2D2ZA

Crystal structure of soluble form of clic4
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
238
structure length
223
Chain Sequence
EPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chloride intracellular channel protein 4
publication title Trimeric structure of the wild soluble chloride intracellular ion channel CLIC4 observed in crystals
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 75
structure length 223
sequence length 238
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2d2zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2d2zA01
4XRDA 5B6NA 1JZWA 3TKSC 4K0GA 1GSSA 4POMA 1EV9A 1QFNA 4JE1A 4TR0A 4KSOA 1K0OA 4PNGA 2C3TA 3GSTA 2V1MA 1PD21 3PR8A 2KHPA 2AYTA 1GH2A 2E7PA 2C4JA 2MBSA 1XOAA 4MJBA 2Z9SA 2HQTA 1OKTA 1ZOFA 4ZL9A 1GTIA 2DJ2A 3ZYWA 3VI5A 2PN8A 5CRDA 1GUMA 2K6VA 3E0UA 3CRTA 5D93A 4MJCA 2VO4A 2NDOA 2L59A 1VRSD 1T7PB 4JBBA 2VLUA 2HT9A 4EDZA 2VD1A 2NBSA 3ZMKA 2WFCA 2HLSA 5IMCA 1SJ6A 4DSQA 3FY7A 4GLTA 2E2MA 3GKKA 4O92A 1OVNA 2GZZA 1VF1A 1YEXA 4JEDA 2L5OA 4QL7A 3GX8A 4K0NA 3C7MA 4IJIA 1M7TA 1BAYA 4ZL8A 4ECIA 5J5NA 2R2JA 3EURA 2FGXA 11GSA 1K0AA 3A2XA 3HCZA 2JU5A 4HJMA 2H76A 4EXJA 2LJKA 2R37A 3TKRA 2PU9C 1Z6NA 3IE3A 5D9TA 2RM5A 1PL1A 2GSTA 3VPTA 2XPDA 3UIWA 1FAAA 1T4ZA 3F8UA 1F2EA 4IKHA 4LL4B 3E3EA 2DJ0A 4DSRA 3TOTA 2VL3A 4TRXA 2TRCP 2ZUPA 1X0RA 1X9WB 1GULA 2IMIA 2HE3A 1XW6A 3ZIVA 2B7JA 3HVVA 4YAPA 2O7KA 3GA4A 1MTCA 4ML1A 3IOSA 5ABRA 3FZ9A 4MZBA 1GUKA 1YJ6A 4G0LA 1PX6A 4O7HA 3APOA 1F37A 2YJ7A 2M46A 2LJRA 3D21A 1B4QA 2YANA 1GSQA 1GLQA 4JZQA 2YPMA 4MP4A 1HQOA 5C00A 4GTUA 3VWUA 2RM6A 5DALA 3WYWA 3QAGA 1R4WA 1O8WA 4FYCA 16GSA 4OFTA 2REMA 3H4KA 1QUWA 3LJRA 2H0IA 5ECNB 3FR9A 4F0BA 1F3BA 1SL0B 2NVLA 2X8GA 1EEMA 1GNEA 3IC8A 5DAKA 3I43A 1K0MA 3QDNA 3HZ8A 3F63A 4ACSA 3GH9A 1AC1A 1K0NA 3TB2A 1GSYA 5IMVA 2IFQA 2OBIA 3GTUB 2N5AA 2VLTA 1V57A 3IDVA 1AIUA 4OO5A 5CO3A 1XWAA 3TRPA 5AISA 2QGVA 1YF0A 1TKDB 1EOGA 4TN8A 5JWQB 1SENA 3QCPA 3ZZXA 3EINA 4CHSA 1Z7RA 3TJBA 2RUFA 5B7CA 4L5OA 2ZCTA 3APQA 3GN3A 1A2JA 1WJKA 5DQYA 1KTEA 1M0UA 2DJ3A 2B6MA 3UAPA 1JLVA 5J4UA 3HKRA 1R26A 3J7Yk 3VFIA 1DE2A 5E59A 3GURA 2V32A 4YQVA 3DEXA 2MMZA 1YEPA 4RQRA 2IN3A 1Q98A 4G10A 2GT5A 1BJXA 1SU9A 3IXRA 4NPBA 1V58A 1ST9A 3W8SA 2VLVA 1EGOA 1T3BA 5IMAA 2G0FA 2K18A 4TR4A 4EL1A 4IVFA 4MF6A 3G9BA 22GSA 3WGXA 1WMJA 3KMOA 1TU7A 2OA7A 3LXZA 3O3TA 3IK9A 2PGTA 2PUKC 4I97A 3WT1A 3QFBC 5EPFA 4ZBBA 4POBA 5G1LA 2R4VA 4I8BA 3KMNA 1OE8A 4TR1A 1TU8A 3UMAA 3Q18A 3HY2A 2HRKB 1SKWB 1A24A 4MDCA 1ERVA 3FZ4A 4XS4A 1TK0B 1XXUA 2H6ZA 3CTGA 3GFKA 3TRXA 3P8WA 2ON7A 2JZTA 4AF2A 2DJ1A 4TXOA 1WWJA 4HEA2 3UL3A 4OD7A 3CXGA 2CQ9A 2FHEA 3ERGA 1PRXA 1U3AA 1BX9A 2C3QA 4POKA 5A4VA 4TVEA 3WGEA 2VM1A 3FZ5A 3ZL5A 1GL8A 2KUCA 5JWOB 3WD6A 3QD9A 4AGSA 2WS2A 1TRSA 2MMAA 2WCIA 3AY8A 2M72A 1N8JA 3PPUA 4ZXGA 4XS1A 2C0EA 5CRGA 3ZTLA 5JCWA 4WF4A 4MH3A 1DUGA 3CRUA 3US3A 3VI7A 3APSA 3L9SA 4N10A 4BL7A 1XBSA 2HSNB 4WF5A 4NWYA 1AQWA 1YDKA 4ZIJA 2OJLA 6GSTA 1WE0A 1IYIA 4O5RA 2MBTA 5CYYA 5DDLA 2MZCA 3F6FA 3MAKA 4IQ1A 1M9BA 2DBCA 4KA0A 5ENUA 2IMDA 2QKEA 1K3OA 3HA9A 3I9V2 4F82A 3D0ZA 1B4PA 1G7OA 1W4VA 2BTOT 5GZZB 2HI7A 1T1VA 2PVQA 4POLA 2VCWA 3NZNA 5F8BA 1DSBA 1FB0A 2FCHA 3A3TA 4MPGA 4Q5FA 4J56E 5JCGA 2WZ9A 3MWHA 4TKYA 1QMVA 3UEMA 1V98A 2GQKA 3D4TA 2V6KA 2L4QA 4HDEA 2IMKA 5IIZA 2GLRA 3GKNA 4G0KA 5GSTA 3V1WA 4IQAA 1SK0A 1PKZA 2LNTA 3TKSE 1RK4A 1OC3A 5ECHB 1MEKA 3GNJA 4N0VA 3ERWA 2FWEA 2EIOA 4MF5A 1QK8A 2K8SA 3TKQA 3BJ5A 1FO5A 1R7HA 3KM6A 4HOJA 2HYXA 3IAS2 1SK2A 2H1AA 4MJEA 4L0UA 4IGJA 4I2TA 2VIMA 3FR6A 2MYGA 4F2IA 4WBRD 2IL3A 2LKUA 5ID2B 3LXTA 2FWGA 1XW5A 1CQHA 3DWVA 5B8BA 5DCHA 3GYKA 1ZGNA 2YWIA 3F3RA 1GTUA 1MDIA 1ILOA 5G31A 4KGIA 3M9KA 5HR2A 3TDGA 3UVHA 5BMUA 2EC4A 2LRCA 2KP1A 4J57E 2HZEA 1U3IA 1OC9A 3DYRA 1BG5A 2H71A 3GH6A 1ZMAA 4YQMA 2GS3A 2I1UA 2CAQA 19GSA 2X64A 4V2NA 1FG4A 2DMLA 4WKWA 5IOXA 4ISDA 5LD0A 2LRTA 1XWBA 5D8IA 2VCQA 6GSUA 5JCUA 2VL2C 4WR4A 5ECQB 2IPAA 1QQ2A 2VCTA 5HFKA 1F6MC 2BMXA 4IP6A 5J9CA 1AUCA 1TP9A 2AB6A 2YCDA 1NW2A 5IQYA 2GSQA 1O8XA 5DAKB 1MDKA 1Z6MA 5D9WA 2XBIA 4BWQA 3N9JA 4EO3A 2VL9A 3UJ1A 1PN9A 1BYEA 2PVOC 1VF4A 2XBQA 4CW9A 4IP1A 2CV4A 5J3RA 1I9DA 1O81A 4PGTA 1URMA 3J7Yb 1SJZA 2L4CA 4ZBAA 4EKZA 3OR5A 2YP6A 2JZSA 2YWOA 2O85A 3VWXA 4LLRA 4NV2A 1BQ7A 1XVQA 3ED3A 5G5FA 1OE7A 1TK5B 4EUYA 3R2QA 3C71A 2X8HA 4DSSA 2DJJA 2H66A 5GAPD 3ZFLA 3KCMA 1AQXA 3KH9A 4MABA 3M9JA 7GSSA 2CZ3A 6GSSA 4GQCA 1J9BA 2YNXA 2HSMB 2CT6A 1Y25A 1PA3A 2OADA 1M2BA 5CAXA 3C1SA 3QOUA 5F07A 5EVOA 3KIJA 4K7OA 3H93A 1AAZA 5L71A 4NHZA 4FH8A 5HFGA 3W6GA 4EDYA 2HNLA 1XWCA 2HZFA 1XOBA 4DVCA 2X8CA 5H5SA 1ZL9A 2CVBA 2YZHA 3LSZA 2LQQA 4RI7A 4JRRA 4N11A 3F9UA 1ERWA 13GSA 2P31A 1MD3A 2L57A 3IPZA 5IOWA 4AJ6A 3HJPA 1PQNA 3PGTA 1OYJA 4OCEA 3EMXA 2R6KA 5B8AA 3H8QA 1K0DA 1NHYA 5DJMA 3TCOA 2H73A 4YAVA 1GUHA 3LORA 2UZ8A 3BCKA 2I4AA 1O73A 3UVTA 1FHEA 4HU9A 2YN1A 1FB6A 4XS4B 1TI1A 3GHAA 1THXA 1FVKA 4HZ2A 2GZYA 4HQSA 4K7IA 3S9FA 4JU5A 4TXOB 2WDUA 2VAFA 4NV5A 2RLIA 3TKPA 2VCVA 3IHQA 3M1GA 2MMOA 1N2AA 1PGTA 4E8EA 4ZILA 3ME7A 1JZOA 1XVWA 1ACVA 3ZITA 3GKXA 5IMFA 3G7JA 1GSDA 2IMEA 4AJ7A 4BVXA 1ZYEA 4IHUA 4V2LA 2JSYA 2YV9A 2B3SA 3TJKA 4MH2A 1O85A 2GGTA 3G7YA 2C8UA 2GSRA 1BEDA 4X43A 1K0CA 1SL1B 4RI6A 2DLXA 2EIQA 2H75A 3TGZA 1G7EA 5IPGA 4CDOA 4ZB6A 4ZL7A 1DE1A 2H1BA 3UBLA 1WRYA 2C1YA 1B48A 1XFLA 3P2AA 3TKSA 1WPIA 4K8MA 4IELA 4GRFA 3UOMA 4MMMA 1ZYQB 3U6VA 1R5PA 3BD2A 2LS5A 1T00A 2IWTA 2AV4A 1O6JA 4WXTA 5G5EA 3IAM2 1ZZYA 1I5GA 5KN3A 2FY6A 2OE3A 3F4RA 1FVJA 1T4YA 3L78A 3KZQA 1W89A 3LFLA 4KNDA 4X1UA 2OE0A 1TTZA 2NPBA 1JZRA 2B5XA 2VUPA 2FWFA 2MMNA 1EV4A 4KCEA 2HRAA 2H1DA 4HS1A 2OKAA 3QFAC 1XWGA 1RQMA 3L0HA 3KTLA 3BOAA 1NHOA 4GSTA 1GTBA 9GSSA 4QL9A 3HDCA 2O87A 3Q74A 2HRFA 2TRXA 4ML6A 3CSIA 5IO2A 2PBJA 1GNWA 3DVWA 4BVYB 4F0CA 1A0FA 4PX1A 4OCFA 3FW2A 3EVIA 1PKWA 5B6MA 4KDYA 4FO5A 2V41A 4EC0A 1R5AA 2F8FA 4FYUA 4L8EA 5HR3A 2H0GA 1NSWA 4D73B 2H6YA 1M99A 12GSA 3E9JB 3RPNA 4I2UA 5ECMB 5COHA 3LQ7A 4MZWA 4MJAA 3WGDA 5CNWA 4Q5NA 4IS0A 3O6TA 3HJOA 4KAEA 4KH7A 1TDIA 5F0GA 1Z9HA 2N5BA 3D22A 4JR4A 3CYNA 1KEBA 4MLYA 5G2ZA 4JR6A 2YOIA 3GTUA 4LL1B 4DEJA 4N30A 4OWYA 4KB3A 3EWLA 3FR3A 1CQGA 2I9HA 1T8EB 3RDWA 3ZVJA 5KN1A 3P7XA 3Q19A 2LSTA 4OFMA 2FLSA 2PWJA 1M2DA 3SWLA 5KN0A 1ZCPA 3NIVA 2E0QA 4K7NA 3IV4A 1YKAA 4PTSA 2LJAA 4XCSA 8GSSA 3GRXA 5A4WA 3FEUA 4WETA 4BPYA 2AJQB 3SBCA 2VCXA 2C0DA 2H01A 2LQOA 4HQZA 4MK3A 2A4VA 3D4MA 3CBUA 5INYA 2GT6A 1O7UA 3F0IA 2HFDA 2LV3A 4V2MA 2CAIA 3H1NA 2PERA 5F05A 5CRHA 5G30A 4RUVA 4LMWA 5F06A 2H30A 5DVBA 4FIWA 2F9SA 3F6DA 2YWMA 5C04A 3L9VA 1QXHA 2A2RA 4K1FA 2ALBA 1YZXA 3GSSA 3A2WA 1SKSB 1JLWA 4GSSA 6GSVA 3QR6A 1Z5YE 3GMFA 1WOUA 1EGRA 2WRTA 3IRAA 2EIRA 2HRKA 1ERTA 5FWGA 3IK7A 4X0XA 3F3QA 1PL2A 5GAND 5ECLB 3ZVJD 4LA1A 4GWRA 2ZNMA 3BCIA 2F51A 5G1KA 2H70A 2G2QA 2IMFA 1AW9A 1MD4A 2F8AA 2R3XA 1GP1A 4EVMA 1Z3EA 4Q5QA 1V40A 3ISOA 18GSA 4WBJA 4FQUA 1FW1A 1B8XA 5IM9A 4PNFA 3ZREA 4KDUA 3CSHA 4F9ZA 3HVXA 2CX4A 3C1RA 2JSZA 2BJXA 2PMTA 1A8LA 2K9FA 2C3NA 3LEFA 3I69A 4RQXA 5FHIA 5DCGA 1JZDA 1SD8A 1HD2A 4GQFA 3FKFA 4G2EA 5DALB 3GX0A 1DBYA 4XRAA 3O76A 2H0HA 1LU4A 3TJFA 5EL8A 3ZLPA 1XWKA 4XIHA 5ECRB 2OACA 3DIEA 1K3YA 2IJYA 1X9MB 4MPFA 1X5EA 1EOHA 3DVXA 4Z7XA 1X9SB 1YKCA 2H19A 1GRXA 3MSZA 3UARA 3NOFA 3M3MA 3ZMLA 1E6BA 2IFQB 4BVXB 1SD9A 5KEJA 1AXDA 2GVPA 1G0TA 3VLNA 3D5JA 2ES7A 2NTOA 2FD3A 1J08A 1GSFA 2GSSA 3GKMA 3KP8A 4KE3A 4HI7A 3BBYA 3VURA 5LNKe 1OC8A 1K3LA 3KP9A 2PPTA 2TIRA 5ECPB 1KBNA 4GSNA 4PQ1A 5J9BA 4XS6A 4PXOA 4FYBA 1ML6A 1TK8B 2B7KA 1KNGA 2YZUA 2H74A 5ECSA 1UA5A 3KTBA 2JL4A 4L0WA 1XW9A 2GZPA 1TRVA 2XC2A 2B1KA 4O32A 5ELAA 3GL5A 3F4TA 5ID2A 4KCAA 3RPPA 4KDXA 1YF1A 4KX4A 2H6XA 3LWAA 1XIYA 2CVKA 3H79A 3DMLA 3TUEA 2JADA 5DQSA 4PQIA 5AIVA 1UC7A 14GSA 4K6XA 1OKDA 2FNOA 4ZB9A 2YV7A 3L4NA 5DJLA 5ELGA 2YJHA 3IR4A 2JZRA 1H75A 1ERUA 1B9XC 2DMMA 2HSHA 3EMPA 2X99A 3QMXA 4TXVA 2HXKA 3GUSA 4IJ3A 2A2SA 4TR1B 3KXOA 1S3CA 2GTUA 1UN2A 2E2GA 2DSAA 2L6DA 4H86A 5HR1A 2FWHA 1XPVA 2LTKA 1NM3A 2IIYA 5GSSA 1JHBA 1G6YA 2V2GA 1USBA 3DKSA 20GSA 4Q5RA 3VWWA 2H8LA 3GIXA 4NMUA 5IMDA 3HD5A 1A23A 4L5LA 2B5YA 3KGKA 1LBKA 2B1LA 4BA7A 2YWNA 4G9HA 4ZBDA 4QQ7A 2AHEA 4TR3A 1S3AA 2O89A 2VM2A 1F9MA 1VGLA 2JACA 3RHCA 3EYTA 3RHBA 1TRUA 2C0FA 3TJJA 1TRWA 2XHFA 2VD0A 3HVSA 3W8JA 2RUEA 2WGRA 3CMIA 3LYPA 6GSWA 3GL3A 4PQHA 2LEGA 2J23A 3M8NA 1HYUA 3Q6OA 5DBQA 1V2AA 4HU7A 4MF7A 4EF0A 3UBKA 1PMTA 5D9VA 4BL7B 2HRNA 3KD0A 5AN1A 2J9HA 4I5QA 4PURA 4K2DA 4TW5A 3VK9A 1GSUA 5LCZA 1YQ1A 1U6TA 2LUSA 1TXXA 10GSA 2CZ2A 3KEBA 1SL2B 2FA4A 1EP7A 4HJ2A 3TJGA 2GDRA 4KF9A 3GV1A 4WR5A 1RW1A 1PX7A 2H72A 3VWVA 2L5LA 3EC3A 3F4SA 2B5EA 2HSYA 2HSMA 4MZCA 1HNBA 3IBHA 4YH2A 2VL2A 4ZB8A 4HZ4A 5IMZA 3HXSA 3FK8A 2XPEA 3QAVA 5J41A 1HNAA 3LYKA 1EZKA 3R3EA 4V1Ag 3DGQA 3FRCA 2CVDA 2R5GA 1F3AA 3IA1A 3FHKA 4N0ZA 3RAZA 1U88A 1A2LA 1M9AA 3EE2A 2O8VB 4ULXA 4PUAA 3QAWA 4USSA 6GSYA 2LNSA 4V1Ap 2K8VA 1Q4JA 5AIXA 2WULA 1GSEA 2QSIA 3DRNA 1YY7A 2FUG2 3M0FA 2FA8A 4P3YB 3QPMA 2DJKA 3C8EA 3TRQA 5HR0A 2RIIA 1SYXA 4AJ8A 1GLPA 3CTFA 4ILFA 5HQPA 5CREA 3RBTA 1A8YA 1TW9A 3KH7A 4TOPA 4IW9A 1C72A 2QC7A 3HYPA 4GXZA 4WEYA 4J2FA 1WIKA 1M2AA 2AAWA 3TOUA 2HZEB 1EWXA 1OC9B 1GWCA 1EEJA 3EU4A 3MDKA 2V6OA 2P5QA 1SK1A 1PSQA 5E4WA 3ME8A 3VPQA 2P5RA 3A5WA 3ZFBA 1Y6EA 5ECKB 5JWRB 1E2YA 4XTSA 5HFIA 3FYGA 1HNCA 4MCUA 3ERFA 2D2ZA 2KLXA 1G6WA 1K0BA 2GQLA 3HZ4A 4ECJA 1VF2A 2OE1A 3ZIJA 3LGCA 5CP1A 1QGVA 1S3DA 5D96A 2OBKA 4G19A 3LG6A 4OO4A 5KN2A 3IC4A 1SJIA 2GQMA 4NHWA 2VOCA 1GTAA 1SYRA 2N5FA 1X5DA 2DIZA 4LMVA 3MNGA 4GCIA 4NAXA 1SKRB 2L6CA 3HHVA 4YQUA 1LJRA 1VF3A 4ECCA 3K8NA 2F3MA 3HJMA 5IPHA 3CSJA 4F03A 5H5QA 2CX3A 5ECIB 4BWSA 4NXIA 2I81A 2M80A 3EU3A 5AGYA 2C80A 5EY6A 1FOVA 4OMVA 2ON5A 1TOFA 5A4UA 3I6AA 1ABAA 4EE0A 4I6XA 1A2MA 1U87A 2C0GA 2VCZA 3A2VA 17GSA 4KW6A 1UVZA 4IN0A 4PUFC 3DXBA 3G7IA 1IYHA 4K9ZA 1JFUA 3PH9A 4DSSB 1AQVA 4KUNA 3JCML 3FZAA 2I3YA 2DIYA 4ECBA 3DD3A 1X5CA 4GF0A 5IO0A 3N5OA 3D6IA 5FT3A 5A5KA 2LRNA 4BVYA 3C73A 4E8HA 3ZRDA 3KJYA 3WT2A 4MA9A 2CA8A 3L9UA 1TI3A 2KOKA 1XCCA 3PINA 1A0RP 2AUVA 5D9XA 1OAZA 3U5RE 1H4OA 4D73A 2DC5A 3P90A 5D73A 5H5RA 1TJDA 4ID0A 1WP0A 1ON4A 6GSXA 2WJUA 1V9WA 4G0IA 1EP8A 1J0FA 2H1GA 4IBPA 4HUAA 2WB9A 4KSMA 1B9YC 4XHMA 1XZOA 1THOA 1MDJA 1Z7PA 5CRWA 2KP2A 4OFNA 2P0GA 5ECOB
