2TA 4GDFA 3CSHA 4K6XA 1T3BA 1K3YA 1JLWA 3P90A 4K2XA 3DXBA 4TOPA 4OD7A 1NW2A 1TRVA 1YF1A 2R2JA 2JSZA 3QD9A 1YZXA 1MEKA 4YKFA 4IQ1A 2UV8G 1DBYA 3ZMKA 4HDEA 4NAXA 3RPPA 1K0DA 1H75A 2HE3A 4GXZA 3US3A 2CZ3A 3CRTA 3GN3A 2LJAA 4JR6A 2VL3A 4I5QA 5G2ZA 1EWXA 3KIJA 6GSTA 3EMPA 1O6JA 4V1Ap 1V40A 1EP8A 1K0NA 5J41A 3GTUB 4PX1A 1SL2B 5KN2A 1KBNA 4ZBBA 1NHYA 4N10A 2LEGA 1K3OA 1SL1B 3IPZA 5CRGA 4GLTA 4HQZA 5HFGA 1M2DA 1SYXA 5J4YA 3IXRA 1A2JA 5IMCA 3VWUA 4KUNA 1PL2A 4POBA 5B6NA 2O87A 4Q5QA 3WGDA 4H86A 1U88A 3H1NA 2M80A 4Z2UA 3TOTA 4I2UA 2PGTA 4NWYA 5G1KA 1FO5A 2QA1A 4PXOA 2H1AA 2OA7A 3ED3A 4AKGA 3KH7A 4L0WA 2LNSA 2DJ1A 2FWHA 1B8XA 3U5RE 3ZLPA 5ECHB 3KCMA 4PQ1A 1YQ1A 2VLTA 2FLSA 3CYNA 2X8CA 2DKIA 2HQTA 1FAAA 4J2FA 3TJJA 3ZZXA 4TKYA 2YP6A 5C00A 4WXTA 3UOMA 5CP1A 1M9AA 4ECIA 3HDCA 4ML1A 4K5SA 1GTIA 3Q18A 3L0HA 1R7HA 5IQYA 5EPFA 4FYUA 1A2MA 5J40A 1TXUA 5ECMB 5DCGA 1K0MA 3D0ZA 4KGIA 2YJHA 2FUG2 1GTAA 4ZBAA 1WMJA 1ZYEA 3WGEA 3J7Yk 2M72A 2YZHA 3CTGA 5C04A 3ZREA 3C71A 1O73A 3TJKA 4K0NA 3APOA 2HSHA 3EPTA 3E0UA 2DMMA 2VM1A 5A4VA 1X5CA 1FB6A 5KN3A 1BAYA 1GUMA 4MJCA 5F06A 4PUFC 4K9ZA 2ON5A 1ILOA 1PX6A 5ECKB 4MZBA 4I97A 4HEA2 4RQRA 2VAFA 2H73A 3NZNA 4WR4A 3WT2A 4MJAA 3HKRA 2K6VA 1FVJA 2JSYA 1MD4A 1ERVA 5LD0A 1AW9A 1TI1A 3O76A 1OYJA 3RPNA 2A2SA 4TXOA 2PN8A 2O8VB 1KEBA 1B4QA 4ZL8A 2ON7A 2EFEA 4BL7A 3HVVA 3ZFLA 2H01A 1HNBA 3MNGA 3Q74A 3F9UA 1USBA 4ID0A 4ML6A 5FHIA 1GLPA 3VWXA 2NTOA 1YKCA 2X64A 4KF9A 1MDJA 4O92A 1XFLA 3ZIVA 3HZ4A 1Q4JA 5A5HA 1GH2A 3GV1A 4K7NA 5HR2A 1B48A 1W89A 3WYWA 3R2QA 3EINA 5BMUA 3VURA 2H1BA 3ZIJA 3RHBA 2E7PA 1J0FA 1HNCA 2KUCA 2FD3A 3IK9A 2IL3A 18GSA 2DJ3A 5J9BA 5HR1A 1JZRA 4ZILA 5AIXA 2B5XA 5HR0A 2L57A 1ZOFA 3L78A 2KHPA 3FMWA 2V1MA 3EE2A 3UARA 5A4WA 4G2EA 1XWGA 1AQVA 1WOUA 5J4UA 3FR9A 4BL7B 1AQXA 4NPBA 2HRAA 4MH3A 1T7PB 1SD9A 3LXZA 3ISOA 2VD0A 2VD1A 2UZ8A 1PN9A 3VPQA 3R3EA 2P5RA 13GSA 5A1NB 1XW5A 4L5LA 4IELA 2YWMA 1BJXA 1B9XC 5KOXA 1WP0A 2X8GA 3L9VA 5J5NA 5BMUB 1FW1A 3QFBC 2LJRA 5H5RA 4WEYA 3TUEA 3GSTA 2HZFA 5D73A 1AQWA 3EWLA 3F3RA 3FK8A 4NHWA 1V58A 1NHOA 1LBKA 1M9BA 4HQSA 2WZ9A 3EU4A 1OE8A 2REMA 2MMNA 3QR6A 4YQMA 2EIOA 2HT9A 1TJDA 5IPHA 3GSSA 3H4KA 3D22A 1OKDA 4J56E 1M7TA 1T4ZA 4L8EA 2J9HA 5D8IA 3Q6OA 5DQYA 2YZUA 5LCZA 2WULA 3ZL5A 2R3XA 3TKSE 2X4AA 1T00A 2RUFA 3F6DA 1PX7A 2H0GA 3L9UA 3I6AA 5E59A 3TKPA 4MP4A 1TOFA 5L71A 2N5BA 4IJIA 2QA2A 2VUPA 3DIEA 4HJMA 4EO3A 3HD5A 5J9CA 3RAZA 1VF4A 1BF5A 4K1FA 3EYTA 4WBRD 3HA9A 4LL4B 4GSNA 1PA3A 4AJ6A 1XW6A 1ZYPA 1PKWA 1PRXA 2H6YA 1EZKA 5IM9A 2C3TA 2OE3A 2JU5A 4XRAA 1JFUA 5LNKe 4E8HA 3ME7A 4TRXA 2O85A 1S3DA 1TDIA 3LW9A 2F9SA 4IP6A 1EGRA 4EDYA 5DAKA 5FT3A 2C4JA 5AGYA 5F05A 4BVXB 5D9WA 5ECNB 6GSWA 4G0KA 2GSQA 5D93A 3IK7A 4GCIA 2CQ9A 4NMUA 1SVLA 5H5QA 4AJ8A 1CQHA 5B8AA 1ZYNA 4YH2A 5COHA 1MDKA 2TRCP 2O7KA 2B1KA 2CAIA 1B9YC 1HQOA 2B1LA 2HFDA 4ECBA 3C1RA 3DMLA 5D96A 2OKAA 3FEUA 1SJIA 2FY6A 1GULA 3GRXA 4TR1B 2K18A 2VLVA 2YCDA 3UL3A 4BVYA 3F0IA 1FG4A 3MDKA 2R5GA 4GQFA 5IMDA 1TU8A 2OE1A 5B8BA 2H1LA 1Z6NA 4XRDA 2QC7A 4AKIA 1ZMAA 3CSIA 3D4MA 5DQSA 4NXIA 1F3AA 1VRSD 4AF2A 2GT6A 2AB6A 5CRDA 2MMOA 3IHGA 3S9FA 4O32A 1A0FA 5DCHA 1YKAA 2R4VA 3Q19A 4CHSA 3TDGA 3LSZA 1QXHA 3BOAA 3P2AA 1GSFA 4G9HA 4JEDA 2L5OA 1GSQA 3GL3A 2PVOC 3FZ9A 2HSYA 4FYCA 2VIMA 4FH8A 5G31A 3P7XA 2C0GA 1AUCA 3KD0A 3GYKA 2DJ0A 1BEDA 2VCZA 3M9KA 4KDXA 1SJZA 5CRHA 4QMKA 3TCOA 5KN0A 1KTEA 2GZZA 5J4VA 4GSTA 4MPFA 4LA1A 1ZL9A 2YV9A 4BWQA 1HYUA 3PH9A 5D9TA 4XS6A 2GT5A 4XS4A 4EE0A 2H1DA 3ZYWA 3F8UA 4O5QA 5D9XA 1N2AA 1S3CA 3TKSC 3TJGA 2HRKA 4NV5A 1EP7A 2GGTA 4FYBA 1PN0A 3A2WA 1XZOA 5H5SA 4EXJA 3PPUA 2F3MA 2H19A 2DLXA 2O89A 3HJOA 3VWWA 4XCSA 3GKNA 2I81A 3LGCA 5G5FA 2C3QA 4MJBA 1WE0A 1U87A 1R4WA 1OC3A 1ML6A 2JZTA 3E3EA 2J23A 2P5QA 1YJ6A 1T8EB 4ILFA 1TRSA 1UA5A 3LXTA 2R37A 1X9SB 1K3LA 5G30A 1GTUA 4MLYA 1ON4A 4I8BA 2ALBA 3GUSA 4OFTA 1YEXA 3EVIA 5ECIB 5J3RA 4ZB9A 2V6OA 3F4SA 1XVWA 4YQVA 3KMNA 3QFAC 2OE0A 4K5RA 1Z6MA 1A8YA 4A5PA 4K8MA 2LQOA 3K8NA 4FQUA 4ZL7A 3QAWA 2H72A 1ACVA 1I9DA 2OADA 3EU3A 1GSYA 3U6VA 4TR0A 4Q5FA 3KJYA 4KCAA 4KE3A 4YQUA 5IMAA 1X9WB 3HXSA 7GSSA 2DIYA 3VPTA 1O85A 1FOHA 2D2ZA 2AJQB 1Y6EA 3KMOA 2OJLA 2VL2A 4K2DA 1MTCA 2HI7A 3A5IA 1Y25A 2H70A 2GDRA 1ZYQB 4MPGA 2PVQA 1VF2A 3TJBA 4V1Ag 2DJ2A 3A3TA 1TK8B 3O6TA 3RDWA 5ELGA 2R6KA 5AN1A 2V2GA 3UVHA 2R0CA 1G7EA 2PERA 2IMIA 3KP9A 1C72A 1O8WA 1A8LA 2ES7A 2L4QA 3ZMLA 2IMKA 4MZWA 3QOUA 2VO4A 2GSSA 3DYRA 3TGZA 2GSTA 5JWOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APQ A;  3TRP A;  2PBJ A;  5JCU A;  2TIR A;  4USS A;  2VOC A;  3W8S A;  2LRN A;  4Q5R A;  5DJL A;  3TRQ A;  4WF5 A;  1SKR B;  1AAZ A;  3BD2 A;  2JZS A;  10GS A;  1WWJ A;  2FWE A;  4KH7 A;  1XOA A;  5DAL A;  1EOG A;  3GL5 A;  2P31 A;  1HD2 A;  1FHE A;  4TR4 A;  2RII A;  2WDU A;  2MYG A;  3GNJ A;  5A4U A;  5GAP D;  4MDC A;  4D73 A;  4G0I A;  3KEB A;  3F4R A;  1SK0 A;  2F51 A;  1URM A;  2YWO A;  3HJM A;  5CNW A;  5INY A;  2MZC A;  4TVE A;  4KSM A;  2NBS A;  3I43 A;  1V2A A;  2ZUP A;  1ERT A;  3BBY A;  3MAK A;  2X8H A;  3LJR A;  2XPE A;  4HZ2 A;  1DUG A;  3E9J B;  4G0L A;  3JCM L;  2B5Y A;  2DJJ A;  1XOB A;  4PUA A;  2LRT A;  3TKS A;  4IHU A;  5DJM A;  2L59 A;  1CQG A;  1SK2 A;  3UVT A;  2K8V A;  1AC1 A;  2Z9S A;  3LEF A;  1YEP A;  4TXO B;  2GZY A;  3F6F A;  2HSM A;  1X0R A;  2C1Y A;  1JHB A;  3HZ8 A;  2CAQ A;  4D73 B;  1TKD B;  1EEJ A;  4OO5 A;  3TKQ A;  2H66 A;  5IO0 A;  1EGO A;  4AJ7 A;  3KP8 A;  2OBK A;  1U3A A;  1GUK A;  3CSJ A;  3G7Y A;  4HU9 A;  1EV4 A;  2EIQ A;  1GSD A;  6GSU A;  3HCZ A;  2LJK A;  3RHC A;  4BPY A;  5D9V A;  3F4T A;  4MK3 A;  1TP9 A;  2LUS A;  4K7I A;  4OO4 A;  1X5E A;  5GAN D;  3FW2 A;  3TJF A;  1XW9 A;  1GSS A;  5F0G A;  1A0R P;  2E2M A;  4NHZ A;  4IGJ A;  1OC9 A;  3DGQ A;  4DSS A;  2C0D A;  4ISD A;  2MBS A;  2PPT A;  5DVB A;  1ERW A;  4LMW A;  1JZD A;  2VCT A;  3TKR A;  3UMA A;  2YOI A;  3DVX A;  2HSM B;  3GKK A;  1DE1 A;  1PSQ A;  5IOW A;  1SJ6 A;  1T1V A;  2GQM A;  4HI7 A;  5ECR B;  2C0E A;  2AV4 A;  4ACS A;  2CVB A;  2H8L A;  2H30 A;  3DKS A;  4X0X A;  1GSE A;  1VGL A;  5CRW A;  3DWV A;  3FZ5 A;  1GNW A;  2IWT A;  4KND A;  1XWA A;  4GQC A;  3F63 A;  4AGS A;  1OKT A;  3MWH A;  1TTZ A;  2LNT A;  8GSS A;  4POM A;  2FHE A;  2A4V A;  