4G0KA

Glutathionyl-hydroquinone reductase, yqjg, of e.coli complexed with gs-menadione
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0kA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0kA01
4Q5RA 4EDZA 1U3IA 1ZL9A 4ID0A 4IS0A 1PD21 3WD6A 3GTUB 5AIVA 2CVDA 2WJUA 3IBHA 3EE2A 1K3LA 4IW9A 2VCTA 1LJRA 3G7IA 1HNBA 2VCVA 3HKRA 3I69A 3F63A 2PMTA 1PL2A 4YH2A 4IQ1A 4MK3A 4HI7A 4G19A 2HQTA 4KGIA 1F3BA 4O7HA 5A4VA 3P8WA 4O92A 3IE3A 3R2QA 3ERGA 3CSJA 3D0ZA 3NIVA 3PPUA 3LSZA 5A4WA 3TOTA 4KF9A 1UA5A 1PKZA 4KSMA 5DCGA 5DAKA 2VD0A 4PNFA 5KEJA 3LQ7A 4ECJA 3GSSA 1GNWA 1GSEA 10GSA 5JCUA 3Q18A 2CA8A 3VPTA 3LXTA 3M0FA 22GSA 1GNEA 1GULA 1KBNA 3KMNA 2HSMB 5A4UA 2CAQA 1VF3A 3F6DA 3VLNA 3PGTA 3GX0A 1Y6EA 3FR9A 1GLQA 1GUKA 2F8FA 4TOPA 5DDLA 3VK9A 4NAXA 2PERA 1JLVA 4BVYB 4HZ2A 5D9VA 2IMIA 4K0GA 2UZ8A 4I97A 2OADA 4G10A 2C80A 1AQVA 1USBA 14GSA 1Q4JA 1A0FA 1OYJA 4KX4A 1GTBA 4WR5A 4BVXA 3UBLA 1E6BA 5D73A 1VF4A 1DUGA 4ZXGA 5B7CA 1IYIA 3UBKA 5DJLA 1LBKA 1EEMA 1BG5A 1GSFA 2GSTA 1YY7A 2PGTA 1EV4A 1XWGA 3M3MA 1GTUA 5DALB 6GSWA 1ZGNA 2DC5A 4MZWA 4MDCA 1GSYA 1XW5A 5AN1A 1K3OA 3ZFBA 1GWCA 5ECLB 1IYHA 1BAYA 1TU7A 2WDUA 2WRTA 5ECHB 2VO4A 2VCZA 1GSDA 1VF1A 2HRAA 5ECKB 3ZFLA 1GUMA 4MP4A 4PGTA 2A2RA 1TDIA 1HQOA 4ECIA 3QAGA 5FWGA 3RBTA 5AISA 1FHEA 3G7JA 1PA3A 3ZMKA 1TU8A 3Q19A 1C72A 4OMVA 4YAPA 5D9WA 1BYEA 4IELA 5ELGA 4MF6A 1U87A 5ECOB 1GSQA 2CZ3A 3QAVA 5ECQB 4BL7B 4USSA 16GSA 3CSHA 6GSUA 5F07A 3BBYA 1GTAA 2YV7A 1OKTA 6GSVA 3VI7A 2HNLA 2WB9A 3VURA 1BX9A 5IQYA 4ACSA 3P90A 1PX6A 1PL1A 4E8HA 2FHEA 1YJ6A 6GSTA 4GF0A 3C8EA 4J2FA 4GLTA 5ECIB 4GCIA 3M8NA 2GLRA 1N2AA 1JLWA 2R4VA 4KAEA 1XWKA 5DQSA 1K0NA 4RI6A 5HFKA 3CRTA 3F6FA 1M99A 5F8BA 2HRKB 2CAIA 4DEJA 2GTUA 2GDRA 1JZRA 4L5OA 4YQMA 3LYPA 1GTIA 4PNGA 2ON5A 1YKCA 3TOUA 2NTOA 3ERFA 3GH6A 2D2ZA 4Q5NA 1G6WA 5J4UA 1K0OA 4PX1A 4ZBAA 3DD3A 1GSUA 5ECSA 4ZB8A 4KE3A 3GTUA 3UARA 2OACA 19GSA 4ZB9A 2PVQA 2J9HA 2WS2A 9GSSA 4EC0A 4GSTA 1U88A 3LG6A 4G0IA 3R3EA 1YQ1A 3I6AA 5EL8A 4F03A 1VF2A 2F3MA 3ISOA 4OFNA 2C3TA 2R5GA 4IKHA 4PURA 1ML6A 1K0CA 1RK4A 8GSSA 2OA7A 5AIXA 5DJMA 4AGSA 3H1NA 1G6YA 17GSA 3WYWA 12GSA 13GSA 3QR6A 1EOHA 1PGTA 3N5OA 3GUSA 4FQUA 4PQIA 5FHIA 5AGYA 1HNAA 5A5KA 3O76A 2V6KA 4ZBDA 4EE0A 4IBPA 3LYKA 1B4PA 1K0BA 2HSMA 2GSRA 1PN9A 5DAKB 20GSA 4QQ7A 4G0LA 3U6VA 3VWXA 4EDYA 1GUHA 3CRUA 6GSXA 2C4JA 4EXJA 4JZQA 4F0CA 1F2EA 1K3YA 1MD4A 3TGZA 4BVYA 1OE7A 1MD3A 4N0VA 4HOJA 1FW1A 3UVHA 1M0UA 2N5FA 4MPFA 2C3QA 4HJ2A 1G7OA 3FYGA 1AW9A 2C8UA 4JBBA 1M9AA 7GSSA 4ECCA 5FT3A 2GSSA 2JL4A 3CBUA 1PMTA 1B48A 2AB6A 4YAVA 4PQHA 4IJIA 4IGJA 2CZ2A 1GSSA 5D9XA 5ELAA 3KJYA 4F0BA 4YQVA 2R6KA 2HSNB 3L0HA 5DALA 2GSQA 4KH7A 5LCZA 3AY8A 4OFTA 1B8XA 1XW6A 4BVXB 1PKWA 2PBJA 18GSA 3QAWA 3Q74A 2X64A 3N9JA 3SWLA 5G5FA 3FR3A 11GSA 1PX7A 3LFLA 1EV9A 3MDKA 3KXOA 4L5LA 3HJOA 5G5EA 2IL3A 1M9BA 1OE8A 1R5AA 2R3XA 5LD0A 4OFMA 3DGQA 5EVOA 5F06A 4ECBA 4ZBBA 2YCDA 3FRCA 2LJRA 4NHWA 2VCWA 4Q5FA 4PXOA 5ECNB 4MF5A 1HNCA 1NHYA 4Q5QA 4YQUA 1K0MA 4HZ4A 5BMUA 1K0AA 3GSTA 4BL7A 3KTLA 5J41A 4LMWA 2YV9A 6GSSA 4LMVA 5EY6A 3PR8A 4IVFA 3LJRA 2DSAA 1AQWA 4RI7A 4PTSA 1GLPA 1K0DA 5F05A 2VCQA 3FY7A 3HJMA 2ON7A 3IK9A 1MTCA 4E8EA 4MF7A 2AAWA 4GSNA 3MAKA 4ZB6A 5F0GA 3O3TA 5ECMB 2VD1A 2VCXA 3KM6A 5J5NA 2FNOA 4WR4A 3M1GA 1AQXA 4G0KA 1F3AA 1YDKA 4NHZA 2A2SA 3GURA 3W8SA 2HRKA 4KDXA 6GSYA 4G9HA 4JEDA 3IK7A 1V40A 4MPGA 5GZZB 5ECPB 3VPQA 4IQAA 5D9TA 3IC8A 3IR4A 1Z9HA 4K0NA 4KDYA 3LXZA 4KDUA 5ECRB 5GSSA 4GSSA 2AHEA 4PUAA 4L8EA 1V2AA 2IMKA 3ZMLA 1TW9A 5GSTA 2C3NA 5JCWA 3UAPA 4CHSA 3EINA 3KMOA 1EOGA 1AXDA 3CSIA 3FR6A 3VI5A 4GTUA 4ISDA
chains in the Genus database with same CATH superfamily
3KD0A 3HMJG 2QA1A 1X5CA 1WMJA 2A2PA 3TKRA 4E68A 3GTUB 5AIVA 1S3DA 5CRDA 2CVDA 2WJUA 3IBHA 2JADA 2V1MA 3LGCA 2F51A 4IW9A 4N3ZA 2O7KA 2E2GA 1HNBA 3HKRA 2PMTA 4YH2A 4IQ1A 2NDOA 5HR0A 4HI7A 5B6NA 4G19A 2YWMA 3A5IA 2RUFA 3IE3A 1Q98A 5J4YA 2ALBA 3RFRC 5DBQA 3CSJA 3KH9A 3LSZA 5IOWA 1PKZA 5DCGA 2YN1A 2WVXB 1GSEA 2GZPA 3F4SA 2CA8A 1J0FA 2MMZA 4KA0A 5DQYA 22GSA 1GULA 5A4UA 1ERUA 3VLNA 2H0GA 5LNKe 3TJBA 3FR9A 1GLQA 2VL3A 3VWWA 2JU5A 3WGEA 2C0DA 4BA7A 2H1GA 3C1RA 2EIRA 1Q4JA 1A0FA 1W4VA 4WR5A 3UBLA 4NPBA 5D73A 2B5YA 2RLIA 4ZXGA 5B7CA 1IYIA 4TXOB 2YNXA 1YY7A 5G30A 3M3MA 3GKXA 2VM1A 4EIQA 1GSYA 4ZL7A 4RUVA 5AN1A 1Z6NA 1O6JA 3QPMA 5ECLB 4AKGA 1IYHA 4ZB7A 1EP8A 4HQZA 3GIXA 2WDUA 1RW1A 2JZTA 4KB3A 2O85A 4MJBA 1V98A 2VLUA 2VL2C 4OCFA 4LLRA 2LSTA 3HVXA 3HY2A 2VL2A 4MP4A 3J7Yb 3EVIA 4I5QA 3RBTA 4BWSA 3G7JA 1PA3A 4MCUA 2I1UA 1TU8A 3RPPA 2H6XA 2M46A 2RUEA 5D9WA 3TKPA 3UOMA 4MF6A 3F9UA 1NHOA 4L0UA 1GSQA 4XS1A 4GWRA 4AJ6A 3EMXA 5ECQB 4BL7B 2WCIA 3BOAA 3CSHA 3I43A 3OR5A 3BBYA 3TKSA 2YV7A 2FWFA 4RQRA 2L57A 4TR3A 2WB9A 2OE1A 2K8SA 5IQYA 5IM9A 4NXIA 1UVZA 1PL1A 2WW2A 4E8HA 1JHBA 1V9WA 2B5XA 3D6IA 1SJ6A 5ECIB 2H66A 1TI3A 3IV4A 3EU4A 2GLRA 1TKDB 1PN0A 3W8JA 3ZIVA 4RI6A 3A2XA 4GQCA 4JR6A 1M2AA 4K6XA 2R0GA 3FZ9A 2CAIA 4HUAA 4XS4B 1GTIA 1NW2A 2ON5A 3KH7A 5KN1A 4BWQA 2NTOA 2DJ0A 3KP9A 1O85A 5J4UA 2K18A 2R0PA 1OAZA 4ZBAA 5BRTA 1GSUA 3GTUA 3UARA 1O81A 2WS2A 2O3EA 2P5QA 2L59A 2VLVA 4EC0A 1U88A 3I6AA 4F03A 1VF2A 1T4YA 1FO5A 2C3TA 3HYPA 2AUVA 2I81A 3JCML 4K9ZA 4IKHA 4ZL9A 5AIXA 2HYXA 3GRXA 3WGDA 2LRTA 3HCZA 3QOUA 1G6YA 3WYWA 2DIYA 3QR6A 1EOHA 1PGTA 4N0ZA 2EIQA 5KN2A 3LW9A 3GA4A 4FQUA 4PQIA 1HD2A 1M7TA 5AGYA 2WVXA 2XBIA 2LJKA 4XTSA 1X0RA 4PI0C 2NVLA 5CP1A 4EE0A 4IBPA 3GKNA 1G0TA 3P7XA 5E4WA 2RIIA 4W66A 1PN9A 1TXXA 20GSA 3VWXA 2B6MA 4EDYA 1GUHA 2C4JA 3TGZA 1MD4A 1OE7A 4K5RA 4HOJA 1KNGA 3MWHA 4D73B 1QFNA 1M0UA 1M3IA 4K8MA 1BF5A 1XVQA 3NZNA 2G2QA 1SK0A 3F8UA 7GSSA 1XW9A 2IFQB 2EFHA 2QGVA 2JL4A 4YAVA 2GQLA 2JSYA 3ZREA 4WF4A 4EUYA 5G2ZA 4TXOA 5D9XA 4F0BA 1SKSB 2R6KA 4FH8A 4F82A 2GSQA 2H6YA 3F3RA 1E2YA 1J9BA 2B5EA 4TVEA 3N9JA 1TXUA 2QC7A 11GSA 3MDKA 4K7IA 1WP0A 4AJ7A 2R3XA 4DVCA 3TB2A 3CQFA 4WBJA 4ECBA 5F06A 4ZBBA 1SD8A 5IO0A 4K5SA 1NM3A 1A2LA 2I9HA 2PN8A 1URMA 2IPAA 2LJRA 4AJ8A 2H76A 2ES7A 3WGXA 2PUKC 3H93A 1QGVA 2O89A 2O5VA 1XOBA 3HHVA 1HNCA 3EMPA 3RHBA 4V1Ap 2H72A 3D5JA 5A1NB 1TTZA 2OE3A 3GSTA 4BL7A 2AYTA 3PR8A 1TOFA 1AQWA 1GLPA 4OD7A 4EIPA 1SENA 2F8AA 2VOCA 3D4TA 2KP1A 4NWYA 2H30A 5ECMB 1W89A 2LS5A 1SVLA 2OJLA 4WR4A 2L4QA 3QD9A 1YDKA 1ZYQB 2A2SA 3W8SA 3QDNA 4G9HA 1SK2A 1WE0A 4JEDA 1AIUA 4MPGA 3VPQA 4IQAA 1ON4A 4XS4A 2B1KA 1X9SB 3KCMA 4EO3A 3RHCA 3IC4A 4V2NA 4PUAA 2AHEA 2DLXA 4I2TA 1R5PA 2L5OA 2IMKA 3ZMLA 1VGLA 1SJZA 2XPEA 3E0UA 3FR6A 2LKUA 2OBKA 2Z9SA 1CQHA 4ISDA 3FZAA 1X9WB 5ENUA 4I6XA 1AC1A 4IS0A 4HQSA 1PD21 3WD6A 1TRVA 2IMDA 3APSA 4ZIJA 2M80A 2LRNA 1B9XC 4J56E 3EE2A 1F6MC 3Q6OA 3G7IA 2YWIA 2VCVA 3F63A 1PL2A 1Z3EA 4MZCA 4O7HA 3RDWA 5IMFA 3R2QA 2E7PA 2HSHA 3D0ZA 5GAPD 3NIVA 3TJJA 2L6DA 1BEDA 3TOTA 4KF9A 1CQGA 2DJ3A 5H5SA 4KSMA 3GL3A 2VD0A 4WEYA 4QL9A 3GSSA 1V57A 4O5UA 1N8JA 1QQ2A 3Q18A 1X9MB 4TXVA 2IIYA 3LXTA 4POLA 2CX4A 2V2GA 1ERTA 1T4ZA 3GX0A 1Y6EA 4ZL8A 3UEMA 3IDVA 3CWGA 1GUKA 2F8FA 3ERWA 3HJPA 4BVYB 2IFQA 5IO2A 4K0GA 1EWXA 3IRAA 4I97A 4G10A 2C80A 1AQVA 1USBA 14GSA 1H75A 1OYJA 2N5BA 3ZVJD 3FK8A 3BCKA 1SYXA 5DJLA 2PVOC 1EEMA 2GSTA 4H86A 2PGTA 4V2LA 1XWGA 2H19A 1YEWC 3G9BA 4G01A 2CV4A 3FZ4A 2DC5A 3CHXC 4MDCA 4OO4A 1Z7RA 3ZFBA 3PH9A 1GWCA 2VKZG 2HFDA 4QMKA 4OO5A 2X4AA 2K6VA 3ZRDA 3M9JA 3UL3A 2EC4A 1GP1A 1GUMA 2X8CA 3D4MA 2DJ1A 2L4CA 2CVKA 1A2JA 1XG8A 3ZLPA 1B4QA 2A2RA 5A1NA 3F4RA 2YZUA 2FD3A 5IMAA 5FWGA 4F9ZA 3W6GA 4G2EA 1BYEA 2VL9A 3GN3A 3C1SA 5ECOB 5IMCA 5CYYA 5BMUB 3QAVA 4MA9A 2FWEA 1OKTA 3ZZXA 1R4WA 6GSVA 1FOVA 2AJQB 2MZCA 5G1LA 5IOXA 4GF0A 3EYTA 2I3YA 4J2FA 4GLTA 4O5RA 2CVBA 