chains in the Genus database with same CATH superfamily
4XRDA 5B6NA 1JZWA 3TKSC 4K0GA 1GSSA 4POMA 1EV9A 1QFNA 4JE1A 4TR0A 4KSOA 1K0OA 4PNGA 2C3TA 3GSTA 2V1MA 1PD21 3PR8A 2KHPA 2AYTA 1GH2A 1TXUA 2E7PA 2C4JA 2MBSA 1XOAA 4MJBA 2Z9SA 2HQTA 1OKTA 1ZOFA 4ZL9A 1GTIA 2DJ2A 3ZYWA 4K2XA 3VI5A 5A1NB 2PN8A 5CRDA 5J40A 1GUMA 2K6VA 3E0UA 3CRTA 5D93A 4MJCA 2VO4A 2A2PA 2NDOA 2L59A 1VRSD 1T7PB 4JBBA 2VLUA 2HT9A 4EDZA 2VD1A 2NBSA 3ZMKA 2WFCA 2HLSA 5IMCA 1SJ6A 4DSQA 3FY7A 4GLTA 2E2MA 3GKKA 5A5HB 4O92A 1OVNA 2GZZA 1VF1A 1YEXA 4JEDA 2L5OA 4QL7A 3GX8A 4K0NA 3C7MA 4IJIA 1M7TA 1BAYA 4ZL8A 4ECIA 5J5NA 2R2JA 3EURA 2FGXA 11GSA 1K0AA 3A2XA 3HCZA 2JU5A 4HJMA 2H76A 4EXJA 2LJKA 2R37A 2WW1A 3TKRA 2PU9C 1Z6NA 3IE3A 5D9TA 2RM5A 1PL1A 2GSTA 3VPTA 2XPDA 3UIWA 1FAAA 1T4ZA 3F8UA 1F2EA 4IKHA 4LL4B 3E3EA 2DJ0A 4DSRA 3TOTA 2VL3A 4TRXA 2TRCP 2ZUPA 1X0RA 1X9WB 1GULA 2IMIA 2HE3A 1XW6A 3ZIVA 2B7JA 3HVVA 4YAPA 2O7KA 3GA4A 3HVNA 1MTCA 4ML1A 3IOSA 5ABRA 3FZ9A 4MZBA 1GUKA 1YJ6A 4G0LA 1PX6A 4O7HA 3APOA 1F37A 2YJ7A 2M46A 2LJRA 3D21A 1B4QA 2YANA 1GSQA 1GLQA 4JZQA 2YPMA 4AKXB 4MP4A 1HQOA 5C00A 4GTUA 3VWUA 2RM6A 5DALA 3WYWA 3QAGA 1R4WA 1O8WA 2VKZG 4FYCA 16GSA 4OFTA 4Z2TA 2REMA 3H4KA 1QUWA 3LJRA 2H0IA 5ECNB 3FR9A 4F0BA 1F3BA 1SL0B 2NVLA 2X8GA 3CQFA 1EEMA 1GNEA 3IC8A 5DAKA 3I43A 1K0MA 3QDNA 3HZ8A 3F63A 4ACSA 3GH9A 1AC1A 1K0NA 3TB2A 1GSYA 5IMVA 2IFQA 2OBIA 3GTUB 1BG1A 2N5AA 2VLTA 1V57A 3IDVA 1AIUA 4OO5A 5CO3A 1XWAA 3TRPA 5AISA 2QGVA 1YF0A 1TKDB 1EOGA 4TN8A 5JWQB 1SENA 3QCPA 3ZZXA 3EINA 4CHSA 1Z7RA 3TJBA 2RUFA 5B7CA 4L5OA 2ZCTA 3APQA 3GN3A 1A2JA 1WJKA 5DQYA 1KTEA 1M0UA 2DJ3A 2B6MA 3UAPA 1JLVA 5J4UA 3HKRA 1R26A 3J7Yk 3VFIA 1DE2A 5E59A 3GURA 2V32A 4YQVA 3DEXA 2MMZA 1YEPA 4RQRA 2IN3A 1Q98A 4G10A 2GT5A 1BJXA 1SU9A 3IXRA 4NPBA 1V58A 1ST9A 3W8SA 2VLVA 1EGOA 1T3BA 5IMAA 2G0FA 2K18A 5BRTA 4TR4A 4EL1A 2A4HA 4IVFA 4MF6A 3G9BA 22GSA 3WGXA 4Z2UA 1WMJA 3KMOA 1TU7A 2OA7A 3LXZA 3O3TA 3IK9A 2PGTA 2PUKC 4I97A 3WT1A 3QFBC 5EPFA 4ZBBA 4POBA 5G1LA 2R4VA 4I8BA 3KMNA 1OE8A 4TR1A 4EIPA 1TU8A 3UMAA 1SVOA 3Q18A 3HY2A 2WW0A 2HRKB 1SKWB 1A24A 4MDCA 1ERVA 3FZ4A 4XS4A 1TK0B 1XXUA 2H6ZA 3CTGA 3GFKA 3TRXA 3P8WA 2ON7A 2JZTA 4AF2A 2DJ1A 4TXOA 1WWJA 4HEA2 3UL3A 4OD7A 3CXGA 2CQ9A 2FHEA 3ERGA 1PRXA 1U3AA 1BX9A 2C3QA 4POKA 5A4VA 4TVEA 3WGEA 2VM1A 3FZ5A 3ZL5A 1GL8A 2KUCA 4K5SA 5JWOB 3WD6A 3QD9A 4AGSA 2WS2A 1TRSA 2MMAA 2WCIA 3AY8A 2M72A 1N8JA 3PPUA 4ZXGA 4XS1A 2C0EA 5CRGA 3ZTLA 5JCWA 4WF4A 4MH3A 1DUGA 3CRUA 3US3A 3VI7A 3APSA 3RGBC 3L9SA 4N10A 4BL7A 1XBSA 2HSNB 4WF5A 4NWYA 1AQWA 1YDKA 4ZIJA 2OJLA 6GSTA 1WE0A 1IYIA 2WVXA 4O5RA 2MBTA 5CYYA 2QA1A 5DDLA 2MZCA 3F6FA 3MAKA 1YVLA 3CWGA 4IQ1A 1M9BA 2DBCA 4KA0A 2O3EA 5ENUA 2IMDA 2QKEA 1K3OA 3HA9A 3I9V2 4F82A 4CY6A 3D0ZA 1B4PA 1G7OA 1W4VA 2BTOT 5GZZB 2HI7A 1T1VA 2PVQA 4POLA 2VCWA 3NZNA 5F8BA 1DSBA 1FB0A 2FCHA 3A3TA 4MPGA 4Q5FA 4J56E 5JCGA 2WZ9A 3MWHA 1S4BP 4TKYA 1QMVA 3UEMA 1V98A 2GQKA 3D4TA 2V6KA 2L4QA 4HDEA 2IMKA 5IIZA 2GLRA 3GKNA 4G0KA 5GSTA 3V1WA 4IQAA 1SK0A 1PKZA 2LNTA 3TKSE 1RK4A 1OC3A 5ECHB 1MEKA 3GNJA 4N0VA 3ERWA 2FWEA 2EIOA 2R0CA 4MF5A 1QK8A 2K8SA 3TKQA 3BJ5A 1FO5A 1R7HA 3KM6A 4HOJA 2HYXA 3IAS2 1SK2A 2H1AA 4MJEA 4L0UA 4IGJA 4I2TA 2VIMA 3FR6A 2MYGA 4F2IA 4WBRD 2IL3A 4G01A 2LKUA 5ID2B 3LXTA 2FWGA 1XW5A 1CQHA 3DWVA 5B8BA 5DCHA 3GYKA 1ZGNA 2YWIA 3F3RA 1GTUA 1MDIA 1ILOA 5G31A 4KGIA 3M9KA 5HR2A 3TDGA 3UVHA 5J4YA 5BMUA 2EC4A 2LRCA 2KP1A 5A34B 4J57E 4A5PA 2HZEA 1U3IA 1OC9A 1PFOA 3DYRA 1BG5A 2H71A 3GH6A 1ZMAA 4YQMA 2GS3A 4O5QA 2I1UA 2CAQA 19GSA 2X64A 4V2NA 1FG4A 2DMLA 4WKWA 5IOXA 4ISDA 5LD0A 2LRTA 1XWBA 5D8IA 2VCQA 6GSUA 5JCUA 2VL2C 4WR4A 5ECQB 2IPAA 1QQ2A 2VCTA 5HFKA 1F6MC 2BMXA 4IP6A 5J9CA 1AUCA 1TP9A 2AB6A 2YCDA 1NW2A 5IQYA 2GSQA 1O8XA 2O36A 5DAKB 1MDKA 1Z6MA 5D9WA 2XBIA 4BWQA 3N9JA 4EO3A 2VL9A 3UJ1A 1PN9A 1BYEA 2PVOC 1VF4A 2XBQA 4CW9A 4IP1A 2CV4A 5J3RA 1I9DA 1O81A 4PGTA 1URMA 3J7Yb 1SJZA 2L4CA 4ZBAA 4EKZA 3OR5A 2YP6A 2JZSA 2YWOA 2O85A 3VWXA 4LLRA 4NV2A 1BQ7A 1XVQA 3ED3A 5G5FA 1OE7A 1TK5B 4EUYA 3R2QA 3C71A 2X8HA 4DSSA 2DJJA 2H66A 2WW3A 5GAPD 3ZFLA 3KCMA 1AQXA 3KH9A 4MABA 3M9JA 7GSSA 2CZ3A 6GSSA 4GQCA 1J9BA 2YNXA 2HSMB 2CT6A 1Y25A 1PA3A 2OADA 1M2BA 5CAXA 3C1SA 3QOUA 4AKIA 5F07A 5EVOA 3KIJA 4K7OA 3H93A 1AAZA 5L71A 4NHZA 4FH8A 5HFGA 3W6GA 4EDYA 2HNLA 1XWCA 2HZFA 1XOBA 4DVCA 2X8CA 5H5SA 1ZL9A 4O5UA 2CVBA 2YZHA 3LSZA 2LQQA 4RI7A 4JRRA 4N11A 3F9UA 1ERWA 13GSA 2P31A 1MD3A 2L57A 3IPZA 5IOWA 4AJ6A 3HJPA 1PQNA 3PGTA 1OYJA 4OCEA 4AKHA 3EMXA 2R6KA 5B8AA 3H8QA 1K0DA 1NHYA 5DJMA 3TCOA 2H73A 4YAVA 1GUHA 3LORA 2UZ8A 3BCKA 2I4AA 1O73A 3UVTA 1FHEA 4HU9A 2YN1A 1FB6A 4XS4B 1TI1A 3GHAA 1THXA 1FVKA 4HZ2A 2GZYA 4HQSA 4K7IA 3S9FA 4JU5A 4TXOB 2WDUA 2VAFA 4NV5A 2RLIA 1N25A 3TKPA 2VCVA 3IHQA 3M1GA 2MMOA 1N2AA 1PGTA 4E8EA 4ZILA 3ME7A 1JZOA 5A1NA 1XVWA 1ACVA 3ZITA 3GKXA 5IMFA 3G7JA 1GSDA 2IMEA 4AJ7A 4BVXA 1ZYEA 3EPTA 4IHUA 4V2LA 2JSYA 2YV9A 2B3SA 3TJKA 4MH2A 1O85A 2GGTA 3G7YA 2C8UA 2GSRA 1BEDA 4X43A 1K0CA 1SL1B 4RI6A 2DLXA 2EIQA 2H75A 3TGZA 1G7EA 5IPGA 4CDOA 4ZB6A 4ZL7A 1DE1A 2H1BA 5A5HA 3UBLA 1WRYA 5KOXA 2C1YA 2X49A 1B48A 1XFLA 3P2AA 3TKSA 1WPIA 4K8MA 4IELA 2UV8G 4GRFA 3UOMA 4MMMA 1ZYQB 3U6VA 1R5PA 3BD2A 2LS5A 1T00A 2IWTA 2AV4A 4E68A 1O6JA 4WXTA 5G5EA 3IAM2 1ZZYA 1I5GA 5KN3A 2FY6A 2OE3A 3F4RA 1FVJA 1T4YA 3L78A 3KZQA 1SVLA 1W89A 1PN0A 3LFLA 4KNDA 4X1UA 2X4AA 2OE0A 1TTZA 2NPBA 1JZRA 2B5XA 2VUPA 2FWFA 2MMNA 1EV4A 1ZYNA 4KCEA 2HRAA 2H1DA 4HS1A 2OKAA 3QFAC 1XWGA 1RQMA 3L0HA 3KTLA 3MIXA 3BOAA 1NHOA 4YKGA 4GSTA 1GTBA 2EFHA 9GSSA 4QL9A 3HDCA 2O87A 3Q74A 2HRFA 2TRXA 4ML6A 3CSIA 5IO2A 2PBJA 1GNWA 3DVWA 4BVYB 4F0CA 1A0FA 4PX1A 4OCFA 3FW2A 3EVIA 1PKWA 5B6MA 4KDYA 4FO5A 2V41A 4EC0A 1R5AA 2F8FA 4FYUA 4L8EA 5HR3A 2H0GA 1NSWA 4D73B 2H6YA 1M99A 12GSA 3E9JB 3RPNA 4I2UA 5ECMB 5COHA 3LQ7A 4MZWA 4MJAA 3WGDA 5CNWA 4Q5NA 4Z2RA 4IS0A 3O6TA 3HJOA 4KAEA 4KH7A 1TDIA 5F0GA 1Z9HA 2N5BA 3D22A 4JR4A 3CYNA 1KEBA 4MLYA 5G2ZA 4JR6A 2YOIA 3GTUA 1S3RA 4LL1B 4DEJA 4N30A 4OWYA 4KB3A 3EWLA 3FR3A 1CQGA 2I9HA 1T8EB 3MYDA 4AI6A 4X4JA 3RDWA 3ZVJA 5KN1A 4PI2C 3P7XA 3Q19A 2LSTA 4OFMA 2FLSA 2PWJA 1M2DA 3SWLA 4GDFA 5KN0A 1ZCPA 3NIVA 2E0QA 4K7NA 3IV4A 1YKAA 4PTSA 2LJAA 4XCSA 8GSSA 3GRXA 5A4WA 3FEUA 4WETA 4BPYA 2AJQB 3SBCA 2VCXA 2C0DA 2H01A 2LQOA 4HQZA 1YEWC 4MK3A 2A4VA 3D4MA 3CBUA 4K5RA 5INYA 2GT6A 1O7UA 3F0IA 2HFDA 4YKFA 2LV3A 4V2MA 2O5VA 2CAIA 3H1NA 2PERA 4N3ZA 5F05A 5CRHA 5G30A 4RUVA 4LMWA 5F06A 2H30A 5DVBA 4FIWA 2F9SA 3F6DA 2YWMA 5C04A 3L9VA 1QXHA 2A2RA 4K1FA 1BF5A 2ALBA 1YZXA 3GSSA 3A2WA 2R0GA 1SKSB 1JLWA 4GSSA 6GSVA 3QR6A 5KOWA 1Z5YE 3GMFA 1WOUA 1EGRA 2WRTA 3IRAA 2EIRA 2HRKA 1ERTA 5FWGA 3IK7A 4X0XA 3F3QA 1PL2A 5GAND 5ECLB 3ZVJD 4LA1A 4GWRA 2ZNMA 3BCIA 1Y1UA 2F51A 5G1KA 2H70A 2G2QA 2IMFA 1AW9A 1MD4A 2F8AA 2R3XA 1GP1A 4EVMA 1Z3EA 4Q5QA 1V40A 3ISOA 18GSA 4WBJA 4FQUA 1FW1A 1B8XA 4ZB7A 5IM9A 4PNFA 3ZREA 4KDUA 3CSHA 4F9ZA 3HVXA 2CX4A 3C1RA 2JSZA 2BJXA 2PMTA 1A8LA 2K9FA 2C3NA 3LEFA 3I69A 4RQXA 3HMJG 5FHIA 5DCGA 1JZDA 1SD8A 1HD2A 4GQFA 3FKFA 4G2EA 5DALB 3GX0A 1DBYA 4XRAA 2HSNA 3O76A 2H0HA 1LU4A 3TJFA 2WW2A 5EL8A 3ZLPA 4ICYA 1XWKA 4XIHA 5ECRB 2OACA 3DIEA 1K3YA 2IJYA 1X9MB 4MPFA 1X5EA 1EOHA 3DVXA 4Z7XA 1X9SB 3IHGA 1YKCA 2H19A 1GRXA 3MSZA 2WZSA 3UARA 3NOFA 3M3MA 3ZMLA 3CHXC 1E6BA 2IFQB 4BVXB 1SD9A 5KEJA 1AXDA 5J4VA 2GVPA 1G0TA 3VLNA 3D5JA 2ES7A 2NTOA 2FD3A 1J08A 1ZYPA 1GSFA 2GSSA 3GKMA 3KP8A 4KE3A 4HI7A 3BBYA 3VURA 5LNKe 4W66A 1OC8A 2DKIA 1K3LA 3KP9A 2PPTA 2TIRA 5ECPB 1KBNA 4GSNA 4PQ1A 5J9BA 4XS6A 4PXOA 4FYBA 1ML6A 1TK8B 2B7KA 1KNGA 2YZUA 2H74A 5ECSA 1UA5A 3KTBA 2JL4A 4L0WA 1XW9A 2GZPA 1TRVA 2XC2A 2B1KA 4O32A 5ELAA 3GL5A 3FMWA 3F4TA 5ID2A 4KCAA 3RPPA 4KDXA 1YF1A 4KX4A 2H6XA 3LWAA 1XIYA 2CVKA 3H79A 3DMLA 3TUEA 2JADA 5DQSA 4PQIA 5AIVA 1UC7A 4EIQA 14GSA 4K6XA 2WVZA 1OKDA 2FNOA 4ZB9A 2YV7A 3L4NA 5DJLA 5ELGA 2YJHA 3IR4A 2JZRA 1H75A 1ERUA 5A34A 1B9XC 2DMMA 2HSHA 3EMPA 2X99A 3QMXA 4TXVA 2HXKA 3GUSA 4IJ3A 2OT3A 2A2SA 4TR1B 3KXOA 1S3CA 2GTUA 1UN2A 2E2GA 2DSAA 2L6DA 4H86A 5HR1A 2FWHA 1XPVA 2LTKA 1NM3A 2IIYA 5GSSA 1JHBA 1G6YA 2V2GA 1USBA 3DKSA 20GSA 4Q5RA 3VWWA 2H8LA 3GIXA 4NMUA 5IMDA 1FOHA 3HD5A 1A23A 1M3JA 4L5LA 2B5YA 3KGKA 1LBKA 2B1LA 4BA7A 2YWNA 2R0PA 4G9HA 4ZBDA 4QQ7A 2AHEA 4TR3A 1S3AA 2O89A 2VM2A 1F9MA 1VGLA 2JACA 2H1LA 3RHCA 3EYTA 3RHBA 1TRUA 2C0FA 3TJJA 1TRWA 2XHFA 2VD0A 3HVSA 3W8JA 2RUEA 2WGRA 3CMIA 3LYPA 6GSWA 3GL3A 4PQHA 2LEGA 2J23A 3M8NA 1HYUA 3Q6OA 5DBQA 1V2AA 4HU7A 4MF7A 4EF0A 3UBKA 1PMTA 5D9VA 4BL7B 1I1IP 1XG8A 2HRNA 3KD0A 5AN1A 2J9HA 4I5QA 4PURA 4K2DA 4TW5A 3VK9A 2WVXB 1GSUA 5LCZA 1YQ1A 1U6TA 2LUSA 1TXXA 10GSA 2CZ2A 3KEBA 1SL2B 2FA4A 3A5IA 1EP7A 4HJ2A 3TJGA 2EFCA 2GDRA 4KF9A 3GV1A 4WR5A 1RW1A 1PX7A 2H72A 3VWVA 2L5LA 3EC3A 3F4SA 4AKGA 2B5EA 2HSYA 2HSMA 4MZCA 1HNBA 3IBHA 4YH2A 2VL2A 4ZB8A 4HZ4A 5IMZA 3HXSA 2QA2A 3FK8A 2XPEA 3QAVA 5J41A 1HNAA 3LYKA 1EZKA 3R3EA 4V1Ag 3DGQA 3FRCA 3RFRC 2CVDA 2R5GA 1F3AA 3IA1A 3FHKA 4N0ZA 3RAZA 