4G0KA

Glutathionyl-hydroquinone reductase, yqjg, of e.coli complexed with gs-menadione
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
GQLIDGVWHDTWYDTKSTGGKFQRSASAFRNWLTADGAPGPTGTGGFIAEKDRYHLYVSLACPWAHRTLIMRKLKGLEPFISVSVVNPLMLENGWTFDDSFPGATGDTLYQNEFLYQLYLHADPHYSGRVTVPVLWDKKNHTIVSNESAEIIRMFNTAFDALGAKAGDYYPPALQTKIDELNGWIYDTVNNGVYKAGFATSQEAYDEAVAKVFESLARLEQILGQHRYLTGNQLTEADIRLWTTLVRFDPVYVTHFKCDKHRISDYLNLYGFLRDIYQMPGIAETVNFDHIRNHYFRSHKTINPTGIISIGPWQDLDEPHGRDVRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords protein yqjG
publication title Structural understanding of the glutathione-dependent reduction mechanism of glutathionyl-hydroquinone reductases.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature ec 1.8.5.7: Glutathionyl-hydroquinone reductase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g0kA02
3.40.30.130 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g0kA01
5J5NA 4IQ1A 4L8EA 4HZ4A 4YQMA 5ECRB 1VF2A 3UBLA 3O76A 1GSSA 1OKTA 2A2SA 3KMOA 3LXZA 5ECPB 4USSA 1VF3A 3C8EA 3IK9A 3PPUA 3Q74A 4BVYB 4YQUA 3UARA 16GSA 2CAIA 1B8XA 5B7CA 4OFMA 5A4WA 3VURA 2C4JA 4Q5QA 1GULA 5D9TA 3LSZA 4IKHA 4JZQA 4JEDA 4G0KA 4EXJA 4HZ2A 4KX4A 4ZBBA 1PKWA 4MF5A 5D9XA 1JZRA 5ECOB 1G6WA 2C3QA 4GSSA 5HFKA 4AGSA 1AQWA 3IK7A 3P90A 1YDKA 2PBJA 4ACSA 6GSTA 1PX7A 1ZL9A 4K0GA 2WJUA 3HKRA 4PX1A 1XW5A 2YV9A 4PURA 3ISOA 4ECBA 2FNOA 2CA8A 2WRTA 5IQYA 5BMUA 5A4VA 2HRKB 4F0CA 2DC5A 3LG6A 4BVXA 1BAYA 1GLQA 1V40A 3M1GA 5KEJA 3KMNA 5DAKA 4HI7A 4PNGA 6GSSA 4G9HA 1R5AA 4ZB9A 4EE0A 4NHZA 5F0GA 4E8HA 4Q5NA 1PX6A 1BG5A 3ZFLA 3RBTA 1B48A 3EINA 5DCGA 3GURA 1GUMA 2CZ3A 4PUAA 1ML6A 1M9AA 4RI7A 3CRUA 5DJLA 4EDYA 3L0HA 1K0NA 1F2EA 4O7HA 1G7OA 3WD6A 1XW6A 2WDUA 1GWCA 2PMTA 3GSSA 1V2AA 4HJ2A 7GSSA 3VI7A 4K0NA 1F3BA 2GSSA 5D73A 4IVFA 3QAVA 5AGYA 1EV4A 5DQSA 3TOTA 4MF7A 2CVDA 4ZXGA 3FYGA 4FQUA 1MD4A 2OACA 1HNAA 1K0BA 5AIXA 4LMWA 1XWKA 3FR3A 4PTSA 2HSMA 3QAGA 5GSTA 1JLWA 4IS0A 1GSUA 3Q18A 2F3MA 4J2FA 6GSUA 4O92A 3KXOA 5DALA 1PN9A 2VCXA 6GSWA 2YCDA 19GSA 1K0MA 4KDYA 1FHEA 22GSA 4L5OA 5AISA 4PNFA 2C8UA 5A4UA 3UVHA 1PKZA 3CSIA 4QQ7A 4WR4A 3TOUA 1PGTA 1YQ1A 4DEJA 1K0DA 5J41A 5ECIB 4TOPA 3PGTA 11GSA 1MD3A 4IELA 4HOJA 4GSTA 4IW9A 8GSSA 1EOGA 1GLPA 1NHYA 4MZWA 4N0VA 4PQHA 1PMTA 4LMVA 1PD21 2NTOA 5F8BA 1TU8A 1OYJA 2HRAA 3BBYA 4BL7A 1EEMA 1TU7A 18GSA 4ZB8A 1K0AA 5DALB 3VK9A 1EOHA 3D0ZA 2GLRA 5ECHB 5FWGA 2GTUA 3G7IA 1USBA 2WB9A 1HQOA 3I69A 3FR9A 3WYWA 5FHIA 3EE2A 10GSA 4GSNA 2HSNB 3VLNA 3IBHA 2WS2A 2CAQA 3F6DA 1PL1A 4IBPA 2GDRA 3LJRA 3O3TA 4E8EA 14GSA 2R3XA 6GSVA 2VCVA 4KH7A 4YAPA 2HNLA 2IMKA 3G7JA 1UA5A 3FY7A 3QR6A 3IR4A 4KF9A 5ECSA 1BYEA 4G0IA 3GTUA 4MPFA 3SWLA 1GSFA 3F63A 1K3YA 1GSYA 3HJMA 1LBKA 3AY8A 4GCIA 1C72A 5JCWA 4ECJA 1GTIA 4EC0A 1M99A 2PVQA 1KBNA 5EL8A 4YH2A 1GSEA 3P8WA 3R2QA 5F07A 2C80A 4ECIA 4BVXB 5ECLB 1GTAA 20GSA 3M0FA 5DAKB 2OADA 1K0OA 1M0UA 4CHSA 5GZZB 1K3OA 1U88A 1Z9HA 5J4UA 1YY7A 1YKCA 2X64A 3CSHA 2N5FA 2F8FA 5AIVA 5EVOA 1ZGNA 2AHEA 4G10A 4MF6A 3MAKA 1A0FA 3CSJA 5LCZA 1AQVA 1TW9A 3IE3A 4ECCA 3GH6A 3M3MA 5LD0A 2OA7A 4GF0A 3VPTA 3QAWA 1K3LA 5ECQB 2JL4A 2A2RA 3TGZA 2R5GA 3UBKA 1XWGA 2VCZA 5A5KA 1VF4A 4JBBA 4G0LA 5FT3A 3ZMKA 4YQVA 2PERA 3UAPA 1U3IA 2AB6A 4KE3A 4Q5RA 1JLVA 4RI6A 3ZMLA 2IMIA 3LFLA 2R6KA 1IYIA 4IGJA 2C3TA 3H1NA 2ON5A 2VCWA 2HSMB 4ID0A 2UZ8A 3MDKA 2HRKA 5F05A 3CBUA 3DGQA 1OE7A 4YAVA 2FHEA 3DD3A 2VO4A 4IQAA 1GUKA 5DDLA 3FRCA 2J9HA 3LQ7A 1LJRA 1DUGA 2CZ2A 4EDZA 3LYPA 2IL3A 3I6AA 13GSA 3M8NA 2HQTA 2VD1A 1G6YA 1K0CA 1GNWA 3FR6A 1EV9A 3VPQA 4MP4A 3CRTA 5D9WA 17GSA 1HNCA 4MPGA 5GSSA 5EY6A 5ELAA 6GSXA 4KSMA 6GSYA 1IYHA 3Q19A 1RK4A 3KJYA 3KTLA 3VI5A 1PL2A 1OE8A 4IJIA 1B4PA 4I97A 4KDUA 3ERGA 2PGTA 5ECKB 5ELGA 1HNBA 2ON7A 3LYKA 1Q4JA 1GTBA 4Q5FA 4OFTA 9GSSA 3U6VA 4PGTA 5F06A 3HJOA 4BL7B 1MTCA 4GTUA 1M9BA 2VCTA 5ECMB 1GNEA 1GTUA 1U87A 4F0BA 1AQXA 5DJMA 1BX9A 4PQIA 2DSAA 4ZBDA 2VD0A 4G19A 3R3EA 2R4VA 1YJ6A 4F03A 4ISDA 4MK3A 2C3NA 1AW9A 1FW1A 5G5EA 4NAXA 1E6BA 3W8SA 3LXTA 1GSDA 3NIVA 2VCQA 2YV7A 1Y6EA 3GTUB 5AN1A 3N9JA 3ZFBA 4OMVA 2AAWA 2LJRA 3KM6A 1GUHA 4GLTA 1VF1A 4KGIA 3IC8A 4BVYA 2GSRA 2D2ZA 3GUSA 3GX0A 1PA3A 12GSA 4KAEA 3GSTA 3PR8A 4PXOA 2GSQA 1GSQA 5JCUA 3N5OA 3F6FA 4NHWA 4WR5A 2GSTA 3ERFA 4L5LA 4KDXA 1N2AA 1AXDA 5G5FA 3VWXA 4OFNA 4ZB6A 2V6KA 5D9VA 1TDIA 1F3AA 5ECNB 4ZBAA 4MDCA
chains in the Genus database with same CATH superfamily
5J5NA 4POBA 2R0PA 4ML6A 2KP2A 4HZ4A 4YQMA 1T4YA 4AKXB 1VF2A 1OKTA 2FA8A 1PQNA 3KMOA 2I81A 4V2NA 3C8EA 3UL3A 1R4WA 3Q74A 2M46A 2X99A 1PFOA 5B7CA 1M3IA 2LQOA 3VURA 2C4JA 2PVOC 5DVBA 4JZQA 2FWEA 5H5RA 2OE3A 1PKWA 1JZDA 4AJ6A 2M72A 1FB6A 2WULA 5HR0A 1EP8A 2DJKA 1XW5A 1AC1A 2YV9A 3BCKA 4ECBA 2CA8A 1EGOA 1T8EB 2WW2A 5BMUA 2PU9C 4BVXA 1BAYA 5KEJA 3VWUA 4PNGA 6GSSA 1R5AA 1CQGA 3HJPA 3DMLA 4IJ3A 4NV5A 1PX6A 3CQFA 3ZFLA 4XHMA 3A5WA 3EINA 4POMA 1GUMA 2FY6A 1O73A 4PUAA 2O87A 4RI7A 3CRUA 4EDYA 2V41A 2WZSA 1G7OA 3LORA 4LLRA 2AJQB 2WDUA 1V2AA 5KN2A 1NSWA 3FZ9A 5A5HA 1MDKA 4DVCA 1A0RP 4N30A 4JR6A 2CVDA 4ZXGA 4O32A 4FQUA 1MD4A 3BD2A 3IRAA 4LMWA 1XWKA 2GQKA 3KD0A 4FYUA 4PTSA 2KUCA 5D8IA 4AJ8A 1JLWA 2CT6A 4CDOA 2F3MA 2H66A 4MZBA 2LRCA 3FK8A 6GSUA 4POKA 4NMUA 3FZ4A 4O92A 1PN9A 2OE0A 4K2DA 2LNTA 3CHXC 4V2MA 5BRTA 3UVHA 1PKZA 3CSIA 2YJ7A 4WR4A 1YQ1A 4ILFA 4K7IA 2DIYA 3LGCA 1WPIA 2LKUA 4K8MA 3PGTA 11GSA 2H8LA 4FH8A 4HOJA 2R0GA 2M80A 4PQHA 1SKSB 2NTOA 1YZXA 3DIEA 3DYRA 4ZB8A 1K0AA 2VL9A 2K18A 3P7XA 2GTUA 1DBYA 2WB9A 10GSA 1GL8A 1FG4A 3MYDA 2RM5A 2EFHA 3VLNA 3IBHA 3ERWA 1PSQA 4MH2A 2GDRA 1SJIA 4CW9A 1A23A 1UVZA 3M9JA 4AF2A 2VCVA 2REMA 4YAPA 5B8BA 5IPGA 3C1SA 5ECSA 1TXXA 3GTUA 5IMDA 2JZSA 4ML1A 3FEUA 3UMAA 4DSSA 1K3YA 1LBKA 1N25A 3V1WA 2XC2A 2DJJA 2RLIA 4GCIA 1C72A 5HFGA 4I2TA 4ECJA 4EC0A 1Z7RA 2O36A 5G30A 3P8WA 2C80A 5DAKB 3VFIA 1TJDA 3U5RE 3CYNA 3L78A 2N5BA 1SL2B 3F4TA 1U88A 1Z9HA 4AI6A 3HCZA 2X64A 3A2VA 4XIHA 5EVOA 1N8JA 3F3RA 3GHAA 2F9SA 2AHEA 4HS1A 4E68A 2JZTA 2GQMA 4AJ7A 3QAWA 2JL4A 2B7JA 4X4JA 1BJXA 1XWGA 2VCZA 1VF4A 3TB2A 5FT3A 3ZMKA 2G0FA 1NHOA 2PERA 2AB6A 3MWHA 4Q5RA 4BWQA 3M9KA 5L71A 2VL3A 1TTZA 4K7OA 3IAM2 1IYIA 4P3YB 2IFQA 2H1LA 3S9FA 2H19A 4ID0A 3HDCA 2MBTA 2HRKA 4J57E 2XBQA 3TJBA 2WVYA 3CBUA 1NM3A 4TR1A 3KP8A 4D73A 5DDLA 3LQ7A 2MMNA 2EFEA 2IJYA 3RPPA 2DKIA 2GQLA 2A4VA 1GNWA 1EV9A 3VPQA 1X9MB 1S4BP 1HNCA 4MPGA 3TJFA 2RIIA 3HVXA 3TKQA 3D5JA 3Q19A 3IOSA 1TXUA 4I8BA 2VKZG 3KTLA 3VI5A 1OE8A 2DBCA 4IJIA 2WVZA 5COHA 4DSQA 1FB0A 2ON7A 1Q4JA 3GNJA 5E4WA 2C0EA 2DLXA 2H1BA 2OBIA 4BL7B 1MTCA 5ABRA 4D73B 1HYUA 5J4YA 4GWRA 1A8YA 5B6MA 1BX9A 3EVIA 2DSAA 1WOUA 5IO2A 3BOAA 1YJ6A 4MK3A 3HVSA 1WIKA 2N5AA 2DMMA 5IIZA 1FW1A 4NAXA 2WFCA 1DE1A 1I1IP 2IN3A 1MDJA 1T3BA 1WE0A 5CRWA 3GMFA 3WT1A 4BVYA 2D2ZA 3GX0A 3ZZXA 3GSTA 3GV1A 2X8HA 2GSQA 3K8NA 3F6FA 1XWCA 4NHWA 4WR5A 4XS4B 3ZTLA 4MJEA 4L5LA 4KDXA 4Z7XA 1AXDA 2L4QA 2QA2A 3VWXA 4K5RA 5D9VA 1F3AA 3EU4A 2KP1A 4XRAA 2HFDA 1ERWA 2KHPA 4ZBAA 5KN1A 3RGBC 4MDCA 5JWQB 5C00A 5ECRB 3A5IA 1KNGA 3ED3A 3O76A 1GSSA 3TUEA 3LXZA 2LUSA 1O6JA 4YKFA 4BVYB 3EWLA 2H01A 3DVWA 2BMXA 4QMKA 1TRVA 5KN3A 1B8XA 4KCEA 1Z5YE 1GULA 5D9TA 3EMPA 3H8QA 3ME8A 3LSZA 3FZAA 1ZYQB 4JEDA 4YKGA 4G0KA 4EXJA 4V2LA 4G01A 1JFUA 4MF5A 1G0TA 2O85A 1GRXA 2O5VA 4ZL8A 5ECOB 2C3QA 4GSSA 4XCSA 4GXZA 1AQWA 1FOHA 2VL2C 3P90A 1YDKA 6GSTA 3BCIA 3HKRA 4ZILA 3EYTA 2FUG2 5DQYA 1R26A 4OO5A 3H93A 2HZEA 3ZVJA 2WRTA 5IQYA 2VL2A 2IPAA 4G2EA 4XTSA 4MNNA 2DC5A 5ID2A 3M1GA 2L5OA 3I43A 2X49A 4G9HA 5J9BA 1OC3A 4EE0A 1S3AA 1ACVA 4NHZA 3KCMA 1V98A 2L57A 3RBTA 3Q6OA 1M9AA 2H70A 2VM1A 4RUVA 1TK8B 2B3SA 1K0NA 3I9V2 2K6VA 1XW6A 4RQXA 1GWCA 4N0ZA 4AKHA 2PMTA 1XVWA 1YVLA 3WGEA 1F3BA 5D73A 4IVFA 4X0XA 