1AXDA

Structure of glutathione s-transferase-i bound with the ligand lactoylglutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
APMKLYGAVMSWNLTRCATALEEAGSDYEIVPINFATAEHKSPEHLVRNPFGQVPALQDGDLYLFESRAICKYAARKNKPELLREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSGLMERPSVQKVAALM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE I
publication title Crystal structure of herbicide-detoxifying maize glutathione S-transferase-I in complex with lactoylglutathione: evidence for an induced-fit mechanism.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 76
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1997-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1axdA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1axdA01
5A4VA 3DIEA 2TIRA 1ON4A 4HU9A 4BWQA 2B5XA 3QAGA 2JL4A 1JZDA 1H4OA 1TK0B 3C1RA 2WCIA 1K0DA 2MZCA 3HYPA 1AQXA 4O7HA 4MDCA 1NW2A 3UBKA 4QL7A 2PGTA 4K1FA 4MABA 1NSWA 5IMZA 2C80A 4IGJA 2DJ2A 5ECOB 1M9AA 3RBTA 3P7XA 1QFNA 4WXTA 4KDUA 5CP1A 4HJ2A 4F82A 3R2QA 4XS4B 4KUNA 3KIJA 3KJYA 3ZMLA 1MD4A 5HFKA 5LD0A 1T4YA 2FY6A 5L71A 2VD0A 4XRAA 5D8IA 4KF9A 5HQPA 5DCGA 2HXKA 1C72A 2WB9A 1PKWA 1ZCPA 2HZEA 4EVMA 1JLWA 4NWYA 1JLVA 4LL1B 4MZCA 3DYRA 4AJ8A 5HR2A 4TR1A 1MTCA 1V98A 2FWGA 2C1YA 2L6CA 4IJ3A 3FRCA 4PURA 2WRTA 5D9XA 2MBTA 1SJ6A 2EIRA 5C04A 2LTKA 2UZ8A 2IL3A 1YJ6A 1U3AA 4IW9A 3IBHA 5CRHA 1IYIA 1XBSA 2CA8A 2XPEA 1FW1A 5CNWA 1K3LA 1MDJA 4JR6A 3F6FA 1EEJA 5F05A 4K8MA 3ZITA 4TXVA 3DVWA 5DDLA 4MF6A 5AGYA 4Q5FA 4BVYA 1OKDA 4J2FA 3EYTA 3IK7A 3LWAA 3ED3A 4ZILA 4OCFA 4RUVA 1PGTA 1R26A 3F9UA 3HJOA 1GSUA 4L5OA 5EVOA 1S3AA 4K9ZA 3D4TA 2G0FA 3IK9A 3U5RE 2IMFA 1ST9A 4TOPA 1FVKA 3C71A 1BEDA 1DBYA 5B6NA 4N11A 3H8QA 5KN3A 2K8VA 1X5CA 2RM5A 1WJKA 3Q19A 1URMA 1XFLA 1M7TA 4RI6A 5DBQA 3GL3A 1N2AA 3ZL5A 1EV4A 2VCXA 3A5WA 2H30A 4XS4A 2IMKA 4N0VA 2GSQA 1A23A 2L4CA 1K0AA 3A2XA 1F6MC 1K3YA 1O8XA 3TJFA 2NVLA 3ZLPA 3PINA 2LJKA 4PUFC 1WMJA 1VF3A 4ZXGA 4ECBA 2EC4A 4PX1A 3F6DA 2FWHA 3TKSE 4PXOA 3TRPA 3QMXA 1Z5YE 2F51A 3TRQA 5ECSA 2H6YA 1K0MA 4K0NA 3CRUA 2CQ9A 3WT1A 2C3QA 3TB2A 2K8SA 2N5FA 1V2AA 4TRXA 1XCCA 4GCIA 1ZMAA 2H72A 2FHEA 4ZL9A 2REMA 2VCZA 4IKHA 3I69A 3UOMA 1VF1A 1GSEA 3VWUA 4TR0A 1DE1A 1TP9A 1K0OA 2M80A 1X9SB 4QQ7A 4K7OA 1VGLA 1Z6NA 1F3AA 3LEFA 1JHBA 3IHQA 2C3NA 5AN1A 3GURA 4KSMA 5KN2A 3GV1A 3MNGA 2A4VA 4OO4A 1OE7A 1V9WA 5IO2A 5HR1A 5IPHA 1KNGA 4ILFA 3I6AA 5J4UA 3ISOA 5G2ZA 2C0DA 3MWHA 2ES7A 2FD3A 1MD3A 4V1Ag 5H5RA 2X8HA 3NIVA 5E59A 3HZ8A 2H70A 3P8WA 1G7OA 2CV4A 3TOTA 1GTUA 4I97A 3OR5A 3UMAA 1FVJA 2LJAA 3N9JA 3R3EA 4WKWA 5GZZB 4IQAA 1TRSA 1A0RP 2PU9C 4IQ1A 3WGXA 1XIYA 3S9FA 4HJMA 3ZFBA 5DJMA 2DJJA 3EMXA 1LBKA 1GSFA 1TRVA 3C73A 4F0BA 2B5YA 2C8UA 1SKSB 1V40A 3JCML 4YQVA 2VCVA 1UVZA 2ZCTA 3KP9A 5GAPD 3QCPA 2DJ3A 2IJYA 1GLPA 2JSZA 3HY2A 1ACVA 3VPQA 2CVBA 1QXHA 2O85A 2YP6A 4OMVA 4ZL7A 2OACA 2XPDA 3C7MA 6GSXA 2OKAA 4TN8A 4OFTA 3FY7A 2B7KA 4RQXA 2B3SA 3D0ZA 1N8JA 3GH9A 4WF5A 1FG4A 3UIWA 2H1GA 4XS6A 3GNJA 3CTFA 2OA7A 3LG6A 2H8LA 5E4WA 4OFNA 2YPMA 2C0GA 1GL8A 3GTUB 3LXZA 2DJKA 2CZ2A 4QL9A 3VK9A 1EV9A 2PUKC 1XOBA 1EEMA 1SK1A 1OC9B 2I1UA 2X64A 5G30A 3FZ5A 3GA4A 2H1DA 4JRRA 5ECPB 2HLSA 3HJMA 3ZYWA 2AB6A 1AIUA 4EDZA 4JR4A 2HI7A 3HVVA 3IC4A 4KNDA 1O85A 1B9YC 3ERWA 1W4VA 1ERUA 1DE2A 5IOXA 1S3DA 2WZ9A 5JWQB 1HD2A 3IV4A 3DGQA 1EZKA 5A4UA 1XWKA 5IO0A 3EWLA 5J9CA 5DAKB 4JE1A 3D4MA 1TKDB 3LYKA 1PL1A 1OC3A 5KN0A 1T3BA 2ALBA 3VFIA 2PBJA 2XBQA 2LQQA 3H79A 4V2NA 5FWGA 1V57A 2LRTA 5F06A 4MLYA 3CYNA 5JWOB 5B6MA 1M2DA 2B5EA 3NOFA 4J57E 3TJKA 3L9SA 3IC8A 4ZBDA 4KCEA 2H1BA 3TKSC 2GSRA 1B4PA 2BMXA 5ENUA 2JZTA 2H01A 7GSSA 4L8EA 2H75A 5IIZA 1GRXA 4WR5A 1U88A 3DRNA 4BVXB 2YZUA 3TGZA 3QR6A 1GH2A 2YZHA 3TDGA 5D93A 2PN8A 4FH8A 1AAZA 4TVEA 3U6VA 1YKCA 3EMPA 3WGDA 3GKNA 1A2LA 4EC0A 5IPGA 4MK3A 3LGCA 2HSHA 1OAZA 2V2GA 3C1SA 4GQFA 2KOKA 1I5GA 2CAIA 4GF0A 5F07A 2KLXA 4MH3A 3VI7A 3P90A 1MEKA 1XVWA 1GNEA 3RPNA 1GP1A 4XS1A 2O89A 1Q98A 1PKZA 13GSA 4MPFA 2HT9A 2H0HA 3L0HA 1QK8A 1BX9A 2XC2A 1YF1A 3FW2A 3Q74A 2GQKA 2H73A 4G0LA 4F9ZA 3TJBA 4DSRA 1ZYEA 2VLUA 4L0WA 2FGXA 4HU7A 2LRCA 2I3YA 2H74A 2X8CA 3QAVA 5ID2B 4MZWA 1CQHA 2VD1A 1R7HA 4Q5QA 2L59A 3M0FA 4PNFA 1DUGA 4GRFA 12GSA 1BAYA 2C4JA 2A2RA 2KHPA 2Z9SA 3TKPA 3TRXA 2RUFA 3TJJA 5BMUA 3KCMA 3J7Yk 2IMEA 1EP7A 4KAEA 1M2AA 1E6BA 3WD6A 4WF4A 4HQZA 3GUSA 5EY6A 1PD21 4AJ7A 3ZTLA 4ECCA 2DMMA 1YEPA 5IMFA 3ZRDA 3W6GA 2FA8A 3KD0A 3HVXA 3KEBA 1F37A 1CQGA 4BL7B 2EIOA 1DSBA 3M1GA 3EVIA 3O76A 4ML6A 4N0ZA 5CO3A 4BVXA 3GKKA 4KE3A 3EE2A 1ZOFA 5IMCA 2F8AA 1QQ2A 3CBUA 4DSSB 4AF2A 2GT6A 4EL1A 1VF2A 3GFKA 4PNGA 3UL3A 3UJ1A 2VL2C 3VWWA 4YAPA 1XWCA 1XW9A 1J0FA 3IRAA 1Z6MA 2NPBA 3ZZXA 2D2ZA 1FB0A 1M2BA 4LA1A 1Q4JA 3VI5A 2CVDA 1OE8A 3Q6OA 4WEYA 3EINA 1T7PB 5AIXA 1M0UA 5B8AA 3GN3A 4ACSA 2DIZA 1M99A 4NHZA 4D73B 2MMOA 2A2SA 2VL3A 2LV3A 4CW9A 2VLVA 1R4WA 3DXBA 4PQ1A 2C0EA 2GZPA 5A5KA 1USBA 3HKRA 1U6TA 1FOVA 4IVFA 1XXUA 2HYXA 1HNAA 3CMIA 2IPAA 3LJRA 5ABRA 3FYGA 4MJEA 1THXA 1HNBA 1MDKA 4GSSA 3F0IA 2GGTA 2E2GA 1R5PA 2HSNB 4I2UA 1T8EB 1Z9HA 2OJLA 5INYA 3F3QA 1TJDA 3AY8A 2HRAA 1GTAA 3WGEA 5DALB 2LRNA 1E2YA 4POLA 1TRWA 2M72A 5ECQB 1OC8A 4DEJA 2KP2A 1A2MA 5A4WA 1KEBA 4XTSA 4KSOA 5ECIB 1BJXA 4G0KA 3LQ7A 4NV5A 4BL7A 14GSA 4I2TA 1O8WA 1ML6A 4KA0A 4JBBA 3KM6A 2C0FA 1XW5A 3ZIVA 1SKRB 1GTIA 5G1LA 4DVCA 1BYEA 5ELGA 1SK0A 2WDUA 2B1KA 2OE1A 1GTBA 4DSSA 5CREA 3TCOA 3TKQA 3APSA 2JADA 2YCDA 1ERWA 3RDWA 2YV9A 4ZBBA 2OBKA 3PPUA 1ERVA 1EOHA 3GSSA 3ME8A 2RIIA 3KP8A 1FO5A 4K7IA 2AJQB 1AXDA 2YOIA 4IJIA 5CRDA 2MMNA 5DQYA 4PQHA 3HXSA 3KTBA 5D9WA 2HFDA 1X9MB 3TUEA 4KDYA 3VURA 4D73A 6GSVA 1A8YA 5EL8A 3QD9A 2VCTA 3PGTA 2VL9A 3EU3A 3GL5A 1T4ZA 4V2MA 3A2VA 4MZBA 4MCUA 1SKWB 4JEDA 2L5LA 2M46A 2QC7A 4XRDA 2R4VA 3FR9A 1GLQA 3O6TA 2CVKA 2H19A 2GS3A 5IOWA 4MP4A 2VUPA 2FUG2 1EOGA 2XBIA 3HJPA 3A2WA 3WYWA 2B1LA 3UVHA 3ZMKA 1ILOA 2IFQB 2I9HA 2QKEA 5D73A 2JU5A 2YANA 3GIXA 2K18A 2WFCA 2CX4A 5IMDA 3LXTA 1TW9A 5ECKB 3FZ9A 3IE3A 3UBLA 4I5QA 1NHOA 1XWBA 3UEMA 3FEUA 8GSSA 2N5AA 2YNXA 3FR6A 3RHBA 2WJUA 2ON5A 1W89A 1F9MA 1GNWA 4BPYA 2GZZA 1XWGA 1LU4A 2GT5A 3J7Yb 4WBJA 4MMMA 4IHUA 2DSAA 5ECNB 6GSTA 1TXXA 4O32A 3DWVA 2X99A 4LMVA 1AC1A 4EUYA 6GSWA 3CRTA 5J41A 2NTOA 1TU7A 2JSYA 1ZYQB 4WR4A 5ECHB 1YEXA 2RM6A 1JZWA 4ZB8A 4X0XA 3QPMA 2R37A 2TRXA 2P31A 1SD9A 4HZ2A 4IP1A 2AYTA 1YZXA 4XIHA 2V6KA 1OYJA 2WS2A 4MJAA 1SD8A 4KGIA 5H5QA 1A24A 4RQRA 1O81A 22GSA 3CSIA 2LKUA 1BG5A 2AV4A 1K0BA 1O7UA 1PL2A 2H1AA 3BJ5A 2BJXA 2H71A 4BWSA 1Z3EA 1PQNA 1AW9A 3G7IA 3KMNA 3US3A 5C00A 2L5OA 2G2QA 4L0UA 2H66A 3F4SA 3MDKA 4EDYA 1B8XA 5DCHA 2MMAA 1QUWA 4OD7A 4G10A 3W8JA 2FNOA 3D21A 2J23A 1Y6EA 5DVBA 4ECIA 1XVQA 1MDIA 3ZVJD 1T00A 2F8FA 4KW6A 1XOAA 1KBNA 4F0CA 1WP0A 3D22A 5DQSA 4IS0A 1GUHA 5FHIA 2IN3A 1AUCA 3IXRA 4V2LA 4ULXA 2J9HA 1I9DA 4I6XA 3HCZA 4CDOA 4ZL8A 4USSA 5G5EA 3MAKA 4Q5NA 3EU4A 4DSQA 6GSUA 4EO3A 5IM9A 1AQWA 4EXJA 2PPTA 1WOUA 3C8EA 3UARA 1SJZA 3SWLA 1SYRA 4OO5A 2JACA 1GUMA 4X43A 3UAPA 2PERA 2OE0A 1FHEA 10GSA 2NBSA 3GX8A 3GYKA 3QDNA 5FT3A 2N5BA 2V41A 1U3IA 3GTUA 3I9V2 4BA7A 3M9KA 4KCAA 2IWTA 2B6MA 3KXOA 3IPZA 1SL1B 3QFAC 1OC9A 3FKFA 3GSTA 2KP1A 5JCGA 2I4AA 2FWFA 4ZB9A 2H6ZA 5IMAA 1EGOA 2LNTA 2YWNA 3CTGA 2LSTA 2RUEA 5F8BA 2VM2A 1HQOA 3ERGA 2DJ0A 2MMZA 1WPIA 3LORA 2B7JA 4H86A 3ZIJA 1SL0B 3BBYA 1OKTA 5DJLA 1WWJA 1PA3A 1EWXA 3PH9A 2L6DA 1EGRA 4ID0A 2IMIA 4P3YB 4E8HA 1TDIA 4K6XA 2DC5A 4KDXA 1TK5B 2E2MA 5CAXA 5DAKA 2OADA 4GSNA 4ML1A 2VCWA 3M8NA 5GAND 2LJRA 5B7CA 4FYBA 1SJIA 3KH9A 4TXOB 19GSA 3Q18A 3VWXA 1KTEA 2VLTA 3VLNA 5IMVA 2YJHA 5GSTA 1RK4A 3IAM2 1WE0A 3KMOA 3P2AA 4MPGA 3K8NA 4Q5RA 3CXGA 3I43A 3RHCA 1ERTA 1TTZA 4FIWA 9GSSA 5CRWA 2AUVA 3N5OA 3SBCA 3GMFA 2I81A 4IP6A 3QAWA 4OWYA 5HR3A 3GH6A 3TKSA 1S3CA 1T1VA 5KN1A 4PUAA 3E3EA 3ERFA 3EC3A 1HYUA 2VCQA 3DKSA 2R2JA 1ABAA 2O7KA 5J5NA 2YWMA 2H6XA 2LQOA 4GLTA 2QSIA 5ECRB 1K3OA 1XZOA 1K0NA 4YH2A 1TU8A 1X5DA 1B48A 5COHA 1J08A 2C3TA 4J56E 1YF0A 1YDKA 5G5FA 4NMUA 3FZAA 1RQMA 1GSYA 4F2IA 1G0TA 4HUAA 5AISA 3BCKA 3V1WA 3UVTA 1UC7A 4MA9A 1TK8B 3LSZA 4MJCA 3L9UA 3TKRA 5G31A 4GTUA 3E0UA 4POKA 4IBPA 4WETA 1QMVA 5JWRB 3H1NA 5IQYA 2WULA 17GSA 3KGKA 5HFIA 4PGTA 4JU5A 2K6VA 2P0GA 2HSMB 1PMTA 4MJBA 4HQSA 4OCEA 5ID2A 2R6KA 4ECJA 2DMLA 4MH2A 2O87A 3IOSA 2NDOA 4XCSA 2DLXA 4KH7A 4GQCA 1U87A 4TXOA 3GHAA 2FLSA 2PWJA 3WT2A 1H75A 2GQLA 3G9BA 18GSA 3L78A 5LNKe 2IIYA 4ZBAA 1M9BA 1X9WB 1VF4A 1Z7PA 3A3TA 1XWAA 2WGRA 3ME7A 2HRNA 1IYHA 1AQVA 5HFGA 4GWRA 4TR3A 4LMWA 3KH7A 3APOA 1G6YA 1XPVA 3L4NA 2P5QA 3HHVA 2MYGA 2QGVA 2DIYA 1UA5A 16GSA 5B8BA 2F3MA 3H93A 5CYYA 1V58A 5LCZA 2CAQA 2BTOT 4HDEA 2OE3A 1FAAA 2VO4A 1VRSD 4ZB6A 1GSDA 4KB3A 2X8GA 2HRFA 5J9BA 3HVSA 2YWOA 4YQUA 3BOAA 3KZQA 2GVPA 1EP8A 2JZRA 4N30A 1NM3A 4XHMA 1R5AA 3D6IA 3W8SA 1ZL9A 2H76A 2L4QA 1TOFA 2CZ3A 4G0IA 2LNSA 1JFUA 4TKYA 2VL2A 1PX6A 3G7YA 2VIMA 4IN0A 2YV7A 5CRGA 1OVNA 5D9TA 2HSYA 2O8VB 3ZVJA 1GULA 2AHEA 5D9VA 1A0FA 4F03A 2CX3A 2YWIA 2GSSA 5KEJA 4LLRA 4ZIJA 4POBA 5HR0A 4OFMA 3FHKA 2OBIA 2FCHA 2L57A 5F0GA 1SU9A 4HZ4A 4K2DA 2HSMA 4X1UA 3O3TA 1GSQA 2AAWA 2F9SA 1JZRA 5EPFA 3ZFLA 4IELA 1YY7A 6GSSA 1G6WA 6GSYA 2FA4A 3FK8A 2R5GA 4NHWA 4PQIA 4WBRD 4Z7XA 3LYPA 2P5RA 4CHSA 2DBCA 1SK2A 3F3RA 5DALA 3APQA 2FWEA 1PN9A 2ON7A 4K7NA 2V6OA 3ZREA 1ZZYA 5J3RA 3IR4A 4AGSA 1GSSA 1QGVA 3G7JA 3QOUA 3TJGA 2XHFA 4HI7A 1YKAA 11GSA 3RPPA 4NAXA 1THOA 1BQ7A 3GX0A 1SL2B 2H0GA 5ECLB 3H4KA 1O73A 3D5JA 1TI3A 3F8UA 3HDCA 2E7PA 3GRXA 3BCIA 2EIQA 1GUKA 5ECMB 3RAZA 4AJ6A 3F63A 3GKMA 3F4RA 4FO5A 1PRXA 2VM1A 2LUSA 4G9HA 4HOJA 1B9XC 2MBSA 2V32A 1YQ1A 2H0IA 3FZ4A 2ZUPA 4EE0A 1Y25A 1O6JA 3IDVA 1TRUA 1X5EA 2YN1A 2TRCP 1Z7RA 4G2EA 1SENA 20GSA 3DVXA 2GLRA 2ZNMA 2HRKB 2VOCA 2GSTA 1FB6A 1F2EA 2K9FA 5G1KA 3VPTA 4FQUA 4K0GA 4MF5A 2YJ7A 1HNCA 4N10A 2PMTA 4O5RA 1PX7A 1PSQA 4FYUA 3HZ4A 4YAVA 4I8BA 2DJ1A 3FR3A 2HNLA 1LJRA 5JCWA 2GZYA 1RW1A 3TOUA 4JZQA 2KUCA 2CT6A 1UN2A 2PVOC 4L5LA 5GSSA 3PR8A 4O92A 2HE3A 4HS1A 4POMA 2IMDA 3E9JB 4NXIA 3CSJA 3DMLA 4GSTA 4TW5A 5D96A 3BD2A 2GDRA 3CSHA 3HD5A 4GXZA 1G7EA 4MF7A 1GWCA 4ISDA 1K0CA 5H5SA 1XW6A 2IFQA 4G19A 3KTLA 1X0RA 4NPBA 3LFLA 1B4QA 3DD3A 2JZSA 4FYCA 4NV2A 2HQTA 3HA9A 1SYXA 2PVQA 1TI1A 1ZGNA 1J9BA 2HZEB 4E8EA 1JZOA 2HZFA 4KX4A 4PTSA 4TR1B 3F4TA 4HEA2 3NZNA 4LL4B 4YQMA 2LS5A 3IAS2 3M9JA 4EKZA 2LEGA 2R3XA 1WRYA 2VAFA 5ELAA 3VWVA 4TR4A 1A2JA 1WIKA 2V1MA 3QFBC 2E0QA 3DEXA 4EF0A 4V1Ap 3IA1A 3EURA 2GTUA 1F3BA 3M3MA 2HRKA 5JCUA 4RI7A 2RLIA 5AIVA 3L9VA 1A8LA 2GQMA 3GKXA 4BVYB 3MSZA 1NHYA
