4G19A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium in complex with glutathione
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
b'AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase GTE1
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g19A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g19A01
3ZL5A 1GSUA 2HI7A 1K3YA 1SJZA 4KF9A 4I6XA 4HEA2 1Z5YE 3DEXA 2FNOA 4K8MA 3F3QA 3DD3A 2AYTA 2CAQA 3M8NA 3F9UA 4JR6A 3KGKA 4KDYA 2EIQA 3CRUA 2LQOA 4YAVA 3WGDA 4I2UA 3FK8A 4ZBDA 1GTAA 3N9JA 3I6AA 4USSA 2HSHA 1J9BA 3VI5A 4EDYA 5IIZA 2NTOA 2IWTA 2WB9A 1USBA 1XW5A 3GYKA 3ZFBA 1TXXA 1SKRB 4NHZA 4YQMA 4PXOA 3ZMLA 4AJ7A 3ZIJA 3F4RA 2B7KA 5F0GA 4JZQA 1Z9HA 2V1MA 2IMKA 5DALA 2F8FA 2YZHA 3KH7A 4LLRA 2Z9SA 3UL3A 5IMZA 1KTEA 2MMZA 2GQLA 4X0XA 3F6DA 3GKNA 2H76A 1XBSA 2VL2C 3FR6A 1GUKA 2XBQA 4N30A 3C1RA 1XOAA 5H5QA 2QGVA 1WPIA 1SJ6A 4IJ3A 3UVTA 2NDOA 3FZ4A 1YY7A 1XWBA 5ECPB 4MP4A 4LMWA 2FWEA 2OBKA 2DMMA 2YPMA 7GSSA 4FO5A 3CTFA 3IOSA 3US3A 19GSA 5B6MA 3QAGA 1VF2A 5J41A 2HE3A 2LEGA 2P31A 2UZ8A 1JLWA 4JRRA 4TN8A 3RHCA 4IGJA 3WT2A 4DSSA 3C1SA 2MBTA 1AW9A 4JE1A 4EL1A 2L59A 3LG6A 3IXRA 5BMUA 2HRNA 5J4UA 3SBCA 4BL7B 3UMAA 1ZYQB 3I69A 2YNXA 4RQXA 2K8VA 2N5AA 4Q5NA 2DMLA 2FWHA 1OE7A 3ISOA 4HS1A 4L5OA 4Q5RA 1SD8A 2GGTA 4QL9A 5ELGA 3TRQA 1YEPA 4MJEA 2M80A 1IYHA 5ID2A 4DSQA 4MMMA 4DSRA 5IMVA 3TOTA 5B6NA 4CHSA 2L6DA 2CAIA 2JZTA 5F05A 2YWOA 1JLVA 4GQCA 1I9DA 3Q18A 3TJJA 2YWNA 4TXVA 5FWGA 1GSYA 1W89A 1VRSD 3HZ8A 3QFAC 2ES7A 4I8BA 4HI7A 2H6ZA 2F9SA 4P3YB 1XWGA 4X1UA 3JCML 1TKDB 5GSTA 4NV2A 2YV7A 4G10A 2VCTA 3UOMA 3F6FA 3KP8A 3FY7A 3OR5A 5JWOB 1U88A 4YQUA 1U3IA 2DSAA 1OE8A 3PPUA 2VLVA 5D9WA 3LFLA 4JEDA 2LKUA 1ERVA 2HYXA 1OVNA 4GQFA 1V2AA 1B8XA 1ERUA 3RPNA 1V57A 1BJXA 4ECCA 4OMVA 2HSNB 2GLRA 4WEYA 3TKSE 4ZL7A 5JWRB 2B5YA 4KB3A 5E4WA 2VIMA 3GKKA 1O81A 4F9ZA 3KMOA 3TJBA 2VAFA 4JU5A 4LL4B 4AF2A 4ID0A 3KIJA 3VWUA 1ZYEA 2DLXA 3IDVA 1XVWA 3CYNA 3W6GA 3GFKA 2LV3A 1B4PA 3LSZA 1ZMAA 2GQKA 4WF5A 1JZWA 1FAAA 1Y25A 1QXHA 1UVZA 3GUSA 1THOA 4I2TA 2R6KA 4OFMA 4BVYA 1QK8A 1JZDA 1V40A 2HRFA 2H70A 3A2XA 3EWLA 1R5AA 5GAPD 5C04A 1XIYA 3WD6A 1K0BA 1FW1A 3E3EA 5IMDA 3GHAA 3GN3A 1GSFA 2VOCA 2I9HA 1BQ7A 3TKSC 3L9SA 1XPVA 2H71A 1TRWA 3LYKA 4V1Ap 3VWWA 5GAND 2WFCA 4HDEA 4HU9A 4IS0A 3CBUA 1TK5B 2P5QA 2KP2A 2FCHA 1EV9A 2I1UA 2J9HA 2WJUA 1NW2A 4XS6A 1Y6EA 4MF7A 2K8SA 5CRGA 3CSIA 4WF4A 2IIYA 4EC0A 5AGYA 4IW9A 4IP1A 3KXOA 3D0ZA 16GSA 3PINA 2EC4A 4MZWA 5COHA 1PSQA 1XWKA 1AQVA 2RM5A 1TU7A 2OBIA 1OAZA 2V32A 2R37A 4MDCA 3E9JB 1M2AA 4HU7A 3IA1A 5FHIA 2H30A 4GWRA 1XXUA 2HT9A 1JZOA 5GZZB 4D73B 1LBKA 3GV1A 3RAZA 3VPTA 1A0RP 3GH6A 1B48A 1M7TA 1B9YC 3QAWA 5D9VA 4HZ2A 2LRNA 3DVWA 4PURA 1K0DA 3GX0A 2CVKA 3L0HA 1ZCPA 1TI3A 1TJDA 4TXOB 3IV4A 2QKEA 1PX6A 4FYCA 5B8BA 2B5XA 2KP1A 4ZB9A 4MZCA 5IOWA 2L5OA 1X0RA 1R7HA 1TW9A 2H0HA 1GWCA 4K1FA 2BMXA 1T7PB 5ECQB 1T1VA 2OE3A 2NVLA 2HZFA 5ABRA 1DE1A 1GH2A 4ULXA 4XRAA 4ECBA 1FVJA 4J56E 1SK0A 3FYGA 3ZRDA 2WZ9A 1C72A 1HNBA 1YJ6A 5ECRB 5CO3A 2L6CA 6GSVA 5B8AA 5ECKB 3P7XA 1HNAA 2FLSA 1UC7A 5ECLB 4GTUA 3CRTA 4ZB8A 20GSA 5LNKe 2O7KA 3HA9A 3DRNA 1QQ2A 1O7UA 1PA3A 2JZRA 2GSQA 1WWJA 3SWLA 5J3RA 4BVXA 1YF0A 3HVSA 2C80A 4ML1A 4ZILA 1S3DA 3TRPA 3IE3A 3HXSA 4ZL9A 4PTSA 4NPBA 1UA5A 2V2GA 4CDOA 1CQGA 3UAPA 2NPBA 2PVQA 1O73A 2IN3A 3TJGA 1X5EA 3KM6A 3QD9A 3GA4A 2JSYA 3KTBA 5ELAA 4IQAA 1UN2A 2H1BA 1WP0A 4ECJA 2C0FA 5D8IA 3UARA 3IC8A 10GSA 4YQVA 1SU9A 4KH7A 5DAKB 1GLPA 2HRKB 3F4TA 3DXBA 4RQRA 3UIWA 3RBTA 3MSZA 2K9FA 5IQYA 3UBLA 2H75A 5IPGA 3WT1A 2HXKA 3GMFA 4RI7A 4HUAA 5ECSA 5ECMB 2A2RA 2DIYA 5A5KA 2VL3A 2CX4A 2H19A 1OC8A 2H01A 4F2IA 4MH3A 1S3CA 2F3MA 4MH2A 4GSSA 2H72A 4MABA 3BCIA 4KDUA 2CZ3A 1DUGA 3WGEA 1F3BA 5LD0A 1SYRA 2I3YA 4O5RA 1N2AA 5A4WA 2E2MA 2YANA 3HD5A 3FKFA 1A0FA 1ML6A 4NV5A 4BWSA 1WE0A 3IBHA 3ME7A 2RUEA 4KSMA 3EYTA 2HQTA 2ALBA 1OKTA 3PR8A 1ERTA 3G9BA 3FZAA 2KOKA 4KAEA 3EMXA 4K7IA 4K0GA 3VI7A 1AQXA 3IPZA 1SYXA 3BOAA 3ZTLA 1GNEA 2O87A 3APSA 1HNCA 1MD3A 3NOFA 4MPFA 3TRXA 3GNJA 2XHFA 1MDIA 5IOXA 4OO4A 2XPEA 3LJRA 4BL7A 3VWXA 2M46A 1YDKA 3CTGA 2JSZA 3L9UA 1G7EA 2BJXA 1K0NA 5EVOA 2GT6A 5JWQB 2AHEA 4X43A 1M99A 1BEDA 3DWVA 2B1KA 2REMA 3NZNA 4PNGA 1A2MA 3KD0A 5CYYA 1LU4A 2DJKA 3IHQA 2CQ9A 4OWYA 3RDWA 1V98A 1BG5A 3K8NA 5J9BA 1Z6MA 4GLTA 1T8EB 4HJ2A 2HSMB 4KCAA 1K0MA 2HRAA 2IFQB 1G7OA 1AAZA 2N5BA 1GULA 3ZFLA 2DIZA 1NSWA 2CV4A 2HNLA 3CSHA 1YKAA 2IMEA 3A3TA 2X8CA 4Q5FA 3V1WA 3GH9A 2HFDA 1OYJA 3U6VA 1TI1A 2WRTA 2VCXA 3A5WA 1EP8A 5KN3A 4V2LA 4FQUA 2GSRA 4F0BA 2YJHA 4BA7A 4GSTA 1F9MA 5ECHB 3TB2A 5D96A 3I9V2 4TR4A 2TRCP 4XIHA 4TR0A 4NHWA 4TR1B 2JZSA 3E0UA 3F8UA 5H5SA 3MDKA 1SL1B 2MMOA 1A2JA 1GSDA 5DQSA 1PKWA 1DBYA 4ZIJA 4WKWA 2R4VA 1OC3A 3DKSA 3F0IA 1K0OA 5CAXA 4YH2A 3VLNA 4N0VA 1PX7A 5IMCA 2CVBA 4N10A 1M9BA 4GXZA 5C00A 1TRSA 3R3EA 1K0CA 3HZ4A 3LQ7A 1EWXA 1OKDA 3F4SA 3IRAA 1ZGNA 4MF5A 3KMNA 1TTZA 1PN9A 4FYBA 1GTBA 2G2QA 1GSQA 2YP6A 2LQQA 3GL5A 1EP7A 3HHVA 2X99A 5G5EA 2H1AA 2YWMA 1PRXA 5CRHA 3DVXA 2PGTA 1EGRA 1QMVA 2LNSA 4GCIA 2EIRA 3CMIA 2C0GA 3DIEA 4TKYA 3KTLA 5HFKA 4POBA 5CREA 1PKZA 1SD9A 5DVBA 4KGIA 2VL9A 1HQOA 2LS5A 4OD7A 5G2ZA 4BWQA 2VD0A 1U87A 2VL2A 3EINA 6GSXA 2P0GA 1J08A 3KEBA 3D4MA 2TIRA 4G0KA 3FRCA 1X5CA 4J57E 1YKCA 4WXTA 3W8SA 4K2DA 3ZITA 1TRVA 3Q74A 2MYGA 3IC4A 4OFNA 4ILFA 5DCHA 3HCZA 5HR2A 4BPYA 2PPTA 5KN1A 3S9FA 2DJ0A 3GKMA 3QMXA 2NBSA 1NHYA 1FB6A 3M3MA 3TCOA 1T4ZA 4G2EA 3BD2A 2WGRA 2GTUA 3HJPA 4G0LA 2PUKC 3EMPA 4DVCA 2F8AA 2AAWA 4FYUA 2YJ7A 4XTSA 17GSA 3H1NA 1MEKA 3EURA 2IMFA 2C0EA 3GSTA 5A4VA 3TKPA 1A8LA 3H79A 1O6JA 1A2LA 3VK9A 4O32A 2WS2A 2B6MA 2AV4A 4EF0A 1V58A 2PWJA 2LRCA 1KBNA 3LYPA 2HZEB 1F37A 5HFGA 3HJOA 1QUWA 4IP6A 1SJIA 4PUAA 4AJ6A 2DBCA 1GNWA 6GSWA 1PGTA 1TDIA 2H73A 4XRDA 4XCSA 2H66A 4E8HA 1K3OA 3C7MA 5D9XA 2GZYA 1ILOA 5JCGA 1VF1A 1WRYA 4Z7XA 5IMAA 3GTUB 2L5LA 1A8YA 4D73A 1YEXA 2FWGA 4WBRD 2LNTA 1VF3A 4LL1B 2MBSA 3ED3A 2OKAA 5G1KA 1K3LA 4IKHA 4ZBBA 4PQIA 2VM1A 1DE2A 3BCKA 3QR6A 1LJRA 1J0FA 4TXOA 2AUVA 2QC7A 4PQ1A 5CRDA 3TUEA 5DJMA 1K0AA 2CX3A 3VPQA 2VM2A 2KUCA 3FW2A 4MZBA 4FH8A 5IMFA 4DEJA 1XW9A 5DCGA 2RM6A 1M2DA 4PNFA 1KNGA 4KNDA 1E6BA 3RPPA 3P2AA 1H4OA 1Z7PA 2IMDA 2G0FA 3U5RE 4L8EA 1IYIA 3ZREA 2TRXA 5CP1A 1ERWA 1MDKA 1T00A 5L71A 2OJLA 4GRFA 1Q4JA 1I5GA 1R5PA 3ERGA 3D4TA 1GLQA 1ON4A 2GZZA 4AJ8A 1XWCA 4AGSA 2H74A 1OC9B 2ZUPA 2YWIA 1XW6A 3UVHA 4PGTA 3HJMA 5ECNB 4POKA 4KX4A 2GZPA 1X9WB 3QDNA 2IL3A 5HQPA 1M0UA 3R2QA 2E2GA 4TVEA 4K6XA 2XPDA 5AIXA 2H6XA 5A4UA 4IVFA 3GSSA 1TRUA 3M9KA 2F51A 3P8WA 4Q5QA 2GQMA 1EV4A 1M2BA 2CVDA 3GIXA 2D2ZA 3DMLA 2LTKA 3KCMA 4F82A 6GSTA 2C0DA 4ZB6A 1QGVA 4WR4A 1THXA 2E7PA 4PX1A 3F3RA 2CA8A 1MTCA 4NAXA 4GF0A 3TJKA 1AQWA 2R3XA 3IAM2 3O6TA 5JCUA 5EL8A 2R2JA 2CT6A 1CQHA 5DAKA 3D5JA 2HRKA 3VURA 4KSOA 3AY8A 1O85A 2PERA 2FUG2 3RHBA 4ML6A 3DGQA 3LXTA 4IELA 2HSYA 3LORA 2JU5A 2A2SA 4WETA 1PQNA 3TKSA 1VGLA 4K7NA 1JHBA 2C3NA 1FO5A 5DJLA 2RLIA 4WR5A 3TDGA 2ZNMA 2JL4A 5ECOB 2VLTA 1NHOA 4KA0A 2AJQB 5ENUA 1YZXA 6GSSA 3FEUA 5HFIA 3D21A 3QFBC 3MWHA 1GL8A 3WYWA 1SKWB 4PQHA 4XS4A 4IN0A 2VCQA 4V1Ag 3FR9A 3D22A 4G0IA 1EEJA 4F03A 1PL1A 4K0NA 5D9TA 3GKXA 4LA1A 3UBKA 2H0GA 4XS4B 2YCDA 3LEFA 1HD2A 3LWAA 2A4VA 3GL3A 2FWFA 2BTOT 2LRTA 1FHEA 3ERWA 1XWAA 1SL2B 2MMAA 2GDRA 4N0ZA 3HKRA 5D93A 2OE1A 2H1GA 1G6YA 5DALB 3G7YA 3GX8A 1Z3EA 3BJ5A 3C71A 3LGCA 2H6YA 2L4QA 1X5DA 1RK4A 6GSYA 1E2YA 3FR3A 3W8JA 1QFNA 4MJCA 1G6WA 2GSTA 2QSIA 3EE2A 2C1YA 4O7HA 2B1LA 2XC2A 1URMA 3HVXA 4QL7A 1A24A 3ZZXA 1PMTA 2B3SA 3DYRA 2WCIA 2B7JA 4HQSA 3PGTA 5IO0A 1TP9A 3FZ9A 2VLUA 2J23A 1RW1A 3ZLPA 2C3QA 1BX9A 3UEMA 4OFTA 2VD1A 5AISA 3M1GA 4TW5A 3NIVA 2X64A 5KEJA 1XCCA 2HSMA 2VCZA 1GSSA 3TGZA 2IFQA 2AB6A 1BYEA 1ZZYA 1FG4A 4F0CA 3M9JA 4K9ZA 3VFIA 4ACSA 4O92A 1EEMA 4MK3A 4DSSB 2HLSA 3EU3A 2O89A 5FT3A 2PN8A 1GUHA 1R26A 2VO4A 4L5LA 3VWVA 2WULA 3QPMA 1FB0A 4MA9A 5HR1A 2JADA 3C8EA 4L0WA 4EDZA 1AC1A 4TR1A 3TJFA 3F63A 4IHUA 3EVIA 4J2FA 5JCWA 1FOVA 3QCPA 2MMNA 2RIIA 2O85A 1AUCA 5ID2B 3ERFA 1JFUA 4EKZA 1YF1A 3IR4A 2N5FA 1EOGA 4KUNA 1GTUA 3J7Yb 3HYPA 4NMUA 5IO2A 4IBPA 1G0TA 5F06A 4G19A 2MZCA 3ZMKA 2X8HA 3CSJA 3TKQA 2ON5A 1SK2A 1WOUA 2FY6A 5F8BA 2GVPA 2EIOA 4TRXA 2WDUA 5B7CA 4KCEA 2C3TA 1FVKA 1NM3A 2IMIA 4GSNA 4EVMA 1EZKA 4ISDA 3I43A 1GP1A 5D73A 2OADA 3MAKA 2OE0A 4RUVA 3FHKA 2PBJA 3ZVJD 3H4KA 2C4JA 1O8XA 1RQMA 2V6KA 3O76A 2LJRA 1YQ1A 4KW6A 1S3AA 4XS1A 1KEBA 4MCUA 3PH9A 5G5FA 4NWYA 2M72A 3P90A 1M9AA 2B5EA 2X8GA 5G30A 3MNGA 1HYUA 1TU8A 4JBBA 1WMJA 9GSSA 3D6IA 3GRXA 4ZBAA 3A2WA 1XOBA 5E59A 2O8VB 2PVOC 4HJMA 4V2NA 4ZXGA 5F07A 22GSA 3Q6OA 1SK1A 1Q98A 4EE0A 2KHPA 3ME8A 2C8UA 2K6VA 4IQ1A 3H93A 2LJKA 5J9CA 4KE3A 3APOA 4ECIA 2FGXA 4HQZA 3H8QA 5GSSA 2ZCTA 4XHMA 1GUMA 1XZOA 3Q19A 1T3BA 1SKSB 3FZ5A 1SL0B 1GSEA 1B9XC 1TK8B 4MPGA 2E0QA 4BVYB 2P5RA 1U6TA 3BBYA 3N5OA 5HR3A 1Z7RA 3ZIVA 4EUYA 2L4CA 2ON7A 3M0FA 11GSA 12GSA 4CW9A 3IK9A 5IM9A 3KJYA 4I97A 3APQA 3LXZA 2YN1A 2GS3A 2OACA 2CZ2A 2K18A 4HZ4A 2HZEA 1H75A 1R4WA 4MLYA 4POMA 1GTIA 3ZVJA 5EPFA 4LMVA 1X9SB 3A2VA 2DJ1A 3HDCA 2IJYA 3IK7A 4MJBA 5J5NA 2DJ2A 5INYA 1JZRA 1A23A 3GTUA 2GSSA 1ACVA 3J7Yk 3WGXA 4JR4A 1MD4A 2DJ3A 1EGOA 6GSUA 4POLA 2GT5A 2KLXA 3KP9A 5G1LA 2V6OA 1W4VA 1XFLA 4MF6A 2JACA 4YAPA 3IAS2 1BAYA 5EY6A 3O3TA 1ABAA 1MDJA 1GRXA 1PL2A 4EXJA 5LCZA 2LUSA 2PU9C 5DBQA 1DSBA 2FD3A 2YV9A 2YZUA 1Z6NA 2XBIA 1ST9A 5DQYA 2PMTA 2I4AA 3TOUA 1V9WA 2LJAA 3L78A 5KN2A 1EOHA 1AIUA 4EO3A 3HVVA 3KZQA 4PUFC 4K7OA 2IPAA 5AN1A 4QQ7A 4NXIA 2FA4A 5CRWA 1N8JA 4OCFA 1OC9A 5DDLA 3TKRA 1TOFA 2R5GA 4FIWA 1ZOFA 2DJJA 5IPHA 4WBJA 2OA7A 5HR0A 1U3AA 4OO5A 3L4NA 4ZL8A 1T4YA 5AIVA 1XVQA 1TK0B 1F2EA 18GSA 3G7JA 13GSA 1WIKA 5CNWA 4TR3A 3GURA 3KH9A 1F3AA 4RI6A 1ZL9A 3L9VA 3ZYWA 3CXGA 4H86A 3EC3A 2VUPA 2VCVA 5ECIB 5H5RA 2I81A 2VCWA 1AXDA 1O8WA 1X9MB 3QAVA 2FA8A 4MJAA 1SENA 2H8LA 3C73A 5G31A 4IJIA 4I5QA 3UJ1A 3HY2A 4HOJA 4E8EA 1VF4A 2YOIA 2FHEA 4TOPA 4V2MA 4L0UA 3G7IA 2DC5A 4OCEA 1B4QA 1F6MC 2LSTA 4KDXA 4G9HA 1PD21 4N11A 2V41A 2RUFA 2H0IA 3QOUA 1WJKA 2L57A 2H1DA 14GSA 3EU4A 5KN0A 8GSSA 4BVXB
