2D2ZA

Crystal structure of soluble form of clic4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
223
Chain Sequence
EPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Chloride intracellular channel protein 4
publication title Trimeric structure of the wild soluble chloride intracellular ion channel CLIC4 observed in crystals
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 223
sequence length 238
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2d2zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2d2zA01
1E6BA 1ZZYA 1V40A 4WR4A 2A4VA 2RUEA 3SBCA 2JZSA 3H1NA 4POLA 4MDCA 3TRXA 1EEJA 3GL3A 3GUSA 3PH9A 1XIYA 4AJ8A 1PX7A 1TP9A 4POMA 3GX8A 1TKDB 1AC1A 1FO5A 4PQHA 2OA7A 1ML6A 5J3RA 2O7KA 3VWVA 4XRAA 1ERVA 3FR6A 2B6MA 4OMVA 1J08A 5FT3A 2L59A 4FYCA 1OKDA 3KXOA 1Q4JA 1GUHA 3CSIA 3A2VA 3LGCA 3RPPA 4DSSB 2P31A 1ILOA 2VLVA 5DALB 4EKZA 1GTUA 3FW2A 5G1LA 2VM2A 5EPFA 4IQAA 5ELGA 2OACA 2CA8A 1SK2A 3CSJA 1I5GA 3F63A 1WPIA 4J57E 2H70A 2P5RA 2GSTA 5DJMA 1TRWA 4XS4B 3CTGA 2LJAA 1QXHA 2GVPA 2VCXA 3L0HA 5KN3A 2OADA 3LJRA 1A24A 4V2MA 2LS5A 2IIYA 3HHVA 5CO3A 5H5RA 4GQCA 4NWYA 4KA0A 4IP6A 3HJOA 1K3OA 1V2AA 1HYUA 3UVHA 2BTOT 3QAWA 3I69A 5ENUA 1BAYA 2O85A 1JHBA 1HNBA 1GTBA 1PD21 4F03A 3FZ9A 4JR4A 4Z7XA 4V1Ag 5GAPD 3U5RE 1PQNA 5C04A 2J9HA 3K8NA 2BMXA 1YY7A 3MWHA 1YJ6A 6GSWA 2FA4A 6GSXA 1A0FA 1B8XA 3M0FA 3VI7A 4K0GA 3QPMA 3HKRA 1LJRA 2YV7A 3TUEA 2LRTA 5AGYA 1R4WA 2X8CA 4TR1B 1PSQA 2PWJA 2IMIA 2YZHA 17GSA 5F0GA 1T00A 4N10A 2YPMA 1M0UA 3M9JA 1GULA 2H6XA 2DJ1A 1FHEA 2YJHA 2C3NA 2RUFA 1PL1A 1YZXA 5ELAA 2TRCP 3D21A 5EVOA 2DMMA 4MP4A 2V6KA 1OC8A 4X43A 1BEDA 2WS2A 2PGTA 3BJ5A 2LEGA 2DBCA 5F05A 4BA7A 3IAM2 3TRQA 5ECKB 2DJ0A 1S3AA 2RM5A 3HY2A 1O81A 2IJYA 1YF0A 1T1VA 5GAND 3UVTA 3G7IA 1G7OA 2GQKA 4OFNA 5A4UA 2JSZA 3US3A 3LG6A 1R26A 4WEYA 1MDKA 2MMAA 3GN3A 2E0QA 2LTKA 3KCMA 5JWOB 4L0WA 1T4ZA 4RI7A 5FWGA 2H71A 2H74A 1GP1A 5CP1A 3DRNA 2KUCA 1EP7A 3ZL5A 1DSBA 3EVIA 4TXOA 5H5QA 3HVXA 2B3SA 3EINA 4MF6A 3QDNA 2HQTA 3TKSA 2VM1A 5HR3A 4L5OA 1AW9A 3GKMA 4K8MA 3KJYA 1U6TA 2NVLA 1VRSD 1ZYEA 2LNTA 1Z5YE 4PURA 5GZZB 4RUVA 3KP9A 1AQWA 5AISA 2C3TA 4IN0A 1U3IA 3ZITA 4KE3A 4MZWA 3ZYWA 5ID2A 3BBYA 4PNFA 2VCTA 2Z9SA 3QD9A 1SJIA 4MA9A 2FNOA 4MJEA 2GTUA 4MJCA 1BYEA 2A2RA 4OCEA 3JCML 3HVSA 3ZTLA 2X8HA 2X64A 3DGQA 2IFQB 4EUYA 2HZEA 1A23A 3C1RA 1AIUA 1XOBA 2AAWA 1GSUA 4HS1A 3LEFA 5IOXA 3TOUA 2PVOC 1R5PA 4Q5NA 4WR5A 3F8UA 1XWKA 1F2EA 4HJMA 3E9JB 2H30A 2AV4A 4ZL9A 4BL7B 1X9MB 1EV9A 10GSA 4TXVA 4ACSA 3ZMLA 2C8UA 4GLTA 4D73B 3TB2A 3HVVA 1AUCA 1SU9A 2X8GA 3LYKA 5D93A 1XXUA 4JE1A 1QK8A 1JLWA 4ML6A 2GSRA 1PN9A 2GT6A 4JZQA 3O6TA 2ON7A 2PN8A 4IHUA 3BD2A 2AJQB 4KUNA 3UJ1A 3QOUA 3TKSC 2YN1A 1OE8A 4HEA2 3ZLPA 2IL3A 5ECRB 2F8AA 1F6MC 2GDRA 3HA9A 3Q6OA 2DLXA 4EXJA 2G0FA 5LNKe 3W8SA 2F8FA 4Q5RA 4MABA 3Q19A 4KH7A 4KX4A 2MMOA 1M9AA 2HFDA 4V1Ap 3HDCA 2AYTA 1XZOA 1GSQA 2QKEA 2L6DA 5CAXA 2JZRA 1YKCA 4IQ1A 4KAEA 1Z9HA 4GXZA 4MCUA 3M9KA 2B5EA 2HSHA 3IE3A 3Q74A 1MD3A 4TR0A 1YEXA 1XWAA 1Q98A 4XS4A 2PERA 4ZB6A 4HZ4A 1GSSA 5G5EA 4IVFA 2VL2A 1ZL9A 2C80A 2V1MA 2L4QA 4MPFA 2WDUA 3ZFLA 4TXOB 1GUMA 4NAXA 4FO5A 5CRGA 2OE1A 1TRUA 22GSA 4MF7A 6GSYA 2ZNMA 3IOSA 2L6CA 3BOAA 3EC3A 2C3QA 2O8VB 2HXKA 3TJKA 4KDUA 1FOVA 2PBJA 1V9WA 3LQ7A 1OVNA 5ID2B 3G7YA 3LFLA 2O87A 3RPNA 3O3TA 5CNWA 3GURA 3GH9A 3VURA 1M9BA 6GSUA 2YWMA 1PMTA 4DSQA 3GKKA 5DBQA 1XPVA 1TI1A 4OWYA 4RQRA 4X0XA 1FAAA 4JU5A 1OKTA 2O89A 4MJBA 3DXBA 2HZEB 1Z7RA 4IJIA 1XCCA 3IK9A 3NIVA 4KB3A 3UL3A 3EMXA 2KHPA 1ABAA 2HRAA 3C73A 2L4CA 3WT2A 1G6WA 5IMVA 1JFUA 2H66A 5G1KA 4PGTA 4N11A 1WMJA 3N9JA 5IOWA 2H0IA 2CAIA 4HQSA 1TW9A 1GRXA 3KP8A 4KCEA 4GQFA 2X99A 3A5WA 1SK1A 4POKA 5E4WA 4IKHA 3UBKA 1XWCA 2JU5A 4EDYA 3TGZA 2M80A 4ISDA 3PR8A 2VL2C 1Y25A 1QGVA 5J9CA 4MH3A 2R3XA 5IMZA 3LORA 1JZDA 4ID0A 2VCQA 4F2IA 3GHAA 1BX9A 1O6JA 2EC4A 2YNXA 3C8EA 1S3CA 4XTSA 1G0TA 3ZREA 13GSA 5COHA 4G0IA 2C0DA 4ILFA 3H8QA 2R37A 1F3AA 2FD3A 3UIWA 1K0DA 5AIVA 2GZPA 3D6IA 4POBA 5HR1A 3D4MA 5GSTA 1GSDA 2GZZA 1ERTA 2B7KA 1BQ7A 4ECJA 1A2MA 5B6NA 3GMFA 2N5FA 1GTAA 5IMFA 3QFBC 4GF0A 4NXIA 1WE0A 2H76A 3FK8A 1PX6A 5A4VA 2B1KA 1GLQA 5D9TA 2WULA 1Z6NA 3FEUA 3ZZXA 4DEJA 3F4SA 3GH6A 1EOGA 5KEJA 2IPAA 5HR2A 5HR0A 1B9XC 4K9ZA 2GT5A 4KGIA 3FY7A 1QFNA 2E2GA 5ECHB 2HYXA 5IMAA 1LBKA 3CXGA 4PNGA 2B7JA 2HLSA 4PQ1A 4OO4A 1K3LA 3CSHA 2CVDA 3E0UA 1V57A 2OBKA 4DVCA 1X5CA 1YKAA 1JZWA 1SD8A 2MBTA 2WRTA 4K2DA 2VUPA 4IGJA 7GSSA 2V6OA 3ERWA 3APQA 2EIRA 2CVKA 2IFQA 5JCUA 1ZMAA 4USSA 2F9SA 2R2JA 1X9WB 1ON4A 2LNSA 3EMPA 4NV2A 5ECQB 2LKUA 3EURA 5E59A 1HNAA 4KSOA 1KBNA 2GQMA 4K6XA 3QAGA 5J9BA 1O85A 11GSA 3W8JA 1AQVA 5KN2A 2P0GA 4BL7A 2FHEA 3WYWA 4ZBBA 2KP2A 3QCPA 4PXOA 4D73A 3TJGA 4O7HA 4AJ6A 3APOA 2EIOA 1X0RA 4ZB8A 1MTCA 1W4VA 1XW9A 3IV4A 1B48A 2ZCTA 2H73A 3UAPA 3L9VA 1X9SB 5ECOB 1WIKA 2F51A 2I4AA 3F9UA 2LRNA 1V98A 1HD2A 2FWEA 1I9DA 1VF4A 5DDLA 2JSYA 3ZVJA 2LQOA 1FG4A 4L5LA 4FYUA 1GWCA 1USBA 5KN1A 2H75A 2HRKA 4JEDA 2VL3A 3L4NA 3RBTA 4BVXA 2B5XA 5A4WA 4K7NA 3WT1A 4KSMA 5DVBA 1SKWB 2R5GA 5HFGA 4MZBA 1O8WA 5IO2A 3LYPA 5EL8A 4HQZA 1M2DA 3IC8A 1URMA 2CX3A 4GWRA 4NHZA 4EVMA 1K0OA 4JBBA 4G19A 3L78A 5LCZA 4I2UA 5J5NA 4YAVA 1NM3A 1K0CA 2YWNA 2IWTA 3GL5A 4IS0A 3RDWA 3DKSA 3UBLA 1XWBA 4ECIA 3IK7A 4HU9A 4RQXA 2HI7A 1YDKA 2OE0A 1BJXA 4HOJA 2V41A 5GSSA 3UOMA 4GSTA 1TI3A 4TR3A 1IYIA 2K8SA 1AAZA 3IHQA 4HDEA 3VPQA 4JR6A 2UZ8A 1A2JA 3VWXA 4GSNA 4N30A 3VWWA 1EP8A 3IC4A 1SKSB 1VF1A 2HSMA 3ME7A 6GSTA 3GYKA 5FHIA 4EDZA 3KH9A 2GGTA 3FR9A 5JCWA 4CW9A 1T7PB 2JADA 3G7JA 2CX4A 3KTLA 2V32A 2YOIA 3R2QA 3IXRA 3L9SA 2IMKA 2H0HA 1U3AA 4OFTA 5B8BA 1G6YA 1T4YA 1THXA 4L8EA 5F07A 5D8IA 2VLUA 3IAS2 2NTOA 3I43A 1EZKA 1FB0A 1OYJA 3ERGA 1SENA 1ZOFA 4CDOA 2XPEA 3GSSA 3FR3A 2I1UA 1XFLA 2FUG2 4AJ7A 1Z3EA 1N8JA 2WFCA 4TR4A 4ZILA 4I5QA 4I2TA 2BJXA 1VGLA 2E7PA 2QGVA 2DSAA 4YQVA 3CTFA 3ZFBA 2D2ZA 1ZYQB 4JRRA 4OD7A 4BVYB 2H8LA 1CQHA 6GSVA 3J7Yk 1EWXA 3KEBA 1EOHA 2PUKC 4XS1A 3GKXA 1BG5A 2ON5A 4X1UA 3GA4A 3TKPA 16GSA 4TOPA 19GSA 9GSSA 2TRXA 1GSYA 3GNJA 5AIXA 1OE7A 3RAZA 1LU4A 3S9FA 1W89A 3RHCA 1DE1A 1GLPA 1EV4A 4QL9A 2FY6A 4J56E 4E8EA 2FWFA 2HRKB 2LQQA 2XBQA 3WD6A 4LA1A 2R6KA 1R7HA 2VCWA 4BVXB 4LLRA 2VAFA 2YWIA 3HJPA 2DJKA 4BWSA 2FLSA 3P2AA 3CRTA 1B4PA 2E2MA 3ISOA 1WOUA 3ZIJA 5JWRB 4OO5A 5ECMB 3KIJA 2HSYA 2AUVA 2YZUA 3OR5A 3GIXA 4OFMA 1FB6A 3DMLA 3I6AA 3HYPA 5CRWA 3DWVA 2HRNA 3P8WA 1XBSA 4K0NA 3WGEA 3GSTA 4GTUA 4G0KA 1TRVA 3KH7A 3ERFA 1K0NA 1O8XA 4KCAA 4WETA 2CV4A 3NZNA 1XOAA 3PINA 3GTUB 4NV5A 2PPTA 5DCHA 2OJLA 2C0EA 2NBSA 1EEMA 1ST9A 2HSMB 4MF5A 3DIEA 1WWJA 4PUFC 1M2BA 1R5AA 2DC5A 2L5LA 5D9XA 5F8BA 2GLRA 1O73A 1SYXA 2LUSA 4L0UA 3KMOA 1PA3A 3QR6A 3PPUA 1Y6EA 4XHMA 2L5OA 3DVWA 4FYBA 2MYGA 4QQ7A 1NHOA 4KNDA 1K3YA 1DE2A 1YF1A 4XIHA 4WXTA 4MPGA 1M7TA 5H5SA 4HJ2A 1UA5A 2LSTA 3D0ZA 4ULXA 1K0BA 1PRXA 1QQ2A 2WCIA 1XVQA 1T8EB 1JLVA 1SL1B 2MBSA 3GV1A 3HD5A 5G5FA 2KOKA 1J0FA 2HRFA 3D5JA 1WP0A 4ML1A 5AN1A 3CMIA 4ECCA 1A2LA 3KD0A 1TRSA 4QL7A 2GQLA 1M99A 4ZL7A 3MAKA 3KTBA 1T3BA 4DSRA 1DBYA 2V2GA 2L57A 1JZRA 1ZGNA 2I81A 5ECNB 4NMUA 2FCHA 4NPBA 5IMCA 2ALBA 4F0CA 3SWLA 1JZOA 3F6FA 3ZVJD 3EU4A 5IO0A 2VD1A 2FGXA 3VWUA 2H01A 2IMEA 5G31A 2LV3A 5G2ZA 1SL0B 4ZBDA 2JZTA 3VI5A 4FH8A 2H1DA 3HXSA 3MDKA 2LJKA 4WBRD 1HNCA 4HU7A 1NHYA 3IPZA 1HQOA 3DD3A 5DQYA 2TIRA 1ACVA 2KLXA 1SD9A 3KGKA 2NDOA 1S3DA 3ZMKA 2YANA 2XPDA 3QFAC 4CHSA 3HZ8A 2B1LA 1MDIA 4V2LA 4XS6A 2HZFA 2ZUPA 2VOCA 1YQ1A 2MZCA 4MH2A 2H1GA 4XCSA 5CYYA 3WGDA 2JL4A 2I9HA 3DYRA 4TW5A 5KN0A 5BMUA 3DVXA 4RI6A 4TVEA 3WGXA 4IELA 1A0RP 3A2WA 3Q18A 2H19A 3F0IA 3F3QA 1VF2A 3TKQA 3C71A 2N5AA 4I6XA 4KW6A 3ME8A 4KF9A 2QSIA 2HT9A 4O92A 3H4KA 2A2SA 3FHKA 3D22A 4BPYA 1FVJA 3TCOA 4N0ZA 3EU3A 3UEMA 4K7IA 4PQIA 1AXDA 1U88A 2HSNB 1GUKA 1OC3A 5DAKA 5IPHA 3LXTA 3MNGA 5IM9A 1EGOA 5L71A 4HZ2A 3KM6A 4G2EA 4ZIJA 2VL9A 1ZCPA 1A8LA 3M1GA 1SKRB 4LMWA 1YEPA 2AB6A 2VLTA 2ES7A 4H86A 2VCZA 5CREA 2H1AA 2R4VA 4BVYA 2RLIA 2K18A 1KNGA 5HQPA 3H93A 1V58A 3RHBA 5ECLB 4YH2A 1KTEA 5CRHA 2PVQA 2CVBA 2B5YA 1NW2A 2CZ2A 5G30A 4G10A 3TJFA 1OAZA 2HE3A 3A2XA 1XWGA 20GSA 5DJLA 5JWQB 1GNWA 3ED3A 1PKZA 2P5QA 4ZL8A 5ECSA 5IMDA 3F3RA 3L9UA 2DIYA 4XRDA 1XVWA 4ZB9A 5B8AA 4Q5QA 2CAQA 3APSA 2XBIA 1WJKA 4TN8A 4NHWA 3BCIA 5JCGA 3MSZA 1F37A 3IRAA 3CRUA 2RM6A 4F9ZA 4F0BA 4GRFA 2YJ7A 3PGTA 4ZBAA 1GSEA 4YAPA 5ABRA 3AY8A 3CYNA 3VFIA 4IBPA 2DIZA 1OC9A 1PGTA 4O32A 2MMNA 1THOA 3UARA 1QMVA 1SJZA 2H1BA 4ZXGA 1RW1A 3C1SA 2PMTA 2YV9A 3IBHA 4FIWA 3N5OA 2AHEA 2K9FA 3GTUA 3FZ5A 5A5KA 2VD0A 1AQXA 4MLYA 3D4TA 3VPTA 5IPGA 5LD0A 1G7EA 1XW5A 1QUWA 2DJ3A 2K6VA 4EF0A 2C4JA 2M72A 3FYGA 2KP1A 2OBIA 4KDXA 2OKAA 4LL1B 4MZCA 4LMVA 1SK0A 2C1YA 1TK8B 3LWAA 1GNEA 18GSA 1UN2A 1Z7PA 2H72A 2LRCA 3TDGA 5EY6A 3P7XA 1ERWA 4EE0A 4HUAA 5IIZA 2VO4A 3C7MA 1TTZA 2PU9C 1TDIA 2N5BA 3NOFA 2DJ2A 3GX0A 4MK3A 1C72A 3ZIVA 5HFKA 2FWHA 1X5DA 5DAKB 1SL2B 5D9VA 3M3MA 2I3YA 4K7OA 3F4RA 4IP1A 2QC7A 3U6VA 3QMXA 4KDYA 3F6DA 14GSA 1M2AA 5D73A 2EIQA 4MJAA 1RK4A 3TOTA 3ZRDA 4EC0A 3TJBA 2DMLA 4WF4A 2VCVA 3FKFA 4YQUA 4V2NA 2G2QA 1SYRA 3J7Yb 4N0VA 4TKYA 3I9V2 3LSZA 4WBJA 5DCGA 2REMA 1A8YA 5ECIB 4AGSA 1TXXA 3DEXA 3GKNA 3A3TA 1E2YA 4EL1A 5DQSA 2RIIA 5ECPB 3FRCA 3LXZA 5IQYA 4E8HA 4F82A 1TJDA 1FVKA 3UMAA 5B6MA 5CRDA 2WGRA 3E3EA 2M46A 3HCZA 1F9MA 3BCKA 4LL4B 2FA8A 2GSQA 4TRXA 3KZQA 3V1WA 1H4OA 1CQGA 2YP6A 6GSSA 2CZ3A 1GL8A 3HJMA 1EGRA 4P3YB 1UVZA 3FZAA 3TRPA 4DSSA 2H6ZA 1J9BA 3W6GA 5DALA 2XHFA 1XW6A 4ECBA 2IN3A 3IA1A 3P90A 2C0GA 1OC9B 1F3BA 3R3EA 3IDVA 8GSSA 2GSSA 1PL2A 4IW9A 3O76A 2WJUA 3VLNA 1GSFA 2IMDA 5D96A 4G0LA 2IMFA 4FQUA 3TKRA 1TU7A 3FZ4A 2YCDA 3EYTA 1UC7A 1SJ6A 2XC2A 1DUGA 1GTIA 1RQMA 3EE2A 2GS3A 1FW1A 2H6YA 2WB9A 2NPBA 4WF5A 3HZ4A 1GH2A 1B4QA 3VK9A 4J2FA 3TKSE 4HI7A 4O5RA 2DJJA 1B9YC 1TU8A 5F06A 1KEBA 4EO3A 2LJRA 1IYHA 4Q5FA 1VF3A 1TK0B 2C0FA 2GZYA 1X5EA 5C00A 1TK5B 4GCIA 2WZ9A 3TJJA 5INYA 1O7UA 4G9HA 1PKWA 4PX1A 3QAVA 3M8NA 1Z6MA 1K0AA 3CBUA 5J4UA 3H79A 1U87A 4PUAA 2H0GA 2CT6A 2F3MA 4MMMA 3EWLA 3GRXA 5B7CA 1TOFA 1ERUA 4YQMA 1MEKA 4OCFA 12GSA 5J41A 4PTSA 4TR1A 4I97A 3F4TA 2JACA 1WRYA 5HFIA 3GFKA 1MDJA 1MD4A 2YWOA 3G9BA 5D9WA 2HNLA 3IR4A 1N2AA 2MMZA 4AF2A 2CQ9A 4BWQA 1K0MA 4GSSA 2OE3A 3KMNA 2VIMA 4IJ3A 2J23A 4I8BA 4K1FA 1NSWA 2FWGA 2K8VA 4WKWA 1H75A