chains in the Genus database with same CATH superfamily
5A4VA 3DIEA 2TIRA 1ON4A 4HU9A 4BWQA 2B5XA 3QAGA 2JL4A 1JZDA 1H4OA 1TK0B 3C1RA 5A1NB 2WCIA 1K0DA 2MZCA 3HYPA 1AQXA 4O7HA 2QA2A 4MDCA 1NW2A 3UBKA 4QL7A 2PGTA 4K1FA 4MABA 1NSWA 5IMZA 2C80A 4IGJA 2DJ2A 5ECOB 1M9AA 3RBTA 3P7XA 1QFNA 4WXTA 4KDUA 5CP1A 4HJ2A 4F82A 3R2QA 4XS4B 4KUNA 3KIJA 4O5QA 4EIPA 3KJYA 3ZMLA 1MD4A 5HFKA 5LD0A 1T4YA 2FY6A 5L71A 2VD0A 4XRAA 5D8IA 4KF9A 5HQPA 5DCGA 2HXKA 1C72A 2WB9A 1PKWA 1ZCPA 2HZEA 4EVMA 1JLWA 4NWYA 1JLVA 4LL1B 4MZCA 3DYRA 4AJ8A 5HR2A 4TR1A 1MTCA 1V98A 2FWGA 2C1YA 2L6CA 4IJ3A 3FRCA 4PURA 2WRTA 5D9XA 2MBTA 1SJ6A 2EIRA 5C04A 2LTKA 2UZ8A 2IL3A 1YJ6A 1U3AA 4IW9A 3IBHA 5CRHA 1IYIA 1XBSA 2CA8A 2XPEA 1FW1A 2H1LA 5CNWA 1K3LA 1MDJA 4JR6A 3F6FA 5J47A 1EEJA 5F05A 4K8MA 3ZITA 4TXVA 3DVWA 3CHXC 5DDLA 4MF6A 5AGYA 4Q5FA 5A5HA 4BVYA 4YKGA 1OKDA 4J2FA 1N25A 3EYTA 3IK7A 3LWAA 3ED3A 4ZILA 4OCFA 4RUVA 1PGTA 1R26A 3F9UA 3HJOA 1GSUA 1ZYNA 4L5OA 5EVOA 1S3AA 4K9ZA 3D4TA 2G0FA 3IK9A 3U5RE 2IMFA 1ST9A 4TOPA 5J4YA 1FVKA 3C71A 4EIQA 1BEDA 1DBYA 2EFDA 5B6NA 4W66A 3H8QA 4N11A 5KN3A 2K8VA 1X5CA 2RM5A 1WJKA 3Q19A 1URMA 1XFLA 3CQFA 1M7TA 4RI6A 5DBQA 3GL3A 1N2AA 3ZL5A 1EV4A 2VCXA 3A5WA 2H30A 4XS4A 2IMKA 4N0VA 2GSQA 1A23A 2L4CA 1K0AA 3A2XA 1F6MC 1K3YA 1O8XA 3TJFA 2NVLA 3ZLPA 3PINA 2LJKA 4PUFC 1WMJA 1VF3A 4ZXGA 4ECBA 2EC4A 4PX1A 3F6DA 2FWHA 3TKSE 4PXOA 3TRPA 3QMXA 1Z5YE 2F51A 3TRQA 5ECSA 4K2XA 2H6YA 1K0MA 4K0NA 3CRUA 2CQ9A 3WT1A 2C3QA 3TB2A 2K8SA 2N5FA 1V2AA 4TRXA 1XCCA 4GCIA 1ZMAA 2H72A 2FHEA 4ZL9A 2REMA 2VCZA 4IKHA 3I69A 4GDFA 3UOMA 1VF1A 4Z2RA 1GSEA 3VWUA 4TR0A 1DE1A 1TP9A 1K0OA 2M80A 1X9SB 4QQ7A 4K7OA 1VGLA 2X4AA 1Z6NA 1F3AA 2WZSA 4ICYA 3LEFA 1JHBA 3IHQA 2C3NA 5AN1A 3GURA 4KSMA 5KN2A 3GV1A 3MNGA 2A4VA 2EFCA 4OO4A 1OE7A 3TU3B 1V9WA 5IO2A 5HR1A 5IPHA 1KNGA 4ILFA 3I6AA 5J4UA 3ISOA 5G2ZA 2C0DA 3MWHA 2ES7A 2FD3A 1MD3A 4V1Ag 5H5RA 2X8HA 3NIVA 5E59A 3HZ8A 2H70A 3P8WA 1G7OA 2CV4A 3TOTA 1GTUA 4I97A 3OR5A 3UMAA 1FVJA 2LJAA 3N9JA 3R3EA 4WKWA 5GZZB 4IQAA 1TRSA 1A0RP 2PU9C 4IQ1A 4AKHA 3WGXA 1XIYA 3S9FA 4HJMA 3ZFBA 5DJMA 2DJJA 3EMXA 1LBKA 1GSFA 1TRVA 5KOXA 3C73A 4F0BA 2B5YA 2C8UA 1SKSB 1V40A 3JCML 4YQVA 2VCVA 1UVZA 2ZCTA 3KP9A 5GAPD 3QCPA 2DJ3A 2IJYA 1GLPA 2JSZA 3HY2A 1ACVA 3VPQA 2CVBA 1QXHA 2EFHA 2O85A 2YP6A 4OMVA 4ZL7A 2OACA 2XPDA 3C7MA 6GSXA 2OKAA 4TN8A 4OFTA 5J4VA 3FY7A 2B7KA 4RQXA 2B3SA 3D0ZA 1N8JA 3GH9A 4WF5A 1FG4A 4CY6A 3UIWA 2H1GA 4XS6A 3GNJA 3CTFA 2OA7A 3LG6A 2H8LA 5E4WA 4OFNA 2YPMA 2C0GA 1GL8A 3GTUB 3LXZA 2DJKA 4A5PA 2CZ2A 4QL9A 3VK9A 1EV9A 2PUKC 2R0PA 1XOBA 1EEMA 1SK1A 1OC9B 2I1UA 2X64A 5G30A 3FZ5A 3GA4A 2H1DA 4JRRA 5ECPB 2HLSA 3HJMA 3ZYWA 2AB6A 1AIUA 4EDZA 4JR4A 2HI7A 3HVVA 3IC4A 4KNDA 1O85A 1B9YC 3IHGA 3ERWA 1W4VA 1ERUA 1DE2A 5IOXA 1S3DA 2WZ9A 5JWQB 1HD2A 2OT3A 4X4JA 3IV4A 3DGQA 1EZKA 5A4UA 1XWKA 5IO0A 3EWLA 5J9CA 5DAKB 4JE1A 3D4MA 1TKDB 3LYKA 1PL1A 1OC3A 2WW3A 5KN0A 1T3BA 2ALBA 3VFIA 2PBJA 2XBQA 2LQQA 4BIKA 3H79A 4V2NA 5FWGA 1V57A 2LRTA 5F06A 4MLYA 3CYNA 5JWOB 5B6MA 1M2DA 2B5EA 3NOFA 4J57E 3TJKA 3L9SA 3IC8A 4ZBDA 4KCEA 2H1BA 3TKSC 2GSRA 1B4PA 2BMXA 5ENUA 2JZTA 2H01A 7GSSA 4L8EA 2H75A 5IIZA 1GRXA 4WR5A 1U88A 3DRNA 4BVXB 2YZUA 3TGZA 3QR6A 1GH2A 2YZHA 3TDGA 5D93A 2PN8A 1AAZA 4FH8A 4TVEA 3U6VA 1YKCA 3EMPA 3WGDA 3GKNA 1A2LA 4EC0A 5IPGA 4MK3A 3LGCA 2HSHA 1OAZA 2V2GA 3C1SA 4GQFA 2KOKA 1I5GA 2CAIA 4GF0A 5F07A 2DKHA 2KLXA 4MH3A 3VI7A 3P90A 1MEKA 1XVWA 1GNEA 3RPNA 1GP1A 4XS1A 2O89A 1Q98A 1PKZA 13GSA 4MPFA 2HT9A 2H0HA 3L0HA 1QK8A 1I1IP 1BX9A 3HVNA 2XC2A 1YF1A 3FW2A 3Q74A 2GQKA 2H73A 4G0LA 2WW2A 4F9ZA 3TJBA 4DSRA 1ZYEA 2VLUA 4L0WA 2FGXA 4HU7A 4N3ZA 2LRCA 2I3YA 2H74A 2X8CA 3QAVA 5ID2B 4MZWA 1CQHA 2VD1A 1R7HA 4Q5QA 2L59A 3M0FA 4PNFA 1DUGA 4GRFA 12GSA 4Z2UA 1BAYA 2C4JA 2A2RA 2KHPA 2Z9SA 3TKPA 3TRXA 2RUFA 3TJJA 5BMUA 3KCMA 3J7Yk 2IMEA 1EP7A 4KAEA 1M2AA 1E6BA 3WD6A 4WF4A 4HQZA 3GUSA 5EY6A 1PD21 4AJ7A 3ZTLA 4ECCA 2DMMA 1YEPA 5IMFA 3ZRDA 3W6GA 2FA8A 3KD0A 3HVXA 3KEBA 1F37A 1CQGA 4BL7B 2EIOA 1XG8A 1DSBA 3M1GA 3EVIA 4PI2C 3O76A 4ML6A 4N0ZA 5CO3A 4BVXA 3GKKA 4KE3A 3EE2A 1ZOFA 5IMCA 2F8AA 1QQ2A 3CBUA 4DSSB 4AF2A 2GT6A 4EL1A 1VF2A 3GFKA 4PNGA 3UL3A 3UJ1A 2VL2C 3VWWA 4YAPA 1XWCA 1XW9A 1J0FA 3IRAA 1Z6MA 2NPBA 3ZZXA 2D2ZA 1FB0A 1M2BA 4LA1A 1Q4JA 3VI5A 2CVDA 1OE8A 3Q6OA 4WEYA 3EINA 1T7PB 5AIXA 1M0UA 5B8AA 3GN3A 4ACSA 2DIZA 1M99A 4NHZA 4D73B 5A1NA 2MMOA 2A2SA 2VL3A 2LV3A 4CW9A 2VLVA 1R4WA 3DXBA 4PQ1A 2C0EA 2GZPA 5A5KA 1USBA 3HKRA 1U6TA 1FOVA 4IVFA 1XXUA 2HYXA 1HNAA 3CMIA 2IPAA 3LJRA 5ABRA 3FYGA 4MJEA 1THXA 1HNBA 1MDKA 3EPTA 4GSSA 3F0IA 2GGTA 2E2GA 1R5PA 2HSNB 4I2UA 1T8EB 1Z9HA 2OJLA 5INYA 3F3QA 1TJDA 3AY8A 2HRAA 1GTAA 3WGEA 5DALB 2LRNA 1E2YA 4POLA 1TRWA 2M72A 5ECQB 1OC8A 4DEJA 2KP2A 1A2MA 5A4WA 1KEBA 2R0GA 4XTSA 4KSOA 5ECIB 1BJXA 4G0KA 3LQ7A 4NV5A 3CWGA 4BL7A 14GSA 4I2TA 3MIXA 1O8WA 1ML6A 4KA0A 4JBBA 3KM6A 2C0FA 1XW5A 3ZIVA 1SKRB 1GTIA 5G1LA 4DVCA 1BYEA 5ELGA 1SK0A 2WDUA 2B1KA 2OE1A 1GTBA 4DSSA 5CREA 3TCOA 3TKQA 3APSA 2JADA 2YCDA 1ERWA 3RDWA 2YV9A 4O5UA 4ZBBA 2OBKA 3PPUA 1ERVA 1EOHA 3GSSA 3ME8A 2RIIA 3KP8A 1FO5A 4K7IA 2AJQB 1M3IA 1AXDA 2YOIA 4IJIA 5CRDA 2MMNA 5DQYA 4PQHA 3HXSA 3KTBA 5D9WA 2HFDA 1X9MB 3TUEA 4YKFA 4PI0C 4KDYA 3VURA 2DKIA 4D73A 6GSVA 1A8YA 5EL8A 3QD9A 2VCTA 3PGTA 4AI6A 2VL9A 3EU3A 3HMJG 3GL5A 1T4ZA 4V2MA 3A2VA 4MZBA 4MCUA 1SKWB 4JEDA 2L5LA 2M46A 2QC7A 4XRDA 2R4VA 2WVXB 3FR9A 1GLQA 4PHZC 3O6TA 2CVKA 2H19A 2GS3A 5IOWA 4MP4A 2VUPA 2FUG2 1EOGA 2XBIA 3HJPA 3A2WA 3WYWA 2B1LA 3UVHA 3ZMKA 1ILOA 2IFQB 2I9HA 2QKEA 5D73A 2JU5A 2YANA 3GIXA 2K18A 2WFCA 2CX4A 5IMDA 3LXTA 1TW9A 1FOHA 5ECKB 1PN0A 3FZ9A 3IE3A 3UBLA 4I5QA 4AKGA 1NHOA 1XWBA 3UEMA 5BRTA 4FXYP 3FEUA 8GSSA 2N5AA 2YNXA 3FR6A 3RHBA 2WJUA 2ON5A 1W89A 1F9MA 1GNWA 4BPYA 2GZZA 1XWGA 1LU4A 2GT5A 3J7Yb 4WBJA 4MMMA 4IHUA 2DSAA 5ECNB 6GSTA 1TXXA 4ZB7A 4O32A 3DWVA 1BG1A 2X99A 4LMVA 1AC1A 4EUYA 6GSWA 3CRTA 2EFEA 4MNNA 5J41A 2NTOA 1TU7A 2JSYA 1ZYQB 4WR4A 5ECHB 1YEXA 2RM6A 1JZWA 4ZB8A 4X0XA 3QPMA 2R37A 2TRXA 2P31A 1SD9A 4HZ2A 4IP1A 2AYTA 1YZXA 4XIHA 2V6KA 1OYJA 2WS2A 4MJAA 1SD8A 4KGIA 5H5QA 1A24A 2UV8G 4RQRA 1O81A 22GSA 3CSIA 2LKUA 1BG5A 2AV4A 1K0BA 1O7UA 1PL2A 2H1AA 3BJ5A 2BJXA 2H71A 4BWSA 1SVMA 1Z3EA 1PQNA 1AW9A 3G7IA 2QA1A 3KMNA 3US3A 4Z2TA 5C00A 2L5OA 2G2QA 4L0UA 2H66A 2WVXA 3F4SA 3MDKA 4EDYA 1B8XA 5DCHA 2MMAA 1QUWA 2R0CA 4OD7A 4G10A 3W8JA 2FNOA 3D21A 2J23A 1Y6EA 5DVBA 4ECIA 1XVQA 1MDIA 1SVLA 3ZVJD 1T00A 1S4BP 2F8FA 4KW6A 1XOAA 3A5IA 1KBNA 4F0CA 1WP0A 3D22A 5DQSA 4IS0A 1GUHA 5FHIA 2IN3A 1AUCA 3IXRA 4V2LA 4ULXA 2J9HA 1I9DA 4I6XA 3HCZA 4CDOA 4ZL8A 4USSA 5G5EA 3MAKA 4Q5NA 3EU4A 4DSQA 4AKIA 6GSUA 4EO3A 5IM9A 1AQWA 4EXJA 2PPTA 1WOUA 3C8EA 3UARA 1SJZA 5J40A 3SWLA 1SYRA 4OO5A 2JACA 1GUMA 4X43A 3UAPA 2OE0A 2PERA 1FHEA 2WVYA 10GSA 2NBSA 3GX8A 3GYKA 3QDNA 5FT3A 2N5BA 2V41A 1U3IA 3GTUA 3I9V2 4BA7A 3M9KA 4KCAA 2IWTA 2B6MA 3KXOA 3IPZA 1SL1B 3QFAC 1OC9A 3FKFA 3GSTA 2KP1A 5JCGA 2I4AA 2FWFA 4ZB9A 2H6ZA 5IMAA 1EGOA 2LNTA 2YWNA 3CTGA 2LSTA 3LW9A 2RUEA 5F8BA 2VM2A 1HQOA 3ERGA 2DJ0A 2MMZA 1WPIA 3LORA 2B7JA 1PFOA 4H86A 3ZIJA 1SL0B 4G01A 3BBYA 1OKTA 5DJLA 5A34B 2WVZA 1WWJA 1PA3A 1EWXA 3PH9A 2L6DA 1EGRA 4ID0A 2IMIA 4P3YB 4E8HA 1TDIA 4K6XA 2DC5A 4KDXA 1TK5B 2E2MA 5CAXA 5DAKA 2OADA 4GSNA 4ML1A 1ZYPA 2VCWA 3M8NA 5GAND 2LJRA 5B7CA 4HSCX 4FYBA 1SJIA 3KH9A 4TXOB 19GSA 3Q18A 3VWXA 1KTEA 2VLTA 3VLNA 5IMVA 2YJHA 5GSTA 1RK4A 3IAM2 1WE0A 3KMOA 3P2AA 4MPGA 3K8NA 4Q5RA 3CXGA 3I43A 3RHCA 1SVOA 1ERTA 1TTZA 4FIWA 9GSSA 5CRWA 2AUVA 3N5OA 3SBCA 3GMFA 2I81A 4IP6A 3QAWA 4OWYA 5HR3A 3GH6A 3TKSA 1S3CA 1T1VA 5KN1A 4PUAA 3E3EA 3ERFA 2A2PA 3EC3A 1HYUA 2VCQA 3DKSA 2R2JA 1ABAA 2O7KA 5J5NA 2YWMA 4CY8A 2H6XA 2LQOA 4GLTA 2QSIA 5ECRB 2WW1A 1K3OA 2A4HA 1XZOA 1K0NA 4YH2A 1TU8A 1X5DA 1B48A 5COHA 1J08A 2C3TA 4J56E 1YF0A 1YDKA 5G5FA 4NMUA 3FZAA 1RQMA 1GSYA 4F2IA 1G0TA 4HUAA 5AISA 3BCKA 3V1WA 3UVTA 1UC7A 4MA9A 1TK8B 3LSZA 4MJCA 3L9UA 3TKRA 5G31A 4GTUA 3E0UA 4POKA 4IBPA 4WETA 1QMVA 5JWRB 5A34A 3H1NA 5IQYA 2WULA 17GSA 3KGKA 5HFIA 4PGTA 4JU5A 2K6VA 2P0GA 2HSMB 1PMTA 4MJBA 4HQSA 4OCEA 5ID2A 2R6KA 4ECJA 2DMLA 4MH2A 2O87A 3IOSA 2NDOA 4XCSA 2DLXA 4KH7A 4GQCA 1U87A 4TXOA 3GHAA 2FLSA 2PWJA 3WT2A 1H75A 2GQLA 3G9BA 18GSA 3L78A 5LNKe 2IIYA 4ZBAA 1M9BA 1X9WB 1VF4A 1Z7PA 3A3TA 1XWAA 2WGRA 4AKXB 3ME7A 2HRNA 1IYHA 1AQVA 5HFGA 2O36A 4GWRA 1M3JA 4TR3A 4LMWA 3KH7A 3APOA 1G6YA 1XPVA 3L4NA 2P5QA 3HHVA 2MYGA 2QGVA 2DIYA 1UA5A 16GSA 5B8BA 2F3MA 3H93A 5CYYA 1V58A 5LCZA 2CAQA 2BTOT 4HDEA 2OE3A 1FAAA 2VO4A 1VRSD 4ZB6A 1GSDA 4KB3A 2X8GA 2HRFA 5J9BA 3HVSA 2YWOA 4YQUA 3BOAA 1BF5A 3KZQA 2GVPA 1EP8A 2JZRA 4N30A 1NM3A 4XHMA 1R5AA 3D6IA 3W8SA 1ZL9A 2H76A 2L4QA 1TOFA 2CZ3A 4G0IA 2LNSA 1JFUA 4TKYA 2VL2A 1PX6A 3G7YA 3RGBC 2VIMA 3RFRC 4IN0A 2YV7A 5CRGA 1OVNA 5D9TA 2O8VB 2HSYA 3ZVJA 1GULA 