chains in the Genus database with same CATH superfamily
3ZL5A 1GSUA 2HI7A 1K3YA 1SJZA 4KF9A 4I6XA 4HEA2 1Z5YE 1PFOA 3DEXA 2FNOA 4K8MA 3F3QA 3DD3A 2AYTA 2CAQA 3M8NA 3F9UA 4JR6A 3KGKA 4KDYA 2EIQA 3CRUA 2LQOA 4YAVA 3WGDA 4I2UA 3FK8A 4ZBDA 1GTAA 3N9JA 3I6AA 4USSA 2HSHA 1J9BA 3VI5A 4EDYA 5IIZA 2NTOA 2IWTA 2WB9A 1USBA 1XW5A 3GYKA 3ZFBA 1TXXA 1SKRB 4NHZA 4YQMA 2OT3A 4PXOA 3ZMLA 4AJ7A 3ZIJA 3F4RA 2B7KA 5F0GA 4JZQA 1Z9HA 2V1MA 2IMKA 5DALA 2F8FA 2YZHA 3KH7A 4LLRA 2Z9SA 3UL3A 5IMZA 1KTEA 2MMZA 2GQLA 4X0XA 3F6DA 3GKNA 2H76A 3LW9A 1XBSA 2VL2C 3FR6A 1GUKA 2XBQA 4N30A 3C1RA 1XOAA 5H5QA 2QGVA 1WPIA 1SJ6A 4IJ3A 3UVTA 2NDOA 3FZ4A 1YY7A 1XWBA 5ECPB 4MP4A 4LMWA 2FWEA 2OBKA 3MIXA 2DMMA 2YPMA 7GSSA 4FO5A 3CTFA 3IOSA 3US3A 3EPTA 19GSA 5B6MA 3QAGA 1VF2A 5J41A 1SVLA 2HE3A 2A4HA 2LEGA 2P31A 2UZ8A 1JLWA 4JRRA 4TN8A 3RHCA 4IGJA 3WT2A 4DSSA 3C1SA 2MBTA 1AW9A 4JE1A 4EL1A 2L59A 3LG6A 3IXRA 5BMUA 2HRNA 5J4UA 2QA2A 3SBCA 4BL7B 3UMAA 1ZYQB 3I69A 2YNXA 4RQXA 2K8VA 2N5AA 4Q5NA 2DMLA 1BG1A 2FWHA 1OE7A 4K5SA 3ISOA 4HS1A 4L5OA 4Q5RA 1SD8A 2GGTA 4PI0C 4QL9A 5ELGA 3TRQA 1YEPA 4MJEA 2M80A 1IYHA 5ID2A 4DSQA 5A1NA 4MMMA 4DSRA 5IMVA 3TOTA 5B6NA 4CHSA 2L6DA 2CAIA 2JZTA 5F05A 2YWOA 1JLVA 4GQCA 1I9DA 3Q18A 3TJJA 2YWNA 4TXVA 5FWGA 1GSYA 1W89A 1VRSD 3HZ8A 3QFAC 2ES7A 4I8BA 4HI7A 2H6ZA 2F9SA 4AKGA 4P3YB 5A34B 1XWGA 4X1UA 3JCML 1TKDB 5GSTA 4NV2A 2YV7A 4G10A 2VCTA 3UOMA 3F6FA 3KP8A 3FY7A 3OR5A 5JWOB 1U88A 2A2PA 4YQUA 1U3IA 2DSAA 1OE8A 3PPUA 2VLVA 5D9WA 3LFLA 4JEDA 2LKUA 1ERVA 2HYXA 1OVNA 4GQFA 1V2AA 1YVLA 1B8XA 1ERUA 3RPNA 1V57A 1BJXA 4ECCA 4OMVA 2O5VA 2HSNB 2GLRA 4WEYA 3TKSE 4ZL7A 5JWRB 2B5YA 4KB3A 5E4WA 2VIMA 3GKKA 1O81A 4F9ZA 3KMOA 3TJBA 2VAFA 4JU5A 4LL4B 4AF2A 4ID0A 3KIJA 3VWUA 1ZYEA 2DLXA 1SVMA 5KOXA 3IDVA 1XVWA 3CYNA 3W6GA 3GFKA 1N25A 2LV3A 1B4PA 3LSZA 1ZMAA 2GQKA 4WF5A 1JZWA 1FAAA 1Y25A 1QXHA 1UVZA 3GUSA 1THOA 4I2TA 2R6KA 4OFMA 4BVYA 1QK8A 1JZDA 1V40A 2HRFA 2H70A 3A2XA 4W66A 3EWLA 1R5AA 5GAPD 5C04A 1XIYA 3WD6A 2WVXB 1K0BA 4E68A 1FW1A 3E3EA 5IMDA 3GHAA 3GN3A 1GSFA 2VOCA 2I9HA 1BQ7A 3TKSC 3L9SA 1XPVA 2H71A 4AKXB 1TRWA 3LYKA 4V1Ap 3VWWA 5GAND 2WFCA 4HDEA 4HU9A 4IS0A 3CBUA 1TK5B 2P5QA 2KP2A 2FCHA 1SVOA 1EV9A 2I1UA 2J9HA 2WJUA 1NW2A 4XS6A 1Y6EA 1ZYNA 4MF7A 2K8SA 5CRGA 3CSIA 4WF4A 2IIYA 4EC0A 5AGYA 4IW9A 4IP1A 3KXOA 3D0ZA 16GSA 3PINA 2EC4A 4MZWA 5COHA 1PSQA 1XWKA 1AQVA 2RM5A 1TU7A 2OBIA 1OAZA 2V32A 2R37A 4MDCA 3E9JB 1M2AA 4HU7A 3IA1A 5FHIA 2H30A 4GWRA 1XXUA 2HT9A 1JZOA 4CY8A 5GZZB 4D73B 1LBKA 3GV1A 3RAZA 3VPTA 1A0RP 3GH6A 1B48A 1M7TA 1B9YC 3QAWA 5D9VA 4HZ2A 2LRNA 3DVWA 4PURA 1K0DA 3GX0A 5J47A 2CVKA 3L0HA 1ZCPA 1TI3A 1TJDA 4TXOB 3IV4A 2QKEA 1PX6A 4FYCA 5B8BA 2B5XA 2KP1A 4ZB9A 2EFCA 4MZCA 5IOWA 2L5OA 1X0RA 1R7HA 2UV8G 1TW9A 2H0HA 1GWCA 4K1FA 2BMXA 1T7PB 5ECQB 1T1VA 2OE3A 2NVLA 2HZFA 5ABRA 1DE1A 1GH2A 4ULXA 4XRAA 4ECBA 1FVJA 4J56E 1SK0A 3FYGA 3ZRDA 2WZ9A 1C72A 1HNBA 1YJ6A 5ECRB 2R0GA 5CO3A 2L6CA 6GSVA 5B8AA 5ECKB 3P7XA 1HNAA 2FLSA 2O3EA 1UC7A 5ECLB 4GTUA 3CRTA 4ZB8A 20GSA 5LNKe 2O7KA 3HA9A 3DRNA 1QQ2A 1O7UA 1PA3A 4BIKA 2JZRA 2GSQA 1WWJA 4K5RA 3SWLA 5J3RA 4BVXA 1YF0A 3HVSA 2C80A 4ML1A 4ZILA 1S3DA 3TRPA 4AKIA 3IE3A 3HXSA 4ZL9A 4PTSA 4NPBA 1UA5A 2V2GA 4CDOA 1CQGA 3UAPA 2NPBA 2PVQA 1O73A 2IN3A 3TJGA 1X5EA 3KM6A 3QD9A 3GA4A 2JSYA 3KTBA 5ELAA 4IQAA 1UN2A 2H1BA 1WP0A 4ECJA 4CY6A 2C0FA 5D8IA 3UARA 3IC8A 10GSA 4YQVA 1SU9A 3CWGA 4KH7A 5DAKB 1GLPA 2HRKB 3F4TA 3DXBA 4RQRA 4AKHA 2X49A 3UIWA 3RBTA 3MSZA 2K9FA 5IQYA 3UBLA 2H75A 5IPGA 3WT1A 2HXKA 3GMFA 4RI7A 4HUAA 5ECSA 5ECMB 2A2RA 2DIYA 5A5KA 2VL3A 2CX4A 2H19A 1OC8A 2H01A 4F2IA 2EFDA 4MH3A 1S3CA 2F3MA 4MH2A 4GSSA 2H72A 4MABA 3BCIA 4KDUA 2CZ3A 1DUGA 3WGEA 1F3BA 5LD0A 1SYRA 2I3YA 4O5RA 1N2AA 5A4WA 2E2MA 2YANA 3HD5A 3FKFA 1A0FA 1PN0A 1ML6A 4NV5A 4BWSA 1WE0A 3IBHA 4QMKA 3ME7A 2RUEA 4KSMA 3EYTA 2HQTA 2ALBA 1OKTA 3PR8A 1ERTA 3G9BA 3FZAA 2KOKA 4KAEA 3EMXA 3HMJG 4K7IA 4K0GA 3VI7A 1AQXA 3IPZA 1SYXA 3BOAA 3ZTLA 1GNEA 3APSA 2O87A 1HNCA 1MD3A 3NOFA 4MPFA 3TRXA 3GNJA 2XHFA 1MDIA 4GDFA 5IOXA 4OO4A 2XPEA 3LJRA 4BL7A 3VWXA 2M46A 1YDKA 3CTGA 2JSZA 3L9UA 1G7EA 2BJXA 1K0NA 5EVOA 2GT6A 5JWQB 2AHEA 4X43A 1M99A 1BEDA 3DWVA 2B1KA 1S4BP 2REMA 1Y1UA 3NZNA 4PNGA 1A2MA 3KD0A 5CYYA 1LU4A 2DJKA 3IHQA 5J4YA 2CQ9A 4OWYA 3RDWA 1V98A 1BG5A 3K8NA 5J9BA 1Z6MA 4GLTA 1T8EB 4HJ2A 2HSMB 4KCAA 1K0MA 2HRAA 2IFQB 1G7OA 1AAZA 2N5BA 3CQFA 1GULA 1TXUA 3ZFLA 1NSWA 2CV4A 2DIZA 2HNLA 3CSHA 1YKAA 2IMEA 3A3TA 2X8CA 4Q5FA 3V1WA 3GH9A 2HFDA 1OYJA 3U6VA 1TI1A 4ZB7A 2WRTA 2VCXA 3A5WA 1EP8A 5KN3A 4V2LA 4FQUA 2GSRA 4F0BA 2YJHA 4BA7A 4GSTA 1F9MA 5ECHB 3TB2A 5D96A 3I9V2 4TR4A 2TRCP 5A34A 4XIHA 4TR0A 4NHWA 4TR1B 2JZSA 3E0UA 3F8UA 5A5HB 5H5SA 3MDKA 1SL1B 3MYDA 2MMOA 1A2JA 1GSDA 5DQSA 1PKWA 1DBYA 4ZIJA 4WKWA 2R4VA 1OC3A 3DKSA 3F0IA 1K0OA 5CAXA 4YH2A 4N3ZA 3VLNA 4N0VA 1PX7A 4O5QA 5IMCA 2CVBA 4N10A 1M9BA 4GXZA 5C00A 1TRSA 3R3EA 1K0CA 2HSNA 3HZ4A 3LQ7A 1EWXA 1OKDA 3F4SA 3IRAA 1ZGNA 4MF5A 3KMNA 1TTZA 1PN9A 4FYBA 1GTBA 2H1LA 2G2QA 1GSQA 2YP6A 2LQQA 3GL5A 4EIQA 1EP7A 3HHVA 2X99A 5G5EA 2H1AA 2YWMA 1PRXA 5CRHA 3DVXA 2PGTA 1EGRA 5BRTA 1QMVA 2LNSA 4GCIA 2EIRA 3CMIA 2C0GA 3DIEA 4TKYA 3KTLA 5HFKA 4POBA 5CREA 1PKZA 1SD9A 5DVBA 4KGIA 2VL9A 1HQOA 2LS5A 4OD7A 5G2ZA 4BWQA 2VD0A 1U87A 2VL2A 3EINA 6GSXA 2P0GA 1J08A 3KEBA 3D4MA 2TIRA 4G0KA 3FRCA 1X5CA 4J57E 1YKCA 4WXTA 3W8SA 4K2DA 2WVXA 3ZITA 1TRVA 3Q74A 2MYGA 3IC4A 4OFNA 4ILFA 5DCHA 3HCZA 5HR2A 4BPYA 2PPTA 5KN1A 3S9FA 2DJ0A 3GKMA 2WW1A 3QMXA 2NBSA 1NHYA 1FB6A 3M3MA 3TCOA 1T4ZA 4G2EA 3BD2A 1M3JA 2GTUA 2WGRA 3HJPA 4G0LA 2PUKC 3EMPA 4DVCA 2F8AA 4G01A 2AAWA 4FYUA 2YJ7A 4XTSA 17GSA 3H1NA 1MEKA 4FXYP 2WW3A 3EURA 2IMFA 2C0EA 3GSTA 5A4VA 3TKPA 1A8LA 4YKGA 3H79A 1O6JA 1A2LA 3VK9A 4O32A 2WS2A 2B6MA 2AV4A 4EF0A 1V58A 2PWJA 2LRCA 1KBNA 3LYPA 2HZEB 1F37A 5HFGA 3HJOA 1QUWA 4IP6A 1SJIA 4PUAA 4AJ6A 2DBCA 2WW0A 1GNWA 6GSWA 1PGTA 1TDIA 2H73A 4XRDA 4XCSA 2H66A 4E8HA 1K3OA 3C7MA 5D9XA 1S3RA 2GZYA 1ILOA 5JCGA 1VF1A 1WRYA 4Z2RA 4Z7XA 5IMAA 3GTUB 2L5LA 1A8YA 4D73A 3RFRC 1YEXA 2FWGA 4WBRD 2LNTA 1VF3A 4LL1B 2MBSA 3ED3A 2OKAA 5G1KA 1K3LA 4IKHA 4ZBBA 3RGBC 4PQIA 2VM1A 1DE2A 3BCKA 3QR6A 1LJRA 1J0FA 4TXOA 4PI2C 3FMWA 2AUVA 2QC7A 4PQ1A 5CRDA 3TUEA 5DJMA 1K0AA 2CX3A 3VPQA 2VM2A 2KUCA 3TU3B 3FW2A 4MZBA 4FH8A 5IMFA 4DEJA 1XW9A 5DCGA 2R0CA 2RM6A 1M2DA 4PNFA 1KNGA 4KNDA 1E6BA 3RPPA 3P2AA 1H4OA 1Z7PA 1I1IP 2IMDA 2G0FA 3U5RE 4L8EA 1IYIA 3ZREA 2TRXA 5CP1A 1ERWA 1MDKA 1T00A 5L71A 2OJLA 4GRFA 1Q4JA 1I5GA 1R5PA 3ERGA 3D4TA 1GLQA 1ON4A 2GZZA 4AJ8A 4EIPA 1XWCA 4AGSA 2H74A 1OC9B 2ZUPA 2YWIA 1XW6A 3UVHA 4PGTA 3HJMA 5ECNB 4POKA 4KX4A 2GZPA 1X9WB 3QDNA 2IL3A 5HQPA 1M0UA 3R2QA 2E2GA 4TVEA 4K6XA 3A5IA 2XPDA 5AIXA 2H6XA 5A4UA 4IVFA 3GSSA 1TRUA 3M9KA 2F51A 3P8WA 4Q5QA 2GQMA 1EV4A 1M2BA 2CVDA 3GIXA 2D2ZA 3DMLA 2LTKA 5KOWA 3KCMA 4F82A 6GSTA 2C0DA 4ZB6A 1QGVA 4WR4A 1THXA 4O5UA 2E7PA 4PX1A 3F3RA 2CA8A 1MTCA 4NAXA 5J40A 4GF0A 3TJKA 1AQWA 2R3XA 3IAM2 3O6TA 5JCUA 5EL8A 2R2JA 2CT6A 1CQHA 5DAKA 3D5JA 2HRKA 3VURA 4KSOA 3AY8A 1O85A 2PERA 2FUG2 3RHBA 2VKZG 4ML6A 3DGQA 3LXTA 4IELA 2HSYA 3LORA 2JU5A 2A2SA 4K2XA 4WETA 1PQNA 3TKSA 1VGLA 4K7NA 1JHBA 2C3NA 1FO5A 5DJLA 2RLIA 4WR5A 3TDGA 2ZNMA 2JL4A 5ECOB 2VLTA 1NHOA 4KA0A 2AJQB 5ENUA 1YZXA 6GSSA 3FEUA 5HFIA 3D21A 3QFBC 3MWHA 1GL8A 3WYWA 1SKWB 4PQHA 4XS4A 4IN0A 2VCQA 4V1Ag 3FR9A 3D22A 4G0IA 1XG8A 1EEJA 4F03A 1PL1A 4K0NA 2QA1A 5D9TA 3GKXA 4LA1A 4MNNA 3UBKA 2H0GA 4XS4B 2YCDA 3LEFA 1HD2A 3LWAA 2A4VA 3GL3A 2FWFA 2BTOT 2LRTA 1FHEA 3ERWA 1XWAA 1SL2B 2MMAA 2GDRA 4N0ZA 3HKRA 5D93A 2OE1A 2H1GA 1G6YA 5DALB 3G7YA 3GX8A 4AI6A 1Z3EA 2X4AA 3BJ5A 3C71A 3LGCA 2H6YA 2L4QA 1X5DA 1RK4A 6GSYA 1E2YA 3FR3A 3W8JA 2EFHA 1QFNA 4MJCA 1G6WA 2GSTA 2QSIA 3EE2A 2C1YA 4O7HA 2B1LA 2XC2A 1URMA 3HVXA 4QL7A 1A24A 3ZZXA 1PMTA 2B3SA 3DYRA 2WCIA 1FOHA 2B7JA 4HQSA 3PGTA 5IO0A 1TP9A 3FZ9A 2VLUA 2J23A 1RW1A 3ZLPA 2C3QA 1BX9A 3UEMA 4OFTA 2VD1A 2WVYA 5AISA 3M1GA 4TW5A 3NIVA 2X64A 5KEJA 1XCCA 2HSMA 2VCZA 1GSSA 3TGZA 2IFQA 2AB6A 1BYEA 1ZZYA 1FG4A 4F0CA 3M9JA 4K9ZA 3VFIA 4ACSA 4O92A 1EEMA 4MK3A 4DSSB 2HLSA 3EU3A 2O89A 5FT3A 2PN8A 1GUHA 1R26A 2VO4A 4L5LA 5BMUB 3VWVA 2WULA 3QPMA 1FB0A 4MA9A 5HR1A 2JADA 3C8EA 4L0WA 4EDZA 1AC1A 4TR1A 5A5HA 3TJFA 3F63A 4IHUA 3EVIA 4J2FA 5JCWA 1FOVA 4HSCX 3QCPA 2MMNA 4ICYA 2RIIA 2O85A 1AUCA 5ID2B 3ERFA 1JFUA 4EKZA 1YF1A 3IR4A 2N5FA 5A1NB 1EOGA 4KUNA 1GTUA 3J7Yb 3HYPA 4NMUA 5IO2A 4IBPA 1G0TA 5F06A 4G19A 2MZCA 3ZMKA 2X8HA 3CSJA 3TKQA 2ON5A 1SK2A 1WOUA 2FY6A 5F8BA 2GVPA 2EIOA 4TRXA 2WDUA 5B7CA 4KCEA 2WZSA 2C3TA 1FVKA 1NM3A 2IMIA 4GSNA 4EVMA 1EZKA 4ISDA 3I43A 1GP1A 5D73A 2OADA 4X4JA 3MAKA 2OE0A 4RUVA 3FHKA 2PBJA 3ZVJD 3H4KA 2C4JA 1O8XA 1RQMA 2V6KA 3O76A 2LJRA 1YQ1A 4KW6A 1S3AA 4XS1A 1YEWC 1KEBA 4MCUA 2EFEA 3PH9A 5G5FA 4NWYA 2M72A 3P90A 4YKFA 1M9AA 2B5EA 2X8GA 5G30A 3MNGA 1HYUA 2O36A 1TU8A 4JBBA 1WMJA 9GSSA 3D6IA 3GRXA 4ZBAA 2DKIA 3A2WA 1XOBA 5E59A 2O8VB 2PVOC 4HJMA 4V2NA 4A5PA 4ZXGA 5F07A 22GSA 3Q6OA 1SK1A 1Q98A 4EE0A 2KHPA 3ME8A 2C8UA 2K6VA 4IQ1A 3H93A 2LJKA 5J9CA 4KE3A 3APOA 4ECIA 2FGXA 4HQZA 5J4VA 3H8QA 5GSSA 2ZCTA 4XHMA 1GUMA 1XZOA 3Q19A 1T3BA 1SKSB 3FZ5A 1SL0B 1GSEA 1B9XC 1TK8B 4MPGA 2E0QA 4BVYB 2P5RA 1U6TA 3BBYA 3N5OA 5HR3A 2WW2A 1Z7RA 3ZIVA 4EUYA 2L4CA 2ON7A 3M0FA 11GSA 12GSA 4CW9A 3IK9A 5IM9A 3KJYA 4I97A 3APQA 3LXZA 2YN1A 2GS3A 2OACA 2CZ2A 2K18A 4Z2UA 4HZ4A 2HZEA 1H75A 1R4WA 2WVZA 4MLYA 4POMA 1GTIA 3ZVJA 5EPFA 4LMVA 1X9SB 3A2VA 2DJ1A 3HDCA 2IJYA 3IK7A 4MJBA 5J5NA 2DJ2A 5INYA 1JZRA 1A23A 3GTUA 2GSSA 1ACVA 3J7Yk 3WGXA 4JR4A 1MD4A 2DJ3A 1EGOA 6GSUA 4POLA 2GT5A 2KLXA 3KP9A 5G1LA 2V6OA 1W4VA 1XFLA 4MF6A 2JACA 4YAPA 3IAS2 1BAYA 5EY6A 3O3TA 1ABAA 1MDJA 1GRXA 1PL2A 4EXJA 5LCZA 2LUSA 2PU9C 5DBQA 1DSBA 1ZYPA 2FD3A 2YV9A 2YZUA 1Z6NA 2XBIA 3CHXC 1ST9A 5DQYA 2PMTA 2I4AA 3TOUA 1V9WA 2LJAA 4Z2TA 3L78A 5KN2A 1EOHA 1AIUA 4EO3A 3HVVA 3KZQA 4PUFC 1M3IA 4K7OA 2IPAA 5AN1A 4QQ7A 4NXIA 2FA4A 5CRWA 1N8JA 4OCFA 1OC9A 5DDLA 3TKRA 1TOFA 2R5GA 4FIWA 3IHGA 1ZOFA 2DJJA 5IPHA 4WBJA 2OA7A 5HR0A 1U3AA 4OO5A 3L4NA 4ZL8A 1T4YA 5AIVA 1BF5A 1XVQA 1TK0B 1F2EA 18GSA 3G7JA 13GSA 1WIKA 5CNWA 4TR3A 3GURA 3KH9A 1F3AA 4PHZC 4RI6A 1ZL9A 3L9VA 3ZYWA 3CXGA 4H86A 3EC3A 2VUPA 2VCVA 5ECIB 5H5RA 2I81A 2VCWA 1AXDA 1O8WA 1X9MB 3QAVA 2FA8A 4MJAA 1SENA 2H8LA 3C73A 5G31A 4IJIA 4I5QA 3UJ1A 3HY2A 4HOJA 4E8EA 2DKHA 2R0PA 1VF4A 2YOIA 2FHEA 4TOPA 4V2MA 4L0UA 3HVNA 3G7IA 2DC5A 4OCEA 1B4QA 1F6MC 2LSTA 4KDXA 4G9HA 1PD21 4N11A 2V41A 2RUFA 2H0IA 3QOUA 1WJKA 2L57A 2H1DA 14GSA 3EU4A 5KN0A 8GSSA 4BVXB
