1VF2A

Cgsta1-1 in complex with s-hexyl-glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
225
structure length
225
Chain Sequence
KPVLYYFNGRGKMESIRWLLAAAGVEFEEVFLETREQYEKLLQSGILMFQQVPMVEIDGMKLVQTRAILNYIAGKYNLYGKDLKERALIDMYVGGTDDLMGFLLSFPFLSAEDKVKQCAFVVEKATSRYFPAYEKVLKDHGQDFLVGNRLSWADIHLLEAILMVEEKKSDALSGFPLLQAFKKRISSIPTIKKFLAPGSKRKPISDDKYVETVRRVLRMYYDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 3
publication title Crystal structures of chicken glutathione S-transferase A1-1
rcsb
source organism Gallus gallus
total genus 76
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1vf2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1vf2A01
2FWHA 2I4AA 4N10A 1E2YA 2V32A 4MF7A 2CAQA 3IDVA 3ISOA 3QDNA 5HR0A 4POMA 1A2LA 4L8EA 2HSMA 4IS0A 2Z9SA 4NAXA 1A24A 1K0NA 2DIZA 2FCHA 3IHQA 1X5DA 1A2JA 2O85A 2AYTA 1SD9A 3G9BA 2C3TA 4ZILA 1TDIA 4WBRD 2LKUA 5IM9A 5B6NA 3SWLA 1SD8A 2FD3A 1FB0A 2VCWA 5D73A 1XVQA 2V2GA 2H0GA 4YAPA 2L4CA 2IMEA 4POKA 1F3BA 2OA7A 2PGTA 1RK4A 1Q98A 2DJ0A 2HLSA 1DSBA 3NIVA 1LBKA 3CTFA 2H01A 5KN3A 4AJ7A 1M99A 4KDYA 1X9MB 3UJ1A 2PN8A 4TKYA 4IJ3A 3QPMA 4WF5A 6GSXA 4EDZA 5CRHA 4N0ZA 4ILFA 4J57E 2IMFA 3NZNA 2GSSA 5IOXA 2HSNB 3CBUA 2YWNA 5HQPA 3IXRA 3GKXA 1PA3A 1MDKA 2OJLA 1TXXA 1URMA 1TK5B 5CYYA 4DSRA 2CVDA 2VM1A 4GF0A 3F4SA 3RHBA 4G0KA 3UARA 2DJKA 1SKSB 1Y25A 3ZRDA 1EWXA 3C73A 1VF3A 2PBJA 1Y6EA 4NWYA 4F82A 5F07A 4JBBA 4ECJA 1WOUA 2L5LA 1SL2B 3C1RA 4TXOB 3HJMA 3KCMA 4DSSB 1XW6A 3QAWA 4LL1B 1EEMA 2BTOT 2MMOA 4NV5A 3LG6A 5EL8A 3EU3A 4XRDA 2JSZA 4MMMA 5JWOB 3D4TA 5DVBA 2JL4A 2HZEA 3TRQA 5DAKB 1C72A 5D9TA 1G7OA 2K8SA 4TR1A 1O73A 4ZL7A 4YH2A 1FB6A 3A5WA 3C7MA 2IN3A 1GSSA 3D21A 3HCZA 3LJRA 5A4VA 3IA1A 3O6TA 1KBNA 4MJBA 1DE2A 3VPTA 1EP7A 2B3SA 5G2ZA 2PERA 2HSMB 2FWEA 1GP1A 4MF6A 1XIYA 3F6DA 3FEUA 5D96A 3HVSA 1ML6A 4K8MA 4EE0A 2AB6A 3IE3A 3RAZA 2XPDA 2PWJA 1QGVA 4N0VA 4ZB9A 4KE3A 1XZOA 2FHEA 1TKDB 3ZMLA 3IOSA 2K9FA 5IO2A 1H4OA 1NM3A 4I97A 2QSIA 2O89A 4O32A 4OFNA 1TU7A 1JLVA 1V57A 3UVHA 3QFBC 2XHFA 2VM2A 3CMIA 1WMJA 4I8BA 1F3AA 2GSRA 6GSWA 2GZPA 1XCCA 2RM5A 3F0IA 4AGSA 3EVIA 2LTKA 2C4JA 4K7OA 4AF2A 1AC1A 1K0DA 1V98A 3RDWA 4HZ4A 3ZREA 2X99A 2B1LA 3G7JA 1PMTA 2H73A 2H66A 2WGRA 4PNFA 1E6BA 1Z5YE 3EC3A 4Z7XA 3HKRA 2XBIA 3TKQA 3UVTA 3IR4A 1S3CA 4E8EA 3KP9A 3LORA 1K0OA 2ZCTA 3MWHA 4MDCA 2EIQA 4TR3A 2WFCA 1B9XC 2KLXA 5G5EA 2WDUA 2WS2A 3GX8A 2GLRA 2FUG2 4HUAA 1M9AA 2I3YA 5A5KA 4YQUA 4BA7A 3FHKA 2LJKA 1O81A 4EDYA 1M2AA 1OC8A 3VPQA 1SU9A 1YQ1A 2E0QA 3A2XA 4MPGA 2DC5A 4L5LA 3LYKA 5ECKB 3FR9A 2HZEB 2DJ2A 1ZMAA 3Q6OA 1OKTA 4HJ2A 5JWQB 4IBPA 3CSHA 2VLUA 1AAZA 6GSTA 5LD0A 3WT2A 2ON5A 1OVNA 4GTUA 2LEGA 5IPGA 2E7PA 3QFAC 2CX3A 1FAAA 5JWRB 4IGJA 1BEDA 2LNTA 2HI7A 4YQVA 1GTIA 3DGQA 4IJIA 3TJKA 3VI7A 4I6XA 4HU7A 2CZ3A 4MK3A 4PNGA 3KJYA 2I1UA 2F8FA 3I69A 5KN1A 2VCXA 1XWGA 1TRWA 1PKZA 1TOFA 3BCKA 5DQYA 1R7HA 3GN3A 1EOGA 3V1WA 5IMZA 3M1GA 3FYGA 4I5QA 4K7NA 3VLNA 4JRRA 5C04A 1GSDA 1FO5A 1K0CA 5HR2A 3C1SA 3PGTA 2IMIA 4MPFA 2H76A 3H79A 1GUMA 3F63A 5EY6A 2G2QA 1G7EA 1THOA 1XWAA 1U87A 4HJMA 1T4ZA 4MJAA 1ZCPA 4WF4A 1AXDA 2R5GA 3BCIA 4F0CA 1M7TA 4L0UA 3P90A 1PD21 4PUFC 3ME8A 4ZBAA 4MZWA 4P3YB 3EMPA 1GNEA 2B1KA 5ENUA 3DVWA 1GUKA 2CQ9A 2DIYA 3P2AA 4G0LA 2HQTA 3TKSA 3NOFA 1LJRA 5ABRA 2PPTA 2L6DA 2CA8A 2JZRA 4MZCA 2VOCA 2LJRA 3GH6A 1TK0B 4BWSA 2DMMA 4WXTA 1OAZA 1GWCA 2H0HA 5LCZA 2YPMA 4PTSA 1RW1A 4FYBA 5IIZA 2R3XA 4KF9A 3TOTA 5J5NA 1T8EB 1K0BA 3RBTA 4ZL8A 5C00A 1Z3EA 4FIWA 5H5QA 2OACA 5INYA 2A4VA 3EYTA 1OKDA 3LEFA 4TXOA 3TKRA 2GTUA 1YF0A 3PINA 2VL9A 2H30A 1SYRA 2C3QA 1U88A 2LV3A 3N9JA 2JADA 4IN0A 2H19A 1CQHA 1ERWA 3HZ4A 1GTUA 2YWOA 5ELGA 2WZ9A 4ZBBA 3U5RE 2YWIA 3IRAA 1OC3A 3GHAA 3FR6A 5F8BA 3HVVA 3TKPA 2GGTA 3ZYWA 5ECNB 3S9FA 5AIVA 1GNWA 1ST9A 3UAPA 5B7CA 4OD7A 2L59A 3HXSA 5CO3A 2A2SA 1N2AA 2VLTA 4KUNA 2OKAA 1T1VA 1U6TA 7GSSA 2J23A 4KCEA 3BOAA 2HNLA 4F0BA 2PMTA 4K6XA 5D9WA 5DJMA 1W89A 1TRSA 5KN2A 4FO5A 1O8XA 3ZFBA 3K8NA 1EP8A 2CT6A 2WRTA 4J56E 1J0FA 2KUCA 4KSOA 4LMVA 4QL7A 1YKCA 2BJXA 3UMAA 1F37A 1KNGA 1XWKA 1BYEA 4BVYA 1JFUA 4IQ1A 3ERFA 6GSSA 3GRXA 2NPBA 1V40A 4EKZA 2MBSA 4FYCA 3FZ4A 1GSFA 2H1DA 1M9BA 4OFTA 1K0AA 3HJOA 4TRXA 2VL2C 2IFQA 5AGYA 4POBA 3CYNA 2H6YA 4KB3A 4JEDA 1SL1B 1XXUA 3ZL5A 2C0DA 1O8WA 4TOPA 1XBSA 3ERWA 4GSSA 4XHMA 1EGRA 3KMOA 1G6YA 2GT5A 3F8UA 5J3RA 4ACSA 4XS1A 1X5EA 4N11A 1GSYA 2XC2A 11GSA 3CSIA 13GSA 16GSA 3P7XA 5IMVA 2M72A 2HRKA 4IP1A 3MSZA 4KA0A 1KTEA 4ZXGA 3P8WA 5ID2A 3R2QA 1T00A 3APQA 2WJUA 3QAVA 2JZSA 2VLVA 4TR4A 1DE1A 3GURA 5D9XA 4JZQA 1HNBA 1SL0B 4PQIA 4KNDA 4MA9A 2EC4A 5EVOA 2VCQA 1SK2A 4NPBA 4XTSA 3L78A 2C3NA 3FR3A 2C0EA 1QFNA 1BX9A 1USBA 5DCGA 3ZIJA 2HXKA 3HHVA 4LA1A 1OC9A 2OBIA 1OE8A 1A0FA 1ZYQB 1FHEA 4GWRA 4TR0A 3C71A 3OR5A 5H5SA 5DALA 3CSJA 1NHYA 4E8HA 4F9ZA 3G7IA 1FOVA 2LUSA 2DJJA 1HNAA 3F3QA 2MYGA 3L9VA 1I5GA 3KGKA 3VWWA 2NDOA 5IMDA 5KN0A 2A2RA 3HA9A 1QUWA 5DBQA 3F4RA 1WJKA 1ZOFA 8GSSA 2L5OA 3GKKA 1GTAA 1N8JA 1VF4A 4EXJA 4XS4A 1EGOA 2FLSA 2AJQB 4ML1A 3H1NA 1EOHA 3LWAA 2NTOA 1WE0A 22GSA 2E2MA 4FH8A 18GSA 1EV9A 3EE2A 1AUCA 2N5AA 4HS1A 4XCSA 2XPEA 1SJZA 3DYRA 3J7Yb 4DSQA 3A2VA 4NXIA 1XOBA 1VGLA 3DIEA 1PQNA 1NHOA 1S3AA 3F4TA 3ZFLA 1DUGA 3EMXA 3GIXA 20GSA 4BVYB 3ZVJD 1OE7A 3FK8A 3L9UA 1R5AA 2X8CA 4V1Ap 4HZ2A 2B5XA 4Q5FA 5F06A 5JCGA 3VWUA 3O3TA 1B4QA 1ZZYA 2KP2A 3TKSC 2PVOC 2H72A 1T4YA 5GZZB 3DRNA 2IFQB 2TRCP 4XS6A 4MH3A 5F05A 3AY8A 2G0FA 3F9UA 2RIIA 4ZIJA 1BJXA 5FWGA 1AW9A 3ZLPA 5CRDA 4AJ8A 1JLWA 1GTBA 4WETA 3HYPA 5DQSA 3U6VA 4GQFA 3SBCA 1EZKA 4X0XA 1GL8A 3GNJA 4ECCA 1S3DA 1SENA 2GQMA 2HRKB 3FZAA 1X5CA 5DCHA 3DWVA 5ID2B 6GSYA 1O6JA 1YKAA 1YY7A 3F6FA 3D6IA 1UVZA 1DBYA 1T7PB 4X43A 2VUPA 4KW6A 2B7KA 1T3BA 3DXBA 4ML6A 1Z7PA 2L57A 1M2DA 1TU8A 5CNWA 4RQRA 3L9SA 10GSA 3RPPA 1OC9B 2LQOA 1FG4A 1PGTA 1AQVA 5DALB 4HU9A 5G31A 1WWJA 1XWBA 2P0GA 1B8XA 2HRAA 2GQKA 4XIHA 4PQHA 3D4MA 4PURA 4ECBA 2FWGA 2N5BA 1ZGNA 1QXHA 2LS5A 1A23A 1Q4JA 5FHIA 1F9MA 2P5QA 5G30A 5A4UA 3GL5A 1JZWA 5HR1A 3BJ5A 2C0FA 1H75A 1B4PA 3KP8A 3VWXA 5ECOB 3GL3A 4WR4A 1TRUA 2AV4A 4JR6A 1K3OA 2LRNA 4F2IA 4MF5A 4XS4B 1G0TA 2HT9A 1SKRB 2WULA 4I2UA 2VIMA 1XPVA 3L0HA 2VCTA 4O92A 2P5RA 4GQCA 4BPYA 1GSQA 2MBTA 2RLIA 2HE3A 5ECSA 3GKNA 3VFIA 3VURA 5G1KA 2YZUA 3MDKA 2KHPA 3HJPA 2HFDA 2MMNA 4ISDA 2LRTA 3MNGA 3KIJA 3BD2A 2H1GA 4KX4A 5HFGA 5IOWA 4AJ6A 4KH7A 4RQXA 3D22A 1QK8A 5ECIB 1ILOA 3TJBA 2REMA 5ECLB 2IL3A 2VAFA 4MH2A 4QQ7A 2MMAA 3WGXA 4IKHA 3WGEA 3EINA 2FNOA 1I9DA 2F9SA 3GFKA 3KXOA 5IMCA 2OE0A 1MDJA 3LFLA 1B9YC 1ERTA 2C80A 4K9ZA 5ECQB 1VF1A 2TIRA 2HRNA 3BBYA 2M46A 1K0MA 1LU4A 4X1UA 2AUVA 3TJGA 2QGVA 2YANA 1IYHA 1QQ2A 3H93A 2RUFA 3WYWA 4LLRA 4QL9A 2FGXA 1SJIA 3M9KA 2P31A 2V6KA 4ZBDA 3IAS2 2GVPA 1TP9A 4TW5A 3E9JB 3WGDA 2IWTA 4MZBA 5G5FA 5B8BA 3QOUA 1AIUA 1SK0A 4MJCA 2YNXA 3IV4A 4HQSA 3M8NA 6GSUA 3DKSA 1X0RA 4NV2A 3CRTA 2V41A 2LJAA 3KH9A 2LNSA 3GKMA 3M9JA 1ZL9A 3JCML 1TW9A 3LQ7A 3IAM2 2OADA 5COHA 2C1YA 3Q74A 3ZVJA 2CZ2A 2UZ8A 3Q18A 14GSA 5DJLA 1YEXA 3LGCA 4Q5NA 1A8LA 4G9HA 3VK9A 1ERVA 1F6MC 3M0FA 3FZ5A 2GS3A 1FW1A 5J4UA 4IVFA 3WT1A 2M80A 1J9BA 4ECIA 4KAEA 4GSTA 3GV1A 5D8IA 1PX7A 1EEJA 2JSYA 4USSA 2YV7A 2MMZA 3W8SA 4PXOA 3I6AA 5GSTA 3FW2A 3UIWA 4FQUA 3D0ZA 3UBKA 2R2JA 4OCEA 3TCOA 3APSA 3LXTA 3GTUA 4LL4B 2FA8A 4HI7A 1HQOA 9GSSA 1GLPA 1WPIA 4OCFA 4CDOA 4WBJA 3H8QA 3O76A 2GT6A 2CAIA 4V1Ag 5HFKA 1R5PA 5J9BA 2F51A 4IHUA 4MABA 3H4KA 1AQXA 2HSYA 1MTCA 2HZFA 2VD1A 3HY2A 3VWVA 4V2MA 2K8VA 4WR5A 2HRFA 2ON7A 1Z9HA 2H71A 2C0GA 4BVXA 1JZOA 2WB9A 1PL2A 1O7UA 4GSNA 1UN2A 4D73A 4WEYA 4F03A 2KOKA 5HFIA 1ON4A 2H6XA 2FWFA 3US3A 3GX0A 4POLA 1XFLA 3DD3A 5AIXA 4OO4A 2GDRA 3ZTLA 1V9WA 1R4WA 4EF0A 3HVXA 2YP6A 2YOIA 2H0IA 3UL3A 5GSSA 3G7YA 3KD0A 4EUYA 1G6WA 2OE1A 2GSTA 1V58A 4PGTA 2OBKA 2LRCA 5J41A 2B5EA 2VO4A 1HYUA 3APOA 3FRCA 1PN9A 4CW9A 2H8LA 4WKWA 1IYIA 5ECMB 1UA5A 4V2LA 4I2TA 4NHZA 2QC7A 3KEBA 4CHSA 2RUEA 1JZRA 5ECHB 1ACVA 1MEKA 2B6MA 2VL3A 19GSA 2N5FA 2MZCA 4K7IA 1KEBA 1R26A 5JCUA 1ZYEA 1GH2A 1A2MA 3PH9A 3KZQA 4RI6A 4DEJA 1VRSD 5B8AA 2D2ZA 4HOJA 3ZITA 2IMKA 3LXZA 2O87A 1SK1A 3FY7A 3MAKA 2H1AA 4GCIA 5CP1A 3KH7A 1M0UA 4RUVA 4H86A 2K6VA 5GAPD 1TK8B 1V2AA 2GZZA 5IPHA 1TJDA 3QD9A 3IPZA 5GAND 1Z7RA 4L0WA 1U3IA 2ZNMA 12GSA 2IMDA 1UC7A 4IP6A 1Z6NA 3E3EA 2DLXA 4PX1A 1A8YA 3I9V2 4G2EA 1J08A 2YV9A 4GRFA 3HZ8A 5J9CA 3GTUB 3ZZXA 4JR4A 3C8EA 3GUSA 1YZXA 3GMFA 2TRXA 1RQMA 3A2WA 4G10A 2H70A 2PUKC 3R3EA 3N5OA 2FY6A 2NBSA 2KP1A 2R6KA 2LSTA 2OE3A 2DJ3A 2FA4A 5ELAA 1FVKA 3IBHA 2IJYA 2YWMA 3KTLA 2GZYA 2X64A 3TOUA 1PX6A 1WIKA 3PPUA 1YDKA 1ERUA 1K3LA 3I43A 2PVQA 3GSSA 4PUAA 3CTGA 3IC8A 2C8UA 4BVXB 2VCVA 4HQZA 5ECRB 4NHWA 4IW9A 4JU5A 2V1MA 4K0NA 3WD6A 1MDIA 2R37A 4D73B 3HD5A 3KMNA 3DMLA 2IIYA 2GSQA 5D93A 2LQQA 1XW5A 1GSUA 3TUEA 1X9SB 2YZHA 2L4QA 4G19A 2YCDA 3GSTA 1GSEA 4K0GA 2QKEA 2F3MA 3FZ9A 4EO3A 1MD3A 2E2GA 3TDGA 4GXZA 2EIRA 3D5JA 1TRVA 2HYXA 1F2EA 4PQ1A 4GLTA 2BMXA 2GQLA 1GLQA 4TVEA 3DEXA 2VL2A 1ABAA 1AQWA 1PKWA 1NSWA 1OYJA 3UBLA 4BL7A 1BAYA 1YJ6A 3TRXA 1CQGA 4EL1A 3QMXA 3LSZA 1SKWB 4EC0A 5H5RA 4IQAA 2L6CA 5ECPB 2H74A 2AAWA 2CV4A 2DJ1A 2YN1A 5A4WA 4JE1A 1QMVA 2H6ZA 1FVJA 5HR3A 5B6MA 4KSMA 4KCAA 2CVKA 1YF1A 2I81A 3KM6A 4ZL9A 1HD2A 6GSVA 3M3MA 3ME7A 1PL1A 3PR8A 5D9VA 2R4VA 2IPAA 1TTZA 5DDLA 1XVWA 4YAVA 2X8HA 1K3YA 4TR1B 3CXGA 1JHBA 1X9WB 3UEMA 2K18A 3EU4A 4Q5QA 4L5OA 5E59A 4KGIA 5LNKe 3EURA 3KTBA 5F0GA 3W6GA 4ZB6A 5L71A 2DMLA 4OFMA 1XOAA 3IK7A 4KDUA 3TB2A 3FKFA 2X8GA 3HDCA 1BG5A 1TI1A 4KDXA 4OWYA 5JCWA 4YQMA 4NMUA 4ULXA 1TI3A 2V6OA 4V2NA 3LYPA 1HNCA 5G1LA 4DVCA 3IC4A 2JZTA 2PU9C 2B5YA 3GYKA 3EWLA 3F3RA 5FT3A 2H75A 4MP4A 1WRYA 4MJEA 1SYXA 1A0RP 5AN1A 4MCUA 5E4WA 5AISA 2XBQA 3TRPA 5IMFA 4TXVA 4ID0A 2O8VB 2JU5A 4N30A 4IELA 2JACA 5EPFA 1XW9A 1JZDA 3J7Yk 2VD0A 4FYUA 4RI7A 1SJ6A 4LMWA 1O85A 1THXA 5CREA 2EIOA 3TGZA 4TN8A 2H1BA 2ALBA 3E0UA 1M2BA 3UOMA 1EV4A 2F8AA 4ZB8A 5CAXA 1PSQA 3VI5A 4G0IA 4MLYA 3RHCA 1YEPA 3Q19A 5IMAA 1VF2A 3ZMKA 4BL7B 2O7KA 1PRXA 2DBCA 2I9HA 5KEJA 5CRGA 1BQ7A 2AHEA 2CVBA 3QAGA 4Q5RA 4EVMA 2J9HA 3CRUA 4K2DA 1W4VA 1GRXA 1B48A 1NW2A 3A3TA 5BMUA 1WP0A 3ZIVA 2B7JA 3ED3A 5IO0A 3DVXA 4HEA2 2YJ7A 4O5RA 2ZUPA 3W8JA 4OMVA 3QCPA 2RM6A 5IQYA 5CRWA 2YJHA 4HDEA 4BWQA 17GSA 2ES7A 3TJFA 4DSSA 2WCIA 3RPNA 1XWCA 2CX4A 3GA4A 3GH9A 2NVLA 2DSAA 1GULA 3L4NA 1GUHA 3IK9A 3QR6A 4J2FA 4O7HA 5DAKA 2HSHA 3ERGA 2VCZA 1U3AA 1MD4A 4XRAA 3TKSE 3TJJA 4K1FA 1Z6MA 4OO5A