chains in the Genus database with same CATH superfamily
1E6BA 1ZZYA 1V40A 4WR4A 5KOXA 2A4VA 2RUEA 3TU3B 3SBCA 2JZSA 3H1NA 4POLA 4MDCA 3TRXA 1EEJA 3GL3A 3GUSA 3PH9A 1XIYA 4AJ8A 1PX7A 1TP9A 4POMA 3GX8A 4W66A 1TKDB 1AC1A 1FO5A 4PQHA 2OA7A 1ML6A 5J3RA 2O7KA 3VWVA 4XRAA 1ERVA 3FR6A 2B6MA 4OMVA 1J08A 5FT3A 2L59A 4FYCA 1OKDA 3KXOA 1Q4JA 1GUHA 3CSIA 3A2VA 3LGCA 3RPPA 4DSSB 2P31A 1ILOA 2VLVA 5DALB 4EKZA 1GTUA 3FW2A 5G1LA 2VM2A 5EPFA 4IQAA 5ELGA 2OACA 2CA8A 1SK2A 3CSJA 1I5GA 3F63A 4A5PA 1WPIA 4J57E 2H70A 2P5RA 2GSTA 5DJMA 1TRWA 4XS4B 3CTGA 2LJAA 1QXHA 2GVPA 2VCXA 3L0HA 5KN3A 2OADA 3LJRA 1A24A 4V2MA 2LS5A 2IIYA 3HHVA 5CO3A 5H5RA 4GQCA 4NWYA 4KA0A 4IP6A 2OT3A 4ICYA 3HJOA 1K3OA 1V2AA 1HYUA 4G01A 3UVHA 2BTOT 3QAWA 3I69A 4AI6A 5ENUA 1BAYA 2O85A 1JHBA 1HNBA 1GTBA 1PD21 4F03A 3FZ9A 4JR4A 4Z7XA 4V1Ag 5GAPD 3U5RE 1PQNA 5C04A 2J9HA 3K8NA 2BMXA 1YY7A 3MWHA 1YJ6A 6GSWA 2FA4A 6GSXA 1A0FA 1B8XA 3M0FA 3VI7A 5A5HB 4K0GA 3QPMA 3HKRA 1LJRA 2YV7A 3TUEA 2LRTA 5AGYA 1R4WA 2X8CA 4TR1B 1PSQA 2PWJA 2IMIA 2YZHA 17GSA 5F0GA 1T00A 4N10A 2YPMA 1M0UA 3M9JA 1GULA 2H6XA 2DJ1A 1FHEA 2YJHA 2C3NA 2RUFA 1PL1A 2X49A 1YZXA 5ELAA 2TRCP 3D21A 5EVOA 2DMMA 4MP4A 2V6KA 1OC8A 4X43A 1BEDA 5J47A 2WS2A 2PGTA 3BJ5A 2LEGA 2DBCA 5F05A 4BA7A 3IAM2 3TRQA 5ECKB 2DJ0A 1S3AA 2RM5A 3HY2A 1O81A 2IJYA 1YF0A 4GDFA 1T1VA 5GAND 5A34B 3UVTA 3G7IA 1G7OA 2GQKA 4OFNA 5A4UA 2JSZA 3US3A 3LG6A 1R26A 4WEYA 1MDKA 2MMAA 3GN3A 2E0QA 2LTKA 3KCMA 5JWOB 4L0WA 1T4ZA 4RI7A 5FWGA 2H71A 2H74A 1GP1A 5CP1A 3DRNA 2KUCA 1EP7A 3ZL5A 1DSBA 3EVIA 4TXOA 5H5QA 3HVXA 3CQFA 2B3SA 3EINA 4MF6A 3QDNA 2HQTA 3TKSA 2VM1A 5HR3A 4L5OA 1AW9A 3GKMA 4K8MA 3KJYA 1U6TA 2NVLA 1VRSD 1ZYEA 2LNTA 1Z5YE 4PURA 5GZZB 4RUVA 3KP9A 1AQWA 5AISA 2C3TA 4IN0A 1U3IA 3ZITA 4KE3A 4MZWA 3ZYWA 5ID2A 5KOWA 3BBYA 4PNFA 2VCTA 2Z9SA 3QD9A 1SJIA 4MA9A 2FNOA 4MJEA 2GTUA 4MJCA 1BYEA 2A2RA 4OCEA 3JCML 3HVSA 3ZTLA 4PI2C 2X8HA 2X64A 3DGQA 2IFQB 4EUYA 2HZEA 1A23A 3C1RA 1AIUA 1XOBA 2AAWA 2EFHA 1GSUA 4HS1A 3LEFA 5IOXA 4CY6A 3TOUA 2PVOC 1R5PA 4CY8A 4Q5NA 4WR5A 3F8UA 1XWKA 1F2EA 4HJMA 3E9JB 2H30A 2AV4A 4ZL9A 4BL7B 1X9MB 1EV9A 10GSA 4TXVA 4ACSA 3ZMLA 2C8UA 4GLTA 4D73B 3TB2A 3HVVA 1AUCA 1SU9A 2X8GA 3LYKA 5D93A 1XXUA 4JE1A 1QK8A 1JLWA 4ML6A 2GSRA 1PN9A 2GT6A 4JZQA 3O6TA 2UV8G 2ON7A 4FXYP 2PN8A 4IHUA 3BD2A 2AJQB 4KUNA 3UJ1A 3QOUA 3TKSC 2YN1A 1XG8A 1OE8A 4HEA2 3ZLPA 2IL3A 5ECRB 4PHZC 2F8AA 1F6MC 2GDRA 3HA9A 3Q6OA 4HSCX 2DLXA 4EXJA 2G0FA 5LNKe 3W8SA 2F8FA 4Q5RA 4MABA 3Q19A 4KH7A 4KX4A 2MMOA 1M9AA 2HFDA 4V1Ap 3HDCA 2AYTA 1XZOA 1GSQA 2QKEA 2L6DA 5CAXA 2JZRA 4PI0C 1YKCA 4IQ1A 4KAEA 1Z9HA 4GXZA 4MCUA 3M9KA 2B5EA 2HSHA 3IE3A 3Q74A 1MD3A 4TR0A 1YEXA 4QMKA 1XWAA 1Q98A 2QA2A 4XS4A 2PERA 4ZB6A 4HZ4A 1GSSA 5G5EA 5A1NB 4IVFA 2VL2A 1ZL9A 2C80A 2V1MA 2L4QA 4MPFA 2WDUA 3ZFLA 4TXOB 1GUMA 4NAXA 4FO5A 5CRGA 2OE1A 1TRUA 22GSA 4MF7A 6GSYA 2ZNMA 3IOSA 2L6CA 3BOAA 3EC3A 2C3QA 2O8VB 2HXKA 3TJKA 4KDUA 1FOVA 2PBJA 1V9WA 3LQ7A 1OVNA 5ID2B 3G7YA 3LFLA 2O87A 3RPNA 3O3TA 5CNWA 3GURA 3GH9A 3VURA 1M9BA 3CWGA 6GSUA 2R0CA 4EIPA 2YWMA 1PMTA 4DSQA 3GKKA 5DBQA 1XPVA 1TI1A 4OWYA 4RQRA 4X0XA 1FAAA 5A5HA 4JU5A 1OKTA 2O89A 4MJBA 3DXBA 2HZEB 1Z7RA 4IJIA 1XCCA 3IK9A 3NIVA 4KB3A 3UL3A 3EMXA 2KHPA 1ABAA 2HRAA 3C73A 1PFOA 2L4CA 3WT2A 1G6WA 5IMVA 1JFUA 1N25A 2H66A 5G1KA 4PGTA 4N11A 1WMJA 3N9JA 5IOWA 1S3RA 2H0IA 2CAIA 4HQSA 1TW9A 1GRXA 3KP8A 4KCEA 4GQFA 2X99A 1SVMA 3A5WA 1SK1A 4POKA 5E4WA 4IKHA 3UBKA 1XWCA 4BIKA 2JU5A 4EDYA 3TGZA 2M80A 4ISDA 3PR8A 2VL2C 1Y25A 1QGVA 5J9CA 4AKGA 4MH3A 2R3XA 2WW2A 5IMZA 3LORA 1JZDA 4ID0A 2VCQA 4F2IA 3GHAA 1BX9A 1O6JA 2EC4A 5A34A 2YNXA 3C8EA 1S3CA 4XTSA 1G0TA 3ZREA 13GSA 5COHA 4G0IA 2C0DA 2R0PA 4ILFA 3H8QA 2R37A 1F3AA 2FD3A 3UIWA 1S4BP 1K0DA 5AIVA 2GZPA 3D6IA 4POBA 5HR1A 3D4MA 4K2XA 5GSTA 1GSDA 2GZZA 1ERTA 2B7KA 1BQ7A 4ECJA 1A2MA 5B6NA 3GMFA 2N5FA 1GTAA 5IMFA 3QFBC 3HMJG 4GF0A 4NXIA 1WE0A 2H76A 3FK8A 1PX6A 5A4VA 2B1KA 1GLQA 5D9TA 2WULA 1Z6NA 3FEUA 3ZZXA 4DEJA 3F4SA 3GH6A 1EOGA 5KEJA 2IPAA 5HR2A 5HR0A 1B9XC 4AKXB 3IHGA 4K9ZA 2GT5A 4KGIA 3FY7A 1QFNA 2E2GA 5ECHB 2HYXA 5IMAA 1LBKA 3CXGA 4PNGA 2B7JA 2HLSA 4PQ1A 4OO4A 1K3LA 3CSHA 2CVDA 3E0UA 1V57A 2OBKA 2O3EA 4DVCA 1X5CA 4O5UA 1YKAA 1JZWA 1SD8A 2MBTA 2WRTA 4K2DA 2VUPA 4IGJA 7GSSA 2V6OA 3ERWA 3APQA 2EIRA 2CVKA 2IFQA 5JCUA 1ZMAA 4USSA 2F9SA 2R2JA 1X9WB 1ON4A 2LNSA 3EMPA 4NV2A 5ECQB 2LKUA 3EURA 5E59A 1HNAA 4KSOA 1KBNA 2GQMA 4K6XA 3QAGA 5J9BA 1O85A 11GSA 3W8JA 1AQVA 5KN2A 2P0GA 4BL7A 2FHEA 3WYWA 4AKIA 4ZBBA 2KP2A 3QCPA 4PXOA 4D73A 3TJGA 4O7HA 4AJ6A 3APOA 2EIOA 1X0RA 4ZB8A 1MTCA 1W4VA 1XW9A 3IV4A 1B48A 2ZCTA 2H73A 3UAPA 3L9VA 1X9SB 1PN0A 5ECOB 1WIKA 2F51A 2I4AA 3F9UA 2LRNA 1V98A 1HD2A 2FWEA 1I9DA 1VF4A 5DDLA 2JSYA 3ZVJA 2LQOA 1FG4A 4L5LA 4FYUA 1GWCA 1USBA 5KN1A 1SVLA 2H75A 2HRKA 4JEDA 2VL3A 3L4NA 3RBTA 4BVXA 2B5XA 5A4WA 2O36A 4K7NA 3WT1A 4KSMA 5DVBA 1SKWB 2R5GA 5HFGA 4MZBA 1O8WA 5IO2A 3LYPA 3RFRC 5EL8A 2VKZG 4HQZA 1M2DA 3IC8A 1URMA 2CX3A 3MYDA 4GWRA 4NHZA 4EVMA 1K0OA 1I1IP 4JBBA 4G19A 3L78A 5LCZA 4I2UA 5J5NA 4YAVA 5A1NA 1K0CA 1NM3A 2YWNA 2IWTA 3GL5A 4IS0A 3RDWA 3DKSA 4Z2TA 3UBLA 1XWBA 4ECIA 3IK7A 4HU9A 4RQXA 2HI7A 1YDKA 2OE0A 1BJXA 4HOJA 2V41A 5GSSA 3UOMA 4GSTA 1TI3A 4TR3A 1IYIA 2K8SA 4EIQA 1AAZA 3IHQA 4HDEA 3VPQA 4JR6A 2UZ8A 1A2JA 3VWXA 4GSNA 4N30A 3VWWA 1EP8A 3IC4A 1SKSB 1VF1A 2HSMA 3ME7A 6GSTA 3GYKA 5FHIA 4EDZA 3KH9A 2GGTA 3FR9A 5JCWA 4CW9A 1T7PB 2JADA 3G7JA 3EPTA 2CX4A 3KTLA 2V32A 2YOIA 3R2QA 3IXRA 3L9SA 2IMKA 2H0HA 1U3AA 1M3IA 4OFTA 5B8BA 1G6YA 1T4YA 1THXA 4L8EA 5F07A 5D8IA 2VLUA 3IAS2 2NTOA 3I43A 1EZKA 1FB0A 1OYJA 3ERGA 1SENA 4K5RA 1ZOFA 4CDOA 2XPEA 3GSSA 3FR3A 2I1UA 1XFLA 2FUG2 4AJ7A 1Z3EA 1N8JA 2WFCA 4Z2RA 4TR4A 4ZILA 4I5QA 4I2TA 2BJXA 1VGLA 2E7PA 2QGVA 2DSAA 4YQVA 3CTFA 3ZFBA 2D2ZA 1ZYQB 4JRRA 4OD7A 3FMWA 4BVYB 2H8LA 1CQHA 6GSVA 3J7Yk 1EWXA 3MIXA 3KEBA 1EOHA 2PUKC 4XS1A 3GKXA 1BG5A 1BF5A 2ON5A 4X1UA 3GA4A 3TKPA 16GSA 4TOPA 19GSA 2WW0A 9GSSA 2TRXA 1FOHA 1GSYA 3GNJA 5AIXA 1OE7A 3RAZA 1LU4A 3S9FA 1W89A 3RHCA 1DE1A 1GLPA 1EV4A 4QL9A 2FY6A 4J56E 4E8EA 2FWFA 2HRKB 2LQQA 2XBQA 3WD6A 4LA1A 2R6KA 1R7HA 2VCWA 4BVXB 4LLRA 2VAFA 2YWIA 3HJPA 4N3ZA 2DJKA 4BWSA 2FLSA 3P2AA 3CRTA 1B4PA 2E2MA 3ISOA 1WOUA 3ZIJA 5JWRB 4OO5A 5ECMB 3KIJA 2HSYA 4YKGA 2AUVA 2YZUA 3OR5A 3GIXA 4OFMA 1FB6A 3DMLA 3I6AA 3HYPA 5CRWA 3DWVA 2HRNA 3P8WA 1XBSA 4K0NA 5J40A 3WGEA 3GSTA 4GTUA 4G0KA 1TRVA 3KH7A 2WVXA 2WVZA 3ERFA 4X4JA 1K0NA 4Z2UA 1O8XA 4KCAA 4WETA 2CV4A 3NZNA 1XOAA 3PINA 2EFEA 3GTUB 4NV5A 2PPTA 5DCHA 2OJLA 2C0EA 2NBSA 1EEMA 1BG1A 1ST9A 2HSMB 4MF5A 3DIEA 1WWJA 4PUFC 1M2BA 1R5AA 2DC5A 1YEWC 2L5LA 5D9XA 5F8BA 2GLRA 1O73A 1SYXA 2HSNA 2LUSA 4L0UA 3KMOA 1PA3A 3QR6A 3PPUA 1Y6EA 4XHMA 2L5OA 3DVWA 4FYBA 2MYGA 4QQ7A 1NHOA 4KNDA 1K3YA 1DE2A 1YF1A 4XIHA 4WXTA 4MPGA 1M7TA 5H5SA 4HJ2A 1UA5A 2LSTA 3D0ZA 4ULXA 1K0BA 1PRXA 1QQ2A 2WCIA 4K5SA 1XVQA 1T8EB 2O5VA 1JLVA 1SL1B 2MBSA 3GV1A 3HD5A 5G5FA 2KOKA 1J0FA 2HRFA 3D5JA 1WP0A 4ML1A 5AN1A 3CMIA 4ECCA 1A2LA 3KD0A 1TRSA 4QL7A 2GQLA 1M99A 4ZL7A 3MAKA 3KTBA 1T3BA 4DSRA 1DBYA 2V2GA 2L57A 1JZRA 1ZGNA 2I81A 5ECNB 4NMUA 2FCHA 4NPBA 5IMCA 2ALBA 4F0CA 3SWLA 2X4AA 1JZOA 3F6FA 3ZVJD 3EU4A 5IO0A 2VD1A 2FGXA 3VWUA 2H01A 2IMEA 5G31A 2LV3A 5G2ZA 1SL0B 4ZBDA 2JZTA 3VI5A 4FH8A 2H1DA 3HXSA 3MDKA 2LJKA 4WBRD 1TXUA 1HNCA 4HU7A 1NHYA 3IPZA 1HQOA 3DD3A 5DQYA 2TIRA 1ACVA 2KLXA 1SD9A 3KGKA 2NDOA 1S3DA 3ZMKA 2YANA 2XPDA 3QFAC 4CHSA 3HZ8A 2B1LA 2H1LA 1MDIA 4V2LA 4XS6A 2HZFA 2ZUPA 2VOCA 1YQ1A 2MZCA 4MH2A 2H1GA 2DKIA 4XCSA 5CYYA 3WGDA 2JL4A 2I9HA 3DYRA 5J4VA 4TW5A 5KN0A 2WW1A 5BMUA 3DVXA 4RI6A 4TVEA 3WGXA 2WVYA 2WVXB 4IELA 1A0RP 3A2WA 3Q18A 2H19A 3F0IA 3F3QA 1VF2A 3TKQA 3C71A 2N5AA 4I6XA 4KW6A 3ME8A 4KF9A 2QSIA 2HT9A 4O92A 3H4KA 2A2SA 3FHKA 5BRTA 3D22A 4BPYA 1FVJA 3TCOA 4N0ZA 3EU3A 3UEMA 4K7IA 4PQIA 1AXDA 1U88A 2HSNB 1GUKA 3CHXC 1OC3A 5DAKA 5IPHA 3LXTA 3MNGA 5IM9A 1EGOA 5L71A 4HZ2A 3KM6A 4G2EA 3HVNA 4ZIJA 2VL9A 1ZCPA 1A8LA 3M1GA 1SKRB 1SVOA 4LMWA 1YEPA 2AB6A 2VLTA 2ES7A 4H86A 2VCZA 5CREA 2H1AA 2R4VA 4BVYA 2RLIA 2EFDA 1YVLA 2K18A 1KNGA 5HQPA 3H93A 1V58A 3RHBA 5ECLB 4YH2A 1KTEA 5CRHA 2PVQA 2CVBA 2B5YA 1NW2A 2CZ2A 5G30A 4G10A 3TJFA 1OAZA 2HE3A 3A2XA 1XWGA 20GSA 5DJLA 5JWQB 1GNWA 3ED3A 1PKZA 2P5QA 4ZL8A 5ECSA 5IMDA 3F3RA 3L9UA 2DIYA 4XRDA 1XVWA 4ZB9A 5B8AA 4Q5QA 2CAQA 3APSA 2XBIA 1WJKA 4TN8A 4NHWA 3BCIA 5JCGA 3MSZA 1F37A 3IRAA 3CRUA 2RM6A 4F9ZA 4F0BA 4GRFA 2YJ7A 3PGTA 4ZBAA 1GSEA 4YAPA 5ABRA 3AY8A 3CYNA 3VFIA 4IBPA 2DIZA 1OC9A 1PGTA 4O32A 2MMNA 1THOA 3UARA 1QMVA 1SJZA 2H1BA 2R0GA 4ZXGA 1RW1A 3C1SA 2PMTA 2YV9A 3IBHA 4FIWA 3N5OA 2AHEA 2K9FA 3GTUA 3FZ5A 5A5KA 2VD0A 1AQXA 2DKHA 4MLYA 3D4TA 3VPTA 5IPGA 5LD0A 1G7EA 1XW5A 1QUWA 5BMUB 2DJ3A 2K6VA 4EF0A 2C4JA 2M72A 3FYGA 4AKHA 2KP1A 2OBIA 4KDXA 2OKAA 4LL1B 4MZCA 4LMVA 1SK0A 2C1YA 1TK8B 3LWAA 1GNEA 18GSA 4E68A 1UN2A 1Z7PA 2H72A 2LRCA 3TDGA 5EY6A 3P7XA 1ERWA 4EE0A 4HUAA 5IIZA 2VO4A 3C7MA 1TTZA 2PU9C 1M3JA 1TDIA 2N5BA 3NOFA 2DJ2A 3GX0A 4MK3A 