4G19A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium in complex with glutathione
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase GTE1
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
total genus 94
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g19A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g19A01
2DC5A 2L59A 1FHEA 3K8NA 1YKCA 5IMCA 2JSZA 1KBNA 5A4WA 3L0HA 1OC9A 3DEXA 1TI3A 5ECLB 2X8HA 3MWHA 3R3EA 2KP2A 2IPAA 4HU7A 3H8QA 1YQ1A 1GTUA 1M7TA 4MP4A 3D6IA 4MF7A 1WE0A 2CVBA 1TP9A 3LGCA 3I6AA 2AAWA 13GSA 1JZDA 2H30A 4NMUA 2H6ZA 1PL2A 4KAEA 3A2WA 2HYXA 4TKYA 2B7KA 1V98A 4K7NA 3LORA 2E0QA 5GSSA 2LS5A 1SU9A 4IELA 3J7Yk 3GX8A 4E8HA 4K0NA 4TN8A 5G30A 3GNJA 1SJZA 1K3LA 2WB9A 4QL9A 1G6WA 3KTBA 4DSSA 3F4RA 2GZZA 3D5JA 3LXTA 3GKXA 2B1LA 2WGRA 3M3MA 4TR0A 4IN0A 3TRPA 4ZXGA 5B7CA 1A2LA 2H72A 6GSVA 3PGTA 8GSSA 5HR3A 3P2AA 1U87A 2PMTA 1GSUA 3JCML 4NV5A 2C3QA 2RUFA 3TJKA 2DSAA 5ECIB 5EL8A 1T4YA 3CSHA 4WETA 1XWBA 3RBTA 1T4ZA 2IL3A 1FB0A 1QGVA 3F4TA 4GRFA 3VI5A 4EDZA 2VLTA 1GLPA 1BG5A 1DBYA 2LJAA 4KDXA 2LNSA 3GRXA 3EE2A 5H5RA 11GSA 2C3NA 3GA4A 1XWAA 2YWIA 3MDKA 1JZOA 3ERGA 3FEUA 1YY7A 3ZZXA 4IQAA 4IVFA 3KP9A 1A2JA 3TJGA 2VUPA 2YJHA 2X64A 2O8VB 2AV4A 3PINA 4D73B 4MDCA 2QSIA 5CAXA 5B6MA 2H0IA 3LWAA 2FHEA 5D9WA 1PX7A 1F2EA 3LJRA 5DJMA 2BTOT 2YNXA 1MD3A 2C0EA 1M9AA 1T8EB 3KH7A 4L8EA 1Z5YE 3G7JA 1A24A 3DRNA 1XPVA 2JSYA 2C3TA 3ME7A 2WZ9A 1J0FA 3QAVA 2LUSA 2N5FA 3Q18A 2K6VA 2OE1A 2JZTA 1B9XC 4NXIA 2K8SA 1S3AA 2HQTA 2MZCA 3WT2A 2ES7A 4N30A 3QFBC 1BX9A 3IXRA 5JWRB 3ZVJD 1EEJA 5DAKA 1SJ6A 2GSQA 4GTUA 3KGKA 3IV4A 2REMA 4G10A 3CTGA 1FAAA 2LEGA 3H79A 3VFIA 5IPGA 3F4SA 2VCQA 2OADA 3NIVA 5LD0A 3C7MA 1WWJA 3GSSA 3LG6A 2H0HA 2YANA 5ECKB 3DGQA 4TR1A 4MCUA 1DUGA 1I5GA 3L9VA 3BCIA 4HQSA 5D8IA 1LJRA 3C71A 4PXOA 4JBBA 1F6MC 2H71A 1EGRA 5AIVA 1ML6A 5ECMB 3TOUA 4I2UA 2PBJA 3FY7A 1XW6A 4MZBA 2HFDA 5G31A 3VWWA 2OE3A 1BJXA 2H70A 3VPQA 4WBRD 1V9WA 9GSSA 5LCZA 3V1WA 5IO0A 3CTFA 4WR4A 2JL4A 2IJYA 5CRGA 5KN3A 2FNOA 1FO5A 3KMOA 2I9HA 1SKWB 6GSXA 1B4PA 5LNKe 4IW9A 3F0IA 3O3TA 1K3YA 4HU9A 3G9BA 2C8UA 1YZXA 5D96A 3NOFA 3UIWA 1YEXA 4BWQA 1V58A 4RI6A 4D73A 2GT5A 2VL3A 5D93A 2VL2A 3EU3A 5F0GA 5ECRB 2OJLA 1GP1A 5G2ZA 4WEYA 1A8YA 2IFQA 2VCTA 3MNGA 3UAPA 3C8EA 2IMEA 2N5AA 1DE1A 1HQOA 1M2DA 2LNTA 3TOTA 1GRXA 2B3SA 4MF5A 5J9BA 2GLRA 5CP1A 2R37A 2VCZA 2HRKA 1ZYQB 1G6YA 1QQ2A 4PQHA 4GWRA 3F6DA 5CYYA 3GHAA 2PVOC 5B8BA 4XS6A 2HNLA 3ZFBA 4IHUA 4PQ1A 4CHSA 2X99A 3LQ7A 2ZCTA 1PN9A 1R7HA 5IMVA 3VLNA 1G0TA 1NHYA 2GT6A 4HEA2 1OE8A 5DJLA 2DJKA 3GTUA 4MZWA 3QD9A 3APOA 3QAGA 4AJ6A 4K0GA 1X9SB 6GSUA 2CT6A 4MMMA 1MD4A 3SWLA 5AN1A 5EPFA 4IQ1A 3MSZA 3I43A 2YP6A 2G0FA 1TU8A 1AAZA 5HR0A 3EINA 1WP0A 4ZILA 1Z9HA 3J7Yb 1ON4A 5E59A 2VO4A 5IPHA 2DJ3A 4KSMA 3IDVA 3H4KA 5L71A 4MK3A 2MBSA 2WCIA 1HYUA 1XWKA 3PPUA 4K6XA 2LRTA 3GFKA 4GQCA 2K18A 4HQZA 3DYRA 1GUHA 2DLXA 1C72A 2GQKA 3LYPA 1EP8A 2GZYA 4I5QA 1F37A 20GSA 1HNBA 4KUNA 2JACA 1MDIA 1M9BA 1QMVA 4MZCA 4EO3A 5IMZA 4QQ7A 1YF0A 3ISOA 4YAVA 1USBA 2LJKA 2RLIA 6GSWA 4F03A 2PGTA 1TRSA 3U5RE 1MDJA 2L6DA 4DSSB 4F82A 5KN0A 1ZOFA 2HE3A 2CQ9A 2FA8A 4KH7A 2IWTA 2HI7A 4G0IA 3APSA 1G7EA 1SK2A 1UA5A 1O7UA 4TVEA 1U3AA 1E2YA 2C0FA 1J9BA 3UVHA 5F06A 1B9YC 1Z6MA 2HSYA 3F8UA 3KP8A 2C4JA 2HSNB 4F2IA 3HD5A 4AF2A 2HRAA 1MTCA 4NHWA 4NHZA 2PWJA 3P8WA 1V2AA 2B7JA 1FW1A 2CAQA 2XC2A 1ABAA 4I8BA 5JWQB 4XTSA 3DWVA 4LL1B 2LRNA 1K0AA 4KCAA 3LYKA 2VL2C 3ZRDA 3LFLA 2R6KA 3CYNA 1X5DA 3L9UA 5GAPD 4I6XA 1FVKA 2KLXA 3E9JB 1M0UA 2R5GA 1TOFA 4EDYA 1HNCA 4N11A 4FYCA 1HNAA 3F63A 2WULA 4O7HA 4MA9A 2VL9A 2VOCA 4MJEA 2YWMA 2AJQB 1OC8A 3O76A 1OAZA 3IC4A 1THXA 3ZIJA 1KNGA 4BVXA 3RPPA 5IOWA 1K0MA 1GH2A 5DAKB 3F3QA 2CZ2A 3FZ4A 3TGZA 1B4QA 1EWXA 3IAM2 4BL7A 3F6FA 3BOAA 1MEKA 4XRAA 4HI7A 3M9JA 3VI7A 3ED3A 3UJ1A 5EY6A 1SENA 1SKRB 1SL2B 2DJ1A 4G9HA 1Z3EA 4HS1A 2B5XA 17GSA 2PN8A 4TR1B 1KEBA 2JZSA 3QPMA 1A0RP 2MMZA 4YH2A 2PU9C 3M0FA 2OA7A 2K8VA 4GSSA 1AQVA 3GN3A 1ZL9A 1VF1A 3ZREA 5G5EA 4HZ4A 1DE2A 2NPBA 5B8AA 3HA9A 3Q6OA 3PH9A 4DEJA 4EF0A 1GTAA 3DKSA 3Q74A 4BPYA 2H76A 5G1KA 3TKPA 2B5YA 2CA8A 3KMNA 3WGDA 2HSHA 3D21A 5ABRA 1QFNA 1HD2A 4PGTA 1FVJA 22GSA 4PUFC 1N8JA 1SYRA 3FZAA 5JCGA 5ELGA 1ZGNA 4KW6A 4MJCA 2H6XA 4F0CA 2H73A 4L5OA 4I97A 1YF1A 1X5CA 3ZTLA 1UN2A 3HCZA 2VCWA 4KX4A 1ERTA 2IFQB 1FG4A 2H1DA 4EC0A 2E2MA 3C73A 5ECOB 2JADA 2KOKA 4HJ2A 3HHVA 5ELAA 1XOBA 2H19A 1R4WA 2D2ZA 2R3XA 1GTBA 2XBIA 3FK8A 2DJJA 3RPNA 3IC8A 2HRKB 2YV9A 6GSYA 2HRNA 4OFNA 1Y25A 4YQVA 4ID0A 4BVYA 3VURA 4DVCA 4KNDA 3QOUA 3US3A 5J3RA 2VM1A 1ZCPA 4G2EA 2MBTA 1ILOA 1PMTA 1A2MA 2CAIA 1TU7A 5IIZA 5CRDA 3GTUB 3HZ4A 2C0GA 2FA4A 1O85A 3HVXA 4NV2A 16GSA 4F0BA 1EP7A 2A2RA 4FH8A 2GSRA 3M1GA 1ACVA 2AUVA 4KDUA 1YJ6A 4KGIA 3IRAA 2I3YA 1JZRA 1GUMA 2K9FA 3DVWA 2C0DA 4K1FA 1Y6EA 3A2XA 4AJ7A 1G7OA 2H6YA 3LEFA 4ECBA 4JRRA 1EV9A 1BQ7A 4NAXA 2YWOA 1PSQA 1XXUA 2OBIA 2YZHA 1AXDA 3IK7A 1XIYA 2F3MA 1T3BA 1RW1A 4TRXA 2RM6A 1XVQA 1UVZA 2AB6A 2GSSA 4HOJA 5JCUA 4V1Ap 3IHQA 3O6TA 5B6NA 3N5OA 4HUAA 1OYJA 2F8AA 2CVDA 3FYGA 1O81A 4HZ2A 4ZL7A 4LL4B 2L4QA 3A3TA 4TXVA 4CDOA 1DSBA 4POMA 2LSTA 4HDEA 2HZEA 4OWYA 3VWVA 1Z7PA 12GSA 1OKTA 1GSDA 4PNFA 5AIXA 4Z7XA 4ULXA 5A5KA 4OCFA 5ECNB 3TDGA 1PL1A 1ZZYA 1JFUA 1SD9A 4YAPA 3HVSA 3QR6A 2OKAA 4ZBAA 2WFCA 5ECQB 4GF0A 1TXXA 3BJ5A 3I9V2 3H93A 1SJIA 6GSTA 4WXTA 1RQMA 3H1NA 3TRQA 4N0ZA 2P31A 2FLSA 1X0RA 3ZLPA 5ECHB 3LSZA 5KEJA 2QKEA 3GV1A 1U88A 1F3AA 2LRCA 1SK1A 4IGJA 3APQA 1K0DA 4EVMA 1WOUA 1TK0B 1W89A 2EIRA 4POBA 2XHFA 2OE0A 1OKDA 1XW9A 2B6MA 5ECSA 1VGLA 5DALA 2RM5A 3E0UA 2Z9SA 5D9TA 2FWFA 2JZRA 19GSA 2NBSA 4JZQA 1TRVA 1Q98A 2V6OA 1XCCA 2PUKC 3GIXA 3L9SA 2O89A 2LQOA 4ZB9A 1JLWA 1GLQA 2X8GA 7GSSA 2VM2A 5DDLA 3ZITA 4TR4A 2E7PA 2FWHA 1IYIA 3P7XA 2MMNA 4N10A 1OE7A 4ML1A 2J23A 4CW9A 1YKAA 3ME8A 4TXOA 2CX3A 4ZL8A 3CRTA 3TCOA 1TJDA 4J56E 4PQIA 1TK5B 2LTKA 4EXJA 4NPBA 3TKRA 3GH6A 4BVXB 3TKSA 4OO4A 2DIZA 2IMDA 3TJJA 2LJRA 4BL7B 4PX1A 3DD3A 2QC7A 4EL1A 4L5LA 5H5SA 1WJKA 4MPFA 4O32A 4WF5A 5INYA 4G19A 1WRYA 4EKZA 1K0CA 5J41A 4K7IA 3KCMA 4L0UA 1NM3A 4WR5A 3D0ZA 5FHIA 1TKDB 2VIMA 2QGVA 1AUCA 1GSSA 4TW5A 5A4VA 2B5EA 1UC7A 2FWGA 3FR6A 3QMXA 2LQQA 3KJYA 4X0XA 4MABA 2JU5A 5HFKA 4POLA 4KCEA 5JCWA 1GSFA 1Z7RA 2DMMA 1TW9A 4WF4A 2V32A 3EC3A 5A4UA 2NTOA 3AY8A 2IMIA 5CNWA 4GCIA 3R2QA 1QK8A 2ON5A 3IR4A 1ST9A 4FYUA 1B8XA 4H86A 1O8WA 3QFAC 2FWEA 1EZKA 1F9MA 1U6TA 5HR2A 1X5EA 5DCHA 3KD0A 3M9KA 3IE3A 1PGTA 2DMLA 3GL5A 2IMKA 3CXGA 2A2SA 5IMFA 4AGSA 4MLYA 1M2AA 4ECCA 1XFLA 1S3CA 4XRDA 1AC1A 4MJAA 2L5LA 1F3BA 4GXZA 3EYTA 4POKA 5IO2A 4PURA 3TKQA 4RUVA 4IKHA 2FD3A 1AW9A 2V2GA 3HXSA 5C00A 3VWXA 4LMWA 4PTSA 3UARA 4I2TA 5IM9A 3KIJA 3FKFA 1GSQA 5IOXA 3RHBA 3WGEA 1XWCA 4GSNA 1YEPA 3TKSE 2A4VA 1K0OA 2H1AA 4MPGA 3QDNA 4BVYB 2F9SA 4WKWA 3TJFA 2HT9A 1AQWA 4JR4A 5G1LA 4ZIJA 4GQFA 1TI1A 4USSA 2O87A 1J08A 3BCKA 2C80A 2R2JA 3KM6A 4J57E 2XPEA 3ZIVA 5FWGA 3TB2A 3FR3A 2F8FA 4FIWA 4AJ8A 5COHA 3KEBA 2YV7A 1TTZA 5HQPA 1ERUA 5CRHA 2WDUA 4XCSA 4IP1A 4G0LA 1SK0A 1VF3A 4K2DA 2NVLA 1OC3A 1VRSD 3HKRA 3WD6A 2C1YA 5KN1A 1XVWA 3C1SA 1O6JA 3HY2A 2ZUPA 1B48A 1K3OA 1URMA 4V1Ag 2KUCA 4QL7A 2M46A 2KHPA 2YWNA 1TK8B 2M80A 3HJOA 3DXBA 2V6KA 1GNEA 3U6VA 1XZOA 4P3YB 2PPTA 3TKSC 4MH2A 1M99A 2EIOA 3A2VA 3CRUA 2FUG2 3UVTA 1TDIA 2FGXA 1T1VA 3IA1A 1AQXA 4K7OA 3GH9A 5AISA 2BJXA 1PQNA 14GSA 3FRCA 2LKUA 2HSMA 1T00A 1YDKA 3EMPA 3ERWA 4Q5QA 4L0WA 2GSTA 1S3DA 2HXKA 4FYBA 4PUAA 3RAZA 3L78A 1OVNA 2HZEB 4OD7A 4FQUA 4X43A 3PR8A 2CX4A 5J5NA 1GNWA 2IMFA 2P0GA 4JU5A 4ACSA 3GUSA 1VF4A 2F51A 5ID2A 4WBJA 1AIUA 5H5QA 1IYHA 2EC4A 1SYXA 1QXHA 4ZBBA 5HFIA 4EE0A 5CO3A 5FT3A 4XS4A 1M2BA 2TIRA 4PNGA 5D9XA 5CREA 3E3EA 3F9UA 4OFMA 2AYTA 3CBUA 5G5FA 1EOGA 1WPIA 2I4AA 2H01A 1K0BA 1X9MB 2VCXA 5F8BA 3ZMLA 3D4TA 1WIKA 4TR3A 3TJBA 4K9ZA 2FCHA 4KF9A 2H1BA 3W8JA 4ISDA 1U3IA 5F07A 2H75A 1TRUA 3WT1A 3ZFLA 3BBYA 3UMAA 4HJMA 5IMAA 4ZL9A 3BD2A 2J9HA 5KN2A 5DALB 2YOIA 3GL3A 2R4VA 1I9DA 1BYEA 1RK4A 2VD0A 5ECPB 4NWYA 4IP6A 1EGOA 3IOSA 2YCDA 3S9FA 2X8CA 5HR1A 4E8EA 1R5AA 2GZPA 4BWSA 3UEMA 1T7PB 2TRCP 3CMIA 5JWOB 3DIEA 4DSRA 4OCEA 4YQUA 4ECJA 3M8NA 1NW2A 1W4VA 2VAFA 3UL3A 2GQLA 5D73A 4TXOB 2I1UA 4LMVA 2GTUA 2GVPA 5F05A 1PKWA 1BEDA 3KTLA 3I69A 2L4CA 1LU4A 3ZMKA 5J4UA 4V2LA 1CQGA 2V1MA 2DIYA 2ZNMA 3GYKA 2MMOA 4KB3A 5BMUA 4MJBA 3EWLA 2YZUA 3GSTA 3EMXA 4XHMA 1FOVA 3IAS2 2XPDA 4V2NA 3GX0A 3DVXA 3VPTA 1PD21 2L6CA 2MMAA 3IK9A 3DMLA 1SKSB 2DJ0A 2NDOA 3HVVA 3IBHA 4KDYA 2LV3A 4IJIA 3EVIA 5D9VA 4RI7A 4EUYA 1ZMAA 4JEDA 3CSJA 1PA3A 2IIYA 18GSA 4JR6A 3RHCA 2TRXA 3HZ8A 4MF6A 4O92A 2P5RA 4F9ZA 4KE3A 3L4NA 4RQRA 3A5WA 1K0NA 3D4MA 3WYWA 2H1GA 5CRWA 2H66A 5DCGA 2L57A 1LBKA 1MDKA 1GTIA 2E2GA 1ERWA 4LLRA 1O73A 2H74A 1R5PA 1THOA 2YPMA 3KH9A 1QUWA 5DQSA 2O7KA 1N2AA 3VWUA 1GSEA 2EIQA 5DQYA 1XOAA 2CZ3A 1SL1B 2WJUA 1A23A 3QAWA 5GAND 4O5RA 3MAKA 1ZYEA 3FZ9A 4ILFA 5DVBA 5GZZB 4OFTA 4J2FA 1GULA 1H4OA 3EU4A 3GKMA 1V40A 1FB6A 1TRWA 1XBSA 5EVOA 2DJ2A 2OACA 2GGTA 5GSTA 4DSQA 4ECIA 1H75A 2RIIA 3P90A 3HJMA 1VF2A 4K8MA 1GL8A 3EURA 6GSSA 3GKNA 3G7IA 4G0KA 2PVQA 2YN1A 4FO5A 4Q5FA 1ERVA 1A8LA 4ZB6A 2XBQA 1X9WB 4XS1A 2KP1A 1OC9B 4RQXA 1R26A 4OMVA 2H0GA 1PX6A 3KXOA 4N0VA 2UZ8A 2P5QA 1GUKA 4V2MA 3LXZA 2B1KA 2GS3A 3FZ5A 4ZBDA 3GURA 1CQHA 4XIHA 3UOMA 1KTEA 3WGXA 4Q5NA 1EV4A 2AHEA 3OR5A 3QCPA 4IJ3A 3W8SA 3KZQA 5J9CA 2WS2A 2CV4A 3ZVJA 4IBPA 2V41A 2CVKA 3UBKA 3FW2A 2VCVA 2WRTA 3GMFA 3HDCA 4LA1A 1JHBA 3ZYWA 3VK9A 1NHOA 3FHKA 2N5BA 3GKKA 5E4WA 3RDWA 2I81A 4Q5RA 3TUEA 2ALBA 1Q4JA 2YJ7A 2PERA 1Z6NA 2VLVA 1JZWA 3G7YA 3Q19A 2VLUA 2O85A 3F3RA 2ON7A 4MH3A 4IS0A 3SBCA 5DBQA 2L5OA 1GSYA 3N9JA 4KSOA 1JLVA 2HSMB 2HZFA 3C1RA 2HLSA 1GWCA 2OBKA 3HJPA 2HRFA 4KA0A 1XWGA 4TOPA 2H8LA 3TRXA 2GDRA 4ZB8A 5AGYA 3NZNA 1XW5A 2GQMA 5ENUA 1NSWA 3FR9A 5IMDA 3IPZA 4BA7A 5IQYA 4ML6A 4YQMA 2G2QA 5C04A 5ID2B 5HFGA 1EEMA 2DBCA 1PKZA 4JE1A 4XS4B 1PRXA 1WMJA 1EOHA 4X1UA 4GLTA 1A0FA 1SD8A 1BAYA 4OO5A 3HYPA 1SL0B 1V57A 2RUEA 3D22A 2FY6A 10GSA 2VD1A 3CSIA 2M72A 3ERFA 1E6BA 2IN3A 2BMXA 4GSTA 2MYGA 3UBLA 3ZL5A 1O8XA 3W6GA