1YF0 A;  5F07 A;  1VF1 A;  4HJ2 A;  4PUR A;  4POL A;  4L5O A;  3GH6 A;  5GSS A;  2XBQ A;  1E2Y A;  4DSS B;  1F37 A;  2YNX A;  5KN1 A;  5IMV A;  3OR5 A;  4DSR A;  1F2E A;  5GST A;  1JZW A;  5JWQ B;  1EV9 A;  1GWC A;  3TRX A;  1PMT A;  3I9V 2;  2HRN A;  2VCX A;  1OVN A;  1X5D A;  1LJR A;  4OMV A;  4F2I A;  2YN1 A;  3ZTL A;  2MMA A;  2H0I A;  4LL1 B;  3M3M A;  5ID2 A;  2DC5 A;  2DBC A;  4ZB6 A;  1F6M C;  2I3Y A;  3M9J A;  5ELA A;  4DVC A;  1QK8 A;  1UVZ A;  6GSS A;  1SYR A;  3GKM A;  2HSN B;  3UBL A;  1Z9H A;  1N8J A;  4N11 A;  2RM5 A;  3CRU A;  1A2L A;  5CRE A;  3CTF A;  4OCE A;  3IV4 A;  3FYG A;  1O81 A;  2H76 A;  3VWV A;  4N0V A;  3FRC A;  1ST9 A;  1FVK A;  1RK4 A;  4MF6 A;  4KX4 A;  3KXO A;  1OAZ A;  4J57 E;  3H79 A;  1XPV A;  4PQI A;  2WFC A;  2C0F A;  3FR6 A;  4MA9 A;  2HNL A;  1THO A;  2V32 A;  4PQH A;  1UN2 A;  1F3B A;  3A5W A;  4EC0 A;  4F9Z A;  2WRT A;  4HZ4 A;  1VF3 A;  12GS A;  4BWS A;  3IA1 A;  2GQL A;  2WCI A;  3HJP A;  4FO5 A;  1YY7 A;  3NIV A;  1SD8 A;  2RM6 A;  1XBS A;  4N0Z A;  4KA0 A;  4G19 A;  2H6Z A;  2TRX A;  5DAK B;  2XPD A;  2LQQ A;  2H71 A;  2XBI A;  3FZA A;  1S3A A;  3D6I A;  4KSO A;  4OFM A;  1HNA A;  4I6X A;  2H74 A;  4G10 A;  3H8Q A;  1A24 A;  1BYE A;  3H93 A;  1M0U A;  3EUR A;  3L9S A;  5IMF A;  3A2X A;  2CX3 A;  5AIV A;  4EF0 A;  1K0B A;  2YPM A;  4LLR A;  3VI5 A;  3NOF A;  3IE3 A;  2P0G A;  2IIY A;  1EEM A;  3HHV A;  3QAV A;  1ABA A;  3GIX A;  1R5A A;  1TRU A;  3ERW A;  4BVY B;  2XC2 A;  2AAW A;  3DEX A;  3J7Y b;  3DD3 A;  3P8W A;  4QL9 A;  2ZCT A;  3GFK A;  2A2R A;  1SKW B;  5CAX A;  4OCF A;  4V2N A;  2IFQ A;  2IMF A;  1F9M A;  2HRF A;  3GTU A;  5G1L A;  1GTB A;  4XHM A;  5DBQ A;  2C8U A;  4DSQ A;  3ZVJ D;  1XWB A;  2IMD A;  2N5F A;  3WGX A;  2FCH A;  3ERF A;  1UC7 A;  2FA8 A;  2WGR A;  2AUV A;  1V57 A;  2VL9 A;  4F0C A;  2HZE A;  1AIU A;  3LQ7 A;  3N9J A;  3BCK A;  4CDO A;  4P3Y B;  1V98 A;  1A23 A;  2YAN A;  2VCV A;  2LKU A;  4ZL9 A;  1ERU A;  1E6B A;  4IKH A;  1PGT A;  1ZGN A;  1V9W A;  2DSA A;  2IFQ B;  2WB9 A;  20GS A;  3QCP A;  3FR3 A;  3ZFB A;  1PQN A;  4KDY A;  4XS4 B;  3KGK A;  3IAM 2;  3I69 A;  3GH9 A;  2NDO A;  1TXX A;  3PGT A;  1THX A;  4KW6 A;  2GQK A;  1QUW A;  2HRK B;  4O5R A;  2I4A A;  2IN3 A;  2E2G A;  3W8J A;  2EIR A;  3KZQ A;  4JU5 A;  4L0U A;  2HZE B;  4KCE A;  1KNG A;  1K0A A;  4X1U A;  2YJ7 A;  2OAC A;  5EL8 A;  4MH2 A;  1TU7 A;  4IJ3 A;  1M2B A;  2MMZ A;  2NVL A;  4N30 A;  1TRW A;  1GL8 A;  5HFK A;  4IW9 A;  6GSY A;  3VI7 A;  5G5E A;  3QMX A;  2QGV A;  4EL1 A;  17GS A;  1TK5 B;  4GSS A;  3PR8 A;  2CA8 A;  2BMX A;  3LOR A;  1M99 A;  2C80 A;  3FY7 A;  3G7J A;  2CX4 A;  4V2M A;  2I1U A;  1XXU A;  4JZQ A;  2M46 A;  1SU9 A;  3N5O A;  1QGV A;  1G6W A;  2YV7 A;  4EUY A;  1U6T A;  3V1W A;  2KOK A;  4IQA A;  1Z5Y E;  2HYX A;  5DDL A;  3ZRD A;  2IME A;  3GUR A;  3BJ5 A;  4GRF A;  4POK A;  4K0G A;  2DIZ A;  5ABR A;  3M8N A;  3UEM A;  3WD6 A;  3AY8 A;  3F3Q A;  19GS A;  4IVF A;  1I5G A;  2H0H A;  2G2Q A;  2L6C A;  2CT6 A;  4X43 A;  4RQX A;  3UJ1 A;  1DE2 A;  2JAC A;  2PU9 C;  5A5K A;  5ECP B;  2LV3 A;  3ME8 A;  3GKX A;  2V41 A;  4CW9 A;  4TN8 A;  5FWG A;  4WBJ A;  2KP2 A;  5IMZ A;  1Z3E A;  1XWK A;  1FOV A;  5KEJ A;  1PL1 A;  2H1G A;  2CV4 A;  3GHA A;  4ZXG A;  1PD2 1;  1GUH A;  3M1G A;  2E0Q A;  2K9F A;  1T4Y A;  4MJE A;  5EY6 A;  4V2L A;  1K0C A;  2C3N A;  1NM3 A;  4JRR A;  2DJK A;  4HS1 A;  3ERG A;  1TI3 A;  3C1S A;  1MD3 A;  5ECS A;  4XIH A;  3MSZ A;  5ECO B;  1ZZY A;  3KTB A;  4MMM A;  4PGT A;  3IHQ A;  4TXV A;  3LG6 A;  2IPA A;  2FWF A;  4Q5N A;  5IIZ A;  4YAP A;  3DVW A;  2OBI A;  1YDK A;  5DAL B;  1QFN A;  2JAD A;  1J9B A;  4Z7X A;  3GX8 A;  2X99 A;  1FB0 A;  2PWJ A;  1LU4 A;  3CMI A;  4TR3 A;  4ULX A;  4IBP A;  1W4V A;  2VLU A;  4PNF A;  1NSW A;  3IOS A;  2RUE A;  2I9H A;  6GSX A;  5AIS A;  4MZC A;  1WRY A;  4LMV A;  1X9M B;  4YAV A;  2QKE A;  3IAS 2;  2BJX A;  1GNE A;  4ZIJ A;  3KTL A;  1XVQ A;  3IC8 A;  5B6M A;  2LS5 A;  4GF0 A;  2L5L A;  2B7J A;  2KP1 A;  1QMV A;  5JCW A;  2L4C A;  1H4O A;  3W6G A;  4OWY A;  4ZBD A;  1WPI A;  1O8X A;  2IJY A;  1XIY A;  5IOX A;  1G6Y A;  2BTO T;  4F03 A;  3BCI A;  2YWN A;  2QSI A;  14GS A;  2FWG A;  3LFL A;  3GMF A;  4WR5 A;  4GTU A;  4O7H A;  4JE1 A;  2WJU A;  2EC4 A;  1SKS B;  5HQP A;  2N5A A;  4PTS A;  1PKZ A;  3D21 A;  3FZ4 A;  2F8F A;  3GA4 A;  4DEJ A;  1AXD A;  3QDN A;  1RW1 A;  1WIK A;  2H75 A;  3VK9 A;  4E8E A;  4JBB A;  1G0T A;  11GS A;  3LYP A;  3IDV A;  3IRA A;  4MF5 A;  4WF4 A;  4NV2 A;  1IYH A;  2WS2 A;  3HY2 A;  4IN0 A;  3DRN A;  1J08 A;  3LYK A;  4EVM A;  2YWI A;  2VCW A;  5IO2 A;  1BG5 A;  2F8A A;  2PMT A;  1JZO A;  3RBT A;  1OC8 A;  3L4N A;  5JCG A;  4GWR A;  16GS A;  2HLS A;  4XTS A;  1BQ7 A;  1Z7P A;  3TOU A;  3O3T A;  2VM2 A;  3G7I A;  4BVX A;  1OC9 B;  3IR4 A;  5CO3 A;  3TB2 A;  2LTK A;  1R5P A;  4BA7 A;  3EC3 A;  3C7M A;  2B7K A;  2GSR A;  2GTU A;  5HFI A;  2MBT A;  4HUA A;  3CXG A;  2B5E A;  1SL0 B;  1SK1 A;  3D5J A;  4XS1 A;  2CVD A;  3QAG A;  3IBH A;  1RQM A;  4KB3 A;  4JR4 A;  1GSU A;  4QL7 A;  5ECL B;  22GS A;  4ZB8 A;  3HVX A;  4TW5 A;  2JL4 A;  3D4T A;  4TR1 A;  3SBC A;  2CVK A;  1GRX A;  3ZVJ A;  3APS A;  2RLI A;  2ZNM A;  4FIW A;  5ENU A;  4EKZ A;  1XCC A;  5JWR B;  5B7C A;  5F8B A;  2L6D A;  2LRC A;  4KAE A;  3LWA A;  1M2A A;  3QPM A;  2CZ2 A;  3G9B A;  3EMX A;  2HXK A;  5E4W A;  3FKF A;  4OFN A;  4ECJ A;  4K7O A;  1WJK A;  1QQ2 A;  2GS3 A;  3UIW A;  9GSS A;  3SWL A;  6GSV A;  4KDU A;  1K0O A;  3ZIT A;  3M0F A;  2VL2 C;  3GX0 A;  1U3I A;  5ECQ B;  2AHE A;  2FNO A;  2AYT A;  3C73 A;  5ID2 B;  1Z7R A;  2B6M A;  1IYI A;  4F82 A;  2V6K A;  3UAP A;  5HR3 A;  1GP1 A;  2GVP A;  2LST A;  1EOH A;  3CBU A;  2G0F A;  4WKW A;  1JLV A;  3HYP A;  4HU7 A;  4WET A;  1B4P A;  3C8E A;  3IC4 A;  5GZZ B;  4RUV A;  4EDZ A;  2KLX A;  3WT1 A;  3VFI A;  4IS0 A;  2FGX A;  1SEN A;  4F0B A;  2VCQ A;  1MDI A;  2PUK C;  4QQ7 A;  2K8S A;  4MF7 A;  5CYY A;  4MAB A;  3A2V A;  1XWC A;  2GLR A;  4PNG A;  4HOJ A;  1BX9 A;  1GLQ A;  4MCU A;  3KH9 A;  2FA4 A;  1TK0 B;  2H6X A;  2B3S A;  1TW9 A;  3FHK A;  3PIN A;  1G7O A;  2DML A;  1Q98 A;  3KM6 A;  5EVO A;  