2KUCA 4WETA 3EURA 4DSRA 1WRYA 4KAEA 5DQSA 1XWKA 2C0GA 4KCAA 5HFGA 1M2DA 2HRKB 3FEUA 1SL1B 3L78A 1JZRA 4L5OA 3ZL5A 4PNGA 1EZKA 4AI6A 3TOUA 2D2ZA 1G6WA 1ILOA 3DD3A 1PRXA 5ECSA 1SVMA 2FWHA 4ZB8A 4KE3A 2MBTA 2N5AA 4YKGA 2OACA 1OVNA 2TRCP 1S3CA 2PVQA 1A24A 4AKHA 2H0IA 5G1KA 4GSTA 1OKDA 4GRFA 3R3EA 4YKFA 8GSSA 1K0CA 1T7PB 1TK0B 2OA7A 5DJMA 2B1LA 4HDEA 1OC9B 4I8BA 4MH2A 12GSA 5KOWA 5J40A 1GL8A 3C73A 1B4PA 3TCOA 2OE0A 2HZFA 4QQ7A 4G0LA 2H73A 4HS1A 5CO3A 1QMVA 4XIHA 5D8IA 4EXJA 1F2EA 1K3YA 4BVYA 4N0VA 5CNWA 3BJ5A 1TK5B 4MH3A 1SL2B 5KN3A 1TJDA 3TKSC 1A8LA 1AW9A 3F4TA 2J23A 1XFLA 2A4HA 2QSIA 1M9AA 4IP1A 4ECCA 5FT3A 2GSSA 1Z6MA 3FZ5A 3CBUA 1U3AA 4PQHA 1GSSA 4GDFA 5INYA 2FY6A 1ZOFA 2HSNB 2MYGA 3L0HA 5LCZA 1THXA 2FA4A 3AY8A 4OFTA 1XW6A 4BVXB 1PKWA 18GSA 1SJIA 2H01A 4O32A 1XWCA 4XHMA 2X64A 3FR3A 2V32A 3LFLA 1EV9A 2LJAA 2WZ9A 3E3EA 2B7JA 1DBYA 2YJHA 4IP6A 4V1Ag 5B6MA 3TRPA 4JRRA 1ZCPA 5EVOA 4PUFC 4TKYA 1Y25A 4K2DA 5J47A 4NHWA 1T8EB 1XIYA 2YOIA 2O36A 4PXOA 5ECNB 4O5QA 5L71A 3DEXA 1NHYA 2IJYA 4Q5QA 1K0MA 5BMUA 1F9MA 5JWRB 2VLTA 1RQMA 2H70A 3DVXA 1SKRB 2DMLA 4LMVA 2O87A 4IVFA 3LJRA 4RI7A 1K0DA 4ULXA 3QFBC 4X43A 2AAWA 4GSNA 3FHKA 3APOA 2H0HA 2VD1A 1SYRA 3GYKA 5HR3A 5GAND 4NHZA 2HZEB 4CY8A 2HRKA 4KDXA 2H1AA 2I4AA 6GSYA 3L9SA 5GZZB 2GQKA 5D9TA 3SBCA 2HE3A 3DMLA 4ICYA 2ZNMA 1ZMAA 4KDUA 5GSSA 5KOXA 5J9BA 2GZYA 3H79A 2LEGA 3DYRA 2C3NA 4CHSA 3EINA 3CMIA 2FCHA 1S3AA 5HR2A 3GNJA 2DJKA 1AXDA 3CSIA 3MYDA 3VI5A 1S3RA 4EDZA 1O7UA 4QL7A 3C71A 5DVBA 3GH9A 4Z2UA 1SKWB 3MIXA 4K7NA 2YP6A 1LJRA 1OC9A 2KP2A 4IHUA 3I69A 5B8BA 4OWYA 3WT2A 4KGIA 5A4VA 2GT6A 1KTEA 3HVVA 3ERGA 1TK8B 2ZUPA 1FB0A 3QFAC 2FA8A 3PPUA 5A4WA 4WKWA 1FG4A 1UA5A 2WGRA 3LQ7A 10GSA 5JCUA 1QK8A 4GXZA 3VPTA 2DBCA 1N25A 3VWUA 2RM6A 1KBNA 2H1LA 3KMNA 1OC8A 2HSMB 4XRDA 2YZHA 3F6DA 2FWGA 3UIWA 3PGTA 2B7KA 2CQ9A 4MNNA 5DDLA 2PERA 1JLVA 3VWVA 2PU9C 5D9VA 4Z2RA 3E9JB 2UZ8A 2OADA 4BPYA 1Y1UA 1R26A 1XPVA 2HSNA 4DSSB 4KX4A 2TIRA 1I5GA 4X1UA 1GTBA 4BVXA 1PSQA 5KN0A 1VF4A 2XBQA 1DUGA 1Z5YE 4A5PA 1LBKA 1R7HA 3V1WA 4TR4A 1AUCA 3BD2A 1ZGNA 5J3RA 2GZZA 1MDJA 4ML6A 3DIEA 1K3OA 1TP9A 3DRNA 1TU7A 1JZOA 1X5DA 5ECHB 2GT5A 2VCZA 5D93A 2QA2A 1ABAA 3EU3A 2LUSA 4TW5A 2YPMA 2DMMA 2B3SA 2HXKA 1TDIA 1HQOA 4ECIA 2PPTA 3TKQA 5IPGA 5AISA 3ZMKA 1ST9A 3Q19A 1C72A 1V58A 3H4KA 3RAZA 4OMVA 4YAPA 3IAS2 5ELGA 2LQQA 1U87A 5IIZA 1XCCA 5G31A 4F2IA 1NSWA 4TN8A 6GSUA 1TRSA 1GTAA 5E59A 3VI7A 4KNDA 4X4JA 3UJ1A 1A8YA 3VURA 2EFCA 1UC7A 1PX6A 3GL5A 1ZZYA 2FHEA 6GSTA 2HZEA 5CAXA 2XC2A 3C8EA 3RGBC 4K1FA 4Z7XA 5A34B 2IMEA 2R2JA 4GCIA 3M8NA 1MDKA 1N2AA 2R4VA 5HFKA 3F6FA 1M99A 1TRWA 4WF5A 1J08A 3C7MA 4DEJA 2GTUA 4YQMA 3LYPA 3IAM2 2G0FA 2QKEA 2H1BA 1YKAA 2LNSA 1YKCA 4PI2C 1BQ7A 2XPDA 3HD5A 3GH6A 4PX1A 1GH2A 1I9DA 1OC3A 4MJAA 2X8HA 1SU9A 19GSA 2V41A 4ZB9A 4N10A 3RPNA 2J9HA 4WXTA 3KIJA 2HRNA 2JACA 9GSSA 3LG6A 1S4BP 5ID2B 2F3MA 1O8XA 3ISOA 1YEPA 1ERWA 2R5GA 3HVNA 1ML6A 1RK4A 4X0XA 2MBSA 3HZ4A 2REMA 2OBIA 13GSA 3US3A 3N5OA 3CTFA 2H1DA 1O73A 2LNTA 3GUSA 3H8QA 3K8NA 3O76A 2P5RA 3NOFA 4ZBDA 2HI7A 3KZQA 4ZILA 2EFEA 4AF2A 5HQPA 2HSMA 1SL0B 5DAKB 3HVSA 3U6VA 3A5WA 3LORA 6GSXA 4V2MA 4JZQA 5DCHA 4JE1A 3KP8A 4MPFA 3DKSA 2C3QA 2GGTA 2UV8G 4HJ2A 3FYGA 4DSSA 4JBBA 1F37A 1JZWA 1WWJA 2AB6A 1B48A 5J4VA 4IJIA 4IGJA 2CZ2A 2X49A 2WW1A 4K2XA 4NV5A 4JR4A 1TRUA 3UMAA 1B8XA 2PBJA 5C04A 3QAWA 3I9V2 3SWLA 1GRXA 5G5FA 1FOHA 1PX7A 3GKKA 5IMDA 2JZSA 3HJOA 4AKXB 5G5EA 1BJXA 2IL3A 4MZBA 1R5AA 5LD0A 4OFMA 1YZXA 4N11A 2VIMA 5J9CA 2IWTA 3TDGA 4XRAA 5COHA 3FRCA 4MJCA 2MMNA 2KOKA 3GMFA 4MF5A 3HDCA 3TUEA 4TRXA 5D96A 3O6TA 4YQUA 4FYUA 4XCSA 3KTLA 5J41A 5IPHA 1FB6A 1JZDA 2LV3A 6GSSA 2YWNA 5EY6A 2BJXA 2H75A 2DSAA 4PTSA 2C1YA 5F05A 3ED3A 3FY7A 1SK1A 3HJMA 2ON7A 3IK9A 2WFCA 4P3YB 4E8EA 3ZTLA 3MAKA 3GFKA 3ZIJA 3O3TA 1A23A 1X5EA 1YEXA 5A34A 2L6CA 4XS6A 3GHAA 3KM6A 3D21A 2FNOA 1WPIA 2DKHA 4G0KA 1G7EA 2H74A 3HZ8A 3EWLA 2DIZA 4LL4B 3GURA 1WIKA 5B8AA 2DJJA 2L5LA 2WW0A 3IK7A 4EVMA 5ECPB 4EL1A 2M72A 4K7OA 4KCEA 3IC8A 3TRXA 3IR4A 1Z9HA 4K0NA 3APQA 5ECRB 4GSSA 4DSQA 4L8EA 3TJGA 1THOA 3TKSE 4GQFA 2LTKA 5GSTA 4N30A 5CREA 3KMOA 2K9FA 2FGXA 4HJMA 1ZYNA 4GTUA 2E2MA 4Q5RA 1U3IA 1ZL9A 3BCIA 4ID0A 5ID2A 4HU9A 1FAAA 2YANA 5CRGA 4BIKA 1K3LA 4IJ3A 2VCTA 4FYCA 4MK3A 2HQTA 1F3BA 3P8WA 5CRHA 4O92A 1EGRA 3PINA 5H5QA 1XVWA 5A5HB 5DAKA 3LEFA 4PNFA 5KEJA 2F9SA 4ECJA 1GNWA 2R37A 4NV2A 2FUG2 3HA9A 2WZSA 3M0FA 2C0EA 3A2VA 1GNEA 5HR1A 3M9KA 2CAQA 1VF3A 1ERVA 4JU5A 4L0WA 4POBA 2R0CA 4TOPA 3VK9A 4FYBA 4NAXA 1BG1A 1O8WA 1A2MA 4HZ2A 4MABA 2IMIA 1SVOA 4NMUA 2JZRA 1MDIA 2FLSA 2VAFA 3P2AA 1E6BA 5JCGA 2EIOA 3UBKA 3S9FA 1BG5A 2X8GA 1GSFA 1EV4A 1GTUA 5DALB 6GSWA 2WVZA 4MJEA 4MZWA 1EGOA 1XW5A 4MMMA 4I2UA 1Z7PA 3L4NA 4HU7A 1BAYA 2WRTA 4KSOA 4HEA2 2VO4A 3IHQA 4IN0A 1YF0A 4KW6A 1GSDA 1VF1A 2CT6A 2HRAA 5ECKB 2H6ZA 3ZFLA 3DXBA 2P31A 1JFUA 4PGTA 4TR1B 3QAGA 1FHEA 2YWOA 2PWJA 2IMFA 4WBRD 2ZCTA 4IELA 2OKAA 2CZ3A 3MSZA 4USSA 16GSA 1PQNA 1T1VA 5F07A 1XWBA 4J57E 2HNLA 3TJKA 4LA1A 2IN3A 1BX9A 4ACSA 3CYNA 3P90A 1HYUA 2WULA 4EKZA 1YJ6A 1T3BA 3GV1A 4TR0A 2YJ7A 1JLWA 1K0NA 4ILFA 3CRTA 3D22A 5F8BA 2E0QA 2GDRA 1YVLA 3CTGA 3IXRA 4FIWA 3FMWA 3ERFA 4Q5NA 2GS3A 3IOSA 5EPFA 1K0OA 2O8VB 4CW9A 1XBSA 3U5RE 3A3TA 1M3JA 5H5RA 1YF1A 3DVWA 2KLXA 3UVTA 4G0IA 2GQMA 4LL1B 1YQ1A 4AKIA 5EL8A 1PFOA 2NBSA 2NPBA 2WVYA 4FXYP 2LQOA 4OFNA 2P0GA 1T00A 2AV4A 4CY6A 1TI1A 4PURA 1I1IP 3F3QA 4AGSA 3H1NA 4POKA 5JWQB 1DE1A 17GSA 2TRXA 2X99A 1DE2A 5A5HA 5FHIA 1HNAA 5A5KA 2V6KA 3LYKA 1K0BA 3MNGA 2BMXA 2WW3A 2GSRA 3L9VA 3CRUA 4POMA 4F0CA 2RM5A 2MMOA 1ZYPA 3FKFA 1MEKA 1MD3A 2BTOT 2OT3A 4PQ1A 1FW1A 3UVHA 2DJ2A 2KHPA 2N5FA 3ZVJA 1FVJA 1G7OA 2CX3A 1XWAA 2C8UA 3CXGA 1EP7A 2DKIA 2XHFA 4CDOA 3EPTA 3IPZA 3LWAA 1PMTA 2VM2A 3A2WA 3TU3B 4EF0A 5ELAA 3KJYA 4YQVA 1FVKA 2MMAA 5DALA 4KH7A 1B9YC 2VUPA 3Q74A 5IMVA 2HSYA 1QUWA 1U6TA 5CRWA 3ME8A 3KXOA 4L5LA 1ACVA 1M9BA 1OE8A 1SD9A 4FO5A 1DSBA 3DGQA 2LRCA 2YCDA 2EFDA 3G7YA 1H4OA 3FW2A 3F0IA 4TR1A 4MLYA 1EEJA 1AAZA 4HSCX 4ML1A 1M2BA 2VCWA 4Q5FA 2V6OA 3ZITA 3IA1A 5C00A 4D73A 1A0RP 2HLSA 3DWVA 1XOAA 2HRFA 3KEBA 4HZ4A 5ABRA 1K0AA 3L9UA 2H8LA 1WOUA 4RQXA 4LMWA 2K8VA 2YV9A 3HXSA 1KEBA 3QCPA 3ME7A 2JSZA 2VCQA 2A4VA 3TJFA 1MTCA 2HT9A 3EC3A 4MF7A 3ZYWA 4ZB6A 5F0GA 2C0FA 3J7Yk 1WJKA 2GVPA 4KUNA 2VCXA 5J5NA 3GKMA 2H71A 3M1GA 1AQXA 1LU4A 1XXUA 1F3AA 1QXHA 1V40A 4PHZC 3IHGA 3QMXA 4OCEA 4Z2TA 5IMZA 4KDYA 1XZOA 3LXZA 1VRSD 1V2AA 3WT1A 1TW9A 1UN2A 5JWOB 3GX8A 5JCWA 3UAPA 3KTBA 1EOGA 3KGKA 3TRQA 3VFIA 5HFIA 1ZYEA
chains in the Genus database with same CATH topology