chains in the Genus database with same CATH superfamily
2DC5A 2L59A 1FHEA 3K8NA 2R0PA 1YKCA 5IMCA 2JSZA 1KBNA 5A4WA 3L0HA 1OC9A 3DEXA 1TI3A 5ECLB 2X8HA 3MWHA 3R3EA 2KP2A 2IPAA 4HU7A 3H8QA 1YQ1A 4Z2UA 2WVYA 1GTUA 1M7TA 4MP4A 3D6IA 4MF7A 1WE0A 2CVBA 1TP9A 4ICYA 3LGCA 3I6AA 2AAWA 13GSA 1JZDA 2H30A 4NMUA 2H6ZA 1PL2A 4KAEA 3A2WA 2HYXA 4TKYA 2B7KA 1V98A 4K7NA 3LORA 2E0QA 5J4YA 5GSSA 4G01A 2R0GA 2LS5A 1SU9A 4IELA 3J7Yk 3GX8A 4E8HA 4K0NA 4TN8A 5G30A 3GNJA 1SJZA 1K3LA 2WB9A 4QL9A 1G6WA 3KTBA 2OT3A 3F4RA 4DSSA 2GZZA 3D5JA 3LXTA 3GKXA 2B1LA 2WGRA 3M3MA 4TR0A 4IN0A 3TRPA 4ZXGA 5B7CA 1A2LA 2H72A 6GSVA 3PGTA 8GSSA 5BMUB 5HR3A 3P2AA 1U87A 2PMTA 1GSUA 3JCML 4NV5A 2C3QA 2RUFA 2HSNA 3TJKA 2DSAA 5ECIB 5EL8A 1T4YA 3CSHA 4WETA 1XWBA 3RBTA 1T4ZA 2IL3A 1FB0A 1QGVA 3F4TA 4GRFA 3VI5A 4EDZA 2VLTA 1GLPA 1BG5A 1DBYA 2LJAA 4KDXA 4EIPA 2LNSA 3GRXA 3EE2A 5H5RA 11GSA 2C3NA 3GA4A 1XWAA 2YWIA 3MDKA 1JZOA 3ERGA 3FEUA 1YY7A 3ZZXA 4IQAA 4IVFA 3KP9A 1A2JA 3TJGA 2VUPA 2YJHA 2X64A 1FOHA 2O8VB 2AV4A 3PINA 4D73B 4MDCA 2QSIA 5CAXA 5B6MA 2H0IA 3LWAA 2FHEA 5D9WA 1PX7A 1F2EA 3LJRA 5DJMA 2BTOT 2YNXA 1MD3A 4HSCX 2C0EA 1M9AA 1T8EB 3KH7A 4L8EA 1Z5YE 3G7JA 1A24A 3DRNA 1XPVA 2JSYA 2C3TA 3ME7A 2WZ9A 1J0FA 3QAVA 2LUSA 2N5FA 3Q18A 2K6VA 2OE1A 5A5HB 2JZTA 1B9XC 4NXIA 2K8SA 1S3AA 2HQTA 2MZCA 3WT2A 4Z2TA 2ES7A 4N30A 3QFBC 1BX9A 3IXRA 5JWRB 3ZVJD 1EEJA 5DAKA 1SJ6A 2GSQA 4GTUA 5KOXA 3KGKA 3IV4A 2REMA 4G10A 3CTGA 1FAAA 2LEGA 3H79A 3VFIA 5IPGA 3F4SA 2VCQA 2OADA 3NIVA 5LD0A 3C7MA 1WWJA 3GSSA 3LG6A 2H0HA 2YANA 5ECKB 3DGQA 4TR1A 4MCUA 1DUGA 1I5GA 3L9VA 3BCIA 4N3ZA 4HQSA 5D8IA 1LJRA 3C71A 3CHXC 4PXOA 4JBBA 1F6MC 2H71A 1EGRA 5AIVA 3HVNA 1ML6A 5ECMB 3TOUA 4I2UA 2PBJA 3FY7A 1XW6A 4MZBA 2HFDA 5G31A 3VWWA 2OE3A 1BJXA 2H70A 3VPQA 4WBRD 1V9WA 9GSSA 5LCZA 3V1WA 5IO0A 3CTFA 4WR4A 2JL4A 2IJYA 5CRGA 5KN3A 2FNOA 1FO5A 3KMOA 2I9HA 4GDFA 1SKWB 6GSXA 1B4PA 5LNKe 4IW9A 3F0IA 3O3TA 1K3YA 4HU9A 3G9BA 2C8UA 1YZXA 5D96A 3NOFA 3UIWA 1YEXA 4BWQA 1V58A 4RI6A 4D73A 2GT5A 3CQFA 2VL3A 5D93A 2VL2A 3EU3A 5F0GA 5ECRB 2OJLA 1GP1A 5G2ZA 4WEYA 1A8YA 2IFQA 2VCTA 3MNGA 3UAPA 3C8EA 2IMEA 2DKIA 2N5AA 1DE1A 1HQOA 4PHZC 1M2DA 2LNTA 3TOTA 1GRXA 2B3SA 4MF5A 5J9BA 2GLRA 5CP1A 2R37A 2VCZA 2HRKA 1ZYQB 1G6YA 1QQ2A 4PQHA 4GWRA 3F6DA 5CYYA 3GHAA 2PVOC 5B8BA 4XS6A 2UV8G 2HNLA 3ZFBA 4IHUA 4PQ1A 4CHSA 2X99A 3LQ7A 2ZCTA 1PN9A 1R7HA 5IMVA 3VLNA 1G0TA 1NHYA 2GT6A 4HEA2 1OE8A 5DJLA 2DJKA 3GTUA 4MZWA 3QD9A 3APOA 3QAGA 4AJ6A 4K0GA 1X9SB 6GSUA 2CT6A 4MMMA 1MD4A 3SWLA 5AN1A 5EPFA 1ZYNA 4IQ1A 3I43A 3MSZA 2YP6A 2G0FA 4Z2RA 1TU8A 1AAZA 5HR0A 3EINA 1WP0A 4ZILA 3CWGA 1Z9HA 1SVMA 3J7Yb 1ON4A 5E59A 2VO4A 5IPHA 2DJ3A 4KSMA 3IDVA 3H4KA 5L71A 1PFOA 4MK3A 2MBSA 2WCIA 1HYUA 1XWKA 3PPUA 4AKHA 4K6XA 2LRTA 3GFKA 4GQCA 2K18A 4HQZA 3DYRA 1GUHA 3IHGA 2DLXA 1C72A 2GQKA 3LYPA 1EP8A 2GZYA 4I5QA 1F37A 20GSA 1HNBA 4KUNA 2JACA 1MDIA 1M9BA 1QMVA 4MZCA 4EO3A 5IMZA 4QQ7A 1YF0A 3ISOA 4YAVA 1USBA 2LJKA 2RLIA 6GSWA 4F03A 2PGTA 1TRSA 3U5RE 1MDJA 2L6DA 4DSSB 4F82A 5KN0A 1ZOFA 2HE3A 2CQ9A 2FA8A 4KH7A 2IWTA 2HI7A 4G0IA 3APSA 1G7EA 1SK2A 1UA5A 1O7UA 4TVEA 1U3AA 1E2YA 2C0FA 1J9BA 3UVHA 5F06A 1B9YC 1Z6MA 2HSYA 3F8UA 1YVLA 3KP8A 2C4JA 2HSNB 4F2IA 3HD5A 4AF2A 2HRAA 1MTCA 4NHWA 4NHZA 2PWJA 3P8WA 1V2AA 2B7JA 1FW1A 2CAQA 2XC2A 1ABAA 4I8BA 5JWQB 4XTSA 3DWVA 4LL1B 2LRNA 3FMWA 1K0AA 1BF5A 4KCAA 3LYKA 2VL2C 3ZRDA 3EPTA 3LFLA 2R6KA 3CYNA 1X5DA 3L9UA 5GAPD 4I6XA 4ZB7A 4A5PA 1FVKA 2KLXA 3E9JB 1M0UA 2R5GA 1TOFA 4EDYA 1HNCA 4N11A 4FYCA 1HNAA 3F63A 2WULA 4O7HA 4MA9A 2VL9A 2VOCA 2O36A 4MJEA 2YWMA 2AJQB 1OC8A 3O76A 1OAZA 3IC4A 1THXA 3ZIJA 1KNGA 4BVXA 3RPPA 5IOWA 1K0MA 1GH2A 5DAKB 3F3QA 2CZ2A 3FZ4A 3TGZA 1B4QA 1EWXA 3IAM2 4BL7A 1M3IA 3F6FA 3BOAA 4PI0C 1MEKA 4XRAA 4HI7A 3M9JA 3VI7A 3ED3A 3UJ1A 5EY6A 1SENA 1SKRB 1SL2B 2DJ1A 4G9HA 1Z3EA 4HS1A 2B5XA 17GSA 2PN8A 2WZSA 4TR1B 1KEBA 2EFEA 2JZSA 3QPMA 1A0RP 2MMZA 4YH2A 2PU9C 3M0FA 2OA7A 2K8VA 4GSSA 1AQVA 3GN3A 1ZL9A 1VF1A 3ZREA 5G5EA 4HZ4A 1DE2A 2NPBA 5B8AA 3HA9A 3Q6OA 3PH9A 4DEJA 4E68A 4EF0A 1GTAA 3DKSA 3Q74A 4BPYA 2H76A 5G1KA 3TKPA 2B5YA 2CA8A 3KMNA 3WGDA 2HSHA 3D21A 5ABRA 1QFNA 1HD2A 4PGTA 1FVJA 22GSA 4PUFC 1N8JA 1SYRA 3FZAA 5JCGA 5ELGA 1ZGNA 4KW6A 4MJCA 2H6XA 4F0CA 2H73A 4L5OA 4I97A 1YF1A 1X5CA 3ZTLA 1UN2A 3HCZA 2O3EA 2VCWA 4KX4A 1ERTA 2IFQB 1FG4A 2H1DA 4EC0A 2E2MA 3C73A 1S3RA 5ECOB 2JADA 2KOKA 4HJ2A 3HHVA 5ELAA 1XOBA 2H19A 1R4WA 2D2ZA 2R3XA 1GTBA 2XBIA 3FK8A 4AKXB 2DJJA 3RPNA 3IC8A 2HRKB 2YV9A 6GSYA 2HRNA 4OFNA 1Y25A 4YQVA 4ID0A 4YKGA 4BVYA 3VURA 4DVCA 4KNDA 3QOUA 3US3A 5J3RA 2VM1A 1ZCPA 4G2EA 2MBTA 1ILOA 1PMTA 1A2MA 2CAIA 1TU7A 5IIZA 5CRDA 3GTUB 3HZ4A 3HMJG 2C0GA 2WVXA 2FA4A 1O85A 3HVXA 2WW1A 4NV2A 16GSA 4F0BA 1EP7A 2A2RA 4FH8A 2GSRA 4CY8A 3M1GA 1ACVA 2AUVA 4KDUA 1YJ6A 4KGIA 3IRAA 2I3YA 1JZRA 1GUMA 2K9FA 3DVWA 2C0DA 4K1FA 1Y6EA 3A2XA 4AJ7A 1G7OA 2H6YA 3LEFA 4ECBA 2A4HA 4JRRA 1EV9A 1BQ7A 4NAXA 4O5UA 2YWOA 1PSQA 1XXUA 2OBIA 2YZHA 1AXDA 3IK7A 1XIYA 2F3MA 1T3BA 1RW1A 4TRXA 3LW9A 3RFRC 2RM6A 1XVQA 1UVZA 2AB6A 2GSSA 4HOJA 5JCUA 4V1Ap 3IHQA 3O6TA 5B6NA 3N5OA 4HUAA 1OYJA 2F8AA 2CVDA 3FYGA 1O81A 4HZ2A 4ZL7A 4LL4B 2L4QA 3A3TA 4TXVA 5BRTA 4CY6A 4CDOA 1DSBA 4POMA 2LSTA 4HDEA 2HZEA 4OWYA 3VWVA 1Z7PA 12GSA 1OKTA 1GSDA 1N25A 4PNFA 5AIXA 4Z7XA 4ULXA 5A5KA 4OCFA 5ECNB 3TDGA 1PL1A 1ZZYA 1BG1A 1JFUA 1SD9A 4YAPA 3HVSA 3QR6A 2OKAA 4ZBAA 2WFCA 5ECQB 4GF0A 1TXXA 3BJ5A 3I9V2 3H93A 1SJIA 6GSTA 4WXTA 1RQMA 3H1NA 3TRQA 4N0ZA 2P31A 2FLSA 1X0RA 3ZLPA 5ECHB 3LSZA 5KEJA 2QKEA 2EFHA 1ZYPA 3GV1A 1U88A 1F3AA 2LRCA 1SK1A 4IGJA 3APQA 1K0DA 4EVMA 1WOUA 1TK0B 1W89A 2EIRA 4POBA 2XHFA 2OE0A 1OKDA 1XW9A 2WVZA 2B6MA 5ECSA 1VGLA 5DALA 2RM5A 3E0UA 2Z9SA 5D9TA 2FWFA 2JZRA 19GSA 2NBSA 4JZQA 1TRVA 1Q98A 2V6OA 1XCCA 2PUKC 3GIXA 3L9SA 2O89A 2LQOA 4ZB9A 2WW3A 1JLWA 1GLQA 2X8GA 7GSSA 2VM2A 5DDLA 3ZITA 4TR4A 2E7PA 2FWHA 1IYIA 3P7XA 2MMNA 4N10A 1OE7A 4ML1A 2J23A 4BIKA 4CW9A 1YKAA 2VKZG 4O5QA 3ME8A 4TXOA 2CX3A 4ZL8A 3CRTA 3TCOA 1TJDA 4J56E 4PQIA 1TK5B 1I1IP 2LTKA 4EXJA 4NPBA 3TKRA 3GH6A 4BVXB 3TKSA 4OO4A 2DIZA 2IMDA 3TJJA 3TU3B 2LJRA 4BL7B 4PX1A 3DD3A 2QC7A 4EL1A 4L5LA 5H5SA 1WJKA 4MPFA 4O32A 4WF5A 5INYA 4G19A 1WRYA 4EKZA 1K0CA 5J41A 4K7IA 3KCMA 4L0UA 1NM3A 1YEWC 4WR5A 3D0ZA 5FHIA 1TKDB 2VIMA 2QGVA 1AUCA 1GSSA 4TW5A 5A4VA 2B5EA 1UC7A 2FWGA 3FR6A 3QMXA 2LQQA 3KJYA 4X0XA 4MABA 2JU5A 5HFKA 1SVOA 4POLA 4KCEA 5JCWA 1GSFA 1Z7RA 2DMMA 1TW9A 4WF4A 2V32A 3EC3A 5A4UA 4FXYP 2NTOA 3AY8A 4AI6A 2IMIA 5CNWA 4GCIA 3R2QA 1QK8A 2ON5A 3IR4A 1ST9A 4FYUA 1B8XA 4H86A 2EFCA 5J4VA 1O8WA 3QFAC 2FWEA 1EZKA 1F9MA 1U6TA 5HR2A 1X5EA 5DCHA 3A5IA 3KD0A 3M9KA 3IE3A 1PGTA 2DMLA 3GL5A 2IMKA 3CXGA 2A2SA 5IMFA 2A2PA 4AGSA 4MLYA 1M2AA 4ECCA 1XFLA 1S3CA 4XRDA 4EIQA 1AC1A 4MJAA 2L5LA 1F3BA 4GXZA 2O5VA 5A34A 3EYTA 4POKA 5IO2A 4PURA 3TKQA 4RUVA 4IKHA 2FD3A 1AW9A 2V2GA 3HXSA 5C00A 3VWXA 4LMWA 4YKFA 4PTSA 3UARA 4I2TA 5IM9A 3KIJA 3FKFA 5A1NA 1GSQA 5IOXA 3RHBA 3WGEA 2EFDA 1XWCA 4GSNA 1YEPA 2DKHA 3TKSE 2X4AA 2A4VA 1K0OA 2H1AA 4MPGA 3QDNA 4BVYB 2F9SA 4WKWA 3TJFA 2HT9A 1AQWA 4JR4A 5G1LA 4ZIJA 4GQFA 1TI1A 4USSA 2O87A 1J08A 3BCKA 2C80A 2R2JA 3KM6A 4J57E 2XPEA 3ZIVA 1TXUA 5FWGA 3TB2A 3FR3A 2F8FA 4FIWA 2WVXB 4AJ8A 5COHA 3KEBA 2YV7A 1TTZA 5HQPA 1ERUA 5CRHA 2WDUA 4XCSA 4IP1A 4G0LA 1PN0A 1SK0A 1VF3A 4K2DA 2NVLA 1OC3A 1VRSD 3HKRA 3WD6A 2C1YA 5KN1A 1XVWA 3C1SA 1O6JA 2QA2A 3HY2A 2ZUPA 1B48A 1K3OA 1URMA 4V1Ag 2KUCA 4QL7A 2M46A 2KHPA 2YWNA 1TK8B 2M80A 3HJOA 3DXBA 2V6KA 1GNEA 3U6VA 1XZOA 4P3YB 2PPTA 3TKSC 4MH2A 1M99A 2EIOA 3A2VA 3CRUA 2FUG2 3UVTA 1TDIA 2FGXA 1T1VA 3IA1A 1AQXA 4K7OA 3GH9A 1S4BP 5AISA 2BJXA 1PQNA 14GSA 3FRCA 2LKUA 2HSMA 1T00A 1YDKA 3EMPA 3ERWA 4Q5QA 5J40A 4L0WA 2GSTA 1S3DA 2HXKA 4MNNA 4FYBA 4PUAA 3RAZA 3L78A 1OVNA 2HZEB 4OD7A 4FQUA 4X43A 3PR8A 2CX4A 5J5NA 1GNWA 2IMFA 2P0GA 4JU5A 4ACSA 3GUSA 1VF4A 2F51A 5ID2A 4WBJA 1AIUA 5H5QA 1IYHA 2EC4A 1SYXA 1QXHA 4ZBBA 5HFIA 4W66A 4EE0A 5CO3A 5FT3A 4XS4A 1M2BA 2TIRA 4PNGA 5D9XA 5CREA 3E3EA 3F9UA 4OFMA 2AYTA 3CBUA 5G5FA 1EOGA 1WPIA 2I4AA 2H01A 3MYDA 1K0BA 1X9MB 2VCXA 5F8BA 3ZMLA 3D4TA 4X4JA 1WIKA 4TR3A 3TJBA 4K9ZA 5KOWA 2FCHA 4KF9A 2H1BA 3W8JA 4ISDA 1U3IA 5F07A 2H75A 1TRUA 3WT1A 3ZFLA 3BBYA 3UMAA 2QA1A 4HJMA 5IMAA 4ZL9A 3BD2A 2J9HA 5KN2A 5DALB 2YOIA 3GL3A 2R4VA 4QMKA 1I9DA 1BYEA 1RK4A 2VD0A 5ECPB 4NWYA 4IP6A 1EGOA 3IOSA 2YCDA 3S9FA 2X8CA 5HR1A 4E8EA 1R5AA 2GZPA 4BWSA 3UEMA 1T7PB 2TRCP 3CMIA 5JWOB 3DIEA 4DSRA 