2D2ZA

Crystal structure of soluble form of clic4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
223
Chain Sequence
EPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 4
publication title Trimeric structure of the wild soluble chloride intracellular ion channel CLIC4 observed in crystals
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 75
structure length 223
sequence length 238
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2d2zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2d2zA01
1ZZYA 3WT1A 5IOXA 1OKTA 2PN8A 1MD3A 4IVFA 3C7MA 2N5BA 1SKRB 5JWRB 2A2RA 4JR6A 1EOGA 3QD9A 3BD2A 3ZTLA 5GAPD 2GVPA 3GL3A 2JZSA 2OA7A 4KH7A 2IWTA 1O8XA 1I5GA 1S3AA 1SK2A 3G7IA 3UOMA 1XW5A 3KJYA 4GF0A 4IJ3A 4Q5QA 3L4NA 4MP4A 3VK9A 1BYEA 3TGZA 1GWCA 1O85A 1EGOA 4D73B 2KHPA 1X0RA 2B5YA 5ECNB 2K8SA 1DE1A 3ERGA 2CVKA 2H6XA 2EC4A 4OFNA 3TKSC 4ISDA 22GSA 3ME7A 1GTAA 3GSTA 1KEBA 1OE8A 4Q5FA 1TTZA 5ECSA 3M0FA 2MZCA 5GSTA 3S9FA 4EVMA 4XCSA 2KLXA 1XXUA 3L9SA 4KDUA 2ALBA 3DVXA 3IDVA 2B1LA 3FEUA 4PUAA 4IW9A 3N5OA 4NXIA 5D96A 5G5FA 2IFQB 1FG4A 3VFIA 1ZYEA 1SL1B 3F6DA 2YZHA 2HYXA 3TKSA 3CTFA 2LTKA 4YQMA 6GSUA 18GSA 3IXRA 2XPDA 2KOKA 3EC3A 1OC9B 4GQFA 4I2UA 3VWWA 4GTUA 1HNBA 4LA1A 4BVYA 3ZFLA 5J41A 1MEKA 1ZYQB 4BL7A 1M99A 1Y25A 4ZL8A 2I81A 1U87A 4TKYA 4GQCA 5CREA 20GSA 4OMVA 2E7PA 4JRRA 4HU9A 4PGTA 3JCML 3H4KA 1QXHA 1M2DA 3HHVA 1J9BA 4MA9A 1PD21 1RK4A 2HRKB 1M9AA 5B7CA 4EF0A 1YY7A 2KUCA 2LJAA 2UZ8A 1FAAA 4TRXA 5F8BA 3LSZA 1UC7A 1W4VA 1K0DA 2NDOA 1F37A 3GKKA 1SKSB 3LWAA 4K1FA 2CA8A 3APSA 4NAXA 3VI5A 3FZAA 5D9VA 7GSSA 3GV1A 4L5LA 2QSIA 2F3MA 2FCHA 4HZ2A 4BVXA 4N0VA 1W89A 4OD7A 4PQ1A 2P0GA 3KZQA 5G31A 2XHFA 2PWJA 3EU4A 1A2MA 4IGJA 3ZLPA 1WWJA 3ZVJA 3IAM2 2WS2A 4JU5A 3IK7A 2GZPA 1MDJA 2MMAA 2YZUA 2WULA 3DWVA 4HI7A 4KDYA 2DJ3A 4PX1A 3VURA 2JACA 4JBBA 4POMA 5IMFA 4P3YB 1XW9A 5CP1A 4E8EA 4AJ7A 1Z5YE 2YWIA 3ZITA 4AJ6A 2QKEA 3HKRA 4PNGA 3BOAA 2GQKA 5HQPA 2R2JA 2DJ0A 2HFDA 1S3DA 2VUPA 3LYPA 3ISOA 2M72A 1BQ7A 3GUSA 5ECHB 4JEDA 2C1YA 3GX8A 1TK8B 5CYYA 3IC8A 1OKDA 4MLYA 3IV4A 2YOIA 8GSSA 4O92A 1PQNA 2WJUA 4HEA2 3UAPA 1M9BA 3D5JA 1GLPA 1PKZA 4EXJA 5AN1A 2JZTA 2NTOA 2DMLA 2TIRA 4TN8A 4YQUA 4KNDA 1QMVA 1WP0A 3KCMA 2DLXA 3LFLA 5ELAA 5IMZA 2H75A 2FWEA 6GSTA 1DSBA 3G7JA 4KSOA 4K2DA 2DJ2A 2PU9C 2GZYA 2DJJA 4K7NA 3IC4A 4WR5A 3CMIA 5CRWA 3C8EA 4AGSA 1GUHA 1XWKA 3WGEA 3BCKA 1ZL9A 5DALB 1TDIA 2R3XA 2F9SA 3UL3A 1CQGA 2IMKA 4RUVA 2YWMA 3NOFA 2G2QA 5G1KA 3FR3A 1ERVA 2OKAA 2C0DA 2YWNA 2LNSA 5J9BA 1V57A 3EYTA 2JADA 4F0BA 3GL5A 2LRNA 4ECIA 4OFMA 2WDUA 4FH8A 4XS1A 3GSSA 1GP1A 3WGXA 5L71A 4OCFA 3ERFA 2I9HA 1XW6A 5J4UA 1ERTA 3GH6A 4WBRD 3IRAA 2L5OA 4N11A 2RUEA 1HNAA 4ZBBA 2IPAA 1UN2A 4RI7A 5HFGA 3TKPA 5DQYA 2LQOA 1TU7A 1PMTA 4LMWA 3M9KA 1TK5B 3UARA 2CZ3A 4D73A 4TXVA 2GTUA 4E8HA 3LEFA 2MYGA 3W6GA 4ECBA 2XBIA 4WBJA 5FHIA 3M9JA 2WZ9A 1AW9A 3KD0A 1X5EA 4Q5RA 1ZOFA 3WD6A 2HQTA 4NV5A 5HFKA 4V2MA 2AYTA 2I4AA 3M3MA 4WF5A 3FW2A 2HZEA 2X8CA 3KMNA 3DD3A 2DSAA 4TXOB 3ZIVA 5D93A 1LBKA 2C3TA 2Z9SA 1A2JA 1TK0B 1TXXA 2NVLA 5AIXA 3ZVJD 1M0UA 1VGLA 1YF1A 10GSA 3GTUB 3CBUA 1GUKA 2RM6A 4IN0A 3PINA 4HU7A 4G0LA 5J3RA 2MMNA 1A8YA 3A5WA 1F6MC 5DBQA 4HDEA 3VWXA 1KTEA 2P5RA 2AHEA 1B4QA 1XFLA 3DEXA 1U88A 2ZUPA 4BWSA 1TRWA 3KH7A 1XCCA 3EE2A 3IHQA 1M7TA 2X64A 2PGTA 3ZMKA 2B1KA 2VCVA 2H72A 1F9MA 3TRXA 1ABAA 5JWOB 4POBA 4IELA 2O87A 5IPHA 1EV4A 2H1GA 1SYRA 5AIVA 3GA4A 1K3YA 2YP6A 2J9HA 6GSYA 2YV7A 3RPPA 2PPTA 5DAKB 5JCWA 3AY8A 2O89A 3UEMA 3HDCA 4XRDA 4MABA 2FUG2 4I2TA 1E2YA 3RHBA 1PRXA 2H30A 5EY6A 4EL1A 1SJZA 1T4YA 5F05A 1AQXA 1K0NA 4MK3A 3C1SA 4WETA 4X1UA 2HSYA 3W8JA 6GSVA 2VCXA 3UMAA 1G6WA 1JZWA 3QFAC 2V32A 3MAKA 5ID2B 4YAPA 3ZZXA 5G1LA 3WYWA 4XIHA 3C1RA 1KNGA 1SENA 2O8VB 2VCWA 1THOA 4CHSA 4Q5NA 1SD9A 1AAZA 1SJ6A 2FA4A 2IMFA 4G2EA 1TJDA 4YQVA 4MJBA 2GDRA 3FZ9A 1ZGNA 4AF2A 2H19A 3D6IA 3TB2A 1YF0A 3H8QA 1H4OA 5E59A 4FIWA 2H70A 3GH9A 4TVEA 3QCPA 5D9XA 3DKSA 1B48A 1AQVA 4MPGA 1R5AA 1PN9A 4GCIA 1X5CA 2AUVA 3LGCA 2I3YA 3F6FA 4QL7A 1Z9HA 4ML6A 2VLTA 2VD1A 3LQ7A 5KN2A 1T8EB 1MD4A 1M2AA 3KEBA 3TJGA 4X43A 2G0FA 5GSSA 4ZIJA 2DJ1A 3F4SA 3VPTA 5GZZB 3V1WA 2YPMA 1ZCPA 1SJIA 2V41A 3HZ4A 4ACSA 1GSSA 3VWVA 3L0HA 3HD5A 2O85A 1A2LA 2LUSA 3W8SA 1A0FA 2K6VA 5B8AA 3Q18A 3H79A 2KP2A 1X9MB 2B5EA 4MH2A 1OC3A 4AJ8A 2HNLA 1URMA 1JLWA 2GGTA 6GSSA 5CAXA 2GSRA 2HRFA 3RDWA 3MNGA 2OE3A 2C4JA 2R6KA 3FYGA 3ERWA 3QPMA 1K3OA 3QAVA 3FHKA 1ST9A 5E4WA 2OE0A 4USSA 4TR1B 2BMXA 3ZFBA 2MBTA 4ZB8A 3HVSA 2OBKA 1IYHA 4IHUA 3E9JB 3EMXA 3OR5A 2HSNB 1VF2A 2C0EA 2V6KA 4J57E 5ECKB 1SD8A 3U6VA 3APQA 4ULXA 2QGVA 1AUCA 4MJCA 3LXTA 3F9UA 2AB6A 1EP8A 1TI1A 2RLIA 2IL3A 1FVJA 4PURA 1V2AA 3LORA 1EWXA 4GSTA 4O7HA 4GLTA 5CNWA 4XRAA 3FR6A 3TJKA 4IP6A 2KP1A 1YQ1A 4EC0A 1SK0A 1XPVA 1XOBA 5ECIB 4PUFC 2PVQA 3IPZA 1JFUA 5CRDA 3P2AA 1BG5A 3Q6OA 1MDKA 4FQUA 1EV9A 1YEXA 1B4PA 4MCUA 2L5LA 1JZDA 1GSDA 2MMZA 5BMUA 1WPIA 2P5QA 2K18A 3HVVA 4MZCA 3FK8A 2VCTA 1T4ZA 1X9SB 2PVOC 2ES7A 1R26A 5KN0A 4Z7XA 2JL4A 3RPNA 2AAWA 3KMOA 4K9ZA 1C72A 3ZREA 1A0RP 1Z3EA 2L57A 2REMA 3GNJA 1WMJA 2GT5A 2E2MA 1V98A 1B9XC 1VRSD 4K8MA 2LRTA 4IS0A 2QC7A 3GTUA 2RUFA 4EUYA 4KB3A 5DVBA 5ABRA 2GQMA 5A4UA 2X99A 5IMDA 1XVWA 2IMDA 1PL2A 5LD0A 11GSA 2YJHA 5DJMA 4KGIA 2IN3A 4ECJA 2YN1A 5IO2A 3BBYA 1THXA 4F9ZA 2ZNMA 5IQYA 1B8XA 16GSA 4POKA 4KW6A 3M8NA 4V1Ap 4X0XA 1AXDA 4MF5A 1Z6MA 2WRTA 3IA1A 1TW9A 2IIYA 3R2QA 1WE0A 2YWOA 2AJQB 1SYXA 4KA0A 5D9TA 5KN3A 1TKDB 4IQ1A 3C71A 4GXZA 4K0NA 3L9VA 4GRFA 2B5XA 4XS4A 4BVYB 1FVKA 1XWBA 4DSRA 4OFTA 2R37A 1K0CA 4BL7B 1O81A 1AQWA 3QR6A 5HR0A 4NPBA 13GSA 3A2WA 3ZIJA 2RM5A 2OBIA 5A4WA 3DYRA 4FYBA 1GLQA 5H5SA 4F2IA 3NIVA 3UJ1A 4G0IA 4TR0A 1GSEA 3TKSE 3DVWA 3LG6A 5ELGA 2C0GA 4ILFA 1PSQA 2B3SA 2FHEA 4KDXA 2VO4A 4EDYA 4BA7A 4LLRA 2E2GA 4PTSA 5A4VA 2C3QA 1OE7A 1GRXA 1OAZA 2X8HA 2DJKA 5DCHA 1USBA 1LU4A 4V1Ag 1FB6A 2E0QA 1OC8A 4L8EA 3IBHA 2LNTA 2CAIA 1HYUA 1V58A 4ZB6A 2L6CA 4DSSB 1GSFA 3I69A 5ECRB 2ON5A 3A3TA 3D21A 2WFCA 2HI7A 3MWHA 1I9DA 2HE3A 3HCZA 1XVQA 4OO4A 4JE1A 3WT2A 2HSHA 5ECQB 4N0ZA 4HQSA 5DCGA 3GFKA 4G0KA 4K0GA 1SK1A 4RQXA 2L4CA 2H8LA 2XC2A 17GSA 1YEPA 2DC5A 4RQRA 3GX0A 5D73A 5IOWA 1BX9A 1PL1A 1QUWA 2LJRA 2IFQA 2FA8A 1FW1A 4NMUA 1Y6EA 1GNEA 2FWGA 2MBSA 2CZ2A 1EGRA 3SBCA 5C00A 4ML1A 1G6YA 1MDIA 4F82A 2D2ZA 1ILOA 3O76A 1O73A 2FNOA 4XS6A 4ZL7A 4DSQA 3APOA 2WCIA 2HZFA 2L6DA 1A8LA 3F3RA 2GSSA 1OC9A 2L59A 4ZBDA 2GQLA 4H86A 2B7JA 3O6TA 1GSUA 4MF7A 2VM1A 2CQ9A 2M46A 1FOVA 2VIMA 2N5FA 2MMOA 2LS5A 3EINA 2J23A 5ECPB 2VLUA 5LCZA 1NSWA 2K8VA 5D8IA 2FD3A 2HRKA 3A2XA 1PKWA 2R4VA 3TCOA 2H74A 1IYIA 4GSSA 3IK9A 3UIWA 3VLNA 4KE3A 5ECMB 2H73A 4MH3A 1NM3A 4K6XA 2FWFA 2GZZA 1WJKA 1T1VA 3J7Yk 2V2GA 4CDOA 3CYNA 1AC1A 4V2LA 2CV4A 4PQIA 1ACVA 12GSA 2HSMB 3TOTA 1NHYA 4PXOA 3F4TA 4GWRA 3TRQA 1Z7RA 1GUMA 3DRNA 3RHCA 1K3LA 3F8UA 4KAEA 3GIXA 5JCUA 4MZWA 3H93A 3KH9A 4ZILA 3WGDA 5H5QA 5FT3A 4L5OA 4PQHA 4KSMA 2H71A 4JZQA 3IAS2 3CSJA 5DDLA 4G19A 2F8FA 4MJEA 1GL8A 3EU3A 9GSSA 1TRVA 4TW5A 5DQSA 3J7Yb 4EE0A 3TUEA 3TRPA 3F63A 5KEJA 2GS3A 3D4TA 4LL1B 4IJIA 1EEMA 5CO3A 2CX4A 3BJ5A 3TKQA 1Q4JA 1V9WA 2N5AA 3ZYWA 1SKWB 3GKMA 2HLSA 1R7HA 1QK8A 1QFNA 1QQ2A 2AV4A 1ML6A 5IO0A 2HRNA 3GKXA 3HVXA 1FHEA 4ZL9A 1V40A 3A2VA 4ECCA 2OACA 2M80A 3KXOA 1TRSA 2HZEB 5HR3A 1GSQA 1DBYA 3HXSA 3TJFA 1X5DA 3D22A 1XBSA 2VM2A 1GULA 3NZNA 3US3A 3FZ5A 1GTBA 1SU9A 1R5PA 1ZMAA 4K7OA 5HR2A 2DMMA 1O8WA 2YNXA 1A23A 3QFBC 4HJ2A 5IM9A 2BJXA 2XBQA 3L78A 3EURA 5INYA 4KCEA 4GSNA 1PX6A 3VWUA 19GSA 5CRHA 3HJMA 1S3CA 3I9V2 4V2NA 5J5NA 1LJRA 4YH2A 3Q19A 1VF1A 2H0GA 4PNFA 1EP7A 1K0OA 2H6YA 4XTSA 2PERA 3Q74A 1GTUA 1YKAA 6GSXA 2YANA 4OCEA 1JZOA 4EO3A 4WKWA 1O7UA 3QAGA 3HJPA 1Z6NA 4O32A 2RIIA 3GRXA 1CQHA 5DALA 4LMVA 4EDZA 2A4VA 3SWLA 1TOFA 3KGKA 5GAND 2JSZA 4WXTA 3QOUA 3P8WA 4J56E 1EEJA 1XZOA 1PX7A 5IIZA 5AISA 2IMEA 1U3AA 4IKHA 3FKFA 1R4WA 4WEYA 2DIZA 4FYCA 4RI6A 3CSIA 1A24A 3N9JA 3KP8A 1ERWA 3GYKA 2V1MA 3QDNA 1AIUA 4HOJA 2VAFA 2X8GA 3CRTA 5G2ZA 4DVCA 5B6MA 6GSWA 2CAQA 2JSYA 1OYJA 2ON7A 3UVHA 2PMTA 3DMLA 4FYUA 4IP1A 2C8UA 1XWGA 5F0GA 5DJLA 2JU5A 2NBSA 5IMCA 2R5GA 1G7EA 2JZRA 1YJ6A 2LEGA 2XPEA 1E6BA 2VD0A 5B8BA 1F3BA 1GTIA 1N2AA 1T7PB 3MDKA 3FY7A 1G0TA 2PUKC 4QQ7A 4MF6A 3R3EA 3I6AA 4L0UA 3EMPA 5JCGA 3GKNA 2LV3A 2TRXA 2ZCTA 2H1BA 4BPYA 4DSSA 2GLRA 3F0IA 4WF4A 2B7KA 3ED3A 1JLVA 2FGXA 1WOUA 3M1GA 1GNWA 2GT6A 3DIEA 3P7XA 4TXOA 2V6OA 5EL8A 2HXKA 5FWGA 1FO5A 5EPFA 3LYKA 4NV2A 1YZXA 2C0FA 2CVBA 2H76A 1J08A 5KN1A 3FRCA 1XOAA 2WGRA 4IQAA 1Q98A 3UVTA 2CT6A 3HY2A 5H5RA 1T00A 1GSYA 1PGTA 5JWQB 2YV9A 1TI3A 4ZXGA 2PBJA 2FLSA 1OVNA 2VLVA 3LXZA 5IMVA 1O6JA 4J2FA 5C04A 1XIYA 3DGQA 3KTLA 2VOCA 4I97A 3FZ4A 4MMMA 4ZBAA 2DIYA 4KUNA 4TR3A 2F8AA 3HJOA 4IBPA 1F3AA 2C3NA 1TP9A 2HRAA 5D9WA 3PGTA 3QAWA 3H1NA 4CW9A 2BTOT 2CX3A 4XHMA 5ENUA 3TOUA 4L0WA 3FR9A 2YJ7A 2VCQA 1DE2A 1M2BA 1TRUA 4O5RA 1KBNA 1WRYA 5DAKA 1G7OA 4I8BA 1Z7PA 5EVOA 5B6NA 2CVDA 4MDCA 3EWLA 1UA5A 3TJJA 3F3QA 5LNKe 3VI7A 4ID0A 4ZB9A 2OADA 3ZMLA 1YKCA 4DEJA 5AGYA 3IOSA 1VF3A 1U6TA 2VL3A 1BAYA 2HT9A 1ON4A 3UBKA 1K0BA 2I1UA 5HFIA 4BWQA 4YAVA 3IE3A 3GHAA 3HZ8A 2H6ZA 3ZRDA 3KM6A 2EIRA 2HSMA 5ID2A 3TDGA 4TR4A 3GURA 2LJKA 5G30A 3IR4A 4TOPA 2H1AA 2H66A 1TU8A 1F2EA 3KP9A 3CXGA 1JZRA 4HJMA 2A2SA 3KIJA 4KF9A 1B9YC 3CSHA 1XWCA 4JR4A 3I43A 4OO5A 14GSA 2IMIA 2H0IA 3PH9A 3D0ZA 4I6XA 2GSQA 2LQQA 4BVXB 1ERUA 2O7KA 3LJRA 2IJYA 4N30A 3HYPA 3MSZA 5COHA 3PR8A 3HA9A 3RBTA 1J0FA 3EVIA 1QGVA 5A5KA 5ECOB 4MPFA 3U5RE 3O3TA 3G7YA 2WB9A 2TRCP 1NHOA 2VL2C 1K0AA 5HR1A 3D4MA 1XWAA 5J9CA 4WR4A 1HD2A 3PPUA 4F03A 2H1DA 3K8NA 2H01A 4G10A 3QMXA 1EOHA 1PA3A 2K9FA 1T3BA 1X9WB 1JHBA 3RAZA 1DUGA 4KCAA 1SL2B 1BJXA 3DXBA 4NHZA 3CRUA 3P90A 3C73A 3ME8A 5IPGA 4HS1A 4MJAA 4K7IA 2VL9A 1RW1A 1UVZA 5CRGA 1HQOA 2EIQA 4QL9A 2B6MA 2L4QA 1VF4A 2DBCA 2LKUA 2VL2A 2FWHA 3VPQA 1U3IA 4POLA 4FO5A 1NW2A 3G9BA 1BEDA 2OE1A 2YCDA 2VCZA 1HNCA 2NPBA 4HQZA 3TJBA 4TR1A 1EZKA 3F4RA 3E0UA 2P31A 2OJLA 1H75A 2LRCA 1WIKA 4OWYA 4N10A 2C80A 2FY6A 3BCIA 4G9HA 3GN3A 4NHWA 4I5QA 1YDKA 5ECLB 1MTCA 4KX4A 1GH2A 3TKRA 4LL4B 1K0MA 3L9UA 2F51A 4MZBA 2H0HA 5F07A 3UBLA 2EIOA 3KTBA 5G5EA 4HUAA 4EKZA 5IMAA 1FB0A 1N8JA 1RQMA 1SL0B 3CTGA 4F0CA 3ZL5A 5F06A 2LSTA 3E3EA 4NWYA 4XS4B 4HZ4A 3GMFA 2GSTA