1DSB A;  1R26 A;  5IPG A;  4RI6 A;  3HVS A;  4ECC A;  4IP1 A;  4RI7 A;  3UBK A;  2JZR A;  2NPB A;  1ZCP A;  2GZP A;  1O7U A;  1OE7 A;  2XHF A;  3VLN A;  4I2T A;  3CSH A;  4K6X A;  1T3B A;  1K3Y A;  1JLW A;  3P90 A;  3DXB A;  4TOP A;  4OD7 A;  1NW2 A;  1TRV A;  1YF1 A;  2R2J A;  2JSZ A;  3QD9 A;  1YZX A;  1MEK A;  4IQ1 A;  1DBY A;  3ZMK A;  4HDE A;  4NAX A;  3RPP A;  1K0D A;  1H75 A;  2HE3 A;  4GXZ A;  3US3 A;  2CZ3 A;  3CRT A;  3GN3 A;  2LJA A;  4JR6 A;  2VL3 A;  4I5Q A;  5G2Z A;  1EWX A;  3KIJ A;  6GST A;  3EMP A;  1O6J A;  4V1A p;  1V40 A;  1EP8 A;  1K0N A;  5J41 A;  3GTU B;  4PX1 A;  1SL2 B;  5KN2 A;  1KBN A;  4ZBB A;  1NHY A;  4N10 A;  2LEG A;  1K3O A;  1SL1 B;  3IPZ A;  5CRG A;  4GLT A;  4HQZ A;  5HFG A;  1M2D A;  1SYX A;  3IXR A;  1A2J A;  5IMC A;  3VWU A;  4KUN A;  1PL2 A;  4POB A;  5B6N A;  2O87 A;  4Q5Q A;  3WGD A;  4H86 A;  1U88 A;  3H1N A;  2M80 A;  3TOT A;  4I2U A;  2PGT A;  4NWY A;  5G1K A;  1FO5 A;  4PXO A;  2H1A A;  2OA7 A;  3ED3 A;  3KH7 A;  4L0W A;  2LNS A;  2DJ1 A;  2FWH A;  1B8X A;  3U5R E;  3ZLP A;  5ECH B;  3KCM A;  4PQ1 A;  1YQ1 A;  2VLT A;  2FLS A;  3CYN A;  2X8C A;  2HQT A;  1FAA A;  4J2F A;  3TJJ A;  3ZZX A;  4TKY A;  2YP6 A;  5C00 A;  4WXT A;  3UOM A;  5CP1 A;  1M9A A;  4ECI A;  3HDC A;  4ML1 A;  1GTI A;  3Q18 A;  3L0H A;  1R7H A;  5IQY A;  5EPF A;  4FYU A;  1A2M A;  5ECM B;  5DCG A;  1K0M A;  3D0Z A;  4KGI A;  2YJH A;  2FUG 2;  1GTA A;  4ZBA A;  1WMJ A;  1ZYE A;  3WGE A;  3J7Y k;  2M72 A;  2YZH A;  3CTG A;  5C04 A;  3ZRE A;  3C71 A;  1O73 A;  3TJK A;  4K0N A;  3APO A;  2HSH A;  3E0U A;  2DMM A;  2VM1 A;  5A4V A;  1X5C A;  1FB6 A;  5KN3 A;  1BAY A;  1GUM A;  4MJC A;  5F06 A;  4PUF C;  4K9Z A;  2ON5 A;  1ILO A;  1PX6 A;  5ECK B;  4MZB A;  4I97 A;  4HEA 2;  4RQR A;  2VAF A;  2H73 A;  3NZN A;  4WR4 A;  3WT2 A;  4MJA A;  3HKR A;  2K6V A;  1FVJ A;  2JSY A;  1MD4 A;  1ERV A;  5LD0 A;  1AW9 A;  1TI1 A;  3O76 A;  1OYJ A;  3RPN A;  2A2S A;  4TXO A;  2PN8 A;  2O8V B;  1KEB A;  1B4Q A;  4ZL8 A;  2ON7 A;  4BL7 A;  3HVV A;  3ZFL A;  2H01 A;  1HNB A;  3MNG A;  3Q74 A;  3F9U A;  1USB A;  4ID0 A;  4ML6 A;  5FHI A;  1GLP A;  3VWX A;  2NTO A;  1YKC A;  2X64 A;  4KF9 A;  1MDJ A;  4O92 A;  1XFL A;  3ZIV A;  3HZ4 A;  1Q4J A;  3GV1 A;  1GH2 A;  4K7N A;  5HR2 A;  1B48 A;  1W89 A;  3WYW A;  3R2Q A;  3EIN A;  5BMU A;  3VUR A;  2H1B A;  3ZIJ A;  3RHB A;  2E7P A;  1J0F A;  1HNC A;  2KUC A;  2FD3 A;  3IK9 A;  2IL3 A;  18GS A;  2DJ3 A;  5J9B A;  5HR1 A;  1JZR A;  4ZIL A;  5AIX A;  2B5X A;  5HR0 A;  2L57 A;  1ZOF A;  3L78 A;  2KHP A;  2V1M A;  3EE2 A;  3UAR A;  5A4W A;  4G2E A;  1XWG A;  1AQV A;  1WOU A;  5J4U A;  3FR9 A;  4BL7 B;  1AQX A;  4NPB A;  2HRA A;  4MH3 A;  1T7P B;  1SD9 A;  3LXZ A;  3ISO A;  2VD0 A;  2VD1 A;  2UZ8 A;  1PN9 A;  3VPQ A;  3R3E A;  2P5R A;  13GS A;  1XW5 A;  4L5L A;  4IEL A;  2YWM A;  1BJX A;  1B9X C;  1WP0 A;  2X8G A;  3L9V A;  5J5N A;  1FW1 A;  3QFB C;  2LJR A;  5H5R A;  4WEY A;  3TUE A;  3GST A;  2HZF A;  5D73 A;  1AQW A;  3EWL A;  3F3R A;  3FK8 A;  4NHW A;  1V58 A;  1NHO A;  1LBK A;  1M9B A;  4HQS A;  2WZ9 A;  3EU4 A;  1OE8 A;  2REM A;  2MMN A;  3QR6 A;  4YQM A;  2EIO A;  2HT9 A;  1TJD A;  5IPH A;  3GSS A;  3H4K A;  3D22 A;  1OKD A;  4J56 E;  1M7T A;  1T4Z A;  4L8E A;  2J9H A;  5D8I A;  3Q6O A;  5DQY A;  2YZU A;  5LCZ A;  2WUL A;  3ZL5 A;  2R3X A;  3TKS E;  1T00 A;  2RUF A;  3F6D A;  1PX7 A;  2H0G A;  3L9U A;  3I6A A;  5E59 A;  3TKP A;  4MP4 A;  1TOF A;  5L71 A;  2N5B A;  4IJI A;  2VUP A;  3DIE A;  4HJM A;  4EO3 A;  3HD5 A;  5J9C A;  3RAZ A;  1VF4 A;  4K1F A;  3EYT A;  4WBR D;  3HA9 A;  4LL4 B;  4GSN A;  1PA3 A;  4AJ6 A;  1XW6 A;  1PKW A;  1PRX A;  2H6Y A;  1EZK A;  5IM9 A;  2C3T A;  2OE3 A;  2JU5 A;  4XRA A;  1JFU A;  5LNK e;  4E8H A;  3ME7 A;  4TRX A;  2O85 A;  1S3D A;  1TDI A;  2F9S A;  4IP6 A;  1EGR A;  4EDY A;  5DAK A;  5FT3 A;  2C4J A;  5AGY A;  5F05 A;  4BVX B;  5D9W A;  5ECN B;  6GSW A;  4G0K A;  2GSQ A;  5D93 A;  3IK7 A;  4GCI A;  2CQ9 A;  4NMU A;  5H5Q A;  4AJ8 A;  1CQH A;  5B8A A;  4YH2 A;  5COH A;  1MDK A;  2TRC P;  2O7K A;  2B1K A;  2CAI A;  1B9Y C;  1HQO A;  2B1L A;  2HFD A;  4ECB A;  3C1R A;  3DML A;  5D96 A;  2OKA A;  3FEU A;  1SJI A;  2FY6 A;  1GUL A;  3GRX A;  4TR1 B;  2K18 A;  2VLV A;  2YCD A;  3UL3 A;  4BVY A;  3F0I A;  1FG4 A;  3MDK A;  2R5G A;  4GQF A;  5IMD A;  1TU8 A;  2OE1 A;  5B8B A;  1Z6N A;  4XRD A;  2QC7 A;  1ZMA A;  3CSI A;  3D4M A;  5DQS A;  4NXI A;  1F3A A;  1VRS D;  4AF2 A;  2GT6 A;  2AB6 A;  5CRD A;  2MMO A;  3S9F A;  4O32 A;  1A0F A;  5DCH A;  1YKA A;  2R4V A;  3Q19 A;  4CHS A;  3TDG A;  3LSZ A;  1QXH A;  3BOA A;  3P2A A;  1GSF A;  4G9H A;  4JED A;  2L5O A;  1GSQ A;  3GL3 A;  2PVO C;  3FZ9 A;  2HSY A;  4FYC A;  2VIM A;  4FH8 A;  5G31 A;  3P7X A;  2C0G A;  1AUC A;  3KD0 A;  3GYK A;  2DJ0 A;  1BED A;  2VCZ A;  3M9K A;  4KDX A;  1SJZ A;  5CRH A;  3TCO A;  5KN0 A;  1KTE A;  2GZZ A;  4GST A;  4MPF A;  4LA1 A;  1ZL9 A;  2YV9 A;  4BWQ A;  1HYU A;  3PH9 A;  5D9T A;  4XS6 A;  2GT5 A;  4XS4 A;  4EE0 A;  2H1D A;  3ZYW A;  3F8U A;  5D9X A;  1N2A A;  1S3C A;  3TKS C;  3TJG A;  2HRK A;  4NV5 A;  1EP7 A;  2GGT A;  4FYB A;  3A2W A;  1XZO A;  5H5S A;  4EXJ A;  3PPU A;  2F3M A;  2H19 A;  2DLX A;  2O89 A;  3HJO A;  3VWW A;  4XCS A;  3GKN A;  2I81 A;  3LGC A;  5G5F A;  2C3Q A;  4MJB A;  1WE0 A;  1U87 A;  1R4W A;  1OC3 A;  1ML6 A;  2JZT A;  3E3E A;  2J23 A;  2P5Q A;  1YJ6 A;  1T8E B;  4ILF A;  1TRS A;  1UA5 A;  3LXT A;  2R37 A;  1X9S B;  1K3L A;  5G30 A;  1GTU A;  4MLY A;  1ON4 A;  4I8B A;  2ALB A;  3GUS A;  4OFT A;  1YEX A;  3EVI A;  5ECI B;  5J3R A;  4ZB9 A;  2V6O A;  3F4S A;  1XVW A;  4YQV A;  3KMN A;  3QFA C;  2OE0 A;  1Z6M A;  1A8Y A;  4K8M A;  2LQO A;  3K8N A;  4FQU A;  4ZL7 A;  3QAW A;  2H72 A;  1ACV A;  1I9D A;  2OAD A;  3EU3 A;  1GSY A;  3U6V A;  4TR0 A;  4Q5F A;  3KJY A;  4KCA A;  4KE3 A;  4YQU A;  5IMA A;  1X9W B;  3HXS A;  7GSS A;  2DIY A;  3VPT A;  1O85 A;  2D2Z A;  2AJQ B;  1Y6E A;  3KMO A;  2OJL A;  2VL2 A;  4K2D A;  1MTC A;  2HI7 A;  1Y25 A;  2H70 A;  2GDR A;  1ZYQ B;  4MPG A;  2PVQ A;  1VF2 A;  3TJB A;  4V1A g;  2DJ2 A;  3A3T A;  1TK8 B;  3O6T A;  3RDW A;  5ELG A;  2R6K A;  5AN1 A;  2V2G A;  3UVH A;  1G7E A;  2PER A;  2IMI A;  3KP9 A;  1C72 A;  1O8W A;  1A8L A;  2ES7 A;  2L4Q A;  3ZML A;  2IMK A;  4MZW A;  3QOU A;  2VO4 A;  2GSS A;  3DYR A;  3TGZ A;  2GST A;  5JWO B; 