chains in the Genus database with same CATH topology
3ZL5A 1GSUA 2HI7A 1K3YA 1SJZA 4KF9A 4I6XA 4HEA2 1Z5YE 3DEXA 2FNOA 4K8MA 3F3QA 3DD3A 2AYTA 2CAQA 3M8NA 3F9UA 4JR6A 3KGKA 4KDYA 2EIQA 3CRUA 2LQOA 4YAVA 3WGDA 4I2UA 3FK8A 4ZBDA 1GTAA 3N9JA 3I6AA 4USSA 2HSHA 1J9BA 3VI5A 4EDYA 5IIZA 2NTOA 2IWTA 2WB9A 1USBA 1XW5A 3GYKA 3ZFBA 1TXXA 1SKRB 4NHZA 4YQMA 2OT3A 4PXOA 3ZMLA 4AJ7A 3ZIJA 3F4RA 2B7KA 5F0GA 4JZQA 1Z9HA 2V1MA 2IMKA 5DALA 2F8FA 2YZHA 3KH7A 4LLRA 2Z9SA 3UL3A 5IMZA 1KTEA 2MMZA 2GQLA 4X0XA 3F6DA 3GKNA 2H76A 3LW9A 1XBSA 2VL2C 3FR6A 1GUKA 2XBQA 4N30A 3C1RA 1XOAA 5H5QA 2QGVA 1WPIA 1SJ6A 4IJ3A 3UVTA 2NDOA 3FZ4A 1YY7A 1XWBA 5ECPB 4MP4A 4LMWA 2FWEA 2OBKA 3MIXA 2DMMA 2YPMA 7GSSA 4FO5A 3CTFA 3IOSA 3US3A 3EPTA 19GSA 5B6MA 3QAGA 1VF2A 5J41A 1SVLA 2HE3A 2A4HA 2LEGA 2P31A 2UZ8A 1JLWA 4JRRA 4TN8A 3RHCA 4IGJA 3WT2A 4DSSA 3C1SA 2MBTA 1AW9A 4JE1A 4EL1A 2L59A 3LG6A 3IXRA 5BMUA 2HRNA 5J4UA 2QA2A 3SBCA 4BL7B 3UMAA 1ZYQB 3I69A 2YNXA 4RQXA 2K8VA 2N5AA 4Q5NA 2DMLA 1BG1A 2FWHA 1OE7A 4K5SA 3ISOA 4HS1A 4L5OA 4Q5RA 1SD8A 2GGTA 4QL9A 5ELGA 3TRQA 1YEPA 4MJEA 2M80A 1IYHA 5ID2A 4DSQA 5A1NA 4MMMA 4DSRA 5IMVA 3TOTA 5B6NA 4CHSA 2L6DA 2CAIA 2JZTA 5F05A 2YWOA 1JLVA 4GQCA 1I9DA 3Q18A 3TJJA 2YWNA 4TXVA 5FWGA 1GSYA 1W89A 1VRSD 3HZ8A 3QFAC 2ES7A 4I8BA 4HI7A 2H6ZA 2F9SA 4AKGA 4P3YB 5A34B 1XWGA 4X1UA 3JCML 1TKDB 5GSTA 4NV2A 2YV7A 4G10A 2VCTA 3UOMA 3F6FA 3KP8A 3FY7A 3OR5A 5JWOB 1U88A 2A2PA 4YQUA 1U3IA 2DSAA 1OE8A 3PPUA 2VLVA 5D9WA 3LFLA 4JEDA 2LKUA 1ERVA 2HYXA 1OVNA 4GQFA 1V2AA 1YVLA 1B8XA 1ERUA 3RPNA 1V57A 1BJXA 4ECCA 4OMVA 2O5VA 2HSNB 2GLRA 4WEYA 3TKSE 4ZL7A 5JWRB 2B5YA 4KB3A 5E4WA 2VIMA 3GKKA 1O81A 4F9ZA 3KMOA 3TJBA 2VAFA 4JU5A 4LL4B 4AF2A 4ID0A 3KIJA 3VWUA 1ZYEA 2DLXA 1SVMA 5KOXA 3IDVA 1XVWA 3CYNA 3W6GA 3GFKA 1N25A 2LV3A 1B4PA 3LSZA 1ZMAA 2GQKA 4WF5A 1JZWA 1FAAA 1Y25A 1QXHA 1UVZA 3GUSA 1THOA 4I2TA 2R6KA 4OFMA 4BVYA 1QK8A 1JZDA 1V40A 2HRFA 2H70A 3A2XA 4W66A 3EWLA 1R5AA 5GAPD 5C04A 1XIYA 3WD6A 1K0BA 4E68A 1FW1A 3E3EA 5IMDA 3GHAA 3GN3A 1GSFA 2VOCA 2I9HA 1BQ7A 3TKSC 3L9SA 1XPVA 2H71A 4AKXB 1TRWA 3LYKA 4V1Ap 3VWWA 5GAND 2WFCA 4HDEA 4HU9A 4IS0A 3CBUA 1TK5B 2P5QA 2KP2A 2FCHA 1SVOA 1EV9A 2I1UA 2J9HA 2WJUA 1NW2A 4XS6A 1Y6EA 1ZYNA 4MF7A 2K8SA 5CRGA 3CSIA 4WF4A 2IIYA 4EC0A 5AGYA 4IW9A 4IP1A 3KXOA 3D0ZA 16GSA 3PINA 2EC4A 4MZWA 5COHA 1PSQA 1XWKA 1AQVA 2RM5A 1TU7A 2OBIA 1OAZA 2V32A 2R37A 4MDCA 3E9JB 1M2AA 4HU7A 3IA1A 5FHIA 2H30A 4GWRA 1XXUA 2HT9A 1JZOA 4CY8A 5GZZB 4D73B 1LBKA 3GV1A 3RAZA 3VPTA 1A0RP 3GH6A 1B48A 1M7TA 1B9YC 3QAWA 5D9VA 4HZ2A 2LRNA 3DVWA 4PURA 1K0DA 3GX0A 5J47A 2CVKA 3L0HA 1ZCPA 1TI3A 1TJDA 4TXOB 3IV4A 2QKEA 1PX6A 4FYCA 5B8BA 2B5XA 2KP1A 4ZB9A 2EFCA 4MZCA 5IOWA 2L5OA 1X0RA 1R7HA 2UV8G 1TW9A 2H0HA 1GWCA 4K1FA 2BMXA 1T7PB 5ECQB 1T1VA 2OE3A 2NVLA 2HZFA 5ABRA 1DE1A 1GH2A 4ULXA 4XRAA 4ECBA 1FVJA 4J56E 1SK0A 3FYGA 3ZRDA 2WZ9A 1C72A 1HNBA 1YJ6A 5ECRB 2R0GA 5CO3A 2L6CA 6GSVA 5B8AA 5ECKB 3P7XA 1HNAA 2FLSA 1UC7A 5ECLB 4GTUA 3CRTA 4ZB8A 20GSA 5LNKe 2O7KA 3HA9A 3DRNA 1QQ2A 1O7UA 1PA3A 2JZRA 2GSQA 1WWJA 4K5RA 3SWLA 5J3RA 4BVXA 1YF0A 3HVSA 2C80A 4ML1A 4ZILA 1S3DA 3TRPA 4AKIA 3IE3A 3HXSA 4ZL9A 4PTSA 4NPBA 1UA5A 2V2GA 4CDOA 1CQGA 3UAPA 2NPBA 2PVQA 1O73A 2IN3A 3TJGA 1X5EA 3KM6A 3QD9A 3GA4A 2JSYA 3KTBA 5ELAA 4IQAA 1UN2A 2H1BA 1WP0A 4ECJA 4CY6A 2C0FA 5D8IA 3UARA 3IC8A 10GSA 4YQVA 1SU9A 3CWGA 4KH7A 5DAKB 1GLPA 2HRKB 3F4TA 3DXBA 4RQRA 4AKHA 2X49A 3UIWA 3RBTA 3MSZA 2K9FA 5IQYA 3UBLA 2H75A 5IPGA 3WT1A 2HXKA 3GMFA 4RI7A 4HUAA 5ECSA 5ECMB 2A2RA 2DIYA 5A5KA 2VL3A 2CX4A 2H19A 1OC8A 2H01A 4F2IA 2EFDA 4MH3A 1S3CA 2F3MA 4MH2A 4GSSA 2H72A 4MABA 3BCIA 4KDUA 2CZ3A 1DUGA 3WGEA 1F3BA 5LD0A 1SYRA 2I3YA 4O5RA 1N2AA 5A4WA 2E2MA 2YANA 3HD5A 3FKFA 1A0FA 1PN0A 1ML6A 4NV5A 4BWSA 1WE0A 3IBHA 4QMKA 3ME7A 2RUEA 4KSMA 3EYTA 2HQTA 2ALBA 1OKTA 3PR8A 1ERTA 3G9BA 3FZAA 2KOKA 4KAEA 3EMXA 3HMJG 4K7IA 4K0GA 3VI7A 1AQXA 3IPZA 1SYXA 3BOAA 3ZTLA 1GNEA 3APSA 2O87A 1HNCA 1MD3A 3NOFA 4MPFA 3TRXA 3GNJA 2XHFA 1MDIA 4GDFA 5IOXA 4OO4A 2XPEA 3LJRA 4BL7A 3VWXA 2M46A 1YDKA 3CTGA 2JSZA 3L9UA 1G7EA 2BJXA 1K0NA 5EVOA 2GT6A 5JWQB 2AHEA 4X43A 1M99A 1BEDA 3DWVA 2B1KA 2REMA 1Y1UA 3NZNA 4PNGA 1A2MA 3KD0A 5CYYA 1LU4A 2DJKA 3IHQA 5J4YA 2CQ9A 4OWYA 3RDWA 1V98A 1BG5A 3K8NA 5J9BA 1Z6MA 4GLTA 1T8EB 4HJ2A 2HSMB 4KCAA 1K0MA 2HRAA 2IFQB 1G7OA 1AAZA 2N5BA 1GULA 1TXUA 3ZFLA 1NSWA 2CV4A 2DIZA 2HNLA 3CSHA 1YKAA 2IMEA 3A3TA 2X8CA 4Q5FA 3V1WA 3GH9A 2HFDA 1OYJA 3U6VA 1TI1A 4ZB7A 2WRTA 2VCXA 3A5WA 1EP8A 5KN3A 4V2LA 4FQUA 2GSRA 4F0BA 2YJHA 4BA7A 4GSTA 1F9MA 5ECHB 3TB2A 5D96A 3I9V2 4TR4A 2TRCP 5A34A 4XIHA 4TR0A 4NHWA 4TR1B 2JZSA 3E0UA 3F8UA 5A5HB 5H5SA 3MDKA 1SL1B 3MYDA 2MMOA 1A2JA 1GSDA 5DQSA 1PKWA 1DBYA 4ZIJA 4WKWA 2R4VA 1OC3A 3DKSA 3F0IA 1K0OA 5CAXA 4YH2A 4N3ZA 3VLNA 4N0VA 1PX7A 4O5QA 5IMCA 2CVBA 4N10A 1M9BA 4GXZA 5C00A 1TRSA 3R3EA 1K0CA 2HSNA 3HZ4A 3LQ7A 1EWXA 1OKDA 3F4SA 3IRAA 1ZGNA 4MF5A 3KMNA 1TTZA 1PN9A 4FYBA 1GTBA 2H1LA 2G2QA 1GSQA 2YP6A 2LQQA 3GL5A 4EIQA 1EP7A 3HHVA 2X99A 5G5EA 2H1AA 2YWMA 1PRXA 5CRHA 3DVXA 2PGTA 1EGRA 5BRTA 1QMVA 2LNSA 4GCIA 2EIRA 3CMIA 2C0GA 3DIEA 4TKYA 3KTLA 5HFKA 4POBA 5CREA 1PKZA 1SD9A 5DVBA 4KGIA 2VL9A 1HQOA 2LS5A 4OD7A 5G2ZA 4BWQA 2VD0A 1U87A 2VL2A 3EINA 6GSXA 2P0GA 1J08A 3KEBA 3D4MA 2TIRA 4G0KA 3FRCA 1X5CA 4J57E 1YKCA 4WXTA 3W8SA 4K2DA 3ZITA 1TRVA 3Q74A 2MYGA 3IC4A 4OFNA 4ILFA 5DCHA 3HCZA 5HR2A 4BPYA 2PPTA 5KN1A 3S9FA 2DJ0A 3GKMA 3QMXA 2NBSA 1NHYA 1FB6A 3M3MA 3TCOA 1T4ZA 4G2EA 3BD2A 2WGRA 2GTUA 3HJPA 4G0LA 2PUKC 3EMPA 4DVCA 2F8AA 4G01A 2AAWA 4FYUA 2YJ7A 4XTSA 17GSA 3H1NA 1MEKA 3EURA 2IMFA 2C0EA 3GSTA 5A4VA 3TKPA 1A8LA 4YKGA 3H79A 1O6JA 1A2LA 3VK9A 4O32A 2WS2A 2B6MA 2AV4A 4EF0A 1V58A 2PWJA 2LRCA 1KBNA 3LYPA 2HZEB 1F37A 5HFGA 3HJOA 1QUWA 4IP6A 1SJIA 4PUAA 4AJ6A 2DBCA 1GNWA 6GSWA 1PGTA 1TDIA 2H73A 4XRDA 4XCSA 2H66A 4E8HA 1K3OA 3C7MA 5D9XA 2GZYA 1ILOA 5JCGA 1VF1A 1WRYA 4Z2RA 4Z7XA 5IMAA 3GTUB 2L5LA 1A8YA 4D73A 1YEXA 2FWGA 4WBRD 2LNTA 1VF3A 4LL1B 2MBSA 3ED3A 2OKAA 5G1KA 1K3LA 4IKHA 4ZBBA 4PQIA 2VM1A 1DE2A 3BCKA 3QR6A 1LJRA 1J0FA 4TXOA 3FMWA 2AUVA 2QC7A 4PQ1A 5CRDA 3TUEA 5DJMA 1K0AA 2CX3A 3VPQA 2VM2A 2KUCA 3TU3B 3FW2A 4MZBA 4FH8A 5IMFA 4DEJA 1XW9A 5DCGA 2R0CA 2RM6A 1M2DA 4PNFA 1KNGA 4KNDA 1E6BA 3RPPA 3P2AA 1H4OA 1Z7PA 2IMDA 2G0FA 3U5RE 4L8EA 1IYIA 3ZREA 2TRXA 5CP1A 1ERWA 1MDKA 1T00A 5L71A 2OJLA 4GRFA 1Q4JA 1I5GA 1R5PA 3ERGA 3D4TA 1GLQA 1ON4A 2GZZA 4AJ8A 4EIPA 1XWCA 4AGSA 2H74A 1OC9B 2ZUPA 2YWIA 1XW6A 3UVHA 4PGTA 3HJMA 5ECNB 4POKA 4KX4A 2GZPA 1X9WB 3QDNA 2IL3A 5HQPA 1M0UA 3R2QA 2E2GA 4TVEA 4K6XA 3A5IA 2XPDA 5AIXA 2H6XA 5A4UA 4IVFA 3GSSA 1TRUA 3M9KA 2F51A 3P8WA 4Q5QA 2GQMA 1EV4A 1M2BA 2CVDA 3GIXA 2D2ZA 3DMLA 2LTKA 5KOWA 3KCMA 4F82A 6GSTA 2C0DA 4ZB6A 1QGVA 4WR4A 1THXA 4O5UA 2E7PA 4PX1A 3F3RA 2CA8A 1MTCA 4NAXA 5J40A 4GF0A 3TJKA 1AQWA 2R3XA 3IAM2 3O6TA 5JCUA 5EL8A 2R2JA 2CT6A 1CQHA 5DAKA 3D5JA 2HRKA 3VURA 4KSOA 3AY8A 1O85A 2PERA 2FUG2 3RHBA 2VKZG 4ML6A 3DGQA 3LXTA 4IELA 2HSYA 3LORA 2JU5A 2A2SA 4K2XA 4WETA 1PQNA 3TKSA 1VGLA 4K7NA 1JHBA 2C3NA 1FO5A 5DJLA 2RLIA 4WR5A 3TDGA 2ZNMA 2JL4A 5ECOB 2VLTA 1NHOA 4KA0A 2AJQB 5ENUA 1YZXA 6GSSA 3FEUA 5HFIA 3D21A 3QFBC 3MWHA 1GL8A 3WYWA 1SKWB 4PQHA 4XS4A 4IN0A 2VCQA 4V1Ag 3FR9A 3D22A 4G0IA 1EEJA 4F03A 1PL1A 4K0NA 2QA1A 5D9TA 3GKXA 4LA1A 4MNNA 3UBKA 2H0GA 4XS4B 2YCDA 3LEFA 1HD2A 3LWAA 2A4VA 3GL3A 2FWFA 2BTOT 2LRTA 1FHEA 3ERWA 1XWAA 1SL2B 2MMAA 2GDRA 4N0ZA 3HKRA 5D93A 2OE1A 2H1GA 1G6YA 5DALB 3G7YA 3GX8A 4AI6A 1Z3EA 2X4AA 3BJ5A 3C71A 3LGCA 2H6YA 2L4QA 1X5DA 1RK4A 6GSYA 1E2YA 3FR3A 3W8JA 2EFHA 1QFNA 4MJCA 1G6WA 2GSTA 2QSIA 3EE2A 2C1YA 4O7HA 2B1LA 2XC2A 1URMA 3HVXA 4QL7A 1A24A 3ZZXA 1PMTA 2B3SA 3DYRA 2WCIA 1FOHA 2B7JA 4HQSA 3PGTA 5IO0A 1TP9A 3FZ9A 2VLUA 2J23A 1RW1A 3ZLPA 2C3QA 1BX9A 3UEMA 4OFTA 2VD1A 5AISA 3M1GA 4TW5A 3NIVA 2X64A 5KEJA 1XCCA 2HSMA 2VCZA 1GSSA 3TGZA 2IFQA 2AB6A 1BYEA 1ZZYA 1FG4A 4F0CA 3M9JA 4K9ZA 3VFIA 4ACSA 4O92A 1EEMA 4MK3A 4DSSB 2HLSA 3EU3A 2O89A 5FT3A 2PN8A 1GUHA 1R26A 2VO4A 4L5LA 5BMUB 3VWVA 2WULA 3QPMA 1FB0A 4MA9A 5HR1A 2JADA 3C8EA 4L0WA 4EDZA 1AC1A 4TR1A 5A5HA 3TJFA 3F63A 4IHUA 3EVIA 4J2FA 5JCWA 1FOVA 3QCPA 2MMNA 4ICYA 2RIIA 2O85A 1AUCA 5ID2B 3ERFA 1JFUA 4EKZA 1YF1A 3IR4A 2N5FA 