1Y1UA 1C72A 3ZIVA 5HFKA 2FWHA 1X5DA 5DAKB 1SL2B 5D9VA 3M3MA 2I3YA 4K7OA 3F4RA 4IP1A 2QC7A 3U6VA 3QMXA 4KDYA 3F6DA 14GSA 1M2AA 5D73A 2EIQA 4MJAA 1RK4A 3TOTA 3ZRDA 4EC0A 3TJBA 2DMLA 4WF4A 4YKFA 2VCVA 3FKFA 4YQUA 4V2NA 2G2QA 1SYRA 2A4HA 3J7Yb 4N0VA 4TKYA 3I9V2 3LSZA 4WBJA 2QA1A 5DCGA 2REMA 1A8YA 5ECIB 4AGSA 1TXXA 3DEXA 3GKNA 3A3TA 1E2YA 4EL1A 5DQSA 2RIIA 5ECPB 3FRCA 3LXZA 2WZSA 5IQYA 4E8HA 4F82A 1TJDA 1FVKA 3UMAA 5B6MA 5CRDA 2WGRA 3E3EA 2M46A 3HCZA 1F9MA 3BCKA 4LL4B 2FA8A 2GSQA 1ZYNA 4TRXA 3KZQA 3V1WA 1H4OA 1CQGA 2YP6A 6GSSA 2CZ3A 1GL8A 3HJMA 1EGRA 4P3YB 2A2PA 1UVZA 3FZAA 3TRPA 4DSSA 2H6ZA 1J9BA 3W6GA 5DALA 2XHFA 1XW6A 4ECBA 2IN3A 3IA1A 4MNNA 3LW9A 3P90A 2C0GA 1OC9B 1F3BA 3R3EA 3IDVA 8GSSA 2GSSA 5J4YA 1PL2A 4IW9A 3O76A 2WJUA 3VLNA 1GSFA 2IMDA 5D96A 4G0LA 2IMFA 4FQUA 3TKRA 1TU7A 3FZ4A 2YCDA 3EYTA 1UC7A 1SJ6A 2XC2A 1DUGA 1GTIA 1RQMA 3EE2A 2GS3A 1FW1A 2H6YA 2WB9A 2NPBA 1ZYPA 4WF5A 3HZ4A 1GH2A 1B4QA 3VK9A 3RGBC 4J2FA 3TKSE 4HI7A 2WW3A 4O5RA 2DJJA 1B9YC 1TU8A 5F06A 1KEBA 4EO3A 2LJRA 1IYHA 4Q5FA 1VF3A 1TK0B 2C0FA 2GZYA 1X5EA 5C00A 1TK5B 4GCIA 2WZ9A 3TJJA 5INYA 1O7UA 4G9HA 1PKWA 4PX1A 3QAVA 3M8NA 1Z6MA 1K0AA 3CBUA 5J4UA 3H79A 1U87A 4PUAA 2H0GA 2CT6A 2F3MA 4MMMA 3EWLA 3GRXA 5B7CA 1TOFA 1ERUA 4YQMA 1MEKA 4OCFA 12GSA 5J41A 4PTSA 4TR1A 4I97A 3F4TA 2JACA 4O5QA 1WRYA 3A5IA 5HFIA 3GFKA 1MDJA 1MD4A 2YWOA 3G9BA 5D9WA 2HNLA 3IR4A 1N2AA 2MMZA 4AF2A 4ZB7A 2CQ9A 4BWQA 1K0MA 4GSSA 2OE3A 3KMNA 2VIMA 4IJ3A 2J23A 4I8BA 4K1FA 2EFCA 1NSWA 2FWGA 2K8VA 4WKWA 1H75A
chains in the Genus database with same CATH topology
1E6BA 1ZZYA 1V40A 4WR4A 5KOXA 2A4VA 2RUEA 3TU3B 3SBCA 2JZSA 3H1NA 4POLA 4MDCA 3TRXA 1EEJA 3GL3A 3GUSA 3PH9A 1XIYA 4AJ8A 1PX7A 1TP9A 4POMA 3GX8A 4W66A 1TKDB 1AC1A 1FO5A 4PQHA 2OA7A 1ML6A 5J3RA 2O7KA 3VWVA 4XRAA 1ERVA 3FR6A 2B6MA 4OMVA 1J08A 5FT3A 2L59A 4FYCA 1OKDA 3KXOA 1Q4JA 1GUHA 3CSIA 3A2VA 3LGCA 3RPPA 4DSSB 2P31A 1ILOA 2VLVA 5DALB 4EKZA 1GTUA 3FW2A 5G1LA 2VM2A 5EPFA 4IQAA 5ELGA 2OACA 2CA8A 1SK2A 3CSJA 1I5GA 3F63A 4A5PA 1WPIA 4J57E 2H70A 2P5RA 2GSTA 5DJMA 1TRWA 4XS4B 3CTGA 2LJAA 1QXHA 2GVPA 2VCXA 3L0HA 5KN3A 2OADA 3LJRA 1A24A 4V2MA 2LS5A 2IIYA 3HHVA 5CO3A 5H5RA 4GQCA 4NWYA 4KA0A 4IP6A 2OT3A 4ICYA 3HJOA 1K3OA 1V2AA 1HYUA 4G01A 3UVHA 2BTOT 3QAWA 3I69A 4AI6A 5ENUA 1BAYA 2O85A 1JHBA 1HNBA 1GTBA 1PD21 4F03A 3FZ9A 4JR4A 4Z7XA 4V1Ag 5GAPD 3U5RE 1PQNA 5C04A 2J9HA 3K8NA 2BMXA 1YY7A 3MWHA 1YJ6A 6GSWA 2FA4A 6GSXA 1A0FA 1B8XA 3M0FA 3VI7A 5A5HB 4K0GA 3QPMA 3HKRA 1LJRA 2YV7A 3TUEA 2LRTA 5AGYA 1R4WA 2X8CA 4TR1B 1PSQA 2PWJA 2IMIA 2YZHA 17GSA 5F0GA 1T00A 4N10A 2YPMA 1M0UA 3M9JA 1GULA 2H6XA 2DJ1A 1FHEA 2YJHA 2C3NA 2RUFA 1PL1A 2X49A 1YZXA 5ELAA 2TRCP 3D21A 5EVOA 2DMMA 4MP4A 2V6KA 1OC8A 4X43A 1BEDA 5J47A 2WS2A 2PGTA 3BJ5A 2LEGA 2DBCA 5F05A 4BA7A 3IAM2 3TRQA 5ECKB 2DJ0A 1S3AA 2RM5A 3HY2A 1O81A 2IJYA 1YF0A 4GDFA 1T1VA 5GAND 5A34B 3UVTA 3G7IA 1G7OA 2GQKA 4OFNA 5A4UA 2JSZA 3US3A 3LG6A 1R26A 4WEYA 1MDKA 2MMAA 3GN3A 2E0QA 2LTKA 3KCMA 5JWOB 4L0WA 1T4ZA 4RI7A 5FWGA 2H71A 2H74A 1GP1A 5CP1A 3DRNA 2KUCA 1EP7A 3ZL5A 1DSBA 3EVIA 4TXOA 5H5QA 3HVXA 2B3SA 3EINA 4MF6A 3QDNA 2HQTA 3TKSA 2VM1A 5HR3A 4L5OA 1AW9A 3GKMA 4K8MA 3KJYA 1U6TA 2NVLA 1VRSD 1ZYEA 2LNTA 1Z5YE 4PURA 5GZZB 4RUVA 3KP9A 1AQWA 5AISA 2C3TA 4IN0A 1U3IA 3ZITA 4KE3A 4MZWA 3ZYWA 5ID2A 5KOWA 3BBYA 4PNFA 2VCTA 2Z9SA 3QD9A 1SJIA 4MA9A 2FNOA 4MJEA 2GTUA 4MJCA 1BYEA 2A2RA 4OCEA 3JCML 3HVSA 3ZTLA 2X8HA 2X64A 3DGQA 2IFQB 4EUYA 2HZEA 1A23A 3C1RA 1AIUA 1XOBA 2AAWA 2EFHA 1GSUA 4HS1A 3LEFA 5IOXA 4CY6A 3TOUA 2PVOC 1R5PA 4CY8A 4Q5NA 4WR5A 3F8UA 1XWKA 1F2EA 4HJMA 3E9JB 2H30A 2AV4A 4ZL9A 4BL7B 1X9MB 1EV9A 10GSA 4TXVA 4ACSA 3ZMLA 2C8UA 4GLTA 4D73B 3TB2A 3HVVA 1AUCA 1SU9A 2X8GA 3LYKA 5D93A 1XXUA 4JE1A 1QK8A 1JLWA 4ML6A 2GSRA 1PN9A 2GT6A 4JZQA 3O6TA 2UV8G 2ON7A 2PN8A 4IHUA 3BD2A 2AJQB 4KUNA 3UJ1A 3QOUA 3TKSC 2YN1A 1OE8A 4HEA2 3ZLPA 2IL3A 5ECRB 2F8AA 1F6MC 2GDRA 3HA9A 3Q6OA 2DLXA 4EXJA 2G0FA 5LNKe 3W8SA 2F8FA 4Q5RA 4MABA 3Q19A 4KH7A 4KX4A 2MMOA 1M9AA 2HFDA 4V1Ap 3HDCA 2AYTA 1XZOA 1GSQA 2QKEA 2L6DA 5CAXA 2JZRA 1YKCA 4IQ1A 4KAEA 1Z9HA 4GXZA 4MCUA 3M9KA 2B5EA 2HSHA 3IE3A 3Q74A 1MD3A 4TR0A 1YEXA 4QMKA 1XWAA 1Q98A 2QA2A 4XS4A 2PERA 4ZB6A 4HZ4A 1GSSA 5G5EA 5A1NB 4IVFA 2VL2A 1ZL9A 2C80A 2V1MA 2L4QA 4MPFA 2WDUA 3ZFLA 4TXOB 1GUMA 4NAXA 4FO5A 5CRGA 2OE1A 1TRUA 22GSA 4MF7A 6GSYA 2ZNMA 3IOSA 2L6CA 3BOAA 3EC3A 2C3QA 2O8VB 2HXKA 3TJKA 4KDUA 1FOVA 2PBJA 1V9WA 3LQ7A 1OVNA 5ID2B 3G7YA 3LFLA 2O87A 3RPNA 3O3TA 5CNWA 3GURA 3GH9A 3VURA 1M9BA 3CWGA 6GSUA 2R0CA 4EIPA 2YWMA 1PMTA 4DSQA 3GKKA 5DBQA 1XPVA 1TI1A 4OWYA 4RQRA 4X0XA 1FAAA 5A5HA 4JU5A 1OKTA 2O89A 4MJBA 3DXBA 2HZEB 1Z7RA 4IJIA 1XCCA 3IK9A 3NIVA 4KB3A 3UL3A 3EMXA 2KHPA 1ABAA 2HRAA 3C73A 2L4CA 3WT2A 1G6WA 5IMVA 1JFUA 1N25A 2H66A 5G1KA 4PGTA 4N11A 1WMJA 3N9JA 5IOWA 2H0IA 2CAIA 4HQSA 1TW9A 1GRXA 3KP8A 4KCEA 4GQFA 2X99A 1SVMA 3A5WA 1SK1A 4POKA 5E4WA 4IKHA 3UBKA 1XWCA 2JU5A 4EDYA 3TGZA 2M80A 4ISDA 3PR8A 2VL2C 1Y25A 1QGVA 5J9CA 4AKGA 4MH3A 2R3XA 5IMZA 3LORA 1JZDA 4ID0A 2VCQA 4F2IA 3GHAA 1BX9A 1O6JA 2EC4A 5A34A 2YNXA 3C8EA 1S3CA 4XTSA 1G0TA 3ZREA 13GSA 5COHA 4G0IA 2C0DA 2R0PA 4ILFA 3H8QA 2R37A 1F3AA 2FD3A 3UIWA 1K0DA 5AIVA 2GZPA 3D6IA 4POBA 5HR1A 3D4MA 4K2XA 5GSTA 1GSDA 2GZZA 1ERTA 2B7KA 1BQ7A 4ECJA 1A2MA 5B6NA 3GMFA 2N5FA 1GTAA 5IMFA 3QFBC 3HMJG 4GF0A 4NXIA 1WE0A 2H76A 3FK8A 1PX6A 5A4VA 2B1KA 1GLQA 5D9TA 2WULA 1Z6NA 3FEUA 3ZZXA 4DEJA 3F4SA 3GH6A 1EOGA 5KEJA 2IPAA 5HR2A 5HR0A 1B9XC 4AKXB 3IHGA 4K9ZA 2GT5A 4KGIA 3FY7A 1QFNA 2E2GA 5ECHB 2HYXA 5IMAA 1LBKA 3CXGA 4PNGA 2B7JA 2HLSA 4PQ1A 4OO4A 1K3LA 3CSHA 2CVDA 3E0UA 1V57A 2OBKA 4DVCA 1X5CA 4O5UA 1YKAA 1JZWA 1SD8A 2MBTA 2WRTA 4K2DA 2VUPA 4IGJA 7GSSA 2V6OA 3ERWA 3APQA 2EIRA 2CVKA 2IFQA 5JCUA 1ZMAA 4USSA 2F9SA 2R2JA 1X9WB 1ON4A 2LNSA 3EMPA 4NV2A 5ECQB 2LKUA 3EURA 5E59A 1HNAA 4KSOA 1KBNA 2GQMA 4K6XA 3QAGA 5J9BA 1O85A 11GSA 3W8JA 1AQVA 5KN2A 2P0GA 4BL7A 2FHEA 3WYWA 4AKIA 4ZBBA 2KP2A 3QCPA 4PXOA 4D73A 3TJGA 4O7HA 4AJ6A 3APOA 2EIOA 1X0RA 4ZB8A 1MTCA 1W4VA 1XW9A 3IV4A 1B48A 2ZCTA 2H73A 3UAPA 3L9VA 1X9SB 1PN0A 5ECOB 1WIKA 2F51A 2I4AA 3F9UA 2LRNA 1V98A 1HD2A 2FWEA 1I9DA 1VF4A 5DDLA 2JSYA 3ZVJA 2LQOA 1FG4A 4L5LA 4FYUA 1GWCA 1USBA 5KN1A 1SVLA 2H75A 2HRKA 4JEDA 2VL3A 3L4NA 3RBTA 4BVXA 2B5XA 5A4WA 4K7NA 3WT1A 4KSMA 5DVBA 1SKWB 2R5GA 5HFGA 4MZBA 1O8WA 5IO2A 3LYPA 5EL8A 2VKZG 4HQZA 1M2DA 3IC8A 1URMA 2CX3A 3MYDA 4GWRA 4NHZA 4EVMA 1K0OA 4JBBA 4G19A 3L78A 5LCZA 4I2UA 5J5NA 4YAVA 5A1NA 1K0CA 1NM3A 2YWNA 2IWTA 3GL5A 4IS0A 3RDWA 3DKSA 4Z2TA 3UBLA 1XWBA 4ECIA 3IK7A 4HU9A 4RQXA 2HI7A 1YDKA 2OE0A 1BJXA 4HOJA 2V41A 5GSSA 3UOMA 4GSTA 1TI3A 4TR3A 1IYIA 2K8SA 4EIQA 1AAZA 3IHQA 4HDEA 3VPQA 4JR6A 2UZ8A 1A2JA 3VWXA 4GSNA 4N30A 3VWWA 1EP8A 3IC4A 1SKSB 1VF1A 2HSMA 3ME7A 6GSTA 3GYKA 5FHIA 4EDZA 3KH9A 2GGTA 3FR9A 5JCWA 4CW9A 1T7PB 2JADA 3G7JA 3EPTA 2CX4A 3KTLA 2V32A 2YOIA 3R2QA 3IXRA 3L9SA 2IMKA 2H0HA 1U3AA 4OFTA 5B8BA 1G6YA 1T4YA 1THXA 4L8EA 5F07A 5D8IA 2VLUA 3IAS2 2NTOA 3I43A 1EZKA 1FB0A 1OYJA 3ERGA 1SENA 4K5RA 1ZOFA 4CDOA 2XPEA 3GSSA 3FR3A 2I1UA 1XFLA 2FUG2 4AJ7A 1Z3EA 1N8JA 2WFCA 4Z2RA 4TR4A 4ZILA 4I5QA 4I2TA 2BJXA 1VGLA 2E7PA 2QGVA 2DSAA 4YQVA 3CTFA 3ZFBA 2D2ZA 1ZYQB 4JRRA 4OD7A 3FMWA 4BVYB 2H8LA 1CQHA 6GSVA 3J7Yk 1EWXA 3MIXA 3KEBA 1EOHA 2PUKC 4XS1A 3GKXA 1BG5A 1BF5A 2ON5A 4X1UA 3GA4A 3TKPA 16GSA 4TOPA 19GSA 9GSSA 2TRXA 1FOHA 1GSYA 3GNJA 5AIXA 1OE7A 3RAZA 1LU4A 3S9FA 1W89A 3RHCA 1DE1A 1GLPA 1EV4A 4QL9A 2FY6A 4J56E 4E8EA 2FWFA 2HRKB 2LQQA 2XBQA 3WD6A 4LA1A 2R6KA 1R7HA 2VCWA 4BVXB 4LLRA 2VAFA 2YWIA 3HJPA 4N3ZA 2DJKA 4BWSA 2FLSA 3P2AA 3CRTA 1B4PA 2E2MA 3ISOA 1WOUA 3ZIJA 5JWRB 4OO5A 5ECMB 3KIJA 2HSYA 4YKGA 2AUVA 2YZUA 3OR5A 3GIXA 4OFMA 1FB6A 3DMLA 3I6AA 3HYPA 5CRWA 3DWVA 2HRNA 3P8WA 1XBSA 4K0NA 5J40A 3WGEA 3GSTA 4GTUA 4G0KA 1TRVA 3KH7A 3ERFA 4X4JA 1K0NA 4Z2UA 1O8XA 4KCAA 4WETA 2CV4A 3NZNA 1XOAA 3PINA 2EFEA 3GTUB 4NV5A 2PPTA 5DCHA 2OJLA 2C0EA 2NBSA 1EEMA 1BG1A 1ST9A 2HSMB 4MF5A 3DIEA 1WWJA 4PUFC 1M2BA 1R5AA 2DC5A 2L5LA 5D9XA 5F8BA 2GLRA 1O73A 1SYXA 2HSNA 2LUSA 4L0UA 3KMOA 1PA3A 3QR6A 3PPUA 1Y6EA 4XHMA 2L5OA 3DVWA 4FYBA 2MYGA 4QQ7A 1NHOA 4KNDA 1K3YA 1DE2A 1YF1A 4XIHA 4WXTA 4MPGA 1M7TA 5H5SA 4HJ2A 1UA5A 2LSTA 3D0ZA 4ULXA 1K0BA 1PRXA 1QQ2A 2WCIA 4K5SA 1XVQA 1T8EB 2O5VA 1JLVA 1SL1B 2MBSA 3GV1A 3HD5A 5G5FA 2KOKA 1J0FA 2HRFA 3D5JA 1WP0A 4ML1A 5AN1A 3CMIA 4ECCA 1A2LA 3KD0A 1TRSA 4QL7A 2GQLA 1M99A 4ZL7A 3MAKA 3KTBA 1T3BA 4DSRA 1DBYA 2V2GA 2L57A 1JZRA 1ZGNA 2I81A 5ECNB 4NMUA 2FCHA 4NPBA 5IMCA 2ALBA 4F0CA 3SWLA 2X4AA 1JZOA 3F6FA 3ZVJD 3EU4A 5IO0A 2VD1A 2FGXA 3VWUA 2H01A 2IMEA 5G31A 2LV3A 5G2ZA 1SL0B 4ZBDA 2JZTA 3VI5A 4FH8A 2H1DA 3HXSA 3MDKA 2LJKA 4WBRD 1TXUA 1HNCA 4HU7A 1NHYA 3IPZA 1HQOA 3DD3A 5DQYA 2TIRA 1ACVA 2KLXA 1SD9A 3KGKA 2NDOA 1S3DA 3ZMKA 2YANA 2XPDA 3QFAC 4CHSA 3HZ8A 2B1LA 2H1LA 1MDIA 4V2LA 4XS6A 2HZFA 2ZUPA 2VOCA 1YQ1A 2MZCA 4MH2A 2H1GA 2DKIA 4XCSA 5CYYA 3WGDA 2JL4A 2I9HA 3DYRA 5J4VA 4TW5A 5KN0A 5BMUA 3DVXA 4RI6A 4TVEA 3WGXA 4IELA 1A0RP 3A2WA 3Q18A 2H19A 3F0IA 3F3QA 1VF2A 3TKQA 3C71A 2N5AA 4I6XA 4KW6A 3ME8A 4KF9A 2QSIA 2HT9A 4O92A 3H4KA 2A2SA 3FHKA 5BRTA 3D22A 4BPYA 1FVJA 3TCOA 4N0ZA 3EU3A 3UEMA 4K7IA 4PQIA 1AXDA 1U88A 2HSNB 1GUKA 1OC3A 5DAKA 5IPHA 3LXTA 3MNGA 5IM9A 1EGOA 5L71A 4HZ2A 3KM6A 4G2EA 4ZIJA 2VL9A 1ZCPA 1A8LA 3M1GA 1SKRB 1SVOA 4LMWA 1YEPA 2AB6A 2VLTA 2ES7A 4H86A 2VCZA 5CREA 2H1AA 2R4VA 4BVYA 2RLIA 2EFDA 1YVLA 2K18A 1KNGA 5HQPA 3H93A 1V58A 3RHBA 5ECLB 4YH2A 1KTEA 5CRHA 2PVQA 2CVBA 2B5YA 1NW2A 2CZ2A 5G30A 4G10A 3TJFA 1OAZA 2HE3A 3A2XA 1XWGA 20GSA 5DJLA 5JWQB 1GNWA 3ED3A 1PKZA 2P5QA 4ZL8A 