chains in the Genus database with same CATH superfamily
1ZZYA 3WT1A 5IOXA 1OKTA 2PN8A 1MD3A 4IVFA 3C7MA 2N5BA 1SKRB 5JWRB 2A2RA 5A1NB 4JR6A 4EIPA 1EOGA 3QD9A 4O5QA 3BD2A 3ZTLA 5GAPD 2GVPA 3GL3A 2JZSA 2OA7A 4KH7A 2IWTA 1O8XA 1I5GA 1S3AA 1SK2A 3G7IA 3UOMA 1XW5A 3KJYA 4GF0A 4IJ3A 4Q5QA 3L4NA 4MP4A 3VK9A 1BYEA 3TGZA 1GWCA 4A5PA 1O85A 1EGOA 4D73B 5A5HA 2KHPA 5A34B 1X0RA 2EFHA 2B5YA 5ECNB 4BIKA 2K8SA 1DE1A 3ERGA 2CVKA 2H6XA 2EC4A 4OFNA 3TKSC 4ISDA 22GSA 3ME7A 1GTAA 5J40A 3GSTA 1KEBA 1OE8A 4Q5FA 1TTZA 5ECSA 3M0FA 2MZCA 5GSTA 4K5SA 3S9FA 4EVMA 4XCSA 2KLXA 1XXUA 3L9SA 4KDUA 2ALBA 3DVXA 3IDVA 2B1LA 3FEUA 4PUAA 4IW9A 3N5OA 4NXIA 5D96A 5G5FA 2IFQB 1FG4A 1PN0A 3VFIA 1ZYEA 1SL1B 3F6DA 2YZHA 2HYXA 3TKSA 3CTFA 2LTKA 4YQMA 1ZYPA 6GSUA 18GSA 3IXRA 2XPDA 1XG8A 2KOKA 3EC3A 1OC9B 4GQFA 4I2UA 3VWWA 4GTUA 1HNBA 4LA1A 4BVYA 3ZFLA 5J41A 1MEKA 1ZYQB 4BL7A 1M99A 1Y25A 4ZL8A 5J4VA 2I81A 1U87A 4TKYA 4GQCA 5CREA 20GSA 4OMVA 2E7PA 4JRRA 4HU9A 4PGTA 3JCML 3H4KA 1QXHA 1M2DA 3HHVA 4AKGA 1J9BA 4MA9A 1PD21 1RK4A 2HRKB 1M9AA 5B7CA 4EF0A 1YY7A 2KUCA 2LJAA 2UZ8A 1FAAA 4TRXA 5F8BA 3LSZA 1UC7A 1W4VA 1K0DA 2NDOA 1F37A 3GKKA 1SKSB 3LWAA 4K1FA 2CA8A 3APSA 4NAXA 3VI5A 3FZAA 5D9VA 7GSSA 3GV1A 4L5LA 2QSIA 2F3MA 2FCHA 4HZ2A 4BVXA 4N0VA 1W89A 4OD7A 4PQ1A 2P0GA 3KZQA 5G31A 2XHFA 2PWJA 3EU4A 1A2MA 4IGJA 3ZLPA 1WWJA 3ZVJA 3IAM2 2WS2A 4JU5A 3IK7A 2GZPA 1MDJA 2MMAA 2YZUA 2WULA 3DWVA 1BF5A 4HI7A 4KDYA 2DJ3A 4PX1A 3VURA 2JACA 2O5VA 4JBBA 4POMA 5IMFA 4P3YB 1XW9A 5CP1A 4E8EA 4AJ7A 1Z5YE 2YWIA 3LW9A 3ZITA 4AJ6A 2QKEA 3HKRA 5J47A 4PNGA 4K5RA 1PFOA 3BOAA 2GQKA 5HQPA 2R2JA 2DJ0A 2HFDA 2H1LA 1S3DA 2VUPA 3LYPA 3ISOA 4YKFA 1FOHA 2M72A 1BQ7A 3GUSA 5ECHB 4JEDA 2C1YA 3GX8A 1TK8B 5CYYA 3IC8A 1OKDA 4MLYA 3IV4A 2YOIA 8GSSA 4O92A 1PQNA 2WJUA 4HEA2 3UAPA 1M9BA 2DKHA 3D5JA 1GLPA 1PKZA 4EXJA 5AN1A 2JZTA 2NTOA 2DMLA 2TIRA 4TN8A 4YQUA 2EFCA 4KNDA 1QMVA 1WP0A 3KCMA 2DLXA 3LFLA 5ELAA 5IMZA 2H75A 2FWEA 6GSTA 1DSBA 3G7JA 2O3EA 4KSOA 4K2DA 2DJ2A 2PU9C 2GZYA 2DJJA 4K7NA 3IC4A 2X49A 4WR5A 3CMIA 5CRWA 3C8EA 4AGSA 1GUHA 1XWKA 3WGEA 3BCKA 1ZL9A 5DALB 1TDIA 2R3XA 2F9SA 3UL3A 1CQGA 2IMKA 4RUVA 2YWMA 3NOFA 2G2QA 5G1KA 5KOXA 3FR3A 1ERVA 2OKAA 2C0DA 2YWNA 2LNSA 5J9BA 1V57A 3EYTA 2JADA 3MYDA 4F0BA 3GL5A 2QA1A 2LRNA 4ECIA 4OFMA 2WDUA 4FH8A 4XS1A 3GSSA 1GP1A 3WGXA 5L71A 4OCFA 3ERFA 2I9HA 1XW6A 5J4UA 1ERTA 3GH6A 4WBRD 3IRAA 2L5OA 4N11A 2RUEA 1HNAA 4ZBBA 2IPAA 1UN2A 4RI7A 5HFGA 3TKPA 5DQYA 2LQOA 1TU7A 1PMTA 4LMWA 3M9KA 1TK5B 3UARA 2CZ3A 4G01A 4D73A 4TXVA 2GTUA 4E8HA 5A34A 3LEFA 2MYGA 3W6GA 4ECBA 2XBIA 4WBJA 5FHIA 3M9JA 2WZ9A 1AW9A 3KD0A 1X5EA 4Q5RA 1ZOFA 3WD6A 2HQTA 4NV5A 5HFKA 4V2MA 2AYTA 2I4AA 3M3MA 4WF5A 3FW2A 2HZEA 2X8CA 3KMNA 3DD3A 2DSAA 4TXOB 3ZIVA 5D93A 2R0GA 1LBKA 2C3TA 2Z9SA 1A2JA 1TK0B 1TXXA 2NVLA 5AIXA 2WZSA 3ZVJD 1M0UA 1VGLA 1YF1A 10GSA 3GTUB 4K2XA 3CBUA 1GUKA 2RM6A 4IN0A 4EIQA 3PINA 4HU7A 4G0LA 5J3RA 2MMNA 1A8YA 3A5WA 3CQFA 1F6MC 5DBQA 4HDEA 3VWXA 1KTEA 2P5RA 2AHEA 1B4QA 1XFLA 3DEXA 1U88A 2ZUPA 4BWSA 1TRWA 3KH7A 1XCCA 3EE2A 3IHQA 4X4JA 1M7TA 2X64A 2PGTA 3ZMKA 2B1KA 2VCVA 2H72A 1F9MA 3TRXA 1ABAA 5JWOB 4POBA 4IELA 2O87A 5IPHA 1EV4A 2H1GA 1SYRA 5AIVA 3GA4A 1K3YA 2YP6A 2J9HA 6GSYA 2YV7A 4PHZC 1M3JA 3RPPA 2PPTA 5DAKB 5JCWA 3AY8A 2O89A 3UEMA 3HDCA 4XRDA 4MABA 2WW2A 2FUG2 4I2TA 1E2YA 3RHBA 1PRXA 2H30A 5EY6A 4EL1A 4GDFA 1SJZA 1T4YA 5F05A 1AQXA 1K0NA 4MK3A 3C1SA 4WETA 4X1UA 2HSYA 3W8JA 6GSVA 2VCXA 3UMAA 1G6WA 1JZWA 3QFAC 2V32A 3MAKA 5ID2B 4YAPA 3ZZXA 5G1LA 3WYWA 4XIHA 4QMKA 3C1RA 1KNGA 2WVZA 1SENA 2O8VB 2VCWA 1THOA 4CHSA 4Q5NA 1SD9A 1AAZA 1SJ6A 2FA4A 2IMFA 1TJDA 4G2EA 4YQVA 4MJBA 2GDRA 3FZ9A 1ZGNA 4AF2A 2H19A 3D6IA 3TB2A 1YF0A 3H8QA 1H4OA 5E59A 4FIWA 2H70A 3GH9A 3RFRC 4TVEA 3QCPA 5D9XA 3DKSA 1SVMA 1B48A 1AQVA 4MPGA 2A4HA 1R5AA 1PN9A 4GCIA 1X5CA 2AUVA 3LGCA 2I3YA 3F6FA 4QL7A 1Z9HA 4ML6A 2VLTA 2VD1A 3LQ7A 5KN2A 1T8EB 1MD4A 1M2AA 3KEBA 3TJGA 4X43A 2G0FA 5GSSA 4ZIJA 2DJ1A 3F4SA 3VPTA 5GZZB 3V1WA 2YPMA 1ZCPA 1SJIA 4E68A 2V41A 3HZ4A 4ACSA 1GSSA 3VWVA 3L0HA 3HD5A 2O85A 1A2LA 2LUSA 3RGBC 3W8SA 1A0FA 2K6VA 5B8AA 3Q18A 3H79A 2KP2A 1X9MB 2B5EA 4MH2A 1OC3A 4HSCX 4AJ8A 2HNLA 1URMA 1JLWA 2GGTA 6GSSA 5CAXA 2GSRA 2HRFA 3RDWA 3MNGA 2OE3A 2C4JA 2R6KA 3FYGA 3ERWA 3QPMA 1K3OA 1YEWC 3QAVA 3FHKA 1ST9A 5E4WA 2OE0A 4USSA 4TR1B 2BMXA 3ZFBA 2MBTA 4ZB8A 3HVSA 2OBKA 2VKZG 1IYHA 4IHUA 3E9JB 3EMXA 3OR5A 2HSNB 1VF2A 2C0EA 2V6KA 4J57E 5ECKB 1SD8A 3U6VA 3APQA 4ULXA 2QGVA 1AUCA 4MJCA 3LXTA 3F9UA 2AB6A 1EP8A 1TI1A 2RLIA 2IL3A 1FVJA 4PURA 1V2AA 3LORA 1EWXA 4GSTA 4O7HA 4GLTA 5CNWA 4XRAA 3FR6A 3TJKA 4IP6A 2KP1A 1YQ1A 3FMWA 4EC0A 1SK0A 1XPVA 1XOBA 5ECIB 4PUFC 2PVQA 3IPZA 1JFUA 5CRDA 3P2AA 1BG5A 3Q6OA 1MDKA 4FQUA 1EV9A 1YEXA 1B4PA 4MCUA 2L5LA 1JZDA 1GSDA 2MMZA 5BMUA 1WPIA 2P5QA 2K18A 3HVVA 4MZCA 3FK8A 2VCTA 1T4ZA 1X9SB 1ZYNA 2PVOC 2ES7A 4W66A 4Z2UA 1R26A 5KN0A 2UV8G 4Z7XA 3EPTA 2JL4A 3RPNA 2AAWA 3KMOA 4K9ZA 1C72A 3ZREA 1A0RP 1Z3EA 2L57A 2REMA 3GNJA 1WMJA 2GT5A 2E2MA 1V98A 1B9XC 1VRSD 4K8MA 2LRTA 4IS0A 2QC7A 4PI0C 3GTUA 2RUFA 4EUYA 4KB3A 5DVBA 5ABRA 2GQMA 5A4UA 2X99A 5IMDA 1XVWA 2IMDA 1PL2A 5LD0A 11GSA 2YJHA 5DJMA 4KGIA 2IN3A 4ECJA 2YN1A 5IO2A 3BBYA 1THXA 4F9ZA 2ZNMA 5IQYA 1B8XA 16GSA 4POKA 4FXYP 4KW6A 3M8NA 4V1Ap 4X0XA 1TXUA 1AXDA 4MF5A 1Z6MA 2WRTA 3IA1A 1TW9A 2WVYA 2IIYA 3R2QA 1WE0A 2YWOA 2AJQB 1SYXA 4KA0A 5D9TA 5KN3A 1TKDB 4IQ1A 3C71A 4GXZA 4K0NA 3L9VA 4GRFA 2B5XA 4XS4A 4BVYB 1FVKA 1XWBA 4DSRA 4OFTA 1M3IA 1K0CA 2R37A 4BL7B 1O81A 1AQWA 3CWGA 3QR6A 2EFDA 5HR0A 4NPBA 13GSA 3A2WA 4CY8A 3ZIJA 2RM5A 2OBIA 5A4WA 3DYRA 4FYBA 5A1NA 1GLQA 5H5SA 4F2IA 3NIVA 3UJ1A 4G0IA 4TR0A 1GSEA 3TKSE 3DVWA 3LG6A 5ELGA 2C0GA 4ILFA 1PSQA 2B3SA 2FHEA 4KDXA 2VO4A 3HVNA 4EDYA 4BA7A 4LLRA 4MNNA 2E2GA 4PTSA 5A4VA 2C3QA 1OE7A 1GRXA 1I1IP 1OAZA 2X8HA 2DJKA 5DCHA 1USBA 4AKIA 1LU4A 4V1Ag 1N25A 1FB6A 2E0QA 1OC8A 4L8EA 3IBHA 3IHGA 2LNTA 2CAIA 1HYUA 1V58A 4ZB6A 2L6CA 4DSSB 1GSFA 3I69A 5ECRB 2ON5A 3A3TA 3D21A 2WFCA 2HI7A 3MWHA 1I9DA 2HE3A 3HCZA 1XVQA 4OO4A 4JE1A 3WT2A 2HSHA 5ECQB 4N0ZA 4HQSA 5DCGA 3GFKA 4G0KA 4K0GA 1SK1A 4RQXA 2L4CA 2H8LA 2XC2A 17GSA 1YEPA 4AKHA 2DC5A 4RQRA 3GX0A 5D73A 5IOWA 1BX9A 1PL1A 1QUWA 2LJRA 2IFQA 2FA8A 1FW1A 4NMUA 1Y6EA 1GNEA 2FWGA 4Z2RA 2MBSA 2CZ2A 1EGRA 3SBCA 5C00A 5J4YA 4ML1A 1G6YA 1MDIA 4F82A 2D2ZA 1ILOA 3O76A 1O73A 2FNOA 4XS6A 4ZL7A 4DSQA 3APOA 3A5IA 2QA2A 2WCIA 1BG1A 2HZFA 2L6DA 1A8LA 3F3RA 2GSSA 1OC9A 2L59A 4ZBDA 2GQLA 4H86A 2B7JA 3O6TA 1GSUA 4MF7A 2VM1A 2CQ9A 2M46A 1FOVA 2VIMA 2N5FA 2MMOA 2LS5A 3EINA 2J23A 5ECPB 2HSNA 2VLUA 2WVXB 5LCZA 1NSWA 2K8VA 5D8IA 2OT3A 2FD3A 3MIXA 2HRKA 3A2XA 1PKWA 2R4VA 3TCOA 2H74A 1IYIA 4AI6A 4GSSA 3IK9A 3UIWA 3VLNA 4KE3A 5ECMB 2H73A 4MH3A 1NM3A 4K6XA 2FWFA 2GZZA 1WJKA 1T1VA 3J7Yk 2V2GA 4CDOA 3CYNA 1AC1A 4V2LA 2CV4A 4PQIA 1ACVA 12GSA 2HSMB 3TOTA 1NHYA 4PXOA 3F4TA 4GWRA 3TRQA 1Z7RA 1GUMA 2WW0A 3DRNA 1K3LA 3RHCA 3F8UA 4KAEA 4YKGA 3GIXA 5JCUA 4MZWA 3H93A 3KH9A 4ZILA 3WGDA 5H5QA 5FT3A 4L5OA 4PQHA 1S4BP 4KSMA 2H71A 4JZQA 3IAS2 3CSJA 5DDLA 4G19A 2F8FA 4MJEA 1GL8A 3EU3A 9GSSA 1TRVA 4TW5A 5DQSA 3J7Yb 4EE0A 3TUEA 3TRPA 3F63A 5KEJA 2GS3A 3D4TA 4LL1B 4IJIA 1EEMA 5CO3A 2CX4A 4Z2TA 3BJ5A 3TKQA 1Q4JA 1V9WA 2N5AA 3ZYWA 1SKWB 3GKMA 2HLSA 1R7HA 1QK8A 1QFNA 1QQ2A 2AV4A 1ML6A 1SVLA 5IO0A 2HRNA 3GKXA 3HVXA 1FHEA 4ZL9A 1V40A 3A2VA 4ECCA 2OACA 2M80A 3KXOA 1TRSA 2HZEB 5HR3A 1GSQA 1DBYA 3HXSA 3TJFA 1X5DA 3D22A 1XBSA 2VM2A 1GULA 3NZNA 3US3A 3FZ5A 1GTBA 1SU9A 1R5PA 1ZMAA 4K7OA 5HR2A 2DMMA 1O8WA 2YNXA 1A23A 3QFBC 4HJ2A 5IM9A 2BJXA 2XBQA 3L78A 3EURA 5INYA 4KCEA 4GSNA 1PX6A 3VWUA 19GSA 5CRHA 3HJMA 1S3CA 3I9V2 4V2NA 5J5NA 1LJRA 4YH2A 3Q19A 1VF1A 2H0GA 4PNFA 1EP7A 1K0OA 2H6YA 4XTSA 2PERA 3Q74A 1GTUA 1YKAA 6GSXA 2YANA 4OCEA 1JZOA 4EO3A 4WKWA 1O7UA 3QAGA 3TU3B 1Z6NA 3HJPA 4O32A 2RIIA 3GRXA 1CQHA 5DALA 4LMVA 2WW3A 4EDZA 2A4VA 3SWLA 1TOFA 3KGKA 5GAND 2JSZA 4WXTA 3QOUA 3P8WA 4J56E 1EEJA 1XZOA 1PX7A 5IIZA 5AISA 2IMEA 1U3AA 4N3ZA 4IKHA 3FKFA 1R4WA 4WEYA 2DIZA 4FYCA 4RI6A 3CSIA 1A24A 3N9JA 3KP8A 1ERWA 3GYKA 2V1MA 2A2PA 3QDNA 1AIUA 4HOJA 2VAFA 2X8GA 3CRTA 5G2ZA 4DVCA 5B6MA 6GSWA 2CAQA 2JSYA 1OYJA 2ON7A 3UVHA 2PMTA 3DMLA 4FYUA 4IP1A 2C8UA 1XWGA 5F0GA 5DJLA 2JU5A 2NBSA 5IMCA 2R5GA 1G7EA 2JZRA 1YJ6A 2LEGA 2XPEA 1E6BA 2VD0A 5B8BA 1F3BA 1GTIA 1N2AA 1T7PB 3MDKA 3FY7A 1G0TA 4PI2C 2PUKC 2R0CA 4QQ7A 4MF6A 3R3EA 3I6AA 4L0UA 3EMPA 5JCGA 3GKNA 3HMJG 2LV3A 4O5UA 2TRXA 2ZCTA 2H1BA 4BPYA 4DSSA 2GLRA 3F0IA 4WF4A 2B7KA 3ED3A 1JLVA 2FGXA 1YVLA 1WOUA 3M1GA 1GNWA 2GT6A 3DIEA 3P7XA 4TXOA 2V6OA 5EL8A 5A5HB 2HXKA 5FWGA 1FO5A 5EPFA 3LYKA 4NV2A 1YZXA 2C0FA 2CVBA 2H76A 1J08A 5KN1A 3FRCA 1XOAA 2WGRA 4IQAA 1Y1UA 1Q98A 3UVTA 2CT6A 3HY2A 5H5RA 1T00A 1GSYA 1PGTA 5JWQB 2YV9A 1TI3A 4ZXGA 2PBJA 2FLSA 1OVNA 2VLVA 3LXZA 5IMVA 1O6JA 4J2FA 5C04A 1XIYA 3DGQA 3KTLA 2VOCA 4I97A 3FZ4A 4MMMA 4ZBAA 2DIYA 3CHXC 4ZB7A 4KUNA 4TR3A 2F8AA 3HJOA 4IBPA 1F3AA 1SVOA 2C3NA 5KOWA 1TP9A 2HRAA 5D9WA 3PGTA 3QAWA 3H1NA 4CW9A 2BTOT 2WVXA 2CX3A 