chains in the Genus database with same CATH superfamily
2FWHA 2I4AA 4N10A 1E2YA 2V32A 4MF7A 2CAQA 3IDVA 3ISOA 3QDNA 5HR0A 4POMA 1A2LA 4L8EA 2HSMA 4IS0A 1XG8A 2Z9SA 4NAXA 1A24A 1K0NA 2DIZA 2FCHA 3IHQA 1X5DA 1A2JA 2O85A 2AYTA 1SD9A 3G9BA 1SVLA 2C3TA 4ZILA 1TDIA 4WBRD 2LKUA 5IM9A 5B6NA 3SWLA 1SD8A 2FD3A 1FB0A 2VCWA 5D73A 1XVQA 2V2GA 2H0GA 4YAPA 2L4CA 2IMEA 4POKA 4K5SA 1F3BA 2OA7A 2PGTA 1RK4A 1Q98A 2DJ0A 2HLSA 4A5PA 2VKZG 1DSBA 3NIVA 1LBKA 3CTFA 2H01A 5KN3A 4AJ7A 1M99A 4KDYA 1X9MB 3UJ1A 2PN8A 4TKYA 4IJ3A 3QPMA 4N3ZA 4WF5A 6GSXA 4EDZA 5CRHA 4N0ZA 4ILFA 4J57E 4CY8A 2IMFA 3NZNA 2GSSA 5IOXA 2HSNB 3CBUA 2YWNA 5HQPA 3IXRA 3GKXA 1PA3A 1MDKA 2OJLA 1TXXA 1URMA 1TK5B 5CYYA 4DSRA 2CVDA 2VM1A 4GF0A 3F4SA 3RHBA 4G0KA 3UARA 2DJKA 1SKSB 5BMUB 1Y25A 3ZRDA 1EWXA 3C73A 1VF3A 2PBJA 1Y6EA 4NWYA 5J47A 4F82A 5F07A 4JBBA 4ECJA 4AKGA 1WOUA 2L5LA 1SL2B 3C1RA 4TXOB 3HJMA 3KCMA 4DSSB 1XW6A 3QAWA 4LL1B 5A5HB 1EEMA 2BTOT 2MMOA 4NV5A 4YKFA 3LG6A 5EL8A 3EU3A 4XRDA 2JSZA 4MMMA 5JWOB 3D4TA 5DVBA 2JL4A 2HZEA 3TRQA 5DAKB 1C72A 5D9TA 1G7OA 2K8SA 4TR1A 1O73A 4ZL7A 1YVLA 4YH2A 1FB6A 3A5WA 3C7MA 2IN3A 1GSSA 3D21A 3HCZA 2O36A 1M3IA 3LJRA 5A4VA 3IA1A 3O6TA 1KBNA 4MJBA 1DE2A 3VPTA 4G01A 4QMKA 1EP7A 2B3SA 5G2ZA 2PERA 2HSMB 2FWEA 1GP1A 4MF6A 1XIYA 3F6DA 3FEUA 5D96A 3HVSA 1ML6A 4K8MA 4EE0A 2AB6A 3IE3A 3RAZA 2XPDA 2PWJA 1QGVA 4N0VA 4ZB9A 4KE3A 1XZOA 2FHEA 3IHGA 1TKDB 3ZMLA 3IOSA 2K9FA 5IO2A 1H4OA 1NM3A 4I97A 2QSIA 2O3EA 2O89A 4O32A 4OFNA 4YKGA 1TU7A 1JLVA 1V57A 3UVHA 3QFBC 2XHFA 4EIQA 2VM2A 3CMIA 1WMJA 4I8BA 1F3AA 2GSRA 6GSWA 2O5VA 2GZPA 1XCCA 2RM5A 3F0IA 4AGSA 3EVIA 2LTKA 2C4JA 4K7OA 4AF2A 1AC1A 1K0DA 1V98A 3RDWA 4HZ4A 3ZREA 2X99A 2B1LA 3G7JA 1PMTA 1PN0A 2H73A 2H66A 2WGRA 4PNFA 1E6BA 1Z5YE 3EC3A 4Z7XA 3HKRA 2XBIA 3TKQA 3UVTA 3IR4A 1S3CA 4E8EA 1Y1UA 3KP9A 3LORA 1K0OA 2ZCTA 3MWHA 4MDCA 2EIQA 4TR3A 2WFCA 1B9XC 2KLXA 5G5EA 2WDUA 2WS2A 3GX8A 2GLRA 2FUG2 4HUAA 2X4AA 1M9AA 2I3YA 5A5KA 4YQUA 4BA7A 3FHKA 2LJKA 1O81A 4EDYA 1M2AA 1OC8A 4E68A 3VPQA 1SU9A 1YQ1A 2E0QA 3A2XA 4MPGA 2DC5A 4L5LA 3LYKA 5ECKB 3FR9A 2HZEB 2DJ2A 1ZMAA 3Q6OA 1OKTA 4HJ2A 5JWQB 4IBPA 3CSHA 2VLUA 1AAZA 6GSTA 5LD0A 3WT2A 2ON5A 1OVNA 4GTUA 2LEGA 5IPGA 2E7PA 3QFAC 2CX3A 1FAAA 5JWRB 4IGJA 1BEDA 2LNTA 2HI7A 4YQVA 1GTIA 3DGQA 4IJIA 3TJKA 3VI7A 4I6XA 4HU7A 2CZ3A 4MK3A 4PNGA 3KJYA 2I1UA 2F8FA 3I69A 5KN1A 2VCXA 1XWGA 1TRWA 1PKZA 1TOFA 3BCKA 5DQYA 1R7HA 3GN3A 1EOGA 3V1WA 5IMZA 4Z2TA 3M1GA 3FYGA 4I5QA 4K7NA 3VLNA 1ZYNA 4JRRA 5C04A 1GSDA 1FO5A 1K0CA 5HR2A 3C1SA 3PGTA 2IMIA 4MPFA 2H76A 3H79A 1GUMA 3F63A 5EY6A 2G2QA 1G7EA 1THOA 1XWAA 1U87A 4HJMA 1T4ZA 4MJAA 1ZCPA 4WF4A 1AXDA 2R5GA 3BCIA 4F0CA 1M7TA 4L0UA 3P90A 1PD21 4PUFC 3ME8A 4ZBAA 4MZWA 4P3YB 3EMPA 1GNEA 2B1KA 5ENUA 3DVWA 1GUKA 2CQ9A 2DIYA 3P2AA 4G0LA 2HQTA 3TKSA 3NOFA 1LJRA 2EFCA 5ABRA 2PPTA 2L6DA 2CA8A 2JZRA 4W66A 4MZCA 2VOCA 2LJRA 3GH6A 1TK0B 4BWSA 2DMMA 4WXTA 1OAZA 1GWCA 2H0HA 5LCZA 2YPMA 4PTSA 1RW1A 4FYBA 5IIZA 2R3XA 4KF9A 1YEWC 3TOTA 5J5NA 1T8EB 1K0BA 3RBTA 4ZL8A 5C00A 1Z3EA 4FIWA 5H5QA 2OACA 5INYA 2A4VA 3EYTA 1OKDA 3LEFA 4TXOA 3TKRA 2GTUA 1YF0A 3PINA 2VL9A 1PFOA 2H30A 1SYRA 2C3QA 1U88A 2LV3A 4PHZC 3N9JA 2JADA 4IN0A 2H19A 1CQHA 1ERWA 3HZ4A 1GTUA 2YWOA 5ELGA 2WZ9A 4ZBBA 3U5RE 2YWIA 3IRAA 1OC3A 3GHAA 3FR6A 5F8BA 3HVVA 3TKPA 2GGTA 3ZYWA 5ECNB 3S9FA 5AIVA 1GNWA 1ST9A 3UAPA 5B7CA 4OD7A 2L59A 1S3RA 3HXSA 5CO3A 2A2SA 1N2AA 2VLTA 4KUNA 2OKAA 1T1VA 1U6TA 7GSSA 2J23A 4KCEA 3BOAA 2HNLA 4F0BA 2PMTA 4K6XA 5D9WA 5DJMA 1W89A 1TRSA 5KN2A 4FO5A 1O8XA 3ZFBA 3K8NA 1EP8A 2CT6A 3MIXA 2WRTA 4J56E 3CQFA 1J0FA 2KUCA 4KSOA 4LMVA 3CWGA 1YKCA 4QL7A 2BJXA 3UMAA 1F37A 1KNGA 1XWKA 1BYEA 2WW3A 4BVYA 1JFUA 4IQ1A 3ERFA 6GSSA 3GRXA 2NPBA 1V40A 4EKZA 2MBSA 4FYCA 3FZ4A 1GSFA 4O5UA 2H1DA 1M9BA 4OFTA 1K0AA 3HJOA 4TRXA 2VL2C 2IFQA 5AGYA 4POBA 3CYNA 2H6YA 4KB3A 4JEDA 1SL1B 1XXUA 3ZL5A 2C0DA 1O8WA 4TOPA 1XBSA 3ERWA 4GSSA 4XHMA 1EGRA 3KMOA 1G6YA 2GT5A 3F8UA 5J3RA 4ACSA 4XS1A 1X5EA 4N11A 1GSYA 4EIPA 2XC2A 11GSA 3CSIA 13GSA 16GSA 3P7XA 5IMVA 2M72A 2HRKA 4IP1A 3MSZA 4KA0A 1KTEA 4ZXGA 3P8WA 5ID2A 3R2QA 1T00A 3APQA 2WJUA 3QAVA 2JZSA 2VLVA 4TR4A 1DE1A 3GURA 5D9XA 4JZQA 1HNBA 1SL0B 2R0GA 4PQIA 4KNDA 4MA9A 2EC4A 5EVOA 2VCQA 1SK2A 4NPBA 4XTSA 3L78A 2C3NA 3FR3A 2C0EA 1QFNA 1BX9A 1USBA 5DCGA 3ZIJA 2HXKA 3HHVA 4LA1A 1OC9A 2OBIA 1OE8A 1A0FA 1ZYQB 1FHEA 4GWRA 4TR0A 4Z2RA 3C71A 3OR5A 5H5SA 5DALA 3CSJA 1NHYA 4BIKA 4E8HA 4F9ZA 3G7IA 1FOVA 2LUSA 2DJJA 1HNAA 3F3QA 2MYGA 3L9VA 1I5GA 1BF5A 3KGKA 3VWWA 2NDOA 5IMDA 5KN0A 4FXYP 2A2RA 3HA9A 1QUWA 5DBQA 3F4RA 1WJKA 1ZOFA 8GSSA 2L5OA 3GKKA 1GTAA 1N8JA 3HVNA 1VF4A 4EXJA 4XS4A 1EGOA 2FLSA 2AJQB 4ML1A 3H1NA 1EOHA 3LWAA 2NTOA 1WE0A 22GSA 2E2MA 4FH8A 18GSA 1EV9A 3EE2A 1AUCA 2N5AA 4HS1A 4XCSA 2XPEA 1SJZA 3DYRA 3J7Yb 4DSQA 3A2VA 4NXIA 1XOBA 1VGLA 3DIEA 1PQNA 1NHOA 1S3AA 3F4TA 3ZFLA 1DUGA 3EMXA 3GIXA 20GSA 4BVYB 3ZVJD 1OE7A 3FK8A 3L9UA 1R5AA 2X8CA 4V1Ap 4HZ2A 2B5XA 4Q5FA 5F06A 5JCGA 3VWUA 3O3TA 1B4QA 1ZZYA 2KP2A 3TKSC 2PVOC 5KOWA 2H72A 1T4YA 5GZZB 3DRNA 2WW2A 2IFQB 2TRCP 4XS6A 4MH3A 5F05A 4CY6A 3AY8A 2G0FA 3F9UA 2RIIA 4ZIJA 1BJXA 5FWGA 1AW9A 3ZLPA 5CRDA 4AJ8A 1JLWA 1GTBA 4WETA 3HYPA 5DQSA 4GDFA 4ZB7A 3U6VA 4GQFA 4HSCX 3SBCA 1EZKA 1N25A 4X0XA 1GL8A 3GNJA 4MNNA 4ECCA 1S3DA 1SENA 2GQMA 2HRKB 2A2PA 3FZAA 1X5CA 5DCHA 3DWVA 1I1IP 5ID2B 6GSYA 1O6JA 1YKAA 1YY7A 3F6FA 3D6IA 1UVZA 1DBYA 1T7PB 4X43A 4PI2C 2H1LA 2VUPA 4KW6A 2B7KA 1T3BA 3DXBA 4ML6A 1Z7PA 2L57A 1M2DA 1TU8A 5CNWA 4RQRA 3L9SA 10GSA 3RPPA 1OC9B 2LQOA 1FG4A 1PGTA 1AQVA 5DALB 4HU9A 5G31A 1WWJA 1XWBA 2P0GA 1B8XA 2HRAA 2GQKA 4XIHA 4PQHA 3D4MA 4PURA 4ECBA 2FWGA 2N5BA 1ZGNA 1QXHA 2LS5A 1A23A 1Q4JA 5FHIA 1F9MA 2P5QA 5G30A 5A4UA 3GL5A 1JZWA 1S4BP 5HR1A 3BJ5A 2C0FA 1H75A 1B4PA 3KP8A 3VWXA 5ECOB 3GL3A 4WR4A 1TRUA 2AV4A 4JR6A 2EFEA 1K3OA 2LRNA 4F2IA 4MF5A 4XS4B 1G0TA 2HT9A 1SKRB 2WULA 4I2UA 2VIMA 1XPVA 3L0HA 2VCTA 4O92A 2P5RA 4GQCA 4BPYA 1GSQA 2MBTA 4Z2UA 2RLIA 2HE3A 5ECSA 3GKNA 3VFIA 3VURA 5G1KA 2YZUA 3MDKA 1BG1A 2KHPA 5J4YA 3HJPA 2HFDA 2MMNA 4ISDA 2LRTA 3MNGA 3KIJA 3BD2A 2H1GA 4KX4A 5HFGA 5IOWA 4AJ6A 4KH7A 4RQXA 3D22A 1QK8A 5ECIB 1ILOA 3TJBA 2REMA 5ECLB 2IL3A 2VAFA 4MH2A 4QQ7A 2MMAA 3WGXA 4IKHA 3WGEA 3EINA 2FNOA 3LW9A 1I9DA 2F9SA 3GFKA 3KXOA 5IMCA 2OE0A 1MDJA 3LFLA 1B9YC 1ERTA 2C80A 4K9ZA 5ECQB 1VF1A 2TIRA 2HRNA 3BBYA 2M46A 1K0MA 1LU4A 4X1UA 2AUVA 3TJGA 2QGVA 2YANA 1IYHA 1QQ2A 3H93A 2RUFA 3WYWA 4LLRA 4QL9A 2FGXA 1SJIA 2DKHA 3M9KA 2P31A 2V6KA 4ZBDA 3IAS2 2GVPA 1TP9A 2WVZA 4TW5A 3E9JB 3WGDA 2IWTA 4MZBA 4K5RA 5G5FA 5B8BA 3QOUA 1AIUA 1SK0A 4MJCA 2YNXA 3IV4A 4HQSA 3M8NA 6GSUA 3DKSA 1X0RA 4NV2A 3CRTA 2V41A 2LJAA 3KH9A 2LNSA 3GKMA 3M9JA 1ZL9A 3JCML 1TW9A 3LQ7A 2QA1A 2OADA 3IAM2 5COHA 2C1YA 3Q74A 5A34A 3ZVJA 2CZ2A 2UZ8A 1SVMA 3Q18A 14GSA 4K2XA 5DJLA 1YEXA 3LGCA 4Q5NA 2WW1A 2WVXA 1A8LA 4G9HA 3VK9A 1ERVA 1F6MC 3M0FA 3FZ5A 2GS3A 1FW1A 5J4UA 4IVFA 3WT1A 2M80A 1J9BA 4ECIA 4KAEA 4GSTA 3GV1A 5D8IA 1PX7A 2WVYA 1EEJA 2JSYA 4USSA 2YV7A 1TXUA 2MMZA 4AKXB 5A1NA 3W8SA 4PXOA 3I6AA 4X4JA 5GSTA 3FW2A 3UIWA 4FQUA 3D0ZA 3UBKA 2R2JA 4OCEA 3TCOA 3APSA 3LXTA 3GTUA 4LL4B 2FA8A 4HI7A 1HQOA 9GSSA 1GLPA 1WPIA 4OCFA 4CDOA 4WBJA 3MYDA 3H8QA 3O76A 2GT6A 2CAIA 4V1Ag 5HFKA 2WZSA 1R5PA 5J9BA 3RGBC 2F51A 4IHUA 4MABA 3H4KA 1ZYPA 1AQXA 5J40A 2HSYA 1MTCA 2HZFA 2VD1A 3HY2A 3VWVA 4V2MA 2K8VA 4WR5A 2HRFA 2ON7A 1Z9HA 2H71A 2C0GA 4BVXA 1JZOA 2R0PA 2WB9A 1PL2A 1O7UA 4GSNA 1UN2A 4D73A 4WEYA 4F03A 2KOKA 4ICYA 5HFIA 1ON4A 2H6XA 2FWFA 3US3A 3GX0A 4POLA 4AKIA 1XFLA 3DD3A 5AIXA 4OO4A 2GDRA 3ZTLA 1V9WA 1R4WA 4EF0A 3HVXA 2YP6A 2YOIA 4O5QA 2H0IA 3UL3A 5GSSA 3G7YA 3KD0A 4EUYA 1G6WA 2OE1A 2GSTA 1V58A 4PGTA 2OBKA 2LRCA 5J41A 2B5EA 2VO4A 4AI6A 1HYUA 3APOA 3FRCA 1PN9A 4CW9A 2H8LA 4WKWA 1IYIA 5ECMB 1UA5A 4V2LA 4I2TA 4NHZA 2QC7A 3KEBA 4CHSA 2RUEA 1JZRA 5ECHB 2DKIA 1ACVA 1MEKA 2B6MA 2VL3A 19GSA 2N5FA 2MZCA 5A34B 4K7IA 1KEBA 1R26A 5JCUA 1ZYEA 1GH2A 1A2MA 3PH9A 3KZQA 4RI6A 4DEJA 2WVXB 1VRSD 5B8AA 2D2ZA 4HOJA 4PI0C 3ZITA 2IMKA 3LXZA 2O87A 1SK1A 3FY7A 3MAKA 2EFDA 2H1AA 4GCIA 5CP1A 3KH7A 1M0UA 4RUVA 4H86A 2K6VA 5GAPD 1FOHA 1V2AA 1TK8B 2GZZA 2R0CA 5IPHA 2UV8G 1TJDA 3QD9A 3IPZA 5GAND 1Z7RA 4L0WA 1U3IA 5A1NB 2ZNMA 4AKHA 2WW0A 12GSA 3RFRC 2IMDA 1UC7A 3E3EA 1Z6NA 4IP6A 2DLXA 4PX1A 1A8YA 3I9V2 4G2EA 1J08A 2YV9A 4GRFA 3HZ8A 5J9CA 3GTUB 3ZZXA 4JR4A 3C8EA 3GUSA 1YZXA 3GMFA 2TRXA 1RQMA 3A2WA 4G10A 2H70A 2PUKC 3R3EA 3N5OA 2FY6A 2NBSA 2KP1A 2R6KA 2LSTA 2OE3A 2DJ3A 2FA4A 5ELAA 1FVKA 3IBHA 2IJYA 2YWMA 3KTLA 2GZYA 2X64A 3TOUA 1PX6A 1WIKA 3PPUA 1YDKA 1ERUA 1K3LA 3I43A 2PVQA 3GSSA 4PUAA 3CTGA 3IC8A 2C8UA 4BVXB 2VCVA 4HQZA 5ECRB 4NHWA 4IW9A 4JU5A 2V1MA 4K0NA 3WD6A 1MDIA 2R37A 4D73B 3HD5A 3KMNA 3DMLA 2IIYA 2GSQA 1SVOA 5D93A 2LQQA 1XW5A 1GSUA 3TUEA 1X9SB 2YZHA 2L4QA 4G19A 2YCDA 3GSTA 1GSEA 1M3JA 4K0GA 2EFHA 2QKEA 2F3MA 3FZ9A 4EO3A 1MD3A 2E2GA 2QA2A 