4OCEA 4YQUA 4ECJA 3M8NA 1NW2A 1W4VA 2VAFA 3UL3A 2GQLA 5D73A 3RGBC 4TXOB 2I1UA 4LMVA 2GTUA 2GVPA 5F05A 1PKWA 1BEDA 3KTLA 3I69A 2L4CA 1LU4A 3ZMKA 5J4UA 4V2LA 1CQGA 2V1MA 2DIYA 2ZNMA 3GYKA 2MMOA 2WW0A 4KB3A 5BMUA 4MJBA 3EWLA 2YZUA 3GSTA 3EMXA 4XHMA 1FOVA 3IAS2 2XPDA 4V2NA 3GX0A 3DVXA 3VPTA 1PD21 2L6CA 2MMAA 3IK9A 3DMLA 1SKSB 2DJ0A 4K5RA 2NDOA 3HVVA 3IBHA 4KDYA 2LV3A 4IJIA 3EVIA 5D9VA 4RI7A 4EUYA 1ZMAA 4JEDA 3CSJA 1PA3A 2IIYA 18GSA 4JR6A 3RHCA 2TRXA 3HZ8A 4MF6A 4O92A 2P5RA 4F9ZA 4KE3A 3L4NA 4RQRA 3A5WA 1K0NA 3D4MA 3WYWA 2H1GA 5CRWA 2H66A 5DCGA 2L57A 1LBKA 1MDKA 1GTIA 3MIXA 2E2GA 1ERWA 2H1LA 4LLRA 4AKIA 1O73A 2H74A 1R5PA 1THOA 2YPMA 3KH9A 1QUWA 5DQSA 2O7KA 1N2AA 3VWUA 1GSEA 2EIQA 5DQYA 1XOAA 2CZ3A 4K5SA 1SL1B 2WJUA 1A23A 5A5HA 3QAWA 5A34B 4O5RA 5GAND 3MAKA 1ZYEA 3FZ9A 4ILFA 5DVBA 5GZZB 5A1NB 4OFTA 4J2FA 1GULA 1H4OA 3EU4A 3GKMA 1V40A 1FB6A 1XG8A 1TRWA 1XBSA 5EVOA 2DJ2A 2OACA 2GGTA 5GSTA 4DSQA 4ECIA 1H75A 2RIIA 3P90A 3HJMA 1VF2A 4K8MA 1GL8A 3EURA 6GSSA 3GKNA 3G7IA 4G0KA 2PVQA 2YN1A 4FO5A 4Q5FA 1ERVA 1A8LA 4ZB6A 2XBQA 1X9WB 4XS1A 2KP1A 2R0CA 1OC9B 4RQXA 1R26A 4OMVA 5J47A 2H0GA 1PX6A 1SVLA 3KXOA 4N0VA 4K2XA 2UZ8A 2P5QA 1GUKA 4V2MA 3LXZA 2B1KA 2GS3A 3FZ5A 4ZBDA 3GURA 1CQHA 4XIHA 3UOMA 1KTEA 3WGXA 4Q5NA 1EV4A 2AHEA 3OR5A 3QCPA 4IJ3A 3W8SA 3KZQA 5J9CA 2WS2A 2CV4A 3ZVJA 4IBPA 2V41A 2CVKA 3UBKA 3FW2A 2VCVA 2WRTA 3GMFA 3HDCA 4LA1A 1JHBA 3ZYWA 3VK9A 1NHOA 3FHKA 2N5BA 3GKKA 5E4WA 3RDWA 2I81A 4Q5RA 3TUEA 2ALBA 1Q4JA 2YJ7A 2PERA 1Z6NA 2VLVA 1JZWA 3G7YA 3Q19A 2VLUA 2O85A 3F3RA 2ON7A 4MH3A 4IS0A 2X49A 3SBCA 5DBQA 2L5OA 1GSYA 3N9JA 4KSOA 1JLVA 2HSMB 4PI2C 2HZFA 3C1RA 2HLSA 1GWCA 2OBKA 3HJPA 2HRFA 4KA0A 1XWGA 4TOPA 2WW2A 2H8LA 2GDRA 3TRXA 4ZB8A 5AGYA 3NZNA 1XW5A 2GQMA 5ENUA 1NSWA 3FR9A 5IMDA 3IPZA 4BA7A 5IQYA 4ML6A 1Y1UA 4YQMA 2G2QA 5C04A 5ID2B 5HFGA 4AKGA 1EEMA 2DBCA 1M3JA 1PKZA 4JE1A 4XS4B 1PRXA 1WMJA 1EOHA 4X1UA 4GLTA 1A0FA 1SD8A 1BAYA 4OO5A 3HYPA 1SL0B 1V57A 2RUEA 3D22A 2FY6A 10GSA 2VD1A 3CSIA 2M72A 3ERFA 1E6BA 2IN3A 2BMXA 4GSTA 2MYGA 3UBLA 3ZL5A 1O8XA 3W6GA
chains in the Genus database with same CATH topology
2DC5A 2L59A 1FHEA 3K8NA 2R0PA 1YKCA 5IMCA 2JSZA 1KBNA 5A4WA 3L0HA 1OC9A 3DEXA 1TI3A 5ECLB 2X8HA 3MWHA 3R3EA 2KP2A 2IPAA 4HU7A 3H8QA 1YQ1A 4Z2UA 1GTUA 1M7TA 4MP4A 3D6IA 4MF7A 1WE0A 2CVBA 1TP9A 4ICYA 3LGCA 3I6AA 2AAWA 13GSA 1JZDA 2H30A 4NMUA 2H6ZA 1PL2A 4KAEA 3A2WA 2HYXA 4TKYA 2B7KA 1V98A 4K7NA 3LORA 2E0QA 5J4YA 5GSSA 4G01A 2R0GA 2LS5A 1SU9A 4IELA 3J7Yk 3GX8A 4E8HA 4K0NA 4TN8A 5G30A 3GNJA 1SJZA 1K3LA 2WB9A 4QL9A 1G6WA 3KTBA 2OT3A 3F4RA 4DSSA 2GZZA 3D5JA 3LXTA 3GKXA 2B1LA 2WGRA 3M3MA 4TR0A 4IN0A 3TRPA 4ZXGA 5B7CA 1A2LA 2H72A 6GSVA 3PGTA 8GSSA 5BMUB 5HR3A 3P2AA 1U87A 2PMTA 1GSUA 3JCML 4NV5A 2C3QA 2RUFA 2HSNA 3TJKA 2DSAA 5ECIB 5EL8A 1T4YA 3CSHA 4WETA 1XWBA 3RBTA 1T4ZA 2IL3A 1FB0A 1QGVA 3F4TA 4GRFA 3VI5A 4EDZA 2VLTA 1GLPA 1BG5A 1DBYA 2LJAA 4KDXA 4EIPA 2LNSA 3GRXA 3EE2A 5H5RA 11GSA 2C3NA 3GA4A 1XWAA 2YWIA 3MDKA 1JZOA 3ERGA 3FEUA 1YY7A 3ZZXA 4IQAA 4IVFA 3KP9A 1A2JA 3TJGA 2VUPA 2YJHA 2X64A 1FOHA 2O8VB 2AV4A 3PINA 4D73B 4MDCA 2QSIA 5CAXA 5B6MA 2H0IA 3LWAA 2FHEA 5D9WA 1PX7A 1F2EA 3LJRA 5DJMA 2BTOT 2YNXA 1MD3A 2C0EA 1M9AA 1T8EB 3KH7A 4L8EA 1Z5YE 3G7JA 1A24A 3DRNA 1XPVA 2JSYA 2C3TA 3ME7A 2WZ9A 1J0FA 3QAVA 2LUSA 2N5FA 3Q18A 2K6VA 2OE1A 5A5HB 2JZTA 1B9XC 4NXIA 2K8SA 1S3AA 2HQTA 2MZCA 3WT2A 4Z2TA 2ES7A 4N30A 3QFBC 1BX9A 3IXRA 5JWRB 3ZVJD 1EEJA 5DAKA 1SJ6A 2GSQA 4GTUA 5KOXA 3KGKA 3IV4A 2REMA 4G10A 3CTGA 1FAAA 2LEGA 3H79A 3VFIA 5IPGA 3F4SA 2VCQA 2OADA 3NIVA 5LD0A 3C7MA 1WWJA 3GSSA 3LG6A 2H0HA 2YANA 5ECKB 3DGQA 4TR1A 4MCUA 1DUGA 1I5GA 3L9VA 3BCIA 4N3ZA 4HQSA 5D8IA 1LJRA 3C71A 4PXOA 4JBBA 1F6MC 2H71A 1EGRA 5AIVA 1ML6A 5ECMB 3TOUA 4I2UA 2PBJA 3FY7A 1XW6A 4MZBA 2HFDA 5G31A 3VWWA 2OE3A 1BJXA 2H70A 3VPQA 4WBRD 1V9WA 9GSSA 5LCZA 3V1WA 5IO0A 3CTFA 4WR4A 2JL4A 2IJYA 5CRGA 5KN3A 2FNOA 1FO5A 3KMOA 2I9HA 4GDFA 1SKWB 6GSXA 1B4PA 5LNKe 4IW9A 3F0IA 3O3TA 1K3YA 4HU9A 3G9BA 2C8UA 1YZXA 5D96A 3NOFA 3UIWA 1YEXA 4BWQA 1V58A 4RI6A 4D73A 2GT5A 2VL3A 5D93A 2VL2A 3EU3A 5F0GA 5ECRB 2OJLA 1GP1A 5G2ZA 4WEYA 1A8YA 2IFQA 2VCTA 3MNGA 3UAPA 3C8EA 2IMEA 2DKIA 2N5AA 1DE1A 1HQOA 1M2DA 2LNTA 3TOTA 1GRXA 2B3SA 4MF5A 5J9BA 2GLRA 5CP1A 2R37A 2VCZA 2HRKA 1ZYQB 1G6YA 1QQ2A 4PQHA 4GWRA 3F6DA 5CYYA 3GHAA 2PVOC 5B8BA 4XS6A 2UV8G 2HNLA 3ZFBA 4IHUA 4PQ1A 4CHSA 2X99A 3LQ7A 2ZCTA 1PN9A 1R7HA 5IMVA 3VLNA 1G0TA 1NHYA 2GT6A 4HEA2 1OE8A 5DJLA 2DJKA 3GTUA 4MZWA 3QD9A 3APOA 3QAGA 4AJ6A 4K0GA 1X9SB 6GSUA 2CT6A 4MMMA 1MD4A 3SWLA 5AN1A 5EPFA 1ZYNA 4IQ1A 3MSZA 3I43A 2YP6A 2G0FA 4Z2RA 1TU8A 1AAZA 5HR0A 3EINA 1WP0A 4ZILA 3CWGA 1Z9HA 1SVMA 3J7Yb 1ON4A 5E59A 2VO4A 5IPHA 2DJ3A 4KSMA 3IDVA 3H4KA 5L71A 4MK3A 2MBSA 2WCIA 1HYUA 1XWKA 3PPUA 4AKHA 4K6XA 2LRTA 3GFKA 4GQCA 2K18A 4HQZA 3DYRA 1GUHA 3IHGA 2DLXA 1C72A 2GQKA 3LYPA 1EP8A 2GZYA 4I5QA 1F37A 20GSA 1HNBA 4KUNA 2JACA 1MDIA 1M9BA 1QMVA 4MZCA 4EO3A 5IMZA 4QQ7A 1YF0A 3ISOA 4YAVA 1USBA 2LJKA 2RLIA 6GSWA 4F03A 2PGTA 1TRSA 3U5RE 1MDJA 2L6DA 4DSSB 4F82A 5KN0A 1ZOFA 2HE3A 2CQ9A 2FA8A 4KH7A 2IWTA 2HI7A 4G0IA 3APSA 1G7EA 1SK2A 1UA5A 1O7UA 4TVEA 1U3AA 1E2YA 2C0FA 1J9BA 3UVHA 5F06A 1B9YC 1Z6MA 2HSYA 3F8UA 1YVLA 3KP8A 2C4JA 2HSNB 4F2IA 3HD5A 4AF2A 2HRAA 1MTCA 4NHWA 4NHZA 2PWJA 3P8WA 1V2AA 2B7JA 1FW1A 2CAQA 2XC2A 1ABAA 4I8BA 5JWQB 4XTSA 3DWVA 4LL1B 2LRNA 3FMWA 1K0AA 1BF5A 4KCAA 3LYKA 2VL2C 3ZRDA 3EPTA 3LFLA 2R6KA 3CYNA 1X5DA 3L9UA 5GAPD 4I6XA 4ZB7A 4A5PA 1FVKA 2KLXA 3E9JB 1M0UA 2R5GA 1TOFA 4EDYA 1HNCA 4N11A 4FYCA 1HNAA 3F63A 2WULA 4O7HA 4MA9A 2VL9A 2VOCA 4MJEA 2YWMA 2AJQB 1OC8A 3O76A 1OAZA 3IC4A 1THXA 3ZIJA 1KNGA 4BVXA 3RPPA 5IOWA 1K0MA 1GH2A 5DAKB 3F3QA 2CZ2A 3FZ4A 3TGZA 1B4QA 1EWXA 3IAM2 4BL7A 3F6FA 3BOAA 1MEKA 4XRAA 4HI7A 3M9JA 3VI7A 3ED3A 3UJ1A 5EY6A 1SENA 1SKRB 1SL2B 2DJ1A 4G9HA 1Z3EA 4HS1A 2B5XA 17GSA 2PN8A 4TR1B 1KEBA 2EFEA 2JZSA 3QPMA 1A0RP 2MMZA 4YH2A 2PU9C 3M0FA 2OA7A 2K8VA 4GSSA 1AQVA 3GN3A 1ZL9A 1VF1A 3ZREA 5G5EA 4HZ4A 1DE2A 2NPBA 5B8AA 3HA9A 3Q6OA 3PH9A 4DEJA 4E68A 4EF0A 1GTAA 3DKSA 3Q74A 4BPYA 2H76A 5G1KA 3TKPA 2B5YA 2CA8A 3KMNA 3WGDA 2HSHA 3D21A 5ABRA 1QFNA 1HD2A 4PGTA 1FVJA 22GSA 4PUFC 1N8JA 1SYRA 3FZAA 5JCGA 5ELGA 1ZGNA 4KW6A 4MJCA 2H6XA 4F0CA 2H73A 4L5OA 4I97A 1YF1A 1X5CA 3ZTLA 1UN2A 3HCZA 2VCWA 4KX4A 1ERTA 2IFQB 1FG4A 2H1DA 4EC0A 2E2MA 3C73A 5ECOB 2JADA 2KOKA 4HJ2A 3HHVA 5ELAA 1XOBA 2H19A 1R4WA 2D2ZA 2R3XA 1GTBA 2XBIA 3FK8A 4AKXB 2DJJA 3RPNA 3IC8A 2HRKB 2YV9A 6GSYA 2HRNA 4OFNA 1Y25A 4YQVA 4ID0A 4YKGA 4BVYA 3VURA 4DVCA 4KNDA 3QOUA 3US3A 5J3RA 2VM1A 1ZCPA 4G2EA 2MBTA 1ILOA 1PMTA 1A2MA 2CAIA 1TU7A 5IIZA 5CRDA 3GTUB 3HZ4A 3HMJG 2C0GA 2FA4A 1O85A 3HVXA 4NV2A 16GSA 4F0BA 1EP7A 2A2RA 4FH8A 2GSRA 4CY8A 3M1GA 1ACVA 2AUVA 4KDUA 1YJ6A 4KGIA 3IRAA 2I3YA 1JZRA 1GUMA 2K9FA 3DVWA 2C0DA 4K1FA 1Y6EA 3A2XA 4AJ7A 1G7OA 2H6YA 3LEFA 4ECBA 2A4HA 4JRRA 1EV9A 1BQ7A 4NAXA 4O5UA 2YWOA 1PSQA 1XXUA 2OBIA 2YZHA 1AXDA 3IK7A 1XIYA 2F3MA 1T3BA 1RW1A 4TRXA 3LW9A 2RM6A 1XVQA 1UVZA 2AB6A 2GSSA 4HOJA 5JCUA 4V1Ap 3IHQA 3O6TA 5B6NA 3N5OA 4HUAA 1OYJA 2F8AA 2CVDA 3FYGA 1O81A 4HZ2A 4ZL7A 4LL4B 2L4QA 3A3TA 4TXVA 5BRTA 4CY6A 4CDOA 1DSBA 4POMA 2LSTA 4HDEA 2HZEA 4OWYA 3VWVA 1Z7PA 12GSA 1OKTA 1GSDA 1N25A 4PNFA 5AIXA 4Z7XA 4ULXA 5A5KA 4OCFA 5ECNB 3TDGA 1PL1A 1ZZYA 1BG1A 1JFUA 1SD9A 4YAPA 3HVSA 3QR6A 2OKAA 4ZBAA 2WFCA 5ECQB 4GF0A 1TXXA 3BJ5A 3I9V2 3H93A 1SJIA 6GSTA 4WXTA 1RQMA 3H1NA 3TRQA 4N0ZA 2P31A 2FLSA 1X0RA 3ZLPA 5ECHB 3LSZA 5KEJA 2QKEA 2EFHA 1ZYPA 3GV1A 1U88A 1F3AA 2LRCA 1SK1A 4IGJA 3APQA 1K0DA 4EVMA 1WOUA 1TK0B 1W89A 2EIRA 4POBA 2XHFA 2OE0A 1OKDA 1XW9A 2B6MA 5ECSA 1VGLA 5DALA 2RM5A 3E0UA 2Z9SA 5D9TA 2FWFA 2JZRA 19GSA 2NBSA 4JZQA 1TRVA 1Q98A 2V6OA 1XCCA 2PUKC 3GIXA 3L9SA 2O89A 2LQOA 4ZB9A 1JLWA 1GLQA 2X8GA 7GSSA 2VM2A 5DDLA 3ZITA 4TR4A 2E7PA 2FWHA 1IYIA 3P7XA 2MMNA 4N10A 1OE7A 4ML1A 2J23A 4CW9A 1YKAA 2VKZG 4O5QA 3ME8A 4TXOA 2CX3A 4ZL8A 3CRTA 3TCOA 1TJDA 4J56E 4PQIA 1TK5B 2LTKA 4EXJA 4NPBA 3TKRA 3GH6A 4BVXB 3TKSA 4OO4A 2DIZA 2IMDA 3TJJA 3TU3B 2LJRA 4BL7B 4PX1A 3DD3A 2QC7A 4EL1A 4L5LA 5H5SA 1WJKA 4MPFA 4O32A 4WF5A 5INYA 4G19A 1WRYA 4EKZA 1K0CA 5J41A 4K7IA 3KCMA 4L0UA 1NM3A 4WR5A 3D0ZA 5FHIA 1TKDB 2VIMA 2QGVA 1AUCA 1GSSA 4TW5A 5A4VA 2B5EA 1UC7A 2FWGA 3FR6A 3QMXA 2LQQA 3KJYA 4X0XA 4MABA 2JU5A 5HFKA 1SVOA 4POLA 4KCEA 5JCWA 1GSFA 1Z7RA 2DMMA 1TW9A 4WF4A 2V32A 3EC3A 5A4UA 2NTOA 3AY8A 4AI6A 2IMIA 5CNWA 4GCIA 3R2QA 1QK8A 2ON5A 3IR4A 1ST9A 4FYUA 1B8XA 4H86A 2EFCA 5J4VA 1O8WA 3QFAC 2FWEA 1EZKA 1F9MA 1U6TA 5HR2A 1X5EA 5DCHA 3A5IA 3KD0A 3M9KA 3IE3A 1PGTA 2DMLA 3GL5A 2IMKA 3CXGA 2A2SA 5IMFA 2A2PA 4AGSA 4MLYA 1M2AA 4ECCA 1XFLA 1S3CA 4XRDA 4EIQA 1AC1A 4MJAA 2L5LA 1F3BA 4GXZA 2O5VA 5A34A 3EYTA 4POKA 5IO2A 4PURA 3TKQA 4RUVA 4IKHA 2FD3A 1AW9A 2V2GA 3HXSA 5C00A 3VWXA 4LMWA 4YKFA 4PTSA 3UARA 4I2TA 5IM9A 3KIJA 3FKFA 5A1NA 1GSQA 5IOXA 3RHBA 3WGEA 2EFDA 1XWCA 4GSNA 1YEPA 2DKHA 3TKSE 2X4AA 2A4VA 1K0OA 2H1AA 4MPGA 3QDNA 4BVYB 2F9SA 4WKWA 3TJFA 2HT9A 1AQWA 4JR4A 5G1LA 4ZIJA 4GQFA 1TI1A 4USSA 2O87A 1J08A 3BCKA 2C80A 2R2JA 3KM6A 4J57E 2XPEA 3ZIVA 1TXUA 5FWGA 3TB2A 3FR3A 2F8FA 4FIWA 4AJ8A 5COHA 3KEBA 2YV7A 1TTZA 5HQPA 1ERUA 5CRHA 2WDUA 4XCSA 4IP1A 4G0LA 1PN0A 1SK0A 1VF3A 4K2DA 2NVLA 1OC3A 