1U88A 1A2LA 1M9AA 3EE2A 2O8VB 4ULXA 4PUAA 3QAWA 3LW9A 4USSA 6GSYA 2LNSA 4V1Ap 2K8VA 2EFDA 1Q4JA 5AIXA 2WULA 1GSEA 2QSIA 3DRNA 2DKHA 1YY7A 5J47A 2FUG2 3M0FA 2FA8A 4P3YB 4QMKA 3QPMA 2DJKA 3C8EA 3TRQA 5HR0A 2RIIA 1SYXA 4AJ8A 1GLPA 3CTFA 4ILFA 5HQPA 4CY8A 5CREA 3RBTA 1A8YA 1TW9A 3KH7A 4TOPA 4IW9A 1C72A 5BMUB 2QC7A 3HYPA 4GXZA 4WEYA 4J2FA 1WIKA 1M2AA 2WVYA 2AAWA 3TOUA 2HZEB 1EWXA 1OC9B 1GWCA 4PI0C 1EEJA 3EU4A 3MDKA 2V6OA 2P5QA 1SK1A 1PSQA 5E4WA 3ME8A 3VPQA 2P5RA 3A5WA 3ZFBA 1Y6EA 5ECKB 5JWRB 1E2YA 4XTSA 5HFIA 3FYGA 1HNCA 4MCUA 3ERFA 2D2ZA 2KLXA 1G6WA 1K0BA 2GQLA 3HZ4A 4ECJA 1VF2A 2OE1A 1M3IA 3ZIJA 3LGCA 5CP1A 1QGVA 4HSCX 1S3DA 5D96A 2OBKA 4G19A 3LG6A 4OO4A 5KN2A 3IC4A 1SJIA 4BIKA 2GQMA 4NHWA 4FXYP 2VOCA 1GTAA 1SYRA 2N5FA 1X5DA 2DIZA 4LMVA 4GCIA 4NAXA 3MNGA 1SKRB 2L6CA 3HHVA 4YQUA 1LJRA 1VF3A 4ECCA 3K8NA 2F3MA 3HJMA 5IPHA 3CSJA 2EFEA 4F03A 5H5QA 2CX3A 5ECIB 4BWSA 4NXIA 2I81A 2M80A 3EU3A 5AGYA 2C80A 5EY6A 1FOVA 4OMVA 3TU3B 2ON5A 1TOFA 5A4UA 3I6AA 1ABAA 4EE0A 4I6XA 1A2MA 1U87A 2C0GA 2VCZA 3A2VA 17GSA 4KW6A 1UVZA 4IN0A 4PUFC 3DXBA 3G7IA 1IYHA 1SVMA 1JFUA 3PH9A 4K9ZA 4DSSB 1AQVA 4KUNA 3JCML 3FZAA 2I3YA 2DIYA 4ECBA 3DD3A 1X5CA 4GF0A 5IO0A 3N5OA 3D6IA 5FT3A 5A5KA 2LRNA 4BVYA 3C73A 4E8HA 3ZRDA 3KJYA 4MNNA 3WT2A 4MA9A 2CA8A 3L9UA 1TI3A 2KOKA 4PHZC 1XCCA 3PINA 1A0RP 2AUVA 5D9XA 1OAZA 3U5RE 1H4OA 4D73A 2DC5A 3P90A 5D73A 5H5RA 1TJDA 4ID0A 1WP0A 1ON4A 6GSXA 2WJUA 1V9WA 4G0IA 1EP8A 1J0FA 2H1GA 4IBPA 4HUAA 2WB9A 4KSMA 1B9YC 4XHMA 1XZOA 1THOA 1MDJA 1Z7PA 5CRWA 2KP2A 4OFNA 2P0GA 5ECOB
chains in the Genus database with same CATH topology
4XRDA 5B6NA 1JZWA 3TKSC 4K0GA 1GSSA 4POMA 1EV9A 1QFNA 4JE1A 4TR0A 4KSOA 1K0OA 4PNGA 2C3TA 3GSTA 2V1MA 1PD21 3PR8A 2KHPA 2AYTA 1GH2A 1TXUA 2E7PA 2C4JA 2MBSA 1XOAA 4MJBA 2Z9SA 2HQTA 1OKTA 1ZOFA 4ZL9A 1GTIA 2DJ2A 3ZYWA 4K2XA 3VI5A 5A1NB 2PN8A 5CRDA 5J40A 1GUMA 2K6VA 3E0UA 3CRTA 5D93A 4MJCA 2VO4A 2A2PA 2NDOA 2L59A 1VRSD 1T7PB 4JBBA 2VLUA 2HT9A 4EDZA 2VD1A 2NBSA 3ZMKA 2WFCA 2HLSA 5IMCA 1SJ6A 4DSQA 3FY7A 4GLTA 2E2MA 3GKKA 5A5HB 4O92A 1OVNA 2GZZA 1VF1A 1YEXA 4JEDA 2L5OA 4QL7A 3GX8A 4K0NA 3C7MA 4IJIA 1M7TA 1BAYA 4ZL8A 4ECIA 5J5NA 2R2JA 3EURA 2FGXA 11GSA 1K0AA 3A2XA 3HCZA 2JU5A 4HJMA 2H76A 4EXJA 2LJKA 2R37A 3TKRA 2PU9C 1Z6NA 3IE3A 5D9TA 2RM5A 1PL1A 2GSTA 3VPTA 2XPDA 3UIWA 1FAAA 1T4ZA 3F8UA 1F2EA 4IKHA 4LL4B 3E3EA 2DJ0A 4DSRA 3TOTA 2VL3A 4TRXA 2TRCP 2ZUPA 1X0RA 1X9WB 1GULA 2IMIA 2HE3A 1XW6A 3ZIVA 2B7JA 3HVVA 4YAPA 2O7KA 3GA4A 1MTCA 4ML1A 3IOSA 5ABRA 3FZ9A 4MZBA 1GUKA 1YJ6A 4G0LA 1PX6A 4O7HA 3APOA 1F37A 2YJ7A 2M46A 2LJRA 3D21A 1B4QA 2YANA 1GSQA 1GLQA 4JZQA 2YPMA 4AKXB 4MP4A 1HQOA 5C00A 4GTUA 3VWUA 2RM6A 5DALA 3WYWA 3QAGA 1R4WA 1O8WA 2VKZG 4FYCA 16GSA 4OFTA 4Z2TA 2REMA 3H4KA 1QUWA 3LJRA 2H0IA 5ECNB 3FR9A 4F0BA 1F3BA 1SL0B 2NVLA 2X8GA 1EEMA 1GNEA 3IC8A 5DAKA 3I43A 1K0MA 3QDNA 3HZ8A 3F63A 4ACSA 3GH9A 1AC1A 1K0NA 3TB2A 1GSYA 5IMVA 2IFQA 2OBIA 3GTUB 1BG1A 2N5AA 2VLTA 1V57A 3IDVA 1AIUA 4OO5A 5CO3A 1XWAA 3TRPA 5AISA 2QGVA 1YF0A 1TKDB 1EOGA 4TN8A 5JWQB 1SENA 3QCPA 3ZZXA 3EINA 4CHSA 1Z7RA 3TJBA 2RUFA 5B7CA 4L5OA 2ZCTA 3APQA 3GN3A 1A2JA 1WJKA 5DQYA 1KTEA 1M0UA 2DJ3A 2B6MA 3UAPA 1JLVA 5J4UA 3HKRA 1R26A 3J7Yk 3VFIA 1DE2A 5E59A 3GURA 2V32A 4YQVA 3DEXA 2MMZA 1YEPA 4RQRA 2IN3A 1Q98A 4G10A 2GT5A 1BJXA 1SU9A 3IXRA 4NPBA 1V58A 1ST9A 3W8SA 2VLVA 1EGOA 1T3BA 5IMAA 2G0FA 2K18A 5BRTA 4TR4A 4EL1A 2A4HA 4IVFA 4MF6A 3G9BA 22GSA 3WGXA 4Z2UA 1WMJA 3KMOA 1TU7A 2OA7A 3LXZA 3O3TA 3IK9A 2PGTA 2PUKC 4I97A 3WT1A 3QFBC 5EPFA 4ZBBA 4POBA 5G1LA 2R4VA 4I8BA 3KMNA 1OE8A 4TR1A 4EIPA 1TU8A 3UMAA 1SVOA 3Q18A 3HY2A 2HRKB 1SKWB 1A24A 4MDCA 1ERVA 3FZ4A 4XS4A 1TK0B 1XXUA 2H6ZA 3CTGA 3GFKA 3TRXA 3P8WA 2ON7A 2JZTA 4AF2A 2DJ1A 4TXOA 1WWJA 4HEA2 3UL3A 4OD7A 3CXGA 2CQ9A 2FHEA 3ERGA 1PRXA 1U3AA 1BX9A 2C3QA 4POKA 5A4VA 4TVEA 3WGEA 2VM1A 3FZ5A 3ZL5A 1GL8A 2KUCA 4K5SA 5JWOB 3WD6A 3QD9A 4AGSA 2WS2A 1TRSA 2MMAA 2WCIA 3AY8A 2M72A 1N8JA 3PPUA 4ZXGA 4XS1A 2C0EA 5CRGA 3ZTLA 5JCWA 4WF4A 4MH3A 1DUGA 3CRUA 3US3A 3VI7A 3APSA 3L9SA 4N10A 4BL7A 1XBSA 2HSNB 4WF5A 4NWYA 1AQWA 1YDKA 4ZIJA 2OJLA 6GSTA 1WE0A 1IYIA 4O5RA 2MBTA 5CYYA 2QA1A 5DDLA 2MZCA 3F6FA 3MAKA 1YVLA 3CWGA 4IQ1A 1M9BA 2DBCA 4KA0A 5ENUA 2IMDA 2QKEA 1K3OA 3HA9A 3I9V2 4F82A 4CY6A 3D0ZA 1B4PA 1G7OA 1W4VA 2BTOT 5GZZB 2HI7A 1T1VA 2PVQA 4POLA 2VCWA 3NZNA 5F8BA 1DSBA 1FB0A 2FCHA 3A3TA 4MPGA 4Q5FA 4J56E 5JCGA 2WZ9A 3MWHA 4TKYA 1QMVA 3UEMA 1V98A 2GQKA 3D4TA 2V6KA 2L4QA 4HDEA 2IMKA 5IIZA 2GLRA 3GKNA 4G0KA 5GSTA 3V1WA 4IQAA 1SK0A 1PKZA 2LNTA 3TKSE 1RK4A 1OC3A 5ECHB 1MEKA 3GNJA 4N0VA 3ERWA 2FWEA 2EIOA 2R0CA 4MF5A 1QK8A 2K8SA 3TKQA 3BJ5A 1FO5A 1R7HA 3KM6A 4HOJA 2HYXA 3IAS2 1SK2A 2H1AA 4MJEA 4L0UA 4IGJA 4I2TA 2VIMA 3FR6A 2MYGA 4F2IA 4WBRD 2IL3A 4G01A 2LKUA 5ID2B 3LXTA 2FWGA 1XW5A 1CQHA 3DWVA 5B8BA 5DCHA 3GYKA 1ZGNA 2YWIA 3F3RA 1GTUA 1MDIA 1ILOA 5G31A 4KGIA 3M9KA 5HR2A 3TDGA 3UVHA 5J4YA 5BMUA 2EC4A 2LRCA 2KP1A 5A34B 4J57E 4A5PA 2HZEA 1U3IA 1OC9A 3DYRA 1BG5A 2H71A 3GH6A 1ZMAA 4YQMA 2GS3A 4O5QA 2I1UA 2CAQA 19GSA 2X64A 4V2NA 1FG4A 2DMLA 4WKWA 5IOXA 4ISDA 5LD0A 2LRTA 1XWBA 5D8IA 2VCQA 6GSUA 5JCUA 2VL2C 4WR4A 5ECQB 2IPAA 1QQ2A 2VCTA 5HFKA 1F6MC 2BMXA 4IP6A 5J9CA 1AUCA 1TP9A 2AB6A 2YCDA 1NW2A 5IQYA 2GSQA 1O8XA 5DAKB 1MDKA 1Z6MA 5D9WA 2XBIA 4BWQA 3N9JA 4EO3A 2VL9A 3UJ1A 1PN9A 1BYEA 2PVOC 1VF4A 2XBQA 4CW9A 4IP1A 2CV4A 5J3RA 1I9DA 1O81A 4PGTA 1URMA 3J7Yb 1SJZA 2L4CA 4ZBAA 4EKZA 3OR5A 2YP6A 2JZSA 2YWOA 2O85A 3VWXA 4LLRA 4NV2A 1BQ7A 1XVQA 3ED3A 5G5FA 1OE7A 1TK5B 4EUYA 3R2QA 3C71A 2X8HA 4DSSA 2DJJA 2H66A 5GAPD 3ZFLA 3KCMA 1AQXA 3KH9A 4MABA 3M9JA 7GSSA 2CZ3A 6GSSA 4GQCA 1J9BA 2YNXA 2HSMB 2CT6A 1Y25A 1PA3A 2OADA 1M2BA 5CAXA 3C1SA 3QOUA 4AKIA 5F07A 5EVOA 3KIJA 4K7OA 3H93A 1AAZA 5L71A 4NHZA 4FH8A 5HFGA 3W6GA 4EDYA 2HNLA 1XWCA 2HZFA 1XOBA 4DVCA 2X8CA 5H5SA 1ZL9A 4O5UA 2CVBA 2YZHA 3LSZA 2LQQA 4RI7A 4JRRA 4N11A 3F9UA 1ERWA 13GSA 2P31A 1MD3A 2L57A 3IPZA 5IOWA 4AJ6A 3HJPA 1PQNA 3PGTA 1OYJA 4OCEA 4AKHA 3EMXA 2R6KA 5B8AA 3H8QA 1K0DA 1NHYA 5DJMA 3TCOA 2H73A 4YAVA 1GUHA 3LORA 2UZ8A 3BCKA 2I4AA 1O73A 3UVTA 1FHEA 4HU9A 2YN1A 1FB6A 4XS4B 1TI1A 3GHAA 1THXA 1FVKA 4HZ2A 2GZYA 4HQSA 4K7IA 3S9FA 4JU5A 4TXOB 2WDUA 2VAFA 4NV5A 2RLIA 1N25A 3TKPA 2VCVA 3IHQA 3M1GA 2MMOA 1N2AA 1PGTA 4E8EA 4ZILA 3ME7A 1JZOA 5A1NA 1XVWA 1ACVA 3ZITA 3GKXA 5IMFA 3G7JA 1GSDA 2IMEA 4AJ7A 4BVXA 1ZYEA 3EPTA 4IHUA 4V2LA 2JSYA 2YV9A 2B3SA 3TJKA 4MH2A 1O85A 2GGTA 3G7YA 2C8UA 2GSRA 1BEDA 4X43A 1K0CA 1SL1B 4RI6A 2DLXA 2EIQA 2H75A 3TGZA 1G7EA 5IPGA 4CDOA 4ZB6A 4ZL7A 1DE1A 2H1BA 5A5HA 3UBLA 1WRYA 5KOXA 2C1YA 2X49A 1B48A 1XFLA 3P2AA 3TKSA 1WPIA 4K8MA 4IELA 2UV8G 4GRFA 3UOMA 4MMMA 1ZYQB 3U6VA 1R5PA 3BD2A 2LS5A 1T00A 2IWTA 2AV4A 4E68A 1O6JA 4WXTA 5G5EA 3IAM2 1ZZYA 1I5GA 5KN3A 2FY6A 2OE3A 3F4RA 1FVJA 1T4YA 3L78A 3KZQA 1SVLA 1W89A 1PN0A 3LFLA 4KNDA 4X1UA 2X4AA 2OE0A 1TTZA 2NPBA 1JZRA 2B5XA 2VUPA 2FWFA 2MMNA 1EV4A 1ZYNA 4KCEA 2HRAA 2H1DA 4HS1A 2OKAA 3QFAC 1XWGA 1RQMA 3L0HA 3KTLA 3MIXA 3BOAA 1NHOA 4YKGA 4GSTA 1GTBA 2EFHA 9GSSA 4QL9A 3HDCA 2O87A 3Q74A 2HRFA 2TRXA 4ML6A 3CSIA 5IO2A 2PBJA 1GNWA 3DVWA 4BVYB 4F0CA 1A0FA 4PX1A 4OCFA 3FW2A 3EVIA 1PKWA 5B6MA 4KDYA 4FO5A 2V41A 4EC0A 1R5AA 2F8FA 4FYUA 4L8EA 5HR3A 2H0GA 1NSWA 4D73B 2H6YA 1M99A 12GSA 3E9JB 3RPNA 4I2UA 5ECMB 5COHA 3LQ7A 4MZWA 4MJAA 3WGDA 5CNWA 4Q5NA 4Z2RA 4IS0A 3O6TA 3HJOA 4KAEA 4KH7A 1TDIA 5F0GA 1Z9HA 2N5BA 3D22A 4JR4A 3CYNA 1KEBA 4MLYA 5G2ZA 4JR6A 2YOIA 3GTUA 4LL1B 4DEJA 4N30A 4OWYA 4KB3A 3EWLA 3FR3A 1CQGA 2I9HA 1T8EB 3MYDA 4AI6A 4X4JA 3RDWA 3ZVJA 5KN1A 3P7XA 3Q19A 2LSTA 4OFMA 2FLSA 2PWJA 1M2DA 3SWLA 4GDFA 5KN0A 1ZCPA 3NIVA 2E0QA 4K7NA 3IV4A 1YKAA 4PTSA 2LJAA 4XCSA 8GSSA 3GRXA 5A4WA 3FEUA 4WETA 4BPYA 2AJQB 3SBCA 2VCXA 2C0DA 2H01A 2LQOA 4HQZA 4MK3A 2A4VA 3D4MA 3CBUA 4K5RA 5INYA 2GT6A 1O7UA 3F0IA 2HFDA 4YKFA 2LV3A 4V2MA 2O5VA 2CAIA 3H1NA 2PERA 4N3ZA 5F05A 5CRHA 5G30A 4RUVA 4LMWA 5F06A 2H30A 5DVBA 4FIWA 2F9SA 3F6DA 2YWMA 5C04A 3L9VA 1QXHA 2A2RA 4K1FA 1BF5A 2ALBA 1YZXA 3GSSA 3A2WA 2R0GA 1SKSB 1JLWA 4GSSA 6GSVA 3QR6A 5KOWA 1Z5YE 3GMFA 1WOUA 1EGRA 2WRTA 3IRAA 2EIRA 2HRKA 1ERTA 5FWGA 3IK7A 4X0XA 3F3QA 1PL2A 5GAND 5ECLB 3ZVJD 4LA1A 4GWRA 2ZNMA 3BCIA 1Y1UA 2F51A 5G1KA 2H70A 2G2QA 2IMFA 1AW9A 1MD4A 2F8AA 2R3XA 1GP1A 4EVMA 1Z3EA 4Q5QA 1V40A 3ISOA 18GSA 4WBJA 4FQUA 1FW1A 1B8XA 4ZB7A 5IM9A 4PNFA 3ZREA 4KDUA 3CSHA 4F9ZA 3HVXA 2CX4A 3C1RA 2JSZA 2BJXA 2PMTA 1A8LA 2K9FA 2C3NA 3LEFA 3I69A 4RQXA 3HMJG 5FHIA 5DCGA 1JZDA 1SD8A 1HD2A 4GQFA 3FKFA 4G2EA 5DALB 3GX0A 1DBYA 4XRAA 2HSNA 3O76A 2H0HA 1LU4A 3TJFA 5EL8A 3ZLPA 4ICYA 1XWKA 4XIHA 5ECRB 2OACA 3DIEA 1K3YA 2IJYA 1X9MB 4MPFA 1X5EA 1EOHA 3DVXA 4Z7XA 1X9SB 3IHGA 1YKCA 2H19A 1GRXA 3MSZA 3UARA 3NOFA 3M3MA 3ZMLA 1E6BA 2IFQB 4BVXB 1SD9A 5KEJA 1AXDA 5J4VA 2GVPA 1G0TA 3VLNA 3D5JA 2ES7A 2NTOA 2FD3A 1J08A 1ZYPA 1GSFA 2GSSA 3GKMA 3KP8A 4KE3A 4HI7A 3BBYA 3VURA 5LNKe 4W66A 1OC8A 2DKIA 1K3LA 3KP9A 2PPTA 2TIRA 5ECPB 1KBNA 4GSNA 4PQ1A 5J9BA 4XS6A 4PXOA 4FYBA 1ML6A 1TK8B 2B7KA 1KNGA 2YZUA 2H74A 5ECSA 1UA5A 3KTBA 2JL4A 4L0WA 1XW9A 2GZPA 1TRVA 2XC2A 2B1KA 4O32A 5ELAA 3GL5A 3FMWA 3F4TA 5ID2A 4KCAA 3RPPA 4KDXA 1YF1A 4KX4A 2H6XA 3LWAA 1XIYA 2CVKA 3H79A 3DMLA 3TUEA 2JADA 5DQSA 4PQIA 5AIVA 1UC7A 4EIQA 14GSA 4K6XA 1OKDA 2FNOA 4ZB9A 2YV7A 3L4NA 5DJLA 5ELGA 2YJHA 3IR4A 2JZRA 1H75A 1ERUA 5A34A 1B9XC 2DMMA 2HSHA 3EMPA 2X99A 3QMXA 4TXVA 2HXKA 3GUSA 4IJ3A 2OT3A 2A2SA 4TR1B 3KXOA 1S3CA 2GTUA 1UN2A 2E2GA 2DSAA 2L6DA 4H86A 5HR1A 2FWHA 1XPVA 2LTKA 1NM3A 2IIYA 5GSSA 1JHBA 1G6YA 2V2GA 1USBA 3DKSA 20GSA 4Q5RA 3VWWA 2H8LA 3GIXA 4NMUA 5IMDA 1FOHA 3HD5A 1A23A 4L5LA 2B5YA 3KGKA 