1AXDA

Structure of glutathione s-transferase-i bound with the ligand lactoylglutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords GLUTATHIONE S-TRANSFERASE I
publication title Crystal structure of herbicide-detoxifying maize glutathione S-transferase-I in complex with lactoylglutathione: evidence for an induced-fit mechanism.
pubmed doi rcsb
source organism Zea mays
total genus 76
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1axdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1axdA01
2G2QA 4X0XA 2WGRA 4N30A 2F3MA 2IMKA 2VCTA 4D73B 2VO4A 5LD0A 4GQFA 5J9CA 4NV2A 4MF6A 4KGIA 4O32A 1ERUA 1Z7PA 4P3YB 4G9HA 5LNKe 2LUSA 2REMA 4IS0A 1BX9A 3GSSA 2YV7A 2KP2A 5J41A 1AW9A 5D73A 3EVIA 1SJZA 2K9FA 1M2AA 1TK0B 4HQSA 3GFKA 4WF4A 2KUCA 3EYTA 3ZMLA 16GSA 3APQA 5IM9A 1K3YA 5INYA 1UA5A 1SL1B 5FWGA 2F51A 5DBQA 2OJLA 1TRVA 5IPGA 1B9XC 3A2WA 3BD2A 1R26A 3ZFLA 1QUWA 1YJ6A 1Z3EA 2H01A 4ZB9A 5CRGA 2NPBA 4RUVA 1R5PA 3HVXA 3BCKA 2VD1A 5AN1A 2X99A 3LORA 2C0DA 1X5DA 2PWJA 4EDYA 1DSBA 2N5AA 1ZGNA 3KMOA 1USBA 3GN3A 2CZ2A 3TB2A 5G2ZA 3TKRA 2PVOC 3FKFA 3UJ1A 3TUEA 2G0FA 1SK2A 3RAZA 3Q19A 6GSXA 2PU9C 1ERWA 4X1UA 2H0GA 1TRUA 1OE8A 2GSQA 3EU3A 3UL3A 5HR2A 5ELGA 1XVWA 3GYKA 4WR5A 3VPQA 1GSSA 2GLRA 6GSYA 1YDKA 1ZOFA 3O76A 3QAGA 3GA4A 3GURA 2HRFA 5CRDA 1F2EA 3IAM2 4KDXA 3M8NA 1M2BA 1SKRB 3IXRA 4TXOA 4I6XA 1O7UA 3GNJA 5IMCA 5EL8A 4KAEA 3GKMA 1NHYA 4E8HA 1SJIA 4EKZA 1T1VA 3IA1A 2IFQB 1TRWA 1SKSB 1FO5A 4JR6A 1MDJA 3L9VA 2DIZA 3ZL5A 4LLRA 1ACVA 2HQTA 2LRNA 2PMTA 2IMDA 5B8BA 2LNTA 4LL1B 3A5WA 1GL8A 5DJLA 3EURA 4ECJA 4EF0A 1TU8A 4USSA 2B5YA 3BOAA 3L78A 5ELAA 5IOXA 5H5QA 4BVYA 1U87A 1OC3A 2VAFA 4K2DA 4F0BA 1XW5A 1TI1A 2I1UA 2VLTA 1OC9A 3LFLA 1HYUA 2MZCA 2TRCP 3GKKA 1ZYEA 1TXXA 5DCHA 4CDOA 3HA9A 2HT9A 2WZ9A 4TR4A 2OKAA 1TDIA 1BQ7A 1YF1A 2YCDA 3FZ4A 3MWHA 4MLYA 2VOCA 2EC4A 4K7OA 5B8AA 2LV3A 1AQWA 3IK7A 1O73A 5AIXA 1XWBA 4PNFA 4JRRA 2ON7A 5IO0A 5CNWA 5CREA 2GT5A 3HZ8A 4BWQA 1K0NA 1SENA 3VWXA 4JZQA 5IO2A 1R5AA 4L0WA 3D6IA 3WGEA 2I9HA 4BWSA 5HR1A 1YY7A 2O7KA 3DMLA 4YAVA 2B7JA 3KXOA 3RHBA 1NHOA 3WD6A 1TKDB 2VCZA 4MZWA 3QPMA 5EY6A 1F3BA 4F0CA 1YQ1A 2IMIA 3H8QA 4IQAA 3KP8A 2H71A 1FAAA 1XZOA 4L0UA 1TRSA 2HRAA 1OAZA 3QD9A 2CV4A 3QFAC 4KNDA 4NWYA 4ULXA 3IK9A 3KMNA 1W4VA 3VWWA 4ZL9A 5DVBA 1OYJA 2L57A 3H93A 4G19A 1XWGA 5G5FA 2H0HA 1PD21 1K3OA 1GUMA 1FB6A 2PBJA 2RLIA 3HD5A 4WETA 2B5XA 1X9MB 1PL2A 5B6MA 2JU5A 2NVLA 2OA7A 5G30A 3RBTA 4MPGA 2I4AA 4K0GA 1F37A 3VFIA 4K9ZA 3ZVJA 1QQ2A 3BCIA 3C73A 4NHWA 3EC3A 5C04A 1QXHA 1T4YA 4I97A 1Q98A 3UVTA 1U3AA 1BJXA 1J9BA 4OMVA 3HJPA 4F03A 1G6WA 4HJ2A 1V58A 2YV9A 4L5OA 4K6XA 5DAKA 4IBPA 3APSA 3FR6A 4IVFA 4MCUA 2H1GA 10GSA 3IR4A 4K8MA 4TR1A 1F9MA 3C8EA 4ZBDA 2DJKA 4MMMA 4ECBA 3CMIA 1FVJA 1U6TA 2H6ZA 5IMDA 3K8NA 4ZL8A 4J57E 4E8EA 2CX4A 4RI6A 3HYPA 1WE0A 4KUNA 1SD9A 3W6GA 4QQ7A 2WS2A 5IMAA 3PPUA 3FR9A 6GSUA 2MBTA 2VCWA 1K0MA 4O7HA 1TJDA 3RPNA 3E0UA 1SJ6A 2Z9SA 4PUFC 1YF0A 4EC0A 3UIWA 2H8LA 4GWRA 3US3A 2GSRA 2CX3A 3D5JA 6GSSA 5J5NA 2A2RA 2HRKB 3N9JA 1JZWA 3TJGA 1HQOA 4GLTA 1SYXA 2LS5A 1GWCA 3U5RE 1EOHA 3A3TA 2HLSA 3WT1A 2B3SA 5CO3A 2A4VA 1PA3A 2L4QA 1VF4A 3O6TA 3MDKA 1O8WA 2B7KA 1A8LA 3ZIJA 3C1SA 1QK8A 3TRPA 2VCQA 3D4MA 4DVCA 1N8JA 1GH2A 2L6CA 2AAWA 4MH2A 3KCMA 4G0IA 4AF2A 1EOGA 3F63A 1SL0B 3KD0A 1TTZA 3FRCA 2VLVA 3UARA 1ZYQB 4LA1A 2OACA 2F8AA 1SYRA 2H1BA 2WCIA 1ZMAA 4MK3A 4FH8A 3HVSA 1LBKA 4KX4A 2VUPA 2CA8A 4KCAA 4IKHA 2GZZA 4G0LA 4GXZA 1O85A 2JZSA 2NTOA 3JCML 4EDZA 1XIYA 5BMUA 3M3MA 2YWIA 4HS1A 2XHFA 2HSNB 4MH3A 4MF5A 5G1LA 3TKQA 1TK5B 5ECKB 4KSMA 2YNXA 3G7JA 1HNAA 1THXA 2BJXA 3VI5A 2WULA 2IPAA 2HE3A 2IIYA 3N5OA 5DAKB 2CT6A 5GZZB 3UEMA 5DALA 3DWVA 1YKCA 3EMPA 4TOPA 4AGSA 2LNSA 3QFBC 2MMNA 2EIQA 2PN8A 3UAPA 3VK9A 1ERVA 2VL2C 3PH9A 4OCFA 3FZ9A 8GSSA 4G0KA 3TOUA 3GX8A 1GSUA 4JU5A 1EEJA 3HJMA 3LQ7A 4XS6A 1T4ZA 5GSSA 3FEUA 4YH2A 1NW2A 1RK4A 4MP4A 1Z5YE 3CBUA 3PINA 5A4WA 2C4JA 2PERA 5KEJA 5ECMB 1PKWA 3ZITA 1K0BA 3DGQA 3HJOA 4PUAA 3J7Yb 2HSYA 2JACA 3H4KA 2H1DA 1B4QA 2AV4A 5D9WA 2XBIA 2XPEA 4TXVA 1JHBA 1Z6MA 1EV9A 2RUEA 1MD4A 3BJ5A 5IQYA 2V1MA 3LGCA 3FW2A 3GIXA 4IP1A 3P2AA 2HYXA 3TGZA 4I8BA 3M9KA 4OO4A 4EE0A 5ID2B 3WGXA 5CP1A 4KF9A 4MDCA 4KB3A 5DDLA 1OVNA 1KBNA 1A0FA 1A2MA 2OE0A 3KM6A 1E6BA 1WPIA 2X8CA 1O81A 1TK8B 3VLNA 3CSIA 4XRAA 3L9UA 3E3EA 2YPMA 2GSTA 5F07A 3RDWA 1S3DA 5A5KA 20GSA 1MTCA 5IIZA 5COHA 2MMAA 2AJQB 2DMMA 1KNGA 3GH9A 4HDEA 2E0QA 3HY2A 2IWTA 1PX7A 5JCGA 1VF1A 4PGTA 1FW1A 5ECRB 5AGYA 3KZQA 1PGTA 4Z7XA 2WRTA 2K18A 2YOIA 2QC7A 2FLSA 4TN8A 4V1Ag 4XS1A 2H70A 5AISA 5ECPB 4DSSB 5F8BA 3C71A 2C8UA 2YZHA 4FIWA 3QR6A 2R4VA 2IMEA 3L4NA 3OR5A 5AIVA 5J4UA 1JZRA 3M9JA 4GCIA 3J7Yk 2R3XA 2ZCTA 1GSEA 1J08A 3KEBA 1Y25A 1XBSA 4IJIA 5DQSA 3IDVA 4XCSA 4I2TA 2YWOA 3ZFBA 3IBHA 2YJHA 1A2LA 1MDKA 4TKYA 4BPYA 2RIIA 5G1KA 1V9WA 1V98A 1N2AA 1G0TA 3H79A 1H75A 3E9JB 2RUFA 2L4CA 1MDIA 4EL1A 3NOFA 3KTBA 5J3RA 4TR3A 1F3AA 4NXIA 6GSWA 3CTFA 1PSQA 4G2EA 2DSAA 5JWQB 4IGJA 2DJ1A 2H6XA 3PGTA 2YANA 4TW5A 4MABA 2VCVA 4ZL7A 1TI3A 3IE3A 4PQHA 2YN1A 1PQNA 3F3RA 1QFNA 3H1NA 2BTOT 2DJ2A 4Q5NA 1O6JA 2DLXA 2NBSA 4ID0A 3ME8A 1R7HA 4N10A 3KH7A 4NPBA 1SL2B 1R4WA 1FB0A 2YJ7A 1XW9A 2BMXA 4I5QA 2LQOA 2JSYA 3SWLA 3KP9A 1OKTA 3ERWA 11GSA 3C1RA 4GSNA 2TIRA 4EVMA 4CHSA 3HZ4A 4WF5A 3R2QA 1A2JA 1W89A 2VL2A 1THOA 3EWLA 2XC2A 3DXBA 1TU7A 3CSHA 4CW9A 2O87A 3EINA 4GRFA 1V57A 2WJUA 2NDOA 3GTUA 2GSSA 3LYPA 19GSA 1TW9A 1OKDA 3UMAA 4LL4B 3ZYWA 1EGRA 2C1YA 1I5GA 1ZL9A 3CSJA 1ERTA 1SK0A 2L5LA 3U6VA 3P7XA 3Q74A 3VI7A 4ILFA 1GP1A 2CQ9A 2KLXA 2V32A 3DVWA 3LEFA 4GTUA 4K7IA 7GSSA 4IHUA 3ZIVA 5E4WA 5EVOA 1GSFA 1S3AA 5JCWA 5ECLB 2DJJA 1NM3A 4TXOB 4IN0A 3VPTA 4Q5FA 3BBYA 1WJKA 2GZYA 3GL5A 4MZBA 3ZLPA 2M72A 4XS4A 1M9BA 4WKWA 1Z9HA 4RQRA 3TKPA 4AJ7A 2JL4A 2C0EA 2H1AA 2LEGA 3CYNA 2P5RA 1FVKA 3TKSC 3VWVA 4ZXGA 1ABAA 2M80A 4PQIA 2FUG2 3QCPA 4KCEA 1GUKA 2P31A 4NV5A 4ECIA 1IYIA 4K7NA 3F9UA 2HI7A 2FNOA 4PQ1A 4BVYB 1PRXA 2MYGA 4XIHA 3IC4A 3G7IA 5ECQB 2H30A 4FYUA 1WMJA 3FR3A 1OC9B 2KOKA 2AHEA 3W8SA 2HZFA 2OADA 1B48A 2LQQA 4O5RA 17GSA 3DKSA 2FHEA 3EU4A 1AAZA 3TJKA 1XOAA 1MEKA 4N0ZA 3DRNA 1JLVA 2VL9A 4HI7A 2MMOA 2HFDA 3P8WA 4MJCA 4KSOA 1QGVA 3F6FA 2GDRA 1Y6EA 4OO5A 3TCOA 1GSDA 2PVQA 1EZKA 1SK1A 2L5OA 5KN3A 4D73A 2EIOA 4QL9A 1FHEA 5IPHA 2FWEA 4HUAA 3FY7A 1F6MC 2D2ZA 4WBJA 4Q5RA 3AY8A 2DJ3A 2E2MA 1K0DA 4V1Ap 4NHZA 2CVKA 4N0VA 1ML6A 4HZ2A 1XWCA 3GTUB 2C3QA 4K0NA 3I9V2 2H66A 3IHQA 1EP7A 4FQUA 5KN1A 2P5QA 4JR4A 4QL7A 3LJRA 5CAXA 2F9SA 5B6NA 2LJRA 4ZBAA 4POBA 1V2AA 2EIRA 1WWJA 4OCEA 1GTUA 2TRXA 2ZNMA 4MJAA 2IL3A 1LU4A 3LXTA 4Q5QA 4PX1A 5LCZA 2FCHA 1A23A 3C7MA 3A2VA 1HD2A 4ZILA 3TJJA 4DSRA 4MJBA 2V6KA 2GQLA 4G10A 3V1WA 3WT2A 4POLA 2LJAA 4KA0A 4RQXA 22GSA 2X8GA 2MBSA 5IMVA 5A4VA 3TJBA 5IMZA 2AB6A 1WIKA 3NZNA 4HQZA 3GRXA 2YP6A 2QSIA 1AQVA 3LSZA 2VM2A 1G7EA 3WGDA 4NAXA 1X5EA 3ERFA 3Q6OA 3ZTLA 4FO5A 3HKRA 2K8SA 2B5EA 1EV4A 3ZREA 2FY6A 5D96A 1URMA 5E59A 2CAQA 2K6VA 5D8IA 3F6DA 1XWKA 1JZDA 5HR0A 3M0FA 1GSYA 2V41A 1GNEA 4TR1B 3UVHA 4WR4A 4O92A 1I9DA 1GNWA 1SU9A 4WEYA 4F82A 2WDUA 3MSZA 1GSQA 3CRTA 3LYKA 3DYRA 2HSMA 4YAPA 2V2GA 2C80A 3L0HA 1GRXA 3HCZA 1M9AA 4IQ1A 4XRDA 2DBCA 3G7YA 4JBBA 3D0ZA 5GAND 1GULA 5ENUA 2B6MA 2FWFA 1YEPA 2IFQA 1M7TA 5D9VA 2OBIA 1ZZYA 4DSQA 4I2UA 1B9YC 1LJRA 2DMLA 3RHCA 5ECIB 4EXJA 2H0IA 1B8XA 4BL7A 1PX6A 2H72A 4POKA 5DJMA 4IJ3A 1BAYA 14GSA 3TKSA 1E2YA 2JZTA 2H74A 4ISDA 2JZRA 4OFTA 5B7CA 3ED3A 5CYYA 3NIVA 1EEMA 1AUCA 1IYHA 1Z6NA 3WYWA 1EGOA 2GGTA 1XCCA 2H75A 2N5BA 4ACSA 1M2DA 1XOBA 5H5SA 2C3TA 1PN9A 3DD3A 4L8EA 2ON5A 4OFMA 1DBYA 2H73A 5F05A 3F4RA 2CVDA 2L59A 2XBQA 5GSTA 4FYCA 2QGVA 4IW9A 2IJYA 4HJMA 5JCUA 1AXDA 1QMVA 2RM6A 1A8YA 2K8VA 3MAKA 1SD8A 2H19A 4WXTA 3EMXA 3GMFA 2J9HA 3ZZXA 2N5FA 3D21A 5L71A 2DC5A 1PMTA 2JSZA 2IMFA 4V2LA 3SBCA 1VF2A 1BYEA 2HNLA 2FWGA 2GS3A 2GQKA 2X64A 2R2JA 5DALB 2JADA 4XTSA 2FGXA 2X8HA 3KH9A 1XPVA 3IC8A 2ALBA 5J9BA 3F4SA 1VF3A 1JFUA 3O3TA 4MF7A 2QKEA 2F8FA 1X9SB 3HXSA 1YEXA 1X9WB 4F9ZA 4J2FA 2HSMB 3VWUA 1CQGA 4H86A 4HU7A 1PL1A 2YWMA 2E7PA 4YQVA 1XXUA 3APOA 1HNBA 3GSTA 5C00A 1KEBA 3TRQA 4OD7A 2DJ0A 4MA9A 5IOWA 2OBKA 2KHPA 1UC7A 3QMXA 4BVXA 2A2SA 1YKAA 1XWAA 1EP8A 3IOSA 5JWRB 4GQCA 4BL7B 1A24A 4XHMA 3F4TA 1T3BA 2FA4A 1WRYA 3CRUA 3R3EA 1ZCPA 5KN2A 2HXKA 3VURA 3HHVA 4V2NA 1WP0A 4TVEA 2E2GA 1ILOA 1B4PA 1J0FA 1G6YA 3GKXA 2R6KA 3M1GA 2HZEA 5DCGA 1OC8A 1GTAA 3KIJA 3QAVA 1C72A 1OE7A 2C0GA 1GTIA 4WBRD 4EO3A 2O89A 1DE2A 1U3IA 1FG4A 2GQMA 5CRHA 3ZVJD 1K0OA 3QDNA 4HZ4A 1CQHA 2LRTA 3L9SA 3FK8A 3TKSE 3TRXA 3F0IA 4POMA 13GSA 4F2IA 4JE1A 3P90A 2V6OA 4HEA2 3DEXA 1VGLA 3S9FA 1X5CA 3DVXA 1RQMA 1KTEA 2CAIA 4K1FA 2HRKA 1Q4JA 4ZB6A 2C0FA 4PTSA 4JEDA 2LRCA 3W8JA 2VL3A 3GKNA 4AJ8A 3RPPA 5DQYA 5HR3A 1AQXA 3ISOA 5HFKA 2O85A 2I81A 2FD3A 3GX0A 3UBLA 3GUSA 4KDUA 1SKWB 3DIEA 1GLQA 6GSVA 3FZ5A 3IRAA 2ES7A 2UZ8A 5F06A 3QOUA 3QAWA 4ML1A 1XW6A 4GSSA 1T00A 3ZMKA 5FHIA 5KN0A 5HFGA 3ME7A 3TDGA 4ZBBA 4J56E 2AUVA 2LJKA 1EWXA 5D9XA 4TRXA 1S3CA 4KE3A 4PXOA 3TOTA 1PKZA 1MD3A 2PUKC 4GF0A 4BVXB 3MNGA 4HU9A 1T8EB 1XVQA 1HNCA 1K0CA 2GTUA 3FHKA 1TOFA 2HRNA 3FZAA 3UOMA 4BA7A 4HOJA 1XFLA 2AYTA 3IAS2 3A2XA 3PR8A 3IV4A 4ECCA 2YZUA 3KGKA 1WOUA 3GHAA 1K3LA 5D9TA 1DUGA 1UVZA 5ECNB 3KJYA 3Q18A 5A4UA 9GSSA 1K0AA 3F8UA 3D22A 2HZEB 2GZPA 5FT3A 4MPFA 4NMUA 3I69A 5ECOB 2YWNA 1O8XA 2WB9A 4ML6A 3FYGA 2LTKA 1H4OA 3GV1A 2C3NA 2VM1A 3GL3A 5EPFA 5F0GA 4PURA 1AIUA 2M46A 5ECSA 4RI7A 2PGTA 1NSWA 2HSHA 2VIMA 1GLPA 2VD0A 2I3YA 1X0RA 3I43A 3I6AA 5H5RA 4MJEA 5G5EA 2J23A 3IPZA 18GSA 2VCXA 1GTBA 2R5GA 1TP9A 5D93A 2B1KA 5G31A 1YZXA 5ABRA 3D4TA 1JZOA 2FWHA 2XPDA 4OFNA 3CXGA 1ST9A 4KW6A 2OE1A 3ERGA 2R37A 3LG6A 1T7PB 2IN3A 2P0GA 5JWOB 4LMWA 2CZ3A 4L5LA 4YQUA 2MMZA 4LMVA 5ID2A 2CVBA 1ON4A 3LXZA 4XS4B 2KP1A 2H76A 2O8VB 2VLUA 1RW1A 3EE2A 3HVVA 1A0RP 1M0UA 4DEJA 4MZCA 6GSTA 5HQPA 4ZB8A 2ZUPA 3GH6A 3UBKA 4V2MA 1VRSD 4FYBA 4X43A 5GAPD 1AC1A 3TJFA 4KH7A 3LWAA 2GT6A 4IELA 1Z7RA 5CRWA 1UN2A 4PNGA 1FOVA 4AJ6A 4EUYA 2B1LA 4GSTA 2RM5A 4TR0A 2DIYA 4IP6A 3HDCA 4YQMA 5HFIA 2LSTA 5ECHB 2FA8A 3CTGA 2OE3A 3ZRDA 1GUHA 4KDYA 4ZIJA 3KTLA 2H6YA 4N11A 1U88A 3G9BA 1G7OA 3F3QA 2L6DA 4DSSA 2PPTA 2LKUA 1JLWA 4OWYA 2GVPA 2WFCA 1BEDA 1BG5A 1M99A 1DE1A 12GSA 1V40A 5IMFA