3KD0A 3HMJG 2QA1A 1X5CA 1WMJA 2A2PA 3TKRA 4E68A 3GTUB 5AIVA 1S3DA 5CRDA 2CVDA 2WJUA 3IBHA 2JADA 2V1MA 3LGCA 2F51A 4IW9A 4N3ZA 2O7KA 2E2GA 1HNBA 3HKRA 2PMTA 4YH2A 4IQ1A 2NDOA 5HR0A 4HI7A 5B6NA 4G19A 2YWMA 3A5IA 2RUFA 3IE3A 1Q98A 5J4YA 2ALBA 5DBQA 3CSJA 3KH9A 3LSZA 5IOWA 1PKZA 5DCGA 2YN1A 1GSEA 2GZPA 3F4SA 2CA8A 1J0FA 2MMZA 4KA0A 5DQYA 22GSA 1GULA 5A4UA 1ERUA 3VLNA 2H0GA 5LNKe 3TJBA 3FR9A 1GLQA 2VL3A 3VWWA 2JU5A 3WGEA 2C0DA 4BA7A 2H1GA 3C1RA 2EIRA 1Q4JA 1A0FA 1W4VA 4WR5A 3UBLA 4NPBA 5D73A 2B5YA 2RLIA 4ZXGA 5B7CA 1IYIA 4TXOB 2YNXA 1YY7A 5G30A 3M3MA 3GKXA 2VM1A 4EIQA 1GSYA 4ZL7A 4RUVA 5AN1A 1Z6NA 1O6JA 3QPMA 5ECLB 4AKGA 1IYHA 4ZB7A 1EP8A 4HQZA 3GIXA 2WDUA 1RW1A 2JZTA 4KB3A 2O85A 4MJBA 1V98A 2VLUA 2VL2C 4OCFA 4LLRA 2LSTA 3HVXA 3HY2A 2VL2A 4MP4A 3J7Yb 3EVIA 4I5QA 3RBTA 4BWSA 3G7JA 1PA3A 4MCUA 2I1UA 1TU8A 3RPPA 2H6XA 2M46A 2RUEA 5D9WA 3TKPA 3UOMA 4MF6A 3F9UA 1NHOA 4L0UA 1GSQA 4XS1A 4GWRA 4AJ6A 3EMXA 5ECQB 4BL7B 2WCIA 3BOAA 3CSHA 3I43A 3OR5A 3BBYA 3TKSA 2YV7A 2FWFA 4RQRA 2L57A 4TR3A 2WB9A 2OE1A 2K8SA 5IQYA 5IM9A 4NXIA 1UVZA 1PL1A 1JHBA 4E8HA 1V9WA 2B5XA 3D6IA 1SJ6A 5ECIB 2H66A 1TI3A 3IV4A 3EU4A 2GLRA 1TKDB 1PN0A 3W8JA 3ZIVA 4RI6A 3A2XA 4GQCA 4JR6A 1M2AA 4K6XA 2R0GA 3FZ9A 2CAIA 4HUAA 4XS4B 1GTIA 1NW2A 2ON5A 3KH7A 5KN1A 4BWQA 2NTOA 2DJ0A 3KP9A 1O85A 5J4UA 2K18A 2R0PA 1OAZA 4ZBAA 5BRTA 1GSUA 3GTUA 3UARA 1O81A 2WS2A 2P5QA 2L59A 2VLVA 4EC0A 1U88A 3I6AA 4F03A 1VF2A 1T4YA 1FO5A 2C3TA 3HYPA 2AUVA 2I81A 3JCML 4K9ZA 4IKHA 4ZL9A 5AIXA 2HYXA 3GRXA 3WGDA 2LRTA 3HCZA 3QOUA 1G6YA 3WYWA 2DIYA 3QR6A 1EOHA 1PGTA 4N0ZA 2EIQA 5KN2A 3LW9A 3GA4A 4FQUA 4PQIA 1HD2A 1M7TA 5AGYA 2XBIA 2LJKA 4XTSA 1X0RA 2NVLA 5CP1A 4EE0A 4IBPA 3GKNA 1G0TA 3P7XA 5E4WA 2RIIA 4W66A 1PN9A 1TXXA 20GSA 3VWXA 2B6MA 4EDYA 1GUHA 2C4JA 3TGZA 1MD4A 1OE7A 4K5RA 4HOJA 1KNGA 3MWHA 4D73B 1QFNA 1M0UA 4K8MA 1BF5A 1XVQA 3NZNA 2G2QA 1SK0A 3F8UA 7GSSA 1XW9A 2IFQB 2EFHA 2QGVA 2JL4A 4YAVA 2GQLA 2JSYA 3ZREA 4WF4A 4EUYA 5G2ZA 4TXOA 5D9XA 4F0BA 1SKSB 2R6KA 4FH8A 4F82A 2GSQA 2H6YA 3F3RA 1E2YA 1J9BA 2B5EA 4TVEA 3N9JA 1TXUA 2QC7A 11GSA 3MDKA 4K7IA 1WP0A 4AJ7A 2R3XA 4DVCA 3TB2A 4WBJA 4ECBA 5F06A 4ZBBA 1SD8A 5IO0A 4K5SA 1NM3A 1A2LA 2I9HA 2PN8A 1URMA 2IPAA 2LJRA 4AJ8A 2H76A 2ES7A 3WGXA 2PUKC 3H93A 1QGVA 2O89A 2O5VA 1XOBA 3HHVA 1HNCA 3EMPA 3RHBA 4V1Ap 2H72A 3D5JA 5A1NB 1TTZA 2OE3A 3GSTA 4BL7A 2AYTA 3PR8A 1TOFA 1AQWA 1GLPA 4OD7A 4EIPA 1SENA 2F8AA 2VOCA 3D4TA 2KP1A 4NWYA 2H30A 5ECMB 1W89A 2LS5A 1SVLA 2OJLA 4WR4A 2L4QA 3QD9A 1YDKA 1ZYQB 2A2SA 3W8SA 3QDNA 4G9HA 1SK2A 1WE0A 4JEDA 1AIUA 4MPGA 3VPQA 4IQAA 1ON4A 4XS4A 2B1KA 1X9SB 3KCMA 4EO3A 3RHCA 3IC4A 4V2NA 4PUAA 2AHEA 2DLXA 4I2TA 1R5PA 2L5OA 2IMKA 3ZMLA 1VGLA 1SJZA 2XPEA 3E0UA 3FR6A 2LKUA 2OBKA 2Z9SA 1CQHA 4ISDA 3FZAA 1X9WB 5ENUA 4I6XA 1AC1A 4IS0A 4HQSA 1PD21 3WD6A 1TRVA 2IMDA 3APSA 4ZIJA 2M80A 2LRNA 1B9XC 4J56E 3EE2A 1F6MC 3Q6OA 3G7IA 2YWIA 2VCVA 3F63A 1PL2A 1Z3EA 4MZCA 4O7HA 3RDWA 5IMFA 3R2QA 2E7PA 2HSHA 3D0ZA 5GAPD 3NIVA 3TJJA 2L6DA 1BEDA 3TOTA 4KF9A 1CQGA 2DJ3A 5H5SA 4KSMA 3GL3A 2VD0A 4WEYA 4QL9A 3GSSA 1V57A 4O5UA 1N8JA 1QQ2A 3Q18A 1X9MB 4TXVA 2IIYA 3LXTA 4POLA 2CX4A 2V2GA 1ERTA 1T4ZA 3GX0A 1Y6EA 4ZL8A 3UEMA 3IDVA 3CWGA 1GUKA 2F8FA 3ERWA 3HJPA 4BVYB 2IFQA 5IO2A 4K0GA 1EWXA 3IRAA 4I97A 4G10A 2C80A 1AQVA 1USBA 14GSA 1H75A 1OYJA 2N5BA 3ZVJD 3FK8A 3BCKA 1SYXA 5DJLA 2PVOC 1EEMA 2GSTA 4H86A 2PGTA 4V2LA 1XWGA 2H19A 3G9BA 4G01A 2CV4A 3FZ4A 2DC5A 4MDCA 4OO4A 1Z7RA 3ZFBA 3PH9A 1GWCA 2VKZG 2HFDA 4QMKA 4OO5A 2X4AA 2K6VA 3ZRDA 3M9JA 3UL3A 2EC4A 1GP1A 1GUMA 2X8CA 3D4MA 2DJ1A 2L4CA 2CVKA 1A2JA 3ZLPA 1B4QA 2A2RA 5A1NA 3F4RA 2YZUA 2FD3A 5IMAA 5FWGA 4F9ZA 3W6GA 4G2EA 1BYEA 2VL9A 3GN3A 3C1SA 5ECOB 5IMCA 5CYYA 5BMUB 3QAVA 4MA9A 2FWEA 1OKTA 3ZZXA 1R4WA 6GSVA 1FOVA 2AJQB 2MZCA 5G1LA 5IOXA 4GF0A 3EYTA 2I3YA 4J2FA 4GLTA 4O5RA 2CVBA 2KUCA 4WETA 3EURA 4DSRA 1WRYA 4KAEA 5DQSA 1XWKA 2C0GA 4KCAA 5HFGA 1M2DA 2HRKB 3FEUA 1SL1B 3L78A 1JZRA 4L5OA 3ZL5A 4PNGA 1EZKA 4AI6A 3TOUA 2D2ZA 1G6WA 1ILOA 3DD3A 1PRXA 5ECSA 1SVMA 2FWHA 4ZB8A 4KE3A 2MBTA 2N5AA 4YKGA 2OACA 1OVNA 2TRCP 1S3CA 2PVQA 1A24A 4AKHA 2H0IA 5G1KA 4GSTA 1OKDA 4GRFA 3R3EA 4YKFA 8GSSA 1K0CA 1T7PB 1TK0B 2OA7A 5DJMA 2B1LA 4HDEA 1OC9B 4I8BA 4MH2A 12GSA 5KOWA 5J40A 1GL8A 3C73A 1B4PA 3TCOA 2OE0A 2HZFA 4QQ7A 4G0LA 2H73A 4HS1A 5CO3A 1QMVA 4XIHA 5D8IA 4EXJA 1F2EA 1K3YA 4BVYA 4N0VA 5CNWA 3BJ5A 1TK5B 4MH3A 1SL2B 5KN3A 1TJDA 3TKSC 1A8LA 1AW9A 3F4TA 2J23A 1XFLA 2A4HA 2QSIA 1M9AA 4IP1A 4ECCA 5FT3A 2GSSA 1Z6MA 3FZ5A 3CBUA 1U3AA 4PQHA 1GSSA 4GDFA 5INYA 2FY6A 1ZOFA 2HSNB 2MYGA 3L0HA 5LCZA 1THXA 2FA4A 3AY8A 4OFTA 1XW6A 4BVXB 1PKWA 18GSA 1SJIA 2H01A 4O32A 1XWCA 4XHMA 2X64A 3FR3A 2V32A 3LFLA 1EV9A 2LJAA 2WZ9A 3E3EA 2B7JA 1DBYA 2YJHA 4IP6A 4V1Ag 5B6MA 3TRPA 4JRRA 1ZCPA 5EVOA 4PUFC 4TKYA 1Y25A 4K2DA 5J47A 4NHWA 1T8EB 1XIYA 2YOIA 4PXOA 5ECNB 4O5QA 5L71A 3DEXA 1NHYA 2IJYA 4Q5QA 1K0MA 5BMUA 1F9MA 5JWRB 2VLTA 1RQMA 2H70A 3DVXA 1SKRB 2DMLA 4LMVA 2O87A 4IVFA 3LJRA 4RI7A 1K0DA 4ULXA 3QFBC 4X43A 2AAWA 4GSNA 3FHKA 3APOA 2H0HA 2VD1A 1SYRA 3GYKA 5HR3A 5GAND 4NHZA 2HZEB 4CY8A 2HRKA 4KDXA 2H1AA 2I4AA 6GSYA 3L9SA 5GZZB 2GQKA 5D9TA 3SBCA 2HE3A 3DMLA 4ICYA 2ZNMA 1ZMAA 4KDUA 5GSSA 5KOXA 5J9BA 2GZYA 3H79A 2LEGA 3DYRA 2C3NA 4CHSA 3EINA 3CMIA 2FCHA 1S3AA 5HR2A 3GNJA 2DJKA 1AXDA 3CSIA 3MYDA 3VI5A 4EDZA 1O7UA 4QL7A 3C71A 5DVBA 3GH9A 4Z2UA 1SKWB 3MIXA 4K7NA 2YP6A 1LJRA 1OC9A 2KP2A 4IHUA 3I69A 5B8BA 4OWYA 3WT2A 4KGIA 5A4VA 2GT6A 1KTEA 3HVVA 3ERGA 1TK8B 2ZUPA 1FB0A 3QFAC 2FA8A 3PPUA 5A4WA 4WKWA 1FG4A 1UA5A 2WGRA 3LQ7A 10GSA 5JCUA 1QK8A 4GXZA 3VPTA 2DBCA 1N25A 3VWUA 2RM6A 1KBNA 2H1LA 3KMNA 1OC8A 2HSMB 4XRDA 2YZHA 3F6DA 2FWGA 3UIWA 3PGTA 2B7KA 2CQ9A 4MNNA 5DDLA 2PERA 1JLVA 3VWVA 2PU9C 5D9VA 4Z2RA 3E9JB 2UZ8A 2OADA 4BPYA 1Y1UA 1R26A 1XPVA 2HSNA 4DSSB 4KX4A 2TIRA 1I5GA 4X1UA 1GTBA 4BVXA 1PSQA 5KN0A 1VF4A 2XBQA 1DUGA 1Z5YE 4A5PA 1LBKA 1R7HA 3V1WA 4TR4A 1AUCA 3BD2A 1ZGNA 5J3RA 2GZZA 1MDJA 4ML6A 3DIEA 1K3OA 1TP9A 3DRNA 1TU7A 1JZOA 1X5DA 5ECHB 2GT5A 2VCZA 5D93A 2QA2A 1ABAA 3EU3A 2LUSA 4TW5A 2YPMA 2DMMA 2B3SA 2HXKA 1TDIA 1HQOA 4ECIA 2PPTA 3TKQA 5IPGA 5AISA 3ZMKA 1ST9A 3Q19A 1C72A 1V58A 3H4KA 3RAZA 4OMVA 4YAPA 3IAS2 5ELGA 2LQQA 1U87A 5IIZA 1XCCA 5G31A 4F2IA 1NSWA 4TN8A 6GSUA 1TRSA 1GTAA 5E59A 3VI7A 4KNDA 4X4JA 3UJ1A 1A8YA 3VURA 2EFCA 1UC7A 1PX6A 3GL5A 1ZZYA 2FHEA 6GSTA 2HZEA 5CAXA 2XC2A 3C8EA 4K1FA 4Z7XA 5A34B 2IMEA 2R2JA 4GCIA 3M8NA 1MDKA 1N2AA 2R4VA 5HFKA 3F6FA 1M99A 1TRWA 4WF5A 1J08A 3C7MA 4DEJA 2GTUA 4YQMA 3LYPA 3IAM2 2G0FA 2QKEA 2H1BA 1YKAA 2LNSA 1YKCA 1BQ7A 2XPDA 3HD5A 3GH6A 4PX1A 1GH2A 1I9DA 1OC3A 4MJAA 2X8HA 1SU9A 19GSA 2V41A 4ZB9A 4N10A 3RPNA 2J9HA 4WXTA 3KIJA 2HRNA 2JACA 9GSSA 3LG6A 5ID2B 2F3MA 1O8XA 3ISOA 1YEPA 1ERWA 2R5GA 1ML6A 1RK4A 4X0XA 2MBSA 3HZ4A 2REMA 2OBIA 13GSA 3US3A 3N5OA 3CTFA 2H1DA 1O73A 2LNTA 3GUSA 3H8QA 3K8NA 3O76A 2P5RA 3NOFA 4ZBDA 2HI7A 3KZQA 4ZILA 2EFEA 4AF2A 5HQPA 2HSMA 1SL0B 5DAKB 3HVSA 3U6VA 3A5WA 3LORA 6GSXA 4V2MA 4JZQA 5DCHA 4JE1A 3KP8A 4MPFA 3DKSA 2C3QA 2GGTA 2UV8G 4HJ2A 3FYGA 4DSSA 4JBBA 1F37A 1JZWA 1WWJA 2AB6A 1B48A 5J4VA 4IJIA 4IGJA 2CZ2A 2X49A 4K2XA 4NV5A 4JR4A 1TRUA 3UMAA 1B8XA 2PBJA 5C04A 3QAWA 3I9V2 3SWLA 1GRXA 5G5FA 1FOHA 1PX7A 3GKKA 5IMDA 2JZSA 3HJOA 4AKXB 5G5EA 1BJXA 2IL3A 4MZBA 1R5AA 5LD0A 4OFMA 1YZXA 4N11A 2VIMA 5J9CA 2IWTA 3TDGA 4XRAA 5COHA 3FRCA 4MJCA 2MMNA 2KOKA 3GMFA 4MF5A 3HDCA 3TUEA 4TRXA 5D96A 3O6TA 4YQUA 4FYUA 4XCSA 3KTLA 5J41A 5IPHA 1FB6A 1JZDA 2LV3A 6GSSA 2YWNA 5EY6A 2BJXA 2H75A 2DSAA 4PTSA 2C1YA 5F05A 3ED3A 3FY7A 1SK1A 3HJMA 2ON7A 3IK9A 2WFCA 4P3YB 4E8EA 3ZTLA 3MAKA 3GFKA 3ZIJA 3O3TA 1A23A 1X5EA 1YEXA 5A34A 2L6CA 4XS6A 3GHAA 3KM6A 3D21A 2FNOA 1WPIA 2DKHA 4G0KA 1G7EA 2H74A 3HZ8A 3EWLA 2DIZA 4LL4B 3GURA 1WIKA 5B8AA 2DJJA 2L5LA 3IK7A 4EVMA 5ECPB 4EL1A 2M72A 4K7OA 4KCEA 3IC8A 3TRXA 3IR4A 1Z9HA 4K0NA 3APQA 5ECRB 4GSSA 4DSQA 4L8EA 3TJGA 1THOA 3TKSE 4GQFA 2LTKA 5GSTA 4N30A 5CREA 3KMOA 2K9FA 2FGXA 4HJMA 1ZYNA 4GTUA 2E2MA 4Q5RA 1U3IA 1ZL9A 3BCIA 4ID0A 5ID2A 4HU9A 1FAAA 2YANA 5CRGA 1K3LA 4IJ3A 2VCTA 4FYCA 4MK3A 2HQTA 1F3BA 3P8WA 5CRHA 4O92A 1EGRA 3PINA 5H5QA 1XVWA 5A5HB 5DAKA 3LEFA 4PNFA 5KEJA 2F9SA 4ECJA 1GNWA 2R37A 4NV2A 2FUG2 3HA9A 3M0FA 2C0EA 3A2VA 1GNEA 5HR1A 3M9KA 2CAQA 1VF3A 1ERVA 4JU5A 4L0WA 4POBA 2R0CA 4TOPA 3VK9A 4FYBA 4NAXA 1BG1A 1O8WA 1A2MA 4HZ2A 4MABA 2IMIA 1SVOA 4NMUA 2JZRA 1MDIA 2FLSA 2VAFA 3P2AA 1E6BA 5JCGA 2EIOA 3UBKA 3S9FA 1BG5A 2X8GA 1GSFA 1EV4A 1GTUA 5DALB 6GSWA 4MJEA 4MZWA 1EGOA 1XW5A 4MMMA 4I2UA 1Z7PA 3L4NA 4HU7A 1BAYA 2WRTA 4KSOA 4HEA2 2VO4A 3IHQA 4IN0A 1YF0A 4KW6A 1GSDA 1VF1A 2CT6A 2HRAA 5ECKB 2H6ZA 3ZFLA 