2AHEA 5D9VA 1A0FA 4F03A 2CX3A 2YWIA 2GSSA 5KEJA 4LLRA 4ZIJA 4POBA 5HR0A 4OFMA 3FHKA 2OBIA 2FCHA 2L57A 5F0GA 1SU9A 4HZ4A 4K2DA 2HSMA 4X1UA 3O3TA 1GSQA 2AAWA 2F9SA 1JZRA 5EPFA 3ZFLA 4IELA 1YY7A 6GSSA 1G6WA 2HSNA 6GSYA 2FA4A 3FK8A 2R5GA 4NHWA 4PQIA 4WBRD 4Z7XA 3LYPA 2P5RA 4CHSA 2DBCA 1SK2A 3F3RA 5DALA 3APQA 2FWEA 1PN9A 2ON7A 4K7NA 2V6OA 3ZREA 1ZZYA 5J3RA 3IR4A 4AGSA 1GSSA 1QGVA 3G7JA 3QOUA 3TJGA 2XHFA 3MYDA 4HI7A 1YKAA 11GSA 2O3EA 3RPPA 4NAXA 1THOA 1BQ7A 3GX0A 1TXUA 1SL2B 2H0GA 5ECLB 3H4KA 1O73A 3D5JA 1TI3A 3F8UA 3HDCA 2E7PA 3GRXA 3BCIA 2EIQA 1GUKA 5ECMB 3RAZA 4AJ6A 3F63A 3GKMA 3F4RA 4FO5A 1PRXA 2VM1A 2O5VA 2LUSA 4G9HA 4HOJA 1B9XC 2MBSA 2V32A 1YQ1A 2H0IA 3FZ4A 2ZUPA 4EE0A 1Y25A 1O6JA 3IDVA 1TRUA 1X5EA 2YN1A 2TRCP 1Z7RA 4G2EA 1SENA 20GSA 3DVXA 2GLRA 2ZNMA 2HRKB 2VOCA 2GSTA 1FB6A 1F2EA 2K9FA 5G1KA 3VPTA 4FQUA 2X49A 4K0GA 4MF5A 2YJ7A 1HNCA 4N10A 2PMTA 4O5RA 1PX7A 1PSQA 4FYUA 3HZ4A 4YAVA 2VKZG 4I8BA 2DJ1A 3FR3A 2HNLA 1LJRA 5JCWA 2GZYA 1RW1A 3TOUA 4JZQA 2KUCA 2CT6A 1UN2A 2PVOC 4L5LA 5GSSA 3PR8A 4O92A 2HE3A 4HS1A 4POMA 2IMDA 3E9JB 4NXIA 3CSJA 3DMLA 4GSTA 4TW5A 5D96A 3BD2A 2GDRA 3CSHA 3HD5A 4GXZA 1G7EA 4MF7A 1GWCA 4ISDA 1K0CA 5H5SA 1XW6A 2IFQA 4G19A 1YEWC 3KTLA 4QMKA 1X0RA 4NPBA 3LFLA 1B4QA 3DD3A 4K5SA 1S3RA 2JZSA 5BMUB 4FYCA 4NV2A 2HQTA 3HA9A 1SYXA 2PVQA 1TI1A 1ZGNA 1J9BA 2HZEB 5KOWA 1Y1UA 4E8EA 1JZOA 2HZFA 4KX4A 4PTSA 4TR1B 3F4TA 4HEA2 3NZNA 4LL4B 4YQMA 2LS5A 3IAS2 4E68A 3M9JA 4K5RA 4EKZA 2LEGA 2R3XA 1WRYA 2VAFA 5ELAA 3VWVA 4TR4A 1A2JA 1WIKA 2V1MA 3QFBC 2E0QA 3DEXA 2WW0A 1YVLA 4EF0A 4V1Ap 3IA1A 3EURA 2GTUA 1F3BA 3M3MA 2HRKA 5JCUA 4RI7A 2RLIA 5AIVA 3L9VA 1A8LA 2GQMA 3GKXA 5A5HB 4BVYB 3MSZA 3FMWA 1NHYA
chains in the Genus database with same CATH topology
5A4VA 3DIEA 2TIRA 1ON4A 4HU9A 4BWQA 2B5XA 3QAGA 2JL4A 1JZDA 1H4OA 1TK0B 3C1RA 5A1NB 2WCIA 1K0DA 2MZCA 3HYPA 1AQXA 4O7HA 2QA2A 4MDCA 1NW2A 3UBKA 4QL7A 2PGTA 4K1FA 4MABA 1NSWA 5IMZA 2C80A 4IGJA 2DJ2A 5ECOB 1M9AA 3RBTA 3P7XA 1QFNA 4WXTA 4KDUA 5CP1A 4HJ2A 4F82A 3R2QA 4XS4B 4KUNA 3KIJA 4O5QA 4EIPA 3KJYA 3ZMLA 1MD4A 5HFKA 5LD0A 1T4YA 2FY6A 5L71A 2VD0A 4XRAA 5D8IA 4KF9A 5HQPA 5DCGA 2HXKA 1C72A 2WB9A 1PKWA 1ZCPA 2HZEA 4EVMA 1JLWA 4NWYA 1JLVA 4LL1B 4MZCA 3DYRA 4AJ8A 5HR2A 4TR1A 1MTCA 1V98A 2FWGA 2C1YA 2L6CA 4IJ3A 3FRCA 4PURA 2WRTA 5D9XA 2MBTA 1SJ6A 2EIRA 5C04A 2LTKA 2UZ8A 2IL3A 1YJ6A 1U3AA 4IW9A 3IBHA 5CRHA 1IYIA 1XBSA 2CA8A 2XPEA 1FW1A 2H1LA 5CNWA 1K3LA 1MDJA 4JR6A 3F6FA 5J47A 1EEJA 5F05A 4K8MA 3ZITA 4TXVA 3DVWA 5DDLA 4MF6A 5AGYA 4Q5FA 5A5HA 4BVYA 4YKGA 1OKDA 4J2FA 1N25A 3EYTA 3IK7A 3LWAA 3ED3A 4ZILA 4OCFA 4RUVA 1PGTA 1R26A 3F9UA 3HJOA 1GSUA 1ZYNA 4L5OA 5EVOA 1S3AA 4K9ZA 3D4TA 2G0FA 3IK9A 3U5RE 2IMFA 1ST9A 4TOPA 5J4YA 1FVKA 3C71A 4EIQA 1BEDA 1DBYA 2EFDA 5B6NA 4W66A 3H8QA 4N11A 5KN3A 2K8VA 1X5CA 2RM5A 1WJKA 3Q19A 1URMA 1XFLA 1M7TA 4RI6A 5DBQA 3GL3A 1N2AA 3ZL5A 1EV4A 2VCXA 3A5WA 2H30A 4XS4A 2IMKA 4N0VA 2GSQA 1A23A 2L4CA 1K0AA 3A2XA 1F6MC 1K3YA 1O8XA 3TJFA 2NVLA 3ZLPA 3PINA 2LJKA 4PUFC 1WMJA 1VF3A 4ZXGA 4ECBA 2EC4A 4PX1A 3F6DA 2FWHA 3TKSE 4PXOA 3TRPA 3QMXA 1Z5YE 2F51A 3TRQA 5ECSA 4K2XA 2H6YA 1K0MA 4K0NA 3CRUA 2CQ9A 3WT1A 2C3QA 3TB2A 2K8SA 2N5FA 1V2AA 4TRXA 1XCCA 4GCIA 1ZMAA 2H72A 2FHEA 4ZL9A 2REMA 2VCZA 4IKHA 3I69A 4GDFA 3UOMA 1VF1A 4Z2RA 1GSEA 3VWUA 4TR0A 1DE1A 1TP9A 1K0OA 2M80A 1X9SB 4QQ7A 4K7OA 1VGLA 2X4AA 1Z6NA 1F3AA 4ICYA 3LEFA 1JHBA 3IHQA 2C3NA 5AN1A 3GURA 4KSMA 5KN2A 3GV1A 3MNGA 2A4VA 2EFCA 4OO4A 1OE7A 3TU3B 1V9WA 5IO2A 5HR1A 5IPHA 1KNGA 4ILFA 3I6AA 5J4UA 3ISOA 5G2ZA 2C0DA 3MWHA 2ES7A 2FD3A 1MD3A 4V1Ag 5H5RA 2X8HA 3NIVA 5E59A 3HZ8A 2H70A 3P8WA 1G7OA 2CV4A 3TOTA 1GTUA 4I97A 3OR5A 3UMAA 1FVJA 2LJAA 3N9JA 3R3EA 4WKWA 5GZZB 4IQAA 1TRSA 1A0RP 2PU9C 4IQ1A 4AKHA 3WGXA 1XIYA 3S9FA 4HJMA 3ZFBA 5DJMA 2DJJA 3EMXA 1LBKA 1GSFA 1TRVA 5KOXA 3C73A 4F0BA 2B5YA 2C8UA 1SKSB 1V40A 3JCML 4YQVA 2VCVA 1UVZA 2ZCTA 3KP9A 5GAPD 3QCPA 2DJ3A 2IJYA 1GLPA 2JSZA 3HY2A 1ACVA 3VPQA 2CVBA 1QXHA 2EFHA 2O85A 2YP6A 4OMVA 4ZL7A 2OACA 2XPDA 3C7MA 6GSXA 2OKAA 4TN8A 4OFTA 5J4VA 3FY7A 2B7KA 4RQXA 2B3SA 3D0ZA 1N8JA 3GH9A 4WF5A 1FG4A 4CY6A 3UIWA 2H1GA 4XS6A 3GNJA 3CTFA 2OA7A 3LG6A 2H8LA 5E4WA 4OFNA 2YPMA 2C0GA 1GL8A 3GTUB 3LXZA 2DJKA 4A5PA 2CZ2A 4QL9A 3VK9A 1EV9A 2PUKC 2R0PA 1XOBA 1EEMA 1SK1A 1OC9B 2I1UA 2X64A 5G30A 3FZ5A 3GA4A 2H1DA 4JRRA 5ECPB 2HLSA 3HJMA 3ZYWA 2AB6A 1AIUA 4EDZA 4JR4A 2HI7A 3HVVA 3IC4A 4KNDA 1O85A 1B9YC 3IHGA 3ERWA 1W4VA 1ERUA 1DE2A 5IOXA 1S3DA 2WZ9A 5JWQB 1HD2A 2OT3A 4X4JA 3IV4A 3DGQA 1EZKA 5A4UA 1XWKA 5IO0A 3EWLA 5J9CA 5DAKB 4JE1A 3D4MA 1TKDB 3LYKA 1PL1A 1OC3A 5KN0A 1T3BA 2ALBA 3VFIA 2PBJA 2XBQA 2LQQA 3H79A 4V2NA 5FWGA 1V57A 2LRTA 5F06A 4MLYA 3CYNA 5JWOB 5B6MA 1M2DA 2B5EA 3NOFA 4J57E 3TJKA 3L9SA 3IC8A 4ZBDA 4KCEA 2H1BA 3TKSC 2GSRA 1B4PA 2BMXA 5ENUA 2JZTA 2H01A 7GSSA 4L8EA 2H75A 5IIZA 1GRXA 4WR5A 1U88A 3DRNA 4BVXB 2YZUA 3TGZA 3QR6A 1GH2A 2YZHA 3TDGA 5D93A 2PN8A 1AAZA 4FH8A 4TVEA 3U6VA 1YKCA 3EMPA 3WGDA 3GKNA 1A2LA 4EC0A 5IPGA 4MK3A 3LGCA 2HSHA 1OAZA 2V2GA 3C1SA 4GQFA 2KOKA 1I5GA 2CAIA 4GF0A 5F07A 2DKHA 2KLXA 4MH3A 3VI7A 3P90A 1MEKA 1XVWA 1GNEA 3RPNA 1GP1A 4XS1A 2O89A 1Q98A 1PKZA 13GSA 4MPFA 2HT9A 2H0HA 3L0HA 1QK8A 1BX9A 2XC2A 1YF1A 3FW2A 3Q74A 2GQKA 2H73A 4G0LA 4F9ZA 3TJBA 4DSRA 1ZYEA 2VLUA 4L0WA 2FGXA 4HU7A 4N3ZA 2LRCA 2I3YA 2H74A 2X8CA 3QAVA 5ID2B 4MZWA 1CQHA 2VD1A 1R7HA 4Q5QA 2L59A 3M0FA 4PNFA 1DUGA 4GRFA 12GSA 4Z2UA 1BAYA 2C4JA 2A2RA 2KHPA 2Z9SA 3TKPA 3TRXA 2RUFA 3TJJA 5BMUA 3KCMA 3J7Yk 2IMEA 1EP7A 4KAEA 1M2AA 1E6BA 3WD6A 4WF4A 4HQZA 3GUSA 5EY6A 1PD21 4AJ7A 3ZTLA 4ECCA 2DMMA 1YEPA 5IMFA 3ZRDA 3W6GA 2FA8A 3KD0A 3HVXA 3KEBA 1F37A 1CQGA 4BL7B 2EIOA 1DSBA 3M1GA 3EVIA 3O76A 4ML6A 4N0ZA 5CO3A 4BVXA 3GKKA 4KE3A 3EE2A 1ZOFA 5IMCA 2F8AA 1QQ2A 3CBUA 4DSSB 4AF2A 2GT6A 4EL1A 1VF2A 3GFKA 4PNGA 3UL3A 3UJ1A 2VL2C 3VWWA 4YAPA 1XWCA 1XW9A 1J0FA 3IRAA 1Z6MA 2NPBA 3ZZXA 2D2ZA 1FB0A 1M2BA 4LA1A 1Q4JA 3VI5A 2CVDA 1OE8A 3Q6OA 4WEYA 3EINA 1T7PB 5AIXA 1M0UA 5B8AA 3GN3A 4ACSA 2DIZA 1M99A 4NHZA 4D73B 5A1NA 2MMOA 2A2SA 2VL3A 2LV3A 4CW9A 2VLVA 1R4WA 3DXBA 4PQ1A 2C0EA 2GZPA 5A5KA 1USBA 3HKRA 1U6TA 1FOVA 4IVFA 1XXUA 2HYXA 1HNAA 3CMIA 2IPAA 3LJRA 5ABRA 3FYGA 4MJEA 1THXA 1HNBA 1MDKA 3EPTA 4GSSA 3F0IA 2GGTA 2E2GA 1R5PA 2HSNB 4I2UA 1T8EB 1Z9HA 2OJLA 5INYA 3F3QA 1TJDA 3AY8A 2HRAA 1GTAA 3WGEA 5DALB 2LRNA 1E2YA 4POLA 1TRWA 2M72A 5ECQB 1OC8A 4DEJA 2KP2A 1A2MA 5A4WA 1KEBA 2R0GA 4XTSA 4KSOA 5ECIB 1BJXA 4G0KA 3LQ7A 4NV5A 3CWGA 4BL7A 14GSA 4I2TA 3MIXA 1O8WA 1ML6A 4KA0A 4JBBA 3KM6A 2C0FA 1XW5A 3ZIVA 1SKRB 1GTIA 5G1LA 4DVCA 1BYEA 5ELGA 1SK0A 2WDUA 2B1KA 2OE1A 1GTBA 4DSSA 5CREA 3TCOA 3TKQA 3APSA 2JADA 2YCDA 1ERWA 3RDWA 2YV9A 4O5UA 4ZBBA 2OBKA 3PPUA 1ERVA 1EOHA 3GSSA 3ME8A 2RIIA 3KP8A 1FO5A 4K7IA 2AJQB 1AXDA 2YOIA 4IJIA 5CRDA 2MMNA 5DQYA 4PQHA 3HXSA 3KTBA 5D9WA 2HFDA 1X9MB 3TUEA 4YKFA 4KDYA 3VURA 2DKIA 4D73A 6GSVA 1A8YA 5EL8A 3QD9A 2VCTA 3PGTA 4AI6A 2VL9A 3EU3A 3HMJG 3GL5A 1T4ZA 4V2MA 3A2VA 4MZBA 4MCUA 1SKWB 4JEDA 2L5LA 2M46A 2QC7A 4XRDA 2R4VA 3FR9A 1GLQA 3O6TA 2CVKA 2H19A 2GS3A 5IOWA 4MP4A 2VUPA 2FUG2 1EOGA 2XBIA 3HJPA 3A2WA 3WYWA 2B1LA 3UVHA 3ZMKA 1ILOA 2IFQB 2I9HA 2QKEA 5D73A 2JU5A 2YANA 3GIXA 2K18A 2WFCA 2CX4A 5IMDA 3LXTA 1TW9A 1FOHA 5ECKB 1PN0A 3FZ9A 3IE3A 3UBLA 4I5QA 4AKGA 1NHOA 1XWBA 3UEMA 5BRTA 3FEUA 8GSSA 2N5AA 2YNXA 3FR6A 3RHBA 2WJUA 2ON5A 1W89A 1F9MA 1GNWA 4BPYA 2GZZA 1XWGA 1LU4A 2GT5A 3J7Yb 4WBJA 4MMMA 4IHUA 2DSAA 5ECNB 6GSTA 1TXXA 4ZB7A 4O32A 3DWVA 1BG1A 2X99A 4LMVA 1AC1A 4EUYA 6GSWA 3CRTA 2EFEA 4MNNA 5J41A 2NTOA 1TU7A 2JSYA 1ZYQB 4WR4A 5ECHB 1YEXA 2RM6A 1JZWA 4ZB8A 4X0XA 3QPMA 2R37A 2TRXA 2P31A 1SD9A 4HZ2A 4IP1A 2AYTA 1YZXA 4XIHA 2V6KA 1OYJA 2WS2A 4MJAA 1SD8A 4KGIA 5H5QA 1A24A 2UV8G 4RQRA 1O81A 22GSA 3CSIA 2LKUA 1BG5A 2AV4A 1K0BA 1O7UA 1PL2A 2H1AA 3BJ5A 2BJXA 2H71A 4BWSA 1SVMA 1Z3EA 1PQNA 1AW9A 3G7IA 2QA1A 3KMNA 3US3A 4Z2TA 5C00A 2L5OA 2G2QA 4L0UA 2H66A 3F4SA 3MDKA 4EDYA 1B8XA 5DCHA 2MMAA 1QUWA 2R0CA 4OD7A 4G10A 3W8JA 2FNOA 3D21A 2J23A 1Y6EA 5DVBA 4ECIA 1XVQA 1MDIA 1SVLA 3ZVJD 1T00A 2F8FA 4KW6A 1XOAA 3A5IA 1KBNA 4F0CA 1WP0A 3D22A 5DQSA 4IS0A 1GUHA 5FHIA 2IN3A 1AUCA 3IXRA 4V2LA 4ULXA 2J9HA 1I9DA 4I6XA 3HCZA 4CDOA 4ZL8A 4USSA 5G5EA 3MAKA 4Q5NA 3EU4A 4DSQA 4AKIA 6GSUA 4EO3A 5IM9A 1AQWA 4EXJA 2PPTA 1WOUA 3C8EA 3UARA 1SJZA 5J40A 3SWLA 1SYRA 4OO5A 2JACA 1GUMA 4X43A 3UAPA 2PERA 2OE0A 1FHEA 10GSA 2NBSA 3GX8A 3GYKA 3QDNA 5FT3A 2N5BA 2V41A 1U3IA 3GTUA 3I9V2 4BA7A 3M9KA 4KCAA 2IWTA 2B6MA 3KXOA 3IPZA 1SL1B 3QFAC 1OC9A 3FKFA 3GSTA 2KP1A 5JCGA 2I4AA 2FWFA 4ZB9A 2H6ZA 5IMAA 1EGOA 2LNTA 2YWNA 3CTGA 2LSTA 3LW9A 2RUEA 5F8BA 2VM2A 1HQOA 3ERGA 2DJ0A 2MMZA 1WPIA 3LORA 2B7JA 4H86A 3ZIJA 1SL0B 4G01A 3BBYA 1OKTA 5DJLA 5A34B 1WWJA 1PA3A 1EWXA 3PH9A 2L6DA 1EGRA 4ID0A 2IMIA 4P3YB 4E8HA 1TDIA 4K6XA 2DC5A 4KDXA 1TK5B 2E2MA 5CAXA 5DAKA 2OADA 4GSNA 4ML1A 1ZYPA 2VCWA 3M8NA 5GAND 2LJRA 5B7CA 4FYBA 1SJIA 3KH9A 4TXOB 19GSA 3Q18A 3VWXA 1KTEA 2VLTA 3VLNA 5IMVA 2YJHA 5GSTA 1RK4A 3IAM2 1WE0A 3KMOA 3P2AA 4MPGA 3K8NA 4Q5RA 3CXGA 3I43A 3RHCA 1SVOA 1ERTA 1TTZA 4FIWA 9GSSA 5CRWA 2AUVA 3N5OA 3SBCA 3GMFA 2I81A 4IP6A 3QAWA 4OWYA 5HR3A 3GH6A 3TKSA 1S3CA 1T1VA 5KN1A 4PUAA 3E3EA 3ERFA 2A2PA 3EC3A 1HYUA 2VCQA 3DKSA 2R2JA 1ABAA 2O7KA 5J5NA 2YWMA 4CY8A 2H6XA 2LQOA 4GLTA 2QSIA 5ECRB 1K3OA 2A4HA 1XZOA 1K0NA 4YH2A 1TU8A 1X5DA 1B48A 5COHA 1J08A 2C3TA 4J56E 1YF0A 1YDKA 5G5FA 4NMUA 3FZAA 1RQMA 1GSYA 4F2IA 1G0TA 4HUAA 5AISA 3BCKA 3V1WA 3UVTA 1UC7A 4MA9A 1TK8B 3LSZA 4MJCA 3L9UA 3TKRA 5G31A 4GTUA 3E0UA 4POKA 4IBPA 4WETA 1QMVA 5JWRB 5A34A 3H1NA 5IQYA 2WULA 17GSA 3KGKA 5HFIA 4PGTA 4JU5A 2K6VA 2P0GA 2HSMB 1PMTA 4MJBA 4HQSA 4OCEA 