3TDGA 4GXZA 2EIRA 3D5JA 1TRVA 2HYXA 1F2EA 4PQ1A 4GLTA 2BMXA 2GQLA 1GLQA 4TVEA 3DEXA 2VL2A 1ABAA 1AQWA 1PKWA 1NSWA 1OYJA 3UBLA 4BL7A 1BAYA 1YJ6A 3TRXA 1CQGA 4EL1A 3QMXA 3LSZA 1SKWB 4EC0A 5H5RA 4IQAA 2L6CA 5BRTA 5ECPB 2H74A 2AAWA 2CV4A 2DJ1A 2YN1A 3A5IA 5A4WA 4JE1A 1QMVA 5J4VA 2H6ZA 1FVJA 5HR3A 5B6MA 4KSMA 2X49A 4KCAA 2CVKA 1YF1A 2I81A 3KM6A 4ZL9A 5KOXA 1HD2A 6GSVA 3M3MA 3ME7A 1PL1A 3PR8A 5D9VA 2R4VA 2IPAA 1TTZA 3EPTA 5DDLA 1XVWA 4YAVA 2X8HA 1K3YA 4TR1B 3CXGA 1JHBA 1X9WB 3UEMA 2K18A 3EU4A 4Q5QA 4L5OA 5E59A 4KGIA 5LNKe 3EURA 3KTBA 5F0GA 3W6GA 2OT3A 4ZB6A 5L71A 2DMLA 4OFMA 1XOAA 3IK7A 4KDUA 3TB2A 3FKFA 2X8GA 3HDCA 1BG5A 1TI1A 4KDXA 4OWYA 3TU3B 5JCWA 4YQMA 4NMUA 4ULXA 1TI3A 3HMJG 2V6OA 4V2NA 3LYPA 1HNCA 5G1LA 4DVCA 3IC4A 2JZTA 2PU9C 2B5YA 3GYKA 3EWLA 3F3RA 5FT3A 2H75A 4MP4A 1WRYA 4MJEA 1SYXA 1A0RP 5AN1A 4MCUA 5E4WA 5AISA 2XBQA 3TRPA 5IMFA 4TXVA 4ID0A 2O8VB 2JU5A 4N30A 4IELA 2JACA 5EPFA 1XW9A 1JZDA 3J7Yk 2VD0A 4FYUA 4RI7A 3FMWA 1SJ6A 4LMWA 1O85A 1THXA 5CREA 2EIOA 3TGZA 4TN8A 2H1BA 2ALBA 3E0UA 1M2BA 3UOMA 1EV4A 2F8AA 4ZB8A 5CAXA 1PSQA 3VI5A 4G0IA 4MLYA 3RHCA 1YEPA 3Q19A 5IMAA 1VF2A 3ZMKA 2HSNA 4BL7B 2O7KA 1PRXA 2DBCA 2I9HA 5KEJA 5CRGA 1BQ7A 2AHEA 2CVBA 3QAGA 4Q5RA 4EVMA 2J9HA 3CRUA 4K2DA 1W4VA 1GRXA 1B48A 1NW2A 3A3TA 5BMUA 1WP0A 3ZIVA 2B7JA 3ED3A 5IO0A 3DVXA 4HEA2 2YJ7A 4O5RA 2ZUPA 3W8JA 4OMVA 3QCPA 2A4HA 2RM6A 5IQYA 5CRWA 2YJHA 4HDEA 4BWQA 17GSA 2ES7A 3TJFA 4DSSA 2WCIA 5A5HA 3RPNA 1XWCA 2CX4A 3GA4A 3GH9A 2NVLA 2DSAA 1GULA 3L4NA 1GUHA 3IK9A 3CHXC 3QR6A 4J2FA 4O7HA 5DAKA 2HSHA 3ERGA 2VCZA 1U3AA 1MD4A 4XRAA 3TKSE 3TJJA 4K1FA 1Z6MA 4OO5A
chains in the Genus database with same CATH topology
2FWHA 2I4AA 4N10A 1E2YA 2V32A 4MF7A 2CAQA 3IDVA 3ISOA 3QDNA 5HR0A 4POMA 1A2LA 4L8EA 2HSMA 4IS0A 2Z9SA 4NAXA 1A24A 1K0NA 2DIZA 2FCHA 3IHQA 1X5DA 1A2JA 2O85A 2AYTA 1SD9A 3G9BA 1SVLA 2C3TA 4ZILA 1TDIA 4WBRD 2LKUA 5IM9A 5B6NA 3SWLA 1SD8A 2FD3A 1FB0A 2VCWA 5D73A 1XVQA 2V2GA 2H0GA 4YAPA 2L4CA 2IMEA 4POKA 4K5SA 1F3BA 2OA7A 2PGTA 1RK4A 1Q98A 2DJ0A 2HLSA 4A5PA 2VKZG 1DSBA 3NIVA 1LBKA 3CTFA 2H01A 5KN3A 4AJ7A 1M99A 4KDYA 1X9MB 3UJ1A 2PN8A 4TKYA 4IJ3A 3QPMA 4N3ZA 4WF5A 6GSXA 4EDZA 5CRHA 4N0ZA 4ILFA 4J57E 4CY8A 2IMFA 3NZNA 2GSSA 5IOXA 2HSNB 3CBUA 2YWNA 5HQPA 3IXRA 3GKXA 1PA3A 1MDKA 2OJLA 1TXXA 1URMA 1TK5B 5CYYA 4DSRA 2CVDA 2VM1A 4GF0A 3F4SA 3RHBA 4G0KA 3UARA 2DJKA 1SKSB 5BMUB 1Y25A 3ZRDA 1EWXA 3C73A 1VF3A 2PBJA 1Y6EA 4NWYA 5J47A 4F82A 5F07A 4JBBA 4ECJA 4AKGA 1WOUA 2L5LA 1SL2B 3C1RA 4TXOB 3HJMA 3KCMA 4DSSB 1XW6A 3QAWA 4LL1B 5A5HB 1EEMA 2BTOT 2MMOA 4NV5A 4YKFA 3LG6A 5EL8A 3EU3A 4XRDA 2JSZA 4MMMA 5JWOB 3D4TA 5DVBA 2JL4A 2HZEA 3TRQA 5DAKB 1C72A 5D9TA 1G7OA 2K8SA 4TR1A 1O73A 4ZL7A 1YVLA 4YH2A 1FB6A 3A5WA 3C7MA 2IN3A 1GSSA 3D21A 3HCZA 3LJRA 5A4VA 3IA1A 3O6TA 1KBNA 4MJBA 1DE2A 3VPTA 4G01A 4QMKA 1EP7A 2B3SA 5G2ZA 2PERA 2HSMB 2FWEA 1GP1A 4MF6A 1XIYA 3F6DA 3FEUA 5D96A 3HVSA 1ML6A 4K8MA 4EE0A 2AB6A 3IE3A 3RAZA 2XPDA 2PWJA 1QGVA 4N0VA 4ZB9A 4KE3A 1XZOA 2FHEA 3IHGA 1TKDB 3ZMLA 3IOSA 2K9FA 5IO2A 1H4OA 1NM3A 4I97A 2QSIA 2O89A 4O32A 4OFNA 4YKGA 1TU7A 1JLVA 1V57A 3UVHA 3QFBC 2XHFA 4EIQA 2VM2A 3CMIA 1WMJA 4I8BA 1F3AA 2GSRA 6GSWA 2O5VA 2GZPA 1XCCA 2RM5A 3F0IA 4AGSA 3EVIA 2LTKA 2C4JA 4K7OA 4AF2A 1AC1A 1K0DA 1V98A 3RDWA 4HZ4A 3ZREA 2X99A 2B1LA 3G7JA 1PMTA 1PN0A 2H73A 2H66A 2WGRA 4PNFA 1E6BA 1Z5YE 3EC3A 4Z7XA 3HKRA 2XBIA 3TKQA 3UVTA 3IR4A 1S3CA 4E8EA 1Y1UA 3KP9A 3LORA 1K0OA 2ZCTA 3MWHA 4MDCA 2EIQA 4TR3A 2WFCA 1B9XC 2KLXA 5G5EA 2WDUA 2WS2A 3GX8A 2GLRA 2FUG2 4HUAA 2X4AA 1M9AA 2I3YA 5A5KA 4YQUA 4BA7A 3FHKA 2LJKA 1O81A 4EDYA 1M2AA 1OC8A 4E68A 3VPQA 1SU9A 1YQ1A 2E0QA 3A2XA 4MPGA 2DC5A 4L5LA 3LYKA 5ECKB 3FR9A 2HZEB 2DJ2A 1ZMAA 3Q6OA 1OKTA 4HJ2A 5JWQB 4IBPA 3CSHA 2VLUA 1AAZA 6GSTA 5LD0A 3WT2A 2ON5A 1OVNA 4GTUA 2LEGA 5IPGA 2E7PA 3QFAC 2CX3A 1FAAA 5JWRB 4IGJA 1BEDA 2LNTA 2HI7A 4YQVA 1GTIA 3DGQA 4IJIA 3TJKA 3VI7A 4I6XA 4HU7A 2CZ3A 4MK3A 4PNGA 3KJYA 2I1UA 2F8FA 3I69A 5KN1A 2VCXA 1XWGA 1TRWA 1PKZA 1TOFA 3BCKA 5DQYA 1R7HA 3GN3A 1EOGA 3V1WA 5IMZA 4Z2TA 3M1GA 3FYGA 4I5QA 4K7NA 3VLNA 1ZYNA 4JRRA 5C04A 1GSDA 1FO5A 1K0CA 5HR2A 3C1SA 3PGTA 2IMIA 4MPFA 2H76A 3H79A 1GUMA 3F63A 5EY6A 2G2QA 1G7EA 1THOA 1XWAA 1U87A 4HJMA 1T4ZA 4MJAA 1ZCPA 4WF4A 1AXDA 2R5GA 3BCIA 4F0CA 1M7TA 4L0UA 3P90A 1PD21 4PUFC 3ME8A 4ZBAA 4MZWA 4P3YB 3EMPA 1GNEA 2B1KA 5ENUA 3DVWA 1GUKA 2CQ9A 2DIYA 3P2AA 4G0LA 2HQTA 3TKSA 3NOFA 1LJRA 2EFCA 5ABRA 2PPTA 2L6DA 2CA8A 2JZRA 4W66A 4MZCA 2VOCA 2LJRA 3GH6A 1TK0B 4BWSA 2DMMA 4WXTA 1OAZA 1GWCA 2H0HA 5LCZA 2YPMA 4PTSA 1RW1A 4FYBA 5IIZA 2R3XA 4KF9A 3TOTA 5J5NA 1T8EB 1K0BA 3RBTA 4ZL8A 5C00A 1Z3EA 4FIWA 5H5QA 2OACA 5INYA 2A4VA 3EYTA 1OKDA 3LEFA 4TXOA 3TKRA 2GTUA 1YF0A 3PINA 2VL9A 2H30A 1SYRA 2C3QA 1U88A 2LV3A 3N9JA 2JADA 4IN0A 2H19A 1CQHA 1ERWA 3HZ4A 1GTUA 2YWOA 5ELGA 2WZ9A 4ZBBA 3U5RE 2YWIA 3IRAA 1OC3A 3GHAA 3FR6A 5F8BA 3HVVA 3TKPA 2GGTA 3ZYWA 5ECNB 3S9FA 5AIVA 1GNWA 1ST9A 3UAPA 5B7CA 4OD7A 2L59A 3HXSA 5CO3A 2A2SA 1N2AA 2VLTA 4KUNA 2OKAA 1T1VA 1U6TA 7GSSA 2J23A 4KCEA 3BOAA 2HNLA 4F0BA 2PMTA 4K6XA 5D9WA 5DJMA 1W89A 1TRSA 5KN2A 4FO5A 1O8XA 3ZFBA 3K8NA 1EP8A 2CT6A 3MIXA 2WRTA 4J56E 1J0FA 2KUCA 4KSOA 4LMVA 3CWGA 1YKCA 4QL7A 2BJXA 3UMAA 1F37A 1KNGA 1XWKA 1BYEA 4BVYA 1JFUA 4IQ1A 3ERFA 6GSSA 3GRXA 2NPBA 1V40A 4EKZA 2MBSA 4FYCA 3FZ4A 1GSFA 4O5UA 2H1DA 1M9BA 4OFTA 1K0AA 3HJOA 4TRXA 2VL2C 2IFQA 5AGYA 4POBA 3CYNA 2H6YA 4KB3A 4JEDA 1SL1B 1XXUA 3ZL5A 2C0DA 1O8WA 4TOPA 1XBSA 3ERWA 4GSSA 4XHMA 1EGRA 3KMOA 1G6YA 2GT5A 3F8UA 5J3RA 4ACSA 4XS1A 1X5EA 4N11A 1GSYA 4EIPA 2XC2A 11GSA 3CSIA 13GSA 16GSA 3P7XA 5IMVA 2M72A 2HRKA 4IP1A 3MSZA 4KA0A 1KTEA 4ZXGA 3P8WA 5ID2A 3R2QA 1T00A 3APQA 2WJUA 3QAVA 2JZSA 2VLVA 4TR4A 1DE1A 3GURA 5D9XA 4JZQA 1HNBA 1SL0B 2R0GA 4PQIA 4KNDA 4MA9A 2EC4A 5EVOA 2VCQA 1SK2A 4NPBA 4XTSA 3L78A 2C3NA 3FR3A 2C0EA 1QFNA 1BX9A 1USBA 5DCGA 3ZIJA 2HXKA 3HHVA 4LA1A 1OC9A 2OBIA 1OE8A 1A0FA 1ZYQB 1FHEA 4GWRA 4TR0A 4Z2RA 3C71A 3OR5A 5H5SA 5DALA 3CSJA 1NHYA 4E8HA 4F9ZA 3G7IA 1FOVA 2LUSA 2DJJA 1HNAA 3F3QA 2MYGA 3L9VA 1I5GA 1BF5A 3KGKA 3VWWA 2NDOA 5IMDA 5KN0A 2A2RA 3HA9A 1QUWA 5DBQA 3F4RA 1WJKA 1ZOFA 8GSSA 2L5OA 3GKKA 1GTAA 1N8JA 1VF4A 4EXJA 4XS4A 1EGOA 2FLSA 2AJQB 4ML1A 3H1NA 1EOHA 3LWAA 2NTOA 1WE0A 22GSA 2E2MA 4FH8A 18GSA 1EV9A 3EE2A 1AUCA 2N5AA 4HS1A 4XCSA 2XPEA 1SJZA 3DYRA 3J7Yb 4DSQA 3A2VA 4NXIA 1XOBA 1VGLA 3DIEA 1PQNA 1NHOA 1S3AA 3F4TA 3ZFLA 1DUGA 3EMXA 3GIXA 20GSA 4BVYB 3ZVJD 1OE7A 3FK8A 3L9UA 1R5AA 2X8CA 4V1Ap 4HZ2A 2B5XA 4Q5FA 5F06A 5JCGA 3VWUA 3O3TA 1B4QA 1ZZYA 2KP2A 3TKSC 2PVOC 5KOWA 2H72A 1T4YA 5GZZB 3DRNA 2IFQB 2TRCP 4XS6A 4MH3A 5F05A 4CY6A 3AY8A 2G0FA 3F9UA 2RIIA 4ZIJA 1BJXA 5FWGA 1AW9A 3ZLPA 5CRDA 4AJ8A 1JLWA 1GTBA 4WETA 3HYPA 5DQSA 4GDFA 4ZB7A 3U6VA 4GQFA 3SBCA 1EZKA 1N25A 4X0XA 1GL8A 3GNJA 4MNNA 4ECCA 1S3DA 1SENA 2GQMA 2HRKB 2A2PA 3FZAA 1X5CA 5DCHA 3DWVA 5ID2B 6GSYA 1O6JA 1YKAA 1YY7A 3F6FA 3D6IA 1UVZA 1DBYA 1T7PB 4X43A 2H1LA 2VUPA 4KW6A 2B7KA 1T3BA 3DXBA 4ML6A 1Z7PA 2L57A 1M2DA 1TU8A 5CNWA 4RQRA 3L9SA 10GSA 3RPPA 1OC9B 2LQOA 1FG4A 1PGTA 1AQVA 5DALB 4HU9A 5G31A 1WWJA 1XWBA 2P0GA 1B8XA 2HRAA 2GQKA 4XIHA 4PQHA 3D4MA 4PURA 4ECBA 2FWGA 2N5BA 1ZGNA 1QXHA 2LS5A 1A23A 1Q4JA 5FHIA 1F9MA 2P5QA 5G30A 5A4UA 3GL5A 1JZWA 5HR1A 3BJ5A 2C0FA 1H75A 1B4PA 3KP8A 3VWXA 5ECOB 3GL3A 4WR4A 1TRUA 2AV4A 4JR6A 2EFEA 1K3OA 2LRNA 4F2IA 4MF5A 4XS4B 1G0TA 2HT9A 1SKRB 2WULA 4I2UA 2VIMA 1XPVA 3L0HA 2VCTA 4O92A 2P5RA 4GQCA 4BPYA 1GSQA 2MBTA 4Z2UA 2RLIA 2HE3A 5ECSA 3GKNA 3VFIA 3VURA 5G1KA 2YZUA 3MDKA 1BG1A 2KHPA 5J4YA 3HJPA 2HFDA 2MMNA 4ISDA 2LRTA 3MNGA 3KIJA 3BD2A 2H1GA 4KX4A 5HFGA 5IOWA 4AJ6A 4KH7A 4RQXA 3D22A 1QK8A 5ECIB 1ILOA 3TJBA 2REMA 5ECLB 2IL3A 2VAFA 4MH2A 4QQ7A 2MMAA 3WGXA 4IKHA 3WGEA 3EINA 2FNOA 3LW9A 1I9DA 2F9SA 3GFKA 3KXOA 5IMCA 2OE0A 1MDJA 3LFLA 1B9YC 1ERTA 2C80A 4K9ZA 5ECQB 1VF1A 2TIRA 2HRNA 3BBYA 2M46A 1K0MA 1LU4A 4X1UA 2AUVA 3TJGA 2QGVA 2YANA 1IYHA 1QQ2A 3H93A 2RUFA 3WYWA 4LLRA 4QL9A 2FGXA 1SJIA 2DKHA 3M9KA 2P31A 2V6KA 4ZBDA 3IAS2 2GVPA 1TP9A 4TW5A 3E9JB 3WGDA 2IWTA 4MZBA 4K5RA 5G5FA 5B8BA 3QOUA 1AIUA 1SK0A 4MJCA 2YNXA 3IV4A 4HQSA 3M8NA 6GSUA 3DKSA 1X0RA 4NV2A 3CRTA 2V41A 2LJAA 3KH9A 2LNSA 3GKMA 3M9JA 1ZL9A 3JCML 1TW9A 3LQ7A 2QA1A 2OADA 3IAM2 5COHA 2C1YA 3Q74A 5A34A 3ZVJA 2CZ2A 2UZ8A 1SVMA 3Q18A 14GSA 4K2XA 5DJLA 1YEXA 3LGCA 4Q5NA 1A8LA 4G9HA 3VK9A 1ERVA 1F6MC 3M0FA 3FZ5A 2GS3A 1FW1A 5J4UA 4IVFA 3WT1A 2M80A 1J9BA 4ECIA 4KAEA 4GSTA 3GV1A 5D8IA 1PX7A 1EEJA 2JSYA 4USSA 2YV7A 1TXUA 2MMZA 4AKXB 5A1NA 3W8SA 4PXOA 3I6AA 4X4JA 5GSTA 3FW2A 3UIWA 4FQUA 3D0ZA 3UBKA 2R2JA 4OCEA 3TCOA 3APSA 3LXTA 3GTUA 4LL4B 2FA8A 4HI7A 1HQOA 9GSSA 1GLPA 1WPIA 4OCFA 4CDOA 4WBJA 3MYDA 3H8QA 3O76A 2GT6A 2CAIA 4V1Ag 5HFKA 1R5PA 5J9BA 2F51A 4IHUA 4MABA 3H4KA 1ZYPA 1AQXA 5J40A 2HSYA 1MTCA 2HZFA 2VD1A 3HY2A 3VWVA 4V2MA 2K8VA 4WR5A 2HRFA 2ON7A 1Z9HA 2H71A 2C0GA 4BVXA 1JZOA 2R0PA 2WB9A 1PL2A 1O7UA 4GSNA 1UN2A 4D73A 4WEYA 4F03A 2KOKA 4ICYA 5HFIA 1ON4A 2H6XA 2FWFA 3US3A 3GX0A 4POLA 4AKIA 1XFLA 3DD3A 5AIXA 4OO4A 2GDRA 3ZTLA 1V9WA 1R4WA 4EF0A 3HVXA 2YP6A 2YOIA 4O5QA 2H0IA 3UL3A 5GSSA 3G7YA 3KD0A 4EUYA 1G6WA 2OE1A 2GSTA 1V58A 4PGTA 2OBKA 2LRCA 5J41A 2B5EA 2VO4A 4AI6A 1HYUA 3APOA 3FRCA 1PN9A 4CW9A 2H8LA 4WKWA 1IYIA 5ECMB 1UA5A 4V2LA 4I2TA 4NHZA 2QC7A 3KEBA 4CHSA 2RUEA 1JZRA 5ECHB 2DKIA 1ACVA 1MEKA 2B6MA 2VL3A 19GSA 2N5FA 2MZCA 5A34B 4K7IA 1KEBA 1R26A 5JCUA 1ZYEA 1GH2A 1A2MA 3PH9A 3KZQA 4RI6A 4DEJA 1VRSD 5B8AA 2D2ZA 4HOJA 3ZITA 2IMKA 3LXZA 2O87A 1SK1A 3FY7A 3MAKA 2EFDA 2H1AA 4GCIA 5CP1A 3KH7A 1M0UA 4RUVA 4H86A 2K6VA 5GAPD 1FOHA 1V2AA 1TK8B 2GZZA 2R0CA 5IPHA 2UV8G 1TJDA 3QD9A 