5HFIA 1XWAA 5AGYA 2ZCTA 3GKNA 1EV4A 4HDEA 3TOTA 1QUWA 4K6XA 3FYGA 4O5QA 1HNAA 4MA9A 3FR3A 4MJCA 3EU3A 2HSMA 3F3QA 2TIRA 1XXUA 5EPFA 2YJHA 1FOVA 1SD8A 4JU5A 3KXOA 6GSWA 2VCXA 2QGVA 1FHEA 1SYXA 2YWOA 5AISA 2C8UA 4XRDA 5A4UA 4JRRA 2LJKA 4QQ7A 1XIYA 3TOUA 1PGTA 1F6MC 4MCUA 4EIPA 5GAPD 3EPTA 2XBIA 1MD3A 4XS6A 1R5PA 2BTOT 2EIQA 4GSTA 4IW9A 4CY6A 8GSSA 3W6GA 3APSA 4MZWA 3ZL5A 1PMTA 1O85A 4LMVA 1PD21 1VGLA 2KOKA 1TRUA 4FIWA 1EEMA 5CRHA 1Y25A 1O8XA 1JHBA 2YZHA 5ECHB 3LWAA 3DRNA 3C1RA 2I4AA 1ZYPA 3G7IA 2KLXA 4K9ZA 1HQOA 3QOUA 3I69A 3WYWA 2C0DA 2P0GA 1TRWA 5DBQA 4BWSA 4IBPA 3LJRA 4E8EA 6GSVA 3GIXA 2MMZA 2IMKA 3O6TA 4J56E 2WW0A 4TRXA 4PHZC 1B9YC 1LU4A 1BQ7A 4KW6A 1M99A 3H79A 2PVQA 3QFAC 1GSEA 5BMUB 2HRFA 3WGDA 2H0HA 4BVXB 1GTAA 4TW5A 1J0FA 2FA4A 2OADA 2YWNA 1M0UA 3HD5A 1TP9A 1FVKA 4PUFC 1PRXA 4Z2TA 1YF1A 1GP1A 1BF5A 2H73A 2L4CA 4F9ZA 3DWVA 1ZYEA 5AIVA 1Z6NA 3UVTA 4O5UA 3ME7A 3MAKA 2FGXA 3CSJA 1TW9A 2LQQA 1ERUA 2ALBA 2HE3A 5CRDA 2OA7A 3VPTA 3IHQA 1K3LA 5ECQB 2H0GA 1W89A 5JCGA 2JSZA 3IC4A 1KEBA 3DVXA 5G2ZA 3UAPA 5A5HB 1YEWC 2GT5A 3GN3A 3ZMLA 4BPYA 1SK0A 2IMIA 4IGJA 3HMJG 1ABAA 3DGQA 5HQPA 1OE7A 1A2JA 1XBSA 1TK5B 2VO4A 5KOWA 2CZ2A 4EDZA 3IA1A 3LYPA 1TK0B 2IL3A 3I6AA 13GSA 2YOIA 2VD1A 3APOA 1G6YA 3FR6A 1S3CA 3CRTA 5D9WA 4N10A 2ZUPA 2TRXA 2E2GA 3D21A 2B6MA 2C0GA 2L59A 5E59A 1SKWB 2J23A 5IPHA 4TR3A 1B4PA 4I97A 5J47A 3QD9A 4OD7A 5ECKB 4NPBA 1O7UA 3LYKA 5A34A 2FLSA 2QC7A 4OFTA 9GSSA 5HR3A 4PGTA 2ES7A 3UEMA 1SK1A 1X9WB 2OKAA 5F06A 1Z7PA 2B7KA 3MIXA 4TR0A 3QPMA 1SVOA 5ENUA 4OWYA 3KP9A 4F0BA 1AQXA 5DJMA 2BJXA 3L9VA 2P31A 2I1UA 3IAS2 2NDOA 3HHVA 4G19A 4MJAA 1HD2A 3A2XA 4ISDA 3HVNA 5J9CA 2HI7A 1XG8A 3GKKA 3US3A 4QL9A 4K2XA 3ZYWA 3NIVA 3D4MA 1MDIA 2FWGA 4IHUA 1A24A 3D6IA 2GZZA 3GTUB 3D22A 1URMA 2LJRA 3KM6A 1WJKA 4GLTA 5IMAA 1VF1A 4DSSB 3IC8A 4KAEA 2HSHA 5CO3A 3N5OA 3EMXA 2CQ9A 2Z9SA 2V32A 3KGKA 3TKSA 3ZLPA 3HY2A 4Z2UA 1TKDB 3APQA 2H6ZA 2PWJA 4OO4A 2P5QA 1NW2A 1YEXA 4USSA 3TJKA 1VF3A 3TRQA 1X0RA 2O7KA 2GZPA 2HSNA 3UARA 2IMEA 16GSA 2YP6A 2CAIA 4N11A 2ZNMA 2K8SA 3QCPA 4Q5QA 2HRNA 3QFBC 5B6NA 4KX4A 2E7PA 5JWOB 4MH3A 2GGTA 1JZRA 5HFKA 3IK7A 3ZIJA 1EGRA 2B5YA 1PX7A 4K0GA 4PX1A 4K7NA 1Z3EA 4PURA 5CAXA 2IFQB 4K1FA 3WT2A 4FYBA 4WEYA 1U3AA 5A4VA 2HRKB 4F0CA 3DXBA 3DEXA 1Z6MA 2RUEA 1GLQA 4TR1B 1V40A 4I6XA 1B4QA 5IM9A 1EZKA 5F0GA 4E8HA 4F82A 4MZCA 2L5LA 4GQCA 1B48A 3TRXA 5DCGA 3GURA 2YZUA 2CZ3A 2WW3A 1QFNA 1GH2A 1ML6A 1BG1A 3C7MA 1F2EA 3C71A 4O7HA 3GX8A 3WD6A 4WBRD 4BA7A 3GSSA 4HJ2A 7GSSA 2R37A 2CVKA 3QAVA 3TKRA 4H86A 2WCIA 5LNKe 3GFKA 1EWXA 5GSTA 5IMVA 4IS0A 3KH7A 3C73A 4J2FA 1T1VA 2LJAA 4F2IA 5DALA 19GSA 4KDYA 22GSA 4L5OA 3F8UA 3WGXA 2C1YA 2DKHA 2NVLA 4DEJA 4MABA 2WW1A 1K0DA 3RHBA 1WMJA 2K8VA 5A1NA 5J41A 4IP6A 5CP1A 4TOPA 4MLYA 2B5XA 4IELA 1H75A 4V1Ag 1NHYA 4N0VA 1ZCPA 4ULXA 4KSOA 1TU8A 5G1KA 2DJ3A 2HRAA 4EL1A 2HSYA 5DALB 2EC4A 3D0ZA 3TCOA 5FWGA 2C0FA 2VUPA 1X9SB 4X1UA 2JADA 2O3EA 5FHIA 3EE2A 3UIWA 4GSNA 3VWVA 4MMMA 1WRYA 2H76A 1XFLA 4EF0A 3NOFA 2WS2A 3F6DA 4WETA 3O3TA 3KTBA 3EC3A 4KH7A 3G7JA 1WWJA 4Z2RA 4KF9A 2DJ0A 4G0IA 4MPFA 3SWLA 2LS5A 1GSFA 2YPMA 2H6YA 2H72A 1M3JA 5H5SA 1WP0A 3HJMA 3LEFA 3QMXA 5JCWA 2MZCA 4IN0A 3FKFA 2HZEB 4YH2A 1VRSD 3R2QA 1I9DA 1EEJA 4ECIA 5ID2B 2MBSA 3IV4A 1SK2A 1FAAA 4KB3A 4KUNA 1K0OA 2G2QA 4CY8A 2B1LA 4AKGA 1K3OA 1JZWA 1X5EA 4L0WA 3TJGA 2LSTA 1O8WA 1YY7A 4FO5A 1YKCA 3CSHA 2N5FA 1A0FA 2DJ2A 1ZMAA 1AQVA 4PI0C 3IE3A 4ECCA 3M3MA 1TOFA 1ZZYA 5LD0A 2VLVA 4GF0A 5KOXA 3BJ5A 2LRTA 3UBKA 1XOAA 4EO3A 1T7PB 2VIMA 4KE3A 2YWIA 3RDWA 4NXIA 3PH9A 3LFLA 5H5QA 2R6KA 1SVMA 3L9UA 2H30A 2ON5A 2VCWA 1QGVA 2HSMB 3ZVJD 2UZ8A 3MDKA 2B5EA 1OC8A 1XZOA 2FHEA 3GYKA 3FRCA 1T00A 4PQ1A 3L9SA 2J9HA 1LJRA 4EIQA 3A3TA 3M8NA 2HQTA 1QMVA 4QL7A 5CYYA 3KH9A 1K0CA 1M2BA 17GSA 5EY6A 6GSXA 1SVLA 3F4RA 1AAZA 3FW2A 1SL1B 3FHKA 3GL3A 3JCML 4N3ZA 4MJBA 1RK4A 3CWGA 1PL2A 2XPDA 2AUVA 5C04A 4KDUA 2TRCP 2CX4A 3ERGA 2PGTA 5ELGA 1THOA 2E0QA 4HQZA 3MSZA 4EKZA 2L6CA 4GTUA 2VCTA 2WZ9A 5ECMB 2YANA 1GNEA 1GTUA 4JE1A 2VM2A 1XPVA 1V9WA 1ST9A 2H74A 4PQIA 4TXVA 3HXSA 4HEA2 2FWHA 1OVNA 3R3EA 3GKXA 4F03A 2IIYA 1XVQA 5IOXA 3HVVA 1AW9A 3IDVA 2GS3A 4HUAA 5G5EA 4AKIA 4IP1A 2FD3A 1E6BA 3W8SA 3LXTA 3TJJA 1GSDA 2YV7A 4LL4B 2LNSA 4ZIJA 2H1AA 2DMLA 3F9UA 1S3DA 2GSRA 3GUSA 3FMWA 1PA3A 3IPZA 4NV2A 2L6DA 1SJ6A 1GSQA 5JCUA 2IMFA 2HZFA 2GSTA 4EUYA 2R2JA 5G5FA 3D4TA 4OFNA 4GQFA 4HJMA 1E2YA 1ILOA 2EFDA 3TRPA 1M7TA 4WKWA 2I9HA 1UN2A 4TN8A 5CNWA 3EURA 4IQ1A 4L8EA 1T4ZA 3UBLA 1ZYNA 2HYXA 2A2SA 5ECPB 1XCCA 1F9MA 3IK9A 3PPUA 2PPTA 2DJ1A 3QDNA 5J3RA 4YQUA 2XHFA 3HZ4A 4HSCX 3ZRDA 2VOCA 4TVEA 4OFMA 3CXGA 4LA1A 5A4WA 1H4OA 3F0IA 2P5RA 4IKHA 4HZ2A 4ZBBA 1BEDA 4XS1A 5D9XA 2JSYA 3HA9A 1G6WA 4AGSA 2CV4A 1SENA 2PBJA 4ACSA 1ZL9A 2WJUA 2WGRA 1OKDA 2OBKA 3ISOA 2FNOA 3A2WA 4DSRA 3VWWA 3L4NA 3TKPA 3LG6A 3UJ1A 1YKAA 3KMNA 1S3RA 5DAKA 1G7EA 4HI7A 2LV3A 4ZL9A 4ZB9A 3W8JA 1F37A 3TU3B 4Q5NA 1BG5A 4W66A 3HZ8A 5IO0A 2RM6A 1KTEA 1O81A 4KNDA 5CRGA 4L0UA 5DJLA 5B8AA 3E3EA 2H75A 3L0HA 4ICYA 2V6OA 2MMAA 5A34B 1RQMA 3IHGA 2E2MA 2EIOA 5G1LA 3VI7A 4K0NA 1A2MA 2GSSA 5CREA 1SJZA 2H0IA 1PN0A 2QKEA 5DQSA 2JZRA 5IMZA 4MF7A 2GT6A 3E0UA 3TKSC 1U6TA 3GL5A 2OACA 3TKSE 3CMIA 2QSIA 1K0BA 5AIXA 3UOMA 5JWRB 5J40A 3MNGA 4WF5A 4EVMA 1R7HA 1X5CA 3QAGA 4TKYA 2VLUA 1GSUA 3Q18A 1AUCA 1J08A 1OAZA 4HU9A 2YCDA 1K0MA 1SD9A 4POLA 4PNFA 2XPEA 1Q98A 2YWMA 3GA4A 2HXKA 1SKRB 2FCHA 1MEKA 2A2PA 2GVPA 1V57A 2YNXA 5ECIB 3PINA 2X8GA 1EOGA 1GLPA 2FWFA 5F8BA 4FYCA 1OYJA 1FVJA 2GZYA 4I2UA 3BBYA 4BL7A 5IMFA 1TU7A 18GSA 4ZB7A 3KEBA 3VK9A 1EOHA 2GLRA 1USBA 3RPNA 1M2AA 5HR1A 3FR9A 2HLSA 2MMOA 2HSNB 1QK8A 2CAQA 1PL1A 3RFRC 14GSA 2R3XA 3ZIVA 1ON4A 2HNLA 1UA5A 3FY7A 1CQHA 4OCEA 3QR6A 4WBJA 5INYA 3IR4A 3CTFA 1BYEA 2VLTA 3E9JB 4FXYP 4KCAA 3F63A 2OT3A 2IWTA 1GSYA 2NPBA 2EFCA 2YN1A 3AY8A 2NBSA 1GTIA 4HQSA 1KBNA 5EL8A 4XS4A 4ZL7A 2PUKC 5F07A 1W4VA 2H71A 2H6XA 3SBCA 4HU7A 5ECLB 4JR4A 20GSA 1SL0B 3M0FA 4CHSA 4O5RA 3J7Yb 5GZZB 1XW9A 2AYTA 1QXHA 4K5SA 5J4UA 1THXA 2F8FA 2EIRA 1ZGNA 4G10A 4MF6A 3KIJA 1UC7A 5LCZA 2V2GA 4NWYA 3TDGA 2MYGA 3GH6A 1J9BA 5D96A 2O89A 1RW1A 5J4VA 4RQRA 4X43A 2A2RA 3TGZA 2R5GA 5A5KA 1I5GA 2UV8G 4JBBA 4G0LA 4YQVA 1U3IA 1JLVA 4RI6A 1FO5A 3RAZA 3GRXA 3DKSA 2I3YA 2R0CA 1OC9A 2C3TA 3H1NA 1AIUA 3HYPA 2HT9A 2B1KA 2OJLA 3FZ5A 2IMDA 5F05A 1XWBA 2OE1A 4YAVA 3DD3A 4IQAA 4I5QA 1GUKA 2JU5A 1DUGA 1YF0A 4GRFA 5D93A 1V58A 4LL1B 4MP4A 5GSSA 2AV4A 4TXOA 5ELAA 4KSMA 6GSYA 1IYHA 1B9XC 5GAND 3KJYA 3GKMA 4PI2C 5A1NB 3G9BA 3OR5A 2LTKA 2DIZA 2PN8A 1OC9B 4TR4A 1HNBA 2JACA 3CTGA 2O8VB 3KZQA 1GTBA 5DCHA 4Q5FA 5HR2A 3U6VA 2CVBA 3F4SA 5IMCA 3HJOA 2CX3A 1EP7A 1YEPA 1XOBA 1ZOFA 1M9BA 1U87A 4OCFA 1M2DA 2X4AA 1DSBA 2WVXA 3RHCA 4ZBDA 2VD0A 1TI3A 3NZNA 4TXOB 4GDFA 2R4VA 4V1Ap 2C3NA 4A5PA 3GH9A 5G31A 2H1DA 3P2AA 1ERTA 2RUFA 2V1MA 2VCQA 5IOWA 3G7YA 2H1GA 3J7Yk 1DE2A 1Y6EA 5AN1A 3N9JA 3ZFBA 4OMVA 2AAWA 1A2LA 1GUHA 4KGIA 1TRSA 4WF4A 2LEGA 2QA1A 3ZREA 3LW9A 12GSA 1SYRA 3PR8A 4PXOA 2X8CA 4BIKA 2F8AA 2WVXB 1ERVA 3ZITA 2K9FA 2VAFA 3IXRA 3ERFA 2A4HA 3H4KA 1X5DA 1N2AA 5KN0A 4WXTA 4ZB6A 2V6KA 2F51A 1A8LA 1TDIA 4KA0A 5ECNB 1TI1A 1Y1UA 2LRNA 1QQ2A 1JZOA 1SU9A
chains in the Genus database with same CATH topology