5ECSA 5IMDA 3F3RA 3L9UA 2DIYA 4XRDA 1XVWA 4ZB9A 5B8AA 4Q5QA 2CAQA 3APSA 2XBIA 1WJKA 4TN8A 4NHWA 3BCIA 5JCGA 3MSZA 1F37A 3IRAA 3CRUA 2RM6A 4F9ZA 4F0BA 4GRFA 2YJ7A 3PGTA 4ZBAA 1GSEA 4YAPA 5ABRA 3AY8A 3CYNA 3VFIA 4IBPA 2DIZA 1OC9A 1PGTA 4O32A 2MMNA 1THOA 3UARA 1QMVA 1SJZA 2H1BA 2R0GA 4ZXGA 1RW1A 3C1SA 2PMTA 2YV9A 3IBHA 4FIWA 3N5OA 2AHEA 2K9FA 3GTUA 3FZ5A 5A5KA 2VD0A 1AQXA 2DKHA 4MLYA 3D4TA 3VPTA 5IPGA 5LD0A 1G7EA 1XW5A 1QUWA 5BMUB 2DJ3A 2K6VA 4EF0A 2C4JA 2M72A 3FYGA 4AKHA 2KP1A 2OBIA 4KDXA 2OKAA 4LL1B 4MZCA 4LMVA 1SK0A 2C1YA 1TK8B 3LWAA 1GNEA 18GSA 4E68A 1UN2A 1Z7PA 2H72A 2LRCA 3TDGA 5EY6A 3P7XA 1ERWA 4EE0A 4HUAA 5IIZA 2VO4A 3C7MA 1TTZA 2PU9C 1TDIA 2N5BA 3NOFA 2DJ2A 3GX0A 4MK3A 1Y1UA 1C72A 3ZIVA 5HFKA 2FWHA 1X5DA 5DAKB 1SL2B 5D9VA 3M3MA 2I3YA 4K7OA 3F4RA 4IP1A 2QC7A 3U6VA 3QMXA 4KDYA 3F6DA 14GSA 1M2AA 5D73A 2EIQA 4MJAA 1RK4A 3TOTA 3ZRDA 4EC0A 3TJBA 2DMLA 4WF4A 4YKFA 2VCVA 3FKFA 4YQUA 4V2NA 2G2QA 1SYRA 2A4HA 3J7Yb 4N0VA 4TKYA 3I9V2 3LSZA 4WBJA 2QA1A 5DCGA 2REMA 1A8YA 5ECIB 4AGSA 1TXXA 3DEXA 3GKNA 3A3TA 1E2YA 4EL1A 5DQSA 2RIIA 5ECPB 3FRCA 3LXZA 5IQYA 4E8HA 4F82A 1TJDA 1FVKA 3UMAA 5B6MA 5CRDA 2WGRA 3E3EA 2M46A 3HCZA 1F9MA 3BCKA 4LL4B 2FA8A 2GSQA 1ZYNA 4TRXA 3KZQA 3V1WA 1H4OA 1CQGA 2YP6A 6GSSA 2CZ3A 1GL8A 3HJMA 1EGRA 4P3YB 2A2PA 1UVZA 3FZAA 3TRPA 4DSSA 2H6ZA 1J9BA 3W6GA 5DALA 2XHFA 1XW6A 4ECBA 2IN3A 3IA1A 4MNNA 3LW9A 3P90A 2C0GA 1OC9B 1F3BA 3R3EA 3IDVA 8GSSA 2GSSA 5J4YA 1PL2A 4IW9A 3O76A 2WJUA 3VLNA 1GSFA 2IMDA 5D96A 4G0LA 2IMFA 4FQUA 3TKRA 1TU7A 3FZ4A 2YCDA 3EYTA 1UC7A 1SJ6A 2XC2A 1DUGA 1GTIA 1RQMA 3EE2A 2GS3A 1FW1A 2H6YA 2WB9A 2NPBA 1ZYPA 4WF5A 3HZ4A 1GH2A 1B4QA 3VK9A 4J2FA 3TKSE 4HI7A 4O5RA 2DJJA 1B9YC 1TU8A 5F06A 1KEBA 4EO3A 2LJRA 1IYHA 4Q5FA 1VF3A 1TK0B 2C0FA 2GZYA 1X5EA 5C00A 1TK5B 4GCIA 2WZ9A 3TJJA 5INYA 1O7UA 4G9HA 1PKWA 4PX1A 3QAVA 3M8NA 1Z6MA 1K0AA 3CBUA 5J4UA 3H79A 1U87A 4PUAA 2H0GA 2CT6A 2F3MA 4MMMA 3EWLA 3GRXA 5B7CA 1TOFA 1ERUA 4YQMA 1MEKA 4OCFA 12GSA 5J41A 4PTSA 4TR1A 4I97A 3F4TA 2JACA 4O5QA 1WRYA 3A5IA 5HFIA 3GFKA 1MDJA 1MD4A 2YWOA 3G9BA 5D9WA 2HNLA 3IR4A 1N2AA 2MMZA 4AF2A 4ZB7A 2CQ9A 4BWQA 1K0MA 4GSSA 2OE3A 3KMNA 2VIMA 4IJ3A 2J23A 4I8BA 4K1FA 2EFCA 1NSWA 2FWGA 2K8VA 4WKWA 1H75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6B A;  1ZZY A;  1V40 A;  4WR4 A;  2A4V A;  2RUE A;  3SBC A;  2JZS A;  3H1N A;  4POL A;  4MDC A;  3TRX A;  1EEJ A;  3GL3 A;  3GUS A;  3PH9 A;  1XIY A;  4AJ8 A;  1PX7 A;  1TP9 A;  4POM A;  3GX8 A;  1TKD B;  1AC1 A;  1FO5 A;  4PQH A;  2OA7 A;  1ML6 A;  5J3R A;  2O7K A;  3VWV A;  4XRA A;  1ERV A;  3FR6 A;  2B6M A;  4OMV A;  1J08 A;  5FT3 A;  2L59 A;  4FYC A;  1OKD A;  3KXO A;  1Q4J A;  1GUH A;  3CSI A;  3A2V A;  3LGC A;  3RPP A;  4DSS B;  2P31 A;  1ILO A;  2VLV A;  5DAL B;  4EKZ A;  1GTU A;  3FW2 A;  5G1L A;  2VM2 A;  5EPF A;  4IQA A;  5ELG A;  2OAC A;  2CA8 A;  1SK2 A;  3CSJ A;  1I5G A;  3F63 A;  1WPI A;  4J57 E;  2H70 A;  2P5R A;  2GST A;  5DJM A;  1TRW A;  4XS4 B;  3CTG A;  2LJA A;  1QXH A;  2GVP A;  2VCX A;  3L0H A;  5KN3 A;  2OAD A;  3LJR A;  1A24 A;  4V2M A;  2LS5 A;  2IIY A;  3HHV A;  5CO3 A;  5H5R A;  4GQC A;  4NWY A;  4KA0 A;  4IP6 A;  3HJO A;  1K3O A;  1V2A A;  1HYU A;  3UVH A;  2BTO T;  3QAW A;  3I69 A;  5ENU A;  1BAY A;  2O85 A;  1JHB A;  1HNB A;  1GTB A;  1PD2 1;  4F03 A;  3FZ9 A;  4JR4 A;  4Z7X A;  4V1A g;  5GAP D;  3U5R E;  1PQN A;  5C04 A;  2J9H A;  3K8N A;  2BMX A;  1YY7 A;  3MWH A;  1YJ6 A;  6GSW A;  2FA4 A;  6GSX A;  1A0F A;  1B8X A;  3M0F A;  3VI7 A;  4K0G A;  3QPM A;  3HKR A;  1LJR A;  2YV7 A;  3TUE A;  2LRT A;  5AGY A;  1R4W A;  2X8C A;  4TR1 B;  1PSQ A;  2PWJ A;  2IMI A;  2YZH A;  17GS A;  5F0G A;  1T00 A;  4N10 A;  2YPM A;  1M0U A;  3M9J A;  1GUL A;  2H6X A;  2DJ1 A;  1FHE A;  2YJH A;  2C3N A;  2RUF A;  1PL1 A;  1YZX A;  5ELA A;  2TRC P;  3D21 A;  5EVO A;  2DMM A;  4MP4 A;  2V6K A;  1OC8 A;  4X43 A;  1BED A;  2WS2 A;  2PGT A;  3BJ5 A;  2LEG A;  2DBC A;  5F05 A;  4BA7 A;  3IAM 2;  3TRQ A;  5ECK B;  2DJ0 A;  1S3A A;  2RM5 A;  3HY2 A;  1O81 A;  2IJY A;  1YF0 A;  1T1V A;  5GAN D;  3UVT A;  3G7I A;  1G7O A;  2GQK A;  4OFN A;  5A4U A;  2JSZ A;  3US3 A;  3LG6 A;  1R26 A;  4WEY A;  1MDK A;  2MMA A;  3GN3 A;  2E0Q A;  2LTK A;  3KCM A;  5JWO B;  4L0W A;  1T4Z A;  4RI7 A;  5FWG A;  2H71 A;  2H74 A;  1GP1 A;  5CP1 A;  3DRN A;  2KUC A;  1EP7 A;  3ZL5 A;  1DSB A;  3EVI A;  4TXO A;  5H5Q A;  3HVX A;  2B3S A;  3EIN A;  4MF6 A;  3QDN A;  2HQT A;  3TKS A;  2VM1 A;  5HR3 A;  4L5O A;  1AW9 A;  3GKM A;  4K8M A;  3KJY A;  1U6T A;  2NVL A;  1VRS D;  1ZYE A;  2LNT A;  1Z5Y E;  4PUR A;  5GZZ B;  4RUV A;  3KP9 A;  1AQW A;  5AIS A;  2C3T A;  4IN0 A;  1U3I A;  3ZIT A;  4KE3 A;  4MZW A;  3ZYW A;  5ID2 A;  3BBY A;  4PNF A;  2VCT A;  2Z9S A;  3QD9 A;  1SJI A;  4MA9 A;  2FNO A;  4MJE A;  2GTU A;  4MJC A;  1BYE A;  2A2R A;  4OCE A;  3JCM L;  3HVS A;  3ZTL A;  2X8H A;  2X64 A;  3DGQ A;  2IFQ B;  4EUY A;  2HZE A;  1A23 A;  3C1R A;  1AIU A;  1XOB A;  2AAW A;  1GSU A;  4HS1 A;  3LEF A;  5IOX A;  3TOU A;  2PVO C;  1R5P A;  4Q5N A;  4WR5 A;  3F8U A;  1XWK A;  1F2E A;  4HJM A;  3E9J B;  2H30 A;  2AV4 A;  4ZL9 A;  4BL7 B;  1X9M B;  1EV9 A;  10GS A;  4TXV A;  4ACS A;  3ZML A;  2C8U A;  4GLT A;  4D73 B;  3TB2 A;  3HVV A;  1AUC A;  1SU9 A;  2X8G A;  3LYK A;  5D93 A;  1XXU A;  4JE1 A;  1QK8 A;  1JLW A;  4ML6 A;  2GSR A;  1PN9 A;  2GT6 A;  4JZQ A;  3O6T A;  2ON7 A;  2PN8 A;  4IHU A;  3BD2 A;  2AJQ B;  4KUN A;  3UJ1 A;  3QOU A;  3TKS C;  2YN1 A;  1OE8 A;  4HEA 2;  3ZLP A;  2IL3 A;  5ECR B;  2F8A A;  1F6M C;  2GDR A;  3HA9 A;  3Q6O A;  2DLX A;  4EXJ A;  2G0F A;  5LNK e;  3W8S A;  2F8F A;  4Q5R A;  4MAB A;  3Q19 A;  4KH7 A;  4KX4 A;  2MMO A;  1M9A A;  2HFD A;  4V1A p;  3HDC A;  2AYT A;  1XZO A;  1GSQ A;  2QKE A;  2L6D A;  5CAX A;  2JZR A;  1YKC A;  4IQ1 A;  4KAE A;  1Z9H A;  4GXZ A;  4MCU A;  3M9K A;  2B5E A;  2HSH A;  3IE3 A;  3Q74 A;  1MD3 A;  4TR0 A;  1YEX A;  1XWA A;  1Q98 A;  4XS4 A;  2PER A;  4ZB6 A;  4HZ4 A;  1GSS A;  5G5E A;  4IVF A;  2VL2 A;  1ZL9 A;  2C80 A;  2V1M A;  2L4Q A;  4MPF A;  2WDU A;  3ZFL A;  4TXO B;  1GUM A;  4NAX A;  4FO5 A;  5CRG A;  2OE1 A;  1TRU A;  22GS A;  4MF7 A;  6GSY A;  2ZNM A;  3IOS A;  2L6C A;  3BOA A;  3EC3 A;  2C3Q A;  2O8V B;  2HXK A;  3TJK A;  4KDU A;  1FOV A;  2PBJ A;  1V9W A;  3LQ7 A;  1OVN A;  5ID2 B;  3G7Y A;  3LFL A;  2O87 A;  3RPN A;  3O3T A;  5CNW A;  3GUR A;  3GH9 A;  3VUR A;  1M9B A;  6GSU A;  2YWM A;  1PMT A;  4DSQ A;  3GKK A;  5DBQ A;  1XPV A;  1TI1 A;  4OWY A;  4RQR A;  4X0X A;  1FAA A;  4JU5 A;  1OKT A;  2O89 A;  4MJB A;  3DXB A;  2HZE B;  1Z7R A;  4IJI A;  1XCC A;  3IK9 A;  3NIV A;  4KB3 A;  3UL3 A;  3EMX A;  2KHP A;  1ABA A;  2HRA A;  3C73 A;  2L4C A;  3WT2 A;  1G6W A;  5IMV A;  1JFU A;  2H66 A;  5G1K A;  4PGT A;  4N11 A;  1WMJ A;  3N9J A;  5IOW A;  2H0I A;  2CAI A;  4HQS A;  1TW9 A;  1GRX A;  3KP8 A;  4KCE A;  4GQF A;  2X99 A;  3A5W A;  1SK1 A;  4POK A;  5E4W A;  4IKH A;  3UBK A;  1XWC A;  2JU5 A;  4EDY A;  3TGZ A;  2M80 A;  4ISD A;  3PR8 A;  2VL2 C;  1Y25 A;  1QGV A;  5J9C A;  4MH3 A;  2R3X A;  5IMZ A;  3LOR A;  1JZD A;  4ID0 A;  2VCQ A;  4F2I A;  3GHA A;  1BX9 A;  1O6J A;  2EC4 A;  2YNX A;  3C8E A;  1S3C A;  4XTS A;  1G0T A;  3ZRE A;  13GS A;  5COH A;  4G0I A;  2C0D A;  4ILF A;  3H8Q A;  2R37 A;  1F3A A;  2FD3 A;  3UIW A;  1K0D A;  5AIV A;  2GZP A;  3D6I A;  4POB A;  5HR1 A;  3D4M A;  5GST A;  1GSD A;  2GZZ A;  1ERT A;  2B7K A;  1BQ7 A;  4ECJ A;  1A2M A;  5B6N A;  3GMF A;  2N5F A;  1GTA A;  5IMF A;  3QFB C;  4GF0 A;  4NXI A;  1WE0 A;  2H76 A;  3FK8 A;  1PX6 A;  5A4V A;  2B1K A;  1GLQ A;  5D9T A;  2WUL A;  1Z6N A;  3FEU A;  3ZZX A;  4DEJ A;  3F4S A;  3GH6 A;  1EOG A;  5KEJ A;  2IPA A;  5HR2 A;  5HR0 A;  1B9X C;  4K9Z A;  2GT5 A;  4KGI A;  3FY7 A;  1QFN A;  2E2G A;  5ECH B;  2HYX A;  5IMA A;  1LBK A;  3CXG A;  4PNG A;  2B7J A;  2HLS A;  4PQ1 A;  4OO4 A;  1K3L A;  3CSH A;  2CVD A;  3E0U A;  1V57 A;  2OBK A;  4DVC A;  1X5C A;  1YKA A;  1JZW A;  1SD8 A;  2MBT A;  2WRT A;  4K2D A;  2VUP A;  4IGJ A;  7GSS A;  2V6O A;  3ERW A;  3APQ A;  2EIR A;  2CVK A;  2IFQ A;  5JCU A;  1ZMA A;  4USS A;  2F9S A;  2R2J A;  1X9W B;  1ON4 A;  2LNS A;  3EMP A;  4NV2 A;  5ECQ B;  2LKU A;  3EUR A;  5E59 A;  1HNA A;  4KSO A;  1KBN A;  2GQM A;  4K6X A;  3QAG A;  5J9B A;  1O85 A;  11GS A;  3W8J A;  1AQV A;  5KN2 A;  2P0G A;  4BL7 A;  2FHE A;  3WYW A;  4ZBB A;  2KP2 A;  3QCP A;  4PXO A;  4D73 A;  3TJG A;  4O7H A;  4AJ6 A;  3APO A;  2EIO A;  1X0R A;  4ZB8 A;  1MTC A;  1W4V A;  1XW9 A;  3IV4 A;  1B48 A;  2ZCT A;  2H73 A;  3UAP A;  3L9V A;  1X9S B;  5ECO B;  1WIK A;  2F51 A;  2I4A A;  3F9U A;  2LRN A;  1V98 A;  1HD2 A;  2FWE A;  1I9D A;  1VF4 A;  5DDL A;  2JSY A;  3ZVJ A;  2LQO A;  1FG4 A;  4L5L A;  4FYU A;  1GWC A;  1USB A;  5KN1 A;  2H75 A;  2HRK A;  4JED A;  2VL3 A;  3L4N A;  3RBT A;  4BVX A;  2B5X A;  5A4W A;  4K7N A;  3WT1 A;  4KSM A;  5DVB A;  1SKW B;  2R5G A;  5HFG A;  4MZB A;  1O8W A;  5IO2 A;  3LYP A;  5EL8 A;  4HQZ A;  1M2D A;  3IC8 A;  1URM A;  2CX3 A;  4GWR A;  4NHZ A;  4EVM A;  1K0O A;  4JBB A;  4G19 A;  3L78 A;  5LCZ A;  4I2U A;  5J5N A;  4YAV A;  1NM3 A;  1K0C A;  2YWN A;  2IWT A;  3GL5 A;  4IS0 A;  3RDW A;  3DKS A;  3UBL A;  1XWB A;  4ECI A;  3IK7 A;  4HU9 A;  4RQX A;  2HI7 A;  1YDK A;  2OE0 A;  1BJX A;  4HOJ A;  2V41 A;  5GSS A;  3UOM A;  4GST A;  1TI3 A;  4TR3 A;  1IYI A;  2K8S A;  1AAZ A;  3IHQ A;  4HDE A;  3VPQ A;  4JR6 A;  2UZ8 A;  1A2J A;  3VWX A;  4GSN A;  4N30 A;  3VWW A;  1EP8 A;  