4G0KA

Glutathionyl-hydroquinone reductase, yqjg, of e.coli complexed with gs-menadione
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
b'GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0kA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0kA01
1USBA 1PX7A 3ERFA 3CRUA 5ELAA 3LJRA 4YQMA 2GSSA 3N5OA 1GWCA 3AY8A 4HZ4A 22GSA 1VF4A 4MP4A 1G6WA 3QR6A 2LJRA 1OKTA 3I69A 3ZFLA 2VCWA 2N5FA 3IR4A 3GUSA 4GSSA 4IQ1A 4GSTA 3M1GA 5G5EA 3SWLA 4PXOA 2VD0A 2GSRA 14GSA 1U88A 1K3OA 1FHEA 4BVYB 6GSUA 3UBLA 3VI5A 1GSUA 1IYIA 1E6BA 2HRKA 2GSQA 3LFLA 1K0BA 4GF0A 1PL1A 3IC8A 4KAEA 9GSSA 1K0NA 1YY7A 2HSMB 2DC5A 4IJIA 3TOTA 3GTUA 2F8FA 4E8EA 5D9TA 3ZFBA 3PPUA 4MDCA 1FW1A 3I6AA 4N0VA 4TOPA 5J5NA 3HJOA 4MK3A 1AQWA 3VLNA 5DAKB 5A4VA 1PMTA 3CRTA 3HKRA 2VCXA 5DDLA 4GSNA 4MPFA 3ZMLA 2R6KA 4K0NA 1GTIA 2AB6A 5DQSA 19GSA 1GLQA 2JL4A 2A2SA 4PGTA 1G6YA 4GTUA 1OYJA 4G19A 5D9XA 1YQ1A 5GZZB 3GX0A 3VWXA 3L0HA 5ELGA 1MD3A 3F6DA 1JLVA 1ZL9A 4EE0A 5F8BA 1F2EA 3LQ7A 2PVQA 4KDXA 2PGTA 4PQIA 1PA3A 4G0LA 5GSTA 3Q18A 4IKHA 1ML6A 3ERGA 20GSA 3LYKA 1XW6A 2IMIA 5EL8A 4YQUA 4G0KA 1GTUA 5AISA 4G9HA 2C4JA 1AQVA 3ZMKA 2D2ZA 1TU8A 3NIVA 3MDKA 3PGTA 4PNGA 2GTUA 1V40A 3C8EA 3LYPA 3KTLA 2C3QA 4MF6A 4ECJA 10GSA 2HNLA 5J41A 3CSHA 2VD1A 3FR6A 1XWKA 4KDYA 1Z9HA 1GULA 3CSIA 2YV9A 1RK4A 1EEMA 2R3XA 5B7CA 5ECNB 4ZB6A 1C72A 4USSA 5JCWA 1HQOA 4J2FA 5HFKA 3VPTA 3GH6A 2HSNB 2OA7A 4PQHA 1PX6A 5D73A 5DCGA 4MF7A 5DJMA 4PTSA 4CHSA 4EDZA 4YH2A 2OADA 4ISDA 5EVOA 4F03A 11GSA 1PL2A 3CBUA 3VK9A 1GSDA 1M99A 1V2AA 3P8WA 1MD4A 4EC0A 3MAKA 3FY7A 5ECIB 4ZB8A 2AHEA 3GTUB 4LMVA 1XW5A 1DUGA 1B8XA 1EV9A 4PURA 4ZB9A 2WB9A 1A0FA 4JEDA 4BL7A 1F3BA 3VPQA 2OACA 1U3IA 18GSA 3CSJA 4OFNA 4MPGA 2HRAA 4KDUA 1ZGNA 2CZ3A 4GCIA 6GSXA 1GSFA 1PKWA 2X64A 3LXZA 4I97A 1GSQA 5AGYA 3LG6A 2V6KA 2YV7A 1K0OA 1GNEA 4KSMA 3G7IA 4G0IA 4IVFA 5A4UA 4DEJA 2UZ8A 1Y6EA 5A5KA 4IBPA 1GNWA 4PX1A 4OFMA 2HSMA 1GSSA 4ZBBA 1M0UA 3P90A 2CVDA 1BYEA 1OE8A 4JBBA 5ECMB 3TOUA 4G10A 2VCZA 7GSSA 4Q5NA 3ISOA 5G5FA 3EINA 4BVXA 5FHIA 1YDKA 2IL3A 1YKCA 2ON7A 4OFTA 2R5GA 5DAKA 3F63A 2GSTA 1R5AA 2J9HA 1PD21 2HQTA 2WJUA 1UA5A 2A2RA 6GSYA 4F0BA 5ECKB 4HI7A 3QAVA 5LD0A 2C80A 6GSTA 4LMWA 3DD3A 4ECIA 5IQYA 3O76A 2CZ2A 1N2AA 3LSZA 6GSVA 4RI7A 1AXDA 3N9JA 1JLWA 2YCDA 2PERA 1AQXA 3QAWA 5ECRB 12GSA 3FYGA 1GTBA 2CA8A 3UVHA 1EV4A 3DGQA 5DALA 3VURA 3UAPA 5JCUA 4IW9A 1K0AA 4PNFA 3GSSA 2VCTA 4KH7A 4Q5RA 4HJ2A 3WYWA 4Q5FA 3GSTA 3H1NA 5BMUA 3IE3A 5ECOB 6GSWA 1G7OA 3UBKA 4L5LA 4YAVA 1GUHA 2C3TA 1GTAA 3M0FA 4NHWA 5ECLB 2R4VA 1Q4JA 2F3MA 4NHZA 1TU7A 1TDIA 5FWGA 2PMTA 3KXOA 4O92A 3FRCA 4ZBDA 2HRKB 1PKZA 1VF3A 1YJ6A 3W8SA 2CAQA 4KGIA 4F0CA 1K0MA 2FNOA 3M8NA 1VF1A 5A4WA 3R2QA 5F05A 1GUKA 2WDUA 4YAPA 2IMKA 4O7HA 1U87A 1EOHA 1BX9A 3GURA 3VI7A 4BL7B 5ECQB 3M3MA 4IGJA 2C3NA 3F6FA 1PGTA 1K0DA 5ECPB 1B4PA 4IS0A 4IQAA 3KJYA 5ECSA 1K3YA 2C8UA 3FR9A 3UARA 4KF9A 1TW9A 3D0ZA 4HOJA 1NHYA 1GSYA 5F07A 3FR3A 1VF2A 1K0CA 2WRTA 1M9AA 4ECBA 4ZBAA 1GSEA 3WD6A 4BVYA 5AIVA 1HNAA 5LCZA 4MZWA 5EY6A 4RI6A 2VCVA 2FHEA 1BAYA 2ON5A 1PN9A 2VO4A 4BVXB 4OMVA 4FQUA 4NAXA 4QQ7A 2GLRA 5D9VA 3IBHA 2CAIA 4K0GA 4PUAA 4L5OA 1JZRA 4ID0A 3U6VA 4GLTA 3IK9A 4AGSA 5AIXA 3Q74A 4KE3A 3KMOA 3R3EA 4WR5A 3IK7A 4Q5QA 1F3AA 2PBJA 4YQVA 5AN1A 8GSSA 1BG5A 1LBKA 4L8EA 1GUMA 3KMNA 3O3TA 1LJRA 4KX4A 1IYHA 4JZQA 5DALB 5GSSA 4IELA 1XWGA 1HNCA 13GSA 1GLPA 1AW9A 5F06A 1B48A 2WS2A 1K3LA 4MF5A 17GSA 1OE7A 5DJLA 3Q19A 2GDRA 4WR4A 1EOGA 5ECHB 3TGZA 3RBTA 2NTOA 3QAGA 3BBYA 4ACSA 6GSSA 5J4UA 5KEJA 4EDYA 4HZ2A 1HNBA 2AAWA 3EE2A 2VCQA 3PR8A 5FT3A 3HJMA 2DSAA 4ECCA 1KBNA 1M9BA 3KM6A 4ZXGA 4EXJA 16GSA 5D9WA 3G7JA 5F0GA 3LXTA 4E8HA 1MTCA
chains in the Genus database with same CATH superfamily
3GYKA 1SKRB 2L57A 3A3TA 3CRUA 4K9ZA 1U6TA 3QDNA 5IOXA 2GSSA 1GWCA 5HR2A 2H1BA 1KEBA 1TK0B 4MP4A 1OKTA 4AKGA 1T1VA 3IV4A 2JU5A 1Z3EA 3ME8A 2N5FA 2FY6A 4IQ1A 1TKDB 1O81A 2LEGA 3M1GA 1YEPA 2VD0A 2LJKA 4WF5A 2VUPA 1XW9A 1GSUA 2HRKA 2GSQA 4LL1B 2EFCA 4GDFA 1K0NA 1YY7A 1A8YA 1WRYA 2VL3A 3GHAA 1CQHA 2F8FA 4E8EA 3ZFBA 2H75A 5J47A 4N0VA 4TOPA 1AQWA 3KIJA 2RUFA 1XOBA 4CW9A 1ON4A 2FA4A 4K0NA 1GTIA 2JACA 3E3EA 3J7Yb 4F9ZA 2A2SA 4PGTA 2X8GA 3MWHA 1YQ1A 1QQ2A 1XBSA 2OE0A 2O36A 5ELGA 4WBJA 4TR0A 5F8BA 2PVQA 2QC7A 1SVLA 4E68A 4RQXA 2FCHA 4G0LA 1QMVA 2C1YA 2H66A 4EF0A 4YKGA 1ML6A 2M80A 1XW6A 3F9UA 1WPIA 1PRXA 2RUEA 2IMIA 1ERWA 4BWSA 4XS1A 3GA4A 1SKWB 5AISA 2PU9C 2CX3A 2J23A 1AQVA 3ZMKA 2D2ZA 1FO5A 4KB3A 3TRQA 1TU8A 3MDKA 3PGTA 4PNGA 1B9YC 4TXOB 1V40A 4QL9A 3KTLA 4I8BA 2L5LA 2LJAA 2C3QA 4X4JA 3U5RE 3CMIA 3TRXA 3FR6A 3GFKA 1Z9HA 1OC8A 2YV9A 1TRSA 3EC3A 4BPYA 1TRUA 3ZZXA 3HVNA 3TDGA 3ZRDA 1W4VA 4J2FA 3VPTA 1XWBA 4N0ZA 1V57A 1T4ZA 4OO4A 2HYXA 1PX6A 5D73A 1AAZA 4MF7A 4YH2A 1TXXA 11GSA 1GSDA 4EC0A 3MAKA 1B9XC 4LMVA 2YWIA 1WMJA 2H30A 5A1NA 5IMVA 3WGEA 2WB9A 4AF2A 3VPQA 2Z9SA 4G2EA 1SK1A 4HU7A 3IOSA 1S4BP 4KUNA 3E9JB 4XHMA 3ERWA 5DQYA 2HSYA 2B7JA 3LXZA 4ILFA 3TKRA 5DVBA 2YV7A 1XCCA 1K0OA 1NM3A 4G0IA 1XWCA 2VIMA 4DEJA 3HVVA 2BMXA 5B8AA 1QXHA 3HHVA 4IBPA 1GNWA 2HSMA 1ACVA 2EFEA 5ECMB 3QOUA 3FHKA 4V1Ap 1XPVA 3G9BA 3EINA 3FMWA 4BVXA 2VM2A 4GQCA 3QPMA 2H1AA 2YZHA 3TKSE 2ON7A 2GSTA 1PD21 2HQTA 1O85A 3EWLA 5IO0A 3TJFA 5ECKB 2H0GA 3QAVA 1T7PB 5LD0A 5IQYA 2JZSA 4J57E 2OT3A 1XXUA 4RI7A 2KUCA 3GRXA 2YCDA 2PERA 5ECRB 3UVHA 1HYUA 3O6TA 1PFOA 5HFGA 5JCUA 4PNFA 3ZVJA 3TKQA 1A2JA 3FZAA 3H1NA 5BMUA 5KN1A 2KOKA 1T00A 4MNNA 2DMLA 1Y25A 2C3TA 2FWFA 4TR1A 1FB0A 1GTAA 2X4AA 2B5YA 2R0PA 3APOA 2HT9A 3NZNA 4HJMA 1YKAA 5ECLB 1Q4JA 2L6DA 2KP1A 1TDIA 2I1UA 4NPBA 5A5HA 3HZ4A 2M46A 1TXUA 1TTZA 1A8LA 5ABRA 4J56E 1YJ6A 3W8SA 4KGIA 4F82A 5IM9A 3L9VA 2VAFA 1K0MA 2C0GA 5A34A 1XWAA 4GRFA 3R2QA 5F05A 5KN2A 4YAPA 1GL8A 3HY2A 4O7HA 1U87A 3F3RA 2L6CA 4DVCA 4BL7B 3M3MA 1QK8A 1PGTA 2DMMA 5IMZA 3A2VA 4ZL7A 3L4NA 2C0FA 4ZL8A 2MMNA 1K3YA 2FD3A 4XTSA 1TW9A 1EP7A 1W89A 1GSYA 3UEMA 2OKAA 4OD7A 1M9AA 4ZBAA 4BVYA 2TRCP 3EU4A 4IP1A 4LL4B 4PUFC 4HU9A 2H19A 4GQFA 4DSSB 3TJKA 5EY6A 2FHEA 1SVMA 2G2QA 3VWVA 1EGOA 2CAIA 4K7IA 4K0GA 4PUAA 4L5OA 4P3YB 1A2LA 1M3JA 3IK9A 4AGSA 4N10A 3R3EA 1O7UA 5DBQA 3UOMA 8GSSA 3UVTA 5E4WA 4L8EA 4EKZA 1ZOFA 2YPMA 1Z7PA 1SL0B 2H6XA 1HNCA 2B3SA 4JR6A 4ZIJA 1GLPA 5F06A 1RW1A 1K3LA 1VRSD 4WR4A 1EOGA 3HJPA 3S9FA 2HRFA 1M7TA 1EEJA 4ACSA 5J4UA 4ML6A 4HZ2A 5L71A 3K8NA 1WJKA 2VCQA 4EVMA 1RQMA 2MZCA 1OC3A 5KOXA 3I43A 3HZ8A 2JSYA 3HYPA 3KM6A 4POMA 3RDWA 4JR4A 4KSOA 2XC2A 2X99A 4XCSA 5H5RA 3EYTA 1ZYQB 1MTCA 1ZZYA 3FZ5A 5ELAA 2H0HA 5B6NA 3LJRA 4YQMA 22GSA 1KNGA 1SD9A 2E2MA 2GVPA 2V32A 2B7KA 2VLUA 3GUSA 1UVZA 4GSSA 2C0DA 5G5EA 3QD9A 3MSZA 3ZREA 2JSZA 3QMXA 2GSRA 14GSA 1TOFA 3GIXA 1K3OA 2HSNA 6GSUA 1X9SB 3UBLA 2GQMA 1T4YA 4Z2TA 5J4YA 1OAZA 2LTKA 3HA9A 2H73A 3WGXA 3LFLA 1K0BA 5KN0A 4GF0A 3IC8A 9GSSA 3APSA 2R0CA 3TOTA 3GTUA 3L78A 2H6ZA 3RPPA 2HRNA 5CRHA 2WZSA 3HD5A 1OC9B 2IMFA 5DAKB 1R7HA 3CRTA 3GL3A 2VCXA 1QUWA 4GSNA 2DJKA 3FW2A 4YKFA 4O5QA 2JADA 2YWOA 4GXZA 1GLQA 3OR5A 2F8AA 2JL4A 2HZEB 3LW9A 1G6YA 1OYJA 4I2TA 3VWXA 2OE3A 4KW6A 5C00A 3F8UA 3F6DA 4EO3A 1ZL9A 1NSWA 1WP0A 3PINA 5ID2A 1GH2A 2ES7A 5EL8A 4YQUA 2IJYA 4QMKA 2OBKA 2WFCA 3DKSA 2O7KA 1BJXA 4AJ8A 3QFBC 3LYPA 1THXA 2GT6A 2JZTA 3DMLA 4MF6A 3GH9A 4D73B 4Z2RA 2FLSA 1JHBA 4OO5A 3UJ1A 2L5OA 4MMMA 5B7CA 5ECNB 2GT5A 5JCWA 3MIXA 3GH6A 5CRDA 2H74A 3HVSA 5D93A 3RFRC 4PQHA 2FGXA 4TR3A 4CHSA 4PTSA 2PVOC 5EVOA 3KEBA 3ED3A 4XRAA 2P0GA 1MD4A 1X0RA 5ECIB 1XW5A 1DUGA 2K8VA 1I5GA 3GKKA 1B8XA 1EV9A 5CNWA 4ZB9A 5ENUA 1MDIA 4F2IA 3QFAC 3BJ5A 1E2YA 3EU3A 3IPZA 4TKYA 2HRAA 2CX4A 2CZ3A 2H6YA 4GCIA 4AJ7A 3GV1A 1XFLA 1TJDA 2V1MA 