3IPZA 5GAND 1Z7RA 4L0WA 1U3IA 5A1NB 2ZNMA 4AKHA 12GSA 2IMDA 1UC7A 3E3EA 1Z6NA 4IP6A 2DLXA 4PX1A 1A8YA 3I9V2 4G2EA 1J08A 2YV9A 4GRFA 3HZ8A 5J9CA 3GTUB 3ZZXA 4JR4A 3C8EA 3GUSA 1YZXA 3GMFA 2TRXA 1RQMA 3A2WA 4G10A 2H70A 2PUKC 3R3EA 3N5OA 2FY6A 2NBSA 2KP1A 2R6KA 2LSTA 2OE3A 2DJ3A 2FA4A 5ELAA 1FVKA 3IBHA 2IJYA 2YWMA 3KTLA 2GZYA 2X64A 3TOUA 1PX6A 1WIKA 3PPUA 1YDKA 1ERUA 1K3LA 3I43A 2PVQA 3GSSA 4PUAA 3CTGA 3IC8A 2C8UA 4BVXB 2VCVA 4HQZA 5ECRB 4NHWA 4IW9A 4JU5A 2V1MA 4K0NA 3WD6A 1MDIA 2R37A 4D73B 3HD5A 3KMNA 3DMLA 2IIYA 2GSQA 1SVOA 5D93A 2LQQA 1XW5A 1GSUA 3TUEA 1X9SB 2YZHA 2L4QA 4G19A 2YCDA 3GSTA 1GSEA 4K0GA 2EFHA 2QKEA 2F3MA 3FZ9A 4EO3A 1MD3A 2E2GA 2QA2A 3TDGA 4GXZA 2EIRA 3D5JA 1TRVA 2HYXA 1F2EA 4PQ1A 4GLTA 2BMXA 2GQLA 1GLQA 4TVEA 3DEXA 2VL2A 1ABAA 1AQWA 1PKWA 1NSWA 1OYJA 3UBLA 4BL7A 1BAYA 1YJ6A 3TRXA 1CQGA 4EL1A 3QMXA 3LSZA 1SKWB 4EC0A 5H5RA 4IQAA 2L6CA 5BRTA 5ECPB 2H74A 2AAWA 2CV4A 2DJ1A 2YN1A 3A5IA 5A4WA 4JE1A 1QMVA 5J4VA 2H6ZA 1FVJA 5HR3A 5B6MA 4KSMA 2X49A 4KCAA 2CVKA 1YF1A 2I81A 3KM6A 4ZL9A 5KOXA 1HD2A 6GSVA 3M3MA 3ME7A 1PL1A 3PR8A 5D9VA 2R4VA 2IPAA 1TTZA 3EPTA 5DDLA 1XVWA 4YAVA 2X8HA 1K3YA 4TR1B 3CXGA 1JHBA 1X9WB 3UEMA 2K18A 3EU4A 4Q5QA 4L5OA 5E59A 4KGIA 5LNKe 3EURA 3KTBA 5F0GA 3W6GA 2OT3A 4ZB6A 5L71A 2DMLA 4OFMA 1XOAA 3IK7A 4KDUA 3TB2A 3FKFA 2X8GA 3HDCA 1BG5A 1TI1A 4KDXA 4OWYA 3TU3B 5JCWA 4YQMA 4NMUA 4ULXA 1TI3A 3HMJG 2V6OA 4V2NA 3LYPA 1HNCA 5G1LA 4DVCA 3IC4A 2JZTA 2PU9C 2B5YA 3GYKA 3EWLA 3F3RA 5FT3A 2H75A 4MP4A 1WRYA 4MJEA 1SYXA 1A0RP 5AN1A 4MCUA 5E4WA 5AISA 2XBQA 3TRPA 5IMFA 4TXVA 4ID0A 2O8VB 2JU5A 4N30A 4IELA 2JACA 5EPFA 1XW9A 1JZDA 3J7Yk 2VD0A 4FYUA 4RI7A 3FMWA 1SJ6A 4LMWA 1O85A 1THXA 5CREA 2EIOA 3TGZA 4TN8A 2H1BA 2ALBA 3E0UA 1M2BA 3UOMA 1EV4A 2F8AA 4ZB8A 5CAXA 1PSQA 3VI5A 4G0IA 4MLYA 3RHCA 1YEPA 3Q19A 5IMAA 1VF2A 3ZMKA 2HSNA 4BL7B 2O7KA 1PRXA 2DBCA 2I9HA 5KEJA 5CRGA 1BQ7A 2AHEA 2CVBA 3QAGA 4Q5RA 4EVMA 2J9HA 3CRUA 4K2DA 1W4VA 1GRXA 1B48A 1NW2A 3A3TA 5BMUA 1WP0A 3ZIVA 2B7JA 3ED3A 5IO0A 3DVXA 4HEA2 2YJ7A 4O5RA 2ZUPA 3W8JA 4OMVA 3QCPA 2A4HA 2RM6A 5IQYA 5CRWA 2YJHA 4HDEA 4BWQA 17GSA 2ES7A 3TJFA 4DSSA 2WCIA 5A5HA 3RPNA 1XWCA 2CX4A 3GA4A 3GH9A 2NVLA 2DSAA 1GULA 3L4NA 1GUHA 3IK9A 3QR6A 4J2FA 4O7HA 5DAKA 2HSHA 3ERGA 2VCZA 1U3AA 1MD4A 4XRAA 3TKSE 3TJJA 4K1FA 1Z6MA 4OO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWH A;  2I4A A;  4N10 A;  1E2Y A;  2V32 A;  4MF7 A;  2CAQ A;  3IDV A;  3ISO A;  3QDN A;  5HR0 A;  4POM A;  1A2L A;  4L8E A;  2HSM A;  4IS0 A;  2Z9S A;  4NAX A;  1A24 A;  1K0N A;  2DIZ A;  2FCH A;  3IHQ A;  1X5D A;  1A2J A;  2O85 A;  2AYT A;  1SD9 A;  3G9B A;  2C3T A;  4ZIL A;  1TDI A;  4WBR D;  2LKU A;  5IM9 A;  5B6N A;  3SWL A;  1SD8 A;  2FD3 A;  1FB0 A;  2VCW A;  5D73 A;  1XVQ A;  2V2G A;  2H0G A;  4YAP A;  2L4C A;  2IME A;  4POK A;  1F3B A;  2OA7 A;  2PGT A;  1RK4 A;  1Q98 A;  2DJ0 A;  2HLS A;  1DSB A;  3NIV A;  1LBK A;  3CTF A;  2H01 A;  5KN3 A;  4AJ7 A;  1M99 A;  4KDY A;  1X9M B;  3UJ1 A;  2PN8 A;  4TKY A;  4IJ3 A;  3QPM A;  4WF5 A;  6GSX A;  4EDZ A;  5CRH A;  4N0Z A;  4ILF A;  4J57 E;  2IMF A;  3NZN A;  2GSS A;  5IOX A;  2HSN B;  3CBU A;  2YWN A;  5HQP A;  3IXR A;  3GKX A;  1PA3 A;  1MDK A;  2OJL A;  1TXX A;  1URM A;  1TK5 B;  5CYY A;  4DSR A;  2CVD A;  2VM1 A;  4GF0 A;  3F4S A;  3RHB A;  4G0K A;  3UAR A;  2DJK A;  1SKS B;  1Y25 A;  3ZRD A;  1EWX A;  3C73 A;  1VF3 A;  2PBJ A;  1Y6E A;  4NWY A;  4F82 A;  5F07 A;  4JBB A;  4ECJ A;  1WOU A;  2L5L A;  1SL2 B;  3C1R A;  4TXO B;  3HJM A;  3KCM A;  4DSS B;  1XW6 A;  3QAW A;  4LL1 B;  1EEM A;  2BTO T;  2MMO A;  4NV5 A;  3LG6 A;  5EL8 A;  3EU3 A;  4XRD A;  2JSZ A;  4MMM A;  5JWO B;  3D4T A;  5DVB A;  2JL4 A;  2HZE A;  3TRQ A;  5DAK B;  1C72 A;  5D9T A;  1G7O A;  2K8S A;  4TR1 A;  1O73 A;  4ZL7 A;  4YH2 A;  1FB6 A;  3A5W A;  3C7M A;  2IN3 A;  1GSS A;  3D21 A;  3HCZ A;  3LJR A;  5A4V A;  3IA1 A;  3O6T A;  1KBN A;  4MJB A;  1DE2 A;  3VPT A;  1EP7 A;  2B3S A;  5G2Z A;  2PER A;  2HSM B;  2FWE A;  1GP1 A;  4MF6 A;  1XIY A;  3F6D A;  3FEU A;  5D96 A;  3HVS A;  1ML6 A;  4K8M A;  4EE0 A;  2AB6 A;  3IE3 A;  3RAZ A;  2XPD A;  2PWJ A;  1QGV A;  4N0V A;  4ZB9 A;  4KE3 A;  1XZO A;  2FHE A;  1TKD B;  3ZML A;  3IOS A;  2K9F A;  5IO2 A;  1H4O A;  1NM3 A;  4I97 A;  2QSI A;  2O89 A;  4O32 A;  4OFN A;  1TU7 A;  1JLV A;  1V57 A;  3UVH A;  3QFB C;  2XHF A;  2VM2 A;  3CMI A;  1WMJ A;  4I8B A;  1F3A A;  2GSR A;  6GSW A;  2GZP A;  1XCC A;  2RM5 A;  3F0I A;  4AGS A;  3EVI A;  2LTK A;  2C4J A;  4K7O A;  4AF2 A;  1AC1 A;  1K0D A;  1V98 A;  3RDW A;  4HZ4 A;  3ZRE A;  2X99 A;  2B1L A;  3G7J A;  1PMT A;  2H73 A;  2H66 A;  2WGR A;  4PNF A;  1E6B A;  1Z5Y E;  3EC3 A;  4Z7X A;  3HKR A;  2XBI A;  3TKQ A;  3UVT A;  3IR4 A;  1S3C A;  4E8E A;  3KP9 A;  3LOR A;  1K0O A;  2ZCT A;  3MWH A;  4MDC A;  2EIQ A;  4TR3 A;  2WFC A;  1B9X C;  2KLX A;  5G5E A;  2WDU A;  2WS2 A;  3GX8 A;  2GLR A;  2FUG 2;  4HUA A;  1M9A A;  2I3Y A;  5A5K A;  4YQU A;  4BA7 A;  3FHK A;  2LJK A;  1O81 A;  4EDY A;  1M2A A;  1OC8 A;  3VPQ A;  1SU9 A;  1YQ1 A;  2E0Q A;  3A2X A;  4MPG A;  2DC5 A;  4L5L A;  3LYK A;  5ECK B;  3FR9 A;  2HZE B;  2DJ2 A;  1ZMA A;  3Q6O A;  1OKT A;  4HJ2 A;  5JWQ B;  4IBP A;  3CSH A;  2VLU A;  1AAZ A;  6GST A;  5LD0 A;  3WT2 A;  2ON5 A;  1OVN A;  4GTU A;  2LEG A;  5IPG A;  2E7P A;  3QFA C;  2CX3 A;  1FAA A;  5JWR B;  4IGJ A;  1BED A;  2LNT A;  2HI7 A;  4YQV A;  1GTI A;  3DGQ A;  4IJI A;  3TJK A;  3VI7 A;  4I6X A;  4HU7 A;  2CZ3 A;  4MK3 A;  4PNG A;  3KJY A;  2I1U A;  2F8F A;  3I69 A;  5KN1 A;  2VCX A;  1XWG A;  1TRW A;  1PKZ A;  1TOF A;  3BCK A;  5DQY A;  1R7H A;  3GN3 A;  1EOG A;  3V1W A;  5IMZ A;  3M1G A;  3FYG A;  4I5Q A;  4K7N A;  3VLN A;  4JRR A;  5C04 A;  1GSD A;  1FO5 A;  1K0C A;  5HR2 A;  3C1S A;  3PGT A;  2IMI A;  4MPF A;  2H76 A;  3H79 A;  1GUM A;  3F63 A;  5EY6 A;  2G2Q A;  1G7E A;  1THO A;  1XWA A;  1U87 A;  4HJM A;  1T4Z A;  4MJA A;  1ZCP A;  4WF4 A;  1AXD A;  2R5G A;  3BCI A;  4F0C A;  1M7T A;  4L0U A;  3P90 A;  1PD2 1;  4PUF C;  3ME8 A;  4ZBA A;  4MZW A;  4P3Y B;  3EMP A;  1GNE A;  2B1K A;  5ENU A;  3DVW A;  1GUK A;  2CQ9 A;  2DIY A;  3P2A A;  4G0L A;  2HQT A;  3TKS A;  3NOF A;  1LJR A;  5ABR A;  2PPT A;  2L6D A;  2CA8 A;  2JZR A;  4MZC A;  2VOC A;  2LJR A;  3GH6 A;  1TK0 B;  4BWS A;  2DMM A;  4WXT A;  1OAZ A;  1GWC A;  2H0H A;  5LCZ A;  2YPM A;  4PTS A;  1RW1 A;  4FYB A;  5IIZ A;  2R3X A;  4KF9 A;  3TOT A;  5J5N A;  1T8E B;  1K0B A;  3RBT A;  4ZL8 A;  5C00 A;  1Z3E A;  4FIW A;  5H5Q A;  2OAC A;  5INY A;  2A4V A;  3EYT A;  1OKD A;  3LEF A;  4TXO A;  3TKR A;  2GTU A;  1YF0 A;  3PIN A;  2VL9 A;  2H30 A;  1SYR A;  2C3Q A;  1U88 A;  2LV3 A;  3N9J A;  2JAD A;  4IN0 A;  2H19 A;  1CQH A;  1ERW A;  3HZ4 A;  1GTU A;  2YWO A;  5ELG A;  2WZ9 A;  4ZBB A;  3U5R E;  2YWI A;  3IRA A;  1OC3 A;  3GHA A;  3FR6 A;  5F8B A;  3HVV A;  3TKP A;  2GGT A;  3ZYW A;  5ECN B;  3S9F A;  5AIV A;  1GNW A;  1ST9 A;  3UAP A;  5B7C A;  4OD7 A;  2L59 A;  3HXS A;  5CO3 A;  2A2S A;  1N2A A;  2VLT A;  4KUN A;  2OKA A;  1T1V A;  1U6T A;  7GSS A;  2J23 A;  4KCE A;  3BOA A;  2HNL A;  4F0B A;  2PMT A;  4K6X A;  5D9W A;  5DJM A;  1W89 A;  1TRS A;  5KN2 A;  4FO5 A;  1O8X A;  3ZFB A;  3K8N A;  1EP8 A;  2CT6 A;  2WRT A;  4J56 E;  1J0F A;  2KUC A;  4KSO A;  4LMV A;  4QL7 A;  1YKC A;  2BJX A;  3UMA A;  1F37 A;  1KNG A;  1XWK A;  1BYE A;  4BVY A;  1JFU A;  4IQ1 A;  3ERF A;  6GSS A;  3GRX A;  2NPB A;  1V40 A;  4EKZ A;  2MBS A;  4FYC A;  3FZ4 A;  1GSF A;  2H1D A;  1M9B A;  4OFT A;  1K0A A;  3HJO A;  4TRX A;  2VL2 C;  2IFQ A;  5AGY A;  4POB A;  3CYN A;  2H6Y A;  4KB3 A;  4JED A;  1SL1 B;  1XXU A;  3ZL5 A;  2C0D A;  1O8W A;  4TOP A;  1XBS A;  3ERW A;  4GSS A;  4XHM A;  1EGR A;  3KMO A;  1G6Y A;  2GT5 A;  3F8U A;  5J3R A;  4ACS A;  4XS1 A;  1X5E A;  4N11 A;  1GSY A;  2XC2 A;  11GS A;  3CSI A;  13GS A;  16GS A;  3P7X A;  5IMV A;  2M72 A;  2HRK A;  4IP1 A;  3MSZ A;  4KA0 A;  1KTE A;  4ZXG A;  3P8W A;  5ID2 A;  3R2Q A;  1T00 A;  3APQ A;  2WJU A;  3QAV A;  2JZS A;  2VLV A;  4TR4 A;  1DE1 A;  3GUR A;  5D9X A;  4JZQ A;  1HNB A;  1SL0 B;  4PQI A;  4KND A;  4MA9 A;  2EC4 A;  5EVO A;  2VCQ A;  1SK2 A;  4NPB A;  4XTS A;  3L78 A;  2C3N A;  3FR3 A;  2C0E A;  1QFN A;  1BX9 A;  1USB A;  5DCG A;  3ZIJ A;  2HXK A;  3HHV A;  4LA1 A;  1OC9 A;  2OBI A;  1OE8 A;  1A0F A;  1ZYQ B;  1FHE A;  4GWR A;  4TR0 A;  3C71 A;  3OR5 A;  5H5S A;  5DAL A;  3CSJ A;  1NHY A;  4E8H A;  4F9Z A;  3G7I A;  1FOV A;  2LUS A;  2DJJ A;  1HNA A;  3F3Q A;  2MYG A;  3L9V A;  1I5G A;  3KGK A;  3VWW A;  2NDO A;  5IMD A;  5KN0 A;  2A2R A;  3HA9 A;  1QUW A;  5DBQ A;  3F4R A;  1WJK A;  1ZOF A;  8GSS A;  2L5O A;  3GKK A;  1GTA A;  1N8J A;  1VF4 A;  4EXJ A;  4XS4 A;  1EGO A;  2FLS A;  2AJQ B;  4ML1 A;  3H1N A;  1EOH A;  3LWA A;  2NTO A;  1WE0 A;  22GS A;  2E2M A;  4FH8 A;  18GS A;  1EV9 A;  3EE2 A;  1AUC A;  2N5A A;  4HS1 A;  4XCS A;  2XPE A;  1SJZ A;  3DYR A;  3J7Y b;  4DSQ A;  3A2V A;  4NXI A;  1XOB A;  1VGL A;  3DIE A;  1PQN A;  1NHO A;  1S3A A;  3F4T A;  3ZFL A;  1DUG A;  3EMX A;  3GIX A;  20GS A;  4BVY B;  3ZVJ D;  1OE7 A;  3FK8 A;  3L9U A;  1R5A A;  2X8C A;  4V1A p;  4HZ2 A;  2B5X A;  4Q5F A;  5F06 A;  5JCG A;  3VWU A;  3O3T A;  1B4Q A;  1ZZY A;  2KP2 A;  3TKS C;  2PVO C;  2H72 A;  1T4Y A;  5GZZ B;  3DRN A;  2IFQ B;  2TRC P;  4XS6 A;  4MH3 A;  5F05 A;  3AY8 A;  2G0F A;  3F9U A;  2RII A;  4ZIJ A;  1BJX A;  5FWG A;  1AW9 A;  3ZLP A;  5CRD A;  4AJ8 A;  1JLW A;  1GTB A;  4WET A;  3HYP A;  5DQS A;  3U6V A;  4GQF A;  3SBC