3IC4 A;  1SKS B;  1VF1 A;  2HSM A;  3ME7 A;  6GST A;  3GYK A;  5FHI A;  4EDZ A;  3KH9 A;  2GGT A;  3FR9 A;  5JCW A;  4CW9 A;  1T7P B;  2JAD A;  3G7J A;  2CX4 A;  3KTL A;  2V32 A;  2YOI A;  3R2Q A;  3IXR A;  3L9S A;  2IMK A;  2H0H A;  1U3A A;  4OFT A;  5B8B A;  1G6Y A;  1T4Y A;  1THX A;  4L8E A;  5F07 A;  5D8I A;  2VLU A;  3IAS 2;  2NTO A;  3I43 A;  1EZK A;  1FB0 A;  1OYJ A;  3ERG A;  1SEN A;  1ZOF A;  4CDO A;  2XPE A;  3GSS A;  3FR3 A;  2I1U A;  1XFL A;  2FUG 2;  4AJ7 A;  1Z3E A;  1N8J A;  2WFC A;  4TR4 A;  4ZIL A;  4I5Q A;  4I2T A;  2BJX A;  1VGL A;  2E7P A;  2QGV A;  2DSA A;  4YQV A;  3CTF A;  3ZFB A;  2D2Z A;  1ZYQ B;  4JRR A;  4OD7 A;  4BVY B;  2H8L A;  1CQH A;  6GSV A;  3J7Y k;  1EWX A;  3KEB A;  1EOH A;  2PUK C;  4XS1 A;  3GKX A;  1BG5 A;  2ON5 A;  4X1U A;  3GA4 A;  3TKP A;  16GS A;  4TOP A;  19GS A;  9GSS A;  2TRX A;  1GSY A;  3GNJ A;  5AIX A;  1OE7 A;  3RAZ A;  1LU4 A;  3S9F A;  1W89 A;  3RHC A;  1DE1 A;  1GLP A;  1EV4 A;  4QL9 A;  2FY6 A;  4J56 E;  4E8E A;  2FWF A;  2HRK B;  2LQQ A;  2XBQ A;  3WD6 A;  4LA1 A;  2R6K A;  1R7H A;  2VCW A;  4BVX B;  4LLR A;  2VAF A;  2YWI A;  3HJP A;  2DJK A;  4BWS A;  2FLS A;  3P2A A;  3CRT A;  1B4P A;  2E2M A;  3ISO A;  1WOU A;  3ZIJ A;  5JWR B;  4OO5 A;  5ECM B;  3KIJ A;  2HSY A;  2AUV A;  2YZU A;  3OR5 A;  3GIX A;  4OFM A;  1FB6 A;  3DML A;  3I6A A;  3HYP A;  5CRW A;  3DWV A;  2HRN A;  3P8W A;  1XBS A;  4K0N A;  3WGE A;  3GST A;  4GTU A;  4G0K A;  1TRV A;  3KH7 A;  3ERF A;  1K0N A;  1O8X A;  4KCA A;  4WET A;  2CV4 A;  3NZN A;  1XOA A;  3PIN A;  3GTU B;  4NV5 A;  2PPT A;  5DCH A;  2OJL A;  2C0E A;  2NBS A;  1EEM A;  1ST9 A;  2HSM B;  4MF5 A;  3DIE A;  1WWJ A;  4PUF C;  1M2B A;  1R5A A;  2DC5 A;  2L5L A;  5D9X A;  5F8B A;  2GLR A;  1O73 A;  1SYX A;  2LUS A;  4L0U A;  3KMO A;  1PA3 A;  3QR6 A;  3PPU A;  1Y6E A;  4XHM A;  2L5O A;  3DVW A;  4FYB A;  2MYG A;  4QQ7 A;  1NHO A;  4KND A;  1K3Y A;  1DE2 A;  1YF1 A;  4XIH A;  4WXT A;  4MPG A;  1M7T A;  5H5S A;  4HJ2 A;  1UA5 A;  2LST A;  3D0Z A;  4ULX A;  1K0B A;  1PRX A;  1QQ2 A;  2WCI A;  1XVQ A;  1T8E B;  1JLV A;  1SL1 B;  2MBS A;  3GV1 A;  3HD5 A;  5G5F A;  2KOK A;  1J0F A;  2HRF A;  3D5J A;  1WP0 A;  4ML1 A;  5AN1 A;  3CMI A;  4ECC A;  1A2L A;  3KD0 A;  1TRS A;  4QL7 A;  2GQL A;  1M99 A;  4ZL7 A;  3MAK A;  3KTB A;  1T3B A;  4DSR A;  1DBY A;  2V2G A;  2L57 A;  1JZR A;  1ZGN A;  2I81 A;  5ECN B;  4NMU A;  2FCH A;  4NPB A;  5IMC A;  2ALB A;  4F0C A;  3SWL A;  1JZO A;  3F6F A;  3ZVJ D;  3EU4 A;  5IO0 A;  2VD1 A;  2FGX A;  3VWU A;  2H01 A;  2IME A;  5G31 A;  2LV3 A;  5G2Z A;  1SL0 B;  4ZBD A;  2JZT A;  3VI5 A;  4FH8 A;  2H1D A;  3HXS A;  3MDK A;  2LJK A;  4WBR D;  1HNC A;  4HU7 A;  1NHY A;  3IPZ A;  1HQO A;  3DD3 A;  5DQY A;  2TIR A;  1ACV A;  2KLX A;  1SD9 A;  3KGK A;  2NDO A;  1S3D A;  3ZMK A;  2YAN A;  2XPD A;  3QFA C;  4CHS A;  3HZ8 A;  2B1L A;  1MDI A;  4V2L A;  4XS6 A;  2HZF A;  2ZUP A;  2VOC A;  1YQ1 A;  2MZC A;  4MH2 A;  2H1G A;  4XCS A;  5CYY A;  3WGD A;  2JL4 A;  2I9H A;  3DYR A;  4TW5 A;  5KN0 A;  5BMU A;  3DVX A;  4RI6 A;  4TVE A;  3WGX A;  4IEL A;  1A0R P;  3A2W A;  3Q18 A;  2H19 A;  3F0I A;  3F3Q A;  1VF2 A;  3TKQ A;  3C71 A;  2N5A A;  4I6X A;  4KW6 A;  3ME8 A;  4KF9 A;  2QSI A;  2HT9 A;  4O92 A;  3H4K A;  2A2S A;  3FHK A;  3D22 A;  4BPY A;  1FVJ A;  3TCO A;  4N0Z A;  3EU3 A;  3UEM A;  4K7I A;  4PQI A;  1AXD A;  1U88 A;  2HSN B;  1GUK A;  1OC3 A;  5DAK A;  5IPH A;  3LXT A;  3MNG A;  5IM9 A;  1EGO A;  5L71 A;  4HZ2 A;  3KM6 A;  4G2E A;  4ZIJ A;  2VL9 A;  1ZCP A;  1A8L A;  3M1G A;  1SKR B;  4LMW A;  1YEP A;  2AB6 A;  2VLT A;  2ES7 A;  4H86 A;  2VCZ A;  5CRE A;  2H1A A;  2R4V A;  4BVY A;  2RLI A;  2K18 A;  1KNG A;  5HQP A;  3H93 A;  1V58 A;  3RHB A;  5ECL B;  4YH2 A;  1KTE A;  5CRH A;  2PVQ A;  2CVB A;  2B5Y A;  1NW2 A;  2CZ2 A;  5G30 A;  4G10 A;  3TJF A;  1OAZ A;  2HE3 A;  3A2X A;  1XWG A;  20GS A;  5DJL A;  5JWQ B;  1GNW A;  3ED3 A;  1PKZ A;  2P5Q A;  4ZL8 A;  5ECS A;  5IMD A;  3F3R A;  3L9U A;  2DIY A;  4XRD A;  1XVW A;  4ZB9 A;  5B8A A;  4Q5Q A;  2CAQ A;  3APS A;  2XBI A;  1WJK A;  4TN8 A;  4NHW A;  3BCI A;  5JCG A;  3MSZ A;  1F37 A;  3IRA A;  3CRU A;  2RM6 A;  4F9Z A;  4F0B A;  4GRF A;  2YJ7 A;  3PGT A;  4ZBA A;  1GSE A;  4YAP A;  5ABR A;  3AY8 A;  3CYN A;  3VFI A;  4IBP A;  2DIZ A;  1OC9 A;  1PGT A;  4O32 A;  2MMN A;  1THO A;  3UAR A;  1QMV A;  1SJZ A;  2H1B A;  4ZXG A;  1RW1 A;  3C1S A;  2PMT A;  2YV9 A;  3IBH A;  4FIW A;  3N5O A;  2AHE A;  2K9F A;  3GTU A;  3FZ5 A;  5A5K A;  2VD0 A;  1AQX A;  4MLY A;  3D4T A;  3VPT A;  5IPG A;  5LD0 A;  1G7E A;  1XW5 A;  1QUW A;  2DJ3 A;  2K6V A;  4EF0 A;  2C4J A;  2M72 A;  3FYG A;  2KP1 A;  2OBI A;  4KDX A;  2OKA A;  4LL1 B;  4MZC A;  4LMV A;  1SK0 A;  2C1Y A;  1TK8 B;  3LWA A;  1GNE A;  18GS A;  1UN2 A;  1Z7P A;  2H72 A;  2LRC A;  3TDG A;  5EY6 A;  3P7X A;  1ERW A;  4EE0 A;  4HUA A;  5IIZ A;  2VO4 A;  3C7M A;  1TTZ A;  2PU9 C;  1TDI A;  2N5B A;  3NOF A;  2DJ2 A;  3GX0 A;  4MK3 A;  1C72 A;  3ZIV A;  5HFK A;  2FWH A;  1X5D A;  5DAK B;  1SL2 B;  5D9V A;  3M3M A;  2I3Y A;  4K7O A;  3F4R A;  4IP1 A;  2QC7 A;  3U6V A;  3QMX A;  4KDY A;  3F6D A;  14GS A;  1M2A A;  5D73 A;  2EIQ A;  4MJA A;  1RK4 A;  3TOT A;  3ZRD A;  4EC0 A;  3TJB A;  2DML A;  4WF4 A;  2VCV A;  3FKF A;  4YQU A;  4V2N A;  2G2Q A;  1SYR A;  3J7Y b;  4N0V A;  4TKY A;  3I9V 2;  3LSZ A;  4WBJ A;  5DCG A;  2REM A;  1A8Y A;  5ECI B;  4AGS A;  1TXX A;  3DEX A;  3GKN A;  3A3T A;  1E2Y A;  4EL1 A;  5DQS A;  2RII A;  5ECP B;  3FRC A;  3LXZ A;  5IQY A;  4E8H A;  4F82 A;  1TJD A;  1FVK A;  3UMA A;  5B6M A;  5CRD A;  2WGR A;  3E3E A;  2M46 A;  3HCZ A;  1F9M A;  3BCK A;  4LL4 B;  2FA8 A;  2GSQ A;  4TRX A;  3KZQ A;  3V1W A;  1H4O A;  1CQG A;  2YP6 A;  6GSS A;  2CZ3 A;  1GL8 A;  3HJM A;  1EGR A;  4P3Y B;  1UVZ A;  3FZA A;  3TRP A;  4DSS A;  2H6Z A;  1J9B A;  3W6G A;  5DAL A;  2XHF A;  1XW6 A;  4ECB A;  2IN3 A;  3IA1 A;  3P90 A;  2C0G A;  1OC9 B;  1F3B A;  3R3E A;  3IDV A;  8GSS A;  2GSS A;  1PL2 A;  4IW9 A;  3O76 A;  2WJU A;  3VLN A;  1GSF A;  2IMD A;  5D96 A;  4G0L A;  2IMF A;  4FQU A;  3TKR A;  1TU7 A;  3FZ4 A;  2YCD A;  3EYT A;  1UC7 A;  1SJ6 A;  2XC2 A;  1DUG A;  1GTI A;  1RQM A;  3EE2 A;  2GS3 A;  1FW1 A;  2H6Y A;  2WB9 A;  2NPB A;  4WF5 A;  3HZ4 A;  1GH2 A;  1B4Q A;  3VK9 A;  4J2F A;  3TKS E;  4HI7 A;  4O5R A;  2DJJ A;  1B9Y C;  1TU8 A;  5F06 A;  1KEB A;  4EO3 A;  2LJR A;  1IYH A;  4Q5F A;  1VF3 A;  1TK0 B;  2C0F A;  2GZY A;  1X5E A;  5C00 A;  1TK5 B;  4GCI A;  2WZ9 A;  3TJJ A;  5INY A;  1O7U A;  4G9H A;  1PKW A;  4PX1 A;  3QAV A;  3M8N A;  1Z6M A;  1K0A A;  3CBU A;  5J4U A;  3H79 A;  1U87 A;  4PUA A;  2H0G A;  2CT6 A;  2F3M A;  4MMM A;  3EWL A;  3GRX A;  5B7C A;  1TOF A;  1ERU A;  4YQM A;  1MEK A;  4OCF A;  12GS A;  5J41 A;  4PTS A;  4TR1 A;  4I97 A;  3F4T A;  2JAC A;  1WRY A;  5HFI A;  3GFK A;  1MDJ A;  1MD4 A;  2YWO A;  3G9B A;  5D9W A;  2HNL A;  3IR4 A;  1N2A A;  2MMZ A;  4AF2 A;  2CQ9 A;  4BWQ A;  1K0M A;  4GSS A;  2OE3 A;  3KMN A;  2VIM A;  4IJ3 A;  2J23 A;  4I8B A;  4K1F A;  1NSW A;  2FWG A;  2K8V A;  4WKW A;  1H75 A; 
#chains in the Genus database with same CATH topology
 1E6B A;  1ZZY A;  1V40 A;  4WR4 A;  5KOX A;  2A4V A;  2RUE A;  3TU3 B;  3SBC A;  2JZS A;  3H1N A;  4POL A;  4MDC A;  3TRX A;  1EEJ A;  3GL3 A;  3GUS A;  3PH9 A;  1XIY A;  4AJ8 A;  1PX7 A;  1TP9 A;  4POM A;  3GX8 A;  4W66 A;  1TKD B;  1AC1 A;  1FO5 A;  4PQH A;  2OA7 A;  1ML6 A;  5J3R A;  2O7K A;  3VWV A;  4XRA A;  1ERV A;  3FR6 A;  2B6M A;  4OMV A;  1J08 A;  5FT3 A;  2L59 A;  4FYC A;  1OKD A;  3KXO A;  1Q4J A;  1GUH A;  3CSI A;  3A2V A;  3LGC A;  3RPP A;  4DSS B;  2P31 A;  1ILO A;  2VLV A;  5DAL B;  4EKZ A;  1GTU A;  3FW2 A;  5G1L A;  2VM2 A;  5EPF A;  4IQA A;  5ELG A;  2OAC A;  2CA8 A;  1SK2 A;  3CSJ A;  1I5G A;  3F63 A;  4A5P A;  1WPI A;  4J57 E;  2H70 A;  2P5R A;  2GST A;  5DJM A;  1TRW A;  4XS4 B;  3CTG A;  2LJA A;  1QXH A;  2GVP A;  2VCX A;  3L0H A;  5KN3 A;  2OAD A;  3LJR A;  1A24 A;  4V2M A;  2LS5 A;  2IIY A;  3HHV A;  5CO3 A;  5H5R A;  4GQC A;  4NWY A;  4KA0 A;  4IP6 A;  2OT3 A;  4ICY A;  3HJO A;  1K3O A;  1V2A A;  1HYU A;  4G01 A;  3UVH A;  2BTO T;  3QAW A;  3I69 A;  4AI6 A;  5ENU A;  1BAY A;  2O85 A;  1JHB A;  1HNB A;  1GTB A;  1PD2 1;  4F03 A;  3FZ9 A;  4JR4 A;  4Z7X A;  4V1A g;  5GAP D;  3U5R E;  1PQN A;  5C04 A;  2J9H A;  3K8N A;  2BMX A;  1YY7 A;  3MWH A;  1YJ6 A;  6GSW A;  2FA4 A;  6GSX A;  1A0F A;  1B8X A;  3M0F A;  3VI7 A;  5A5H B;  4K0G A;  3QPM A;  3HKR A;  1LJR A;  2YV7 A;  3TUE A;  2LRT A;  5AGY A;  1R4W A;  2X8C A;  4TR1 B;  1PSQ A;  2PWJ A;  2IMI A;  2YZH A;  17GS A;  5F0G A;  1T00 A;  4N10 A;  2YPM A;  1M0U A;  3M9J A;  1GUL A;  2H6X A;  2DJ1 A;  1FHE A;  2YJH A;  2C3N A;  2RUF A;  1PL1 A;  2X49 A;  1YZX A;  5ELA A;  2TRC P;  3D21 A;  5EVO A;  2DMM A;  4MP4 A;  2V6K A;  1OC8 A;  4X43 A;  1BED A;  5J47 A;  2WS2 A;  2PGT A;  3BJ5 A;  2LEG A;  2DBC A;  5F05 A;  4BA7 A;  3IAM 2;  3TRQ A;  5ECK B;  2DJ0 A;  1S3A A;  2RM5 A;  3HY2 A;  1O81 A;  2IJY A;  1YF0 A;  4GDF A;  1T1V A;  5GAN D;  5A34 B;  3UVT A;  3G7I A;  1G7O A;  2GQK A;  4OFN A;  5A4U A;  2JSZ A;  3US3 A;  3LG6 A;  1R26 A;  4WEY A;  1MDK A;  2MMA A;  3GN3 A;  2E0Q A;  2LTK A;  3KCM A;  5JWO B;  4L0W A;  1T4Z A;  4RI7 A;  5FWG A;  2H71 A;  2H74 A;  1GP1 A;  5CP1 A;  3DRN A;  2KUC A;  1EP7 A;  3ZL5 A;  1DSB A;  3EVI A;  4TXO A;  5H5Q A;  3HVX A;  3CQF A;  2B3S A;  3EIN A;  4MF6 A;  3QDN