5ID2A 2R6KA 4ECJA 2DMLA 4MH2A 2O87A 3IOSA 2NDOA 4XCSA 2DLXA 4KH7A 4GQCA 1U87A 4TXOA 3GHAA 2FLSA 2PWJA 3WT2A 1H75A 2GQLA 3G9BA 18GSA 3L78A 5LNKe 2IIYA 4ZBAA 1M9BA 1X9WB 1VF4A 1Z7PA 3A3TA 1XWAA 2WGRA 4AKXB 3ME7A 2HRNA 1IYHA 1AQVA 5HFGA 4GWRA 4TR3A 4LMWA 3KH7A 3APOA 1G6YA 1XPVA 3L4NA 2P5QA 3HHVA 2MYGA 2QGVA 2DIYA 1UA5A 16GSA 5B8BA 2F3MA 3H93A 5CYYA 1V58A 5LCZA 2CAQA 2BTOT 4HDEA 2OE3A 1FAAA 2VO4A 1VRSD 4ZB6A 1GSDA 4KB3A 2X8GA 2HRFA 5J9BA 3HVSA 2YWOA 4YQUA 3BOAA 1BF5A 3KZQA 2GVPA 1EP8A 2JZRA 4N30A 1NM3A 4XHMA 1R5AA 3D6IA 3W8SA 1ZL9A 2H76A 2L4QA 1TOFA 2CZ3A 4G0IA 2LNSA 1JFUA 4TKYA 2VL2A 1PX6A 3G7YA 2VIMA 4IN0A 2YV7A 5CRGA 1OVNA 5D9TA 2O8VB 2HSYA 3ZVJA 1GULA 2AHEA 5D9VA 1A0FA 4F03A 2CX3A 2YWIA 2GSSA 5KEJA 4LLRA 4ZIJA 4POBA 5HR0A 4OFMA 3FHKA 2OBIA 2FCHA 2L57A 5F0GA 1SU9A 4HZ4A 4K2DA 2HSMA 4X1UA 3O3TA 1GSQA 2AAWA 2F9SA 1JZRA 5EPFA 3ZFLA 4IELA 1YY7A 6GSSA 1G6WA 2HSNA 6GSYA 2FA4A 3FK8A 2R5GA 4NHWA 4PQIA 4WBRD 4Z7XA 3LYPA 2P5RA 4CHSA 2DBCA 1SK2A 3F3RA 5DALA 3APQA 2FWEA 1PN9A 2ON7A 4K7NA 2V6OA 3ZREA 1ZZYA 5J3RA 3IR4A 4AGSA 1GSSA 1QGVA 3G7JA 3QOUA 3TJGA 2XHFA 3MYDA 4HI7A 1YKAA 11GSA 3RPPA 4NAXA 1THOA 1BQ7A 3GX0A 1TXUA 1SL2B 2H0GA 5ECLB 3H4KA 1O73A 3D5JA 1TI3A 3F8UA 3HDCA 2E7PA 3GRXA 3BCIA 2EIQA 1GUKA 5ECMB 3RAZA 4AJ6A 3F63A 3GKMA 3F4RA 4FO5A 1PRXA 2VM1A 2O5VA 2LUSA 4G9HA 4HOJA 1B9XC 2MBSA 2V32A 1YQ1A 2H0IA 3FZ4A 2ZUPA 4EE0A 1Y25A 1O6JA 3IDVA 1TRUA 1X5EA 2YN1A 2TRCP 1Z7RA 4G2EA 1SENA 20GSA 3DVXA 2GLRA 2ZNMA 2HRKB 2VOCA 2GSTA 1FB6A 1F2EA 2K9FA 5G1KA 3VPTA 4FQUA 2X49A 4K0GA 4MF5A 2YJ7A 1HNCA 4N10A 2PMTA 4O5RA 1PX7A 1PSQA 4FYUA 3HZ4A 4YAVA 2VKZG 4I8BA 2DJ1A 3FR3A 2HNLA 1LJRA 5JCWA 2GZYA 1RW1A 3TOUA 4JZQA 2KUCA 2CT6A 1UN2A 2PVOC 4L5LA 5GSSA 3PR8A 4O92A 2HE3A 4HS1A 4POMA 2IMDA 3E9JB 4NXIA 3CSJA 3DMLA 4GSTA 4TW5A 5D96A 3BD2A 2GDRA 3CSHA 3HD5A 4GXZA 1G7EA 4MF7A 1GWCA 4ISDA 1K0CA 5H5SA 1XW6A 2IFQA 4G19A 3KTLA 4QMKA 1X0RA 4NPBA 3LFLA 1B4QA 3DD3A 4K5SA 2JZSA 5BMUB 4FYCA 4NV2A 2HQTA 3HA9A 1SYXA 2PVQA 1TI1A 1ZGNA 1J9BA 2HZEB 5KOWA 1Y1UA 4E8EA 1JZOA 2HZFA 4KX4A 4PTSA 4TR1B 3F4TA 4HEA2 3NZNA 4LL4B 4YQMA 2LS5A 3IAS2 4E68A 3M9JA 4K5RA 4EKZA 2LEGA 2R3XA 1WRYA 2VAFA 5ELAA 3VWVA 4TR4A 1A2JA 1WIKA 2V1MA 3QFBC 2E0QA 3DEXA 1YVLA 4EF0A 4V1Ap 3IA1A 3EURA 2GTUA 1F3BA 3M3MA 2HRKA 5JCUA 4RI7A 2RLIA 5AIVA 3L9VA 1A8LA 2GQMA 3GKXA 5A5HB 4BVYB 3MSZA 3FMWA 1NHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A4V A;  3DIE A;  2TIR A;  1ON4 A;  4HU9 A;  4BWQ A;  2B5X A;  3QAG A;  2JL4 A;  1JZD A;  1H4O A;  1TK0 B;  3C1R A;  2WCI A;  1K0D A;  2MZC A;  3HYP A;  1AQX A;  4O7H A;  4MDC A;  1NW2 A;  3UBK A;  4QL7 A;  2PGT A;  4K1F A;  4MAB A;  1NSW A;  5IMZ A;  2C80 A;  4IGJ A;  2DJ2 A;  5ECO B;  1M9A A;  3RBT A;  3P7X A;  1QFN A;  4WXT A;  4KDU A;  5CP1 A;  4HJ2 A;  4F82 A;  3R2Q A;  4XS4 B;  4KUN A;  3KIJ A;  3KJY A;  3ZML A;  1MD4 A;  5HFK A;  5LD0 A;  1T4Y A;  2FY6 A;  5L71 A;  2VD0 A;  4XRA A;  5D8I A;  4KF9 A;  5HQP A;  5DCG A;  2HXK A;  1C72 A;  2WB9 A;  1PKW A;  1ZCP A;  2HZE A;  4EVM A;  1JLW A;  4NWY A;  1JLV A;  4LL1 B;  4MZC A;  3DYR A;  4AJ8 A;  5HR2 A;  4TR1 A;  1MTC A;  1V98 A;  2FWG A;  2C1Y A;  2L6C A;  4IJ3 A;  3FRC A;  4PUR A;  2WRT A;  5D9X A;  2MBT A;  1SJ6 A;  2EIR A;  5C04 A;  2LTK A;  2UZ8 A;  2IL3 A;  1YJ6 A;  1U3A A;  4IW9 A;  3IBH A;  5CRH A;  1IYI A;  1XBS A;  2CA8 A;  2XPE A;  1FW1 A;  5CNW A;  1K3L A;  1MDJ A;  4JR6 A;  3F6F A;  1EEJ A;  5F05 A;  4K8M A;  3ZIT A;  4TXV A;  3DVW A;  5DDL A;  4MF6 A;  5AGY A;  4Q5F A;  4BVY A;  1OKD A;  4J2F A;  3EYT A;  3IK7 A;  3LWA A;  3ED3 A;  4ZIL A;  4OCF A;  4RUV A;  1PGT A;  1R26 A;  3F9U A;  3HJO A;  1GSU A;  4L5O A;  5EVO A;  1S3A A;  4K9Z A;  3D4T A;  2G0F A;  3IK9 A;  3U5R E;  2IMF A;  1ST9 A;  4TOP A;  1FVK A;  3C71 A;  1BED A;  1DBY A;  5B6N A;  4N11 A;  3H8Q A;  5KN3 A;  2K8V A;  1X5C A;  2RM5 A;  1WJK A;  3Q19 A;  1URM A;  1XFL A;  1M7T A;  4RI6 A;  5DBQ A;  3GL3 A;  1N2A A;  3ZL5 A;  1EV4 A;  2VCX A;  3A5W A;  2H30 A;  4XS4 A;  2IMK A;  4N0V A;  2GSQ A;  1A23 A;  2L4C A;  1K0A A;  3A2X A;  1F6M C;  1K3Y A;  1O8X A;  3TJF A;  2NVL A;  3ZLP A;  3PIN A;  2LJK A;  4PUF C;  1WMJ A;  1VF3 A;  4ZXG A;  4ECB A;  2EC4 A;  4PX1 A;  3F6D A;  2FWH A;  3TKS E;  4PXO A;  3TRP A;  3QMX A;  1Z5Y E;  2F51 A;  3TRQ A;  5ECS A;  2H6Y A;  1K0M A;  4K0N A;  3CRU A;  2CQ9 A;  3WT1 A;  2C3Q A;  3TB2 A;  2K8S A;  2N5F A;  1V2A A;  4TRX A;  1XCC A;  4GCI A;  1ZMA A;  2H72 A;  2FHE A;  4ZL9 A;  2REM A;  2VCZ A;  4IKH A;  3I69 A;  3UOM A;  1VF1 A;  1GSE A;  3VWU A;  4TR0 A;  1DE1 A;  1TP9 A;  1K0O A;  2M80 A;  1X9S B;  4QQ7 A;  4K7O A;  1VGL A;  1Z6N A;  1F3A A;  3LEF A;  1JHB A;  3IHQ A;  2C3N A;  5AN1 A;  3GUR A;  4KSM A;  5KN2 A;  3GV1 A;  3MNG A;  2A4V A;  4OO4 A;  1OE7 A;  1V9W A;  5IO2 A;  5HR1 A;  5IPH A;  1KNG A;  4ILF A;  3I6A A;  5J4U A;  3ISO A;  5G2Z A;  2C0D A;  3MWH A;  2ES7 A;  2FD3 A;  1MD3 A;  4V1A g;  5H5R A;  2X8H A;  3NIV A;  5E59 A;  3HZ8 A;  2H70 A;  3P8W A;  1G7O A;  2CV4 A;  3TOT A;  1GTU A;  4I97 A;  3OR5 A;  3UMA A;  1FVJ A;  2LJA A;  3N9J A;  3R3E A;  4WKW A;  5GZZ B;  4IQA A;  1TRS A;  1A0R P;  2PU9 C;  4IQ1 A;  3WGX A;  1XIY A;  3S9F A;  4HJM A;  3ZFB A;  5DJM A;  2DJJ A;  3EMX A;  1LBK A;  1GSF A;  1TRV A;  3C73 A;  4F0B A;  2B5Y A;  2C8U A;  1SKS B;  1V40 A;  3JCM L;  4YQV A;  2VCV A;  1UVZ A;  2ZCT A;  3KP9 A;  5GAP D;  3QCP A;  2DJ3 A;  2IJY A;  1GLP A;  2JSZ A;  3HY2 A;  1ACV A;  3VPQ A;  2CVB A;  1QXH A;  2O85 A;  2YP6 A;  4OMV A;  4ZL7 A;  2OAC A;  2XPD A;  3C7M A;  6GSX A;  2OKA A;  4TN8 A;  4OFT A;  3FY7 A;  2B7K A;  4RQX A;  2B3S A;  3D0Z A;  1N8J A;  3GH9 A;  4WF5 A;  1FG4 A;  3UIW A;  2H1G A;  4XS6 A;  3GNJ A;  3CTF A;  2OA7 A;  3LG6 A;  2H8L A;  5E4W A;  4OFN A;  2YPM A;  2C0G A;  1GL8 A;  3GTU B;  3LXZ A;  2DJK A;  2CZ2 A;  4QL9 A;  3VK9 A;  1EV9 A;  2PUK C;  1XOB A;  1EEM A;  1SK1 A;  1OC9 B;  2I1U A;  2X64 A;  5G30 A;  3FZ5 A;  3GA4 A;  2H1D A;  4JRR A;  5ECP B;  2HLS A;  3HJM A;  3ZYW A;  2AB6 A;  1AIU A;  4EDZ A;  4JR4 A;  2HI7 A;  3HVV A;  3IC4 A;  4KND A;  1O85 A;  1B9Y C;  3ERW A;  1W4V A;  1ERU A;  1DE2 A;  5IOX A;  1S3D A;  2WZ9 A;  5JWQ B;  1HD2 A;  3IV4 A;  3DGQ A;  1EZK A;  5A4U A;  1XWK A;  5IO0 A;  3EWL A;  5J9C A;  5DAK B;  4JE1 A;  3D4M A;  1TKD B;  3LYK A;  1PL1 A;  1OC3 A;  5KN0 A;  1T3B A;  2ALB A;  3VFI A;  2PBJ A;  2XBQ A;  2LQQ A;  3H79 A;  4V2N A;  5FWG A;  1V57 A;  2LRT A;  5F06 A;  4MLY A;  3CYN A;  5JWO B;  5B6M A;  1M2D A;  2B5E A;  3NOF A;  4J57 E;  3TJK A;  3L9S A;  3IC8 A;  4ZBD A;  4KCE A;  2H1B A;  3TKS C;  2GSR A;  1B4P A;  2BMX A;  5ENU A;  2JZT A;  2H01 A;  7GSS A;  4L8E A;  2H75 A;  5IIZ A;  1GRX A;  4WR5 A;  1U88 A;  3DRN A;  4BVX B;  2YZU A;  3TGZ A;  3QR6 A;  1GH2 A;  2YZH A;  3TDG A;  5D93 A;  2PN8 A;  4FH8 A;  1AAZ A;  4TVE A;  3U6V A;  1YKC A;  3EMP A;  3WGD A;  3GKN A;  1A2L A;  4EC0 A;  5IPG A;  4MK3 A;  3LGC A;  2HSH A;  1OAZ A;  2V2G A;  3C1S A;  4GQF A;  2KOK A;  1I5G A;  2CAI A;  4GF0 A;  5F07 A;  2KLX A;  4MH3 A;  3VI7 A;  3P90 A;  1MEK A;  1XVW A;  1GNE A;  3RPN A;  1GP1 A;  4XS1 A;  2O89 A;  1Q98 A;  1PKZ A;  13GS A;  4MPF A;  2HT9 A;  2H0H A;  3L0H A;  1QK8 A;  1BX9 A;  2XC2 A;  1YF1 A;  3FW2 A;  3Q74 A;  2GQK A;  2H73 A;  4G0L A;  4F9Z A;  3TJB A;  4DSR A;  1ZYE A;  2VLU A;  4L0W A;  2FGX A;  4HU7 A;  2LRC A;  2I3Y A;  2H74 A;  2X8C A;  3QAV A;  5ID2 B;  4MZW A;  1CQH A;  2VD1 A;  1R7H A;  4Q5Q A;  2L59 A;  3M0F A;  4PNF A;  1DUG A;  4GRF A;  12GS A;  1BAY A;  2C4J A;  2A2R A;  2KHP A;  2Z9S A;  3TKP A;  3TRX A;  2RUF A;  3TJJ A;  5BMU A;  3KCM A;  3J7Y k;  2IME A;  1EP7 A;  4KAE A;  1M2A A;  1E6B A;  3WD6 A;  4WF4 A;  4HQZ A;  3GUS A;  5EY6 A;  1PD2 1;  4AJ7 A;  3ZTL A;  4ECC A;  2DMM A;  1YEP A;  5IMF A;  3ZRD A;  3W6G A;  2FA8 A;  3KD0 A;  3HVX A;  3KEB A;  1F37 A;  1CQG A;  4BL7 B;  2EIO A;  1DSB A;  3M1G A;  3EVI A;  3O76 A;  4ML6 A;  4N0Z A;  5CO3 A;  4BVX A;  3GKK A;  4KE3 A;  3EE2 A;  1ZOF A;  5IMC A;  2F8A A;  1QQ2 A;  3CBU A;  4DSS B;  4AF2 A;  2GT6 A;  4EL1 A;  1VF2 A;  3GFK A;  4PNG A;  3UL3 A;  3UJ1 A;  2VL2 C;  3VWW A;  4YAP A;  1XWC A;  1XW9 A;  1J0F A;  3IRA A;  1Z6M A;  2NPB A;  3ZZX A;  2D2Z A;  1FB0 A;  1M2B A;  4LA1 A;  1Q4J A;  3VI5 A;  2CVD A;  1OE8 A;  3Q6O A;  4WEY A;  3EIN A;  1T7P B;  5AIX A;  1M0U A;  5B8A A;  3GN3 A;  4ACS A;  2DIZ A;  1M99 A;  4NHZ A;  4D73 B;  2MMO A;  2A2S A;  2VL3 A;  2LV3 A;  4CW9 A;  2VLV A;  1R4W A;  3DXB A;  4PQ1 A;  2C0E A;  2GZP A;  5A5K A;  1USB A;  3HKR A;  1U6T A;  1FOV A;  4IVF A;  1XXU A;  2HYX A;  1HNA A;  3CMI A;  2IPA A;  3LJR A;  5ABR A;  3FYG A;  4MJE A;  1THX A;  1HNB A;  1MDK A;  4GSS A;  3F0I A;  2GGT A;  2E2G A;  1R5P A;  2HSN B;  4I2U A;  1T8E B;  1Z9H A;  2OJL A;  5INY A;  3F3Q A;  1TJD A;  3AY8 A;  2HRA A;  1GTA A;  3WGE A;  5DAL B;  2LRN A;  1E2Y A;  4POL A;  1TRW A;  2M72 A;  5ECQ B;  1OC8 A;  4DEJ A;  2KP2 A;  1A2M A;  5A4W A;  1KEB A;  4XTS A;  4KSO A;  5ECI B;  1BJX A;  4G0K A;  3LQ7 A;  4NV5 A;  4BL7 A;  14GS A;  4I2T A;  1O8W A;  1ML6 A;  4KA0 A;  4JBB A;  3KM6 A;  2C0F A;  1XW5 A;  3ZIV A;  1SKR B;  1GTI A;  5G1L A;  4DVC A;  1BYE A;  5ELG A;  1SK0 A;  2WDU A;  2B1K A;  2OE1 A;  1GTB A;  4DSS A;  5CRE A;  3TCO A;  3TKQ A;  3APS A;  2JAD A;  2YCD A;  1ERW A;  3RDW A;  2YV9 A;  4ZBB A;  2OBK A;  3PPU A;  1ERV A;  1EOH A;  3GSS A;  3ME8 A;  2RII A;  3KP8 A;  1FO5 A;  4K7I A;  2AJQ B;  1AXD A;  2YOI A;  4IJI A;  5CRD A;  2MMN A;  5DQY A;  4PQH A;  3HXS A;  3KTB A;  5D9W A;  2HFD A;  