#chains in the Genus database with same CATH topology
 3APQ A;  1S3R A;  3HMJ G;  3TRP A;  2PBJ A;  5JCU A;  2TIR A;  4USS A;  2VOC A;  3W8S A;  2LRN A;  4Q5R A;  5DJL A;  3TRQ A;  4WF5 A;  1SKR B;  1AAZ A;  3BD2 A;  2JZS A;  10GS A;  1WWJ A;  2FWE A;  4KH7 A;  1XOA A;  5DAL A;  1EOG A;  3GL5 A;  2WW0 A;  2P31 A;  1HD2 A;  1FHE A;  4TR4 A;  2RII A;  2WDU A;  2MYG A;  3GNJ A;  5A4U A;  5GAP D;  4MDC A;  4D73 A;  4G0I A;  3KEB A;  3F4R A;  1SK0 A;  2F51 A;  1URM A;  2YWO A;  3HJM A;  5CNW A;  5INY A;  2MZC A;  4TVE A;  4KSM A;  2NBS A;  3I43 A;  1V2A A;  2O3E A;  2O5V A;  2ZUP A;  1ERT A;  3BBY A;  3MAK A;  1M3I A;  2X8H A;  3LJR A;  2XPE A;  4HZ2 A;  1DUG A;  3E9J B;  4G0L A;  3JCM L;  2B5Y A;  2DJJ A;  1XOB A;  4PUA A;  2LRT A;  3TKS A;  4IHU A;  5DJM A;  1S4B P;  2L59 A;  1CQG A;  1SK2 A;  3UVT A;  2K8V A;  1AC1 A;  2Z9S A;  3LEF A;  1YEP A;  4TXO B;  2GZY A;  3F6F A;  2HSM A;  1X0R A;  2C1Y A;  1JHB A;  3HZ8 A;  2CAQ A;  4D73 B;  1TKD B;  1EEJ A;  4OO5 A;  3TKQ A;  2H66 A;  5IO0 A;  1EGO A;  4AJ7 A;  3KP8 A;  2OBK A;  1U3A A;  1GUK A;  3CSJ A;  3G7Y A;  4HU9 A;  1EV4 A;  2EIQ A;  1GSD A;  6GSU A;  3HCZ A;  2LJK A;  3CHX C;  3RHC A;  4BPY A;  5D9V A;  2A2P A;  3F4T A;  4MK3 A;  1TP9 A;  2LUS A;  5A5H B;  4K7I A;  4OO4 A;  1X5E A;  5GAN D;  3FW2 A;  3TJF A;  1XW9 A;  5BRT A;  1GSS A;  5F0G A;  1A0R P;  2E2M A;  4NHZ A;  4IGJ A;  1OC9 A;  3DGQ A;  4DSS A;  2C0D A;  4ISD A;  2MBS A;  2PPT A;  5DVB A;  1ERW A;  4LMW A;  1JZD A;  2VCT A;  3TKR A;  3UMA A;  2YOI A;  3DVX A;  2HSM B;  3GKK A;  1DE1 A;  1PSQ A;  5IOW A;  1SJ6 A;  1T1V A;  2GQM A;  4HI7 A;  5ECR B;  2C0E A;  2AV4 A;  4ACS A;  2CVB A;  2H8L A;  2H30 A;  3DKS A;  4X0X A;  1GSE A;  1VGL A;  5CRW A;  3DWV A;  3FZ5 A;  1GNW A;  2IWT A;  2R0P A;  4KND A;  1XWA A;  2HSN A;  4GQC A;  3F63 A;  4AGS A;  1OKT A;  3MWH A;  1TTZ A;  3MYD A;  2LNT A;  8GSS A;  4POM A;  2FHE A;  2A4V A;  1YF0 A;  5F07 A;  1VF1 A;  4HJ2 A;  4PUR A;  4POL A;  4L5O A;  3GH6 A;  5GSS A;  2XBQ A;  1E2Y A;  4DSS B;  1F37 A;  2YNX A;  5KN1 A;  5IMV A;  3OR5 A;  4DSR A;  1F2E A;  5GST A;  1JZW A;  5JWQ B;  1EV9 A;  1GWC A;  3TRX A;  1PMT A;  3I9V 2;  2HRN A;  2R0G A;  2VCX A;  1OVN A;  1X5D A;  1LJR A;  4OMV A;  1Y1U A;  4F2I A;  2YN1 A;  3ZTL A;  2MMA A;  2H0I A;  4LL1 B;  3M3M A;  5ID2 A;  2DC5 A;  2DBC A;  4ZB6 A;  1F6M C;  2I3Y A;  3M9J A;  5ELA A;  4DVC A;  4E68 A;  1QK8 A;  1UVZ A;  6GSS A;  5J47 A;  1SYR A;  3GKM A;  4YKG A;  2HSN B;  3UBL A;  1Z9H A;  1N8J A;  4N11 A;  2RM5 A;  3CRU A;  1SVM A;  1A2L A;  5CRE A;  3CTF A;  4OCE A;  3IV4 A;  3FYG A;  1O81 A;  2H76 A;  3VWV A;  4N0V A;  3FRC A;  1ST9 A;  1FVK A;  1RK4 A;  4MF6 A;  4KX4 A;  3KXO A;  4CY6 A;  1OAZ A;  4J57 E;  3H79 A;  1XPV A;  4PQI A;  2WFC A;  2C0F A;  3FR6 A;  4MA9 A;  2HNL A;  1THO A;  2V32 A;  4PQH A;  1UN2 A;  1F3B A;  3A5W A;  4HSC X;  4EC0 A;  2EFH A;  4F9Z A;  2WRT A;  4HZ4 A;  4PI0 C;  1VF3 A;  12GS A;  4BWS A;  3IA1 A;  2GQL A;  2WCI A;  3HJP A;  4FO5 A;  1YY7 A;  3NIV A;  1SD8 A;  2RM6 A;  1XBS A;  4N0Z A;  4KA0 A;  4G19 A;  2H6Z A;  2TRX A;  5DAK B;  2XPD A;  2LQQ A;  2H71 A;  2XBI A;  3FZA A;  1S3A A;  3D6I A;  4KSO A;  4OFM A;  1HNA A;  4I6X A;  2H74 A;  4G10 A;  3H8Q A;  1A24 A;  1BYE A;  3H93 A;  1M0U A;  3EUR A;  3L9S A;  5IMF A;  3A2X A;  2CX3 A;  5AIV A;  4EF0 A;  1K0B A;  2YPM A;  4LLR A;  3VI5 A;  3NOF A;  3IE3 A;  2P0G A;  4BIK A;  2IIY A;  5KOW A;  1EEM A;  3HHV A;  3QAV A;  1ABA A;  3GIX A;  1R5A A;  1TRU A;  3ERW A;  4BVY B;  2XC2 A;  2AAW A;  3DEX A;  3J7Y b;  3DD3 A;  3P8W A;  4EIP A;  4QL9 A;  2ZCT A;  3GFK A;  2A2R A;  1SKW B;  5CAX A;  4OCF A;  4V2N A;  2IFQ A;  2IMF A;  1F9M A;  2HRF A;  3GTU A;  5G1L A;  1GTB A;  4XHM A;  5DBQ A;  2C8U A;  4DSQ A;  3ZVJ D;  1XWB A;  2IMD A;  2N5F A;  3WGX A;  2FCH A;  3ERF A;  1UC7 A;  2FA8 A;  2WGR A;  2AUV A;  1V57 A;  2VL9 A;  4O5U A;  4F0C A;  4ICY A;  2HZE A;  1AIU A;  3LQ7 A;  3N9J A;  3BCK A;  4CDO A;  4P3Y B;  1V98 A;  1A23 A;  2YAN A;  2VCV A;  2LKU A;  4ZL9 A;  1ERU A;  1E6B A;  4IKH A;  1PGT A;  1ZGN A;  1V9W A;  2DSA A;  2WVY A;  2IFQ B;  2WB9 A;  20GS A;  3QCP A;  3FR3 A;  3ZFB A;  1PQN A;  4KDY A;  4XS4 B;  2WW2 A;  3KGK A;  3IAM 2;  3I69 A;  3GH9 A;  2NDO A;  1TXX A;  3PGT A;  1THX A;  4KW6 A;  2GQK A;  1QUW A;  2HRK B;  4O5R A;  2I4A A;  2IN3 A;  2E2G A;  2EFC A;  3W8J A;  2EIR A;  3KZQ A;  4JU5 A;  4L0U A;  2HZE B;  4KCE A;  1KNG A;  1K0A A;  4X1U A;  2YJ7 A;  2OAC A;  5EL8 A;  4G01 A;  4MH2 A;  1TU7 A;  4IJ3 A;  1M2B A;  2MMZ A;  2NVL A;  4N30 A;  1TRW A;  1GL8 A;  5HFK A;  4IW9 A;  6GSY A;  3VI7 A;  5G5E A;  3QMX A;  2QGV A;  4EL1 A;  17GS A;  1TK5 B;  4GSS A;  3PR8 A;  2CA8 A;  2BMX A;  3LOR A;  1M99 A;  2C80 A;  3FY7 A;  3G7J A;  2CX4 A;  4V2M A;  2I1U A;  1XXU A;  4JZQ A;  2M46 A;  1SU9 A;  3N5O A;  4ZB7 A;  1QGV A;  1G6W A;  2YV7 A;  4EUY A;  1U6T A;  3V1W A;  2KOK A;  4IQA A;  4Z2T A;  1Z5Y E;  2HYX A;  5DDL A;  3ZRD A;  2IME A;  3GUR A;  3BJ5 A;  4GRF A;  2WZS A;  4POK A;  4K0G A;  2DIZ A;  5ABR A;  3M8N A;  3UEM A;  4W66 A;  3WD6 A;  3AY8 A;  3F3Q A;  1SVO A;  19GS A;  4IVF A;  1I5G A;  2H0H A;  2G2Q A;  2L6C A;  2CT6 A;  4X43 A;  4RQX A;  3UJ1 A;  1DE2 A;  2JAC A;  2PU9 C;  5A5K A;  5ECP B;  2LV3 A;  3ME8 A;  3GKX A;  2V41 A;  4CW9 A;  4TN8 A;  5FWG A;  4WBJ A;  2KP2 A;  5IMZ A;  1Z3E A;  1XWK A;  1FOV A;  5KEJ A;  2OT3 A;  1PL1 A;  2H1G A;  2CV4 A;  3GHA A;  4ZXG A;  1PD2 1;  1GUH A;  3M1G A;  2E0Q A;  2EFD A;  2K9F A;  1T4Y A;  4MJE A;  5EY6 A;  4V2L A;  4AKX B;  1K0C A;  2C3N A;  1NM3 A;  4JRR A;  4X4J A;  2DJK A;  4HS1 A;  3ERG A;  1TI3 A;  3C1S A;  1MD3 A;  5ECS A;  4XIH A;  3MSZ A;  5ECO B;  1ZZY A;  3KTB A;  4MMM A;  4PGT A;  3IHQ A;  4TXV A;  3LG6 A;  2IPA A;  2FWF A;  4Q5N A;  5IIZ A;  1BG1 A;  5A1N A;  4YAP A;  2VKZ G;  3DVW A;  2OBI A;  1YDK A;  5DAL B;  1QFN A;  2JAD A;  1J9B A;  4Z7X A;  3GX8 A;  2X99 A;  1FB0 A;  2PWJ A;  1LU4 A;  3CMI A;  4TR3 A;  4ULX A;  