A;  2HQT A;  3TKS A;  2VM1 A;  5HR3 A;  4L5O A;  1AW9 A;  3GKM A;  4K8M A;  3KJY A;  1U6T A;  2NVL A;  1VRS D;  1ZYE A;  2LNT A;  1Z5Y E;  4PUR A;  5GZZ B;  4RUV A;  3KP9 A;  1AQW A;  5AIS A;  2C3T A;  4IN0 A;  1U3I A;  3ZIT A;  4KE3 A;  4MZW A;  3ZYW A;  5ID2 A;  5KOW A;  3BBY A;  4PNF A;  2VCT A;  2Z9S A;  3QD9 A;  1SJI A;  4MA9 A;  2FNO A;  4MJE A;  2GTU A;  4MJC A;  1BYE A;  2A2R A;  4OCE A;  3JCM L;  3HVS A;  3ZTL A;  4PI2 C;  2X8H A;  2X64 A;  3DGQ A;  2IFQ B;  4EUY A;  2HZE A;  1A23 A;  3C1R A;  1AIU A;  1XOB A;  2AAW A;  2EFH A;  1GSU A;  4HS1 A;  3LEF A;  5IOX A;  4CY6 A;  3TOU A;  2PVO C;  1R5P A;  4CY8 A;  4Q5N A;  4WR5 A;  3F8U A;  1XWK A;  1F2E A;  4HJM A;  3E9J B;  2H30 A;  2AV4 A;  4ZL9 A;  4BL7 B;  1X9M B;  1EV9 A;  10GS A;  4TXV A;  4ACS A;  3ZML A;  2C8U A;  4GLT A;  4D73 B;  3TB2 A;  3HVV A;  1AUC A;  1SU9 A;  2X8G A;  3LYK A;  5D93 A;  1XXU A;  4JE1 A;  1QK8 A;  1JLW A;  4ML6 A;  2GSR A;  1PN9 A;  2GT6 A;  4JZQ A;  3O6T A;  2UV8 G;  2ON7 A;  4FXY P;  2PN8 A;  4IHU A;  3BD2 A;  2AJQ B;  4KUN A;  3UJ1 A;  3QOU A;  3TKS C;  2YN1 A;  1XG8 A;  1OE8 A;  4HEA 2;  3ZLP A;  2IL3 A;  5ECR B;  4PHZ C;  2F8A A;  1F6M C;  2GDR A;  3HA9 A;  3Q6O A;  4HSC X;  2DLX A;  4EXJ A;  2G0F A;  5LNK e;  3W8S A;  2F8F A;  4Q5R A;  4MAB A;  3Q19 A;  4KH7 A;  4KX4 A;  2MMO A;  1M9A A;  2HFD A;  4V1A p;  3HDC A;  2AYT A;  1XZO A;  1GSQ A;  2QKE A;  2L6D A;  5CAX A;  2JZR A;  4PI0 C;  1YKC A;  4IQ1 A;  4KAE A;  1Z9H A;  4GXZ A;  4MCU A;  3M9K A;  2B5E A;  2HSH A;  3IE3 A;  3Q74 A;  1MD3 A;  4TR0 A;  1YEX A;  4QMK A;  1XWA A;  1Q98 A;  2QA2 A;  4XS4 A;  2PER A;  4ZB6 A;  4HZ4 A;  1GSS A;  5G5E A;  5A1N B;  4IVF A;  2VL2 A;  1ZL9 A;  2C80 A;  2V1M A;  2L4Q A;  4MPF A;  2WDU A;  3ZFL A;  4TXO B;  1GUM A;  4NAX A;  4FO5 A;  5CRG A;  2OE1 A;  1TRU A;  22GS A;  4MF7 A;  6GSY A;  2ZNM A;  3IOS A;  2L6C A;  3BOA A;  3EC3 A;  2C3Q A;  2O8V B;  2HXK A;  3TJK A;  4KDU A;  1FOV A;  2PBJ A;  1V9W A;  3LQ7 A;  1OVN A;  5ID2 B;  3G7Y A;  3LFL A;  2O87 A;  3RPN A;  3O3T A;  5CNW A;  3GUR A;  3GH9 A;  3VUR A;  1M9B A;  3CWG A;  6GSU A;  2R0C A;  4EIP A;  2YWM A;  1PMT A;  4DSQ A;  3GKK A;  5DBQ A;  1XPV A;  1TI1 A;  4OWY A;  4RQR A;  4X0X A;  1FAA A;  5A5H A;  4JU5 A;  1OKT A;  2O89 A;  4MJB A;  3DXB A;  2HZE B;  1Z7R A;  4IJI A;  1XCC A;  3IK9 A;  3NIV A;  4KB3 A;  3UL3 A;  3EMX A;  2KHP A;  1ABA A;  2HRA A;  3C73 A;  1PFO A;  2L4C A;  3WT2 A;  1G6W A;  5IMV A;  1JFU A;  1N25 A;  2H66 A;  5G1K A;  4PGT A;  4N11 A;  1WMJ A;  3N9J A;  5IOW A;  1S3R A;  2H0I A;  2CAI A;  4HQS A;  1TW9 A;  1GRX A;  3KP8 A;  4KCE A;  4GQF A;  2X99 A;  1SVM A;  3A5W A;  1SK1 A;  4POK A;  5E4W A;  4IKH A;  3UBK A;  1XWC A;  4BIK A;  2JU5 A;  4EDY A;  3TGZ A;  2M80 A;  4ISD A;  3PR8 A;  2VL2 C;  1Y25 A;  1QGV A;  5J9C A;  4AKG A;  4MH3 A;  2R3X A;  2WW2 A;  5IMZ A;  3LOR A;  1JZD A;  4ID0 A;  2VCQ A;  4F2I A;  3GHA A;  1BX9 A;  1O6J A;  2EC4 A;  5A34 A;  2YNX A;  3C8E A;  1S3C A;  4XTS A;  1G0T A;  3ZRE A;  13GS A;  5COH A;  4G0I A;  2C0D A;  2R0P A;  4ILF A;  3H8Q A;  2R37 A;  1F3A A;  2FD3 A;  3UIW A;  1S4B P;  1K0D A;  5AIV A;  2GZP A;  3D6I A;  4POB A;  5HR1 A;  3D4M A;  4K2X A;  5GST A;  1GSD A;  2GZZ A;  1ERT A;  2B7K A;  1BQ7 A;  4ECJ A;  1A2M A;  5B6N A;  3GMF A;  2N5F A;  1GTA A;  5IMF A;  3QFB C;  3HMJ G;  4GF0 A;  4NXI A;  1WE0 A;  2H76 A;  3FK8 A;  1PX6 A;  5A4V A;  2B1K A;  1GLQ A;  5D9T A;  2WUL A;  1Z6N A;  3FEU A;  3ZZX A;  4DEJ A;  3F4S A;  3GH6 A;  1EOG A;  5KEJ A;  2IPA A;  5HR2 A;  5HR0 A;  1B9X C;  4AKX B;  3IHG A;  4K9Z A;  2GT5 A;  4KGI A;  3FY7 A;  1QFN A;  2E2G A;  5ECH B;  2HYX A;  5IMA A;  1LBK A;  3CXG A;  4PNG A;  2B7J A;  2HLS A;  4PQ1 A;  4OO4 A;  1K3L A;  3CSH A;  2CVD A;  3E0U A;  1V57 A;  2OBK A;  2O3E A;  4DVC A;  1X5C A;  4O5U A;  1YKA A;  1JZW A;  1SD8 A;  2MBT A;  2WRT A;  4K2D A;  2VUP A;  4IGJ A;  7GSS A;  2V6O A;  3ERW A;  3APQ A;  2EIR A;  2CVK A;  2IFQ A;  5JCU A;  1ZMA A;  4USS A;  2F9S A;  2R2J A;  1X9W B;  1ON4 A;  2LNS A;  3EMP A;  4NV2 A;  5ECQ B;  2LKU A;  3EUR A;  5E59 A;  1HNA A;  4KSO A;  1KBN A;  2GQM A;  4K6X A;  3QAG A;  5J9B A;  1O85 A;  11GS A;  3W8J A;  1AQV A;  5KN2 A;  2P0G A;  4BL7 A;  2FHE A;  3WYW A;  4AKI A;  4ZBB A;  2KP2 A;  3QCP A;  4PXO A;  4D73 A;  3TJG A;  4O7H A;  4AJ6 A;  3APO A;  2EIO A;  1X0R A;  4ZB8 A;  1MTC A;  1W4V A;  1XW9 A;  3IV4 A;  1B48 A;  2ZCT A;  2H73 A;  3UAP A;  3L9V A;  1X9S B;  1PN0 A;  5ECO B;  1WIK A;  2F51 A;  2I4A A;  3F9U A;  2LRN A;  1V98 A;  1HD2 A;  2FWE A;  1I9D A;  1VF4 A;  5DDL A;  2JSY A;  3ZVJ A;  2LQO A;  1FG4 A;  4L5L A;  4FYU A;  1GWC A;  1USB A;  5KN1 A;  1SVL A;  2H75 A;  2HRK A;  4JED A;  2VL3 A;  3L4N A;  3RBT A;  4BVX A;  2B5X A;  5A4W A;  2O36 A;  4K7N A;  3WT1 A;  4KSM A;  5DVB A;  1SKW B;  2R5G A;  5HFG A;  4MZB A;  1O8W A;  5IO2 A;  3LYP A;  3RFR C;  5EL8 A;  2VKZ G;  4HQZ A;  1M2D A;  3IC8 A;  1URM A;  2CX3 A;  3MYD A;  4GWR A;  4NHZ A;  4EVM A;  1K0O A;  1I1I P;  4JBB A;  4G19 A;  3L78 A;  5LCZ A;  4I2U A;  5J5N A;  4YAV A;  5A1N A;  1K0C A;  1NM3 A;  2YWN A;  2IWT A;  3GL5 A;  4IS0 A;  3RDW A;  3DKS A;  4Z2T A;  3UBL A;  1XWB A;  4ECI A;  3IK7 A;  4HU9 A;  4RQX A;  2HI7 A;  1YDK A;  2OE0 A;  1BJX A;  4HOJ A;  2V41 A;  5GSS A;  3UOM A;  4GST A;  1TI3 A;  4TR3 A;  1IYI A;  2K8S A;  4EIQ A;  1AAZ A;  3IHQ A;  4HDE A;  3VPQ A;  4JR6 A;  2UZ8 A;  1A2J A;  3VWX A;  4GSN A;  4N30 A;  3VWW A;  1EP8 A;  3IC4 A;  1SKS B;  1VF1 A;  2HSM A;  3ME7 A;  6GST A;  3GYK A;  5FHI A;  4EDZ A;  3KH9 A;  2GGT A;  3FR9 A;  5JCW A;  4CW9 A;  1T7P B;  2JAD A;  3G7J A;  3EPT A;  2CX4 A;  3KTL A;  2V32 A;  2YOI A;  3R2Q A;  3IXR A;  3L9S A;  2IMK A;  2H0H A;  1U3A A;  1M3I A;  4OFT A;  5B8B A;  1G6Y A;  1T4Y A;  1THX A;  4L8E A;  5F07 A;  5D8I A;  2VLU A;  3IAS 2;  2NTO A;  3I43 A;  1EZK A;  1FB0 A;  1OYJ A;  3ERG A;  1SEN A;  4K5R A;  1ZOF A;  4CDO A;  2XPE A;  3GSS A;  3FR3 A;  2I1U A;  1XFL A;  2FUG 2;  4AJ7 A;  1Z3E A;  1N8J A;  2WFC A;  4Z2R A;  4TR4 A;  4ZIL A;  4I5Q A;  4I2T A;  2BJX A;  1VGL A;  2E7P A;  2QGV A;  2DSA A;  4YQV A;  3CTF A;  3ZFB A;  2D2Z A;  1ZYQ B;  4JRR A;  4OD7 A;  3FMW A;  4BVY B;  2H8L A;  1CQH A;  6GSV A;  3J7Y k;  1EWX A;  3MIX A;  3KEB A;  1EOH A;  2PUK C;  4XS1 A;  3GKX A;  1BG5 A;  1BF5 A;  2ON5 A;  4X1U A;  3GA4 A;  3TKP A;  16GS A;  4TOP A;  19GS A;  2WW0 A;  9GSS A;  2TRX A;  1FOH A;  1GSY A;  3GNJ A;  5AIX A;  1OE7 A;  3RAZ A;  1LU4 A;  3S9F A;  1W89 A;  3RHC A;  1DE1 A;  1GLP A;  1EV4 A;  4QL9 A;  2FY6 A;  4J56 E;  4E8E A;  2FWF A;  2HRK B;  2LQQ A;  2XBQ A;  3WD6 A;  4LA1 A;  2R6K A;  1R7H A;  2VCW A;  4BVX B;  4LLR A;  2VAF A;  2YWI A;  3HJP A;  4N3Z A;  2DJK A;  4BWS A;  2FLS A;  3P2A A;  3CRT A;  1B4P A;  2E2M A;  3ISO A;  1WOU A;  3ZIJ A;  5JWR B;  4OO5 A;  5ECM B;  3KIJ A;  2HSY A;  4YKG A;  2AUV A;  2YZU A;  3OR5 A;  3GIX A;  4OFM A;  1FB6 A;  3DML A;  3I6A A;  3HYP A;  5CRW A;  3DWV A;  2HRN A;  3P8W A;  1XBS A;  4K0N A;  5J40 A;  3WGE A;  3GST A;  4GTU A;  4G0K A;  1TRV A;  3KH7 A;  2WVX A;  2WVZ A;  3ERF A;  4X4J A;  1K0N A;  4Z2U A;  1O8X A;  4KCA A;  4WET A;  2CV4 A;  3NZN A;  1XOA A;  3PIN A;  2EFE A;  3GTU B;  4NV5 A;  2PPT A;  5DCH A;  2OJL A;  2C0E A;  2NBS A;  1EEM A;  1BG1 A;  1ST9 A;  2HSM B;  4MF5 A;  3DIE A;  1WWJ A;  4PUF C;  1M2B A;  1R5A A;  2DC5 A;  1YEW C;  2L5L A;  5D9X A;  5F8B A;  2GLR A;  1O73 A;  1SYX A;  2HSN A;  2LUS A;  4L0U A;  3KMO A;  1PA3 A;  3QR6 A;  3PPU A;  1Y6E A;  4XHM A;  2L5O A;  3DVW A;  4FYB A;  2MYG A;  4QQ7 A;  1NHO A;  4KND A;  1K3Y A;  1DE2 A;  1YF1 A;  4XIH A;  4WXT A;  4MPG A;  1M7T A;  5H5S A;  4HJ2 A;  1UA5 A;  2LST A;  3D0Z A;  4ULX A;  1K0B A;  1PRX A;  1QQ2 A;  2WCI A;  4K5S A;  1XVQ A;  1T8E B;  2O5V A;  1JLV A;  1SL1 B;  2MBS A;  3GV1 A;  3HD5 A;  5G5F A;  2KOK A;  1J0F A;  2HRF A;  3D5J A;  1WP0 A;  4ML1 A;  5AN1 A;  3CMI A;  4ECC A;  1A2L A;  3KD0 A;  1TRS A;  4QL7 A;  2GQL A;  1M99 A;  4ZL7 A;  3MAK A;  3KTB A;  1T3B A;  4DSR A;  1DBY A;  2V2G A;  2L57 A;  1JZR A;  1ZGN A;  2I81 A;  5ECN B;  4NMU A;  2FCH A;  4NPB A;  5IMC A;  2ALB A;  4F0C A;  3SWL A;  2X4A A;  1JZO A;  3F6F A;  3ZVJ D;  3EU4 A;  5IO0 A;  2VD1 A;  2FGX A;  3VWU A;  2H01 A;  2IME A;  5G31 A;  2LV3 A;  5G2Z A;  1SL0 B;  4ZBD A;  2JZT A;  3VI5 A;  4FH8 A;  2H1D A;  3HXS A;  3MDK A;  2LJK A;  4WBR D;  1TXU A;  1HNC A;  4HU7 A;  1NHY A;  3IPZ A;  1HQO A;  3DD3 A;  5DQY A;  2TIR A;  1ACV A;  2KLX A;  1SD9 A;  3KGK A;  2NDO A;  1S3D A;  3ZMK A;  2YAN A;  2XPD A;  3QFA C;  4CHS A;  3HZ8 A;  2B1L A;  2H1L A;  1MDI A;  4V2L A;  4XS6 A;  2HZF A;  2ZUP A;  2VOC A;  1YQ1 A;  2MZC A;  4MH2 A;  2H1G A;  2DKI A;  4XCS A;  5CYY A;  3WGD A;  2JL4 A;  2I9H A;  3DYR A;  5J4V A;  4TW5 A;  5KN0 A;  2WW1 A;  5BMU A;  3DVX A;  4RI6 A;  4TVE A;  3WGX A;  2WVY A;  2WVX B;  4IEL A;  1A0R P;  3A2W A;  3Q18 A;  2H19 A;  3F0I A;  3F3Q A;  1VF2 A;  3TKQ A;  3C71 A;  2N5A A;  4I6X A;  4KW6 A;  3ME8 A;  4KF9 A;  2QSI A;  2HT9 A;  4O92 A;  3H4K A;  2A2S A;  3FHK A;  5BRT A;  3D22 A;  4BPY A;  1FVJ A;  3TCO A;  4N0Z A;  3EU3 A;  3UEM A;  4K7I A;  4PQI A;  1AXD A;  1U88 A;  2HSN B;  1GUK A;  3CHX C;  1OC3 A;  5DAK A;  5IPH A;  3LXT A;  3MNG A;  5IM9 A;  1EGO A;  5L71 A;  4HZ2 A;  3KM6 A;  4G2E A;  3HVN A;  4ZIJ A;  2VL9 A;  1ZCP A;  1A8L A;  3M1G A;  1SKR B;  1SVO A;  4LMW A;  1YEP A;  2AB6 A;  2VLT A;  2ES7 A;  4H86 A;  2VCZ A;  5CRE A;  2H1A A;  2R4V