4XHMA 5ENUA 3TOUA 4L0WA 3FR9A 2YJ7A 2VCQA 1DE2A 1M2BA 1TRUA 4O5RA 1KBNA 1WRYA 5DAKA 1G7OA 4I8BA 1Z7PA 5EVOA 5B6NA 2CVDA 4MDCA 3EWLA 1UA5A 3TJJA 3F3QA 5LNKe 3VI7A 4ID0A 4ZB9A 2OADA 5BRTA 3ZMLA 1YKCA 4DEJA 5AGYA 3IOSA 1VF3A 1U6TA 2VL3A 1BAYA 2HT9A 1ON4A 3UBKA 1K0BA 2I1UA 5HFIA 4BWQA 4YAVA 3IE3A 3GHAA 3HZ8A 2H6ZA 3ZRDA 3KM6A 2EIRA 2HSMA 5ID2A 3TDGA 4TR4A 3GURA 2LJKA 5G30A 2R0PA 2WW1A 3IR4A 4TOPA 2H1AA 2H66A 1TU8A 1F2EA 3KP9A 3CXGA 1JZRA 4HJMA 2A2SA 3KIJA 4KF9A 1B9YC 3CSHA 1XWCA 4JR4A 3I43A 4OO5A 14GSA 2IMIA 2H0IA 3PH9A 3D0ZA 4I6XA 2GSQA 2LQQA 4BVXB 2X4AA 1ERUA 2O7KA 3LJRA 2IJYA 4N30A 3HYPA 3MSZA 5COHA 3PR8A 2DKIA 3HA9A 1S3RA 3RBTA 1J0FA 3EVIA 1QGVA 5A5KA 5ECOB 4MPFA 3U5RE 3O3TA 5BMUB 3G7YA 2WB9A 2TRCP 1NHOA 2VL2C 1K0AA 5HR1A 3D4MA 1XWAA 5J9CA 4WR4A 1HD2A 3PPUA 4F03A 2H1DA 3K8NA 2H01A 4G10A 3QMXA 1EOHA 1PA3A 2O36A 2K9FA 1T3BA 1X9WB 1JHBA 3RAZA 1DUGA 4KCAA 1SL2B 1BJXA 3DXBA 4NHZA 3CRUA 3P90A 3C73A 3ME8A 5IPGA 4HS1A 4MJAA 4K7IA 2VL9A 1RW1A 1UVZA 5CRGA 1HQOA 2EIQA 4QL9A 2B6MA 2L4QA 1VF4A 2DBCA 2LKUA 2VL2A 2FWHA 3VPQA 1U3IA 4POLA 4FO5A 1NW2A 3G9BA 1BEDA 2OE1A 2YCDA 2VCZA 1HNCA 2NPBA 4HQZA 3TJBA 4TR1A 1EZKA 3F4RA 3E0UA 2P31A 2OJLA 1H75A 2LRCA 4ICYA 1WIKA 4OWYA 4N10A 2C80A 2FY6A 3BCIA 4G9HA 3GN3A 4NHWA 4AKXB 4I5QA 1YDKA 4CY6A 5ECLB 1MTCA 4KX4A 1GH2A 3TKRA 4LL4B 1K0MA 3L9UA 2F51A 4MZBA 2H0HA 5F07A 3UBLA 2EIOA 3KTBA 5G5EA 4HUAA 4EKZA 5IMAA 1FB0A 1N8JA 1RQMA 2EFEA 1SL0B 3CTGA 4F0CA 3ZL5A 5F06A 2LSTA 3E3EA 4NWYA 4XS4B 4HZ4A 3GMFA 2GSTA
chains in the Genus database with same CATH topology
1ZZYA 3WT1A 5IOXA 1OKTA 2PN8A 1MD3A 4IVFA 3C7MA 2N5BA 1SKRB 5JWRB 2A2RA 5A1NB 4JR6A 4EIPA 1EOGA 3QD9A 4O5QA 3BD2A 3ZTLA 5GAPD 2GVPA 3GL3A 2JZSA 2OA7A 4KH7A 2IWTA 1O8XA 1I5GA 1S3AA 1SK2A 3G7IA 3UOMA 1XW5A 3KJYA 4GF0A 4IJ3A 4Q5QA 3L4NA 4MP4A 3VK9A 1BYEA 3TGZA 1GWCA 4A5PA 1O85A 1EGOA 4D73B 5A5HA 2KHPA 5A34B 1X0RA 2EFHA 2B5YA 5ECNB 2K8SA 1DE1A 3ERGA 2CVKA 2H6XA 2EC4A 4OFNA 3TKSC 4ISDA 22GSA 3ME7A 1GTAA 5J40A 3GSTA 1KEBA 1OE8A 4Q5FA 1TTZA 5ECSA 3M0FA 2MZCA 5GSTA 4K5SA 3S9FA 4EVMA 4XCSA 2KLXA 1XXUA 3L9SA 4KDUA 2ALBA 3DVXA 3IDVA 2B1LA 3FEUA 4PUAA 4IW9A 3N5OA 4NXIA 5D96A 5G5FA 2IFQB 1FG4A 1PN0A 3VFIA 1ZYEA 1SL1B 3F6DA 2YZHA 2HYXA 3TKSA 3CTFA 2LTKA 4YQMA 1ZYPA 6GSUA 18GSA 3IXRA 2XPDA 2KOKA 3EC3A 1OC9B 4GQFA 4I2UA 3VWWA 4GTUA 1HNBA 4LA1A 4BVYA 3ZFLA 5J41A 1MEKA 1ZYQB 4BL7A 1M99A 1Y25A 4ZL8A 5J4VA 2I81A 1U87A 4TKYA 4GQCA 5CREA 20GSA 4OMVA 2E7PA 4JRRA 4HU9A 4PGTA 3JCML 3H4KA 1QXHA 1M2DA 3HHVA 4AKGA 1J9BA 4MA9A 1PD21 1RK4A 2HRKB 1M9AA 5B7CA 4EF0A 1YY7A 2KUCA 2LJAA 2UZ8A 1FAAA 4TRXA 5F8BA 3LSZA 1UC7A 1W4VA 1K0DA 2NDOA 1F37A 3GKKA 1SKSB 3LWAA 4K1FA 2CA8A 3APSA 4NAXA 3VI5A 3FZAA 5D9VA 7GSSA 3GV1A 4L5LA 2QSIA 2F3MA 2FCHA 4HZ2A 4BVXA 4N0VA 1W89A 4OD7A 4PQ1A 2P0GA 3KZQA 5G31A 2XHFA 2PWJA 3EU4A 1A2MA 4IGJA 3ZLPA 1WWJA 3ZVJA 3IAM2 2WS2A 4JU5A 3IK7A 2GZPA 1MDJA 2MMAA 2YZUA 2WULA 3DWVA 1BF5A 4HI7A 4KDYA 2DJ3A 4PX1A 3VURA 2JACA 2O5VA 4JBBA 4POMA 5IMFA 4P3YB 1XW9A 5CP1A 4E8EA 4AJ7A 1Z5YE 2YWIA 3LW9A 3ZITA 4AJ6A 2QKEA 3HKRA 5J47A 4PNGA 4K5RA 3BOAA 2GQKA 5HQPA 2R2JA 2DJ0A 2HFDA 2H1LA 1S3DA 2VUPA 3LYPA 3ISOA 4YKFA 1FOHA 2M72A 1BQ7A 3GUSA 5ECHB 4JEDA 2C1YA 3GX8A 1TK8B 5CYYA 3IC8A 1OKDA 4MLYA 3IV4A 2YOIA 8GSSA 4O92A 1PQNA 2WJUA 4HEA2 3UAPA 1M9BA 2DKHA 3D5JA 1GLPA 1PKZA 4EXJA 5AN1A 2JZTA 2NTOA 2DMLA 2TIRA 4TN8A 4YQUA 2EFCA 4KNDA 1QMVA 1WP0A 3KCMA 2DLXA 3LFLA 5ELAA 5IMZA 2H75A 2FWEA 6GSTA 1DSBA 3G7JA 4KSOA 4K2DA 2DJ2A 2PU9C 2GZYA 2DJJA 4K7NA 3IC4A 2X49A 4WR5A 3CMIA 5CRWA 3C8EA 4AGSA 1GUHA 1XWKA 3WGEA 3BCKA 1ZL9A 5DALB 1TDIA 2R3XA 2F9SA 3UL3A 1CQGA 2IMKA 4RUVA 2YWMA 3NOFA 2G2QA 5G1KA 5KOXA 3FR3A 1ERVA 2OKAA 2C0DA 2YWNA 2LNSA 5J9BA 1V57A 3EYTA 2JADA 3MYDA 4F0BA 3GL5A 2QA1A 2LRNA 4ECIA 4OFMA 2WDUA 4FH8A 4XS1A 3GSSA 1GP1A 3WGXA 5L71A 4OCFA 3ERFA 2I9HA 1XW6A 5J4UA 1ERTA 3GH6A 4WBRD 3IRAA 2L5OA 4N11A 2RUEA 1HNAA 4ZBBA 2IPAA 1UN2A 4RI7A 5HFGA 3TKPA 5DQYA 2LQOA 1TU7A 1PMTA 4LMWA 3M9KA 1TK5B 3UARA 2CZ3A 4G01A 4D73A 4TXVA 2GTUA 4E8HA 5A34A 3LEFA 2MYGA 3W6GA 4ECBA 2XBIA 4WBJA 5FHIA 3M9JA 2WZ9A 1AW9A 3KD0A 1X5EA 4Q5RA 1ZOFA 3WD6A 2HQTA 4NV5A 5HFKA 4V2MA 2AYTA 2I4AA 3M3MA 4WF5A 3FW2A 2HZEA 2X8CA 3KMNA 3DD3A 2DSAA 4TXOB 3ZIVA 5D93A 2R0GA 1LBKA 2C3TA 2Z9SA 1A2JA 1TK0B 1TXXA 2NVLA 5AIXA 3ZVJD 1M0UA 1VGLA 1YF1A 10GSA 3GTUB 4K2XA 3CBUA 1GUKA 2RM6A 4IN0A 4EIQA 3PINA 4HU7A 4G0LA 5J3RA 2MMNA 1A8YA 3A5WA 1F6MC 5DBQA 4HDEA 3VWXA 1KTEA 2P5RA 2AHEA 1B4QA 1XFLA 3DEXA 1U88A 2ZUPA 4BWSA 1TRWA 3KH7A 1XCCA 3EE2A 3IHQA 4X4JA 1M7TA 2X64A 2PGTA 3ZMKA 2B1KA 2VCVA 2H72A 1F9MA 3TRXA 1ABAA 5JWOB 4POBA 4IELA 2O87A 5IPHA 1EV4A 2H1GA 1SYRA 5AIVA 3GA4A 1K3YA 2YP6A 2J9HA 6GSYA 2YV7A 3RPPA 2PPTA 5DAKB 5JCWA 3AY8A 2O89A 3UEMA 3HDCA 4XRDA 4MABA 2FUG2 4I2TA 1E2YA 3RHBA 1PRXA 2H30A 5EY6A 4EL1A 4GDFA 1SJZA 1T4YA 5F05A 1AQXA 1K0NA 4MK3A 3C1SA 4WETA 4X1UA 2HSYA 3W8JA 6GSVA 2VCXA 3UMAA 1G6WA 1JZWA 3QFAC 2V32A 3MAKA 5ID2B 4YAPA 3ZZXA 5G1LA 3WYWA 4XIHA 4QMKA 3C1RA 1KNGA 1SENA 2O8VB 2VCWA 1THOA 4CHSA 4Q5NA 1SD9A 1AAZA 1SJ6A 2FA4A 2IMFA 1TJDA 4G2EA 4YQVA 4MJBA 2GDRA 3FZ9A 1ZGNA 4AF2A 2H19A 3D6IA 3TB2A 1YF0A 3H8QA 1H4OA 5E59A 4FIWA 2H70A 3GH9A 4TVEA 3QCPA 5D9XA 3DKSA 1SVMA 1B48A 1AQVA 4MPGA 2A4HA 1R5AA 1PN9A 4GCIA 1X5CA 2AUVA 3LGCA 2I3YA 3F6FA 4QL7A 1Z9HA 4ML6A 2VLTA 2VD1A 3LQ7A 5KN2A 1T8EB 1MD4A 1M2AA 3KEBA 3TJGA 4X43A 2G0FA 5GSSA 4ZIJA 2DJ1A 3F4SA 3VPTA 5GZZB 3V1WA 2YPMA 1ZCPA 1SJIA 4E68A 2V41A 3HZ4A 4ACSA 1GSSA 3VWVA 3L0HA 3HD5A 2O85A 1A2LA 2LUSA 3W8SA 1A0FA 2K6VA 5B8AA 3Q18A 3H79A 2KP2A 1X9MB 2B5EA 4MH2A 1OC3A 4AJ8A 2HNLA 1URMA 1JLWA 2GGTA 6GSSA 5CAXA 2GSRA 2HRFA 3RDWA 3MNGA 2OE3A 2C4JA 2R6KA 3FYGA 3ERWA 3QPMA 1K3OA 3QAVA 3FHKA 1ST9A 5E4WA 2OE0A 4USSA 4TR1B 2BMXA 3ZFBA 2MBTA 4ZB8A 3HVSA 2OBKA 2VKZG 1IYHA 4IHUA 3E9JB 3EMXA 3OR5A 2HSNB 1VF2A 2C0EA 2V6KA 4J57E 5ECKB 1SD8A 3U6VA 3APQA 4ULXA 2QGVA 1AUCA 4MJCA 3LXTA 3F9UA 2AB6A 1EP8A 1TI1A 2RLIA 2IL3A 1FVJA 4PURA 1V2AA 3LORA 1EWXA 4GSTA 4O7HA 4GLTA 5CNWA 4XRAA 3FR6A 3TJKA 4IP6A 2KP1A 1YQ1A 3FMWA 4EC0A 1SK0A 1XPVA 1XOBA 5ECIB 4PUFC 2PVQA 3IPZA 1JFUA 5CRDA 3P2AA 1BG5A 3Q6OA 1MDKA 4FQUA 1EV9A 1YEXA 1B4PA 4MCUA 2L5LA 1JZDA 1GSDA 2MMZA 5BMUA 1WPIA 2P5QA 2K18A 3HVVA 4MZCA 3FK8A 2VCTA 1T4ZA 1X9SB 1ZYNA 2PVOC 2ES7A 4W66A 4Z2UA 1R26A 5KN0A 2UV8G 4Z7XA 3EPTA 2JL4A 3RPNA 2AAWA 3KMOA 4K9ZA 1C72A 3ZREA 1A0RP 1Z3EA 2L57A 2REMA 3GNJA 1WMJA 2GT5A 2E2MA 1V98A 1B9XC 1VRSD 4K8MA 2LRTA 4IS0A 2QC7A 3GTUA 2RUFA 4EUYA 4KB3A 5DVBA 5ABRA 2GQMA 5A4UA 2X99A 5IMDA 1XVWA 2IMDA 1PL2A 5LD0A 11GSA 2YJHA 5DJMA 4KGIA 2IN3A 4ECJA 2YN1A 5IO2A 3BBYA 1THXA 4F9ZA 2ZNMA 5IQYA 1B8XA 16GSA 4POKA 4KW6A 3M8NA 4V1Ap 4X0XA 1TXUA 1AXDA 4MF5A 1Z6MA 2WRTA 3IA1A 1TW9A 2IIYA 3R2QA 1WE0A 2YWOA 2AJQB 1SYXA 4KA0A 5D9TA 5KN3A 1TKDB 4IQ1A 3C71A 4GXZA 4K0NA 3L9VA 4GRFA 2B5XA 4XS4A 4BVYB 1FVKA 1XWBA 4DSRA 4OFTA 2R37A 1K0CA 4BL7B 1O81A 1AQWA 3CWGA 3QR6A 2EFDA 5HR0A 4NPBA 13GSA 3A2WA 4CY8A 3ZIJA 2RM5A 2OBIA 5A4WA 3DYRA 4FYBA 5A1NA 1GLQA 5H5SA 4F2IA 3NIVA 3UJ1A 4G0IA 4TR0A 1GSEA 3TKSE 3DVWA 3LG6A 5ELGA 2C0GA 4ILFA 1PSQA 2B3SA 2FHEA 4KDXA 2VO4A 4EDYA 4BA7A 4LLRA 4MNNA 2E2GA 4PTSA 5A4VA 2C3QA 1OE7A 1GRXA 1OAZA 2X8HA 2DJKA 5DCHA 1USBA 4AKIA 1LU4A 4V1Ag 1N25A 1FB6A 2E0QA 1OC8A 4L8EA 3IBHA 3IHGA 2LNTA 2CAIA 1HYUA 1V58A 4ZB6A 2L6CA 4DSSB 1GSFA 3I69A 5ECRB 2ON5A 3A3TA 3D21A 2WFCA 2HI7A 3MWHA 1I9DA 2HE3A 3HCZA 1XVQA 4OO4A 4JE1A 3WT2A 2HSHA 5ECQB 4N0ZA 4HQSA 5DCGA 3GFKA 4G0KA 4K0GA 1SK1A 4RQXA 2L4CA 2H8LA 2XC2A 17GSA 1YEPA 4AKHA 2DC5A 4RQRA 3GX0A 5D73A 5IOWA 1BX9A 1PL1A 1QUWA 2LJRA 2IFQA 2FA8A 1FW1A 4NMUA 1Y6EA 1GNEA 2FWGA 4Z2RA 2MBSA 2CZ2A 1EGRA 3SBCA 5C00A 5J4YA 4ML1A 1G6YA 1MDIA 4F82A 2D2ZA 1ILOA 3O76A 1O73A 2FNOA 4XS6A 4ZL7A 4DSQA 3APOA 3A5IA 2QA2A 2WCIA 1BG1A 2HZFA 2L6DA 1A8LA 3F3RA 2GSSA 1OC9A 2L59A 4ZBDA 2GQLA 4H86A 2B7JA 3O6TA 1GSUA 4MF7A 2VM1A 2CQ9A 2M46A 1FOVA 2VIMA 2N5FA 2MMOA 2LS5A 3EINA 2J23A 5ECPB 2HSNA 2VLUA 5LCZA 1NSWA 2K8VA 5D8IA 2OT3A 2FD3A 3MIXA 2HRKA 3A2XA 1PKWA 2R4VA 3TCOA 2H74A 1IYIA 4AI6A 4GSSA 3IK9A 3UIWA 3VLNA 4KE3A 5ECMB 2H73A 4MH3A 1NM3A 4K6XA 2FWFA 2GZZA 1WJKA 1T1VA 3J7Yk 2V2GA 4CDOA 3CYNA 1AC1A 4V2LA 2CV4A 4PQIA 1ACVA 12GSA 2HSMB 3TOTA 1NHYA 4PXOA 3F4TA 4GWRA 3TRQA 1Z7RA 1GUMA 3DRNA 3RHCA 1K3LA 3F8UA 4KAEA 4YKGA 3GIXA 5JCUA 4MZWA 3H93A 3KH9A 4ZILA 3WGDA 5H5QA 5FT3A 4L5OA 4PQHA 4KSMA 2H71A 4JZQA 3IAS2 3CSJA 5DDLA 4G19A 2F8FA 4MJEA 1GL8A 3EU3A 9GSSA 1TRVA 4TW5A 5DQSA 3J7Yb 4EE0A 3TUEA 3TRPA 3F63A 5KEJA 2GS3A 3D4TA 4LL1B 4IJIA 1EEMA 5CO3A 2CX4A 4Z2TA 3BJ5A 3TKQA 1Q4JA 1V9WA 2N5AA 3ZYWA 1SKWB 3GKMA 2HLSA 1R7HA 1QK8A 1QFNA 1QQ2A 2AV4A 1ML6A 1SVLA 5IO0A 2HRNA 3GKXA 3HVXA 1FHEA 4ZL9A 1V40A 3A2VA 4ECCA 2OACA 2M80A 3KXOA 1TRSA 2HZEB 5HR3A 1GSQA 1DBYA 3HXSA 3TJFA 1X5DA 3D22A 1XBSA 2VM2A 1GULA 3NZNA 3US3A 3FZ5A 1GTBA 1SU9A 1R5PA 1ZMAA 4K7OA 5HR2A 2DMMA 1O8WA 2YNXA 1A23A 3QFBC 4HJ2A 5IM9A 2BJXA 2XBQA 3L78A 3EURA 5INYA 4KCEA 4GSNA 1PX6A 3VWUA 19GSA 5CRHA 3HJMA 1S3CA 3I9V2 4V2NA 5J5NA 1LJRA 4YH2A 3Q19A 1VF1A 2H0GA 4PNFA 1EP7A 1K0OA 2H6YA 4XTSA 2PERA 3Q74A 1GTUA 1YKAA 6GSXA 2YANA 4OCEA 1JZOA 4EO3A 4WKWA 1O7UA 3QAGA 3TU3B 1Z6NA 3HJPA 4O32A 2RIIA 3GRXA 1CQHA 5DALA 4LMVA 4EDZA 2A4VA 3SWLA 1TOFA 3KGKA 5GAND 2JSZA 4WXTA 3QOUA 3P8WA 4J56E 1EEJA 1XZOA 1PX7A 5IIZA 5AISA 2IMEA 1U3AA 4N3ZA 4IKHA 3FKFA 1R4WA 4WEYA 2DIZA 4FYCA 4RI6A 3CSIA 1A24A 3N9JA 3KP8A 1ERWA 3GYKA 2V1MA 2A2PA 3QDNA 1AIUA 4HOJA 2VAFA 2X8GA 3CRTA 5G2ZA 4DVCA 5B6MA 6GSWA 2CAQA 2JSYA 1OYJA 2ON7A 3UVHA 2PMTA 3DMLA 4FYUA 4IP1A 2C8UA 1XWGA 5F0GA 5DJLA 2JU5A 2NBSA 5IMCA 2R5GA 1G7EA 2JZRA 1YJ6A 