5J5NA 4POBA 2R0PA 4ML6A 2KP2A 4HZ4A 4YQMA 1T4YA 4AKXB 1VF2A 1OKTA 2FA8A 1PQNA 3KMOA 2I81A 4V2NA 3C8EA 3UL3A 1R4WA 3Q74A 2M46A 2X99A 5B7CA 2LQOA 3VURA 2C4JA 2PVOC 5DVBA 4JZQA 2FWEA 5H5RA 2OE3A 1PKWA 1JZDA 4AJ6A 2M72A 1FB6A 2WULA 5HR0A 1EP8A 2DJKA 1XW5A 1AC1A 2YV9A 3BCKA 4ECBA 2CA8A 1EGOA 1T8EB 5BMUA 2PU9C 4BVXA 1BAYA 5KEJA 3VWUA 4PNGA 6GSSA 1R5AA 1CQGA 3HJPA 3DMLA 4IJ3A 4NV5A 1PX6A 3ZFLA 4XHMA 3A5WA 3EINA 4POMA 1GUMA 2FY6A 1O73A 4PUAA 2O87A 4RI7A 3CRUA 4EDYA 2V41A 1G7OA 3LORA 4LLRA 2AJQB 2WDUA 1V2AA 5KN2A 1NSWA 3FZ9A 5A5HA 1MDKA 4DVCA 1A0RP 4N30A 4JR6A 2CVDA 4ZXGA 4O32A 4FQUA 1MD4A 3BD2A 3IRAA 4LMWA 1XWKA 2GQKA 3KD0A 4FYUA 4PTSA 2KUCA 5D8IA 4AJ8A 1JLWA 2CT6A 4CDOA 2F3MA 2H66A 4MZBA 2LRCA 3FK8A 6GSUA 4POKA 4NMUA 3FZ4A 4O92A 1PN9A 2OE0A 4K2DA 2LNTA 4V2MA 5BRTA 3UVHA 1PKZA 3CSIA 2YJ7A 4WR4A 1YQ1A 4ILFA 4K7IA 2DIYA 3LGCA 1WPIA 2LKUA 4K8MA 3PGTA 11GSA 2H8LA 4FH8A 4HOJA 2R0GA 2M80A 4PQHA 1SKSB 2NTOA 1YZXA 3DIEA 3DYRA 4ZB8A 1K0AA 2VL9A 2K18A 3P7XA 2GTUA 1DBYA 2WB9A 10GSA 1GL8A 1FG4A 3MYDA 2RM5A 2EFHA 3VLNA 3IBHA 3ERWA 1PSQA 4MH2A 2GDRA 1SJIA 4CW9A 1A23A 1UVZA 3M9JA 4AF2A 2VCVA 2REMA 4YAPA 5B8BA 5IPGA 3C1SA 5ECSA 1TXXA 3GTUA 5IMDA 2JZSA 4ML1A 3FEUA 3UMAA 4DSSA 1K3YA 1LBKA 1N25A 3V1WA 2XC2A 2DJJA 2RLIA 4GCIA 1C72A 5HFGA 4I2TA 4ECJA 4EC0A 1Z7RA 5G30A 3P8WA 2C80A 5DAKB 3VFIA 1TJDA 3U5RE 3CYNA 3L78A 2N5BA 1SL2B 3F4TA 1U88A 1Z9HA 4AI6A 3HCZA 2X64A 3A2VA 4XIHA 5EVOA 1N8JA 3F3RA 3GHAA 2F9SA 2AHEA 4HS1A 4E68A 2JZTA 2GQMA 4AJ7A 3QAWA 2JL4A 2B7JA 4X4JA 1BJXA 1XWGA 2VCZA 1VF4A 3TB2A 5FT3A 3ZMKA 2G0FA 1NHOA 2PERA 2AB6A 3MWHA 4Q5RA 4BWQA 3M9KA 5L71A 2VL3A 1TTZA 4K7OA 3IAM2 1IYIA 4P3YB 2IFQA 2H1LA 3S9FA 2H19A 4ID0A 3HDCA 2MBTA 2HRKA 4J57E 2XBQA 3TJBA 3CBUA 1NM3A 4TR1A 3KP8A 4D73A 5DDLA 3LQ7A 2MMNA 2EFEA 2IJYA 3RPPA 2DKIA 2GQLA 2A4VA 1GNWA 1EV9A 3VPQA 1X9MB 1HNCA 4MPGA 3TJFA 2RIIA 3HVXA 3TKQA 3D5JA 3Q19A 3IOSA 1TXUA 4I8BA 2VKZG 3KTLA 3VI5A 1OE8A 2DBCA 4IJIA 5COHA 4DSQA 1FB0A 2ON7A 1Q4JA 3GNJA 5E4WA 2C0EA 2DLXA 2H1BA 2OBIA 4BL7B 1MTCA 5ABRA 4D73B 1HYUA 5J4YA 4GWRA 1A8YA 5B6MA 1BX9A 3EVIA 2DSAA 1WOUA 5IO2A 3BOAA 1YJ6A 4MK3A 3HVSA 1WIKA 2N5AA 2DMMA 5IIZA 1FW1A 4NAXA 2WFCA 1DE1A 2IN3A 1MDJA 1T3BA 1WE0A 5CRWA 3GMFA 3WT1A 4BVYA 2D2ZA 3GX0A 3ZZXA 3GSTA 3GV1A 2X8HA 2GSQA 3K8NA 3F6FA 1XWCA 4NHWA 4WR5A 4XS4B 3ZTLA 4MJEA 4L5LA 4KDXA 4Z7XA 1AXDA 2L4QA 2QA2A 3VWXA 4K5RA 5D9VA 1F3AA 3EU4A 2KP1A 4XRAA 2HFDA 1ERWA 2KHPA 4ZBAA 5KN1A 4MDCA 5JWQB 5C00A 5ECRB 3A5IA 1KNGA 3ED3A 3O76A 1GSSA 3TUEA 3LXZA 2LUSA 1O6JA 4YKFA 4BVYB 3EWLA 2H01A 3DVWA 2BMXA 4QMKA 1TRVA 5KN3A 1B8XA 4KCEA 1Z5YE 1GULA 5D9TA 3EMPA 3H8QA 3ME8A 3LSZA 3FZAA 1ZYQB 4JEDA 4YKGA 4G0KA 4EXJA 4V2LA 4G01A 1JFUA 4MF5A 1G0TA 2O85A 1GRXA 2O5VA 4ZL8A 5ECOB 2C3QA 4GSSA 4XCSA 4GXZA 1AQWA 1FOHA 2VL2C 3P90A 1YDKA 6GSTA 3BCIA 3HKRA 4ZILA 3EYTA 2FUG2 5DQYA 1R26A 4OO5A 3H93A 2HZEA 3ZVJA 2WRTA 5IQYA 2VL2A 2IPAA 4G2EA 4XTSA 4MNNA 2DC5A 5ID2A 3M1GA 2L5OA 3I43A 2X49A 4G9HA 5J9BA 1OC3A 4EE0A 1S3AA 1ACVA 4NHZA 3KCMA 1V98A 2L57A 3RBTA 3Q6OA 1M9AA 2H70A 2VM1A 4RUVA 1TK8B 2B3SA 1K0NA 3I9V2 2K6VA 1XW6A 4RQXA 1GWCA 4N0ZA 4AKHA 2PMTA 1XVWA 1YVLA 3WGEA 1F3BA 5D73A 4IVFA 4X0XA 5HFIA 1XWAA 5AGYA 2ZCTA 3GKNA 1EV4A 4HDEA 3TOTA 1QUWA 4K6XA 3FYGA 4O5QA 1HNAA 4MA9A 3FR3A 4MJCA 3EU3A 2HSMA 3F3QA 2TIRA 1XXUA 5EPFA 2YJHA 1FOVA 1SD8A 4JU5A 3KXOA 6GSWA 2VCXA 2QGVA 1FHEA 1SYXA 2YWOA 5AISA 2C8UA 4XRDA 5A4UA 4JRRA 2LJKA 4QQ7A 1XIYA 3TOUA 1PGTA 1F6MC 4MCUA 4EIPA 5GAPD 3EPTA 2XBIA 1MD3A 4XS6A 1R5PA 2BTOT 2EIQA 4GSTA 4IW9A 4CY6A 8GSSA 3W6GA 3APSA 4MZWA 3ZL5A 1PMTA 1O85A 4LMVA 1PD21 1VGLA 2KOKA 1TRUA 4FIWA 1EEMA 5CRHA 1Y25A 1O8XA 1JHBA 2YZHA 5ECHB 3LWAA 3DRNA 3C1RA 2I4AA 1ZYPA 3G7IA 2KLXA 4K9ZA 1HQOA 3QOUA 3I69A 3WYWA 2C0DA 2P0GA 1TRWA 5DBQA 4BWSA 4IBPA 3LJRA 4E8EA 6GSVA 3GIXA 2MMZA 2IMKA 3O6TA 4J56E 4TRXA 1B9YC 1LU4A 1BQ7A 4KW6A 1M99A 3H79A 2PVQA 3QFAC 1GSEA 5BMUB 2HRFA 3WGDA 2H0HA 4BVXB 1GTAA 4TW5A 1J0FA 2FA4A 2OADA 2YWNA 1M0UA 3HD5A 1TP9A 1FVKA 4PUFC 1PRXA 4Z2TA 1YF1A 1GP1A 1BF5A 2H73A 2L4CA 4F9ZA 3DWVA 1ZYEA 5AIVA 1Z6NA 3UVTA 4O5UA 3ME7A 3MAKA 2FGXA 3CSJA 1TW9A 2LQQA 1ERUA 2ALBA 2HE3A 5CRDA 2OA7A 3VPTA 3IHQA 1K3LA 5ECQB 2H0GA 1W89A 5JCGA 2JSZA 3IC4A 1KEBA 3DVXA 5G2ZA 3UAPA 5A5HB 2GT5A 3GN3A 3ZMLA 4BPYA 1SK0A 2IMIA 4IGJA 3HMJG 1ABAA 3DGQA 5HQPA 1OE7A 1A2JA 1XBSA 1TK5B 2VO4A 5KOWA 2CZ2A 4EDZA 3IA1A 3LYPA 1TK0B 2IL3A 3I6AA 13GSA 2YOIA 2VD1A 3APOA 1G6YA 3FR6A 1S3CA 3CRTA 5D9WA 4N10A 2ZUPA 2TRXA 2E2GA 3D21A 2B6MA 2C0GA 2L59A 5E59A 1SKWB 2J23A 5IPHA 4TR3A 1B4PA 4I97A 5J47A 3QD9A 4OD7A 5ECKB 4NPBA 1O7UA 3LYKA 5A34A 2FLSA 2QC7A 4OFTA 9GSSA 5HR3A 4PGTA 2ES7A 3UEMA 1SK1A 1X9WB 2OKAA 5F06A 1Z7PA 2B7KA 3MIXA 4TR0A 3QPMA 1SVOA 5ENUA 4OWYA 3KP9A 4F0BA 1AQXA 5DJMA 2BJXA 3L9VA 2P31A 2I1UA 3IAS2 2NDOA 3HHVA 4G19A 4MJAA 1HD2A 3A2XA 4ISDA 5J9CA 2HI7A 3US3A 3GKKA 4QL9A 4K2XA 3ZYWA 3NIVA 3D4MA 1MDIA 2FWGA 4IHUA 1A24A 3D6IA 2GZZA 3GTUB 3D22A 1URMA 2LJRA 3KM6A 1WJKA 4GLTA 5IMAA 1VF1A 4DSSB 3IC8A 4KAEA 2HSHA 5CO3A 3N5OA 3EMXA 2CQ9A 2Z9SA 2V32A 3KGKA 3TKSA 3ZLPA 3HY2A 4Z2UA 1TKDB 3APQA 2H6ZA 2PWJA 4OO4A 2P5QA 1NW2A 1YEXA 4USSA 3TJKA 1VF3A 3TRQA 1X0RA 2O7KA 2GZPA 2HSNA 3UARA 2IMEA 16GSA 2YP6A 2CAIA 4N11A 2ZNMA 2K8SA 3QCPA 4Q5QA 2HRNA 3QFBC 5B6NA 4KX4A 2E7PA 5JWOB 4MH3A 2GGTA 1JZRA 5HFKA 3IK7A 3ZIJA 1EGRA 2B5YA 1PX7A 4K0GA 4PX1A 4K7NA 1Z3EA 4PURA 5CAXA 2IFQB 4K1FA 3WT2A 4FYBA 4WEYA 1U3AA 5A4VA 2HRKB 4F0CA 3DXBA 3DEXA 1Z6MA 2RUEA 1GLQA 4TR1B 1V40A 4I6XA 1B4QA 5IM9A 1EZKA 5F0GA 4E8HA 4F82A 4MZCA 2L5LA 4GQCA 1B48A 3TRXA 5DCGA 3GURA 2YZUA 2CZ3A 1QFNA 1GH2A 1ML6A 1BG1A 3C7MA 1F2EA 3C71A 4O7HA 3GX8A 3WD6A 4WBRD 4BA7A 3GSSA 4HJ2A 7GSSA 2R37A 2CVKA 3QAVA 3TKRA 4H86A 2WCIA 5LNKe 3GFKA 1EWXA 5GSTA 5IMVA 3KH7A 4IS0A 3C73A 4J2FA 1T1VA 2LJAA 4F2IA 5DALA 19GSA 4KDYA 22GSA 4L5OA 3F8UA 3WGXA 2C1YA 2DKHA 2NVLA 4DEJA 4MABA 1K0DA 3RHBA 1WMJA 2K8VA 5A1NA 5J41A 4IP6A 5CP1A 4TOPA 4MLYA 2B5XA 4IELA 1H75A 4V1Ag 1NHYA 4N0VA 1ZCPA 4ULXA 4KSOA 1TU8A 5G1KA 2DJ3A 2HRAA 4EL1A 2HSYA 5DALB 2EC4A 3D0ZA 3TCOA 5FWGA 2C0FA 2VUPA 1X9SB 4X1UA 2JADA 5FHIA 3EE2A 3UIWA 4GSNA 3VWVA 4MMMA 1WRYA 2H76A 1XFLA 4EF0A 3NOFA 2WS2A 3F6DA 4WETA 3O3TA 3KTBA 3EC3A 4KH7A 3G7JA 1WWJA 4Z2RA 4KF9A 2DJ0A 4G0IA 4MPFA 3SWLA 2LS5A 1GSFA 2YPMA 2H6YA 2H72A 5H5SA 1WP0A 3HJMA 3LEFA 3QMXA 5JCWA 2MZCA 4IN0A 3FKFA 2HZEB 4YH2A 1VRSD 3R2QA 1I9DA 1EEJA 4ECIA 5ID2B 2MBSA 3IV4A 1SK2A 1FAAA 4KB3A 4KUNA 1K0OA 2G2QA 4CY8A 2B1LA 4AKGA 1K3OA 1JZWA 1X5EA 4L0WA 3TJGA 2LSTA 1O8WA 1YY7A 4FO5A 1YKCA 3CSHA 2N5FA 1A0FA 2DJ2A 1ZMAA 1AQVA 3IE3A 4ECCA 3M3MA 1TOFA 1ZZYA 5LD0A 2VLVA 4GF0A 5KOXA 3BJ5A 2LRTA 3UBKA 1XOAA 4EO3A 1T7PB 2VIMA 4KE3A 2YWIA 3RDWA 4NXIA 3PH9A 3LFLA 5H5QA 2R6KA 1SVMA 3L9UA 2H30A 2ON5A 2VCWA 1QGVA 2HSMB 3ZVJD 2UZ8A 3MDKA 2B5EA 1OC8A 1XZOA 2FHEA 3GYKA 3FRCA 1T00A 4PQ1A 3L9SA 2J9HA 1LJRA 4EIQA 3A3TA 3M8NA 2HQTA 1QMVA 4QL7A 5CYYA 3KH9A 1K0CA 1M2BA 17GSA 5EY6A 6GSXA 1SVLA 3F4RA 1AAZA 3FW2A 1SL1B 3FHKA 3GL3A 3JCML 4N3ZA 4MJBA 1RK4A 3CWGA 1PL2A 2XPDA 2AUVA 5C04A 4KDUA 2TRCP 2CX4A 3ERGA 2PGTA 5ELGA 1THOA 2E0QA 4HQZA 3MSZA 4EKZA 2L6CA 4GTUA 2VCTA 2WZ9A 5ECMB 2YANA 1GNEA 1GTUA 4JE1A 2VM2A 1XPVA 1V9WA 1ST9A 2H74A 4PQIA 4TXVA 3HXSA 4HEA2 2FWHA 1OVNA 3R3EA 3GKXA 4F03A 2IIYA 1XVQA 5IOXA 3HVVA 1AW9A 2GS3A 3IDVA 4HUAA 5G5EA 4AKIA 4IP1A 2FD3A 1E6BA 3W8SA 3LXTA 3TJJA 1GSDA 2YV7A 4LL4B 2LNSA 4ZIJA 2H1AA 2DMLA 3F9UA 1S3DA 2GSRA 3GUSA 3FMWA 1PA3A 3IPZA 4NV2A 2L6DA 1SJ6A 1GSQA 5JCUA 2IMFA 2HZFA 2GSTA 4EUYA 2R2JA 5G5FA 3D4TA 4OFNA 4GQFA 4HJMA 1E2YA 1ILOA 2EFDA 3TRPA 1M7TA 4WKWA 2I9HA 1UN2A 4TN8A 5CNWA 3EURA 4IQ1A 4L8EA 1T4ZA 3UBLA 1ZYNA 2HYXA 2A2SA 5ECPB 1XCCA 1F9MA 3IK9A 3PPUA 2PPTA 2DJ1A 3QDNA 5J3RA 4YQUA 2XHFA 3HZ4A 3ZRDA 2VOCA 4TVEA 4OFMA 3CXGA 4LA1A 5A4WA 1H4OA 3F0IA 2P5RA 4IKHA 4HZ2A 4ZBBA 1BEDA 4XS1A 5D9XA 2JSYA 3HA9A 1G6WA 4AGSA 2CV4A 1SENA 2PBJA 4ACSA 1ZL9A 2WJUA 2WGRA 1OKDA 2OBKA 3ISOA 2FNOA 3A2WA 4DSRA 3VWWA 3L4NA 3TKPA 3LG6A 3UJ1A 1YKAA 3KMNA 5DAKA 1G7EA 4HI7A 2LV3A 4ZL9A 4ZB9A 3W8JA 1F37A 3TU3B 4Q5NA 1BG5A 4W66A 3HZ8A 5IO0A 2RM6A 1KTEA 1O81A 4KNDA 5CRGA 4L0UA 5DJLA 5B8AA 3E3EA 2H75A 3L0HA 4ICYA 2V6OA 