4IBP A;  1W4V A;  2VLU A;  4PNF A;  3IOS A;  1NSW A;  2RUE A;  2I9H A;  6GSX A;  5AIS A;  4MZC A;  1WRY A;  4LMV A;  1X9M B;  4YAV A;  2QKE A;  3IAS 2;  2BJX A;  1GNE A;  4ZIJ A;  3KTL A;  4AKH A;  1XVQ A;  3IC8 A;  5B6M A;  2LS5 A;  4GF0 A;  2L5L A;  2B7J A;  2KP1 A;  1QMV A;  5JCW A;  2L4C A;  1H4O A;  3W6G A;  4OWY A;  4ZBD A;  1WPI A;  1O8X A;  2IJY A;  1XIY A;  5IOX A;  1G6Y A;  2BTO T;  4F03 A;  3BCI A;  2YWN A;  2QSI A;  14GS A;  2FWG A;  3LFL A;  3GMF A;  4WR5 A;  4GTU A;  4O7H A;  4JE1 A;  2WJU A;  2EC4 A;  1SKS B;  5HQP A;  2N5A A;  4PTS A;  1PKZ A;  3D21 A;  3FZ4 A;  2F8F A;  3GA4 A;  4DEJ A;  3HVN A;  1AXD A;  3QDN A;  1RW1 A;  1WIK A;  2H75 A;  3VK9 A;  2DKH A;  4E8E A;  4JBB A;  1G0T A;  11GS A;  3LYP A;  1N25 A;  3TU3 B;  3IDV A;  3IRA A;  4MF5 A;  4WF4 A;  4NV2 A;  1IYH A;  2WS2 A;  3HY2 A;  4IN0 A;  3DRN A;  1J08 A;  3LYK A;  4AI6 A;  4EVM A;  2YWI A;  2VCW A;  5IO2 A;  1BG5 A;  4MNN A;  2F8A A;  2PMT A;  1JZO A;  3RBT A;  1OC8 A;  3L4N A;  5JCG A;  4GWR A;  16GS A;  2HLS A;  4XTS A;  1BQ7 A;  1Z7P A;  3TOU A;  3O3T A;  2VM2 A;  3G7I A;  4BVX A;  1OC9 B;  3IR4 A;  5CO3 A;  3TB2 A;  2LTK A;  1R5P A;  4BA7 A;  3EC3 A;  3C7M A;  2B7K A;  2GSR A;  2GTU A;  5HFI A;  2MBT A;  1YVL A;  4HUA A;  3CXG A;  2B5E A;  1SL0 B;  1SK1 A;  3D5J A;  4XS1 A;  2CVD A;  3QAG A;  3IBH A;  1RQM A;  4KB3 A;  4Z2R A;  4JR4 A;  1GSU A;  4QL7 A;  5ECL B;  22GS A;  4ZB8 A;  3HVX A;  4TW5 A;  2JL4 A;  5A34 A;  3D4T A;  4TR1 A;  3SBC A;  2CVK A;  1GRX A;  3ZVJ A;  3APS A;  2RLI A;  2ZNM A;  4FIW A;  5ENU A;  4EKZ A;  1XCC A;  5JWR B;  5B7C A;  5F8B A;  2L6D A;  2LRC A;  4KAE A;  3LWA A;  1M2A A;  3QPM A;  2CZ2 A;  3G9B A;  3EMX A;  2HXK A;  5E4W A;  3FKF A;  4EIQ A;  4OFN A;  4ECJ A;  4K7O A;  4PHZ C;  1WJK A;  1QQ2 A;  2GS3 A;  3UIW A;  9GSS A;  3SWL A;  6GSV A;  4KDU A;  1K0O A;  3ZIT A;  3M0F A;  2VL2 C;  3GX0 A;  1U3I A;  5ECQ B;  2AHE A;  2FNO A;  2AYT A;  3C73 A;  4CY8 A;  5ID2 B;  1Z7R A;  2B6M A;  3CWG A;  1IYI A;  5A34 B;  4F82 A;  2V6K A;  3UAP A;  5HR3 A;  1GP1 A;  2GVP A;  2LST A;  2WVX A;  1EOH A;  3CBU A;  2G0F A;  4WKW A;  1JLV A;  3HYP A;  4HU7 A;  4WET A;  1B4P A;  3C8E A;  3IC4 A;  5GZZ B;  4RUV A;  4EDZ A;  2KLX A;  3WT1 A;  3VFI A;  4IS0 A;  2FGX A;  1SEN A;  4F0B A;  2VCQ A;  1MDI A;  2PUK C;  4QQ7 A;  2K8S A;  4MF7 A;  5CYY A;  4MAB A;  3A2V A;  2X49 A;  2A4H A;  1XWC A;  2GLR A;  4PNG A;  4HOJ A;  1BX9 A;  1GLQ A;  3CQF A;  4MCU A;  3KH9 A;  3MIX A;  2FA4 A;  1TK0 B;  2H6X A;  2B3S A;  1TW9 A;  3FHK A;  3PIN A;  1G7O A;  2DML A;  1Q98 A;  3KM6 A;  5EVO A;  1DSB A;  1R26 A;  5IPG A;  4RI6 A;  3HVS A;  4ECC A;  4N3Z A;  4IP1 A;  4RI7 A;  3UBK A;  2JZR A;  2NPB A;  1ZCP A;  2GZP A;  1O7U A;  1OE7 A;  2XHF A;  2WVX B;  3VLN A;  4I2T A;  4GDF A;  3CSH A;  4K6X A;  1T3B A;  1K3Y A;  1JLW A;  3P90 A;  4K2X A;  3DXB A;  4TOP A;  4OD7 A;  1NW2 A;  1TRV A;  1YF1 A;  2R2J A;  2JSZ A;  3QD9 A;  4FXY P;  1YZX A;  1MEK A;  4YKF A;  4IQ1 A;  2UV8 G;  1DBY A;  3ZMK A;  4HDE A;  4NAX A;  3RPP A;  1K0D A;  1H75 A;  2HE3 A;  4GXZ A;  3US3 A;  2CZ3 A;  3CRT A;  3GN3 A;  2LJA A;  4JR6 A;  2VL3 A;  4I5Q A;  5G2Z A;  1EWX A;  3KIJ A;  6GST A;  3EMP A;  1O6J A;  4V1A p;  1V40 A;  1EP8 A;  1K0N A;  5J41 A;  3GTU B;  4PX1 A;  1SL2 B;  5KN2 A;  1KBN A;  4ZBB A;  1NHY A;  4N10 A;  2LEG A;  1K3O A;  1SL1 B;  3IPZ A;  5CRG A;  4GLT A;  4HQZ A;  5HFG A;  1M2D A;  1SYX A;  5J4Y A;  3IXR A;  1A2J A;  5IMC A;  3VWU A;  4KUN A;  1PL2 A;  4POB A;  5B6N A;  2O87 A;  4Q5Q A;  3WGD A;  4H86 A;  1U88 A;  3H1N A;  2M80 A;  4Z2U A;  3TOT A;  4I2U A;  2PGT A;  4NWY A;  5G1K A;  1FO5 A;  2QA1 A;  4PXO A;  2H1A A;  2OA7 A;  3ED3 A;  4AKG A;  3KH7 A;  4L0W A;  1M3J A;  2LNS A;  2DJ1 A;  2FWH A;  1B8X A;  3U5R E;  3ZLP A;  5ECH B;  3KCM A;  4PQ1 A;  1YQ1 A;  2VLT A;  2FLS A;  3CYN A;  2X8C A;  2DKI A;  2HQT A;  1FAA A;  4J2F A;  3TJJ A;  3ZZX A;  4TKY A;  2YP6 A;  5C00 A;  4WXT A;  3UOM A;  5CP1 A;  1M9A A;  4ECI A;  3HDC A;  4ML1 A;  4K5S A;  1GTI A;  1PFO A;  3Q18 A;  3L0H A;  1R7H A;  5IQY A;  5EPF A;  4FYU A;  1A2M A;  5J40 A;  1TXU A;  5ECM B;  5DCG A;  1K0M A;  3D0Z A;  4KGI A;  2YJH A;  2FUG 2;  1GTA A;  4ZBA A;  1WMJ A;  1ZYE A;  3WGE A;  3J7Y k;  2M72 A;  2YZH A;  3CTG A;  5C04 A;  3ZRE A;  3C71 A;  1O73 A;  3TJK A;  4K0N A;  3APO A;  2HSH A;  3EPT A;  3E0U A;  2DMM A;  2VM1 A;  5A4V A;  1X5C A;  1FB6 A;  5KN3 A;  1BAY A;  1GUM A;  4MJC A;  5F06 A;  4PUF C;  4K9Z A;  2ON5 A;  1ILO A;  1PX6 A;  5ECK B;  4MZB A;  4I97 A;  4HEA 2;  4RQR A;  2VAF A;  2H73 A;  3NZN A;  4WR4 A;  3WT2 A;  4MJA A;  3HKR A;  2K6V A;  1FVJ A;  2JSY A;  1MD4 A;  1ERV A;  5LD0 A;  1AW9 A;  1TI1 A;  3O76 A;  1OYJ A;  3RPN A;  2A2S A;  4TXO A;  2PN8 A;  2O8V B;  1KEB A;  1B4Q A;  4ZL8 A;  2ON7 A;  2WW3 A;  2EFE A;  4BL7 A;  3HVV A;  3ZFL A;  2H01 A;  1HNB A;  3MNG A;  3Q74 A;  3F9U A;  1USB A;  4ID0 A;  4ML6 A;  5FHI A;  1GLP A;  3VWX A;  2NTO A;  1YKC A;  2X64 A;  4KF9 A;  2WW1 A;  1MDJ A;  4O92 A;  1XFL A;  3RFR C;  3HZ4 A;  3ZIV A;  1Q4J A;  5A5H A;  1GH2 A;  3GV1 A;  4K7N A;  5HR2 A;  1B48 A;  1W89 A;  3WYW A;  3R2Q A;  3EIN A;  5BMU A;  3VUR A;  2H1B A;  3ZIJ A;  3RHB A;  2E7P A;  1J0F A;  1HNC A;  2KUC A;  2FD3 A;  3IK9 A;  2IL3 A;  18GS A;  2DJ3 A;  5J9B A;  5HR1 A;  1JZR A;  4ZIL A;  5AIX A;  2B5X A;  5HR0 A;  2L57 A;  1ZOF A;  3L78 A;  2KHP A;  3FMW A;  2V1M A;  3EE2 A;  3UAR A;  5A4W A;  4G2E A;  1XWG A;  1AQV A;  1WOU A;  5J4U A;  3FR9 A;  4BL7 B;  1AQX A;  4NPB A;  2HRA A;  4MH3 A;  1T7P B;  1SD9 A;  3LXZ A;  3ISO A;  2VD0 A;  2VD1 A;  2WVZ A;  2UZ8 A;  1PN9 A;  3VPQ A;  3R3E A;  2P5R A;  13GS A;  5A1N B;  1XW5 A;  4L5L A;  4IEL A;  2YWM A;  1BJX A;  1B9X C;  5KOX A;  1WP0 A;  2X8G A;  3L9V A;  5J5N A;  5BMU B;  1FW1 A;  3QFB C;  2LJR A;  5H5R A;  4WEY A;  3TUE A;  3GST A;  2HZF A;  5D73 A;  1AQW A;  3EWL A;  3F3R A;  3FK8 A;  4NHW A;  1V58 A;  1NHO A;  1LBK A;  1M9B A;  4HQS A;  2WZ9 A;  3EU4 A;  1OE8 A;  2REM A;  2MMN A;  3QR6 A;  4YQM A;  2EIO A;  2HT9 A;  1TJD A;  5IPH A;  3GSS A;  3H4K A;  3D22 A;  1OKD A;  4J56 E;  1M7T A;  1T4Z A;  4L8E A;  2J9H A;  5D8I A;  3Q6O A;  5DQY A;  