1LBKA 2B1LA 4BA7A 2YWNA 2R0PA 4G9HA 4ZBDA 4QQ7A 2AHEA 4TR3A 1S3AA 2O89A 2VM2A 1F9MA 1VGLA 2JACA 2H1LA 3RHCA 3EYTA 3RHBA 1TRUA 2C0FA 3TJJA 1TRWA 2XHFA 2VD0A 3HVSA 3W8JA 2RUEA 2WGRA 3CMIA 3LYPA 6GSWA 3GL3A 4PQHA 2LEGA 2J23A 3M8NA 1HYUA 3Q6OA 5DBQA 1V2AA 4HU7A 4MF7A 4EF0A 3UBKA 1PMTA 5D9VA 4BL7B 2HRNA 3KD0A 5AN1A 2J9HA 4I5QA 4PURA 4K2DA 4TW5A 3VK9A 1GSUA 5LCZA 1YQ1A 1U6TA 2LUSA 1TXXA 10GSA 2CZ2A 3KEBA 1SL2B 2FA4A 3A5IA 1EP7A 4HJ2A 3TJGA 2EFCA 2GDRA 4KF9A 3GV1A 4WR5A 1RW1A 1PX7A 2H72A 3VWVA 2L5LA 3EC3A 3F4SA 4AKGA 2B5EA 2HSYA 2HSMA 4MZCA 1HNBA 3IBHA 4YH2A 2VL2A 4ZB8A 4HZ4A 5IMZA 3HXSA 2QA2A 3FK8A 2XPEA 3QAVA 5J41A 1HNAA 3LYKA 1EZKA 3R3EA 4V1Ag 3DGQA 3FRCA 2CVDA 2R5GA 1F3AA 3IA1A 3FHKA 4N0ZA 3RAZA 1U88A 1A2LA 1M9AA 3EE2A 2O8VB 4ULXA 4PUAA 3QAWA 3LW9A 4USSA 6GSYA 2LNSA 4V1Ap 2K8VA 2EFDA 1Q4JA 5AIXA 2WULA 1GSEA 2QSIA 3DRNA 2DKHA 1YY7A 5J47A 2FUG2 3M0FA 2FA8A 4P3YB 4QMKA 3QPMA 2DJKA 3C8EA 3TRQA 5HR0A 2RIIA 1SYXA 4AJ8A 1GLPA 3CTFA 4ILFA 5HQPA 4CY8A 5CREA 3RBTA 1A8YA 1TW9A 3KH7A 4TOPA 4IW9A 1C72A 5BMUB 2QC7A 3HYPA 4GXZA 4WEYA 4J2FA 1WIKA 1M2AA 2AAWA 3TOUA 2HZEB 1EWXA 1OC9B 1GWCA 1EEJA 3EU4A 3MDKA 2V6OA 2P5QA 1SK1A 1PSQA 5E4WA 3ME8A 3VPQA 2P5RA 3A5WA 3ZFBA 1Y6EA 5ECKB 5JWRB 1E2YA 4XTSA 5HFIA 3FYGA 1HNCA 4MCUA 3ERFA 2D2ZA 2KLXA 1G6WA 1K0BA 2GQLA 3HZ4A 4ECJA 1VF2A 2OE1A 3ZIJA 3LGCA 5CP1A 1QGVA 1S3DA 5D96A 2OBKA 4G19A 3LG6A 4OO4A 5KN2A 3IC4A 1SJIA 2GQMA 4NHWA 2VOCA 1GTAA 1SYRA 2N5FA 1X5DA 2DIZA 4LMVA 3MNGA 4GCIA 4NAXA 1SKRB 2L6CA 3HHVA 4YQUA 1LJRA 1VF3A 4ECCA 3K8NA 2F3MA 3HJMA 5IPHA 3CSJA 2EFEA 4F03A 5H5QA 2CX3A 5ECIB 4BWSA 4NXIA 2I81A 2M80A 3EU3A 5AGYA 2C80A 5EY6A 1FOVA 4OMVA 3TU3B 2ON5A 1TOFA 5A4UA 3I6AA 1ABAA 4EE0A 4I6XA 1A2MA 1U87A 2C0GA 2VCZA 3A2VA 17GSA 4KW6A 1UVZA 4IN0A 4PUFC 3DXBA 3G7IA 1IYHA 1SVMA 1JFUA 3PH9A 4K9ZA 4DSSB 1AQVA 4KUNA 3JCML 3FZAA 2I3YA 2DIYA 4ECBA 3DD3A 1X5CA 4GF0A 5IO0A 3N5OA 3D6IA 5FT3A 5A5KA 2LRNA 4BVYA 3C73A 4E8HA 3ZRDA 3KJYA 4MNNA 3WT2A 4MA9A 2CA8A 3L9UA 1TI3A 2KOKA 1XCCA 3PINA 1A0RP 2AUVA 5D9XA 1OAZA 3U5RE 1H4OA 4D73A 2DC5A 3P90A 5D73A 5H5RA 1TJDA 4ID0A 1WP0A 1ON4A 6GSXA 2WJUA 1V9WA 4G0IA 1EP8A 1J0FA 2H1GA 4IBPA 4HUAA 2WB9A 4KSMA 1B9YC 4XHMA 1XZOA 1THOA 1MDJA 1Z7PA 5CRWA 2KP2A 4OFNA 2P0GA 5ECOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRD A;  5B6N A;  1JZW A;  3TKS C;  4K0G A;  1GSS A;  4POM A;  1EV9 A;  1QFN A;  4JE1 A;  4TR0 A;  4KSO A;  1K0O A;  4PNG A;  2C3T A;  3GST A;  2V1M A;  1PD2 1;  3PR8 A;  2KHP A;  2AYT A;  1GH2 A;  2E7P A;  2C4J A;  2MBS A;  1XOA A;  4MJB A;  2Z9S A;  2HQT A;  1OKT A;  1ZOF A;  4ZL9 A;  1GTI A;  2DJ2 A;  3ZYW A;  3VI5 A;  2PN8 A;  5CRD A;  1GUM A;  2K6V A;  3E0U A;  3CRT A;  5D93 A;  4MJC A;  2VO4 A;  2NDO A;  2L59 A;  1VRS D;  1T7P B;  4JBB A;  2VLU A;  2HT9 A;  4EDZ A;  2VD1 A;  2NBS A;  3ZMK A;  2WFC A;  2HLS A;  5IMC A;  1SJ6 A;  4DSQ A;  3FY7 A;  4GLT A;  2E2M A;  3GKK A;  4O92 A;  1OVN A;  2GZZ A;  1VF1 A;  1YEX A;  4JED A;  2L5O A;  4QL7 A;  3GX8 A;  4K0N A;  3C7M A;  4IJI A;  1M7T A;  1BAY A;  4ZL8 A;  4ECI A;  5J5N A;  2R2J A;  3EUR A;  2FGX A;  11GS A;  1K0A A;  3A2X A;  3HCZ A;  2JU5 A;  4HJM A;  2H76 A;  4EXJ A;  2LJK A;  2R37 A;  3TKR A;  2PU9 C;  1Z6N A;  3IE3 A;  5D9T A;  2RM5 A;  1PL1 A;  2GST A;  3VPT A;  2XPD A;  3UIW A;  1FAA A;  1T4Z A;  3F8U A;  1F2E A;  4IKH A;  4LL4 B;  3E3E A;  2DJ0 A;  4DSR A;  3TOT A;  2VL3 A;  4TRX A;  2TRC P;  2ZUP A;  1X0R A;  1X9W B;  1GUL A;  2IMI A;  2HE3 A;  1XW6 A;  3ZIV A;  2B7J A;  3HVV A;  4YAP A;  2O7K A;  3GA4 A;  1MTC A;  4ML1 A;  3IOS A;  5ABR A;  3FZ9 A;  4MZB A;  1GUK A;  1YJ6 A;  4G0L A;  1PX6 A;  4O7H A;  3APO A;  1F37 A;  2YJ7 A;  2M46 A;  2LJR A;  3D21 A;  1B4Q A;  2YAN A;  1GSQ A;  1GLQ A;  4JZQ A;  2YPM A;  4MP4 A;  1HQO A;  5C00 A;  4GTU A;  3VWU A;  2RM6 A;  5DAL A;  3WYW A;  3QAG A;  1R4W A;  1O8W A;  4FYC A;  16GS A;  4OFT A;  2REM A;  3H4K A;  1QUW A;  3LJR A;  2H0I A;  5ECN B;  3FR9 A;  4F0B A;  1F3B A;  1SL0 B;  2NVL A;  2X8G A;  1EEM A;  1GNE A;  3IC8 A;  5DAK A;  3I43 A;  1K0M A;  3QDN A;  3HZ8 A;  3F63 A;  4ACS A;  3GH9 A;  1AC1 A;  1K0N A;  3TB2 A;  1GSY A;  5IMV A;  2IFQ A;  2OBI A;  3GTU B;  2N5A A;  2VLT A;  1V57 A;  3IDV A;  1AIU A;  4OO5 A;  5CO3 A;  1XWA A;  3TRP A;  5AIS A;  2QGV A;  1YF0 A;  1TKD B;  1EOG A;  4TN8 A;  5JWQ B;  1SEN A;  3QCP A;  3ZZX A;  3EIN A;  4CHS A;  1Z7R A;  3TJB A;  2RUF A;  5B7C A;  4L5O A;  2ZCT A;  3APQ A;  3GN3 A;  1A2J A;  1WJK A;  5DQY A;  1KTE A;  1M0U A;  2DJ3 A;  2B6M A;  3UAP A;  1JLV A;  5J4U A;  3HKR A;  1R26 A;  3J7Y k;  3VFI A;  1DE2 A;  5E59 A;  3GUR A;  2V32 A;  4YQV A;  3DEX A;  2MMZ A;  1YEP A;  4RQR A;  2IN3 A;  1Q98 A;  4G10 A;  2GT5 A;  1BJX A;  1SU9 A;  3IXR A;  4NPB A;  1V58 A;  1ST9 A;  3W8S A;  2VLV A;  1EGO A;  1T3B A;  5IMA A;  2G0F A;  2K18 A;  4TR4 A;  4EL1 A;  4IVF A;  4MF6 A;  3G9B A;  22GS A;  3WGX A;  1WMJ A;  3KMO A;  1TU7 A;  2OA7 A;  3LXZ A;  3O3T A;  3IK9 A;  2PGT A;  2PUK C;  4I97 A;  3WT1 A;  3QFB C;  5EPF A;  4ZBB A;  4POB A;  5G1L A;  2R4V A;  4I8B A;  3KMN A;  1OE8 A;  4TR1 A;  1TU8 A;  3UMA A;  3Q18 A;  3HY2 A;  2HRK B;  1SKW B;  1A24 A;  4MDC A;  1ERV A;  3FZ4 A;  4XS4 A;  1TK0 B;  1XXU A;  2H6Z A;  3CTG A;  3GFK A;  3TRX A;  3P8W A;  2ON7 A;  2JZT A;  4AF2 A;  2DJ1 A;  4TXO A;  1WWJ A;  4HEA 2;  3UL3 A;  4OD7 A;  3CXG A;  2CQ9 A;  2FHE A;  3ERG A;  1PRX A;  1U3A A;  1BX9 A;  2C3Q A;  4POK A;  5A4V A;  4TVE A;  3WGE A;  2VM1 A;  3FZ5 A;  3ZL5 A;  1GL8 A;  2KUC A;  5JWO B;  3WD6 A;  3QD9 A;  4AGS A;  2WS2 A;  1TRS A;  2MMA A;  2WCI A;  3AY8 A;  2M72 A;  1N8J A;  3PPU A;  4ZXG A;  4XS1 A;  2C0E A;  5CRG A;  3ZTL A;  5JCW A;  4WF4 A;  4MH3 A;  1DUG A;  3CRU A;  3US3 A;  3VI7 A;  3APS A;  3L9S A;  4N10 A;  4BL7 A;  1XBS A;  2HSN B;  4WF5 A;  4NWY A;  1AQW A;  1YDK A;  4ZIJ A;  2OJL A;  6GST A;  1WE0 A;  1IYI A;  4O5R A;  2MBT A;  5CYY A;  5DDL A;  2MZC A;  3F6F A;  3MAK A;  4IQ1 A;  1M9B A;  2DBC A;  4KA0 A;  5ENU A;  2IMD A;  2QKE A;  1K3O A;  3HA9 A;  3I9V 2;  4F82 A;  3D0Z A;  1B4P A;  1G7O A;  1W4V A;  2BTO T;  5GZZ B;  2HI7 A;  1T1V A;  2PVQ A;  4POL A;  2VCW A;  3NZN A;  5F8B A;  1DSB A;  1FB0 A;  2FCH A;  3A3T A;  4MPG A;  4Q5F A;  4J56 E;  5JCG A;  2WZ9 A;  3MWH A;  4TKY A;  1QMV A;  3UEM A;  1V98 A;  2GQK A;  3D4T A;  2V6K A;  2L4Q A;  4HDE A;  2IMK A;  5IIZ A;  2GLR A;  3GKN A;  4G0K A;  5GST A;  3V1W A;  4IQA A;  1SK0 A;  1PKZ A;  2LNT A;  3TKS E;  1RK4 A;  1OC3 A;  5ECH B;  1MEK A;  3GNJ A;  4N0V A;  3ERW A;  2FWE A;  2EIO A;  4MF5 A;  1QK8 A;  2K8S A;  3TKQ A;  3BJ5 A;  1FO5 A;  1R7H A;  3KM6 A;  4HOJ A;  2HYX A;  3IAS 2;  1SK2 A;  2H1A A;  4MJE A;  4L0U A;  4IGJ A;  4I2T A;  2VIM A;  3FR6 A;  2MYG A;  4F2I A;  4WBR D;  2IL3 A;  2LKU A;  5ID2 B;  3LXT A;  2FWG A;  1XW5 A;  1CQH A;  3DWV A;  5B8B A;  5DCH A;  3GYK A;  1ZGN A;  2YWI A;  3F3R A;  1GTU A;  1MDI A;  1ILO A;  5G31 A;  4KGI A;  3M9K A;  5HR2 A;  3TDG A;  3UVH A;  5BMU A;  2EC4 A;  2LRC A;  2KP1 A;  4J57 E;  2HZE A;  1U3I A;  1OC9 A;  3DYR A;  1BG5 A;  2H71 A;  3GH6 A;  1ZMA A;  4YQM A;  2GS3 A;  2I1U A;  2CAQ A;  19GS A;  2X64 A;  4V2N A;  1FG4 A;  2DML A;  4WKW A;  5IOX A;  4ISD A;  5LD0 A;  2LRT A;  1XWB A;  5D8I A;  2VCQ A;  6GSU A;  5JCU A;  2VL2 C;  4WR4 A;  5ECQ B;  2IPA A;  1QQ2 A;  2VCT A;  5HFK A;  1F6M C;  2BMX A;  4IP6 A;  5J9C A;  1AUC A;  1TP9 A;  2AB6 A;  2YCD A;  1NW2 A;  5IQY A;  2GSQ A;  1O8X A;  5DAK B;  1MDK A;  1Z6M A;  5D9W A;  2XBI A;  4BWQ A;  3N9J A;  4EO3 A;  2VL9 A;  3UJ1 A;  1PN9 A;  1BYE A;  2PVO C;  1VF4 A;  2XBQ A;  4CW9 A;  4IP1 A;  2CV4 A;  5J3R A;  1I9D A;  1O81 A;  4PGT A;  1URM A;  3J7Y b;  1SJZ A;  2L4C A;  4ZBA A;  4EKZ A;  3OR5 A;  2YP6 A;  2JZS A;  2YWO A;  2O85 A;  3VWX A;  4LLR A;  4NV2 A;  1BQ7 A;  1XVQ A;  3ED3 A;  5G5F A;  1OE7 A;  1TK5 B;  4EUY A;  3R2Q A;  3C71 A;  2X8H A;  4DSS A;  2DJJ A;  2H66 A;  5GAP D;  3ZFL A;  3KCM A;  1AQX A;  3KH9 A;  4MAB A;  3M9J A;  7GSS A;  2CZ3 A;  6GSS A;  4GQC A;  1J9B A;  2YNX A;  2HSM B;  2CT6 A;  1Y25 A;  1PA3 A;  2OAD A;  1M2B A;  5CAX A;  3C1S A;  3QOU A;  5F07 A;  5EVO A;  3KIJ A;  4K7O A;  3H93 A;  1AAZ A;  5L71 A;  4NHZ A;  4FH8 A;  5HFG A;  3W6G A;  4EDY A;  2HNL A;  1XWC A;  2HZF A;  1XOB A;  4DVC A;  2X8C A;  5H5S A;  1ZL9 A;  2CVB A;  2YZH A;  3LSZ A;  2LQQ A;  4RI7 A;  4JRR A;  4N11 A;  3F9U A;  1ERW A;  13GS A;  2P31 A;  1MD3 A;  2L57 A;  3IPZ A;  5IOW A;  4AJ6 A;  3HJP A;  1PQN A;  3PGT A;  1OYJ A;  4OCE A;  3EMX A;  2R6K A;  5B8A A;  3H8Q A;  1K0D A;  1NHY A;  5DJM A;  3TCO A;  2H73 A;  4YAV A;  1GUH A;  3LOR A;  2UZ8 A;  3BCK A;  2I4A A;  1O73 A;  3UVT A;  1FHE A;  4HU9 A;  2YN1 A;  1FB6 A;  4XS4 B;  1TI1 A;  3GHA A;  1THX A;  1FVK A;  4HZ2 A;  2GZY A;  4HQS A;  4K7I A;  3S9F A;  4JU5 A;  4TXO B;  2WDU A;  2VAF A;  4NV5 A;  2RLI A;  3TKP A;  2VCV A;  3IHQ A;  3M1G A;  2MMO A;  1N2A A;  1PGT A;  4E8E A;  4ZIL A;  3ME7 A;  1JZO A;  1XVW A;  1ACV A;  3ZIT A;  3GKX A;  5IMF A;  3G7J A;  1GSD A;  2IME A;  4AJ7 A;  4BVX A;  1ZYE A;  4IHU A;  4V2L A;  2JSY A;  2YV9 A;  2B3S A;  3TJK A;  4MH2 A;  1O85 A;  2GGT A;  3G7Y A;  2C8U A;  2GSR A;  1BED A;  4X43 A;  1K0C A;  1SL1 B;  4RI6 A;  2DLX A;  2EIQ A;  2H75 A;  3TGZ A;  1G7E A;  5IPG A;  4CDO A;  4ZB6 A;  4ZL7 A;  1DE1 A;  2H1B A;  3UBL A;  1WRY A;  2C1Y A;  1B48 A;  1XFL A;  3P2A A;  3TKS A;  1WPI A;  4K8M A;  4IEL A;  4GRF A;  3UOM A;  4MMM A;  1ZYQ B;  3U6V A;  1R5P A;  3BD2 A;  2LS5 A;  1T00 A;  2IWT A;  2AV4 A;  1O6J