2MMAA 5A34B 1RQMA 3IHGA 2E2MA 2EIOA 5G1LA 3VI7A 4K0NA 1A2MA 2GSSA 5CREA 1SJZA 2H0IA 1PN0A 2QKEA 5DQSA 2JZRA 5IMZA 4MF7A 2GT6A 3E0UA 3TKSC 1U6TA 3GL5A 2OACA 3TKSE 3CMIA 2QSIA 1K0BA 5AIXA 3UOMA 5JWRB 5J40A 3MNGA 4WF5A 4EVMA 1R7HA 1X5CA 3QAGA 4TKYA 2VLUA 1GSUA 3Q18A 1AUCA 1J08A 1OAZA 4HU9A 2YCDA 1K0MA 1SD9A 4POLA 4PNFA 2XPEA 1Q98A 2YWMA 3GA4A 2HXKA 1SKRB 2FCHA 1MEKA 2A2PA 2GVPA 1V57A 2YNXA 5ECIB 3PINA 2X8GA 1EOGA 1GLPA 2FWFA 5F8BA 4FYCA 1OYJA 1FVJA 2GZYA 4I2UA 3BBYA 4BL7A 5IMFA 1TU7A 18GSA 4ZB7A 3KEBA 3VK9A 1EOHA 2GLRA 1USBA 3RPNA 1M2AA 5HR1A 3FR9A 2HLSA 2MMOA 2HSNB 1QK8A 2CAQA 1PL1A 14GSA 2R3XA 3ZIVA 1ON4A 2HNLA 1UA5A 3FY7A 1CQHA 4OCEA 3QR6A 4WBJA 5INYA 3IR4A 3CTFA 1BYEA 2VLTA 3E9JB 4KCAA 3F63A 2OT3A 2IWTA 1GSYA 2NPBA 2EFCA 2YN1A 3AY8A 2NBSA 1GTIA 4HQSA 1KBNA 5EL8A 4XS4A 4ZL7A 2PUKC 5F07A 1W4VA 2H71A 2H6XA 3SBCA 4HU7A 5ECLB 4JR4A 20GSA 1SL0B 3M0FA 4CHSA 4O5RA 3J7Yb 5GZZB 1XW9A 2AYTA 1QXHA 4K5SA 5J4UA 1THXA 2F8FA 2EIRA 1ZGNA 4G10A 4MF6A 3KIJA 1UC7A 5LCZA 2V2GA 4NWYA 3TDGA 2MYGA 3GH6A 1J9BA 5D96A 2O89A 1RW1A 5J4VA 4RQRA 4X43A 2A2RA 3TGZA 2R5GA 5A5KA 1I5GA 2UV8G 4JBBA 4G0LA 4YQVA 1U3IA 1JLVA 4RI6A 1FO5A 3RAZA 3GRXA 3DKSA 2I3YA 2R0CA 1OC9A 2C3TA 3H1NA 1AIUA 3HYPA 2HT9A 2B1KA 2OJLA 3FZ5A 2IMDA 5F05A 1XWBA 2OE1A 4YAVA 3DD3A 4IQAA 4I5QA 1GUKA 2JU5A 1DUGA 1YF0A 4GRFA 5D93A 1V58A 4LL1B 4MP4A 5GSSA 2AV4A 4TXOA 5ELAA 4KSMA 6GSYA 1IYHA 1B9XC 5GAND 3KJYA 3GKMA 5A1NB 3G9BA 3OR5A 2LTKA 2DIZA 2PN8A 1OC9B 4TR4A 1HNBA 2JACA 3CTGA 3KZQA 2O8VB 1GTBA 5DCHA 4Q5FA 5HR2A 3U6VA 2CVBA 3F4SA 5IMCA 3HJOA 2CX3A 1EP7A 1YEPA 1XOBA 1ZOFA 1M9BA 1U87A 4OCFA 1M2DA 2X4AA 1DSBA 3RHCA 4ZBDA 2VD0A 1TI3A 3NZNA 4TXOB 4GDFA 2R4VA 4V1Ap 2C3NA 4A5PA 3GH9A 5G31A 2H1DA 3P2AA 1ERTA 2RUFA 2V1MA 2VCQA 5IOWA 3G7YA 2H1GA 3J7Yk 1DE2A 1Y6EA 5AN1A 3N9JA 3ZFBA 4OMVA 2AAWA 1A2LA 1GUHA 4KGIA 1TRSA 4WF4A 2LEGA 2QA1A 3ZREA 3LW9A 12GSA 1SYRA 3PR8A 4PXOA 2X8CA 2F8AA 1ERVA 3ZITA 2K9FA 2VAFA 3IXRA 3ERFA 2A4HA 3H4KA 1X5DA 1N2AA 5KN0A 4WXTA 4ZB6A 2V6KA 2F51A 1A8LA 1TDIA 4KA0A 5ECNB 1TI1A 1Y1UA 2LRNA 1QQ2A 1JZOA 1SU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J5N A;  4IQ1 A;  4L8E A;  4HZ4 A;  4YQM A;  5ECR B;  1VF2 A;  3UBL A;  3O76 A;  1GSS A;  1OKT A;  2A2S A;  3KMO A;  3LXZ A;  5ECP B;  4USS A;  1VF3 A;  3C8E A;  3IK9 A;  3PPU A;  3Q74 A;  4BVY B;  4YQU A;  3UAR A;  16GS A;  2CAI A;  1B8X A;  5B7C A;  4OFM A;  5A4W A;  3VUR A;  2C4J A;  4Q5Q A;  1GUL A;  5D9T A;  3LSZ A;  4IKH A;  4JZQ A;  4JED A;  4G0K A;  4EXJ A;  4HZ2 A;  4KX4 A;  4ZBB A;  1PKW A;  4MF5 A;  5D9X A;  1JZR A;  5ECO B;  1G6W A;  2C3Q A;  4GSS A;  5HFK A;  4AGS A;  1AQW A;  3IK7 A;  3P90 A;  1YDK A;  2PBJ A;  4ACS A;  6GST A;  1PX7 A;  1ZL9 A;  4K0G A;  2WJU A;  3HKR A;  4PX1 A;  1XW5 A;  2YV9 A;  4PUR A;  3ISO A;  4ECB A;  2FNO A;  2CA8 A;  2WRT A;  5IQY A;  5BMU A;  5A4V A;  2HRK B;  4F0C A;  2DC5 A;  3LG6 A;  4BVX A;  1BAY A;  1GLQ A;  1V40 A;  3M1G A;  5KEJ A;  3KMN A;  5DAK A;  4HI7 A;  4PNG A;  6GSS A;  4G9H A;  1R5A A;  4ZB9 A;  4EE0 A;  4NHZ A;  5F0G A;  4E8H A;  4Q5N A;  1PX6 A;  1BG5 A;  3ZFL A;  3RBT A;  1B48 A;  3EIN A;  5DCG A;  3GUR A;  1GUM A;  2CZ3 A;  4PUA A;  1ML6 A;  1M9A A;  4RI7 A;  3CRU A;  5DJL A;  4EDY A;  3L0H A;  1K0N A;  1F2E A;  4O7H A;  1G7O A;  3WD6 A;  1XW6 A;  2WDU A;  1GWC A;  2PMT A;  3GSS A;  1V2A A;  4HJ2 A;  7GSS A;  3VI7 A;  4K0N A;  1F3B A;  2GSS A;  5D73 A;  4IVF A;  3QAV A;  5AGY A;  1EV4 A;  5DQS A;  3TOT A;  4MF7 A;  2CVD A;  4ZXG A;  3FYG A;  4FQU A;  1MD4 A;  2OAC A;  1HNA A;  1K0B A;  5AIX A;  4LMW A;  1XWK A;  3FR3 A;  4PTS A;  2HSM A;  3QAG A;  5GST A;  1JLW A;  4IS0 A;  1GSU A;  3Q18 A;  2F3M A;  4J2F A;  6GSU A;  4O92 A;  3KXO A;  5DAL A;  1PN9 A;  2VCX A;  6GSW A;  2YCD A;  19GS A;  1K0M A;  4KDY A;  1FHE A;  22GS A;  4L5O A;  5AIS A;  4PNF A;  2C8U A;  5A4U A;  3UVH A;  1PKZ A;  3CSI A;  4QQ7 A;  4WR4 A;  3TOU A;  1PGT A;  1YQ1 A;  4DEJ A;  1K0D A;  5J41 A;  5ECI B;  4TOP A;  3PGT A;  11GS A;  1MD3 A;  4IEL A;  4HOJ A;  4GST A;  4IW9 A;  8GSS A;  1EOG A;  1GLP A;  1NHY A;  4MZW A;  4N0V A;  4PQH A;  1PMT A;  4LMV A;  1PD2 1;  2NTO A;  5F8B A;  1TU8 A;  1OYJ A;  2HRA A;  3BBY A;  4BL7 A;  1EEM A;  1TU7 A;  18GS A;  4ZB8 A;  1K0A A;  5DAL B;  3VK9 A;  1EOH A;  3D0Z A;  2GLR A;  5ECH B;  5FWG A;  2GTU A;  3G7I A;  1USB A;  2WB9 A;  1HQO A;  3I69 A;  3FR9 A;  3WYW A;  5FHI A;  3EE2 A;  10GS A;  4GSN A;  2HSN B;  3VLN A;  3IBH A;  2WS2 A;  2CAQ A;  3F6D A;  1PL1 A;  4IBP A;  2GDR A;  3LJR A;  3O3T A;  4E8E A;  14GS A;  2R3X A;  6GSV A;  2VCV A;  4KH7 A;  4YAP A;  2HNL A;  2IMK A;  3G7J A;  1UA5 A;  3FY7 A;  3QR6 A;  3IR4 A;  4KF9 A;  5ECS A;  1BYE A;  4G0I A;  3GTU A;  4MPF A;  3SWL A;  1GSF A;  3F63 A;  1K3Y A;  1GSY A;  3HJM A;  1LBK A;  3AY8 A;  4GCI A;  1C72 A;  5JCW A;  4ECJ A;  1GTI A;  4EC0 A;  1M99 A;  2PVQ A;  1KBN A;  5EL8 A;  4YH2 A;  1GSE A;  3P8W A;  3R2Q A;  5F07 A;  2C80 A;  4ECI A;  4BVX B;  5ECL B;  1GTA A;  20GS A;  3M0F A;  5DAK B;  2OAD A;  1K0O A;  1M0U A;  4CHS A;  5GZZ B;  1K3O A;  1U88 A;  1Z9H A;  5J4U A;  1YY7 A;  1YKC A;  2X64 A;  3CSH A;  2N5F A;  2F8F A;  5AIV A;  5EVO A;  1ZGN A;  2AHE A;  4G10 A;  4MF6 A;  3MAK A;  1A0F A;  3CSJ A;  5LCZ A;  1AQV A;  1TW9 A;  3IE3 A;  4ECC A;  3GH6 A;  3M3M A;  5LD0 A;  2OA7 A;  4GF0 A;  3VPT A;  3QAW A;  1K3L A;  5ECQ B;  2JL4 A;  2A2R A;  3TGZ A;  2R5G A;  3UBK A;  1XWG A;  2VCZ A;  5A5K A;  1VF4 A;  4JBB A;  4G0L A;  5FT3 A;  3ZMK A;  4YQV A;  2PER A;  3UAP A;  1U3I A;  2AB6 A;  4KE3 A;  4Q5R A;  1JLV A;  4RI6 A;  3ZML A;  2IMI A;  3LFL A;  2R6K A;  1IYI A;  4IGJ A;  2C3T A;  3H1N A;  2ON5 A;  2VCW A;  2HSM B;  4ID0 A;  2UZ8 A;  3MDK A;  2HRK A;  5F05 A;  3CBU A;  3DGQ A;  1OE7 A;  4YAV A;  2FHE A;  3DD3 A;  2VO4 A;  4IQA A;  1GUK A;  5DDL A;  3FRC A;  2J9H A;  3LQ7 A;  1LJR A;  1DUG A;  2CZ2 A;  4EDZ A;  3LYP A;  2IL3 A;  3I6A A;  13GS A;  3M8N A;  2HQT A;  2VD1 A;  1G6Y A;  1K0C A;  1GNW A;  3FR6 A;  1EV9 A;  3VPQ A;  4MP4 A;  3CRT A;  5D9W A;  17GS A;  1HNC A;  4MPG A;  5GSS A;  5EY6 A;  5ELA A;  6GSX A;  4KSM A;  6GSY A;  1IYH A;  3Q19 A;  1RK4 A;  3KJY A;  3KTL A;  3VI5 A;  1PL2 A;  1OE8 A;  4IJI A;  1B4P A;  4I97 A;  4KDU A;  3ERG A;  2PGT A;  5ECK B;  5ELG A;  1HNB A;  2ON7 A;  3LYK A;  1Q4J A;  1GTB A;  4Q5F A;  4OFT A;  9GSS A;  3U6V A;  4PGT A;  5F06 A;  3HJO A;  4BL7 B;  1MTC A;  4GTU A;  1M9B A;  2VCT A;  5ECM B;  1GNE A;  1GTU A;  1U87 A;  4F0B A;  1AQX A;  5DJM A;  1BX9 A;  4PQI A;  2DSA A;  4ZBD A;  2VD0 A;  4G19 A;  3R3E A;  2R4V A;  1YJ6 A;  4F03 A;  4ISD A;  4MK3 A;  2C3N A;  1AW9 A;  1FW1 A;  5G5E A;  4NAX A;  1E6B A;  3W8S A;  3LXT A;  1GSD A;  3NIV A;  2VCQ A;  2YV7 A;  1Y6E A;  3GTU B;  5AN1 A;  3N9J A;  3ZFB A;  4OMV A;  2AAW A;  2LJR A;  3KM6 A;  1GUH A;  4GLT A;  1VF1 A;  4KGI A;  3IC8 A;  4BVY A;  2GSR A;  2D2Z A;  3GUS A;  3GX0 A;  1PA3 A;  12GS A;  4KAE A;  3GST A;  3PR8 A;  4PXO A;  2GSQ A;  1GSQ A;  5JCU A;  3N5O A;  3F6F A;  4NHW A;  4WR5 A;  2GST A;  3ERF A;  4L5L A;  4KDX A;  1N2A A;  1AXD A;  5G5F A;  3VWX A;  4OFN A;  4ZB6 A;  2V6K A;  5D9V A;  1TDI A;  1F3A A;  5ECN B;  4ZBA A;  4MDC A; 
#chains in the Genus database with same CATH topology