5A1NB 1EOGA 4KUNA 1GTUA 3J7Yb 3HYPA 4NMUA 5IO2A 4IBPA 1G0TA 5F06A 4G19A 2MZCA 3ZMKA 2X8HA 3CSJA 3TKQA 2ON5A 1SK2A 1WOUA 2FY6A 5F8BA 2GVPA 2EIOA 4TRXA 2WDUA 5B7CA 4KCEA 2C3TA 1FVKA 1NM3A 2IMIA 4GSNA 4EVMA 1EZKA 4ISDA 3I43A 1GP1A 5D73A 2OADA 4X4JA 3MAKA 2OE0A 4RUVA 3FHKA 2PBJA 3ZVJD 3H4KA 2C4JA 1O8XA 1RQMA 2V6KA 3O76A 2LJRA 1YQ1A 4KW6A 1S3AA 4XS1A 1KEBA 4MCUA 2EFEA 3PH9A 5G5FA 4NWYA 2M72A 3P90A 4YKFA 1M9AA 2B5EA 2X8GA 5G30A 3MNGA 1HYUA 1TU8A 4JBBA 1WMJA 9GSSA 3D6IA 3GRXA 4ZBAA 2DKIA 3A2WA 1XOBA 5E59A 2O8VB 2PVOC 4HJMA 4V2NA 4A5PA 4ZXGA 5F07A 22GSA 3Q6OA 1SK1A 1Q98A 4EE0A 2KHPA 3ME8A 2C8UA 2K6VA 4IQ1A 3H93A 2LJKA 5J9CA 4KE3A 3APOA 4ECIA 2FGXA 4HQZA 5J4VA 3H8QA 5GSSA 2ZCTA 4XHMA 1GUMA 1XZOA 3Q19A 1T3BA 1SKSB 3FZ5A 1SL0B 1GSEA 1B9XC 1TK8B 4MPGA 2E0QA 4BVYB 2P5RA 1U6TA 3BBYA 3N5OA 5HR3A 1Z7RA 3ZIVA 4EUYA 2L4CA 2ON7A 3M0FA 11GSA 12GSA 4CW9A 3IK9A 5IM9A 3KJYA 4I97A 3APQA 3LXZA 2YN1A 2GS3A 2OACA 2CZ2A 2K18A 4Z2UA 4HZ4A 2HZEA 1H75A 1R4WA 4MLYA 4POMA 1GTIA 3ZVJA 5EPFA 4LMVA 1X9SB 3A2VA 2DJ1A 3HDCA 2IJYA 3IK7A 4MJBA 5J5NA 2DJ2A 5INYA 1JZRA 1A23A 3GTUA 2GSSA 1ACVA 3J7Yk 3WGXA 4JR4A 1MD4A 2DJ3A 1EGOA 6GSUA 4POLA 2GT5A 2KLXA 3KP9A 5G1LA 2V6OA 1W4VA 1XFLA 4MF6A 2JACA 4YAPA 3IAS2 1BAYA 5EY6A 3O3TA 1ABAA 1MDJA 1GRXA 1PL2A 4EXJA 5LCZA 2LUSA 2PU9C 5DBQA 1DSBA 1ZYPA 2FD3A 2YV9A 2YZUA 1Z6NA 2XBIA 1ST9A 5DQYA 2PMTA 2I4AA 3TOUA 1V9WA 2LJAA 4Z2TA 3L78A 5KN2A 1EOHA 1AIUA 4EO3A 3HVVA 3KZQA 4PUFC 4K7OA 2IPAA 5AN1A 4QQ7A 4NXIA 2FA4A 5CRWA 1N8JA 4OCFA 1OC9A 5DDLA 3TKRA 1TOFA 2R5GA 4FIWA 3IHGA 1ZOFA 2DJJA 5IPHA 4WBJA 2OA7A 5HR0A 1U3AA 4OO5A 3L4NA 4ZL8A 1T4YA 5AIVA 1BF5A 1XVQA 1TK0B 1F2EA 18GSA 3G7JA 13GSA 1WIKA 5CNWA 4TR3A 3GURA 3KH9A 1F3AA 4RI6A 1ZL9A 3L9VA 3ZYWA 3CXGA 4H86A 3EC3A 2VUPA 2VCVA 5ECIB 5H5RA 2I81A 2VCWA 1AXDA 1O8WA 1X9MB 3QAVA 2FA8A 4MJAA 1SENA 2H8LA 3C73A 5G31A 4IJIA 4I5QA 3UJ1A 3HY2A 4HOJA 4E8EA 2DKHA 2R0PA 1VF4A 2YOIA 2FHEA 4TOPA 4V2MA 4L0UA 3G7IA 2DC5A 4OCEA 1B4QA 1F6MC 2LSTA 4KDXA 4G9HA 1PD21 4N11A 2V41A 2RUFA 2H0IA 3QOUA 1WJKA 2L57A 2H1DA 14GSA 3EU4A 5KN0A 8GSSA 4BVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL5 A;  1GSU A;  2HI7 A;  1K3Y A;  1SJZ A;  4KF9 A;  4I6X A;  4HEA 2;  1Z5Y E;  3DEX A;  2FNO A;  4K8M A;  3F3Q A;  3DD3 A;  2AYT A;  2CAQ A;  3M8N A;  3F9U A;  4JR6 A;  3KGK A;  4KDY A;  2EIQ A;  3CRU A;  2LQO A;  4YAV A;  3WGD A;  4I2U A;  3FK8 A;  4ZBD A;  1GTA A;  3N9J A;  3I6A A;  4USS A;  2HSH A;  1J9B A;  3VI5 A;  4EDY A;  5IIZ A;  2NTO A;  2IWT A;  2WB9 A;  1USB A;  1XW5 A;  3GYK A;  3ZFB A;  1TXX A;  1SKR B;  4NHZ A;  4YQM A;  4PXO A;  3ZML A;  4AJ7 A;  3ZIJ A;  3F4R A;  2B7K A;  5F0G A;  4JZQ A;  1Z9H A;  2V1M A;  2IMK A;  5DAL A;  2F8F A;  2YZH A;  3KH7 A;  4LLR A;  2Z9S A;  3UL3 A;  5IMZ A;  1KTE A;  2MMZ A;  2GQL A;  4X0X A;  3F6D A;  3GKN A;  2H76 A;  1XBS A;  2VL2 C;  3FR6 A;  1GUK A;  2XBQ A;  4N30 A;  3C1R A;  1XOA A;  5H5Q A;  2QGV A;  1WPI A;  1SJ6 A;  4IJ3 A;  3UVT A;  2NDO A;  3FZ4 A;  1YY7 A;  1XWB A;  5ECP B;  4MP4 A;  4LMW A;  2FWE A;  2OBK A;  2DMM A;  2YPM A;  7GSS A;  4FO5 A;  3CTF A;  3IOS A;  3US3 A;  19GS A;  5B6M A;  3QAG A;  1VF2 A;  5J41 A;  2HE3 A;  2LEG A;  2P31 A;  2UZ8 A;  1JLW A;  4JRR A;  4TN8 A;  3RHC A;  4IGJ A;  3WT2 A;  4DSS A;  3C1S A;  2MBT A;  1AW9 A;  4JE1 A;  4EL1 A;  2L59 A;  3LG6 A;  3IXR A;  5BMU A;  2HRN A;  5J4U A;  3SBC A;  4BL7 B;  3UMA A;  1ZYQ B;  3I69 A;  2YNX A;  4RQX A;  2K8V A;  2N5A A;  4Q5N A;  2DML A;  2FWH A;  1OE7 A;  3ISO A;  4HS1 A;  4L5O A;  4Q5R A;  1SD8 A;  2GGT A;  4QL9 A;  5ELG A;  3TRQ A;  1YEP A;  4MJE A;  2M80 A;  1IYH A;  5ID2 A;  4DSQ A;  4MMM A;  4DSR A;  5IMV A;  3TOT A;  5B6N A;  4CHS A;  2L6D A;  2CAI A;  2JZT A;  5F05 A;  2YWO A;  1JLV A;  4GQC A;  1I9D A;  3Q18 A;  3TJJ A;  2YWN A;  4TXV A;  5FWG A;  1GSY A;  1W89 A;  1VRS D;  3HZ8 A;  3QFA C;  2ES7 A;  4I8B A;  4HI7 A;  2H6Z A;  2F9S A;  4P3Y B;  1XWG A;  4X1U A;  3JCM L;  1TKD B;  5GST A;  4NV2 A;  2YV7 A;  4G10 A;  2VCT A;  3UOM A;  3F6F A;  3KP8 A;  3FY7 A;  3OR5 A;  5JWO B;  1U88 A;  4YQU A;  1U3I A;  2DSA A;  1OE8 A;  3PPU A;  2VLV A;  5D9W A;  3LFL A;  4JED A;  2LKU A;  1ERV A;  2HYX A;  1OVN A;  4GQF A;  1V2A A;  1B8X A;  1ERU A;  3RPN A;  1V57 A;  1BJX A;  4ECC A;  4OMV A;  2HSN B;  2GLR A;  4WEY A;  3TKS E;  4ZL7 A;  5JWR B;  2B5Y A;  4KB3 A;  5E4W A;  2VIM A;  3GKK A;  1O81 A;  4F9Z A;  3KMO A;  3TJB A;  2VAF A;  4JU5 A;  4LL4 B;  4AF2 A;  4ID0 A;  3KIJ A;  3VWU A;  1ZYE A;  2DLX A;  3IDV A;  1XVW A;  3CYN A;  3W6G A;  3GFK A;  2LV3 A;  1B4P A;  3LSZ A;  1ZMA A;  2GQK A;  4WF5 A;  1JZW A;  1FAA A;  1Y25 A;  1QXH A;  1UVZ A;  3GUS A;  1THO A;  4I2T A;  2R6K A;  4OFM A;  4BVY A;  1QK8 A;  1JZD A;  1V40 A;  2HRF A;  2H70 A;  3A2X A;  3EWL A;  1R5A A;  5GAP D;  5C04 A;  1XIY A;  3WD6 A;  1K0B A;  1FW1 A;  3E3E A;  5IMD A;  3GHA A;  3GN3 A;  1GSF A;  2VOC A;  2I9H A;  1BQ7 A;  3TKS C;  3L9S A;  1XPV A;  2H71 A;  1TRW A;  3LYK A;  4V1A p;  3VWW A;  5GAN D;  2WFC A;  4HDE A;  4HU9 A;  4IS0 A;  3CBU A;  1TK5 B;  2P5Q A;  2KP2 A;  2FCH A;  1EV9 A;  2I1U A;  2J9H A;  2WJU A;  1NW2 A;  4XS6 A;  1Y6E A;  4MF7 A;  2K8S A;  5CRG A;  3CSI A;  4WF4 A;  2IIY A;  4EC0 A;  5AGY A;  4IW9 A;  4IP1 A;  3KXO A;  3D0Z A;  16GS A;  3PIN A;  2EC4 A;  4MZW A;  5COH A;  1PSQ A;  1XWK A;  1AQV A;  2RM5 A;  1TU7 A;  2OBI A;  1OAZ A;  2V32 A;  2R37 A;  4MDC A;  3E9J B;  1M2A A;  4HU7 A;  3IA1 A;  5FHI A;  2H30 A;  4GWR A;  1XXU A;  2HT9 A;  1JZO A;  5GZZ B;  4D73 B;  1LBK A;  3GV1 A;  3RAZ A;  3VPT A;  1A0R P;  3GH6 A;  1B48 A;  1M7T A;  1B9Y C;  3QAW A;  5D9V A;  4HZ2 A;  2LRN A;  3DVW A;  4PUR A;  1K0D A;  3GX0 A;  2CVK A;  3L0H A;  1ZCP A;  1TI3 A;  1TJD A;  4TXO B;  3IV4 A;  2QKE A;  1PX6 A;  4FYC A;  5B8B A;  2B5X A;  2KP1 A;  4ZB9 A;  4MZC A;  5IOW A;  2L5O A;  1X0R A;  1R7H A;  1TW9 A;  2H0H A;  1GWC A;  4K1F A;  2BMX A;  1T7P B;  5ECQ B;  1T1V A;  2OE3 A;  2NVL A;  2HZF A;  5ABR A;  1DE1 A;  1GH2 A;  4ULX A;  4XRA A;  4ECB A;  1FVJ A;  4J56 E;  1SK0 A;  3FYG A;  3ZRD A;  2WZ9 A;  1C72 A;  1HNB A;  1YJ6 A;  5ECR B;  5CO3 A;  2L6C A;  6GSV A;  5B8A A;  5ECK B;  3P7X A;  1HNA A;  2FLS A;  1UC7 A;  5ECL B;  4GTU A;  3CRT A;  4ZB8 A;  20GS A;  5LNK e;  2O7K A;  3HA9 A;  3DRN A;  1QQ2 A;  1O7U A;  1PA3 A;  2JZR A;  2GSQ A;  1WWJ A;  3SWL A;  5J3R A;  4BVX A;  1YF0 A;  3HVS A;  2C80 A;  4ML1 A;  4ZIL A;  1S3D A;  3TRP A;  3IE3 A;  3HXS A;  4ZL9 A;  4PTS A;  4NPB A;  1UA5 A;  2V2G A;  4CDO A;  1CQG A;  3UAP A;  2NPB A;  2PVQ A;  1O73 A;  2IN3 A;  3TJG A;  1X5E A;  3KM6 A;  3QD9 A;  3GA4 A;  2JSY A;  3KTB A;  5ELA A;  4IQA A;  1UN2 A;  2H1B A;  1WP0 A;  4ECJ A;  2C0F A;  5D8I A;  3UAR A;  3IC8 A;  10GS A;  4YQV A;  1SU9 A;  4KH7 A;  5DAK B;  1GLP A;  2HRK B;  3F4T A;  3DXB A;  4RQR A;  3UIW A;  3RBT A;  3MSZ A;  2K9F A;  5IQY A;  3UBL A;  2H75 A;  5IPG A;  3WT1 A;  2HXK A;  3GMF A;  4RI7 A;  4HUA A;  5ECS A;  5ECM B;  2A2R A;  2DIY A;  5A5K A;  2VL3 A;  2CX4 A;  2H19 A;  1OC8 A;  2H01 A;  4F2I A;  4MH3 A;  1S3C A;  2F3M A;  4MH2 A;  4GSS A;  2H72 A;  4MAB A;  3BCI A;  4KDU A;  2CZ3 A;  1DUG A;  3WGE A;  1F3B A;  5LD0 A;  1SYR A;  2I3Y A;  4O5R A;  1N2A A;  5A4W A;  2E2M A;  2YAN A;  3HD5 A;  3FKF A;  1A0F A;  1ML6 A;  4NV5 A;  4BWS A;  1WE0 A;  3IBH A;  3ME7 A;  2RUE A;  4KSM A;  3EYT A;  2HQT A;  2ALB A;  1OKT A;  3PR8 A;  1ERT A;  3G9B A;  3FZA A;  2KOK A;  4KAE A;  3EMX A;  4K7I A;  4K0G A;  3VI7 A;  1AQX A;  3IPZ A;  1SYX A;  3BOA A;  3ZTL A;  1GNE A;  2O87 A;  3APS A;  1HNC A;  1MD3 A;  3NOF A;  4MPF A;  3TRX A;  3GNJ A;  2XHF A;  1MDI A;  5IOX A;  4OO4 A;  2XPE A;  3LJR A;  4BL7 A;  3VWX A;  2M46 A;  1YDK A;  3CTG A;  2JSZ A;  3L9U A;  1G7E A;  2BJX A;  1K0N A;  5EVO A;  2GT6 A;  5JWQ B;  2AHE A;  4X43 A;  1M99 A;  1BED A;  3DWV A;  2B1K A;  2REM A;  3NZN A;  4PNG A;  1A2M A;  3KD0 A;  5CYY A;  1LU4 A;  2DJK A;  3IHQ A;  2CQ9 A;  4OWY A;  3RDW A;  1V98 A;  1BG5 A;  3K8N A;  5J9B A;  1Z6M A;  4GLT A;  1T8E B;  4HJ2 A;  2HSM B;  4KCA A;  1K0M A;  2HRA A;  2IFQ B;  1G7O A;  1AAZ A;  2N5B A;  1GUL A;  3ZFL A;  2DIZ A;  1NSW A;  2CV4 A;  2HNL A;  3CSH A;  1YKA A;  2IME A;  3A3T A;  2X8C A;  4Q5F A;  3V1W A;  3GH9 A;  2HFD A;  1OYJ A;  3U6V A;  1TI1 A;  2WRT A;  2VCX A;  3A5W A;  1EP8 A;  5KN3 A;  4V2L A;  4FQU A;  2GSR A;  4F0B A;  2YJH A;  4BA7 A;  4GST A;  1F9M A;  5ECH B;  3TB2 A;  5D96 A;  3I9V 2;  4TR4 A;  2TRC P;  4XIH A;  4TR0 A;  4NHW A;  4TR1 B;  2JZS A;  3E0U A;  3F8U A;  5H5S A;  3MDK A;  1SL1 B;  2MMO A;  1A2J A;  1GSD A;  5DQS A;  1PKW A;  1DBY A;  4ZIJ A;  4WKW A;  2R4V A;  1OC3 A;  3DKS A;  3F0I A;  1K0O A;  5CAX A;  4YH2 A;  3VLN A;  4N0V A;  1PX7 A;  5IMC A;  2CVB A;  4N10 A;  1M9B A;  4GXZ A;  5C00 A;  1TRS A;  3R3E A;  1K0C A;  3HZ4 A;  3LQ7 A;  1EWX A;  1OKD A;  3F4S A;  3IRA A;  1ZGN A;  4MF5 A;  3KMN A;  1TTZ A;  1PN9 A;  4FYB A;  1GTB A;  2G2Q A;  1GSQ A;  2YP6 A;  2LQQ A;  3GL5 A;  1EP7 A;  3HHV A;  2X99 A;  5G5E A;  2H1A A;  2YWM A;  1PRX A;  5CRH A;  3DVX A;  2PGT A;  1EGR A;  1QMV A;  2LNS A;  4GCI A;  2EIR A;  3CMI A;  2C0G A;  3DIE A;  4TKY A;  3KTL A;  5HFK A;  4POB A;  5CRE A;  1PKZ A;  1SD9 A;  5DVB A;  4KGI A;  2VL9 A;  1HQO A;  2LS5 A;  4OD7 A;  5G2Z A;  4BWQ A;  2VD0 A;  1U87 A;  2VL2 A;  3EIN A;  6GSX A;  2P0G A;  1J08 A;  3KEB A;  3D4M A;  2TIR A;  4G0K A;  3FRC A;  1X5C A;  4J57 E;  1YKC A;  4WXT A;  3W8S A;  4K2D A;  3ZIT A;  1TRV A;  3Q74 A;  2MYG