2LEGA 2XPEA 1E6BA 2VD0A 5B8BA 1F3BA 1GTIA 1N2AA 1T7PB 3MDKA 3FY7A 1G0TA 2PUKC 2R0CA 4QQ7A 4MF6A 3R3EA 3I6AA 4L0UA 3EMPA 5JCGA 3GKNA 3HMJG 2LV3A 4O5UA 2TRXA 2ZCTA 2H1BA 4BPYA 4DSSA 2GLRA 3F0IA 4WF4A 2B7KA 3ED3A 1JLVA 2FGXA 1YVLA 1WOUA 3M1GA 1GNWA 2GT6A 3DIEA 3P7XA 4TXOA 2V6OA 5EL8A 5A5HB 2HXKA 5FWGA 1FO5A 5EPFA 3LYKA 4NV2A 1YZXA 2C0FA 2CVBA 2H76A 1J08A 5KN1A 3FRCA 1XOAA 2WGRA 4IQAA 1Y1UA 1Q98A 3UVTA 2CT6A 3HY2A 5H5RA 1T00A 1GSYA 1PGTA 5JWQB 2YV9A 1TI3A 4ZXGA 2PBJA 2FLSA 1OVNA 2VLVA 3LXZA 5IMVA 1O6JA 4J2FA 5C04A 1XIYA 3DGQA 3KTLA 2VOCA 4I97A 3FZ4A 4MMMA 4ZBAA 2DIYA 4ZB7A 4KUNA 4TR3A 2F8AA 3HJOA 4IBPA 1F3AA 1SVOA 2C3NA 5KOWA 1TP9A 2HRAA 5D9WA 3PGTA 3QAWA 3H1NA 4CW9A 2BTOT 2CX3A 4XHMA 5ENUA 3TOUA 4L0WA 3FR9A 2YJ7A 2VCQA 1DE2A 1M2BA 1TRUA 4O5RA 1KBNA 1WRYA 5DAKA 1G7OA 4I8BA 1Z7PA 5EVOA 5B6NA 2CVDA 4MDCA 3EWLA 1UA5A 3TJJA 3F3QA 5LNKe 3VI7A 4ID0A 4ZB9A 2OADA 5BRTA 3ZMLA 1YKCA 4DEJA 5AGYA 3IOSA 1VF3A 1U6TA 2VL3A 1BAYA 2HT9A 1ON4A 3UBKA 1K0BA 2I1UA 5HFIA 4BWQA 4YAVA 3IE3A 3GHAA 3HZ8A 2H6ZA 3ZRDA 3KM6A 2EIRA 2HSMA 5ID2A 3TDGA 4TR4A 3GURA 2LJKA 5G30A 2R0PA 3IR4A 4TOPA 2H1AA 2H66A 1TU8A 1F2EA 3KP9A 3CXGA 1JZRA 4HJMA 2A2SA 3KIJA 4KF9A 1B9YC 3CSHA 1XWCA 4JR4A 3I43A 4OO5A 14GSA 2IMIA 2H0IA 3PH9A 3D0ZA 4I6XA 2GSQA 2LQQA 4BVXB 2X4AA 1ERUA 2O7KA 3LJRA 2IJYA 4N30A 3HYPA 3MSZA 5COHA 3PR8A 2DKIA 3HA9A 3RBTA 1J0FA 3EVIA 1QGVA 5A5KA 5ECOB 4MPFA 3U5RE 3O3TA 5BMUB 3G7YA 2WB9A 2TRCP 1NHOA 2VL2C 1K0AA 5HR1A 3D4MA 1XWAA 5J9CA 4WR4A 1HD2A 3PPUA 4F03A 2H1DA 3K8NA 2H01A 4G10A 3QMXA 1EOHA 1PA3A 2K9FA 1T3BA 1X9WB 1JHBA 3RAZA 1DUGA 4KCAA 1SL2B 1BJXA 3DXBA 4NHZA 3CRUA 3P90A 3C73A 3ME8A 5IPGA 4HS1A 4MJAA 4K7IA 2VL9A 1RW1A 1UVZA 5CRGA 1HQOA 2EIQA 4QL9A 2B6MA 2L4QA 1VF4A 2DBCA 2LKUA 2VL2A 2FWHA 3VPQA 1U3IA 4POLA 4FO5A 1NW2A 3G9BA 1BEDA 2OE1A 2YCDA 2VCZA 1HNCA 2NPBA 4HQZA 3TJBA 4TR1A 1EZKA 3F4RA 3E0UA 2P31A 2OJLA 1H75A 2LRCA 4ICYA 1WIKA 4OWYA 4N10A 2C80A 2FY6A 3BCIA 4G9HA 3GN3A 4NHWA 4AKXB 4I5QA 1YDKA 4CY6A 5ECLB 1MTCA 4KX4A 1GH2A 3TKRA 4LL4B 1K0MA 3L9UA 2F51A 4MZBA 2H0HA 5F07A 3UBLA 2EIOA 3KTBA 5G5EA 4HUAA 4EKZA 5IMAA 1FB0A 1N8JA 1RQMA 2EFEA 1SL0B 3CTGA 4F0CA 3ZL5A 5F06A 2LSTA 3E3EA 4NWYA 4XS4B 4HZ4A 3GMFA 2GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZY A;  3WT1 A;  5IOX A;  1OKT A;  2PN8 A;  1MD3 A;  4IVF A;  3C7M A;  2N5B A;  1SKR B;  5JWR B;  2A2R A;  4JR6 A;  1EOG A;  3QD9 A;  3BD2 A;  3ZTL A;  5GAP D;  2GVP A;  3GL3 A;  2JZS A;  2OA7 A;  4KH7 A;  2IWT A;  1O8X A;  1I5G A;  1S3A A;  1SK2 A;  3G7I A;  3UOM A;  1XW5 A;  3KJY A;  4GF0 A;  4IJ3 A;  4Q5Q A;  3L4N A;  4MP4 A;  3VK9 A;  1BYE A;  3TGZ A;  1GWC A;  1O85 A;  1EGO A;  4D73 B;  2KHP A;  1X0R A;  2B5Y A;  5ECN B;  2K8S A;  1DE1 A;  3ERG A;  2CVK A;  2H6X A;  2EC4 A;  4OFN A;  3TKS C;  4ISD A;  22GS A;  3ME7 A;  1GTA A;  3GST A;  1KEB A;  1OE8 A;  4Q5F A;  1TTZ A;  5ECS A;  3M0F A;  2MZC A;  5GST A;  3S9F A;  4EVM A;  4XCS A;  2KLX A;  1XXU A;  3L9S A;  4KDU A;  2ALB A;  3DVX A;  3IDV A;  2B1L A;  3FEU A;  4PUA A;  4IW9 A;  3N5O A;  4NXI A;  5D96 A;  5G5F A;  2IFQ B;  1FG4 A;  3VFI A;  1ZYE A;  1SL1 B;  3F6D A;  2YZH A;  2HYX A;  3TKS A;  3CTF A;  2LTK A;  4YQM A;  6GSU A;  18GS A;  3IXR A;  2XPD A;  2KOK A;  3EC3 A;  1OC9 B;  4GQF A;  4I2U A;  3VWW A;  4GTU A;  1HNB A;  4LA1 A;  4BVY A;  3ZFL A;  5J41 A;  1MEK A;  1ZYQ B;  4BL7 A;  1M99 A;  1Y25 A;  4ZL8 A;  2I81 A;  1U87 A;  4TKY A;  4GQC A;  5CRE A;  20GS A;  4OMV A;  2E7P A;  4JRR A;  4HU9 A;  4PGT A;  3JCM L;  3H4K A;  1QXH A;  1M2D A;  3HHV A;  1J9B A;  4MA9 A;  1PD2 1;  1RK4 A;  2HRK B;  1M9A A;  5B7C A;  4EF0 A;  1YY7 A;  2KUC A;  2LJA A;  2UZ8 A;  1FAA A;  4TRX A;  5F8B A;  3LSZ A;  1UC7 A;  1W4V A;  1K0D A;  2NDO A;  1F37 A;  3GKK A;  1SKS B;  3LWA A;  4K1F A;  2CA8 A;  3APS A;  4NAX A;  3VI5 A;  3FZA A;  5D9V A;  7GSS A;  3GV1 A;  4L5L A;  2QSI A;  2F3M A;  2FCH A;  4HZ2 A;  4BVX A;  4N0V A;  1W89 A;  4OD7 A;  4PQ1 A;  2P0G A;  3KZQ A;  5G31 A;  2XHF A;  2PWJ A;  3EU4 A;  1A2M A;  4IGJ A;  3ZLP A;  1WWJ A;  3ZVJ A;  3IAM 2;  2WS2 A;  4JU5 A;  3IK7 A;  2GZP A;  1MDJ A;  2MMA A;  2YZU A;  2WUL A;  3DWV A;  4HI7 A;  4KDY A;  2DJ3 A;  4PX1 A;  3VUR A;  2JAC A;  4JBB A;  4POM A;  5IMF A;  4P3Y B;  1XW9 A;  5CP1 A;  4E8E A;  4AJ7 A;  1Z5Y E;  2YWI A;  3ZIT A;  4AJ6 A;  2QKE A;  3HKR A;  4PNG A;  3BOA A;  2GQK A;  5HQP A;  2R2J A;  2DJ0 A;  2HFD A;  1S3D A;  2VUP A;  3LYP A;  3ISO A;  2M72 A;  1BQ7 A;  3GUS A;  5ECH B;  4JED A;  2C1Y A;  3GX8 A;  1TK8 B;  5CYY A;  3IC8 A;  1OKD A;  4MLY A;  3IV4 A;  2YOI A;  8GSS A;  4O92 A;  1PQN A;  2WJU A;  4HEA 2;  3UAP A;  1M9B A;  3D5J A;  1GLP A;  1PKZ A;  4EXJ A;  5AN1 A;  2JZT A;  2NTO A;  2DML A;  2TIR A;  4TN8 A;  4YQU A;  4KND A;  1QMV A;  1WP0 A;  3KCM A;  2DLX A;  3LFL A;  5ELA A;  5IMZ A;  2H75 A;  2FWE A;  6GST A;  1DSB A;  3G7J A;  4KSO A;  4K2D A;  2DJ2 A;  2PU9 C;  2GZY A;  2DJJ A;  4K7N A;  3IC4 A;  4WR5 A;  3CMI A;  5CRW A;  3C8E A;  4AGS A;  1GUH A;  1XWK A;  3WGE A;  3BCK A;  1ZL9 A;  5DAL B;  1TDI A;  2R3X A;  2F9S A;  3UL3 A;  1CQG A;  2IMK A;  4RUV A;  2YWM A;  3NOF A;  2G2Q A;  5G1K A;  3FR3 A;  1ERV A;  2OKA A;  2C0D A;  2YWN A;  2LNS A;  5J9B A;  1V57 A;  3EYT A;  2JAD A;  4F0B A;  3GL5 A;  2LRN A;  4ECI A;  4OFM A;  2WDU A;  4FH8 A;  4XS1 A;  3GSS A;  1GP1 A;  3WGX A;  5L71 A;  4OCF A;  3ERF A;  2I9H A;  1XW6 A;  5J4U A;  1ERT A;  3GH6 A;  4WBR D;  3IRA A;  2L5O A;  4N11 A;  2RUE A;  1HNA A;  4ZBB A;  2IPA A;  1UN2 A;  4RI7 A;  5HFG A;  3TKP A;  5DQY A;  2LQO A;  1TU7 A;  1PMT A;  4LMW A;  3M9K A;  1TK5 B;  3UAR A;  2CZ3 A;  4D73 A;  4TXV A;  2GTU A;  4E8H A;  3LEF A;  2MYG A;  3W6G A;  4ECB A;  2XBI A;  4WBJ A;  5FHI A;  3M9J A;  2WZ9 A;  1AW9 A;  3KD0 A;  1X5E A;  4Q5R A;  1ZOF A;  3WD6 A;  2HQT A;  4NV5 A;  5HFK A;  4V2M A;  2AYT A;  2I4A A;  3M3M A;  4WF5 A;  3FW2 A;  2HZE A;  2X8C A;  3KMN A;  3DD3 A;  2DSA A;  4TXO B;  3ZIV A;  5D93 A;  1LBK A;  2C3T A;  2Z9S A;  1A2J A;  1TK0 B;  1TXX A;  2NVL A;  5AIX A;  3ZVJ D;  1M0U A;  1VGL A;  1YF1 A;  10GS A;  3GTU B;  3CBU A;  1GUK A;  2RM6 A;  4IN0 A;  3PIN A;  4HU7 A;  4G0L A;  5J3R A;  2MMN A;  1A8Y A;  3A5W A;  1F6M C;  5DBQ A;  4HDE A;  3VWX A;  1KTE A;  2P5R A;  2AHE A;  1B4Q A;  1XFL A;  3DEX A;  1U88 A;  2ZUP A;  4BWS A;  1TRW A;  3KH7 A;  1XCC A;  3EE2 A;  3IHQ A;  1M7T A;  2X64 A;  2PGT A;  3ZMK A;  2B1K A;  2VCV A;  2H72 A;  1F9M A;  3TRX A;  1ABA A;  5JWO B;  4POB A;  4IEL A;  2O87 A;  5IPH A;  1EV4 A;  2H1G A;  1SYR A;  5AIV A;  3GA4 A;  1K3Y A;  2YP6 A;  2J9H A;  6GSY A;  2YV7 A;  3RPP A;  2PPT A;  5DAK B;  5JCW A;  3AY8 A;  2O89 A;  3UEM A;  3HDC A;  4XRD A;  4MAB A;  2FUG 2;  4I2T A;  1E2Y A;  3RHB A;  1PRX A;  2H30 A;  5EY6 A;  4EL1 A;  1SJZ A;  1T4Y A;  5F05 A;  1AQX A;  1K0N A;  4MK3 A;  3C1S A;  4WET A;  4X1U A;  2HSY A;  3W8J A;  6GSV A;  2VCX A;  3UMA A;  1G6W A;  1JZW A;  3QFA C;  2V32 A;  3MAK A;  5ID2 B;  4YAP A;  3ZZX A;  5G1L A;  3WYW A;  4XIH A;  3C1R A;  1KNG A;  1SEN A;  2O8V B;  2VCW A;  1THO A;  4CHS A;  4Q5N A;  1SD9 A;  1AAZ A;  1SJ6 A;  2FA4 A;  2IMF A;  4G2E A;  1TJD A;  4YQV A;  4MJB A;  2GDR A;  3FZ9 A;  1ZGN A;  4AF2 A;  2H19 A;  3D6I A;  3TB2 A;  1YF0 A;  3H8Q A;  1H4O A;  5E59 A;  4FIW A;  2H70 A;  3GH9 A;  4TVE A;  3QCP A;  5D9X A;  3DKS A;  1B48 A;  1AQV A;  4MPG A;  1R5A A;  1PN9 A;  4GCI A;  1X5C A;  2AUV A;  3LGC A;  2I3Y A;  3F6F A;  4QL7 A;  1Z9H A;  4ML6 A;  2VLT A;  2VD1 A;  3LQ7 A;  5KN2 A;  1T8E B;  1MD4 A;  1M2A A;  3KEB A;  3TJG A;  4X43 A;  2G0F A;  5GSS A;  4ZIJ A;  2DJ1 A;  3F4S A;  3VPT A;  5GZZ B;  3V1W A;  2YPM A;  1ZCP A;  1SJI A;  2V41 A;  3HZ4 A;  4ACS A;  1GSS A;  3VWV A;  3L0H A;  3HD5 A;  2O85 A;  1A2L A;  2LUS A;  3W8S A;  1A0F A;  2K6V A;  5B8A A;  3Q18 A;  3H79 A;  2KP2 A;  1X9M B;  2B5E A;  4MH2 A;  1OC3 A;  4AJ8 A;  2HNL A;  1URM A;  1JLW A;  2GGT A;  6GSS A;  5CAX A;  2GSR A;  2HRF A;  3RDW A;  3MNG A;  2OE3 A;  2C4J A;  2R6K A;  3FYG A;  3ERW A;  3QPM A;  1K3O A;  3QAV A;  3FHK A;  1ST9 A;  5E4W A;  2OE0 A;  4USS A;  4TR1 B;  2BMX A;  3ZFB A;  2MBT A;  4ZB8 A;  3HVS A;  2OBK A;  1IYH A;  4IHU A;  3E9J B;  3EMX A;  3OR5 A;  2HSN B;  1VF2 A;  2C0E A;  2V6K A;  4J57 E;  5ECK B;  1SD8 A;  3U6V A;  3APQ A;  4ULX A;  2QGV A;  1AUC A;  4MJC A;  3LXT A;  3F9U A;  2AB6 A;  1EP8 A;  1TI1 A;  2RLI A;  2IL3 A;  1FVJ A;  4PUR A;  1V2A A;  3LOR A;  1EWX A;  4GST A;  4O7H A;  4GLT A;  5CNW A;  4XRA A;  3FR6 A;  3TJK A;  4IP6 A;  2KP1 A;  1YQ1 A;  4EC0 A;  1SK0 A;  1XPV A;  1XOB A;  5ECI B;  4PUF C;  2PVQ A;  3IPZ A;  1JFU A;  5CRD A;  3P2A A;  1BG5 A;  3Q6O A;  1MDK A;  4FQU A;  1EV9 A;  1YEX A;  1B4P A;  4MCU A;  2L5L A;  1JZD A;  1GSD A;  2MMZ A;  5BMU A;  1WPI A;  2P5Q A;  2K18 A;  3HVV A;  4MZC A;  3FK8 A;  2VCT A;  1T4Z A;  1X9S B;  2PVO C;  2ES7 A;  1R26 A;  5KN0 A;  4Z7X A;  2JL4 A;  3RPN A;  2AAW A;  3KMO A;  4K9Z A;  1C72 A;  3ZRE A;  1A0R P;  1Z3E A;  2L57 A;  2REM A;  3GNJ A;  1WMJ A;  2GT5 A;  2E2M A;  1V98 A;  1B9X C;  1VRS D;  4K8M A;  2LRT A;  4IS0 A;  2QC7 A;  3GTU A;  2RUF A;  4EUY A;  4KB3 A;  5DVB A;  5ABR A;  2GQM A;  5A4U A;  2X99 A;  5IMD A;  1XVW A;  2IMD A;  1PL2 A;  5LD0 A;  11GS A;  2YJH A;  5DJM A;  4KGI A;  2IN3 A;  4ECJ A;  2YN1 A;  5IO2 A;  3BBY A;  1THX A;  4F9Z A;  2ZNM A;  5IQY A;  1B8X A;  16GS A;  4POK A;  4KW6 A;  3M8N A;  4V1A p;  4X0X A;  1AXD A;  4MF5 A;  1Z6M A;  2WRT A;  3IA1 A;  1TW9 A;  2IIY A;  3R2Q A;  1WE0 A;  2YWO A;  2AJQ B;  