3DXBA 2P31A 1JFUA 4PGTA 4TR1B 3QAGA 1FHEA 2YWOA 2PWJA 2IMFA 4WBRD 2ZCTA 4IELA 2OKAA 2CZ3A 3MSZA 4USSA 16GSA 1PQNA 1T1VA 5F07A 1XWBA 4J57E 2HNLA 3TJKA 4LA1A 2IN3A 1BX9A 4ACSA 3CYNA 3P90A 1HYUA 2WULA 4EKZA 1YJ6A 1T3BA 3GV1A 4TR0A 2YJ7A 1JLWA 1K0NA 4ILFA 3CRTA 3D22A 5F8BA 2E0QA 2GDRA 1YVLA 3CTGA 3IXRA 4FIWA 3FMWA 3ERFA 4Q5NA 2GS3A 3IOSA 5EPFA 1K0OA 2O8VB 4CW9A 1XBSA 3U5RE 3A3TA 5H5RA 1YF1A 3DVWA 2KLXA 3UVTA 4G0IA 2GQMA 4LL1B 1YQ1A 4AKIA 5EL8A 2NBSA 2NPBA 2LQOA 4OFNA 2P0GA 1T00A 2AV4A 4CY6A 1TI1A 4PURA 3F3QA 4AGSA 3H1NA 4POKA 5JWQB 1DE1A 17GSA 2TRXA 2X99A 1DE2A 5A5HA 5FHIA 1HNAA 5A5KA 2V6KA 3LYKA 1K0BA 3MNGA 2BMXA 2GSRA 3L9VA 3CRUA 4POMA 4F0CA 2RM5A 2MMOA 1ZYPA 3FKFA 1MEKA 1MD3A 2BTOT 2OT3A 4PQ1A 1FW1A 3UVHA 2DJ2A 2KHPA 2N5FA 3ZVJA 1FVJA 1G7OA 2CX3A 1XWAA 2C8UA 3CXGA 1EP7A 2DKIA 2XHFA 4CDOA 3EPTA 3IPZA 3LWAA 1PMTA 2VM2A 3A2WA 3TU3B 4EF0A 5ELAA 3KJYA 4YQVA 1FVKA 2MMAA 5DALA 4KH7A 1B9YC 2VUPA 3Q74A 5IMVA 2HSYA 1QUWA 1U6TA 5CRWA 3ME8A 3KXOA 4L5LA 1ACVA 1M9BA 1OE8A 1SD9A 4FO5A 1DSBA 3DGQA 2LRCA 2YCDA 2EFDA 3G7YA 1H4OA 3FW2A 3F0IA 4TR1A 4MLYA 1EEJA 1AAZA 4ML1A 1M2BA 2VCWA 4Q5FA 2V6OA 3ZITA 3IA1A 5C00A 4D73A 1A0RP 2HLSA 3DWVA 1XOAA 2HRFA 3KEBA 4HZ4A 5ABRA 1K0AA 3L9UA 2H8LA 1WOUA 4RQXA 4LMWA 2K8VA 2YV9A 3HXSA 1KEBA 3QCPA 3ME7A 2JSZA 2VCQA 2A4VA 3TJFA 1MTCA 2HT9A 3EC3A 4MF7A 3ZYWA 4ZB6A 5F0GA 2C0FA 3J7Yk 1WJKA 2GVPA 4KUNA 2VCXA 5J5NA 3GKMA 2H71A 3M1GA 1AQXA 1LU4A 1XXUA 1F3AA 1QXHA 1V40A 3IHGA 3QMXA 4OCEA 4Z2TA 5IMZA 4KDYA 1XZOA 3LXZA 1VRSD 1V2AA 3WT1A 1TW9A 1UN2A 5JWOB 3GX8A 5JCWA 3UAPA 3KTBA 1EOGA 3KGKA 3TRQA 3VFIA 5HFIA 1ZYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5R A;  4EDZ A;  1U3I A;  1ZL9 A;  4ID0 A;  4IS0 A;  1PD2 1;  3WD6 A;  3GTU B;  5AIV A;  2CVD A;  2WJU A;  3IBH A;  3EE2 A;  1K3L A;  4IW9 A;  2VCT A;  1LJR A;  3G7I A;  1HNB A;  2VCV A;  3HKR A;  3I69 A;  3F63 A;  2PMT A;  1PL2 A;  4YH2 A;  4IQ1 A;  4MK3 A;  4HI7 A;  4G19 A;  2HQT A;  4KGI A;  1F3B A;  4O7H A;  5A4V A;  3P8W A;  4O92 A;  3IE3 A;  3R2Q A;  3ERG A;  3CSJ A;  3D0Z A;  3NIV A;  3PPU A;  3LSZ A;  5A4W A;  3TOT A;  4KF9 A;  1UA5 A;  1PKZ A;  4KSM A;  5DCG A;  5DAK A;  2VD0 A;  4PNF A;  5KEJ A;  3LQ7 A;  4ECJ A;  3GSS A;  1GNW A;  1GSE A;  10GS A;  5JCU A;  3Q18 A;  2CA8 A;  3VPT A;  3LXT A;  3M0F A;  22GS A;  1GNE A;  1GUL A;  1KBN A;  3KMN A;  2HSM B;  5A4U A;  2CAQ A;  1VF3 A;  3F6D A;  3VLN A;  3PGT A;  3GX0 A;  1Y6E A;  3FR9 A;  1GLQ A;  1GUK A;  2F8F A;  4TOP A;  5DDL A;  3VK9 A;  4NAX A;  2PER A;  1JLV A;  4BVY B;  4HZ2 A;  5D9V A;  2IMI A;  4K0G A;  2UZ8 A;  4I97 A;  2OAD A;  4G10 A;  2C80 A;  1AQV A;  1USB A;  14GS A;  1Q4J A;  1A0F A;  1OYJ A;  4KX4 A;  1GTB A;  4WR5 A;  4BVX A;  3UBL A;  1E6B A;  5D73 A;  1VF4 A;  1DUG A;  4ZXG A;  5B7C A;  1IYI A;  3UBK A;  5DJL A;  1LBK A;  1EEM A;  1BG5 A;  1GSF A;  2GST A;  1YY7 A;  2PGT A;  1EV4 A;  1XWG A;  3M3M A;  1GTU A;  5DAL B;  6GSW A;  1ZGN A;  2DC5 A;  4MZW A;  4MDC A;  1GSY A;  1XW5 A;  5AN1 A;  1K3O A;  3ZFB A;  1GWC A;  5ECL B;  1IYH A;  1BAY A;  1TU7 A;  2WDU A;  2WRT A;  5ECH B;  2VO4 A;  2VCZ A;  1GSD A;  1VF1 A;  2HRA A;  5ECK B;  3ZFL A;  1GUM A;  4MP4 A;  4PGT A;  2A2R A;  1TDI A;  1HQO A;  4ECI A;  3QAG A;  5FWG A;  3RBT A;  5AIS A;  1FHE A;  3G7J A;  1PA3 A;  3ZMK A;  1TU8 A;  3Q19 A;  1C72 A;  4OMV A;  4YAP A;  5D9W A;  1BYE A;  4IEL A;  5ELG A;  4MF6 A;  1U87 A;  5ECO B;  1GSQ A;  2CZ3 A;  3QAV A;  5ECQ B;  4BL7 B;  4USS A;  16GS A;  3CSH A;  6GSU A;  5F07 A;  3BBY A;  1GTA A;  2YV7 A;  1OKT A;  6GSV A;  3VI7 A;  2HNL A;  2WB9 A;  3VUR A;  1BX9 A;  5IQY A;  4ACS A;  3P90 A;  1PX6 A;  1PL1 A;  4E8H A;  2FHE A;  1YJ6 A;  6GST A;  4GF0 A;  3C8E A;  4J2F A;  4GLT A;  5ECI B;  4GCI A;  3M8N A;  2GLR A;  1N2A A;  1JLW A;  2R4V A;  4KAE A;  1XWK A;  5DQS A;  1K0N A;  4RI6 A;  5HFK A;  3CRT A;  3F6F A;  1M99 A;  5F8B A;  2HRK B;  2CAI A;  4DEJ A;  2GTU A;  2GDR A;  1JZR A;  4L5O A;  4YQM A;  3LYP A;  1GTI A;  4PNG A;  2ON5 A;  1YKC A;  3TOU A;  2NTO A;  3ERF A;  3GH6 A;  2D2Z A;  4Q5N A;  1G6W A;  5J4U A;  1K0O A;  4PX1 A;  4ZBA A;  3DD3 A;  1GSU A;  5ECS A;  4ZB8 A;  4KE3 A;  3GTU A;  3UAR A;  2OAC A;  19GS A;  4ZB9 A;  2PVQ A;  2J9H A;  2WS2 A;  9GSS A;  4EC0 A;  4GST A;  1U88 A;  3LG6 A;  4G0I A;  3R3E A;  1YQ1 A;  3I6A A;  5EL8 A;  4F03 A;  1VF2 A;  2F3M A;  3ISO A;  4OFN A;  2C3T A;  2R5G A;  4IKH A;  4PUR A;  1ML6 A;  1K0C A;  1RK4 A;  8GSS A;  2OA7 A;  5AIX A;  5DJM A;  4AGS A;  3H1N A;  1G6Y A;  17GS A;  3WYW A;  12GS A;  13GS A;  3QR6 A;  1EOH A;  1PGT A;  3N5O A;  3GUS A;  4FQU A;  4PQI A;  5FHI A;  5AGY A;  1HNA A;  5A5K A;  3O76 A;  2V6K A;  4ZBD A;  4EE0 A;  4IBP A;  3LYK A;  1B4P A;  1K0B A;  2HSM A;  2GSR A;  1PN9 A;  5DAK B;  20GS A;  4QQ7 A;  4G0L A;  3U6V A;  3VWX A;  4EDY A;  1GUH A;  3CRU A;  6GSX A;  2C4J A;  4EXJ A;  4JZQ A;  4F0C A;  1F2E A;  1K3Y A;  1MD4 A;  3TGZ A;  4BVY A;  1OE7 A;  1MD3 A;  4N0V A;  4HOJ A;  1FW1 A;  3UVH A;  1M0U A;  2N5F A;  4MPF A;  2C3Q A;  4HJ2 A;  1G7O A;  3FYG A;  1AW9 A;  2C8U A;  4JBB A;  1M9A A;  7GSS A;  4ECC A;  5FT3 A;  2GSS A;  2JL4 A;  3CBU A;  1PMT A;  1B48 A;  2AB6 A;  4YAV A;  4PQH A;  4IJI A;  4IGJ A;  2CZ2 A;  1GSS A;  5D9X A;  5ELA A;  3KJY A;  4F0B A;  4YQV A;  2R6K A;  2HSN B;  3L0H A;  5DAL A;  2GSQ A;  4KH7 A;  5LCZ A;  3AY8 A;  4OFT A;  1B8X A;  1XW6 A;  4BVX B;  1PKW A;  2PBJ A;  18GS A;  3QAW A;  3Q74 A;  2X64 A;  3N9J A;  3SWL A;  5G5F A;  3FR3 A;  11GS A;  1PX7 A;  3LFL A;  1EV9 A;  3MDK A;  3KXO A;  4L5L A;  3HJO A;  5G5E A;  2IL3 A;  1M9B A;  1OE8 A;  1R5A A;  2R3X A;  5LD0 A;  4OFM A;  3DGQ A;  5EVO A;  5F06 A;  4ECB A;  4ZBB A;  2YCD A;  3FRC A;  2LJR A;  4NHW A;  2VCW A;  4Q5F A;  4PXO A;  5ECN B;  4MF5 A;  1HNC A;  1NHY A;  4Q5Q A;  4YQU A;  1K0M A;  4HZ4 A;  5BMU A;  1K0A A;  3GST A;  4BL7 A;  3KTL A;  5J41 A;  4LMW A;  2YV9 A;  6GSS A;  4LMV A;  5EY6 A;  3PR8 A;  4IVF A;  3LJR A;  2DSA A;  1AQW A;  4RI7 A;  4PTS A;  1GLP A;  1K0D A;  5F05 A;  2VCQ A;  3FY7 A;  3HJM A;  2ON7 A;  3IK9 A;  1MTC A;  4E8E A;  4MF7 A;  2AAW A;  4GSN A;  3MAK A;  4ZB6 A;  5F0G A;  3O3T A;  5ECM B;  2VD1 A;  2VCX A;  3KM6 A;  5J5N A;  2FNO A;  4WR4 A;  3M1G A;  1AQX A;  4G0K A;  1F3A A;  1YDK A;  4NHZ A;  2A2S A;  3GUR A;  3W8S A;  2HRK A;  4KDX A;  6GSY A;  4G9H A;  4JED A;  3IK7 A;  1V40 A;  4MPG A;  5GZZ B;  5ECP B;  3VPQ A;  4IQA A;  5D9T A;  3IC8 A;  3IR4 A;  1Z9H A;  4K0N A;  4KDY A;  3LXZ A;  4KDU A;  5ECR B;  5GSS A;  4GSS A;  2AHE A;  4PUA A;  4L8E A;  1V2A A;  2IMK A;  3ZML A;  1TW9 A;  5GST A;  2C3N A;  5JCW A;  3UAP A;  4CHS A;  3EIN A;  3KMO A;  1EOG A;  1AXD A;  3CSI A;  3FR6 A;  3VI5 A;  4GTU A;  4ISD A; 
#chains in the Genus database with same CATH topology