A;  3IC4 A;  4OFN A;  4ILF A;  5DCH A;  3HCZ A;  5HR2 A;  4BPY A;  2PPT A;  5KN1 A;  3S9F A;  2DJ0 A;  3GKM A;  3QMX A;  2NBS A;  1NHY A;  1FB6 A;  3M3M A;  3TCO A;  1T4Z A;  4G2E A;  3BD2 A;  2WGR A;  2GTU A;  3HJP A;  4G0L A;  2PUK C;  3EMP A;  4DVC A;  2F8A A;  2AAW A;  4FYU A;  2YJ7 A;  4XTS A;  17GS A;  3H1N A;  1MEK A;  3EUR A;  2IMF A;  2C0E A;  3GST A;  5A4V A;  3TKP A;  1A8L A;  3H79 A;  1O6J A;  1A2L A;  3VK9 A;  4O32 A;  2WS2 A;  2B6M A;  2AV4 A;  4EF0 A;  1V58 A;  2PWJ A;  2LRC A;  1KBN A;  3LYP A;  2HZE B;  1F37 A;  5HFG A;  3HJO A;  1QUW A;  4IP6 A;  1SJI A;  4PUA A;  4AJ6 A;  2DBC A;  1GNW A;  6GSW A;  1PGT A;  1TDI A;  2H73 A;  4XRD A;  4XCS A;  2H66 A;  4E8H A;  1K3O A;  3C7M A;  5D9X A;  2GZY A;  1ILO A;  5JCG A;  1VF1 A;  1WRY A;  4Z7X A;  5IMA A;  3GTU B;  2L5L A;  1A8Y A;  4D73 A;  1YEX A;  2FWG A;  4WBR D;  2LNT A;  1VF3 A;  4LL1 B;  2MBS A;  3ED3 A;  2OKA A;  5G1K A;  1K3L A;  4IKH A;  4ZBB A;  4PQI A;  2VM1 A;  1DE2 A;  3BCK A;  3QR6 A;  1LJR A;  1J0F A;  4TXO A;  2AUV A;  2QC7 A;  4PQ1 A;  5CRD A;  3TUE A;  5DJM A;  1K0A A;  2CX3 A;  3VPQ A;  2VM2 A;  2KUC A;  3FW2 A;  4MZB A;  4FH8 A;  5IMF A;  4DEJ A;  1XW9 A;  5DCG A;  2RM6 A;  1M2D A;  4PNF A;  1KNG A;  4KND A;  1E6B A;  3RPP A;  3P2A A;  1H4O A;  1Z7P A;  2IMD A;  2G0F A;  3U5R E;  4L8E A;  1IYI A;  3ZRE A;  2TRX A;  5CP1 A;  1ERW A;  1MDK A;  1T00 A;  5L71 A;  2OJL A;  4GRF A;  1Q4J A;  1I5G A;  1R5P A;  3ERG A;  3D4T A;  1GLQ A;  1ON4 A;  2GZZ A;  4AJ8 A;  1XWC A;  4AGS A;  2H74 A;  1OC9 B;  2ZUP A;  2YWI A;  1XW6 A;  3UVH A;  4PGT A;  3HJM A;  5ECN B;  4POK A;  4KX4 A;  2GZP A;  1X9W B;  3QDN A;  2IL3 A;  5HQP A;  1M0U A;  3R2Q A;  2E2G A;  4TVE A;  4K6X A;  2XPD A;  5AIX A;  2H6X A;  5A4U A;  4IVF A;  3GSS A;  1TRU A;  3M9K A;  2F51 A;  3P8W A;  4Q5Q A;  2GQM A;  1EV4 A;  1M2B A;  2CVD A;  3GIX A;  2D2Z A;  3DML A;  2LTK A;  3KCM A;  4F82 A;  6GST A;  2C0D A;  4ZB6 A;  1QGV A;  4WR4 A;  1THX A;  2E7P A;  4PX1 A;  3F3R A;  2CA8 A;  1MTC A;  4NAX A;  4GF0 A;  3TJK A;  1AQW A;  2R3X A;  3IAM 2;  3O6T A;  5JCU A;  5EL8 A;  2R2J A;  2CT6 A;  1CQH A;  5DAK A;  3D5J A;  2HRK A;  3VUR A;  4KSO A;  3AY8 A;  1O85 A;  2PER A;  2FUG 2;  3RHB A;  4ML6 A;  3DGQ A;  3LXT A;  4IEL A;  2HSY A;  3LOR A;  2JU5 A;  2A2S A;  4WET A;  1PQN A;  3TKS A;  1VGL A;  4K7N A;  1JHB A;  2C3N A;  1FO5 A;  5DJL A;  2RLI A;  4WR5 A;  3TDG A;  2ZNM A;  2JL4 A;  5ECO B;  2VLT A;  1NHO A;  4KA0 A;  2AJQ B;  5ENU A;  1YZX A;  6GSS A;  3FEU A;  5HFI A;  3D21 A;  3QFB C;  3MWH A;  1GL8 A;  3WYW A;  1SKW B;  4PQH A;  4XS4 A;  4IN0 A;  2VCQ A;  4V1A g;  3FR9 A;  3D22 A;  4G0I A;  1EEJ A;  4F03 A;  1PL1 A;  4K0N A;  5D9T A;  3GKX A;  4LA1 A;  3UBK A;  2H0G A;  4XS4 B;  2YCD A;  3LEF A;  1HD2 A;  3LWA A;  2A4V A;  3GL3 A;  2FWF A;  2BTO T;  2LRT A;  1FHE A;  3ERW A;  1XWA A;  1SL2 B;  2MMA A;  2GDR A;  4N0Z A;  3HKR A;  5D93 A;  2OE1 A;  2H1G A;  1G6Y A;  5DAL B;  3G7Y A;  3GX8 A;  1Z3E A;  3BJ5 A;  3C71 A;  3LGC A;  2H6Y A;  2L4Q A;  1X5D A;  1RK4 A;  6GSY A;  1E2Y A;  3FR3 A;  3W8J A;  1QFN A;  4MJC A;  1G6W A;  2GST A;  2QSI A;  3EE2 A;  2C1Y A;  4O7H A;  2B1L A;  2XC2 A;  1URM A;  3HVX A;  4QL7 A;  1A24 A;  3ZZX A;  1PMT A;  2B3S A;  3DYR A;  2WCI A;  2B7J A;  4HQS A;  3PGT A;  5IO0 A;  1TP9 A;  3FZ9 A;  2VLU A;  2J23 A;  1RW1 A;  3ZLP A;  2C3Q A;  1BX9 A;  3UEM A;  4OFT A;  2VD1 A;  5AIS A;  3M1G A;  4TW5 A;  3NIV A;  2X64 A;  5KEJ A;  1XCC A;  2HSM A;  2VCZ A;  1GSS A;  3TGZ A;  2IFQ A;  2AB6 A;  1BYE A;  1ZZY A;  1FG4 A;  4F0C A;  3M9J A;  4K9Z A;  3VFI A;  4ACS A;  4O92 A;  1EEM A;  4MK3 A;  4DSS B;  2HLS A;  3EU3 A;  2O89 A;  5FT3 A;  2PN8 A;  1GUH A;  1R26 A;  2VO4 A;  4L5L A;  3VWV A;  2WUL A;  3QPM A;  1FB0 A;  4MA9 A;  5HR1 A;  2JAD A;  3C8E A;  4L0W A;  4EDZ A;  1AC1 A;  4TR1 A;  3TJF A;  3F63 A;  4IHU A;  3EVI A;  4J2F A;  5JCW A;  1FOV A;  3QCP A;  2MMN A;  2RII A;  2O85 A;  1AUC A;  5ID2 B;  3ERF A;  1JFU A;  4EKZ A;  1YF1 A;  3IR4 A;  2N5F A;  1EOG A;  4KUN A;  1GTU A;  3J7Y b;  3HYP A;  4NMU A;  5IO2 A;  4IBP A;  1G0T A;  5F06 A;  4G19 A;  2MZC A;  3ZMK A;  2X8H A;  3CSJ A;  3TKQ A;  2ON5 A;  1SK2 A;  1WOU A;  2FY6 A;  5F8B A;  2GVP A;  2EIO A;  4TRX A;  2WDU A;  5B7C A;  4KCE A;  2C3T A;  1FVK A;  1NM3 A;  2IMI A;  4GSN A;  4EVM A;  1EZK A;  4ISD A;  3I43 A;  1GP1 A;  5D73 A;  2OAD A;  3MAK A;  2OE0 A;  4RUV A;  3FHK A;  2PBJ A;  3ZVJ D;  3H4K A;  2C4J A;  1O8X A;  1RQM A;  2V6K A;  3O76 A;  2LJR A;  1YQ1 A;  4KW6 A;  1S3A A;  4XS1 A;  1KEB A;  4MCU A;  3PH9 A;  5G5F A;  4NWY A;  2M72 A;  3P90 A;  1M9A A;  2B5E A;  2X8G A;  5G30 A;  3MNG A;  1HYU A;  1TU8 A;  4JBB A;  1WMJ A;  9GSS A;  3D6I A;  3GRX A;  4ZBA A;  3A2W A;  1XOB A;  5E59 A;  2O8V B;  2PVO C;  4HJM A;  4V2N A;  4ZXG A;  5F07 A;  22GS A;  3Q6O A;  1SK1 A;  1Q98 A;  4EE0 A;  2KHP A;  3ME8 A;  2C8U A;  2K6V A;  4IQ1 A;  3H93 A;  2LJK A;  5J9C A;  4KE3 A;  3APO A;  4ECI A;  2FGX A;  4HQZ A;  3H8Q A;  5GSS A;  2ZCT A;  4XHM A;  1GUM A;  1XZO A;  3Q19 A;  1T3B A;  1SKS B;  3FZ5 A;  1SL0 B;  1GSE A;  1B9X C;  1TK8 B;  4MPG A;  2E0Q A;  4BVY B;  2P5R A;  1U6T A;  3BBY A;  3N5O A;  5HR3 A;  1Z7R A;  3ZIV A;  4EUY A;  2L4C A;  2ON7 A;  3M0F A;  11GS A;  12GS A;  4CW9 A;  3IK9 A;  5IM9 A;  3KJY A;  4I97 A;  3APQ A;  3LXZ A;  2YN1 A;  2GS3 A;  2OAC A;  2CZ2 A;  2K18 A;  4HZ4 A;  2HZE A;  1H75 A;  1R4W A;  4MLY A;  4POM A;  1GTI A;  3ZVJ A;  5EPF A;  4LMV A;  1X9S B;  3A2V A;  2DJ1 A;  3HDC A;  2IJY A;  3IK7 A;  4MJB A;  5J5N A;  2DJ2 A;  5INY A;  1JZR A;  1A23 A;  3GTU A;  2GSS A;  1ACV A;  3J7Y k;  3WGX A;  4JR4 A;  1MD4 A;  2DJ3 A;  1EGO A;  6GSU A;  4POL A;  2GT5 A;  2KLX A;  3KP9 A;  5G1L A;  2V6O A;  1W4V A;  1XFL A;  4MF6 A;  2JAC A;  4YAP A;  3IAS 2;  1BAY A;  5EY6 A;  3O3T A;  1ABA A;  1MDJ A;  1GRX A;  1PL2 A;  4EXJ A;  5LCZ A;  2LUS A;  2PU9 C;  5DBQ A;  1DSB A;  2FD3 A;  2YV9 A;  2YZU A;  1Z6N A;  2XBI A;  1ST9 A;  5DQY A;  2PMT A;  2I4A A;  3TOU A;  1V9W A;  2LJA A;  3L78 A;  5KN2 A;  1EOH A;  1AIU A;  4EO3 A;  3HVV A;  3KZQ A;  4PUF C;  4K7O A;  2IPA A;  5AN1 A;  4QQ7 A;  4NXI A;  2FA4 A;  5CRW A;  1N8J A;  4OCF A;  1OC9 A;  5DDL A;  3TKR A;  1TOF A;  2R5G A;  4FIW A;  1ZOF A;  2DJJ A;  5IPH A;  4WBJ A;  2OA7 A;  5HR0 A;  1U3A A;  4OO5 A;  3L4N A;  4ZL8 A;  1T4Y A;  5AIV A;  1XVQ A;  1TK0 B;  1F2E A;  18GS A;  3G7J A;  13GS A;  1WIK A;  5CNW A;  4TR3 A;  3GUR A;  3KH9 A;  1F3A A;  4RI6 A;  1ZL9 A;  3L9V A;  3ZYW A;  3CXG A;  4H86 A;  3EC3 A;  2VUP A;  2VCV A;  5ECI B;  5H5R A;  2I81 A;  2VCW A;  1AXD A;  1O8W A;  1X9M B;  3QAV A;  2FA8 A;  4MJA A;  1SEN A;  2H8L A;  3C73 A;  5G31 A;  4IJI A;  4I5Q A;  3UJ1 A;  3HY2 A;  4HOJ A;  4E8E A;  1VF4 A;  2YOI A;  2FHE A;  4TOP A;  4V2M A;  4L0U A;  3G7I A;  2DC5 A;  4OCE A;  1B4Q A;  1F6M C;  2LST A;  4KDX A;  4G9H A;  1PD2 1;  4N11 A;  2V41 A;  2RUF A;  2H0I A;  3QOU A;  1WJK A;  2L57 A;  2H1D A;  14GS A;  3EU4 A;  5KN0 A;  8GSS A;  4BVX B; 
#chains in the Genus database with same CATH topology
 3ZL5 A;  1GSU A;  2HI7 A;  1K3Y A;  1SJZ A;  4KF9 A;  4I6X A;  4HEA 2;  1Z5Y E;  1PFO A;  3DEX A;  2FNO A;  4K8M A;  3F3Q A;  3DD3 A;  2AYT A;  2CAQ A;  3M8N A;  3F9U A;  4JR6 A;  3KGK A;  4KDY A;  2EIQ A;  3CRU A;  2LQO A;  4YAV A;  3WGD A;  4I2U A;  3FK8 A;  4ZBD A;  1GTA A;  3N9J A;  3I6A A;  4USS A;  2HSH A;  1J9B A;  3VI5 A;  4EDY A;  5IIZ A;  2NTO A;  2IWT A;  2WB9 A;  1USB A;  1XW5 A;  3GYK A;  3ZFB A;  1TXX A;  1SKR B;  4NHZ A;  4YQM A;  2OT3 A;  4PXO A;  3ZML A;  4AJ7 A;  3ZIJ A;  3F4R A;  2B7K A;  5F0G A;  4JZQ A;  1Z9H A;  2V1M A;  2IMK A;  5DAL A;  2F8F A;  2YZH A;  3KH7 A;  4LLR A;  2Z9S A;  3UL3 A;  5IMZ A;  1KTE A;  2MMZ A;  2GQL A;  4X0X A;  3F6D A;  3GKN A;  2H76 A;  3LW9 A;  1XBS A;  2VL2 C;  3FR6 A;  1GUK A;  2XBQ A;  4N30 A;  3C1R A;  1XOA A;  5H5Q A;  2QGV A;  1WPI A;  1SJ6 A;  4IJ3 A;  3UVT A;  2NDO A;  3FZ4 A;  1YY7 A;  1XWB A;  5ECP B;  4MP4 A;  4LMW A;  2FWE A;  2OBK A;  3MIX A;  2DMM A;  2YPM A;  7GSS A;  4FO5 A;  3CTF A;  3IOS A;  3US3 A;  3EPT A;  19GS A;  5B6M A;  3QAG A;  1VF2 A;  5J41 A;  1SVL A;  2HE3 A;  2A4H A;  2LEG A;  2P31 A;  2UZ8 A;  1JLW A;  4JRR A;  4TN8 A;  3RHC A;  4IGJ A;  3WT2 A;  4DSS A;  3C1S A;  2MBT A;  1AW9 A;  4JE1 A;  4EL1 A;  2L59 A;  3LG6 A;  3IXR A;  5BMU A;  2HRN A;  5J4U A;  2QA2 A;  3SBC A;  4BL7 B;  3UMA A;  1ZYQ B;  3I69 A;  2YNX A;  4RQX A;  2K8V A;  2N5A A;  4Q5N A;  2DML A;  1BG1 A;  2FWH A;  1OE7 A;  4K5S A;  3ISO A;  4HS1 A;  4L5O A;  4Q5R A;  1SD8 A;  2GGT A;  4PI0 C;  4QL9 A;  5ELG A;  3TRQ A;  1YEP A;  4MJE A;  2M80 A;  1IYH A;  5ID2 A;  4DSQ A;  5A1N A;  4MMM A;  4DSR A;  5IMV A;  3TOT A;  5B6N A;  4CHS A;  2L6D A;  2CAI A;  2JZT A;  5F05 A;  2YWO A;  1JLV A;  4GQC A;  1I9D A;  3Q18 A;  3TJJ A;  2YWN A;  4TXV A;  5FWG A;  1GSY A;  1W89 A;  1VRS D;  3HZ8 A;  3QFA C;  2ES7 A;  4I8B A;  4HI7 A;  2H6Z A;  2F9S A;  4AKG A;  4P3Y B;  5A34 B;  1XWG A;  4X1U A;  3JCM L;  1TKD B;  5GST A;  4NV2 A;  2YV7 A;  4G10 A;  2VCT A;  3UOM A;  3F6F A;  3KP8 A;  3FY7 A;  3OR5 A;  5JWO B;  1U88 A;  2A2P A;  4YQU A;  1U3I A;  2DSA A;  1OE8 A;  3PPU A;  2VLV A;  5D9W A;  3LFL A;  4JED A;  2LKU A;  1ERV A;  2HYX A;  1OVN A;  4GQF A;  1V2A A;  1YVL A;  1B8X A;  1ERU A;  3RPN A;  1V57 A;  1BJX A;  4ECC A;  4OMV A;  2O5V A;  2HSN B;  2GLR A;  4WEY A;  3TKS E;  4ZL7 A;  5JWR B;  2B5Y A;  4KB3 A;  5E4W