4I97A 1GSQA 5AGYA 3BCIA 1NHOA 1A24A 1JZOA 3QCPA 1GNEA 3G7IA 5A4UA 5H5QA 1DSBA 1Y6EA 5A5KA 4PX1A 4EIPA 5LNKe 1M0UA 3ME7A 1ST9A 2CVDA 1OE8A 4JRRA 4WBRD 5H5SA 2VCZA 4Q5NA 4XS6A 2KHPA 1LU4A 5FHIA 4MCUA 5IMAA 1YDKA 4MLYA 3TCOA 4K5RA 3F63A 3DYRA 1X5CA 3IHGA 1UA5A 3EMXA 4MH3A 5HR1A 2C80A 1FVJA 4LMWA 5CAXA 3O76A 3F4RA 2CZ2A 3KGKA 3LWAA 1AXDA 2TRXA 1JLWA 3QAWA 12GSA 3FYGA 3FZ9A 5DALA 3UAPA 2TIRA 4IW9A 5J9BA 2HLSA 4HJ2A 3WYWA 4Q5FA 1G7OA 2WVXB 3IE3A 5ECOB 6GSWA 1O73A 2YP6A 3GL5A 4YAVA 3L9SA 3W6GA 1KTEA 5G2ZA 2N5AA 2OJLA 3M0FA 2DIYA 2R4VA 2R2JA 2FWHA 5FWGA 2PMTA 3WT2A 3KXOA 1G7EA 4O92A 3FRCA 2RIIA 4TXOA 3GNJA 4MJCA 3M8NA 1VF1A 2H72A 2EIRA 1BF5A 4OCEA 3ZVJD 1AIUA 2HE3A 4K7OA 1SJ6A 2EFDA 2IMKA 4V1Ag 3VI7A 3DIEA 5CP1A 5KN3A 4WETA 4IS0A 2C8UA 2DKHA 4G01A 2HZFA 1WE0A 3DWVA 5F07A 3FR3A 1J0FA 1K0CA 1M3IA 4KA0A 2QKEA 3WD6A 1TI1A 1UC7A 1TRVA 3G7YA 3F0IA 5IPGA 1PN9A 1F6MC 4K5SA 2VO4A 4BVXB 2LQOA 4QQ7A 5D9VA 4MJBA 1S3AA 4ID0A 2NVLA 3RHBA 4GLTA 4NWYA 3Q74A 4KE3A 2O8VB 3ZYWA 5JWOB 2E0QA 4XS4B 4Q5QA 3IAS2 1ZYPA 1X5DA 2CV4A 3MYDA 1BG5A 1SYXA 1LBKA 4EL1A 3RGBC 2OE1A 4IN0A 3O3TA 5GSSA 4IELA 1V58A 2A4VA 1AW9A 4MZBA 4K2XA 2CVBA 4BA7A 4N3ZA 17GSA 1OE7A 5ECHB 4TR1B 3TGZA 1UN2A 4AKIA 5KEJA 2YJ7A 1F9MA 4BWQA 1YF0A 1ZYNA 1M9BA 2XBIA 4EXJA 2WW3A 4Z7XA 5D9WA 3G7JA 3PH9A 2P5QA 1SK2A 2H01A 2GZZA 3LXTA 2H0IA 2IMDA 4K6XA 3DRNA 1WWJA 1USBA 2LRCA 3IAM2 1PX7A 3ERFA 4LA1A 1YVLA 2ZCTA 2R37A 1M2AA 2LJRA 3I69A 4AI6A 1H75A 4NV2A 2IWTA 4FH8A 3ZFLA 2VCWA 1WOUA 3IR4A 4GSTA 3KZQA 3SWLA 4PXOA 3F3QA 1TRWA 1S3DA 1U88A 1X5EA 3EPTA 2E7PA 4BVYB 1T3BA 4XRDA 5B6MA 1TP9A 2IN3A 4KAEA 2DJ3A 2IFQB 2IMEA 1AC1A 1X9MB 3LGCA 3JCML 2DC5A 4IJIA 2L59A 4HUAA 4IJ3A 1SD8A 5D9TA 1URMA 4MDCA 1FW1A 2E2GA 2B6MA 1Z6MA 3UL3A 3HJOA 1J9BA 5JCGA 2RLIA 3GKNA 1PMTA 4MPFA 3W8JA 2YJHA 5G1LA 1SL1B 2WVZA 5DQSA 19GSA 3IXRA 1WIKA 3GX8A 4MH2A 2V41A 5JWQB 4N30A 3C73A 4G19A 1QFNA 5D9XA 4O32A 4HEA2 3GX0A 2CT6A 2F9SA 2VL2C 4DSSA 1N8JA 1GRXA 1J08A 2GZYA 1XG8A 2GQLA 4RUVA 4L0WA 1PQNA 1YEXA 4PQIA 2XPDA 5GSTA 3Q18A 4KCEA 4IKHA 4HQSA 3IRAA 2DLXA 20GSA 1ERTA 3LYKA 2UV8G 3EURA 3LEFA 1TI3A 2YN1A 1GTUA 3ZLPA 2C4JA 2PWJA 3FEUA 5G30A 3NIVA 5HFIA 3C8EA 4TVEA 2VOCA 3TB2A 4ECJA 1BG1A 5J41A 3CSHA 2VD1A 1XWKA 4POKA 2K9FA 3IC4A 1GULA 3CSIA 1SK0A 1EEMA 2WCIA 3MNGA 3GKXA 4H86A 3FK8A 4K7NA 4Z2UA 1SYRA 1C72A 4USSA 4MABA 3HMJG 4TR4A 2HSNB 2OA7A 5DCGA 4MA9A 3D21A 1PSQA 5DJMA 2REMA 1PN0A 2VM1A 4F03A 1DE1A 3CBUA 3VK9A 2OBIA 1M99A 3P8WA 2LNTA 4CY6A 4X0XA 4ZB8A 3GTUB 2F51A 4V2MA 3HDCA 4PURA 1A0FA 4JEDA 2I4AA 2V2GA 1F3BA 2DIZA 2OACA 18GSA 3TRPA 4TW5A 4MPGA 2MBSA 1ZGNA 3VWWA 4O5RA 1PKWA 2X64A 5CRWA 2EC4A 2I3YA 4KNDA 1YZXA 3F4SA 3LG6A 2V6KA 1I9DA 4KSMA 1XZOA 3V1WA 4IVFA 3F4TA 3UMAA 2AJQB 2KLXA 3ZITA 1SENA 1BYEA 4G10A 1A2MA 5G5FA 1SU9A 5CYYA 1OC9A 5IMFA 2WGRA 4TXVA 5E59A 4GWRA 2HI7A 4OFTA 2R5GA 2L4QA 5DAKA 1R5AA 4RQRA 2K18A 2WJUA 2NDOA 6GSYA 4F0BA 4NV5A 1YF1A 6GSTA 2HZEA 3ZIVA 4ECIA 2VL2A 1R26A 1N2AA 3LSZA 5COHA 6GSVA 1AQXA 2HSHA 3H8QA 1GTBA 4HSCX 1EV4A 1XOAA 2X49A 2L4CA 3VURA 5IPHA 3GKMA 1K0AA 2VLVA 2VCTA 4HDEA 2B1LA 5HQPA 2YWMA 1SJZA 1BEDA 3CWGA 4AKHA 1BQ7A 2FA8A 2XHFA 4FIWA 4CDOA 1TK8B 2G0FA 1FOVA 4ZBDA 2H1DA 1ABAA 2PN8A 1U3AA 4X1UA 3CHXC 2HRKB 5BRTA 1PKZA 1VF3A 3E0UA 2CAQA 4F0CA 3TJJA 3D22A 3C1RA 4D73A 5JWRB 5A4WA 1GUKA 2WDUA 2BJXA 1BX9A 1A23A 5HR3A 2DJ2A 4ICYA 4IGJA 3F6FA 2K6VA 2QGVA 2B1KA 1FOHA 5ECPB 2DKIA 3ZL5A 2YZUA 2LS5A 4IQAA 3VWUA 3A5WA 3EVIA 3FR9A 2EIOA 3UARA 4KF9A 3APQA 3ZTLA 2A2PA 3D0ZA 4IP6A 3RHCA 4HOJA 3GMFA 2O85A 1FAAA 2XPEA 5G31A 4TRXA 1VF2A 2EFHA 2LUSA 2FUG2 2WRTA 4X43A 5AIVA 1HNAA 2C0EA 5LCZA 2QSIA 3TKSC 4PI2C 2O5VA 4NAXA 3IBHA 2KP2A 1JZRA 1F37A 2GGTA 3KH9A 1SVOA 3KMOA 3CTGA 4WR5A 3IK7A 3HXSA 3D4TA 1F3AA 4N11A 3A5IA 2PBJA 4FYBA 4YQVA 5AN1A 1EGRA 4BIKA 3KMNA 5CO3A 5J9CA 3TJBA 2DJ0A 5DALB 1XWGA 1OKDA 1XVQA 5J40A 2WS2A 5IMCA 4MF5A 3ZIJA 3Q19A 2NPBA 1O8WA 2DBCA 5J3RA 2X8HA 5INYA 3QAGA 6GSSA 3BBYA 1MDKA 2EIQA 1G0TA 4WKWA 1O6JA 3EE2A 3PR8A 5FT3A 2DSAA 4HQZA 4ECCA 1KBNA 2O89A 4WEYA 4ZXGA 3BCKA 4DSRA 5IIZA 1JZDA 2LV3A 4OCFA 5F0GA 5KOWA 3RAZA 1XIYA 4E8HA 5J4VA 1AUCA 1THOA 2MBTA 1M2BA 2WVYA 4DSQA 2WVXA 5A1NB 3N5OA 2WW2A 1XVWA 2H70A 5C04A 3AY8A 4HZ4A 1S3CA 1CQGA 1VF4A 1G6WA 3QR6A 3CYNA 2N5BA 3M9JA 2HXKA 3CXGA 1FHEA 3VI5A 1Z6NA 1IYIA 4EUYA 1E6BA 2GQKA 1M2DA 3M9KA 4QL7A 1Z7RA 1O8XA 2I81A 1PL1A 4PHZC 3KTBA 1SL2B 3TU3B 2HSMB 2LRTA 3SBCA 1Y1UA 2WZ9A 1DE2A 1NW2A 1JZWA 1FG4A 2I9HA 3PPUA 3I6AA 2YWNA 2PPTA 5J5NA 1H4OA 4MK3A 1FVKA 2MYGA 3HVXA 3DVXA 3VLNA 5A4VA 3HKRA 5DDLA 2HFDA 2H1LA 3ZMLA 2FWGA 2R6KA 2AB6A 4ML1A 3LORA 2RM5A 3KP9A 3KH7A 3D4MA 4GTUA 3H4KA 1TK5B 5GZZB 3KP8A 3TKSA 3L0HA 2ZNMA 3NOFA 1MD3A 1JLVA 4EE0A 1F2EA 3LQ7A 4KDXA 2B5XA 4AJ6A 2PGTA 2AV4A 2XBQA 4I5QA 4POBA 2MMAA 1PA3A 3P7XA 5BMUB 3FZ4A 2R0GA 4AKXB 3ERGA 5D8IA 4K1FA 1Z5YE 1QGVA 4G0KA 2QA1A 4XS4A 4PI0C 4PQ1A 3H79A 2LQQA 1ERVA 2DJ1A 3WT1A 2LRNA 4G9HA 2BTOT 5CRGA 2QA2A 5A5HB 4FYUA 2GTUA 2VKZG 5D96A 2H76A 1V9WA 3UIWA 5A34B 3P2AA 10GSA 2HNLA 2H1GA 2JZRA 4KDYA 3DXBA 1A0RP 2LNSA 1RK4A 2R3XA 2YANA 4ZB6A 4LLRA 1HQOA 4O5UA 5HFKA 4L0UA 4EIQA 4EDZA 2GS3A 2LSTA 2OADA 4ISDA 4JU5A 1PL2A 1ZMAA 1V2AA 2YOIA 3L9UA 3FY7A 4FXYP 3IA1A 2AHEA 5IMDA 5GAND 4V2LA 4JE1A 4BL7A 1U3IA 3CSJA 2FWEA 4OFNA 2CVKA 4KDUA 2P31A 6GSXA 1GSFA 4MJEA 4A5PA 1I1IP 2MMZA 1EP8A 4FO5A 2B5EA 3BOAA 2IFQA 2UZ8A 4OFMA 1EZKA 1GSSA 3TKPA 3C71A 4ZBBA 1FB6A 3P90A 4JBBA 1YEWC 3TOUA 7GSSA 1V98A 3ISOA 3GN3A 3DVWA 1ILOA 4TN8A 1R5PA 3C7MA 2IL3A 1YKCA 5GAPD 2H8LA 4ZL9A 2J9HA 4K2DA 2A2RA 4V2NA 3EMPA 4HI7A 2NBSA 3FKFA 3IDVA 3DD3A 3KD0A 4HS1A 2V6OA 1SKSB 3A2XA 3N9JA 3C1SA 2WW0A 4OWYA 4WXTA 1S3RA 2CA8A 3I9V2 3DGQA 5IOWA 5HR0A 3GSSA 4KH7A 4Q5RA 4IHUA 2ALBA 3GSTA 3UBKA 1SJIA 4L5LA 4I2UA 2AUVA 2LKUA 2RM6A 2DJJA 1GUHA 4NHWA 2YNXA 5EPFA 2F3MA 4NHZA 2X8CA 4CY8A 4ZB7A 1TU7A 3WGDA 5B8BA 2H71A 5IO2A 4FYCA 1VGLA 4MJAA 3DEXA 2WW1A 2VLTA 1ZCPA 2FNOA 1JFUA 3J7Yk 1EOHA 3HCZA 3GURA 5ECQB 2PUKC 2MMOA 2C3NA 3TJGA 1K0DA 1OVNA 1B4PA 2P5RA 3Q6OA 3KJYA 3A2WA 5ECSA 1NHYA 3IHQA 2CQ9A 2M72A 2O3EA 1ZYEA 4NMUA 4ECBA 1GSEA 4KCAA 4ZILA 3VFIA 1N25A 4MZWA 4RI6A 2VCVA 1BAYA 2ON5A 2O87A 4OMVA 4FQUA 5CREA 2GLRA 3U6VA 5DCHA 2IPAA 3US3A 4POLA 3RPNA 5AIXA 5ID2B 4WF4A 3D5JA 1Q98A 3D6IA 4I6XA 3KCMA 4K8MA 3BD2A 1DBYA 1GUMA 4NXIA 1LJRA 4XIHA 3CTFA 1T8EB 4KX4A 1IYHA 4JZQA 3H93A 2K8SA 1B4QA 3CQFA 13GSA 1X9WB 1B48A 5DJLA 1GP1A 2GDRA 1HD2A 2GZPA 2WULA 1MDJA 3RBTA 2NTOA 5G1KA 4EDYA 2ZUPA 4MZCA 2AYTA 4ULXA 2A4HA 1HNBA 1MEKA 2AAWA 4W66A 1EWXA 2IIYA 3HJMA 2VL9A 16GSA 1R4WA 1ERUA 3TUEA
chains in the Genus database with same CATH topology