2YZU A;  5LCZ A;  2WUL A;  3ZL5 A;  2R3X A;  3TKS E;  2X4A A;  1T00 A;  2RUF A;  3F6D A;  1PX7 A;  2H0G A;  3L9U A;  3I6A A;  5E59 A;  3TKP A;  4MP4 A;  1TOF A;  5L71 A;  2N5B A;  4IJI A;  2QA2 A;  2VUP A;  3DIE A;  4HJM A;  4EO3 A;  3HD5 A;  5J9C A;  3RAZ A;  1VF4 A;  1BF5 A;  4K1F A;  3EYT A;  4WBR D;  3HA9 A;  4LL4 B;  4GSN A;  1PA3 A;  4AJ6 A;  1XW6 A;  1ZYP A;  1PKW A;  1PRX A;  2H6Y A;  1EZK A;  5IM9 A;  2C3T A;  2OE3 A;  2JU5 A;  4XRA A;  1JFU A;  5LNK e;  4E8H A;  3ME7 A;  4TRX A;  2O85 A;  1S3D A;  1TDI A;  3LW9 A;  2F9S A;  4IP6 A;  1EGR A;  4EDY A;  5DAK A;  5FT3 A;  2C4J A;  5AGY A;  5F05 A;  4BVX B;  5D9W A;  5ECN B;  6GSW A;  4G0K A;  2GSQ A;  5D93 A;  3IK7 A;  4GCI A;  2CQ9 A;  4NMU A;  1SVL A;  5H5Q A;  4AJ8 A;  1CQH A;  5B8A A;  1ZYN A;  4YH2 A;  5COH A;  1MDK A;  2TRC P;  2O7K A;  2B1K A;  2CAI A;  1B9Y C;  1HQO A;  2B1L A;  2HFD A;  4ECB A;  3C1R A;  3DML A;  5D96 A;  2OKA A;  3FEU A;  1SJI A;  2FY6 A;  1GUL A;  3GRX A;  4TR1 B;  2K18 A;  2VLV A;  2YCD A;  1I1I P;  3UL3 A;  4BVY A;  3F0I A;  1FG4 A;  3MDK A;  2R5G A;  4GQF A;  5IMD A;  1TU8 A;  2OE1 A;  5B8B A;  2H1L A;  1Z6N A;  4XRD A;  2QC7 A;  4AKI A;  1ZMA A;  3CSI A;  3D4M A;  5DQS A;  4NXI A;  1F3A A;  1VRS D;  4AF2 A;  2GT6 A;  2AB6 A;  5CRD A;  2MMO A;  3IHG A;  3S9F A;  4O32 A;  1A0F A;  5DCH A;  1YKA A;  2R4V A;  3Q19 A;  4CHS A;  3TDG A;  3LSZ A;  1QXH A;  3BOA A;  3P2A A;  1GSF A;  4G9H A;  4JED A;  2L5O A;  1GSQ A;  3GL3 A;  2PVO C;  3FZ9 A;  2HSY A;  4FYC A;  2VIM A;  2O36 A;  4FH8 A;  5G31 A;  1YEW C;  3P7X A;  2C0G A;  1AUC A;  3KD0 A;  3RGB C;  2DJ0 A;  3GYK A;  1BED A;  2VCZ A;  3M9K A;  4KDX A;  1SJZ A;  5CRH A;  4QMK A;  3TCO A;  5KN0 A;  1KTE A;  2GZZ A;  5J4V A;  4GST A;  4MPF A;  4LA1 A;  1ZL9 A;  2YV9 A;  4BWQ A;  1XG8 A;  1HYU A;  3PH9 A;  5D9T A;  4XS6 A;  2GT5 A;  4XS4 A;  4EE0 A;  2H1D A;  3ZYW A;  3F8U A;  4O5Q A;  5D9X A;  1N2A A;  1S3C A;  3TKS C;  3TJG A;  2HRK A;  4NV5 A;  1EP7 A;  2GGT A;  4FYB A;  1PN0 A;  3A2W A;  1XZO A;  5H5S A;  4EXJ A;  3PPU A;  2F3M A;  2H19 A;  2DLX A;  2O89 A;  3HJO A;  3VWW A;  4XCS A;  3GKN A;  2I81 A;  3LGC A;  5G5F A;  2C3Q A;  4MJB A;  1WE0 A;  1U87 A;  1R4W A;  1OC3 A;  1ML6 A;  2JZT A;  3E3E A;  2J23 A;  2P5Q A;  1YJ6 A;  1T8E B;  4ILF A;  1TRS A;  1UA5 A;  3LXT A;  2R37 A;  1X9S B;  1K3L A;  5G30 A;  1GTU A;  4MLY A;  1ON4 A;  4I8B A;  2ALB A;  3GUS A;  4OFT A;  1YEX A;  3EVI A;  5ECI B;  5J3R A;  4ZB9 A;  2V6O A;  3F4S A;  1XVW A;  4YQV A;  3KMN A;  3QFA C;  2OE0 A;  4K5R A;  1Z6M A;  1A8Y A;  4A5P A;  4K8M A;  2LQO A;  3K8N A;  4FQU A;  4ZL7 A;  3QAW A;  2H72 A;  1ACV A;  1I9D A;  2OAD A;  3EU3 A;  1GSY A;  3U6V A;  4TR0 A;  4Q5F A;  3KJY A;  4KCA A;  4KE3 A;  4YQU A;  5IMA A;  1X9W B;  3HXS A;  7GSS A;  2DIY A;  3VPT A;  1O85 A;  4PI2 C;  1FOH A;  2D2Z A;  2AJQ B;  1Y6E A;  3KMO A;  2OJL A;  2VL2 A;  4K2D A;  1MTC A;  2HI7 A;  3A5I A;  1Y25 A;  2H70 A;  2GDR A;  1ZYQ B;  4MPG A;  2PVQ A;  1VF2 A;  3TJB A;  4V1A g;  2DJ2 A;  3A3T A;  1TK8 B;  3O6T A;  3RDW A;  5ELG A;  2R6K A;  5AN1 A;  2V2G A;  3UVH A;  2R0C A;  1G7E A;  2PER A;  2IMI A;  3KP9 A;  1C72 A;  1O8W A;  1A8L A;  2ES7 A;  2L4Q A;  3ZML A;  2IMK A;  4MZW A;  3QOU A;  2VO4 A;  2GSS A;  3DYR A;  3TGZ A;  2GST A;  5JWO B; 
#chains in the Genus database with same CATH homology
 3APQ A;  3HMJ G;  3TRP A;  2PBJ A;  5JCU A;  2TIR A;  4USS A;  2VOC A;  3W8S A;  2LRN A;  4Q5R A;  5DJL A;  3TRQ A;  4WF5 A;  1SKR B;  1AAZ A;  3BD2 A;  2JZS A;  10GS A;  1WWJ A;  2FWE A;  4KH7 A;  1XOA A;  5DAL A;  1EOG A;  3GL5 A;  2P31 A;  1HD2 A;  1FHE A;  4TR4 A;  2RII A;  2WDU A;  2MYG A;  3GNJ A;  5A4U A;  5GAP D;  4MDC A;  4D73 A;  4G0I A;  3KEB A;  3F4R A;  1SK0 A;  2F51 A;  1URM A;  2YWO A;  3HJM A;  5CNW A;  5INY A;  2MZC A;  4TVE A;  4KSM A;  2NBS A;  3I43 A;  1V2A A;  2O5V A;  2ZUP A;  1ERT A;  3BBY A;  3MAK A;  2X8H A;  3LJR A;  2XPE A;  4HZ2 A;  1DUG A;  3E9J B;  4G0L A;  3JCM L;  2B5Y A;  2DJJ A;  1XOB A;  4PUA A;  2LRT A;  3TKS A;  4IHU A;  5DJM A;  2L59 A;  1CQG A;  1SK2 A;  3UVT A;  2K8V A;  1AC1 A;  2Z9S A;  3LEF A;  1YEP A;  4TXO B;  2GZY A;  3F6F A;  2HSM A;  1X0R A;  2C1Y A;  1JHB A;  3HZ8 A;  2CAQ A;  4D73 B;  1TKD B;  1EEJ A;  4OO5 A;  3TKQ A;  2H66 A;  5IO0 A;  1EGO A;  4AJ7 A;  3KP8 A;  2OBK A;  1U3A A;  1GUK A;  3CSJ A;  3G7Y A;  4HU9 A;  1EV4 A;  2EIQ A;  1GSD A;  6GSU A;  3HCZ A;  2LJK A;  3RHC A;  4BPY A;  5D9V A;  2A2P A;  3F4T A;  4MK3 A;  1TP9 A;  2LUS A;  5A5H B;  4K7I A;  4OO4 A;  1X5E A;  5GAN D;  3FW2 A;  3TJF A;  1XW9 A;  5BRT A;  1GSS A;  5F0G A;  1A0R P;  2E2M A;  4NHZ A;  4IGJ A;  1OC9 A;  3DGQ A;  4DSS A;  2C0D A;  4ISD A;  2MBS A;  2PPT A;  5DVB A;  1ERW A;  4LMW A;  1JZD A;  2VCT A;  3TKR A;  3UMA A;  2YOI A;  3DVX A;  2HSM B;  3GKK A;  1DE1 A;  1PSQ A;  5IOW A;  1SJ6 A;  1T1V A;  2GQM A;  4HI7 A;  5ECR B;  2C0E A;  2AV4 A;  4ACS A;  2CVB A;  2H8L A;  2H30 A;  3DKS A;  4X0X A;  1GSE A;  1VGL A;  5CRW A;  3DWV A;  3FZ5 A;  1GNW A;  2IWT A;  2R0P A;  4KND A;  1XWA A;  2HSN A;  4GQC A;  3F63 A;  4AGS A;  1OKT A;  3MWH A;  1TTZ A;  3MYD A;  2LNT A;  8GSS A;  4POM A;  2FHE A;  2A4V A;  1YF0 A;  5F07 A;  1VF1 A;  4HJ2 A;  4PUR A;  4POL A;  4L5O A;  3GH6 A;  5GSS A;  2XBQ A;  1E2Y A;  4DSS B;  1F37 A;  2YNX A;  5KN1 A;  5IMV A;  3OR5 A;  4DSR A;  1F2E A;  5GST A;  1JZW A;  5JWQ B;  1EV9 A;  1GWC A;  3TRX A;  1PMT A;  3I9V 2;  2HRN A;  2R0G A;  2VCX A;  1OVN A;  1X5D A;  1LJR A;  4OMV A;  1Y1U A;  4F2I A;  2YN1 A;  3ZTL A;  2MMA A;  2H0I A;  4LL1 B;  3M3M A;  5ID2 A;  2DC5 A;  2DBC A;  4ZB6 A;  1F6M C;  2I3Y A;  3M9J A;  5ELA A;  4DVC A;  4E68 A;  1QK8 A;  1UVZ A;  6GSS A;  5J47 A;  1SYR A;  3GKM A;  4YKG A;  2HSN B;  3UBL A;  1Z9H A;  1N8J A;  4N11 A;  2RM5 A;  3CRU A;  1SVM A;  1A2L A;  5CRE A;  3CTF A;  4OCE A;  3IV4 A;  3FYG A;  1O81 A;  2H76 A;  3VWV A;  4N0V A;  3FRC A;  1ST9 A;  1FVK A;  1RK4 A;  4MF6 A;  4KX4 A;  3KXO A;  4CY6 A;  1OAZ A;  4J57 E;  3H79 A;  1XPV A;  4PQI A;  2WFC A;  2C0F A;  3FR6 A;  4MA9 A;  2HNL A;  1THO A;  2V32 A;  4PQH A;  1UN2 A;  1F3B A;  3A5W A;  4EC0 A;  2EFH A;  4F9Z A;  2WRT A;  4HZ4 A;  1VF3 