A;  1EZK A;  4X0X A;  1GL8 A;  3GNJ A;  4ECC A;  1S3D A;  1SEN A;  2GQM A;  2HRK B;  3FZA A;  1X5C A;  5DCH A;  3DWV A;  5ID2 B;  6GSY A;  1O6J A;  1YKA A;  1YY7 A;  3F6F A;  3D6I A;  1UVZ A;  1DBY A;  1T7P B;  4X43 A;  2VUP A;  4KW6 A;  2B7K A;  1T3B A;  3DXB A;  4ML6 A;  1Z7P A;  2L57 A;  1M2D A;  1TU8 A;  5CNW A;  4RQR A;  3L9S A;  10GS A;  3RPP A;  1OC9 B;  2LQO A;  1FG4 A;  1PGT A;  1AQV A;  5DAL B;  4HU9 A;  5G31 A;  1WWJ A;  1XWB A;  2P0G A;  1B8X A;  2HRA A;  2GQK A;  4XIH A;  4PQH A;  3D4M A;  4PUR A;  4ECB A;  2FWG A;  2N5B A;  1ZGN A;  1QXH A;  2LS5 A;  1A23 A;  1Q4J A;  5FHI A;  1F9M A;  2P5Q A;  5G30 A;  5A4U A;  3GL5 A;  1JZW A;  5HR1 A;  3BJ5 A;  2C0F A;  1H75 A;  1B4P A;  3KP8 A;  3VWX A;  5ECO B;  3GL3 A;  4WR4 A;  1TRU A;  2AV4 A;  4JR6 A;  1K3O A;  2LRN A;  4F2I A;  4MF5 A;  4XS4 B;  1G0T A;  2HT9 A;  1SKR B;  2WUL A;  4I2U A;  2VIM A;  1XPV A;  3L0H A;  2VCT A;  4O92 A;  2P5R A;  4GQC A;  4BPY A;  1GSQ A;  2MBT A;  2RLI A;  2HE3 A;  5ECS A;  3GKN A;  3VFI A;  3VUR A;  5G1K A;  2YZU A;  3MDK A;  2KHP A;  3HJP A;  2HFD A;  2MMN A;  4ISD A;  2LRT A;  3MNG A;  3KIJ A;  3BD2 A;  2H1G A;  4KX4 A;  5HFG A;  5IOW A;  4AJ6 A;  4KH7 A;  4RQX A;  3D22 A;  1QK8 A;  5ECI B;  1ILO A;  3TJB A;  2REM A;  5ECL B;  2IL3 A;  2VAF A;  4MH2 A;  4QQ7 A;  2MMA A;  3WGX A;  4IKH A;  3WGE A;  3EIN A;  2FNO A;  1I9D A;  2F9S A;  3GFK A;  3KXO A;  5IMC A;  2OE0 A;  1MDJ A;  3LFL A;  1B9Y C;  1ERT A;  2C80 A;  4K9Z A;  5ECQ B;  1VF1 A;  2TIR A;  2HRN A;  3BBY A;  2M46 A;  1K0M A;  1LU4 A;  4X1U A;  2AUV A;  3TJG A;  2QGV A;  2YAN A;  1IYH A;  1QQ2 A;  3H93 A;  2RUF A;  3WYW A;  4LLR A;  4QL9 A;  2FGX A;  1SJI A;  3M9K A;  2P31 A;  2V6K A;  4ZBD A;  3IAS 2;  2GVP A;  1TP9 A;  4TW5 A;  3E9J B;  3WGD A;  2IWT A;  4MZB A;  5G5F A;  5B8B A;  3QOU A;  1AIU A;  1SK0 A;  4MJC A;  2YNX A;  3IV4 A;  4HQS A;  3M8N A;  6GSU A;  3DKS A;  1X0R A;  4NV2 A;  3CRT A;  2V41 A;  2LJA A;  3KH9 A;  2LNS A;  3GKM A;  3M9J A;  1ZL9 A;  3JCM L;  1TW9 A;  3LQ7 A;  3IAM 2;  2OAD A;  5COH A;  2C1Y A;  3Q74 A;  3ZVJ A;  2CZ2 A;  2UZ8 A;  3Q18 A;  14GS A;  5DJL A;  1YEX A;  3LGC A;  4Q5N A;  1A8L A;  4G9H A;  3VK9 A;  1ERV A;  1F6M C;  3M0F A;  3FZ5 A;  2GS3 A;  1FW1 A;  5J4U A;  4IVF A;  3WT1 A;  2M80 A;  1J9B A;  4ECI A;  4KAE A;  4GST A;  3GV1 A;  5D8I A;  1PX7 A;  1EEJ A;  2JSY A;  4USS A;  2YV7 A;  2MMZ A;  3W8S A;  4PXO A;  3I6A A;  5GST A;  3FW2 A;  3UIW A;  4FQU A;  3D0Z A;  3UBK A;  2R2J A;  4OCE A;  3TCO A;  3APS A;  3LXT A;  3GTU A;  4LL4 B;  2FA8 A;  4HI7 A;  1HQO A;  9GSS A;  1GLP A;  1WPI A;  4OCF A;  4CDO A;  4WBJ A;  3H8Q A;  3O76 A;  2GT6 A;  2CAI A;  4V1A g;  5HFK A;  1R5P A;  5J9B A;  2F51 A;  4IHU A;  4MAB A;  3H4K A;  1AQX A;  2HSY A;  1MTC A;  2HZF A;  2VD1 A;  3HY2 A;  3VWV A;  4V2M A;  2K8V A;  4WR5 A;  2HRF A;  2ON7 A;  1Z9H A;  2H71 A;  2C0G A;  4BVX A;  1JZO A;  2WB9 A;  1PL2 A;  1O7U A;  4GSN A;  1UN2 A;  4D73 A;  4WEY A;  4F03 A;  2KOK A;  5HFI A;  1ON4 A;  2H6X A;  2FWF A;  3US3 A;  3GX0 A;  4POL A;  1XFL A;  3DD3 A;  5AIX A;  4OO4 A;  2GDR A;  3ZTL A;  1V9W A;  1R4W A;  4EF0 A;  3HVX A;  2YP6 A;  2YOI A;  2H0I A;  3UL3 A;  5GSS A;  3G7Y A;  3KD0 A;  4EUY A;  1G6W A;  2OE1 A;  2GST A;  1V58 A;  4PGT A;  2OBK A;  2LRC A;  5J41 A;  2B5E A;  2VO4 A;  1HYU A;  3APO A;  3FRC A;  1PN9 A;  4CW9 A;  2H8L A;  4WKW A;  1IYI A;  5ECM B;  1UA5 A;  4V2L A;  4I2T A;  4NHZ A;  2QC7 A;  3KEB A;  4CHS A;  2RUE A;  1JZR A;  5ECH B;  1ACV A;  1MEK A;  2B6M A;  2VL3 A;  19GS A;  2N5F A;  2MZC A;  4K7I A;  1KEB A;  1R26 A;  5JCU A;  1ZYE A;  1GH2 A;  1A2M A;  3PH9 A;  3KZQ A;  4RI6 A;  4DEJ A;  1VRS D;  5B8A A;  2D2Z A;  4HOJ A;  3ZIT A;  2IMK A;  3LXZ A;  2O87 A;  1SK1 A;  3FY7 A;  3MAK A;  2H1A A;  4GCI A;  5CP1 A;  3KH7 A;  1M0U A;  4RUV A;  4H86 A;  2K6V A;  5GAP D;  1TK8 B;  1V2A A;  2GZZ A;  5IPH A;  1TJD A;  3QD9 A;  3IPZ A;  5GAN D;  1Z7R A;  4L0W A;  1U3I A;  2ZNM A;  12GS A;  2IMD A;  1UC7 A;  4IP6 A;  1Z6N A;  3E3E A;  2DLX A;  4PX1 A;  1A8Y A;  3I9V 2;  4G2E A;  1J08 A;  2YV9 A;  4GRF A;  3HZ8 A;  5J9C A;  3GTU B;  3ZZX A;  4JR4 A;  3C8E A;  3GUS A;  1YZX A;  3GMF A;  2TRX A;  1RQM A;  3A2W A;  4G10 A;  2H70 A;  2PUK C;  3R3E A;  3N5O A;  2FY6 A;  2NBS A;  2KP1 A;  2R6K A;  2LST A;  2OE3 A;  2DJ3 A;  2FA4 A;  5ELA A;  1FVK A;  3IBH A;  2IJY A;  2YWM A;  3KTL A;  2GZY A;  2X64 A;  3TOU A;  1PX6 A;  1WIK A;  3PPU A;  1YDK A;  1ERU A;  1K3L A;  3I43 A;  2PVQ A;  3GSS A;  4PUA A;  3CTG A;  3IC8 A;  2C8U A;  4BVX B;  2VCV A;  4HQZ A;  5ECR B;  4NHW A;  4IW9 A;  4JU5 A;  2V1M A;  4K0N A;  3WD6 A;  1MDI A;  2R37 A;  4D73 B;  3HD5 A;  3KMN A;  3DML A;  2IIY A;  2GSQ A;  5D93 A;  2LQQ A;  1XW5 A;  1GSU A;  3TUE A;  1X9S B;  2YZH A;  2L4Q A;  4G19 A;  2YCD A;  3GST A;  1GSE A;  4K0G A;  2QKE A;  2F3M A;  3FZ9 A;  4EO3 A;  1MD3 A;  2E2G A;  3TDG A;  4GXZ A;  2EIR A;  3D5J A;  1TRV A;  2HYX A;  1F2E A;  4PQ1 A;  4GLT A;  2BMX A;  2GQL A;  1GLQ A;  4TVE A;  3DEX A;  2VL2 A;  1ABA A;  1AQW A;  1PKW A;  1NSW A;  1OYJ A;  3UBL A;  4BL7 A;  1BAY A;  1YJ6 A;  3TRX A;  1CQG A;  4EL1 A;  3QMX A;  3LSZ A;  1SKW B;  4EC0 A;  5H5R A;  4IQA A;  2L6C A;  5ECP B;  2H74 A;  2AAW A;  2CV4 A;  2DJ1 A;  2YN1 A;  5A4W A;  4JE1 A;  1QMV A;  2H6Z A;  1FVJ A;  5HR3 A;  5B6M A;  4KSM A;  4KCA A;  2CVK A;  1YF1 A;  2I81 A;  3KM6 A;  4ZL9 A;  1HD2 A;  6GSV A;  3M3M A;  3ME7 A;  1PL1 A;  3PR8 A;  5D9V A;  2R4V A;  2IPA A;  1TTZ A;  5DDL A;  1XVW A;  4YAV A;  2X8H A;  1K3Y A;  4TR1 B;  3CXG A;  1JHB A;  1X9W B;  3UEM A;  2K18 A;  3EU4 A;  4Q5Q A;  4L5O A;  5E59 A;  4KGI A;  5LNK e;  3EUR A;  3KTB A;  5F0G A;  3W6G A;  4ZB6 A;  5L71 A;  2DML A;  4OFM A;  1XOA A;  3IK7 A;  4KDU A;  3TB2 A;  3FKF A;  2X8G A;  3HDC A;  1BG5 A;  1TI1 A;  4KDX A;  4OWY A;  5JCW A;  4YQM A;  4NMU A;  4ULX A;  1TI3 A;  2V6O A;  4V2N A;  3LYP A;  1HNC A;  5G1L A;  4DVC A;  3IC4 A;  2JZT A;  2PU9 C;  2B5Y A;  3GYK A;  3EWL A;  3F3R A;  5FT3 A;  2H75 A;  4MP4 A;  1WRY A;  4MJE A;  1SYX A;  1A0R P;  5AN1 A;  4MCU A;  5E4W A;  5AIS A;  2XBQ A;  3TRP A;  5IMF A;  4TXV A;  4ID0 A;  2O8V B;  2JU5 A;  4N30 A;  4IEL A;  2JAC A;  5EPF A;  1XW9 A;  1JZD A;  3J7Y k;  2VD0 A;  4FYU A;  4RI7 A;  1SJ6 A;  4LMW A;  1O85 A;  1THX A;  5CRE A;  2EIO A;  3TGZ A;  4TN8 A;  2H1B A;  2ALB A;  3E0U A;  1M2B A;  3UOM A;  1EV4 A;  2F8A A;  4ZB8 A;  5CAX A;  1PSQ A;  3VI5 A;  4G0I A;  4MLY A;  3RHC A;  1YEP A;  3Q19 A;  5IMA A;  1VF2 A;  3ZMK A;  4BL7 B;  2O7K A;  1PRX A;  2DBC A;  2I9H A;  5KEJ A;  5CRG A;  1BQ7 A;  2AHE A;  2CVB A;  3QAG A;  4Q5R A;  4EVM A;  2J9H A;  3CRU A;  4K2D A;  1W4V A;  1GRX A;  1B48 A;  1NW2 A;  3A3T A;  5BMU A;  1WP0 A;  3ZIV A;  2B7J A;  3ED3 A;  5IO0 A;  3DVX A;  4HEA 2;  2YJ7 A;  4O5R A;  2ZUP A;  3W8J A;  4OMV A;  3QCP A;  2RM6 A;  5IQY A;  5CRW A;  2YJH A;  4HDE A;  4BWQ A;  17GS A;  2ES7 A;  3TJF A;  4DSS A;  2WCI A;  3RPN A;  1XWC A;  2CX4 A;  3GA4 A;  3GH9 A;  2NVL A;  2DSA A;  1GUL A;  3L4N A;  1GUH A;  3IK9 A;  3QR6 A;  4J2F A;  4O7H A;  5DAK A;  2HSH A;  3ERG A;  2VCZ A;  1U3A A;  1MD4 A;  4XRA A;  3TKS E;  3TJJ A;  4K1F A;  1Z6M A;  4OO5 A; 
#chains in the Genus database with same CATH topology
 2FWH A;  2I4A A;  4N10 A;  1E2Y A;  2V32 A;  4MF7 A;  2CAQ A;  3IDV A;  3ISO A;  3QDN A;  5HR0 A;  4POM A;  1A2L A;  4L8E A;  2HSM A;  4IS0 A;  1XG8 A;  2Z9S A;  4NAX A;  1A24 A;  1K0N A;  2DIZ A;  2FCH A;  3IHQ A;  1X5D A;  1A2J A;  2O85 A;  2AYT A;  1SD9 A;  3G9B A;  1SVL A;  2C3T A;  4ZIL A;  1TDI A;  4WBR D;  2LKU A;  5IM9 A;  5B6N A;  3SWL A;  1SD8 A;  2FD3 A;  1FB0 A;  2VCW A;  5D73 A;  1XVQ A;  2V2G A;  2H0G A;  4YAP A;  2L4C A;  2IME A;  4POK A;  4K5S A;  1F3B A;  2OA7 A;  2PGT A;  1RK4 A;  1Q98 A;  2DJ0 A;  2HLS A;  4A5P A;  2VKZ G;  1DSB A;  3NIV A;  1LBK A;  3CTF A;  2H01 A;  5KN3 A;  4AJ7 A;  1M99 A;  4KDY A;  1X9M B;  3UJ1 A;  2PN8 A;  4TKY A;  4IJ3 A;  3QPM A;  4N3Z A;  4WF5 A;  6GSX A;  4EDZ A;  5CRH A;  4N0Z A;  4ILF A;  4J57 E;  4CY8 A;  2IMF A;  3NZN A;  2GSS A;  5IOX A;  2HSN B;  3CBU A;  2YWN A;  5HQP A;  3IXR A;  3GKX A;  1PA3 A;  1MDK A;  2OJL A;  1TXX A;  1URM A;  1TK5 B;  5CYY A;  4DSR A;  2CVD A;  2VM1 A;  4GF0 A;  3F4S A;  3RHB A;  4G0K A;  3UAR A;  2DJK A;  1SKS B;  5BMU B;  1Y25 A;  3ZRD A;  1EWX A;  3C73 A;  1VF3 A;  2PBJ A;  1Y6E A;  4NWY A;  5J47 A;  4F82 A;  5F07 A;  4JBB A;  4ECJ A;  4AKG A;  1WOU A;  2L5L A;  1SL2 B;  3C1R A;  4TXO B;  3HJM A;  3KCM A;  4DSS B;  1XW6 A;  3QAW A;  4LL1 B;  5A5H B;  1EEM A;  2BTO T;  2MMO A;  4NV5 A;  4YKF A;  3LG6 A;  5EL8 A;  3EU3 A;  4XRD A;  2JSZ A;  4MMM A;  5JWO B;  3D4T A;  5DVB A;  2JL4 A;  2HZE A;  3TRQ A;  5DAK B;  1C72 A;  5D9T A;  1G7O A;  2K8S A;  4TR1 A;  1O73 A;  4ZL7 A;  1YVL A;  4YH2 A;  1FB6 A;  3A5W A;  3C7M A;  2IN3 A;  1GSS A;  3D21 A;  3HCZ A;  2O36 A;  1M3I A;  3LJR A;  5A4V A;  3IA1 A;  3O6T A;  1KBN A;  4MJB A;  1DE2 A;  3VPT A;  4G01 A;  4QMK A;  1EP7 A;  2B3S A;  5G2Z A;  2PER A;  2HSM B;  2FWE A;  1GP1 A;  4MF6 A;  1XIY A;  3F6D A;  3FEU A;  5D96 A;  3HVS A;  1ML6 A;  4K8M A;  4EE0 A;  2AB6 A;  3IE3 A;  3RAZ A;  2XPD A;  2PWJ A;  1QGV A;  4N0V A;  4ZB9 A;  4KE3 A;  1XZO A;  2FHE A;  3IHG A;  1TKD B;  3ZML A;  3IOS A;  2K9F A;  5IO2 A;  1H4O A;  1NM3 A;  4I97 A;  2QSI A;  2O3E A;  2O89 A;  4O32 A;  4OFN A;  4YKG A;  1TU7 A;  1JLV A;  1V57 A;  3UVH A;  3QFB C;  2XHF A;  4EIQ A;  2VM2 A;  3CMI A;  1WMJ A;  4I8B A;  1F3A A;  2GSR