3GYKA 1SKRB 2L57A 3A3TA 3CRUA 4K9ZA 1U6TA 3QDNA 5IOXA 2GSSA 1GWCA 5HR2A 2H1BA 1KEBA 1TK0B 4MP4A 1OKTA 4AKGA 1T1VA 3IV4A 2JU5A 1Z3EA 3ME8A 2N5FA 2FY6A 4IQ1A 1TKDB 1O81A 2LEGA 3M1GA 1YEPA 2VD0A 2LJKA 4WF5A 2VUPA 1XW9A 1GSUA 2HRKA 2GSQA 4LL1B 2EFCA 4GDFA 1K0NA 1YY7A 1A8YA 1WRYA 2VL3A 3GHAA 1CQHA 2F8FA 4E8EA 3ZFBA 2H75A 5J47A 4N0VA 4TOPA 1AQWA 3KIJA 2RUFA 1XOBA 4CW9A 1ON4A 2FA4A 4K0NA 1GTIA 2JACA 3E3EA 3J7Yb 4F9ZA 2A2SA 4PGTA 2X8GA 3MWHA 1YQ1A 1QQ2A 1XBSA 2OE0A 5ELGA 4WBJA 4TR0A 5F8BA 2PVQA 2QC7A 1SVLA 4E68A 4RQXA 2FCHA 4G0LA 1QMVA 2C1YA 2H66A 4EF0A 4YKGA 1ML6A 2M80A 1XW6A 3F9UA 1WPIA 1PRXA 2RUEA 2IMIA 1ERWA 4BWSA 4XS1A 3GA4A 1SKWB 5AISA 2PU9C 2CX3A 2J23A 1AQVA 3ZMKA 2D2ZA 1FO5A 4KB3A 3TRQA 1TU8A 3MDKA 3PGTA 4PNGA 1B9YC 4TXOB 1V40A 4QL9A 3KTLA 4I8BA 2L5LA 2LJAA 2C3QA 4X4JA 3U5RE 3CMIA 3TRXA 3FR6A 3GFKA 1Z9HA 1OC8A 2YV9A 1TRSA 3EC3A 4BPYA 1TRUA 3ZZXA 3TDGA 3ZRDA 1W4VA 4J2FA 3VPTA 1XWBA 4N0ZA 1V57A 1T4ZA 4OO4A 2HYXA 1PX6A 5D73A 1AAZA 4MF7A 4YH2A 1TXXA 11GSA 1GSDA 4EC0A 3MAKA 1B9XC 4LMVA 2YWIA 1WMJA 2H30A 5A1NA 5IMVA 3WGEA 2WB9A 4AF2A 3VPQA 2Z9SA 4G2EA 1SK1A 4HU7A 3IOSA 4KUNA 3E9JB 4XHMA 3ERWA 5DQYA 2HSYA 2B7JA 3LXZA 4ILFA 3TKRA 5DVBA 2YV7A 1XCCA 1K0OA 1NM3A 4G0IA 1XWCA 2VIMA 4DEJA 3HVVA 2BMXA 5B8AA 1QXHA 3HHVA 4IBPA 1GNWA 2HSMA 1ACVA 2EFEA 5ECMB 3QOUA 3FHKA 4V1Ap 1XPVA 3G9BA 3EINA 3FMWA 4BVXA 2VM2A 4GQCA 3QPMA 2H1AA 2YZHA 3TKSE 2ON7A 2GSTA 1PD21 2HQTA 1O85A 3EWLA 5IO0A 3TJFA 5ECKB 2H0GA 3QAVA 1T7PB 5LD0A 5IQYA 2JZSA 4J57E 2OT3A 1XXUA 4RI7A 2KUCA 3GRXA 2YCDA 2PERA 5ECRB 3UVHA 1HYUA 3O6TA 5HFGA 5JCUA 4PNFA 3ZVJA 3TKQA 1A2JA 3FZAA 3H1NA 5BMUA 5KN1A 2KOKA 1T00A 4MNNA 2DMLA 1Y25A 2C3TA 2FWFA 4TR1A 1FB0A 1GTAA 2X4AA 2B5YA 2R0PA 3APOA 2HT9A 3NZNA 4HJMA 1YKAA 5ECLB 1Q4JA 2L6DA 2KP1A 1TDIA 2I1UA 4NPBA 5A5HA 3HZ4A 2M46A 1TXUA 1TTZA 1A8LA 5ABRA 4J56E 1YJ6A 3W8SA 4KGIA 4F82A 5IM9A 3L9VA 2VAFA 1K0MA 2C0GA 5A34A 1XWAA 4GRFA 3R2QA 5F05A 5KN2A 4YAPA 1GL8A 3HY2A 4O7HA 1U87A 3F3RA 2L6CA 4DVCA 4BL7B 3M3MA 1QK8A 1PGTA 2DMMA 5IMZA 3A2VA 4ZL7A 3L4NA 2C0FA 4ZL8A 2MMNA 1K3YA 2FD3A 4XTSA 1TW9A 1EP7A 1W89A 1GSYA 3UEMA 2OKAA 4OD7A 1M9AA 4ZBAA 4BVYA 2TRCP 3EU4A 4IP1A 4LL4B 4PUFC 4HU9A 2H19A 4GQFA 4DSSB 3TJKA 5EY6A 2FHEA 1SVMA 2G2QA 3VWVA 1EGOA 2CAIA 4K7IA 4K0GA 4PUAA 4L5OA 4P3YB 1A2LA 3IK9A 4AGSA 4N10A 3R3EA 1O7UA 5DBQA 3UOMA 8GSSA 3UVTA 5E4WA 4L8EA 4EKZA 1ZOFA 2YPMA 1Z7PA 1SL0B 2H6XA 1HNCA 2B3SA 4JR6A 4ZIJA 1GLPA 5F06A 1RW1A 1K3LA 1VRSD 4WR4A 1EOGA 3HJPA 3S9FA 2HRFA 1M7TA 1EEJA 4ACSA 5J4UA 4ML6A 4HZ2A 5L71A 3K8NA 1WJKA 2VCQA 4EVMA 1RQMA 2MZCA 1OC3A 5KOXA 3I43A 3HZ8A 2JSYA 3HYPA 3KM6A 4POMA 3RDWA 4JR4A 4KSOA 2XC2A 2X99A 4XCSA 5H5RA 3EYTA 1ZYQB 1MTCA 1ZZYA 3FZ5A 5ELAA 2H0HA 5B6NA 3LJRA 4YQMA 22GSA 1KNGA 1SD9A 2E2MA 2GVPA 2V32A 2B7KA 2VLUA 3GUSA 1UVZA 4GSSA 2C0DA 5G5EA 3QD9A 3MSZA 3ZREA 2JSZA 3QMXA 2GSRA 14GSA 1TOFA 3GIXA 1K3OA 2HSNA 6GSUA 1X9SB 3UBLA 2GQMA 1T4YA 4Z2TA 5J4YA 1OAZA 2LTKA 3HA9A 2H73A 3WGXA 3LFLA 1K0BA 5KN0A 4GF0A 3IC8A 9GSSA 3APSA 2R0CA 3TOTA 3GTUA 3L78A 2H6ZA 3RPPA 2HRNA 5CRHA 3HD5A 1OC9B 2IMFA 5DAKB 1R7HA 3CRTA 3GL3A 2VCXA 1QUWA 4GSNA 2DJKA 3FW2A 4YKFA 4O5QA 2JADA 2YWOA 4GXZA 1GLQA 3OR5A 2F8AA 2JL4A 2HZEB 3LW9A 1G6YA 1OYJA 4I2TA 3VWXA 2OE3A 4KW6A 5C00A 3F8UA 3F6DA 4EO3A 1ZL9A 1NSWA 1WP0A 3PINA 5ID2A 1GH2A 2ES7A 5EL8A 4YQUA 2IJYA 4QMKA 2OBKA 2WFCA 3DKSA 2O7KA 1BJXA 4AJ8A 3QFBC 3LYPA 1THXA 2GT6A 2JZTA 3DMLA 4MF6A 3GH9A 4D73B 4Z2RA 2FLSA 1JHBA 4OO5A 3UJ1A 2L5OA 4MMMA 5B7CA 5ECNB 2GT5A 5JCWA 3MIXA 3GH6A 5CRDA 2H74A 3HVSA 5D93A 4PQHA 2FGXA 4TR3A 4CHSA 4PTSA 2PVOC 5EVOA 3KEBA 3ED3A 4XRAA 2P0GA 1MD4A 1X0RA 5ECIB 1XW5A 1DUGA 2K8VA 1I5GA 3GKKA 1B8XA 1EV9A 5CNWA 4ZB9A 5ENUA 1MDIA 4F2IA 3QFAC 3BJ5A 1E2YA 3EU3A 3IPZA 4TKYA 2HRAA 2CX4A 2CZ3A 2H6YA 4GCIA 4AJ7A 3GV1A 1XFLA 1TJDA 2V1MA 4I97A 1GSQA 5AGYA 3BCIA 1NHOA 1A24A 1JZOA 3QCPA 1GNEA 3G7IA 5A4UA 5H5QA 1DSBA 1Y6EA 5A5KA 4PX1A 4EIPA 5LNKe 1M0UA 3ME7A 1ST9A 2CVDA 1OE8A 4JRRA 4WBRD 5H5SA 2VCZA 4Q5NA 4XS6A 2KHPA 1LU4A 5FHIA 4MCUA 5IMAA 1YDKA 4MLYA 3TCOA 4K5RA 3F63A 3DYRA 1X5CA 3IHGA 1UA5A 3EMXA 4MH3A 5HR1A 2C80A 1FVJA 4LMWA 5CAXA 3O76A 3F4RA 2CZ2A 3KGKA 3LWAA 1AXDA 2TRXA 1JLWA 3QAWA 12GSA 3FYGA 3FZ9A 5DALA 3UAPA 2TIRA 4IW9A 5J9BA 2HLSA 4HJ2A 3WYWA 4Q5FA 1G7OA 6GSWA 3IE3A 5ECOB 1O73A 2YP6A 3GL5A 4YAVA 3L9SA 3W6GA 1KTEA 5G2ZA 2N5AA 2OJLA 3M0FA 2DIYA 2R4VA 2R2JA 2FWHA 5FWGA 2PMTA 3WT2A 3KXOA 1G7EA 4O92A 3FRCA 2RIIA 4TXOA 3GNJA 4MJCA 3M8NA 1VF1A 2H72A 2EIRA 1BF5A 4OCEA 3ZVJD 1AIUA 2HE3A 4K7OA 1SJ6A 2EFDA 2IMKA 4V1Ag 3VI7A 3DIEA 5CP1A 5KN3A 4WETA 4IS0A 2C8UA 2DKHA 4G01A 2HZFA 1WE0A 3DWVA 5F07A 3FR3A 1J0FA 1K0CA 4KA0A 2QKEA 3WD6A 1TI1A 1UC7A 1TRVA 3G7YA 3F0IA 5IPGA 1PN9A 1F6MC 4K5SA 2VO4A 4BVXB 2LQOA 4QQ7A 5D9VA 4MJBA 1S3AA 4ID0A 2NVLA 3RHBA 4GLTA 4NWYA 3Q74A 4KE3A 2O8VB 3ZYWA 5JWOB 2E0QA 4XS4B 4Q5QA 3IAS2 1ZYPA 1X5DA 2CV4A 3MYDA 1BG5A 1SYXA 1LBKA 4EL1A 2OE1A 4IN0A 3O3TA 5GSSA 4IELA 1V58A 2A4VA 1AW9A 4MZBA 4K2XA 2CVBA 4BA7A 4N3ZA 17GSA 1OE7A 5ECHB 4TR1B 3TGZA 1UN2A 4AKIA 5KEJA 2YJ7A 1F9MA 4BWQA 1YF0A 1ZYNA 1M9BA 2XBIA 4EXJA 4Z7XA 5D9WA 3G7JA 3PH9A 2P5QA 1SK2A 2H01A 2GZZA 3LXTA 2H0IA 2IMDA 4K6XA 3DRNA 1WWJA 1USBA 2LRCA 3IAM2 1PX7A 3ERFA 4LA1A 1YVLA 2ZCTA 2R37A 1M2AA 2LJRA 3I69A 4AI6A 1H75A 4NV2A 2IWTA 4FH8A 3ZFLA 2VCWA 1WOUA 3IR4A 4GSTA 3KZQA 3SWLA 4PXOA 3F3QA 1TRWA 1S3DA 1U88A 1X5EA 3EPTA 2E7PA 4BVYB 1T3BA 4XRDA 5B6MA 1TP9A 2IN3A 4KAEA 2DJ3A 2IFQB 2IMEA 1AC1A 1X9MB 3LGCA 3JCML 2DC5A 4IJIA 2L59A 4HUAA 4IJ3A 1SD8A 5D9TA 1URMA 4MDCA 1FW1A 2E2GA 2B6MA 1Z6MA 3UL3A 3HJOA 1J9BA 5JCGA 2RLIA 3GKNA 1PMTA 4MPFA 3W8JA 2YJHA 5G1LA 1SL1B 5DQSA 19GSA 3IXRA 1WIKA 3GX8A 4MH2A 2V41A 5JWQB 4N30A 3C73A 4G19A 1QFNA 5D9XA 4O32A 4HEA2 3GX0A 2CT6A 2F9SA 2VL2C 4DSSA 1N8JA 1GRXA 1J08A 2GZYA 2GQLA 4RUVA 4L0WA 1PQNA 1YEXA 4PQIA 2XPDA 5GSTA 3Q18A 4KCEA 4IKHA 4HQSA 3IRAA 2DLXA 20GSA 1ERTA 3LYKA 2UV8G 3EURA 3LEFA 1TI3A 2YN1A 1GTUA 3ZLPA 2C4JA 2PWJA 3FEUA 5G30A 3NIVA 5HFIA 3C8EA 4TVEA 2VOCA 3TB2A 4ECJA 1BG1A 5J41A 3CSHA 2VD1A 1XWKA 4POKA 2K9FA 3IC4A 1GULA 3CSIA 1SK0A 1EEMA 2WCIA 3MNGA 3GKXA 4H86A 3FK8A 4K7NA 4Z2UA 1SYRA 1C72A 4USSA 4MABA 3HMJG 4TR4A 2HSNB 2OA7A 5DCGA 4MA9A 3D21A 1PSQA 5DJMA 2REMA 1PN0A 2VM1A 4F03A 1DE1A 3CBUA 3VK9A 2OBIA 1M99A 3P8WA 2LNTA 4CY6A 4X0XA 4ZB8A 3GTUB 2F51A 4V2MA 3HDCA 4PURA 1A0FA 4JEDA 2I4AA 2V2GA 1F3BA 2DIZA 2OACA 18GSA 3TRPA 4TW5A 4MPGA 2MBSA 1ZGNA 3VWWA 4O5RA 1PKWA 2X64A 5CRWA 2EC4A 2I3YA 4KNDA 1YZXA 3F4SA 3LG6A 2V6KA 1I9DA 4KSMA 1XZOA 3V1WA 4IVFA 3F4TA 3UMAA 2AJQB 2KLXA 3ZITA 1SENA 1BYEA 4G10A 1A2MA 5G5FA 1SU9A 5CYYA 1OC9A 5IMFA 2WGRA 4TXVA 5E59A 4GWRA 2HI7A 4OFTA 2R5GA 2L4QA 5DAKA 1R5AA 4RQRA 2K18A 2WJUA 2NDOA 6GSYA 4F0BA 4NV5A 1YF1A 6GSTA 2HZEA 3ZIVA 4ECIA 2VL2A 1R26A 1N2AA 3LSZA 5COHA 6GSVA 1AQXA 2HSHA 3H8QA 1GTBA 1EV4A 1XOAA 2X49A 2L4CA 3VURA 5IPHA 3GKMA 1K0AA 2VLVA 2VCTA 4HDEA 2B1LA 5HQPA 2YWMA 1SJZA 1BEDA 3CWGA 4AKHA 1BQ7A 2FA8A 2XHFA 4FIWA 4CDOA 1TK8B 2G0FA 1FOVA 4ZBDA 2H1DA 1ABAA 2PN8A 1U3AA 4X1UA 2HRKB 5BRTA 1PKZA 1VF3A 3E0UA 2CAQA 4F0CA 3TJJA 3D22A 3C1RA 4D73A 5JWRB 5A4WA 1GUKA 2WDUA 2BJXA 1BX9A 1A23A 5HR3A 2DJ2A 4ICYA 4IGJA 3F6FA 2K6VA 2QGVA 2B1KA 1FOHA 5ECPB 2DKIA 3ZL5A 2YZUA 2LS5A 4IQAA 3VWUA 3A5WA 3EVIA 3FR9A 2EIOA 3UARA 4KF9A 3APQA 3ZTLA 2A2PA 3D0ZA 4IP6A 3RHCA 4HOJA 3GMFA 2O85A 1FAAA 2XPEA 5G31A 4TRXA 1VF2A 2EFHA 2LUSA 2FUG2 2WRTA 4X43A 5AIVA 1HNAA 2C0EA 5LCZA 2QSIA 3TKSC 2O5VA 4NAXA 3IBHA 2KP2A 1JZRA 1F37A 2GGTA 3KH9A 1SVOA 3KMOA 3CTGA 4WR5A 3IK7A 3HXSA 3D4TA 1F3AA 4N11A 3A5IA 2PBJA 4FYBA 4YQVA 5AN1A 1EGRA 3KMNA 5CO3A 5J9CA 3TJBA 2DJ0A 5DALB 1XWGA 1OKDA 1XVQA 5J40A 2WS2A 5IMCA 4MF5A 3ZIJA 3Q19A 2NPBA 1O8WA 2DBCA 5J3RA 2X8HA 5INYA 3QAGA 6GSSA 3BBYA 1MDKA 2EIQA 1G0TA 4WKWA 1O6JA 3EE2A 3PR8A 5FT3A 2DSAA 4HQZA 4ECCA 1KBNA 2O89A 4WEYA 4ZXGA 3BCKA 4DSRA 5IIZA 1JZDA 2LV3A 4OCFA 5F0GA 5KOWA 3RAZA 1XIYA 4E8HA 5J4VA 1AUCA 1THOA 2MBTA 1M2BA 4DSQA 5A1NB 3N5OA 1XVWA 2H70A 5C04A 3AY8A 4HZ4A 1S3CA 1CQGA 1VF4A 1G6WA 3QR6A 3CYNA 2N5BA 3M9JA 2HXKA 3CXGA 1FHEA 3VI5A 1Z6NA 1IYIA 4EUYA 1E6BA 2GQKA 1M2DA 3M9KA 4QL7A 1Z7RA 1O8XA 2I81A 1PL1A 3KTBA 1SL2B 3TU3B 2HSMB 2LRTA 3SBCA 1Y1UA 2WZ9A 1DE2A 1NW2A 1JZWA 1FG4A 2I9HA 3PPUA 3I6AA 2YWNA 2PPTA 5J5NA 1H4OA 4MK3A 1FVKA 2MYGA 3HVXA 3DVXA 3VLNA 5A4VA 3HKRA 5DDLA 2HFDA 2H1LA 3ZMLA 2FWGA 2R6KA 2AB6A 4ML1A 3LORA 2RM5A 3KP9A 3KH7A 3D4MA 4GTUA 3H4KA 1TK5B 5GZZB 3KP8A 3TKSA 3L0HA 2ZNMA 3NOFA 1MD3A 1JLVA 4EE0A 1F2EA 3LQ7A 4KDXA 2B5XA 4AJ6A 2PGTA 2AV4A 2XBQA 4I5QA 4POBA 2MMAA 1PA3A 3P7XA 5BMUB 3FZ4A 2R0GA 4AKXB 3ERGA 5D8IA 4K1FA 1Z5YE 