1X9M B;  3TUE A;  4KDY A;  3VUR A;  4D73 A;  6GSV A;  1A8Y A;  5EL8 A;  3QD9 A;  2VCT A;  3PGT A;  2VL9 A;  3EU3 A;  3GL5 A;  1T4Z A;  4V2M A;  3A2V A;  4MZB A;  4MCU A;  1SKW B;  4JED A;  2L5L A;  2M46 A;  2QC7 A;  4XRD A;  2R4V A;  3FR9 A;  1GLQ A;  3O6T A;  2CVK A;  2H19 A;  2GS3 A;  5IOW A;  4MP4 A;  2VUP A;  2FUG 2;  1EOG A;  2XBI A;  3HJP A;  3A2W A;  3WYW A;  2B1L A;  3UVH A;  3ZMK A;  1ILO A;  2IFQ B;  2I9H A;  2QKE A;  5D73 A;  2JU5 A;  2YAN A;  3GIX A;  2K18 A;  2WFC A;  2CX4 A;  5IMD A;  3LXT A;  1TW9 A;  5ECK B;  3FZ9 A;  3IE3 A;  3UBL A;  4I5Q A;  1NHO A;  1XWB A;  3UEM A;  3FEU A;  8GSS A;  2N5A A;  2YNX A;  3FR6 A;  3RHB A;  2WJU A;  2ON5 A;  1W89 A;  1F9M A;  1GNW A;  4BPY A;  2GZZ A;  1XWG A;  1LU4 A;  2GT5 A;  3J7Y b;  4WBJ A;  4MMM A;  4IHU A;  2DSA A;  5ECN B;  6GST A;  1TXX A;  4O32 A;  3DWV A;  2X99 A;  4LMV A;  1AC1 A;  4EUY A;  6GSW A;  3CRT A;  5J41 A;  2NTO A;  1TU7 A;  2JSY A;  1ZYQ B;  4WR4 A;  5ECH B;  1YEX A;  2RM6 A;  1JZW A;  4ZB8 A;  4X0X A;  3QPM A;  2R37 A;  2TRX A;  2P31 A;  1SD9 A;  4HZ2 A;  4IP1 A;  2AYT A;  1YZX A;  4XIH A;  2V6K A;  1OYJ A;  2WS2 A;  4MJA A;  1SD8 A;  4KGI A;  5H5Q A;  1A24 A;  4RQR A;  1O81 A;  22GS A;  3CSI A;  2LKU A;  1BG5 A;  2AV4 A;  1K0B A;  1O7U A;  1PL2 A;  2H1A A;  3BJ5 A;  2BJX A;  2H71 A;  4BWS A;  1Z3E A;  1PQN A;  1AW9 A;  3G7I A;  3KMN A;  3US3 A;  5C00 A;  2L5O A;  2G2Q A;  4L0U A;  2H66 A;  3F4S A;  3MDK A;  4EDY A;  1B8X A;  5DCH A;  2MMA A;  1QUW A;  4OD7 A;  4G10 A;  3W8J A;  2FNO A;  3D21 A;  2J23 A;  1Y6E A;  5DVB A;  4ECI A;  1XVQ A;  1MDI A;  3ZVJ D;  1T00 A;  2F8F A;  4KW6 A;  1XOA A;  1KBN A;  4F0C A;  1WP0 A;  3D22 A;  5DQS A;  4IS0 A;  1GUH A;  5FHI A;  2IN3 A;  1AUC A;  3IXR A;  4V2L A;  4ULX A;  2J9H A;  1I9D A;  4I6X A;  3HCZ A;  4CDO A;  4ZL8 A;  4USS A;  5G5E A;  3MAK A;  4Q5N A;  3EU4 A;  4DSQ A;  6GSU A;  4EO3 A;  5IM9 A;  1AQW A;  4EXJ A;  2PPT A;  1WOU A;  3C8E A;  3UAR A;  1SJZ A;  3SWL A;  1SYR A;  4OO5 A;  2JAC A;  1GUM A;  4X43 A;  3UAP A;  2PER A;  2OE0 A;  1FHE A;  10GS A;  2NBS A;  3GX8 A;  3GYK A;  3QDN A;  5FT3 A;  2N5B A;  2V41 A;  1U3I A;  3GTU A;  3I9V 2;  4BA7 A;  3M9K A;  4KCA A;  2IWT A;  2B6M A;  3KXO A;  3IPZ A;  1SL1 B;  3QFA C;  1OC9 A;  3FKF A;  3GST A;  2KP1 A;  5JCG A;  2I4A A;  2FWF A;  4ZB9 A;  2H6Z A;  5IMA A;  1EGO A;  2LNT A;  2YWN A;  3CTG A;  2LST A;  2RUE A;  5F8B A;  2VM2 A;  1HQO A;  3ERG A;  2DJ0 A;  2MMZ A;  1WPI A;  3LOR A;  2B7J A;  4H86 A;  3ZIJ A;  1SL0 B;  3BBY A;  1OKT A;  5DJL A;  1WWJ A;  1PA3 A;  1EWX A;  3PH9 A;  2L6D A;  1EGR A;  4ID0 A;  2IMI A;  4P3Y B;  4E8H A;  1TDI A;  4K6X A;  2DC5 A;  4KDX A;  1TK5 B;  2E2M A;  5CAX A;  5DAK A;  2OAD A;  4GSN A;  4ML1 A;  2VCW A;  3M8N A;  5GAN D;  2LJR A;  5B7C A;  4FYB A;  1SJI A;  3KH9 A;  4TXO B;  19GS A;  3Q18 A;  3VWX A;  1KTE A;  2VLT A;  3VLN A;  5IMV A;  2YJH A;  5GST A;  1RK4 A;  3IAM 2;  1WE0 A;  3KMO A;  3P2A A;  4MPG A;  3K8N A;  4Q5R A;  3CXG A;  3I43 A;  3RHC A;  1ERT A;  1TTZ A;  4FIW A;  9GSS A;  5CRW A;  2AUV A;  3N5O A;  3SBC A;  3GMF A;  2I81 A;  4IP6 A;  3QAW A;  4OWY A;  5HR3 A;  3GH6 A;  3TKS A;  1S3C A;  1T1V A;  5KN1 A;  4PUA A;  3E3E A;  3ERF A;  3EC3 A;  1HYU A;  2VCQ A;  3DKS A;  2R2J A;  1ABA A;  2O7K A;  5J5N A;  2YWM A;  2H6X A;  2LQO A;  4GLT A;  2QSI A;  5ECR B;  1K3O A;  1XZO A;  1K0N A;  4YH2 A;  1TU8 A;  1X5D A;  1B48 A;  5COH A;  1J08 A;  2C3T A;  4J56 E;  1YF0 A;  1YDK A;  5G5F A;  4NMU A;  3FZA A;  1RQM A;  1GSY A;  4F2I A;  1G0T A;  4HUA A;  5AIS A;  3BCK A;  3V1W A;  3UVT A;  1UC7 A;  4MA9 A;  1TK8 B;  3LSZ A;  4MJC A;  3L9U A;  3TKR A;  5G31 A;  4GTU A;  3E0U A;  4POK A;  4IBP A;  4WET A;  1QMV A;  5JWR B;  3H1N A;  5IQY A;  2WUL A;  17GS A;  3KGK A;  5HFI A;  4PGT A;  4JU5 A;  2K6V A;  2P0G A;  2HSM B;  1PMT A;  4MJB A;  4HQS A;  4OCE A;  5ID2 A;  2R6K A;  4ECJ A;  2DML A;  4MH2 A;  2O87 A;  3IOS A;  2NDO A;  4XCS A;  2DLX A;  4KH7 A;  4GQC A;  1U87 A;  4TXO A;  3GHA A;  2FLS A;  2PWJ A;  3WT2 A;  1H75 A;  2GQL A;  3G9B A;  18GS A;  3L78 A;  5LNK e;  2IIY A;  4ZBA A;  1M9B A;  1X9W B;  1VF4 A;  1Z7P A;  3A3T A;  1XWA A;  2WGR A;  3ME7 A;  2HRN A;  1IYH A;  1AQV A;  5HFG A;  4GWR A;  4TR3 A;  4LMW A;  3KH7 A;  3APO A;  1G6Y A;  1XPV A;  3L4N A;  2P5Q A;  3HHV A;  2MYG A;  2QGV A;  2DIY A;  1UA5 A;  16GS A;  5B8B A;  2F3M A;  3H93 A;  5CYY A;  1V58 A;  5LCZ A;  2CAQ A;  2BTO T;  4HDE A;  2OE3 A;  1FAA A;  2VO4 A;  1VRS D;  4ZB6 A;  1GSD A;  4KB3 A;  2X8G A;  2HRF A;  5J9B A;  3HVS A;  2YWO A;  4YQU A;  3BOA A;  3KZQ A;  2GVP A;  1EP8 A;  2JZR A;  4N30 A;  1NM3 A;  4XHM A;  1R5A A;  3D6I A;  3W8S A;  1ZL9 A;  2H76 A;  2L4Q A;  1TOF A;  2CZ3 A;  4G0I A;  2LNS A;  1JFU A;  4TKY A;  2VL2 A;  1PX6 A;  3G7Y A;  2VIM A;  4IN0 A;  2YV7 A;  5CRG A;  1OVN A;  5D9T A;  2HSY A;  2O8V B;  3ZVJ A;  1GUL A;  2AHE A;  5D9V A;  1A0F A;  4F03 A;  2CX3 A;  2YWI A;  2GSS A;  5KEJ A;  4LLR A;  4ZIJ A;  4POB A;  5HR0 A;  4OFM A;  3FHK A;  2OBI A;  2FCH A;  2L57 A;  5F0G A;  1SU9 A;  4HZ4 A;  4K2D A;  2HSM A;  4X1U A;  3O3T A;  1GSQ A;  2AAW A;  2F9S A;  1JZR A;  5EPF A;  3ZFL A;  4IEL A;  1YY7 A;  6GSS A;  1G6W A;  6GSY A;  2FA4 A;  3FK8 A;  2R5G A;  4NHW A;  4PQI A;  4WBR D;  4Z7X A;  3LYP A;  2P5R A;  4CHS A;  2DBC A;  1SK2 A;  3F3R A;  5DAL A;  3APQ A;  2FWE A;  1PN9 A;  2ON7 A;  4K7N A;  2V6O A;  3ZRE A;  1ZZY A;  5J3R A;  3IR4 A;  4AGS A;  1GSS A;  1QGV A;  3G7J A;  3QOU A;  3TJG A;  2XHF A;  4HI7 A;  1YKA A;  11GS A;  3RPP A;  4NAX A;  1THO A;  1BQ7 A;  3GX0 A;  1SL2 B;  2H0G A;  5ECL B;  3H4K A;  1O73 A;  3D5J A;  1TI3 A;  3F8U A;  3HDC A;  2E7P A;  3GRX A;  3BCI A;  2EIQ A;  1GUK A;  5ECM B;  3RAZ A;  4AJ6 A;  3F63 A;  3GKM A;  3F4R A;  4FO5 A;  1PRX A;  2VM1 A;  2LUS A;  4G9H A;  4HOJ A;  1B9X C;  2MBS A;  2V32 A;  1YQ1 A;  2H0I A;  3FZ4 A;  2ZUP A;  4EE0 A;  1Y25 A;  1O6J A;  3IDV A;  1TRU A;  1X5E A;  2YN1 A;  2TRC P;  1Z7R A;  4G2E A;  1SEN A;  20GS A;  3DVX A;  2GLR A;  2ZNM A;  2HRK B;  2VOC A;  2GST A;  1FB6 A;  1F2E A;  2K9F A;  5G1K A;  3VPT A;  4FQU A;  4K0G A;  4MF5 A;  2YJ7 A;  1HNC A;  4N10 A;  2PMT A;  4O5R A;  1PX7 A;  1PSQ A;  4FYU A;  3HZ4 A;  4YAV A;  4I8B A;  2DJ1 A;  3FR3 A;  2HNL A;  1LJR A;  5JCW A;  2GZY A;  1RW1 A;  3TOU A;  4JZQ A;  2KUC A;  2CT6 A;  1UN2 A;  2PVO C;  4L5L A;  5GSS A;  3PR8 A;  4O92 A;  2HE3 A;  4HS1 A;  4POM A;  2IMD A;  3E9J B;  4NXI A;  3CSJ A;  3DML A;  4GST A;  4TW5 A;  5D96 A;  3BD2 A;  2GDR A;  3CSH A;  3HD5 A;  4GXZ A;  1G7E A;  4MF7 A;  1GWC A;  4ISD A;  1K0C A;  5H5S A;  1XW6 A;  2IFQ A;  4G19 A;  3KTL A;  1X0R A;  4NPB A;  3LFL A;  1B4Q A;  3DD3 A;  2JZS A;  4FYC A;  4NV2 A;  2HQT A;  3HA9 A;  1SYX A;  2PVQ A;  1TI1 A;  1ZGN A;  1J9B A;  2HZE B;  4E8E A;  1JZO A;  2HZF A;  4KX4 A;  4PTS A;  4TR1 B;  3F4T A;  4HEA 2;  3NZN A;  4LL4 B;  4YQM A;  2LS5 A;  3IAS 2;  3M9J A;  4EKZ A;  2LEG A;  2R3X A;  1WRY A;  2VAF A;  5ELA A;  3VWV A;  4TR4 A;  1A2J A;  1WIK A;  2V1M A;  3QFB C;  2E0Q A;  3DEX A;  4EF0 A;  4V1A p;  3IA1 A;  3EUR A;  2GTU A;  1F3B A;  3M3M A;  2HRK A;  5JCU A;  4RI7 A;  2RLI A;  5AIV A;  3L9V A;  1A8L A;  2GQM A;  3GKX A;  4BVY B;  3MSZ A;  1NHY A; 
#chains in the Genus database with same CATH topology
 5A4V A;  3DIE A;  2TIR A;  1ON4 A;  4HU9 A;  4BWQ A;  2B5X A;  3QAG A;  2JL4 A;  1JZD A;  1H4O A;  1TK0 B;  3C1R A;  5A1N B;  2WCI A;  1K0D A;  2MZC A;  3HYP A;  1AQX A;  4O7H A;  2QA2 A;  4MDC A;  1NW2 A;  3UBK A;  4QL7 A;  2PGT A;  4K1F A;  4MAB A;  1NSW A;  5IMZ A;  2C80 A;  4IGJ A;  2DJ2 A;  5ECO B;  1M9A A;  3RBT A;  3P7X A;  1QFN A;  4WXT A;  4KDU A;  5CP1 A;  4HJ2 A;  4F82 A;  3R2Q A;  4XS4 B;  4KUN A;  3KIJ A;  4O5Q A;  4EIP A;  3KJY A;  3ZML A;  1MD4 A;  5HFK A;  5LD0 A;  1T4Y A;  2FY6 A;  5L71 A;  2VD0 A;  4XRA A;  5D8I A;  4KF9 A;  5HQP A;  5DCG A;  2HXK A;  1C72 A;  2WB9 A;  1PKW A;  1ZCP A;  2HZE A;  4EVM A;  1JLW A;  4NWY A;  1JLV A;  4LL1 B;  4MZC A;  3DYR A;  4AJ8 A;  5HR2 A;  4TR1 A;  1MTC A;  1V98 A;  2FWG A;  2C1Y A;  2L6C A;  4IJ3 A;  3FRC A;  4PUR A;  2WRT A;  5D9X A;  2MBT A;  1SJ6 A;  2EIR A;  5C04 A;  2LTK A;  2UZ8 A;  2IL3 A;  1YJ6 A;  1U3A A;  4IW9 A;  3IBH A;  5CRH A;  1IYI A;  1XBS A;  2CA8 A;  2XPE A;  1FW1 A;  2H1L A;  5CNW A;  1K3L A;  1MDJ A;  4JR6 A;  3F6F A;  5J47 A;  1EEJ A;  5F05 A;  4K8M A;  3ZIT A;  4TXV A;  3DVW A;  3CHX C;  5DDL A;  4MF6 A;  5AGY A;  4Q5F A;  5A5H A;  4BVY A;  4YKG A;  1OKD A;  4J2F A;  1N25 A;  3EYT A;  3IK7 A;  3LWA A;  3ED3 A;  4ZIL A;  4OCF A;  4RUV A;  1PGT A;  1R26 A;  3F9U A;  3HJO A;  1GSU A;  1ZYN A;  4L5O A;  5EVO A;  1S3A A;  4K9Z A;  3D4T A;  2G0F A;  3IK9 A;  3U5R E;  2IMF A;  1ST9 A;  4TOP A;  5J4Y A;  1FVK A;  3C71 A;  4EIQ A;  1BED A;  1DBY A;  2EFD A;  5B6N A;  4W66 A;  3H8Q A;  4N11 A;  5KN3 A;  2K8V A;  1X5C A;  2RM5 A;  1WJK A;  3Q19 A;  1URM A;  1XFL A;  3CQF A;  1M7T A;  4RI6 A;  5DBQ A;  3GL3 A;  1N2A A;  3ZL5 A;  1EV4 A;  2VCX A;  3A5W A;  2H30 A;  4XS4 A;  2IMK A;  4N0V A;  2GSQ A;  1A23 A;  2L4C A;  1K0A A;  3A2X A;  1F6M C;  1K3Y A;  1O8X A;  3TJF A;  2NVL A;  3ZLP A;  3PIN A;  2LJK A;  4PUF C;  1WMJ A;  1VF3 A;  4ZXG A;  4ECB A;  2EC4 A;  4PX1 A;  3F6D A;  2FWH A;  3TKS E;  4PXO A;  3TRP A;  3QMX A;  1Z5Y E;  2F51 A;  3TRQ A;  5ECS A;  4K2X A;  2H6Y A;  1K0M A;  4K0N A;  3CRU A;  2CQ9 A;  3WT1 A;  2C3Q A;  3TB2 A;  2K8S A;  2N5F A;  1V2A A;  4TRX A;  1XCC A;  4GCI A;  1ZMA A;  2H72 A;  2FHE A;  4ZL9 