chains in the Genus database with same CATH superfamily
2G2QA 4X0XA 2WGRA 4N30A 2F3MA 2IMKA 2VCTA 4D73B 4Z2TA 2VO4A 5LD0A 4GQFA 5J9CA 4NV2A 4MF6A 4KGIA 4O32A 1ERUA 1Z7PA 4P3YB 4G9HA 5LNKe 2LUSA 2REMA 4IS0A 1BX9A 3GSSA 2YV7A 2KP2A 5J41A 1AW9A 5D73A 3EVIA 4YKFA 1SJZA 2K9FA 1M2AA 1TK0B 4HQSA 3GFKA 4WF4A 2KUCA 3EYTA 3ZMLA 16GSA 3APQA 5IM9A 1K3YA 4AI6A 5INYA 5A5HA 1UA5A 1SL1B 5FWGA 2F51A 5DBQA 2OJLA 1TRVA 5IPGA 1B9XC 3A2WA 3BD2A 1R26A 3ZFLA 1QUWA 1YJ6A 1Z3EA 2H01A 4ZB9A 5CRGA 2NPBA 4RUVA 1R5PA 3HVXA 3BCKA 2VD1A 5AN1A 2X99A 5A34A 3LORA 2C0DA 1X5DA 2PWJA 2WW0A 4EDYA 1DSBA 2N5AA 1ZGNA 3KMOA 1USBA 3GN3A 2CZ2A 3TB2A 5G2ZA 3TKRA 2PVOC 3FKFA 3UJ1A 3TUEA 2G0FA 1SK2A 3RAZA 3Q19A 6GSXA 2PU9C 1ERWA 4X1UA 2H0GA 1TRUA 4A5PA 1OE8A 2GSQA 3MYDA 3EU3A 3UL3A 5HR2A 5ELGA 1XVWA 3GYKA 4WR5A 1FOHA 3VPQA 1GSSA 2GLRA 6GSYA 1YDKA 1ZOFA 3O76A 3QAGA 3GA4A 3GURA 2HRFA 5CRDA 1F2EA 3IAM2 4KDXA 3M8NA 1M2BA 1SKRB 3IXRA 4TXOA 4I6XA 1O7UA 3GNJA 3IHGA 4YKGA 5IMCA 5EL8A 4KAEA 3GKMA 1NHYA 4E8HA 1SJIA 4EKZA 1T1VA 3IA1A 2IFQB 1TRWA 4CY6A 1SKSB 1FO5A 4JR6A 1MDJA 3L9VA 2DIZA 3ZL5A 4LLRA 1ACVA 2HQTA 2LRNA 2PMTA 2IMDA 5B8BA 2LNTA 4LL1B 3A5WA 2R0CA 1GL8A 1PN0A 5DJLA 3EURA 4ECJA 1S3RA 4EF0A 1TU8A 4USSA 2B5YA 3BOAA 3L78A 5ELAA 5IOXA 5H5QA 4BVYA 1U87A 1OC3A 2VAFA 4K2DA 4F0BA 1XW5A 1TI1A 2R0GA 2I1UA 2VLTA 1OC9A 3LFLA 1HYUA 2MZCA 2TRCP 3GKKA 1ZYEA 1TXXA 5DCHA 4CDOA 5A5HB 3HA9A 2HT9A 2WZ9A 4TR4A 2OKAA 1TDIA 1BQ7A 1YF1A 2YCDA 3RGBC 3FZ4A 3MWHA 4MLYA 2VOCA 2EC4A 4K7OA 5B8AA 2LV3A 1AQWA 3IK7A 2VKZG 1O73A 5AIXA 1XWBA 4PNFA 4PI0C 4JRRA 2ON7A 5IO0A 5CNWA 5CREA 2GT5A 3HZ8A 4BWQA 1K0NA 1SENA 3VWXA 4JZQA 2QA1A 3LW9A 5IO2A 1R5AA 4L0WA 3D6IA 3WGEA 2I9HA 4BWSA 5HR1A 1YY7A 2O7KA 3DMLA 4YAVA 2B7JA 3KXOA 3RHBA 1NHOA 3WD6A 1TKDB 2VCZA 4MZWA 3QPMA 5EY6A 1F3BA 4F0CA 1YQ1A 2IMIA 3H8QA 4IQAA 2H71A 3KP8A 1FAAA 1XZOA 4L0UA 1TRSA 2HRAA 1OAZA 3QD9A 2CV4A 3QFAC 4KNDA 4HSCX 4NWYA 4ULXA 3IK9A 3KMNA 1W4VA 3VWWA 4ZL9A 5DVBA 1OYJA 2L57A 3H93A 4G19A 3HMJG 1XWGA 5G5FA 2H0HA 1PD21 1K3OA 2QA2A 1GUMA 1FB6A 2PBJA 2RLIA 3HD5A 4WETA 2B5XA 1X9MB 1PL2A 5B6MA 2JU5A 2NVLA 2OA7A 5G30A 3RBTA 4MPGA 2I4AA 4K0GA 1F37A 3VFIA 4K9ZA 3ZVJA 1TXUA 1QQ2A 3BCIA 3C73A 4NHWA 3EC3A 5C04A 1QXHA 1T4YA 4I97A 1Q98A 3UVTA 1U3AA 1BJXA 1J9BA 4OMVA 3HJPA 4F03A 1G6WA 4HJ2A 1V58A 2YV9A 4L5OA 4K6XA 5DAKA 4IBPA 3APSA 3FR6A 4IVFA 4MCUA 2H1GA 10GSA 3IR4A 4K8MA 4TR1A 1F9MA 3C8EA 4ZBDA 2DJKA 4MMMA 4ECBA 3CMIA 1FVJA 1U6TA 2H6ZA 2WVXA 5IMDA 3K8NA 4ZL8A 4J57E 5A1NA 4E8EA 2CX4A 4RI6A 3HYPA 1WE0A 4KUNA 1SD9A 3W6GA 4QQ7A 2O5VA 2WS2A 5IMAA 3PPUA 2O36A 3CWGA 3FR9A 6GSUA 2MBTA 3MIXA 2VCWA 1K0MA 4O7HA 4W66A 1TJDA 3RPNA 3E0UA 1SJ6A 4G01A 2Z9SA 4PUFC 1YF0A 4EC0A 3UIWA 2H8LA 4GWRA 3US3A 2GSRA 2CX3A 3D5JA 6GSSA 5J5NA 2A2RA 2HRKB 3N9JA 1JZWA 3TJGA 1HQOA 4GLTA 1SYXA 2LS5A 1GWCA 3U5RE 1EOHA 3A3TA 2HLSA 3WT1A 2B3SA 5CO3A 2A4VA 1PA3A 2L4QA 1VF4A 3O6TA 3MDKA 1O8WA 2B7KA 1A8LA 3ZIJA 4PI2C 3C1SA 1QK8A 3TRPA 2VCQA 3D4MA 4DVCA 1N8JA 1GH2A 1BF5A 2L6CA 2AAWA 4MH2A 3KCMA 4G0IA 4AF2A 1Y1UA 1EOGA 3F63A 1SL0B 3KD0A 1TTZA 3FRCA 2VLVA 3UARA 1ZYQB 4LA1A 2OACA 2F8AA 1SYRA 2H1BA 2WCIA 1ZMAA 4MK3A 4FH8A 3HVSA 1LBKA 4KX4A 2VUPA 2CA8A 4KCAA 4IKHA 2GZZA 4G0LA 4GXZA 1O85A 2JZSA 2NTOA 1ZYPA 3JCML 4EDZA 1XIYA 5BMUA 3M3MA 2YWIA 4HS1A 2XHFA 2HSNB 4MH3A 4MF5A 5G1LA 2X4AA 3TKQA 1TK5B 5ECKB 4KSMA 2YNXA 3G7JA 1HNAA 1THXA 2BJXA 3VI5A 2WULA 2IPAA 2HE3A 2IIYA 3N5OA 5DAKB 2CT6A 5GZZB 3UEMA 5DALA 3DWVA 1YKCA 3EMPA 4TOPA 4AGSA 4EIPA 2LNSA 2EFCA 3QFBC 2MMNA 2EIQA 2PN8A 2WVXB 3UAPA 3VK9A 1ERVA 2VL2C 3PH9A 4OCFA 3FZ9A 8GSSA 4G0KA 3TOUA 1YVLA 3GX8A 1GSUA 4JU5A 1EEJA 3HJMA 3LQ7A 1YEWC 4XS6A 1T4ZA 5GSSA 4GDFA 3FEUA 4YH2A 4CY8A 1NW2A 1RK4A 4MP4A 1Z5YE 3CBUA 3PINA 5A4WA 2C4JA 2PERA 5KEJA 5ECMB 1PKWA 3ZITA 1K0BA 3DGQA 3HJOA 4PUAA 3J7Yb 2HSYA 2JACA 3H4KA 2H1DA 1B4QA 2AV4A 5D9WA 2XBIA 2XPEA 4TXVA 1JHBA 1Z6MA 1EV9A 4Z2UA 2RUEA 1MD4A 3BJ5A 5IQYA 2V1MA 3LGCA 3FW2A 3GIXA 4IP1A 3P2AA 2HYXA 3TGZA 4I8BA 3M9KA 4OO4A 4EE0A 5ID2B 3WGXA 5CP1A 4KF9A 4MDCA 4KB3A 4E68A 4ICYA 5DDLA 1OVNA 1KBNA 1A0FA 1A2MA 2OE0A 3KM6A 1E6BA 1WPIA 2X8CA 1O81A 1TK8B 3VLNA 3CSIA 4XRAA 3L9UA 3E3EA 2YPMA 2GSTA 5F07A 3RDWA 1S3DA 5A5KA 20GSA 1MTCA 5IIZA 5COHA 2MMAA 2AJQB 2DMMA 1KNGA 3GH9A 4HDEA 2E0QA 3HY2A 2IWTA 5BRTA 1PX7A 5JCGA 1VF1A 4PGTA 1FW1A 5ECRB 5AGYA 3KZQA 1PGTA 4Z7XA 2WRTA 2K18A 2YOIA 2QC7A 2FLSA 4TN8A 4V1Ag 4XS1A 2H70A 5AISA 5ECPB 4DSSB 5F8BA 3C71A 2C8UA 2YZHA 4FIWA 3QR6A 2R4VA 2IMEA 3L4NA 3OR5A 5AIVA 5J4UA 1JZRA 3M9JA 4GCIA 3J7Yk 2R3XA 2ZCTA 1GSEA 1J08A 3KEBA 1Y25A 1XBSA 4IJIA 5DQSA 3IDVA 4XCSA 4I2TA 2YWOA 3ZFBA 3IBHA 2YJHA 1A2LA 1MDKA 4TKYA 4BPYA 2RIIA 5G1KA 1V9WA 1V98A 1N2AA 1G0TA 3H79A 1H75A 3E9JB 2RUFA 2L4CA 1MDIA 4EL1A 3NOFA 3KTBA 5J3RA 4TR3A 1F3AA 4NXIA 6GSWA 3CTFA 2WW2A 1PSQA 4G2EA 2DSAA 5JWQB 4IGJA 2DJ1A 2H6XA 3PGTA 5J47A 2YANA 4TW5A 4MABA 2VCVA 4ZL7A 1BG1A 1TI3A 3IE3A 4PQHA 2YN1A 1PQNA 3F3RA 1QFNA 3H1NA 2BTOT 2DJ2A 1N25A 4Q5NA 1O6JA 2DLXA 2NBSA 4ID0A 3ME8A 1R7HA 4N10A 3KH7A 4NPBA 1SL2B 1R4WA 1FB0A 2YJ7A 1XW9A 2BMXA 4I5QA 2LQOA 2JSYA 3SWLA 3KP9A 1OKTA 5A34B 3ERWA 2H1LA 11GSA 3C1RA 4GSNA 4AKHA 2TIRA 4EVMA 4CHSA 3HZ4A 4WF5A 3R2QA 1A2JA 1W89A 2VL2A 4FXYP 1THOA 3EWLA 2XC2A 3DXBA 1TU7A 3CSHA 4CW9A 2O87A 3EINA 4GRFA 1V57A 2WJUA 2NDOA 3GTUA 2GSSA 3LYPA 19GSA 1TW9A 1OKDA 3UMAA 4LL4B 3ZYWA 1EGRA 2C1YA 1I5GA 3RFRC 1ZL9A 3CSJA 1ERTA 1SK0A 2L5LA 3U6VA 3P7XA 3Q74A 3VI7A 4ILFA 1GP1A 2CQ9A 2KLXA 2V32A 3FMWA 3DVWA 3LEFA 4GTUA 4K7IA 7GSSA 4IHUA 3ZIVA 1I1IP 5E4WA 5EVOA 1GSFA 1S3AA 5JCWA 5ECLB 2DJJA 1NM3A 4TXOB 4IN0A 3VPTA 4Q5FA 3BBYA 1WJKA 2GZYA 3GL5A 1ZYNA 4MZBA 3ZLPA 2M72A 4XS4A 1M9BA 4WKWA 1Z9HA 4RQRA 3TKPA 4AJ7A 2JL4A 2C0EA 2H1AA 2LEGA 3CYNA 2P5RA 1FVKA 3TKSC 3VWVA 4ZXGA 1ABAA 2M80A 4PQIA 2FUG2 3QCPA 4KCEA 1GUKA 2P31A 4NV5A 4ECIA 1IYIA 4K7NA 3F9UA 2HI7A 2FNOA 4PQ1A 2O3EA 4BVYB 1PRXA 2MYGA 1PFOA 4XIHA 3IC4A 3G7IA 5ECQB 2H30A 4FYUA 1WMJA 3FR3A 1OC9B 2KOKA 2AHEA 3W8SA 2HZFA 2OADA 1B48A 2LQQA 4O5RA 17GSA 3DKSA 2FHEA 3EU4A 1AAZA 3TJKA 1XOAA 1MEKA 4N0ZA 2A2PA 3DRNA 1JLVA 2VL9A 4HI7A 2MMOA 2HFDA 3P8WA 4MJCA 4KSOA 4QMKA 1QGVA 3F6FA 5J4YA 2GDRA 1Y6EA 4OO5A 3TCOA 1GSDA 2PVQA 1EZKA 1SK1A 2L5OA 5KN3A 4D73A 2EIOA 4QL9A 1FHEA 5IPHA 2FWEA 4HUAA 3FY7A 1F6MC 2D2ZA 4WBJA 4Q5RA 3AY8A 2DJ3A 2E2MA 1K0DA 4V1Ap 4NHZA 2CVKA 4N0VA 1ML6A 2WVZA 4HZ2A 1XWCA 4MNNA 3GTUB 2C3QA 4K0NA 3I9V2 2H66A 3IHQA 4K5SA 1EP7A 4FQUA 5KN1A 2P5QA 4JR4A 1SVMA 4QL7A 3LJRA 5CAXA 2F9SA 5B6NA 2LJRA 4ZBAA 4POBA 1V2AA 2EIRA 1WWJA 4OCEA 1GTUA 2TRXA 2ZNMA 4MJAA 2IL3A 1LU4A 3LXTA 4Q5QA 4PX1A 5LCZA 2FCHA 1A23A 3C7MA 3A2VA 1HD2A 4ZILA 3TJJA 4DSRA 4MJBA 2V6KA 2GQLA 4G10A 3V1WA 3WT2A 4POLA 2EFEA 2LJAA 4KA0A 4RQXA 22GSA 2X8GA 2MBSA 5IMVA 5A4VA 3TJBA 5IMZA 2AB6A 1WIKA 3NZNA 4HQZA 3GRXA 2YP6A 2QSIA 1AQVA 3LSZA 2VM2A 1G7EA 3WGDA 4NAXA 1X5EA 3ERFA 3Q6OA 3ZTLA 4FO5A 2WVYA 3HKRA 2K8SA 2B5EA 1EV4A 3ZREA 2FY6A 5D96A 1URMA 5E59A 2OT3A 2CAQA 2K6VA 5D8IA 3F6DA 1XWKA 1JZDA 5HR0A 3M0FA 1GSYA 2V41A 1GNEA 2WW3A 4TR1B 3UVHA 4WR4A 4O92A 1I9DA 1GNWA 1SU9A 4WEYA 4F82A 2WDUA 3MSZA 1GSQA 4EIQA 3CRTA 4K2XA 3LYKA 5A1NB 3DYRA 2HSMA 4YAPA 2V2GA 1SVOA 2C80A 3L0HA 1GRXA 3HCZA 1M9AA 4IQ1A 4XRDA 2DBCA 3G7YA 4JBBA 3D0ZA 5GAND 1GULA 5KOWA 5ENUA 2B6MA 2FWFA 1YEPA 2IFQA 1M7TA 5D9VA 2OBIA 1ZZYA 4DSQA 4I2UA 1B9YC 1LJRA 2DMLA 3RHCA 5ECIB 4EXJA 2H0IA 1B8XA 4BL7A 1PX6A 2H72A 4POKA 5DJMA 4IJ3A 2WZSA 1BAYA 14GSA 3TKSA 1E2YA 2JZTA 2H74A 2WW1A 4ISDA 2JZRA 4OFTA 5B7CA 3ED3A 4AKIA 5CYYA 3NIVA 1EEMA 1AUCA 1IYHA 1Z6NA 3WYWA 1EGOA 2GGTA 1XCCA 2H75A 2N5BA 4ACSA 1M2DA 1XOBA 5H5SA 2C3TA 1PN9A 3DD3A 4L8EA 2ON5A 4OFMA 1DBYA 2H73A 5KOXA 5J40A 5F05A 3F4RA 2CVDA 2L59A 2XBQA 5GSTA 4FYCA 2QGVA 4N3ZA 4IW9A 2IJYA 4HJMA 5JCUA 5BMUB 1SVLA 1AXDA 1QMVA 2RM6A 1A8YA 2K8VA 3MAKA 1SD8A 2H19A 4WXTA 3EMXA 3GMFA 2J9HA 3ZZXA 2N5FA 3D21A 5L71A 2DC5A 1PMTA 2JSZA 2IMFA 4V2LA 3SBCA 1VF2A 1BYEA 2HNLA 2FWGA 2GS3A 2GQKA 2X64A 2R2JA 5DALB 2JADA 4XTSA 2FGXA 4PHZC 2X8HA 3KH9A 1XPVA 3IC8A 2ALBA 5J9BA 3F4SA 1VF3A 1JFUA 3O3TA 4MF7A 2QKEA 2F8FA 1X9SB 3HXSA 1YEXA 1X9WB 4F9ZA 4O5UA 4J2FA 2HSMB 3VWUA 2EFHA 1CQGA 4X4JA 4H86A 4HU7A 1PL1A 2YWMA 2E7PA 4YQVA 1XXUA 3APOA 1HNBA 3GSTA 5C00A 1KEBA 3TRQA 4OD7A 2DJ0A 4MA9A 5IOWA 2OBKA 2KHPA 1UC7A 3QMXA 4BVXA 2A2SA 1YKAA 1XWAA 1EP8A 3IOSA 5JWRB 4BIKA 4GQCA 4BL7B 1A24A 4XHMA 3F4TA 1T3BA 2FA4A 1WRYA 3CRUA 3R3EA 1ZCPA 5KN2A 2HXKA 3VURA 3HHVA 4V2NA 1WP0A 2EFDA 4TVEA 2E2GA 1ILOA 1B4PA 1J0FA 1G6YA 3GKXA 2R6KA 2UV8G 3M1GA 2HZEA 5DCGA 1OC8A 1GTAA 3KIJA 1C72A 3QAVA 1OE7A 2C0GA 1GTIA 4WBRD 4EO3A 2O89A 1DE2A 1U3IA 1FG4A 2GQMA 5CRHA 3ZVJD 1K0OA 3QDNA 4HZ4A 4O5QA 1CQHA 2LRTA 3L9SA 3FK8A 3TKSE 3TRXA 3F0IA 4POMA 13GSA 4F2IA 4JE1A 3P90A 2V6OA 4HEA2 3DEXA 1VGLA 5J4VA 3S9FA 1X5CA 3DVXA 1RQMA 1KTEA 2CAIA 4K1FA 2HRKA 1Q4JA 4ZB6A 2C0FA 4PTSA 4JEDA 2LRCA 2X49A 3W8JA 2VL3A 2DKIA 3GKNA 4AJ8A 3RPPA 5DQYA 5HR3A 1AQXA 3ISOA 5HFKA 2O85A 2I81A 2FD3A 3GX0A 3UBLA 3GUSA 4KDUA 1SKWB 3DIEA 4K5RA 1GLQA 