1VRSD 3HKRA 3WD6A 2C1YA 5KN1A 1XVWA 3C1SA 1O6JA 2QA2A 3HY2A 2ZUPA 1B48A 1K3OA 1URMA 4V1Ag 2KUCA 4QL7A 2M46A 2KHPA 2YWNA 1TK8B 2M80A 3HJOA 3DXBA 2V6KA 1GNEA 3U6VA 1XZOA 4P3YB 2PPTA 3TKSC 4MH2A 1M99A 2EIOA 3A2VA 3CRUA 2FUG2 3UVTA 1TDIA 2FGXA 1T1VA 3IA1A 1AQXA 4K7OA 3GH9A 5AISA 2BJXA 1PQNA 14GSA 3FRCA 2LKUA 2HSMA 1T00A 1YDKA 3EMPA 3ERWA 4Q5QA 5J40A 4L0WA 2GSTA 1S3DA 2HXKA 4MNNA 4FYBA 4PUAA 3RAZA 3L78A 1OVNA 2HZEB 4OD7A 4FQUA 4X43A 3PR8A 2CX4A 5J5NA 1GNWA 2IMFA 2P0GA 4JU5A 4ACSA 3GUSA 1VF4A 2F51A 5ID2A 4WBJA 1AIUA 5H5QA 1IYHA 2EC4A 1SYXA 1QXHA 4ZBBA 5HFIA 4W66A 4EE0A 5CO3A 5FT3A 4XS4A 1M2BA 2TIRA 4PNGA 5D9XA 5CREA 3E3EA 3F9UA 4OFMA 2AYTA 3CBUA 5G5FA 1EOGA 1WPIA 2I4AA 2H01A 3MYDA 1K0BA 1X9MB 2VCXA 5F8BA 3ZMLA 3D4TA 4X4JA 1WIKA 4TR3A 3TJBA 4K9ZA 5KOWA 2FCHA 4KF9A 2H1BA 3W8JA 4ISDA 1U3IA 5F07A 2H75A 1TRUA 3WT1A 3ZFLA 3BBYA 3UMAA 2QA1A 4HJMA 5IMAA 4ZL9A 3BD2A 2J9HA 5KN2A 5DALB 2YOIA 3GL3A 2R4VA 4QMKA 1I9DA 1BYEA 1RK4A 2VD0A 5ECPB 4NWYA 4IP6A 1EGOA 3IOSA 2YCDA 3S9FA 2X8CA 5HR1A 4E8EA 1R5AA 2GZPA 4BWSA 3UEMA 1T7PB 2TRCP 3CMIA 5JWOB 3DIEA 4DSRA 4OCEA 4YQUA 4ECJA 3M8NA 1NW2A 1W4VA 2VAFA 3UL3A 2GQLA 5D73A 4TXOB 2I1UA 4LMVA 2GTUA 2GVPA 5F05A 1PKWA 1BEDA 3KTLA 3I69A 2L4CA 1LU4A 3ZMKA 5J4UA 4V2LA 1CQGA 2V1MA 2DIYA 2ZNMA 3GYKA 2MMOA 4KB3A 5BMUA 4MJBA 3EWLA 2YZUA 3GSTA 3EMXA 4XHMA 1FOVA 3IAS2 2XPDA 4V2NA 3GX0A 3DVXA 3VPTA 1PD21 2L6CA 2MMAA 3IK9A 3DMLA 1SKSB 2DJ0A 4K5RA 2NDOA 3HVVA 3IBHA 4KDYA 2LV3A 4IJIA 3EVIA 5D9VA 4RI7A 4EUYA 1ZMAA 4JEDA 3CSJA 1PA3A 2IIYA 18GSA 4JR6A 3RHCA 2TRXA 3HZ8A 4MF6A 4O92A 2P5RA 4F9ZA 4KE3A 3L4NA 4RQRA 3A5WA 1K0NA 3D4MA 3WYWA 2H1GA 5CRWA 2H66A 5DCGA 2L57A 1LBKA 1MDKA 1GTIA 3MIXA 2E2GA 1ERWA 2H1LA 4LLRA 4AKIA 1O73A 2H74A 1R5PA 1THOA 2YPMA 3KH9A 1QUWA 5DQSA 2O7KA 1N2AA 3VWUA 1GSEA 2EIQA 5DQYA 1XOAA 2CZ3A 4K5SA 1SL1B 2WJUA 1A23A 5A5HA 3QAWA 5A34B 4O5RA 5GAND 3MAKA 1ZYEA 3FZ9A 4ILFA 5DVBA 5GZZB 5A1NB 4OFTA 4J2FA 1GULA 1H4OA 3EU4A 3GKMA 1V40A 1FB6A 1TRWA 1XBSA 5EVOA 2DJ2A 2OACA 2GGTA 5GSTA 4DSQA 4ECIA 1H75A 2RIIA 3P90A 3HJMA 1VF2A 4K8MA 1GL8A 3EURA 6GSSA 3GKNA 3G7IA 4G0KA 2PVQA 2YN1A 4FO5A 4Q5FA 1ERVA 1A8LA 4ZB6A 2XBQA 1X9WB 4XS1A 2KP1A 2R0CA 1OC9B 4RQXA 1R26A 4OMVA 5J47A 2H0GA 1PX6A 1SVLA 3KXOA 4N0VA 4K2XA 2UZ8A 2P5QA 1GUKA 4V2MA 3LXZA 2B1KA 2GS3A 3FZ5A 4ZBDA 3GURA 1CQHA 4XIHA 3UOMA 1KTEA 3WGXA 4Q5NA 1EV4A 2AHEA 3OR5A 3QCPA 4IJ3A 3W8SA 3KZQA 5J9CA 2WS2A 2CV4A 3ZVJA 4IBPA 2V41A 2CVKA 3UBKA 3FW2A 2VCVA 2WRTA 3GMFA 3HDCA 4LA1A 1JHBA 3ZYWA 3VK9A 1NHOA 3FHKA 2N5BA 3GKKA 5E4WA 3RDWA 2I81A 4Q5RA 3TUEA 2ALBA 1Q4JA 2YJ7A 2PERA 1Z6NA 2VLVA 1JZWA 3G7YA 3Q19A 2VLUA 2O85A 3F3RA 2ON7A 4MH3A 4IS0A 2X49A 3SBCA 5DBQA 2L5OA 1GSYA 3N9JA 4KSOA 1JLVA 2HSMB 2HZFA 3C1RA 2HLSA 1GWCA 2OBKA 3HJPA 2HRFA 4KA0A 1XWGA 4TOPA 2H8LA 3TRXA 2GDRA 4ZB8A 5AGYA 3NZNA 1XW5A 2GQMA 5ENUA 1NSWA 3FR9A 5IMDA 3IPZA 4BA7A 5IQYA 4ML6A 1Y1UA 4YQMA 2G2QA 5C04A 5ID2B 5HFGA 4AKGA 1EEMA 2DBCA 1PKZA 4JE1A 4XS4B 1PRXA 1WMJA 1EOHA 4X1UA 4GLTA 1A0FA 1SD8A 1BAYA 4OO5A 3HYPA 1SL0B 1V57A 2RUEA 3D22A 2FY6A 10GSA 2VD1A 3CSIA 2M72A 3ERFA 1E6BA 2IN3A 2BMXA 4GSTA 2MYGA 3UBLA 3ZL5A 1O8XA 3W6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC5 A;  2L59 A;  1FHE A;  3K8N A;  1YKC A;  5IMC A;  2JSZ A;  1KBN A;  5A4W A;  3L0H A;  1OC9 A;  3DEX A;  1TI3 A;  5ECL B;  2X8H A;  3MWH A;  3R3E A;  2KP2 A;  2IPA A;  4HU7 A;  3H8Q A;  1YQ1 A;  1GTU A;  1M7T A;  4MP4 A;  3D6I A;  4MF7 A;  1WE0 A;  2CVB A;  1TP9 A;  3LGC A;  3I6A A;  2AAW A;  13GS A;  1JZD A;  2H30 A;  4NMU A;  2H6Z A;  1PL2 A;  4KAE A;  3A2W A;  2HYX A;  4TKY A;  2B7K A;  1V98 A;  4K7N A;  3LOR A;  2E0Q A;  5GSS A;  2LS5 A;  1SU9 A;  4IEL A;  3J7Y k;  3GX8 A;  4E8H A;  4K0N A;  4TN8 A;  5G30 A;  3GNJ A;  1SJZ A;  1K3L A;  2WB9 A;  4QL9 A;  1G6W A;  3KTB A;  4DSS A;  3F4R A;  2GZZ A;  3D5J A;  3LXT A;  3GKX A;  2B1L A;  2WGR A;  3M3M A;  4TR0 A;  4IN0 A;  3TRP A;  4ZXG A;  5B7C A;  1A2L A;  2H72 A;  6GSV A;  3PGT A;  8GSS A;  5HR3 A;  3P2A A;  1U87 A;  2PMT A;  1GSU A;  3JCM L;  4NV5 A;  2C3Q A;  2RUF A;  3TJK A;  2DSA A;  5ECI B;  5EL8 A;  1T4Y A;  3CSH A;  4WET A;  1XWB A;  3RBT A;  1T4Z A;  2IL3 A;  1FB0 A;  1QGV A;  3F4T A;  4GRF A;  3VI5 A;  4EDZ A;  2VLT A;  1GLP A;  1BG5 A;  1DBY A;  2LJA A;  4KDX A;  2LNS A;  3GRX A;  3EE2 A;  5H5R A;  11GS A;  2C3N A;  3GA4 A;  1XWA A;  2YWI A;  3MDK A;  1JZO A;  3ERG A;  3FEU A;  1YY7 A;  3ZZX A;  4IQA A;  4IVF A;  3KP9 A;  1A2J A;  3TJG A;  2VUP A;  2YJH A;  2X64 A;  2O8V B;  2AV4 A;  3PIN A;  4D73 B;  4MDC A;  2QSI A;  5CAX A;  5B6M A;  2H0I A;  3LWA A;  2FHE A;  5D9W A;  1PX7 A;  1F2E A;  3LJR A;  5DJM A;  2BTO T;  2YNX A;  1MD3 A;  2C0E A;  1M9A A;  1T8E B;  3KH7 A;  4L8E A;  1Z5Y E;  3G7J A;  1A24 A;  3DRN A;  1XPV A;  2JSY A;  2C3T A;  3ME7 A;  2WZ9 A;  1J0F A;  3QAV A;  2LUS A;  2N5F A;  3Q18 A;  2K6V A;  2OE1 A;  2JZT A;  1B9X C;  4NXI A;  2K8S A;  1S3A A;  2HQT A;  2MZC A;  3WT2 A;  2ES7 A;  4N30 A;  3QFB C;  1BX9 A;  3IXR A;  5JWR B;  3ZVJ D;  1EEJ A;  5DAK A;  1SJ6 A;  2GSQ A;  4GTU A;  3KGK A;  3IV4 A;  2REM A;  4G10 A;  3CTG A;  1FAA A;  2LEG A;  3H79 A;  3VFI A;  5IPG A;  3F4S A;  2VCQ A;  2OAD A;  3NIV A;  5LD0 A;  3C7M A;  1WWJ A;  3GSS A;  3LG6 A;  2H0H A;  2YAN A;  5ECK B;  3DGQ A;  4TR1 A;  4MCU A;  1DUG A;  1I5G A;  3L9V A;  3BCI A;  4HQS A;  5D8I A;  1LJR A;  3C71 A;  4PXO A;  4JBB A;  1F6M C;  2H71 A;  1EGR A;  5AIV A;  1ML6 A;  5ECM B;  3TOU A;  4I2U A;  2PBJ A;  3FY7 A;  1XW6 A;  4MZB A;  2HFD A;  5G31 A;  3VWW A;  2OE3 A;  1BJX A;  2H70 A;  3VPQ A;  4WBR D;  1V9W A;  9GSS A;  5LCZ A;  3V1W A;  5IO0 A;  3CTF A;  4WR4 A;  2JL4 A;  2IJY A;  5CRG A;  5KN3 A;  2FNO A;  1FO5 A;  3KMO A;  2I9H A;  1SKW B;  6GSX A;  1B4P A;  5LNK e;  4IW9 A;  3F0I A;  3O3T A;  1K3Y A;  4HU9 A;  3G9B A;  2C8U A;  1YZX A;  5D96 A;  3NOF A;  3UIW A;  1YEX A;  4BWQ A;  1V58 A;  4RI6 A;  4D73 A;  2GT5 A;  2VL3 A;  5D93 A;  2VL2 A;  3EU3 A;  5F0G A;  5ECR B;  2OJL A;  1GP1 A;  5G2Z A;  4WEY A;  1A8Y A;  2IFQ A;  2VCT A;  3MNG A;  3UAP A;  3C8E A;  2IME A;  2N5A A;  1DE1 A;  1HQO A;  1M2D A;  2LNT A;  3TOT A;  1GRX A;  2B3S A;  4MF5 A;  5J9B A;  2GLR A;  5CP1 A;  2R37 A;  2VCZ A;  2HRK A;  1ZYQ B;  1G6Y A;  1QQ2 A;  4PQH A;  4GWR A;  3F6D A;  5CYY A;  3GHA A;  2PVO C;  5B8B A;  4XS6 A;  2HNL A;  3ZFB A;  4IHU A;  4PQ1 A;  4CHS A;  2X99 A;  3LQ7 A;  2ZCT A;  1PN9 A;  1R7H A;  5IMV A;  3VLN A;  1G0T A;  1NHY A;  2GT6 A;  4HEA 2;  1OE8 A;  5DJL A;  2DJK A;  3GTU A;  4MZW A;  3QD9 A;  3APO A;  3QAG A;  4AJ6 A;  4K0G A;  1X9S B;  6GSU A;  2CT6 A;  4MMM A;  1MD4 A;  3SWL A;  5AN1 A;  5EPF A;  4IQ1 A;  3MSZ A;  3I43 A;  2YP6 A;  2G0F A;  1TU8 A;  1AAZ A;  5HR0 A;  3EIN A;  1WP0 A;  4ZIL A;  1Z9H A;  3J7Y b;  1ON4 A;  5E59 A;  2VO4 A;  5IPH A;  2DJ3 A;  4KSM A;  3IDV A;  3H4K A;  5L71 A;  4MK3 A;  2MBS A;  2WCI A;  1HYU A;  1XWK A;  3PPU A;  4K6X A;  2LRT A;  3GFK A;  4GQC A;  2K18 A;  4HQZ A;  3DYR A;  1GUH A;  2DLX A;  1C72 A;  2GQK A;  3LYP A;  1EP8 A;  2GZY A;  4I5Q A;  1F37 A;  20GS A;  1HNB A;  4KUN A;  2JAC A;  1MDI A;  1M9B A;  1QMV A;  4MZC A;  4EO3 A;  5IMZ A;  4QQ7 A;  1YF0 A;  3ISO A;  4YAV A;  1USB A;  2LJK A;  2RLI A;  6GSW A;  4F03 A;  2PGT A;  1TRS A;  3U5R E;  1MDJ A;  2L6D A;  4DSS B;  4F82 A;  5KN0 A;  1ZOF A;  2HE3 A;  2CQ9 A;  2FA8 A;  4KH7 A;  2IWT A;  2HI7 A;  4G0I A;  3APS A;  1G7E A;  1SK2 A;  1UA5 A;  1O7U A;  4TVE A;  1U3A A;  1E2Y A;  2C0F A;  1J9B A;  3UVH A;  5F06 A;  1B9Y C;  1Z6M A;  2HSY A;  3F8U A;  3KP8 A;  2C4J A;  2HSN B;  4F2I A;  3HD5 A;  4AF2 A;  2HRA A;  1MTC A;  4NHW A;  4NHZ A;  2PWJ A;  3P8W A;  1V2A A;  2B7J A;  1FW1 A;  2CAQ A;  2XC2 A;  1ABA A;  4I8B A;  5JWQ B;  4XTS A;  3DWV A;  4LL1 B;  2LRN A;  1K0A A;  4KCA A;  3LYK A;  2VL2 C;  3ZRD A;  3LFL A;  2R6K A;  3CYN A;  1X5D A;  3L9U A;  5GAP D;  4I6X A;  1FVK A;  2KLX A;  3E9J B;  1M0U A;  2R5G A;  1TOF A;  4EDY A;  1HNC A;  4N11 A;  4FYC A;  1HNA A;  3F63 A;  2WUL A;  4O7H A;  4MA9 A;  2VL9 A;  2VOC A;  4MJE A;  2YWM A;  2AJQ B;  1OC8 A;  3O76 A;  1OAZ A;  3IC4 A;  1THX A;  3ZIJ A;  1KNG A;  4BVX A;  3RPP A;  5IOW A;  1K0M A;  1GH2 A;  5DAK B;  3F3Q A;  2CZ2 A;  3FZ4 A;  3TGZ A;  1B4Q A;  1EWX A;  3IAM 2;  4BL7 A;  3F6F A;  3BOA A;  1MEK A;  4XRA A;  4HI7 A;  3M9J A;  3VI7 A;  3ED3 A;  3UJ1 A;  5EY6 A;  1SEN A;  1SKR B;  1SL2 B;  2DJ1 A;  4G9H A;  1Z3E A;  4HS1 A;  2B5X A;  17GS A;  2PN8 A;  4TR1 B;  1KEB A;  2JZS A;  3QPM A;  1A0R P;  2MMZ A;  4YH2 A;  2PU9 C;  3M0F A;  2OA7 A;  2K8V A;  4GSS A;  1AQV A;  3GN3 A;  1ZL9 A;  1VF1 A;  3ZRE A;  5G5E A;  4HZ4 A;  1DE2 A;  2NPB A;  5B8A A;  3HA9 A;  3Q6O A;  3PH9 A;  4DEJ A;  4EF0 A;  1GTA A;  3DKS A;  3Q74 A;  4BPY A;  2H76 A;  5G1K A;  3TKP A;  2B5Y A;  2CA8 A;  3KMN A;  3WGD A;  2HSH A;  3D21 A;  5ABR A;  1QFN A;  1HD2 A;  4PGT A;  1FVJ A;  22GS A;  4PUF C;  1N8J A;  1SYR A;  3FZA A;  5JCG A;  5ELG A;  1ZGN A;  4KW6 A;  4MJC A;  2H6X A;  4F0C A;  2H73 A;  4L5O A;  4I97 A;  1YF1 A;  1X5C A;  3ZTL A;  1UN2 A;  3HCZ A;  2VCW A;  4KX4 A;  1ERT A;  2IFQ B;  1FG4 A;  2H1D A;  4EC0 A;  2E2M A;  3C73 A;  5ECO B;  2JAD