A;  6GSW A;  2O5V A;  2GZP A;  1XCC A;  2RM5 A;  3F0I A;  4AGS A;  3EVI A;  2LTK A;  2C4J A;  4K7O A;  4AF2 A;  1AC1 A;  1K0D A;  1V98 A;  3RDW A;  4HZ4 A;  3ZRE A;  2X99 A;  2B1L A;  3G7J A;  1PMT A;  1PN0 A;  2H73 A;  2H66 A;  2WGR A;  4PNF A;  1E6B A;  1Z5Y E;  3EC3 A;  4Z7X A;  3HKR A;  2XBI A;  3TKQ A;  3UVT A;  3IR4 A;  1S3C A;  4E8E A;  1Y1U A;  3KP9 A;  3LOR A;  1K0O A;  2ZCT A;  3MWH A;  4MDC A;  2EIQ A;  4TR3 A;  2WFC A;  1B9X C;  2KLX A;  5G5E A;  2WDU A;  2WS2 A;  3GX8 A;  2GLR A;  2FUG 2;  4HUA A;  2X4A A;  1M9A A;  2I3Y A;  5A5K A;  4YQU A;  4BA7 A;  3FHK A;  2LJK A;  1O81 A;  4EDY A;  1M2A A;  1OC8 A;  4E68 A;  3VPQ A;  1SU9 A;  1YQ1 A;  2E0Q A;  3A2X A;  4MPG A;  2DC5 A;  4L5L A;  3LYK A;  5ECK B;  3FR9 A;  2HZE B;  2DJ2 A;  1ZMA A;  3Q6O A;  1OKT A;  4HJ2 A;  5JWQ B;  4IBP A;  3CSH A;  2VLU A;  1AAZ A;  6GST A;  5LD0 A;  3WT2 A;  2ON5 A;  1OVN A;  4GTU A;  2LEG A;  5IPG A;  2E7P A;  3QFA C;  2CX3 A;  1FAA A;  5JWR B;  4IGJ A;  1BED A;  2LNT A;  2HI7 A;  4YQV A;  1GTI A;  3DGQ A;  4IJI A;  3TJK A;  3VI7 A;  4I6X A;  4HU7 A;  2CZ3 A;  4MK3 A;  4PNG A;  3KJY A;  2I1U A;  2F8F A;  3I69 A;  5KN1 A;  2VCX A;  1XWG A;  1TRW A;  1PKZ A;  1TOF A;  3BCK A;  5DQY A;  1R7H A;  3GN3 A;  1EOG A;  3V1W A;  5IMZ A;  4Z2T A;  3M1G A;  3FYG A;  4I5Q A;  4K7N A;  3VLN A;  1ZYN A;  4JRR A;  5C04 A;  1GSD A;  1FO5 A;  1K0C A;  5HR2 A;  3C1S A;  3PGT A;  2IMI A;  4MPF A;  2H76 A;  3H79 A;  1GUM A;  3F63 A;  5EY6 A;  2G2Q A;  1G7E A;  1THO A;  1XWA A;  1U87 A;  4HJM A;  1T4Z A;  4MJA A;  1ZCP A;  4WF4 A;  1AXD A;  2R5G A;  3BCI A;  4F0C A;  1M7T A;  4L0U A;  3P90 A;  1PD2 1;  4PUF C;  3ME8 A;  4ZBA A;  4MZW A;  4P3Y B;  3EMP A;  1GNE A;  2B1K A;  5ENU A;  3DVW A;  1GUK A;  2CQ9 A;  2DIY A;  3P2A A;  4G0L A;  2HQT A;  3TKS A;  3NOF A;  1LJR A;  2EFC A;  5ABR A;  2PPT A;  2L6D A;  2CA8 A;  2JZR A;  4W66 A;  4MZC A;  2VOC A;  2LJR A;  3GH6 A;  1TK0 B;  4BWS A;  2DMM A;  4WXT A;  1OAZ A;  1GWC A;  2H0H A;  5LCZ A;  2YPM A;  4PTS A;  1RW1 A;  4FYB A;  5IIZ A;  2R3X A;  4KF9 A;  1YEW C;  3TOT A;  5J5N A;  1T8E B;  1K0B A;  3RBT A;  4ZL8 A;  5C00 A;  1Z3E A;  4FIW A;  5H5Q A;  2OAC A;  5INY A;  2A4V A;  3EYT A;  1OKD A;  3LEF A;  4TXO A;  3TKR A;  2GTU A;  1YF0 A;  3PIN A;  2VL9 A;  1PFO A;  2H30 A;  1SYR A;  2C3Q A;  1U88 A;  2LV3 A;  4PHZ C;  3N9J A;  2JAD A;  4IN0 A;  2H19 A;  1CQH A;  1ERW A;  3HZ4 A;  1GTU A;  2YWO A;  5ELG A;  2WZ9 A;  4ZBB A;  3U5R E;  2YWI A;  3IRA A;  1OC3 A;  3GHA A;  3FR6 A;  5F8B A;  3HVV A;  3TKP A;  2GGT A;  3ZYW A;  5ECN B;  3S9F A;  5AIV A;  1GNW A;  1ST9 A;  3UAP A;  5B7C A;  4OD7 A;  2L59 A;  1S3R A;  3HXS A;  5CO3 A;  2A2S A;  1N2A A;  2VLT A;  4KUN A;  2OKA A;  1T1V A;  1U6T A;  7GSS A;  2J23 A;  4KCE A;  3BOA A;  2HNL A;  4F0B A;  2PMT A;  4K6X A;  5D9W A;  5DJM A;  1W89 A;  1TRS A;  5KN2 A;  4FO5 A;  1O8X A;  3ZFB A;  3K8N A;  1EP8 A;  2CT6 A;  3MIX A;  2WRT A;  4J56 E;  3CQF A;  1J0F A;  2KUC A;  4KSO A;  4LMV A;  3CWG A;  1YKC A;  4QL7 A;  2BJX A;  3UMA A;  1F37 A;  1KNG A;  1XWK A;  1BYE A;  2WW3 A;  4BVY A;  1JFU A;  4IQ1 A;  3ERF A;  6GSS A;  3GRX A;  2NPB A;  1V40 A;  4EKZ A;  2MBS A;  4FYC A;  3FZ4 A;  1GSF A;  4O5U A;  2H1D A;  1M9B A;  4OFT A;  1K0A A;  3HJO A;  4TRX A;  2VL2 C;  2IFQ A;  5AGY A;  4POB A;  3CYN A;  2H6Y A;  4KB3 A;  4JED A;  1SL1 B;  1XXU A;  3ZL5 A;  2C0D A;  1O8W A;  4TOP A;  1XBS A;  3ERW A;  4GSS A;  4XHM A;  1EGR A;  3KMO A;  1G6Y A;  2GT5 A;  3F8U A;  5J3R A;  4ACS A;  4XS1 A;  1X5E A;  4N11 A;  1GSY A;  4EIP A;  2XC2 A;  11GS A;  3CSI A;  13GS A;  16GS A;  3P7X A;  5IMV A;  2M72 A;  2HRK A;  4IP1 A;  3MSZ A;  4KA0 A;  1KTE A;  4ZXG A;  3P8W A;  5ID2 A;  3R2Q A;  1T00 A;  3APQ A;  2WJU A;  3QAV A;  2JZS A;  2VLV A;  4TR4 A;  1DE1 A;  3GUR A;  5D9X A;  4JZQ A;  1HNB A;  1SL0 B;  2R0G A;  4PQI A;  4KND A;  4MA9 A;  2EC4 A;  5EVO A;  2VCQ A;  1SK2 A;  4NPB A;  4XTS A;  3L78 A;  2C3N A;  3FR3 A;  2C0E A;  1QFN A;  1BX9 A;  1USB A;  5DCG A;  3ZIJ A;  2HXK A;  3HHV A;  4LA1 A;  1OC9 A;  2OBI A;  1OE8 A;  1A0F A;  1ZYQ B;  1FHE A;  4GWR A;  4TR0 A;  4Z2R A;  3C71 A;  3OR5 A;  5H5S A;  5DAL A;  3CSJ A;  1NHY A;  4BIK A;  4E8H A;  4F9Z A;  3G7I A;  1FOV A;  2LUS A;  2DJJ A;  1HNA A;  3F3Q A;  2MYG A;  3L9V A;  1I5G A;  1BF5 A;  3KGK A;  3VWW A;  2NDO A;  5IMD A;  5KN0 A;  4FXY P;  2A2R A;  3HA9 A;  1QUW A;  5DBQ A;  3F4R A;  1WJK A;  1ZOF A;  8GSS A;  2L5O A;  3GKK A;  1GTA A;  1N8J A;  3HVN A;  1VF4 A;  4EXJ A;  4XS4 A;  1EGO A;  2FLS A;  2AJQ B;  4ML1 A;  3H1N A;  1EOH A;  3LWA A;  2NTO A;  1WE0 A;  22GS A;  2E2M A;  4FH8 A;  18GS A;  1EV9 A;  3EE2 A;  1AUC A;  2N5A A;  4HS1 A;  4XCS A;  2XPE A;  1SJZ A;  3DYR A;  3J7Y b;  4DSQ A;  3A2V A;  4NXI A;  1XOB A;  1VGL A;  3DIE A;  1PQN A;  1NHO A;  1S3A A;  3F4T A;  3ZFL A;  1DUG A;  3EMX A;  3GIX A;  20GS A;  4BVY B;  3ZVJ D;  1OE7 A;  3FK8 A;  3L9U A;  1R5A A;  2X8C A;  4V1A p;  4HZ2 A;  2B5X A;  4Q5F A;  5F06 A;  5JCG A;  3VWU A;  3O3T A;  1B4Q A;  1ZZY A;  2KP2 A;  3TKS C;  2PVO C;  5KOW A;  2H72 A;  1T4Y A;  5GZZ B;  3DRN A;  2WW2 A;  2IFQ B;  2TRC P;  4XS6 A;  4MH3 A;  5F05 A;  4CY6 A;  3AY8 A;  2G0F A;  3F9U A;  2RII A;  4ZIJ A;  1BJX A;  5FWG A;  1AW9 A;  3ZLP A;  5CRD A;  4AJ8 A;  1JLW A;  1GTB A;  4WET A;  3HYP A;  5DQS A;  4GDF A;  4ZB7 A;  3U6V A;  4GQF A;  4HSC X;  3SBC A;  1EZK A;  1N25 A;  4X0X A;  1GL8 A;  3GNJ A;  4MNN A;  4ECC A;  1S3D A;  1SEN A;  2GQM A;  2HRK B;  2A2P A;  3FZA A;  1X5C A;  5DCH A;  3DWV A;  1I1I P;  5ID2 B;  6GSY A;  1O6J A;  1YKA A;  1YY7 A;  3F6F A;  3D6I A;  1UVZ A;  1DBY A;  1T7P B;  4X43 A;  4PI2 C;  2H1L A;  2VUP A;  4KW6 A;  2B7K A;  1T3B A;  3DXB A;  4ML6 A;  1Z7P A;  2L57 A;  1M2D A;  1TU8 A;  5CNW A;  4RQR A;  3L9S A;  10GS A;  3RPP A;  1OC9 B;  2LQO A;  1FG4 A;  1PGT A;  1AQV A;  5DAL B;  4HU9 A;  5G31 A;  1WWJ A;  1XWB A;  2P0G A;  1B8X A;  2HRA A;  2GQK A;  4XIH A;  4PQH A;  3D4M A;  4PUR A;  4ECB A;  2FWG A;  2N5B A;  1ZGN A;  1QXH A;  2LS5 A;  1A23 A;  1Q4J A;  5FHI A;  1F9M A;  2P5Q A;  5G30 A;  5A4U A;  3GL5 A;  1JZW A;  1S4B P;  5HR1 A;  3BJ5 A;  2C0F A;  1H75 A;  1B4P A;  3KP8 A;  3VWX A;  5ECO B;  3GL3 A;  4WR4 A;  1TRU A;  2AV4 A;  4JR6 A;  2EFE A;  1K3O A;  2LRN A;  4F2I A;  4MF5 A;  4XS4 B;  1G0T A;  2HT9 A;  1SKR B;  2WUL A;  4I2U A;  2VIM A;  1XPV A;  3L0H A;  2VCT A;  4O92 A;  2P5R A;  4GQC A;  4BPY A;  1GSQ A;  2MBT A;  4Z2U A;  2RLI A;  2HE3 A;  5ECS A;  3GKN A;  3VFI A;  3VUR A;  5G1K A;  2YZU A;  3MDK A;  1BG1 A;  2KHP A;  5J4Y A;  3HJP A;  2HFD A;  2MMN A;  4ISD A;  2LRT A;  3MNG A;  3KIJ A;  3BD2 A;  2H1G A;  4KX4 A;  5HFG A;  5IOW A;  4AJ6 A;  4KH7 A;  4RQX A;  3D22 A;  1QK8 A;  5ECI B;  1ILO A;  3TJB A;  2REM A;  5ECL B;  2IL3 A;  2VAF A;  4MH2 A;  4QQ7 A;  2MMA A;  3WGX A;  4IKH A;  3WGE A;  3EIN A;  2FNO A;  3LW9 A;  1I9D A;  2F9S A;  3GFK A;  3KXO A;  5IMC A;  2OE0 A;  1MDJ A;  3LFL A;  1B9Y C;  1ERT A;  2C80 A;  4K9Z A;  5ECQ B;  1VF1 A;  2TIR A;  2HRN A;  3BBY A;  2M46 A;  1K0M A;  1LU4 A;  4X1U A;  2AUV A;  3TJG A;  2QGV A;  2YAN A;  1IYH A;  1QQ2 A;  3H93 A;  2RUF A;  3WYW A;  4LLR A;  4QL9 A;  2FGX A;  1SJI A;  2DKH A;  3M9K A;  2P31 A;  2V6K A;  4ZBD A;  3IAS 2;  2GVP A;  1TP9 A;  2WVZ A;  4TW5 A;  3E9J B;  3WGD A;  2IWT A;  4MZB A;  4K5R A;  5G5F A;  5B8B A;  3QOU A;  1AIU A;  1SK0 A;  4MJC A;  2YNX A;  3IV4 A;  4HQS A;  3M8N A;  6GSU A;  3DKS A;  1X0R A;  4NV2 A;  3CRT A;  2V41 A;  2LJA A;  3KH9 A;  2LNS A;  3GKM A;  3M9J A;  1ZL9 A;  3JCM L;  1TW9 A;  3LQ7 A;  2QA1 A;  2OAD A;  3IAM 2;  5COH A;  2C1Y A;  3Q74 A;  5A34 A;  3ZVJ A;  2CZ2 A;  2UZ8 A;  1SVM A;  3Q18 A;  14GS A;  4K2X A;  5DJL A;  1YEX A;  3LGC A;  4Q5N A;  2WW1 A;  2WVX A;  1A8L A;  4G9H A;  3VK9 A;  1ERV A;  1F6M C;  3M0F A;  3FZ5 A;  2GS3 A;  1FW1 A;  5J4U A;  4IVF A;  3WT1 A;  2M80 A;  1J9B A;  4ECI A;  4KAE A;  4GST A;  3GV1 A;  5D8I A;  1PX7 A;  2WVY A;  1EEJ A;  2JSY A;  4USS A;  2YV7 A;  1TXU A;  2MMZ A;  4AKX B;  5A1N A;  3W8S A;  4PXO A;  3I6A A;  4X4J A;  5GST A;  3FW2 A;  3UIW A;  4FQU A;  3D0Z A;  3UBK A;  2R2J A;  4OCE A;  3TCO A;  3APS A;  3LXT A;  3GTU A;  4LL4 B;  2FA8 A;  4HI7 A;  1HQO A;  9GSS A;  1GLP A;  1WPI A;  4OCF A;  4CDO A;  4WBJ A;  3MYD A;  3H8Q A;  3O76 A;  2GT6 A;  2CAI A;  4V1A g;  5HFK A;  2WZS A;  1R5P A;  5J9B A;  3RGB C;  2F51 A;  4IHU A;  4MAB A;  3H4K A;  1ZYP A;  1AQX A;  5J40 A;  2HSY A;  1MTC A;  2HZF A;  2VD1 A;  3HY2 A;  3VWV A;  4V2M A;  2K8V A;  4WR5 A;  2HRF A;  2ON7 A;  1Z9H A;  2H71 A;  2C0G A;  4BVX A;  1JZO A;  2R0P A;  2WB9 A;  1PL2 A;  1O7U A;  4GSN A;  1UN2 A;  4D73 A;  4WEY A;  4F03 A;  2KOK A;  4ICY A;  5HFI A;  1ON4 A;  2H6X A;  2FWF A;  3US3 A;  3GX0 A;  4POL A;  4AKI A;  1XFL A;  3DD3 A;  5AIX A;  4OO4 A;  2GDR A;  3ZTL A;  1V9W A;  1R4W A;  4EF0 A;  3HVX A;  2YP6 A;  2YOI A;  4O5Q A;  2H0I A;  3UL3 A;  5GSS A;  3G7Y A;  3KD0 A;  4EUY A;  1G6W A;  2OE1 A;  2GST A;  1V58 A;  4PGT A;  2OBK A;  2LRC A;  5J41 A;  2B5E A;  2VO4 A;  4AI6 A;  1HYU A;  3APO A;  3FRC A;  1PN9 A;  4CW9 A;  2H8L A;  4WKW A;  1IYI A;  5ECM B;  1UA5 A;  4V2L A;  4I2T A;  4NHZ A;  2QC7 A;  3KEB A;  4CHS A;  2RUE A;  1JZR A;  5ECH B;  2DKI A;  1ACV A;  1MEK A;  2B6M A;  2VL3 A;  19GS A;  2N5F A;  2MZC A;  5A34 B;  4K7I A;  1KEB A;  1R26 A;  5JCU A;  1ZYE A;  1GH2 A;  1A2M A;  3PH9 A;  3KZQ A;  4RI6 A;  4DEJ A;  2WVX B;  1VRS D;  5B8A A;  2D2Z A;  4HOJ A;  4PI0 C;  3ZIT A;  