A;  2VIM A;  3GKK A;  1O81 A;  4F9Z A;  3KMO A;  3TJB A;  2VAF A;  4JU5 A;  4LL4 B;  4AF2 A;  4ID0 A;  3KIJ A;  3VWU A;  1ZYE A;  2DLX A;  1SVM A;  5KOX A;  3IDV A;  1XVW A;  3CYN A;  3W6G A;  3GFK A;  1N25 A;  2LV3 A;  1B4P A;  3LSZ A;  1ZMA A;  2GQK A;  4WF5 A;  1JZW A;  1FAA A;  1Y25 A;  1QXH A;  1UVZ A;  3GUS A;  1THO A;  4I2T A;  2R6K A;  4OFM A;  4BVY A;  1QK8 A;  1JZD A;  1V40 A;  2HRF A;  2H70 A;  3A2X A;  4W66 A;  3EWL A;  1R5A A;  5GAP D;  5C04 A;  1XIY A;  3WD6 A;  2WVX B;  1K0B A;  4E68 A;  1FW1 A;  3E3E A;  5IMD A;  3GHA A;  3GN3 A;  1GSF A;  2VOC A;  2I9H A;  1BQ7 A;  3TKS C;  3L9S A;  1XPV A;  2H71 A;  4AKX B;  1TRW A;  3LYK A;  4V1A p;  3VWW A;  5GAN D;  2WFC A;  4HDE A;  4HU9 A;  4IS0 A;  3CBU A;  1TK5 B;  2P5Q A;  2KP2 A;  2FCH A;  1SVO A;  1EV9 A;  2I1U A;  2J9H A;  2WJU A;  1NW2 A;  4XS6 A;  1Y6E A;  1ZYN A;  4MF7 A;  2K8S A;  5CRG A;  3CSI A;  4WF4 A;  2IIY A;  4EC0 A;  5AGY A;  4IW9 A;  4IP1 A;  3KXO A;  3D0Z A;  16GS A;  3PIN A;  2EC4 A;  4MZW A;  5COH A;  1PSQ A;  1XWK A;  1AQV A;  2RM5 A;  1TU7 A;  2OBI A;  1OAZ A;  2V32 A;  2R37 A;  4MDC A;  3E9J B;  1M2A A;  4HU7 A;  3IA1 A;  5FHI A;  2H30 A;  4GWR A;  1XXU A;  2HT9 A;  1JZO A;  4CY8 A;  5GZZ B;  4D73 B;  1LBK A;  3GV1 A;  3RAZ A;  3VPT A;  1A0R P;  3GH6 A;  1B48 A;  1M7T A;  1B9Y C;  3QAW A;  5D9V A;  4HZ2 A;  2LRN A;  3DVW A;  4PUR A;  1K0D A;  3GX0 A;  5J47 A;  2CVK A;  3L0H A;  1ZCP A;  1TI3 A;  1TJD A;  4TXO B;  3IV4 A;  2QKE A;  1PX6 A;  4FYC A;  5B8B A;  2B5X A;  2KP1 A;  4ZB9 A;  2EFC A;  4MZC A;  5IOW A;  2L5O A;  1X0R A;  1R7H A;  2UV8 G;  1TW9 A;  2H0H A;  1GWC A;  4K1F A;  2BMX A;  1T7P B;  5ECQ B;  1T1V A;  2OE3 A;  2NVL A;  2HZF A;  5ABR A;  1DE1 A;  1GH2 A;  4ULX A;  4XRA A;  4ECB A;  1FVJ A;  4J56 E;  1SK0 A;  3FYG A;  3ZRD A;  2WZ9 A;  1C72 A;  1HNB A;  1YJ6 A;  5ECR B;  2R0G A;  5CO3 A;  2L6C A;  6GSV A;  5B8A A;  5ECK B;  3P7X A;  1HNA A;  2FLS A;  2O3E A;  1UC7 A;  5ECL B;  4GTU A;  3CRT A;  4ZB8 A;  20GS A;  5LNK e;  2O7K A;  3HA9 A;  3DRN A;  1QQ2 A;  1O7U A;  1PA3 A;  4BIK A;  2JZR A;  2GSQ A;  1WWJ A;  4K5R A;  3SWL A;  5J3R A;  4BVX A;  1YF0 A;  3HVS A;  2C80 A;  4ML1 A;  4ZIL A;  1S3D A;  3TRP A;  4AKI A;  3IE3 A;  3HXS A;  4ZL9 A;  4PTS A;  4NPB A;  1UA5 A;  2V2G A;  4CDO A;  1CQG A;  3UAP A;  2NPB A;  2PVQ A;  1O73 A;  2IN3 A;  3TJG A;  1X5E A;  3KM6 A;  3QD9 A;  3GA4 A;  2JSY A;  3KTB A;  5ELA A;  4IQA A;  1UN2 A;  2H1B A;  1WP0 A;  4ECJ A;  4CY6 A;  2C0F A;  5D8I A;  3UAR A;  3IC8 A;  10GS A;  4YQV A;  1SU9 A;  3CWG A;  4KH7 A;  5DAK B;  1GLP A;  2HRK B;  3F4T A;  3DXB A;  4RQR A;  4AKH A;  2X49 A;  3UIW A;  3RBT A;  3MSZ A;  2K9F A;  5IQY A;  3UBL A;  2H75 A;  5IPG A;  3WT1 A;  2HXK A;  3GMF A;  4RI7 A;  4HUA A;  5ECS A;  5ECM B;  2A2R A;  2DIY A;  5A5K A;  2VL3 A;  2CX4 A;  2H19 A;  1OC8 A;  2H01 A;  4F2I A;  2EFD A;  4MH3 A;  1S3C A;  2F3M A;  4MH2 A;  4GSS A;  2H72 A;  4MAB A;  3BCI A;  4KDU A;  2CZ3 A;  1DUG A;  3WGE A;  1F3B A;  5LD0 A;  1SYR A;  2I3Y A;  4O5R A;  1N2A A;  5A4W A;  2E2M A;  2YAN A;  3HD5 A;  3FKF A;  1A0F A;  1PN0 A;  1ML6 A;  4NV5 A;  4BWS A;  1WE0 A;  3IBH A;  4QMK A;  3ME7 A;  2RUE A;  4KSM A;  3EYT A;  2HQT A;  2ALB A;  1OKT A;  3PR8 A;  1ERT A;  3G9B A;  3FZA A;  2KOK A;  4KAE A;  3EMX A;  3HMJ G;  4K7I A;  4K0G A;  3VI7 A;  1AQX A;  3IPZ A;  1SYX A;  3BOA A;  3ZTL A;  1GNE A;  3APS A;  2O87 A;  1HNC A;  1MD3 A;  3NOF A;  4MPF A;  3TRX A;  3GNJ A;  2XHF A;  1MDI A;  4GDF A;  5IOX A;  4OO4 A;  2XPE A;  3LJR A;  4BL7 A;  3VWX A;  2M46 A;  1YDK A;  3CTG A;  2JSZ A;  3L9U A;  1G7E A;  2BJX A;  1K0N A;  5EVO A;  2GT6 A;  5JWQ B;  2AHE A;  4X43 A;  1M99 A;  1BED A;  3DWV A;  2B1K A;  1S4B P;  2REM A;  1Y1U A;  3NZN A;  4PNG A;  1A2M A;  3KD0 A;  5CYY A;  1LU4 A;  2DJK A;  3IHQ A;  5J4Y A;  2CQ9 A;  4OWY A;  3RDW A;  1V98 A;  1BG5 A;  3K8N A;  5J9B A;  1Z6M A;  4GLT A;  1T8E B;  4HJ2 A;  2HSM B;  4KCA A;  1K0M A;  2HRA A;  2IFQ B;  1G7O A;  1AAZ A;  2N5B A;  3CQF A;  1GUL A;  1TXU A;  3ZFL A;  1NSW A;  2CV4 A;  2DIZ A;  2HNL A;  3CSH A;  1YKA A;  2IME A;  3A3T A;  2X8C A;  4Q5F A;  3V1W A;  3GH9 A;  2HFD A;  1OYJ A;  3U6V A;  1TI1 A;  4ZB7 A;  2WRT A;  2VCX A;  3A5W A;  1EP8 A;  5KN3 A;  4V2L A;  4FQU A;  2GSR A;  4F0B A;  2YJH A;  4BA7 A;  4GST A;  1F9M A;  5ECH B;  3TB2 A;  5D96 A;  3I9V 2;  4TR4 A;  2TRC P;  5A34 A;  4XIH A;  4TR0 A;  4NHW A;  4TR1 B;  2JZS A;  3E0U A;  3F8U A;  5A5H B;  5H5S A;  3MDK A;  1SL1 B;  3MYD A;  2MMO A;  1A2J A;  1GSD A;  5DQS A;  1PKW A;  1DBY A;  4ZIJ A;  4WKW A;  2R4V A;  1OC3 A;  3DKS A;  3F0I A;  1K0O A;  5CAX A;  4YH2 A;  4N3Z A;  3VLN A;  4N0V A;  1PX7 A;  4O5Q A;  5IMC A;  2CVB A;  4N10 A;  1M9B A;  4GXZ A;  5C00 A;  1TRS A;  3R3E A;  1K0C A;  2HSN A;  3HZ4 A;  3LQ7 A;  1EWX A;  1OKD A;  3F4S A;  3IRA A;  1ZGN A;  4MF5 A;  3KMN A;  1TTZ A;  1PN9 A;  4FYB A;  1GTB A;  2H1L A;  2G2Q A;  1GSQ A;  2YP6 A;  2LQQ A;  3GL5 A;  4EIQ A;  1EP7 A;  3HHV A;  2X99 A;  5G5E A;  2H1A A;  2YWM A;  1PRX A;  5CRH A;  3DVX A;  2PGT A;  1EGR A;  5BRT A;  1QMV A;  2LNS A;  4GCI A;  2EIR A;  3CMI A;  2C0G A;  3DIE A;  4TKY A;  3KTL A;  5HFK A;  4POB A;  5CRE A;  1PKZ A;  1SD9 A;  5DVB A;  4KGI A;  2VL9 A;  1HQO A;  2LS5 A;  4OD7 A;  5G2Z A;  4BWQ A;  2VD0 A;  1U87 A;  2VL2 A;  3EIN A;  6GSX A;  2P0G A;  1J08 A;  3KEB A;  3D4M A;  2TIR A;  4G0K A;  3FRC A;  1X5C A;  4J57 E;  1YKC A;  4WXT A;  3W8S A;  4K2D A;  2WVX A;  3ZIT A;  1TRV A;  3Q74 A;  2MYG A;  3IC4 A;  4OFN A;  4ILF A;  5DCH A;  3HCZ A;  5HR2 A;  4BPY A;  2PPT A;  5KN1 A;  3S9F A;  2DJ0 A;  3GKM A;  2WW1 A;  3QMX A;  2NBS A;  1NHY A;  1FB6 A;  3M3M A;  3TCO A;  1T4Z A;  4G2E A;  3BD2 A;  1M3J A;  2GTU A;  2WGR A;  3HJP A;  4G0L A;  2PUK C;  3EMP A;  4DVC A;  2F8A A;  4G01 A;  2AAW A;  4FYU A;  2YJ7 A;  4XTS A;  17GS A;  3H1N A;  1MEK A;  4FXY P;  2WW3 A;  3EUR A;  2IMF A;  2C0E A;  3GST A;  5A4V A;  3TKP A;  1A8L A;  4YKG A;  3H79 A;  1O6J A;  1A2L A;  3VK9 A;  4O32 A;  2WS2 A;  2B6M A;  2AV4 A;  4EF0 A;  1V58 A;  2PWJ A;  2LRC A;  1KBN A;  3LYP A;  2HZE B;  1F37 A;  5HFG A;  3HJO A;  1QUW A;  4IP6 A;  1SJI A;  4PUA A;  4AJ6 A;  2DBC A;  2WW0 A;  1GNW A;  6GSW A;  1PGT A;  1TDI A;  2H73 A;  4XRD A;  4XCS A;  2H66 A;  4E8H A;  1K3O A;  3C7M A;  5D9X A;  1S3R A;  2GZY A;  1ILO A;  5JCG A;  1VF1 A;  1WRY A;  4Z2R A;  4Z7X A;  5IMA A;  3GTU B;  2L5L A;  1A8Y A;  4D73 A;  3RFR C;  1YEX A;  2FWG A;  4WBR D;  2LNT A;  1VF3 A;  4LL1 B;  2MBS A;  3ED3 A;  2OKA A;  5G1K A;  1K3L A;  4IKH A;  4ZBB A;  3RGB C;  4PQI A;  2VM1 A;  1DE2 A;  3BCK A;  3QR6 A;  1LJR A;  1J0F A;  4TXO A;  4PI2 C;  3FMW A;  2AUV A;  2QC7 A;  4PQ1 A;  5CRD A;  3TUE A;  5DJM A;  1K0A A;  2CX3 A;  3VPQ A;  2VM2 A;  2KUC A;  3TU3 B;  3FW2 A;  4MZB A;  4FH8 A;  5IMF A;  4DEJ A;  1XW9 A;  5DCG A;  2R0C A;  2RM6 A;  1M2D A;  4PNF A;  1KNG A;  4KND A;  1E6B A;  3RPP A;  3P2A A;  1H4O A;  1Z7P A;  1I1I P;  2IMD A;  2G0F A;  3U5R E;  4L8E A;  1IYI A;  3ZRE A;  2TRX A;  5CP1 A;  1ERW A;  1MDK A;  1T00 A;  5L71 A;  2OJL A;  4GRF A;  1Q4J A;  1I5G A;  1R5P A;  3ERG A;  3D4T A;  1GLQ A;  1ON4 A;  2GZZ A;  4AJ8 A;  4EIP A;  1XWC A;  4AGS A;  2H74 A;  1OC9 B;  2ZUP A;  2YWI A;  1XW6 A;  3UVH A;  4PGT A;  3HJM A;  5ECN B;  4POK A;  4KX4 A;  2GZP A;  1X9W B;  3QDN A;  2IL3 A;  5HQP A;  1M0U A;  3R2Q A;  2E2G A;  4TVE A;  4K6X A;  3A5I A;  2XPD A;  5AIX A;  2H6X A;  5A4U A;  4IVF A;  3GSS A;  1TRU A;  3M9K A;  2F51 A;  3P8W A;  4Q5Q A;  2GQM A;  1EV4 A;  1M2B A;  2CVD A;  3GIX A;  2D2Z A;  3DML A;  2LTK A;  5KOW A;  3KCM A;  4F82 A;  6GST A;  2C0D A;  4ZB6 A;  1QGV A;  4WR4 A;  1THX A;  4O5U A;  2E7P A;  4PX1 A;  3F3R A;  2CA8 A;  1MTC A;  4NAX A;  5J40 A;  4GF0 A;  3TJK A;  1AQW A;  2R3X A;  3IAM 2;  3O6T A;  5JCU A;  5EL8 A;  2R2J A;  2CT6 A;  1CQH A;  5DAK A;  3D5J A;  2HRK A;  3VUR A;  4KSO A;  3AY8 A;  1O85 A;  2PER A;  2FUG 2;  3RHB A;  2VKZ G;  4ML6 A;  3DGQ A;  3LXT A;  4IEL A;  2HSY A;  3LOR A;  2JU5 A;  2A2S A;  4K2X A;  4WET A;  1PQN A;  3TKS A;  1VGL A;  4K7N A;  1JHB A;  2C3N A;  1FO5 A;  5DJL A;  2RLI A;  4WR5 A;  3TDG A;  2ZNM A;  2JL4 A;  5ECO B;  2VLT A;  1NHO A;  4KA0 A;  2AJQ B;  5ENU A;  1YZX A;  6GSS A;  3FEU A;  5HFI A;  3D21 A;  3QFB C;  3MWH A;  1GL8 A;  3WYW A;  1SKW B;  4PQH A;  4XS4 A;  4IN0 A;  2VCQ A;  4V1A g;  3FR9 A;  3D22 A;  4G0I A;  1XG8 A;  1EEJ A;  4F03 A;  1PL1 A;  4K0N A;  2QA1 A;  5D9T A;  3GKX A;  4LA1 A;  4MNN A;  3UBK A;  2H0G A;  4XS4 B;  2YCD A;  3LEF A;  1HD2 A;  3LWA A;  2A4V A;  3GL3 A;  2FWF A;  2BTO T;  2LRT A;  1FHE A;  3ERW A;  1XWA A;  1SL2 B;  2MMA A;  2GDR A;  4N0Z A;  3HKR A;  5D93 A;  2OE1 A;  2H1G A;  1G6Y A;  5DAL B;  3G7Y A;  3GX8 A;  4AI6 A;  1Z3E A;  2X4A A;  3BJ5 A;  3C71 A;  3LGC A;  2H6Y A;  2L4Q A;  1X5D A;  1RK4 A;  6GSY A;  1E2Y A;  3FR3 A;  3W8J A;  2EFH A;  1QFN A;  4MJC A;  1G6W A;  2GST A;  2QSI A;  3EE2 A;  2C1Y A;  4O7H A;  2B1L A;  2XC2 A;  1URM A;  3HVX A;  4QL7 A;  1A24 A;  3ZZX A;  1PMT A;  2B3S A;  3DYR A;  2WCI A;  1FOH A;  2B7J A;  4HQS A;  3PGT A;  5IO0 A;  1TP9 A;  3FZ9 A;  2VLU A;  2J23 A;  1RW1 A;  3ZLP A;  2C3Q A;  1BX9 A;  3UEM A;  4OFT A;  2VD1 A;  2WVY A;  5AIS A;  3M1G A;  4TW5 A;  3NIV A;  2X64 A;  5KEJ A;  1XCC A;  2HSM A;  2VCZ A;  1GSS A;  3TGZ A;  2IFQ A;  2AB6 A;  1BYE A;  1ZZY A;  1FG4 A;  4F0C A;  3M9J A;  4K9Z A;  3VFI A;  4ACS A;  4O92 A;  1EEM A;  4MK3 