A;  12GS A;  4BWS A;  3IA1 A;  2GQL A;  2WCI A;  3HJP A;  4FO5 A;  1YY7 A;  3NIV A;  1SD8 A;  2RM6 A;  1XBS A;  4N0Z A;  4KA0 A;  4G19 A;  2H6Z A;  2TRX A;  5DAK B;  2XPD A;  2LQQ A;  2H71 A;  2XBI A;  3FZA A;  1S3A A;  3D6I A;  4KSO A;  4OFM A;  1HNA A;  4I6X A;  2H74 A;  4G10 A;  3H8Q A;  1A24 A;  1BYE A;  3H93 A;  1M0U A;  3EUR A;  3L9S A;  5IMF A;  3A2X A;  2CX3 A;  5AIV A;  4EF0 A;  1K0B A;  2YPM A;  4LLR A;  3VI5 A;  3NOF A;  3IE3 A;  2P0G A;  2IIY A;  5KOW A;  1EEM A;  3HHV A;  3QAV A;  1ABA A;  3GIX A;  1R5A A;  1TRU A;  3ERW A;  4BVY B;  2XC2 A;  2AAW A;  3DEX A;  3J7Y b;  3DD3 A;  3P8W A;  4EIP A;  4QL9 A;  2ZCT A;  3GFK A;  2A2R A;  1SKW B;  5CAX A;  4OCF A;  4V2N A;  2IFQ A;  2IMF A;  1F9M A;  2HRF A;  3GTU A;  5G1L A;  1GTB A;  4XHM A;  5DBQ A;  2C8U A;  4DSQ A;  3ZVJ D;  1XWB A;  2IMD A;  2N5F A;  3WGX A;  2FCH A;  3ERF A;  1UC7 A;  2FA8 A;  2WGR A;  2AUV A;  1V57 A;  2VL9 A;  4O5U A;  4F0C A;  4ICY A;  2HZE A;  1AIU A;  3LQ7 A;  3N9J A;  3BCK A;  4CDO A;  4P3Y B;  1V98 A;  1A23 A;  2YAN A;  2VCV A;  2LKU A;  4ZL9 A;  1ERU A;  1E6B A;  4IKH A;  1PGT A;  1ZGN A;  1V9W A;  2DSA A;  2IFQ B;  2WB9 A;  20GS A;  3QCP A;  3FR3 A;  3ZFB A;  1PQN A;  4KDY A;  4XS4 B;  3KGK A;  3IAM 2;  3I69 A;  3GH9 A;  2NDO A;  1TXX A;  3PGT A;  1THX A;  4KW6 A;  2GQK A;  1QUW A;  2HRK B;  4O5R A;  2I4A A;  2IN3 A;  2E2G A;  2EFC A;  3W8J A;  2EIR A;  3KZQ A;  4JU5 A;  4L0U A;  2HZE B;  4KCE A;  1KNG A;  1K0A A;  4X1U A;  2YJ7 A;  2OAC A;  5EL8 A;  4G01 A;  4MH2 A;  1TU7 A;  4IJ3 A;  1M2B A;  2MMZ A;  2NVL A;  4N30 A;  1TRW A;  1GL8 A;  5HFK A;  4IW9 A;  6GSY A;  3VI7 A;  5G5E A;  3QMX A;  2QGV A;  4EL1 A;  17GS A;  1TK5 B;  4GSS A;  3PR8 A;  2CA8 A;  2BMX A;  3LOR A;  1M99 A;  2C80 A;  3FY7 A;  3G7J A;  2CX4 A;  4V2M A;  2I1U A;  1XXU A;  4JZQ A;  2M46 A;  1SU9 A;  3N5O A;  4ZB7 A;  1QGV A;  1G6W A;  2YV7 A;  4EUY A;  1U6T A;  3V1W A;  2KOK A;  4IQA A;  4Z2T A;  1Z5Y E;  2HYX A;  5DDL A;  3ZRD A;  2IME A;  3GUR A;  3BJ5 A;  4GRF A;  4POK A;  4K0G A;  2DIZ A;  5ABR A;  3M8N A;  3UEM A;  4W66 A;  3WD6 A;  3AY8 A;  3F3Q A;  1SVO A;  19GS A;  4IVF A;  1I5G A;  2H0H A;  2G2Q A;  2L6C A;  2CT6 A;  4X43 A;  4RQX A;  3UJ1 A;  1DE2 A;  2JAC A;  2PU9 C;  5A5K A;  5ECP B;  2LV3 A;  3ME8 A;  3GKX A;  2V41 A;  4CW9 A;  4TN8 A;  5FWG A;  4WBJ A;  2KP2 A;  5IMZ A;  1Z3E A;  1XWK A;  1FOV A;  5KEJ A;  2OT3 A;  1PL1 A;  2H1G A;  2CV4 A;  3GHA A;  4ZXG A;  1PD2 1;  1GUH A;  3M1G A;  2E0Q A;  2EFD A;  2K9F A;  1T4Y A;  4MJE A;  5EY6 A;  4V2L A;  4AKX B;  1K0C A;  2C3N A;  1NM3 A;  4JRR A;  4X4J A;  2DJK A;  4HS1 A;  3ERG A;  1TI3 A;  3C1S A;  1MD3 A;  5ECS A;  4XIH A;  3MSZ A;  5ECO B;  1ZZY A;  3KTB A;  4MMM A;  4PGT A;  3IHQ A;  4TXV A;  3LG6 A;  2IPA A;  2FWF A;  4Q5N A;  5IIZ A;  1BG1 A;  5A1N A;  4YAP A;  2VKZ G;  3DVW A;  2OBI A;  1YDK A;  5DAL B;  1QFN A;  2JAD A;  1J9B A;  4Z7X A;  3GX8 A;  2X99 A;  1FB0 A;  2PWJ A;  1LU4 A;  3CMI A;  4TR3 A;  4ULX A;  4IBP A;  1W4V A;  2VLU A;  4PNF A;  1NSW A;  3IOS A;  2RUE A;  2I9H A;  6GSX A;  5AIS A;  4MZC A;  1WRY A;  4LMV A;  1X9M B;  4YAV A;  2QKE A;  3IAS 2;  2BJX A;  1GNE A;  4ZIJ A;  3KTL A;  4AKH A;  1XVQ A;  3IC8 A;  5B6M A;  2LS5 A;  4GF0 A;  2L5L A;  2B7J A;  2KP1 A;  1QMV A;  5JCW A;  2L4C A;  1H4O A;  3W6G A;  4OWY A;  4ZBD A;  1WPI A;  1O8X A;  2IJY A;  1XIY A;  5IOX A;  1G6Y A;  2BTO T;  4F03 A;  3BCI A;  2YWN A;  2QSI A;  14GS A;  2FWG A;  3LFL A;  3GMF A;  4WR5 A;  4GTU A;  4O7H A;  4JE1 A;  2WJU A;  2EC4 A;  1SKS B;  5HQP A;  2N5A A;  4PTS A;  1PKZ A;  3D21 A;  3FZ4 A;  2F8F A;  3GA4 A;  4DEJ A;  1AXD A;  3QDN A;  1RW1 A;  1WIK A;  2H75 A;  3VK9 A;  2DKH A;  4E8E A;  4JBB A;  1G0T A;  11GS A;  3LYP A;  1N25 A;  3TU3 B;  3IDV A;  3IRA A;  4MF5 A;  4WF4 A;  4NV2 A;  1IYH A;  2WS2 A;  3HY2 A;  4IN0 A;  3DRN A;  1J08 A;  3LYK A;  4AI6 A;  4EVM A;  2YWI A;  2VCW A;  5IO2 A;  1BG5 A;  4MNN A;  2F8A A;  2PMT A;  1JZO A;  3RBT A;  1OC8 A;  3L4N A;  5JCG A;  4GWR A;  16GS A;  2HLS A;  4XTS A;  1BQ7 A;  1Z7P A;  3TOU A;  3O3T A;  2VM2 A;  3G7I A;  4BVX A;  1OC9 B;  3IR4 A;  5CO3 A;  3TB2 A;  2LTK A;  1R5P A;  4BA7 A;  3EC3 A;  3C7M A;  2B7K A;  2GSR A;  2GTU A;  5HFI A;  2MBT A;  1YVL A;  4HUA A;  3CXG A;  2B5E A;  1SL0 B;  1SK1 A;  3D5J A;  4XS1 A;  2CVD A;  3QAG A;  3IBH A;  1RQM A;  4KB3 A;  4Z2R A;  4JR4 A;  1GSU A;  4QL7 A;  5ECL B;  22GS A;  4ZB8 A;  3HVX A;  4TW5 A;  2JL4 A;  5A34 A;  3D4T A;  4TR1 A;  3SBC A;  2CVK A;  1GRX A;  3ZVJ A;  3APS A;  2RLI A;  2ZNM A;  4FIW A;  5ENU A;  4EKZ A;  1XCC A;  5JWR B;  5B7C A;  5F8B A;  2L6D A;  2LRC A;  4KAE A;  3LWA A;  1M2A A;  3QPM A;  2CZ2 A;  3G9B A;  3EMX A;  2HXK A;  5E4W A;  3FKF A;  4EIQ A;  4OFN A;  4ECJ A;  4K7O A;  1WJK A;  1QQ2 A;  2GS3 A;  3UIW A;  9GSS A;  3SWL A;  6GSV A;  4KDU A;  1K0O A;  3ZIT A;  3M0F A;  2VL2 C;  3GX0 A;  1U3I A;  5ECQ B;  2AHE A;  2FNO A;  2AYT A;  3C73 A;  4CY8 A;  5ID2 B;  1Z7R A;  2B6M A;  3CWG A;  1IYI A;  5A34 B;  4F82 A;  2V6K A;  3UAP A;  5HR3 A;  1GP1 A;  2GVP A;  2LST A;  1EOH A;  3CBU A;  2G0F A;  4WKW A;  1JLV A;  3HYP A;  4HU7 A;  4WET A;  1B4P A;  3C8E A;  3IC4 A;  5GZZ B;  4RUV A;  4EDZ A;  2KLX A;  3WT1 A;  3VFI A;  4IS0 A;  2FGX A;  1SEN A;  4F0B A;  2VCQ A;  1MDI A;  2PUK C;  4QQ7 A;  2K8S A;  4MF7 A;  5CYY A;  4MAB A;  3A2V A;  2X49 A;  2A4H A;  1XWC A;  2GLR A;  4PNG A;  4HOJ A;  1BX9 A;  1GLQ A;  4MCU A;  3KH9 A;  3MIX A;  2FA4 A;  1TK0 B;  2H6X A;  2B3S A;  1TW9 A;  3FHK A;  3PIN A;  1G7O A;  2DML A;  1Q98 A;  3KM6 A;  5EVO A;  1DSB A;  1R26 A;  5IPG A;  4RI6 A;  3HVS A;  4ECC A;  4N3Z A;  4IP1 A;  4RI7 A;  3UBK A;  2JZR A;  2NPB A;  1ZCP A;  2GZP A;  1O7U A;  1OE7 A;  2XHF A;  3VLN A;  4I2T A;  4GDF A;  3CSH A;  4K6X A;  1T3B A;  1K3Y A;  1JLW A;  3P90 A;  4K2X A;  3DXB A;  4TOP A;  4OD7 A;  1NW2 A;  1TRV A;  1YF1 A;  2R2J A;  2JSZ A;  3QD9 A;  1YZX A;  1MEK A;  4YKF A;  4IQ1 A;  2UV8 G;  1DBY A;  3ZMK A;  4HDE A;  4NAX A;  3RPP A;  1K0D A;  1H75 A;  2HE3 A;  4GXZ A;  3US3 A;  2CZ3 A;  3CRT A;  3GN3 A;  2LJA A;  4JR6 A;  2VL3 A;  4I5Q A;  5G2Z A;  1EWX A;  3KIJ A;  6GST A;  3EMP A;  1O6J A;  4V1A p;  1V40 