A;  4WXT A;  5G5E A;  3IAM 2;  1ZZY A;  1I5G A;  5KN3 A;  2FY6 A;  2OE3 A;  3F4R A;  1FVJ A;  1T4Y A;  3L78 A;  3KZQ A;  1W89 A;  3LFL A;  4KND A;  4X1U A;  2OE0 A;  1TTZ A;  2NPB A;  1JZR A;  2B5X A;  2VUP A;  2FWF A;  2MMN A;  1EV4 A;  4KCE A;  2HRA A;  2H1D A;  4HS1 A;  2OKA A;  3QFA C;  1XWG A;  1RQM A;  3L0H A;  3KTL A;  3BOA A;  1NHO A;  4GST A;  1GTB A;  9GSS A;  4QL9 A;  3HDC A;  2O87 A;  3Q74 A;  2HRF A;  2TRX A;  4ML6 A;  3CSI A;  5IO2 A;  2PBJ A;  1GNW A;  3DVW A;  4BVY B;  4F0C A;  1A0F A;  4PX1 A;  4OCF A;  3FW2 A;  3EVI A;  1PKW A;  5B6M A;  4KDY A;  4FO5 A;  2V41 A;  4EC0 A;  1R5A A;  2F8F A;  4FYU A;  4L8E A;  5HR3 A;  2H0G A;  1NSW A;  4D73 B;  2H6Y A;  1M99 A;  12GS A;  3E9J B;  3RPN A;  4I2U A;  5ECM B;  5COH A;  3LQ7 A;  4MZW A;  4MJA A;  3WGD A;  5CNW A;  4Q5N A;  4IS0 A;  3O6T A;  3HJO A;  4KAE A;  4KH7 A;  1TDI A;  5F0G A;  1Z9H A;  2N5B A;  3D22 A;  4JR4 A;  3CYN A;  1KEB A;  4MLY A;  5G2Z A;  4JR6 A;  2YOI A;  3GTU A;  4LL1 B;  4DEJ A;  4N30 A;  4OWY A;  4KB3 A;  3EWL A;  3FR3 A;  1CQG A;  2I9H A;  1T8E B;  3RDW A;  3ZVJ A;  5KN1 A;  3P7X A;  3Q19 A;  2LST A;  4OFM A;  2FLS A;  2PWJ A;  1M2D A;  3SWL A;  5KN0 A;  1ZCP A;  3NIV A;  2E0Q A;  4K7N A;  3IV4 A;  1YKA A;  4PTS A;  2LJA A;  4XCS A;  8GSS A;  3GRX A;  5A4W A;  3FEU A;  4WET A;  4BPY A;  2AJQ B;  3SBC A;  2VCX A;  2C0D A;  2H01 A;  2LQO A;  4HQZ A;  4MK3 A;  2A4V A;  3D4M A;  3CBU A;  5INY A;  2GT6 A;  1O7U A;  3F0I A;  2HFD A;  2LV3 A;  4V2M A;  2CAI A;  3H1N A;  2PER A;  5F05 A;  5CRH A;  5G30 A;  4RUV A;  4LMW A;  5F06 A;  2H30 A;  5DVB A;  4FIW A;  2F9S A;  3F6D A;  2YWM A;  5C04 A;  3L9V A;  1QXH A;  2A2R A;  4K1F A;  2ALB A;  1YZX A;  3GSS A;  3A2W A;  1SKS B;  1JLW A;  4GSS A;  6GSV A;  3QR6 A;  1Z5Y E;  3GMF A;  1WOU A;  1EGR A;  2WRT A;  3IRA A;  2EIR A;  2HRK A;  1ERT A;  5FWG A;  3IK7 A;  4X0X A;  3F3Q A;  1PL2 A;  5GAN D;  5ECL B;  3ZVJ D;  4LA1 A;  4GWR A;  2ZNM A;  3BCI A;  2F51 A;  5G1K A;  2H70 A;  2G2Q A;  2IMF A;  1AW9 A;  1MD4 A;  2F8A A;  2R3X A;  1GP1 A;  4EVM A;  1Z3E A;  4Q5Q A;  1V40 A;  3ISO A;  18GS A;  4WBJ A;  4FQU A;  1FW1 A;  1B8X A;  5IM9 A;  4PNF A;  3ZRE A;  4KDU A;  3CSH A;  4F9Z A;  3HVX A;  2CX4 A;  3C1R A;  2JSZ A;  2BJX A;  2PMT A;  1A8L A;  2K9F A;  2C3N A;  3LEF A;  3I69 A;  4RQX A;  5FHI A;  5DCG A;  1JZD A;  1SD8 A;  1HD2 A;  4GQF A;  3FKF A;  4G2E A;  5DAL B;  3GX0 A;  1DBY A;  4XRA A;  3O76 A;  2H0H A;  1LU4 A;  3TJF A;  5EL8 A;  3ZLP A;  1XWK A;  4XIH A;  5ECR B;  2OAC A;  3DIE A;  1K3Y A;  2IJY A;  1X9M B;  4MPF A;  1X5E A;  1EOH A;  3DVX A;  4Z7X A;  1X9S B;  1YKC A;  2H19 A;  1GRX A;  3MSZ A;  3UAR A;  3NOF A;  3M3M A;  3ZML A;  1E6B A;  2IFQ B;  4BVX B;  1SD9 A;  5KEJ A;  1AXD A;  2GVP A;  1G0T A;  3VLN A;  3D5J A;  2ES7 A;  2NTO A;  2FD3 A;  1J08 A;  1GSF A;  2GSS A;  3GKM A;  3KP8 A;  4KE3 A;  4HI7 A;  3BBY A;  3VUR A;  5LNK e;  1OC8 A;  1K3L A;  3KP9 A;  2PPT A;  2TIR A;  5ECP B;  1KBN A;  4GSN A;  4PQ1 A;  5J9B A;  4XS6 A;  4PXO A;  4FYB A;  1ML6 A;  1TK8 B;  2B7K A;  1KNG A;  2YZU A;  2H74 A;  5ECS A;  1UA5 A;  3KTB A;  2JL4 A;  4L0W A;  1XW9 A;  2GZP A;  1TRV A;  2XC2 A;  2B1K A;  4O32 A;  5ELA A;  3GL5 A;  3F4T A;  5ID2 A;  4KCA A;  3RPP A;  4KDX A;  1YF1 A;  4KX4 A;  2H6X A;  3LWA A;  1XIY A;  2CVK A;  3H79 A;  3DML A;  3TUE A;  2JAD A;  5DQS A;  4PQI A;  5AIV A;  1UC7 A;  14GS A;  4K6X A;  1OKD A;  2FNO A;  4ZB9 A;  2YV7 A;  3L4N A;  5DJL A;  5ELG A;  2YJH A;  3IR4 A;  2JZR A;  1H75 A;  1ERU A;  1B9X C;  2DMM A;  2HSH A;  3EMP A;  2X99 A;  3QMX A;  4TXV A;  2HXK A;  3GUS A;  4IJ3 A;  2A2S A;  4TR1 B;  3KXO A;  1S3C A;  2GTU A;  1UN2 A;  2E2G A;  2DSA A;  2L6D A;  4H86 A;  5HR1 A;  2FWH A;  1XPV A;  2LTK A;  1NM3 A;  2IIY A;  5GSS A;  1JHB A;  1G6Y A;  2V2G A;  1USB A;  3DKS A;  20GS A;  4Q5R A;  3VWW A;  2H8L A;  3GIX A;  4NMU A;  5IMD A;  3HD5 A;  1A23 A;  4L5L A;  2B5Y A;  3KGK A;  1LBK A;  2B1L A;  4BA7 A;  2YWN A;  4G9H A;  4ZBD A;  4QQ7 A;  2AHE A;  4TR3 A;  1S3A A;  2O89 A;  2VM2 A;  1F9M A;  1VGL A;  2JAC A;  3RHC A;  3EYT A;  3RHB A;  1TRU A;  2C0F A;  3TJJ A;  1TRW A;  2XHF A;  2VD0 A;  3HVS A;  3W8J A;  2RUE A;  2WGR A;  3CMI A;  3LYP A;  6GSW A;  3GL3 A;  4PQH A;  2LEG A;  2J23 A;  3M8N A;  1HYU A;  3Q6O A;  5DBQ A;  1V2A A;  4HU7 A;  4MF7 A;  4EF0 A;  3UBK A;  1PMT A;  5D9V A;  4BL7 B;  2HRN A;  3KD0 A;  5AN1 A;  2J9H A;  4I5Q A;  4PUR A;  4K2D A;  4TW5 A;  3VK9 A;  1GSU A;  5LCZ A;  1YQ1 A;  1U6T A;  2LUS A;  1TXX A;  10GS A;  2CZ2 A;  3KEB A;  1SL2 B;  2FA4 A;  1EP7 A;  4HJ2 A;  3TJG A;  2GDR A;  4KF9 A;  3GV1 A;  4WR5 A;  1RW1 A;  1PX7 A;  2H72 A;  3VWV A;  2L5L A;  3EC3 A;  3F4S A;  2B5E A;  2HSY A;  2HSM A;  4MZC A;  1HNB A;  3IBH A;  4YH2 A;  2VL2 A;  4ZB8 A;  4HZ4 A;  5IMZ A;  3HXS A;  3FK8 A;  2XPE A;  3QAV A;  5J41 A;  1HNA A;  3LYK A;  1EZK A;  3R3E A;  4V1A g;  3DGQ A;  3FRC A;  2CVD A;  2R5G A;  1F3A A;  3IA1 A;  3FHK A;  4N0Z A;  3RAZ A;  1U88 A;  1A2L A;  1M9A A;  3EE2 A;  2O8V B;  4ULX A;  4PUA A;  3QAW A;  4USS A;  6GSY A;  2LNS A;  4V1A p;  2K8V A;  1Q4J A;  5AIX A;  2WUL A;  1GSE A;  2QSI A;  3DRN A;  1YY7 A;  2FUG 2;  3M0F A;  2FA8 A;  4P3Y B;  3QPM A;  2DJK A;  3C8E A;  3TRQ A;  5HR0 A;  2RII A;  1SYX A;  4AJ8 A;  1GLP A;  3CTF A;  4ILF A;  5HQP A;  5CRE A;  3RBT A;  1A8Y A;  1TW9 A;  3KH7 A;  4TOP A;  4IW9 A;  1C72 A;  2QC7 A;  3HYP A;  4GXZ A;  4WEY A;  4J2F A;  1WIK A;  1M2A A;  2AAW A;  3TOU A;  2HZE B;  1EWX A;  1OC9 B;  1GWC A;  1EEJ A;  3EU4 A;  3MDK A;  2V6O A;  2P5Q A;  1SK1 A;  1PSQ A;  5E4W A;  3ME8 A;  3VPQ A;  2P5R A;  3A5W A;  3ZFB A;  1Y6E A;  5ECK B;  5JWR B;  1E2Y A;  4XTS A;  5HFI A;  3FYG A;  1HNC A;  4MCU A;  3ERF A;  2D2Z A;  2KLX A;  1G6W A;  1K0B A;  2GQL A;  3HZ4 A;  4ECJ A;  1VF2 A;  2OE1 A;  3ZIJ A;  3LGC A;  5CP1 A;  1QGV A;  1S3D A;  5D96 A;  2OBK A;  4G19 A;  3LG6 A;  4OO4 A;  5KN2 A;  3IC4 A;  1SJI A;  2GQM A;  4NHW A;  2VOC A;  1GTA A;  1SYR A;  2N5F A;  1X5D A;  2DIZ A;  4LMV A;  3MNG A;  4GCI A;  4NAX A;  1SKR B;  2L6C A;  3HHV A;  4YQU A;  1LJR A;  1VF3 A;  4ECC A;  3K8N A;  2F3M A;  3HJM A;  5IPH A;  3CSJ A;  4F03 A;  5H5Q A;  2CX3 A;  5ECI B;  4BWS A;  4NXI A;  2I81 A;  2M80 A;  3EU3 A;  5AGY A;  2C80 A;  5EY6 A;  1FOV A;  4OMV A;  2ON5 A;  1TOF A;  5A4U A;  3I6A A;  1ABA A;  4EE0 A;  4I6X A;  1A2M A;  1U87 A;  2C0G A;  2VCZ A;  3A2V A;  17GS A;  4KW6 A;  1UVZ A;  4IN0 A;  4PUF C;  3DXB A;  3G7I A;  1IYH A;  4K9Z A;  1JFU A;  3PH9 A;  4DSS B;  1AQV A;  4KUN A;  3JCM L;  3FZA A;  2I3Y A;  2DIY A;  4ECB A;  3DD3 A;  1X5C A;  4GF0 A;  5IO0 A;  3N5O A;  3D6I A;  5FT3 A;  5A5K A;  2LRN A;  4BVY A;  3C73 A;  4E8H A;  3ZRD A;  3KJY A;  3WT2 A;  4MA9 A;  2CA8 A;  3L9U A;  1TI3 A;  2KOK A;  1XCC A;  3PIN A;  1A0R P;  2AUV A;  5D9X A;  1OAZ A;  3U5R E;  1H4O A;  4D73 A;  2DC5 A;  3P90 A;  5D73 A;  5H5R A;  1TJD A;  4ID0 A;  1WP0 A;  1ON4 A;  6GSX A;  2WJU A;  1V9W A;  4G0I A;  1EP8 A;  1J0F A;  2H1G A;  4IBP A;  4HUA A;  2WB9 A;  4KSM A;  1B9Y C;  4XHM A;  1XZO A;  1THO A;  1MDJ A;  1Z7P A;  5CRW A;  2KP2 A;  4OFN A;  2P0G A;  5ECO B; 
#chains in the Genus database with same CATH topology
 4XRD A;  5B6N A;  1JZW A;  3TKS C;  4K0G A;  1GSS A;  4POM A;  1EV9 A;  1QFN A;  4JE1 A;  4TR0 A;  4KSO A;  1K0O A;  4PNG A;  2C3T A;  3GST A;  2V1M A;  1PD2 1;  3PR8 A;  2KHP A;  2AYT A;  1GH2 A;  1TXU A;  2E7P A;  2C4J A;  2MBS A;  1XOA A;  4MJB A;  2Z9S A;  2HQT A;  1OKT A;  1ZOF A;  4ZL9 A;  1GTI A;  2DJ2 A;  3ZYW A;  4K2X A;  3VI5 A;  5A1N B;  2PN8 A;  5CRD A;  5J40 A;  1GUM A;  2K6V A;  3E0U A;  3CRT A;  5D93 A;  4MJC A;  2VO4 A;  2A2P A;  2NDO A;  2L59 A;  1VRS D;  1T7P B;  4JBB A;  2VLU A;  2HT9 A;  4EDZ A;  2VD1 A;  2NBS A;  3ZMK A;  2WFC A;  2HLS A;  5IMC A;  1SJ6 A;  4DSQ A;  3FY7 A;  4GLT A;  2E2M A;  3GKK A;  5A5H B;  4O92 A;  1OVN A;  2GZZ A;  1VF1 A;  1YEX A;  4JED A;  2L5O A;  4QL7 A;  3GX8 A;  4K0N A;  3C7M A;  4IJI A;  1M7T A;  1BAY A;  4ZL8 A;  4ECI A;  5J5N A;  2R2J A;  3EUR A;  2FGX A;  11GS A;  1K0A A;  3A2X A;  3HCZ A;  2JU5 A;  4HJM A;  2H76 A;  4EXJ A;  2LJK A;  2R37 A;  2WW1 A;  3TKR A;  2PU9 C;  1Z6N A;  3IE3 A;  5D9T A;  2RM5 A;  1PL1 A;  2GST A;  3VPT A;  2XPD A;  3UIW A;  1FAA A;  1T4Z A;  3F8U A;  1F2E A;  4IKH A;  4LL4 B;  3E3E A;  2DJ0 A;  4DSR A;  3TOT A;  2VL3 A;  4TRX A;  2TRC P;  2ZUP A;  1X0R A;  1X9W B;  1GUL A;  2IMI A;  2HE3 A;  1XW6 A;  3ZIV A;  2B7J A;  3HVV A;  4YAP A;  2O7K A;  3GA4 A;  3HVN A;  1MTC A;  4ML1 A;  3IOS A;  5ABR A;  3FZ9 A;  4MZB A;  1GUK A;  1YJ6 A;  4G0L A;  1PX6 A;  4O7H A;  3APO A;  1F37 A;  2YJ7 A;  2M46 A;  2LJR A;  3D21 A;  1B4Q A;  2YAN A;  1GSQ A;  1GLQ A;  4JZQ A;  2YPM A;  4AKX B;  4MP4 A;  1HQO A;  5C00 A;  4GTU A;  3VWU A;  2RM6 A;  5DAL A;  3WYW A;  3QAG A;  1R4W A;  1O8W A;  2VKZ G;  4FYC A;  16GS A;  4OFT A;  4Z2T A;  2REM A;  3H4K A;  1QUW A;  3LJR A;  2H0I A;  5ECN B;  3FR9 A;  4F0B A;  1F3B A;  1SL0 B;  2NVL A;  2X8G A;  3CQF A;  1EEM A;  1GNE A;  3IC8 A;  5DAK A;  3I43 A;  1K0M A;  3QDN A;  3HZ8 A;  3F63 A;  4ACS A;  3GH9 A;  1AC1 A;  1K0N A;  3TB2 A;  1GSY A;  5IMV A;  2IFQ A;  2OBI A;  3GTU B;  1BG1 A;  2N5A A;  2VLT A;  1V57 A;  3IDV A;  1AIU A;  4OO5 A;  5CO3 A;  1XWA A;  3TRP A;  5AIS A;  2QGV A;  1YF0 A;  1TKD B;  1EOG A;  4TN8 A;  5JWQ B;  1SEN A;  3QCP A;  3ZZX A;  3EIN A;  4CHS A;  1Z7R A;  3TJB A;  2RUF A;  5B7C A;  4L5O A;  2ZCT A;  3APQ A;  3GN3 A;  1A2J A;  