6GSVA 3FZ5A 3IRAA 2ES7A 2UZ8A 5F06A 3QOUA 3QAWA 4ML1A 1XW6A 4GSSA 1T00A 3ZMKA 5FHIA 5KN0A 5HFGA 3ME7A 3CQFA 3TDGA 4ZBBA 4J56E 2AUVA 2LJKA 1EWXA 5D9XA 4TRXA 1S3CA 4KE3A 4PXOA 3TOTA 1PKZA 1MD3A 2HSNA 2PUKC 4GF0A 4BVXB 3MNGA 4HU9A 1T8EB 1XVQA 1HNCA 1K0CA 2GTUA 1M3JA 3FHKA 1TOFA 2HRNA 3FZAA 3UOMA 4BA7A 4HOJA 1XFLA 2AYTA 3IAS2 3A2XA 3PR8A 3IV4A 4ECCA 2YZUA 3KGKA 1WOUA 3GHAA 1K3LA 5D9TA 1DUGA 1UVZA 5ECNB 3KJYA 3Q18A 5A4UA 9GSSA 1K0AA 3F8UA 3D22A 2HZEB 2GZPA 5FT3A 4MPFA 4NMUA 3I69A 5ECOB 2YWNA 1O8XA 2WB9A 4ML6A 3FYGA 2LTKA 1H4OA 3GV1A 3EPTA 2C3NA 2VM1A 3GL3A 5EPFA 5F0GA 4PURA 1AIUA 2M46A 5ECSA 4RI7A 2PGTA 1NSWA 2HSHA 3A5IA 2VIMA 1GLPA 2VD0A 2I3YA 1X0RA 3I43A 3I6AA 4AKGA 5H5RA 4MJEA 5G5EA 2J23A 3IPZA 18GSA 2VCXA 1GTBA 2R5GA 1TP9A 5D93A 2B1KA 5G31A 3HVNA 1XG8A 1YZXA 5ABRA 3D4TA 1JZOA 2FWHA 2XPDA 4OFNA 3CXGA 1ST9A 4KW6A 4Z2RA 2OE1A 3ERGA 2R37A 4ZB7A 3LG6A 1T7PB 2IN3A 2P0GA 5JWOB 4LMWA 2CZ3A 4L5LA 4YQUA 2MMZA 4LMVA 5ID2A 2CVBA 1ON4A 3TU3B 3LXZA 4XS4B 2KP1A 2H76A 2O8VB 2VLUA 1RW1A 3EE2A 3HVVA 1A0RP 1M0UA 4DEJA 4MZCA 6GSTA 2R0PA 5HQPA 4ZB8A 2ZUPA 2A4HA 3GH6A 3UBKA 4V2MA 1VRSD 1S4BP 4FYBA 4X43A 5GAPD 1AC1A 3TJFA 4KH7A 3LWAA 2GT6A 3CHXC 1M3IA 4IELA 1Z7RA 5CRWA 1UN2A 4PNGA 1FOVA 4AJ6A 4EUYA 2B1LA 4GSTA 2DKHA 2RM5A 4TR0A 2DIYA 4IP6A 3HDCA 4YQMA 5HFIA 2LSTA 5ECHB 2FA8A 3CTGA 2OE3A 3ZRDA 1GUHA 4KDYA 4AKXB 4ZIJA 3KTLA 2H6YA 4N11A 1U88A 3G9BA 1G7OA 3F3QA 2L6DA 4DSSA 2PPTA 2LKUA 1JLWA 4OWYA 2GVPA 2WFCA 1BEDA 1BG5A 1M99A 1DE1A 12GSA 1V40A 5IMFA
chains in the Genus database with same CATH topology
2G2QA 4X0XA 2WGRA 4N30A 2F3MA 2IMKA 2VCTA 4D73B 4Z2TA 2VO4A 5LD0A 4GQFA 5J9CA 4NV2A 4MF6A 4KGIA 4O32A 1ERUA 1Z7PA 4P3YB 4G9HA 5LNKe 2LUSA 2REMA 4IS0A 1BX9A 3GSSA 2YV7A 2KP2A 5J41A 1AW9A 5D73A 3EVIA 4YKFA 1SJZA 2K9FA 1M2AA 1TK0B 4HQSA 3GFKA 4WF4A 2KUCA 3EYTA 3ZMLA 16GSA 3APQA 5IM9A 1K3YA 4AI6A 5INYA 5A5HA 1UA5A 1SL1B 5FWGA 2F51A 5DBQA 2OJLA 1TRVA 5IPGA 1B9XC 3A2WA 3BD2A 1R26A 3ZFLA 1QUWA 1YJ6A 1Z3EA 2H01A 4ZB9A 5CRGA 2NPBA 4RUVA 1R5PA 3HVXA 3BCKA 2VD1A 5AN1A 2X99A 5A34A 3LORA 2C0DA 1X5DA 2PWJA 4EDYA 1DSBA 2N5AA 1ZGNA 3KMOA 1USBA 3GN3A 2CZ2A 3TB2A 5G2ZA 3TKRA 2PVOC 3FKFA 3UJ1A 3TUEA 2G0FA 1SK2A 3RAZA 3Q19A 6GSXA 2PU9C 1ERWA 4X1UA 2H0GA 1TRUA 4A5PA 1OE8A 2GSQA 3MYDA 3EU3A 3UL3A 5HR2A 5ELGA 1XVWA 3GYKA 4WR5A 1FOHA 3VPQA 1GSSA 2GLRA 6GSYA 1YDKA 1ZOFA 3O76A 3QAGA 3GA4A 3GURA 2HRFA 5CRDA 1F2EA 3IAM2 4KDXA 3M8NA 1M2BA 1SKRB 3IXRA 4TXOA 4I6XA 1O7UA 3GNJA 3IHGA 4YKGA 5IMCA 5EL8A 4KAEA 3GKMA 1NHYA 4E8HA 1SJIA 4EKZA 1T1VA 3IA1A 2IFQB 1TRWA 4CY6A 1SKSB 1FO5A 4JR6A 1MDJA 3L9VA 2DIZA 3ZL5A 4LLRA 1ACVA 2HQTA 2LRNA 2PMTA 2IMDA 5B8BA 2LNTA 4LL1B 3A5WA 2R0CA 1GL8A 1PN0A 5DJLA 3EURA 4ECJA 4EF0A 1TU8A 4USSA 2B5YA 3BOAA 3L78A 5ELAA 5IOXA 5H5QA 4BVYA 1U87A 1OC3A 2VAFA 4K2DA 4F0BA 1XW5A 1TI1A 2R0GA 2I1UA 2VLTA 1OC9A 3LFLA 1HYUA 2MZCA 2TRCP 3GKKA 1ZYEA 1TXXA 5DCHA 4CDOA 5A5HB 3HA9A 2HT9A 2WZ9A 4TR4A 2OKAA 1TDIA 1BQ7A 1YF1A 2YCDA 3FZ4A 3MWHA 4MLYA 2VOCA 2EC4A 4K7OA 5B8AA 2LV3A 1AQWA 3IK7A 2VKZG 1O73A 5AIXA 1XWBA 4PNFA 4JRRA 2ON7A 5IO0A 5CNWA 5CREA 2GT5A 3HZ8A 4BWQA 1K0NA 1SENA 3VWXA 4JZQA 2QA1A 3LW9A 5IO2A 1R5AA 4L0WA 3D6IA 3WGEA 2I9HA 4BWSA 5HR1A 1YY7A 2O7KA 3DMLA 4YAVA 2B7JA 3KXOA 3RHBA 1NHOA 3WD6A 1TKDB 2VCZA 4MZWA 3QPMA 5EY6A 1F3BA 4F0CA 1YQ1A 2IMIA 3H8QA 4IQAA 3KP8A 2H71A 1FAAA 1XZOA 4L0UA 1TRSA 2HRAA 1OAZA 3QD9A 2CV4A 3QFAC 4KNDA 4NWYA 4ULXA 3IK9A 3KMNA 1W4VA 3VWWA 4ZL9A 5DVBA 1OYJA 2L57A 3H93A 4G19A 3HMJG 1XWGA 5G5FA 2H0HA 1PD21 1K3OA 2QA2A 1GUMA 1FB6A 2PBJA 2RLIA 3HD5A 4WETA 2B5XA 1X9MB 1PL2A 5B6MA 2JU5A 2NVLA 2OA7A 5G30A 3RBTA 4MPGA 2I4AA 4K0GA 1F37A 3VFIA 4K9ZA 3ZVJA 1TXUA 1QQ2A 3BCIA 3C73A 4NHWA 3EC3A 5C04A 1QXHA 1T4YA 4I97A 1Q98A 3UVTA 1U3AA 1BJXA 1J9BA 4OMVA 3HJPA 4F03A 1G6WA 4HJ2A 1V58A 2YV9A 4L5OA 4K6XA 5DAKA 4IBPA 3APSA 3FR6A 4IVFA 4MCUA 2H1GA 10GSA 3IR4A 4K8MA 4TR1A 1F9MA 3C8EA 4ZBDA 2DJKA 4MMMA 4ECBA 3CMIA 1FVJA 1U6TA 2H6ZA 5IMDA 3K8NA 4ZL8A 4J57E 5A1NA 4E8EA 2CX4A 4RI6A 3HYPA 1WE0A 4KUNA 1SD9A 3W6GA 4QQ7A 2O5VA 2WS2A 5IMAA 3PPUA 3CWGA 3FR9A 6GSUA 2MBTA 3MIXA 2VCWA 1K0MA 4O7HA 4W66A 1TJDA 3RPNA 3E0UA 1SJ6A 4G01A 2Z9SA 4PUFC 1YF0A 4EC0A 3UIWA 2H8LA 4GWRA 3US3A 2GSRA 2CX3A 3D5JA 6GSSA 5J5NA 2A2RA 2HRKB 3N9JA 1JZWA 3TJGA 1HQOA 4GLTA 1SYXA 2LS5A 1GWCA 3U5RE 1EOHA 3A3TA 2HLSA 3WT1A 2B3SA 5CO3A 2A4VA 1PA3A 2L4QA 1VF4A 3O6TA 3MDKA 1O8WA 2B7KA 1A8LA 3ZIJA 3C1SA 1QK8A 3TRPA 2VCQA 3D4MA 4DVCA 1N8JA 1GH2A 1BF5A 2L6CA 2AAWA 4MH2A 3KCMA 4G0IA 4AF2A 1Y1UA 1EOGA 3F63A 1SL0B 3KD0A 1TTZA 3FRCA 2VLVA 3UARA 1ZYQB 4LA1A 2OACA 2F8AA 1SYRA 2H1BA 2WCIA 1ZMAA 4MK3A 4FH8A 3HVSA 1LBKA 4KX4A 2VUPA 2CA8A 4KCAA 4IKHA 2GZZA 4G0LA 4GXZA 1O85A 2JZSA 2NTOA 1ZYPA 3JCML 4EDZA 1XIYA 5BMUA 3M3MA 2YWIA 4HS1A 2XHFA 2HSNB 4MH3A 4MF5A 5G1LA 2X4AA 3TKQA 1TK5B 5ECKB 4KSMA 2YNXA 3G7JA 1HNAA 1THXA 2BJXA 3VI5A 2WULA 2IPAA 2HE3A 2IIYA 3N5OA 5DAKB 2CT6A 5GZZB 3UEMA 5DALA 3DWVA 1YKCA 3EMPA 4TOPA 4AGSA 4EIPA 2LNSA 2EFCA 3QFBC 2MMNA 2EIQA 2PN8A 3UAPA 3VK9A 1ERVA 2VL2C 3PH9A 4OCFA 3FZ9A 8GSSA 4G0KA 3TOUA 1YVLA 3GX8A 1GSUA 4JU5A 1EEJA 3HJMA 3LQ7A 4XS6A 1T4ZA 5GSSA 4GDFA 3FEUA 4YH2A 4CY8A 1NW2A 1RK4A 4MP4A 1Z5YE 3CBUA 3PINA 5A4WA 2C4JA 2PERA 5KEJA 5ECMB 1PKWA 3ZITA 1K0BA 3DGQA 3HJOA 4PUAA 3J7Yb 2HSYA 2JACA 3H4KA 2H1DA 1B4QA 2AV4A 5D9WA 2XBIA 2XPEA 4TXVA 1JHBA 1Z6MA 1EV9A 4Z2UA 2RUEA 1MD4A 3BJ5A 5IQYA 2V1MA 3LGCA 3FW2A 3GIXA 4IP1A 3P2AA 2HYXA 3TGZA 4I8BA 3M9KA 4OO4A 4EE0A 5ID2B 3WGXA 5CP1A 4KF9A 4MDCA 4KB3A 4E68A 4ICYA 5DDLA 1OVNA 1KBNA 1A0FA 1A2MA 2OE0A 3KM6A 1E6BA 1WPIA 2X8CA 1O81A 1TK8B 3VLNA 3CSIA 4XRAA 3L9UA 3E3EA 2YPMA 2GSTA 5F07A 3RDWA 1S3DA 5A5KA 20GSA 1MTCA 5IIZA 5COHA 2MMAA 2AJQB 2DMMA 1KNGA 3GH9A 4HDEA 2E0QA 3HY2A 2IWTA 5BRTA 1PX7A 5JCGA 1VF1A 4PGTA 1FW1A 5ECRB 5AGYA 3KZQA 1PGTA 4Z7XA 2WRTA 2K18A 2YOIA 2QC7A 2FLSA 4TN8A 4V1Ag 4XS1A 2H70A 5AISA 5ECPB 4DSSB 5F8BA 3C71A 2C8UA 2YZHA 4FIWA 3QR6A 2R4VA 2IMEA 3L4NA 3OR5A 5AIVA 5J4UA 1JZRA 3M9JA 4GCIA 3J7Yk 2R3XA 2ZCTA 1GSEA 1J08A 3KEBA 1Y25A 1XBSA 4IJIA 5DQSA 3IDVA 4XCSA 4I2TA 2YWOA 3ZFBA 3IBHA 2YJHA 1A2LA 1MDKA 4TKYA 4BPYA 2RIIA 5G1KA 1V9WA 1V98A 1N2AA 1G0TA 3H79A 1H75A 3E9JB 2RUFA 2L4CA 1MDIA 4EL1A 3NOFA 3KTBA 5J3RA 4TR3A 1F3AA 4NXIA 6GSWA 3CTFA 1PSQA 4G2EA 2DSAA 5JWQB 4IGJA 2DJ1A 2H6XA 3PGTA 5J47A 2YANA 4TW5A 4MABA 2VCVA 4ZL7A 1BG1A 1TI3A 3IE3A 4PQHA 2YN1A 1PQNA 3F3RA 1QFNA 3H1NA 2BTOT 2DJ2A 1N25A 4Q5NA 1O6JA 2DLXA 2NBSA 4ID0A 3ME8A 1R7HA 4N10A 3KH7A 4NPBA 1SL2B 1R4WA 1FB0A 2YJ7A 1XW9A 2BMXA 4I5QA 2LQOA 2JSYA 3SWLA 3KP9A 1OKTA 5A34B 3ERWA 2H1LA 11GSA 3C1RA 4GSNA 4AKHA 2TIRA 4EVMA 4CHSA 3HZ4A 4WF5A 3R2QA 1A2JA 1W89A 2VL2A 1THOA 3EWLA 2XC2A 3DXBA 1TU7A 3CSHA 4CW9A 2O87A 3EINA 4GRFA 1V57A 2WJUA 2NDOA 3GTUA 2GSSA 3LYPA 19GSA 1TW9A 1OKDA 3UMAA 4LL4B 3ZYWA 1EGRA 2C1YA 1I5GA 1ZL9A 3CSJA 1ERTA 1SK0A 2L5LA 3U6VA 3P7XA 3Q74A 3VI7A 4ILFA 1GP1A 2CQ9A 2KLXA 2V32A 3FMWA 3DVWA 3LEFA 4GTUA 4K7IA 7GSSA 4IHUA 3ZIVA 5E4WA 5EVOA 1GSFA 1S3AA 5JCWA 5ECLB 2DJJA 1NM3A 4TXOB 4IN0A 3VPTA 4Q5FA 3BBYA 1WJKA 2GZYA 3GL5A 1ZYNA 4MZBA 3ZLPA 2M72A 4XS4A 1M9BA 4WKWA 1Z9HA 4RQRA 3TKPA 4AJ7A 2JL4A 2C0EA 2H1AA 2LEGA 3CYNA 2P5RA 1FVKA 3TKSC 3VWVA 4ZXGA 1ABAA 2M80A 4PQIA 2FUG2 3QCPA 4KCEA 1GUKA 2P31A 4NV5A 4ECIA 1IYIA 4K7NA 3F9UA 2HI7A 2FNOA 4PQ1A 4BVYB 1PRXA 2MYGA 4XIHA 3IC4A 3G7IA 5ECQB 2H30A 4FYUA 1WMJA 3FR3A 1OC9B 2KOKA 2AHEA 3W8SA 2HZFA 2OADA 1B48A 2LQQA 4O5RA 17GSA 3DKSA 2FHEA 3EU4A 1AAZA 3TJKA 1XOAA 1MEKA 4N0ZA 2A2PA 3DRNA 1JLVA 2VL9A 4HI7A 2MMOA 2HFDA 3P8WA 4MJCA 4KSOA 4QMKA 1QGVA 3F6FA 5J4YA 2GDRA 1Y6EA 4OO5A 3TCOA 1GSDA 2PVQA 1EZKA 1SK1A 2L5OA 5KN3A 4D73A 2EIOA 4QL9A 1FHEA 5IPHA 2FWEA 4HUAA 3FY7A 1F6MC 2D2ZA 4WBJA 4Q5RA 3AY8A 2DJ3A 2E2MA 1K0DA 4V1Ap 4NHZA 2CVKA 4N0VA 1ML6A 4HZ2A 1XWCA 4MNNA 3GTUB 2C3QA 4K0NA 3I9V2 2H66A 3IHQA 4K5SA 1EP7A 4FQUA 5KN1A 2P5QA 4JR4A 1SVMA 4QL7A 3LJRA 5CAXA 2F9SA 5B6NA 2LJRA 4ZBAA 4POBA 1V2AA 2EIRA 1WWJA 4OCEA 1GTUA 2TRXA 2ZNMA 4MJAA 2IL3A 1LU4A 3LXTA 4Q5QA 4PX1A 5LCZA 2FCHA 1A23A 3C7MA 3A2VA 1HD2A 4ZILA 3TJJA 4DSRA 4MJBA 2V6KA 2GQLA 4G10A 3V1WA 3WT2A 4POLA 2EFEA 2LJAA 4KA0A 4RQXA 22GSA 2X8GA 2MBSA 5IMVA 5A4VA 3TJBA 5IMZA 2AB6A 1WIKA 3NZNA 4HQZA 3GRXA 2YP6A 2QSIA 1AQVA 3LSZA 2VM2A 1G7EA 3WGDA 4NAXA 1X5EA 3ERFA 3Q6OA 3ZTLA 4FO5A 3HKRA 2K8SA 2B5EA 1EV4A 3ZREA 2FY6A 5D96A 1URMA 5E59A 2OT3A 2CAQA 2K6VA 5D8IA 3F6DA 1XWKA 1JZDA 5HR0A 3M0FA 1GSYA 2V41A 1GNEA 4TR1B 3UVHA 4WR4A 4O92A 1I9DA 1GNWA 1SU9A 4WEYA 4F82A 2WDUA 3MSZA 1GSQA 4EIQA 3CRTA 4K2XA 3LYKA 5A1NB 3DYRA 2HSMA 4YAPA 2V2GA 1SVOA 2C80A 3L0HA 1GRXA 3HCZA 1M9AA 4IQ1A 4XRDA 2DBCA 3G7YA 4JBBA 3D0ZA 5GAND 1GULA 5KOWA 5ENUA 2B6MA 2FWFA 1YEPA 2IFQA 1M7TA 5D9VA 2OBIA 1ZZYA 4DSQA 4I2UA 1B9YC 1LJRA 2DMLA 3RHCA 5ECIB 4EXJA 2H0IA 1B8XA 4BL7A 1PX6A 2H72A 4POKA 5DJMA 4IJ3A 1BAYA 14GSA 3TKSA 1E2YA 2JZTA 2H74A 4ISDA 2JZRA 4OFTA 5B7CA 3ED3A 4AKIA 5CYYA 3NIVA 1EEMA 1AUCA 1IYHA 1Z6NA 3WYWA 1EGOA 2GGTA 1XCCA 2H75A 2N5BA 4ACSA 1M2DA 1XOBA 5H5SA 2C3TA 1PN9A 3DD3A 4L8EA 2ON5A 4OFMA 1DBYA 2H73A 5KOXA 5J40A 5F05A 3F4RA 2CVDA 2L59A 2XBQA 5GSTA 4FYCA 2QGVA 4N3ZA 4IW9A 2IJYA 4HJMA 5JCUA 5BMUB 1SVLA 1AXDA 1QMVA 2RM6A 1A8YA 2K8VA 3MAKA 1SD8A 2H19A 4WXTA 3EMXA 3GMFA 2J9HA 3ZZXA 2N5FA 3D21A 5L71A 2DC5A 1PMTA 2JSZA 2IMFA 4V2LA 3SBCA 1VF2A 1BYEA 2HNLA 2FWGA 2GS3A 2GQKA 2X64A 2R2JA 5DALB 2JADA 4XTSA 2FGXA 2X8HA 3KH9A 1XPVA 3IC8A 2ALBA 5J9BA 3F4SA 1VF3A 1JFUA 3O3TA 4MF7A 2QKEA 2F8FA 1X9SB 3HXSA 1YEXA 1X9WB 4F9ZA 4O5UA 4J2FA 2HSMB 3VWUA 2EFHA 1CQGA 4X4JA 4H86A 4HU7A 1PL1A 2YWMA 2E7PA 4YQVA 1XXUA 3APOA 1HNBA 3GSTA 5C00A 1KEBA 3TRQA 4OD7A 2DJ0A 4MA9A 