1SYX A;  4KA0 A;  5D9T A;  5KN3 A;  1TKD B;  4IQ1 A;  3C71 A;  4GXZ A;  4K0N A;  3L9V A;  4GRF A;  2B5X A;  4XS4 A;  4BVY B;  1FVK A;  1XWB A;  4DSR A;  4OFT A;  2R37 A;  1K0C A;  4BL7 B;  1O81 A;  1AQW A;  3QR6 A;  5HR0 A;  4NPB A;  13GS A;  3A2W A;  3ZIJ A;  2RM5 A;  2OBI A;  5A4W A;  3DYR A;  4FYB A;  1GLQ A;  5H5S A;  4F2I A;  3NIV A;  3UJ1 A;  4G0I A;  4TR0 A;  1GSE A;  3TKS E;  3DVW A;  3LG6 A;  5ELG A;  2C0G A;  4ILF A;  1PSQ A;  2B3S A;  2FHE A;  4KDX A;  2VO4 A;  4EDY A;  4BA7 A;  4LLR A;  2E2G A;  4PTS A;  5A4V A;  2C3Q A;  1OE7 A;  1GRX A;  1OAZ A;  2X8H A;  2DJK A;  5DCH A;  1USB A;  1LU4 A;  4V1A g;  1FB6 A;  2E0Q A;  1OC8 A;  4L8E A;  3IBH A;  2LNT A;  2CAI A;  1HYU A;  1V58 A;  4ZB6 A;  2L6C A;  4DSS B;  1GSF A;  3I69 A;  5ECR B;  2ON5 A;  3A3T A;  3D21 A;  2WFC A;  2HI7 A;  3MWH A;  1I9D A;  2HE3 A;  3HCZ A;  1XVQ A;  4OO4 A;  4JE1 A;  3WT2 A;  2HSH A;  5ECQ B;  4N0Z A;  4HQS A;  5DCG A;  3GFK A;  4G0K A;  4K0G A;  1SK1 A;  4RQX A;  2L4C A;  2H8L A;  2XC2 A;  17GS A;  1YEP A;  2DC5 A;  4RQR A;  3GX0 A;  5D73 A;  5IOW A;  1BX9 A;  1PL1 A;  1QUW A;  2LJR A;  2IFQ A;  2FA8 A;  1FW1 A;  4NMU A;  1Y6E A;  1GNE A;  2FWG A;  2MBS A;  2CZ2 A;  1EGR A;  3SBC A;  5C00 A;  4ML1 A;  1G6Y A;  1MDI A;  4F82 A;  2D2Z A;  1ILO A;  3O76 A;  1O73 A;  2FNO A;  4XS6 A;  4ZL7 A;  4DSQ A;  3APO A;  2WCI A;  2HZF A;  2L6D A;  1A8L A;  3F3R A;  2GSS A;  1OC9 A;  2L59 A;  4ZBD A;  2GQL A;  4H86 A;  2B7J A;  3O6T A;  1GSU A;  4MF7 A;  2VM1 A;  2CQ9 A;  2M46 A;  1FOV A;  2VIM A;  2N5F A;  2MMO A;  2LS5 A;  3EIN A;  2J23 A;  5ECP B;  2VLU A;  5LCZ A;  1NSW A;  2K8V A;  5D8I A;  2FD3 A;  2HRK A;  3A2X A;  1PKW A;  2R4V A;  3TCO A;  2H74 A;  1IYI A;  4GSS A;  3IK9 A;  3UIW A;  3VLN A;  4KE3 A;  5ECM B;  2H73 A;  4MH3 A;  1NM3 A;  4K6X A;  2FWF A;  2GZZ A;  1WJK A;  1T1V A;  3J7Y k;  2V2G A;  4CDO A;  3CYN A;  1AC1 A;  4V2L A;  2CV4 A;  4PQI A;  1ACV A;  12GS A;  2HSM B;  3TOT A;  1NHY A;  4PXO A;  3F4T A;  4GWR A;  3TRQ A;  1Z7R A;  1GUM A;  3DRN A;  3RHC A;  1K3L A;  3F8U A;  4KAE A;  3GIX A;  5JCU A;  4MZW A;  3H93 A;  3KH9 A;  4ZIL A;  3WGD A;  5H5Q A;  5FT3 A;  4L5O A;  4PQH A;  4KSM A;  2H71 A;  4JZQ A;  3IAS 2;  3CSJ A;  5DDL A;  4G19 A;  2F8F A;  4MJE A;  1GL8 A;  3EU3 A;  9GSS A;  1TRV A;  4TW5 A;  5DQS A;  3J7Y b;  4EE0 A;  3TUE A;  3TRP A;  3F63 A;  5KEJ A;  2GS3 A;  3D4T A;  4LL1 B;  4IJI A;  1EEM A;  5CO3 A;  2CX4 A;  3BJ5 A;  3TKQ A;  1Q4J A;  1V9W A;  2N5A A;  3ZYW A;  1SKW B;  3GKM A;  2HLS A;  1R7H A;  1QK8 A;  1QFN A;  1QQ2 A;  2AV4 A;  1ML6 A;  5IO0 A;  2HRN A;  3GKX A;  3HVX A;  1FHE A;  4ZL9 A;  1V40 A;  3A2V A;  4ECC A;  2OAC A;  2M80 A;  3KXO A;  1TRS A;  2HZE B;  5HR3 A;  1GSQ A;  1DBY A;  3HXS A;  3TJF A;  1X5D A;  3D22 A;  1XBS A;  2VM2 A;  1GUL A;  3NZN A;  3US3 A;  3FZ5 A;  1GTB A;  1SU9 A;  1R5P A;  1ZMA A;  4K7O A;  5HR2 A;  2DMM A;  1O8W A;  2YNX A;  1A23 A;  3QFB C;  4HJ2 A;  5IM9 A;  2BJX A;  2XBQ A;  3L78 A;  3EUR A;  5INY A;  4KCE A;  4GSN A;  1PX6 A;  3VWU A;  19GS A;  5CRH A;  3HJM A;  1S3C A;  3I9V 2;  4V2N A;  5J5N A;  1LJR A;  4YH2 A;  3Q19 A;  1VF1 A;  2H0G A;  4PNF A;  1EP7 A;  1K0O A;  2H6Y A;  4XTS A;  2PER A;  3Q74 A;  1GTU A;  1YKA A;  6GSX A;  2YAN A;  4OCE A;  1JZO A;  4EO3 A;  4WKW A;  1O7U A;  3QAG A;  3HJP A;  1Z6N A;  4O32 A;  2RII A;  3GRX A;  1CQH A;  5DAL A;  4LMV A;  4EDZ A;  2A4V A;  3SWL A;  1TOF A;  3KGK A;  5GAN D;  2JSZ A;  4WXT A;  3QOU A;  3P8W A;  4J56 E;  1EEJ A;  1XZO A;  1PX7 A;  5IIZ A;  5AIS A;  2IME A;  1U3A A;  4IKH A;  3FKF A;  1R4W A;  4WEY A;  2DIZ A;  4FYC A;  4RI6 A;  3CSI A;  1A24 A;  3N9J A;  3KP8 A;  1ERW A;  3GYK A;  2V1M A;  3QDN A;  1AIU A;  4HOJ A;  2VAF A;  2X8G A;  3CRT A;  5G2Z A;  4DVC A;  5B6M A;  6GSW A;  2CAQ A;  2JSY A;  1OYJ A;  2ON7 A;  3UVH A;  2PMT A;  3DML A;  4FYU A;  4IP1 A;  2C8U A;  1XWG A;  5F0G A;  5DJL A;  2JU5 A;  2NBS A;  5IMC A;  2R5G A;  1G7E A;  2JZR A;  1YJ6 A;  2LEG A;  2XPE A;  1E6B A;  2VD0 A;  5B8B A;  1F3B A;  1GTI A;  1N2A A;  1T7P B;  3MDK A;  3FY7 A;  1G0T A;  2PUK C;  4QQ7 A;  4MF6 A;  3R3E A;  3I6A A;  4L0U A;  3EMP A;  5JCG A;  3GKN A;  2LV3 A;  2TRX A;  2ZCT A;  2H1B A;  4BPY A;  4DSS A;  2GLR A;  3F0I A;  4WF4 A;  2B7K A;  3ED3 A;  1JLV A;  2FGX A;  1WOU A;  3M1G A;  1GNW A;  2GT6 A;  3DIE A;  3P7X A;  4TXO A;  2V6O A;  5EL8 A;  2HXK A;  5FWG A;  1FO5 A;  5EPF A;  3LYK A;  4NV2 A;  1YZX A;  2C0F A;  2CVB A;  2H76 A;  1J08 A;  5KN1 A;  3FRC A;  1XOA A;  2WGR A;  4IQA A;  1Q98 A;  3UVT A;  2CT6 A;  3HY2 A;  5H5R A;  1T00 A;  1GSY A;  1PGT A;  5JWQ B;  2YV9 A;  1TI3 A;  4ZXG A;  2PBJ A;  2FLS A;  1OVN A;  2VLV A;  3LXZ A;  5IMV A;  1O6J A;  4J2F A;  5C04 A;  1XIY A;  3DGQ A;  3KTL A;  2VOC A;  4I97 A;  3FZ4 A;  4MMM A;  4ZBA A;  2DIY A;  4KUN A;  4TR3 A;  2F8A A;  3HJO A;  4IBP A;  1F3A A;  2C3N A;  1TP9 A;  2HRA A;  5D9W A;  3PGT A;  3QAW A;  3H1N A;  4CW9 A;  2BTO T;  2CX3 A;  4XHM A;  5ENU A;  3TOU A;  4L0W A;  3FR9 A;  2YJ7 A;  2VCQ A;  1DE2 A;  1M2B A;  1TRU A;  4O5R A;  1KBN A;  1WRY A;  5DAK A;  1G7O A;  4I8B A;  1Z7P A;  5EVO A;  5B6N A;  2CVD A;  4MDC A;  3EWL A;  1UA5 A;  3TJJ A;  3F3Q A;  5LNK e;  3VI7 A;  4ID0 A;  4ZB9 A;  2OAD A;  3ZML A;  1YKC A;  4DEJ A;  5AGY A;  3IOS A;  1VF3 A;  1U6T A;  2VL3 A;  1BAY A;  2HT9 A;  1ON4 A;  3UBK A;  1K0B A;  2I1U A;  5HFI A;  4BWQ A;  4YAV A;  3IE3 A;  3GHA A;  3HZ8 A;  2H6Z A;  3ZRD A;  3KM6 A;  2EIR A;  2HSM A;  5ID2 A;  3TDG A;  4TR4 A;  3GUR A;  2LJK A;  5G30 A;  3IR4 A;  4TOP A;  2H1A A;  2H66 A;  1TU8 A;  1F2E A;  3KP9 A;  3CXG A;  1JZR A;  4HJM A;  2A2S A;  3KIJ A;  4KF9 A;  1B9Y C;  3CSH A;  1XWC A;  4JR4 A;  3I43 A;  4OO5 A;  14GS A;  2IMI A;  2H0I A;  3PH9 A;  3D0Z A;  4I6X A;  2GSQ A;  2LQQ A;  4BVX B;  1ERU A;  2O7K A;  3LJR A;  2IJY A;  4N30 A;  3HYP A;  3MSZ A;  5COH A;  3PR8 A;  3HA9 A;  3RBT A;  1J0F A;  3EVI A;  1QGV A;  5A5K A;  5ECO B;  4MPF A;  3U5R E;  3O3T A;  3G7Y A;  2WB9 A;  2TRC P;  1NHO A;  2VL2 C;  1K0A A;  5HR1 A;  3D4M A;  1XWA A;  5J9C A;  4WR4 A;  1HD2 A;  3PPU A;  4F03 A;  2H1D A;  3K8N A;  2H01 A;  4G10 A;  3QMX A;  1EOH A;  1PA3 A;  2K9F A;  1T3B A;  1X9W B;  1JHB A;  3RAZ A;  1DUG A;  4KCA A;  1SL2 B;  1BJX A;  3DXB A;  4NHZ A;  3CRU A;  3P90 A;  3C73 A;  3ME8 A;  5IPG A;  4HS1 A;  4MJA A;  4K7I A;  2VL9 A;  1RW1 A;  1UVZ A;  5CRG A;  1HQO A;  2EIQ A;  4QL9 A;  2B6M A;  2L4Q A;  1VF4 A;  2DBC A;  2LKU A;  2VL2 A;  2FWH A;  3VPQ A;  1U3I A;  4POL A;  4FO5 A;  1NW2 A;  3G9B A;  1BED A;  2OE1 A;  2YCD A;  2VCZ A;  1HNC A;  2NPB A;  4HQZ A;  3TJB A;  4TR1 A;  1EZK A;  3F4R A;  3E0U A;  2P31 A;  2OJL A;  1H75 A;  2LRC A;  1WIK A;  4OWY A;  4N10 A;  2C80 A;  2FY6 A;  3BCI A;  4G9H A;  3GN3 A;  4NHW A;  4I5Q A;  1YDK A;  5ECL B;  1MTC A;  4KX4 A;  1GH2 A;  3TKR A;  4LL4 B;  1K0M A;  3L9U A;  2F51 A;  4MZB A;  2H0H A;  5F07 A;  3UBL A;  2EIO A;  3KTB A;  5G5E A;  4HUA A;  4EKZ A;  5IMA A;  1FB0 A;  1N8J A;  1RQM A;  1SL0 B;  3CTG A;  4F0C A;  3ZL5 A;  5F06 A;  2LST A;  3E3E A;  4NWY A;  4XS4 B;  4HZ4 A;  3GMF A;  2GST A; 
#chains in the Genus database with same CATH topology
 1ZZY A;  3WT1 A;  5IOX A;  1OKT A;  2PN8 A;  1MD3 A;  4IVF A;  3C7M A;  2N5B A;  1SKR B;  5JWR B;  2A2R A;  5A1N B;  4JR6 A;  4EIP A;  1EOG A;  3QD9 A;  4O5Q A;  3BD2 A;  3ZTL A;  5GAP D;  2GVP A;  3GL3 A;  2JZS A;  2OA7 A;  4KH7 A;  2IWT A;  1O8X A;  1I5G A;  1S3A A;  1SK2 A;  3G7I A;  3UOM A;  1XW5 A;  3KJY A;  4GF0 A;  4IJ3 A;  4Q5Q A;  3L4N A;  4MP4 A;  3VK9 A;  1BYE A;  3TGZ A;  1GWC A;  4A5P A;  1O85 A;  1EGO A;  4D73 B;  5A5H A;  2KHP A;  5A34 B;  1X0R A;  2EFH A;  2B5Y A;  5ECN B;  4BIK A;  2K8S A;  1DE1 A;  3ERG A;  2CVK A;  2H6X A;  2EC4 A;  4OFN A;  3TKS C;  4ISD A;  22GS A;  3ME7 A;  1GTA A;  5J40 A;  3GST A;  1KEB A;  1OE8 A;  4Q5F A;  1TTZ A;  5ECS A;  3M0F A;  2MZC A;  5GST A;  4K5S A;  3S9F A;  4EVM A;  4XCS A;  2KLX A;  1XXU A;  3L9S A;  4KDU A;  2ALB A;  3DVX A;  3IDV A;  2B1L A;  3FEU A;  4PUA A;  4IW9 A;  3N5O A;  4NXI A;  5D96 A;  5G5F A;  2IFQ B;  1FG4 A;  1PN0 A;  3VFI A;  1ZYE A;  1SL1 B;  3F6D A;  2YZH A;  2HYX A;  3TKS A;  3CTF A;  2LTK A;  4YQM A;  1ZYP A;  6GSU A;  18GS A;  3IXR A;  2XPD A;  1XG8 A;  2KOK A;  3EC3 A;  1OC9 B;  4GQF A;  4I2U A;  3VWW A;  4GTU A;  1HNB A;  4LA1 A;  4BVY A;  3ZFL A;  5J41 A;  1MEK A;  1ZYQ B;  4BL7 A;  1M99 A;  1Y25 A;  4ZL8 A;  5J4V A;  2I81 A;  1U87 A;  4TKY A;  4GQC A;  5CRE A;  20GS A;  4OMV A;  2E7P A;  4JRR A;  4HU9 A;  4PGT A;  3JCM L;  3H4K A;  1QXH A;  1M2D A;  3HHV A;  4AKG A;  1J9B A;  4MA9 A;  1PD2 1;  1RK4 A;  2HRK B;  1M9A A;  5B7C A;  4EF0 A;  1YY7 A;  2KUC A;  2LJA A;  2UZ8 A;  1FAA A;  4TRX A;  5F8B A;  3LSZ A;  1UC7 A;  1W4V A;  1K0D A;  2NDO A;  1F37 A;  3GKK A;  1SKS B;  3LWA A;  4K1F A;  2CA8 A;  3APS A;  4NAX A;  3VI5 A;  3FZA A;  5D9V A;  7GSS A;  3GV1 A;  4L5L A;  2QSI A;  2F3M A;  2FCH A;  4HZ2 A;  4BVX A;  4N0V A;  1W89 A;  4OD7 A;  4PQ1 A;  2P0G A;  3KZQ A;  5G31 A;  2XHF A;  2PWJ A;  3EU4 A;  1A2M A;  4IGJ A;  3ZLP A;  1WWJ A;  3ZVJ A;  3IAM 2;  2WS2 A;  4JU5 A;  3IK7 A;  2GZP A;  1MDJ A;  2MMA A;  2YZU A;  2WUL A;  3DWV A;  1BF5 A;  4HI7 A;  4KDY A;  2DJ3 A;  4PX1 A;  3VUR A;  2JAC A;  2O5V A;  4JBB A;  4POM A;  5IMF A;  4P3Y B;  1XW9 A;  5CP1 A;  4E8E A;  4AJ7 A;  1Z5Y E;  2YWI A;  3LW9 A;  3ZIT A;  4AJ6 A;  2QKE A;  3HKR A;  5J47 A;  4PNG A;  4K5R A;  1PFO A;  3BOA A;  2GQK A;  5HQP