A;  2KOK A;  4HJ2 A;  3HHV A;  5ELA A;  1XOB A;  2H19 A;  1R4W A;  2D2Z A;  2R3X A;  1GTB A;  2XBI A;  3FK8 A;  2DJJ A;  3RPN A;  3IC8 A;  2HRK B;  2YV9 A;  6GSY A;  2HRN A;  4OFN A;  1Y25 A;  4YQV A;  4ID0 A;  4BVY A;  3VUR A;  4DVC A;  4KND A;  3QOU A;  3US3 A;  5J3R A;  2VM1 A;  1ZCP A;  4G2E A;  2MBT A;  1ILO A;  1PMT A;  1A2M A;  2CAI A;  1TU7 A;  5IIZ A;  5CRD A;  3GTU B;  3HZ4 A;  2C0G A;  2FA4 A;  1O85 A;  3HVX A;  4NV2 A;  16GS A;  4F0B A;  1EP7 A;  2A2R A;  4FH8 A;  2GSR A;  3M1G A;  1ACV A;  2AUV A;  4KDU A;  1YJ6 A;  4KGI A;  3IRA A;  2I3Y A;  1JZR A;  1GUM A;  2K9F A;  3DVW A;  2C0D A;  4K1F A;  1Y6E A;  3A2X A;  4AJ7 A;  1G7O A;  2H6Y A;  3LEF A;  4ECB A;  4JRR A;  1EV9 A;  1BQ7 A;  4NAX A;  2YWO A;  1PSQ A;  1XXU A;  2OBI A;  2YZH A;  1AXD A;  3IK7 A;  1XIY A;  2F3M A;  1T3B A;  1RW1 A;  4TRX A;  2RM6 A;  1XVQ A;  1UVZ A;  2AB6 A;  2GSS A;  4HOJ A;  5JCU A;  4V1A p;  3IHQ A;  3O6T A;  5B6N A;  3N5O A;  4HUA A;  1OYJ A;  2F8A A;  2CVD A;  3FYG A;  1O81 A;  4HZ2 A;  4ZL7 A;  4LL4 B;  2L4Q A;  3A3T A;  4TXV A;  4CDO A;  1DSB A;  4POM A;  2LST A;  4HDE A;  2HZE A;  4OWY A;  3VWV A;  1Z7P A;  12GS A;  1OKT A;  1GSD A;  4PNF A;  5AIX A;  4Z7X A;  4ULX A;  5A5K A;  4OCF A;  5ECN B;  3TDG A;  1PL1 A;  1ZZY A;  1JFU A;  1SD9 A;  4YAP A;  3HVS A;  3QR6 A;  2OKA A;  4ZBA A;  2WFC A;  5ECQ B;  4GF0 A;  1TXX A;  3BJ5 A;  3I9V 2;  3H93 A;  1SJI A;  6GST A;  4WXT A;  1RQM A;  3H1N A;  3TRQ A;  4N0Z A;  2P31 A;  2FLS A;  1X0R A;  3ZLP A;  5ECH B;  3LSZ A;  5KEJ A;  2QKE A;  3GV1 A;  1U88 A;  1F3A A;  2LRC A;  1SK1 A;  4IGJ A;  3APQ A;  1K0D A;  4EVM A;  1WOU A;  1TK0 B;  1W89 A;  2EIR A;  4POB A;  2XHF A;  2OE0 A;  1OKD A;  1XW9 A;  2B6M A;  5ECS A;  1VGL A;  5DAL A;  2RM5 A;  3E0U A;  2Z9S A;  5D9T A;  2FWF A;  2JZR A;  19GS A;  2NBS A;  4JZQ A;  1TRV A;  1Q98 A;  2V6O A;  1XCC A;  2PUK C;  3GIX A;  3L9S A;  2O89 A;  2LQO A;  4ZB9 A;  1JLW A;  1GLQ A;  2X8G A;  7GSS A;  2VM2 A;  5DDL A;  3ZIT A;  4TR4 A;  2E7P A;  2FWH A;  1IYI A;  3P7X A;  2MMN A;  4N10 A;  1OE7 A;  4ML1 A;  2J23 A;  4CW9 A;  1YKA A;  3ME8 A;  4TXO A;  2CX3 A;  4ZL8 A;  3CRT A;  3TCO A;  1TJD A;  4J56 E;  4PQI A;  1TK5 B;  2LTK A;  4EXJ A;  4NPB A;  3TKR A;  3GH6 A;  4BVX B;  3TKS A;  4OO4 A;  2DIZ A;  2IMD A;  3TJJ A;  2LJR A;  4BL7 B;  4PX1 A;  3DD3 A;  2QC7 A;  4EL1 A;  4L5L A;  5H5S A;  1WJK A;  4MPF A;  4O32 A;  4WF5 A;  5INY A;  4G19 A;  1WRY A;  4EKZ A;  1K0C A;  5J41 A;  4K7I A;  3KCM A;  4L0U A;  1NM3 A;  4WR5 A;  3D0Z A;  5FHI A;  1TKD B;  2VIM A;  2QGV A;  1AUC A;  1GSS A;  4TW5 A;  5A4V A;  2B5E A;  1UC7 A;  2FWG A;  3FR6 A;  3QMX A;  2LQQ A;  3KJY A;  4X0X A;  4MAB A;  2JU5 A;  5HFK A;  4POL A;  4KCE A;  5JCW A;  1GSF A;  1Z7R A;  2DMM A;  1TW9 A;  4WF4 A;  2V32 A;  3EC3 A;  5A4U A;  2NTO A;  3AY8 A;  2IMI A;  5CNW A;  4GCI A;  3R2Q A;  1QK8 A;  2ON5 A;  3IR4 A;  1ST9 A;  4FYU A;  1B8X A;  4H86 A;  1O8W A;  3QFA C;  2FWE A;  1EZK A;  1F9M A;  1U6T A;  5HR2 A;  1X5E A;  5DCH A;  3KD0 A;  3M9K A;  3IE3 A;  1PGT A;  2DML A;  3GL5 A;  2IMK A;  3CXG A;  2A2S A;  5IMF A;  4AGS A;  4MLY A;  1M2A A;  4ECC A;  1XFL A;  1S3C A;  4XRD A;  1AC1 A;  4MJA A;  2L5L A;  1F3B A;  4GXZ A;  3EYT A;  4POK A;  5IO2 A;  4PUR A;  3TKQ A;  4RUV A;  4IKH A;  2FD3 A;  1AW9 A;  2V2G A;  3HXS A;  5C00 A;  3VWX A;  4LMW A;  4PTS A;  3UAR A;  4I2T A;  5IM9 A;  3KIJ A;  3FKF A;  1GSQ A;  5IOX A;  3RHB A;  3WGE A;  1XWC A;  4GSN A;  1YEP A;  3TKS E;  2A4V A;  1K0O A;  2H1A A;  4MPG A;  3QDN A;  4BVY B;  2F9S A;  4WKW A;  3TJF A;  2HT9 A;  1AQW A;  4JR4 A;  5G1L A;  4ZIJ A;  4GQF A;  1TI1 A;  4USS A;  2O87 A;  1J08 A;  3BCK A;  2C80 A;  2R2J A;  3KM6 A;  4J57 E;  2XPE A;  3ZIV A;  5FWG A;  3TB2 A;  3FR3 A;  2F8F A;  4FIW A;  4AJ8 A;  5COH A;  3KEB A;  2YV7 A;  1TTZ A;  5HQP A;  1ERU A;  5CRH A;  2WDU A;  4XCS A;  4IP1 A;  4G0L A;  1SK0 A;  1VF3 A;  4K2D A;  2NVL A;  1OC3 A;  1VRS D;  3HKR A;  3WD6 A;  2C1Y A;  5KN1 A;  1XVW A;  3C1S A;  1O6J A;  3HY2 A;  2ZUP A;  1B48 A;  1K3O A;  1URM A;  4V1A g;  2KUC A;  4QL7 A;  2M46 A;  2KHP A;  2YWN A;  1TK8 B;  2M80 A;  3HJO A;  3DXB A;  2V6K A;  1GNE A;  3U6V A;  1XZO A;  4P3Y B;  2PPT A;  3TKS C;  4MH2 A;  1M99 A;  2EIO A;  3A2V A;  3CRU A;  2FUG 2;  3UVT A;  1TDI A;  2FGX A;  1T1V A;  3IA1 A;  1AQX A;  4K7O A;  3GH9 A;  5AIS A;  2BJX A;  1PQN A;  14GS A;  3FRC A;  2LKU A;  2HSM A;  1T00 A;  1YDK A;  3EMP A;  3ERW A;  4Q5Q A;  4L0W A;  2GST A;  1S3D A;  2HXK A;  4FYB A;  4PUA A;  3RAZ A;  3L78 A;  1OVN A;  2HZE B;  4OD7 A;  4FQU A;  4X43 A;  3PR8 A;  2CX4 A;  5J5N A;  1GNW A;  2IMF A;  2P0G A;  4JU5 A;  4ACS A;  3GUS A;  1VF4 A;  2F51 A;  5ID2 A;  4WBJ A;  1AIU A;  5H5Q A;  1IYH A;  2EC4 A;  1SYX A;  1QXH A;  4ZBB A;  5HFI A;  4EE0 A;  5CO3 A;  5FT3 A;  4XS4 A;  1M2B A;  2TIR A;  4PNG A;  5D9X A;  5CRE A;  3E3E A;  3F9U A;  4OFM A;  2AYT A;  3CBU A;  5G5F A;  1EOG A;  1WPI A;  2I4A A;  2H01 A;  1K0B A;  1X9M B;  2VCX A;  5F8B A;  3ZML A;  3D4T A;  1WIK A;  4TR3 A;  3TJB A;  4K9Z A;  2FCH A;  4KF9 A;  2H1B A;  3W8J A;  4ISD A;  1U3I A;  5F07 A;  2H75 A;  1TRU A;  3WT1 A;  3ZFL A;  3BBY A;  3UMA A;  4HJM A;  5IMA A;  4ZL9 A;  3BD2 A;  2J9H A;  5KN2 A;  5DAL B;  2YOI A;  3GL3 A;  2R4V A;  1I9D A;  1BYE A;  1RK4 A;  2VD0 A;  5ECP B;  4NWY A;  4IP6 A;  1EGO A;  3IOS A;  2YCD A;  3S9F A;  2X8C A;  5HR1 A;  4E8E A;  1R5A A;  2GZP A;  4BWS A;  3UEM A;  1T7P B;  2TRC P;  3CMI A;  5JWO B;  3DIE A;  4DSR A;  4OCE A;  4YQU A;  4ECJ A;  3M8N A;  1NW2 A;  1W4V A;  2VAF A;  3UL3 A;  2GQL A;  5D73 A;  4TXO B;  2I1U A;  4LMV A;  2GTU A;  2GVP A;  5F05 A;  1PKW A;  1BED A;  3KTL A;  3I69 A;  2L4C A;  1LU4 A;  3ZMK A;  5J4U A;  4V2L A;  1CQG A;  2V1M A;  2DIY A;  2ZNM A;  3GYK A;  2MMO A;  4KB3 A;  5BMU A;  4MJB A;  3EWL A;  2YZU A;  3GST A;  3EMX A;  4XHM A;  1FOV A;  3IAS 2;  2XPD A;  4V2N A;  3GX0 A;  3DVX A;  3VPT A;  1PD2 1;  2L6C A;  2MMA A;  3IK9 A;  3DML A;  1SKS B;  2DJ0 A;  2NDO A;  3HVV A;  3IBH A;  4KDY A;  2LV3 A;  4IJI A;  3EVI A;  5D9V A;  4RI7 A;  4EUY A;  1ZMA A;  4JED A;  3CSJ A;  1PA3 A;  2IIY A;  18GS A;  4JR6 A;  3RHC A;  2TRX A;  3HZ8 A;  4MF6 A;  4O92 A;  2P5R A;  4F9Z A;  4KE3 A;  3L4N A;  4RQR A;  3A5W A;  1K0N A;  3D4M A;  3WYW A;  2H1G A;  5CRW A;  2H66 A;  5DCG A;  2L57 A;  1LBK A;  1MDK A;  1GTI A;  2E2G A;  1ERW A;  4LLR A;  1O73 A;  2H74 A;  1R5P A;  1THO A;  2YPM A;  3KH9 A;  1QUW A;  5DQS A;  2O7K A;  1N2A A;  3VWU A;  1GSE A;  2EIQ A;  5DQY A;  1XOA A;  2CZ3 A;  1SL1 B;  2WJU A;  1A23 A;  3QAW A;  5GAN D;  4O5R A;  3MAK A;  1ZYE A;  3FZ9 A;  4ILF A;  5DVB A;  5GZZ B;  4OFT A;  4J2F A;  1GUL A;  1H4O A;  3EU4 A;  3GKM A;  1V40 A;  1FB6 A;  1TRW A;  1XBS A;  5EVO A;  2DJ2 A;  2OAC A;  2GGT A;  5GST A;  4DSQ A;  4ECI A;  1H75 A;  2RII A;  3P90 A;  3HJM A;  1VF2 A;  4K8M A;  1GL8 A;  3EUR A;  6GSS A;  3GKN A;  3G7I A;  4G0K A;  2PVQ A;  2YN1 A;  4FO5 A;  4Q5F A;  1ERV A;  1A8L A;  4ZB6 A;  2XBQ A;  1X9W B;  4XS1 A;  2KP1 A;  1OC9 B;  4RQX A;  1R26 A;  4OMV A;  2H0G A;  1PX6 A;  3KXO A;  4N0V A;  2UZ8 A;  2P5Q A;  1GUK A;  4V2M A;  3LXZ A;  2B1K A;  2GS3 A;  3FZ5 A;  4ZBD A;  3GUR A;  1CQH A;  4XIH A;  3UOM A;  1KTE A;  3WGX A;  4Q5N A;  1EV4 A;  2AHE A;  3OR5 A;  3QCP A;  4IJ3 A;  3W8S A;  3KZQ A;  5J9C A;  2WS2 A;  2CV4 A;  3ZVJ A;  4IBP A;  2V41 A;  2CVK A;  3UBK A;  3FW2 A;  2VCV A;  2WRT A;  3GMF A;  3HDC A;  4LA1 A;  1JHB A;  3ZYW A;  3VK9 A;  1NHO A;  3FHK A;  2N5B A;  3GKK A;  5E4W A;  3RDW A;  2I81 A;  4Q5R A;  3TUE A;  2ALB A;  1Q4J A;  2YJ7 A;  2PER A;  1Z6N A;  2VLV A;  1JZW A;  3G7Y A;  3Q19 A;  2VLU A;  2O85 A;  3F3R A;  2ON7 A;  4MH3 A;  4IS0 A;  3SBC A;  5DBQ A;  2L5O A;  1GSY A;  3N9J A;  4KSO A;  1JLV A;  2HSM B;  2HZF A;  3C1R A;  2HLS A;  1GWC A;  2OBK A;  3HJP A;  2HRF A;  4KA0 A;  1XWG A;  4TOP A;  2H8L A;  3TRX A;  2GDR A;  4ZB8 A;  5AGY A;  3NZN A;  1XW5 A;  2GQM A;  5ENU A;  1NSW A;  3FR9 A;  5IMD A;  3IPZ A;  4BA7 A;  5IQY A;  4ML6 A;  4YQM A;  2G2Q A;  5C04 A;  5ID2 B;  5HFG A;  1EEM A;  2DBC A;  1PKZ A;  4JE1 A;  4XS4 B;  1PRX A;  1WMJ A;  1EOH A;  4X1U A;  4GLT A;  1A0F A;  1SD8 A;  1BAY A;  4OO5 A;  3HYP A;  1SL0 B;  1V57 A;  2RUE A;  3D22 A;  2FY6 A;  10GS A;  2VD1 A;  3CSI A;  2M72 A;  3ERF A;  1E6B A;  2IN3 A;  2BMX A;  4GST A;  2MYG A;  3UBL A;  3ZL5 A;  1O8X A;  3W6G A; 
#chains in the Genus database with same CATH topology