A;  4DSS B;  2HLS A;  3EU3 A;  2O89 A;  5FT3 A;  2PN8 A;  1GUH A;  1R26 A;  2VO4 A;  4L5L A;  5BMU B;  3VWV A;  2WUL A;  3QPM A;  1FB0 A;  4MA9 A;  5HR1 A;  2JAD A;  3C8E A;  4L0W A;  4EDZ A;  1AC1 A;  4TR1 A;  5A5H A;  3TJF A;  3F63 A;  4IHU A;  3EVI A;  4J2F A;  5JCW A;  1FOV A;  4HSC X;  3QCP A;  2MMN A;  4ICY A;  2RII A;  2O85 A;  1AUC A;  5ID2 B;  3ERF A;  1JFU A;  4EKZ A;  1YF1 A;  3IR4 A;  2N5F A;  5A1N B;  1EOG A;  4KUN A;  1GTU A;  3J7Y b;  3HYP A;  4NMU A;  5IO2 A;  4IBP A;  1G0T A;  5F06 A;  4G19 A;  2MZC A;  3ZMK A;  2X8H A;  3CSJ A;  3TKQ A;  2ON5 A;  1SK2 A;  1WOU A;  2FY6 A;  5F8B A;  2GVP A;  2EIO A;  4TRX A;  2WDU A;  5B7C A;  4KCE A;  2WZS A;  2C3T A;  1FVK A;  1NM3 A;  2IMI A;  4GSN A;  4EVM A;  1EZK A;  4ISD A;  3I43 A;  1GP1 A;  5D73 A;  2OAD A;  4X4J A;  3MAK A;  2OE0 A;  4RUV A;  3FHK A;  2PBJ A;  3ZVJ D;  3H4K A;  2C4J A;  1O8X A;  1RQM A;  2V6K A;  3O76 A;  2LJR A;  1YQ1 A;  4KW6 A;  1S3A A;  4XS1 A;  1YEW C;  1KEB A;  4MCU A;  2EFE A;  3PH9 A;  5G5F A;  4NWY A;  2M72 A;  3P90 A;  4YKF A;  1M9A A;  2B5E A;  2X8G A;  5G30 A;  3MNG A;  1HYU A;  2O36 A;  1TU8 A;  4JBB A;  1WMJ A;  9GSS A;  3D6I A;  3GRX A;  4ZBA A;  2DKI A;  3A2W A;  1XOB A;  5E59 A;  2O8V B;  2PVO C;  4HJM A;  4V2N A;  4A5P A;  4ZXG A;  5F07 A;  22GS A;  3Q6O A;  1SK1 A;  1Q98 A;  4EE0 A;  2KHP A;  3ME8 A;  2C8U A;  2K6V A;  4IQ1 A;  3H93 A;  2LJK A;  5J9C A;  4KE3 A;  3APO A;  4ECI A;  2FGX A;  4HQZ A;  5J4V A;  3H8Q A;  5GSS A;  2ZCT A;  4XHM A;  1GUM A;  1XZO A;  3Q19 A;  1T3B A;  1SKS B;  3FZ5 A;  1SL0 B;  1GSE A;  1B9X C;  1TK8 B;  4MPG A;  2E0Q A;  4BVY B;  2P5R A;  1U6T A;  3BBY A;  3N5O A;  5HR3 A;  2WW2 A;  1Z7R A;  3ZIV A;  4EUY A;  2L4C A;  2ON7 A;  3M0F A;  11GS A;  12GS A;  4CW9 A;  3IK9 A;  5IM9 A;  3KJY A;  4I97 A;  3APQ A;  3LXZ A;  2YN1 A;  2GS3 A;  2OAC A;  2CZ2 A;  2K18 A;  4Z2U A;  4HZ4 A;  2HZE A;  1H75 A;  1R4W A;  2WVZ A;  4MLY A;  4POM A;  1GTI A;  3ZVJ A;  5EPF A;  4LMV A;  1X9S B;  3A2V A;  2DJ1 A;  3HDC A;  2IJY A;  3IK7 A;  4MJB A;  5J5N A;  2DJ2 A;  5INY A;  1JZR A;  1A23 A;  3GTU A;  2GSS A;  1ACV A;  3J7Y k;  3WGX A;  4JR4 A;  1MD4 A;  2DJ3 A;  1EGO A;  6GSU A;  4POL A;  2GT5 A;  2KLX A;  3KP9 A;  5G1L A;  2V6O A;  1W4V A;  1XFL A;  4MF6 A;  2JAC A;  4YAP A;  3IAS 2;  1BAY A;  5EY6 A;  3O3T A;  1ABA A;  1MDJ A;  1GRX A;  1PL2 A;  4EXJ A;  5LCZ A;  2LUS A;  2PU9 C;  5DBQ A;  1DSB A;  1ZYP A;  2FD3 A;  2YV9 A;  2YZU A;  1Z6N A;  2XBI A;  3CHX C;  1ST9 A;  5DQY A;  2PMT A;  2I4A A;  3TOU A;  1V9W A;  2LJA A;  4Z2T A;  3L78 A;  5KN2 A;  1EOH A;  1AIU A;  4EO3 A;  3HVV A;  3KZQ A;  4PUF C;  1M3I A;  4K7O A;  2IPA A;  5AN1 A;  4QQ7 A;  4NXI A;  2FA4 A;  5CRW A;  1N8J A;  4OCF A;  1OC9 A;  5DDL A;  3TKR A;  1TOF A;  2R5G A;  4FIW A;  3IHG A;  1ZOF A;  2DJJ A;  5IPH A;  4WBJ A;  2OA7 A;  5HR0 A;  1U3A A;  4OO5 A;  3L4N A;  4ZL8 A;  1T4Y A;  5AIV A;  1BF5 A;  1XVQ A;  1TK0 B;  1F2E A;  18GS A;  3G7J A;  13GS A;  1WIK A;  5CNW A;  4TR3 A;  3GUR A;  3KH9 A;  1F3A A;  4PHZ C;  4RI6 A;  1ZL9 A;  3L9V A;  3ZYW A;  3CXG A;  4H86 A;  3EC3 A;  2VUP A;  2VCV A;  5ECI B;  5H5R A;  2I81 A;  2VCW A;  1AXD A;  1O8W A;  1X9M B;  3QAV A;  2FA8 A;  4MJA A;  1SEN A;  2H8L A;  3C73 A;  5G31 A;  4IJI A;  4I5Q A;  3UJ1 A;  3HY2 A;  4HOJ A;  4E8E A;  2DKH A;  2R0P A;  1VF4 A;  2YOI A;  2FHE A;  4TOP A;  4V2M A;  4L0U A;  3HVN A;  3G7I A;  2DC5 A;  4OCE A;  1B4Q A;  1F6M C;  2LST A;  4KDX A;  4G9H A;  1PD2 1;  4N11 A;  2V41 A;  2RUF A;  2H0I A;  3QOU A;  1WJK A;  2L57 A;  2H1D A;  14GS A;  3EU4 A;  5KN0 A;  8GSS A;  4BVX B; 
#chains in the Genus database with same CATH homology
 3ZL5 A;  1GSU A;  2HI7 A;  1K3Y A;  1SJZ A;  4KF9 A;  4I6X A;  4HEA 2;  1Z5Y E;  3DEX A;  2FNO A;  4K8M A;  3F3Q A;  3DD3 A;  2AYT A;  2CAQ A;  3M8N A;  3F9U A;  4JR6 A;  3KGK A;  4KDY A;  2EIQ A;  3CRU A;  2LQO A;  4YAV A;  3WGD A;  4I2U A;  3FK8 A;  4ZBD A;  1GTA A;  3N9J A;  3I6A A;  4USS A;  2HSH A;  1J9B A;  3VI5 A;  4EDY A;  5IIZ A;  2NTO A;  2IWT A;  2WB9 A;  1USB A;  1XW5 A;  3GYK A;  3ZFB A;  1TXX A;  1SKR B;  4NHZ A;  4YQM A;  2OT3 A;  4PXO A;  3ZML A;  4AJ7 A;  3ZIJ A;  3F4R A;  2B7K A;  5F0G A;  4JZQ A;  1Z9H A;  2V1M A;  2IMK A;  5DAL A;  2F8F A;  2YZH A;  3KH7 A;  4LLR A;  2Z9S A;  3UL3 A;  5IMZ A;  1KTE A;  2MMZ A;  2GQL A;  4X0X A;  3F6D A;  3GKN A;  2H76 A;  3LW9 A;  1XBS A;  2VL2 C;  3FR6 A;  1GUK A;  2XBQ A;  4N30 A;  3C1R A;  1XOA A;  5H5Q A;  2QGV A;  1WPI A;  1SJ6 A;  4IJ3 A;  3UVT A;  2NDO A;  3FZ4 A;  1YY7 A;  1XWB A;  5ECP B;  4MP4 A;  4LMW A;  2FWE A;  2OBK A;  3MIX A;  2DMM A;  2YPM A;  7GSS A;  4FO5 A;  3CTF A;  3IOS A;  3US3 A;  3EPT A;  19GS A;  5B6M A;  3QAG A;  1VF2 A;  5J41 A;  1SVL A;  2HE3 A;  2A4H A;  2LEG A;  2P31 A;  2UZ8 A;  1JLW A;  4JRR A;  4TN8 A;  3RHC A;  4IGJ A;  3WT2 A;  4DSS A;  3C1S A;  2MBT A;  1AW9 A;  4JE1 A;  4EL1 A;  2L59 A;  3LG6 A;  3IXR A;  5BMU A;  2HRN A;  5J4U A;  2QA2 A;  3SBC A;  4BL7 B;  3UMA A;  1ZYQ B;  3I69 A;  2YNX A;  4RQX A;  2K8V A;  2N5A A;  4Q5N A;  2DML A;  1BG1 A;  2FWH A;  1OE7 A;  4K5S A;  3ISO A;  4HS1 A;  4L5O A;  4Q5R A;  1SD8 A;  2GGT A;  4QL9 A;  5ELG A;  3TRQ A;  1YEP A;  4MJE A;  2M80 A;  1IYH A;  5ID2 A;  4DSQ A;  5A1N A;  4MMM A;  4DSR A;  5IMV A;  3TOT A;  5B6N A;  4CHS A;  2L6D A;  2CAI A;  2JZT A;  5F05 A;  2YWO A;  1JLV A;  4GQC A;  1I9D A;  3Q18 A;  3TJJ A;  2YWN A;  4TXV A;  5FWG A;  1GSY A;  1W89 A;  1VRS D;  3HZ8 A;  3QFA C;  2ES7 A;  4I8B A;  4HI7 A;  2H6Z A;  2F9S A;  4AKG A;  4P3Y B;  5A34 B;  1XWG A;  4X1U A;  3JCM L;  1TKD B;  5GST A;  4NV2 A;  2YV7 A;  4G10 A;  2VCT A;  3UOM A;  3F6F A;  3KP8 A;  3FY7 A;  3OR5 A;  5JWO B;  1U88 A;  2A2P A;  4YQU A;  1U3I A;  2DSA A;  1OE8 A;  3PPU A;  2VLV A;  5D9W A;  3LFL A;  4JED A;  2LKU A;  1ERV A;  2HYX A;  1OVN A;  4GQF A;  1V2A A;  1YVL A;  1B8X A;  1ERU A;  3RPN A;  1V57 A;  1BJX A;  4ECC A;  4OMV A;  2O5V A;  2HSN B;  2GLR A;  4WEY A;  3TKS E;  4ZL7 A;  5JWR B;  2B5Y A;  4KB3 A;  5E4W A;  2VIM A;  3GKK A;  1O81 A;  4F9Z A;  3KMO A;  3TJB A;  2VAF A;  4JU5 A;  4LL4 B;  4AF2 A;  4ID0 A;  3KIJ A;  3VWU A;  1ZYE A;  2DLX A;  1SVM A;  5KOX A;  3IDV A;  1XVW A;  3CYN A;  3W6G A;  3GFK A;  1N25 A;  2LV3 A;  1B4P A;  3LSZ A;  1ZMA A;  2GQK A;  4WF5 A;  1JZW A;  1FAA A;  1Y25 A;  1QXH A;  1UVZ A;  3GUS A;  1THO A;  4I2T A;  2R6K A;  4OFM A;  4BVY A;  1QK8 A;  1JZD A;  1V40 A;  2HRF A;  2H70 A;  3A2X A;  4W66 A;  3EWL A;  1R5A A;  5GAP D;  5C04 A;  1XIY A;  3WD6 A;  1K0B A;  4E68 A;  1FW1 A;  3E3E A;  5IMD A;  3GHA A;  3GN3 A;  1GSF A;  2VOC A;  2I9H A;  1BQ7 A;  3TKS C;  3L9S A;  1XPV A;  2H71 A;  4AKX B;  1TRW A;  3LYK A;  4V1A p;  3VWW A;  5GAN D;  2WFC A;  4HDE A;  4HU9 A;  4IS0 A;  3CBU A;  1TK5 B;  2P5Q A;  2KP2 A;  2FCH A;  1SVO A;  1EV9 A;  2I1U A;  2J9H A;  2WJU A;  1NW2 A;  4XS6 A;  1Y6E A;  1ZYN A;  4MF7 A;  2K8S A;  5CRG A;  3CSI A;  4WF4 A;  2IIY A;  4EC0 A;  5AGY A;  4IW9 A;  4IP1 A;  3KXO A;  3D0Z A;  16GS A;  3PIN A;  2EC4 A;  4MZW A;  5COH A;  1PSQ A;  1XWK A;  1AQV A;  2RM5 A;  1TU7 A;  2OBI A;  1OAZ A;  2V32 A;  2R37 A;  4MDC A;  3E9J B;  1M2A A;  4HU7 A;  3IA1 A;  5FHI A;  2H30 A;  4GWR A;  1XXU A;  2HT9 A;  1JZO A;  4CY8 A;  5GZZ B;  4D73 B;  1LBK A;  3GV1 A;  3RAZ A;  3VPT A;  1A0R P;  3GH6 A;  1B48 A;  1M7T A;  1B9Y C;  3QAW A;  5D9V A;  4HZ2 A;  2LRN A;  3DVW A;  4PUR A;  1K0D A;  3GX0 A;  5J47 A;  2CVK A;  3L0H A;  1ZCP A;  1TI3 A;  1TJD A;  4TXO B;  3IV4 A;  2QKE A;  1PX6 A;  4FYC A;  5B8B A;  2B5X A;  2KP1 A;  4ZB9 A;  2EFC A;  4MZC A;  5IOW A;  2L5O A;  1X0R A;  1R7H A;  2UV8 G;  1TW9 A;  2H0H A;  1GWC A;  4K1F A;  2BMX A;  1T7P B;  5ECQ B;  1T1V A;  2OE3 A;  2NVL A;  2HZF A;  5ABR A;  1DE1 A;  1GH2 A;  4ULX A;  4XRA A;  4ECB A;  1FVJ A;  4J56 E;  1SK0 A;  3FYG A;  3ZRD A;  2WZ9 A;  1C72 A;  1HNB A;  1YJ6 A;  5ECR B;  2R0G A;  5CO3 A;  2L6C A;  6GSV A;  5B8A A;  5ECK B;  3P7X A;  1HNA A;  2FLS A;  1UC7 A;  5ECL B;  4GTU A;  3CRT A;  4ZB8 A;  20GS A;  5LNK e;  2O7K A;  3HA9 A;  3DRN A;  1QQ2 A;  1O7U A;  1PA3 A;  2JZR A;  2GSQ A;  1WWJ A;  4K5R A;  3SWL A;  5J3R A;  4BVX A;  1YF0 A;  3HVS A;  2C80 A;  4ML1 A;  4ZIL A;  1S3D A;  3TRP A;  4AKI A;  3IE3 A;  3HXS A;  4ZL9 A;  4PTS A;  4NPB A;  1UA5 A;  2V2G A;  4CDO A;  1CQG A;  3UAP A;  2NPB A;  2PVQ A;  1O73 A;  2IN3 A;  3TJG A;  1X5E A;  3KM6 A;  3QD9 A;  3GA4 A;  2JSY A;  3KTB A;  5ELA A;  4IQA A;  1UN2 A;  2H1B A;  1WP0 A;  4ECJ A;  4CY6 A;  2C0F A;  5D8I A;  3UAR A;  3IC8 A;  10GS A;  4YQV A;  1SU9 A;  3CWG A;  4KH7 A;  5DAK B;  1GLP A;  2HRK B;  3F4T A;  3DXB A;  4RQR A;  4AKH A;  2X49 A;  3UIW A;  3RBT A;  3MSZ A;  2K9F A;  5IQY A;  3UBL A;  2H75 A;  5IPG A;  3WT1 A;  2HXK A;  3GMF A;  4RI7 A;  4HUA A;  5ECS A;  5ECM B;  2A2R A;  2DIY A;  5A5K A;  2VL3 A;  2CX4 A;  2H19 A;  1OC8 A;  2H01 A;  4F2I A;  2EFD A;  4MH3 A;  1S3C A;  2F3M A;  4MH2 A;  4GSS A;  2H72 A;  4MAB A;  3BCI A;  4KDU A;  2CZ3 A;  1DUG A;  3WGE A;  1F3B A;  5LD0 A;  1SYR A;  2I3Y A;  4O5R A;  1N2A A;  5A4W A;  2E2M A;  2YAN A;  3HD5 A;  3FKF A;  1A0F A;  1PN0 A;  1ML6 A;  4NV5 A;  4BWS A;  1WE0 A;  3IBH A;  4QMK A;  3ME7 A;  2RUE A;  4KSM A;  3EYT A;  2HQT A;  2ALB A;  1OKT A;  3PR8 A;  1ERT A;  3G9B A;  3FZA A;  2KOK A;  4KAE A;  3EMX A;  3HMJ G;  4K7I A;  4K0G A;  3VI7 A;  1AQX A;  3IPZ A;  1SYX A;  3BOA A;  3ZTL A;  1GNE A;  3APS A;  2O87 A;  1HNC A;  1MD3 