5IOWA 2OBKA 2KHPA 1UC7A 3QMXA 4BVXA 2A2SA 1YKAA 1XWAA 1EP8A 3IOSA 5JWRB 4GQCA 4BL7B 1A24A 4XHMA 3F4TA 1T3BA 2FA4A 1WRYA 3CRUA 3R3EA 1ZCPA 5KN2A 2HXKA 3VURA 3HHVA 4V2NA 1WP0A 2EFDA 4TVEA 2E2GA 1ILOA 1B4PA 1J0FA 1G6YA 3GKXA 2R6KA 2UV8G 3M1GA 2HZEA 5DCGA 1OC8A 1GTAA 3KIJA 1C72A 3QAVA 1OE7A 2C0GA 1GTIA 4WBRD 4EO3A 2O89A 1DE2A 1U3IA 1FG4A 2GQMA 5CRHA 3ZVJD 1K0OA 3QDNA 4HZ4A 4O5QA 1CQHA 2LRTA 3L9SA 3FK8A 3TKSE 3TRXA 3F0IA 4POMA 13GSA 4F2IA 4JE1A 3P90A 2V6OA 4HEA2 3DEXA 1VGLA 5J4VA 3S9FA 1X5CA 3DVXA 1RQMA 1KTEA 2CAIA 4K1FA 2HRKA 1Q4JA 4ZB6A 2C0FA 4PTSA 4JEDA 2LRCA 2X49A 3W8JA 2VL3A 2DKIA 3GKNA 4AJ8A 3RPPA 5DQYA 5HR3A 1AQXA 3ISOA 5HFKA 2O85A 2I81A 2FD3A 3GX0A 3UBLA 3GUSA 4KDUA 1SKWB 3DIEA 4K5RA 1GLQA 6GSVA 3FZ5A 3IRAA 2ES7A 2UZ8A 5F06A 3QOUA 3QAWA 4ML1A 1XW6A 4GSSA 1T00A 3ZMKA 5FHIA 5KN0A 5HFGA 3ME7A 3TDGA 4ZBBA 4J56E 2AUVA 2LJKA 1EWXA 5D9XA 4TRXA 1S3CA 4KE3A 4PXOA 3TOTA 1PKZA 1MD3A 2HSNA 2PUKC 4GF0A 4BVXB 3MNGA 4HU9A 1T8EB 1XVQA 1HNCA 1K0CA 2GTUA 3FHKA 1TOFA 2HRNA 3FZAA 3UOMA 4BA7A 4HOJA 1XFLA 2AYTA 3IAS2 3A2XA 3PR8A 3IV4A 4ECCA 2YZUA 3KGKA 1WOUA 3GHAA 1K3LA 5D9TA 1DUGA 1UVZA 5ECNB 3KJYA 3Q18A 5A4UA 9GSSA 1K0AA 3F8UA 3D22A 2HZEB 2GZPA 5FT3A 4MPFA 4NMUA 3I69A 5ECOB 2YWNA 1O8XA 2WB9A 4ML6A 3FYGA 2LTKA 1H4OA 3GV1A 3EPTA 2C3NA 2VM1A 3GL3A 5EPFA 5F0GA 4PURA 1AIUA 2M46A 5ECSA 4RI7A 2PGTA 1NSWA 2HSHA 3A5IA 2VIMA 1GLPA 2VD0A 2I3YA 1X0RA 3I43A 3I6AA 4AKGA 5H5RA 4MJEA 5G5EA 2J23A 3IPZA 18GSA 2VCXA 1GTBA 2R5GA 1TP9A 5D93A 2B1KA 5G31A 1YZXA 5ABRA 3D4TA 1JZOA 2FWHA 2XPDA 4OFNA 3CXGA 1ST9A 4KW6A 4Z2RA 2OE1A 3ERGA 2R37A 4ZB7A 3LG6A 1T7PB 2IN3A 2P0GA 5JWOB 4LMWA 2CZ3A 4L5LA 4YQUA 2MMZA 4LMVA 5ID2A 2CVBA 1ON4A 3TU3B 3LXZA 4XS4B 2KP1A 2H76A 2O8VB 2VLUA 1RW1A 3EE2A 3HVVA 1A0RP 1M0UA 4DEJA 4MZCA 6GSTA 2R0PA 5HQPA 4ZB8A 2ZUPA 2A4HA 3GH6A 3UBKA 4V2MA 1VRSD 4FYBA 4X43A 5GAPD 1AC1A 3TJFA 4KH7A 3LWAA 2GT6A 4IELA 1Z7RA 5CRWA 1UN2A 4PNGA 1FOVA 4AJ6A 4EUYA 2B1LA 4GSTA 2DKHA 2RM5A 4TR0A 2DIYA 4IP6A 3HDCA 4YQMA 5HFIA 2LSTA 5ECHB 2FA8A 3CTGA 2OE3A 3ZRDA 1GUHA 4KDYA 4AKXB 4ZIJA 3KTLA 2H6YA 4N11A 1U88A 3G9BA 1G7OA 3F3QA 2L6DA 4DSSA 2PPTA 2LKUA 1JLWA 4OWYA 2GVPA 2WFCA 1BEDA 1BG5A 1M99A 1DE1A 12GSA 1V40A 5IMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2Q A;  4X0X A;  2WGR A;  4N30 A;  2F3M A;  2IMK A;  2VCT A;  4D73 B;  2VO4 A;  5LD0 A;  4GQF A;  5J9C A;  4NV2 A;  4MF6 A;  4KGI A;  4O32 A;  1ERU A;  1Z7P A;  4P3Y B;  4G9H A;  5LNK e;  2LUS A;  2REM A;  4IS0 A;  1BX9 A;  3GSS A;  2YV7 A;  2KP2 A;  5J41 A;  1AW9 A;  5D73 A;  3EVI A;  1SJZ A;  2K9F A;  1M2A A;  1TK0 B;  4HQS A;  3GFK A;  4WF4 A;  2KUC A;  3EYT A;  3ZML A;  16GS A;  3APQ A;  5IM9 A;  1K3Y A;  5INY A;  1UA5 A;  1SL1 B;  5FWG A;  2F51 A;  5DBQ A;  2OJL A;  1TRV A;  5IPG A;  1B9X C;  3A2W A;  3BD2 A;  1R26 A;  3ZFL A;  1QUW A;  1YJ6 A;  1Z3E A;  2H01 A;  4ZB9 A;  5CRG A;  2NPB A;  4RUV A;  1R5P A;  3HVX A;  3BCK A;  2VD1 A;  5AN1 A;  2X99 A;  3LOR A;  2C0D A;  1X5D A;  2PWJ A;  4EDY A;  1DSB A;  2N5A A;  1ZGN A;  3KMO A;  1USB A;  3GN3 A;  2CZ2 A;  3TB2 A;  5G2Z A;  3TKR A;  2PVO C;  3FKF A;  3UJ1 A;  3TUE A;  2G0F A;  1SK2 A;  3RAZ A;  3Q19 A;  6GSX A;  2PU9 C;  1ERW A;  4X1U A;  2H0G A;  1TRU A;  1OE8 A;  2GSQ A;  3EU3 A;  3UL3 A;  5HR2 A;  5ELG A;  1XVW A;  3GYK A;  4WR5 A;  3VPQ A;  1GSS A;  2GLR A;  6GSY A;  1YDK A;  1ZOF A;  3O76 A;  3QAG A;  3GA4 A;  3GUR A;  2HRF A;  5CRD A;  1F2E A;  3IAM 2;  4KDX A;  3M8N A;  1M2B A;  1SKR B;  3IXR A;  4TXO A;  4I6X A;  1O7U A;  3GNJ A;  5IMC A;  5EL8 A;  4KAE A;  3GKM A;  1NHY A;  4E8H A;  1SJI A;  4EKZ A;  1T1V A;  3IA1 A;  2IFQ B;  1TRW A;  1SKS B;  1FO5 A;  4JR6 A;  1MDJ A;  3L9V A;  2DIZ A;  3ZL5 A;  4LLR A;  1ACV A;  2HQT A;  2LRN A;  2PMT A;  2IMD A;  5B8B A;  2LNT A;  4LL1 B;  3A5W A;  1GL8 A;  5DJL A;  3EUR A;  4ECJ A;  4EF0 A;  1TU8 A;  4USS A;  2B5Y A;  3BOA A;  3L78 A;  5ELA A;  5IOX A;  5H5Q A;  4BVY A;  1U87 A;  1OC3 A;  2VAF A;  4K2D A;  4F0B A;  1XW5 A;  1TI1 A;  2I1U A;  2VLT A;  1OC9 A;  3LFL A;  1HYU A;  2MZC A;  2TRC P;  3GKK A;  1ZYE A;  1TXX A;  5DCH A;  4CDO A;  3HA9 A;  2HT9 A;  2WZ9 A;  4TR4 A;  2OKA A;  1TDI A;  1BQ7 A;  1YF1 A;  2YCD A;  3FZ4 A;  3MWH A;  4MLY A;  2VOC A;  2EC4 A;  4K7O A;  5B8A A;  2LV3 A;  1AQW A;  3IK7 A;  1O73 A;  5AIX A;  1XWB A;  4PNF A;  4JRR A;  2ON7 A;  5IO0 A;  5CNW A;  5CRE A;  2GT5 A;  3HZ8 A;  4BWQ A;  1K0N A;  1SEN A;  3VWX A;  4JZQ A;  5IO2 A;  1R5A A;  4L0W A;  3D6I A;  3WGE A;  2I9H A;  4BWS A;  5HR1 A;  1YY7 A;  2O7K A;  3DML A;  4YAV A;  2B7J A;  3KXO A;  3RHB A;  1NHO A;  3WD6 A;  1TKD B;  2VCZ A;  4MZW A;  3QPM A;  5EY6 A;  1F3B A;  4F0C A;  1YQ1 A;  2IMI A;  3H8Q A;  4IQA A;  3KP8 A;  2H71 A;  1FAA A;  1XZO A;  4L0U A;  1TRS A;  2HRA A;  1OAZ A;  3QD9 A;  2CV4 A;  3QFA C;  4KND A;  4NWY A;  4ULX A;  3IK9 A;  3KMN A;  1W4V A;  3VWW A;  4ZL9 A;  5DVB A;  1OYJ A;  2L57 A;  3H93 A;  4G19 A;  1XWG A;  5G5F A;  2H0H A;  1PD2 1;  1K3O A;  1GUM A;  1FB6 A;  2PBJ A;  2RLI A;  3HD5 A;  4WET A;  2B5X A;  1X9M B;  1PL2 A;  5B6M A;  2JU5 A;  2NVL A;  2OA7 A;  5G30 A;  3RBT A;  4MPG A;  2I4A A;  4K0G A;  1F37 A;  3VFI A;  4K9Z A;  3ZVJ A;  1QQ2 A;  3BCI A;  3C73 A;  4NHW A;  3EC3 A;  5C04 A;  1QXH A;  1T4Y A;  4I97 A;  1Q98 A;  3UVT A;  1U3A A;  1BJX A;  1J9B A;  4OMV A;  3HJP A;  4F03 A;  1G6W A;  4HJ2 A;  1V58 A;  2YV9 A;  4L5O A;  4K6X A;  5DAK A;  4IBP A;  3APS A;  3FR6 A;  4IVF A;  4MCU A;  2H1G A;  10GS A;  3IR4 A;  4K8M A;  4TR1 A;  1F9M A;  3C8E A;  4ZBD A;  2DJK A;  4MMM A;  4ECB A;  3CMI A;  1FVJ A;  1U6T A;  2H6Z A;  5IMD A;  3K8N A;  4ZL8 A;  4J57 E;  4E8E A;  2CX4 A;  4RI6 A;  3HYP A;  1WE0 A;  4KUN A;  1SD9 A;  3W6G A;  4QQ7 A;  2WS2 A;  5IMA A;  3PPU A;  3FR9 A;  6GSU A;  2MBT A;  2VCW A;  1K0M A;  4O7H A;  1TJD A;  3RPN A;  3E0U A;  1SJ6 A;  2Z9S A;  4PUF C;  1YF0 A;  4EC0 A;  3UIW A;  2H8L A;  4GWR A;  3US3 A;  2GSR A;  2CX3 A;  3D5J A;  6GSS A;  5J5N A;  2A2R A;  2HRK B;  3N9J A;  1JZW A;  3TJG A;  1HQO A;  4GLT A;  1SYX A;  2LS5 A;  1GWC A;  3U5R E;  1EOH A;  3A3T A;  2HLS A;  3WT1 A;  2B3S A;  5CO3 A;  2A4V A;  1PA3 A;  2L4Q A;  1VF4 A;  3O6T A;  3MDK A;  1O8W A;  2B7K A;  1A8L A;  3ZIJ A;  3C1S A;  1QK8 A;  3TRP A;  2VCQ A;  3D4M A;  4DVC A;  1N8J A;  1GH2 A;  2L6C A;  2AAW A;  4MH2 A;  3KCM A;  4G0I A;  4AF2 A;  1EOG A;  3F63 A;  1SL0 B;  3KD0 A;  1TTZ A;  3FRC A;  2VLV A;  3UAR A;  1ZYQ B;  4LA1 A;  2OAC A;  2F8A A;  1SYR A;  2H1B A;  2WCI A;  1ZMA A;  4MK3 A;  4FH8 A;  3HVS A;  1LBK A;  4KX4 A;  2VUP A;  2CA8 A;  4KCA A;  4IKH A;  2GZZ A;  4G0L A;  4GXZ A;  1O85 A;  2JZS A;  2NTO A;  3JCM L;  4EDZ A;  1XIY A;  5BMU A;  3M3M A;  2YWI A;  4HS1 A;  2XHF A;  2HSN B;  4MH3 A;  4MF5 A;  5G1L A;  3TKQ A;  1TK5 B;  5ECK B;  4KSM A;  2YNX A;  3G7J A;  1HNA A;  1THX A;  2BJX A;  3VI5 A;  2WUL A;  2IPA A;  2HE3 A;  2IIY A;  3N5O A;  5DAK B;  2CT6 A;  5GZZ B;  3UEM A;  5DAL A;  3DWV A;  1YKC A;  3EMP A;  4TOP A;  4AGS A;  2LNS A;  3QFB C;  2MMN A;  2EIQ A;  2PN8 A;  3UAP A;  3VK9 A;  1ERV A;  2VL2 C;  3PH9 A;  4OCF A;  3FZ9 A;  8GSS A;  4G0K A;  3TOU A;  3GX8 A;  1GSU A;  4JU5 A;  1EEJ A;  3HJM A;  3LQ7 A;  4XS6 A;  1T4Z A;  5GSS A;  3FEU A;  4YH2 A;  1NW2 A;  1RK4 A;  4MP4 A;  1Z5Y E;  3CBU A;  3PIN A;  5A4W A;  2C4J A;  2PER A;  5KEJ A;  5ECM B;  1PKW A;  3ZIT A;  1K0B A;  3DGQ A;  3HJO A;  4PUA A;  3J7Y b;  2HSY A;  2JAC A;  3H4K A;  2H1D A;  1B4Q A;  2AV4 A;  5D9W A;  2XBI A;  2XPE A;  4TXV A;  1JHB A;  1Z6M A;  1EV9 A;  2RUE A;  1MD4 A;  3BJ5 A;  5IQY A;  2V1M A;  3LGC A;  3FW2 A;  3GIX A;  4IP1 A;  3P2A A;  2HYX A;  3TGZ A;  4I8B A;  3M9K A;  4OO4 A;  4EE0 A;  5ID2 B;  3WGX A;  5CP1 A;  4KF9 A;  4MDC A;  4KB3 A;  5DDL A;  1OVN A;  1KBN A;  1A0F A;  1A2M A;  2OE0 A;  3KM6 A;  1E6B A;  1WPI A;  2X8C A;  1O81 A;  1TK8 B;  3VLN A;  3CSI A;  4XRA A;  3L9U A;  3E3E A;  2YPM A;  2GST A;  5F07 A;  3RDW A;  1S3D A;  5A5K A;  20GS A;  1MTC A;  5IIZ A;  5COH A;  2MMA A;  2AJQ B;  2DMM A;  1KNG A;  3GH9 A;  4HDE A;  2E0Q A;  3HY2 A;  2IWT A;  1PX7 A;  5JCG A;  1VF1 A;  4PGT A;  1FW1 A;  5ECR B;  5AGY A;  3KZQ A;  1PGT A;  4Z7X A;  2WRT A;  2K18 A;  2YOI A;  2QC7 A;  2FLS A;  4TN8 A;  4V1A g;  4XS1 A;  2H70 A;  5AIS A;  5ECP B;  4DSS B;  5F8B A;  3C71 A;  2C8U A;  2YZH A;  4FIW A;  3QR6 A;  2R4V A;  2IME A;  3L4N A;  3OR5 A;  5AIV A;  5J4U A;  1JZR A;  3M9J A;  4GCI A;  3J7Y k;  2R3X A;  2ZCT A;  1GSE A;  1J08 A;  3KEB A;  1Y25 A;  1XBS A;  4IJI A;  5DQS A;  3IDV A;  4XCS A;  4I2T A;  2YWO A;  3ZFB A;  3IBH A;  2YJH A;  1A2L A;  1MDK A;  4TKY A;  4BPY A;  2RII A;  5G1K A;  1V9W A;  1V98 A;  1N2A A;  1G0T A;  3H79 A;  1H75 A;  3E9J B;  2RUF A;  2L4C A;  1MDI A;  4EL1 A;  3NOF A;  3KTB A;  5J3R A;  4TR3 A;  1F3A A;  4NXI A;  6GSW A;  3CTF A;  1PSQ A;  4G2E A;  2DSA A;  5JWQ B;  4IGJ A;  2DJ1 A;  2H6X A;  3PGT A;  2YAN A;  4TW5 A;  4MAB A;  2VCV A;  4ZL7 A;  1TI3 A;  3IE3 A;  4PQH A;  2YN1 A;  1PQN A;  3F3R A;  1QFN A;  3H1N A;  2BTO T;  2DJ2 A;  4Q5N A;  1O6J A;  2DLX A;  2NBS A;  4ID0 A;  3ME8 A;  1R7H A;  4N10 A;  3KH7 A;  4NPB A;  1SL2 B;  1R4W A;  1FB0 A;  2YJ7 A;  1XW9 A;  2BMX A;  4I5Q A;  2LQO A;  2JSY A;  3SWL A;  3KP9 A;  1OKT A;  3ERW A;  11GS A;  3C1R A;  4GSN A;  2TIR A;  4EVM A;  4CHS A;  3HZ4 A;  4WF5 A;  3R2Q A;  1A2J A;  1W89 A;  2VL2 A;  1THO A;  3EWL A;  2XC2 A;  3DXB A;  1TU7 A;  3CSH A;  4CW9 A;  2O87 A;  3EIN A;  4GRF A;  1V57 A;  2WJU A;  2NDO A;  3GTU A;  2GSS A;  3LYP A;  