 3KD0 A;  3HMJ G;  2QA1 A;  1X5C A;  1WMJ A;  2A2P A;  3TKR A;  4E68 A;  3GTU B;  5AIV A;  1S3D A;  5CRD A;  2CVD A;  2WJU A;  3IBH A;  2JAD A;  2V1M A;  3LGC A;  2F51 A;  4IW9 A;  4N3Z A;  2O7K A;  2E2G A;  1HNB A;  3HKR A;  2PMT A;  4YH2 A;  4IQ1 A;  2NDO A;  5HR0 A;  4HI7 A;  5B6N A;  4G19 A;  2YWM A;  3A5I A;  2RUF A;  3IE3 A;  1Q98 A;  5J4Y A;  2ALB A;  3RFR C;  5DBQ A;  3CSJ A;  3KH9 A;  3LSZ A;  5IOW A;  1PKZ A;  5DCG A;  2YN1 A;  2WVX B;  1GSE A;  2GZP A;  3F4S A;  2CA8 A;  1J0F A;  2MMZ A;  4KA0 A;  5DQY A;  22GS A;  1GUL A;  5A4U A;  1ERU A;  3VLN A;  2H0G A;  5LNK e;  3TJB A;  3FR9 A;  1GLQ A;  2VL3 A;  3VWW A;  2JU5 A;  3WGE A;  2C0D A;  4BA7 A;  2H1G A;  3C1R A;  2EIR A;  1Q4J A;  1A0F A;  1W4V A;  4WR5 A;  3UBL A;  4NPB A;  5D73 A;  2B5Y A;  2RLI A;  4ZXG A;  5B7C A;  1IYI A;  4TXO B;  2YNX A;  1YY7 A;  5G30 A;  3M3M A;  3GKX A;  2VM1 A;  4EIQ A;  1GSY A;  4ZL7 A;  4RUV A;  5AN1 A;  1Z6N A;  1O6J A;  3QPM A;  5ECL B;  4AKG A;  1IYH A;  4ZB7 A;  1EP8 A;  4HQZ A;  3GIX A;  2WDU A;  1RW1 A;  2JZT A;  4KB3 A;  2O85 A;  4MJB A;  1V98 A;  2VLU A;  2VL2 C;  4OCF A;  4LLR A;  2LST A;  3HVX A;  3HY2 A;  2VL2 A;  4MP4 A;  3J7Y b;  3EVI A;  4I5Q A;  3RBT A;  4BWS A;  3G7J A;  1PA3 A;  4MCU A;  2I1U A;  1TU8 A;  3RPP A;  2H6X A;  2M46 A;  2RUE A;  5D9W A;  3TKP A;  3UOM A;  4MF6 A;  3F9U A;  1NHO A;  4L0U A;  1GSQ A;  4XS1 A;  4GWR A;  4AJ6 A;  3EMX A;  5ECQ B;  4BL7 B;  2WCI A;  3BOA A;  3CSH A;  3I43 A;  3OR5 A;  3BBY A;  3TKS A;  2YV7 A;  2FWF A;  4RQR A;  2L57 A;  4TR3 A;  2WB9 A;  2OE1 A;  2K8S A;  5IQY A;  5IM9 A;  4NXI A;  1UVZ A;  1PL1 A;  2WW2 A;  4E8H A;  1JHB A;  1V9W A;  2B5X A;  3D6I A;  1SJ6 A;  5ECI B;  2H66 A;  1TI3 A;  3IV4 A;  3EU4 A;  2GLR A;  1TKD B;  1PN0 A;  3W8J A;  3ZIV A;  4RI6 A;  3A2X A;  4GQC A;  4JR6 A;  1M2A A;  4K6X A;  2R0G A;  3FZ9 A;  2CAI A;  4HUA A;  4XS4 B;  1GTI A;  1NW2 A;  2ON5 A;  3KH7 A;  5KN1 A;  4BWQ A;  2NTO A;  2DJ0 A;  3KP9 A;  1O85 A;  5J4U A;  2K18 A;  2R0P A;  1OAZ A;  4ZBA A;  5BRT A;  1GSU A;  3GTU A;  3UAR A;  1O81 A;  2WS2 A;  2O3E A;  2P5Q A;  2L59 A;  2VLV A;  4EC0 A;  1U88 A;  3I6A A;  4F03 A;  1VF2 A;  1T4Y A;  1FO5 A;  2C3T A;  3HYP A;  2AUV A;  2I81 A;  3JCM L;  4K9Z A;  4IKH A;  4ZL9 A;  5AIX A;  2HYX A;  3GRX A;  3WGD A;  2LRT A;  3HCZ A;  3QOU A;  1G6Y A;  3WYW A;  2DIY A;  3QR6 A;  1EOH A;  1PGT A;  4N0Z A;  2EIQ A;  5KN2 A;  3LW9 A;  3GA4 A;  4FQU A;  4PQI A;  1HD2 A;  1M7T A;  5AGY A;  2WVX A;  2XBI A;  2LJK A;  4XTS A;  1X0R A;  4PI0 C;  2NVL A;  5CP1 A;  4EE0 A;  4IBP A;  3GKN A;  1G0T A;  3P7X A;  5E4W A;  2RII A;  4W66 A;  1PN9 A;  1TXX A;  20GS A;  3VWX A;  2B6M A;  4EDY A;  1GUH A;  2C4J A;  3TGZ A;  1MD4 A;  1OE7 A;  4K5R A;  4HOJ A;  1KNG A;  3MWH A;  4D73 B;  1QFN A;  1M0U A;  1M3I A;  4K8M A;  1BF5 A;  1XVQ A;  3NZN A;  2G2Q A;  1SK0 A;  3F8U A;  7GSS A;  1XW9 A;  2IFQ B;  2EFH A;  2QGV A;  2JL4 A;  4YAV A;  2GQL A;  2JSY A;  3ZRE A;  4WF4 A;  4EUY A;  5G2Z A;  4TXO A;  5D9X A;  4F0B A;  1SKS B;  2R6K A;  4FH8 A;  4F82 A;  2GSQ A;  2H6Y A;  3F3R A;  1E2Y A;  1J9B A;  2B5E A;  4TVE A;  3N9J A;  1TXU A;  2QC7 A;  11GS A;  3MDK A;  4K7I A;  1WP0 A;  4AJ7 A;  2R3X A;  4DVC A;  3TB2 A;  3CQF A;  4WBJ A;  4ECB A;  5F06 A;  4ZBB A;  1SD8 A;  5IO0 A;  4K5S A;  1NM3 A;  1A2L A;  2I9H A;  2PN8 A;  1URM A;  2IPA A;  2LJR A;  4AJ8 A;  2H76 A;  2ES7 A;  3WGX A;  2PUK C;  3H93 A;  1QGV A;  2O89 A;  2O5V A;  1XOB A;  3HHV A;  1HNC A;  3EMP A;  3RHB A;  4V1A p;  2H72 A;  3D5J A;  5A1N B;  1TTZ A;  2OE3 A;  3GST A;  4BL7 A;  2AYT A;  3PR8 A;  1TOF A;  1AQW A;  1GLP A;  4OD7 A;  4EIP A;  1SEN A;  2F8A A;  2VOC A;  3D4T A;  2KP1 A;  4NWY A;  2H30 A;  5ECM B;  1W89 A;  2LS5 A;  1SVL A;  2OJL A;  4WR4 A;  2L4Q A;  3QD9 A;  1YDK A;  1ZYQ B;  2A2S A;  3W8S A;  3QDN A;  4G9H A;  1SK2 A;  1WE0 A;  4JED A;  1AIU A;  4MPG A;  3VPQ A;  4IQA A;  1ON4 A;  4XS4 A;  2B1K A;  1X9S B;  3KCM A;  4EO3 A;  3RHC A;  3IC4 A;  4V2N A;  4PUA A;  2AHE A;  2DLX A;  4I2T A;  1R5P A;  2L5O A;  2IMK A;  3ZML A;  1VGL A;  1SJZ A;  2XPE A;  3E0U A;  3FR6 A;  2LKU A;  2OBK A;  2Z9S A;  1CQH A;  4ISD A;  3FZA A;  1X9W B;  5ENU A;  4I6X A;  1AC1 A;  4IS0 A;  4HQS A;  1PD2 1;  3WD6 A;  1TRV A;  2IMD A;  3APS A;  4ZIJ A;  2M80 A;  2LRN A;  1B9X C;  4J56 E;  3EE2 A;  1F6M C;  3Q6O A;  3G7I A;  2YWI A;  2VCV A;  3F63 A;  1PL2 A;  1Z3E A;  4MZC A;  4O7H A;  3RDW A;  5IMF A;  3R2Q A;  2E7P A;  2HSH A;  3D0Z A;  5GAP D;  3NIV A;  3TJJ A;  2L6D A;  1BED A;  3TOT A;  4KF9 A;  1CQG A;  2DJ3 A;  5H5S A;  4KSM A;  3GL3 A;  2VD0 A;  4WEY A;  4QL9 A;  3GSS A;  1V57 A;  4O5U A;  1N8J A;  1QQ2 A;  3Q18 A;  1X9M B;  4TXV A;  2IIY A;  3LXT A;  4POL A;  2CX4 A;  2V2G A;  1ERT A;  1T4Z A;  3GX0 A;  1Y6E A;  4ZL8 A;  3UEM A;  3IDV A;  3CWG A;  1GUK A;  2F8F A;  3ERW A;  3HJP A;  4BVY B;  2IFQ A;  5IO2 A;  4K0G A;  1EWX A;  3IRA A;  4I97 A;  4G10 A;  2C80 A;  1AQV A;  1USB A;  14GS A;  1H75 A;  1OYJ A;  2N5B A;  3ZVJ D;  3FK8 A;  3BCK A;  1SYX A;  5DJL A;  2PVO C;  1EEM A;  2GST A;  4H86 A;  2PGT A;  4V2L A;  1XWG A;  2H19 A;  1YEW C;  3G9B A;  4G01 A;  2CV4 A;  3FZ4 A;  2DC5 A;  3CHX C;  4MDC A;  4OO4 A;  1Z7R A;  3ZFB A;  3PH9 A;  1GWC A;  2VKZ G;  2HFD A;  4QMK A;  4OO5 A;  2X4A A;  2K6V A;  3ZRD A;  3M9J A;  3UL3 A;  2EC4 A;  1GP1 A;  1GUM A;  2X8C A;  3D4M A;  2DJ1 A;  2L4C A;  2CVK A;  1A2J A;  1XG8 A;  3ZLP A;  1B4Q A;  2A2R A;  5A1N A;  3F4R A;  2YZU A;  2FD3 A;  5IMA A;  5FWG A;  4F9Z A;  3W6G A;  4G2E A;  1BYE A;  2VL9 A;  3GN3 A;  3C1S A;  5ECO B;  5IMC A;  5CYY A;  5BMU B;  3QAV A;  4MA9 A;  2FWE A;  1OKT A;  3ZZX A;  1R4W A;  6GSV A;  1FOV A;  2AJQ B;  2MZC A;  5G1L A;  5IOX A;  4GF0 A;  3EYT A;  2I3Y A;  4J2F A;  4GLT A;  4O5R A;  2CVB A;  2KUC A;  4WET A;  3EUR A;  4DSR A;  1WRY A;  4KAE A;  5DQS A;  1XWK A;  2C0G A;  4KCA A;  5HFG A;  1M2D A;  2HRK B;  3FEU A;  1SL1 B;  3L78 A;  1JZR A;  4L5O A;  3ZL5 A;  4PNG A;  1EZK A;  4AI6 A;  3TOU A;  2D2Z A;  1G6W A;  1ILO A;  3DD3 A;  1PRX A;  5ECS A;  1SVM A;  2FWH A;  4ZB8 A;  4KE3 A;  2MBT A;  2N5A A;  4YKG A;  2OAC A;  1OVN A;  2TRC P;  1S3C A;  2PVQ A;  1A24 A;  4AKH A;  2H0I A;  5G1K A;  4GST A;  1OKD A;  4GRF A;  3R3E A;  4YKF A;  8GSS A;  1K0C A;  1T7P B;  1TK0 B;  2OA7 A;  5DJM A;  2B1L A;  4HDE A;  1OC9 B;  4I8B A;  4MH2 A;  12GS A;  5KOW A;  5J40 A;  1GL8 A;  3C73 A;  1B4P A;  3TCO A;  2OE0 A;  2HZF A;  4QQ7 A;  4G0L A;  2H73 A;  4HS1 A;  5CO3 A;  1QMV A;  4XIH A;  5D8I A;  4EXJ A;  1F2E A;  1K3Y A;  4BVY A;  4N0V A;  5CNW A;  3BJ5 A;  1TK5 B;  4MH3 A;  1SL2 B;  5KN3 A;  1TJD A;  3TKS C;  1A8L A;  1AW9 A;  3F4T A;  2J23 A;  1XFL A;  2A4H A;  2QSI A;  1M9A A;  4IP1 A;  4ECC A;  5FT3 A;  2GSS A;  1Z6M A;  3FZ5 A;  3CBU A;  1U3A A;  4PQH A;  1GSS A;  4GDF A;  5INY A;  2FY6 A;  1ZOF A;  2HSN B;  2MYG A;  3L0H A;  5LCZ A;  1THX A;  2FA4 A;  3AY8 A;  4OFT A;  1XW6 A;  4BVX B;  1PKW A;  18GS A;  1SJI A;  2H01 A;  4O32 A;  1XWC A;  4XHM A;  2X64 A;  3FR3 A;  2V32 A;  3LFL A;  1EV9 A;  2LJA A;  2WZ9 A;  3E3E A;  2B7J A;  1DBY A;  2YJH A;  4IP6 A;  4V1A g;  5B6M A;  3TRP A;  4JRR A;  1ZCP A;  5EVO A;  4PUF C;  4TKY A;  1Y25 A;  4K2D A;  5J47 A;  4NHW A;  1T8E B;  1XIY A;  2YOI A;  2O36 A;  4PXO A;  5ECN B;  4O5Q A;  5L71 A;  3DEX A;  1NHY A;  2IJY A;  4Q5Q A;  1K0M A;  5BMU A;  1F9M A;  5JWR B;  2VLT A;  1RQM A;  2H70 A;  3DVX A;  1SKR B;  2DML A;  4LMV A;  2O87 A;  4IVF A;  3LJR A;  4RI7 A;  1K0D A;  4ULX A;  3QFB C;  4X43 A;  2AAW A;  4GSN A;  3FHK A;  3APO A;  2H0H A;  2VD1 A;  1SYR A;  3GYK A;  5HR3 A;  5GAN D;  4NHZ A;  2HZE B;  4CY8 A;  2HRK A;  4KDX A;  2H1A A;  2I4A A;  6GSY A;  3L9S A;  5GZZ B;  2GQK A;  5D9T A;  3SBC A;  2HE3 A;  3DML A;  4ICY A;  2ZNM A;  1ZMA A;  4KDU A;  5GSS A;  5KOX A;  5J9B A;  2GZY A;  3H79 A;  2LEG A;  3DYR A;  2C3N A;  4CHS A;  3EIN A;  3CMI A;  2FCH A;  1S3A A;  5HR2 A;  3GNJ A;  2DJK A;  1AXD A;  3CSI A;  3MYD A;  3VI5 A;  1S3R A;  4EDZ A;  1O7U A;  4QL7 A;  3C71 A;  5DVB A;  3GH9 A;  4Z2U A;  1SKW B;  3MIX A;  4K7N A;  2YP6 A;  1LJR A;  1OC9 A;  2KP2 A;  4IHU A;  3I69 A;  5B8B A;  4OWY A;  3WT2 A;  4KGI A;  5A4V A;  2GT6 A;  1KTE A;  3HVV A;  3ERG A;  1TK8 