A;  2REM A;  2VCZ A;  4IKH A;  3I69 A;  4GDF A;  3UOM A;  1VF1 A;  4Z2R A;  1GSE A;  3VWU A;  4TR0 A;  1DE1 A;  1TP9 A;  1K0O A;  2M80 A;  1X9S B;  4QQ7 A;  4K7O A;  1VGL A;  2X4A A;  1Z6N A;  1F3A A;  2WZS A;  4ICY A;  3LEF A;  1JHB A;  3IHQ A;  2C3N A;  5AN1 A;  3GUR A;  4KSM A;  5KN2 A;  3GV1 A;  3MNG A;  2A4V A;  2EFC A;  4OO4 A;  1OE7 A;  3TU3 B;  1V9W A;  5IO2 A;  5HR1 A;  5IPH A;  1KNG A;  4ILF A;  3I6A A;  5J4U A;  3ISO A;  5G2Z A;  2C0D A;  3MWH A;  2ES7 A;  2FD3 A;  1MD3 A;  4V1A g;  5H5R A;  2X8H A;  3NIV A;  5E59 A;  3HZ8 A;  2H70 A;  3P8W A;  1G7O A;  2CV4 A;  3TOT A;  1GTU A;  4I97 A;  3OR5 A;  3UMA A;  1FVJ A;  2LJA A;  3N9J A;  3R3E A;  4WKW A;  5GZZ B;  4IQA A;  1TRS A;  1A0R P;  2PU9 C;  4IQ1 A;  4AKH A;  3WGX A;  1XIY A;  3S9F A;  4HJM A;  3ZFB A;  5DJM A;  2DJJ A;  3EMX A;  1LBK A;  1GSF A;  1TRV A;  5KOX A;  3C73 A;  4F0B A;  2B5Y A;  2C8U A;  1SKS B;  1V40 A;  3JCM L;  4YQV A;  2VCV A;  1UVZ A;  2ZCT A;  3KP9 A;  5GAP D;  3QCP A;  2DJ3 A;  2IJY A;  1GLP A;  2JSZ A;  3HY2 A;  1ACV A;  3VPQ A;  2CVB A;  1QXH A;  2EFH A;  2O85 A;  2YP6 A;  4OMV A;  4ZL7 A;  2OAC A;  2XPD A;  3C7M A;  6GSX A;  2OKA A;  4TN8 A;  4OFT A;  5J4V A;  3FY7 A;  2B7K A;  4RQX A;  2B3S A;  3D0Z A;  1N8J A;  3GH9 A;  4WF5 A;  1FG4 A;  4CY6 A;  3UIW A;  2H1G A;  4XS6 A;  3GNJ A;  3CTF A;  2OA7 A;  3LG6 A;  2H8L A;  5E4W A;  4OFN A;  2YPM A;  2C0G A;  1GL8 A;  3GTU B;  3LXZ A;  2DJK A;  4A5P A;  2CZ2 A;  4QL9 A;  3VK9 A;  1EV9 A;  2PUK C;  2R0P A;  1XOB A;  1EEM A;  1SK1 A;  1OC9 B;  2I1U A;  2X64 A;  5G30 A;  3FZ5 A;  3GA4 A;  2H1D A;  4JRR A;  5ECP B;  2HLS A;  3HJM A;  3ZYW A;  2AB6 A;  1AIU A;  4EDZ A;  4JR4 A;  2HI7 A;  3HVV A;  3IC4 A;  4KND A;  1O85 A;  1B9Y C;  3IHG A;  3ERW A;  1W4V A;  1ERU A;  1DE2 A;  5IOX A;  1S3D A;  2WZ9 A;  5JWQ B;  1HD2 A;  2OT3 A;  4X4J A;  3IV4 A;  3DGQ A;  1EZK A;  5A4U A;  1XWK A;  5IO0 A;  3EWL A;  5J9C A;  5DAK B;  4JE1 A;  3D4M A;  1TKD B;  3LYK A;  1PL1 A;  1OC3 A;  2WW3 A;  5KN0 A;  1T3B A;  2ALB A;  3VFI A;  2PBJ A;  2XBQ A;  2LQQ A;  4BIK A;  3H79 A;  4V2N A;  5FWG A;  1V57 A;  2LRT A;  5F06 A;  4MLY A;  3CYN A;  5JWO B;  5B6M A;  1M2D A;  2B5E A;  3NOF A;  4J57 E;  3TJK A;  3L9S A;  3IC8 A;  4ZBD A;  4KCE A;  2H1B A;  3TKS C;  2GSR A;  1B4P A;  2BMX A;  5ENU A;  2JZT A;  2H01 A;  7GSS A;  4L8E A;  2H75 A;  5IIZ A;  1GRX A;  4WR5 A;  1U88 A;  3DRN A;  4BVX B;  2YZU A;  3TGZ A;  3QR6 A;  1GH2 A;  2YZH A;  3TDG A;  5D93 A;  2PN8 A;  1AAZ A;  4FH8 A;  4TVE A;  3U6V A;  1YKC A;  3EMP A;  3WGD A;  3GKN A;  1A2L A;  4EC0 A;  5IPG A;  4MK3 A;  3LGC A;  2HSH A;  1OAZ A;  2V2G A;  3C1S A;  4GQF A;  2KOK A;  1I5G A;  2CAI A;  4GF0 A;  5F07 A;  2DKH A;  2KLX A;  4MH3 A;  3VI7 A;  3P90 A;  1MEK A;  1XVW A;  1GNE A;  3RPN A;  1GP1 A;  4XS1 A;  2O89 A;  1Q98 A;  1PKZ A;  13GS A;  4MPF A;  2HT9 A;  2H0H A;  3L0H A;  1QK8 A;  1I1I P;  1BX9 A;  3HVN A;  2XC2 A;  1YF1 A;  3FW2 A;  3Q74 A;  2GQK A;  2H73 A;  4G0L A;  2WW2 A;  4F9Z A;  3TJB A;  4DSR A;  1ZYE A;  2VLU A;  4L0W A;  2FGX A;  4HU7 A;  4N3Z A;  2LRC A;  2I3Y A;  2H74 A;  2X8C A;  3QAV A;  5ID2 B;  4MZW A;  1CQH A;  2VD1 A;  1R7H A;  4Q5Q A;  2L59 A;  3M0F A;  4PNF A;  1DUG A;  4GRF A;  12GS A;  4Z2U A;  1BAY A;  2C4J A;  2A2R A;  2KHP A;  2Z9S A;  3TKP A;  3TRX A;  2RUF A;  3TJJ A;  5BMU A;  3KCM A;  3J7Y k;  2IME A;  1EP7 A;  4KAE A;  1M2A A;  1E6B A;  3WD6 A;  4WF4 A;  4HQZ A;  3GUS A;  5EY6 A;  1PD2 1;  4AJ7 A;  3ZTL A;  4ECC A;  2DMM A;  1YEP A;  5IMF A;  3ZRD A;  3W6G A;  2FA8 A;  3KD0 A;  3HVX A;  3KEB A;  1F37 A;  1CQG A;  4BL7 B;  2EIO A;  1XG8 A;  1DSB A;  3M1G A;  3EVI A;  4PI2 C;  3O76 A;  4ML6 A;  4N0Z A;  5CO3 A;  4BVX A;  3GKK A;  4KE3 A;  3EE2 A;  1ZOF A;  5IMC A;  2F8A A;  1QQ2 A;  3CBU A;  4DSS B;  4AF2 A;  2GT6 A;  4EL1 A;  1VF2 A;  3GFK A;  4PNG A;  3UL3 A;  3UJ1 A;  2VL2 C;  3VWW A;  4YAP A;  1XWC A;  1XW9 A;  1J0F A;  3IRA A;  1Z6M A;  2NPB A;  3ZZX A;  2D2Z A;  1FB0 A;  1M2B A;  4LA1 A;  1Q4J A;  3VI5 A;  2CVD A;  1OE8 A;  3Q6O A;  4WEY A;  3EIN A;  1T7P B;  5AIX A;  1M0U A;  5B8A A;  3GN3 A;  4ACS A;  2DIZ A;  1M99 A;  4NHZ A;  4D73 B;  5A1N A;  2MMO A;  2A2S A;  2VL3 A;  2LV3 A;  4CW9 A;  2VLV A;  1R4W A;  3DXB A;  4PQ1 A;  2C0E A;  2GZP A;  5A5K A;  1USB A;  3HKR A;  1U6T A;  1FOV A;  4IVF A;  1XXU A;  2HYX A;  1HNA A;  3CMI A;  2IPA A;  3LJR A;  5ABR A;  3FYG A;  4MJE A;  1THX A;  1HNB A;  1MDK A;  3EPT A;  4GSS A;  3F0I A;  2GGT A;  2E2G A;  1R5P A;  2HSN B;  4I2U A;  1T8E B;  1Z9H A;  2OJL A;  5INY A;  3F3Q A;  1TJD A;  3AY8 A;  2HRA A;  1GTA A;  3WGE A;  5DAL B;  2LRN A;  1E2Y A;  4POL A;  1TRW A;  2M72 A;  5ECQ B;  1OC8 A;  4DEJ A;  2KP2 A;  1A2M A;  5A4W A;  1KEB A;  2R0G A;  4XTS A;  4KSO A;  5ECI B;  1BJX A;  4G0K A;  3LQ7 A;  4NV5 A;  3CWG A;  4BL7 A;  14GS A;  4I2T A;  3MIX A;  1O8W A;  1ML6 A;  4KA0 A;  4JBB A;  3KM6 A;  2C0F A;  1XW5 A;  3ZIV A;  1SKR B;  1GTI A;  5G1L A;  4DVC A;  1BYE A;  5ELG A;  1SK0 A;  2WDU A;  2B1K A;  2OE1 A;  1GTB A;  4DSS A;  5CRE A;  3TCO A;  3TKQ A;  3APS A;  2JAD A;  2YCD A;  1ERW A;  3RDW A;  2YV9 A;  4O5U A;  4ZBB A;  2OBK A;  3PPU A;  1ERV A;  1EOH A;  3GSS A;  3ME8 A;  2RII A;  3KP8 A;  1FO5 A;  4K7I A;  2AJQ B;  1M3I A;  1AXD A;  2YOI A;  4IJI A;  5CRD A;  2MMN A;  5DQY A;  4PQH A;  3HXS A;  3KTB A;  5D9W A;  2HFD A;  1X9M B;  3TUE A;  4YKF A;  4PI0 C;  4KDY A;  3VUR A;  2DKI A;  4D73 A;  6GSV A;  1A8Y A;  5EL8 A;  3QD9 A;  2VCT A;  3PGT A;  4AI6 A;  2VL9 A;  3EU3 A;  3HMJ G;  3GL5 A;  1T4Z A;  4V2M A;  3A2V A;  4MZB A;  4MCU A;  1SKW B;  4JED A;  2L5L A;  2M46 A;  2QC7 A;  4XRD A;  2R4V A;  2WVX B;  3FR9 A;  1GLQ A;  4PHZ C;  3O6T A;  2CVK A;  2H19 A;  2GS3 A;  5IOW A;  4MP4 A;  2VUP A;  2FUG 2;  1EOG A;  2XBI A;  3HJP A;  3A2W A;  3WYW A;  2B1L A;  3UVH A;  3ZMK A;  1ILO A;  2IFQ B;  2I9H A;  2QKE A;  5D73 A;  2JU5 A;  2YAN A;  3GIX A;  2K18 A;  2WFC A;  2CX4 A;  5IMD A;  3LXT A;  1TW9 A;  1FOH A;  5ECK B;  1PN0 A;  3FZ9 A;  3IE3 A;  3UBL A;  4I5Q A;  4AKG A;  1NHO A;  1XWB A;  3UEM A;  5BRT A;  4FXY P;  3FEU A;  8GSS A;  2N5A A;  2YNX A;  3FR6 A;  3RHB A;  2WJU A;  2ON5 A;  1W89 A;  1F9M A;  1GNW A;  4BPY A;  2GZZ A;  1XWG A;  1LU4 A;  2GT5 A;  3J7Y b;  4WBJ A;  4MMM A;  4IHU A;  2DSA A;  5ECN B;  6GST A;  1TXX A;  4ZB7 A;  4O32 A;  3DWV A;  1BG1 A;  2X99 A;  4LMV A;  1AC1 A;  4EUY A;  6GSW A;  3CRT A;  2EFE A;  4MNN A;  5J41 A;  2NTO A;  1TU7 A;  2JSY A;  1ZYQ B;  4WR4 A;  5ECH B;  1YEX A;  2RM6 A;  1JZW A;  4ZB8 A;  4X0X A;  3QPM A;  2R37 A;  2TRX A;  2P31 A;  1SD9 A;  4HZ2 A;  4IP1 A;  2AYT A;  1YZX A;  4XIH A;  2V6K A;  1OYJ A;  2WS2 A;  4MJA A;  1SD8 A;  4KGI A;  5H5Q A;  1A24 A;  2UV8 G;  4RQR A;  1O81 A;  22GS A;  3CSI A;  2LKU A;  1BG5 A;  2AV4 A;  1K0B A;  1O7U A;  1PL2 A;  2H1A A;  3BJ5 A;  2BJX A;  2H71 A;  4BWS A;  1SVM A;  1Z3E A;  1PQN A;  1AW9 A;  3G7I A;  2QA1 A;  3KMN A;  3US3 A;  4Z2T A;  5C00 A;  2L5O A;  2G2Q A;  4L0U A;  2H66 A;  2WVX A;  3F4S A;  3MDK A;  4EDY A;  1B8X A;  5DCH A;  2MMA A;  1QUW A;  2R0C A;  4OD7 A;  4G10 A;  3W8J A;  2FNO A;  3D21 A;  2J23 A;  1Y6E A;  5DVB A;  4ECI A;  1XVQ A;  1MDI A;  1SVL A;  3ZVJ D;  1T00 A;  1S4B P;  2F8F A;  4KW6 A;  1XOA A;  3A5I A;  1KBN A;  4F0C A;  1WP0 A;  3D22 A;  5DQS A;  4IS0 A;  1GUH A;  5FHI A;  2IN3 A;  1AUC A;  3IXR A;  4V2L A;  4ULX A;  2J9H A;  1I9D A;  4I6X A;  3HCZ A;  4CDO A;  4ZL8 A;  4USS A;  5G5E A;  3MAK A;  4Q5N A;  3EU4 A;  4DSQ A;  4AKI A;  6GSU A;  4EO3 A;  5IM9 A;  1AQW A;  4EXJ A;  2PPT A;  1WOU A;  3C8E A;  3UAR A;  1SJZ A;  5J40 A;  3SWL A;  1SYR A;  4OO5 A;  2JAC A;  1GUM A;  4X43 A;  3UAP A;  2OE0 A;  2PER A;  1FHE A;  2WVY A;  10GS A;  2NBS A;  3GX8 A;  3GYK A;  3QDN A;  5FT3 A;  2N5B A;  2V41 A;  1U3I A;  3GTU A;  3I9V 2;  4BA7 A;  3M9K A;  4KCA A;  2IWT A;  2B6M A;  3KXO A;  3IPZ A;  1SL1 B;  3QFA C;  1OC9 A;  3FKF A;  3GST A;  2KP1 A;  5JCG A;  2I4A A;  2FWF A;  4ZB9 A;  2H6Z A;  5IMA A;  1EGO A;  2LNT A;  2YWN A;  3CTG A;  2LST A;  3LW9 A;  2RUE A;  5F8B A;  2VM2 A;  1HQO A;  3ERG A;  2DJ0 A;  2MMZ A;  1WPI A;  3LOR A;  2B7J A;  1PFO A;  4H86 A;  3ZIJ A;  1SL0 B;  4G01 A;  3BBY A;  1OKT A;  5DJL A;  5A34 B;  2WVZ A;  1WWJ A;  1PA3 A;  1EWX A;  3PH9 A;  2L6D A;  1EGR A;  4ID0 A;  2IMI A;  4P3Y B;  4E8H A;  1TDI A;  4K6X A;  2DC5 A;  4KDX A;  1TK5 B;  2E2M A;  5CAX A;  5DAK A;  2OAD A;  4GSN A;  4ML1 A;  1ZYP A;  2VCW A;  3M8N A;  5GAN D;  2LJR A;  5B7C A;  4HSC X;  4FYB A;  1SJI A;  3KH9 A;  4TXO B;  19GS A;  3Q18 A;  3VWX A;  1KTE A;  2VLT A;  3VLN A;  5IMV A;  2YJH A;  5GST A;  1RK4 A;  3IAM 2;  1WE0 A;  3KMO A;  3P2A A;  4MPG A;  3K8N A;  4Q5R A;  3CXG A;  3I43 A;  3RHC A;  1SVO A;  1ERT A;  1TTZ A;  4FIW A;  9GSS A;  5CRW A;  2AUV A;  3N5O A;  3SBC A;  3GMF A;  2I81 A;  4IP6 A;  3QAW A;  4OWY A;  5HR3 A;  3GH6 A;  3TKS A;  1S3C A;  1T1V A;  5KN1 A;  4PUA A;  3E3E A;  3ERF A;  2A2P A;  3EC3 A;  1HYU A;  2VCQ A;  3DKS A;  2R2J A;  1ABA A;  2O7K A;  5J5N A;  2YWM A;  4CY8 A;  2H6X A;  2LQO A;  4GLT A;  2QSI A;  5ECR B;  2WW1 A;  1K3O A;  2A4H A;  1XZO A;  1K0N A;  4YH2 A;  1TU8 A;  1X5D A;  1B48 A;  5COH A;  1J08 A;  2C3T A;  4J56 E;  1YF0 A;  1YDK A;  5G5F A;  4NMU A;  3FZA A;  1RQM A;  1GSY A;  4F2I A;  1G0T A;  4HUA A;  5AIS A;  3BCK A;  3V1W A;  3UVT A;  1UC7 A;  4MA9 A;  1TK8 B;  3LSZ A;  4MJC A;  3L9U A;  3TKR A;  5G31 A;  4GTU A;  3E0U A;  4POK A;  4IBP A;  4WET A;  1QMV A;  5JWR B;  5A34 A;  3H1N