19GS A;  1TW9 A;  1OKD A;  3UMA A;  4LL4 B;  3ZYW A;  1EGR A;  2C1Y A;  1I5G A;  1ZL9 A;  3CSJ A;  1ERT A;  1SK0 A;  2L5L A;  3U6V A;  3P7X A;  3Q74 A;  3VI7 A;  4ILF A;  1GP1 A;  2CQ9 A;  2KLX A;  2V32 A;  3DVW A;  3LEF A;  4GTU A;  4K7I A;  7GSS A;  4IHU A;  3ZIV A;  5E4W A;  5EVO A;  1GSF A;  1S3A A;  5JCW A;  5ECL B;  2DJJ A;  1NM3 A;  4TXO B;  4IN0 A;  3VPT A;  4Q5F A;  3BBY A;  1WJK A;  2GZY A;  3GL5 A;  4MZB A;  3ZLP A;  2M72 A;  4XS4 A;  1M9B A;  4WKW A;  1Z9H A;  4RQR A;  3TKP A;  4AJ7 A;  2JL4 A;  2C0E A;  2H1A A;  2LEG A;  3CYN A;  2P5R A;  1FVK A;  3TKS C;  3VWV A;  4ZXG A;  1ABA A;  2M80 A;  4PQI A;  2FUG 2;  3QCP A;  4KCE A;  1GUK A;  2P31 A;  4NV5 A;  4ECI A;  1IYI A;  4K7N A;  3F9U A;  2HI7 A;  2FNO A;  4PQ1 A;  4BVY B;  1PRX A;  2MYG A;  4XIH A;  3IC4 A;  3G7I A;  5ECQ B;  2H30 A;  4FYU A;  1WMJ A;  3FR3 A;  1OC9 B;  2KOK A;  2AHE A;  3W8S A;  2HZF A;  2OAD A;  1B48 A;  2LQQ A;  4O5R A;  17GS A;  3DKS A;  2FHE A;  3EU4 A;  1AAZ A;  3TJK A;  1XOA A;  1MEK A;  4N0Z A;  3DRN A;  1JLV A;  2VL9 A;  4HI7 A;  2MMO A;  2HFD A;  3P8W A;  4MJC A;  4KSO A;  1QGV A;  3F6F A;  2GDR A;  1Y6E A;  4OO5 A;  3TCO A;  1GSD A;  2PVQ A;  1EZK A;  1SK1 A;  2L5O A;  5KN3 A;  4D73 A;  2EIO A;  4QL9 A;  1FHE A;  5IPH A;  2FWE A;  4HUA A;  3FY7 A;  1F6M C;  2D2Z A;  4WBJ A;  4Q5R A;  3AY8 A;  2DJ3 A;  2E2M A;  1K0D A;  4V1A p;  4NHZ A;  2CVK A;  4N0V A;  1ML6 A;  4HZ2 A;  1XWC A;  3GTU B;  2C3Q A;  4K0N A;  3I9V 2;  2H66 A;  3IHQ A;  1EP7 A;  4FQU A;  5KN1 A;  2P5Q A;  4JR4 A;  4QL7 A;  3LJR A;  5CAX A;  2F9S A;  5B6N A;  2LJR A;  4ZBA A;  4POB A;  1V2A A;  2EIR A;  1WWJ A;  4OCE A;  1GTU A;  2TRX A;  2ZNM A;  4MJA A;  2IL3 A;  1LU4 A;  3LXT A;  4Q5Q A;  4PX1 A;  5LCZ A;  2FCH A;  1A23 A;  3C7M A;  3A2V A;  1HD2 A;  4ZIL A;  3TJJ A;  4DSR A;  4MJB A;  2V6K A;  2GQL A;  4G10 A;  3V1W A;  3WT2 A;  4POL A;  2LJA A;  4KA0 A;  4RQX A;  22GS A;  2X8G A;  2MBS A;  5IMV A;  5A4V A;  3TJB A;  5IMZ A;  2AB6 A;  1WIK A;  3NZN A;  4HQZ A;  3GRX A;  2YP6 A;  2QSI A;  1AQV A;  3LSZ A;  2VM2 A;  1G7E A;  3WGD A;  4NAX A;  1X5E A;  3ERF A;  3Q6O A;  3ZTL A;  4FO5 A;  3HKR A;  2K8S A;  2B5E A;  1EV4 A;  3ZRE A;  2FY6 A;  5D96 A;  1URM A;  5E59 A;  2CAQ A;  2K6V A;  5D8I A;  3F6D A;  1XWK A;  1JZD A;  5HR0 A;  3M0F A;  1GSY A;  2V41 A;  1GNE A;  4TR1 B;  3UVH A;  4WR4 A;  4O92 A;  1I9D A;  1GNW A;  1SU9 A;  4WEY A;  4F82 A;  2WDU A;  3MSZ A;  1GSQ A;  3CRT A;  3LYK A;  3DYR A;  2HSM A;  4YAP A;  2V2G A;  2C80 A;  3L0H A;  1GRX A;  3HCZ A;  1M9A A;  4IQ1 A;  4XRD A;  2DBC A;  3G7Y A;  4JBB A;  3D0Z A;  5GAN D;  1GUL A;  5ENU A;  2B6M A;  2FWF A;  1YEP A;  2IFQ A;  1M7T A;  5D9V A;  2OBI A;  1ZZY A;  4DSQ A;  4I2U A;  1B9Y C;  1LJR A;  2DML A;  3RHC A;  5ECI B;  4EXJ A;  2H0I A;  1B8X A;  4BL7 A;  1PX6 A;  2H72 A;  4POK A;  5DJM A;  4IJ3 A;  1BAY A;  14GS A;  3TKS A;  1E2Y A;  2JZT A;  2H74 A;  4ISD A;  2JZR A;  4OFT A;  5B7C A;  3ED3 A;  5CYY A;  3NIV A;  1EEM A;  1AUC A;  1IYH A;  1Z6N A;  3WYW A;  1EGO A;  2GGT A;  1XCC A;  2H75 A;  2N5B A;  4ACS A;  1M2D A;  1XOB A;  5H5S A;  2C3T A;  1PN9 A;  3DD3 A;  4L8E A;  2ON5 A;  4OFM A;  1DBY A;  2H73 A;  5F05 A;  3F4R A;  2CVD A;  2L59 A;  2XBQ A;  5GST A;  4FYC A;  2QGV A;  4IW9 A;  2IJY A;  4HJM A;  5JCU A;  1AXD A;  1QMV A;  2RM6 A;  1A8Y A;  2K8V A;  3MAK A;  1SD8 A;  2H19 A;  4WXT A;  3EMX A;  3GMF A;  2J9H A;  3ZZX A;  2N5F A;  3D21 A;  5L71 A;  2DC5 A;  1PMT A;  2JSZ A;  2IMF A;  4V2L A;  3SBC A;  1VF2 A;  1BYE A;  2HNL A;  2FWG A;  2GS3 A;  2GQK A;  2X64 A;  2R2J A;  5DAL B;  2JAD A;  4XTS A;  2FGX A;  2X8H A;  3KH9 A;  1XPV A;  3IC8 A;  2ALB A;  5J9B A;  3F4S A;  1VF3 A;  1JFU A;  3O3T A;  4MF7 A;  2QKE A;  2F8F A;  1X9S B;  3HXS A;  1YEX A;  1X9W B;  4F9Z A;  4J2F A;  2HSM B;  3VWU A;  1CQG A;  4H86 A;  4HU7 A;  1PL1 A;  2YWM A;  2E7P A;  4YQV A;  1XXU A;  3APO A;  1HNB A;  3GST A;  5C00 A;  1KEB A;  3TRQ A;  4OD7 A;  2DJ0 A;  4MA9 A;  5IOW A;  2OBK A;  2KHP A;  1UC7 A;  3QMX A;  4BVX A;  2A2S A;  1YKA A;  1XWA A;  1EP8 A;  3IOS A;  5JWR B;  4GQC A;  4BL7 B;  1A24 A;  4XHM A;  3F4T A;  1T3B A;  2FA4 A;  1WRY A;  3CRU A;  3R3E A;  1ZCP A;  5KN2 A;  2HXK A;  3VUR A;  3HHV A;  4V2N A;  1WP0 A;  4TVE A;  2E2G A;  1ILO A;  1B4P A;  1J0F A;  1G6Y A;  3GKX A;  2R6K A;  3M1G A;  2HZE A;  5DCG A;  1OC8 A;  1GTA A;  3KIJ A;  3QAV A;  1C72 A;  1OE7 A;  2C0G A;  1GTI A;  4WBR D;  4EO3 A;  2O89 A;  1DE2 A;  1U3I A;  1FG4 A;  2GQM A;  5CRH A;  3ZVJ D;  1K0O A;  3QDN A;  4HZ4 A;  1CQH A;  2LRT A;  3L9S A;  3FK8 A;  3TKS E;  3TRX A;  3F0I A;  4POM A;  13GS A;  4F2I A;  4JE1 A;  3P90 A;  2V6O A;  4HEA 2;  3DEX A;  1VGL A;  3S9F A;  1X5C A;  3DVX A;  1RQM A;  1KTE A;  2CAI A;  4K1F A;  2HRK A;  1Q4J A;  4ZB6 A;  2C0F A;  4PTS A;  4JED A;  2LRC A;  3W8J A;  2VL3 A;  3GKN A;  4AJ8 A;  3RPP A;  5DQY A;  5HR3 A;  1AQX A;  3ISO A;  5HFK A;  2O85 A;  2I81 A;  2FD3 A;  3GX0 A;  3UBL A;  3GUS A;  4KDU A;  1SKW B;  3DIE A;  1GLQ A;  6GSV A;  3FZ5 A;  3IRA A;  2ES7 A;  2UZ8 A;  5F06 A;  3QOU A;  3QAW A;  4ML1 A;  1XW6 A;  4GSS A;  1T00 A;  3ZMK A;  5FHI A;  5KN0 A;  5HFG A;  3ME7 A;  3TDG A;  4ZBB A;  4J56 E;  2AUV A;  2LJK A;  1EWX A;  5D9X A;  4TRX A;  1S3C A;  4KE3 A;  4PXO A;  3TOT A;  1PKZ A;  1MD3 A;  2PUK C;  4GF0 A;  4BVX B;  3MNG A;  4HU9 A;  1T8E B;  1XVQ A;  1HNC A;  1K0C A;  2GTU A;  3FHK A;  1TOF A;  2HRN A;  3FZA A;  3UOM A;  4BA7 A;  4HOJ A;  1XFL A;  2AYT A;  3IAS 2;  3A2X A;  3PR8 A;  3IV4 A;  4ECC A;  2YZU A;  3KGK A;  1WOU A;  3GHA A;  1K3L A;  5D9T A;  1DUG A;  1UVZ A;  5ECN B;  3KJY A;  3Q18 A;  5A4U A;  9GSS A;  1K0A A;  3F8U A;  3D22 A;  2HZE B;  2GZP A;  5FT3 A;  4MPF A;  4NMU A;  3I69 A;  5ECO B;  2YWN A;  1O8X A;  2WB9 A;  4ML6 A;  3FYG A;  2LTK A;  1H4O A;  3GV1 A;  2C3N A;  2VM1 A;  3GL3 A;  5EPF A;  5F0G A;  4PUR A;  1AIU A;  2M46 A;  5ECS A;  4RI7 A;  2PGT A;  1NSW A;  2HSH A;  2VIM A;  1GLP A;  2VD0 A;  2I3Y A;  1X0R A;  3I43 A;  3I6A A;  5H5R A;  4MJE A;  5G5E A;  2J23 A;  3IPZ A;  18GS A;  2VCX A;  1GTB A;  2R5G A;  1TP9 A;  5D93 A;  2B1K A;  5G31 A;  1YZX A;  5ABR A;  3D4T A;  1JZO A;  2FWH A;  2XPD A;  4OFN A;  3CXG A;  1ST9 A;  4KW6 A;  2OE1 A;  3ERG A;  2R37 A;  3LG6 A;  1T7P B;  2IN3 A;  2P0G A;  5JWO B;  4LMW A;  2CZ3 A;  4L5L A;  4YQU A;  2MMZ A;  4LMV A;  5ID2 A;  2CVB A;  1ON4 A;  3LXZ A;  4XS4 B;  2KP1 A;  2H76 A;  2O8V B;  2VLU A;  1RW1 A;  3EE2 A;  3HVV A;  1A0R P;  1M0U A;  4DEJ A;  4MZC A;  6GST A;  5HQP A;  4ZB8 A;  2ZUP A;  3GH6 A;  3UBK A;  4V2M A;  1VRS D;  4FYB A;  4X43 A;  5GAP D;  1AC1 A;  3TJF A;  4KH7 A;  3LWA A;  2GT6 A;  4IEL A;  1Z7R A;  5CRW A;  1UN2 A;  4PNG A;  1FOV A;  4AJ6 A;  4EUY A;  2B1L A;  4GST A;  2RM5 A;  4TR0 A;  2DIY A;  4IP6 A;  3HDC A;  4YQM A;  5HFI A;  2LST A;  5ECH B;  2FA8 A;  3CTG A;  2OE3 A;  3ZRD A;  1GUH A;  4KDY A;  4ZIJ A;  3KTL A;  2H6Y A;  4N11 A;  1U88 A;  3G9B A;  1G7O A;  3F3Q A;  2L6D A;  4DSS A;  2PPT A;  2LKU A;  1JLW A;  4OWY A;  2GVP A;  2WFC A;  1BED A;  1BG5 A;  1M99 A;  1DE1 A;  12GS A;  1V40 A;  5IMF A; 
#chains in the Genus database with same CATH topology
 2G2Q A;  4X0X A;  2WGR A;  4N30 A;  2F3M A;  2IMK A;  2VCT A;  4D73 B;  4Z2T A;  2VO4 A;  5LD0 A;  4GQF A;  5J9C A;  4NV2 A;  4MF6 A;  4KGI A;  4O32 A;  1ERU A;  1Z7P A;  4P3Y B;  4G9H A;  5LNK e;  2LUS A;  2REM A;  4IS0 A;  1BX9 A;  3GSS A;  2YV7 A;  2KP2 A;  5J41 A;  1AW9 A;  5D73 A;  3EVI A;  4YKF A;  1SJZ A;  2K9F A;  1M2A A;  1TK0 B;  4HQS A;  3GFK A;  4WF4 A;  2KUC A;  3EYT A;  3ZML A;  16GS A;  3APQ A;  5IM9 A;  1K3Y A;  4AI6 A;  5INY A;  5A5H A;  1UA5 A;  1SL1 B;  5FWG A;  2F51 A;  5DBQ A;  2OJL A;  1TRV A;  5IPG A;  1B9X C;  3A2W A;  3BD2 A;  1R26 A;  3ZFL A;  1QUW A;  1YJ6 A;  1Z3E A;  2H01 A;  4ZB9 A;  5CRG A;  2NPB A;  4RUV A;  1R5P A;  3HVX A;  3BCK A;  2VD1 A;  5AN1 A;  2X99 A;  5A34 A;  3LOR A;  2C0D A;  1X5D A;  2PWJ A;  2WW0 A;  4EDY A;  1DSB A;  2N5A A;  1ZGN A;  3KMO A;  1USB A;  3GN3 A;  2CZ2 A;  3TB2 A;  5G2Z A;  3TKR A;  2PVO C;  3FKF A;  3UJ1 A;  3TUE A;  2G0F A;  1SK2 A;  3RAZ A;  3Q19 A;  6GSX A;  2PU9 C;  1ERW A;  4X1U A;  2H0G A;  1TRU A;  4A5P A;  1OE8 A;  2GSQ A;  3MYD A;  3EU3 A;  3UL3 A;  5HR2 A;  5ELG A;  1XVW A;  3GYK A;  4WR5 A;  1FOH A;  3VPQ A;  1GSS A;  2GLR A;  6GSY A;  1YDK A;  1ZOF A;  3O76 A;  3QAG A;  3GA4 A;  3GUR A;  2HRF A;  5CRD A;  1F2E A;  3IAM 2;  4KDX A;  3M8N A;  1M2B A;  1SKR B;  3IXR A;  4TXO A;  4I6X A;  1O7U A;  3GNJ A;  3IHG A;  4YKG A;  5IMC A;  5EL8 A;  4KAE A;  3GKM A;  1NHY A;  4E8H A;  1SJI A;  4EKZ A;  1T1V A;  3IA1 A;  2IFQ B;  1TRW A;  4CY6 A;  1SKS B;  1FO5 A;  4JR6 A;  1MDJ A;  3L9V A;  2DIZ A;  3ZL5 A;  4LLR A;  1ACV A;  2HQT A;  2LRN A;  2PMT A;  2IMD A;  5B8B A;  2LNT A;  4LL1 B;  3A5W A;  2R0C A;  1GL8 A;  1PN0 A;  5DJL A;  3EUR A;  4ECJ A;  1S3R A;  4EF0 A;  1TU8 A;  4USS A;  2B5Y A;  3BOA A;  3L78 A;  5ELA A;  5IOX A;  5H5Q A;  4BVY A;  1U87 A;  1OC3 A;  2VAF A;  4K2D A;  4F0B A;  1XW5 A;  1TI1 A;  2R0G A;  2I1U A;  2VLT A;  1OC9 A;  3LFL A;  1HYU A;  2MZC A;  2TRC P;  3GKK A;  1ZYE A;  1TXX A;  5DCH A;  4CDO A;  5A5H B;  3HA9 A;  2HT9 A;  2WZ9 A;  4TR4 A;  2OKA A;  1TDI A;  1BQ7 A;  1YF1 A;  2YCD A;  3RGB C;  3FZ4 A;  3MWH A;  4MLY A;  2VOC A;  2EC4 A;  4K7O A;  5B8A A;  2LV3 A;  1AQW A;  3IK7 A;  2VKZ G;  1O73 A;  5AIX A;  1XWB A;  4PNF A;  4PI0 C;  4JRR A;  2ON7 A;  5IO0 A;  5CNW A;  5CRE A;  2GT5 