B;  2ZUP A;  1FB0 A;  3QFA C;  2FA8 A;  3PPU A;  5A4W A;  4WKW A;  1FG4 A;  1UA5 A;  2WGR A;  3LQ7 A;  10GS A;  5JCU A;  1QK8 A;  4GXZ A;  3VPT A;  2DBC A;  1N25 A;  3VWU A;  2RM6 A;  1KBN A;  2H1L A;  3KMN A;  1OC8 A;  2HSM B;  4XRD A;  2YZH A;  3F6D A;  2FWG A;  3UIW A;  3PGT A;  2B7K A;  2CQ9 A;  4MNN A;  5DDL A;  2PER A;  1JLV A;  3VWV A;  2PU9 C;  5D9V A;  4Z2R A;  3E9J B;  2UZ8 A;  2OAD A;  4BPY A;  1Y1U A;  1R26 A;  1XPV A;  2HSN A;  4DSS B;  4KX4 A;  2TIR A;  1I5G A;  4X1U A;  1GTB A;  4BVX A;  1PSQ A;  5KN0 A;  1VF4 A;  2XBQ A;  1DUG A;  1Z5Y E;  4A5P A;  1LBK A;  1R7H A;  3V1W A;  4TR4 A;  1AUC A;  3BD2 A;  1ZGN A;  5J3R A;  2GZZ A;  1MDJ A;  4ML6 A;  3DIE A;  1K3O A;  1TP9 A;  3DRN A;  1TU7 A;  1JZO A;  1X5D A;  5ECH B;  2GT5 A;  2VCZ A;  5D93 A;  2QA2 A;  1ABA A;  3EU3 A;  2LUS A;  4TW5 A;  2YPM A;  2DMM A;  2B3S A;  2HXK A;  1TDI A;  1HQO A;  4ECI A;  2PPT A;  3TKQ A;  5IPG A;  5AIS A;  3ZMK A;  1ST9 A;  3Q19 A;  1C72 A;  1V58 A;  3H4K A;  3RAZ A;  4OMV A;  4YAP A;  3IAS 2;  5ELG A;  2LQQ A;  1U87 A;  5IIZ A;  1XCC A;  5G31 A;  4F2I A;  1NSW A;  4TN8 A;  6GSU A;  1TRS A;  1GTA A;  5E59 A;  3VI7 A;  4KND A;  4X4J A;  3UJ1 A;  1A8Y A;  3VUR A;  2EFC A;  1UC7 A;  1PX6 A;  3GL5 A;  1ZZY A;  2FHE A;  6GST A;  2HZE A;  5CAX A;  2XC2 A;  3C8E A;  3RGB C;  4K1F A;  4Z7X A;  5A34 B;  2IME A;  2R2J A;  4GCI A;  3M8N A;  1MDK A;  1N2A A;  2R4V A;  5HFK A;  3F6F A;  1M99 A;  1TRW A;  4WF5 A;  1J08 A;  3C7M A;  4DEJ A;  2GTU A;  4YQM A;  3LYP A;  3IAM 2;  2G0F A;  2QKE A;  2H1B A;  1YKA A;  2LNS A;  1YKC A;  4PI2 C;  1BQ7 A;  2XPD A;  3HD5 A;  3GH6 A;  4PX1 A;  1GH2 A;  1I9D A;  1OC3 A;  4MJA A;  2X8H A;  1SU9 A;  19GS A;  2V41 A;  4ZB9 A;  4N10 A;  3RPN A;  2J9H A;  4WXT A;  3KIJ A;  2HRN A;  2JAC A;  9GSS A;  3LG6 A;  1S4B P;  5ID2 B;  2F3M A;  1O8X A;  3ISO A;  1YEP A;  1ERW A;  2R5G A;  3HVN A;  1ML6 A;  1RK4 A;  4X0X A;  2MBS A;  3HZ4 A;  2REM A;  2OBI A;  13GS A;  3US3 A;  3N5O A;  3CTF A;  2H1D A;  1O73 A;  2LNT A;  3GUS A;  3H8Q A;  3K8N A;  3O76 A;  2P5R A;  3NOF A;  4ZBD A;  2HI7 A;  3KZQ A;  4ZIL A;  2EFE A;  4AF2 A;  5HQP A;  2HSM A;  1SL0 B;  5DAK B;  3HVS A;  3U6V A;  3A5W A;  3LOR A;  6GSX A;  4V2M A;  4JZQ A;  5DCH A;  4JE1 A;  3KP8 A;  4MPF A;  3DKS A;  2C3Q A;  2GGT A;  2UV8 G;  4HJ2 A;  3FYG A;  4DSS A;  4JBB A;  1F37 A;  1JZW A;  1WWJ A;  2AB6 A;  1B48 A;  5J4V A;  4IJI A;  4IGJ A;  2CZ2 A;  2X49 A;  2WW1 A;  4K2X A;  4NV5 A;  4JR4 A;  1TRU A;  3UMA A;  1B8X A;  2PBJ A;  5C04 A;  3QAW A;  3I9V 2;  3SWL A;  1GRX A;  5G5F A;  1FOH A;  1PX7 A;  3GKK A;  5IMD A;  2JZS A;  3HJO A;  4AKX B;  5G5E A;  1BJX A;  2IL3 A;  4MZB A;  1R5A A;  5LD0 A;  4OFM A;  1YZX A;  4N11 A;  2VIM A;  5J9C A;  2IWT A;  3TDG A;  4XRA A;  5COH A;  3FRC A;  4MJC A;  2MMN A;  2KOK A;  3GMF A;  4MF5 A;  3HDC A;  3TUE A;  4TRX A;  5D96 A;  3O6T A;  4YQU A;  4FYU A;  4XCS A;  3KTL A;  5J41 A;  5IPH A;  1FB6 A;  1JZD A;  2LV3 A;  6GSS A;  2YWN A;  5EY6 A;  2BJX A;  2H75 A;  2DSA A;  4PTS A;  2C1Y A;  5F05 A;  3ED3 A;  3FY7 A;  1SK1 A;  3HJM A;  2ON7 A;  3IK9 A;  2WFC A;  4P3Y B;  4E8E A;  3ZTL A;  3MAK A;  3GFK A;  3ZIJ A;  3O3T A;  1A23 A;  1X5E A;  1YEX A;  5A34 A;  2L6C A;  4XS6 A;  3GHA A;  3KM6 A;  3D21 A;  2FNO A;  1WPI A;  2DKH A;  4G0K A;  1G7E A;  2H74 A;  3HZ8 A;  3EWL A;  2DIZ A;  4LL4 B;  3GUR A;  1WIK A;  5B8A A;  2DJJ A;  2L5L A;  2WW0 A;  3IK7 A;  4EVM A;  5ECP B;  4EL1 A;  2M72 A;  4K7O A;  4KCE A;  3IC8 A;  3TRX A;  3IR4 A;  1Z9H A;  4K0N A;  3APQ A;  5ECR B;  4GSS A;  4DSQ A;  4L8E A;  3TJG A;  1THO A;  3TKS E;  4GQF A;  2LTK A;  5GST A;  4N30 A;  5CRE A;  3KMO A;  2K9F A;  2FGX A;  4HJM A;  1ZYN A;  4GTU A;  2E2M A;  4Q5R A;  1U3I A;  1ZL9 A;  3BCI A;  4ID0 A;  5ID2 A;  4HU9 A;  1FAA A;  2YAN A;  5CRG A;  4BIK A;  1K3L A;  4IJ3 A;  2VCT A;  4FYC A;  4MK3 A;  2HQT A;  1F3B A;  3P8W A;  5CRH A;  4O92 A;  1EGR A;  3PIN A;  5H5Q A;  1XVW A;  5A5H B;  5DAK A;  3LEF A;  4PNF A;  5KEJ A;  2F9S A;  4ECJ A;  1GNW A;  2R37 A;  4NV2 A;  2FUG 2;  3HA9 A;  2WZS A;  3M0F A;  2C0E A;  3A2V A;  1GNE A;  5HR1 A;  3M9K A;  2CAQ A;  1VF3 A;  1ERV A;  4JU5 A;  4L0W A;  4POB A;  2R0C A;  4TOP A;  3VK9 A;  4FYB A;  4NAX A;  1BG1 A;  1O8W A;  1A2M A;  4HZ2 A;  4MAB A;  2IMI A;  1SVO A;  4NMU A;  2JZR A;  1MDI A;  2FLS A;  2VAF A;  3P2A A;  1E6B A;  5JCG A;  2EIO A;  3UBK A;  3S9F A;  1BG5 A;  2X8G A;  1GSF A;  1EV4 A;  1GTU A;  5DAL B;  6GSW A;  2WVZ A;  4MJE A;  4MZW A;  1EGO A;  1XW5 A;  4MMM A;  4I2U A;  1Z7P A;  3L4N A;  4HU7 A;  1BAY A;  2WRT A;  4KSO A;  4HEA 2;  2VO4 A;  3IHQ A;  4IN0 A;  1YF0 A;  4KW6 A;  1GSD A;  1VF1 A;  2CT6 A;  2HRA A;  5ECK B;  2H6Z A;  3ZFL A;  3DXB A;  2P31 A;  1JFU A;  4PGT A;  4TR1 B;  3QAG A;  1FHE A;  2YWO A;  2PWJ A;  2IMF A;  4WBR D;  2ZCT A;  4IEL A;  2OKA A;  2CZ3 A;  3MSZ A;  4USS A;  16GS A;  1PQN A;  1T1V A;  5F07 A;  1XWB A;  4J57 E;  2HNL A;  3TJK A;  4LA1 A;  2IN3 A;  1BX9 A;  4ACS A;  3CYN A;  3P90 A;  1HYU A;  2WUL A;  4EKZ A;  1YJ6 A;  1T3B A;  3GV1 A;  4TR0 A;  2YJ7 A;  1JLW A;  1K0N A;  4ILF A;  3CRT A;  3D22 A;  5F8B A;  2E0Q A;  2GDR A;  1YVL A;  3CTG A;  3IXR A;  4FIW A;  3FMW A;  3ERF A;  4Q5N A;  2GS3 A;  3IOS A;  5EPF A;  1K0O A;  2O8V B;  4CW9 A;  1XBS A;  3U5R E;  3A3T A;  1M3J A;  5H5R A;  1YF1 A;  3DVW A;  2KLX A;  3UVT A;  4G0I A;  2GQM A;  4LL1 B;  1YQ1 A;  4AKI A;  5EL8 A;  1PFO A;  2NBS A;  2NPB A;  2WVY A;  4FXY P;  2LQO A;  4OFN A;  2P0G A;  1T00 A;  2AV4 A;  4CY6 A;  1TI1 A;  4PUR A;  1I1I P;  3F3Q A;  4AGS A;  3H1N A;  4POK A;  5JWQ B;  1DE1 A;  17GS A;  2TRX A;  2X99 A;  1DE2 A;  5A5H A;  5FHI A;  1HNA A;  5A5K A;  2V6K A;  3LYK A;  1K0B A;  3MNG A;  2BMX A;  2WW3 A;  2GSR A;  3L9V A;  3CRU A;  4POM A;  4F0C A;  2RM5 A;  2MMO A;  1ZYP A;  3FKF A;  1MEK A;  1MD3 A;  2BTO T;  2OT3 A;  4PQ1 A;  1FW1 A;  3UVH A;  2DJ2 A;  2KHP A;  2N5F A;  3ZVJ A;  1FVJ A;  1G7O A;  2CX3 A;  1XWA A;  2C8U A;  3CXG A;  1EP7 A;  2DKI A;  2XHF A;  4CDO A;  3EPT A;  3IPZ A;  3LWA A;  1PMT A;  2VM2 A;  3A2W A;  3TU3 B;  4EF0 A;  5ELA A;  3KJY A;  4YQV A;  1FVK A;  2MMA A;  5DAL A;  4KH7 A;  1B9Y C;  2VUP A;  3Q74 A;  5IMV A;  2HSY A;  1QUW A;  1U6T A;  5CRW A;  3ME8 A;  3KXO A;  4L5L A;  1ACV A;  1M9B A;  1OE8 A;  1SD9 A;  4FO5 A;  1DSB A;  3DGQ A;  2LRC A;  2YCD A;  2EFD A;  3G7Y A;  1H4O A;  3FW2 A;  3F0I A;  4TR1 A;  4MLY A;  1EEJ A;  1AAZ A;  4HSC X;  4ML1 A;  1M2B A;  2VCW A;  4Q5F A;  2V6O A;  3ZIT A;  3IA1 A;  5C00 A;  4D73 A;  1A0R P;  2HLS A;  3DWV A;  1XOA A;  2HRF A;  3KEB A;  4HZ4 A;  5ABR A;  1K0A A;  3L9U A;  2H8L A;  1WOU A;  4RQX A;  4LMW A;  2K8V A;  2YV9 A;  3HXS A;  1KEB A;  3QCP A;  3ME7 A;  2JSZ A;  2VCQ A;  2A4V A;  3TJF A;  1MTC A;  2HT9 A;  3EC3 A;  4MF7 A;  3ZYW A;  4ZB6 A;  5F0G A;  2C0F A;  3J7Y k;  1WJK A;  2GVP A;  4KUN A;  2VCX A;  5J5N A;  3GKM A;  2H71 A;  3M1G A;  1AQX A;  1LU4 A;  1XXU A;  1F3A A;  1QXH A;  1V40 A;  4PHZ C;  3IHG A;  3QMX A;  4OCE A;  4Z2T A;  5IMZ A;  4KDY A;  1XZO A;  3LXZ A;  1VRS D;  1V2A A;  3WT1 A;  1TW9 A;  1UN2 A;  5JWO B;  3GX8 A;  5JCW A;  3UAP A;  3KTB A;  1EOG A;  3KGK A;  3TRQ A;  3VFI A;  5HFI A;  1ZYE A; 
#chains in the Genus database with same CATH homology