 5J5N A;  4POB A;  2R0P A;  4ML6 A;  2KP2 A;  4HZ4 A;  4YQM A;  1T4Y A;  4AKX B;  1VF2 A;  1OKT A;  2FA8 A;  1PQN A;  3KMO A;  2I81 A;  4V2N A;  3C8E A;  3UL3 A;  1R4W A;  3Q74 A;  2M46 A;  2X99 A;  1PFO A;  5B7C A;  1M3I A;  2LQO A;  3VUR A;  2C4J A;  2PVO C;  5DVB A;  4JZQ A;  2FWE A;  5H5R A;  2OE3 A;  1PKW A;  1JZD A;  4AJ6 A;  2M72 A;  1FB6 A;  2WUL A;  5HR0 A;  1EP8 A;  2DJK A;  1XW5 A;  1AC1 A;  2YV9 A;  3BCK A;  4ECB A;  2CA8 A;  1EGO A;  1T8E B;  2WW2 A;  5BMU A;  2PU9 C;  4BVX A;  1BAY A;  5KEJ A;  3VWU A;  4PNG A;  6GSS A;  1R5A A;  1CQG A;  3HJP A;  3DML A;  4IJ3 A;  4NV5 A;  1PX6 A;  3CQF A;  3ZFL A;  4XHM A;  3A5W A;  3EIN A;  4POM A;  1GUM A;  2FY6 A;  1O73 A;  4PUA A;  2O87 A;  4RI7 A;  3CRU A;  4EDY A;  2V41 A;  2WZS A;  1G7O A;  3LOR A;  4LLR A;  2AJQ B;  2WDU A;  1V2A A;  5KN2 A;  1NSW A;  3FZ9 A;  5A5H A;  1MDK A;  4DVC A;  1A0R P;  4N30 A;  4JR6 A;  2CVD A;  4ZXG A;  4O32 A;  4FQU A;  1MD4 A;  3BD2 A;  3IRA A;  4LMW A;  1XWK A;  2GQK A;  3KD0 A;  4FYU A;  4PTS A;  2KUC A;  5D8I A;  4AJ8 A;  1JLW A;  2CT6 A;  4CDO A;  2F3M A;  2H66 A;  4MZB A;  2LRC A;  3FK8 A;  6GSU A;  4POK A;  4NMU A;  3FZ4 A;  4O92 A;  1PN9 A;  2OE0 A;  4K2D A;  2LNT A;  3CHX C;  4V2M A;  5BRT A;  3UVH A;  1PKZ A;  3CSI A;  2YJ7 A;  4WR4 A;  1YQ1 A;  4ILF A;  4K7I A;  2DIY A;  3LGC A;  1WPI A;  2LKU A;  4K8M A;  3PGT A;  11GS A;  2H8L A;  4FH8 A;  4HOJ A;  2R0G A;  2M80 A;  4PQH A;  1SKS B;  2NTO A;  1YZX A;  3DIE A;  3DYR A;  4ZB8 A;  1K0A A;  2VL9 A;  2K18 A;  3P7X A;  2GTU A;  1DBY A;  2WB9 A;  10GS A;  1GL8 A;  1FG4 A;  3MYD A;  2RM5 A;  2EFH A;  3VLN A;  3IBH A;  3ERW A;  1PSQ A;  4MH2 A;  2GDR A;  1SJI A;  4CW9 A;  1A23 A;  1UVZ A;  3M9J A;  4AF2 A;  2VCV A;  2REM A;  4YAP A;  5B8B A;  5IPG A;  3C1S A;  5ECS A;  1TXX A;  3GTU A;  5IMD A;  2JZS A;  4ML1 A;  3FEU A;  3UMA A;  4DSS A;  1K3Y A;  1LBK A;  1N25 A;  3V1W A;  2XC2 A;  2DJJ A;  2RLI A;  4GCI A;  1C72 A;  5HFG A;  4I2T A;  4ECJ A;  4EC0 A;  1Z7R A;  2O36 A;  5G30 A;  3P8W A;  2C80 A;  5DAK B;  3VFI A;  1TJD A;  3U5R E;  3CYN A;  3L78 A;  2N5B A;  1SL2 B;  3F4T A;  1U88 A;  1Z9H A;  4AI6 A;  3HCZ A;  2X64 A;  3A2V A;  4XIH A;  5EVO A;  1N8J A;  3F3R A;  3GHA A;  2F9S A;  2AHE A;  4HS1 A;  4E68 A;  2JZT A;  2GQM A;  4AJ7 A;  3QAW A;  2JL4 A;  2B7J A;  4X4J A;  1BJX A;  1XWG A;  2VCZ A;  1VF4 A;  3TB2 A;  5FT3 A;  3ZMK A;  2G0F A;  1NHO A;  2PER A;  2AB6 A;  3MWH A;  4Q5R A;  4BWQ A;  3M9K A;  5L71 A;  2VL3 A;  1TTZ A;  4K7O A;  3IAM 2;  1IYI A;  4P3Y B;  2IFQ A;  2H1L A;  3S9F A;  2H19 A;  4ID0 A;  3HDC A;  2MBT A;  2HRK A;  4J57 E;  2XBQ A;  3TJB A;  2WVY A;  3CBU A;  1NM3 A;  4TR1 A;  3KP8 A;  4D73 A;  5DDL A;  3LQ7 A;  2MMN A;  2EFE A;  2IJY A;  3RPP A;  2DKI A;  2GQL A;  2A4V A;  1GNW A;  1EV9 A;  3VPQ A;  1X9M B;  1S4B P;  1HNC A;  4MPG A;  3TJF A;  2RII A;  3HVX A;  3TKQ A;  3D5J A;  3Q19 A;  3IOS A;  1TXU A;  4I8B A;  2VKZ G;  3KTL A;  3VI5 A;  1OE8 A;  2DBC A;  4IJI A;  2WVZ A;  5COH A;  4DSQ A;  1FB0 A;  2ON7 A;  1Q4J A;  3GNJ A;  5E4W A;  2C0E A;  2DLX A;  2H1B A;  2OBI A;  4BL7 B;  1MTC A;  5ABR A;  4D73 B;  1HYU A;  5J4Y A;  4GWR A;  1A8Y A;  5B6M A;  1BX9 A;  3EVI A;  2DSA A;  1WOU A;  5IO2 A;  3BOA A;  1YJ6 A;  4MK3 A;  3HVS A;  1WIK A;  2N5A A;  2DMM A;  5IIZ A;  1FW1 A;  4NAX A;  2WFC A;  1DE1 A;  1I1I P;  2IN3 A;  1MDJ A;  1T3B A;  1WE0 A;  5CRW A;  3GMF A;  3WT1 A;  4BVY A;  2D2Z A;  3GX0 A;  3ZZX A;  3GST A;  3GV1 A;  2X8H A;  2GSQ A;  3K8N A;  3F6F A;  1XWC A;  4NHW A;  4WR5 A;  4XS4 B;  3ZTL A;  4MJE A;  4L5L A;  4KDX A;  4Z7X A;  1AXD A;  2L4Q A;  2QA2 A;  3VWX A;  4K5R A;  5D9V A;  1F3A A;  3EU4 A;  2KP1 A;  4XRA A;  2HFD A;  1ERW A;  2KHP A;  4ZBA A;  5KN1 A;  3RGB C;  4MDC A;  5JWQ B;  5C00 A;  5ECR B;  3A5I A;  1KNG A;  3ED3 A;  3O76 A;  1GSS A;  3TUE A;  3LXZ A;  2LUS A;  1O6J A;  4YKF A;  4BVY B;  3EWL A;  2H01 A;  3DVW A;  2BMX A;  4QMK A;  1TRV A;  5KN3 A;  1B8X A;  4KCE A;  1Z5Y E;  1GUL A;  5D9T A;  3EMP A;  3H8Q A;  3ME8 A;  3LSZ A;  3FZA A;  1ZYQ B;  4JED A;  4YKG A;  4G0K A;  4EXJ A;  4V2L A;  4G01 A;  1JFU A;  4MF5 A;  1G0T A;  2O85 A;  1GRX A;  2O5V A;  4ZL8 A;  5ECO B;  2C3Q A;  4GSS A;  4XCS A;  4GXZ A;  1AQW A;  1FOH A;  2VL2 C;  3P90 A;  1YDK A;  6GST A;  3BCI A;  3HKR A;  4ZIL A;  3EYT A;  2FUG 2;  5DQY A;  1R26 A;  4OO5 A;  3H93 A;  2HZE A;  3ZVJ A;  2WRT A;  5IQY A;  2VL2 A;  2IPA A;  4G2E A;  4XTS A;  4MNN A;  2DC5 A;  5ID2 A;  3M1G A;  2L5O A;  3I43 A;  2X49 A;  4G9H A;  5J9B A;  1OC3 A;  4EE0 A;  1S3A A;  1ACV A;  4NHZ A;  3KCM A;  1V98 A;  2L57 A;  3RBT A;  3Q6O A;  1M9A A;  2H70 A;  2VM1 A;  4RUV A;  1TK8 B;  2B3S A;  1K0N A;  3I9V 2;  2K6V A;  1XW6 A;  4RQX A;  1GWC A;  4N0Z A;  4AKH A;  2PMT A;  1XVW A;  1YVL A;  3WGE A;  1F3B A;  5D73 A;  4IVF A;  4X0X A;  5HFI A;  1XWA A;  5AGY A;  2ZCT A;  3GKN A;  1EV4 A;  4HDE A;  3TOT A;  1QUW A;  4K6X A;  3FYG A;  4O5Q A;  1HNA A;  4MA9 A;  3FR3 A;  4MJC A;  3EU3 A;  2HSM A;  3F3Q A;  2TIR A;  1XXU A;  5EPF A;  2YJH A;  1FOV A;  1SD8 A;  4JU5 A;  3KXO A;  6GSW A;  2VCX A;  2QGV A;  1FHE A;  1SYX A;  2YWO A;  5AIS A;  2C8U A;  4XRD A;  5A4U A;  4JRR A;  2LJK A;  4QQ7 A;  1XIY A;  3TOU A;  1PGT A;  1F6M C;  4MCU A;  4EIP A;  5GAP D;  3EPT A;  2XBI A;  1MD3 A;  4XS6 A;  1R5P A;  2BTO T;  2EIQ A;  4GST A;  4IW9 A;  4CY6 A;  8GSS A;  3W6G A;  3APS A;  4MZW A;  3ZL5 A;  1PMT A;  1O85 A;  4LMV A;  1PD2 1;  1VGL A;  2KOK A;  1TRU A;  4FIW A;  1EEM A;  5CRH A;  1Y25 A;  1O8X A;  1JHB A;  2YZH A;  5ECH B;  3LWA A;  3DRN A;  3C1R A;  2I4A A;  1ZYP A;  3G7I A;  2KLX A;  4K9Z A;  1HQO A;  3QOU A;  3I69 A;  3WYW A;  2C0D A;  2P0G A;  1TRW A;  5DBQ A;  4BWS A;  4IBP A;  3LJR A;  4E8E A;  6GSV A;  3GIX A;  2MMZ A;  2IMK A;  3O6T A;  4J56 E;  2WW0 A;  4TRX A;  4PHZ C;  1B9Y C;  1LU4 A;  1BQ7 A;  4KW6 A;  1M99 A;  3H79 A;  2PVQ A;  3QFA C;  1GSE A;  5BMU B;  2HRF A;  3WGD A;  2H0H A;  4BVX B;  1GTA A;  4TW5 A;  1J0F A;  2FA4 A;  2OAD A;  2YWN A;  1M0U A;  3HD5 A;  1TP9 A;  1FVK A;  4PUF C;  1PRX A;  4Z2T A;  1YF1 A;  1GP1 A;  1BF5 A;  2H73 A;  2L4C A;  4F9Z A;  3DWV A;  1ZYE A;  5AIV A;  1Z6N A;  3UVT A;  4O5U A;  3ME7 A;  3MAK A;  2FGX A;  3CSJ A;  1TW9 A;  2LQQ A;  1ERU A;  2ALB A;  2HE3 A;  5CRD A;  2OA7 A;  3VPT A;  3IHQ A;  1K3L A;  5ECQ B;  2H0G A;  1W89 A;  5JCG A;  2JSZ A;  3IC4 A;  1KEB A;  3DVX A;  5G2Z A;  3UAP A;  5A5H B;  1YEW C;  2GT5 A;  3GN3 A;  3ZML A;  4BPY A;  1SK0 A;  2IMI A;  4IGJ A;  3HMJ G;  1ABA A;  3DGQ A;  5HQP A;  1OE7 A;  1A2J A;  1XBS A;  1TK5 B;  2VO4 A;  5KOW A;  2CZ2 A;  4EDZ A;  3IA1 A;  3LYP A;  1TK0 B;  2IL3 A;  3I6A A;  13GS A;  2YOI A;  2VD1 A;  3APO A;  1G6Y A;  3FR6 A;  1S3C A;  3CRT A;  5D9W A;  4N10 A;  2ZUP A;  2TRX A;  2E2G A;  3D21 A;  2B6M A;  2C0G A;  2L59 A;  5E59 A;  1SKW B;  2J23 A;  5IPH A;  4TR3 A;  1B4P A;  4I97 A;  5J47 A;  3QD9 A;  4OD7 A;  5ECK B;  4NPB A;  1O7U A;  3LYK A;  5A34 A;  2FLS A;  2QC7 A;  4OFT A;  9GSS A;  5HR3 A;  4PGT A;  2ES7 A;  3UEM A;  1SK1 A;  1X9W B;  2OKA A;  5F06 A;  1Z7P A;  2B7K A;  3MIX A;  4TR0 A;  3QPM A;  1SVO A;  5ENU A;  4OWY A;  3KP9 A;  4F0B A;  1AQX A;  5DJM A;  2BJX A;  3L9V A;  2P31 A;  2I1U A;  3IAS 2;  2NDO A;  3HHV A;  4G19 A;  4MJA A;  1HD2 A;  3A2X A;  4ISD A;  3HVN A;  5J9C A;  2HI7 A;  1XG8 A;  3GKK A;  3US3 A;  4QL9 A;  4K2X A;  3ZYW A;  3NIV A;  3D4M A;  1MDI A;  2FWG A;  4IHU A;  1A24 A;  3D6I A;  2GZZ A;  3GTU B;  3D22 A;  1URM A;  2LJR A;  3KM6 A;  1WJK A;  4GLT A;  5IMA A;  1VF1 A;  4DSS B;  3IC8 A;  4KAE A;  2HSH A;  5CO3 A;  3N5O A;  3EMX A;  2CQ9 A;  2Z9S A;  2V32 A;  3KGK A;  3TKS A;  3ZLP A;  3HY2 A;  4Z2U A;  1TKD B;  3APQ A;  2H6Z A;  2PWJ A;  4OO4 A;  2P5Q A;  1NW2 A;  1YEX A;  4USS A;  3TJK A;  1VF3 A;  3TRQ A;  1X0R A;  2O7K A;  2GZP A;  2HSN A;  3UAR A;  2IME A;  16GS A;  2YP6 A;  2CAI A;  4N11 A;  2ZNM A;  2K8S A;  3QCP A;  4Q5Q A;  2HRN A;  3QFB C;  5B6N A;  