 2DC5 A;  2L59 A;  1FHE A;  3K8N A;  2R0P A;  1YKC A;  5IMC A;  2JSZ A;  1KBN A;  5A4W A;  3L0H A;  1OC9 A;  3DEX A;  1TI3 A;  5ECL B;  2X8H A;  3MWH A;  3R3E A;  2KP2 A;  2IPA A;  4HU7 A;  3H8Q A;  1YQ1 A;  4Z2U A;  2WVY A;  1GTU A;  1M7T A;  4MP4 A;  3D6I A;  4MF7 A;  1WE0 A;  2CVB A;  1TP9 A;  4ICY A;  3LGC A;  3I6A A;  2AAW A;  13GS A;  1JZD A;  2H30 A;  4NMU A;  2H6Z A;  1PL2 A;  4KAE A;  3A2W A;  2HYX A;  4TKY A;  2B7K A;  1V98 A;  4K7N A;  3LOR A;  2E0Q A;  5J4Y A;  5GSS A;  4G01 A;  2R0G A;  2LS5 A;  1SU9 A;  4IEL A;  3J7Y k;  3GX8 A;  4E8H A;  4K0N A;  4TN8 A;  5G30 A;  3GNJ A;  1SJZ A;  1K3L A;  2WB9 A;  4QL9 A;  1G6W A;  3KTB A;  2OT3 A;  3F4R A;  4DSS A;  2GZZ A;  3D5J A;  3LXT A;  3GKX A;  2B1L A;  2WGR A;  3M3M A;  4TR0 A;  4IN0 A;  3TRP A;  4ZXG A;  5B7C A;  1A2L A;  2H72 A;  6GSV A;  3PGT A;  8GSS A;  5BMU B;  5HR3 A;  3P2A A;  1U87 A;  2PMT A;  1GSU A;  3JCM L;  4NV5 A;  2C3Q A;  2RUF A;  2HSN A;  3TJK A;  2DSA A;  5ECI B;  5EL8 A;  1T4Y A;  3CSH A;  4WET A;  1XWB A;  3RBT A;  1T4Z A;  2IL3 A;  1FB0 A;  1QGV A;  3F4T A;  4GRF A;  3VI5 A;  4EDZ A;  2VLT A;  1GLP A;  1BG5 A;  1DBY A;  2LJA A;  4KDX A;  4EIP A;  2LNS A;  3GRX A;  3EE2 A;  5H5R A;  11GS A;  2C3N A;  3GA4 A;  1XWA A;  2YWI A;  3MDK A;  1JZO A;  3ERG A;  3FEU A;  1YY7 A;  3ZZX A;  4IQA A;  4IVF A;  3KP9 A;  1A2J A;  3TJG A;  2VUP A;  2YJH A;  2X64 A;  1FOH A;  2O8V B;  2AV4 A;  3PIN A;  4D73 B;  4MDC A;  2QSI A;  5CAX A;  5B6M A;  2H0I A;  3LWA A;  2FHE A;  5D9W A;  1PX7 A;  1F2E A;  3LJR A;  5DJM A;  2BTO T;  2YNX A;  1MD3 A;  4HSC X;  2C0E A;  1M9A A;  1T8E B;  3KH7 A;  4L8E A;  1Z5Y E;  3G7J A;  1A24 A;  3DRN A;  1XPV A;  2JSY A;  2C3T A;  3ME7 A;  2WZ9 A;  1J0F A;  3QAV A;  2LUS A;  2N5F A;  3Q18 A;  2K6V A;  2OE1 A;  5A5H B;  2JZT A;  1B9X C;  4NXI A;  2K8S A;  1S3A A;  2HQT A;  2MZC A;  3WT2 A;  4Z2T A;  2ES7 A;  4N30 A;  3QFB C;  1BX9 A;  3IXR A;  5JWR B;  3ZVJ D;  1EEJ A;  5DAK A;  1SJ6 A;  2GSQ A;  4GTU A;  5KOX A;  3KGK A;  3IV4 A;  2REM A;  4G10 A;  3CTG A;  1FAA A;  2LEG A;  3H79 A;  3VFI A;  5IPG A;  3F4S A;  2VCQ A;  2OAD A;  3NIV A;  5LD0 A;  3C7M A;  1WWJ A;  3GSS A;  3LG6 A;  2H0H A;  2YAN A;  5ECK B;  3DGQ A;  4TR1 A;  4MCU A;  1DUG A;  1I5G A;  3L9V A;  3BCI A;  4N3Z A;  4HQS A;  5D8I A;  1LJR A;  3C71 A;  3CHX C;  4PXO A;  4JBB A;  1F6M C;  2H71 A;  1EGR A;  5AIV A;  3HVN A;  1ML6 A;  5ECM B;  3TOU A;  4I2U A;  2PBJ A;  3FY7 A;  1XW6 A;  4MZB A;  2HFD A;  5G31 A;  3VWW A;  2OE3 A;  1BJX A;  2H70 A;  3VPQ A;  4WBR D;  1V9W A;  9GSS A;  5LCZ A;  3V1W A;  5IO0 A;  3CTF A;  4WR4 A;  2JL4 A;  2IJY A;  5CRG A;  5KN3 A;  2FNO A;  1FO5 A;  3KMO A;  2I9H A;  4GDF A;  1SKW B;  6GSX A;  1B4P A;  5LNK e;  4IW9 A;  3F0I A;  3O3T A;  1K3Y A;  4HU9 A;  3G9B A;  2C8U A;  1YZX A;  5D96 A;  3NOF A;  3UIW A;  1YEX A;  4BWQ A;  1V58 A;  4RI6 A;  4D73 A;  2GT5 A;  3CQF A;  2VL3 A;  5D93 A;  2VL2 A;  3EU3 A;  5F0G A;  5ECR B;  2OJL A;  1GP1 A;  5G2Z A;  4WEY A;  1A8Y A;  2IFQ A;  2VCT A;  3MNG A;  3UAP A;  3C8E A;  2IME A;  2DKI A;  2N5A A;  1DE1 A;  1HQO A;  4PHZ C;  1M2D A;  2LNT A;  3TOT A;  1GRX A;  2B3S A;  4MF5 A;  5J9B A;  2GLR A;  5CP1 A;  2R37 A;  2VCZ A;  2HRK A;  1ZYQ B;  1G6Y A;  1QQ2 A;  4PQH A;  4GWR A;  3F6D A;  5CYY A;  3GHA A;  2PVO C;  5B8B A;  4XS6 A;  2UV8 G;  2HNL A;  3ZFB A;  4IHU A;  4PQ1 A;  4CHS A;  2X99 A;  3LQ7 A;  2ZCT A;  1PN9 A;  1R7H A;  5IMV A;  3VLN A;  1G0T A;  1NHY A;  2GT6 A;  4HEA 2;  1OE8 A;  5DJL A;  2DJK A;  3GTU A;  4MZW A;  3QD9 A;  3APO A;  3QAG A;  4AJ6 A;  4K0G A;  1X9S B;  6GSU A;  2CT6 A;  4MMM A;  1MD4 A;  3SWL A;  5AN1 A;  5EPF A;  1ZYN A;  4IQ1 A;  3I43 A;  3MSZ A;  2YP6 A;  2G0F A;  4Z2R A;  1TU8 A;  1AAZ A;  5HR0 A;  3EIN A;  1WP0 A;  4ZIL A;  3CWG A;  1Z9H A;  1SVM A;  3J7Y b;  1ON4 A;  5E59 A;  2VO4 A;  5IPH A;  2DJ3 A;  4KSM A;  3IDV A;  3H4K A;  5L71 A;  1PFO A;  4MK3 A;  2MBS A;  2WCI A;  1HYU A;  1XWK A;  3PPU A;  4AKH A;  4K6X A;  2LRT A;  3GFK A;  4GQC A;  2K18 A;  4HQZ A;  3DYR A;  1GUH A;  3IHG A;  2DLX A;  1C72 A;  2GQK A;  3LYP A;  1EP8 A;  2GZY A;  4I5Q A;  1F37 A;  20GS A;  1HNB A;  4KUN A;  2JAC A;  1MDI A;  1M9B A;  1QMV A;  4MZC A;  4EO3 A;  5IMZ A;  4QQ7 A;  1YF0 A;  3ISO A;  4YAV A;  1USB A;  2LJK A;  2RLI A;  6GSW A;  4F03 A;  2PGT A;  1TRS A;  3U5R E;  1MDJ A;  2L6D A;  4DSS B;  4F82 A;  5KN0 A;  1ZOF A;  2HE3 A;  2CQ9 A;  2FA8 A;  4KH7 A;  2IWT A;  2HI7 A;  4G0I A;  3APS A;  1G7E A;  1SK2 A;  1UA5 A;  1O7U A;  4TVE A;  1U3A A;  1E2Y A;  2C0F A;  1J9B A;  3UVH A;  5F06 A;  1B9Y C;  1Z6M A;  2HSY A;  3F8U A;  1YVL A;  3KP8 A;  2C4J A;  2HSN B;  4F2I A;  3HD5 A;  4AF2 A;  2HRA A;  1MTC A;  4NHW A;  4NHZ A;  2PWJ A;  3P8W A;  1V2A A;  2B7J A;  1FW1 A;  2CAQ A;  2XC2 A;  1ABA A;  4I8B A;  5JWQ B;  4XTS A;  3DWV A;  4LL1 B;  2LRN A;  3FMW A;  1K0A A;  1BF5 A;  4KCA A;  3LYK A;  2VL2 C;  3ZRD A;  3EPT A;  3LFL A;  2R6K A;  3CYN A;  1X5D A;  3L9U A;  5GAP D;  4I6X A;  4ZB7 A;  4A5P A;  1FVK A;  2KLX A;  3E9J B;  1M0U A;  2R5G A;  1TOF A;  4EDY A;  1HNC A;  4N11 A;  4FYC A;  1HNA A;  3F63 A;  2WUL A;  4O7H A;  4MA9 A;  2VL9 A;  2VOC A;  2O36 A;  4MJE A;  2YWM A;  2AJQ B;  1OC8 A;  3O76 A;  1OAZ A;  3IC4 A;  1THX A;  3ZIJ A;  1KNG A;  4BVX A;  3RPP A;  5IOW A;  1K0M A;  1GH2 A;  5DAK B;  3F3Q A;  2CZ2 A;  3FZ4 A;  3TGZ A;  1B4Q A;  1EWX A;  3IAM 2;  4BL7 A;  1M3I A;  3F6F A;  3BOA A;  4PI0 C;  1MEK A;  4XRA A;  4HI7 A;  3M9J A;  3VI7 A;  3ED3 A;  3UJ1 A;  5EY6 A;  1SEN A;  1SKR B;  1SL2 B;  2DJ1 A;  4G9H A;  1Z3E A;  4HS1 A;  2B5X A;  17GS A;  2PN8 A;  2WZS A;  4TR1 B;  1KEB A;  2EFE A;  2JZS A;  3QPM A;  1A0R P;  2MMZ A;  4YH2 A;  2PU9 C;  3M0F A;  2OA7 A;  2K8V A;  4GSS A;  1AQV A;  3GN3 A;  1ZL9 A;  1VF1 A;  3ZRE A;  5G5E A;  4HZ4 A;  1DE2 A;  2NPB A;  5B8A A;  3HA9 A;  3Q6O A;  3PH9 A;  4DEJ A;  4E68 A;  4EF0 A;  1GTA A;  3DKS A;  3Q74 A;  4BPY A;  2H76 A;  5G1K A;  3TKP A;  2B5Y A;  2CA8 A;  3KMN A;  3WGD A;  2HSH A;  3D21 A;  5ABR A;  1QFN A;  1HD2 A;  4PGT A;  1FVJ A;  22GS A;  4PUF C;  1N8J A;  1SYR A;  3FZA A;  5JCG A;  5ELG A;  1ZGN A;  4KW6 A;  4MJC A;  2H6X A;  4F0C A;  2H73 A;  4L5O A;  4I97 A;  1YF1 A;  1X5C A;  3ZTL A;  1UN2 A;  3HCZ A;  2O3E A;  2VCW A;  4KX4 A;  1ERT A;  2IFQ B;  1FG4 A;  2H1D A;  4EC0 A;  2E2M A;  3C73 A;  1S3R A;  5ECO B;  2JAD A;  2KOK A;  4HJ2 A;  3HHV A;  5ELA A;  1XOB A;  2H19 A;  1R4W A;  2D2Z A;  2R3X A;  1GTB A;  2XBI A;  3FK8 A;  4AKX B;  2DJJ A;  3RPN A;  3IC8 A;  2HRK B;  2YV9 A;  6GSY A;  2HRN A;  4OFN A;  1Y25 A;  4YQV A;  4ID0 A;  4YKG A;  4BVY A;  3VUR A;  4DVC A;  4KND A;  3QOU A;  3US3 A;  5J3R A;  2VM1 A;  1ZCP A;  4G2E A;  2MBT A;  1ILO A;  1PMT A;  1A2M A;  2CAI A;  1TU7 A;  5IIZ A;  5CRD A;  3GTU B;  3HZ4 A;  3HMJ G;  2C0G A;  2WVX A;  2FA4 A;  1O85 A;  3HVX A;  2WW1 A;  4NV2 A;  16GS A;  4F0B A;  1EP7 A;  2A2R A;  4FH8 A;  2GSR A;  4CY8 A;  3M1G A;  1ACV A;  2AUV A;  4KDU A;  1YJ6 A;  4KGI A;  3IRA A;  2I3Y A;  1JZR A;  1GUM A;  2K9F A;  3DVW A;  2C0D A;  4K1F A;  1Y6E A;  3A2X A;  4AJ7 A;  1G7O A;  2H6Y A;  3LEF A;  4ECB A;  2A4H A;  4JRR A;  1EV9 A;  1BQ7 A;  4NAX A;  4O5U A;  2YWO A;  1PSQ A;  1XXU A;  2OBI A;  2YZH A;  1AXD A;  3IK7 A;  1XIY A;  2F3M A;  1T3B A;  1RW1 A;  4TRX A;  3LW9 A;  3RFR C;  2RM6 A;  1XVQ A;  1UVZ A;  2AB6 A;  2GSS A;  4HOJ A;  5JCU A;  4V1A p;  3IHQ A;  3O6T A;  5B6N A;  3N5O A;  4HUA A;  1OYJ A;  2F8A A;  2CVD A;  3FYG A;  1O81 A;  4HZ2 A;  4ZL7 A;  4LL4 B;  2L4Q A;  3A3T A;  4TXV A;  5BRT A;  4CY6 A;  4CDO A;  1DSB A;  4POM A;  2LST A;  4HDE A;  2HZE A;  4OWY A;  3VWV A;  1Z7P A;  12GS A;  1OKT A;  1GSD A;  1N25 A;  4PNF A;  5AIX A;  4Z7X A;  4ULX A;  5A5K A;  4OCF A;  5ECN B;  3TDG A;  1PL1 A;  1ZZY A;  1BG1 A;  1JFU A;  1SD9 A;  4YAP A;  3HVS A;  3QR6 A;  2OKA A;  4ZBA A;  2WFC A;  5ECQ B;  4GF0 A;  1TXX A;  3BJ5 A;  3I9V 2;  3H93 A;  1SJI A;  6GST A;  4WXT A;  1RQM A;  3H1N A;  3TRQ A;  4N0Z A;  2P31 A;  2FLS A;  1X0R A;  3ZLP A;  5ECH B;  3LSZ A;  5KEJ A;  2QKE A;  2EFH A;  1ZYP A;  3GV1 A;  1U88 A;  1F3A A;  2LRC A;  1SK1 A;  4IGJ A;  3APQ A;  1K0D A;  4EVM A;  1WOU A;  1TK0 B;  1W89 A;  2EIR A;  4POB A;  2XHF A;  2OE0 A;  1OKD A;  1XW9 A;  2WVZ A;  2B6M A;  5ECS A;  1VGL A;  5DAL A;  2RM5 A;  3E0U A;  2Z9S A;  5D9T A;  2FWF A;  2JZR A;  19GS A;  2NBS A;  4JZQ A;  1TRV A;  1Q98 A;  2V6O A;  1XCC A;  2PUK C;  3GIX A;  3L9S A;  2O89 A;  2LQO A;  4ZB9 A;  2WW3 A;  1JLW A;  1GLQ A;  2X8G A;  7GSS A;  2VM2 A;  5DDL A;  3ZIT A;  4TR4 A;  2E7P A;  2FWH A;  1IYI A;  3P7X A;  2MMN A;  4N10 A;  1OE7 A;  4ML1 A;  2J23 A;  4BIK A;  4CW9 A;  1YKA A;  2VKZ G;  4O5Q A;  3ME8 A;  4TXO A;  2CX3 A;  4ZL8 A;  3CRT A;  3TCO A;  1TJD A;  4J56 E;  4PQI A;  1TK5 B;  1I1I P;  2LTK A;  4EXJ A;  4NPB A;  3TKR A;  3GH6 A;  4BVX B;  3TKS A;  4OO4 A;  2DIZ A;  2IMD A;  3TJJ A;  3TU3 B;  2LJR A;  4BL7 B;  4PX1 A;  3DD3 A;  2QC7 A;  4EL1 A;  4L5L A;  5H5S A;  1WJK A;  4MPF A;  4O32 A;  4WF5 A;  5INY A;  4G19 A;  1WRY A;  4EKZ A;  1K0C A;  5J41 A;  4K7I A;  3KCM A;  4L0U A;  1NM3 A;  1YEW C;  4WR5 A;  3D0Z A;  5FHI A;  1TKD B;  2VIM A;  2QGV A;  1AUC A;  1GSS A;  4TW5 A;  5A4V A;  2B5E A;  1UC7 A;  2FWG A;  3FR6 A;  3QMX A;  2LQQ A;  3KJY A;  4X0X A;  4MAB A;  2JU5 A;  5HFK A;  1SVO A;  4POL A;  4KCE A;  5JCW A;  1GSF A;  1Z7R A;  2DMM A;  1TW9 A;  4WF4 A;  2V32 A;  3EC3 A;  5A4U A;  4FXY P;  2NTO A;  3AY8 A;  4AI6 A;  2IMI A;  5CNW A;  4GCI A;  3R2Q A;  1QK8 A;  2ON5 A;  3IR4 A;  1ST9 A;  4FYU A;  1B8X A;  4H86 A;  2EFC A;  5J4V A;  1O8W A;  3QFA C;  2FWE A;  1EZK A;  1F9M A;  1U6T A;  5HR2 A;  1X5E A;  5DCH A;  3A5I A;  3KD0 A;  3M9K A;  3IE3 A;  1PGT A;  2DML A;  3GL5 A;  2IMK A;  3CXG A;  2A2S