 3KD0 A;  3HMJ G;  2QA1 A;  1X5C A;  1WMJ A;  2A2P A;  3TKR A;  4E68 A;  3GTU B;  5AIV A;  1S3D A;  5CRD A;  2CVD A;  2WJU A;  3IBH A;  2JAD A;  2V1M A;  3LGC A;  2F51 A;  4IW9 A;  4N3Z A;  2O7K A;  2E2G A;  1HNB A;  3HKR A;  2PMT A;  4YH2 A;  4IQ1 A;  2NDO A;  5HR0 A;  4HI7 A;  5B6N A;  4G19 A;  2YWM A;  3A5I A;  2RUF A;  3IE3 A;  1Q98 A;  5J4Y A;  2ALB A;  5DBQ A;  3CSJ A;  3KH9 A;  3LSZ A;  5IOW A;  1PKZ A;  5DCG A;  2YN1 A;  1GSE A;  2GZP A;  3F4S A;  2CA8 A;  1J0F A;  2MMZ A;  4KA0 A;  5DQY A;  22GS A;  1GUL A;  5A4U A;  1ERU A;  3VLN A;  2H0G A;  5LNK e;  3TJB A;  3FR9 A;  1GLQ A;  2VL3 A;  3VWW A;  2JU5 A;  3WGE A;  2C0D A;  4BA7 A;  2H1G A;  3C1R A;  2EIR A;  1Q4J A;  1A0F A;  1W4V A;  4WR5 A;  3UBL A;  4NPB A;  5D73 A;  2B5Y A;  2RLI A;  4ZXG A;  5B7C A;  1IYI A;  4TXO B;  2YNX A;  1YY7 A;  5G30 A;  3M3M A;  3GKX A;  2VM1 A;  4EIQ A;  1GSY A;  4ZL7 A;  4RUV A;  5AN1 A;  1Z6N A;  1O6J A;  3QPM A;  5ECL B;  4AKG A;  1IYH A;  4ZB7 A;  1EP8 A;  4HQZ A;  3GIX A;  2WDU A;  1RW1 A;  2JZT A;  4KB3 A;  2O85 A;  4MJB A;  1V98 A;  2VLU A;  2VL2 C;  4OCF A;  4LLR A;  2LST A;  3HVX A;  3HY2 A;  2VL2 A;  4MP4 A;  3J7Y b;  3EVI A;  4I5Q A;  3RBT A;  4BWS A;  3G7J A;  1PA3 A;  4MCU A;  2I1U A;  1TU8 A;  3RPP A;  2H6X A;  2M46 A;  2RUE A;  5D9W A;  3TKP A;  3UOM A;  4MF6 A;  3F9U A;  1NHO A;  4L0U A;  1GSQ A;  4XS1 A;  4GWR A;  4AJ6 A;  3EMX A;  5ECQ B;  4BL7 B;  2WCI A;  3BOA A;  3CSH A;  3I43 A;  3OR5 A;  3BBY A;  3TKS A;  2YV7 A;  2FWF A;  4RQR A;  2L57 A;  4TR3 A;  2WB9 A;  2OE1 A;  2K8S A;  5IQY A;  5IM9 A;  4NXI A;  1UVZ A;  1PL1 A;  1JHB A;  4E8H A;  1V9W A;  2B5X A;  3D6I A;  1SJ6 A;  5ECI B;  2H66 A;  1TI3 A;  3IV4 A;  3EU4 A;  2GLR A;  1TKD B;  1PN0 A;  3W8J A;  3ZIV A;  4RI6 A;  3A2X A;  4GQC A;  4JR6 A;  1M2A A;  4K6X A;  2R0G A;  3FZ9 A;  2CAI A;  4HUA A;  4XS4 B;  1GTI A;  1NW2 A;  2ON5 A;  3KH7 A;  5KN1 A;  4BWQ A;  2NTO A;  2DJ0 A;  3KP9 A;  1O85 A;  5J4U A;  2K18 A;  2R0P A;  1OAZ A;  4ZBA A;  5BRT A;  1GSU A;  3GTU A;  3UAR A;  1O81 A;  2WS2 A;  2P5Q A;  2L59 A;  2VLV A;  4EC0 A;  1U88 A;  3I6A A;  4F03 A;  1VF2 A;  1T4Y A;  1FO5 A;  2C3T A;  3HYP A;  2AUV A;  2I81 A;  3JCM L;  4K9Z A;  4IKH A;  4ZL9 A;  5AIX A;  2HYX A;  3GRX A;  3WGD A;  2LRT A;  3HCZ A;  3QOU A;  1G6Y A;  3WYW A;  2DIY A;  3QR6 A;  1EOH A;  1PGT A;  4N0Z A;  2EIQ A;  5KN2 A;  3LW9 A;  3GA4 A;  4FQU A;  4PQI A;  1HD2 A;  1M7T A;  5AGY A;  2XBI A;  2LJK A;  4XTS A;  1X0R A;  2NVL A;  5CP1 A;  4EE0 A;  4IBP A;  3GKN A;  1G0T A;  3P7X A;  5E4W A;  2RII A;  4W66 A;  1PN9 A;  1TXX A;  20GS A;  3VWX A;  2B6M A;  4EDY A;  1GUH A;  2C4J A;  3TGZ A;  1MD4 A;  1OE7 A;  4K5R A;  4HOJ A;  1KNG A;  3MWH A;  4D73 B;  1QFN A;  1M0U A;  4K8M A;  1BF5 A;  1XVQ A;  3NZN A;  2G2Q A;  1SK0 A;  3F8U A;  7GSS A;  1XW9 A;  2IFQ B;  2EFH A;  2QGV A;  2JL4 A;  4YAV A;  2GQL A;  2JSY A;  3ZRE A;  4WF4 A;  4EUY A;  5G2Z A;  4TXO A;  5D9X A;  4F0B A;  1SKS B;  2R6K A;  4FH8 A;  4F82 A;  2GSQ A;  2H6Y A;  3F3R A;  1E2Y A;  1J9B A;  2B5E A;  4TVE A;  3N9J A;  1TXU A;  2QC7 A;  11GS A;  3MDK A;  4K7I A;  1WP0 A;  4AJ7 A;  2R3X A;  4DVC A;  3TB2 A;  4WBJ A;  4ECB A;  5F06 A;  4ZBB A;  1SD8 A;  5IO0 A;  4K5S A;  1NM3 A;  1A2L A;  2I9H A;  2PN8 A;  1URM A;  2IPA A;  2LJR A;  4AJ8 A;  2H76 A;  2ES7 A;  3WGX A;  2PUK C;  3H93 A;  1QGV A;  2O89 A;  2O5V A;  1XOB A;  3HHV A;  1HNC A;  3EMP A;  3RHB A;  4V1A p;  2H72 A;  3D5J A;  5A1N B;  1TTZ A;  2OE3 A;  3GST A;  4BL7 A;  2AYT A;  3PR8 A;  1TOF A;  1AQW A;  1GLP A;  4OD7 A;  4EIP A;  1SEN A;  2F8A A;  2VOC A;  3D4T A;  2KP1 A;  4NWY A;  2H30 A;  5ECM B;  1W89 A;  2LS5 A;  1SVL A;  2OJL A;  4WR4 A;  2L4Q A;  3QD9 A;  1YDK A;  1ZYQ B;  2A2S A;  3W8S A;  3QDN A;  4G9H A;  1SK2 A;  1WE0 A;  4JED A;  1AIU A;  4MPG A;  3VPQ A;  4IQA A;  1ON4 A;  4XS4 A;  2B1K A;  1X9S B;  3KCM A;  4EO3 A;  3RHC A;  3IC4 A;  4V2N A;  4PUA A;  2AHE A;  2DLX A;  4I2T A;  1R5P A;  2L5O A;  2IMK A;  3ZML A;  1VGL A;  1SJZ A;  2XPE A;  3E0U A;  3FR6 A;  2LKU A;  2OBK A;  2Z9S A;  1CQH A;  4ISD A;  3FZA A;  1X9W B;  5ENU A;  4I6X A;  1AC1 A;  4IS0 A;  4HQS A;  1PD2 1;  3WD6 A;  1TRV A;  2IMD A;  3APS A;  4ZIJ A;  2M80 A;  2LRN A;  1B9X C;  4J56 E;  3EE2 A;  1F6M C;  3Q6O A;  3G7I A;  2YWI A;  2VCV A;  3F63 A;  1PL2 A;  1Z3E A;  4MZC A;  4O7H A;  3RDW A;  5IMF A;  3R2Q A;  2E7P A;  2HSH A;  3D0Z A;  5GAP D;  3NIV A;  3TJJ A;  2L6D A;  1BED A;  3TOT A;  4KF9 A;  1CQG A;  2DJ3 A;  5H5S A;  4KSM A;  3GL3 A;  2VD0 A;  4WEY A;  4QL9 A;  3GSS A;  1V57 A;  4O5U A;  1N8J A;  1QQ2 A;  3Q18 A;  1X9M B;  4TXV A;  2IIY A;  3LXT A;  4POL A;  2CX4 A;  2V2G A;  1ERT A;  1T4Z A;  3GX0 A;  1Y6E A;  4ZL8 A;  3UEM A;  3IDV A;  3CWG A;  1GUK A;  2F8F A;  3ERW A;  3HJP A;  4BVY B;  2IFQ A;  5IO2 A;  4K0G A;  1EWX A;  3IRA A;  4I97 A;  4G10 A;  2C80 A;  1AQV A;  1USB A;  14GS A;  1H75 A;  1OYJ A;  2N5B A;  3ZVJ D;  3FK8 A;  3BCK A;  1SYX A;  5DJL A;  2PVO C;  1EEM A;  2GST A;  4H86 A;  2PGT A;  4V2L A;  1XWG A;  2H19 A;  3G9B A;  4G01 A;  2CV4 A;  3FZ4 A;  2DC5 A;  4MDC A;  4OO4 A;  1Z7R A;  3ZFB A;  3PH9 A;  1GWC A;  2VKZ G;  2HFD A;  4QMK A;  4OO5 A;  2X4A A;  2K6V A;  3ZRD A;  3M9J A;  3UL3 A;  2EC4 A;  1GP1 A;  1GUM A;  2X8C A;  3D4M A;  2DJ1 A;  2L4C A;  2CVK A;  1A2J A;  3ZLP A;  1B4Q A;  2A2R A;  5A1N A;  3F4R A;  2YZU A;  2FD3 A;  5IMA A;  5FWG A;  4F9Z A;  3W6G A;  4G2E A;  1BYE A;  2VL9 A;  3GN3 A;  3C1S A;  5ECO B;  5IMC A;  5CYY A;  5BMU B;  3QAV A;  4MA9 A;  2FWE A;  1OKT A;  3ZZX A;  1R4W A;  6GSV A;  1FOV A;  2AJQ B;  2MZC A;  5G1L A;  5IOX A;  4GF0 A;  3EYT A;  2I3Y A;  4J2F A;  4GLT A;  4O5R A;  2CVB A;  2KUC A;  4WET A;  3EUR A;  4DSR A;  1WRY A;  4KAE A;  5DQS A;  1XWK A;  2C0G A;  4KCA A;  5HFG A;  1M2D A;  2HRK B;  3FEU A;  1SL1 B;  3L78 A;  1JZR A;  4L5O A;  3ZL5 A;  4PNG A;  1EZK A;  4AI6 A;  3TOU A;  2D2Z A;  1G6W A;  1ILO A;  3DD3 A;  1PRX A;  5ECS A;  1SVM A;  2FWH A;  4ZB8 A;  4KE3 A;  2MBT A;  2N5A A;  4YKG A;  2OAC A;  1OVN A;  2TRC P;  1S3C A;  2PVQ A;  1A24 A;  4AKH A;  2H0I A;  5G1K A;  4GST A;  1OKD A;  4GRF A;  3R3E A;  4YKF A;  8GSS A;  1K0C A;  1T7P B;  1TK0 B;  2OA7 A;  5DJM A;  2B1L A;  4HDE A;  1OC9 B;  4I8B A;  4MH2 A;  12GS A;  5KOW A;  5J40 A;  1GL8 A;  3C73 A;  1B4P A;  3TCO A;  2OE0 A;  2HZF A;  4QQ7 A;  4G0L A;  2H73 A;  4HS1 A;  5CO3 A;  1QMV A;  4XIH A;  5D8I A;  4EXJ A;  1F2E A;  1K3Y A;  4BVY A;  4N0V A;  5CNW A;  3BJ5 A;  1TK5 B;  4MH3 A;  1SL2 B;  5KN3 A;  1TJD A;  3TKS C;  1A8L A;  1AW9 A;  3F4T A;  2J23 A;  1XFL A;  2A4H A;  2QSI A;  1M9A A;  4IP1 A;  4ECC A;  5FT3 A;  2GSS A;  1Z6M A;  3FZ5 A;  3CBU A;  1U3A A;  4PQH A;  1GSS A;  4GDF A;  5INY A;  2FY6 A;  1ZOF A;  2HSN B;  2MYG A;  3L0H A;  5LCZ A;  1THX A;  2FA4 A;  3AY8 A;  4OFT A;  1XW6 A;  4BVX B;  1PKW A;  18GS A;  1SJI A;  2H01 A;  4O32 A;  1XWC A;  4XHM A;  2X64 A;  3FR3 A;  2V32 A;  3LFL A;  1EV9 A;  2LJA A;  2WZ9 A;  3E3E A;  2B7J A;  1DBY A;  2YJH A;  4IP6 A;  4V1A g;  5B6M A;  3TRP A;  4JRR A;  1ZCP A;  5EVO A;  4PUF C;  4TKY A;  1Y25 A;  4K2D A;  5J47 A;  4NHW A;  1T8E B;  1XIY A;  2YOI A;  4PXO A;  5ECN B;  4O5Q A;  5L71 A;  3DEX A;  1NHY A;  2IJY A;  4Q5Q A;  1K0M A;  5BMU A;  1F9M A;  5JWR B;  2VLT A;  1RQM A;  2H70 A;  3DVX A;  1SKR B;  2DML A;  4LMV A;  2O87 A;  4IVF A;  3LJR A;  4RI7 A;  1K0D A;  4ULX A;  3QFB C;  4X43 A;  2AAW A;  4GSN A;  3FHK A;  3APO A;  2H0H A;  2VD1 A;  1SYR A;  3GYK A;  5HR3 A;  5GAN D;  4NHZ A;  2HZE B;  4CY8 A;  2HRK A;  4KDX A;  2H1A A;  2I4A A;  6GSY A;  3L9S A;  5GZZ B;  2GQK A;  5D9T A;  3SBC A;  2HE3 A;  3DML A;  4ICY A;  2ZNM A;  1ZMA A;  4KDU A;  5GSS A;  5KOX A;  5J9B A;  2GZY A;  