1QGVA 4G0KA 2QA1A 4XS4A 4PQ1A 3H79A 2LQQA 1ERVA 2DJ1A 3WT1A 2LRNA 4G9HA 2BTOT 5CRGA 2QA2A 5A5HB 4FYUA 2GTUA 2VKZG 5D96A 2H76A 1V9WA 3UIWA 5A34B 3P2AA 10GSA 2HNLA 2H1GA 2JZRA 4KDYA 3DXBA 1A0RP 2LNSA 1RK4A 2R3XA 2YANA 4ZB6A 4LLRA 1HQOA 4O5UA 5HFKA 4L0UA 4EIQA 4EDZA 2GS3A 2LSTA 2OADA 4ISDA 4JU5A 1PL2A 1ZMAA 1V2AA 2YOIA 3L9UA 3FY7A 3IA1A 2AHEA 5IMDA 5GAND 4V2LA 4JE1A 4BL7A 1U3IA 3CSJA 2FWEA 4OFNA 2CVKA 4KDUA 2P31A 6GSXA 1GSFA 4MJEA 4A5PA 2MMZA 1EP8A 4FO5A 2B5EA 3BOAA 2IFQA 2UZ8A 4OFMA 1EZKA 1GSSA 3TKPA 3C71A 4ZBBA 1FB6A 3P90A 4JBBA 3TOUA 7GSSA 1V98A 3ISOA 3GN3A 3DVWA 1ILOA 4TN8A 1R5PA 3C7MA 2IL3A 1YKCA 5GAPD 2H8LA 4ZL9A 2J9HA 4K2DA 2A2RA 4V2NA 3EMPA 4HI7A 2NBSA 3FKFA 3IDVA 3DD3A 3KD0A 4HS1A 2V6OA 1SKSB 3A2XA 3N9JA 3C1SA 4OWYA 4WXTA 2CA8A 3I9V2 3DGQA 5IOWA 5HR0A 3GSSA 4KH7A 4Q5RA 4IHUA 2ALBA 3GSTA 3UBKA 1SJIA 4L5LA 4I2UA 2AUVA 2LKUA 2RM6A 2DJJA 1GUHA 4NHWA 2YNXA 5EPFA 2F3MA 4NHZA 2X8CA 4CY8A 4ZB7A 1TU7A 3WGDA 5B8BA 2H71A 5IO2A 4FYCA 1VGLA 4MJAA 3DEXA 2VLTA 1ZCPA 2FNOA 1JFUA 3J7Yk 1EOHA 3HCZA 3GURA 5ECQB 2PUKC 2MMOA 2C3NA 3TJGA 1K0DA 1OVNA 1B4PA 2P5RA 3Q6OA 3KJYA 3A2WA 5ECSA 1NHYA 3IHQA 2CQ9A 2M72A 1ZYEA 4NMUA 4ECBA 1GSEA 4KCAA 4ZILA 3VFIA 1N25A 4MZWA 4RI6A 2VCVA 1BAYA 2ON5A 2O87A 4OMVA 4FQUA 5CREA 2GLRA 3U6VA 5DCHA 2IPAA 3US3A 4POLA 3RPNA 5AIXA 5ID2B 4WF4A 3D5JA 1Q98A 3D6IA 4I6XA 3KCMA 4K8MA 3BD2A 1DBYA 1GUMA 4NXIA 1LJRA 4XIHA 3CTFA 1T8EB 4KX4A 1IYHA 4JZQA 2K8SA 3H93A 1B4QA 13GSA 1X9WB 1B48A 5DJLA 1GP1A 2GDRA 1HD2A 2GZPA 2WULA 1MDJA 3RBTA 2NTOA 5G1KA 4EDYA 2ZUPA 4MZCA 2AYTA 4ULXA 2A4HA 1HNBA 1MEKA 2AAWA 4W66A 1EWXA 2IIYA 3HJMA 2VL9A 16GSA 1R4WA 1ERUA 3TUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USB A;  1PX7 A;  3ERF A;  3CRU A;  5ELA A;  3LJR A;  4YQM A;  2GSS A;  3N5O A;  1GWC A;  3AY8 A;  4HZ4 A;  22GS A;  1VF4 A;  4MP4 A;  1G6W A;  3QR6 A;  2LJR A;  1OKT A;  3I69 A;  3ZFL A;  2VCW A;  2N5F A;  3IR4 A;  3GUS A;  4GSS A;  4IQ1 A;  4GST A;  3M1G A;  5G5E A;  3SWL A;  4PXO A;  2VD0 A;  2GSR A;  14GS A;  1U88 A;  1K3O A;  1FHE A;  4BVY B;  6GSU A;  3UBL A;  3VI5 A;  1GSU A;  1IYI A;  1E6B A;  2HRK A;  2GSQ A;  3LFL A;  1K0B A;  4GF0 A;  1PL1 A;  3IC8 A;  4KAE A;  9GSS A;  1K0N A;  1YY7 A;  2HSM B;  2DC5 A;  4IJI A;  3TOT A;  3GTU A;  2F8F A;  4E8E A;  5D9T A;  3ZFB A;  3PPU A;  4MDC A;  1FW1 A;  3I6A A;  4N0V A;  4TOP A;  5J5N A;  3HJO A;  4MK3 A;  1AQW A;  3VLN A;  5DAK B;  5A4V A;  1PMT A;  3CRT A;  3HKR A;  2VCX A;  5DDL A;  4GSN A;  4MPF A;  3ZML A;  2R6K A;  4K0N A;  1GTI A;  2AB6 A;  5DQS A;  19GS A;  1GLQ A;  2JL4 A;  2A2S A;  4PGT A;  1G6Y A;  4GTU A;  1OYJ A;  4G19 A;  5D9X A;  1YQ1 A;  5GZZ B;  3GX0 A;  3VWX A;  3L0H A;  5ELG A;  1MD3 A;  3F6D A;  1JLV A;  1ZL9 A;  4EE0 A;  5F8B A;  1F2E A;  3LQ7 A;  2PVQ A;  4KDX A;  2PGT A;  4PQI A;  1PA3 A;  4G0L A;  5GST A;  3Q18 A;  4IKH A;  1ML6 A;  3ERG A;  20GS A;  3LYK A;  1XW6 A;  2IMI A;  5EL8 A;  4YQU A;  4G0K A;  1GTU A;  5AIS A;  4G9H A;  2C4J A;  1AQV A;  3ZMK A;  2D2Z A;  1TU8 A;  3NIV A;  3MDK A;  3PGT A;  4PNG A;  2GTU A;  1V40 A;  3C8E A;  3LYP A;  3KTL A;  2C3Q A;  4MF6 A;  4ECJ A;  10GS A;  2HNL A;  5J41 A;  3CSH A;  2VD1 A;  3FR6 A;  1XWK A;  4KDY A;  1Z9H A;  1GUL A;  3CSI A;  2YV9 A;  1RK4 A;  1EEM A;  2R3X A;  5B7C A;  5ECN B;  4ZB6 A;  1C72 A;  4USS A;  5JCW A;  1HQO A;  4J2F A;  5HFK A;  3VPT A;  3GH6 A;  2HSN B;  2OA7 A;  4PQH A;  1PX6 A;  5D73 A;  5DCG A;  4MF7 A;  5DJM A;  4PTS A;  4CHS A;  4EDZ A;  4YH2 A;  2OAD A;  4ISD A;  5EVO A;  4F03 A;  11GS A;  1PL2 A;  3CBU A;  3VK9 A;  1GSD A;  1M99 A;  1V2A A;  3P8W A;  1MD4 A;  4EC0 A;  3MAK A;  3FY7 A;  5ECI B;  4ZB8 A;  2AHE A;  3GTU B;  4LMV A;  1XW5 A;  1DUG A;  1B8X A;  1EV9 A;  4PUR A;  4ZB9 A;  2WB9 A;  1A0F A;  4JED A;  4BL7 A;  1F3B A;  3VPQ A;  2OAC A;  1U3I A;  18GS A;  3CSJ A;  4OFN A;  4MPG A;  2HRA A;  4KDU A;  1ZGN A;  2CZ3 A;  4GCI A;  6GSX A;  1GSF A;  1PKW A;  2X64 A;  3LXZ A;  4I97 A;  1GSQ A;  5AGY A;  3LG6 A;  2V6K A;  2YV7 A;  1K0O A;  1GNE A;  4KSM A;  3G7I A;  4G0I A;  4IVF A;  5A4U A;  4DEJ A;  2UZ8 A;  1Y6E A;  5A5K A;  4IBP A;  1GNW A;  4PX1 A;  4OFM A;  2HSM A;  1GSS A;  4ZBB A;  1M0U A;  3P90 A;  2CVD A;  1BYE A;  1OE8 A;  4JBB A;  5ECM B;  3TOU A;  4G10 A;  2VCZ A;  7GSS A;  4Q5N A;  3ISO A;  5G5F A;  3EIN A;  4BVX A;  5FHI A;  1YDK A;  2IL3 A;  1YKC A;  2ON7 A;  4OFT A;  2R5G A;  5DAK A;  3F63 A;  2GST A;  1R5A A;  2J9H A;  1PD2 1;  2HQT A;  2WJU A;  1UA5 A;  2A2R A;  6GSY A;  4F0B A;  5ECK B;  4HI7 A;  3QAV A;  5LD0 A;  2C80 A;  6GST A;  4LMW A;  3DD3 A;  4ECI A;  5IQY A;  3O76 A;  2CZ2 A;  1N2A A;  3LSZ A;  6GSV A;  4RI7 A;  1AXD A;  3N9J A;  1JLW A;  2YCD A;  2PER A;  1AQX A;  3QAW A;  5ECR B;  12GS A;  3FYG A;  1GTB A;  2CA8 A;  3UVH A;  1EV4 A;  3DGQ A;  5DAL A;  3VUR A;  3UAP A;  5JCU A;  4IW9 A;  1K0A A;  4PNF A;  3GSS A;  2VCT A;  4KH7 A;  4Q5R A;  4HJ2 A;  3WYW A;  4Q5F A;  3GST A;  3H1N A;  5BMU A;  3IE3 A;  5ECO B;  6GSW A;  1G7O A;  3UBK A;  4L5L A;  4YAV A;  1GUH A;  2C3T A;  1GTA A;  3M0F A;  4NHW A;  5ECL B;  2R4V A;  1Q4J A;  2F3M A;  4NHZ A;  1TU7 A;  1TDI A;  5FWG A;  2PMT A;  3KXO A;  4O92 A;  3FRC A;  4ZBD A;  2HRK B;  1PKZ A;  1VF3 A;  1YJ6 A;  3W8S A;  2CAQ A;  4KGI A;  4F0C A;  1K0M A;  2FNO A;  3M8N A;  1VF1 A;  5A4W A;  3R2Q A;  5F05 A;  1GUK A;  2WDU A;  4YAP A;  2IMK A;  4O7H A;  1U87 A;  1EOH A;  1BX9 A;  3GUR A;  3VI7 A;  4BL7 B;  5ECQ B;  3M3M A;  4IGJ A;  2C3N A;  3F6F A;  1PGT A;  1K0D A;  5ECP B;  1B4P A;  4IS0 A;  4IQA A;  3KJY A;  5ECS A;  1K3Y A;  2C8U A;  3FR9 A;  3UAR A;  4KF9 A;  1TW9 A;  3D0Z A;  4HOJ A;  1NHY A;  1GSY A;  5F07 A;  3FR3 A;  1VF2 A;  1K0C A;  2WRT A;  1M9A A;  4ECB A;  4ZBA A;  1GSE A;  3WD6 A;  4BVY A;  5AIV A;  1HNA A;  5LCZ A;  4MZW A;  5EY6 A;  4RI6 A;  2VCV A;  2FHE A;  1BAY A;  2ON5 A;  1PN9 A;  2VO4 A;  4BVX B;  4OMV A;  4FQU A;  4NAX A;  4QQ7 A;  2GLR A;  5D9V A;  3IBH A;  2CAI A;  4K0G A;  4PUA A;  4L5O A;  1JZR A;  4ID0 A;  3U6V A;  4GLT A;  3IK9 A;  4AGS A;  5AIX A;  3Q74 A;  4KE3 A;  3KMO A;  3R3E A;  4WR5 A;  3IK7 A;  4Q5Q A;  1F3A A;  2PBJ A;  4YQV A;  5AN1 A;  8GSS A;  1BG5 A;  1LBK A;  4L8E A;  1GUM A;  3KMN A;  3O3T A;  1LJR A;  4KX4 A;  1IYH A;  4JZQ A;  5DAL B;  5GSS A;  4IEL A;  1XWG A;  1HNC A;  13GS A;  1GLP A;  1AW9 A;  5F06 A;  1B48 A;  2WS2 A;  1K3L A;  4MF5 A;  17GS A;  1OE7 A;  5DJL A;  3Q19 A;  2GDR A;  4WR4 A;  1EOG A;  5ECH B;  3TGZ A;  3RBT A;  2NTO A;  3QAG A;  3BBY A;  4ACS A;  6GSS A;  5J4U A;  5KEJ A;  4EDY A;  4HZ2 A;  1HNB A;  2AAW A;  3EE2 A;  2VCQ A;  3PR8 A;  5FT3 A;  3HJM A;  2DSA A;  4ECC A;  1KBN A;  1M9B A;  3KM6 A;  4ZXG A;  4EXJ A;  16GS A;  5D9W A;  3G7J A;  5F0G A;  3LXT A;  4E8H A;  1MTC A; 
#chains in the Genus database with same CATH topology