A;  3HZ8 A;  4BWQ A;  1K0N A;  1SEN A;  3VWX A;  4JZQ A;  2QA1 A;  3LW9 A;  5IO2 A;  1R5A A;  4L0W A;  3D6I A;  3WGE A;  2I9H A;  4BWS A;  5HR1 A;  1YY7 A;  2O7K A;  3DML A;  4YAV A;  2B7J A;  3KXO A;  3RHB A;  1NHO A;  3WD6 A;  1TKD B;  2VCZ A;  4MZW A;  3QPM A;  5EY6 A;  1F3B A;  4F0C A;  1YQ1 A;  2IMI A;  3H8Q A;  4IQA A;  2H71 A;  3KP8 A;  1FAA A;  1XZO A;  4L0U A;  1TRS A;  2HRA A;  1OAZ A;  3QD9 A;  2CV4 A;  3QFA C;  4KND A;  4HSC X;  4NWY A;  4ULX A;  3IK9 A;  3KMN A;  1W4V A;  3VWW A;  4ZL9 A;  5DVB A;  1OYJ A;  2L57 A;  3H93 A;  4G19 A;  3HMJ G;  1XWG A;  5G5F A;  2H0H A;  1PD2 1;  1K3O A;  2QA2 A;  1GUM A;  1FB6 A;  2PBJ A;  2RLI A;  3HD5 A;  4WET A;  2B5X A;  1X9M B;  1PL2 A;  5B6M A;  2JU5 A;  2NVL A;  2OA7 A;  5G30 A;  3RBT A;  4MPG A;  2I4A A;  4K0G A;  1F37 A;  3VFI A;  4K9Z A;  3ZVJ A;  1TXU A;  1QQ2 A;  3BCI A;  3C73 A;  4NHW A;  3EC3 A;  5C04 A;  1QXH A;  1T4Y A;  4I97 A;  1Q98 A;  3UVT A;  1U3A A;  1BJX A;  1J9B A;  4OMV A;  3HJP A;  4F03 A;  1G6W A;  4HJ2 A;  1V58 A;  2YV9 A;  4L5O A;  4K6X A;  5DAK A;  4IBP A;  3APS A;  3FR6 A;  4IVF A;  4MCU A;  2H1G A;  10GS A;  3IR4 A;  4K8M A;  4TR1 A;  1F9M A;  3C8E A;  4ZBD A;  2DJK A;  4MMM A;  4ECB A;  3CMI A;  1FVJ A;  1U6T A;  2H6Z A;  2WVX A;  5IMD A;  3K8N A;  4ZL8 A;  4J57 E;  5A1N A;  4E8E A;  2CX4 A;  4RI6 A;  3HYP A;  1WE0 A;  4KUN A;  1SD9 A;  3W6G A;  4QQ7 A;  2O5V A;  2WS2 A;  5IMA A;  3PPU A;  2O36 A;  3CWG A;  3FR9 A;  6GSU A;  2MBT A;  3MIX A;  2VCW A;  1K0M A;  4O7H A;  4W66 A;  1TJD A;  3RPN A;  3E0U A;  1SJ6 A;  4G01 A;  2Z9S A;  4PUF C;  1YF0 A;  4EC0 A;  3UIW A;  2H8L A;  4GWR A;  3US3 A;  2GSR A;  2CX3 A;  3D5J A;  6GSS A;  5J5N A;  2A2R A;  2HRK B;  3N9J A;  1JZW A;  3TJG A;  1HQO A;  4GLT A;  1SYX A;  2LS5 A;  1GWC A;  3U5R E;  1EOH A;  3A3T A;  2HLS A;  3WT1 A;  2B3S A;  5CO3 A;  2A4V A;  1PA3 A;  2L4Q A;  1VF4 A;  3O6T A;  3MDK A;  1O8W A;  2B7K A;  1A8L A;  3ZIJ A;  4PI2 C;  3C1S A;  1QK8 A;  3TRP A;  2VCQ A;  3D4M A;  4DVC A;  1N8J A;  1GH2 A;  1BF5 A;  2L6C A;  2AAW A;  4MH2 A;  3KCM A;  4G0I A;  4AF2 A;  1Y1U A;  1EOG A;  3F63 A;  1SL0 B;  3KD0 A;  1TTZ A;  3FRC A;  2VLV A;  3UAR A;  1ZYQ B;  4LA1 A;  2OAC A;  2F8A A;  1SYR A;  2H1B A;  2WCI A;  1ZMA A;  4MK3 A;  4FH8 A;  3HVS A;  1LBK A;  4KX4 A;  2VUP A;  2CA8 A;  4KCA A;  4IKH A;  2GZZ A;  4G0L A;  4GXZ A;  1O85 A;  2JZS A;  2NTO A;  1ZYP A;  3JCM L;  4EDZ A;  1XIY A;  5BMU A;  3M3M A;  2YWI A;  4HS1 A;  2XHF A;  2HSN B;  4MH3 A;  4MF5 A;  5G1L A;  2X4A A;  3TKQ A;  1TK5 B;  5ECK B;  4KSM A;  2YNX A;  3G7J A;  1HNA A;  1THX A;  2BJX A;  3VI5 A;  2WUL A;  2IPA A;  2HE3 A;  2IIY A;  3N5O A;  5DAK B;  2CT6 A;  5GZZ B;  3UEM A;  5DAL A;  3DWV A;  1YKC A;  3EMP A;  4TOP A;  4AGS A;  4EIP A;  2LNS A;  2EFC A;  3QFB C;  2MMN A;  2EIQ A;  2PN8 A;  2WVX B;  3UAP A;  3VK9 A;  1ERV A;  2VL2 C;  3PH9 A;  4OCF A;  3FZ9 A;  8GSS A;  4G0K A;  3TOU A;  1YVL A;  3GX8 A;  1GSU A;  4JU5 A;  1EEJ A;  3HJM A;  3LQ7 A;  1YEW C;  4XS6 A;  1T4Z A;  5GSS A;  4GDF A;  3FEU A;  4YH2 A;  4CY8 A;  1NW2 A;  1RK4 A;  4MP4 A;  1Z5Y E;  3CBU A;  3PIN A;  5A4W A;  2C4J A;  2PER A;  5KEJ A;  5ECM B;  1PKW A;  3ZIT A;  1K0B A;  3DGQ A;  3HJO A;  4PUA A;  3J7Y b;  2HSY A;  2JAC A;  3H4K A;  2H1D A;  1B4Q A;  2AV4 A;  5D9W A;  2XBI A;  2XPE A;  4TXV A;  1JHB A;  1Z6M A;  1EV9 A;  4Z2U A;  2RUE A;  1MD4 A;  3BJ5 A;  5IQY A;  2V1M A;  3LGC A;  3FW2 A;  3GIX A;  4IP1 A;  3P2A A;  2HYX A;  3TGZ A;  4I8B A;  3M9K A;  4OO4 A;  4EE0 A;  5ID2 B;  3WGX A;  5CP1 A;  4KF9 A;  4MDC A;  4KB3 A;  4E68 A;  4ICY A;  5DDL A;  1OVN A;  1KBN A;  1A0F A;  1A2M A;  2OE0 A;  3KM6 A;  1E6B A;  1WPI A;  2X8C A;  1O81 A;  1TK8 B;  3VLN A;  3CSI A;  4XRA A;  3L9U A;  3E3E A;  2YPM A;  2GST A;  5F07 A;  3RDW A;  1S3D A;  5A5K A;  20GS A;  1MTC A;  5IIZ A;  5COH A;  2MMA A;  2AJQ B;  2DMM A;  1KNG A;  3GH9 A;  4HDE A;  2E0Q A;  3HY2 A;  2IWT A;  5BRT A;  1PX7 A;  5JCG A;  1VF1 A;  4PGT A;  1FW1 A;  5ECR B;  5AGY A;  3KZQ A;  1PGT A;  4Z7X A;  2WRT A;  2K18 A;  2YOI A;  2QC7 A;  2FLS A;  4TN8 A;  4V1A g;  4XS1 A;  2H70 A;  5AIS A;  5ECP B;  4DSS B;  5F8B A;  3C71 A;  2C8U A;  2YZH A;  4FIW A;  3QR6 A;  2R4V A;  2IME A;  3L4N A;  3OR5 A;  5AIV A;  5J4U A;  1JZR A;  3M9J A;  4GCI A;  3J7Y k;  2R3X A;  2ZCT A;  1GSE A;  1J08 A;  3KEB A;  1Y25 A;  1XBS A;  4IJI A;  5DQS A;  3IDV A;  4XCS A;  4I2T A;  2YWO A;  3ZFB A;  3IBH A;  2YJH A;  1A2L A;  1MDK A;  4TKY A;  4BPY A;  2RII A;  5G1K A;  1V9W A;  1V98 A;  1N2A A;  1G0T A;  3H79 A;  1H75 A;  3E9J B;  2RUF A;  2L4C A;  1MDI A;  4EL1 A;  3NOF A;  3KTB A;  5J3R A;  4TR3 A;  1F3A A;  4NXI A;  6GSW A;  3CTF A;  2WW2 A;  1PSQ A;  4G2E A;  2DSA A;  5JWQ B;  4IGJ A;  2DJ1 A;  2H6X A;  3PGT A;  5J47 A;  2YAN A;  4TW5 A;  4MAB A;  2VCV A;  4ZL7 A;  1BG1 A;  1TI3 A;  3IE3 A;  4PQH A;  2YN1 A;  1PQN A;  3F3R A;  1QFN A;  3H1N A;  2BTO T;  2DJ2 A;  1N25 A;  4Q5N A;  1O6J A;  2DLX A;  2NBS A;  4ID0 A;  3ME8 A;  1R7H A;  4N10 A;  3KH7 A;  4NPB A;  1SL2 B;  1R4W A;  1FB0 A;  2YJ7 A;  1XW9 A;  2BMX A;  4I5Q A;  2LQO A;  2JSY A;  3SWL A;  3KP9 A;  1OKT A;  5A34 B;  3ERW A;  2H1L A;  11GS A;  3C1R A;  4GSN A;  4AKH A;  2TIR A;  4EVM A;  4CHS A;  3HZ4 A;  4WF5 A;  3R2Q A;  1A2J A;  1W89 A;  2VL2 A;  4FXY P;  1THO A;  3EWL A;  2XC2 A;  3DXB A;  1TU7 A;  3CSH A;  4CW9 A;  2O87 A;  3EIN A;  4GRF A;  1V57 A;  2WJU A;  2NDO A;  3GTU A;  2GSS A;  3LYP A;  19GS A;  1TW9 A;  1OKD A;  3UMA A;  4LL4 B;  3ZYW A;  1EGR A;  2C1Y A;  1I5G A;  3RFR C;  1ZL9 A;  3CSJ A;  1ERT A;  1SK0 A;  2L5L A;  3U6V A;  3P7X A;  3Q74 A;  3VI7 A;  4ILF A;  1GP1 A;  2CQ9 A;  2KLX A;  2V32 A;  3FMW A;  3DVW A;  3LEF A;  4GTU A;  4K7I A;  7GSS A;  4IHU A;  3ZIV A;  1I1I P;  5E4W A;  5EVO A;  1GSF A;  1S3A A;  5JCW A;  5ECL B;  2DJJ A;  1NM3 A;  4TXO B;  4IN0 A;  3VPT A;  4Q5F A;  3BBY A;  1WJK A;  2GZY A;  3GL5 A;  1ZYN A;  4MZB A;  3ZLP A;  2M72 A;  4XS4 A;  1M9B A;  4WKW A;  1Z9H A;  4RQR A;  3TKP A;  4AJ7 A;  2JL4 A;  2C0E A;  2H1A A;  2LEG A;  3CYN A;  2P5R A;  1FVK A;  3TKS C;  3VWV A;  4ZXG A;  1ABA A;  2M80 A;  4PQI A;  2FUG 2;  3QCP A;  4KCE A;  1GUK A;  2P31 A;  4NV5 A;  4ECI A;  1IYI A;  4K7N A;  3F9U A;  2HI7 A;  2FNO A;  4PQ1 A;  2O3E A;  4BVY B;  1PRX A;  2MYG A;  1PFO A;  4XIH A;  3IC4 A;  3G7I A;  5ECQ B;  2H30 A;  4FYU A;  1WMJ A;  3FR3 A;  1OC9 B;  2KOK A;  2AHE A;  3W8S A;  2HZF A;  2OAD A;  1B48 A;  2LQQ A;  4O5R A;  17GS A;  3DKS A;  2FHE A;  3EU4 A;  1AAZ A;  3TJK A;  1XOA A;  1MEK A;  4N0Z A;  2A2P A;  3DRN A;  1JLV A;  2VL9 A;  4HI7 A;  2MMO A;  2HFD A;  3P8W A;  4MJC A;  4KSO A;  4QMK A;  1QGV A;  3F6F A;  5J4Y A;  2GDR A;  1Y6E A;  4OO5 A;  3TCO A;  1GSD A;  2PVQ A;  1EZK A;  1SK1 A;  2L5O A;  5KN3 A;  4D73 A;  2EIO A;  4QL9 A;  1FHE A;  5IPH A;  2FWE A;  4HUA A;  3FY7 A;  1F6M C;  2D2Z A;  4WBJ A;  4Q5R A;  3AY8 A;  2DJ3 A;  2E2M A;  1K0D A;  4V1A p;  4NHZ A;  2CVK A;  4N0V A;  1ML6 A;  2WVZ A;  4HZ2 A;  1XWC A;  4MNN A;  3GTU B;  2C3Q A;  4K0N A;  3I9V 2;  2H66 A;  3IHQ A;  4K5S A;  1EP7 A;  4FQU A;  5KN1 A;  2P5Q A;  4JR4 A;  1SVM A;  4QL7 A;  3LJR A;  5CAX A;  2F9S A;  5B6N A;  2LJR A;  4ZBA A;  4POB A;  1V2A A;  2EIR A;  1WWJ A;  4OCE A;  1GTU A;  2TRX A;  2ZNM A;  4MJA A;  2IL3 A;  1LU4 A;  3LXT A;  4Q5Q A;  4PX1 A;  5LCZ A;  2FCH A;  1A23 A;  3C7M A;  3A2V A;  1HD2 A;  4ZIL A;  3TJJ A;  4DSR A;  4MJB A;  2V6K A;  2GQL A;  4G10 A;  3V1W A;  3WT2 A;  4POL A;  2EFE A;  2LJA A;  4KA0 A;  4RQX A;  22GS A;  2X8G A;  2MBS A;  5IMV A;  5A4V A;  3TJB A;  5IMZ A;  2AB6 A;  1WIK A;  3NZN A;  4HQZ A;  3GRX A;  2YP6 A;  2QSI A;  1AQV A;  3LSZ A;  2VM2 A;  1G7E A;  3WGD A;  4NAX A;  1X5E A;  3ERF A;  3Q6O A;  3ZTL A;  4FO5 A;  2WVY A;  3HKR A;  2K8S A;  2B5E A;  1EV4 A;  3ZRE A;  2FY6 A;  5D96 A;  1URM A;  5E59 A;  2OT3 A;  2CAQ A;  2K6V A;  5D8I A;  3F6D A;  1XWK A;  1JZD A;  5HR0 A;  3M0F A;  1GSY A;  2V41 A;  1GNE A;  2WW3 A;  4TR1 B;  3UVH A;  4WR4 A;  4O92 A;  1I9D A;  1GNW A;  1SU9 A;  4WEY A;  4F82 A;  2WDU A;  3MSZ A;  1GSQ A;  4EIQ A;  3CRT A;  4K2X A;  3LYK A;  5A1N B;  3DYR A;  2HSM A;  4YAP A;  2V2G A;  1SVO A;  2C80 A;  3L0H A;  1GRX A;  3HCZ A;  1M9A A;  4IQ1 A;  4XRD A;  2DBC A;  3G7Y A;  4JBB A;  3D0Z A;  5GAN D;  1GUL A;  5KOW A;  5ENU A;  2B6M A;  2FWF A;  1YEP A;  2IFQ A;  1M7T A;  5D9V A;  2OBI A;  1ZZY A;  4DSQ A;  4I2U A;  1B9Y C;  1LJR A;  2DML A;  3RHC A;  5ECI B;  4EXJ A;  2H0I A;  1B8X A;  4BL7 A;  1PX6 A;  2H72 A;  4POK A;  5DJM A;  4IJ3 A;  2WZS A;  1BAY A;  14GS A;  3TKS A;  1E2Y A;  2JZT A;  2H74 A;  2WW1 A;  4ISD A;  2JZR A;  4OFT A;  5B7C A;  3ED3 A;  4AKI A;  5CYY A;  3NIV A;  1EEM A;  1AUC A;  1IYH A;  1Z6N A;  3WYW A;  1EGO A;  2GGT A;  1XCC A;  2H75 A;  2N5B A;  4ACS A;  1M2D A;  1XOB A;  5H5S A;  2C3T A;  1PN9 A;  3DD3 A;  4L8E A;  2ON5 A;  4OFM A;  1DBY A;  2H73 A;  5KOX A;  5J40 A;  5F05 A;  3F4R A;  2CVD A;  2L59 A;  2XBQ A;  5GST A;  4FYC A;  2QGV A;  4N3Z A;  4IW9 A;  2IJY A;  4HJM A;  5JCU A;  5BMU B;  1SVL A;  1AXD A;  1QMV A;  2RM6 A;  1A8Y A;  2K8V A;  3MAK A;  1SD8 A;  2H19 A;  4WXT A;  3EMX A;  3GMF A;  2J9H A;  3ZZX A;  2N5F A;  3D21 A;  5L71 A;  2DC5 A;  1PMT A;  2JSZ A;  2IMF A;  4V2L A;  3SBC A;  1VF2 A;  1BYE A;  2HNL A;  2FWG A;  2GS3 A;  2GQK A;  2X64 A;  2R2J A;  5DAL B;  2JAD A;  4XTS A;  2FGX A;  4PHZ C;  2X8H A;  3KH9 A;  1XPV A;  3IC8 A;  2ALB A;  5J9B A;  3F4S A;  1VF3 A;  1JFU