A;  5IMF A;  2A2P A;  4AGS A;  4MLY A;  1M2A A;  4ECC A;  1XFL A;  1S3C A;  4XRD A;  4EIQ A;  1AC1 A;  4MJA A;  2L5L A;  1F3B A;  4GXZ A;  2O5V A;  5A34 A;  3EYT A;  4POK A;  5IO2 A;  4PUR A;  3TKQ A;  4RUV A;  4IKH A;  2FD3 A;  1AW9 A;  2V2G A;  3HXS A;  5C00 A;  3VWX A;  4LMW A;  4YKF A;  4PTS A;  3UAR A;  4I2T A;  5IM9 A;  3KIJ A;  3FKF A;  5A1N A;  1GSQ A;  5IOX A;  3RHB A;  3WGE A;  2EFD A;  1XWC A;  4GSN A;  1YEP A;  2DKH A;  3TKS E;  2X4A A;  2A4V A;  1K0O A;  2H1A A;  4MPG A;  3QDN A;  4BVY B;  2F9S A;  4WKW A;  3TJF A;  2HT9 A;  1AQW A;  4JR4 A;  5G1L A;  4ZIJ A;  4GQF A;  1TI1 A;  4USS A;  2O87 A;  1J08 A;  3BCK A;  2C80 A;  2R2J A;  3KM6 A;  4J57 E;  2XPE A;  3ZIV A;  1TXU A;  5FWG A;  3TB2 A;  3FR3 A;  2F8F A;  4FIW A;  2WVX B;  4AJ8 A;  5COH A;  3KEB A;  2YV7 A;  1TTZ A;  5HQP A;  1ERU A;  5CRH A;  2WDU A;  4XCS A;  4IP1 A;  4G0L A;  1PN0 A;  1SK0 A;  1VF3 A;  4K2D A;  2NVL A;  1OC3 A;  1VRS D;  3HKR A;  3WD6 A;  2C1Y A;  5KN1 A;  1XVW A;  3C1S A;  1O6J A;  2QA2 A;  3HY2 A;  2ZUP A;  1B48 A;  1K3O A;  1URM A;  4V1A g;  2KUC A;  4QL7 A;  2M46 A;  2KHP A;  2YWN A;  1TK8 B;  2M80 A;  3HJO A;  3DXB A;  2V6K A;  1GNE A;  3U6V A;  1XZO A;  4P3Y B;  2PPT A;  3TKS C;  4MH2 A;  1M99 A;  2EIO A;  3A2V A;  3CRU A;  2FUG 2;  3UVT A;  1TDI A;  2FGX A;  1T1V A;  3IA1 A;  1AQX A;  4K7O A;  3GH9 A;  1S4B P;  5AIS A;  2BJX A;  1PQN A;  14GS A;  3FRC A;  2LKU A;  2HSM A;  1T00 A;  1YDK A;  3EMP A;  3ERW A;  4Q5Q A;  5J40 A;  4L0W A;  2GST A;  1S3D A;  2HXK A;  4MNN A;  4FYB A;  4PUA A;  3RAZ A;  3L78 A;  1OVN A;  2HZE B;  4OD7 A;  4FQU A;  4X43 A;  3PR8 A;  2CX4 A;  5J5N A;  1GNW A;  2IMF A;  2P0G A;  4JU5 A;  4ACS A;  3GUS A;  1VF4 A;  2F51 A;  5ID2 A;  4WBJ A;  1AIU A;  5H5Q A;  1IYH A;  2EC4 A;  1SYX A;  1QXH A;  4ZBB A;  5HFI A;  4W66 A;  4EE0 A;  5CO3 A;  5FT3 A;  4XS4 A;  1M2B A;  2TIR A;  4PNG A;  5D9X A;  5CRE A;  3E3E A;  3F9U A;  4OFM A;  2AYT A;  3CBU A;  5G5F A;  1EOG A;  1WPI A;  2I4A A;  2H01 A;  3MYD A;  1K0B A;  1X9M B;  2VCX A;  5F8B A;  3ZML A;  3D4T A;  4X4J A;  1WIK A;  4TR3 A;  3TJB A;  4K9Z A;  5KOW A;  2FCH A;  4KF9 A;  2H1B A;  3W8J A;  4ISD A;  1U3I A;  5F07 A;  2H75 A;  1TRU A;  3WT1 A;  3ZFL A;  3BBY A;  3UMA A;  2QA1 A;  4HJM A;  5IMA A;  4ZL9 A;  3BD2 A;  2J9H A;  5KN2 A;  5DAL B;  2YOI A;  3GL3 A;  2R4V A;  4QMK A;  1I9D A;  1BYE A;  1RK4 A;  2VD0 A;  5ECP B;  4NWY A;  4IP6 A;  1EGO A;  3IOS A;  2YCD A;  3S9F A;  2X8C A;  5HR1 A;  4E8E A;  1R5A A;  2GZP A;  4BWS A;  3UEM A;  1T7P B;  2TRC P;  3CMI A;  5JWO B;  3DIE A;  4DSR A;  4OCE A;  4YQU A;  4ECJ A;  3M8N A;  1NW2 A;  1W4V A;  2VAF A;  3UL3 A;  2GQL A;  5D73 A;  3RGB C;  4TXO B;  2I1U A;  4LMV A;  2GTU A;  2GVP A;  5F05 A;  1PKW A;  1BED A;  3KTL A;  3I69 A;  2L4C A;  1LU4 A;  3ZMK A;  5J4U A;  4V2L A;  1CQG A;  2V1M A;  2DIY A;  2ZNM A;  3GYK A;  2MMO A;  2WW0 A;  4KB3 A;  5BMU A;  4MJB A;  3EWL A;  2YZU A;  3GST A;  3EMX A;  4XHM A;  1FOV A;  3IAS 2;  2XPD A;  4V2N A;  3GX0 A;  3DVX A;  3VPT A;  1PD2 1;  2L6C A;  2MMA A;  3IK9 A;  3DML A;  1SKS B;  2DJ0 A;  4K5R A;  2NDO A;  3HVV A;  3IBH A;  4KDY A;  2LV3 A;  4IJI A;  3EVI A;  5D9V A;  4RI7 A;  4EUY A;  1ZMA A;  4JED A;  3CSJ A;  1PA3 A;  2IIY A;  18GS A;  4JR6 A;  3RHC A;  2TRX A;  3HZ8 A;  4MF6 A;  4O92 A;  2P5R A;  4F9Z A;  4KE3 A;  3L4N A;  4RQR A;  3A5W A;  1K0N A;  3D4M A;  3WYW A;  2H1G A;  5CRW A;  2H66 A;  5DCG A;  2L57 A;  1LBK A;  1MDK A;  1GTI A;  3MIX A;  2E2G A;  1ERW A;  2H1L A;  4LLR A;  4AKI A;  1O73 A;  2H74 A;  1R5P A;  1THO A;  2YPM A;  3KH9 A;  1QUW A;  5DQS A;  2O7K A;  1N2A A;  3VWU A;  1GSE A;  2EIQ A;  5DQY A;  1XOA A;  2CZ3 A;  4K5S A;  1SL1 B;  2WJU A;  1A23 A;  5A5H A;  3QAW A;  5A34 B;  4O5R A;  5GAN D;  3MAK A;  1ZYE A;  3FZ9 A;  4ILF A;  5DVB A;  5GZZ B;  5A1N B;  4OFT A;  4J2F A;  1GUL A;  1H4O A;  3EU4 A;  3GKM A;  1V40 A;  1FB6 A;  1XG8 A;  1TRW A;  1XBS A;  5EVO A;  2DJ2 A;  2OAC A;  2GGT A;  5GST A;  4DSQ A;  4ECI A;  1H75 A;  2RII A;  3P90 A;  3HJM A;  1VF2 A;  4K8M A;  1GL8 A;  3EUR A;  6GSS A;  3GKN A;  3G7I A;  4G0K A;  2PVQ A;  2YN1 A;  4FO5 A;  4Q5F A;  1ERV A;  1A8L A;  4ZB6 A;  2XBQ A;  1X9W B;  4XS1 A;  2KP1 A;  2R0C A;  1OC9 B;  4RQX A;  1R26 A;  4OMV A;  5J47 A;  2H0G A;  1PX6 A;  1SVL A;  3KXO A;  4N0V A;  4K2X A;  2UZ8 A;  2P5Q A;  1GUK A;  4V2M A;  3LXZ A;  2B1K A;  2GS3 A;  3FZ5 A;  4ZBD A;  3GUR A;  1CQH A;  4XIH A;  3UOM A;  1KTE A;  3WGX A;  4Q5N A;  1EV4 A;  2AHE A;  3OR5 A;  3QCP A;  4IJ3 A;  3W8S A;  3KZQ A;  5J9C A;  2WS2 A;  2CV4 A;  3ZVJ A;  4IBP A;  2V41 A;  2CVK A;  3UBK A;  3FW2 A;  2VCV A;  2WRT A;  3GMF A;  3HDC A;  4LA1 A;  1JHB A;  3ZYW A;  3VK9 A;  1NHO A;  3FHK A;  2N5B A;  3GKK A;  5E4W A;  3RDW A;  2I81 A;  4Q5R A;  3TUE A;  2ALB A;  1Q4J A;  2YJ7 A;  2PER A;  1Z6N A;  2VLV A;  1JZW A;  3G7Y A;  3Q19 A;  2VLU A;  2O85 A;  3F3R A;  2ON7 A;  4MH3 A;  4IS0 A;  2X49 A;  3SBC A;  5DBQ A;  2L5O A;  1GSY A;  3N9J A;  4KSO A;  1JLV A;  2HSM B;  4PI2 C;  2HZF A;  3C1R A;  2HLS A;  1GWC A;  2OBK A;  3HJP A;  2HRF A;  4KA0 A;  1XWG A;  4TOP A;  2WW2 A;  2H8L A;  2GDR A;  3TRX A;  4ZB8 A;  5AGY A;  3NZN A;  1XW5 A;  2GQM A;  5ENU A;  1NSW A;  3FR9 A;  5IMD A;  3IPZ A;  4BA7 A;  5IQY A;  4ML6 A;  1Y1U A;  4YQM A;  2G2Q A;  5C04 A;  5ID2 B;  5HFG A;  4AKG A;  1EEM A;  2DBC A;  1M3J A;  1PKZ A;  4JE1 A;  4XS4 B;  1PRX A;  1WMJ A;  1EOH A;  4X1U A;  4GLT A;  1A0F A;  1SD8 A;  1BAY A;  4OO5 A;  3HYP A;  1SL0 B;  1V57 A;  2RUE A;  3D22 A;  2FY6 A;  10GS A;  2VD1 A;  3CSI A;  2M72 A;  3ERF A;  1E6B A;  2IN3 A;  2BMX A;  4GST A;  2MYG A;  3UBL A;  3ZL5 A;  1O8X A;  3W6G A; 
#chains in the Genus database with same CATH homology
 2DC5 A;  2L59 A;  1FHE A;  3K8N A;  2R0P A;  1YKC A;  5IMC A;  2JSZ A;  1KBN A;  5A4W A;  3L0H A;  1OC9 A;  3DEX A;  1TI3 A;  5ECL B;  2X8H A;  3MWH A;  3R3E A;  2KP2 A;  2IPA A;  4HU7 A;  3H8Q A;  1YQ1 A;  4Z2U A;  1GTU A;  1M7T A;  4MP4 A;  3D6I A;  4MF7 A;  1WE0 A;  2CVB A;  1TP9 A;  4ICY A;  3LGC A;  3I6A A;  2AAW A;  13GS A;  1JZD A;  2H30 A;  4NMU A;  2H6Z A;  1PL2 A;  4KAE A;  3A2W A;  2HYX A;  4TKY A;  2B7K A;  1V98 A;  4K7N A;  3LOR A;  2E0Q A;  5J4Y A;  5GSS A;  4G01 A;  2R0G A;  2LS5 A;  1SU9 A;  4IEL A;  3J7Y k;  3GX8 A;  4E8H A;  4K0N A;  4TN8 A;  5G30 A;  3GNJ A;  1SJZ A;  1K3L A;  2WB9 A;  4QL9 A;  1G6W A;  3KTB A;  2OT3 A;  3F4R A;  4DSS A;  2GZZ A;  3D5J A;  3LXT A;  3GKX A;  2B1L A;  2WGR A;  3M3M A;  4TR0 A;  4IN0 A;  3TRP A;  4ZXG A;  5B7C A;  1A2L A;  2H72 A;  6GSV A;  3PGT A;  8GSS A;  5BMU B;  5HR3 A;  3P2A A;  1U87 A;  2PMT A;  1GSU A;  3JCM L;  4NV5 A;  2C3Q A;  2RUF A;  2HSN A;  3TJK A;  2DSA A;  5ECI B;  5EL8 A;  1T4Y A;  3CSH A;  4WET A;  1XWB A;  3RBT A;  1T4Z A;  2IL3 A;  1FB0 A;  1QGV A;  3F4T A;  4GRF A;  3VI5 A;  4EDZ A;  2VLT A;  1GLP A;  1BG5 A;  1DBY A;  2LJA A;  4KDX A;  4EIP A;  2LNS A;  3GRX A;  3EE2 A;  5H5R A;  11GS A;  2C3N A;  3GA4 A;  1XWA A;  2YWI A;  3MDK A;  1JZO A;  3ERG A;  3FEU A;  1YY7 A;  3ZZX A;  4IQA A;  4IVF A;  3KP9 A;  1A2J A;  3TJG A;  2VUP A;  2YJH A;  2X64 A;  1FOH A;  2O8V B;  2AV4 A;  3PIN A;  4D73 B;  4MDC A;  2QSI A;  5CAX A;  5B6M A;  2H0I A;  3LWA A;  2FHE A;  5D9W A;  1PX7 A;  1F2E A;  3LJR A;  5DJM A;  2BTO T;  2YNX A;  1MD3 A;  2C0E A;  1M9A A;  1T8E B;  3KH7 A;  4L8E A;  1Z5Y E;  3G7J A;  1A24 A;  3DRN A;  1XPV A;  2JSY A;  2C3T A;  3ME7 A;  2WZ9 A;  1J0F A;  3QAV A;  2LUS A;  2N5F A;  3Q18 A;  2K6V A;  2OE1 A;  5A5H B;  2JZT A;  1B9X C;  4NXI A;  2K8S A;  1S3A A;  2HQT A;  2MZC A;  3WT2 A;  4Z2T A;  2ES7 A;  4N30 A;  3QFB C;  1BX9 A;  3IXR A;  5JWR B;  3ZVJ D;  1EEJ A;  5DAK A;  1SJ6 A;  2GSQ A;  4GTU A;  5KOX A;  3KGK A;  3IV4 A;  2REM A;  4G10 A;  3CTG A;  1FAA A;  2LEG A;  3H79 A;  3VFI A;  5IPG A;  3F4S A;  2VCQ A;  2OAD A;  3NIV A;  5LD0 A;  3C7M A;  1WWJ A;  3GSS A;  3LG6 A;  2H0H A;  2YAN A;  5ECK B;  3DGQ A;  4TR1 A;  4MCU A;  1DUG A;  1I5G A;  3L9V A;  3BCI A;  4N3Z A;  4HQS A;  5D8I A;  1LJR A;  3C71 A;  4PXO A;  4JBB A;  1F6M C;  2H71 A;  1EGR A;  5AIV A;  1ML6 A;  5ECM B;  3TOU A;  4I2U A;  2PBJ A;  3FY7 A;  1XW6 A;  4MZB A;  2HFD A;  5G31 A;  3VWW A;  2OE3 A;  1BJX A;  2H70 A;  3VPQ A;  4WBR D;  1V9W A;  9GSS A;  5LCZ A;  3V1W A;  5IO0 A;  3CTF A;  4WR4 A;  2JL4 A;  2IJY A;  5CRG A;  5KN3 A;  2FNO A;  1FO5 A;  3KMO A;  2I9H A;  4GDF A;  1SKW B;  6GSX A;  1B4P A;  5LNK e;  4IW9 A;  3F0I A;  3O3T A;  1K3Y A;  4HU9 A;  3G9B A;  2C8U A;  1YZX A;  5D96 A;  3NOF A;  3UIW A;  1YEX A;  4BWQ A;  1V58 A;  4RI6 A;  4D73 A;  2GT5 A;  2VL3 A;  5D93 A;  2VL2 A;  3EU3 A;  5F0G A;  5ECR B;  2OJL A;  1GP1 A;  5G2Z A;  4WEY A;  1A8Y A;  2IFQ A;  2VCT A;  3MNG A;  3UAP A;  3C8E A;  2IME A;  2DKI A;  2N5A A;  1DE1 A;  1HQO A;  1M2D A;  2LNT A;  3TOT A;  1GRX A;  2B3S A;  4MF5 A;  5J9B A;  2GLR A;  5CP1 A;  2R37 A;  2VCZ A;  2HRK A;  1ZYQ B;  1G6Y A;  1QQ2 A;  4PQH A;  4GWR A;  3F6D A;  5CYY A;  3GHA A;  2PVO C;  5B8B A;  4XS6 A;  2UV8 G;  2HNL A;  3ZFB A;  4IHU A;  4PQ1 A;  4CHS A;  2X99 A;  3LQ7 A;  2ZCT A;  1PN9 