 3GYK A;  1SKR B;  2L57 A;  3A3T A;  3CRU A;  4K9Z A;  1U6T A;  3QDN A;  5IOX A;  2GSS A;  1GWC A;  5HR2 A;  2H1B A;  1KEB A;  1TK0 B;  4MP4 A;  1OKT A;  4AKG A;  1T1V A;  3IV4 A;  2JU5 A;  1Z3E A;  3ME8 A;  2N5F A;  2FY6 A;  4IQ1 A;  1TKD B;  1O81 A;  2LEG A;  3M1G A;  1YEP A;  2VD0 A;  2LJK A;  4WF5 A;  2VUP A;  1XW9 A;  1GSU A;  2HRK A;  2GSQ A;  4LL1 B;  2EFC A;  4GDF A;  1K0N A;  1YY7 A;  1A8Y A;  1WRY A;  2VL3 A;  3GHA A;  1CQH A;  2F8F A;  4E8E A;  3ZFB A;  2H75 A;  5J47 A;  4N0V A;  4TOP A;  1AQW A;  3KIJ A;  2RUF A;  1XOB A;  4CW9 A;  1ON4 A;  2FA4 A;  4K0N A;  1GTI A;  2JAC A;  3E3E A;  3J7Y b;  4F9Z A;  2A2S A;  4PGT A;  2X8G A;  3MWH A;  1YQ1 A;  1QQ2 A;  1XBS A;  2OE0 A;  2O36 A;  5ELG A;  4WBJ A;  4TR0 A;  5F8B A;  2PVQ A;  2QC7 A;  1SVL A;  4E68 A;  4RQX A;  2FCH A;  4G0L A;  1QMV A;  2C1Y A;  2H66 A;  4EF0 A;  4YKG A;  1ML6 A;  2M80 A;  1XW6 A;  3F9U A;  1WPI A;  1PRX A;  2RUE A;  2IMI A;  1ERW A;  4BWS A;  4XS1 A;  3GA4 A;  1SKW B;  5AIS A;  2PU9 C;  2CX3 A;  2J23 A;  1AQV A;  3ZMK A;  2D2Z A;  1FO5 A;  4KB3 A;  3TRQ A;  1TU8 A;  3MDK A;  3PGT A;  4PNG A;  1B9Y C;  4TXO B;  1V40 A;  4QL9 A;  3KTL A;  4I8B A;  2L5L A;  2LJA A;  2C3Q A;  4X4J A;  3U5R E;  3CMI A;  3TRX A;  3FR6 A;  3GFK A;  1Z9H A;  1OC8 A;  2YV9 A;  1TRS A;  3EC3 A;  4BPY A;  1TRU A;  3ZZX A;  3HVN A;  3TDG A;  3ZRD A;  1W4V A;  4J2F A;  3VPT A;  1XWB A;  4N0Z A;  1V57 A;  1T4Z A;  4OO4 A;  2HYX A;  1PX6 A;  5D73 A;  1AAZ A;  4MF7 A;  4YH2 A;  1TXX A;  11GS A;  1GSD A;  4EC0 A;  3MAK A;  1B9X C;  4LMV A;  2YWI A;  1WMJ A;  2H30 A;  5A1N A;  5IMV A;  3WGE A;  2WB9 A;  4AF2 A;  3VPQ A;  2Z9S A;  4G2E A;  1SK1 A;  4HU7 A;  3IOS A;  1S4B P;  4KUN A;  3E9J B;  4XHM A;  3ERW A;  5DQY A;  2HSY A;  2B7J A;  3LXZ A;  4ILF A;  3TKR A;  5DVB A;  2YV7 A;  1XCC A;  1K0O A;  1NM3 A;  4G0I A;  1XWC A;  2VIM A;  4DEJ A;  3HVV A;  2BMX A;  5B8A A;  1QXH A;  3HHV A;  4IBP A;  1GNW A;  2HSM A;  1ACV A;  2EFE A;  5ECM B;  3QOU A;  3FHK A;  4V1A p;  1XPV A;  3G9B A;  3EIN A;  3FMW A;  4BVX A;  2VM2 A;  4GQC A;  3QPM A;  2H1A A;  2YZH A;  3TKS E;  2ON7 A;  2GST A;  1PD2 1;  2HQT A;  1O85 A;  3EWL A;  5IO0 A;  3TJF A;  5ECK B;  2H0G A;  3QAV A;  1T7P B;  5LD0 A;  5IQY A;  2JZS A;  4J57 E;  2OT3 A;  1XXU A;  4RI7 A;  2KUC A;  3GRX A;  2YCD A;  2PER A;  5ECR B;  3UVH A;  1HYU A;  3O6T A;  1PFO A;  5HFG A;  5JCU A;  4PNF A;  3ZVJ A;  3TKQ A;  1A2J A;  3FZA A;  3H1N A;  5BMU A;  5KN1 A;  2KOK A;  1T00 A;  4MNN A;  2DML A;  1Y25 A;  2C3T A;  2FWF A;  4TR1 A;  1FB0 A;  1GTA A;  2X4A A;  2B5Y A;  2R0P A;  3APO A;  2HT9 A;  3NZN A;  4HJM A;  1YKA A;  5ECL B;  1Q4J A;  2L6D A;  2KP1 A;  1TDI A;  2I1U A;  4NPB A;  5A5H A;  3HZ4 A;  2M46 A;  1TXU A;  1TTZ A;  1A8L A;  5ABR A;  4J56 E;  1YJ6 A;  3W8S A;  4KGI A;  4F82 A;  5IM9 A;  3L9V A;  2VAF A;  1K0M A;  2C0G A;  5A34 A;  1XWA A;  4GRF A;  3R2Q A;  5F05 A;  5KN2 A;  4YAP A;  1GL8 A;  3HY2 A;  4O7H A;  1U87 A;  3F3R A;  2L6C A;  4DVC A;  4BL7 B;  3M3M A;  1QK8 A;  1PGT A;  2DMM A;  5IMZ A;  3A2V A;  4ZL7 A;  3L4N A;  2C0F A;  4ZL8 A;  2MMN A;  1K3Y A;  2FD3 A;  4XTS A;  1TW9 A;  1EP7 A;  1W89 A;  1GSY A;  3UEM A;  2OKA A;  4OD7 A;  1M9A A;  4ZBA A;  4BVY A;  2TRC P;  3EU4 A;  4IP1 A;  4LL4 B;  4PUF C;  4HU9 A;  2H19 A;  4GQF A;  4DSS B;  3TJK A;  5EY6 A;  2FHE A;  1SVM A;  2G2Q A;  3VWV A;  1EGO A;  2CAI A;  4K7I A;  4K0G A;  4PUA A;  4L5O A;  4P3Y B;  1A2L A;  1M3J A;  3IK9 A;  4AGS A;  4N10 A;  3R3E A;  1O7U A;  5DBQ A;  3UOM A;  8GSS A;  3UVT A;  5E4W A;  4L8E A;  4EKZ A;  1ZOF A;  2YPM A;  1Z7P A;  1SL0 B;  2H6X A;  1HNC A;  2B3S A;  4JR6 A;  4ZIJ A;  1GLP A;  5F06 A;  1RW1 A;  1K3L A;  1VRS D;  4WR4 A;  1EOG A;  3HJP A;  3S9F A;  2HRF A;  1M7T A;  1EEJ A;  4ACS A;  5J4U A;  4ML6 A;  4HZ2 A;  5L71 A;  3K8N A;  1WJK A;  2VCQ A;  4EVM A;  1RQM A;  2MZC A;  1OC3 A;  5KOX A;  3I43 A;  3HZ8 A;  2JSY A;  3HYP A;  3KM6 A;  4POM A;  3RDW A;  4JR4 A;  4KSO A;  2XC2 A;  2X99 A;  4XCS A;  5H5R A;  3EYT A;  1ZYQ B;  1MTC A;  1ZZY A;  3FZ5 A;  5ELA A;  2H0H A;  5B6N A;  3LJR A;  4YQM A;  22GS A;  1KNG A;  1SD9 A;  2E2M A;  2GVP A;  2V32 A;  2B7K A;  2VLU A;  3GUS A;  1UVZ A;  4GSS A;  2C0D A;  5G5E A;  3QD9 A;  3MSZ A;  3ZRE A;  2JSZ A;  3QMX A;  2GSR A;  14GS A;  1TOF A;  3GIX A;  1K3O A;  2HSN A;  6GSU A;  1X9S B;  3UBL A;  2GQM A;  1T4Y A;  4Z2T A;  5J4Y A;  1OAZ A;  2LTK A;  3HA9 A;  2H73 A;  3WGX A;  3LFL A;  1K0B A;  5KN0 A;  4GF0 A;  3IC8 A;  9GSS A;  3APS A;  2R0C A;  3TOT A;  3GTU A;  3L78 A;  2H6Z A;  3RPP A;  2HRN A;  5CRH A;  2WZS A;  3HD5 A;  1OC9 B;  2IMF A;  5DAK B;  1R7H A;  3CRT A;  3GL3 A;  2VCX A;  1QUW A;  4GSN A;  2DJK A;  3FW2 A;  4YKF A;  4O5Q A;  2JAD A;  2YWO A;  4GXZ A;  1GLQ A;  3OR5 A;  2F8A A;  2JL4 A;  2HZE B;  3LW9 A;  1G6Y A;  1OYJ A;  4I2T A;  3VWX A;  2OE3 A;  4KW6 A;  5C00 A;  3F8U A;  3F6D A;  4EO3 A;  1ZL9 A;  1NSW A;  1WP0 A;  3PIN A;  5ID2 A;  1GH2 A;  2ES7 A;  5EL8 A;  4YQU A;  2IJY A;  4QMK A;  2OBK A;  2WFC A;  3DKS A;  2O7K A;  1BJX A;  4AJ8 A;  3QFB C;  3LYP A;  1THX A;  2GT6 A;  2JZT A;  3DML A;  4MF6 A;  3GH9 A;  4D73 B;  4Z2R A;  2FLS A;  1JHB A;  4OO5 A;  3UJ1 A;  2L5O A;  4MMM A;  5B7C A;  5ECN B;  2GT5 A;  5JCW A;  3MIX A;  3GH6 A;  5CRD A;  2H74 A;  3HVS A;  5D93 A;  3RFR C;  4PQH A;  2FGX A;  4TR3 A;  4CHS A;  4PTS A;  2PVO C;  5EVO A;  3KEB A;  3ED3 A;  4XRA A;  2P0G A;  1MD4 A;  1X0R A;  5ECI B;  1XW5 A;  1DUG A;  2K8V A;  1I5G A;  3GKK A;  1B8X A;  1EV9 A;  5CNW A;  4ZB9 A;  5ENU A;  1MDI A;  4F2I A;  3QFA C;  3BJ5 A;  1E2Y A;  3EU3 A;  3IPZ A;  4TKY A;  2HRA A;  2CX4 A;  2CZ3 A;  2H6Y A;  4GCI A;  4AJ7 A;  3GV1 A;  1XFL A;  1TJD A;  2V1M A;  4I97 A;  1GSQ A;  5AGY A;  3BCI A;  1NHO A;  1A24 A;  1JZO A;  3QCP A;  1GNE A;  3G7I A;  5A4U A;  5H5Q A;  1DSB A;  1Y6E A;  5A5K A;  4PX1 A;  4EIP A;  5LNK e;  1M0U A;  3ME7 A;  1ST9 A;  2CVD A;  1OE8 A;  4JRR A;  4WBR D;  5H5S A;  2VCZ A;  4Q5N A;  4XS6 A;  2KHP A;  1LU4 A;  5FHI A;  4MCU A;  5IMA A;  1YDK A;  4MLY A;  3TCO A;  4K5R A;  3F63 A;  3DYR A;  1X5C A;  3IHG A;  1UA5 A;  3EMX A;  4MH3 A;  5HR1 A;  2C80 A;  1FVJ A;  4LMW A;  5CAX A;  3O76 A;  3F4R A;  2CZ2 A;  3KGK A;  3LWA A;  1AXD A;  2TRX A;  1JLW A;  3QAW A;  12GS A;  3FYG A;  3FZ9 A;  5DAL A;  3UAP A;  2TIR A;  4IW9 A;  5J9B A;  2HLS A;  4HJ2 A;  3WYW A;  4Q5F A;  1G7O A;  2WVX B;  3IE3 A;  5ECO B;  6GSW A;  1O73 A;  2YP6 A;  3GL5 A;  4YAV A;  3L9S A;  3W6G A;  1KTE A;  5G2Z A;  2N5A A;  2OJL A;  3M0F A;  2DIY A;  2R4V A;  2R2J A;  2FWH A;  5FWG A;  2PMT A;  3WT2 A;  3KXO A;  1G7E A;  4O92 A;  3FRC A;  2RII A;  4TXO A;  3GNJ A;  4MJC A;  3M8N A;  1VF1 A;  2H72 A;  2EIR A;  1BF5 A;  4OCE A;  3ZVJ D;  1AIU A;  2HE3 A;  4K7O A;  1SJ6 A;  2EFD A;  2IMK A;  4V1A g;  3VI7 A;  3DIE A;  5CP1 A;  5KN3 A;  4WET A;  4IS0 A;  2C8U A;  2DKH A;  4G01 A;  2HZF A;  1WE0 A;  3DWV A;  5F07 A;  3FR3 A;  1J0F A;  1K0C A;  1M3I A;  4KA0 A;  2QKE A;  3WD6 A;  1TI1 A;  1UC7 A;  1TRV A;  3G7Y A;  3F0I A;  5IPG A;  1PN9 A;  1F6M C;  4K5S A;  2VO4 A;  4BVX B;  2LQO A;  4QQ7 A;  5D9V A;  4MJB A;  1S3A A;  4ID0 A;  2NVL A;  3RHB A;  4GLT A;  4NWY A;  3Q74 A;  4KE3 A;  2O8V B;  3ZYW A;  5JWO B;  2E0Q A;  4XS4 B;  4Q5Q A;  3IAS 2;  1ZYP A;  1X5D A;  2CV4 A;  3MYD A;  1BG5 A;  1SYX A;  1LBK A;  4EL1 A;  3RGB C;  2OE1 A;  4IN0 A;  3O3T A;  5GSS A;  4IEL A;  1V58 A;  2A4V A;  1AW9 A;  4MZB A;  4K2X A;  2CVB A;  4BA7 A;  4N3Z A;  17GS A;  1OE7 A;  5ECH B;  4TR1 B;  3TGZ A;  1UN2 A;  4AKI A;  5KEJ A;  2YJ7 A;  1F9M A;  4BWQ A;  1YF0 A;  1ZYN A;  1M9B A;  2XBI A;  4EXJ A;  2WW3 A;  4Z7X A;  5D9W A;  3G7J A;  3PH9 A;  2P5Q A;  1SK2 A;  2H01 A;  2GZZ A;  3LXT A;  2H0I A;  2IMD A;  4K6X A;  3DRN A;  1WWJ A;  1USB A;  2LRC A;  3IAM 2;  1PX7 A;  3ERF A;  4LA1 A;  1YVL A;  2ZCT A;  2R37 A;  1M2A A;  2LJR A;  3I69 A;  4AI6 A;  1H75 A;  4NV2 A;  2IWT A;  4FH8 A;  3ZFL A;  2VCW A;  1WOU A;  3IR4 A;  4GST A;  3KZQ A;  3SWL A;  4PXO A;  3F3Q A;  1TRW A;  1S3D A;  1U88 A;  1X5E A;  3EPT A;  2E7P A;  4BVY B;  1T3B A;  4XRD A;  5B6M A;  1TP9 A;  2IN3 A;  4KAE A;  2DJ3 A;  2IFQ B;  2IME A;  1AC1 A;  1X9M B;  3LGC A;  3JCM L;  2DC5 A;  