A;  5IQY A;  2WUL A;  17GS A;  3KGK A;  5HFI A;  4PGT A;  4JU5 A;  2K6V A;  2P0G A;  2HSM B;  1PMT A;  4MJB A;  4HQS A;  4OCE A;  5ID2 A;  2R6K A;  4ECJ A;  2DML A;  4MH2 A;  2O87 A;  3IOS A;  2NDO A;  4XCS A;  2DLX A;  4KH7 A;  4GQC A;  1U87 A;  4TXO A;  3GHA A;  2FLS A;  2PWJ A;  3WT2 A;  1H75 A;  2GQL A;  3G9B A;  18GS A;  3L78 A;  5LNK e;  2IIY A;  4ZBA A;  1M9B A;  1X9W B;  1VF4 A;  1Z7P A;  3A3T A;  1XWA A;  2WGR A;  4AKX B;  3ME7 A;  2HRN A;  1IYH A;  1AQV A;  5HFG A;  2O36 A;  4GWR A;  1M3J A;  4TR3 A;  4LMW A;  3KH7 A;  3APO A;  1G6Y A;  1XPV A;  3L4N A;  2P5Q A;  3HHV A;  2MYG A;  2QGV A;  2DIY A;  1UA5 A;  16GS A;  5B8B A;  2F3M A;  3H93 A;  5CYY A;  1V58 A;  5LCZ A;  2CAQ A;  2BTO T;  4HDE A;  2OE3 A;  1FAA A;  2VO4 A;  1VRS D;  4ZB6 A;  1GSD A;  4KB3 A;  2X8G A;  2HRF A;  5J9B A;  3HVS A;  2YWO A;  4YQU A;  3BOA A;  1BF5 A;  3KZQ A;  2GVP A;  1EP8 A;  2JZR A;  4N30 A;  1NM3 A;  4XHM A;  1R5A A;  3D6I A;  3W8S A;  1ZL9 A;  2H76 A;  2L4Q A;  1TOF A;  2CZ3 A;  4G0I A;  2LNS A;  1JFU A;  4TKY A;  2VL2 A;  1PX6 A;  3G7Y A;  3RGB C;  2VIM A;  3RFR C;  4IN0 A;  2YV7 A;  5CRG A;  1OVN A;  5D9T A;  2O8V B;  2HSY A;  3ZVJ A;  1GUL A;  2AHE A;  5D9V A;  1A0F A;  4F03 A;  2CX3 A;  2YWI A;  2GSS A;  5KEJ A;  4LLR A;  4ZIJ A;  4POB A;  5HR0 A;  4OFM A;  3FHK A;  2OBI A;  2FCH A;  2L57 A;  5F0G A;  1SU9 A;  4HZ4 A;  4K2D A;  2HSM A;  4X1U A;  3O3T A;  1GSQ A;  2AAW A;  2F9S A;  1JZR A;  5EPF A;  3ZFL A;  4IEL A;  1YY7 A;  6GSS A;  1G6W A;  2HSN A;  6GSY A;  2FA4 A;  3FK8 A;  2R5G A;  4NHW A;  4PQI A;  4WBR D;  4Z7X A;  3LYP A;  2P5R A;  4CHS A;  2DBC A;  1SK2 A;  3F3R A;  5DAL A;  3APQ A;  2FWE A;  1PN9 A;  2ON7 A;  4K7N A;  2V6O A;  3ZRE A;  1ZZY A;  5J3R A;  3IR4 A;  4AGS A;  1GSS A;  1QGV A;  3G7J A;  3QOU A;  3TJG A;  2XHF A;  3MYD A;  4HI7 A;  1YKA A;  11GS A;  2O3E A;  3RPP A;  4NAX A;  1THO A;  1BQ7 A;  3GX0 A;  1TXU A;  1SL2 B;  2H0G A;  5ECL B;  3H4K A;  1O73 A;  3D5J A;  1TI3 A;  3F8U A;  3HDC A;  2E7P A;  3GRX A;  3BCI A;  2EIQ A;  1GUK A;  5ECM B;  3RAZ A;  4AJ6 A;  3F63 A;  3GKM A;  3F4R A;  4FO5 A;  1PRX A;  2VM1 A;  2O5V A;  2LUS A;  4G9H A;  4HOJ A;  1B9X C;  2MBS A;  2V32 A;  1YQ1 A;  2H0I A;  3FZ4 A;  2ZUP A;  4EE0 A;  1Y25 A;  1O6J A;  3IDV A;  1TRU A;  1X5E A;  2YN1 A;  2TRC P;  1Z7R A;  4G2E A;  1SEN A;  20GS A;  3DVX A;  2GLR A;  2ZNM A;  2HRK B;  2VOC A;  2GST A;  1FB6 A;  1F2E A;  2K9F A;  5G1K A;  3VPT A;  4FQU A;  2X49 A;  4K0G A;  4MF5 A;  2YJ7 A;  1HNC A;  4N10 A;  2PMT A;  4O5R A;  1PX7 A;  1PSQ A;  4FYU A;  3HZ4 A;  4YAV A;  2VKZ G;  4I8B A;  2DJ1 A;  3FR3 A;  2HNL A;  1LJR A;  5JCW A;  2GZY A;  1RW1 A;  3TOU A;  4JZQ A;  2KUC A;  2CT6 A;  1UN2 A;  2PVO C;  4L5L A;  5GSS A;  3PR8 A;  4O92 A;  2HE3 A;  4HS1 A;  4POM A;  2IMD A;  3E9J B;  4NXI A;  3CSJ A;  3DML A;  4GST A;  4TW5 A;  5D96 A;  3BD2 A;  2GDR A;  3CSH A;  3HD5 A;  4GXZ A;  1G7E A;  4MF7 A;  1GWC A;  4ISD A;  1K0C A;  5H5S A;  1XW6 A;  2IFQ A;  4G19 A;  1YEW C;  3KTL A;  4QMK A;  1X0R A;  4NPB A;  3LFL A;  1B4Q A;  3DD3 A;  4K5S A;  1S3R A;  2JZS A;  5BMU B;  4FYC A;  4NV2 A;  2HQT A;  3HA9 A;  1SYX A;  2PVQ A;  1TI1 A;  1ZGN A;  1J9B A;  2HZE B;  5KOW A;  1Y1U A;  4E8E A;  1JZO A;  2HZF A;  4KX4 A;  4PTS A;  4TR1 B;  3F4T A;  4HEA 2;  3NZN A;  4LL4 B;  4YQM A;  2LS5 A;  3IAS 2;  4E68 A;  3M9J A;  4K5R A;  4EKZ A;  2LEG A;  2R3X A;  1WRY A;  2VAF A;  5ELA A;  3VWV A;  4TR4 A;  1A2J A;  1WIK A;  2V1M A;  3QFB C;  2E0Q A;  3DEX A;  2WW0 A;  1YVL A;  4EF0 A;  4V1A p;  3IA1 A;  3EUR A;  2GTU A;  1F3B A;  3M3M A;  2HRK A;  5JCU A;  4RI7 A;  2RLI A;  5AIV A;  3L9V A;  1A8L A;  2GQM A;  3GKX A;  5A5H B;  4BVY B;  3MSZ A;  3FMW A;  1NHY A; 
#chains in the Genus database with same CATH homology
 5A4V A;  3DIE A;  2TIR A;  1ON4 A;  4HU9 A;  4BWQ A;  2B5X A;  3QAG A;  2JL4 A;  1JZD A;  1H4O A;  1TK0 B;  3C1R A;  5A1N B;  2WCI A;  1K0D A;  2MZC A;  3HYP A;  1AQX A;  4O7H A;  2QA2 A;  4MDC A;  1NW2 A;  3UBK A;  4QL7 A;  2PGT A;  4K1F A;  4MAB A;  1NSW A;  5IMZ A;  2C80 A;  4IGJ A;  2DJ2 A;  5ECO B;  1M9A A;  3RBT A;  3P7X A;  1QFN A;  4WXT A;  4KDU A;  5CP1 A;  4HJ2 A;  4F82 A;  3R2Q A;  4XS4 B;  4KUN A;  3KIJ A;  4O5Q A;  4EIP A;  3KJY A;  3ZML A;  1MD4 A;  5HFK A;  5LD0 A;  1T4Y A;  2FY6 A;  5L71 A;  2VD0 A;  4XRA A;  5D8I A;  4KF9 A;  5HQP A;  5DCG A;  2HXK A;  1C72 A;  2WB9 A;  1PKW A;  1ZCP A;  2HZE A;  4EVM A;  1JLW A;  4NWY A;  1JLV A;  4LL1 B;  4MZC A;  3DYR A;  4AJ8 A;  5HR2 A;  4TR1 A;  1MTC A;  1V98 A;  2FWG A;  2C1Y A;  2L6C A;  4IJ3 A;  3FRC A;  4PUR A;  2WRT A;  5D9X A;  2MBT A;  1SJ6 A;  2EIR A;  5C04 A;  2LTK A;  2UZ8 A;  2IL3 A;  1YJ6 A;  1U3A A;  4IW9 A;  3IBH A;  5CRH A;  1IYI A;  1XBS A;  2CA8 A;  2XPE A;  1FW1 A;  2H1L A;  5CNW A;  1K3L A;  1MDJ A;  4JR6 A;  3F6F A;  5J47 A;  1EEJ A;  5F05 A;  4K8M A;  3ZIT A;  4TXV A;  3DVW A;  5DDL A;  4MF6 A;  5AGY A;  4Q5F A;  5A5H A;  4BVY A;  4YKG A;  1OKD A;  4J2F A;  1N25 A;  3EYT A;  3IK7 A;  3LWA A;  3ED3 A;  4ZIL A;  4OCF A;  4RUV A;  1PGT A;  1R26 A;  3F9U A;  3HJO A;  1GSU A;  1ZYN A;  4L5O A;  5EVO A;  1S3A A;  4K9Z A;  3D4T A;  2G0F A;  3IK9 A;  3U5R E;  2IMF A;  1ST9 A;  4TOP A;  5J4Y A;  1FVK A;  3C71 A;  4EIQ A;  1BED A;  1DBY A;  2EFD A;  5B6N A;  4W66 A;  3H8Q A;  4N11 A;  5KN3 A;  2K8V A;  1X5C A;  2RM5 A;  1WJK A;  3Q19 A;  1URM A;  1XFL A;  1M7T A;  4RI6 A;  5DBQ A;  3GL3 A;  1N2A A;  3ZL5 A;  1EV4 A;  2VCX A;  3A5W A;  2H30 A;  4XS4 A;  2IMK A;  4N0V A;  2GSQ A;  1A23 A;  2L4C A;  1K0A A;  3A2X A;  1F6M C;  1K3Y A;  1O8X A;  3TJF A;  2NVL A;  3ZLP A;  3PIN A;  2LJK A;  4PUF C;  1WMJ A;  1VF3 A;  4ZXG A;  4ECB A;  2EC4 A;  4PX1 A;  3F6D A;  2FWH A;  3TKS E;  4PXO A;  3TRP A;  3QMX A;  1Z5Y E;  2F51 A;  3TRQ A;  5ECS A;  4K2X A;  2H6Y A;  1K0M A;  4K0N A;  3CRU A;  2CQ9 A;  3WT1 A;  2C3Q A;  3TB2 A;  2K8S A;  2N5F A;  1V2A A;  4TRX A;  1XCC A;  4GCI A;  1ZMA A;  2H72 A;  2FHE A;  4ZL9 A;  2REM A;  2VCZ A;  4IKH A;  3I69 A;  4GDF A;  3UOM A;  1VF1 A;  4Z2R A;  1GSE A;  3VWU A;  4TR0 A;  1DE1 A;  1TP9 A;  1K0O A;  2M80 A;  1X9S B;  4QQ7 A;  4K7O A;  1VGL A;  2X4A A;  1Z6N A;  1F3A A;  4ICY A;  3LEF A;  1JHB A;  3IHQ A;  2C3N A;  5AN1 A;  3GUR A;  4KSM A;  5KN2 A;  3GV1 A;  3MNG A;  2A4V A;  2EFC A;  4OO4 A;  1OE7 A;  3TU3 B;  1V9W A;  5IO2 A;  5HR1 A;  5IPH A;  1KNG A;  4ILF A;  3I6A A;  5J4U A;  3ISO A;  5G2Z A;  2C0D A;  3MWH A;  2ES7 A;  2FD3 A;  1MD3 A;  4V1A g;  5H5R A;  2X8H A;  3NIV A;  5E59 A;  3HZ8 A;  2H70 A;  3P8W A;  1G7O A;  2CV4 A;  3TOT A;  1GTU A;  4I97 A;  3OR5 A;  3UMA A;  1FVJ A;  2LJA A;  3N9J A;  3R3E A;  4WKW A;  5GZZ B;  4IQA A;  1TRS A;  1A0R P;  2PU9 C;  4IQ1 A;  4AKH A;  3WGX A;  1XIY A;  3S9F A;  4HJM A;  3ZFB A;  5DJM A;  2DJJ A;  3EMX A;  1LBK A;  1GSF A;  1TRV A;  5KOX A;  3C73 A;  4F0B A;  2B5Y A;  2C8U A;  1SKS B;  1V40 A;  3JCM L;  4YQV A;  2VCV A;  1UVZ A;  2ZCT A;  3KP9 A;  5GAP D;  3QCP A;  2DJ3 A;  2IJY A;  1GLP A;  2JSZ A;  3HY2 A;  1ACV A;  3VPQ A;  2CVB A;  1QXH A;  2EFH A;  2O85 A;  2YP6 A;  4OMV A;  4ZL7 A;  2OAC A;  2XPD A;  3C7M A;  6GSX A;  2OKA A;  4TN8 A;  4OFT A;  5J4V A;  3FY7 A;  2B7K A;  4RQX A;  2B3S A;  3D0Z A;  1N8J A;  3GH9 A;  4WF5 A;  1FG4 A;  4CY6 A;  3UIW A;  2H1G A;  4XS6 A;  3GNJ A;  3CTF A;  2OA7 A;  3LG6 A;  2H8L A;  5E4W A;  4OFN A;  2YPM A;  2C0G A;  1GL8 A;  3GTU B;  3LXZ A;  2DJK A;  4A5P A;  2CZ2 A;  4QL9 A;  3VK9 A;  1EV9 A;  2PUK C;  2R0P A;  1XOB A;  1EEM A;  1SK1 A;  1OC9 B;  2I1U A;  2X64 A;  5G30 A;  3FZ5 A;  3GA4 A;  2H1D A;  4JRR A;  5ECP B;  2HLS A;  3HJM A;  3ZYW A;  2AB6 A;  1AIU A;  4EDZ A;  4JR4 A;  2HI7 A;  3HVV A;  3IC4 A;  4KND A;  1O85 A;  1B9Y C;  3IHG A;  3ERW A;  1W4V A;  1ERU A;  1DE2 A;  5IOX A;  1S3D A;  2WZ9 A;  5JWQ B;  1HD2 A;  2OT3 A;  4X4J A;  3IV4 A;  3DGQ A;  1EZK A;  5A4U A;  1XWK A;  5IO0 A;  3EWL A;  5J9C A;  5DAK B;  4JE1 A;  3D4M A;  1TKD B;  3LYK A;  1PL1 A;  1OC3 A;  5KN0 A;  1T3B A;  2ALB A;  3VFI A;  2PBJ A;  2XBQ A;  2LQQ A;  3H79 A;  4V2N A;  5FWG A;  1V57 A;  2LRT A;  5F06 A;  4MLY A;  3CYN A;  5JWO B;  5B6M A;  1M2D A;  2B5E A;  3NOF A;  4J57 E;  3TJK A;  3L9S A;  3IC8 A;  4ZBD A;  4KCE A;  2H1B A;  3TKS C;  2GSR A;  1B4P A;  2BMX A;  5ENU A;  2JZT A;  2H01 A;  7GSS A;  4L8E A;  2H75 A;  5IIZ A;  1GRX A;  4WR5 A;  1U88 A;  3DRN A;  4BVX B;  2YZU A;  3TGZ A;  3QR6 A;  1GH2 A;  2YZH A;  3TDG A;  5D93 A;  2PN8 A;  1AAZ A;  4FH8 A;  4TVE A;  3U6V A;  1YKC A;  3EMP A;  3WGD A;  3GKN A;  1A2L A;  4EC0 A;  5IPG A;  4MK3 A;  3LGC A;  2HSH A;  1OAZ A;  2V2G A;  3C1S A;  4GQF A;  2KOK A;  1I5G A;  2CAI A;  4GF0 A;  5F07 A;  2DKH A;  2KLX A;  4MH3 A;  3VI7 A;  3P90 A;  1MEK A;  1XVW A;  1GNE A;  3RPN A;  1GP1 A;  4XS1 A;  2O89 A;  1Q98 A;  1PKZ A;  13GS A;  4MPF A;  2HT9 A;  2H0H A;  3L0H A;  1QK8 A;  1BX9 A;  2XC2 A;  1YF1 A;  3FW2 A;  3Q74 A;  2GQK A;  2H73 A;  4G0L A;  4F9Z A;  3TJB A;  4DSR A;  1ZYE A;  2VLU A;  4L0W A;  2FGX A;  4HU7 A;  4N3Z A;  2LRC A;  2I3Y A;  2H74 A;  2X8C A;  3QAV A;  5ID2 B;  4MZW A;  1CQH A;  2VD1 A;  1R7H A;  4Q5Q A;  2L59 A;  3M0F A;  4PNF A;  1DUG A;  4GRF A;  12GS A;  4Z2U A;  1BAY A;  2C4J A;  2A2R A;  2KHP A;  2Z9S A;  3TKP A;  3TRX A;  2RUF A;  3TJJ A;  5BMU A;  3KCM A;  3J7Y k;  2IME A;  1EP7 A;  4KAE A;  1M2A A;  1E6B A;  3WD6 A;  4WF4 A;  4HQZ A;  3GUS A;  5EY6 A;  1PD2 1;  4AJ7 A;  3ZTL A;  4ECC A;  2DMM A;  1YEP A;  5IMF A;  3ZRD A;  3W6G A;  2FA8 A;  3KD0 A;  3HVX