4KX4 A;  2E7P A;  5JWO B;  4MH3 A;  2GGT A;  1JZR A;  5HFK A;  3IK7 A;  3ZIJ A;  1EGR A;  2B5Y A;  1PX7 A;  4K0G A;  4PX1 A;  4K7N A;  1Z3E A;  4PUR A;  5CAX A;  2IFQ B;  4K1F A;  3WT2 A;  4FYB A;  4WEY A;  1U3A A;  5A4V A;  2HRK B;  4F0C A;  3DXB A;  3DEX A;  1Z6M A;  2RUE A;  1GLQ A;  4TR1 B;  1V40 A;  4I6X A;  1B4Q A;  5IM9 A;  1EZK A;  5F0G A;  4E8H A;  4F82 A;  4MZC A;  2L5L A;  4GQC A;  1B48 A;  3TRX A;  5DCG A;  3GUR A;  2YZU A;  2CZ3 A;  2WW3 A;  1QFN A;  1GH2 A;  1ML6 A;  1BG1 A;  3C7M A;  1F2E A;  3C71 A;  4O7H A;  3GX8 A;  3WD6 A;  4WBR D;  4BA7 A;  3GSS A;  4HJ2 A;  7GSS A;  2R37 A;  2CVK A;  3QAV A;  3TKR A;  4H86 A;  2WCI A;  5LNK e;  3GFK A;  1EWX A;  5GST A;  5IMV A;  4IS0 A;  3KH7 A;  3C73 A;  4J2F A;  1T1V A;  2LJA A;  4F2I A;  5DAL A;  19GS A;  4KDY A;  22GS A;  4L5O A;  3F8U A;  3WGX A;  2C1Y A;  2DKH A;  2NVL A;  4DEJ A;  4MAB A;  2WW1 A;  1K0D A;  3RHB A;  1WMJ A;  2K8V A;  5A1N A;  5J41 A;  4IP6 A;  5CP1 A;  4TOP A;  4MLY A;  2B5X A;  4IEL A;  1H75 A;  4V1A g;  1NHY A;  4N0V A;  1ZCP A;  4ULX A;  4KSO A;  1TU8 A;  5G1K A;  2DJ3 A;  2HRA A;  4EL1 A;  2HSY A;  5DAL B;  2EC4 A;  3D0Z A;  3TCO A;  5FWG A;  2C0F A;  2VUP A;  1X9S B;  4X1U A;  2JAD A;  2O3E A;  5FHI A;  3EE2 A;  3UIW A;  4GSN A;  3VWV A;  4MMM A;  1WRY A;  2H76 A;  1XFL A;  4EF0 A;  3NOF A;  2WS2 A;  3F6D A;  4WET A;  3O3T A;  3KTB A;  3EC3 A;  4KH7 A;  3G7J A;  1WWJ A;  4Z2R A;  4KF9 A;  2DJ0 A;  4G0I A;  4MPF A;  3SWL A;  2LS5 A;  1GSF A;  2YPM A;  2H6Y A;  2H72 A;  1M3J A;  5H5S A;  1WP0 A;  3HJM A;  3LEF A;  3QMX A;  5JCW A;  2MZC A;  4IN0 A;  3FKF A;  2HZE B;  4YH2 A;  1VRS D;  3R2Q A;  1I9D A;  1EEJ A;  4ECI A;  5ID2 B;  2MBS A;  3IV4 A;  1SK2 A;  1FAA A;  4KB3 A;  4KUN A;  1K0O A;  2G2Q A;  4CY8 A;  2B1L A;  4AKG A;  1K3O A;  1JZW A;  1X5E A;  4L0W A;  3TJG A;  2LST A;  1O8W A;  1YY7 A;  4FO5 A;  1YKC A;  3CSH A;  2N5F A;  1A0F A;  2DJ2 A;  1ZMA A;  1AQV A;  4PI0 C;  3IE3 A;  4ECC A;  3M3M A;  1TOF A;  1ZZY A;  5LD0 A;  2VLV A;  4GF0 A;  5KOX A;  3BJ5 A;  2LRT A;  3UBK A;  1XOA A;  4EO3 A;  1T7P B;  2VIM A;  4KE3 A;  2YWI A;  3RDW A;  4NXI A;  3PH9 A;  3LFL A;  5H5Q A;  2R6K A;  1SVM A;  3L9U A;  2H30 A;  2ON5 A;  2VCW A;  1QGV A;  2HSM B;  3ZVJ D;  2UZ8 A;  3MDK A;  2B5E A;  1OC8 A;  1XZO A;  2FHE A;  3GYK A;  3FRC A;  1T00 A;  4PQ1 A;  3L9S A;  2J9H A;  1LJR A;  4EIQ A;  3A3T A;  3M8N A;  2HQT A;  1QMV A;  4QL7 A;  5CYY A;  3KH9 A;  1K0C A;  1M2B A;  17GS A;  5EY6 A;  6GSX A;  1SVL A;  3F4R A;  1AAZ A;  3FW2 A;  1SL1 B;  3FHK A;  3GL3 A;  3JCM L;  4N3Z A;  4MJB A;  1RK4 A;  3CWG A;  1PL2 A;  2XPD A;  2AUV A;  5C04 A;  4KDU A;  2TRC P;  2CX4 A;  3ERG A;  2PGT A;  5ELG A;  1THO A;  2E0Q A;  4HQZ A;  3MSZ A;  4EKZ A;  2L6C A;  4GTU A;  2VCT A;  2WZ9 A;  5ECM B;  2YAN A;  1GNE A;  1GTU A;  4JE1 A;  2VM2 A;  1XPV A;  1V9W A;  1ST9 A;  2H74 A;  4PQI A;  4TXV A;  3HXS A;  4HEA 2;  2FWH A;  1OVN A;  3R3E A;  3GKX A;  4F03 A;  2IIY A;  1XVQ A;  5IOX A;  3HVV A;  1AW9 A;  3IDV A;  2GS3 A;  4HUA A;  5G5E A;  4AKI A;  4IP1 A;  2FD3 A;  1E6B A;  3W8S A;  3LXT A;  3TJJ A;  1GSD A;  2YV7 A;  4LL4 B;  2LNS A;  4ZIJ A;  2H1A A;  2DML A;  3F9U A;  1S3D A;  2GSR A;  3GUS A;  3FMW A;  1PA3 A;  3IPZ A;  4NV2 A;  2L6D A;  1SJ6 A;  1GSQ A;  5JCU A;  2IMF A;  2HZF A;  2GST A;  4EUY A;  2R2J A;  5G5F A;  3D4T A;  4OFN A;  4GQF A;  4HJM A;  1E2Y A;  1ILO A;  2EFD A;  3TRP A;  1M7T A;  4WKW A;  2I9H A;  1UN2 A;  4TN8 A;  5CNW A;  3EUR A;  4IQ1 A;  4L8E A;  1T4Z A;  3UBL A;  1ZYN A;  2HYX A;  2A2S A;  5ECP B;  1XCC A;  1F9M A;  3IK9 A;  3PPU A;  2PPT A;  2DJ1 A;  3QDN A;  5J3R A;  4YQU A;  2XHF A;  3HZ4 A;  4HSC X;  3ZRD A;  2VOC A;  4TVE A;  4OFM A;  3CXG A;  4LA1 A;  5A4W A;  1H4O A;  3F0I A;  2P5R A;  4IKH A;  4HZ2 A;  4ZBB A;  1BED A;  4XS1 A;  5D9X A;  2JSY A;  3HA9 A;  1G6W A;  4AGS A;  2CV4 A;  1SEN A;  2PBJ A;  4ACS A;  1ZL9 A;  2WJU A;  2WGR A;  1OKD A;  2OBK A;  3ISO A;  2FNO A;  3A2W A;  4DSR A;  3VWW A;  3L4N A;  3TKP A;  3LG6 A;  3UJ1 A;  1YKA A;  3KMN A;  1S3R A;  5DAK A;  1G7E A;  4HI7 A;  2LV3 A;  4ZL9 A;  4ZB9 A;  3W8J A;  1F37 A;  3TU3 B;  4Q5N A;  1BG5 A;  4W66 A;  3HZ8 A;  5IO0 A;  2RM6 A;  1KTE A;  1O81 A;  4KND A;  5CRG A;  4L0U A;  5DJL A;  5B8A A;  3E3E A;  2H75 A;  3L0H A;  4ICY A;  2V6O A;  2MMA A;  5A34 B;  1RQM A;  3IHG A;  2E2M A;  2EIO A;  5G1L A;  3VI7 A;  4K0N A;  1A2M A;  2GSS A;  5CRE A;  1SJZ A;  2H0I A;  1PN0 A;  2QKE A;  5DQS A;  2JZR A;  5IMZ A;  4MF7 A;  2GT6 A;  3E0U A;  3TKS C;  1U6T A;  3GL5 A;  2OAC A;  3TKS E;  3CMI A;  2QSI A;  1K0B A;  5AIX A;  3UOM A;  5JWR B;  5J40 A;  3MNG A;  4WF5 A;  4EVM A;  1R7H A;  1X5C A;  3QAG A;  4TKY A;  2VLU A;  1GSU A;  3Q18 A;  1AUC A;  1J08 A;  1OAZ A;  4HU9 A;  2YCD A;  1K0M A;  1SD9 A;  4POL A;  4PNF A;  2XPE A;  1Q98 A;  2YWM A;  3GA4 A;  2HXK A;  1SKR B;  2FCH A;  1MEK A;  2A2P A;  2GVP A;  1V57 A;  2YNX A;  5ECI B;  3PIN A;  2X8G A;  1EOG A;  1GLP A;  2FWF A;  5F8B A;  4FYC A;  1OYJ A;  1FVJ A;  2GZY A;  4I2U A;  3BBY A;  4BL7 A;  5IMF A;  1TU7 A;  18GS A;  4ZB7 A;  3KEB A;  3VK9 A;  1EOH A;  2GLR A;  1USB A;  3RPN A;  1M2A A;  5HR1 A;  3FR9 A;  2HLS A;  2MMO A;  2HSN B;  1QK8 A;  2CAQ A;  1PL1 A;  3RFR C;  14GS A;  2R3X A;  3ZIV A;  1ON4 A;  2HNL A;  1UA5 A;  3FY7 A;  1CQH A;  4OCE A;  3QR6 A;  4WBJ A;  5INY A;  3IR4 A;  3CTF A;  1BYE A;  2VLT A;  3E9J B;  4FXY P;  4KCA A;  3F63 A;  2OT3 A;  2IWT A;  1GSY A;  2NPB A;  2EFC A;  2YN1 A;  3AY8 A;  2NBS A;  1GTI A;  4HQS A;  1KBN A;  5EL8 A;  4XS4 A;  4ZL7 A;  2PUK C;  5F07 A;  1W4V A;  2H71 A;  2H6X A;  3SBC A;  4HU7 A;  5ECL B;  4JR4 A;  20GS A;  1SL0 B;  3M0F A;  4CHS A;  4O5R A;  3J7Y b;  5GZZ B;  1XW9 A;  2AYT A;  1QXH A;  4K5S A;  5J4U A;  1THX A;  2F8F A;  2EIR A;  1ZGN A;  4G10 A;  4MF6 A;  3KIJ A;  1UC7 A;  5LCZ A;  2V2G A;  4NWY A;  3TDG A;  2MYG A;  3GH6 A;  1J9B A;  5D96 A;  2O89 A;  1RW1 A;  5J4V A;  4RQR A;  4X43 A;  2A2R A;  3TGZ A;  2R5G A;  5A5K A;  1I5G A;  2UV8 G;  4JBB A;  4G0L A;  4YQV A;  1U3I A;  1JLV A;  4RI6 A;  1FO5 A;  3RAZ A;  3GRX A;  3DKS A;  2I3Y A;  2R0C A;  1OC9 A;  2C3T A;  3H1N A;  1AIU A;  3HYP A;  2HT9 A;  2B1K A;  2OJL A;  3FZ5 A;  2IMD A;  5F05 A;  1XWB A;  2OE1 A;  4YAV A;  3DD3 A;  4IQA A;  4I5Q A;  1GUK A;  2JU5 A;  1DUG A;  1YF0 A;  4GRF A;  5D93 A;  1V58 A;  4LL1 B;  4MP4 A;  5GSS A;  2AV4 A;  4TXO A;  5ELA A;  4KSM A;  6GSY A;  1IYH A;  1B9X C;  5GAN D;  3KJY A;  3GKM A;  4PI2 C;  5A1N B;  3G9B A;  3OR5 A;  2LTK A;  2DIZ A;  2PN8 A;  1OC9 B;  4TR4 A;  1HNB A;  2JAC A;  3CTG A;  2O8V B;  3KZQ A;  1GTB A;  5DCH A;  4Q5F A;  5HR2 A;  3U6V A;  2CVB A;  3F4S A;  5IMC A;  3HJO A;  2CX3 A;  1EP7 A;  1YEP A;  1XOB A;  1ZOF A;  1M9B A;  1U87 A;  4OCF A;  1M2D A;  2X4A A;  1DSB A;  2WVX A;  3RHC A;  4ZBD A;  2VD0 A;  1TI3 A;  3NZN A;  4TXO B;  4GDF A;  2R4V A;  4V1A p;  2C3N A;  4A5P A;  3GH9 A;  5G31 A;  2H1D A;  3P2A A;  1ERT A;  2RUF A;  2V1M A;  2VCQ A;  5IOW A;  3G7Y A;  2H1G A;  3J7Y k;  1DE2 A;  1Y6E A;  5AN1 A;  3N9J A;  3ZFB A;  4OMV A;  2AAW A;  1A2L A;  1GUH A;  4KGI A;  1TRS A;  4WF4 A;  2LEG A;  2QA1 A;  3ZRE A;  3LW9 A;  12GS A;  1SYR A;  3PR8 A;  4PXO A;  2X8C A;  4BIK A;  2F8A A;  2WVX B;  1ERV A;  3ZIT A;  2K9F A;  2VAF A;  3IXR A;  3ERF A;  2A4H A;  3H4K A;  1X5D A;  1N2A A;  5KN0 A;  4WXT A;  4ZB6 A;  2V6K A;  2F51 A;  1A8L A;  1TDI A;  4KA0 A;  5ECN B;  1TI1 A;  1Y1U A;  2LRN A;  1QQ2 A;  1JZO A;  1SU9 A; 
#chains in the Genus database with same CATH homology