4IJI A;  2L59 A;  4HUA A;  4IJ3 A;  1SD8 A;  5D9T A;  1URM A;  4MDC A;  1FW1 A;  2E2G A;  2B6M A;  1Z6M A;  3UL3 A;  3HJO A;  1J9B A;  5JCG A;  2RLI A;  3GKN A;  1PMT A;  4MPF A;  3W8J A;  2YJH A;  5G1L A;  1SL1 B;  2WVZ A;  5DQS A;  19GS A;  3IXR A;  1WIK A;  3GX8 A;  4MH2 A;  2V41 A;  5JWQ B;  4N30 A;  3C73 A;  4G19 A;  1QFN A;  5D9X A;  4O32 A;  4HEA 2;  3GX0 A;  2CT6 A;  2F9S A;  2VL2 C;  4DSS A;  1N8J A;  1GRX A;  1J08 A;  2GZY A;  1XG8 A;  2GQL A;  4RUV A;  4L0W A;  1PQN A;  1YEX A;  4PQI A;  2XPD A;  5GST A;  3Q18 A;  4KCE A;  4IKH A;  4HQS A;  3IRA A;  2DLX A;  20GS A;  1ERT A;  3LYK A;  2UV8 G;  3EUR A;  3LEF A;  1TI3 A;  2YN1 A;  1GTU A;  3ZLP A;  2C4J A;  2PWJ A;  3FEU A;  5G30 A;  3NIV A;  5HFI A;  3C8E A;  4TVE A;  2VOC A;  3TB2 A;  4ECJ A;  1BG1 A;  5J41 A;  3CSH A;  2VD1 A;  1XWK A;  4POK A;  2K9F A;  3IC4 A;  1GUL A;  3CSI A;  1SK0 A;  1EEM A;  2WCI A;  3MNG A;  3GKX A;  4H86 A;  3FK8 A;  4K7N A;  4Z2U A;  1SYR A;  1C72 A;  4USS A;  4MAB A;  3HMJ G;  4TR4 A;  2HSN B;  2OA7 A;  5DCG A;  4MA9 A;  3D21 A;  1PSQ A;  5DJM A;  2REM A;  1PN0 A;  2VM1 A;  4F03 A;  1DE1 A;  3CBU A;  3VK9 A;  2OBI A;  1M99 A;  3P8W A;  2LNT A;  4CY6 A;  4X0X A;  4ZB8 A;  3GTU B;  2F51 A;  4V2M A;  3HDC A;  4PUR A;  1A0F A;  4JED A;  2I4A A;  2V2G A;  1F3B A;  2DIZ A;  2OAC A;  18GS A;  3TRP A;  4TW5 A;  4MPG A;  2MBS A;  1ZGN A;  3VWW A;  4O5R A;  1PKW A;  2X64 A;  5CRW A;  2EC4 A;  2I3Y A;  4KND A;  1YZX A;  3F4S A;  3LG6 A;  2V6K A;  1I9D A;  4KSM A;  1XZO A;  3V1W A;  4IVF A;  3F4T A;  3UMA A;  2AJQ B;  2KLX A;  3ZIT A;  1SEN A;  1BYE A;  4G10 A;  1A2M A;  5G5F A;  1SU9 A;  5CYY A;  1OC9 A;  5IMF A;  2WGR A;  4TXV A;  5E59 A;  4GWR A;  2HI7 A;  4OFT A;  2R5G A;  2L4Q A;  5DAK A;  1R5A A;  4RQR A;  2K18 A;  2WJU A;  2NDO A;  6GSY A;  4F0B A;  4NV5 A;  1YF1 A;  6GST A;  2HZE A;  3ZIV A;  4ECI A;  2VL2 A;  1R26 A;  1N2A A;  3LSZ A;  5COH A;  6GSV A;  1AQX A;  2HSH A;  3H8Q A;  1GTB A;  4HSC X;  1EV4 A;  1XOA A;  2X49 A;  2L4C A;  3VUR A;  5IPH A;  3GKM A;  1K0A A;  2VLV A;  2VCT A;  4HDE A;  2B1L A;  5HQP A;  2YWM A;  1SJZ A;  1BED A;  3CWG A;  4AKH A;  1BQ7 A;  2FA8 A;  2XHF A;  4FIW A;  4CDO A;  1TK8 B;  2G0F A;  1FOV A;  4ZBD A;  2H1D A;  1ABA A;  2PN8 A;  1U3A A;  4X1U A;  3CHX C;  2HRK B;  5BRT A;  1PKZ A;  1VF3 A;  3E0U A;  2CAQ A;  4F0C A;  3TJJ A;  3D22 A;  3C1R A;  4D73 A;  5JWR B;  5A4W A;  1GUK A;  2WDU A;  2BJX A;  1BX9 A;  1A23 A;  5HR3 A;  2DJ2 A;  4ICY A;  4IGJ A;  3F6F A;  2K6V A;  2QGV A;  2B1K A;  1FOH A;  5ECP B;  2DKI A;  3ZL5 A;  2YZU A;  2LS5 A;  4IQA A;  3VWU A;  3A5W A;  3EVI A;  3FR9 A;  2EIO A;  3UAR A;  4KF9 A;  3APQ A;  3ZTL A;  2A2P A;  3D0Z A;  4IP6 A;  3RHC A;  4HOJ A;  3GMF A;  2O85 A;  1FAA A;  2XPE A;  5G31 A;  4TRX A;  1VF2 A;  2EFH A;  2LUS A;  2FUG 2;  2WRT A;  4X43 A;  5AIV A;  1HNA A;  2C0E A;  5LCZ A;  2QSI A;  3TKS C;  4PI2 C;  2O5V A;  4NAX A;  3IBH A;  2KP2 A;  1JZR A;  1F37 A;  2GGT A;  3KH9 A;  1SVO A;  3KMO A;  3CTG A;  4WR5 A;  3IK7 A;  3HXS A;  3D4T A;  1F3A A;  4N11 A;  3A5I A;  2PBJ A;  4FYB A;  4YQV A;  5AN1 A;  1EGR A;  4BIK A;  3KMN A;  5CO3 A;  5J9C A;  3TJB A;  2DJ0 A;  5DAL B;  1XWG A;  1OKD A;  1XVQ A;  5J40 A;  2WS2 A;  5IMC A;  4MF5 A;  3ZIJ A;  3Q19 A;  2NPB A;  1O8W A;  2DBC A;  5J3R A;  2X8H A;  5INY A;  3QAG A;  6GSS A;  3BBY A;  1MDK A;  2EIQ A;  1G0T A;  4WKW A;  1O6J A;  3EE2 A;  3PR8 A;  5FT3 A;  2DSA A;  4HQZ A;  4ECC A;  1KBN A;  2O89 A;  4WEY A;  4ZXG A;  3BCK A;  4DSR A;  5IIZ A;  1JZD A;  2LV3 A;  4OCF A;  5F0G A;  5KOW A;  3RAZ A;  1XIY A;  4E8H A;  5J4V A;  1AUC A;  1THO A;  2MBT A;  1M2B A;  2WVY A;  4DSQ A;  2WVX A;  5A1N B;  3N5O A;  2WW2 A;  1XVW A;  2H70 A;  5C04 A;  3AY8 A;  4HZ4 A;  1S3C A;  1CQG A;  1VF4 A;  1G6W A;  3QR6 A;  3CYN A;  2N5B A;  3M9J A;  2HXK A;  3CXG A;  1FHE A;  3VI5 A;  1Z6N A;  1IYI A;  4EUY A;  1E6B A;  2GQK A;  1M2D A;  3M9K A;  4QL7 A;  1Z7R A;  1O8X A;  2I81 A;  1PL1 A;  4PHZ C;  3KTB A;  1SL2 B;  3TU3 B;  2HSM B;  2LRT A;  3SBC A;  1Y1U A;  2WZ9 A;  1DE2 A;  1NW2 A;  1JZW A;  1FG4 A;  2I9H A;  3PPU A;  3I6A A;  2YWN A;  2PPT A;  5J5N A;  1H4O A;  4MK3 A;  1FVK A;  2MYG A;  3HVX A;  3DVX A;  3VLN A;  5A4V A;  3HKR A;  5DDL A;  2HFD A;  2H1L A;  3ZML A;  2FWG A;  2R6K A;  2AB6 A;  4ML1 A;  3LOR A;  2RM5 A;  3KP9 A;  3KH7 A;  3D4M A;  4GTU A;  3H4K A;  1TK5 B;  5GZZ B;  3KP8 A;  3TKS A;  3L0H A;  2ZNM A;  3NOF A;  1MD3 A;  1JLV A;  4EE0 A;  1F2E A;  3LQ7 A;  4KDX A;  2B5X A;  4AJ6 A;  2PGT A;  2AV4 A;  2XBQ A;  4I5Q A;  4POB A;  2MMA A;  1PA3 A;  3P7X A;  5BMU B;  3FZ4 A;  2R0G A;  4AKX B;  3ERG A;  5D8I A;  4K1F A;  1Z5Y E;  1QGV A;  4G0K A;  2QA1 A;  4XS4 A;  4PI0 C;  4PQ1 A;  3H79 A;  2LQQ A;  1ERV A;  2DJ1 A;  3WT1 A;  2LRN A;  4G9H A;  2BTO T;  5CRG A;  2QA2 A;  5A5H B;  4FYU A;  2GTU A;  2VKZ G;  5D96 A;  2H76 A;  1V9W A;  3UIW A;  5A34 B;  3P2A A;  10GS A;  2HNL A;  2H1G A;  2JZR A;  4KDY A;  3DXB A;  1A0R P;  2LNS A;  1RK4 A;  2R3X A;  2YAN A;  4ZB6 A;  4LLR A;  1HQO A;  4O5U A;  5HFK A;  4L0U A;  4EIQ A;  4EDZ A;  2GS3 A;  2LST A;  2OAD A;  4ISD A;  4JU5 A;  1PL2 A;  1ZMA A;  1V2A A;  2YOI A;  3L9U A;  3FY7 A;  4FXY P;  3IA1 A;  2AHE A;  5IMD A;  5GAN D;  4V2L A;  4JE1 A;  4BL7 A;  1U3I A;  3CSJ A;  2FWE A;  4OFN A;  2CVK A;  4KDU A;  2P31 A;  6GSX A;  1GSF A;  4MJE A;  4A5P A;  1I1I P;  2MMZ A;  1EP8 A;  4FO5 A;  2B5E A;  3BOA A;  2IFQ A;  2UZ8 A;  4OFM A;  1EZK A;  1GSS A;  3TKP A;  3C71 A;  4ZBB A;  1FB6 A;  3P90 A;  4JBB A;  1YEW C;  3TOU A;  7GSS A;  1V98 A;  3ISO A;  3GN3 A;  3DVW A;  1ILO A;  4TN8 A;  1R5P A;  3C7M A;  2IL3 A;  1YKC A;  5GAP D;  2H8L A;  4ZL9 A;  2J9H A;  4K2D A;  2A2R A;  4V2N A;  3EMP A;  4HI7 A;  2NBS A;  3FKF A;  3IDV A;  3DD3 A;  3KD0 A;  4HS1 A;  2V6O A;  1SKS B;  3A2X A;  3N9J A;  3C1S A;  2WW0 A;  4OWY A;  4WXT A;  1S3R A;  2CA8 A;  3I9V 2;  3DGQ A;  5IOW A;  5HR0 A;  3GSS A;  4KH7 A;  4Q5R A;  4IHU A;  2ALB A;  3GST A;  3UBK A;  1SJI A;  4L5L A;  4I2U A;  2AUV A;  2LKU A;  2RM6 A;  2DJJ A;  1GUH A;  4NHW A;  2YNX A;  5EPF A;  2F3M A;  4NHZ A;  2X8C A;  4CY8 A;  4ZB7 A;  1TU7 A;  3WGD A;  5B8B A;  2H71 A;  5IO2 A;  4FYC A;  1VGL A;  4MJA A;  3DEX A;  2WW1 A;  2VLT A;  1ZCP A;  2FNO A;  1JFU A;  3J7Y k;  1EOH A;  3HCZ A;  3GUR A;  5ECQ B;  2PUK C;  2MMO A;  2C3N A;  3TJG A;  1K0D A;  1OVN A;  1B4P A;  2P5R A;  3Q6O A;  3KJY A;  3A2W A;  5ECS A;  1NHY A;  3IHQ A;  2CQ9 A;  2M72 A;  2O3E A;  1ZYE A;  4NMU A;  4ECB A;  1GSE A;  4KCA A;  4ZIL A;  3VFI A;  1N25 A;  4MZW A;  4RI6 A;  2VCV A;  1BAY A;  2ON5 A;  2O87 A;  4OMV A;  4FQU A;  5CRE A;  2GLR A;  3U6V A;  5DCH A;  2IPA A;  3US3 A;  4POL A;  3RPN A;  5AIX A;  5ID2 B;  4WF4 A;  3D5J A;  1Q98 A;  3D6I A;  4I6X A;  3KCM A;  4K8M A;  3BD2 A;  1DBY A;  1GUM A;  4NXI A;  1LJR A;  4XIH A;  3CTF A;  1T8E B;  4KX4 A;  1IYH A;  4JZQ A;  3H93 A;  2K8S A;  1B4Q A;  3CQF A;  13GS A;  1X9W B;  1B48 A;  5DJL A;  1GP1 A;  2GDR A;  1HD2 A;  2GZP A;  2WUL A;  1MDJ A;  3RBT A;  2NTO A;  5G1K A;  4EDY A;  2ZUP A;  4MZC A;  2AYT A;  4ULX A;  2A4H A;  1HNB A;  1MEK A;  2AAW A;  4W66 A;  1EWX A;  2IIY A;  3HJM A;  2VL9 A;  16GS A;  1R4W A;  1ERU A;  3TUE A; 
#chains in the Genus database with same CATH homology