2IMK A;  3LXZ A;  2O87 A;  1SK1 A;  3FY7 A;  3MAK A;  2EFD A;  2H1A A;  4GCI A;  5CP1 A;  3KH7 A;  1M0U A;  4RUV A;  4H86 A;  2K6V A;  5GAP D;  1FOH A;  1V2A A;  1TK8 B;  2GZZ A;  2R0C A;  5IPH A;  2UV8 G;  1TJD A;  3QD9 A;  3IPZ A;  5GAN D;  1Z7R A;  4L0W A;  1U3I A;  5A1N B;  2ZNM A;  4AKH A;  2WW0 A;  12GS A;  3RFR C;  2IMD A;  1UC7 A;  3E3E A;  1Z6N A;  4IP6 A;  2DLX A;  4PX1 A;  1A8Y A;  3I9V 2;  4G2E A;  1J08 A;  2YV9 A;  4GRF A;  3HZ8 A;  5J9C A;  3GTU B;  3ZZX A;  4JR4 A;  3C8E A;  3GUS A;  1YZX A;  3GMF A;  2TRX A;  1RQM A;  3A2W A;  4G10 A;  2H70 A;  2PUK C;  3R3E A;  3N5O A;  2FY6 A;  2NBS A;  2KP1 A;  2R6K A;  2LST A;  2OE3 A;  2DJ3 A;  2FA4 A;  5ELA A;  1FVK A;  3IBH A;  2IJY A;  2YWM A;  3KTL A;  2GZY A;  2X64 A;  3TOU A;  1PX6 A;  1WIK A;  3PPU A;  1YDK A;  1ERU A;  1K3L A;  3I43 A;  2PVQ A;  3GSS A;  4PUA A;  3CTG A;  3IC8 A;  2C8U A;  4BVX B;  2VCV A;  4HQZ A;  5ECR B;  4NHW A;  4IW9 A;  4JU5 A;  2V1M A;  4K0N A;  3WD6 A;  1MDI A;  2R37 A;  4D73 B;  3HD5 A;  3KMN A;  3DML A;  2IIY A;  2GSQ A;  1SVO A;  5D93 A;  2LQQ A;  1XW5 A;  1GSU A;  3TUE A;  1X9S B;  2YZH A;  2L4Q A;  4G19 A;  2YCD A;  3GST A;  1GSE A;  1M3J A;  4K0G A;  2EFH A;  2QKE A;  2F3M A;  3FZ9 A;  4EO3 A;  1MD3 A;  2E2G A;  2QA2 A;  3TDG A;  4GXZ A;  2EIR A;  3D5J A;  1TRV A;  2HYX A;  1F2E A;  4PQ1 A;  4GLT A;  2BMX A;  2GQL A;  1GLQ A;  4TVE A;  3DEX A;  2VL2 A;  1ABA A;  1AQW A;  1PKW A;  1NSW A;  1OYJ A;  3UBL A;  4BL7 A;  1BAY A;  1YJ6 A;  3TRX A;  1CQG A;  4EL1 A;  3QMX A;  3LSZ A;  1SKW B;  4EC0 A;  5H5R A;  4IQA A;  2L6C A;  5BRT A;  5ECP B;  2H74 A;  2AAW A;  2CV4 A;  2DJ1 A;  2YN1 A;  3A5I A;  5A4W A;  4JE1 A;  1QMV A;  5J4V A;  2H6Z A;  1FVJ A;  5HR3 A;  5B6M A;  4KSM A;  2X49 A;  4KCA A;  2CVK A;  1YF1 A;  2I81 A;  3KM6 A;  4ZL9 A;  5KOX A;  1HD2 A;  6GSV A;  3M3M A;  3ME7 A;  1PL1 A;  3PR8 A;  5D9V A;  2R4V A;  2IPA A;  1TTZ A;  3EPT A;  5DDL A;  1XVW A;  4YAV A;  2X8H A;  1K3Y A;  4TR1 B;  3CXG A;  1JHB A;  1X9W B;  3UEM A;  2K18 A;  3EU4 A;  4Q5Q A;  4L5O A;  5E59 A;  4KGI A;  5LNK e;  3EUR A;  3KTB A;  5F0G A;  3W6G A;  2OT3 A;  4ZB6 A;  5L71 A;  2DML A;  4OFM A;  1XOA A;  3IK7 A;  4KDU A;  3TB2 A;  3FKF A;  2X8G A;  3HDC A;  1BG5 A;  1TI1 A;  4KDX A;  4OWY A;  3TU3 B;  5JCW A;  4YQM A;  4NMU A;  4ULX A;  1TI3 A;  3HMJ G;  2V6O A;  4V2N A;  3LYP A;  1HNC A;  5G1L A;  4DVC A;  3IC4 A;  2JZT A;  2PU9 C;  2B5Y A;  3GYK A;  3EWL A;  3F3R A;  5FT3 A;  2H75 A;  4MP4 A;  1WRY A;  4MJE A;  1SYX A;  1A0R P;  5AN1 A;  4MCU A;  5E4W A;  5AIS A;  2XBQ A;  3TRP A;  5IMF A;  4TXV A;  4ID0 A;  2O8V B;  2JU5 A;  4N30 A;  4IEL A;  2JAC A;  5EPF A;  1XW9 A;  1JZD A;  3J7Y k;  2VD0 A;  4FYU A;  4RI7 A;  3FMW A;  1SJ6 A;  4LMW A;  1O85 A;  1THX A;  5CRE A;  2EIO A;  3TGZ A;  4TN8 A;  2H1B A;  2ALB A;  3E0U A;  1M2B A;  3UOM A;  1EV4 A;  2F8A A;  4ZB8 A;  5CAX A;  1PSQ A;  3VI5 A;  4G0I A;  4MLY A;  3RHC A;  1YEP A;  3Q19 A;  5IMA A;  1VF2 A;  3ZMK A;  2HSN A;  4BL7 B;  2O7K A;  1PRX A;  2DBC A;  2I9H A;  5KEJ A;  5CRG A;  1BQ7 A;  2AHE A;  2CVB A;  3QAG A;  4Q5R A;  4EVM A;  2J9H A;  3CRU A;  4K2D A;  1W4V A;  1GRX A;  1B48 A;  1NW2 A;  3A3T A;  5BMU A;  1WP0 A;  3ZIV A;  2B7J A;  3ED3 A;  5IO0 A;  3DVX A;  4HEA 2;  2YJ7 A;  4O5R A;  2ZUP A;  3W8J A;  4OMV A;  3QCP A;  2A4H A;  2RM6 A;  5IQY A;  5CRW A;  2YJH A;  4HDE A;  4BWQ A;  17GS A;  2ES7 A;  3TJF A;  4DSS A;  2WCI A;  5A5H A;  3RPN A;  1XWC A;  2CX4 A;  3GA4 A;  3GH9 A;  2NVL A;  2DSA A;  1GUL A;  3L4N A;  1GUH A;  3IK9 A;  3CHX C;  3QR6 A;  4J2F A;  4O7H A;  5DAK A;  2HSH A;  3ERG A;  2VCZ A;  1U3A A;  1MD4 A;  4XRA A;  3TKS E;  3TJJ A;  4K1F A;  1Z6M A;  4OO5 A; 
#chains in the Genus database with same CATH homology
 2FWH A;  2I4A A;  4N10 A;  1E2Y A;  2V32 A;  4MF7 A;  2CAQ A;  3IDV A;  3ISO A;  3QDN A;  5HR0 A;  4POM A;  1A2L A;  4L8E A;  2HSM A;  4IS0 A;  2Z9S A;  4NAX A;  1A24 A;  1K0N A;  2DIZ A;  2FCH A;  3IHQ A;  1X5D A;  1A2J A;  2O85 A;  2AYT A;  1SD9 A;  3G9B A;  1SVL A;  2C3T A;  4ZIL A;  1TDI A;  4WBR D;  2LKU A;  5IM9 A;  5B6N A;  3SWL A;  1SD8 A;  2FD3 A;  1FB0 A;  2VCW A;  5D73 A;  1XVQ A;  2V2G A;  2H0G A;  4YAP A;  2L4C A;  2IME A;  4POK A;  4K5S A;  1F3B A;  2OA7 A;  2PGT A;  1RK4 A;  1Q98 A;  2DJ0 A;  2HLS A;  4A5P A;  2VKZ G;  1DSB A;  3NIV A;  1LBK A;  3CTF A;  2H01 A;  5KN3 A;  4AJ7 A;  1M99 A;  4KDY A;  1X9M B;  3UJ1 A;  2PN8 A;  4TKY A;  4IJ3 A;  3QPM A;  4N3Z A;  4WF5 A;  6GSX A;  4EDZ A;  5CRH A;  4N0Z A;  4ILF A;  4J57 E;  4CY8 A;  2IMF A;  3NZN A;  2GSS A;  5IOX A;  2HSN B;  3CBU A;  2YWN A;  5HQP A;  3IXR A;  3GKX A;  1PA3 A;  1MDK A;  2OJL A;  1TXX A;  1URM A;  1TK5 B;  5CYY A;  4DSR A;  2CVD A;  2VM1 A;  4GF0 A;  3F4S A;  3RHB A;  4G0K A;  3UAR A;  2DJK A;  1SKS B;  5BMU B;  1Y25 A;  3ZRD A;  1EWX A;  3C73 A;  1VF3 A;  2PBJ A;  1Y6E A;  4NWY A;  5J47 A;  4F82 A;  5F07 A;  4JBB A;  4ECJ A;  4AKG A;  1WOU A;  2L5L A;  1SL2 B;  3C1R A;  4TXO B;  3HJM A;  3KCM A;  4DSS B;  1XW6 A;  3QAW A;  4LL1 B;  5A5H B;  1EEM A;  2BTO T;  2MMO A;  4NV5 A;  4YKF A;  3LG6 A;  5EL8 A;  3EU3 A;  4XRD A;  2JSZ A;  4MMM A;  5JWO B;  3D4T A;  5DVB A;  2JL4 A;  2HZE A;  3TRQ A;  5DAK B;  1C72 A;  5D9T A;  1G7O A;  2K8S A;  4TR1 A;  1O73 A;  4ZL7 A;  1YVL A;  4YH2 A;  1FB6 A;  3A5W A;  3C7M A;  2IN3 A;  1GSS A;  3D21 A;  3HCZ A;  3LJR A;  5A4V A;  3IA1 A;  3O6T A;  1KBN A;  4MJB A;  1DE2 A;  3VPT A;  4G01 A;  4QMK A;  1EP7 A;  2B3S A;  5G2Z A;  2PER A;  2HSM B;  2FWE A;  1GP1 A;  4MF6 A;  1XIY A;  3F6D A;  3FEU A;  5D96 A;  3HVS A;  1ML6 A;  4K8M A;  4EE0 A;  2AB6 A;  3IE3 A;  3RAZ A;  2XPD A;  2PWJ A;  1QGV A;  4N0V A;  4ZB9 A;  4KE3 A;  1XZO A;  2FHE A;  3IHG A;  1TKD B;  3ZML A;  3IOS A;  2K9F A;  5IO2 A;  1H4O A;  1NM3 A;  4I97 A;  2QSI A;  2O89 A;  4O32 A;  4OFN A;  4YKG A;  1TU7 A;  1JLV A;  1V57 A;  3UVH A;  3QFB C;  2XHF A;  4EIQ A;  2VM2 A;  3CMI A;  1WMJ A;  4I8B A;  1F3A A;  2GSR A;  6GSW A;  2O5V A;  2GZP A;  1XCC A;  2RM5 A;  3F0I A;  4AGS A;  3EVI A;  2LTK A;  2C4J A;  4K7O A;  4AF2 A;  1AC1 A;  1K0D A;  1V98 A;  3RDW A;  4HZ4 A;  3ZRE A;  2X99 A;  2B1L A;  3G7J A;  1PMT A;  1PN0 A;  2H73 A;  2H66 A;  2WGR A;  4PNF A;  1E6B A;  1Z5Y E;  3EC3 A;  4Z7X A;  3HKR A;  2XBI A;  3TKQ A;  3UVT A;  3IR4 A;  1S3C A;  4E8E A;  1Y1U A;  3KP9 A;  3LOR A;  1K0O A;  2ZCT A;  3MWH A;  4MDC A;  2EIQ A;  4TR3 A;  2WFC A;  1B9X C;  2KLX A;  5G5E A;  2WDU A;  2WS2 A;  3GX8 A;  2GLR A;  2FUG 2;  4HUA A;  2X4A A;  1M9A A;  2I3Y A;  5A5K A;  4YQU A;  4BA7 A;  3FHK A;  2LJK A;  1O81 A;  4EDY A;  1M2A A;  1OC8 A;  4E68 A;  3VPQ A;  1SU9 A;  1YQ1 A;  2E0Q A;  3A2X A;  4MPG A;  2DC5 A;  4L5L A;  3LYK A;  5ECK B;  3FR9 A;  2HZE B;  2DJ2 A;  1ZMA A;  3Q6O A;  1OKT A;  4HJ2 A;  5JWQ B;  4IBP A;  3CSH A;  2VLU A;  1AAZ A;  6GST A;  5LD0 A;  3WT2 A;  2ON5 A;  1OVN A;  4GTU A;  2LEG A;  5IPG A;  2E7P A;  3QFA C;  2CX3 A;  1FAA A;  5JWR B;  4IGJ A;  1BED A;  2LNT A;  2HI7 A;  4YQV A;  1GTI A;  3DGQ A;  4IJI A;  3TJK A;  3VI7 A;  4I6X A;  4HU7 A;  2CZ3 A;  4MK3 A;  4PNG A;  3KJY A;  2I1U A;  2F8F A;  3I69 A;  5KN1 A;  2VCX A;  1XWG A;  1TRW A;  1PKZ A;  1TOF A;  3BCK A;  5DQY A;  1R7H A;  3GN3 A;  1EOG A;  3V1W A;  5IMZ A;  4Z2T A;  3M1G A;  3FYG A;  4I5Q A;  4K7N A;  3VLN A;  1ZYN A;  4JRR A;  5C04 A;  1GSD A;  1FO5 A;  1K0C A;  5HR2 A;  3C1S A;  3PGT A;  2IMI A;  4MPF A;  2H76 A;  3H79 A;  1GUM A;  3F63 A;  5EY6 A;  2G2Q A;  1G7E A;  1THO A;  1XWA A;  1U87 A;  4HJM A;  1T4Z A;  4MJA A;  1ZCP A;  4WF4 A;  1AXD A;  2R5G A;  3BCI A;  4F0C A;  1M7T A;  4L0U A;  3P90 A;  1PD2 1;  4PUF C;  3ME8 A;  4ZBA A;  4MZW A;  4P3Y B;  3EMP A;  1GNE A;  2B1K A;  5ENU A;  3DVW A;  1GUK A;  2CQ9 A;  2DIY A;  3P2A A;  4G0L A;  2HQT A;  3TKS A;  3NOF A;  1LJR A;  2EFC A;  5ABR A;  2PPT A;  2L6D A;  2CA8 A;  2JZR A;  4W66 A;  4MZC A;  2VOC A;  2LJR A;  3GH6 A;  1TK0 B;  4BWS A;  2DMM A;  4WXT A;  1OAZ A;  1GWC A;  2H0H A;  5LCZ A;  2YPM A;  4PTS A;  1RW1 A;  4FYB A;  5IIZ A;  2R3X A;  4KF9 A;  3TOT A;  5J5N A;  1T8E B;  1K0B A;  3RBT A;  4ZL8 A;  5C00 A;  1Z3E A;  4FIW A;  5H5Q A;  2OAC A;  5INY A;  2A4V A;  3EYT A;  1OKD A;  3LEF A;  4TXO A;  3TKR A;  2GTU A;  1YF0 A;  3PIN A;  2VL9 A;  2H30 A;  1SYR A;  2C3Q A;  1U88 A;  2LV3 A;  3N9J A;  2JAD A;  4IN0 A;  2H19 A;  1CQH A;  1ERW A;  3HZ4 A;  1GTU A;  2YWO A;  5ELG A;  2WZ9 A;  4ZBB A;  3U5R E;  2YWI A;  3IRA A;  1OC3 A;  3GHA A;  3FR6 A;  5F8B A;  3HVV A;  3TKP A;  2GGT A;  3ZYW A;  5ECN B;  3S9F A;  5AIV A;  1GNW A;  1ST9 A;  3UAP A;  5B7C A;  4OD7 A;  2L59 A;  3HXS A;  5CO3 A;  2A2S A;  1N2A A;  2VLT A;  4KUN A;  2OKA A;  1T1V A;  1U6T A;  7GSS A;  2J23 A;  4KCE A;  3BOA A;  2HNL A;  4F0B A;  2PMT A;  4K6X A;  5D9W A;  5DJM A;  1W89 A;  1TRS A;  5KN2 A;  4FO5 A;  1O8X A;  3ZFB A;  3K8N A;  1EP8 A;  2CT6 A;  3MIX A;  2WRT A;  4J56 E;  1J0F A;  2KUC A;  4KSO A;  4LMV A;  3CWG A;  1YKC A;  4QL7 A;  2BJX A;  3UMA A;  1F37 A;  1KNG A;  1XWK A;  1BYE A;  4BVY A;  1JFU A;  4IQ1 A;  3ERF A;  6GSS A;  3GRX A;  2NPB A;  1V40 A;  4EKZ A;  2MBS A;  4FYC A;  3FZ4 A;  1GSF A;  4O5U A;  2H1D A;  1M9B A;  4OFT A;  1K0A A;  3HJO A;  4TRX A;  2VL2 C;  2IFQ A;  5AGY A;  4POB A;  3CYN A;  2H6Y A;  4KB3 A;  4JED A;  1SL1 B;  1XXU A;  3ZL5 A;  2C0D A;  1O8W A;  4TOP A;  1XBS A;  3ERW A;  4GSS A;  4XHM A;  1EGR A;  3KMO A;  1G6Y A;  2GT5 A;  3F8U A;  5J3R A;  4ACS A;  4XS1 A;  1X5E A;  4N11 A;  1GSY A;  4EIP A;  