1WJK A;  5DQY A;  1KTE A;  1M0U A;  2DJ3 A;  2B6M A;  3UAP A;  1JLV A;  5J4U A;  3HKR A;  1R26 A;  3J7Y k;  3VFI A;  1DE2 A;  5E59 A;  3GUR A;  2V32 A;  4YQV A;  3DEX A;  2MMZ A;  1YEP A;  4RQR A;  2IN3 A;  1Q98 A;  4G10 A;  2GT5 A;  1BJX A;  1SU9 A;  3IXR A;  4NPB A;  1V58 A;  1ST9 A;  3W8S A;  2VLV A;  1EGO A;  1T3B A;  5IMA A;  2G0F A;  2K18 A;  5BRT A;  4TR4 A;  4EL1 A;  2A4H A;  4IVF A;  4MF6 A;  3G9B A;  22GS A;  3WGX A;  4Z2U A;  1WMJ A;  3KMO A;  1TU7 A;  2OA7 A;  3LXZ A;  3O3T A;  3IK9 A;  2PGT A;  2PUK C;  4I97 A;  3WT1 A;  3QFB C;  5EPF A;  4ZBB A;  4POB A;  5G1L A;  2R4V A;  4I8B A;  3KMN A;  1OE8 A;  4TR1 A;  4EIP A;  1TU8 A;  3UMA A;  1SVO A;  3Q18 A;  3HY2 A;  2WW0 A;  2HRK B;  1SKW B;  1A24 A;  4MDC A;  1ERV A;  3FZ4 A;  4XS4 A;  1TK0 B;  1XXU A;  2H6Z A;  3CTG A;  3GFK A;  3TRX A;  3P8W A;  2ON7 A;  2JZT A;  4AF2 A;  2DJ1 A;  4TXO A;  1WWJ A;  4HEA 2;  3UL3 A;  4OD7 A;  3CXG A;  2CQ9 A;  2FHE A;  3ERG A;  1PRX A;  1U3A A;  1BX9 A;  2C3Q A;  4POK A;  5A4V A;  4TVE A;  3WGE A;  2VM1 A;  3FZ5 A;  3ZL5 A;  1GL8 A;  2KUC A;  4K5S A;  5JWO B;  3WD6 A;  3QD9 A;  4AGS A;  2WS2 A;  1TRS A;  2MMA A;  2WCI A;  3AY8 A;  2M72 A;  1N8J A;  3PPU A;  4ZXG A;  4XS1 A;  2C0E A;  5CRG A;  3ZTL A;  5JCW A;  4WF4 A;  4MH3 A;  1DUG A;  3CRU A;  3US3 A;  3VI7 A;  3APS A;  3RGB C;  3L9S A;  4N10 A;  4BL7 A;  1XBS A;  2HSN B;  4WF5 A;  4NWY A;  1AQW A;  1YDK A;  4ZIJ A;  2OJL A;  6GST A;  1WE0 A;  1IYI A;  2WVX A;  4O5R A;  2MBT A;  5CYY A;  2QA1 A;  5DDL A;  2MZC A;  3F6F A;  3MAK A;  1YVL A;  3CWG A;  4IQ1 A;  1M9B A;  2DBC A;  4KA0 A;  2O3E A;  5ENU A;  2IMD A;  2QKE A;  1K3O A;  3HA9 A;  3I9V 2;  4F82 A;  4CY6 A;  3D0Z A;  1B4P A;  1G7O A;  1W4V A;  2BTO T;  5GZZ B;  2HI7 A;  1T1V A;  2PVQ A;  4POL A;  2VCW A;  3NZN A;  5F8B A;  1DSB A;  1FB0 A;  2FCH A;  3A3T A;  4MPG A;  4Q5F A;  4J56 E;  5JCG A;  2WZ9 A;  3MWH A;  1S4B P;  4TKY A;  1QMV A;  3UEM A;  1V98 A;  2GQK A;  3D4T A;  2V6K A;  2L4Q A;  4HDE A;  2IMK A;  5IIZ A;  2GLR A;  3GKN A;  4G0K A;  5GST A;  3V1W A;  4IQA A;  1SK0 A;  1PKZ A;  2LNT A;  3TKS E;  1RK4 A;  1OC3 A;  5ECH B;  1MEK A;  3GNJ A;  4N0V A;  3ERW A;  2FWE A;  2EIO A;  2R0C A;  4MF5 A;  1QK8 A;  2K8S A;  3TKQ A;  3BJ5 A;  1FO5 A;  1R7H A;  3KM6 A;  4HOJ A;  2HYX A;  3IAS 2;  1SK2 A;  2H1A A;  4MJE A;  4L0U A;  4IGJ A;  4I2T A;  2VIM A;  3FR6 A;  2MYG A;  4F2I A;  4WBR D;  2IL3 A;  4G01 A;  2LKU A;  5ID2 B;  3LXT A;  2FWG A;  1XW5 A;  1CQH A;  3DWV A;  5B8B A;  5DCH A;  3GYK A;  1ZGN A;  2YWI A;  3F3R A;  1GTU A;  1MDI A;  1ILO A;  5G31 A;  4KGI A;  3M9K A;  5HR2 A;  3TDG A;  3UVH A;  5J4Y A;  5BMU A;  2EC4 A;  2LRC A;  2KP1 A;  5A34 B;  4J57 E;  4A5P A;  2HZE A;  1U3I A;  1OC9 A;  1PFO A;  3DYR A;  1BG5 A;  2H71 A;  3GH6 A;  1ZMA A;  4YQM A;  2GS3 A;  4O5Q A;  2I1U A;  2CAQ A;  19GS A;  2X64 A;  4V2N A;  1FG4 A;  2DML A;  4WKW A;  5IOX A;  4ISD A;  5LD0 A;  2LRT A;  1XWB A;  5D8I A;  2VCQ A;  6GSU A;  5JCU A;  2VL2 C;  4WR4 A;  5ECQ B;  2IPA A;  1QQ2 A;  2VCT A;  5HFK A;  1F6M C;  2BMX A;  4IP6 A;  5J9C A;  1AUC A;  1TP9 A;  2AB6 A;  2YCD A;  1NW2 A;  5IQY A;  2GSQ A;  1O8X A;  2O36 A;  5DAK B;  1MDK A;  1Z6M A;  5D9W A;  2XBI A;  4BWQ A;  3N9J A;  4EO3 A;  2VL9 A;  3UJ1 A;  1PN9 A;  1BYE A;  2PVO C;  1VF4 A;  2XBQ A;  4CW9 A;  4IP1 A;  2CV4 A;  5J3R A;  1I9D A;  1O81 A;  4PGT A;  1URM A;  3J7Y b;  1SJZ A;  2L4C A;  4ZBA A;  4EKZ A;  3OR5 A;  2YP6 A;  2JZS A;  2YWO A;  2O85 A;  3VWX A;  4LLR A;  4NV2 A;  1BQ7 A;  1XVQ A;  3ED3 A;  5G5F A;  1OE7 A;  1TK5 B;  4EUY A;  3R2Q A;  3C71 A;  2X8H A;  4DSS A;  2DJJ A;  2H66 A;  2WW3 A;  5GAP D;  3ZFL A;  3KCM A;  1AQX A;  3KH9 A;  4MAB A;  3M9J A;  7GSS A;  2CZ3 A;  6GSS A;  4GQC A;  1J9B A;  2YNX A;  2HSM B;  2CT6 A;  1Y25 A;  1PA3 A;  2OAD A;  1M2B A;  5CAX A;  3C1S A;  3QOU A;  4AKI A;  5F07 A;  5EVO A;  3KIJ A;  4K7O A;  3H93 A;  1AAZ A;  5L71 A;  4NHZ A;  4FH8 A;  5HFG A;  3W6G A;  4EDY A;  2HNL A;  1XWC A;  2HZF A;  1XOB A;  4DVC A;  2X8C A;  5H5S A;  1ZL9 A;  4O5U A;  2CVB A;  2YZH A;  3LSZ A;  2LQQ A;  4RI7 A;  4JRR A;  4N11 A;  3F9U A;  1ERW A;  13GS A;  2P31 A;  1MD3 A;  2L57 A;  3IPZ A;  5IOW A;  4AJ6 A;  3HJP A;  1PQN A;  3PGT A;  1OYJ A;  4OCE A;  4AKH A;  3EMX A;  2R6K A;  5B8A A;  3H8Q A;  1K0D A;  1NHY A;  5DJM A;  3TCO A;  2H73 A;  4YAV A;  1GUH A;  3LOR A;  2UZ8 A;  3BCK A;  2I4A A;  1O73 A;  3UVT A;  1FHE A;  4HU9 A;  2YN1 A;  1FB6 A;  4XS4 B;  1TI1 A;  3GHA A;  1THX A;  1FVK A;  4HZ2 A;  2GZY A;  4HQS A;  4K7I A;  3S9F A;  4JU5 A;  4TXO B;  2WDU A;  2VAF A;  4NV5 A;  2RLI A;  1N25 A;  3TKP A;  2VCV A;  3IHQ A;  3M1G A;  2MMO A;  1N2A A;  1PGT A;  4E8E A;  4ZIL A;  3ME7 A;  1JZO A;  5A1N A;  1XVW A;  1ACV A;  3ZIT A;  3GKX A;  5IMF A;  3G7J A;  1GSD A;  2IME A;  4AJ7 A;  4BVX A;  1ZYE A;  3EPT A;  4IHU A;  4V2L A;  2JSY A;  2YV9 A;  2B3S A;  3TJK A;  4MH2 A;  1O85 A;  2GGT A;  3G7Y A;  2C8U A;  2GSR A;  1BED A;  4X43 A;  1K0C A;  1SL1 B;  4RI6 A;  2DLX A;  2EIQ A;  2H75 A;  3TGZ A;  1G7E A;  5IPG A;  4CDO A;  4ZB6 A;  4ZL7 A;  1DE1 A;  2H1B A;  5A5H A;  3UBL A;  1WRY A;  5KOX A;  2C1Y A;  2X49 A;  1B48 A;  1XFL A;  3P2A A;  3TKS A;  1WPI A;  4K8M A;  4IEL A;  2UV8 G;  4GRF A;  3UOM A;  4MMM A;  1ZYQ B;  3U6V A;  1R5P A;  3BD2 A;  2LS5 A;  1T00 A;  2IWT A;  2AV4 A;  4E68 A;  1O6J A;  4WXT A;  5G5E A;  3IAM 2;  1ZZY A;  1I5G A;  5KN3 A;  2FY6 A;  2OE3 A;  3F4R A;  1FVJ A;  1T4Y A;  3L78 A;  3KZQ A;  1SVL A;  1W89 A;  1PN0 A;  3LFL A;  4KND A;  4X1U A;  2X4A A;  2OE0 A;  1TTZ A;  2NPB A;  1JZR A;  2B5X A;  2VUP A;  2FWF A;  2MMN A;  1EV4 A;  1ZYN A;  4KCE A;  2HRA A;  2H1D A;  4HS1 A;  2OKA A;  3QFA C;  1XWG A;  1RQM A;  3L0H A;  3KTL A;  3MIX A;  3BOA A;  1NHO A;  4YKG A;  4GST A;  1GTB A;  2EFH A;  9GSS A;  4QL9 A;  3HDC A;  2O87 A;  3Q74 A;  2HRF A;  2TRX A;  4ML6 A;  3CSI A;  5IO2 A;  2PBJ A;  1GNW A;  3DVW A;  4BVY B;  4F0C A;  1A0F A;  4PX1 A;  4OCF A;  3FW2 A;  3EVI A;  1PKW A;  5B6M A;  4KDY A;  4FO5 A;  2V41 A;  4EC0 A;  1R5A A;  2F8F A;  4FYU A;  4L8E A;  5HR3 A;  2H0G A;  1NSW A;  4D73 B;  2H6Y A;  1M99 A;  12GS A;  3E9J B;  3RPN A;  4I2U A;  5ECM B;  5COH A;  3LQ7 A;  4MZW A;  4MJA A;  3WGD A;  5CNW A;  4Q5N A;  4Z2R A;  4IS0 A;  3O6T A;  3HJO A;  4KAE A;  4KH7 A;  1TDI A;  5F0G A;  1Z9H A;  2N5B A;  3D22 A;  4JR4 A;  3CYN A;  1KEB A;  4MLY A;  5G2Z A;  4JR6 A;  2YOI A;  3GTU A;  1S3R A;  4LL1 B;  4DEJ A;  4N30 A;  4OWY A;  4KB3 A;  3EWL A;  3FR3 A;  1CQG A;  2I9H A;  1T8E B;  3MYD A;  4AI6 A;  4X4J A;  3RDW A;  3ZVJ A;  5KN1 A;  4PI2 C;  3P7X A;  3Q19 A;  2LST A;  4OFM A;  2FLS A;  2PWJ A;  1M2D A;  3SWL A;  4GDF A;  5KN0 A;  1ZCP A;  3NIV A;  2E0Q A;  4K7N A;  3IV4 A;  1YKA A;  4PTS A;  2LJA A;  4XCS A;  8GSS A;  3GRX A;  5A4W A;  3FEU A;  4WET A;  4BPY A;  2AJQ B;  3SBC A;  2VCX A;  2C0D A;  2H01 A;  2LQO A;  4HQZ A;  1YEW C;  4MK3 A;  2A4V A;  3D4M A;  3CBU A;  4K5R A;  5INY A;  2GT6 A;  1O7U A;  3F0I A;  2HFD A;  4YKF A;  2LV3 A;  4V2M A;  2O5V A;  2CAI A;  3H1N A;  2PER A;  4N3Z A;  5F05 A;  5CRH A;  5G30 A;  4RUV A;  4LMW A;  5F06 A;  2H30 A;  5DVB A;  4FIW A;  2F9S A;  3F6D A;  2YWM A;  5C04 A;  3L9V A;  1QXH A;  2A2R A;  4K1F A;  1BF5 A;  2ALB A;  1YZX A;  3GSS A;  3A2W A;  2R0G A;  1SKS B;  1JLW A;  4GSS A;  6GSV A;  3QR6 A;  5KOW A;  1Z5Y E;  3GMF A;  1WOU A;  1EGR A;  2WRT A;  3IRA A;  2EIR A;  2HRK A;  1ERT A;  5FWG A;  3IK7 A;  4X0X A;  3F3Q A;  1PL2 A;  5GAN D;  5ECL B;  3ZVJ D;  4LA1 A;  4GWR A;  2ZNM A;  3BCI A;  1Y1U A;  2F51 A;  5G1K A;  2H70 A;  2G2Q A;  2IMF A;  1AW9 A;  1MD4 A;  2F8A A;  2R3X A;  1GP1 A;  4EVM A;  1Z3E A;  4Q5Q A;  1V40 A;  3ISO A;  18GS A;  4WBJ A;  4FQU A;  1FW1 A;  1B8X A;  4ZB7 A;  5IM9 A;  4PNF A;  3ZRE A;  4KDU A;  3CSH A;  4F9Z A;  3HVX A;  2CX4 A;  3C1R A;  2JSZ A;  2BJX A;  2PMT A;  1A8L A;  2K9F A;  2C3N A;  3LEF A;  3I69 A;  4RQX A;  3HMJ G;  5FHI A;  5DCG A;  1JZD A;  1SD8 A;  1HD2 A;  4GQF A;  3FKF A;  4G2E A;  5DAL B;  3GX0 A;  1DBY A;  4XRA A;  2HSN A;  3O76 A;  2H0H A;  1LU4 A;  3TJF A;  2WW2 A;  5EL8 A;  3ZLP A;  4ICY A;  1XWK A;  4XIH A;  5ECR B;  2OAC A;  3DIE A;  1K3Y A;  2IJY A;  1X9M B;  4MPF A;  1X5E A;  1EOH A;  3DVX A;  4Z7X A;  1X9S B;  3IHG A;  1YKC A;  2H19 A;  1GRX A;  3MSZ A;  2WZS A;  3UAR A;  3NOF A;  3M3M A;  3ZML A;  3CHX C;  1E6B A;  2IFQ B;  4BVX B;  1SD9 A;  5KEJ A;  1AXD A;  5J4V A;  2GVP A;  1G0T A;  3VLN A;  3D5J A;  2ES7 A;  2NTO A;  2FD3 A;  1J08 A;  1ZYP A;  1GSF A;  2GSS A;  3GKM A;  3KP8 A;  4KE3 A;  4HI7 A;  3BBY A;  3VUR A;  5LNK e;  4W66 A;  1OC8 A;  2DKI A;  1K3L A;  3KP9 A;  2PPT A;  2TIR A;  5ECP B;  1KBN A;  4GSN A;  4PQ1 A;  5J9B A;  4XS6 A;  4PXO A;  4FYB A;  1ML6 A;  1TK8 B;  2B7K A;  1KNG A;  2YZU A;  2H74 A;  5ECS A;  1UA5 A;  3KTB A;  2JL4 A;  4L0W A;  1XW9 A;  2GZP A;  1TRV A;  2XC2 A;  2B1K A;  4O32 A;  5ELA A;  3GL5 A;  3FMW A;  3F4T A;  5ID2 A;  4KCA A;  3RPP A;  4KDX A;  1YF1 A;  4KX4 A;  2H6X A;  3LWA A;  1XIY A;  2CVK A;  3H79 A;  3DML A;  3TUE A;  2JAD A;  5DQS A;  4PQI A;  5AIV A;  1UC7 A;  4EIQ A;  14GS A;  4K6X A;  2WVZ A;  1OKD A;  2FNO A;  4ZB9 A;  2YV7 A;  3L4N A;  5DJL A;  5ELG A;  2YJH A;  3IR4 A;  2JZR A;  1H75 A;  1ERU A;  5A34 A;  1B9X C;  2DMM A;  2HSH A;  3EMP A;  2X99 A;  3QMX A;  4TXV A;  2HXK A;  3GUS A;  4IJ3 A;  2OT3 A;  2A2S A;  4TR1 B;  3KXO A;  1S3C A;  2GTU A;  1UN2 A;  2E2G A;  2DSA A;  2L6D A;  4H86 A;  5HR1 A;  2FWH