A;  3O3T A;  4MF7 A;  2QKE A;  2F8F A;  1X9S B;  3HXS A;  1YEX A;  1X9W B;  4F9Z A;  4O5U A;  4J2F A;  2HSM B;  3VWU A;  2EFH A;  1CQG A;  4X4J A;  4H86 A;  4HU7 A;  1PL1 A;  2YWM A;  2E7P A;  4YQV A;  1XXU A;  3APO A;  1HNB A;  3GST A;  5C00 A;  1KEB A;  3TRQ A;  4OD7 A;  2DJ0 A;  4MA9 A;  5IOW A;  2OBK A;  2KHP A;  1UC7 A;  3QMX A;  4BVX A;  2A2S A;  1YKA A;  1XWA A;  1EP8 A;  3IOS A;  5JWR B;  4BIK A;  4GQC A;  4BL7 B;  1A24 A;  4XHM A;  3F4T A;  1T3B A;  2FA4 A;  1WRY A;  3CRU A;  3R3E A;  1ZCP A;  5KN2 A;  2HXK A;  3VUR A;  3HHV A;  4V2N A;  1WP0 A;  2EFD A;  4TVE A;  2E2G A;  1ILO A;  1B4P A;  1J0F A;  1G6Y A;  3GKX A;  2R6K A;  2UV8 G;  3M1G A;  2HZE A;  5DCG A;  1OC8 A;  1GTA A;  3KIJ A;  1C72 A;  3QAV A;  1OE7 A;  2C0G A;  1GTI A;  4WBR D;  4EO3 A;  2O89 A;  1DE2 A;  1U3I A;  1FG4 A;  2GQM A;  5CRH A;  3ZVJ D;  1K0O A;  3QDN A;  4HZ4 A;  4O5Q A;  1CQH A;  2LRT A;  3L9S A;  3FK8 A;  3TKS E;  3TRX A;  3F0I A;  4POM A;  13GS A;  4F2I A;  4JE1 A;  3P90 A;  2V6O A;  4HEA 2;  3DEX A;  1VGL A;  5J4V A;  3S9F A;  1X5C A;  3DVX A;  1RQM A;  1KTE A;  2CAI A;  4K1F A;  2HRK A;  1Q4J A;  4ZB6 A;  2C0F A;  4PTS A;  4JED A;  2LRC A;  2X49 A;  3W8J A;  2VL3 A;  2DKI A;  3GKN A;  4AJ8 A;  3RPP A;  5DQY A;  5HR3 A;  1AQX A;  3ISO A;  5HFK A;  2O85 A;  2I81 A;  2FD3 A;  3GX0 A;  3UBL A;  3GUS A;  4KDU A;  1SKW B;  3DIE A;  4K5R A;  1GLQ A;  6GSV A;  3FZ5 A;  3IRA A;  2ES7 A;  2UZ8 A;  5F06 A;  3QOU A;  3QAW A;  4ML1 A;  1XW6 A;  4GSS A;  1T00 A;  3ZMK A;  5FHI A;  5KN0 A;  5HFG A;  3ME7 A;  3CQF A;  3TDG A;  4ZBB A;  4J56 E;  2AUV A;  2LJK A;  1EWX A;  5D9X A;  4TRX A;  1S3C A;  4KE3 A;  4PXO A;  3TOT A;  1PKZ A;  1MD3 A;  2HSN A;  2PUK C;  4GF0 A;  4BVX B;  3MNG A;  4HU9 A;  1T8E B;  1XVQ A;  1HNC A;  1K0C A;  2GTU A;  1M3J A;  3FHK A;  1TOF A;  2HRN A;  3FZA A;  3UOM A;  4BA7 A;  4HOJ A;  1XFL A;  2AYT A;  3IAS 2;  3A2X A;  3PR8 A;  3IV4 A;  4ECC A;  2YZU A;  3KGK A;  1WOU A;  3GHA A;  1K3L A;  5D9T A;  1DUG A;  1UVZ A;  5ECN B;  3KJY A;  3Q18 A;  5A4U A;  9GSS A;  1K0A A;  3F8U A;  3D22 A;  2HZE B;  2GZP A;  5FT3 A;  4MPF A;  4NMU A;  3I69 A;  5ECO B;  2YWN A;  1O8X A;  2WB9 A;  4ML6 A;  3FYG A;  2LTK A;  1H4O A;  3GV1 A;  3EPT A;  2C3N A;  2VM1 A;  3GL3 A;  5EPF A;  5F0G A;  4PUR A;  1AIU A;  2M46 A;  5ECS A;  4RI7 A;  2PGT A;  1NSW A;  2HSH A;  3A5I A;  2VIM A;  1GLP A;  2VD0 A;  2I3Y A;  1X0R A;  3I43 A;  3I6A A;  4AKG A;  5H5R A;  4MJE A;  5G5E A;  2J23 A;  3IPZ A;  18GS A;  2VCX A;  1GTB A;  2R5G A;  1TP9 A;  5D93 A;  2B1K A;  5G31 A;  3HVN A;  1XG8 A;  1YZX A;  5ABR A;  3D4T A;  1JZO A;  2FWH A;  2XPD A;  4OFN A;  3CXG A;  1ST9 A;  4KW6 A;  4Z2R A;  2OE1 A;  3ERG A;  2R37 A;  4ZB7 A;  3LG6 A;  1T7P B;  2IN3 A;  2P0G A;  5JWO B;  4LMW A;  2CZ3 A;  4L5L A;  4YQU A;  2MMZ A;  4LMV A;  5ID2 A;  2CVB A;  1ON4 A;  3TU3 B;  3LXZ A;  4XS4 B;  2KP1 A;  2H76 A;  2O8V B;  2VLU A;  1RW1 A;  3EE2 A;  3HVV A;  1A0R P;  1M0U A;  4DEJ A;  4MZC A;  6GST A;  2R0P A;  5HQP A;  4ZB8 A;  2ZUP A;  2A4H A;  3GH6 A;  3UBK A;  4V2M A;  1VRS D;  1S4B P;  4FYB A;  4X43 A;  5GAP D;  1AC1 A;  3TJF A;  4KH7 A;  3LWA A;  2GT6 A;  3CHX C;  1M3I A;  4IEL A;  1Z7R A;  5CRW A;  1UN2 A;  4PNG A;  1FOV A;  4AJ6 A;  4EUY A;  2B1L A;  4GST A;  2DKH A;  2RM5 A;  4TR0 A;  2DIY A;  4IP6 A;  3HDC A;  4YQM A;  5HFI A;  2LST A;  5ECH B;  2FA8 A;  3CTG A;  2OE3 A;  3ZRD A;  1GUH A;  4KDY A;  4AKX B;  4ZIJ A;  3KTL A;  2H6Y A;  4N11 A;  1U88 A;  3G9B A;  1G7O A;  3F3Q A;  2L6D A;  4DSS A;  2PPT A;  2LKU A;  1JLW A;  4OWY A;  2GVP A;  2WFC A;  1BED A;  1BG5 A;  1M99 A;  1DE1 A;  12GS A;  1V40 A;  5IMF A; 
#chains in the Genus database with same CATH homology
 2G2Q A;  4X0X A;  2WGR A;  4N30 A;  2F3M A;  2IMK A;  2VCT A;  4D73 B;  4Z2T A;  2VO4 A;  5LD0 A;  4GQF A;  5J9C A;  4NV2 A;  4MF6 A;  4KGI A;  4O32 A;  1ERU A;  1Z7P A;  4P3Y B;  4G9H A;  5LNK e;  2LUS A;  2REM A;  4IS0 A;  1BX9 A;  3GSS A;  2YV7 A;  2KP2 A;  5J41 A;  1AW9 A;  5D73 A;  3EVI A;  4YKF A;  1SJZ A;  2K9F A;  1M2A A;  1TK0 B;  4HQS A;  3GFK A;  4WF4 A;  2KUC A;  3EYT A;  3ZML A;  16GS A;  3APQ A;  5IM9 A;  1K3Y A;  4AI6 A;  5INY A;  5A5H A;  1UA5 A;  1SL1 B;  5FWG A;  2F51 A;  5DBQ A;  2OJL A;  1TRV A;  5IPG A;  1B9X C;  3A2W A;  3BD2 A;  1R26 A;  3ZFL A;  1QUW A;  1YJ6 A;  1Z3E A;  2H01 A;  4ZB9 A;  5CRG A;  2NPB A;  4RUV A;  1R5P A;  3HVX A;  3BCK A;  2VD1 A;  5AN1 A;  2X99 A;  5A34 A;  3LOR A;  2C0D A;  1X5D A;  2PWJ A;  4EDY A;  1DSB A;  2N5A A;  1ZGN A;  3KMO A;  1USB A;  3GN3 A;  2CZ2 A;  3TB2 A;  5G2Z A;  3TKR A;  2PVO C;  3FKF A;  3UJ1 A;  3TUE A;  2G0F A;  1SK2 A;  3RAZ A;  3Q19 A;  6GSX A;  2PU9 C;  1ERW A;  4X1U A;  2H0G A;  1TRU A;  4A5P A;  1OE8 A;  2GSQ A;  3MYD A;  3EU3 A;  3UL3 A;  5HR2 A;  5ELG A;  1XVW A;  3GYK A;  4WR5 A;  1FOH A;  3VPQ A;  1GSS A;  2GLR A;  6GSY A;  1YDK A;  1ZOF A;  3O76 A;  3QAG A;  3GA4 A;  3GUR A;  2HRF A;  5CRD A;  1F2E A;  3IAM 2;  4KDX A;  3M8N A;  1M2B A;  1SKR B;  3IXR A;  4TXO A;  4I6X A;  1O7U A;  3GNJ A;  3IHG A;  4YKG A;  5IMC A;  5EL8 A;  4KAE A;  3GKM A;  1NHY A;  4E8H A;  1SJI A;  4EKZ A;  1T1V A;  3IA1 A;  2IFQ B;  1TRW A;  4CY6 A;  1SKS B;  1FO5 A;  4JR6 A;  1MDJ A;  3L9V A;  2DIZ A;  3ZL5 A;  4LLR A;  1ACV A;  2HQT A;  2LRN A;  2PMT A;  2IMD A;  5B8B A;  2LNT A;  4LL1 B;  3A5W A;  2R0C A;  1GL8 A;  1PN0 A;  5DJL A;  3EUR A;  4ECJ A;  4EF0 A;  1TU8 A;  4USS A;  2B5Y A;  3BOA A;  3L78 A;  5ELA A;  5IOX A;  5H5Q A;  4BVY A;  1U87 A;  1OC3 A;  2VAF A;  4K2D A;  4F0B A;  1XW5 A;  1TI1 A;  2R0G A;  2I1U A;  2VLT A;  1OC9 A;  3LFL A;  1HYU A;  2MZC A;  2TRC P;  3GKK A;  1ZYE A;  1TXX A;  5DCH A;  4CDO A;  5A5H B;  3HA9 A;  2HT9 A;  2WZ9 A;  4TR4 A;  2OKA A;  1TDI A;  1BQ7 A;  1YF1 A;  2YCD A;  3FZ4 A;  3MWH A;  4MLY A;  2VOC A;  2EC4 A;  4K7O A;  5B8A A;  2LV3 A;  1AQW A;  3IK7 A;  2VKZ G;  1O73 A;  5AIX A;  1XWB A;  4PNF A;  4JRR A;  2ON7 A;  5IO0 A;  5CNW A;  5CRE A;  2GT5 A;  3HZ8 A;  4BWQ A;  1K0N A;  1SEN A;  3VWX A;  4JZQ A;  2QA1 A;  3LW9 A;  5IO2 A;  1R5A A;  4L0W A;  3D6I A;  3WGE A;  2I9H A;  4BWS A;  5HR1 A;  1YY7 A;  2O7K A;  3DML A;  4YAV A;  2B7J A;  3KXO A;  3RHB A;  1NHO A;  3WD6 A;  1TKD B;  2VCZ A;  4MZW A;  3QPM A;  5EY6 A;  1F3B A;  4F0C A;  1YQ1 A;  2IMI A;  3H8Q A;  4IQA A;  3KP8 A;  2H71 A;  1FAA A;  1XZO A;  4L0U A;  1TRS A;  2HRA A;  1OAZ A;  3QD9 A;  2CV4 A;  3QFA C;  4KND A;  4NWY A;  4ULX A;  3IK9 A;  3KMN A;  1W4V A;  3VWW A;  4ZL9 A;  5DVB A;  1OYJ A;  2L57 A;  3H93 A;  4G19 A;  3HMJ G;  1XWG A;  5G5F A;  2H0H A;  1PD2 1;  1K3O A;  2QA2 A;  1GUM A;  1FB6 A;  2PBJ A;  2RLI A;  3HD5 A;  4WET A;  2B5X A;  1X9M B;  1PL2 A;  5B6M A;  2JU5 A;  2NVL A;  2OA7 A;  5G30 A;  3RBT A;  4MPG A;  2I4A A;  4K0G A;  1F37 A;  3VFI A;  4K9Z A;  3ZVJ A;  1TXU A;  1QQ2 A;  3BCI A;  3C73 A;  4NHW A;  3EC3 A;  5C04 A;  1QXH A;  1T4Y A;  4I97 A;  1Q98 A;  3UVT A;  1U3A A;  1BJX A;  1J9B A;  4OMV A;  3HJP A;  4F03 A;  1G6W A;  4HJ2 A;  1V58 A;  2YV9 A;  4L5O A;  4K6X A;  5DAK A;  4IBP A;  3APS A;  3FR6 A;  4IVF A;  4MCU A;  2H1G A;  10GS A;  3IR4 A;  4K8M A;  4TR1 A;  1F9M A;  3C8E A;  4ZBD A;  2DJK A;  4MMM A;  4ECB A;  3CMI A;  1FVJ A;  1U6T A;  2H6Z A;  5IMD A;  3K8N A;  4ZL8 A;  4J57 E;  5A1N A;  4E8E A;  2CX4 A;  4RI6 A;  3HYP A;  1WE0 A;  4KUN A;  1SD9 A;  3W6G A;  4QQ7 A;  2O5V A;  2WS2 A;  5IMA A;  3PPU A;  3CWG A;  3FR9 A;  6GSU A;  2MBT A;  3MIX A;  2VCW A;  1K0M A;  4O7H A;  4W66 A;  1TJD A;  3RPN A;  3E0U A;  1SJ6 A;  4G01 A;  2Z9S A;  4PUF C;  1YF0 A;  4EC0 A;  3UIW A;  2H8L A;  4GWR A;  3US3 A;  2GSR A;  2CX3 A;  3D5J A;  6GSS A;  5J5N A;  2A2R A;  2HRK B;  3N9J A;  1JZW A;  3TJG A;  1HQO A;  4GLT A;  1SYX A;  2LS5 A;  1GWC A;  3U5R E;  1EOH A;  3A3T A;  2HLS A;  3WT1 A;  2B3S A;  5CO3 A;  2A4V A;  1PA3 A;  2L4Q A;  1VF4 A;  3O6T A;  3MDK A;  1O8W A;  2B7K A;  1A8L A;  3ZIJ A;  3C1S A;  1QK8 A;  3TRP A;  2VCQ A;  3D4M A;  4DVC A;  1N8J A;  1GH2 A;  1BF5 A;  2L6C A;  2AAW A;  4MH2 A;  3KCM A;  4G0I A;  4AF2 A;  1Y1U A;  1EOG A;  3F63 A;  1SL0 B;  3KD0 A;  1TTZ A;  3FRC A;  2VLV A;  3UAR A;  1ZYQ B;  4LA1 A;  2OAC A;  2F8A A;  1SYR A;  2H1B A;  2WCI A;  1ZMA A;  4MK3 A;  4FH8 A;  3HVS A;  1LBK A;  4KX4 A;  2VUP A;  2CA8 A;  4KCA A;  4IKH A;  2GZZ A;  4G0L A;  4GXZ A;  1O85 A;  2JZS A;  2NTO A;  1ZYP A;  3JCM L;  4EDZ A;  1XIY A;  5BMU A;  3M3M A;  2YWI A;  4HS1 A;  2XHF A;  2HSN B;  4MH3 A;  4MF5 A;  5G1L A;  2X4A A;  3TKQ A;  1TK5 B;  5ECK B;  4KSM A;  2YNX A;  3G7J A;  1HNA A;  1THX A;  2BJX A;  3VI5 A;  2WUL A;  2IPA A;  2HE3 A;  2IIY A;  3N5O A;  5DAK B;  2CT6 A;  5GZZ B;  3UEM A;  5DAL A;  3DWV A;  1YKC A;  3EMP A;  4TOP A;  4AGS A;  4EIP A;  2LNS A;  2EFC A;  3QFB C;  2MMN A;  2EIQ A;  2PN8 A;  3UAP A;  3VK9 A;  1ERV A;  2VL2 C;  3PH9 A;  4OCF A;  3FZ9 A;  8GSS A;  4G0K A;  3TOU A;  1YVL A;  3GX8 A;  1GSU A;  4JU5 A;  1EEJ A;  3HJM A;  3LQ7 A;  4XS6 A;  1T4Z A;  5GSS A;  4GDF A;  3FEU A;  4YH2 A;  4CY8 A;  1NW2 A;  1RK4 A;  4MP4 A;  1Z5Y E;  3CBU A;  3PIN A;  5A4W A;  2C4J A;  2PER A;  5KEJ A;  5ECM B;  1PKW A;  3ZIT A;  1K0B A;  3DGQ A;  3HJO A;  4PUA A;  3J7Y b;  2HSY A;  2JAC A;  3H4K A;  2H1D A;  1B4Q A;  2AV4 A;  5D9W A;  2XBI A;  2XPE A;  4TXV A;  1JHB A;  1Z6M A;  1EV9 A;  4Z2U A;  2RUE A;  1MD4 A;  3BJ5 A;  5IQY A;  2V1M A;  3LGC A;  3FW2 A;  3GIX A;  4IP1 A;  3P2A A;  2HYX A;  3TGZ A;  4I8B A;  3M9K A;  4OO4 A;  4EE0 A;  