3H79 A;  2LEG A;  3DYR A;  2C3N A;  4CHS A;  3EIN A;  3CMI A;  2FCH A;  1S3A A;  5HR2 A;  3GNJ A;  2DJK A;  1AXD A;  3CSI A;  3MYD A;  3VI5 A;  4EDZ A;  1O7U A;  4QL7 A;  3C71 A;  5DVB A;  3GH9 A;  4Z2U A;  1SKW B;  3MIX A;  4K7N A;  2YP6 A;  1LJR A;  1OC9 A;  2KP2 A;  4IHU A;  3I69 A;  5B8B A;  4OWY A;  3WT2 A;  4KGI A;  5A4V A;  2GT6 A;  1KTE A;  3HVV A;  3ERG A;  1TK8 B;  2ZUP A;  1FB0 A;  3QFA C;  2FA8 A;  3PPU A;  5A4W A;  4WKW A;  1FG4 A;  1UA5 A;  2WGR A;  3LQ7 A;  10GS A;  5JCU A;  1QK8 A;  4GXZ A;  3VPT A;  2DBC A;  1N25 A;  3VWU A;  2RM6 A;  1KBN A;  2H1L A;  3KMN A;  1OC8 A;  2HSM B;  4XRD A;  2YZH A;  3F6D A;  2FWG A;  3UIW A;  3PGT A;  2B7K A;  2CQ9 A;  4MNN A;  5DDL A;  2PER A;  1JLV A;  3VWV A;  2PU9 C;  5D9V A;  4Z2R A;  3E9J B;  2UZ8 A;  2OAD A;  4BPY A;  1Y1U A;  1R26 A;  1XPV A;  2HSN A;  4DSS B;  4KX4 A;  2TIR A;  1I5G A;  4X1U A;  1GTB A;  4BVX A;  1PSQ A;  5KN0 A;  1VF4 A;  2XBQ A;  1DUG A;  1Z5Y E;  4A5P A;  1LBK A;  1R7H A;  3V1W A;  4TR4 A;  1AUC A;  3BD2 A;  1ZGN A;  5J3R A;  2GZZ A;  1MDJ A;  4ML6 A;  3DIE A;  1K3O A;  1TP9 A;  3DRN A;  1TU7 A;  1JZO A;  1X5D A;  5ECH B;  2GT5 A;  2VCZ A;  5D93 A;  2QA2 A;  1ABA A;  3EU3 A;  2LUS A;  4TW5 A;  2YPM A;  2DMM A;  2B3S A;  2HXK A;  1TDI A;  1HQO A;  4ECI A;  2PPT A;  3TKQ A;  5IPG A;  5AIS A;  3ZMK A;  1ST9 A;  3Q19 A;  1C72 A;  1V58 A;  3H4K A;  3RAZ A;  4OMV A;  4YAP A;  3IAS 2;  5ELG A;  2LQQ A;  1U87 A;  5IIZ A;  1XCC A;  5G31 A;  4F2I A;  1NSW A;  4TN8 A;  6GSU A;  1TRS A;  1GTA A;  5E59 A;  3VI7 A;  4KND A;  4X4J A;  3UJ1 A;  1A8Y A;  3VUR A;  2EFC A;  1UC7 A;  1PX6 A;  3GL5 A;  1ZZY A;  2FHE A;  6GST A;  2HZE A;  5CAX A;  2XC2 A;  3C8E A;  4K1F A;  4Z7X A;  5A34 B;  2IME A;  2R2J A;  4GCI A;  3M8N A;  1MDK A;  1N2A A;  2R4V A;  5HFK A;  3F6F A;  1M99 A;  1TRW A;  4WF5 A;  1J08 A;  3C7M A;  4DEJ A;  2GTU A;  4YQM A;  3LYP A;  3IAM 2;  2G0F A;  2QKE A;  2H1B A;  1YKA A;  2LNS A;  1YKC A;  1BQ7 A;  2XPD A;  3HD5 A;  3GH6 A;  4PX1 A;  1GH2 A;  1I9D A;  1OC3 A;  4MJA A;  2X8H A;  1SU9 A;  19GS A;  2V41 A;  4ZB9 A;  4N10 A;  3RPN A;  2J9H A;  4WXT A;  3KIJ A;  2HRN A;  2JAC A;  9GSS A;  3LG6 A;  5ID2 B;  2F3M A;  1O8X A;  3ISO A;  1YEP A;  1ERW A;  2R5G A;  1ML6 A;  1RK4 A;  4X0X A;  2MBS A;  3HZ4 A;  2REM A;  2OBI A;  13GS A;  3US3 A;  3N5O A;  3CTF A;  2H1D A;  1O73 A;  2LNT A;  3GUS A;  3H8Q A;  3K8N A;  3O76 A;  2P5R A;  3NOF A;  4ZBD A;  2HI7 A;  3KZQ A;  4ZIL A;  2EFE A;  4AF2 A;  5HQP A;  2HSM A;  1SL0 B;  5DAK B;  3HVS A;  3U6V A;  3A5W A;  3LOR A;  6GSX A;  4V2M A;  4JZQ A;  5DCH A;  4JE1 A;  3KP8 A;  4MPF A;  3DKS A;  2C3Q A;  2GGT A;  2UV8 G;  4HJ2 A;  3FYG A;  4DSS A;  4JBB A;  1F37 A;  1JZW A;  1WWJ A;  2AB6 A;  1B48 A;  5J4V A;  4IJI A;  4IGJ A;  2CZ2 A;  2X49 A;  4K2X A;  4NV5 A;  4JR4 A;  1TRU A;  3UMA A;  1B8X A;  2PBJ A;  5C04 A;  3QAW A;  3I9V 2;  3SWL A;  1GRX A;  5G5F A;  1FOH A;  1PX7 A;  3GKK A;  5IMD A;  2JZS A;  3HJO A;  4AKX B;  5G5E A;  1BJX A;  2IL3 A;  4MZB A;  1R5A A;  5LD0 A;  4OFM A;  1YZX A;  4N11 A;  2VIM A;  5J9C A;  2IWT A;  3TDG A;  4XRA A;  5COH A;  3FRC A;  4MJC A;  2MMN A;  2KOK A;  3GMF A;  4MF5 A;  3HDC A;  3TUE A;  4TRX A;  5D96 A;  3O6T A;  4YQU A;  4FYU A;  4XCS A;  3KTL A;  5J41 A;  5IPH A;  1FB6 A;  1JZD A;  2LV3 A;  6GSS A;  2YWN A;  5EY6 A;  2BJX A;  2H75 A;  2DSA A;  4PTS A;  2C1Y A;  5F05 A;  3ED3 A;  3FY7 A;  1SK1 A;  3HJM A;  2ON7 A;  3IK9 A;  2WFC A;  4P3Y B;  4E8E A;  3ZTL A;  3MAK A;  3GFK A;  3ZIJ A;  3O3T A;  1A23 A;  1X5E A;  1YEX A;  5A34 A;  2L6C A;  4XS6 A;  3GHA A;  3KM6 A;  3D21 A;  2FNO A;  1WPI A;  2DKH A;  4G0K A;  1G7E A;  2H74 A;  3HZ8 A;  3EWL A;  2DIZ A;  4LL4 B;  3GUR A;  1WIK A;  5B8A A;  2DJJ A;  2L5L A;  3IK7 A;  4EVM A;  5ECP B;  4EL1 A;  2M72 A;  4K7O A;  4KCE A;  3IC8 A;  3TRX A;  3IR4 A;  1Z9H A;  4K0N A;  3APQ A;  5ECR B;  4GSS A;  4DSQ A;  4L8E A;  3TJG A;  1THO A;  3TKS E;  4GQF A;  2LTK A;  5GST A;  4N30 A;  5CRE A;  3KMO A;  2K9F A;  2FGX A;  4HJM A;  1ZYN A;  4GTU A;  2E2M A;  4Q5R A;  1U3I A;  1ZL9 A;  3BCI A;  4ID0 A;  5ID2 A;  4HU9 A;  1FAA A;  2YAN A;  5CRG A;  1K3L A;  4IJ3 A;  2VCT A;  4FYC A;  4MK3 A;  2HQT A;  1F3B A;  3P8W A;  5CRH A;  4O92 A;  1EGR A;  3PIN A;  5H5Q A;  1XVW A;  5A5H B;  5DAK A;  3LEF A;  4PNF A;  5KEJ A;  2F9S A;  4ECJ A;  1GNW A;  2R37 A;  4NV2 A;  2FUG 2;  3HA9 A;  3M0F A;  2C0E A;  3A2V A;  1GNE A;  5HR1 A;  3M9K A;  2CAQ A;  1VF3 A;  1ERV A;  4JU5 A;  4L0W A;  4POB A;  2R0C A;  4TOP A;  3VK9 A;  4FYB A;  4NAX A;  1BG1 A;  1O8W A;  1A2M A;  4HZ2 A;  4MAB A;  2IMI A;  1SVO A;  4NMU A;  2JZR A;  1MDI A;  2FLS A;  2VAF A;  3P2A A;  1E6B A;  5JCG A;  2EIO A;  3UBK A;  3S9F A;  1BG5 A;  2X8G A;  1GSF A;  1EV4 A;  1GTU A;  5DAL B;  6GSW A;  4MJE A;  4MZW A;  1EGO A;  1XW5 A;  4MMM A;  4I2U A;  1Z7P A;  3L4N A;  4HU7 A;  1BAY A;  2WRT A;  4KSO A;  4HEA 2;  2VO4 A;  3IHQ A;  4IN0 A;  1YF0 A;  4KW6 A;  1GSD A;  1VF1 A;  2CT6 A;  2HRA A;  5ECK B;  2H6Z A;  3ZFL A;  3DXB A;  2P31 A;  1JFU A;  4PGT A;  4TR1 B;  3QAG A;  1FHE A;  2YWO A;  2PWJ A;  2IMF A;  4WBR D;  2ZCT A;  4IEL A;  2OKA A;  2CZ3 A;  3MSZ A;  4USS A;  16GS A;  1PQN A;  1T1V A;  5F07 A;  1XWB A;  4J57 E;  2HNL A;  3TJK A;  4LA1 A;  2IN3 A;  1BX9 A;  4ACS A;  3CYN A;  3P90 A;  1HYU A;  2WUL A;  4EKZ A;  1YJ6 A;  1T3B A;  3GV1 A;  4TR0 A;  2YJ7 A;  1JLW A;  1K0N A;  4ILF A;  3CRT A;  3D22 A;  5F8B A;  2E0Q A;  2GDR A;  1YVL A;  3CTG A;  3IXR A;  4FIW A;  3FMW A;  3ERF A;  4Q5N A;  2GS3 A;  3IOS A;  5EPF A;  1K0O A;  2O8V B;  4CW9 A;  1XBS A;  3U5R E;  3A3T A;  5H5R A;  1YF1 A;  3DVW A;  2KLX A;  3UVT A;  4G0I A;  2GQM A;  4LL1 B;  1YQ1 A;  4AKI A;  5EL8 A;  2NBS A;  2NPB A;  2LQO A;  4OFN A;  2P0G A;  1T00 A;  2AV4 A;  4CY6 A;  1TI1 A;  4PUR A;  3F3Q A;  4AGS A;  3H1N A;  4POK A;  5JWQ B;  1DE1 A;  17GS A;  2TRX A;  2X99 A;  1DE2 A;  5A5H A;  5FHI A;  1HNA A;  5A5K A;  2V6K A;  3LYK A;  1K0B A;  3MNG A;  2BMX A;  2GSR A;  3L9V A;  3CRU A;  4POM A;  4F0C A;  2RM5 A;  2MMO A;  1ZYP A;  3FKF A;  1MEK A;  1MD3 A;  2BTO T;  2OT3 A;  4PQ1 A;  1FW1 A;  3UVH A;  2DJ2 A;  2KHP A;  2N5F A;  3ZVJ A;  1FVJ A;  1G7O A;  2CX3 A;  1XWA A;  2C8U A;  3CXG A;  1EP7 A;  2DKI A;  2XHF A;  4CDO A;  3EPT A;  3IPZ A;  3LWA A;  1PMT A;  2VM2 A;  3A2W A;  3TU3 B;  4EF0 A;  5ELA A;  3KJY A;  4YQV A;  1FVK A;  2MMA A;  5DAL A;  4KH7 A;  1B9Y C;  2VUP A;  3Q74 A;  5IMV A;  2HSY A;  1QUW A;  1U6T A;  5CRW A;  3ME8 A;  3KXO A;  4L5L A;  1ACV A;  1M9B A;  1OE8 A;  1SD9 A;  4FO5 A;  1DSB A;  3DGQ A;  2LRC A;  2YCD A;  2EFD A;  3G7Y A;  1H4O A;  3FW2 A;  3F0I A;  4TR1 A;  4MLY A;  1EEJ A;  1AAZ A;  4ML1 A;  1M2B A;  2VCW A;  4Q5F A;  2V6O A;  3ZIT A;  3IA1 A;  5C00 A;  4D73 A;  1A0R P;  2HLS A;  3DWV A;  1XOA A;  2HRF A;  3KEB A;  4HZ4 A;  5ABR A;  1K0A A;  3L9U A;  2H8L A;  1WOU A;  4RQX A;  4LMW A;  2K8V A;  2YV9 A;  3HXS A;  1KEB A;  3QCP A;  3ME7 A;  2JSZ A;  2VCQ A;  2A4V A;  3TJF A;  1MTC A;  2HT9 A;  3EC3 A;  4MF7 A;  3ZYW A;  4ZB6 A;  5F0G A;  2C0F A;  3J7Y k;  1WJK A;  2GVP A;  4KUN A;  2VCX A;  5J5N A;  3GKM A;  2H71 A;  3M1G A;  1AQX A;  1LU4 A;  1XXU A;  1F3A A;  1QXH A;  1V40 A;  3IHG A;  3QMX A;  4OCE A;  4Z2T A;  5IMZ A;  4KDY A;  1XZO A;  3LXZ A;  1VRS D;  1V2A A;  3WT1 A;  1TW9 A;  1UN2 A;  5JWO B;  3GX8 A;  5JCW A;  3UAP A;  3KTB A;  1EOG A;  3KGK A;  3TRQ A;  3VFI A;  5HFI A;  1ZYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...