2XC2 A;  11GS A;  3CSI A;  13GS A;  16GS A;  3P7X A;  5IMV A;  2M72 A;  2HRK A;  4IP1 A;  3MSZ A;  4KA0 A;  1KTE A;  4ZXG A;  3P8W A;  5ID2 A;  3R2Q A;  1T00 A;  3APQ A;  2WJU A;  3QAV A;  2JZS A;  2VLV A;  4TR4 A;  1DE1 A;  3GUR A;  5D9X A;  4JZQ A;  1HNB A;  1SL0 B;  2R0G A;  4PQI A;  4KND A;  4MA9 A;  2EC4 A;  5EVO A;  2VCQ A;  1SK2 A;  4NPB A;  4XTS A;  3L78 A;  2C3N A;  3FR3 A;  2C0E A;  1QFN A;  1BX9 A;  1USB A;  5DCG A;  3ZIJ A;  2HXK A;  3HHV A;  4LA1 A;  1OC9 A;  2OBI A;  1OE8 A;  1A0F A;  1ZYQ B;  1FHE A;  4GWR A;  4TR0 A;  4Z2R A;  3C71 A;  3OR5 A;  5H5S A;  5DAL A;  3CSJ A;  1NHY A;  4E8H A;  4F9Z A;  3G7I A;  1FOV A;  2LUS A;  2DJJ A;  1HNA A;  3F3Q A;  2MYG A;  3L9V A;  1I5G A;  1BF5 A;  3KGK A;  3VWW A;  2NDO A;  5IMD A;  5KN0 A;  2A2R A;  3HA9 A;  1QUW A;  5DBQ A;  3F4R A;  1WJK A;  1ZOF A;  8GSS A;  2L5O A;  3GKK A;  1GTA A;  1N8J A;  1VF4 A;  4EXJ A;  4XS4 A;  1EGO A;  2FLS A;  2AJQ B;  4ML1 A;  3H1N A;  1EOH A;  3LWA A;  2NTO A;  1WE0 A;  22GS A;  2E2M A;  4FH8 A;  18GS A;  1EV9 A;  3EE2 A;  1AUC A;  2N5A A;  4HS1 A;  4XCS A;  2XPE A;  1SJZ A;  3DYR A;  3J7Y b;  4DSQ A;  3A2V A;  4NXI A;  1XOB A;  1VGL A;  3DIE A;  1PQN A;  1NHO A;  1S3A A;  3F4T A;  3ZFL A;  1DUG A;  3EMX A;  3GIX A;  20GS A;  4BVY B;  3ZVJ D;  1OE7 A;  3FK8 A;  3L9U A;  1R5A A;  2X8C A;  4V1A p;  4HZ2 A;  2B5X A;  4Q5F A;  5F06 A;  5JCG A;  3VWU A;  3O3T A;  1B4Q A;  1ZZY A;  2KP2 A;  3TKS C;  2PVO C;  5KOW A;  2H72 A;  1T4Y A;  5GZZ B;  3DRN A;  2IFQ B;  2TRC P;  4XS6 A;  4MH3 A;  5F05 A;  4CY6 A;  3AY8 A;  2G0F A;  3F9U A;  2RII A;  4ZIJ A;  1BJX A;  5FWG A;  1AW9 A;  3ZLP A;  5CRD A;  4AJ8 A;  1JLW A;  1GTB A;  4WET A;  3HYP A;  5DQS A;  4GDF A;  4ZB7 A;  3U6V A;  4GQF A;  3SBC A;  1EZK A;  1N25 A;  4X0X A;  1GL8 A;  3GNJ A;  4MNN A;  4ECC A;  1S3D A;  1SEN A;  2GQM A;  2HRK B;  2A2P A;  3FZA A;  1X5C A;  5DCH A;  3DWV A;  5ID2 B;  6GSY A;  1O6J A;  1YKA A;  1YY7 A;  3F6F A;  3D6I A;  1UVZ A;  1DBY A;  1T7P B;  4X43 A;  2H1L A;  2VUP A;  4KW6 A;  2B7K A;  1T3B A;  3DXB A;  4ML6 A;  1Z7P A;  2L57 A;  1M2D A;  1TU8 A;  5CNW A;  4RQR A;  3L9S A;  10GS A;  3RPP A;  1OC9 B;  2LQO A;  1FG4 A;  1PGT A;  1AQV A;  5DAL B;  4HU9 A;  5G31 A;  1WWJ A;  1XWB A;  2P0G A;  1B8X A;  2HRA A;  2GQK A;  4XIH A;  4PQH A;  3D4M A;  4PUR A;  4ECB A;  2FWG A;  2N5B A;  1ZGN A;  1QXH A;  2LS5 A;  1A23 A;  1Q4J A;  5FHI A;  1F9M A;  2P5Q A;  5G30 A;  5A4U A;  3GL5 A;  1JZW A;  5HR1 A;  3BJ5 A;  2C0F A;  1H75 A;  1B4P A;  3KP8 A;  3VWX A;  5ECO B;  3GL3 A;  4WR4 A;  1TRU A;  2AV4 A;  4JR6 A;  2EFE A;  1K3O A;  2LRN A;  4F2I A;  4MF5 A;  4XS4 B;  1G0T A;  2HT9 A;  1SKR B;  2WUL A;  4I2U A;  2VIM A;  1XPV A;  3L0H A;  2VCT A;  4O92 A;  2P5R A;  4GQC A;  4BPY A;  1GSQ A;  2MBT A;  4Z2U A;  2RLI A;  2HE3 A;  5ECS A;  3GKN A;  3VFI A;  3VUR A;  5G1K A;  2YZU A;  3MDK A;  1BG1 A;  2KHP A;  5J4Y A;  3HJP A;  2HFD A;  2MMN A;  4ISD A;  2LRT A;  3MNG A;  3KIJ A;  3BD2 A;  2H1G A;  4KX4 A;  5HFG A;  5IOW A;  4AJ6 A;  4KH7 A;  4RQX A;  3D22 A;  1QK8 A;  5ECI B;  1ILO A;  3TJB A;  2REM A;  5ECL B;  2IL3 A;  2VAF A;  4MH2 A;  4QQ7 A;  2MMA A;  3WGX A;  4IKH A;  3WGE A;  3EIN A;  2FNO A;  3LW9 A;  1I9D A;  2F9S A;  3GFK A;  3KXO A;  5IMC A;  2OE0 A;  1MDJ A;  3LFL A;  1B9Y C;  1ERT A;  2C80 A;  4K9Z A;  5ECQ B;  1VF1 A;  2TIR A;  2HRN A;  3BBY A;  2M46 A;  1K0M A;  1LU4 A;  4X1U A;  2AUV A;  3TJG A;  2QGV A;  2YAN A;  1IYH A;  1QQ2 A;  3H93 A;  2RUF A;  3WYW A;  4LLR A;  4QL9 A;  2FGX A;  1SJI A;  2DKH A;  3M9K A;  2P31 A;  2V6K A;  4ZBD A;  3IAS 2;  2GVP A;  1TP9 A;  4TW5 A;  3E9J B;  3WGD A;  2IWT A;  4MZB A;  4K5R A;  5G5F A;  5B8B A;  3QOU A;  1AIU A;  1SK0 A;  4MJC A;  2YNX A;  3IV4 A;  4HQS A;  3M8N A;  6GSU A;  3DKS A;  1X0R A;  4NV2 A;  3CRT A;  2V41 A;  2LJA A;  3KH9 A;  2LNS A;  3GKM A;  3M9J A;  1ZL9 A;  3JCM L;  1TW9 A;  3LQ7 A;  2QA1 A;  2OAD A;  3IAM 2;  5COH A;  2C1Y A;  3Q74 A;  5A34 A;  3ZVJ A;  2CZ2 A;  2UZ8 A;  1SVM A;  3Q18 A;  14GS A;  4K2X A;  5DJL A;  1YEX A;  3LGC A;  4Q5N A;  1A8L A;  4G9H A;  3VK9 A;  1ERV A;  1F6M C;  3M0F A;  3FZ5 A;  2GS3 A;  1FW1 A;  5J4U A;  4IVF A;  3WT1 A;  2M80 A;  1J9B A;  4ECI A;  4KAE A;  4GST A;  3GV1 A;  5D8I A;  1PX7 A;  1EEJ A;  2JSY A;  4USS A;  2YV7 A;  1TXU A;  2MMZ A;  4AKX B;  5A1N A;  3W8S A;  4PXO A;  3I6A A;  4X4J A;  5GST A;  3FW2 A;  3UIW A;  4FQU A;  3D0Z A;  3UBK A;  2R2J A;  4OCE A;  3TCO A;  3APS A;  3LXT A;  3GTU A;  4LL4 B;  2FA8 A;  4HI7 A;  1HQO A;  9GSS A;  1GLP A;  1WPI A;  4OCF A;  4CDO A;  4WBJ A;  3MYD A;  3H8Q A;  3O76 A;  2GT6 A;  2CAI A;  4V1A g;  5HFK A;  1R5P A;  5J9B A;  2F51 A;  4IHU A;  4MAB A;  3H4K A;  1ZYP A;  1AQX A;  5J40 A;  2HSY A;  1MTC A;  2HZF A;  2VD1 A;  3HY2 A;  3VWV A;  4V2M A;  2K8V A;  4WR5 A;  2HRF A;  2ON7 A;  1Z9H A;  2H71 A;  2C0G A;  4BVX A;  1JZO A;  2R0P A;  2WB9 A;  1PL2 A;  1O7U A;  4GSN A;  1UN2 A;  4D73 A;  4WEY A;  4F03 A;  2KOK A;  4ICY A;  5HFI A;  1ON4 A;  2H6X A;  2FWF A;  3US3 A;  3GX0 A;  4POL A;  4AKI A;  1XFL A;  3DD3 A;  5AIX A;  4OO4 A;  2GDR A;  3ZTL A;  1V9W A;  1R4W A;  4EF0 A;  3HVX A;  2YP6 A;  2YOI A;  4O5Q A;  2H0I A;  3UL3 A;  5GSS A;  3G7Y A;  3KD0 A;  4EUY A;  1G6W A;  2OE1 A;  2GST A;  1V58 A;  4PGT A;  2OBK A;  2LRC A;  5J41 A;  2B5E A;  2VO4 A;  4AI6 A;  1HYU A;  3APO A;  3FRC A;  1PN9 A;  4CW9 A;  2H8L A;  4WKW A;  1IYI A;  5ECM B;  1UA5 A;  4V2L A;  4I2T A;  4NHZ A;  2QC7 A;  3KEB A;  4CHS A;  2RUE A;  1JZR A;  5ECH B;  2DKI A;  1ACV A;  1MEK A;  2B6M A;  2VL3 A;  19GS A;  2N5F A;  2MZC A;  5A34 B;  4K7I A;  1KEB A;  1R26 A;  5JCU A;  1ZYE A;  1GH2 A;  1A2M A;  3PH9 A;  3KZQ A;  4RI6 A;  4DEJ A;  1VRS D;  5B8A A;  2D2Z A;  4HOJ A;  3ZIT A;  2IMK A;  3LXZ A;  2O87 A;  1SK1 A;  3FY7 A;  3MAK A;  2EFD A;  2H1A A;  4GCI A;  5CP1 A;  3KH7 A;  1M0U A;  4RUV A;  4H86 A;  2K6V A;  5GAP D;  1FOH A;  1V2A A;  1TK8 B;  2GZZ A;  2R0C A;  5IPH A;  2UV8 G;  1TJD A;  3QD9 A;  3IPZ A;  5GAN D;  1Z7R A;  4L0W A;  1U3I A;  5A1N B;  2ZNM A;  4AKH A;  12GS A;  2IMD A;  1UC7 A;  3E3E A;  1Z6N A;  4IP6 A;  2DLX A;  4PX1 A;  1A8Y A;  3I9V 2;  4G2E A;  1J08 A;  2YV9 A;  4GRF A;  3HZ8 A;  5J9C A;  3GTU B;  3ZZX A;  4JR4 A;  3C8E A;  3GUS A;  1YZX A;  3GMF A;  2TRX A;  1RQM A;  3A2W A;  4G10 A;  2H70 A;  2PUK C;  3R3E A;  3N5O A;  2FY6 A;  2NBS A;  2KP1 A;  2R6K A;  2LST A;  2OE3 A;  2DJ3 A;  2FA4 A;  5ELA A;  1FVK A;  3IBH A;  2IJY A;  2YWM A;  3KTL A;  2GZY A;  2X64 A;  3TOU A;  1PX6 A;  1WIK A;  3PPU A;  1YDK A;  1ERU A;  1K3L A;  3I43 A;  2PVQ A;  3GSS A;  4PUA A;  3CTG A;  3IC8 A;  2C8U A;  4BVX B;  2VCV A;  4HQZ A;  5ECR B;  4NHW A;  4IW9 A;  4JU5 A;  2V1M A;  4K0N A;  3WD6 A;  1MDI A;  2R37 A;  4D73 B;  3HD5 A;  3KMN A;  3DML A;  2IIY A;  2GSQ A;  1SVO A;  5D93 A;  2LQQ A;  1XW5 A;  1GSU A;  3TUE A;  1X9S B;  2YZH A;  2L4Q A;  4G19 A;  2YCD A;  3GST A;  1GSE A;  4K0G A;  2EFH A;  2QKE A;  2F3M A;  3FZ9 A;  4EO3 A;  1MD3 A;  2E2G A;  2QA2 A;  3TDG A;  4GXZ A;  2EIR A;  3D5J A;  1TRV A;  2HYX A;  1F2E A;  4PQ1 A;  4GLT A;  2BMX A;  2GQL A;  1GLQ A;  4TVE A;  3DEX A;  2VL2 A;  1ABA A;  1AQW A;  1PKW A;  1NSW A;  1OYJ A;  3UBL A;  4BL7 A;  1BAY A;  1YJ6 A;  3TRX A;  1CQG A;  4EL1 A;  3QMX A;  3LSZ A;  1SKW B;  4EC0 A;  5H5R A;  4IQA A;  2L6C A;  5BRT A;  5ECP B;  2H74 A;  2AAW A;  2CV4 A;  2DJ1 A;  2YN1 A;  3A5I A;  5A4W A;  4JE1 A;  1QMV A;  5J4V A;  2H6Z A;  1FVJ A;  5HR3 A;  5B6M A;  4KSM A;  2X49 A;  4KCA A;  2CVK A;  1YF1 A;  2I81 A;  3KM6 A;  4ZL9 A;  5KOX A;  1HD2 A;  6GSV A;  3M3M A;  3ME7 A;  1PL1 A;  3PR8 A;  5D9V A;  2R4V A;  2IPA A;  1TTZ A;  3EPT A;  5DDL A;  1XVW A;  4YAV A;  2X8H A;  1K3Y A;  4TR1 B;  3CXG A;  1JHB A;  1X9W B;  3UEM A;  2K18 A;  3EU4 A;  4Q5Q A;  4L5O A;  5E59 A;  4KGI A;  5LNK e;  3EUR A;  3KTB A;  5F0G A;  3W6G A;  2OT3 A;  4ZB6 A;  5L71 A;  2DML A;  4OFM A;  1XOA A;  3IK7 A;  4KDU A;  3TB2 A;  3FKF A;  2X8G A;  3HDC A;  1BG5 A;  1TI1 A;  4KDX A;  4OWY A;  3TU3 B;  5JCW A;  4YQM A;  4NMU A;  4ULX A;  1TI3 A;  3HMJ G;  2V6O A;  4V2N A;  3LYP A;  1HNC A;  5G1L A;  4DVC A;  3IC4 A;  2JZT A;  2PU9 C;  2B5Y A;  3GYK A;  3EWL A;  3F3R A;  5FT3 A;  2H75 A;  4MP4 A;  1WRY A;  4MJE A;  1SYX A;  1A0R P;  5AN1 A;  4MCU A;  5E4W A;  5AIS A;  2XBQ A;  3TRP A;  5IMF A;  4TXV A;  4ID0 A;  2O8V B;  2JU5 A;  4N30 A;  4IEL A;  2JAC A;  5EPF A;  1XW9 A;  1JZD A;  3J7Y k;  2VD0 A;  4FYU A;  4RI7 A;  3FMW A;  1SJ6 A;  4LMW A;  1O85 A;  1THX A;  5CRE A;  2EIO A;  3TGZ A;  4TN8 A;  2H1B A;  2ALB A;  3E0U A;  1M2B A;  3UOM A;  1EV4 A;  2F8A A;  4ZB8 A;  5CAX A;  1PSQ A;  3VI5 A;  4G0I A;  4MLY A;  3RHC A;  1YEP A;  3Q19 A;  5IMA A;  1VF2 A;  3ZMK A;  2HSN A;  4BL7 B;  2O7K A;  1PRX A;  2DBC A;  2I9H A;  5KEJ A;  5CRG A;  1BQ7 A;  2AHE A;  2CVB A;  3QAG A;  4Q5R A;  4EVM A;  2J9H A;  3CRU A;  4K2D A;  1W4V A;  1GRX A;  1B48 A;  1NW2 A;  3A3T A;  5BMU A;  1WP0 A;  3ZIV A;  2B7J A;  3ED3 A;  5IO0 A;  3DVX A;  4HEA 2;  2YJ7 A;  4O5R A;  2ZUP A;  3W8J A;  4OMV A;  3QCP A;  2A4H A;  2RM6 A;  5IQY A;  5CRW A;  2YJH A;  4HDE A;  4BWQ A;  17GS A;  2ES7 A;  3TJF A;  4DSS A;  2WCI A;  5A5H A;  3RPN A;  1XWC A;  2CX4 A;  3GA4 A;  3GH9 A;  2NVL A;  2DSA A;  1GUL A;  3L4N A;  1GUH A;  3IK9 A;  3QR6 A;  4J2F A;  4O7H A;  5DAK A;  2HSH A;  3ERG A;  2VCZ A;  1U3A A;  1MD4 A;  4XRA A;  3TKS E;  3TJJ A;  4K1F A;  1Z6M A;  4OO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...