5ID2 B;  3WGX A;  5CP1 A;  4KF9 A;  4MDC A;  4KB3 A;  4E68 A;  4ICY A;  5DDL A;  1OVN A;  1KBN A;  1A0F A;  1A2M A;  2OE0 A;  3KM6 A;  1E6B A;  1WPI A;  2X8C A;  1O81 A;  1TK8 B;  3VLN A;  3CSI A;  4XRA A;  3L9U A;  3E3E A;  2YPM A;  2GST A;  5F07 A;  3RDW A;  1S3D A;  5A5K A;  20GS A;  1MTC A;  5IIZ A;  5COH A;  2MMA A;  2AJQ B;  2DMM A;  1KNG A;  3GH9 A;  4HDE A;  2E0Q A;  3HY2 A;  2IWT A;  5BRT A;  1PX7 A;  5JCG A;  1VF1 A;  4PGT A;  1FW1 A;  5ECR B;  5AGY A;  3KZQ A;  1PGT A;  4Z7X A;  2WRT A;  2K18 A;  2YOI A;  2QC7 A;  2FLS A;  4TN8 A;  4V1A g;  4XS1 A;  2H70 A;  5AIS A;  5ECP B;  4DSS B;  5F8B A;  3C71 A;  2C8U A;  2YZH A;  4FIW A;  3QR6 A;  2R4V A;  2IME A;  3L4N A;  3OR5 A;  5AIV A;  5J4U A;  1JZR A;  3M9J A;  4GCI A;  3J7Y k;  2R3X A;  2ZCT A;  1GSE A;  1J08 A;  3KEB A;  1Y25 A;  1XBS A;  4IJI A;  5DQS A;  3IDV A;  4XCS A;  4I2T A;  2YWO A;  3ZFB A;  3IBH A;  2YJH A;  1A2L A;  1MDK A;  4TKY A;  4BPY A;  2RII A;  5G1K A;  1V9W A;  1V98 A;  1N2A A;  1G0T A;  3H79 A;  1H75 A;  3E9J B;  2RUF A;  2L4C A;  1MDI A;  4EL1 A;  3NOF A;  3KTB A;  5J3R A;  4TR3 A;  1F3A A;  4NXI A;  6GSW A;  3CTF A;  1PSQ A;  4G2E A;  2DSA A;  5JWQ B;  4IGJ A;  2DJ1 A;  2H6X A;  3PGT A;  5J47 A;  2YAN A;  4TW5 A;  4MAB A;  2VCV A;  4ZL7 A;  1BG1 A;  1TI3 A;  3IE3 A;  4PQH A;  2YN1 A;  1PQN A;  3F3R A;  1QFN A;  3H1N A;  2BTO T;  2DJ2 A;  1N25 A;  4Q5N A;  1O6J A;  2DLX A;  2NBS A;  4ID0 A;  3ME8 A;  1R7H A;  4N10 A;  3KH7 A;  4NPB A;  1SL2 B;  1R4W A;  1FB0 A;  2YJ7 A;  1XW9 A;  2BMX A;  4I5Q A;  2LQO A;  2JSY A;  3SWL A;  3KP9 A;  1OKT A;  5A34 B;  3ERW A;  2H1L A;  11GS A;  3C1R A;  4GSN A;  4AKH A;  2TIR A;  4EVM A;  4CHS A;  3HZ4 A;  4WF5 A;  3R2Q A;  1A2J A;  1W89 A;  2VL2 A;  1THO A;  3EWL A;  2XC2 A;  3DXB A;  1TU7 A;  3CSH A;  4CW9 A;  2O87 A;  3EIN A;  4GRF A;  1V57 A;  2WJU A;  2NDO A;  3GTU A;  2GSS A;  3LYP A;  19GS A;  1TW9 A;  1OKD A;  3UMA A;  4LL4 B;  3ZYW A;  1EGR A;  2C1Y A;  1I5G A;  1ZL9 A;  3CSJ A;  1ERT A;  1SK0 A;  2L5L A;  3U6V A;  3P7X A;  3Q74 A;  3VI7 A;  4ILF A;  1GP1 A;  2CQ9 A;  2KLX A;  2V32 A;  3FMW A;  3DVW A;  3LEF A;  4GTU A;  4K7I A;  7GSS A;  4IHU A;  3ZIV A;  5E4W A;  5EVO A;  1GSF A;  1S3A A;  5JCW A;  5ECL B;  2DJJ A;  1NM3 A;  4TXO B;  4IN0 A;  3VPT A;  4Q5F A;  3BBY A;  1WJK A;  2GZY A;  3GL5 A;  1ZYN A;  4MZB A;  3ZLP A;  2M72 A;  4XS4 A;  1M9B A;  4WKW A;  1Z9H A;  4RQR A;  3TKP A;  4AJ7 A;  2JL4 A;  2C0E A;  2H1A A;  2LEG A;  3CYN A;  2P5R A;  1FVK A;  3TKS C;  3VWV A;  4ZXG A;  1ABA A;  2M80 A;  4PQI A;  2FUG 2;  3QCP A;  4KCE A;  1GUK A;  2P31 A;  4NV5 A;  4ECI A;  1IYI A;  4K7N A;  3F9U A;  2HI7 A;  2FNO A;  4PQ1 A;  4BVY B;  1PRX A;  2MYG A;  4XIH A;  3IC4 A;  3G7I A;  5ECQ B;  2H30 A;  4FYU A;  1WMJ A;  3FR3 A;  1OC9 B;  2KOK A;  2AHE A;  3W8S A;  2HZF A;  2OAD A;  1B48 A;  2LQQ A;  4O5R A;  17GS A;  3DKS A;  2FHE A;  3EU4 A;  1AAZ A;  3TJK A;  1XOA A;  1MEK A;  4N0Z A;  2A2P A;  3DRN A;  1JLV A;  2VL9 A;  4HI7 A;  2MMO A;  2HFD A;  3P8W A;  4MJC A;  4KSO A;  4QMK A;  1QGV A;  3F6F A;  5J4Y A;  2GDR A;  1Y6E A;  4OO5 A;  3TCO A;  1GSD A;  2PVQ A;  1EZK A;  1SK1 A;  2L5O A;  5KN3 A;  4D73 A;  2EIO A;  4QL9 A;  1FHE A;  5IPH A;  2FWE A;  4HUA A;  3FY7 A;  1F6M C;  2D2Z A;  4WBJ A;  4Q5R A;  3AY8 A;  2DJ3 A;  2E2M A;  1K0D A;  4V1A p;  4NHZ A;  2CVK A;  4N0V A;  1ML6 A;  4HZ2 A;  1XWC A;  4MNN A;  3GTU B;  2C3Q A;  4K0N A;  3I9V 2;  2H66 A;  3IHQ A;  4K5S A;  1EP7 A;  4FQU A;  5KN1 A;  2P5Q A;  4JR4 A;  1SVM A;  4QL7 A;  3LJR A;  5CAX A;  2F9S A;  5B6N A;  2LJR A;  4ZBA A;  4POB A;  1V2A A;  2EIR A;  1WWJ A;  4OCE A;  1GTU A;  2TRX A;  2ZNM A;  4MJA A;  2IL3 A;  1LU4 A;  3LXT A;  4Q5Q A;  4PX1 A;  5LCZ A;  2FCH A;  1A23 A;  3C7M A;  3A2V A;  1HD2 A;  4ZIL A;  3TJJ A;  4DSR A;  4MJB A;  2V6K A;  2GQL A;  4G10 A;  3V1W A;  3WT2 A;  4POL A;  2EFE A;  2LJA A;  4KA0 A;  4RQX A;  22GS A;  2X8G A;  2MBS A;  5IMV A;  5A4V A;  3TJB A;  5IMZ A;  2AB6 A;  1WIK A;  3NZN A;  4HQZ A;  3GRX A;  2YP6 A;  2QSI A;  1AQV A;  3LSZ A;  2VM2 A;  1G7E A;  3WGD A;  4NAX A;  1X5E A;  3ERF A;  3Q6O A;  3ZTL A;  4FO5 A;  3HKR A;  2K8S A;  2B5E A;  1EV4 A;  3ZRE A;  2FY6 A;  5D96 A;  1URM A;  5E59 A;  2OT3 A;  2CAQ A;  2K6V A;  5D8I A;  3F6D A;  1XWK A;  1JZD A;  5HR0 A;  3M0F A;  1GSY A;  2V41 A;  1GNE A;  4TR1 B;  3UVH A;  4WR4 A;  4O92 A;  1I9D A;  1GNW A;  1SU9 A;  4WEY A;  4F82 A;  2WDU A;  3MSZ A;  1GSQ A;  4EIQ A;  3CRT A;  4K2X A;  3LYK A;  5A1N B;  3DYR A;  2HSM A;  4YAP A;  2V2G A;  1SVO A;  2C80 A;  3L0H A;  1GRX A;  3HCZ A;  1M9A A;  4IQ1 A;  4XRD A;  2DBC A;  3G7Y A;  4JBB A;  3D0Z A;  5GAN D;  1GUL A;  5KOW A;  5ENU A;  2B6M A;  2FWF A;  1YEP A;  2IFQ A;  1M7T A;  5D9V A;  2OBI A;  1ZZY A;  4DSQ A;  4I2U A;  1B9Y C;  1LJR A;  2DML A;  3RHC A;  5ECI B;  4EXJ A;  2H0I A;  1B8X A;  4BL7 A;  1PX6 A;  2H72 A;  4POK A;  5DJM A;  4IJ3 A;  1BAY A;  14GS A;  3TKS A;  1E2Y A;  2JZT A;  2H74 A;  4ISD A;  2JZR A;  4OFT A;  5B7C A;  3ED3 A;  4AKI A;  5CYY A;  3NIV A;  1EEM A;  1AUC A;  1IYH A;  1Z6N A;  3WYW A;  1EGO A;  2GGT A;  1XCC A;  2H75 A;  2N5B A;  4ACS A;  1M2D A;  1XOB A;  5H5S A;  2C3T A;  1PN9 A;  3DD3 A;  4L8E A;  2ON5 A;  4OFM A;  1DBY A;  2H73 A;  5KOX A;  5J40 A;  5F05 A;  3F4R A;  2CVD A;  2L59 A;  2XBQ A;  5GST A;  4FYC A;  2QGV A;  4N3Z A;  4IW9 A;  2IJY A;  4HJM A;  5JCU A;  5BMU B;  1SVL A;  1AXD A;  1QMV A;  2RM6 A;  1A8Y A;  2K8V A;  3MAK A;  1SD8 A;  2H19 A;  4WXT A;  3EMX A;  3GMF A;  2J9H A;  3ZZX A;  2N5F A;  3D21 A;  5L71 A;  2DC5 A;  1PMT A;  2JSZ A;  2IMF A;  4V2L A;  3SBC A;  1VF2 A;  1BYE A;  2HNL A;  2FWG A;  2GS3 A;  2GQK A;  2X64 A;  2R2J A;  5DAL B;  2JAD A;  4XTS A;  2FGX A;  2X8H A;  3KH9 A;  1XPV A;  3IC8 A;  2ALB A;  5J9B A;  3F4S A;  1VF3 A;  1JFU A;  3O3T A;  4MF7 A;  2QKE A;  2F8F A;  1X9S B;  3HXS A;  1YEX A;  1X9W B;  4F9Z A;  4O5U A;  4J2F A;  2HSM B;  3VWU A;  2EFH A;  1CQG A;  4X4J A;  4H86 A;  4HU7 A;  1PL1 A;  2YWM A;  2E7P A;  4YQV A;  1XXU A;  3APO A;  1HNB A;  3GST A;  5C00 A;  1KEB A;  3TRQ A;  4OD7 A;  2DJ0 A;  4MA9 A;  5IOW A;  2OBK A;  2KHP A;  1UC7 A;  3QMX A;  4BVX A;  2A2S A;  1YKA A;  1XWA A;  1EP8 A;  3IOS A;  5JWR B;  4GQC A;  4BL7 B;  1A24 A;  4XHM A;  3F4T A;  1T3B A;  2FA4 A;  1WRY A;  3CRU A;  3R3E A;  1ZCP A;  5KN2 A;  2HXK A;  3VUR A;  3HHV A;  4V2N A;  1WP0 A;  2EFD A;  4TVE A;  2E2G A;  1ILO A;  1B4P A;  1J0F A;  1G6Y A;  3GKX A;  2R6K A;  2UV8 G;  3M1G A;  2HZE A;  5DCG A;  1OC8 A;  1GTA A;  3KIJ A;  1C72 A;  3QAV A;  1OE7 A;  2C0G A;  1GTI A;  4WBR D;  4EO3 A;  2O89 A;  1DE2 A;  1U3I A;  1FG4 A;  2GQM A;  5CRH A;  3ZVJ D;  1K0O A;  3QDN A;  4HZ4 A;  4O5Q A;  1CQH A;  2LRT A;  3L9S A;  3FK8 A;  3TKS E;  3TRX A;  3F0I A;  4POM A;  13GS A;  4F2I A;  4JE1 A;  3P90 A;  2V6O A;  4HEA 2;  3DEX A;  1VGL A;  5J4V A;  3S9F A;  1X5C A;  3DVX A;  1RQM A;  1KTE A;  2CAI A;  4K1F A;  2HRK A;  1Q4J A;  4ZB6 A;  2C0F A;  4PTS A;  4JED A;  2LRC A;  2X49 A;  3W8J A;  2VL3 A;  2DKI A;  3GKN A;  4AJ8 A;  3RPP A;  5DQY A;  5HR3 A;  1AQX A;  3ISO A;  5HFK A;  2O85 A;  2I81 A;  2FD3 A;  3GX0 A;  3UBL A;  3GUS A;  4KDU A;  1SKW B;  3DIE A;  4K5R A;  1GLQ A;  6GSV A;  3FZ5 A;  3IRA A;  2ES7 A;  2UZ8 A;  5F06 A;  3QOU A;  3QAW A;  4ML1 A;  1XW6 A;  4GSS A;  1T00 A;  3ZMK A;  5FHI A;  5KN0 A;  5HFG A;  3ME7 A;  3TDG A;  4ZBB A;  4J56 E;  2AUV A;  2LJK A;  1EWX A;  5D9X A;  4TRX A;  1S3C A;  4KE3 A;  4PXO A;  3TOT A;  1PKZ A;  1MD3 A;  2HSN A;  2PUK C;  4GF0 A;  4BVX B;  3MNG A;  4HU9 A;  1T8E B;  1XVQ A;  1HNC A;  1K0C A;  2GTU A;  3FHK A;  1TOF A;  2HRN A;  3FZA A;  3UOM A;  4BA7 A;  4HOJ A;  1XFL A;  2AYT A;  3IAS 2;  3A2X A;  3PR8 A;  3IV4 A;  4ECC A;  2YZU A;  3KGK A;  1WOU A;  3GHA A;  1K3L A;  5D9T A;  1DUG A;  1UVZ A;  5ECN B;  3KJY A;  3Q18 A;  5A4U A;  9GSS A;  1K0A A;  3F8U A;  3D22 A;  2HZE B;  2GZP A;  5FT3 A;  4MPF A;  4NMU A;  3I69 A;  5ECO B;  2YWN A;  1O8X A;  2WB9 A;  4ML6 A;  3FYG A;  2LTK A;  1H4O A;  3GV1 A;  3EPT A;  2C3N A;  2VM1 A;  3GL3 A;  5EPF A;  5F0G A;  4PUR A;  1AIU A;  2M46 A;  5ECS A;  4RI7 A;  2PGT A;  1NSW A;  2HSH A;  3A5I A;  2VIM A;  1GLP A;  2VD0 A;  2I3Y A;  1X0R A;  3I43 A;  3I6A A;  4AKG A;  5H5R A;  4MJE A;  5G5E A;  2J23 A;  3IPZ A;  18GS A;  2VCX A;  1GTB A;  2R5G A;  1TP9 A;  5D93 A;  2B1K A;  5G31 A;  1YZX A;  5ABR A;  3D4T A;  1JZO A;  2FWH A;  2XPD A;  4OFN A;  3CXG A;  1ST9 A;  4KW6 A;  4Z2R A;  2OE1 A;  3ERG A;  2R37 A;  4ZB7 A;  3LG6 A;  1T7P B;  2IN3 A;  2P0G A;  5JWO B;  4LMW A;  2CZ3 A;  4L5L A;  4YQU A;  2MMZ A;  4LMV A;  5ID2 A;  2CVB A;  1ON4 A;  3TU3 B;  3LXZ A;  4XS4 B;  2KP1 A;  2H76 A;  2O8V B;  2VLU A;  1RW1 A;  3EE2 A;  3HVV A;  1A0R P;  1M0U A;  4DEJ A;  4MZC A;  6GST A;  2R0P A;  5HQP A;  4ZB8 A;  2ZUP A;  2A4H A;  3GH6 A;  3UBK A;  4V2M A;  1VRS D;  4FYB A;  4X43 A;  5GAP D;  1AC1 A;  3TJF A;  4KH7 A;  3LWA A;  2GT6 A;  4IEL A;  1Z7R A;  5CRW A;  1UN2 A;  4PNG A;  1FOV A;  4AJ6 A;  4EUY A;  2B1L A;  4GST A;  2DKH A;  2RM5 A;  4TR0 A;  2DIY A;  4IP6 A;  3HDC A;  4YQM A;  5HFI A;  2LST A;  5ECH B;  2FA8 A;  3CTG A;  2OE3 A;  3ZRD A;  1GUH A;  4KDY A;  4AKX B;  4ZIJ A;  3KTL A;  2H6Y A;  4N11 A;  1U88 A;  3G9B A;  1G7O A;  3F3Q A;  2L6D A;  4DSS A;  2PPT A;  2LKU A;  1JLW A;  4OWY A;  2GVP A;  2WFC A;  1BED A;  1BG5 A;  1M99 A;  1DE1 A;  12GS A;  1V40 A;  5IMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...