A;  1XPV A;  2LTK A;  1NM3 A;  2IIY A;  5GSS A;  1JHB A;  1G6Y A;  2V2G A;  1USB A;  3DKS A;  20GS A;  4Q5R A;  3VWW A;  2H8L A;  3GIX A;  4NMU A;  5IMD A;  1FOH A;  3HD5 A;  1A23 A;  1M3J A;  4L5L A;  2B5Y A;  3KGK A;  1LBK A;  2B1L A;  4BA7 A;  2YWN A;  2R0P A;  4G9H A;  4ZBD A;  4QQ7 A;  2AHE A;  4TR3 A;  1S3A A;  2O89 A;  2VM2 A;  1F9M A;  1VGL A;  2JAC A;  2H1L A;  3RHC A;  3EYT A;  3RHB A;  1TRU A;  2C0F A;  3TJJ A;  1TRW A;  2XHF A;  2VD0 A;  3HVS A;  3W8J A;  2RUE A;  2WGR A;  3CMI A;  3LYP A;  6GSW A;  3GL3 A;  4PQH A;  2LEG A;  2J23 A;  3M8N A;  1HYU A;  3Q6O A;  5DBQ A;  1V2A A;  4HU7 A;  4MF7 A;  4EF0 A;  3UBK A;  1PMT A;  5D9V A;  4BL7 B;  1I1I P;  1XG8 A;  2HRN A;  3KD0 A;  5AN1 A;  2J9H A;  4I5Q A;  4PUR A;  4K2D A;  4TW5 A;  3VK9 A;  2WVX B;  1GSU A;  5LCZ A;  1YQ1 A;  1U6T A;  2LUS A;  1TXX A;  10GS A;  2CZ2 A;  3KEB A;  1SL2 B;  2FA4 A;  3A5I A;  1EP7 A;  4HJ2 A;  3TJG A;  2EFC A;  2GDR A;  4KF9 A;  3GV1 A;  4WR5 A;  1RW1 A;  1PX7 A;  2H72 A;  3VWV A;  2L5L A;  3EC3 A;  3F4S A;  4AKG A;  2B5E A;  2HSY A;  2HSM A;  4MZC A;  1HNB A;  3IBH A;  4YH2 A;  2VL2 A;  4ZB8 A;  4HZ4 A;  5IMZ A;  3HXS A;  2QA2 A;  3FK8 A;  2XPE A;  3QAV A;  5J41 A;  1HNA A;  3LYK A;  1EZK A;  3R3E A;  4V1A g;  3DGQ A;  3FRC A;  3RFR C;  2CVD A;  2R5G A;  1F3A A;  3IA1 A;  3FHK A;  4N0Z A;  3RAZ A;  1U88 A;  1A2L A;  1M9A A;  3EE2 A;  2O8V B;  4ULX A;  4PUA A;  3QAW A;  3LW9 A;  4USS A;  6GSY A;  2LNS A;  4V1A p;  2K8V A;  2EFD A;  1Q4J A;  5AIX A;  2WUL A;  1GSE A;  2QSI A;  3DRN A;  2DKH A;  1YY7 A;  5J47 A;  2FUG 2;  3M0F A;  2FA8 A;  4P3Y B;  4QMK A;  3QPM A;  2DJK A;  3C8E A;  3TRQ A;  5HR0 A;  2RII A;  1SYX A;  4AJ8 A;  1GLP A;  3CTF A;  4ILF A;  5HQP A;  4CY8 A;  5CRE A;  3RBT A;  1A8Y A;  1TW9 A;  3KH7 A;  4TOP A;  4IW9 A;  1C72 A;  5BMU B;  2QC7 A;  3HYP A;  4GXZ A;  4WEY A;  4J2F A;  1WIK A;  1M2A A;  2WVY A;  2AAW A;  3TOU A;  2HZE B;  1EWX A;  1OC9 B;  1GWC A;  4PI0 C;  1EEJ A;  3EU4 A;  3MDK A;  2V6O A;  2P5Q A;  1SK1 A;  1PSQ A;  5E4W A;  3ME8 A;  3VPQ A;  2P5R A;  3A5W A;  3ZFB A;  1Y6E A;  5ECK B;  5JWR B;  1E2Y A;  4XTS A;  5HFI A;  3FYG A;  1HNC A;  4MCU A;  3ERF A;  2D2Z A;  2KLX A;  1G6W A;  1K0B A;  2GQL A;  3HZ4 A;  4ECJ A;  1VF2 A;  2OE1 A;  1M3I A;  3ZIJ A;  3LGC A;  5CP1 A;  1QGV A;  4HSC X;  1S3D A;  5D96 A;  2OBK A;  4G19 A;  3LG6 A;  4OO4 A;  5KN2 A;  3IC4 A;  1SJI A;  4BIK A;  2GQM A;  4NHW A;  4FXY P;  2VOC A;  1GTA A;  1SYR A;  2N5F A;  1X5D A;  2DIZ A;  4LMV A;  4GCI A;  4NAX A;  3MNG A;  1SKR B;  2L6C A;  3HHV A;  4YQU A;  1LJR A;  1VF3 A;  4ECC A;  3K8N A;  2F3M A;  3HJM A;  5IPH A;  3CSJ A;  2EFE A;  4F03 A;  5H5Q A;  2CX3 A;  5ECI B;  4BWS A;  4NXI A;  2I81 A;  2M80 A;  3EU3 A;  5AGY A;  2C80 A;  5EY6 A;  1FOV A;  4OMV A;  3TU3 B;  2ON5 A;  1TOF A;  5A4U A;  3I6A A;  1ABA A;  4EE0 A;  4I6X A;  1A2M A;  1U87 A;  2C0G A;  2VCZ A;  3A2V A;  17GS A;  4KW6 A;  1UVZ A;  4IN0 A;  4PUF C;  3DXB A;  3G7I A;  1IYH A;  1SVM A;  1JFU A;  3PH9 A;  4K9Z A;  4DSS B;  1AQV A;  4KUN A;  3JCM L;  3FZA A;  2I3Y A;  2DIY A;  4ECB A;  3DD3 A;  1X5C A;  4GF0 A;  5IO0 A;  3N5O A;  3D6I A;  5FT3 A;  5A5K A;  2LRN A;  4BVY A;  3C73 A;  4E8H A;  3ZRD A;  3KJY A;  4MNN A;  3WT2 A;  4MA9 A;  2CA8 A;  3L9U A;  1TI3 A;  2KOK A;  4PHZ C;  1XCC A;  3PIN A;  1A0R P;  2AUV A;  5D9X A;  1OAZ A;  3U5R E;  1H4O A;  4D73 A;  2DC5 A;  3P90 A;  5D73 A;  5H5R A;  1TJD A;  4ID0 A;  1WP0 A;  1ON4 A;  6GSX A;  2WJU A;  1V9W A;  4G0I A;  1EP8 A;  1J0F A;  2H1G A;  4IBP A;  4HUA A;  2WB9 A;  4KSM A;  1B9Y C;  4XHM A;  1XZO A;  1THO A;  1MDJ A;  1Z7P A;  5CRW A;  2KP2 A;  4OFN A;  2P0G A;  5ECO B; 
#chains in the Genus database with same CATH homology
 4XRD A;  5B6N A;  1JZW A;  3TKS C;  4K0G A;  1GSS A;  4POM A;  1EV9 A;  1QFN A;  4JE1 A;  4TR0 A;  4KSO A;  1K0O A;  4PNG A;  2C3T A;  3GST A;  2V1M A;  1PD2 1;  3PR8 A;  2KHP A;  2AYT A;  1GH2 A;  1TXU A;  2E7P A;  2C4J A;  2MBS A;  1XOA A;  4MJB A;  2Z9S A;  2HQT A;  1OKT A;  1ZOF A;  4ZL9 A;  1GTI A;  2DJ2 A;  3ZYW A;  4K2X A;  3VI5 A;  5A1N B;  2PN8 A;  5CRD A;  5J40 A;  1GUM A;  2K6V A;  3E0U A;  3CRT A;  5D93 A;  4MJC A;  2VO4 A;  2A2P A;  2NDO A;  2L59 A;  1VRS D;  1T7P B;  4JBB A;  2VLU A;  2HT9 A;  4EDZ A;  2VD1 A;  2NBS A;  3ZMK A;  2WFC A;  2HLS A;  5IMC A;  1SJ6 A;  4DSQ A;  3FY7 A;  4GLT A;  2E2M A;  3GKK A;  5A5H B;  4O92 A;  1OVN A;  2GZZ A;  1VF1 A;  1YEX A;  4JED A;  2L5O A;  4QL7 A;  3GX8 A;  4K0N A;  3C7M A;  4IJI A;  1M7T A;  1BAY A;  4ZL8 A;  4ECI A;  5J5N A;  2R2J A;  3EUR A;  2FGX A;  11GS A;  1K0A A;  3A2X A;  3HCZ A;  2JU5 A;  4HJM A;  2H76 A;  4EXJ A;  2LJK A;  2R37 A;  3TKR A;  2PU9 C;  1Z6N A;  3IE3 A;  5D9T A;  2RM5 A;  1PL1 A;  2GST A;  3VPT A;  2XPD A;  3UIW A;  1FAA A;  1T4Z A;  3F8U A;  1F2E A;  4IKH A;  4LL4 B;  3E3E A;  2DJ0 A;  4DSR A;  3TOT A;  2VL3 A;  4TRX A;  2TRC P;  2ZUP A;  1X0R A;  1X9W B;  1GUL A;  2IMI A;  2HE3 A;  1XW6 A;  3ZIV A;  2B7J A;  3HVV A;  4YAP A;  2O7K A;  3GA4 A;  1MTC A;  4ML1 A;  3IOS A;  5ABR A;  3FZ9 A;  4MZB A;  1GUK A;  1YJ6 A;  4G0L A;  1PX6 A;  4O7H A;  3APO A;  1F37 A;  2YJ7 A;  2M46 A;  2LJR A;  3D21 A;  1B4Q A;  2YAN A;  1GSQ A;  1GLQ A;  4JZQ A;  2YPM A;  4AKX B;  4MP4 A;  1HQO A;  5C00 A;  4GTU A;  3VWU A;  2RM6 A;  5DAL A;  3WYW A;  3QAG A;  1R4W A;  1O8W A;  2VKZ G;  4FYC A;  16GS A;  4OFT A;  4Z2T A;  2REM A;  3H4K A;  1QUW A;  3LJR A;  2H0I A;  5ECN B;  3FR9 A;  4F0B A;  1F3B A;  1SL0 B;  2NVL A;  2X8G A;  1EEM A;  1GNE A;  3IC8 A;  5DAK A;  3I43 A;  1K0M A;  3QDN A;  3HZ8 A;  3F63 A;  4ACS A;  3GH9 A;  1AC1 A;  1K0N A;  3TB2 A;  1GSY A;  5IMV A;  2IFQ A;  2OBI A;  3GTU B;  1BG1 A;  2N5A A;  2VLT A;  1V57 A;  3IDV A;  1AIU A;  4OO5 A;  5CO3 A;  1XWA A;  3TRP A;  5AIS A;  2QGV A;  1YF0 A;  1TKD B;  1EOG A;  4TN8 A;  5JWQ B;  1SEN A;  3QCP A;  3ZZX A;  3EIN A;  4CHS A;  1Z7R A;  3TJB A;  2RUF A;  5B7C A;  4L5O A;  2ZCT A;  3APQ A;  3GN3 A;  1A2J A;  1WJK A;  5DQY A;  1KTE A;  1M0U A;  2DJ3 A;  2B6M A;  3UAP A;  1JLV A;  5J4U A;  3HKR A;  1R26 A;  3J7Y k;  3VFI A;  1DE2 A;  5E59 A;  3GUR A;  2V32 A;  4YQV A;  3DEX A;  2MMZ A;  1YEP A;  4RQR A;  2IN3 A;  1Q98 A;  4G10 A;  2GT5 A;  1BJX A;  1SU9 A;  3IXR A;  4NPB A;  1V58 A;  1ST9 A;  3W8S A;  2VLV A;  1EGO A;  1T3B A;  5IMA A;  2G0F A;  2K18 A;  5BRT A;  4TR4 A;  4EL1 A;  2A4H A;  4IVF A;  4MF6 A;  3G9B A;  22GS A;  3WGX A;  4Z2U A;  1WMJ A;  3KMO A;  1TU7 A;  2OA7 A;  3LXZ A;  3O3T A;  3IK9 A;  2PGT A;  2PUK C;  4I97 A;  3WT1 A;  3QFB C;  5EPF A;  4ZBB A;  4POB A;  5G1L A;  2R4V A;  4I8B A;  3KMN A;  1OE8 A;  4TR1 A;  4EIP A;  1TU8 A;  3UMA A;  1SVO A;  3Q18 A;  3HY2 A;  2HRK B;  1SKW B;  1A24 A;  4MDC A;  1ERV A;  3FZ4 A;  4XS4 A;  1TK0 B;  1XXU A;  2H6Z A;  3CTG A;  3GFK A;  3TRX A;  3P8W A;  2ON7 A;  2JZT A;  4AF2 A;  2DJ1 A;  4TXO A;  1WWJ A;  4HEA 2;  3UL3 A;  4OD7 A;  3CXG A;  2CQ9 A;  2FHE A;  3ERG A;  1PRX A;  1U3A A;  1BX9 A;  2C3Q A;  4POK A;  5A4V A;  4TVE A;  3WGE A;  2VM1 A;  3FZ5 A;  3ZL5 A;  1GL8 A;  2KUC A;  4K5S A;  5JWO B;  3WD6 A;  3QD9 A;  4AGS A;  2WS2 A;  1TRS A;  2MMA A;  2WCI A;  3AY8 A;  2M72 A;  1N8J A;  3PPU A;  4ZXG A;  4XS1 A;  2C0E A;  5CRG A;  3ZTL A;  5JCW A;  4WF4 A;  4MH3 A;  1DUG A;  3CRU A;  3US3 A;  3VI7 A;  3APS A;  3L9S A;  4N10 A;  4BL7 A;  1XBS A;  2HSN B;  4WF5 A;  4NWY A;  1AQW A;  1YDK A;  4ZIJ A;  2OJL A;  6GST A;  1WE0 A;  1IYI A;  4O5R A;  2MBT A;  5CYY A;  2QA1 A;  5DDL A;  2MZC A;  3F6F A;  3MAK A;  1YVL A;  3CWG A;  4IQ1 A;  1M9B A;  2DBC A;  4KA0 A;  5ENU A;  2IMD A;  2QKE A;  1K3O A;  3HA9 A;  3I9V 2;  4F82 A;  4CY6 A;  3D0Z A;  1B4P A;  1G7O A;  1W4V A;  2BTO T;  5GZZ B;  2HI7 A;  1T1V A;  2PVQ A;  4POL A;  2VCW A;  3NZN A;  5F8B A;  1DSB A;  1FB0 A;  2FCH A;  3A3T A;  4MPG A;  4Q5F A;  4J56 E;  5JCG A;  2WZ9 A;  3MWH A;  4TKY A;  1QMV A;  3UEM A;  1V98 A;  2GQK A;  3D4T A;  2V6K A;  2L4Q A;  4HDE A;  2IMK A;  5IIZ A;  2GLR A;  3GKN A;  4G0K A;  5GST A;  3V1W A;  4IQA A;  1SK0 A;  1PKZ A;  2LNT A;  3TKS E;  1RK4 A;  1OC3 A;  5ECH B;  1MEK A;  3GNJ A;  4N0V A;  3ERW A;  2FWE A;  2EIO A;  2R0C A;  4MF5 A;  1QK8 A;  2K8S A;  3TKQ A;  3BJ5 A;  1FO5 A;  1R7H A;  3KM6 A;  4HOJ A;  2HYX A;  3IAS 2;  1SK2 A;  2H1A A;  4MJE A;  4L0U A;  4IGJ A;  4I2T A;  2VIM A;  3FR6 A;  2MYG A;  4F2I A;  4WBR D;  2IL3 A;  4G01 A;  2LKU A;  5ID2 B;  3LXT A;  2FWG A;  1XW5 A;  1CQH A;  3DWV A;  5B8B A;  5DCH A;  3GYK A;  1ZGN A;  2YWI A;  3F3R A;  1GTU A;  1MDI A;  1ILO A;  5G31 A;  4KGI A;  3M9K A;  5HR2 A;  3TDG A;  3UVH A;  5J4Y A;  5BMU A;  2EC4 A;  2LRC A;  2KP1 A;  5A34 B;  4J57 E;  4A5P A;  2HZE A;  1U3I A;  1OC9 A;  3DYR A;  1BG5 A;  2H71 A;  3GH6 A;  1ZMA A;  4YQM A;  2GS3 A;  4O5Q A;  2I1U A;  2CAQ A;  19GS A;  2X64 A;  4V2N A;  1FG4 A;  2DML A;  4WKW A;  5IOX A;  4ISD A;  5LD0 A;  2LRT A;  1XWB A;  5D8I A;  2VCQ A;  6GSU A;  5JCU A;  2VL2 C;  4WR4 A;  5ECQ B;  2IPA A;  1QQ2 A;  2VCT A;  5HFK A;  1F6M C;  2BMX A;  4IP6 A;  5J9C A;  1AUC A;  1TP9 A;  2AB6 A;  2YCD A;  1NW2 A;  5IQY A;  2GSQ A;  1O8X A;  5DAK B;  1MDK A;  1Z6M A;  5D9W A;  2XBI A;  4BWQ A;  3N9J A;  4EO3 A;  2VL9 A;  3UJ1 A;  1PN9 A;  1BYE A;  2PVO C;  1VF4 A;  2XBQ A;  4CW9 A;  4IP1 A;  2CV4 A;  5J3R A;  1I9D A;  1O81 A;  4PGT A;  1URM A;  3J7Y b;  1SJZ A;  2L4C A;  4ZBA A;  4EKZ A;  3OR5 A;  2YP6 A;  2JZS A;  2YWO A;  2O85 A;  3VWX A;  4LLR A;  4NV2 A;  1BQ7 A;  1XVQ A;  3ED3 A;  