A;  1EP8 A;  1K0N A;  5J41 A;  3GTU B;  4PX1 A;  1SL2 B;  5KN2 A;  1KBN A;  4ZBB A;  1NHY A;  4N10 A;  2LEG A;  1K3O A;  1SL1 B;  3IPZ A;  5CRG A;  4GLT A;  4HQZ A;  5HFG A;  1M2D A;  1SYX A;  5J4Y A;  3IXR A;  1A2J A;  5IMC A;  3VWU A;  4KUN A;  1PL2 A;  4POB A;  5B6N A;  2O87 A;  4Q5Q A;  3WGD A;  4H86 A;  1U88 A;  3H1N A;  2M80 A;  4Z2U A;  3TOT A;  4I2U A;  2PGT A;  4NWY A;  5G1K A;  1FO5 A;  2QA1 A;  4PXO A;  2H1A A;  2OA7 A;  3ED3 A;  4AKG A;  3KH7 A;  4L0W A;  2LNS A;  2DJ1 A;  2FWH A;  1B8X A;  3U5R E;  3ZLP A;  5ECH B;  3KCM A;  4PQ1 A;  1YQ1 A;  2VLT A;  2FLS A;  3CYN A;  2X8C A;  2DKI A;  2HQT A;  1FAA A;  4J2F A;  3TJJ A;  3ZZX A;  4TKY A;  2YP6 A;  5C00 A;  4WXT A;  3UOM A;  5CP1 A;  1M9A A;  4ECI A;  3HDC A;  4ML1 A;  4K5S A;  1GTI A;  3Q18 A;  3L0H A;  1R7H A;  5IQY A;  5EPF A;  4FYU A;  1A2M A;  5J40 A;  1TXU A;  5ECM B;  5DCG A;  1K0M A;  3D0Z A;  4KGI A;  2YJH A;  2FUG 2;  1GTA A;  4ZBA A;  1WMJ A;  1ZYE A;  3WGE A;  3J7Y k;  2M72 A;  2YZH A;  3CTG A;  5C04 A;  3ZRE A;  3C71 A;  1O73 A;  3TJK A;  4K0N A;  3APO A;  2HSH A;  3EPT A;  3E0U A;  2DMM A;  2VM1 A;  5A4V A;  1X5C A;  1FB6 A;  5KN3 A;  1BAY A;  1GUM A;  4MJC A;  5F06 A;  4PUF C;  4K9Z A;  2ON5 A;  1ILO A;  1PX6 A;  5ECK B;  4MZB A;  4I97 A;  4HEA 2;  4RQR A;  2VAF A;  2H73 A;  3NZN A;  4WR4 A;  3WT2 A;  4MJA A;  3HKR A;  2K6V A;  1FVJ A;  2JSY A;  1MD4 A;  1ERV A;  5LD0 A;  1AW9 A;  1TI1 A;  3O76 A;  1OYJ A;  3RPN A;  2A2S A;  4TXO A;  2PN8 A;  2O8V B;  1KEB A;  1B4Q A;  4ZL8 A;  2ON7 A;  2EFE A;  4BL7 A;  3HVV A;  3ZFL A;  2H01 A;  1HNB A;  3MNG A;  3Q74 A;  3F9U A;  1USB A;  4ID0 A;  4ML6 A;  5FHI A;  1GLP A;  3VWX A;  2NTO A;  1YKC A;  2X64 A;  4KF9 A;  1MDJ A;  4O92 A;  1XFL A;  3ZIV A;  3HZ4 A;  1Q4J A;  5A5H A;  1GH2 A;  3GV1 A;  4K7N A;  5HR2 A;  1B48 A;  1W89 A;  3WYW A;  3R2Q A;  3EIN A;  5BMU A;  3VUR A;  2H1B A;  3ZIJ A;  3RHB A;  2E7P A;  1J0F A;  1HNC A;  2KUC A;  2FD3 A;  3IK9 A;  2IL3 A;  18GS A;  2DJ3 A;  5J9B A;  5HR1 A;  1JZR A;  4ZIL A;  5AIX A;  2B5X A;  5HR0 A;  2L57 A;  1ZOF A;  3L78 A;  2KHP A;  3FMW A;  2V1M A;  3EE2 A;  3UAR A;  5A4W A;  4G2E A;  1XWG A;  1AQV A;  1WOU A;  5J4U A;  3FR9 A;  4BL7 B;  1AQX A;  4NPB A;  2HRA A;  4MH3 A;  1T7P B;  1SD9 A;  3LXZ A;  3ISO A;  2VD0 A;  2VD1 A;  2UZ8 A;  1PN9 A;  3VPQ A;  3R3E A;  2P5R A;  13GS A;  5A1N B;  1XW5 A;  4L5L A;  4IEL A;  2YWM A;  1BJX A;  1B9X C;  5KOX A;  1WP0 A;  2X8G A;  3L9V A;  5J5N A;  5BMU B;  1FW1 A;  3QFB C;  2LJR A;  5H5R A;  4WEY A;  3TUE A;  3GST A;  2HZF A;  5D73 A;  1AQW A;  3EWL A;  3F3R A;  3FK8 A;  4NHW A;  1V58 A;  1NHO A;  1LBK A;  1M9B A;  4HQS A;  2WZ9 A;  3EU4 A;  1OE8 A;  2REM A;  2MMN A;  3QR6 A;  4YQM A;  2EIO A;  2HT9 A;  1TJD A;  5IPH A;  3GSS A;  3H4K A;  3D22 A;  1OKD A;  4J56 E;  1M7T A;  1T4Z A;  4L8E A;  2J9H A;  5D8I A;  3Q6O A;  5DQY A;  2YZU A;  5LCZ A;  2WUL A;  3ZL5 A;  2R3X A;  3TKS E;  2X4A A;  1T00 A;  2RUF A;  3F6D A;  1PX7 A;  2H0G A;  3L9U A;  3I6A A;  5E59 A;  3TKP A;  4MP4 A;  1TOF A;  5L71 A;  2N5B A;  4IJI A;  2QA2 A;  2VUP A;  3DIE A;  4HJM A;  4EO3 A;  3HD5 A;  5J9C A;  3RAZ A;  1VF4 A;  1BF5 A;  4K1F A;  3EYT A;  4WBR D;  3HA9 A;  4LL4 B;  4GSN A;  1PA3 A;  4AJ6 A;  1XW6 A;  1ZYP A;  1PKW A;  1PRX A;  2H6Y A;  1EZK A;  5IM9 A;  2C3T A;  2OE3 A;  2JU5 A;  4XRA A;  1JFU A;  5LNK e;  4E8H A;  3ME7 A;  4TRX A;  2O85 A;  1S3D A;  1TDI A;  3LW9 A;  2F9S A;  4IP6 A;  1EGR A;  4EDY A;  5DAK A;  5FT3 A;  2C4J A;  5AGY A;  5F05 A;  4BVX B;  5D9W A;  5ECN B;  6GSW A;  4G0K A;  2GSQ A;  5D93 A;  3IK7 A;  4GCI A;  2CQ9 A;  4NMU A;  1SVL A;  5H5Q A;  4AJ8 A;  1CQH A;  5B8A A;  1ZYN A;  4YH2 A;  5COH A;  1MDK A;  2TRC P;  2O7K A;  2B1K A;  2CAI A;  1B9Y C;  1HQO A;  2B1L A;  2HFD A;  4ECB A;  3C1R A;  3DML A;  5D96 A;  2OKA A;  3FEU A;  1SJI A;  2FY6 A;  1GUL A;  3GRX A;  4TR1 B;  2K18 A;  2VLV A;  2YCD A;  3UL3 A;  4BVY A;  3F0I A;  1FG4 A;  3MDK A;  2R5G A;  4GQF A;  5IMD A;  1TU8 A;  2OE1 A;  5B8B A;  2H1L A;  1Z6N A;  4XRD A;  2QC7 A;  4AKI A;  1ZMA A;  3CSI A;  3D4M A;  5DQS A;  4NXI A;  1F3A A;  1VRS D;  4AF2 A;  2GT6 A;  2AB6 A;  5CRD A;  2MMO A;  3IHG A;  3S9F A;  4O32 A;  1A0F A;  5DCH A;  1YKA A;  2R4V A;  3Q19 A;  4CHS A;  3TDG A;  3LSZ A;  1QXH A;  3BOA A;  3P2A A;  1GSF A;  4G9H A;  4JED A;  2L5O A;  1GSQ A;  3GL3 A;  2PVO C;  3FZ9 A;  2HSY A;  4FYC A;  2VIM A;  4FH8 A;  5G31 A;  3P7X A;  2C0G A;  1AUC A;  3KD0 A;  3GYK A;  2DJ0 A;  1BED A;  2VCZ A;  3M9K A;  4KDX A;  1SJZ A;  5CRH A;  4QMK A;  3TCO A;  5KN0 A;  1KTE A;  2GZZ A;  5J4V A;  4GST A;  4MPF A;  4LA1 A;  1ZL9 A;  2YV9 A;  4BWQ A;  1HYU A;  3PH9 A;  5D9T A;  4XS6 A;  2GT5 A;  4XS4 A;  4EE0 A;  2H1D A;  3ZYW A;  3F8U A;  4O5Q A;  5D9X A;  1N2A A;  1S3C A;  3TKS C;  3TJG A;  2HRK A;  4NV5 A;  1EP7 A;  2GGT A;  4FYB A;  1PN0 A;  3A2W A;  1XZO A;  5H5S A;  4EXJ A;  3PPU A;  2F3M A;  2H19 A;  2DLX A;  2O89 A;  3HJO A;  3VWW A;  4XCS A;  3GKN A;  2I81 A;  3LGC A;  5G5F A;  2C3Q A;  4MJB A;  1WE0 A;  1U87 A;  1R4W A;  1OC3 A;  1ML6 A;  2JZT A;  3E3E A;  2J23 A;  2P5Q A;  1YJ6 A;  1T8E B;  4ILF A;  1TRS A;  1UA5 A;  3LXT A;  2R37 A;  1X9S B;  1K3L A;  5G30 A;  1GTU A;  4MLY A;  1ON4 A;  4I8B A;  2ALB A;  3GUS A;  4OFT A;  1YEX A;  3EVI A;  5ECI B;  5J3R A;  4ZB9 A;  2V6O A;  3F4S A;  1XVW A;  4YQV A;  3KMN A;  3QFA C;  2OE0 A;  4K5R A;  1Z6M A;  1A8Y A;  4A5P A;  4K8M A;  2LQO A;  3K8N A;  4FQU A;  4ZL7 A;  3QAW A;  2H72 A;  1ACV A;  1I9D A;  2OAD A;  3EU3 A;  1GSY A;  3U6V A;  4TR0 A;  4Q5F A;  3KJY A;  4KCA A;  4KE3 A;  4YQU A;  5IMA A;  1X9W B;  3HXS A;  7GSS A;  2DIY A;  3VPT A;  1O85 A;  1FOH A;  2D2Z A;  2AJQ B;  1Y6E A;  3KMO A;  2OJL A;  2VL2 A;  4K2D A;  1MTC A;  2HI7 A;  3A5I A;  1Y25 A;  2H70 A;  2GDR A;  1ZYQ B;  4MPG A;  2PVQ A;  1VF2 A;  3TJB A;  4V1A g;  2DJ2 A;  3A3T A;  1TK8 B;  3O6T A;  3RDW A;  5ELG A;  2R6K A;  5AN1 A;  2V2G A;  3UVH A;  2R0C A;  1G7E A;  2PER A;  2IMI A;  3KP9 A;  1C72 A;  1O8W A;  1A8L A;  2ES7 A;  2L4Q A;  3ZML A;  2IMK A;  4MZW A;  3QOU A;  2VO4 A;  2GSS A;  3DYR A;  3TGZ A;  2GST A;  5JWO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...