A;  3KEB A;  1F37 A;  1CQG A;  4BL7 B;  2EIO A;  1DSB A;  3M1G A;  3EVI A;  3O76 A;  4ML6 A;  4N0Z A;  5CO3 A;  4BVX A;  3GKK A;  4KE3 A;  3EE2 A;  1ZOF A;  5IMC A;  2F8A A;  1QQ2 A;  3CBU A;  4DSS B;  4AF2 A;  2GT6 A;  4EL1 A;  1VF2 A;  3GFK A;  4PNG A;  3UL3 A;  3UJ1 A;  2VL2 C;  3VWW A;  4YAP A;  1XWC A;  1XW9 A;  1J0F A;  3IRA A;  1Z6M A;  2NPB A;  3ZZX A;  2D2Z A;  1FB0 A;  1M2B A;  4LA1 A;  1Q4J A;  3VI5 A;  2CVD A;  1OE8 A;  3Q6O A;  4WEY A;  3EIN A;  1T7P B;  5AIX A;  1M0U A;  5B8A A;  3GN3 A;  4ACS A;  2DIZ A;  1M99 A;  4NHZ A;  4D73 B;  5A1N A;  2MMO A;  2A2S A;  2VL3 A;  2LV3 A;  4CW9 A;  2VLV A;  1R4W A;  3DXB A;  4PQ1 A;  2C0E A;  2GZP A;  5A5K A;  1USB A;  3HKR A;  1U6T A;  1FOV A;  4IVF A;  1XXU A;  2HYX A;  1HNA A;  3CMI A;  2IPA A;  3LJR A;  5ABR A;  3FYG A;  4MJE A;  1THX A;  1HNB A;  1MDK A;  3EPT A;  4GSS A;  3F0I A;  2GGT A;  2E2G A;  1R5P A;  2HSN B;  4I2U A;  1T8E B;  1Z9H A;  2OJL A;  5INY A;  3F3Q A;  1TJD A;  3AY8 A;  2HRA A;  1GTA A;  3WGE A;  5DAL B;  2LRN A;  1E2Y A;  4POL A;  1TRW A;  2M72 A;  5ECQ B;  1OC8 A;  4DEJ A;  2KP2 A;  1A2M A;  5A4W A;  1KEB A;  2R0G A;  4XTS A;  4KSO A;  5ECI B;  1BJX A;  4G0K A;  3LQ7 A;  4NV5 A;  3CWG A;  4BL7 A;  14GS A;  4I2T A;  3MIX A;  1O8W A;  1ML6 A;  4KA0 A;  4JBB A;  3KM6 A;  2C0F A;  1XW5 A;  3ZIV A;  1SKR B;  1GTI A;  5G1L A;  4DVC A;  1BYE A;  5ELG A;  1SK0 A;  2WDU A;  2B1K A;  2OE1 A;  1GTB A;  4DSS A;  5CRE A;  3TCO A;  3TKQ A;  3APS A;  2JAD A;  2YCD A;  1ERW A;  3RDW A;  2YV9 A;  4O5U A;  4ZBB A;  2OBK A;  3PPU A;  1ERV A;  1EOH A;  3GSS A;  3ME8 A;  2RII A;  3KP8 A;  1FO5 A;  4K7I A;  2AJQ B;  1AXD A;  2YOI A;  4IJI A;  5CRD A;  2MMN A;  5DQY A;  4PQH A;  3HXS A;  3KTB A;  5D9W A;  2HFD A;  1X9M B;  3TUE A;  4YKF A;  4KDY A;  3VUR A;  2DKI A;  4D73 A;  6GSV A;  1A8Y A;  5EL8 A;  3QD9 A;  2VCT A;  3PGT A;  4AI6 A;  2VL9 A;  3EU3 A;  3HMJ G;  3GL5 A;  1T4Z A;  4V2M A;  3A2V A;  4MZB A;  4MCU A;  1SKW B;  4JED A;  2L5L A;  2M46 A;  2QC7 A;  4XRD A;  2R4V A;  3FR9 A;  1GLQ A;  3O6T A;  2CVK A;  2H19 A;  2GS3 A;  5IOW A;  4MP4 A;  2VUP A;  2FUG 2;  1EOG A;  2XBI A;  3HJP A;  3A2W A;  3WYW A;  2B1L A;  3UVH A;  3ZMK A;  1ILO A;  2IFQ B;  2I9H A;  2QKE A;  5D73 A;  2JU5 A;  2YAN A;  3GIX A;  2K18 A;  2WFC A;  2CX4 A;  5IMD A;  3LXT A;  1TW9 A;  1FOH A;  5ECK B;  1PN0 A;  3FZ9 A;  3IE3 A;  3UBL A;  4I5Q A;  4AKG A;  1NHO A;  1XWB A;  3UEM A;  5BRT A;  3FEU A;  8GSS A;  2N5A A;  2YNX A;  3FR6 A;  3RHB A;  2WJU A;  2ON5 A;  1W89 A;  1F9M A;  1GNW A;  4BPY A;  2GZZ A;  1XWG A;  1LU4 A;  2GT5 A;  3J7Y b;  4WBJ A;  4MMM A;  4IHU A;  2DSA A;  5ECN B;  6GST A;  1TXX A;  4ZB7 A;  4O32 A;  3DWV A;  1BG1 A;  2X99 A;  4LMV A;  1AC1 A;  4EUY A;  6GSW A;  3CRT A;  2EFE A;  4MNN A;  5J41 A;  2NTO A;  1TU7 A;  2JSY A;  1ZYQ B;  4WR4 A;  5ECH B;  1YEX A;  2RM6 A;  1JZW A;  4ZB8 A;  4X0X A;  3QPM A;  2R37 A;  2TRX A;  2P31 A;  1SD9 A;  4HZ2 A;  4IP1 A;  2AYT A;  1YZX A;  4XIH A;  2V6K A;  1OYJ A;  2WS2 A;  4MJA A;  1SD8 A;  4KGI A;  5H5Q A;  1A24 A;  2UV8 G;  4RQR A;  1O81 A;  22GS A;  3CSI A;  2LKU A;  1BG5 A;  2AV4 A;  1K0B A;  1O7U A;  1PL2 A;  2H1A A;  3BJ5 A;  2BJX A;  2H71 A;  4BWS A;  1SVM A;  1Z3E A;  1PQN A;  1AW9 A;  3G7I A;  2QA1 A;  3KMN A;  3US3 A;  4Z2T A;  5C00 A;  2L5O A;  2G2Q A;  4L0U A;  2H66 A;  3F4S A;  3MDK A;  4EDY A;  1B8X A;  5DCH A;  2MMA A;  1QUW A;  2R0C A;  4OD7 A;  4G10 A;  3W8J A;  2FNO A;  3D21 A;  2J23 A;  1Y6E A;  5DVB A;  4ECI A;  1XVQ A;  1MDI A;  1SVL A;  3ZVJ D;  1T00 A;  2F8F A;  4KW6 A;  1XOA A;  3A5I A;  1KBN A;  4F0C A;  1WP0 A;  3D22 A;  5DQS A;  4IS0 A;  1GUH A;  5FHI A;  2IN3 A;  1AUC A;  3IXR A;  4V2L A;  4ULX A;  2J9H A;  1I9D A;  4I6X A;  3HCZ A;  4CDO A;  4ZL8 A;  4USS A;  5G5E A;  3MAK A;  4Q5N A;  3EU4 A;  4DSQ A;  4AKI A;  6GSU A;  4EO3 A;  5IM9 A;  1AQW A;  4EXJ A;  2PPT A;  1WOU A;  3C8E A;  3UAR A;  1SJZ A;  5J40 A;  3SWL A;  1SYR A;  4OO5 A;  2JAC A;  1GUM A;  4X43 A;  3UAP A;  2PER A;  2OE0 A;  1FHE A;  10GS A;  2NBS A;  3GX8 A;  3GYK A;  3QDN A;  5FT3 A;  2N5B A;  2V41 A;  1U3I A;  3GTU A;  3I9V 2;  4BA7 A;  3M9K A;  4KCA A;  2IWT A;  2B6M A;  3KXO A;  3IPZ A;  1SL1 B;  3QFA C;  1OC9 A;  3FKF A;  3GST A;  2KP1 A;  5JCG A;  2I4A A;  2FWF A;  4ZB9 A;  2H6Z A;  5IMA A;  1EGO A;  2LNT A;  2YWN A;  3CTG A;  2LST A;  3LW9 A;  2RUE A;  5F8B A;  2VM2 A;  1HQO A;  3ERG A;  2DJ0 A;  2MMZ A;  1WPI A;  3LOR A;  2B7J A;  4H86 A;  3ZIJ A;  1SL0 B;  4G01 A;  3BBY A;  1OKT A;  5DJL A;  5A34 B;  1WWJ A;  1PA3 A;  1EWX A;  3PH9 A;  2L6D A;  1EGR A;  4ID0 A;  2IMI A;  4P3Y B;  4E8H A;  1TDI A;  4K6X A;  2DC5 A;  4KDX A;  1TK5 B;  2E2M A;  5CAX A;  5DAK A;  2OAD A;  4GSN A;  4ML1 A;  1ZYP A;  2VCW A;  3M8N A;  5GAN D;  2LJR A;  5B7C A;  4FYB A;  1SJI A;  3KH9 A;  4TXO B;  19GS A;  3Q18 A;  3VWX A;  1KTE A;  2VLT A;  3VLN A;  5IMV A;  2YJH A;  5GST A;  1RK4 A;  3IAM 2;  1WE0 A;  3KMO A;  3P2A A;  4MPG A;  3K8N A;  4Q5R A;  3CXG A;  3I43 A;  3RHC A;  1SVO A;  1ERT A;  1TTZ A;  4FIW A;  9GSS A;  5CRW A;  2AUV A;  3N5O A;  3SBC A;  3GMF A;  2I81 A;  4IP6 A;  3QAW A;  4OWY A;  5HR3 A;  3GH6 A;  3TKS A;  1S3C A;  1T1V A;  5KN1 A;  4PUA A;  3E3E A;  3ERF A;  2A2P A;  3EC3 A;  1HYU A;  2VCQ A;  3DKS A;  2R2J A;  1ABA A;  2O7K A;  5J5N A;  2YWM A;  4CY8 A;  2H6X A;  2LQO A;  4GLT A;  2QSI A;  5ECR B;  1K3O A;  2A4H A;  1XZO A;  1K0N A;  4YH2 A;  1TU8 A;  1X5D A;  1B48 A;  5COH A;  1J08 A;  2C3T A;  4J56 E;  1YF0 A;  1YDK A;  5G5F A;  4NMU A;  3FZA A;  1RQM A;  1GSY A;  4F2I A;  1G0T A;  4HUA A;  5AIS A;  3BCK A;  3V1W A;  3UVT A;  1UC7 A;  4MA9 A;  1TK8 B;  3LSZ A;  4MJC A;  3L9U A;  3TKR A;  5G31 A;  4GTU A;  3E0U A;  4POK A;  4IBP A;  4WET A;  1QMV A;  5JWR B;  5A34 A;  3H1N A;  5IQY A;  2WUL A;  17GS A;  3KGK A;  5HFI A;  4PGT A;  4JU5 A;  2K6V A;  2P0G A;  2HSM B;  1PMT A;  4MJB A;  4HQS A;  4OCE A;  5ID2 A;  2R6K A;  4ECJ A;  2DML A;  4MH2 A;  2O87 A;  3IOS A;  2NDO A;  4XCS A;  2DLX A;  4KH7 A;  4GQC A;  1U87 A;  4TXO A;  3GHA A;  2FLS A;  2PWJ A;  3WT2 A;  1H75 A;  2GQL A;  3G9B A;  18GS A;  3L78 A;  5LNK e;  2IIY A;  4ZBA A;  1M9B A;  1X9W B;  1VF4 A;  1Z7P A;  3A3T A;  1XWA A;  2WGR A;  4AKX B;  3ME7 A;  2HRN A;  1IYH A;  1AQV A;  5HFG A;  4GWR A;  4TR3 A;  4LMW A;  3KH7 A;  3APO A;  1G6Y A;  1XPV A;  3L4N A;  2P5Q A;  3HHV A;  2MYG A;  2QGV A;  2DIY A;  1UA5 A;  16GS A;  5B8B A;  2F3M A;  3H93 A;  5CYY A;  1V58 A;  5LCZ A;  2CAQ A;  2BTO T;  4HDE A;  2OE3 A;  1FAA A;  2VO4 A;  1VRS D;  4ZB6 A;  1GSD A;  4KB3 A;  2X8G A;  2HRF A;  5J9B A;  3HVS A;  2YWO A;  4YQU A;  3BOA A;  1BF5 A;  3KZQ A;  2GVP A;  1EP8 A;  2JZR A;  4N30 A;  1NM3 A;  4XHM A;  1R5A A;  3D6I A;  3W8S A;  1ZL9 A;  2H76 A;  2L4Q A;  1TOF A;  2CZ3 A;  4G0I A;  2LNS A;  1JFU A;  4TKY A;  2VL2 A;  1PX6 A;  3G7Y A;  2VIM A;  4IN0 A;  2YV7 A;  5CRG A;  1OVN A;  5D9T A;  2O8V B;  2HSY A;  3ZVJ A;  1GUL A;  2AHE A;  5D9V A;  1A0F A;  4F03 A;  2CX3 A;  2YWI A;  2GSS A;  5KEJ A;  4LLR A;  4ZIJ A;  4POB A;  5HR0 A;  4OFM A;  3FHK A;  2OBI A;  2FCH A;  2L57 A;  5F0G A;  1SU9 A;  4HZ4 A;  4K2D A;  2HSM A;  4X1U A;  3O3T A;  1GSQ A;  2AAW A;  2F9S A;  1JZR A;  5EPF A;  3ZFL A;  4IEL A;  1YY7 A;  6GSS A;  1G6W A;  2HSN A;  6GSY A;  2FA4 A;  3FK8 A;  2R5G A;  4NHW A;  4PQI A;  4WBR D;  4Z7X A;  3LYP A;  2P5R A;  4CHS A;  2DBC A;  1SK2 A;  3F3R A;  5DAL A;  3APQ A;  2FWE A;  1PN9 A;  2ON7 A;  4K7N A;  2V6O A;  3ZRE A;  1ZZY A;  5J3R A;  3IR4 A;  4AGS A;  1GSS A;  1QGV A;  3G7J A;  3QOU A;  3TJG A;  2XHF A;  3MYD A;  4HI7 A;  1YKA A;  11GS A;  3RPP A;  4NAX A;  1THO A;  1BQ7 A;  3GX0 A;  1TXU A;  1SL2 B;  2H0G A;  5ECL B;  3H4K A;  1O73 A;  3D5J A;  1TI3 A;  3F8U A;  3HDC A;  2E7P A;  3GRX A;  3BCI A;  2EIQ A;  1GUK A;  5ECM B;  3RAZ A;  4AJ6 A;  3F63 A;  3GKM A;  3F4R A;  4FO5 A;  1PRX A;  2VM1 A;  2O5V A;  2LUS A;  4G9H A;  4HOJ A;  1B9X C;  2MBS A;  2V32 A;  1YQ1 A;  2H0I A;  3FZ4 A;  2ZUP A;  4EE0 A;  1Y25 A;  1O6J A;  3IDV A;  1TRU A;  1X5E A;  2YN1 A;  2TRC P;  1Z7R A;  4G2E A;  1SEN A;  20GS A;  3DVX A;  2GLR A;  2ZNM A;  2HRK B;  2VOC A;  2GST A;  1FB6 A;  1F2E A;  2K9F A;  5G1K A;  3VPT A;  4FQU A;  2X49 A;  4K0G A;  4MF5 A;  2YJ7 A;  1HNC A;  4N10 A;  2PMT A;  4O5R A;  1PX7 A;  1PSQ A;  4FYU A;  3HZ4 A;  4YAV A;  2VKZ G;  4I8B A;  2DJ1 A;  3FR3 A;  2HNL A;  1LJR A;  5JCW A;  2GZY A;  1RW1 A;  3TOU A;  4JZQ A;  2KUC A;  2CT6 A;  1UN2 A;  2PVO C;  4L5L A;  5GSS A;  3PR8 A;  4O92 A;  2HE3 A;  4HS1 A;  4POM A;  2IMD A;  3E9J B;  4NXI A;  3CSJ A;  3DML A;  4GST A;  4TW5 A;  5D96 A;  3BD2 A;  2GDR A;  3CSH A;  3HD5 A;  4GXZ A;  1G7E A;  4MF7 A;  1GWC A;  4ISD A;  1K0C A;  5H5S A;  1XW6 A;  2IFQ A;  4G19 A;  3KTL A;  4QMK A;  1X0R A;  4NPB A;  3LFL A;  1B4Q A;  3DD3 A;  4K5S A;  2JZS A;  5BMU B;  4FYC A;  4NV2 A;  2HQT A;  3HA9 A;  1SYX A;  2PVQ A;  1TI1 A;  1ZGN A;  1J9B A;  2HZE B;  5KOW A;  1Y1U A;  4E8E A;  1JZO A;  2HZF A;  4KX4 A;  4PTS A;  4TR1 B;  3F4T A;  4HEA 2;  3NZN A;  4LL4 B;  4YQM A;  2LS5 A;  3IAS 2;  4E68 A;  3M9J A;  4K5R A;  4EKZ A;  2LEG A;  2R3X A;  1WRY A;  2VAF A;  5ELA A;  3VWV A;  4TR4 A;  1A2J A;  1WIK A;  2V1M A;  3QFB C;  2E0Q A;  3DEX A;  1YVL A;  4EF0 A;  4V1A p;  3IA1 A;  3EUR A;  2GTU A;  1F3B A;  3M3M A;  2HRK A;  5JCU A;  4RI7 A;  2RLI A;  5AIV A;  3L9V A;  1A8L A;  2GQM A;  3GKX A;  5A5H B;  4BVY B;  3MSZ A;  3FMW A;  1NHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...