 3GYK A;  1SKR B;  2L57 A;  3A3T A;  3CRU A;  4K9Z A;  1U6T A;  3QDN A;  5IOX A;  2GSS A;  1GWC A;  5HR2 A;  2H1B A;  1KEB A;  1TK0 B;  4MP4 A;  1OKT A;  4AKG A;  1T1V A;  3IV4 A;  2JU5 A;  1Z3E A;  3ME8 A;  2N5F A;  2FY6 A;  4IQ1 A;  1TKD B;  1O81 A;  2LEG A;  3M1G A;  1YEP A;  2VD0 A;  2LJK A;  4WF5 A;  2VUP A;  1XW9 A;  1GSU A;  2HRK A;  2GSQ A;  4LL1 B;  2EFC A;  4GDF A;  1K0N A;  1YY7 A;  1A8Y A;  1WRY A;  2VL3 A;  3GHA A;  1CQH A;  2F8F A;  4E8E A;  3ZFB A;  2H75 A;  5J47 A;  4N0V A;  4TOP A;  1AQW A;  3KIJ A;  2RUF A;  1XOB A;  4CW9 A;  1ON4 A;  2FA4 A;  4K0N A;  1GTI A;  2JAC A;  3E3E A;  3J7Y b;  4F9Z A;  2A2S A;  4PGT A;  2X8G A;  3MWH A;  1YQ1 A;  1QQ2 A;  1XBS A;  2OE0 A;  5ELG A;  4WBJ A;  4TR0 A;  5F8B A;  2PVQ A;  2QC7 A;  1SVL A;  4E68 A;  4RQX A;  2FCH A;  4G0L A;  1QMV A;  2C1Y A;  2H66 A;  4EF0 A;  4YKG A;  1ML6 A;  2M80 A;  1XW6 A;  3F9U A;  1WPI A;  1PRX A;  2RUE A;  2IMI A;  1ERW A;  4BWS A;  4XS1 A;  3GA4 A;  1SKW B;  5AIS A;  2PU9 C;  2CX3 A;  2J23 A;  1AQV A;  3ZMK A;  2D2Z A;  1FO5 A;  4KB3 A;  3TRQ A;  1TU8 A;  3MDK A;  3PGT A;  4PNG A;  1B9Y C;  4TXO B;  1V40 A;  4QL9 A;  3KTL A;  4I8B A;  2L5L A;  2LJA A;  2C3Q A;  4X4J A;  3U5R E;  3CMI A;  3TRX A;  3FR6 A;  3GFK A;  1Z9H A;  1OC8 A;  2YV9 A;  1TRS A;  3EC3 A;  4BPY A;  1TRU A;  3ZZX A;  3TDG A;  3ZRD A;  1W4V A;  4J2F A;  3VPT A;  1XWB A;  4N0Z A;  1V57 A;  1T4Z A;  4OO4 A;  2HYX A;  1PX6 A;  5D73 A;  1AAZ A;  4MF7 A;  4YH2 A;  1TXX A;  11GS A;  1GSD A;  4EC0 A;  3MAK A;  1B9X C;  4LMV A;  2YWI A;  1WMJ A;  2H30 A;  5A1N A;  5IMV A;  3WGE A;  2WB9 A;  4AF2 A;  3VPQ A;  2Z9S A;  4G2E A;  1SK1 A;  4HU7 A;  3IOS A;  4KUN A;  3E9J B;  4XHM A;  3ERW A;  5DQY A;  2HSY A;  2B7J A;  3LXZ A;  4ILF A;  3TKR A;  5DVB A;  2YV7 A;  1XCC A;  1K0O A;  1NM3 A;  4G0I A;  1XWC A;  2VIM A;  4DEJ A;  3HVV A;  2BMX A;  5B8A A;  1QXH A;  3HHV A;  4IBP A;  1GNW A;  2HSM A;  1ACV A;  2EFE A;  5ECM B;  3QOU A;  3FHK A;  4V1A p;  1XPV A;  3G9B A;  3EIN A;  3FMW A;  4BVX A;  2VM2 A;  4GQC A;  3QPM A;  2H1A A;  2YZH A;  3TKS E;  2ON7 A;  2GST A;  1PD2 1;  2HQT A;  1O85 A;  3EWL A;  5IO0 A;  3TJF A;  5ECK B;  2H0G A;  3QAV A;  1T7P B;  5LD0 A;  5IQY A;  2JZS A;  4J57 E;  2OT3 A;  1XXU A;  4RI7 A;  2KUC A;  3GRX A;  2YCD A;  2PER A;  5ECR B;  3UVH A;  1HYU A;  3O6T A;  5HFG A;  5JCU A;  4PNF A;  3ZVJ A;  3TKQ A;  1A2J A;  3FZA A;  3H1N A;  5BMU A;  5KN1 A;  2KOK A;  1T00 A;  4MNN A;  2DML A;  1Y25 A;  2C3T A;  2FWF A;  4TR1 A;  1FB0 A;  1GTA A;  2X4A A;  2B5Y A;  2R0P A;  3APO A;  2HT9 A;  3NZN A;  4HJM A;  1YKA A;  5ECL B;  1Q4J A;  2L6D A;  2KP1 A;  1TDI A;  2I1U A;  4NPB A;  5A5H A;  3HZ4 A;  2M46 A;  1TXU A;  1TTZ A;  1A8L A;  5ABR A;  4J56 E;  1YJ6 A;  3W8S A;  4KGI A;  4F82 A;  5IM9 A;  3L9V A;  2VAF A;  1K0M A;  2C0G A;  5A34 A;  1XWA A;  4GRF A;  3R2Q A;  5F05 A;  5KN2 A;  4YAP A;  1GL8 A;  3HY2 A;  4O7H A;  1U87 A;  3F3R A;  2L6C A;  4DVC A;  4BL7 B;  3M3M A;  1QK8 A;  1PGT A;  2DMM A;  5IMZ A;  3A2V A;  4ZL7 A;  3L4N A;  2C0F A;  4ZL8 A;  2MMN A;  1K3Y A;  2FD3 A;  4XTS A;  1TW9 A;  1EP7 A;  1W89 A;  1GSY A;  3UEM A;  2OKA A;  4OD7 A;  1M9A A;  4ZBA A;  4BVY A;  2TRC P;  3EU4 A;  4IP1 A;  4LL4 B;  4PUF C;  4HU9 A;  2H19 A;  4GQF A;  4DSS B;  3TJK A;  5EY6 A;  2FHE A;  1SVM A;  2G2Q A;  3VWV A;  1EGO A;  2CAI A;  4K7I A;  4K0G A;  4PUA A;  4L5O A;  4P3Y B;  1A2L A;  3IK9 A;  4AGS A;  4N10 A;  3R3E A;  1O7U A;  5DBQ A;  3UOM A;  8GSS A;  3UVT A;  5E4W A;  4L8E A;  4EKZ A;  1ZOF A;  2YPM A;  1Z7P A;  1SL0 B;  2H6X A;  1HNC A;  2B3S A;  4JR6 A;  4ZIJ A;  1GLP A;  5F06 A;  1RW1 A;  1K3L A;  1VRS D;  4WR4 A;  1EOG A;  3HJP A;  3S9F A;  2HRF A;  1M7T A;  1EEJ A;  4ACS A;  5J4U A;  4ML6 A;  4HZ2 A;  5L71 A;  3K8N A;  1WJK A;  2VCQ A;  4EVM A;  1RQM A;  2MZC A;  1OC3 A;  5KOX A;  3I43 A;  3HZ8 A;  2JSY A;  3HYP A;  3KM6 A;  4POM A;  3RDW A;  4JR4 A;  4KSO A;  2XC2 A;  2X99 A;  4XCS A;  5H5R A;  3EYT A;  1ZYQ B;  1MTC A;  1ZZY A;  3FZ5 A;  5ELA A;  2H0H A;  5B6N A;  3LJR A;  4YQM A;  22GS A;  1KNG A;  1SD9 A;  2E2M A;  2GVP A;  2V32 A;  2B7K A;  2VLU A;  3GUS A;  1UVZ A;  4GSS A;  2C0D A;  5G5E A;  3QD9 A;  3MSZ A;  3ZRE A;  2JSZ A;  3QMX A;  2GSR A;  14GS A;  1TOF A;  3GIX A;  1K3O A;  2HSN A;  6GSU A;  1X9S B;  3UBL A;  2GQM A;  1T4Y A;  4Z2T A;  5J4Y A;  1OAZ A;  2LTK A;  3HA9 A;  2H73 A;  3WGX A;  3LFL A;  1K0B A;  5KN0 A;  4GF0 A;  3IC8 A;  9GSS A;  3APS A;  2R0C A;  3TOT A;  3GTU A;  3L78 A;  2H6Z A;  3RPP A;  2HRN A;  5CRH A;  3HD5 A;  1OC9 B;  2IMF A;  5DAK B;  1R7H A;  3CRT A;  3GL3 A;  2VCX A;  1QUW A;  4GSN A;  2DJK A;  3FW2 A;  4YKF A;  4O5Q A;  2JAD A;  2YWO A;  4GXZ A;  1GLQ A;  3OR5 A;  2F8A A;  2JL4 A;  2HZE B;  3LW9 A;  1G6Y A;  1OYJ A;  4I2T A;  3VWX A;  2OE3 A;  4KW6 A;  5C00 A;  3F8U A;  3F6D A;  4EO3 A;  1ZL9 A;  1NSW A;  1WP0 A;  3PIN A;  5ID2 A;  1GH2 A;  2ES7 A;  5EL8 A;  4YQU A;  2IJY A;  4QMK A;  2OBK A;  2WFC A;  3DKS A;  2O7K A;  1BJX A;  4AJ8 A;  3QFB C;  3LYP A;  1THX A;  2GT6 A;  2JZT A;  3DML A;  4MF6 A;  3GH9 A;  4D73 B;  4Z2R A;  2FLS A;  1JHB A;  4OO5 A;  3UJ1 A;  2L5O A;  4MMM A;  5B7C A;  5ECN B;  2GT5 A;  5JCW A;  3MIX A;  3GH6 A;  5CRD A;  2H74 A;  3HVS A;  5D93 A;  4PQH A;  2FGX A;  4TR3 A;  4CHS A;  4PTS A;  2PVO C;  5EVO A;  3KEB A;  3ED3 A;  4XRA A;  2P0G A;  1MD4 A;  1X0R A;  5ECI B;  1XW5 A;  1DUG A;  2K8V A;  1I5G A;  3GKK A;  1B8X A;  1EV9 A;  5CNW A;  4ZB9 A;  5ENU A;  1MDI A;  4F2I A;  3QFA C;  3BJ5 A;  1E2Y A;  3EU3 A;  3IPZ A;  4TKY A;  2HRA A;  2CX4 A;  2CZ3 A;  2H6Y A;  4GCI A;  4AJ7 A;  3GV1 A;  1XFL A;  1TJD A;  2V1M A;  4I97 A;  1GSQ A;  5AGY A;  3BCI A;  1NHO A;  1A24 A;  1JZO A;  3QCP A;  1GNE A;  3G7I A;  5A4U A;  5H5Q A;  1DSB A;  1Y6E A;  5A5K A;  4PX1 A;  4EIP A;  5LNK e;  1M0U A;  3ME7 A;  1ST9 A;  2CVD A;  1OE8 A;  4JRR A;  4WBR D;  5H5S A;  2VCZ A;  4Q5N A;  4XS6 A;  2KHP A;  1LU4 A;  5FHI A;  4MCU A;  5IMA A;  1YDK A;  4MLY A;  3TCO A;  4K5R A;  3F63 A;  3DYR A;  1X5C A;  3IHG A;  1UA5 A;  3EMX A;  4MH3 A;  5HR1 A;  2C80 A;  1FVJ A;  4LMW A;  5CAX A;  3O76 A;  3F4R A;  2CZ2 A;  3KGK A;  3LWA A;  1AXD A;  2TRX A;  1JLW A;  3QAW A;  12GS A;  3FYG A;  3FZ9 A;  5DAL A;  3UAP A;  2TIR A;  4IW9 A;  5J9B A;  2HLS A;  4HJ2 A;  3WYW A;  4Q5F A;  1G7O A;  6GSW A;  3IE3 A;  5ECO B;  1O73 A;  2YP6 A;  3GL5 A;  4YAV A;  3L9S A;  3W6G A;  1KTE A;  5G2Z A;  2N5A A;  2OJL A;  3M0F A;  2DIY A;  2R4V A;  2R2J A;  2FWH A;  5FWG A;  2PMT A;  3WT2 A;  3KXO A;  1G7E A;  4O92 A;  3FRC A;  2RII A;  4TXO A;  3GNJ A;  4MJC A;  3M8N A;  1VF1 A;  2H72 A;  2EIR A;  1BF5 A;  4OCE A;  3ZVJ D;  1AIU A;  2HE3 A;  4K7O A;  1SJ6 A;  2EFD A;  2IMK A;  4V1A g;  3VI7 A;  3DIE A;  5CP1 A;  5KN3 A;  4WET A;  4IS0 A;  2C8U A;  2DKH A;  4G01 A;  2HZF A;  1WE0 A;  3DWV A;  5F07 A;  3FR3 A;  1J0F A;  1K0C A;  4KA0 A;  2QKE A;  3WD6 A;  1TI1 A;  1UC7 A;  1TRV A;  3G7Y A;  3F0I A;  5IPG A;  1PN9 A;  1F6M C;  4K5S A;  2VO4 A;  4BVX B;  2LQO A;  4QQ7 A;  5D9V A;  4MJB A;  1S3A A;  4ID0 A;  2NVL A;  3RHB A;  4GLT A;  4NWY A;  3Q74 A;  4KE3 A;  2O8V B;  3ZYW A;  5JWO B;  2E0Q A;  4XS4 B;  4Q5Q A;  3IAS 2;  1ZYP A;  1X5D A;  2CV4 A;  3MYD A;  1BG5 A;  1SYX A;  1LBK A;  4EL1 A;  2OE1 A;  4IN0 A;  3O3T A;  5GSS A;  4IEL A;  1V58 A;  2A4V A;  1AW9 A;  4MZB A;  4K2X A;  2CVB A;  4BA7 A;  4N3Z A;  17GS A;  1OE7 A;  5ECH B;  4TR1 B;  3TGZ A;  1UN2 A;  4AKI A;  5KEJ A;  2YJ7 A;  1F9M A;  4BWQ A;  1YF0 A;  1ZYN A;  1M9B A;  2XBI A;  4EXJ A;  4Z7X A;  5D9W A;  3G7J A;  3PH9 A;  2P5Q A;  1SK2 A;  2H01 A;  2GZZ A;  3LXT A;  2H0I A;  2IMD A;  4K6X A;  3DRN A;  1WWJ A;  1USB A;  2LRC A;  3IAM 2;  1PX7 A;  3ERF A;  