A;  4BVY A;  2RLI A;  2EFD A;  1YVL A;  2K18 A;  1KNG A;  5HQP A;  3H93 A;  1V58 A;  3RHB A;  5ECL B;  4YH2 A;  1KTE A;  5CRH A;  2PVQ A;  2CVB A;  2B5Y A;  1NW2 A;  2CZ2 A;  5G30 A;  4G10 A;  3TJF A;  1OAZ A;  2HE3 A;  3A2X A;  1XWG A;  20GS A;  5DJL A;  5JWQ B;  1GNW A;  3ED3 A;  1PKZ A;  2P5Q A;  4ZL8 A;  5ECS A;  5IMD A;  3F3R A;  3L9U A;  2DIY A;  4XRD A;  1XVW A;  4ZB9 A;  5B8A A;  4Q5Q A;  2CAQ A;  3APS A;  2XBI A;  1WJK A;  4TN8 A;  4NHW A;  3BCI A;  5JCG A;  3MSZ A;  1F37 A;  3IRA A;  3CRU A;  2RM6 A;  4F9Z A;  4F0B A;  4GRF A;  2YJ7 A;  3PGT A;  4ZBA A;  1GSE A;  4YAP A;  5ABR A;  3AY8 A;  3CYN A;  3VFI A;  4IBP A;  2DIZ A;  1OC9 A;  1PGT A;  4O32 A;  2MMN A;  1THO A;  3UAR A;  1QMV A;  1SJZ A;  2H1B A;  2R0G A;  4ZXG A;  1RW1 A;  3C1S A;  2PMT A;  2YV9 A;  3IBH A;  4FIW A;  3N5O A;  2AHE A;  2K9F A;  3GTU A;  3FZ5 A;  5A5K A;  2VD0 A;  1AQX A;  2DKH A;  4MLY A;  3D4T A;  3VPT A;  5IPG A;  5LD0 A;  1G7E A;  1XW5 A;  1QUW A;  5BMU B;  2DJ3 A;  2K6V A;  4EF0 A;  2C4J A;  2M72 A;  3FYG A;  4AKH A;  2KP1 A;  2OBI A;  4KDX A;  2OKA A;  4LL1 B;  4MZC A;  4LMV A;  1SK0 A;  2C1Y A;  1TK8 B;  3LWA A;  1GNE A;  18GS A;  4E68 A;  1UN2 A;  1Z7P A;  2H72 A;  2LRC A;  3TDG A;  5EY6 A;  3P7X A;  1ERW A;  4EE0 A;  4HUA A;  5IIZ A;  2VO4 A;  3C7M A;  1TTZ A;  2PU9 C;  1M3J A;  1TDI A;  2N5B A;  3NOF A;  2DJ2 A;  3GX0 A;  4MK3 A;  1Y1U A;  1C72 A;  3ZIV A;  5HFK A;  2FWH A;  1X5D A;  5DAK B;  1SL2 B;  5D9V A;  3M3M A;  2I3Y A;  4K7O A;  3F4R A;  4IP1 A;  2QC7 A;  3U6V A;  3QMX A;  4KDY A;  3F6D A;  14GS A;  1M2A A;  5D73 A;  2EIQ A;  4MJA A;  1RK4 A;  3TOT A;  3ZRD A;  4EC0 A;  3TJB A;  2DML A;  4WF4 A;  4YKF A;  2VCV A;  3FKF A;  4YQU A;  4V2N A;  2G2Q A;  1SYR A;  2A4H A;  3J7Y b;  4N0V A;  4TKY A;  3I9V 2;  3LSZ A;  4WBJ A;  2QA1 A;  5DCG A;  2REM A;  1A8Y A;  5ECI B;  4AGS A;  1TXX A;  3DEX A;  3GKN A;  3A3T A;  1E2Y A;  4EL1 A;  5DQS A;  2RII A;  5ECP B;  3FRC A;  3LXZ A;  2WZS A;  5IQY A;  4E8H A;  4F82 A;  1TJD A;  1FVK A;  3UMA A;  5B6M A;  5CRD A;  2WGR A;  3E3E A;  2M46 A;  3HCZ A;  1F9M A;  3BCK A;  4LL4 B;  2FA8 A;  2GSQ A;  1ZYN A;  4TRX A;  3KZQ A;  3V1W A;  1H4O A;  1CQG A;  2YP6 A;  6GSS A;  2CZ3 A;  1GL8 A;  3HJM A;  1EGR A;  4P3Y B;  2A2P A;  1UVZ A;  3FZA A;  3TRP A;  4DSS A;  2H6Z A;  1J9B A;  3W6G A;  5DAL A;  2XHF A;  1XW6 A;  4ECB A;  2IN3 A;  3IA1 A;  4MNN A;  3LW9 A;  3P90 A;  2C0G A;  1OC9 B;  1F3B A;  3R3E A;  3IDV A;  8GSS A;  2GSS A;  5J4Y A;  1PL2 A;  4IW9 A;  3O76 A;  2WJU A;  3VLN A;  1GSF A;  2IMD A;  5D96 A;  4G0L A;  2IMF A;  4FQU A;  3TKR A;  1TU7 A;  3FZ4 A;  2YCD A;  3EYT A;  1UC7 A;  1SJ6 A;  2XC2 A;  1DUG A;  1GTI A;  1RQM A;  3EE2 A;  2GS3 A;  1FW1 A;  2H6Y A;  2WB9 A;  2NPB A;  1ZYP A;  4WF5 A;  3HZ4 A;  1GH2 A;  1B4Q A;  3VK9 A;  3RGB C;  4J2F A;  3TKS E;  4HI7 A;  2WW3 A;  4O5R A;  2DJJ A;  1B9Y C;  1TU8 A;  5F06 A;  1KEB A;  4EO3 A;  2LJR A;  1IYH A;  4Q5F A;  1VF3 A;  1TK0 B;  2C0F A;  2GZY A;  1X5E A;  5C00 A;  1TK5 B;  4GCI A;  2WZ9 A;  3TJJ A;  5INY A;  1O7U A;  4G9H A;  1PKW A;  4PX1 A;  3QAV A;  3M8N A;  1Z6M A;  1K0A A;  3CBU A;  5J4U A;  3H79 A;  1U87 A;  4PUA A;  2H0G A;  2CT6 A;  2F3M A;  4MMM A;  3EWL A;  3GRX A;  5B7C A;  1TOF A;  1ERU A;  4YQM A;  1MEK A;  4OCF A;  12GS A;  5J41 A;  4PTS A;  4TR1 A;  4I97 A;  3F4T A;  2JAC A;  4O5Q A;  1WRY A;  3A5I A;  5HFI A;  3GFK A;  1MDJ A;  1MD4 A;  2YWO A;  3G9B A;  5D9W A;  2HNL A;  3IR4 A;  1N2A A;  2MMZ A;  4AF2 A;  4ZB7 A;  2CQ9 A;  4BWQ A;  1K0M A;  4GSS A;  2OE3 A;  3KMN A;  2VIM A;  4IJ3 A;  2J23 A;  4I8B A;  4K1F A;  2EFC A;  1NSW A;  2FWG A;  2K8V A;  4WKW A;  1H75 A; 
#chains in the Genus database with same CATH homology
 1E6B A;  1ZZY A;  1V40 A;  4WR4 A;  5KOX A;  2A4V A;  2RUE A;  3TU3 B;  3SBC A;  2JZS A;  3H1N A;  4POL A;  4MDC A;  3TRX A;  1EEJ A;  3GL3 A;  3GUS A;  3PH9 A;  1XIY A;  4AJ8 A;  1PX7 A;  1TP9 A;  4POM A;  3GX8 A;  4W66 A;  1TKD B;  1AC1 A;  1FO5 A;  4PQH A;  2OA7 A;  1ML6 A;  5J3R A;  2O7K A;  3VWV A;  4XRA A;  1ERV A;  3FR6 A;  2B6M A;  4OMV A;  1J08 A;  5FT3 A;  2L59 A;  4FYC A;  1OKD A;  3KXO A;  1Q4J A;  1GUH A;  3CSI A;  3A2V A;  3LGC A;  3RPP A;  4DSS B;  2P31 A;  1ILO A;  2VLV A;  5DAL B;  4EKZ A;  1GTU A;  3FW2 A;  5G1L A;  2VM2 A;  5EPF A;  4IQA A;  5ELG A;  2OAC A;  2CA8 A;  1SK2 A;  3CSJ A;  1I5G A;  3F63 A;  4A5P A;  1WPI A;  4J57 E;  2H70 A;  2P5R A;  2GST A;  5DJM A;  1TRW A;  4XS4 B;  3CTG A;  2LJA A;  1QXH A;  2GVP A;  2VCX A;  3L0H A;  5KN3 A;  2OAD A;  3LJR A;  1A24 A;  4V2M A;  2LS5 A;  2IIY A;  3HHV A;  5CO3 A;  5H5R A;  4GQC A;  4NWY A;  4KA0 A;  4IP6 A;  2OT3 A;  4ICY A;  3HJO A;  1K3O A;  1V2A A;  1HYU A;  4G01 A;  3UVH A;  2BTO T;  3QAW A;  3I69 A;  4AI6 A;  5ENU A;  1BAY A;  2O85 A;  1JHB A;  1HNB A;  1GTB A;  1PD2 1;  4F03 A;  3FZ9 A;  4JR4 A;  4Z7X A;  4V1A g;  5GAP D;  3U5R E;  1PQN A;  5C04 A;  2J9H A;  3K8N A;  2BMX A;  1YY7 A;  3MWH A;  1YJ6 A;  6GSW A;  2FA4 A;  6GSX A;  1A0F A;  1B8X A;  3M0F A;  3VI7 A;  5A5H B;  4K0G A;  3QPM A;  3HKR A;  1LJR A;  2YV7 A;  3TUE A;  2LRT A;  5AGY A;  1R4W A;  2X8C A;  4TR1 B;  1PSQ A;  2PWJ A;  2IMI A;  2YZH A;  17GS A;  5F0G A;  1T00 A;  4N10 A;  2YPM A;  1M0U A;  3M9J A;  1GUL A;  2H6X A;  2DJ1 A;  1FHE A;  2YJH A;  2C3N A;  2RUF A;  1PL1 A;  2X49 A;  1YZX A;  5ELA A;  2TRC P;  3D21 A;  5EVO A;  2DMM A;  4MP4 A;  2V6K A;  1OC8 A;  4X43 A;  1BED A;  5J47 A;  2WS2 A;  2PGT A;  3BJ5 A;  2LEG A;  2DBC A;  5F05 A;  4BA7 A;  3IAM 2;  3TRQ A;  5ECK B;  2DJ0 A;  1S3A A;  2RM5 A;  3HY2 A;  1O81 A;  2IJY A;  1YF0 A;  4GDF A;  1T1V A;  5GAN D;  5A34 B;  3UVT A;  3G7I A;  1G7O A;  2GQK A;  4OFN A;  5A4U A;  2JSZ A;  3US3 A;  3LG6 A;  1R26 A;  4WEY A;  1MDK A;  2MMA A;  3GN3 A;  2E0Q A;  2LTK A;  3KCM A;  5JWO B;  4L0W A;  1T4Z A;  4RI7 A;  5FWG A;  2H71 A;  2H74 A;  1GP1 A;  5CP1 A;  3DRN A;  2KUC A;  1EP7 A;  3ZL5 A;  1DSB A;  3EVI A;  4TXO A;  5H5Q A;  3HVX A;  2B3S A;  3EIN A;  4MF6 A;  3QDN A;  2HQT A;  3TKS A;  2VM1 A;  5HR3 A;  4L5O A;  1AW9 A;  3GKM A;  4K8M A;  3KJY A;  1U6T A;  2NVL A;  1VRS D;  1ZYE A;  2LNT A;  1Z5Y E;  4PUR A;  5GZZ B;  4RUV A;  3KP9 A;  1AQW A;  5AIS A;  2C3T A;  4IN0 A;  1U3I A;  3ZIT A;  4KE3 A;  4MZW A;  3ZYW A;  5ID2 A;  5KOW A;  3BBY A;  4PNF A;  2VCT A;  2Z9S A;  3QD9 A;  1SJI A;  4MA9 A;  2FNO A;  4MJE A;  2GTU A;  4MJC A;  1BYE A;  2A2R A;  4OCE A;  3JCM L;  3HVS A;  3ZTL A;  2X8H A;  2X64 A;  3DGQ A;  2IFQ B;  4EUY A;  2HZE A;  1A23 A;  3C1R A;  1AIU A;  1XOB A;  2AAW A;  2EFH A;  1GSU A;  4HS1 A;  3LEF A;  5IOX A;  4CY6 A;  3TOU A;  2PVO C;  1R5P A;  4CY8 A;  4Q5N A;  4WR5 A;  3F8U A;  1XWK A;  1F2E A;  4HJM A;  3E9J B;  2H30 A;  2AV4 A;  4ZL9 A;  4BL7 B;  1X9M B;  1EV9 A;  10GS A;  4TXV A;  4ACS A;  3ZML A;  2C8U A;  4GLT A;  4D73 B;  3TB2 A;  3HVV A;  1AUC A;  1SU9 A;  2X8G A;  3LYK A;  5D93 A;  1XXU A;  4JE1 A;  1QK8 A;  1JLW A;  4ML6 A;  2GSR A;  1PN9 A;  2GT6 A;  4JZQ A;  3O6T A;  2UV8 G;  2ON7 A;  2PN8 A;  4IHU A;  3BD2 A;  2AJQ B;  4KUN A;  3UJ1 A;  3QOU A;  3TKS C;  2YN1 A;  1OE8 A;  4HEA 2;  3ZLP A;  2IL3 A;  5ECR B;  2F8A A;  1F6M C;  2GDR A;  3HA9 A;  3Q6O A;  2DLX A;  4EXJ A;  2G0F A;  5LNK e;  3W8S A;  2F8F A;  4Q5R A;  4MAB A;  3Q19 A;  4KH7 A;  4KX4 A;  2MMO A;  1M9A A;  2HFD A;  4V1A p;  3HDC A;  2AYT A;  1XZO A;  1GSQ A;  2QKE A;  2L6D A;  5CAX A;  2JZR A;  1YKC A;  4IQ1 A;  4KAE A;  1Z9H A;  4GXZ A;  4MCU A;  3M9K A;  2B5E A;  2HSH A;  3IE3 A;  3Q74 A;  1MD3 A;  4TR0 A;  1YEX A;  4QMK A;  1XWA A;  1Q98 A;  2QA2 A;  4XS4 A;  2PER A;  4ZB6 A;  4HZ4 A;  1GSS A;  5G5E A;  5A1N B;  4IVF A;  2VL2 A;  1ZL9 A;  2C80 A;  2V1M A;  2L4Q A;  4MPF A;  2WDU A;  3ZFL A;  4TXO B;  1GUM A;  4NAX A;  4FO5 A;  5CRG A;  2OE1 A;  1TRU A;  22GS A;  4MF7 A;  6GSY A;  2ZNM A;  3IOS A;  2L6C A;  3BOA A;  3EC3 A;  2C3Q A;  2O8V B;  2HXK A;  3TJK A;  4KDU A;  1FOV A;  2PBJ A;  1V9W A;  3LQ7 A;  1OVN A;  5ID2 B;  3G7Y A;  3LFL A;  2O87 A;  3RPN A;  3O3T A;  5CNW A;  3GUR A;  3GH9 A;  3VUR A;  1M9B A;  3CWG A;  6GSU A;  2R0C A;  4EIP A;  2YWM A;  1PMT A;  4DSQ A;  3GKK A;  5DBQ A;  1XPV A;  1TI1 A;  4OWY A;  4RQR A;  4X0X A;  1FAA A;  5A5H A;  4JU5 A;  1OKT A;  2O89 A;  4MJB A;  3DXB A;  2HZE B;  1Z7R A;  4IJI A;  1XCC A;  3IK9 A;  3NIV A;  4KB3 A;  3UL3 A;  3EMX A;  2KHP A;  1ABA A;  2HRA A;  3C73 A;  2L4C A;  3WT2 A;  1G6W A;  5IMV A;  1JFU A;  1N25 A;  2H66 A;  5G1K A;  4PGT A;  4N11 A;  1WMJ A;  3N9J A;  5IOW A;  2H0I A;  2CAI A;  4HQS A;  1TW9 A;  1GRX A;  3KP8 A;  4KCE A;  4GQF A;  2X99 A;  1SVM A;  3A5W A;  1SK1 A;  4POK A;  5E4W A;  4IKH A;  3UBK A;  1XWC A;  2JU5 A;  4EDY A;  3TGZ A;  2M80 A;  4ISD A;  3PR8 A;  2VL2 C;  1Y25 A;  1QGV A;  5J9C A;  4AKG A;  4MH3 A;  2R3X A;  5IMZ A;  3LOR A;  1JZD A;  4ID0 A;  2VCQ A;  4F2I A;  3GHA A;  1BX9 A;  1O6J A;  2EC4 A;  5A34 A;  2YNX A;  3C8E A;  1S3C A;  4XTS A;  1G0T A;  3ZRE A;  13GS A;  5COH A;  4G0I A;  2C0D A;  2R0P A;  4ILF A;  3H8Q A;  2R37 A;  1F3A A;  2FD3 A;  3UIW A;  1K0D A;  5AIV A;  2GZP A;  3D6I A;  4POB A;  5HR1 A;  3D4M A;  4K2X A;  5GST A;  1GSD A;  2GZZ A;  1ERT A;  2B7K A;  1BQ7 A;  4ECJ A;  1A2M A;  5B6N A;  3GMF A;  2N5F A;  1GTA A;  5IMF A;  3QFB C;  3HMJ G;  4GF0 A;  4NXI A;  1WE0 A;  2H76 A;  3FK8 A;  1PX6 A;  5A4V A;  2B1K A;  1GLQ A;  5D9T A;  2WUL A;  1Z6N A;  3FEU A;  3ZZX A;  4DEJ A;  3F4S A;  3GH6 A;  1EOG A;  5KEJ A;  2IPA A;  5HR2 A;  5HR0 