A;  2R2J A;  2DJ0 A;  2HFD A;  2H1L A;  1S3D A;  2VUP A;  3LYP A;  3ISO A;  4YKF A;  1FOH A;  2M72 A;  1BQ7 A;  3GUS A;  5ECH B;  4JED A;  2C1Y A;  3GX8 A;  1TK8 B;  5CYY A;  3IC8 A;  1OKD A;  4MLY A;  3IV4 A;  2YOI A;  8GSS A;  4O92 A;  1PQN A;  2WJU A;  4HEA 2;  3UAP A;  1M9B A;  2DKH A;  3D5J A;  1GLP A;  1PKZ A;  4EXJ A;  5AN1 A;  2JZT A;  2NTO A;  2DML A;  2TIR A;  4TN8 A;  4YQU A;  2EFC A;  4KND A;  1QMV A;  1WP0 A;  3KCM A;  2DLX A;  3LFL A;  5ELA A;  5IMZ A;  2H75 A;  2FWE A;  6GST A;  1DSB A;  3G7J A;  2O3E A;  4KSO A;  4K2D A;  2DJ2 A;  2PU9 C;  2GZY A;  2DJJ A;  4K7N A;  3IC4 A;  2X49 A;  4WR5 A;  3CMI A;  5CRW A;  3C8E A;  4AGS A;  1GUH A;  1XWK A;  3WGE A;  3BCK A;  1ZL9 A;  5DAL B;  1TDI A;  2R3X A;  2F9S A;  3UL3 A;  1CQG A;  2IMK A;  4RUV A;  2YWM A;  3NOF A;  2G2Q A;  5G1K A;  5KOX A;  3FR3 A;  1ERV A;  2OKA A;  2C0D A;  2YWN A;  2LNS A;  5J9B A;  1V57 A;  3EYT A;  2JAD A;  3MYD A;  4F0B A;  3GL5 A;  2QA1 A;  2LRN A;  4ECI A;  4OFM A;  2WDU A;  4FH8 A;  4XS1 A;  3GSS A;  1GP1 A;  3WGX A;  5L71 A;  4OCF A;  3ERF A;  2I9H A;  1XW6 A;  5J4U A;  1ERT A;  3GH6 A;  4WBR D;  3IRA A;  2L5O A;  4N11 A;  2RUE A;  1HNA A;  4ZBB A;  2IPA A;  1UN2 A;  4RI7 A;  5HFG A;  3TKP A;  5DQY A;  2LQO A;  1TU7 A;  1PMT A;  4LMW A;  3M9K A;  1TK5 B;  3UAR A;  2CZ3 A;  4G01 A;  4D73 A;  4TXV A;  2GTU A;  4E8H A;  5A34 A;  3LEF A;  2MYG A;  3W6G A;  4ECB A;  2XBI A;  4WBJ A;  5FHI A;  3M9J A;  2WZ9 A;  1AW9 A;  3KD0 A;  1X5E A;  4Q5R A;  1ZOF A;  3WD6 A;  2HQT A;  4NV5 A;  5HFK A;  4V2M A;  2AYT A;  2I4A A;  3M3M A;  4WF5 A;  3FW2 A;  2HZE A;  2X8C A;  3KMN A;  3DD3 A;  2DSA A;  4TXO B;  3ZIV A;  5D93 A;  2R0G A;  1LBK A;  2C3T A;  2Z9S A;  1A2J A;  1TK0 B;  1TXX A;  2NVL A;  5AIX A;  2WZS A;  3ZVJ D;  1M0U A;  1VGL A;  1YF1 A;  10GS A;  3GTU B;  4K2X A;  3CBU A;  1GUK A;  2RM6 A;  4IN0 A;  4EIQ A;  3PIN A;  4HU7 A;  4G0L A;  5J3R A;  2MMN A;  1A8Y A;  3A5W A;  3CQF A;  1F6M C;  5DBQ A;  4HDE A;  3VWX A;  1KTE A;  2P5R A;  2AHE A;  1B4Q A;  1XFL A;  3DEX A;  1U88 A;  2ZUP A;  4BWS A;  1TRW A;  3KH7 A;  1XCC A;  3EE2 A;  3IHQ A;  4X4J A;  1M7T A;  2X64 A;  2PGT A;  3ZMK A;  2B1K A;  2VCV A;  2H72 A;  1F9M A;  3TRX A;  1ABA A;  5JWO B;  4POB A;  4IEL A;  2O87 A;  5IPH A;  1EV4 A;  2H1G A;  1SYR A;  5AIV A;  3GA4 A;  1K3Y A;  2YP6 A;  2J9H A;  6GSY A;  2YV7 A;  4PHZ C;  1M3J A;  3RPP A;  2PPT A;  5DAK B;  5JCW A;  3AY8 A;  2O89 A;  3UEM A;  3HDC A;  4XRD A;  4MAB A;  2WW2 A;  2FUG 2;  4I2T A;  1E2Y A;  3RHB A;  1PRX A;  2H30 A;  5EY6 A;  4EL1 A;  4GDF A;  1SJZ A;  1T4Y A;  5F05 A;  1AQX A;  1K0N A;  4MK3 A;  3C1S A;  4WET A;  4X1U A;  2HSY A;  3W8J A;  6GSV A;  2VCX A;  3UMA A;  1G6W A;  1JZW A;  3QFA C;  2V32 A;  3MAK A;  5ID2 B;  4YAP A;  3ZZX A;  5G1L A;  3WYW A;  4XIH A;  4QMK A;  3C1R A;  1KNG A;  2WVZ A;  1SEN A;  2O8V B;  2VCW A;  1THO A;  4CHS A;  4Q5N A;  1SD9 A;  1AAZ A;  1SJ6 A;  2FA4 A;  2IMF A;  1TJD A;  4G2E A;  4YQV A;  4MJB A;  2GDR A;  3FZ9 A;  1ZGN A;  4AF2 A;  2H19 A;  3D6I A;  3TB2 A;  1YF0 A;  3H8Q A;  1H4O A;  5E59 A;  4FIW A;  2H70 A;  3GH9 A;  3RFR C;  4TVE A;  3QCP A;  5D9X A;  3DKS A;  1SVM A;  1B48 A;  1AQV A;  4MPG A;  2A4H A;  1R5A A;  1PN9 A;  4GCI A;  1X5C A;  2AUV A;  3LGC A;  2I3Y A;  3F6F A;  4QL7 A;  1Z9H A;  4ML6 A;  2VLT A;  2VD1 A;  3LQ7 A;  5KN2 A;  1T8E B;  1MD4 A;  1M2A A;  3KEB A;  3TJG A;  4X43 A;  2G0F A;  5GSS A;  4ZIJ A;  2DJ1 A;  3F4S A;  3VPT A;  5GZZ B;  3V1W A;  2YPM A;  1ZCP A;  1SJI A;  4E68 A;  2V41 A;  3HZ4 A;  4ACS A;  1GSS A;  3VWV A;  3L0H A;  3HD5 A;  2O85 A;  1A2L A;  2LUS A;  3RGB C;  3W8S A;  1A0F A;  2K6V A;  5B8A A;  3Q18 A;  3H79 A;  2KP2 A;  1X9M B;  2B5E A;  4MH2 A;  1OC3 A;  4HSC X;  4AJ8 A;  2HNL A;  1URM A;  1JLW A;  2GGT A;  6GSS A;  5CAX A;  2GSR A;  2HRF A;  3RDW A;  3MNG A;  2OE3 A;  2C4J A;  2R6K A;  3FYG A;  3ERW A;  3QPM A;  1K3O A;  1YEW C;  3QAV A;  3FHK A;  1ST9 A;  5E4W A;  2OE0 A;  4USS A;  4TR1 B;  2BMX A;  3ZFB A;  2MBT A;  4ZB8 A;  3HVS A;  2OBK A;  2VKZ G;  1IYH A;  4IHU A;  3E9J B;  3EMX A;  3OR5 A;  2HSN B;  1VF2 A;  2C0E A;  2V6K A;  4J57 E;  5ECK B;  1SD8 A;  3U6V A;  3APQ A;  4ULX A;  2QGV A;  1AUC A;  4MJC A;  3LXT A;  3F9U A;  2AB6 A;  1EP8 A;  1TI1 A;  2RLI A;  2IL3 A;  1FVJ A;  4PUR A;  1V2A A;  3LOR A;  1EWX A;  4GST A;  4O7H A;  4GLT A;  5CNW A;  4XRA A;  3FR6 A;  3TJK A;  4IP6 A;  2KP1 A;  1YQ1 A;  3FMW A;  4EC0 A;  1SK0 A;  1XPV A;  1XOB A;  5ECI B;  4PUF C;  2PVQ A;  3IPZ A;  1JFU A;  5CRD A;  3P2A A;  1BG5 A;  3Q6O A;  1MDK A;  4FQU A;  1EV9 A;  1YEX A;  1B4P A;  4MCU A;  2L5L A;  1JZD A;  1GSD A;  2MMZ A;  5BMU A;  1WPI A;  2P5Q A;  2K18 A;  3HVV A;  4MZC A;  3FK8 A;  2VCT A;  1T4Z A;  1X9S B;  1ZYN A;  2PVO C;  2ES7 A;  4W66 A;  4Z2U A;  1R26 A;  5KN0 A;  2UV8 G;  4Z7X A;  3EPT A;  2JL4 A;  3RPN A;  2AAW A;  3KMO A;  4K9Z A;  1C72 A;  3ZRE A;  1A0R P;  1Z3E A;  2L57 A;  2REM A;  3GNJ A;  1WMJ A;  2GT5 A;  2E2M A;  1V98 A;  1B9X C;  1VRS D;  4K8M A;  2LRT A;  4IS0 A;  2QC7 A;  4PI0 C;  3GTU A;  2RUF A;  4EUY A;  4KB3 A;  5DVB A;  5ABR A;  2GQM A;  5A4U A;  2X99 A;  5IMD A;  1XVW A;  2IMD A;  1PL2 A;  5LD0 A;  11GS A;  2YJH A;  5DJM A;  4KGI A;  2IN3 A;  4ECJ A;  2YN1 A;  5IO2 A;  3BBY A;  1THX A;  4F9Z A;  2ZNM A;  5IQY A;  1B8X A;  16GS A;  4POK A;  4FXY P;  4KW6 A;  3M8N A;  4V1A p;  4X0X A;  1TXU A;  1AXD A;  4MF5 A;  1Z6M A;  2WRT A;  3IA1 A;  1TW9 A;  2WVY A;  2IIY A;  3R2Q A;  1WE0 A;  2YWO A;  2AJQ B;  1SYX A;  4KA0 A;  5D9T A;  5KN3 A;  1TKD B;  4IQ1 A;  3C71 A;  4GXZ A;  4K0N A;  3L9V A;  4GRF A;  2B5X A;  4XS4 A;  4BVY B;  1FVK A;  1XWB A;  4DSR A;  4OFT A;  1M3I A;  1K0C A;  2R37 A;  4BL7 B;  1O81 A;  1AQW A;  3CWG A;  3QR6 A;  2EFD A;  5HR0 A;  4NPB A;  13GS A;  3A2W A;  4CY8 A;  3ZIJ A;  2RM5 A;  2OBI A;  5A4W A;  3DYR A;  4FYB A;  5A1N A;  1GLQ A;  5H5S A;  4F2I A;  3NIV A;  3UJ1 A;  4G0I A;  4TR0 A;  1GSE A;  3TKS E;  3DVW A;  3LG6 A;  5ELG A;  2C0G A;  4ILF A;  1PSQ A;  2B3S A;  2FHE A;  4KDX A;  2VO4 A;  3HVN A;  4EDY A;  4BA7 A;  4LLR A;  4MNN A;  2E2G A;  4PTS A;  5A4V A;  2C3Q A;  1OE7 A;  1GRX A;  1I1I P;  1OAZ A;  2X8H A;  2DJK A;  5DCH A;  1USB A;  4AKI A;  1LU4 A;  4V1A g;  1N25 A;  1FB6 A;  2E0Q A;  1OC8 A;  4L8E A;  3IBH A;  3IHG A;  2LNT A;  2CAI A;  1HYU A;  1V58 A;  4ZB6 A;  2L6C A;  4DSS B;  1GSF A;  3I69 A;  5ECR B;  2ON5 A;  3A3T A;  3D21 A;  2WFC A;  2HI7 A;  3MWH A;  1I9D A;  2HE3 A;  3HCZ A;  1XVQ A;  4OO4 A;  4JE1 A;  3WT2 A;  2HSH A;  5ECQ B;  4N0Z A;  4HQS A;  5DCG A;  3GFK A;  4G0K A;  4K0G A;  1SK1 A;  4RQX A;  2L4C A;  2H8L A;  2XC2 A;  17GS A;  1YEP A;  4AKH A;  2DC5 A;  4RQR A;  3GX0 A;  5D73 A;  5IOW A;  1BX9 A;  1PL1 A;  1QUW A;  2LJR A;  2IFQ A;  2FA8 A;  1FW1 A;  4NMU A;  1Y6E A;  1GNE A;  2FWG A;  4Z2R A;  2MBS A;  2CZ2 A;  1EGR A;  3SBC A;  5C00 A;  5J4Y A;  4ML1 A;  1G6Y A;  1MDI A;  4F82 A;  2D2Z A;  1ILO A;  3O76 A;  1O73 A;  2FNO A;  4XS6 A;  4ZL7 A;  4DSQ A;  3APO A;  3A5I A;  2QA2 A;  2WCI A;  1BG1 A;  2HZF A;  2L6D A;  1A8L A;  3F3R A;  2GSS A;  1OC9 A;  2L59 A;  4ZBD A;  2GQL A;  4H86 A;  2B7J A;  3O6T A;  1GSU A;  4MF7 A;  2VM1 A;  2CQ9 A;  2M46 A;  1FOV A;  2VIM A;  2N5F A;  2MMO A;  2LS5 A;  3EIN A;  2J23 A;  5ECP B;  2HSN A;  2VLU A;  2WVX B;  5LCZ A;  1NSW A;  2K8V A;  5D8I A;  2OT3 A;  2FD3 A;  3MIX A;  2HRK A;  3A2X A;  1PKW A;  2R4V A;  3TCO A;  2H74 A;  1IYI A;  4AI6 A;  4GSS A;  3IK9 A;  3UIW A;  3VLN A;  4KE3 A;  5ECM B;  2H73 A;  4MH3 A;  1NM3 A;  4K6X A;  2FWF A;  2GZZ A;  1WJK A;  1T1V A;  3J7Y k;  2V2G A;  4CDO A;  3CYN A;  1AC1 A;  4V2L A;  2CV4 A;  4PQI A;  1ACV A;  12GS A;  2HSM B;  3TOT A;  1NHY A;  4PXO A;  3F4T A;  4GWR A;  3TRQ A;  1Z7R A;  1GUM A;  2WW0 A;  3DRN A;  1K3L A;  3RHC A;  3F8U A;  4KAE A;  4YKG A;  3GIX A;  5JCU A;  4MZW A;  3H93 A;  3KH9 A;  4ZIL A;  3WGD A;  5H5Q A;  5FT3 A;  4L5O A;  4PQH A;  1S4B P;  4KSM A;  2H71 A;  4JZQ A;  3IAS 2;  3CSJ A;  5DDL A;  4G19 A;  2F8F A;  4MJE A;  1GL8 A;  3EU3 A;  9GSS A;  1TRV A;  4TW5 A;  5DQS A;  3J7Y b;  4EE0 A;  3TUE A;  3TRP A;  3F63 A;  5KEJ A;  2GS3 A;  3D4T A;  4LL1 B;  4IJI A;  1EEM A;  5CO3 A;  2CX4 A;  4Z2T A;  3BJ5 A;  3TKQ A;  1Q4J A;  1V9W A;  2N5A A;  3ZYW A;  1SKW B;  3GKM A;  2HLS A;  1R7H A;  1QK8 A;  1QFN A;  1QQ2 A;  2AV4 A;  1ML6 A;  1SVL A;  5IO0 A;  2HRN A;  3GKX A;  3HVX A;  1FHE A;  4ZL9 A;  1V40 A;  3A2V A;  4ECC A;  2OAC A;  2M80 A;  3KXO A;  1TRS A;  2HZE B;  5HR3 A;  1GSQ A;  1DBY A;  3HXS A;  3TJF A;  1X5D A;  3D22 A;  1XBS A;  2VM2 A;  1GUL A;  3NZN A;  3US3 A;  3FZ5 A;  1GTB A;  1SU9 A;  1R5P A;  1ZMA A;  4K7O A;  5HR2 A;  2DMM A;  1O8W A;  2YNX A;  1A23 A;  3QFB C;  4HJ2 A;  5IM9 A;  2BJX A;  2XBQ A;  3L78 A;  3EUR A;  5INY A;  4KCE A;  4GSN A;  1PX6 A;  3VWU A;  19GS A;  5CRH A;  3HJM A;  1S3C A;  3I9V 2;  4V2N A;  5J5N A;  1LJR A;  4YH2 A;  3Q19 A;  1VF1 A;  2H0G A;  4PNF A;  1EP7 A;  1K0O A;  2H6Y A;  4XTS A;  2PER A;  3Q74 A;  1GTU A;  1YKA A;  6GSX A;  2YAN A;  4OCE A;  1JZO A;  4EO3 A;  4WKW A;  1O7U A;  3QAG A;  3TU3 B;  1Z6N A;  3HJP A;  4O32 A;  2RII A;  3GRX A;  1CQH A;  5DAL A;  4LMV A;  2WW3 A;  4EDZ A;  2A4V A;  3SWL A;  1TOF A;  3KGK A;  5GAN D;  2JSZ A;  4WXT A;  3QOU A;  3P8W A;  4J56 E;  1EEJ A;  1XZO A;  1PX7 A;  5IIZ A;  5AIS A;  2IME A;  1U3A A;  4N3Z A;  4IKH A;  3FKF A;  1R4W A;  4WEY A;  2DIZ A;  4FYC A;  4RI6 A;  3CSI A;  1A24 A;  3N9J A;  3KP8 A;  