 5J5N A;  4POB A;  2R0P A;  4ML6 A;  2KP2 A;  4HZ4 A;  4YQM A;  1T4Y A;  4AKX B;  1VF2 A;  1OKT A;  2FA8 A;  1PQN A;  3KMO A;  2I81 A;  4V2N A;  3C8E A;  3UL3 A;  1R4W A;  3Q74 A;  2M46 A;  2X99 A;  5B7C A;  2LQO A;  3VUR A;  2C4J A;  2PVO C;  5DVB A;  4JZQ A;  2FWE A;  5H5R A;  2OE3 A;  1PKW A;  1JZD A;  4AJ6 A;  2M72 A;  1FB6 A;  2WUL A;  5HR0 A;  1EP8 A;  2DJK A;  1XW5 A;  1AC1 A;  2YV9 A;  3BCK A;  4ECB A;  2CA8 A;  1EGO A;  1T8E B;  5BMU A;  2PU9 C;  4BVX A;  1BAY A;  5KEJ A;  3VWU A;  4PNG A;  6GSS A;  1R5A A;  1CQG A;  3HJP A;  3DML A;  4IJ3 A;  4NV5 A;  1PX6 A;  3ZFL A;  4XHM A;  3A5W A;  3EIN A;  4POM A;  1GUM A;  2FY6 A;  1O73 A;  4PUA A;  2O87 A;  4RI7 A;  3CRU A;  4EDY A;  2V41 A;  1G7O A;  3LOR A;  4LLR A;  2AJQ B;  2WDU A;  1V2A A;  5KN2 A;  1NSW A;  3FZ9 A;  5A5H A;  1MDK A;  4DVC A;  1A0R P;  4N30 A;  4JR6 A;  2CVD A;  4ZXG A;  4O32 A;  4FQU A;  1MD4 A;  3BD2 A;  3IRA A;  4LMW A;  1XWK A;  2GQK A;  3KD0 A;  4FYU A;  4PTS A;  2KUC A;  5D8I A;  4AJ8 A;  1JLW A;  2CT6 A;  4CDO A;  2F3M A;  2H66 A;  4MZB A;  2LRC A;  3FK8 A;  6GSU A;  4POK A;  4NMU A;  3FZ4 A;  4O92 A;  1PN9 A;  2OE0 A;  4K2D A;  2LNT A;  4V2M A;  5BRT A;  3UVH A;  1PKZ A;  3CSI A;  2YJ7 A;  4WR4 A;  1YQ1 A;  4ILF A;  4K7I A;  2DIY A;  3LGC A;  1WPI A;  2LKU A;  4K8M A;  3PGT A;  11GS A;  2H8L A;  4FH8 A;  4HOJ A;  2R0G A;  2M80 A;  4PQH A;  1SKS B;  2NTO A;  1YZX A;  3DIE A;  3DYR A;  4ZB8 A;  1K0A A;  2VL9 A;  2K18 A;  3P7X A;  2GTU A;  1DBY A;  2WB9 A;  10GS A;  1GL8 A;  1FG4 A;  3MYD A;  2RM5 A;  2EFH A;  3VLN A;  3IBH A;  3ERW A;  1PSQ A;  4MH2 A;  2GDR A;  1SJI A;  4CW9 A;  1A23 A;  1UVZ A;  3M9J A;  4AF2 A;  2VCV A;  2REM A;  4YAP A;  5B8B A;  5IPG A;  3C1S A;  5ECS A;  1TXX A;  3GTU A;  5IMD A;  2JZS A;  4ML1 A;  3FEU A;  3UMA A;  4DSS A;  1K3Y A;  1LBK A;  1N25 A;  3V1W A;  2XC2 A;  2DJJ A;  2RLI A;  4GCI A;  1C72 A;  5HFG A;  4I2T A;  4ECJ A;  4EC0 A;  1Z7R A;  5G30 A;  3P8W A;  2C80 A;  5DAK B;  3VFI A;  1TJD A;  3U5R E;  3CYN A;  3L78 A;  2N5B A;  1SL2 B;  3F4T A;  1U88 A;  1Z9H A;  4AI6 A;  3HCZ A;  2X64 A;  3A2V A;  4XIH A;  5EVO A;  1N8J A;  3F3R A;  3GHA A;  2F9S A;  2AHE A;  4HS1 A;  4E68 A;  2JZT A;  2GQM A;  4AJ7 A;  3QAW A;  2JL4 A;  2B7J A;  4X4J A;  1BJX A;  1XWG A;  2VCZ A;  1VF4 A;  3TB2 A;  5FT3 A;  3ZMK A;  2G0F A;  1NHO A;  2PER A;  2AB6 A;  3MWH A;  4Q5R A;  4BWQ A;  3M9K A;  5L71 A;  2VL3 A;  1TTZ A;  4K7O A;  3IAM 2;  1IYI A;  4P3Y B;  2IFQ A;  2H1L A;  3S9F A;  2H19 A;  4ID0 A;  3HDC A;  2MBT A;  2HRK A;  4J57 E;  2XBQ A;  3TJB A;  3CBU A;  1NM3 A;  4TR1 A;  3KP8 A;  4D73 A;  5DDL A;  3LQ7 A;  2MMN A;  2EFE A;  2IJY A;  3RPP A;  2DKI A;  2GQL A;  2A4V A;  1GNW A;  1EV9 A;  3VPQ A;  1X9M B;  1HNC A;  4MPG A;  3TJF A;  2RII A;  3HVX A;  3TKQ A;  3D5J A;  3Q19 A;  3IOS A;  1TXU A;  4I8B A;  2VKZ G;  3KTL A;  3VI5 A;  1OE8 A;  2DBC A;  4IJI A;  5COH A;  4DSQ A;  1FB0 A;  2ON7 A;  1Q4J A;  3GNJ A;  5E4W A;  2C0E A;  2DLX A;  2H1B A;  2OBI A;  4BL7 B;  1MTC A;  5ABR A;  4D73 B;  1HYU A;  5J4Y A;  4GWR A;  1A8Y A;  5B6M A;  1BX9 A;  3EVI A;  2DSA A;  1WOU A;  5IO2 A;  3BOA A;  1YJ6 A;  4MK3 A;  3HVS A;  1WIK A;  2N5A A;  2DMM A;  5IIZ A;  1FW1 A;  4NAX A;  2WFC A;  1DE1 A;  2IN3 A;  1MDJ A;  1T3B A;  1WE0 A;  5CRW A;  3GMF A;  3WT1 A;  4BVY A;  2D2Z A;  3GX0 A;  3ZZX A;  3GST A;  3GV1 A;  2X8H A;  2GSQ A;  3K8N A;  3F6F A;  1XWC A;  4NHW A;  4WR5 A;  4XS4 B;  3ZTL A;  4MJE A;  4L5L A;  4KDX A;  4Z7X A;  1AXD A;  2L4Q A;  2QA2 A;  3VWX A;  4K5R A;  5D9V A;  1F3A A;  3EU4 A;  2KP1 A;  4XRA A;  2HFD A;  1ERW A;  2KHP A;  4ZBA A;  5KN1 A;  4MDC A;  5JWQ B;  5C00 A;  5ECR B;  3A5I A;  1KNG A;  3ED3 A;  3O76 A;  1GSS A;  3TUE A;  3LXZ A;  2LUS A;  1O6J A;  4YKF A;  4BVY B;  3EWL A;  2H01 A;  3DVW A;  2BMX A;  4QMK A;  1TRV A;  5KN3 A;  1B8X A;  4KCE A;  1Z5Y E;  1GUL A;  5D9T A;  3EMP A;  3H8Q A;  3ME8 A;  3LSZ A;  3FZA A;  1ZYQ B;  4JED A;  4YKG A;  4G0K A;  4EXJ A;  4V2L A;  4G01 A;  1JFU A;  4MF5 A;  1G0T A;  2O85 A;  1GRX A;  2O5V A;  4ZL8 A;  5ECO B;  2C3Q A;  4GSS A;  4XCS A;  4GXZ A;  1AQW A;  1FOH A;  2VL2 C;  3P90 A;  1YDK A;  6GST A;  3BCI A;  3HKR A;  4ZIL A;  3EYT A;  2FUG 2;  5DQY A;  1R26 A;  4OO5 A;  3H93 A;  2HZE A;  3ZVJ A;  2WRT A;  5IQY A;  2VL2 A;  2IPA A;  4G2E A;  4XTS A;  4MNN A;  2DC5 A;  5ID2 A;  3M1G A;  2L5O A;  3I43 A;  2X49 A;  4G9H A;  5J9B A;  1OC3 A;  4EE0 A;  1S3A A;  1ACV A;  4NHZ A;  3KCM A;  1V98 A;  2L57 A;  3RBT A;  3Q6O A;  1M9A A;  2H70 A;  2VM1 A;  4RUV A;  1TK8 B;  2B3S A;  1K0N A;  3I9V 2;  2K6V A;  1XW6 A;  4RQX A;  1GWC A;  4N0Z A;  4AKH A;  2PMT A;  1XVW A;  1YVL A;  3WGE A;  1F3B A;  5D73 A;  4IVF A;  4X0X A;  5HFI A;  1XWA A;  5AGY A;  2ZCT A;  3GKN A;  1EV4 A;  4HDE A;  3TOT A;  1QUW A;  4K6X A;  3FYG A;  4O5Q A;  1HNA A;  4MA9 A;  3FR3 A;  4MJC A;  3EU3 A;  2HSM A;  3F3Q A;  2TIR A;  1XXU A;  5EPF A;  2YJH A;  1FOV A;  1SD8 A;  4JU5 A;  3KXO A;  6GSW A;  2VCX A;  2QGV A;  1FHE A;  1SYX A;  2YWO A;  5AIS A;  2C8U A;  4XRD A;  5A4U A;  4JRR A;  2LJK A;  4QQ7 A;  1XIY A;  3TOU A;  1PGT A;  1F6M C;  4MCU A;  4EIP A;  5GAP D;  3EPT A;  2XBI A;  1MD3 A;  4XS6 A;  1R5P A;  2BTO T;  2EIQ A;  4GST A;  4IW9 A;  4CY6 A;  8GSS A;  3W6G A;  3APS A;  4MZW A;  3ZL5 A;  1PMT A;  1O85 A;  4LMV A;  1PD2 1;  1VGL A;  2KOK A;  1TRU A;  4FIW A;  1EEM A;  5CRH A;  1Y25 A;  1O8X A;  1JHB A;  2YZH A;  5ECH B;  3LWA A;  3DRN A;  3C1R A;  2I4A A;  1ZYP A;  3G7I A;  2KLX A;  4K9Z A;  1HQO A;  3QOU A;  3I69 A;  3WYW A;  2C0D A;  2P0G A;  1TRW A;  5DBQ A;  4BWS A;  4IBP A;  3LJR A;  4E8E A;  6GSV A;  3GIX A;  2MMZ A;  2IMK A;  3O6T A;  4J56 E;  4TRX A;  1B9Y C;  1LU4 A;  1BQ7 A;  4KW6 A;  1M99 A;  3H79 A;  2PVQ A;  3QFA C;  1GSE A;  5BMU B;  2HRF A;  3WGD A;  2H0H A;  4BVX B;  1GTA A;  4TW5 A;  1J0F A;  2FA4 A;  2OAD A;  2YWN A;  1M0U A;  3HD5 A;  1TP9 A;  1FVK A;  4PUF C;  1PRX A;  4Z2T A;  1YF1 A;  1GP1 A;  1BF5 A;  2H73 A;  2L4C A;  4F9Z A;  3DWV A;  1ZYE A;  5AIV A;  1Z6N A;  3UVT A;  4O5U A;  3ME7 A;  3MAK A;  2FGX A;  3CSJ A;  1TW9 A;  2LQQ A;  1ERU A;  2ALB A;  2HE3 A;  5CRD A;  2OA7 A;  3VPT A;  3IHQ A;  1K3L A;  5ECQ B;  2H0G A;  1W89 A;  5JCG A;  2JSZ A;  3IC4 A;  1KEB A;  3DVX A;  5G2Z A;  3UAP A;  5A5H B;  2GT5 A;  3GN3 A;  3ZML A;  4BPY A;  1SK0 A;  2IMI A;  4IGJ A;  3HMJ G;  1ABA A;  3DGQ A;  5HQP A;  1OE7 A;  1A2J A;  1XBS A;  1TK5 B;  2VO4 A;  5KOW A;  2CZ2 A;  4EDZ A;  3IA1 A;  3LYP A;  1TK0 B;  2IL3 A;  3I6A A;  13GS A;  2YOI A;  2VD1 A;  3APO A;  1G6Y A;  3FR6 A;  1S3C A;  3CRT A;  5D9W A;  4N10 A;  2ZUP A;  2TRX A;  2E2G A;  3D21 A;  2B6M A;  2C0G A;  2L59 A;  5E59 A;  1SKW B;  2J23 A;  5IPH A;  4TR3 A;  1B4P A;  4I97 A;  5J47 A;  3QD9 A;  4OD7 A;  5ECK B;  4NPB A;  1O7U A;  3LYK A;  5A34 A;  2FLS A;  2QC7 A;  4OFT A;  9GSS A;  5HR3 A;  4PGT A;  2ES7 A;  3UEM A;  1SK1 A;  1X9W B;  2OKA A;  5F06 A;  1Z7P A;  2B7K A;  3MIX A;  4TR0 A;  3QPM A;  1SVO A;  5ENU A;  4OWY A;  3KP9 A;  4F0B A;  1AQX A;  5DJM A;  2BJX A;  3L9V A;  2P31 A;  2I1U A;  3IAS 2;  2NDO A;  3HHV A;  4G19 A;  4MJA A;  1HD2 A;  3A2X A;  4ISD A;  5J9C A;  2HI7 A;  3US3 A;  3GKK A;  4QL9 A;  4K2X A;  3ZYW A;  3NIV A;  3D4M A;  1MDI A;  2FWG A;  4IHU A;  1A24 A;  3D6I A;  2GZZ A;  3GTU B;  3D22 A;  1URM A;  2LJR A;  3KM6 A;  1WJK A;  4GLT A;  5IMA A;  1VF1 A;  4DSS B;  3IC8 A;  4KAE A;  2HSH A;  5CO3 A;  3N5O A;  3EMX A;  2CQ9 A;  2Z9S A;  2V32 A;  3KGK A;  3TKS A;  3ZLP A;  3HY2 A;  4Z2U A;  1TKD B;  3APQ A;  2H6Z A;  2PWJ A;  4OO4 A;  2P5Q A;  1NW2 A;  1YEX A;  4USS A;  3TJK A;  1VF3 A;  