4LA1 A;  1YVL A;  2ZCT A;  2R37 A;  1M2A A;  2LJR A;  3I69 A;  4AI6 A;  1H75 A;  4NV2 A;  2IWT A;  4FH8 A;  3ZFL A;  2VCW A;  1WOU A;  3IR4 A;  4GST A;  3KZQ A;  3SWL A;  4PXO A;  3F3Q A;  1TRW A;  1S3D A;  1U88 A;  1X5E A;  3EPT A;  2E7P A;  4BVY B;  1T3B A;  4XRD A;  5B6M A;  1TP9 A;  2IN3 A;  4KAE A;  2DJ3 A;  2IFQ B;  2IME A;  1AC1 A;  1X9M B;  3LGC A;  3JCM L;  2DC5 A;  4IJI A;  2L59 A;  4HUA A;  4IJ3 A;  1SD8 A;  5D9T A;  1URM A;  4MDC A;  1FW1 A;  2E2G A;  2B6M A;  1Z6M A;  3UL3 A;  3HJO A;  1J9B A;  5JCG A;  2RLI A;  3GKN A;  1PMT A;  4MPF A;  3W8J A;  2YJH A;  5G1L A;  1SL1 B;  5DQS A;  19GS A;  3IXR A;  1WIK A;  3GX8 A;  4MH2 A;  2V41 A;  5JWQ B;  4N30 A;  3C73 A;  4G19 A;  1QFN A;  5D9X A;  4O32 A;  4HEA 2;  3GX0 A;  2CT6 A;  2F9S A;  2VL2 C;  4DSS A;  1N8J A;  1GRX A;  1J08 A;  2GZY A;  2GQL A;  4RUV A;  4L0W A;  1PQN A;  1YEX A;  4PQI A;  2XPD A;  5GST A;  3Q18 A;  4KCE A;  4IKH A;  4HQS A;  3IRA A;  2DLX A;  20GS A;  1ERT A;  3LYK A;  2UV8 G;  3EUR A;  3LEF A;  1TI3 A;  2YN1 A;  1GTU A;  3ZLP A;  2C4J A;  2PWJ A;  3FEU A;  5G30 A;  3NIV A;  5HFI A;  3C8E A;  4TVE A;  2VOC A;  3TB2 A;  4ECJ A;  1BG1 A;  5J41 A;  3CSH A;  2VD1 A;  1XWK A;  4POK A;  2K9F A;  3IC4 A;  1GUL A;  3CSI A;  1SK0 A;  1EEM A;  2WCI A;  3MNG A;  3GKX A;  4H86 A;  3FK8 A;  4K7N A;  4Z2U A;  1SYR A;  1C72 A;  4USS A;  4MAB A;  3HMJ G;  4TR4 A;  2HSN B;  2OA7 A;  5DCG A;  4MA9 A;  3D21 A;  1PSQ A;  5DJM A;  2REM A;  1PN0 A;  2VM1 A;  4F03 A;  1DE1 A;  3CBU A;  3VK9 A;  2OBI A;  1M99 A;  3P8W A;  2LNT A;  4CY6 A;  4X0X A;  4ZB8 A;  3GTU B;  2F51 A;  4V2M A;  3HDC A;  4PUR A;  1A0F A;  4JED A;  2I4A A;  2V2G A;  1F3B A;  2DIZ A;  2OAC A;  18GS A;  3TRP A;  4TW5 A;  4MPG A;  2MBS A;  1ZGN A;  3VWW A;  4O5R A;  1PKW A;  2X64 A;  5CRW A;  2EC4 A;  2I3Y A;  4KND A;  1YZX A;  3F4S A;  3LG6 A;  2V6K A;  1I9D A;  4KSM A;  1XZO A;  3V1W A;  4IVF A;  3F4T A;  3UMA A;  2AJQ B;  2KLX A;  3ZIT A;  1SEN A;  1BYE A;  4G10 A;  1A2M A;  5G5F A;  1SU9 A;  5CYY A;  1OC9 A;  5IMF A;  2WGR A;  4TXV A;  5E59 A;  4GWR A;  2HI7 A;  4OFT A;  2R5G A;  2L4Q A;  5DAK A;  1R5A A;  4RQR A;  2K18 A;  2WJU A;  2NDO A;  6GSY A;  4F0B A;  4NV5 A;  1YF1 A;  6GST A;  2HZE A;  3ZIV A;  4ECI A;  2VL2 A;  1R26 A;  1N2A A;  3LSZ A;  5COH A;  6GSV A;  1AQX A;  2HSH A;  3H8Q A;  1GTB A;  1EV4 A;  1XOA A;  2X49 A;  2L4C A;  3VUR A;  5IPH A;  3GKM A;  1K0A A;  2VLV A;  2VCT A;  4HDE A;  2B1L A;  5HQP A;  2YWM A;  1SJZ A;  1BED A;  3CWG A;  4AKH A;  1BQ7 A;  2FA8 A;  2XHF A;  4FIW A;  4CDO A;  1TK8 B;  2G0F A;  1FOV A;  4ZBD A;  2H1D A;  1ABA A;  2PN8 A;  1U3A A;  4X1U A;  2HRK B;  5BRT A;  1PKZ A;  1VF3 A;  3E0U A;  2CAQ A;  4F0C A;  3TJJ A;  3D22 A;  3C1R A;  4D73 A;  5JWR B;  5A4W A;  1GUK A;  2WDU A;  2BJX A;  1BX9 A;  1A23 A;  5HR3 A;  2DJ2 A;  4ICY A;  4IGJ A;  3F6F A;  2K6V A;  2QGV A;  2B1K A;  1FOH A;  5ECP B;  2DKI A;  3ZL5 A;  2YZU A;  2LS5 A;  4IQA A;  3VWU A;  3A5W A;  3EVI A;  3FR9 A;  2EIO A;  3UAR A;  4KF9 A;  3APQ A;  3ZTL A;  2A2P A;  3D0Z A;  4IP6 A;  3RHC A;  4HOJ A;  3GMF A;  2O85 A;  1FAA A;  2XPE A;  5G31 A;  4TRX A;  1VF2 A;  2EFH A;  2LUS A;  2FUG 2;  2WRT A;  4X43 A;  5AIV A;  1HNA A;  2C0E A;  5LCZ A;  2QSI A;  3TKS C;  2O5V A;  4NAX A;  3IBH A;  2KP2 A;  1JZR A;  1F37 A;  2GGT A;  3KH9 A;  1SVO A;  3KMO A;  3CTG A;  4WR5 A;  3IK7 A;  3HXS A;  3D4T A;  1F3A A;  4N11 A;  3A5I A;  2PBJ A;  4FYB A;  4YQV A;  5AN1 A;  1EGR A;  3KMN A;  5CO3 A;  5J9C A;  3TJB A;  2DJ0 A;  5DAL B;  1XWG A;  1OKD A;  1XVQ A;  5J40 A;  2WS2 A;  5IMC A;  4MF5 A;  3ZIJ A;  3Q19 A;  2NPB A;  1O8W A;  2DBC A;  5J3R A;  2X8H A;  5INY A;  3QAG A;  6GSS A;  3BBY A;  1MDK A;  2EIQ A;  1G0T A;  4WKW A;  1O6J A;  3EE2 A;  3PR8 A;  5FT3 A;  2DSA A;  4HQZ A;  4ECC A;  1KBN A;  2O89 A;  4WEY A;  4ZXG A;  3BCK A;  4DSR A;  5IIZ A;  1JZD A;  2LV3 A;  4OCF A;  5F0G A;  5KOW A;  3RAZ A;  1XIY A;  4E8H A;  5J4V A;  1AUC A;  1THO A;  2MBT A;  1M2B A;  4DSQ A;  5A1N B;  3N5O A;  1XVW A;  2H70 A;  5C04 A;  3AY8 A;  4HZ4 A;  1S3C A;  1CQG A;  1VF4 A;  1G6W A;  3QR6 A;  3CYN A;  2N5B A;  3M9J A;  2HXK A;  3CXG A;  1FHE A;  3VI5 A;  1Z6N A;  1IYI A;  4EUY A;  1E6B A;  2GQK A;  1M2D A;  3M9K A;  4QL7 A;  1Z7R A;  1O8X A;  2I81 A;  1PL1 A;  3KTB A;  1SL2 B;  3TU3 B;  2HSM B;  2LRT A;  3SBC A;  1Y1U A;  2WZ9 A;  1DE2 A;  1NW2 A;  1JZW A;  1FG4 A;  2I9H A;  3PPU A;  3I6A A;  2YWN A;  2PPT A;  5J5N A;  1H4O A;  4MK3 A;  1FVK A;  2MYG A;  3HVX A;  3DVX A;  3VLN A;  5A4V A;  3HKR A;  5DDL A;  2HFD A;  2H1L A;  3ZML A;  2FWG A;  2R6K A;  2AB6 A;  4ML1 A;  3LOR A;  2RM5 A;  3KP9 A;  3KH7 A;  3D4M A;  4GTU A;  3H4K A;  1TK5 B;  5GZZ B;  3KP8 A;  3TKS A;  3L0H A;  2ZNM A;  3NOF A;  1MD3 A;  1JLV A;  4EE0 A;  1F2E A;  3LQ7 A;  4KDX A;  2B5X A;  4AJ6 A;  2PGT A;  2AV4 A;  2XBQ A;  4I5Q A;  4POB A;  2MMA A;  1PA3 A;  3P7X A;  5BMU B;  3FZ4 A;  2R0G A;  4AKX B;  3ERG A;  5D8I A;  4K1F A;  1Z5Y E;  1QGV A;  4G0K A;  2QA1 A;  4XS4 A;  4PQ1 A;  3H79 A;  2LQQ A;  1ERV A;  2DJ1 A;  3WT1 A;  2LRN A;  4G9H A;  2BTO T;  5CRG A;  2QA2 A;  5A5H B;  4FYU A;  2GTU A;  2VKZ G;  5D96 A;  2H76 A;  1V9W A;  3UIW A;  5A34 B;  3P2A A;  10GS A;  2HNL A;  2H1G A;  2JZR A;  4KDY A;  3DXB A;  1A0R P;  2LNS A;  1RK4 A;  2R3X A;  2YAN A;  4ZB6 A;  4LLR A;  1HQO A;  4O5U A;  5HFK A;  4L0U A;  4EIQ A;  4EDZ A;  2GS3 A;  2LST A;  2OAD A;  4ISD A;  4JU5 A;  1PL2 A;  1ZMA A;  1V2A A;  2YOI A;  3L9U A;  3FY7 A;  3IA1 A;  2AHE A;  5IMD A;  5GAN D;  4V2L A;  4JE1 A;  4BL7 A;  1U3I A;  3CSJ A;  2FWE A;  4OFN A;  2CVK A;  4KDU A;  2P31 A;  6GSX A;  1GSF A;  4MJE A;  4A5P A;  2MMZ A;  1EP8 A;  4FO5 A;  2B5E A;  3BOA A;  2IFQ A;  2UZ8 A;  4OFM A;  1EZK A;  1GSS A;  3TKP A;  3C71 A;  4ZBB A;  1FB6 A;  3P90 A;  4JBB A;  3TOU A;  7GSS A;  1V98 A;  3ISO A;  3GN3 A;  3DVW A;  1ILO A;  4TN8 A;  1R5P A;  3C7M A;  2IL3 A;  1YKC A;  5GAP D;  2H8L A;  4ZL9 A;  2J9H A;  4K2D A;  2A2R A;  4V2N A;  3EMP A;  4HI7 A;  2NBS A;  3FKF A;  3IDV A;  3DD3 A;  3KD0 A;  4HS1 A;  2V6O A;  1SKS B;  3A2X A;  3N9J A;  3C1S A;  4OWY A;  4WXT A;  2CA8 A;  3I9V 2;  3DGQ A;  5IOW A;  5HR0 A;  3GSS A;  4KH7 A;  4Q5R A;  4IHU A;  2ALB A;  3GST A;  3UBK A;  1SJI A;  4L5L A;  4I2U A;  2AUV A;  2LKU A;  2RM6 A;  2DJJ A;  1GUH A;  4NHW A;  2YNX A;  5EPF A;  2F3M A;  4NHZ A;  2X8C A;  4CY8 A;  4ZB7 A;  1TU7 A;  3WGD A;  5B8B A;  2H71 A;  5IO2 A;  4FYC A;  1VGL A;  4MJA A;  3DEX A;  2VLT A;  1ZCP A;  2FNO A;  1JFU A;  3J7Y k;  1EOH A;  3HCZ A;  3GUR A;  5ECQ B;  2PUK C;  2MMO A;  2C3N A;  3TJG A;  1K0D A;  1OVN A;  1B4P A;  2P5R A;  3Q6O A;  3KJY A;  3A2W A;  5ECS A;  1NHY A;  3IHQ A;  2CQ9 A;  2M72 A;  1ZYE A;  4NMU A;  4ECB A;  1GSE A;  4KCA A;  4ZIL A;  3VFI A;  1N25 A;  4MZW A;  4RI6 A;  2VCV A;  1BAY A;  2ON5 A;  2O87 A;  4OMV A;  4FQU A;  5CRE A;  2GLR A;  3U6V A;  5DCH A;  2IPA A;  3US3 A;  4POL A;  3RPN A;  5AIX A;  5ID2 B;  4WF4 A;  3D5J A;  1Q98 A;  3D6I A;  4I6X A;  3KCM A;  4K8M A;  3BD2 A;  1DBY A;  1GUM A;  4NXI A;  1LJR A;  4XIH A;  3CTF A;  1T8E B;  4KX4 A;  1IYH A;  4JZQ A;  2K8S A;  3H93 A;  1B4Q A;  13GS A;  1X9W B;  1B48 A;  5DJL A;  1GP1 A;  2GDR A;  1HD2 A;  2GZP A;  2WUL A;  1MDJ A;  3RBT A;  2NTO A;  5G1K A;  4EDY A;  2ZUP A;  4MZC A;  2AYT A;  4ULX A;  2A4H A;  1HNB A;  1MEK A;  2AAW A;  4W66 A;  1EWX A;  2IIY A;  3HJM A;  2VL9 A;  16GS A;  1R4W A;  1ERU A;  3TUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...