1ERW A;  3GYK A;  2V1M A;  2A2P A;  3QDN A;  1AIU A;  4HOJ A;  2VAF A;  2X8G A;  3CRT A;  5G2Z A;  4DVC A;  5B6M A;  6GSW A;  2CAQ A;  2JSY A;  1OYJ A;  2ON7 A;  3UVH A;  2PMT A;  3DML A;  4FYU A;  4IP1 A;  2C8U A;  1XWG A;  5F0G A;  5DJL A;  2JU5 A;  2NBS A;  5IMC A;  2R5G A;  1G7E A;  2JZR A;  1YJ6 A;  2LEG A;  2XPE A;  1E6B A;  2VD0 A;  5B8B A;  1F3B A;  1GTI A;  1N2A A;  1T7P B;  3MDK A;  3FY7 A;  1G0T A;  4PI2 C;  2PUK C;  2R0C A;  4QQ7 A;  4MF6 A;  3R3E A;  3I6A A;  4L0U A;  3EMP A;  5JCG A;  3GKN A;  3HMJ G;  2LV3 A;  4O5U A;  2TRX A;  2ZCT A;  2H1B A;  4BPY A;  4DSS A;  2GLR A;  3F0I A;  4WF4 A;  2B7K A;  3ED3 A;  1JLV A;  2FGX A;  1YVL A;  1WOU A;  3M1G A;  1GNW A;  2GT6 A;  3DIE A;  3P7X A;  4TXO A;  2V6O A;  5EL8 A;  5A5H B;  2HXK A;  5FWG A;  1FO5 A;  5EPF A;  3LYK A;  4NV2 A;  1YZX A;  2C0F A;  2CVB A;  2H76 A;  1J08 A;  5KN1 A;  3FRC A;  1XOA A;  2WGR A;  4IQA A;  1Y1U A;  1Q98 A;  3UVT A;  2CT6 A;  3HY2 A;  5H5R A;  1T00 A;  1GSY A;  1PGT A;  5JWQ B;  2YV9 A;  1TI3 A;  4ZXG A;  2PBJ A;  2FLS A;  1OVN A;  2VLV A;  3LXZ A;  5IMV A;  1O6J A;  4J2F A;  5C04 A;  1XIY A;  3DGQ A;  3KTL A;  2VOC A;  4I97 A;  3FZ4 A;  4MMM A;  4ZBA A;  2DIY A;  3CHX C;  4ZB7 A;  4KUN A;  4TR3 A;  2F8A A;  3HJO A;  4IBP A;  1F3A A;  1SVO A;  2C3N A;  5KOW A;  1TP9 A;  2HRA A;  5D9W A;  3PGT A;  3QAW A;  3H1N A;  4CW9 A;  2BTO T;  2WVX A;  2CX3 A;  4XHM A;  5ENU A;  3TOU A;  4L0W A;  3FR9 A;  2YJ7 A;  2VCQ A;  1DE2 A;  1M2B A;  1TRU A;  4O5R A;  1KBN A;  1WRY A;  5DAK A;  1G7O A;  4I8B A;  1Z7P A;  5EVO A;  5B6N A;  2CVD A;  4MDC A;  3EWL A;  1UA5 A;  3TJJ A;  3F3Q A;  5LNK e;  3VI7 A;  4ID0 A;  4ZB9 A;  2OAD A;  5BRT A;  3ZML A;  1YKC A;  4DEJ A;  5AGY A;  3IOS A;  1VF3 A;  1U6T A;  2VL3 A;  1BAY A;  2HT9 A;  1ON4 A;  3UBK A;  1K0B A;  2I1U A;  5HFI A;  4BWQ A;  4YAV A;  3IE3 A;  3GHA A;  3HZ8 A;  2H6Z A;  3ZRD A;  3KM6 A;  2EIR A;  2HSM A;  5ID2 A;  3TDG A;  4TR4 A;  3GUR A;  2LJK A;  5G30 A;  2R0P A;  2WW1 A;  3IR4 A;  4TOP A;  2H1A A;  2H66 A;  1TU8 A;  1F2E A;  3KP9 A;  3CXG A;  1JZR A;  4HJM A;  2A2S A;  3KIJ A;  4KF9 A;  1B9Y C;  3CSH A;  1XWC A;  4JR4 A;  3I43 A;  4OO5 A;  14GS A;  2IMI A;  2H0I A;  3PH9 A;  3D0Z A;  4I6X A;  2GSQ A;  2LQQ A;  4BVX B;  2X4A A;  1ERU A;  2O7K A;  3LJR A;  2IJY A;  4N30 A;  3HYP A;  3MSZ A;  5COH A;  3PR8 A;  2DKI A;  3HA9 A;  1S3R A;  3RBT A;  1J0F A;  3EVI A;  1QGV A;  5A5K A;  5ECO B;  4MPF A;  3U5R E;  3O3T A;  5BMU B;  3G7Y A;  2WB9 A;  2TRC P;  1NHO A;  2VL2 C;  1K0A A;  5HR1 A;  3D4M A;  1XWA A;  5J9C A;  4WR4 A;  1HD2 A;  3PPU A;  4F03 A;  2H1D A;  3K8N A;  2H01 A;  4G10 A;  3QMX A;  1EOH A;  1PA3 A;  2O36 A;  2K9F A;  1T3B A;  1X9W B;  1JHB A;  3RAZ A;  1DUG A;  4KCA A;  1SL2 B;  1BJX A;  3DXB A;  4NHZ A;  3CRU A;  3P90 A;  3C73 A;  3ME8 A;  5IPG A;  4HS1 A;  4MJA A;  4K7I A;  2VL9 A;  1RW1 A;  1UVZ A;  5CRG A;  1HQO A;  2EIQ A;  4QL9 A;  2B6M A;  2L4Q A;  1VF4 A;  2DBC A;  2LKU A;  2VL2 A;  2FWH A;  3VPQ A;  1U3I A;  4POL A;  4FO5 A;  1NW2 A;  3G9B A;  1BED A;  2OE1 A;  2YCD A;  2VCZ A;  1HNC A;  2NPB A;  4HQZ A;  3TJB A;  4TR1 A;  1EZK A;  3F4R A;  3E0U A;  2P31 A;  2OJL A;  1H75 A;  2LRC A;  4ICY A;  1WIK A;  4OWY A;  4N10 A;  2C80 A;  2FY6 A;  3BCI A;  4G9H A;  3GN3 A;  4NHW A;  4AKX B;  4I5Q A;  1YDK A;  4CY6 A;  5ECL B;  1MTC A;  4KX4 A;  1GH2 A;  3TKR A;  4LL4 B;  1K0M A;  3L9U A;  2F51 A;  4MZB A;  2H0H A;  5F07 A;  3UBL A;  2EIO A;  3KTB A;  5G5E A;  4HUA A;  4EKZ A;  5IMA A;  1FB0 A;  1N8J A;  1RQM A;  2EFE A;  1SL0 B;  3CTG A;  4F0C A;  3ZL5 A;  5F06 A;  2LST A;  3E3E A;  4NWY A;  4XS4 B;  4HZ4 A;  3GMF A;  2GST A; 
#chains in the Genus database with same CATH homology
 1ZZY A;  3WT1 A;  5IOX A;  1OKT A;  2PN8 A;  1MD3 A;  4IVF A;  3C7M A;  2N5B A;  1SKR B;  5JWR B;  2A2R A;  5A1N B;  4JR6 A;  4EIP A;  1EOG A;  3QD9 A;  4O5Q A;  3BD2 A;  3ZTL A;  5GAP D;  2GVP A;  3GL3 A;  2JZS A;  2OA7 A;  4KH7 A;  2IWT A;  1O8X A;  1I5G A;  1S3A A;  1SK2 A;  3G7I A;  3UOM A;  1XW5 A;  3KJY A;  4GF0 A;  4IJ3 A;  4Q5Q A;  3L4N A;  4MP4 A;  3VK9 A;  1BYE A;  3TGZ A;  1GWC A;  4A5P A;  1O85 A;  1EGO A;  4D73 B;  5A5H A;  2KHP A;  5A34 B;  1X0R A;  2EFH A;  2B5Y A;  5ECN B;  2K8S A;  1DE1 A;  3ERG A;  2CVK A;  2H6X A;  2EC4 A;  4OFN A;  3TKS C;  4ISD A;  22GS A;  3ME7 A;  1GTA A;  5J40 A;  3GST A;  1KEB A;  1OE8 A;  4Q5F A;  1TTZ A;  5ECS A;  3M0F A;  2MZC A;  5GST A;  4K5S A;  3S9F A;  4EVM A;  4XCS A;  2KLX A;  1XXU A;  3L9S A;  4KDU A;  2ALB A;  3DVX A;  3IDV A;  2B1L A;  3FEU A;  4PUA A;  4IW9 A;  3N5O A;  4NXI A;  5D96 A;  5G5F A;  2IFQ B;  1FG4 A;  1PN0 A;  3VFI A;  1ZYE A;  1SL1 B;  3F6D A;  2YZH A;  2HYX A;  3TKS A;  3CTF A;  2LTK A;  4YQM A;  1ZYP A;  6GSU A;  18GS A;  3IXR A;  2XPD A;  2KOK A;  3EC3 A;  1OC9 B;  4GQF A;  4I2U A;  3VWW A;  4GTU A;  1HNB A;  4LA1 A;  4BVY A;  3ZFL A;  5J41 A;  1MEK A;  1ZYQ B;  4BL7 A;  1M99 A;  1Y25 A;  4ZL8 A;  5J4V A;  2I81 A;  1U87 A;  4TKY A;  4GQC A;  5CRE A;  20GS A;  4OMV A;  2E7P A;  4JRR A;  4HU9 A;  4PGT A;  3JCM L;  3H4K A;  1QXH A;  1M2D A;  3HHV A;  4AKG A;  1J9B A;  4MA9 A;  1PD2 1;  1RK4 A;  2HRK B;  1M9A A;  5B7C A;  4EF0 A;  1YY7 A;  2KUC A;  2LJA A;  2UZ8 A;  1FAA A;  4TRX A;  5F8B A;  3LSZ A;  1UC7 A;  1W4V A;  1K0D A;  2NDO A;  1F37 A;  3GKK A;  1SKS B;  3LWA A;  4K1F A;  2CA8 A;  3APS A;  4NAX A;  3VI5 A;  3FZA A;  5D9V A;  7GSS A;  3GV1 A;  4L5L A;  2QSI A;  2F3M A;  2FCH A;  4HZ2 A;  4BVX A;  4N0V A;  1W89 A;  4OD7 A;  4PQ1 A;  2P0G A;  3KZQ A;  5G31 A;  2XHF A;  2PWJ A;  3EU4 A;  1A2M A;  4IGJ A;  3ZLP A;  1WWJ A;  3ZVJ A;  3IAM 2;  2WS2 A;  4JU5 A;  3IK7 A;  2GZP A;  1MDJ A;  2MMA A;  2YZU A;  2WUL A;  3DWV A;  1BF5 A;  4HI7 A;  4KDY A;  2DJ3 A;  4PX1 A;  3VUR A;  2JAC A;  2O5V A;  4JBB A;  4POM A;  5IMF A;  4P3Y B;  1XW9 A;  5CP1 A;  4E8E A;  4AJ7 A;  1Z5Y E;  2YWI A;  3LW9 A;  3ZIT A;  4AJ6 A;  2QKE A;  3HKR A;  5J47 A;  4PNG A;  4K5R A;  3BOA A;  2GQK A;  5HQP A;  2R2J A;  2DJ0 A;  2HFD A;  2H1L A;  1S3D A;  2VUP A;  3LYP A;  3ISO A;  4YKF A;  1FOH A;  2M72 A;  1BQ7 A;  3GUS A;  5ECH B;  4JED A;  2C1Y A;  3GX8 A;  1TK8 B;  5CYY A;  3IC8 A;  1OKD A;  4MLY A;  3IV4 A;  2YOI A;  8GSS A;  4O92 A;  1PQN A;  2WJU A;  4HEA 2;  3UAP A;  1M9B A;  2DKH A;  3D5J A;  1GLP A;  1PKZ A;  4EXJ A;  5AN1 A;  2JZT A;  2NTO A;  2DML A;  2TIR A;  4TN8 A;  4YQU A;  2EFC A;  4KND A;  1QMV A;  1WP0 A;  3KCM A;  2DLX A;  3LFL A;  5ELA A;  5IMZ A;  2H75 A;  2FWE A;  6GST A;  1DSB A;  3G7J A;  4KSO A;  4K2D A;  2DJ2 A;  2PU9 C;  2GZY A;  2DJJ A;  4K7N A;  3IC4 A;  2X49 A;  4WR5 A;  3CMI A;  5CRW A;  3C8E A;  4AGS A;  1GUH A;  1XWK A;  3WGE A;  3BCK A;  1ZL9 A;  5DAL B;  1TDI A;  2R3X A;  2F9S A;  3UL3 A;  1CQG A;  2IMK A;  4RUV A;  2YWM A;  3NOF A;  2G2Q A;  5G1K A;  5KOX A;  3FR3 A;  1ERV A;  2OKA A;  2C0D A;  2YWN A;  2LNS A;  5J9B A;  1V57 A;  3EYT A;  2JAD A;  3MYD A;  4F0B A;  3GL5 A;  2QA1 A;  2LRN A;  4ECI A;  4OFM A;  2WDU A;  4FH8 A;  4XS1 A;  3GSS A;  1GP1 A;  3WGX A;  5L71 A;  4OCF A;  3ERF A;  2I9H A;  1XW6 A;  5J4U A;  1ERT A;  3GH6 A;  4WBR D;  3IRA A;  2L5O A;  4N11 A;  2RUE A;  1HNA A;  4ZBB A;  2IPA A;  1UN2 A;  4RI7 A;  5HFG A;  3TKP A;  5DQY A;  2LQO A;  1TU7 A;  1PMT A;  4LMW A;  3M9K A;  1TK5 B;  3UAR A;  2CZ3 A;  4G01 A;  4D73 A;  4TXV A;  2GTU A;  4E8H A;  5A34 A;  3LEF A;  2MYG A;  3W6G A;  4ECB A;  2XBI A;  4WBJ A;  5FHI A;  3M9J A;  2WZ9 A;  1AW9 A;  3KD0 A;  1X5E A;  4Q5R A;  1ZOF A;  3WD6 A;  2HQT A;  4NV5 A;  5HFK A;  4V2M A;  2AYT A;  2I4A A;  3M3M A;  4WF5 A;  3FW2 A;  2HZE A;  2X8C A;  3KMN A;  3DD3 A;  2DSA A;  4TXO B;  3ZIV A;  5D93 A;  2R0G A;  1LBK A;  2C3T A;  2Z9S A;  1A2J A;  1TK0 B;  1TXX A;  2NVL A;  5AIX A;  3ZVJ D;  1M0U A;  1VGL A;  1YF1 A;  10GS A;  3GTU B;  4K2X A;  3CBU A;  1GUK A;  2RM6 A;  4IN0 A;  4EIQ A;  3PIN A;  4HU7 A;  4G0L A;  5J3R A;  2MMN A;  1A8Y A;  3A5W A;  1F6M C;  5DBQ A;  4HDE A;  3VWX A;  1KTE A;  2P5R A;  2AHE A;  1B4Q A;  1XFL A;  3DEX A;  1U88 A;  2ZUP A;  4BWS A;  1TRW A;  3KH7 A;  1XCC A;  3EE2 A;  3IHQ A;  4X4J A;  1M7T A;  2X64 A;  2PGT A;  3ZMK A;  2B1K A;  2VCV A;  2H72 A;  1F9M A;  3TRX A;  1ABA A;  5JWO B;  4POB A;  4IEL A;  2O87 A;  5IPH A;  1EV4 A;  2H1G A;  1SYR A;  5AIV A;  3GA4 A;  1K3Y A;  2YP6 A;  2J9H A;  6GSY A;  2YV7 A;  3RPP A;  2PPT A;  5DAK B;  5JCW A;  3AY8 A;  2O89 A;  3UEM A;  3HDC A;  4XRD A;  4MAB A;  2FUG 2;  4I2T A;  1E2Y A;  3RHB A;  1PRX A;  2H30 A;  5EY6 A;  4EL1 A;  4GDF A;  1SJZ A;  1T4Y A;  5F05 A;  1AQX A;  1K0N A;  4MK3 A;  3C1S A;  4WET A;  4X1U A;  2HSY A;  3W8J A;  6GSV A;  2VCX A;  3UMA A;  1G6W A;  1JZW A;  3QFA C;  2V32 A;  3MAK A;  5ID2 B;  4YAP A;  3ZZX A;  5G1L A;  3WYW A;  4XIH A;  4QMK A;  3C1R A;  1KNG A;  1SEN A;  2O8V B;  2VCW A;  1THO A;  4CHS A;  4Q5N A;  1SD9 A;  1AAZ A;  1SJ6 A;  2FA4 A;  2IMF A;  1TJD A;  4G2E A;  4YQV A;  4MJB A;  2GDR A;  3FZ9 A;  1ZGN A;  4AF2 A;  2H19 A;  3D6I A;  3TB2 A;  1YF0 A;  3H8Q A;  1H4O A;  5E59 A;  4FIW A;  2H70 A;  3GH9 A;  4TVE A;  3QCP A;  5D9X A;  3DKS A;  1SVM A;  1B48 A;  1AQV A;  4MPG A;  2A4H A;  1R5A A;  1PN9 A;  4GCI A;  1X5C A;  2AUV A;  3LGC A;  2I3Y A;  3F6F A;  4QL7 A;  1Z9H A;  4ML6 A;  2VLT A;  2VD1 A;  3LQ7 A;  5KN2 A;  1T8E B;  1MD4 A;  1M2A A;  3KEB A;  3TJG A;  4X43 A;  2G0F A;  5GSS A;  4ZIJ A;  2DJ1 A;  3F4S A;  3VPT A;  5GZZ B;  3V1W A;  2YPM A;  1ZCP A;  1SJI A;  4E68 A;  2V41 