5G5F A;  1OE7 A;  1TK5 B;  4EUY A;  3R2Q A;  3C71 A;  2X8H A;  4DSS A;  2DJJ A;  2H66 A;  5GAP D;  3ZFL A;  3KCM A;  1AQX A;  3KH9 A;  4MAB A;  3M9J A;  7GSS A;  2CZ3 A;  6GSS A;  4GQC A;  1J9B A;  2YNX A;  2HSM B;  2CT6 A;  1Y25 A;  1PA3 A;  2OAD A;  1M2B A;  5CAX A;  3C1S A;  3QOU A;  4AKI A;  5F07 A;  5EVO A;  3KIJ A;  4K7O A;  3H93 A;  1AAZ A;  5L71 A;  4NHZ A;  4FH8 A;  5HFG A;  3W6G A;  4EDY A;  2HNL A;  1XWC A;  2HZF A;  1XOB A;  4DVC A;  2X8C A;  5H5S A;  1ZL9 A;  4O5U A;  2CVB A;  2YZH A;  3LSZ A;  2LQQ A;  4RI7 A;  4JRR A;  4N11 A;  3F9U A;  1ERW A;  13GS A;  2P31 A;  1MD3 A;  2L57 A;  3IPZ A;  5IOW A;  4AJ6 A;  3HJP A;  1PQN A;  3PGT A;  1OYJ A;  4OCE A;  4AKH A;  3EMX A;  2R6K A;  5B8A A;  3H8Q A;  1K0D A;  1NHY A;  5DJM A;  3TCO A;  2H73 A;  4YAV A;  1GUH A;  3LOR A;  2UZ8 A;  3BCK A;  2I4A A;  1O73 A;  3UVT A;  1FHE A;  4HU9 A;  2YN1 A;  1FB6 A;  4XS4 B;  1TI1 A;  3GHA A;  1THX A;  1FVK A;  4HZ2 A;  2GZY A;  4HQS A;  4K7I A;  3S9F A;  4JU5 A;  4TXO B;  2WDU A;  2VAF A;  4NV5 A;  2RLI A;  1N25 A;  3TKP A;  2VCV A;  3IHQ A;  3M1G A;  2MMO A;  1N2A A;  1PGT A;  4E8E A;  4ZIL A;  3ME7 A;  1JZO A;  5A1N A;  1XVW A;  1ACV A;  3ZIT A;  3GKX A;  5IMF A;  3G7J A;  1GSD A;  2IME A;  4AJ7 A;  4BVX A;  1ZYE A;  3EPT A;  4IHU A;  4V2L A;  2JSY A;  2YV9 A;  2B3S A;  3TJK A;  4MH2 A;  1O85 A;  2GGT A;  3G7Y A;  2C8U A;  2GSR A;  1BED A;  4X43 A;  1K0C A;  1SL1 B;  4RI6 A;  2DLX A;  2EIQ A;  2H75 A;  3TGZ A;  1G7E A;  5IPG A;  4CDO A;  4ZB6 A;  4ZL7 A;  1DE1 A;  2H1B A;  5A5H A;  3UBL A;  1WRY A;  5KOX A;  2C1Y A;  2X49 A;  1B48 A;  1XFL A;  3P2A A;  3TKS A;  1WPI A;  4K8M A;  4IEL A;  2UV8 G;  4GRF A;  3UOM A;  4MMM A;  1ZYQ B;  3U6V A;  1R5P A;  3BD2 A;  2LS5 A;  1T00 A;  2IWT A;  2AV4 A;  4E68 A;  1O6J A;  4WXT A;  5G5E A;  3IAM 2;  1ZZY A;  1I5G A;  5KN3 A;  2FY6 A;  2OE3 A;  3F4R A;  1FVJ A;  1T4Y A;  3L78 A;  3KZQ A;  1SVL A;  1W89 A;  1PN0 A;  3LFL A;  4KND A;  4X1U A;  2X4A A;  2OE0 A;  1TTZ A;  2NPB A;  1JZR A;  2B5X A;  2VUP A;  2FWF A;  2MMN A;  1EV4 A;  1ZYN A;  4KCE A;  2HRA A;  2H1D A;  4HS1 A;  2OKA A;  3QFA C;  1XWG A;  1RQM A;  3L0H A;  3KTL A;  3MIX A;  3BOA A;  1NHO A;  4YKG A;  4GST A;  1GTB A;  2EFH A;  9GSS A;  4QL9 A;  3HDC A;  2O87 A;  3Q74 A;  2HRF A;  2TRX A;  4ML6 A;  3CSI A;  5IO2 A;  2PBJ A;  1GNW A;  3DVW A;  4BVY B;  4F0C A;  1A0F A;  4PX1 A;  4OCF A;  3FW2 A;  3EVI A;  1PKW A;  5B6M A;  4KDY A;  4FO5 A;  2V41 A;  4EC0 A;  1R5A A;  2F8F A;  4FYU A;  4L8E A;  5HR3 A;  2H0G A;  1NSW A;  4D73 B;  2H6Y A;  1M99 A;  12GS A;  3E9J B;  3RPN A;  4I2U A;  5ECM B;  5COH A;  3LQ7 A;  4MZW A;  4MJA A;  3WGD A;  5CNW A;  4Q5N A;  4Z2R A;  4IS0 A;  3O6T A;  3HJO A;  4KAE A;  4KH7 A;  1TDI A;  5F0G A;  1Z9H A;  2N5B A;  3D22 A;  4JR4 A;  3CYN A;  1KEB A;  4MLY A;  5G2Z A;  4JR6 A;  2YOI A;  3GTU A;  4LL1 B;  4DEJ A;  4N30 A;  4OWY A;  4KB3 A;  3EWL A;  3FR3 A;  1CQG A;  2I9H A;  1T8E B;  3MYD A;  4AI6 A;  4X4J A;  3RDW A;  3ZVJ A;  5KN1 A;  3P7X A;  3Q19 A;  2LST A;  4OFM A;  2FLS A;  2PWJ A;  1M2D A;  3SWL A;  4GDF A;  5KN0 A;  1ZCP A;  3NIV A;  2E0Q A;  4K7N A;  3IV4 A;  1YKA A;  4PTS A;  2LJA A;  4XCS A;  8GSS A;  3GRX A;  5A4W A;  3FEU A;  4WET A;  4BPY A;  2AJQ B;  3SBC A;  2VCX A;  2C0D A;  2H01 A;  2LQO A;  4HQZ A;  4MK3 A;  2A4V A;  3D4M A;  3CBU A;  4K5R A;  5INY A;  2GT6 A;  1O7U A;  3F0I A;  2HFD A;  4YKF A;  2LV3 A;  4V2M A;  2O5V A;  2CAI A;  3H1N A;  2PER A;  4N3Z A;  5F05 A;  5CRH A;  5G30 A;  4RUV A;  4LMW A;  5F06 A;  2H30 A;  5DVB A;  4FIW A;  2F9S A;  3F6D A;  2YWM A;  5C04 A;  3L9V A;  1QXH A;  2A2R A;  4K1F A;  1BF5 A;  2ALB A;  1YZX A;  3GSS A;  3A2W A;  2R0G A;  1SKS B;  1JLW A;  4GSS A;  6GSV A;  3QR6 A;  5KOW A;  1Z5Y E;  3GMF A;  1WOU A;  1EGR A;  2WRT A;  3IRA A;  2EIR A;  2HRK A;  1ERT A;  5FWG A;  3IK7 A;  4X0X A;  3F3Q A;  1PL2 A;  5GAN D;  5ECL B;  3ZVJ D;  4LA1 A;  4GWR A;  2ZNM A;  3BCI A;  1Y1U A;  2F51 A;  5G1K A;  2H70 A;  2G2Q A;  2IMF A;  1AW9 A;  1MD4 A;  2F8A A;  2R3X A;  1GP1 A;  4EVM A;  1Z3E A;  4Q5Q A;  1V40 A;  3ISO A;  18GS A;  4WBJ A;  4FQU A;  1FW1 A;  1B8X A;  4ZB7 A;  5IM9 A;  4PNF A;  3ZRE A;  4KDU A;  3CSH A;  4F9Z A;  3HVX A;  2CX4 A;  3C1R A;  2JSZ A;  2BJX A;  2PMT A;  1A8L A;  2K9F A;  2C3N A;  3LEF A;  3I69 A;  4RQX A;  3HMJ G;  5FHI A;  5DCG A;  1JZD A;  1SD8 A;  1HD2 A;  4GQF A;  3FKF A;  4G2E A;  5DAL B;  3GX0 A;  1DBY A;  4XRA A;  2HSN A;  3O76 A;  2H0H A;  1LU4 A;  3TJF A;  5EL8 A;  3ZLP A;  4ICY A;  1XWK A;  4XIH A;  5ECR B;  2OAC A;  3DIE A;  1K3Y A;  2IJY A;  1X9M B;  4MPF A;  1X5E A;  1EOH A;  3DVX A;  4Z7X A;  1X9S B;  3IHG A;  1YKC A;  2H19 A;  1GRX A;  3MSZ A;  3UAR A;  3NOF A;  3M3M A;  3ZML A;  1E6B A;  2IFQ B;  4BVX B;  1SD9 A;  5KEJ A;  1AXD A;  5J4V A;  2GVP A;  1G0T A;  3VLN A;  3D5J A;  2ES7 A;  2NTO A;  2FD3 A;  1J08 A;  1ZYP A;  1GSF A;  2GSS A;  3GKM A;  3KP8 A;  4KE3 A;  4HI7 A;  3BBY A;  3VUR A;  5LNK e;  4W66 A;  1OC8 A;  2DKI A;  1K3L A;  3KP9 A;  2PPT A;  2TIR A;  5ECP B;  1KBN A;  4GSN A;  4PQ1 A;  5J9B A;  4XS6 A;  4PXO A;  4FYB A;  1ML6 A;  1TK8 B;  2B7K A;  1KNG A;  2YZU A;  2H74 A;  5ECS A;  1UA5 A;  3KTB A;  2JL4 A;  4L0W A;  1XW9 A;  2GZP A;  1TRV A;  2XC2 A;  2B1K A;  4O32 A;  5ELA A;  3GL5 A;  3FMW A;  3F4T A;  5ID2 A;  4KCA A;  3RPP A;  4KDX A;  1YF1 A;  4KX4 A;  2H6X A;  3LWA A;  1XIY A;  2CVK A;  3H79 A;  3DML A;  3TUE A;  2JAD A;  5DQS A;  4PQI A;  5AIV A;  1UC7 A;  4EIQ A;  14GS A;  4K6X A;  1OKD A;  2FNO A;  4ZB9 A;  2YV7 A;  3L4N A;  5DJL A;  5ELG A;  2YJH A;  3IR4 A;  2JZR A;  1H75 A;  1ERU A;  5A34 A;  1B9X C;  2DMM A;  2HSH A;  3EMP A;  2X99 A;  3QMX A;  4TXV A;  2HXK A;  3GUS A;  4IJ3 A;  2OT3 A;  2A2S A;  4TR1 B;  3KXO A;  1S3C A;  2GTU A;  1UN2 A;  2E2G A;  2DSA A;  2L6D A;  4H86 A;  5HR1 A;  2FWH A;  1XPV A;  2LTK A;  1NM3 A;  2IIY A;  5GSS A;  1JHB A;  1G6Y A;  2V2G A;  1USB A;  3DKS A;  20GS A;  4Q5R A;  3VWW A;  2H8L A;  3GIX A;  4NMU A;  5IMD A;  1FOH A;  3HD5 A;  1A23 A;  4L5L A;  2B5Y A;  3KGK A;  1LBK A;  2B1L A;  4BA7 A;  2YWN A;  2R0P A;  4G9H A;  4ZBD A;  4QQ7 A;  2AHE A;  4TR3 A;  1S3A A;  2O89 A;  2VM2 A;  1F9M A;  1VGL A;  2JAC A;  2H1L A;  3RHC A;  3EYT A;  3RHB A;  1TRU A;  2C0F A;  3TJJ A;  1TRW A;  2XHF A;  2VD0 A;  3HVS A;  3W8J A;  2RUE A;  2WGR A;  3CMI A;  3LYP A;  6GSW A;  3GL3 A;  4PQH A;  2LEG A;  2J23 A;  3M8N A;  1HYU A;  3Q6O A;  5DBQ A;  1V2A A;  4HU7 A;  4MF7 A;  4EF0 A;  3UBK A;  1PMT A;  5D9V A;  4BL7 B;  2HRN A;  3KD0 A;  5AN1 A;  2J9H A;  4I5Q A;  4PUR A;  4K2D A;  4TW5 A;  3VK9 A;  1GSU A;  5LCZ A;  1YQ1 A;  1U6T A;  2LUS A;  1TXX A;  10GS A;  2CZ2 A;  3KEB A;  1SL2 B;  2FA4 A;  3A5I A;  1EP7 A;  4HJ2 A;  3TJG A;  2EFC A;  2GDR A;  4KF9 A;  3GV1 A;  4WR5 A;  1RW1 A;  1PX7 A;  2H72 A;  3VWV A;  2L5L A;  3EC3 A;  3F4S A;  4AKG A;  2B5E A;  2HSY A;  2HSM A;  4MZC A;  1HNB A;  3IBH A;  4YH2 A;  2VL2 A;  4ZB8 A;  4HZ4 A;  5IMZ A;  3HXS A;  2QA2 A;  3FK8 A;  2XPE A;  3QAV A;  5J41 A;  1HNA A;  3LYK A;  1EZK A;  3R3E A;  4V1A g;  3DGQ A;  3FRC A;  2CVD A;  2R5G A;  1F3A A;  3IA1 A;  3FHK A;  4N0Z A;  3RAZ A;  1U88 A;  1A2L A;  1M9A A;  3EE2 A;  2O8V B;  4ULX A;  4PUA A;  3QAW A;  3LW9 A;  4USS A;  6GSY A;  2LNS A;  4V1A p;  2K8V A;  2EFD A;  1Q4J A;  5AIX A;  2WUL A;  1GSE A;  2QSI A;  3DRN A;  2DKH A;  1YY7 A;  5J47 A;  2FUG 2;  3M0F A;  2FA8 A;  4P3Y B;  4QMK A;  3QPM A;  2DJK A;  3C8E A;  3TRQ A;  5HR0 A;  2RII A;  1SYX A;  4AJ8 A;  1GLP A;  3CTF A;  4ILF A;  5HQP A;  4CY8 A;  5CRE A;  3RBT A;  1A8Y A;  1TW9 A;  3KH7 A;  4TOP A;  4IW9 A;  1C72 A;  5BMU B;  2QC7 A;  3HYP A;  4GXZ A;  4WEY A;  4J2F A;  1WIK A;  1M2A A;  2AAW A;  3TOU A;  2HZE B;  1EWX A;  1OC9 B;  1GWC A;  1EEJ A;  3EU4 A;  3MDK A;  2V6O A;  2P5Q A;  1SK1 A;  1PSQ A;  5E4W A;  3ME8 A;  3VPQ A;  2P5R A;  3A5W A;  3ZFB A;  1Y6E A;  5ECK B;  5JWR B;  1E2Y A;  4XTS A;  5HFI A;  3FYG A;  1HNC A;  4MCU A;  3ERF A;  2D2Z A;  2KLX A;  1G6W A;  1K0B A;  2GQL A;  3HZ4 A;  4ECJ A;  1VF2 A;  2OE1 A;  3ZIJ A;  3LGC A;  5CP1 A;  1QGV A;  1S3D A;  5D96 A;  2OBK A;  4G19 A;  3LG6 A;  4OO4 A;  5KN2 A;  3IC4 A;  1SJI A;  2GQM A;  4NHW A;  2VOC A;  1GTA A;  1SYR A;  2N5F A;  1X5D A;  2DIZ A;  4LMV A;  3MNG A;  4GCI A;  4NAX A;  1SKR B;  2L6C A;  3HHV A;  4YQU A;  1LJR A;  1VF3 A;  4ECC A;  3K8N A;  2F3M A;  3HJM A;  5IPH A;  3CSJ A;  2EFE A;  4F03 A;  5H5Q A;  2CX3 A;  5ECI B;  4BWS A;  4NXI A;  2I81 A;  2M80 A;  3EU3 A;  5AGY A;  2C80 A;  5EY6 A;  1FOV A;  4OMV A;  3TU3 B;  2ON5 A;  1TOF A;  5A4U A;  3I6A A;  1ABA A;  4EE0 A;  4I6X A;  1A2M A;  1U87 A;  2C0G A;  2VCZ A;  3A2V A;  17GS A;  4KW6 A;  1UVZ A;  4IN0 A;  4PUF C;  3DXB A;  3G7I A;  1IYH A;  1SVM A;  1JFU A;  3PH9 A;  4K9Z A;  4DSS B;  1AQV A;  4KUN A;  3JCM L;  3FZA A;  2I3Y A;  2DIY A;  4ECB A;  3DD3 A;  1X5C A;  4GF0 A;  5IO0 A;  3N5O A;  3D6I A;  5FT3 A;  5A5K A;  2LRN A;  4BVY A;  3C73 A;  4E8H A;  3ZRD A;  3KJY A;  4MNN A;  3WT2 A;  4MA9 A;  2CA8 A;  3L9U A;  1TI3 A;  2KOK A;  1XCC A;  3PIN A;  1A0R P;  2AUV A;  5D9X A;  1OAZ A;  3U5R E;  1H4O A;  4D73 A;  2DC5 A;  3P90 A;  5D73 A;  5H5R A;  1TJD A;  4ID0 A;  1WP0 A;  1ON4 A;  6GSX A;  2WJU A;  1V9W A;  4G0I A;  1EP8 A;  1J0F A;  2H1G A;  4IBP A;  4HUA A;  2WB9 A;  4KSM A;  1B9Y C;  4XHM A;  1XZO A;  1THO A;  1MDJ A;  1Z7P A;  5CRW A;  2KP2 A;  4OFN A;  2P0G A;  5ECO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...