A;  3NOF A;  4MPF A;  3TRX A;  3GNJ A;  2XHF A;  1MDI A;  4GDF A;  5IOX A;  4OO4 A;  2XPE A;  3LJR A;  4BL7 A;  3VWX A;  2M46 A;  1YDK A;  3CTG A;  2JSZ A;  3L9U A;  1G7E A;  2BJX A;  1K0N A;  5EVO A;  2GT6 A;  5JWQ B;  2AHE A;  4X43 A;  1M99 A;  1BED A;  3DWV A;  2B1K A;  2REM A;  1Y1U A;  3NZN A;  4PNG A;  1A2M A;  3KD0 A;  5CYY A;  1LU4 A;  2DJK A;  3IHQ A;  5J4Y A;  2CQ9 A;  4OWY A;  3RDW A;  1V98 A;  1BG5 A;  3K8N A;  5J9B A;  1Z6M A;  4GLT A;  1T8E B;  4HJ2 A;  2HSM B;  4KCA A;  1K0M A;  2HRA A;  2IFQ B;  1G7O A;  1AAZ A;  2N5B A;  1GUL A;  1TXU A;  3ZFL A;  1NSW A;  2CV4 A;  2DIZ A;  2HNL A;  3CSH A;  1YKA A;  2IME A;  3A3T A;  2X8C A;  4Q5F A;  3V1W A;  3GH9 A;  2HFD A;  1OYJ A;  3U6V A;  1TI1 A;  4ZB7 A;  2WRT A;  2VCX A;  3A5W A;  1EP8 A;  5KN3 A;  4V2L A;  4FQU A;  2GSR A;  4F0B A;  2YJH A;  4BA7 A;  4GST A;  1F9M A;  5ECH B;  3TB2 A;  5D96 A;  3I9V 2;  4TR4 A;  2TRC P;  5A34 A;  4XIH A;  4TR0 A;  4NHW A;  4TR1 B;  2JZS A;  3E0U A;  3F8U A;  5A5H B;  5H5S A;  3MDK A;  1SL1 B;  3MYD A;  2MMO A;  1A2J A;  1GSD A;  5DQS A;  1PKW A;  1DBY A;  4ZIJ A;  4WKW A;  2R4V A;  1OC3 A;  3DKS A;  3F0I A;  1K0O A;  5CAX A;  4YH2 A;  4N3Z A;  3VLN A;  4N0V A;  1PX7 A;  4O5Q A;  5IMC A;  2CVB A;  4N10 A;  1M9B A;  4GXZ A;  5C00 A;  1TRS A;  3R3E A;  1K0C A;  2HSN A;  3HZ4 A;  3LQ7 A;  1EWX A;  1OKD A;  3F4S A;  3IRA A;  1ZGN A;  4MF5 A;  3KMN A;  1TTZ A;  1PN9 A;  4FYB A;  1GTB A;  2H1L A;  2G2Q A;  1GSQ A;  2YP6 A;  2LQQ A;  3GL5 A;  4EIQ A;  1EP7 A;  3HHV A;  2X99 A;  5G5E A;  2H1A A;  2YWM A;  1PRX A;  5CRH A;  3DVX A;  2PGT A;  1EGR A;  5BRT A;  1QMV A;  2LNS A;  4GCI A;  2EIR A;  3CMI A;  2C0G A;  3DIE A;  4TKY A;  3KTL A;  5HFK A;  4POB A;  5CRE A;  1PKZ A;  1SD9 A;  5DVB A;  4KGI A;  2VL9 A;  1HQO A;  2LS5 A;  4OD7 A;  5G2Z A;  4BWQ A;  2VD0 A;  1U87 A;  2VL2 A;  3EIN A;  6GSX A;  2P0G A;  1J08 A;  3KEB A;  3D4M A;  2TIR A;  4G0K A;  3FRC A;  1X5C A;  4J57 E;  1YKC A;  4WXT A;  3W8S A;  4K2D A;  3ZIT A;  1TRV A;  3Q74 A;  2MYG A;  3IC4 A;  4OFN A;  4ILF A;  5DCH A;  3HCZ A;  5HR2 A;  4BPY A;  2PPT A;  5KN1 A;  3S9F A;  2DJ0 A;  3GKM A;  3QMX A;  2NBS A;  1NHY A;  1FB6 A;  3M3M A;  3TCO A;  1T4Z A;  4G2E A;  3BD2 A;  2WGR A;  2GTU A;  3HJP A;  4G0L A;  2PUK C;  3EMP A;  4DVC A;  2F8A A;  4G01 A;  2AAW A;  4FYU A;  2YJ7 A;  4XTS A;  17GS A;  3H1N A;  1MEK A;  3EUR A;  2IMF A;  2C0E A;  3GST A;  5A4V A;  3TKP A;  1A8L A;  4YKG A;  3H79 A;  1O6J A;  1A2L A;  3VK9 A;  4O32 A;  2WS2 A;  2B6M A;  2AV4 A;  4EF0 A;  1V58 A;  2PWJ A;  2LRC A;  1KBN A;  3LYP A;  2HZE B;  1F37 A;  5HFG A;  3HJO A;  1QUW A;  4IP6 A;  1SJI A;  4PUA A;  4AJ6 A;  2DBC A;  1GNW A;  6GSW A;  1PGT A;  1TDI A;  2H73 A;  4XRD A;  4XCS A;  2H66 A;  4E8H A;  1K3O A;  3C7M A;  5D9X A;  2GZY A;  1ILO A;  5JCG A;  1VF1 A;  1WRY A;  4Z2R A;  4Z7X A;  5IMA A;  3GTU B;  2L5L A;  1A8Y A;  4D73 A;  1YEX A;  2FWG A;  4WBR D;  2LNT A;  1VF3 A;  4LL1 B;  2MBS A;  3ED3 A;  2OKA A;  5G1K A;  1K3L A;  4IKH A;  4ZBB A;  4PQI A;  2VM1 A;  1DE2 A;  3BCK A;  3QR6 A;  1LJR A;  1J0F A;  4TXO A;  3FMW A;  2AUV A;  2QC7 A;  4PQ1 A;  5CRD A;  3TUE A;  5DJM A;  1K0A A;  2CX3 A;  3VPQ A;  2VM2 A;  2KUC A;  3TU3 B;  3FW2 A;  4MZB A;  4FH8 A;  5IMF A;  4DEJ A;  1XW9 A;  5DCG A;  2R0C A;  2RM6 A;  1M2D A;  4PNF A;  1KNG A;  4KND A;  1E6B A;  3RPP A;  3P2A A;  1H4O A;  1Z7P A;  2IMD A;  2G0F A;  3U5R E;  4L8E A;  1IYI A;  3ZRE A;  2TRX A;  5CP1 A;  1ERW A;  1MDK A;  1T00 A;  5L71 A;  2OJL A;  4GRF A;  1Q4J A;  1I5G A;  1R5P A;  3ERG A;  3D4T A;  1GLQ A;  1ON4 A;  2GZZ A;  4AJ8 A;  4EIP A;  1XWC A;  4AGS A;  2H74 A;  1OC9 B;  2ZUP A;  2YWI A;  1XW6 A;  3UVH A;  4PGT A;  3HJM A;  5ECN B;  4POK A;  4KX4 A;  2GZP A;  1X9W B;  3QDN A;  2IL3 A;  5HQP A;  1M0U A;  3R2Q A;  2E2G A;  4TVE A;  4K6X A;  3A5I A;  2XPD A;  5AIX A;  2H6X A;  5A4U A;  4IVF A;  3GSS A;  1TRU A;  3M9K A;  2F51 A;  3P8W A;  4Q5Q A;  2GQM A;  1EV4 A;  1M2B A;  2CVD A;  3GIX A;  2D2Z A;  3DML A;  2LTK A;  5KOW A;  3KCM A;  4F82 A;  6GST A;  2C0D A;  4ZB6 A;  1QGV A;  4WR4 A;  1THX A;  4O5U A;  2E7P A;  4PX1 A;  3F3R A;  2CA8 A;  1MTC A;  4NAX A;  5J40 A;  4GF0 A;  3TJK A;  1AQW A;  2R3X A;  3IAM 2;  3O6T A;  5JCU A;  5EL8 A;  2R2J A;  2CT6 A;  1CQH A;  5DAK A;  3D5J A;  2HRK A;  3VUR A;  4KSO A;  3AY8 A;  1O85 A;  2PER A;  2FUG 2;  3RHB A;  2VKZ G;  4ML6 A;  3DGQ A;  3LXT A;  4IEL A;  2HSY A;  3LOR A;  2JU5 A;  2A2S A;  4K2X A;  4WET A;  1PQN A;  3TKS A;  1VGL A;  4K7N A;  1JHB A;  2C3N A;  1FO5 A;  5DJL A;  2RLI A;  4WR5 A;  3TDG A;  2ZNM A;  2JL4 A;  5ECO B;  2VLT A;  1NHO A;  4KA0 A;  2AJQ B;  5ENU A;  1YZX A;  6GSS A;  3FEU A;  5HFI A;  3D21 A;  3QFB C;  3MWH A;  1GL8 A;  3WYW A;  1SKW B;  4PQH A;  4XS4 A;  4IN0 A;  2VCQ A;  4V1A g;  3FR9 A;  3D22 A;  4G0I A;  1EEJ A;  4F03 A;  1PL1 A;  4K0N A;  2QA1 A;  5D9T A;  3GKX A;  4LA1 A;  4MNN A;  3UBK A;  2H0G A;  4XS4 B;  2YCD A;  3LEF A;  1HD2 A;  3LWA A;  2A4V A;  3GL3 A;  2FWF A;  2BTO T;  2LRT A;  1FHE A;  3ERW A;  1XWA A;  1SL2 B;  2MMA A;  2GDR A;  4N0Z A;  3HKR A;  5D93 A;  2OE1 A;  2H1G A;  1G6Y A;  5DAL B;  3G7Y A;  3GX8 A;  4AI6 A;  1Z3E A;  2X4A A;  3BJ5 A;  3C71 A;  3LGC A;  2H6Y A;  2L4Q A;  1X5D A;  1RK4 A;  6GSY A;  1E2Y A;  3FR3 A;  3W8J A;  2EFH A;  1QFN A;  4MJC A;  1G6W A;  2GST A;  2QSI A;  3EE2 A;  2C1Y A;  4O7H A;  2B1L A;  2XC2 A;  1URM A;  3HVX A;  4QL7 A;  1A24 A;  3ZZX A;  1PMT A;  2B3S A;  3DYR A;  2WCI A;  1FOH A;  2B7J A;  4HQS A;  3PGT A;  5IO0 A;  1TP9 A;  3FZ9 A;  2VLU A;  2J23 A;  1RW1 A;  3ZLP A;  2C3Q A;  1BX9 A;  3UEM A;  4OFT A;  2VD1 A;  5AIS A;  3M1G A;  4TW5 A;  3NIV A;  2X64 A;  5KEJ A;  1XCC A;  2HSM A;  2VCZ A;  1GSS A;  3TGZ A;  2IFQ A;  2AB6 A;  1BYE A;  1ZZY A;  1FG4 A;  4F0C A;  3M9J A;  4K9Z A;  3VFI A;  4ACS A;  4O92 A;  1EEM A;  4MK3 A;  4DSS B;  2HLS A;  3EU3 A;  2O89 A;  5FT3 A;  2PN8 A;  1GUH A;  1R26 A;  2VO4 A;  4L5L A;  5BMU B;  3VWV A;  2WUL A;  3QPM A;  1FB0 A;  4MA9 A;  5HR1 A;  2JAD A;  3C8E A;  4L0W A;  4EDZ A;  1AC1 A;  4TR1 A;  5A5H A;  3TJF A;  3F63 A;  4IHU A;  3EVI A;  4J2F A;  5JCW A;  1FOV A;  3QCP A;  2MMN A;  4ICY A;  2RII A;  2O85 A;  1AUC A;  5ID2 B;  3ERF A;  1JFU A;  4EKZ A;  1YF1 A;  3IR4 A;  2N5F A;  5A1N B;  1EOG A;  4KUN A;  1GTU A;  3J7Y b;  3HYP A;  4NMU A;  5IO2 A;  4IBP A;  1G0T A;  5F06 A;  4G19 A;  2MZC A;  3ZMK A;  2X8H A;  3CSJ A;  3TKQ A;  2ON5 A;  1SK2 A;  1WOU A;  2FY6 A;  5F8B A;  2GVP A;  2EIO A;  4TRX A;  2WDU A;  5B7C A;  4KCE A;  2C3T A;  1FVK A;  1NM3 A;  2IMI A;  4GSN A;  4EVM A;  1EZK A;  4ISD A;  3I43 A;  1GP1 A;  5D73 A;  2OAD A;  4X4J A;  3MAK A;  2OE0 A;  4RUV A;  3FHK A;  2PBJ A;  3ZVJ D;  3H4K A;  2C4J A;  1O8X A;  1RQM A;  2V6K A;  3O76 A;  2LJR A;  1YQ1 A;  4KW6 A;  1S3A A;  4XS1 A;  1KEB A;  4MCU A;  2EFE A;  3PH9 A;  5G5F A;  4NWY A;  2M72 A;  3P90 A;  4YKF A;  1M9A A;  2B5E A;  2X8G A;  5G30 A;  3MNG A;  1HYU A;  1TU8 A;  4JBB A;  1WMJ A;  9GSS A;  3D6I A;  3GRX A;  4ZBA A;  2DKI A;  3A2W A;  1XOB A;  5E59 A;  2O8V B;  2PVO C;  4HJM A;  4V2N A;  4A5P A;  4ZXG A;  5F07 A;  22GS A;  3Q6O A;  1SK1 A;  1Q98 A;  4EE0 A;  2KHP A;  3ME8 A;  2C8U A;  2K6V A;  4IQ1 A;  3H93 A;  2LJK A;  5J9C A;  4KE3 A;  3APO A;  4ECI A;  2FGX A;  4HQZ A;  5J4V A;  3H8Q A;  5GSS A;  2ZCT A;  4XHM A;  1GUM A;  1XZO A;  3Q19 A;  1T3B A;  1SKS B;  3FZ5 A;  1SL0 B;  1GSE A;  1B9X C;  1TK8 B;  4MPG A;  2E0Q A;  4BVY B;  2P5R A;  1U6T A;  3BBY A;  3N5O A;  5HR3 A;  1Z7R A;  3ZIV A;  4EUY A;  2L4C A;  2ON7 A;  3M0F A;  11GS A;  12GS A;  4CW9 A;  3IK9 A;  5IM9 A;  3KJY A;  4I97 A;  3APQ A;  3LXZ A;  2YN1 A;  2GS3 A;  2OAC A;  2CZ2 A;  2K18 A;  4Z2U A;  4HZ4 A;  2HZE A;  1H75 A;  1R4W A;  4MLY A;  4POM A;  1GTI A;  3ZVJ A;  5EPF A;  4LMV A;  1X9S B;  3A2V A;  2DJ1 A;  3HDC A;  2IJY A;  3IK7 A;  4MJB A;  5J5N A;  2DJ2 A;  5INY A;  1JZR A;  1A23 A;  3GTU A;  2GSS A;  1ACV A;  3J7Y k;  3WGX A;  4JR4 A;  1MD4 A;  2DJ3 A;  1EGO A;  6GSU A;  4POL A;  2GT5 A;  2KLX A;  3KP9 A;  5G1L A;  2V6O A;  1W4V A;  1XFL A;  4MF6 A;  2JAC A;  4YAP A;  3IAS 2;  1BAY A;  5EY6 A;  3O3T A;  1ABA A;  1MDJ A;  1GRX A;  1PL2 A;  4EXJ A;  5LCZ A;  2LUS A;  2PU9 C;  5DBQ A;  1DSB A;  1ZYP A;  2FD3 A;  2YV9 A;  2YZU A;  1Z6N A;  2XBI A;  1ST9 A;  5DQY A;  2PMT A;  2I4A A;  3TOU A;  1V9W A;  2LJA A;  4Z2T A;  3L78 A;  5KN2 A;  1EOH A;  1AIU A;  4EO3 A;  3HVV A;  3KZQ A;  4PUF C;  4K7O A;  2IPA A;  5AN1 A;  4QQ7 A;  4NXI A;  2FA4 A;  5CRW A;  1N8J A;  4OCF A;  1OC9 A;  5DDL A;  3TKR A;  1TOF A;  2R5G A;  4FIW A;  3IHG A;  1ZOF A;  2DJJ A;  5IPH A;  4WBJ A;  2OA7 A;  5HR0 A;  1U3A A;  4OO5 A;  3L4N A;  4ZL8 A;  1T4Y A;  5AIV A;  1BF5 A;  1XVQ A;  1TK0 B;  1F2E A;  18GS A;  3G7J A;  13GS A;  1WIK A;  5CNW A;  4TR3 A;  3GUR A;  3KH9 A;  1F3A A;  4RI6 A;  1ZL9 A;  3L9V A;  3ZYW A;  3CXG A;  4H86 A;  3EC3 A;  2VUP A;  2VCV A;  5ECI B;  5H5R A;  2I81 A;  2VCW A;  1AXD A;  1O8W A;  1X9M B;  3QAV A;  2FA8 A;  4MJA A;  1SEN A;  2H8L A;  3C73 A;  5G31 A;  4IJI A;  4I5Q A;  3UJ1 A;  3HY2 A;  4HOJ A;  4E8E A;  2DKH A;  2R0P A;  1VF4 A;  2YOI A;  2FHE A;  4TOP A;  4V2M A;  4L0U A;  3G7I A;  2DC5 A;  4OCE A;  1B4Q A;  1F6M C;  2LST A;  4KDX A;  4G9H A;  1PD2 1;  4N11 A;  2V41 A;  2RUF A;  2H0I A;  3QOU A;  1WJK A;  2L57 A;  2H1D A;  14GS A;  3EU4 A;  5KN0 A;  8GSS A;  4BVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...