3TRQ A;  1X0R A;  2O7K A;  2GZP A;  2HSN A;  3UAR A;  2IME A;  16GS A;  2YP6 A;  2CAI A;  4N11 A;  2ZNM A;  2K8S A;  3QCP A;  4Q5Q A;  2HRN A;  3QFB C;  5B6N A;  4KX4 A;  2E7P A;  5JWO B;  4MH3 A;  2GGT A;  1JZR A;  5HFK A;  3IK7 A;  3ZIJ A;  1EGR A;  2B5Y A;  1PX7 A;  4K0G A;  4PX1 A;  4K7N A;  1Z3E A;  4PUR A;  5CAX A;  2IFQ B;  4K1F A;  3WT2 A;  4FYB A;  4WEY A;  1U3A A;  5A4V A;  2HRK B;  4F0C A;  3DXB A;  3DEX A;  1Z6M A;  2RUE A;  1GLQ A;  4TR1 B;  1V40 A;  4I6X A;  1B4Q A;  5IM9 A;  1EZK A;  5F0G A;  4E8H A;  4F82 A;  4MZC A;  2L5L A;  4GQC A;  1B48 A;  3TRX A;  5DCG A;  3GUR A;  2YZU A;  2CZ3 A;  1QFN A;  1GH2 A;  1ML6 A;  1BG1 A;  3C7M A;  1F2E A;  3C71 A;  4O7H A;  3GX8 A;  3WD6 A;  4WBR D;  4BA7 A;  3GSS A;  4HJ2 A;  7GSS A;  2R37 A;  2CVK A;  3QAV A;  3TKR A;  4H86 A;  2WCI A;  5LNK e;  3GFK A;  1EWX A;  5GST A;  5IMV A;  3KH7 A;  4IS0 A;  3C73 A;  4J2F A;  1T1V A;  2LJA A;  4F2I A;  5DAL A;  19GS A;  4KDY A;  22GS A;  4L5O A;  3F8U A;  3WGX A;  2C1Y A;  2DKH A;  2NVL A;  4DEJ A;  4MAB A;  1K0D A;  3RHB A;  1WMJ A;  2K8V A;  5A1N A;  5J41 A;  4IP6 A;  5CP1 A;  4TOP A;  4MLY A;  2B5X A;  4IEL A;  1H75 A;  4V1A g;  1NHY A;  4N0V A;  1ZCP A;  4ULX A;  4KSO A;  1TU8 A;  5G1K A;  2DJ3 A;  2HRA A;  4EL1 A;  2HSY A;  5DAL B;  2EC4 A;  3D0Z A;  3TCO A;  5FWG A;  2C0F A;  2VUP A;  1X9S B;  4X1U A;  2JAD A;  5FHI A;  3EE2 A;  3UIW A;  4GSN A;  3VWV A;  4MMM A;  1WRY A;  2H76 A;  1XFL A;  4EF0 A;  3NOF A;  2WS2 A;  3F6D A;  4WET A;  3O3T A;  3KTB A;  3EC3 A;  4KH7 A;  3G7J A;  1WWJ A;  4Z2R A;  4KF9 A;  2DJ0 A;  4G0I A;  4MPF A;  3SWL A;  2LS5 A;  1GSF A;  2YPM A;  2H6Y A;  2H72 A;  5H5S A;  1WP0 A;  3HJM A;  3LEF A;  3QMX A;  5JCW A;  2MZC A;  4IN0 A;  3FKF A;  2HZE B;  4YH2 A;  1VRS D;  3R2Q A;  1I9D A;  1EEJ A;  4ECI A;  5ID2 B;  2MBS A;  3IV4 A;  1SK2 A;  1FAA A;  4KB3 A;  4KUN A;  1K0O A;  2G2Q A;  4CY8 A;  2B1L A;  4AKG A;  1K3O A;  1JZW A;  1X5E A;  4L0W A;  3TJG A;  2LST A;  1O8W A;  1YY7 A;  4FO5 A;  1YKC A;  3CSH A;  2N5F A;  1A0F A;  2DJ2 A;  1ZMA A;  1AQV A;  3IE3 A;  4ECC A;  3M3M A;  1TOF A;  1ZZY A;  5LD0 A;  2VLV A;  4GF0 A;  5KOX A;  3BJ5 A;  2LRT A;  3UBK A;  1XOA A;  4EO3 A;  1T7P B;  2VIM A;  4KE3 A;  2YWI A;  3RDW A;  4NXI A;  3PH9 A;  3LFL A;  5H5Q A;  2R6K A;  1SVM A;  3L9U A;  2H30 A;  2ON5 A;  2VCW A;  1QGV A;  2HSM B;  3ZVJ D;  2UZ8 A;  3MDK A;  2B5E A;  1OC8 A;  1XZO A;  2FHE A;  3GYK A;  3FRC A;  1T00 A;  4PQ1 A;  3L9S A;  2J9H A;  1LJR A;  4EIQ A;  3A3T A;  3M8N A;  2HQT A;  1QMV A;  4QL7 A;  5CYY A;  3KH9 A;  1K0C A;  1M2B A;  17GS A;  5EY6 A;  6GSX A;  1SVL A;  3F4R A;  1AAZ A;  3FW2 A;  1SL1 B;  3FHK A;  3GL3 A;  3JCM L;  4N3Z A;  4MJB A;  1RK4 A;  3CWG A;  1PL2 A;  2XPD A;  2AUV A;  5C04 A;  4KDU A;  2TRC P;  2CX4 A;  3ERG A;  2PGT A;  5ELG A;  1THO A;  2E0Q A;  4HQZ A;  3MSZ A;  4EKZ A;  2L6C A;  4GTU A;  2VCT A;  2WZ9 A;  5ECM B;  2YAN A;  1GNE A;  1GTU A;  4JE1 A;  2VM2 A;  1XPV A;  1V9W A;  1ST9 A;  2H74 A;  4PQI A;  4TXV A;  3HXS A;  4HEA 2;  2FWH A;  1OVN A;  3R3E A;  3GKX A;  4F03 A;  2IIY A;  1XVQ A;  5IOX A;  3HVV A;  1AW9 A;  2GS3 A;  3IDV A;  4HUA A;  5G5E A;  4AKI A;  4IP1 A;  2FD3 A;  1E6B A;  3W8S A;  3LXT A;  3TJJ A;  1GSD A;  2YV7 A;  4LL4 B;  2LNS A;  4ZIJ A;  2H1A A;  2DML A;  3F9U A;  1S3D A;  2GSR A;  3GUS A;  3FMW A;  1PA3 A;  3IPZ A;  4NV2 A;  2L6D A;  1SJ6 A;  1GSQ A;  5JCU A;  2IMF A;  2HZF A;  2GST A;  4EUY A;  2R2J A;  5G5F A;  3D4T A;  4OFN A;  4GQF A;  4HJM A;  1E2Y A;  1ILO A;  2EFD A;  3TRP A;  1M7T A;  4WKW A;  2I9H A;  1UN2 A;  4TN8 A;  5CNW A;  3EUR A;  4IQ1 A;  4L8E A;  1T4Z A;  3UBL A;  1ZYN A;  2HYX A;  2A2S A;  5ECP B;  1XCC A;  1F9M A;  3IK9 A;  3PPU A;  2PPT A;  2DJ1 A;  3QDN A;  5J3R A;  4YQU A;  2XHF A;  3HZ4 A;  3ZRD A;  2VOC A;  4TVE A;  4OFM A;  3CXG A;  4LA1 A;  5A4W A;  1H4O A;  3F0I A;  2P5R A;  4IKH A;  4HZ2 A;  4ZBB A;  1BED A;  4XS1 A;  5D9X A;  2JSY A;  3HA9 A;  1G6W A;  4AGS A;  2CV4 A;  1SEN A;  2PBJ A;  4ACS A;  1ZL9 A;  2WJU A;  2WGR A;  1OKD A;  2OBK A;  3ISO A;  2FNO A;  3A2W A;  4DSR A;  3VWW A;  3L4N A;  3TKP A;  3LG6 A;  3UJ1 A;  1YKA A;  3KMN A;  5DAK A;  1G7E A;  4HI7 A;  2LV3 A;  4ZL9 A;  4ZB9 A;  3W8J A;  1F37 A;  3TU3 B;  4Q5N A;  1BG5 A;  4W66 A;  3HZ8 A;  5IO0 A;  2RM6 A;  1KTE A;  1O81 A;  4KND A;  5CRG A;  4L0U A;  5DJL A;  5B8A A;  3E3E A;  2H75 A;  3L0H A;  4ICY A;  2V6O A;  2MMA A;  5A34 B;  1RQM A;  3IHG A;  2E2M A;  2EIO A;  5G1L A;  3VI7 A;  4K0N A;  1A2M A;  2GSS A;  5CRE A;  1SJZ A;  2H0I A;  1PN0 A;  2QKE A;  5DQS A;  2JZR A;  5IMZ A;  4MF7 A;  2GT6 A;  3E0U A;  3TKS C;  1U6T A;  3GL5 A;  2OAC A;  3TKS E;  3CMI A;  2QSI A;  1K0B A;  5AIX A;  3UOM A;  5JWR B;  5J40 A;  3MNG A;  4WF5 A;  4EVM A;  1R7H A;  1X5C A;  3QAG A;  4TKY A;  2VLU A;  1GSU A;  3Q18 A;  1AUC A;  1J08 A;  1OAZ A;  4HU9 A;  2YCD A;  1K0M A;  1SD9 A;  4POL A;  4PNF A;  2XPE A;  1Q98 A;  2YWM A;  3GA4 A;  2HXK A;  1SKR B;  2FCH A;  1MEK A;  2A2P A;  2GVP A;  1V57 A;  2YNX A;  5ECI B;  3PIN A;  2X8G A;  1EOG A;  1GLP A;  2FWF A;  5F8B A;  4FYC A;  1OYJ A;  1FVJ A;  2GZY A;  4I2U A;  3BBY A;  4BL7 A;  5IMF A;  1TU7 A;  18GS A;  4ZB7 A;  3KEB A;  3VK9 A;  1EOH A;  2GLR A;  1USB A;  3RPN A;  1M2A A;  5HR1 A;  3FR9 A;  2HLS A;  2MMO A;  2HSN B;  1QK8 A;  2CAQ A;  1PL1 A;  14GS A;  2R3X A;  3ZIV A;  1ON4 A;  2HNL A;  1UA5 A;  3FY7 A;  1CQH A;  4OCE A;  3QR6 A;  4WBJ A;  5INY A;  3IR4 A;  3CTF A;  1BYE A;  2VLT A;  3E9J B;  4KCA A;  3F63 A;  2OT3 A;  2IWT A;  1GSY A;  2NPB A;  2EFC A;  2YN1 A;  3AY8 A;  2NBS A;  1GTI A;  4HQS A;  1KBN A;  5EL8 A;  4XS4 A;  4ZL7 A;  2PUK C;  5F07 A;  1W4V A;  2H71 A;  2H6X A;  3SBC A;  4HU7 A;  5ECL B;  4JR4 A;  20GS A;  1SL0 B;  3M0F A;  4CHS A;  4O5R A;  3J7Y b;  5GZZ B;  1XW9 A;  2AYT A;  1QXH A;  4K5S A;  5J4U A;  1THX A;  2F8F A;  2EIR A;  1ZGN A;  4G10 A;  4MF6 A;  3KIJ A;  1UC7 A;  5LCZ A;  2V2G A;  4NWY A;  3TDG A;  2MYG A;  3GH6 A;  1J9B A;  5D96 A;  2O89 A;  1RW1 A;  5J4V A;  4RQR A;  4X43 A;  2A2R A;  3TGZ A;  2R5G A;  5A5K A;  1I5G A;  2UV8 G;  4JBB A;  4G0L A;  4YQV A;  1U3I A;  1JLV A;  4RI6 A;  1FO5 A;  3RAZ A;  3GRX A;  3DKS A;  2I3Y A;  2R0C A;  1OC9 A;  2C3T A;  3H1N A;  1AIU A;  3HYP A;  2HT9 A;  2B1K A;  2OJL A;  3FZ5 A;  2IMD A;  5F05 A;  1XWB A;  2OE1 A;  4YAV A;  3DD3 A;  4IQA A;  4I5Q A;  1GUK A;  2JU5 A;  1DUG A;  1YF0 A;  4GRF A;  5D93 A;  1V58 A;  4LL1 B;  4MP4 A;  5GSS A;  2AV4 A;  4TXO A;  5ELA A;  4KSM A;  6GSY A;  1IYH A;  1B9X C;  5GAN D;  3KJY A;  3GKM A;  5A1N B;  3G9B A;  3OR5 A;  2LTK A;  2DIZ A;  2PN8 A;  1OC9 B;  4TR4 A;  1HNB A;  2JAC A;  3CTG A;  3KZQ A;  2O8V B;  1GTB A;  5DCH A;  4Q5F A;  5HR2 A;  3U6V A;  2CVB A;  3F4S A;  5IMC A;  3HJO A;  2CX3 A;  1EP7 A;  1YEP A;  1XOB A;  1ZOF A;  1M9B A;  1U87 A;  4OCF A;  1M2D A;  2X4A A;  1DSB A;  3RHC A;  4ZBD A;  2VD0 A;  1TI3 A;  3NZN A;  4TXO B;  4GDF A;  2R4V A;  4V1A p;  2C3N A;  4A5P A;  3GH9 A;  5G31 A;  2H1D A;  3P2A A;  1ERT A;  2RUF A;  2V1M A;  2VCQ A;  5IOW A;  3G7Y A;  2H1G A;  3J7Y k;  1DE2 A;  1Y6E A;  5AN1 A;  3N9J A;  3ZFB A;  4OMV A;  2AAW A;  1A2L A;  1GUH A;  4KGI A;  1TRS A;  4WF4 A;  2LEG A;  2QA1 A;  3ZRE A;  3LW9 A;  12GS A;  1SYR A;  3PR8 A;  4PXO A;  2X8C A;  2F8A A;  1ERV A;  3ZIT A;  2K9F A;  2VAF A;  3IXR A;  3ERF A;  2A4H A;  3H4K A;  1X5D A;  1N2A A;  5KN0 A;  4WXT A;  4ZB6 A;  2V6K A;  2F51 A;  1A8L A;  1TDI A;  4KA0 A;  5ECN B;  1TI1 A;  1Y1U A;  2LRN A;  1QQ2 A;  1JZO A;  1SU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...