A;  1B9X C;  4AKX B;  3IHG A;  4K9Z A;  2GT5 A;  4KGI A;  3FY7 A;  1QFN A;  2E2G A;  5ECH B;  2HYX A;  5IMA A;  1LBK A;  3CXG A;  4PNG A;  2B7J A;  2HLS A;  4PQ1 A;  4OO4 A;  1K3L A;  3CSH A;  2CVD A;  3E0U A;  1V57 A;  2OBK A;  4DVC A;  1X5C A;  4O5U A;  1YKA A;  1JZW A;  1SD8 A;  2MBT A;  2WRT A;  4K2D A;  2VUP A;  4IGJ A;  7GSS A;  2V6O A;  3ERW A;  3APQ A;  2EIR A;  2CVK A;  2IFQ A;  5JCU A;  1ZMA A;  4USS A;  2F9S A;  2R2J A;  1X9W B;  1ON4 A;  2LNS A;  3EMP A;  4NV2 A;  5ECQ B;  2LKU A;  3EUR A;  5E59 A;  1HNA A;  4KSO A;  1KBN A;  2GQM A;  4K6X A;  3QAG A;  5J9B A;  1O85 A;  11GS A;  3W8J A;  1AQV A;  5KN2 A;  2P0G A;  4BL7 A;  2FHE A;  3WYW A;  4AKI A;  4ZBB A;  2KP2 A;  3QCP A;  4PXO A;  4D73 A;  3TJG A;  4O7H A;  4AJ6 A;  3APO A;  2EIO A;  1X0R A;  4ZB8 A;  1MTC A;  1W4V A;  1XW9 A;  3IV4 A;  1B48 A;  2ZCT A;  2H73 A;  3UAP A;  3L9V A;  1X9S B;  1PN0 A;  5ECO B;  1WIK A;  2F51 A;  2I4A A;  3F9U A;  2LRN A;  1V98 A;  1HD2 A;  2FWE A;  1I9D A;  1VF4 A;  5DDL A;  2JSY A;  3ZVJ A;  2LQO A;  1FG4 A;  4L5L A;  4FYU A;  1GWC A;  1USB A;  5KN1 A;  1SVL A;  2H75 A;  2HRK A;  4JED A;  2VL3 A;  3L4N A;  3RBT A;  4BVX A;  2B5X A;  5A4W A;  4K7N A;  3WT1 A;  4KSM A;  5DVB A;  1SKW B;  2R5G A;  5HFG A;  4MZB A;  1O8W A;  5IO2 A;  3LYP A;  5EL8 A;  2VKZ G;  4HQZ A;  1M2D A;  3IC8 A;  1URM A;  2CX3 A;  3MYD A;  4GWR A;  4NHZ A;  4EVM A;  1K0O A;  4JBB A;  4G19 A;  3L78 A;  5LCZ A;  4I2U A;  5J5N A;  4YAV A;  5A1N A;  1K0C A;  1NM3 A;  2YWN A;  2IWT A;  3GL5 A;  4IS0 A;  3RDW A;  3DKS A;  4Z2T A;  3UBL A;  1XWB A;  4ECI A;  3IK7 A;  4HU9 A;  4RQX A;  2HI7 A;  1YDK A;  2OE0 A;  1BJX A;  4HOJ A;  2V41 A;  5GSS A;  3UOM A;  4GST A;  1TI3 A;  4TR3 A;  1IYI A;  2K8S A;  4EIQ A;  1AAZ A;  3IHQ A;  4HDE A;  3VPQ A;  4JR6 A;  2UZ8 A;  1A2J A;  3VWX A;  4GSN A;  4N30 A;  3VWW A;  1EP8 A;  3IC4 A;  1SKS B;  1VF1 A;  2HSM A;  3ME7 A;  6GST A;  3GYK A;  5FHI A;  4EDZ A;  3KH9 A;  2GGT A;  3FR9 A;  5JCW A;  4CW9 A;  1T7P B;  2JAD A;  3G7J A;  3EPT A;  2CX4 A;  3KTL A;  2V32 A;  2YOI A;  3R2Q A;  3IXR A;  3L9S A;  2IMK A;  2H0H A;  1U3A A;  4OFT A;  5B8B A;  1G6Y A;  1T4Y A;  1THX A;  4L8E A;  5F07 A;  5D8I A;  2VLU A;  3IAS 2;  2NTO A;  3I43 A;  1EZK A;  1FB0 A;  1OYJ A;  3ERG A;  1SEN A;  4K5R A;  1ZOF A;  4CDO A;  2XPE A;  3GSS A;  3FR3 A;  2I1U A;  1XFL A;  2FUG 2;  4AJ7 A;  1Z3E A;  1N8J A;  2WFC A;  4Z2R A;  4TR4 A;  4ZIL A;  4I5Q A;  4I2T A;  2BJX A;  1VGL A;  2E7P A;  2QGV A;  2DSA A;  4YQV A;  3CTF A;  3ZFB A;  2D2Z A;  1ZYQ B;  4JRR A;  4OD7 A;  3FMW A;  4BVY B;  2H8L A;  1CQH A;  6GSV A;  3J7Y k;  1EWX A;  3MIX A;  3KEB A;  1EOH A;  2PUK C;  4XS1 A;  3GKX A;  1BG5 A;  1BF5 A;  2ON5 A;  4X1U A;  3GA4 A;  3TKP A;  16GS A;  4TOP A;  19GS A;  9GSS A;  2TRX A;  1FOH A;  1GSY A;  3GNJ A;  5AIX A;  1OE7 A;  3RAZ A;  1LU4 A;  3S9F A;  1W89 A;  3RHC A;  1DE1 A;  1GLP A;  1EV4 A;  4QL9 A;  2FY6 A;  4J56 E;  4E8E A;  2FWF A;  2HRK B;  2LQQ A;  2XBQ A;  3WD6 A;  4LA1 A;  2R6K A;  1R7H A;  2VCW A;  4BVX B;  4LLR A;  2VAF A;  2YWI A;  3HJP A;  4N3Z A;  2DJK A;  4BWS A;  2FLS A;  3P2A A;  3CRT A;  1B4P A;  2E2M A;  3ISO A;  1WOU A;  3ZIJ A;  5JWR B;  4OO5 A;  5ECM B;  3KIJ A;  2HSY A;  4YKG A;  2AUV A;  2YZU A;  3OR5 A;  3GIX A;  4OFM A;  1FB6 A;  3DML A;  3I6A A;  3HYP A;  5CRW A;  3DWV A;  2HRN A;  3P8W A;  1XBS A;  4K0N A;  5J40 A;  3WGE A;  3GST A;  4GTU A;  4G0K A;  1TRV A;  3KH7 A;  3ERF A;  4X4J A;  1K0N A;  4Z2U A;  1O8X A;  4KCA A;  4WET A;  2CV4 A;  3NZN A;  1XOA A;  3PIN A;  2EFE A;  3GTU B;  4NV5 A;  2PPT A;  5DCH A;  2OJL A;  2C0E A;  2NBS A;  1EEM A;  1BG1 A;  1ST9 A;  2HSM B;  4MF5 A;  3DIE A;  1WWJ A;  4PUF C;  1M2B A;  1R5A A;  2DC5 A;  2L5L A;  5D9X A;  5F8B A;  2GLR A;  1O73 A;  1SYX A;  2HSN A;  2LUS A;  4L0U A;  3KMO A;  1PA3 A;  3QR6 A;  3PPU A;  1Y6E A;  4XHM A;  2L5O A;  3DVW A;  4FYB A;  2MYG A;  4QQ7 A;  1NHO A;  4KND A;  1K3Y A;  1DE2 A;  1YF1 A;  4XIH A;  4WXT A;  4MPG A;  1M7T A;  5H5S A;  4HJ2 A;  1UA5 A;  2LST A;  3D0Z A;  4ULX A;  1K0B A;  1PRX A;  1QQ2 A;  2WCI A;  4K5S A;  1XVQ A;  1T8E B;  2O5V A;  1JLV A;  1SL1 B;  2MBS A;  3GV1 A;  3HD5 A;  5G5F A;  2KOK A;  1J0F A;  2HRF A;  3D5J A;  1WP0 A;  4ML1 A;  5AN1 A;  3CMI A;  4ECC A;  1A2L A;  3KD0 A;  1TRS A;  4QL7 A;  2GQL A;  1M99 A;  4ZL7 A;  3MAK A;  3KTB A;  1T3B A;  4DSR A;  1DBY A;  2V2G A;  2L57 A;  1JZR A;  1ZGN A;  2I81 A;  5ECN B;  4NMU A;  2FCH A;  4NPB A;  5IMC A;  2ALB A;  4F0C A;  3SWL A;  2X4A A;  1JZO A;  3F6F A;  3ZVJ D;  3EU4 A;  5IO0 A;  2VD1 A;  2FGX A;  3VWU A;  2H01 A;  2IME A;  5G31 A;  2LV3 A;  5G2Z A;  1SL0 B;  4ZBD A;  2JZT A;  3VI5 A;  4FH8 A;  2H1D A;  3HXS A;  3MDK A;  2LJK A;  4WBR D;  1TXU A;  1HNC A;  4HU7 A;  1NHY A;  3IPZ A;  1HQO A;  3DD3 A;  5DQY A;  2TIR A;  1ACV A;  2KLX A;  1SD9 A;  3KGK A;  2NDO A;  1S3D A;  3ZMK A;  2YAN A;  2XPD A;  3QFA C;  4CHS A;  3HZ8 A;  2B1L A;  2H1L A;  1MDI A;  4V2L A;  4XS6 A;  2HZF A;  2ZUP A;  2VOC A;  1YQ1 A;  2MZC A;  4MH2 A;  2H1G A;  2DKI A;  4XCS A;  5CYY A;  3WGD A;  2JL4 A;  2I9H A;  3DYR A;  5J4V A;  4TW5 A;  5KN0 A;  5BMU A;  3DVX A;  4RI6 A;  4TVE A;  3WGX A;  4IEL A;  1A0R P;  3A2W A;  3Q18 A;  2H19 A;  3F0I A;  3F3Q A;  1VF2 A;  3TKQ A;  3C71 A;  2N5A A;  4I6X A;  4KW6 A;  3ME8 A;  4KF9 A;  2QSI A;  2HT9 A;  4O92 A;  3H4K A;  2A2S A;  3FHK A;  5BRT A;  3D22 A;  4BPY A;  1FVJ A;  3TCO A;  4N0Z A;  3EU3 A;  3UEM A;  4K7I A;  4PQI A;  1AXD A;  1U88 A;  2HSN B;  1GUK A;  1OC3 A;  5DAK A;  5IPH A;  3LXT A;  3MNG A;  5IM9 A;  1EGO A;  5L71 A;  4HZ2 A;  3KM6 A;  4G2E A;  4ZIJ A;  2VL9 A;  1ZCP A;  1A8L A;  3M1G A;  1SKR B;  1SVO A;  4LMW A;  1YEP A;  2AB6 A;  2VLT A;  2ES7 A;  4H86 A;  2VCZ A;  5CRE A;  2H1A A;  2R4V A;  4BVY A;  2RLI A;  2EFD A;  1YVL A;  2K18 A;  1KNG A;  5HQP A;  3H93 A;  1V58 A;  3RHB A;  5ECL B;  4YH2 A;  1KTE A;  5CRH A;  2PVQ A;  2CVB A;  2B5Y A;  1NW2 A;  2CZ2 A;  5G30 A;  4G10 A;  3TJF A;  1OAZ A;  2HE3 A;  3A2X A;  1XWG A;  20GS A;  5DJL A;  5JWQ B;  1GNW A;  3ED3 A;  1PKZ A;  2P5Q A;  4ZL8 A;  5ECS A;  5IMD A;  3F3R A;  3L9U A;  2DIY A;  4XRD A;  1XVW A;  4ZB9 A;  5B8A A;  4Q5Q A;  2CAQ A;  3APS A;  2XBI A;  1WJK A;  4TN8 A;  4NHW A;  3BCI A;  5JCG A;  3MSZ A;  1F37 A;  3IRA A;  3CRU A;  2RM6 A;  4F9Z A;  4F0B A;  4GRF A;  2YJ7 A;  3PGT A;  4ZBA A;  1GSE A;  4YAP A;  5ABR A;  3AY8 A;  3CYN A;  3VFI A;  4IBP A;  2DIZ A;  1OC9 A;  1PGT A;  4O32 A;  2MMN A;  1THO A;  3UAR A;  1QMV A;  1SJZ A;  2H1B A;  2R0G A;  4ZXG A;  1RW1 A;  3C1S A;  2PMT A;  2YV9 A;  3IBH A;  4FIW A;  3N5O A;  2AHE A;  2K9F A;  3GTU A;  3FZ5 A;  5A5K A;  2VD0 A;  1AQX A;  2DKH A;  4MLY A;  3D4T A;  3VPT A;  5IPG A;  5LD0 A;  1G7E A;  1XW5 A;  1QUW A;  5BMU B;  2DJ3 A;  2K6V A;  4EF0 A;  2C4J A;  2M72 A;  3FYG A;  4AKH A;  2KP1 A;  2OBI A;  4KDX A;  2OKA A;  4LL1 B;  4MZC A;  4LMV A;  1SK0 A;  2C1Y A;  1TK8 B;  3LWA A;  1GNE A;  18GS A;  4E68 A;  1UN2 A;  1Z7P A;  2H72 A;  2LRC A;  3TDG A;  5EY6 A;  3P7X A;  1ERW A;  4EE0 A;  4HUA A;  5IIZ A;  2VO4 A;  3C7M A;  1TTZ A;  2PU9 C;  1TDI A;  2N5B A;  3NOF A;  2DJ2 A;  3GX0 A;  4MK3 A;  1Y1U A;  1C72 A;  3ZIV A;  5HFK A;  2FWH A;  1X5D A;  5DAK B;  1SL2 B;  5D9V A;  3M3M A;  2I3Y A;  4K7O A;  3F4R A;  4IP1 A;  2QC7 A;  3U6V A;  3QMX A;  4KDY A;  3F6D A;  14GS A;  1M2A A;  5D73 A;  2EIQ A;  4MJA A;  1RK4 A;  3TOT A;  3ZRD A;  4EC0 A;  3TJB A;  2DML A;  4WF4 A;  4YKF A;  2VCV A;  3FKF A;  4YQU A;  4V2N A;  2G2Q A;  1SYR A;  2A4H A;  3J7Y b;  4N0V A;  4TKY A;  3I9V 2;  3LSZ A;  4WBJ A;  2QA1 A;  5DCG A;  2REM A;  1A8Y A;  5ECI B;  4AGS A;  1TXX A;  3DEX A;  3GKN A;  3A3T A;  1E2Y A;  4EL1 A;  5DQS A;  2RII A;  5ECP B;  3FRC A;  3LXZ A;  5IQY A;  4E8H A;  4F82 A;  1TJD A;  1FVK A;  3UMA A;  5B6M A;  5CRD A;  2WGR A;  3E3E A;  2M46 A;  3HCZ A;  1F9M A;  3BCK A;  4LL4 B;  2FA8 A;  2GSQ A;  1ZYN A;  4TRX A;  3KZQ A;  3V1W A;  1H4O A;  1CQG A;  2YP6 A;  6GSS A;  2CZ3 A;  1GL8 A;  3HJM A;  1EGR A;  4P3Y B;  2A2P A;  1UVZ A;  3FZA A;  3TRP A;  4DSS A;  2H6Z A;  1J9B A;  3W6G A;  5DAL A;  2XHF A;  1XW6 A;  4ECB A;  2IN3 A;  3IA1 A;  4MNN A;  3LW9 A;  3P90 A;  2C0G A;  1OC9 B;  1F3B A;  3R3E A;  3IDV A;  8GSS A;  2GSS A;  5J4Y A;  1PL2 A;  4IW9 A;  3O76 A;  2WJU A;  3VLN A;  1GSF A;  2IMD A;  5D96 A;  4G0L A;  2IMF A;  4FQU A;  3TKR A;  1TU7 A;  3FZ4 A;  2YCD A;  3EYT A;  1UC7 A;  1SJ6 A;  2XC2 A;  1DUG A;  1GTI A;  1RQM A;  3EE2 A;  2GS3 A;  1FW1 A;  2H6Y A;  2WB9 A;  2NPB A;  1ZYP A;  4WF5 A;  3HZ4 A;  1GH2 A;  1B4Q A;  3VK9 A;  4J2F A;  3TKS E;  4HI7 A;  4O5R A;  2DJJ A;  1B9Y C;  1TU8 A;  5F06 A;  1KEB A;  4EO3 A;  2LJR A;  1IYH A;  4Q5F A;  1VF3 A;  1TK0 B;  2C0F A;  2GZY A;  1X5E A;  5C00 A;  1TK5 B;  4GCI A;  2WZ9 A;  3TJJ A;  5INY A;  1O7U A;  4G9H A;  1PKW A;  4PX1 A;  3QAV A;  3M8N A;  1Z6M A;  1K0A A;  3CBU A;  5J4U A;  3H79 A;  1U87 A;  4PUA A;  2H0G A;  2CT6 A;  2F3M A;  4MMM A;  3EWL A;  3GRX A;  5B7C A;  1TOF A;  1ERU A;  4YQM A;  1MEK A;  4OCF A;  12GS A;  5J41 A;  4PTS A;  4TR1 A;  4I97 A;  3F4T A;  2JAC A;  4O5Q A;  1WRY A;  3A5I A;  5HFI A;  3GFK A;  1MDJ A;  1MD4 A;  2YWO A;  3G9B A;  5D9W A;  2HNL A;  3IR4 A;  1N2A A;  2MMZ A;  4AF2 A;  4ZB7 A;  2CQ9 A;  4BWQ A;  1K0M A;  4GSS A;  2OE3 A;  3KMN A;  2VIM A;  4IJ3 A;  2J23 A;  4I8B A;  4K1F A;  2EFC A;  1NSW A;  2FWG A;  2K8V A;  4WKW A;  1H75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...