A;  3HZ4 A;  4ACS A;  1GSS A;  3VWV A;  3L0H A;  3HD5 A;  2O85 A;  1A2L A;  2LUS A;  3W8S A;  1A0F A;  2K6V A;  5B8A A;  3Q18 A;  3H79 A;  2KP2 A;  1X9M B;  2B5E A;  4MH2 A;  1OC3 A;  4AJ8 A;  2HNL A;  1URM A;  1JLW A;  2GGT A;  6GSS A;  5CAX A;  2GSR A;  2HRF A;  3RDW A;  3MNG A;  2OE3 A;  2C4J A;  2R6K A;  3FYG A;  3ERW A;  3QPM A;  1K3O A;  3QAV A;  3FHK A;  1ST9 A;  5E4W A;  2OE0 A;  4USS A;  4TR1 B;  2BMX A;  3ZFB A;  2MBT A;  4ZB8 A;  3HVS A;  2OBK A;  2VKZ G;  1IYH A;  4IHU A;  3E9J B;  3EMX A;  3OR5 A;  2HSN B;  1VF2 A;  2C0E A;  2V6K A;  4J57 E;  5ECK B;  1SD8 A;  3U6V A;  3APQ A;  4ULX A;  2QGV A;  1AUC A;  4MJC A;  3LXT A;  3F9U A;  2AB6 A;  1EP8 A;  1TI1 A;  2RLI A;  2IL3 A;  1FVJ A;  4PUR A;  1V2A A;  3LOR A;  1EWX A;  4GST A;  4O7H A;  4GLT A;  5CNW A;  4XRA A;  3FR6 A;  3TJK A;  4IP6 A;  2KP1 A;  1YQ1 A;  3FMW A;  4EC0 A;  1SK0 A;  1XPV A;  1XOB A;  5ECI B;  4PUF C;  2PVQ A;  3IPZ A;  1JFU A;  5CRD A;  3P2A A;  1BG5 A;  3Q6O A;  1MDK A;  4FQU A;  1EV9 A;  1YEX A;  1B4P A;  4MCU A;  2L5L A;  1JZD A;  1GSD A;  2MMZ A;  5BMU A;  1WPI A;  2P5Q A;  2K18 A;  3HVV A;  4MZC A;  3FK8 A;  2VCT A;  1T4Z A;  1X9S B;  1ZYN A;  2PVO C;  2ES7 A;  4W66 A;  4Z2U A;  1R26 A;  5KN0 A;  2UV8 G;  4Z7X A;  3EPT A;  2JL4 A;  3RPN A;  2AAW A;  3KMO A;  4K9Z A;  1C72 A;  3ZRE A;  1A0R P;  1Z3E A;  2L57 A;  2REM A;  3GNJ A;  1WMJ A;  2GT5 A;  2E2M A;  1V98 A;  1B9X C;  1VRS D;  4K8M A;  2LRT A;  4IS0 A;  2QC7 A;  3GTU A;  2RUF A;  4EUY A;  4KB3 A;  5DVB A;  5ABR A;  2GQM A;  5A4U A;  2X99 A;  5IMD A;  1XVW A;  2IMD A;  1PL2 A;  5LD0 A;  11GS A;  2YJH A;  5DJM A;  4KGI A;  2IN3 A;  4ECJ A;  2YN1 A;  5IO2 A;  3BBY A;  1THX A;  4F9Z A;  2ZNM A;  5IQY A;  1B8X A;  16GS A;  4POK A;  4KW6 A;  3M8N A;  4V1A p;  4X0X A;  1TXU A;  1AXD A;  4MF5 A;  1Z6M A;  2WRT A;  3IA1 A;  1TW9 A;  2IIY A;  3R2Q A;  1WE0 A;  2YWO A;  2AJQ B;  1SYX A;  4KA0 A;  5D9T A;  5KN3 A;  1TKD B;  4IQ1 A;  3C71 A;  4GXZ A;  4K0N A;  3L9V A;  4GRF A;  2B5X A;  4XS4 A;  4BVY B;  1FVK A;  1XWB A;  4DSR A;  4OFT A;  2R37 A;  1K0C A;  4BL7 B;  1O81 A;  1AQW A;  3CWG A;  3QR6 A;  2EFD A;  5HR0 A;  4NPB A;  13GS A;  3A2W A;  4CY8 A;  3ZIJ A;  2RM5 A;  2OBI A;  5A4W A;  3DYR A;  4FYB A;  5A1N A;  1GLQ A;  5H5S A;  4F2I A;  3NIV A;  3UJ1 A;  4G0I A;  4TR0 A;  1GSE A;  3TKS E;  3DVW A;  3LG6 A;  5ELG A;  2C0G A;  4ILF A;  1PSQ A;  2B3S A;  2FHE A;  4KDX A;  2VO4 A;  4EDY A;  4BA7 A;  4LLR A;  4MNN A;  2E2G A;  4PTS A;  5A4V A;  2C3Q A;  1OE7 A;  1GRX A;  1OAZ A;  2X8H A;  2DJK A;  5DCH A;  1USB A;  4AKI A;  1LU4 A;  4V1A g;  1N25 A;  1FB6 A;  2E0Q A;  1OC8 A;  4L8E A;  3IBH A;  3IHG A;  2LNT A;  2CAI A;  1HYU A;  1V58 A;  4ZB6 A;  2L6C A;  4DSS B;  1GSF A;  3I69 A;  5ECR B;  2ON5 A;  3A3T A;  3D21 A;  2WFC A;  2HI7 A;  3MWH A;  1I9D A;  2HE3 A;  3HCZ A;  1XVQ A;  4OO4 A;  4JE1 A;  3WT2 A;  2HSH A;  5ECQ B;  4N0Z A;  4HQS A;  5DCG A;  3GFK A;  4G0K A;  4K0G A;  1SK1 A;  4RQX A;  2L4C A;  2H8L A;  2XC2 A;  17GS A;  1YEP A;  4AKH A;  2DC5 A;  4RQR A;  3GX0 A;  5D73 A;  5IOW A;  1BX9 A;  1PL1 A;  1QUW A;  2LJR A;  2IFQ A;  2FA8 A;  1FW1 A;  4NMU A;  1Y6E A;  1GNE A;  2FWG A;  4Z2R A;  2MBS A;  2CZ2 A;  1EGR A;  3SBC A;  5C00 A;  5J4Y A;  4ML1 A;  1G6Y A;  1MDI A;  4F82 A;  2D2Z A;  1ILO A;  3O76 A;  1O73 A;  2FNO A;  4XS6 A;  4ZL7 A;  4DSQ A;  3APO A;  3A5I A;  2QA2 A;  2WCI A;  1BG1 A;  2HZF A;  2L6D A;  1A8L A;  3F3R A;  2GSS A;  1OC9 A;  2L59 A;  4ZBD A;  2GQL A;  4H86 A;  2B7J A;  3O6T A;  1GSU A;  4MF7 A;  2VM1 A;  2CQ9 A;  2M46 A;  1FOV A;  2VIM A;  2N5F A;  2MMO A;  2LS5 A;  3EIN A;  2J23 A;  5ECP B;  2HSN A;  2VLU A;  5LCZ A;  1NSW A;  2K8V A;  5D8I A;  2OT3 A;  2FD3 A;  3MIX A;  2HRK A;  3A2X A;  1PKW A;  2R4V A;  3TCO A;  2H74 A;  1IYI A;  4AI6 A;  4GSS A;  3IK9 A;  3UIW A;  3VLN A;  4KE3 A;  5ECM B;  2H73 A;  4MH3 A;  1NM3 A;  4K6X A;  2FWF A;  2GZZ A;  1WJK A;  1T1V A;  3J7Y k;  2V2G A;  4CDO A;  3CYN A;  1AC1 A;  4V2L A;  2CV4 A;  4PQI A;  1ACV A;  12GS A;  2HSM B;  3TOT A;  1NHY A;  4PXO A;  3F4T A;  4GWR A;  3TRQ A;  1Z7R A;  1GUM A;  3DRN A;  3RHC A;  1K3L A;  3F8U A;  4KAE A;  4YKG A;  3GIX A;  5JCU A;  4MZW A;  3H93 A;  3KH9 A;  4ZIL A;  3WGD A;  5H5Q A;  5FT3 A;  4L5O A;  4PQH A;  4KSM A;  2H71 A;  4JZQ A;  3IAS 2;  3CSJ A;  5DDL A;  4G19 A;  2F8F A;  4MJE A;  1GL8 A;  3EU3 A;  9GSS A;  1TRV A;  4TW5 A;  5DQS A;  3J7Y b;  4EE0 A;  3TUE A;  3TRP A;  3F63 A;  5KEJ A;  2GS3 A;  3D4T A;  4LL1 B;  4IJI A;  1EEM A;  5CO3 A;  2CX4 A;  4Z2T A;  3BJ5 A;  3TKQ A;  1Q4J A;  1V9W A;  2N5A A;  3ZYW A;  1SKW B;  3GKM A;  2HLS A;  1R7H A;  1QK8 A;  1QFN A;  1QQ2 A;  2AV4 A;  1ML6 A;  1SVL A;  5IO0 A;  2HRN A;  3GKX A;  3HVX A;  1FHE A;  4ZL9 A;  1V40 A;  3A2V A;  4ECC A;  2OAC A;  2M80 A;  3KXO A;  1TRS A;  2HZE B;  5HR3 A;  1GSQ A;  1DBY A;  3HXS A;  3TJF A;  1X5D A;  3D22 A;  1XBS A;  2VM2 A;  1GUL A;  3NZN A;  3US3 A;  3FZ5 A;  1GTB A;  1SU9 A;  1R5P A;  1ZMA A;  4K7O A;  5HR2 A;  2DMM A;  1O8W A;  2YNX A;  1A23 A;  3QFB C;  4HJ2 A;  5IM9 A;  2BJX A;  2XBQ A;  3L78 A;  3EUR A;  5INY A;  4KCE A;  4GSN A;  1PX6 A;  3VWU A;  19GS A;  5CRH A;  3HJM A;  1S3C A;  3I9V 2;  4V2N A;  5J5N A;  1LJR A;  4YH2 A;  3Q19 A;  1VF1 A;  2H0G A;  4PNF A;  1EP7 A;  1K0O A;  2H6Y A;  4XTS A;  2PER A;  3Q74 A;  1GTU A;  1YKA A;  6GSX A;  2YAN A;  4OCE A;  1JZO A;  4EO3 A;  4WKW A;  1O7U A;  3QAG A;  3TU3 B;  1Z6N A;  3HJP A;  4O32 A;  2RII A;  3GRX A;  1CQH A;  5DAL A;  4LMV A;  4EDZ A;  2A4V A;  3SWL A;  1TOF A;  3KGK A;  5GAN D;  2JSZ A;  4WXT A;  3QOU A;  3P8W A;  4J56 E;  1EEJ A;  1XZO A;  1PX7 A;  5IIZ A;  5AIS A;  2IME A;  1U3A A;  4N3Z A;  4IKH A;  3FKF A;  1R4W A;  4WEY A;  2DIZ A;  4FYC A;  4RI6 A;  3CSI A;  1A24 A;  3N9J A;  3KP8 A;  1ERW A;  3GYK A;  2V1M A;  2A2P A;  3QDN A;  1AIU A;  4HOJ A;  2VAF A;  2X8G A;  3CRT A;  5G2Z A;  4DVC A;  5B6M A;  6GSW A;  2CAQ A;  2JSY A;  1OYJ A;  2ON7 A;  3UVH A;  2PMT A;  3DML A;  4FYU A;  4IP1 A;  2C8U A;  1XWG A;  5F0G A;  5DJL A;  2JU5 A;  2NBS A;  5IMC A;  2R5G A;  1G7E A;  2JZR A;  1YJ6 A;  2LEG A;  2XPE A;  1E6B A;  2VD0 A;  5B8B A;  1F3B A;  1GTI A;  1N2A A;  1T7P B;  3MDK A;  3FY7 A;  1G0T A;  2PUK C;  2R0C A;  4QQ7 A;  4MF6 A;  3R3E A;  3I6A A;  4L0U A;  3EMP A;  5JCG A;  3GKN A;  3HMJ G;  2LV3 A;  4O5U A;  2TRX A;  2ZCT A;  2H1B A;  4BPY A;  4DSS A;  2GLR A;  3F0I A;  4WF4 A;  2B7K A;  3ED3 A;  1JLV A;  2FGX A;  1YVL A;  1WOU A;  3M1G A;  1GNW A;  2GT6 A;  3DIE A;  3P7X A;  4TXO A;  2V6O A;  5EL8 A;  5A5H B;  2HXK A;  5FWG A;  1FO5 A;  5EPF A;  3LYK A;  4NV2 A;  1YZX A;  2C0F A;  2CVB A;  2H76 A;  1J08 A;  5KN1 A;  3FRC A;  1XOA A;  2WGR A;  4IQA A;  1Y1U A;  1Q98 A;  3UVT A;  2CT6 A;  3HY2 A;  5H5R A;  1T00 A;  1GSY A;  1PGT A;  5JWQ B;  2YV9 A;  1TI3 A;  4ZXG A;  2PBJ A;  2FLS A;  1OVN A;  2VLV A;  3LXZ A;  5IMV A;  1O6J A;  4J2F A;  5C04 A;  1XIY A;  3DGQ A;  3KTL A;  2VOC A;  4I97 A;  3FZ4 A;  4MMM A;  4ZBA A;  2DIY A;  4ZB7 A;  4KUN A;  4TR3 A;  2F8A A;  3HJO A;  4IBP A;  1F3A A;  1SVO A;  2C3N A;  5KOW A;  1TP9 A;  2HRA A;  5D9W A;  3PGT A;  3QAW A;  3H1N A;  4CW9 A;  2BTO T;  2CX3 A;  4XHM A;  5ENU A;  3TOU A;  4L0W A;  3FR9 A;  2YJ7 A;  2VCQ A;  1DE2 A;  1M2B A;  1TRU A;  4O5R A;  1KBN A;  1WRY A;  5DAK A;  1G7O A;  4I8B A;  1Z7P A;  5EVO A;  5B6N A;  2CVD A;  4MDC A;  3EWL A;  1UA5 A;  3TJJ A;  3F3Q A;  5LNK e;  3VI7 A;  4ID0 A;  4ZB9 A;  2OAD A;  5BRT A;  3ZML A;  1YKC A;  4DEJ A;  5AGY A;  3IOS A;  1VF3 A;  1U6T A;  2VL3 A;  1BAY A;  2HT9 A;  1ON4 A;  3UBK A;  1K0B A;  2I1U A;  5HFI A;  4BWQ A;  4YAV A;  3IE3 A;  3GHA A;  3HZ8 A;  2H6Z A;  3ZRD A;  3KM6 A;  2EIR A;  2HSM A;  5ID2 A;  3TDG A;  4TR4 A;  3GUR A;  2LJK A;  5G30 A;  2R0P A;  3IR4 A;  4TOP A;  2H1A A;  2H66 A;  1TU8 A;  1F2E A;  3KP9 A;  3CXG A;  1JZR A;  4HJM A;  2A2S A;  3KIJ A;  4KF9 A;  1B9Y C;  3CSH A;  1XWC A;  4JR4 A;  3I43 A;  4OO5 A;  14GS A;  2IMI A;  2H0I A;  3PH9 A;  3D0Z A;  4I6X A;  2GSQ A;  2LQQ A;  4BVX B;  2X4A A;  1ERU A;  2O7K A;  3LJR A;  2IJY A;  4N30 A;  3HYP A;  3MSZ A;  5COH A;  3PR8 A;  2DKI A;  3HA9 A;  3RBT A;  1J0F A;  3EVI A;  1QGV A;  5A5K A;  5ECO B;  4MPF A;  3U5R E;  3O3T A;  5BMU B;  3G7Y A;  2WB9 A;  2TRC P;  1NHO A;  2VL2 C;  1K0A A;  5HR1 A;  3D4M A;  1XWA A;  5J9C A;  4WR4 A;  1HD2 A;  3PPU A;  4F03 A;  2H1D A;  3K8N A;  2H01 A;  4G10 A;  3QMX A;  1EOH A;  1PA3 A;  2K9F A;  1T3B A;  1X9W B;  1JHB A;  3RAZ A;  1DUG A;  4KCA A;  1SL2 B;  1BJX A;  3DXB A;  4NHZ A;  3CRU A;  3P90 A;  3C73 A;  3ME8 A;  5IPG A;  4HS1 A;  4MJA A;  4K7I A;  2VL9 A;  1RW1 A;  1UVZ A;  5CRG A;  1HQO A;  2EIQ A;  4QL9 A;  2B6M A;  2L4Q A;  1VF4 A;  2DBC A;  2LKU A;  2VL2 A;  2FWH A;  3VPQ A;  1U3I A;  4POL A;  4FO5 A;  1NW2 A;  3G9B A;  1BED A;  2OE1 A;  2YCD A;  2VCZ A;  1HNC A;  2NPB A;  4HQZ A;  3TJB A;  4TR1 A;  1EZK A;  3F4R A;  3E0U A;  2P31 A;  2OJL A;  1H75 A;  2LRC A;  4ICY A;  1WIK A;  4OWY A;  4N10 A;  2C80 A;  2FY6 A;  3BCI A;  4G9H A;  3GN3 A;  4NHW A;  4AKX B;  4I5Q A;  1YDK A;  4CY6 A;  5ECL B;  1MTC A;  4KX4 A;  1GH2 A;  3TKR A;  4LL4 B;  1K0M A;  3L9U A;  2F51 A;  4MZB A;  2H0H A;  5F07 A;  3UBL A;  2EIO A;  3KTB A;  5G5E A;  4HUA A;  4EKZ A;  5IMA A;  1FB0 A;  1N8J A;  1RQM A;  2EFE A;  1SL0 B;  3CTG A;  4F0C A;  3ZL5 A;  5F06 A;  2LST A;  3E3E A;  4NWY A;  4XS4 B;  4HZ4 A;  3GMF A;  2GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...