A;  1R7H A;  5IMV A;  3VLN A;  1G0T A;  1NHY A;  2GT6 A;  4HEA 2;  1OE8 A;  5DJL A;  2DJK A;  3GTU A;  4MZW A;  3QD9 A;  3APO A;  3QAG A;  4AJ6 A;  4K0G A;  1X9S B;  6GSU A;  2CT6 A;  4MMM A;  1MD4 A;  3SWL A;  5AN1 A;  5EPF A;  1ZYN A;  4IQ1 A;  3MSZ A;  3I43 A;  2YP6 A;  2G0F A;  4Z2R A;  1TU8 A;  1AAZ A;  5HR0 A;  3EIN A;  1WP0 A;  4ZIL A;  3CWG A;  1Z9H A;  1SVM A;  3J7Y b;  1ON4 A;  5E59 A;  2VO4 A;  5IPH A;  2DJ3 A;  4KSM A;  3IDV A;  3H4K A;  5L71 A;  4MK3 A;  2MBS A;  2WCI A;  1HYU A;  1XWK A;  3PPU A;  4AKH A;  4K6X A;  2LRT A;  3GFK A;  4GQC A;  2K18 A;  4HQZ A;  3DYR A;  1GUH A;  3IHG A;  2DLX A;  1C72 A;  2GQK A;  3LYP A;  1EP8 A;  2GZY A;  4I5Q A;  1F37 A;  20GS A;  1HNB A;  4KUN A;  2JAC A;  1MDI A;  1M9B A;  1QMV A;  4MZC A;  4EO3 A;  5IMZ A;  4QQ7 A;  1YF0 A;  3ISO A;  4YAV A;  1USB A;  2LJK A;  2RLI A;  6GSW A;  4F03 A;  2PGT A;  1TRS A;  3U5R E;  1MDJ A;  2L6D A;  4DSS B;  4F82 A;  5KN0 A;  1ZOF A;  2HE3 A;  2CQ9 A;  2FA8 A;  4KH7 A;  2IWT A;  2HI7 A;  4G0I A;  3APS A;  1G7E A;  1SK2 A;  1UA5 A;  1O7U A;  4TVE A;  1U3A A;  1E2Y A;  2C0F A;  1J9B A;  3UVH A;  5F06 A;  1B9Y C;  1Z6M A;  2HSY A;  3F8U A;  1YVL A;  3KP8 A;  2C4J A;  2HSN B;  4F2I A;  3HD5 A;  4AF2 A;  2HRA A;  1MTC A;  4NHW A;  4NHZ A;  2PWJ A;  3P8W A;  1V2A A;  2B7J A;  1FW1 A;  2CAQ A;  2XC2 A;  1ABA A;  4I8B A;  5JWQ B;  4XTS A;  3DWV A;  4LL1 B;  2LRN A;  3FMW A;  1K0A A;  1BF5 A;  4KCA A;  3LYK A;  2VL2 C;  3ZRD A;  3EPT A;  3LFL A;  2R6K A;  3CYN A;  1X5D A;  3L9U A;  5GAP D;  4I6X A;  4ZB7 A;  4A5P A;  1FVK A;  2KLX A;  3E9J B;  1M0U A;  2R5G A;  1TOF A;  4EDY A;  1HNC A;  4N11 A;  4FYC A;  1HNA A;  3F63 A;  2WUL A;  4O7H A;  4MA9 A;  2VL9 A;  2VOC A;  4MJE A;  2YWM A;  2AJQ B;  1OC8 A;  3O76 A;  1OAZ A;  3IC4 A;  1THX A;  3ZIJ A;  1KNG A;  4BVX A;  3RPP A;  5IOW A;  1K0M A;  1GH2 A;  5DAK B;  3F3Q A;  2CZ2 A;  3FZ4 A;  3TGZ A;  1B4Q A;  1EWX A;  3IAM 2;  4BL7 A;  3F6F A;  3BOA A;  1MEK A;  4XRA A;  4HI7 A;  3M9J A;  3VI7 A;  3ED3 A;  3UJ1 A;  5EY6 A;  1SEN A;  1SKR B;  1SL2 B;  2DJ1 A;  4G9H A;  1Z3E A;  4HS1 A;  2B5X A;  17GS A;  2PN8 A;  4TR1 B;  1KEB A;  2EFE A;  2JZS A;  3QPM A;  1A0R P;  2MMZ A;  4YH2 A;  2PU9 C;  3M0F A;  2OA7 A;  2K8V A;  4GSS A;  1AQV A;  3GN3 A;  1ZL9 A;  1VF1 A;  3ZRE A;  5G5E A;  4HZ4 A;  1DE2 A;  2NPB A;  5B8A A;  3HA9 A;  3Q6O A;  3PH9 A;  4DEJ A;  4E68 A;  4EF0 A;  1GTA A;  3DKS A;  3Q74 A;  4BPY A;  2H76 A;  5G1K A;  3TKP A;  2B5Y A;  2CA8 A;  3KMN A;  3WGD A;  2HSH A;  3D21 A;  5ABR A;  1QFN A;  1HD2 A;  4PGT A;  1FVJ A;  22GS A;  4PUF C;  1N8J A;  1SYR A;  3FZA A;  5JCG A;  5ELG A;  1ZGN A;  4KW6 A;  4MJC A;  2H6X A;  4F0C A;  2H73 A;  4L5O A;  4I97 A;  1YF1 A;  1X5C A;  3ZTL A;  1UN2 A;  3HCZ A;  2VCW A;  4KX4 A;  1ERT A;  2IFQ B;  1FG4 A;  2H1D A;  4EC0 A;  2E2M A;  3C73 A;  5ECO B;  2JAD A;  2KOK A;  4HJ2 A;  3HHV A;  5ELA A;  1XOB A;  2H19 A;  1R4W A;  2D2Z A;  2R3X A;  1GTB A;  2XBI A;  3FK8 A;  4AKX B;  2DJJ A;  3RPN A;  3IC8 A;  2HRK B;  2YV9 A;  6GSY A;  2HRN A;  4OFN A;  1Y25 A;  4YQV A;  4ID0 A;  4YKG A;  4BVY A;  3VUR A;  4DVC A;  4KND A;  3QOU A;  3US3 A;  5J3R A;  2VM1 A;  1ZCP A;  4G2E A;  2MBT A;  1ILO A;  1PMT A;  1A2M A;  2CAI A;  1TU7 A;  5IIZ A;  5CRD A;  3GTU B;  3HZ4 A;  3HMJ G;  2C0G A;  2FA4 A;  1O85 A;  3HVX A;  4NV2 A;  16GS A;  4F0B A;  1EP7 A;  2A2R A;  4FH8 A;  2GSR A;  4CY8 A;  3M1G A;  1ACV A;  2AUV A;  4KDU A;  1YJ6 A;  4KGI A;  3IRA A;  2I3Y A;  1JZR A;  1GUM A;  2K9F A;  3DVW A;  2C0D A;  4K1F A;  1Y6E A;  3A2X A;  4AJ7 A;  1G7O A;  2H6Y A;  3LEF A;  4ECB A;  2A4H A;  4JRR A;  1EV9 A;  1BQ7 A;  4NAX A;  4O5U A;  2YWO A;  1PSQ A;  1XXU A;  2OBI A;  2YZH A;  1AXD A;  3IK7 A;  1XIY A;  2F3M A;  1T3B A;  1RW1 A;  4TRX A;  3LW9 A;  2RM6 A;  1XVQ A;  1UVZ A;  2AB6 A;  2GSS A;  4HOJ A;  5JCU A;  4V1A p;  3IHQ A;  3O6T A;  5B6N A;  3N5O A;  4HUA A;  1OYJ A;  2F8A A;  2CVD A;  3FYG A;  1O81 A;  4HZ2 A;  4ZL7 A;  4LL4 B;  2L4Q A;  3A3T A;  4TXV A;  5BRT A;  4CY6 A;  4CDO A;  1DSB A;  4POM A;  2LST A;  4HDE A;  2HZE A;  4OWY A;  3VWV A;  1Z7P A;  12GS A;  1OKT A;  1GSD A;  1N25 A;  4PNF A;  5AIX A;  4Z7X A;  4ULX A;  5A5K A;  4OCF A;  5ECN B;  3TDG A;  1PL1 A;  1ZZY A;  1BG1 A;  1JFU A;  1SD9 A;  4YAP A;  3HVS A;  3QR6 A;  2OKA A;  4ZBA A;  2WFC A;  5ECQ B;  4GF0 A;  1TXX A;  3BJ5 A;  3I9V 2;  3H93 A;  1SJI A;  6GST A;  4WXT A;  1RQM A;  3H1N A;  3TRQ A;  4N0Z A;  2P31 A;  2FLS A;  1X0R A;  3ZLP A;  5ECH B;  3LSZ A;  5KEJ A;  2QKE A;  2EFH A;  1ZYP A;  3GV1 A;  1U88 A;  1F3A A;  2LRC A;  1SK1 A;  4IGJ A;  3APQ A;  1K0D A;  4EVM A;  1WOU A;  1TK0 B;  1W89 A;  2EIR A;  4POB A;  2XHF A;  2OE0 A;  1OKD A;  1XW9 A;  2B6M A;  5ECS A;  1VGL A;  5DAL A;  2RM5 A;  3E0U A;  2Z9S A;  5D9T A;  2FWF A;  2JZR A;  19GS A;  2NBS A;  4JZQ A;  1TRV A;  1Q98 A;  2V6O A;  1XCC A;  2PUK C;  3GIX A;  3L9S A;  2O89 A;  2LQO A;  4ZB9 A;  1JLW A;  1GLQ A;  2X8G A;  7GSS A;  2VM2 A;  5DDL A;  3ZIT A;  4TR4 A;  2E7P A;  2FWH A;  1IYI A;  3P7X A;  2MMN A;  4N10 A;  1OE7 A;  4ML1 A;  2J23 A;  4CW9 A;  1YKA A;  2VKZ G;  4O5Q A;  3ME8 A;  4TXO A;  2CX3 A;  4ZL8 A;  3CRT A;  3TCO A;  1TJD A;  4J56 E;  4PQI A;  1TK5 B;  2LTK A;  4EXJ A;  4NPB A;  3TKR A;  3GH6 A;  4BVX B;  3TKS A;  4OO4 A;  2DIZ A;  2IMD A;  3TJJ A;  3TU3 B;  2LJR A;  4BL7 B;  4PX1 A;  3DD3 A;  2QC7 A;  4EL1 A;  4L5L A;  5H5S A;  1WJK A;  4MPF A;  4O32 A;  4WF5 A;  5INY A;  4G19 A;  1WRY A;  4EKZ A;  1K0C A;  5J41 A;  4K7I A;  3KCM A;  4L0U A;  1NM3 A;  4WR5 A;  3D0Z A;  5FHI A;  1TKD B;  2VIM A;  2QGV A;  1AUC A;  1GSS A;  4TW5 A;  5A4V A;  2B5E A;  1UC7 A;  2FWG A;  3FR6 A;  3QMX A;  2LQQ A;  3KJY A;  4X0X A;  4MAB A;  2JU5 A;  5HFK A;  1SVO A;  4POL A;  4KCE A;  5JCW A;  1GSF A;  1Z7R A;  2DMM A;  1TW9 A;  4WF4 A;  2V32 A;  3EC3 A;  5A4U A;  2NTO A;  3AY8 A;  4AI6 A;  2IMI A;  5CNW A;  4GCI A;  3R2Q A;  1QK8 A;  2ON5 A;  3IR4 A;  1ST9 A;  4FYU A;  1B8X A;  4H86 A;  2EFC A;  5J4V A;  1O8W A;  3QFA C;  2FWE A;  1EZK A;  1F9M A;  1U6T A;  5HR2 A;  1X5E A;  5DCH A;  3A5I A;  3KD0 A;  3M9K A;  3IE3 A;  1PGT A;  2DML A;  3GL5 A;  2IMK A;  3CXG A;  2A2S A;  5IMF A;  2A2P A;  4AGS A;  4MLY A;  1M2A A;  4ECC A;  1XFL A;  1S3C A;  4XRD A;  4EIQ A;  1AC1 A;  4MJA A;  2L5L A;  1F3B A;  4GXZ A;  2O5V A;  5A34 A;  3EYT A;  4POK A;  5IO2 A;  4PUR A;  3TKQ A;  4RUV A;  4IKH A;  2FD3 A;  1AW9 A;  2V2G A;  3HXS A;  5C00 A;  3VWX A;  4LMW A;  4YKF A;  4PTS A;  3UAR A;  4I2T A;  5IM9 A;  3KIJ A;  3FKF A;  5A1N A;  1GSQ A;  5IOX A;  3RHB A;  3WGE A;  2EFD A;  1XWC A;  4GSN A;  1YEP A;  2DKH A;  3TKS E;  2X4A A;  2A4V A;  1K0O A;  2H1A A;  4MPG A;  3QDN A;  4BVY B;  2F9S A;  4WKW A;  3TJF A;  2HT9 A;  1AQW A;  4JR4 A;  5G1L A;  4ZIJ A;  4GQF A;  1TI1 A;  4USS A;  2O87 A;  1J08 A;  3BCK A;  2C80 A;  2R2J A;  3KM6 A;  4J57 E;  2XPE A;  3ZIV A;  1TXU A;  5FWG A;  3TB2 A;  3FR3 A;  2F8F A;  4FIW A;  4AJ8 A;  5COH A;  3KEB A;  2YV7 A;  1TTZ A;  5HQP A;  1ERU A;  5CRH A;  2WDU A;  4XCS A;  4IP1 A;  4G0L A;  1PN0 A;  1SK0 A;  1VF3 A;  4K2D A;  2NVL A;  1OC3 A;  1VRS D;  3HKR A;  3WD6 A;  2C1Y A;  5KN1 A;  1XVW A;  3C1S A;  1O6J A;  2QA2 A;  3HY2 A;  2ZUP A;  1B48 A;  1K3O A;  1URM A;  4V1A g;  2KUC A;  4QL7 A;  2M46 A;  2KHP A;  2YWN A;  1TK8 B;  2M80 A;  3HJO A;  3DXB A;  2V6K A;  1GNE A;  3U6V A;  1XZO A;  4P3Y B;  2PPT A;  3TKS C;  4MH2 A;  1M99 A;  2EIO A;  3A2V A;  3CRU A;  2FUG 2;  3UVT A;  1TDI A;  2FGX A;  1T1V A;  3IA1 A;  1AQX A;  4K7O A;  3GH9 A;  5AIS A;  2BJX A;  1PQN A;  14GS A;  3FRC A;  2LKU A;  2HSM A;  1T00 A;  1YDK A;  3EMP A;  3ERW A;  4Q5Q A;  5J40 A;  4L0W A;  2GST A;  1S3D A;  2HXK A;  4MNN A;  4FYB A;  4PUA A;  3RAZ A;  3L78 A;  1OVN A;  2HZE B;  4OD7 A;  4FQU A;  4X43 A;  3PR8 A;  2CX4 A;  5J5N A;  1GNW A;  2IMF A;  2P0G A;  4JU5 A;  4ACS A;  3GUS A;  1VF4 A;  2F51 A;  5ID2 A;  4WBJ A;  1AIU A;  5H5Q A;  1IYH A;  2EC4 A;  1SYX A;  1QXH A;  4ZBB A;  5HFI A;  4W66 A;  4EE0 A;  5CO3 A;  5FT3 A;  4XS4 A;  1M2B A;  2TIR A;  4PNG A;  5D9X A;  5CRE A;  3E3E A;  3F9U A;  4OFM A;  2AYT A;  3CBU A;  5G5F A;  1EOG A;  1WPI A;  2I4A A;  2H01 A;  3MYD A;  1K0B A;  1X9M B;  2VCX A;  5F8B A;  3ZML A;  3D4T A;  4X4J A;  1WIK A;  4TR3 A;  3TJB A;  4K9Z A;  5KOW A;  2FCH A;  4KF9 A;  2H1B A;  3W8J A;  4ISD A;  1U3I A;  5F07 A;  2H75 A;  1TRU A;  3WT1 A;  3ZFL A;  3BBY A;  3UMA A;  2QA1 A;  4HJM A;  5IMA A;  4ZL9 A;  3BD2 A;  2J9H A;  5KN2 A;  5DAL B;  2YOI A;  3GL3 A;  2R4V A;  4QMK A;  1I9D A;  1BYE A;  1RK4 A;  2VD0 A;  5ECP B;  4NWY A;  4IP6 A;  1EGO A;  3IOS A;  2YCD A;  3S9F A;  2X8C A;  5HR1 A;  4E8E A;  1R5A A;  2GZP A;  4BWS A;  3UEM A;  1T7P B;  2TRC P;  3CMI A;  5JWO B;  3DIE A;  4DSR A;  4OCE A;  4YQU A;  4ECJ A;  3M8N A;  1NW2 A;  1W4V A;  2VAF A;  3UL3 A;  2GQL A;  5D73 A;  4TXO B;  2I1U A;  4LMV A;  2GTU A;  2GVP A;  5F05 A;  1PKW A;  1BED A;  3KTL A;  3I69 A;  2L4C A;  1LU4 A;  3ZMK A;  5J4U A;  4V2L A;  1CQG A;  2V1M A;  2DIY A;  2ZNM A;  3GYK A;  2MMO A;  4KB3 A;  5BMU A;  4MJB A;  3EWL A;  2YZU A;  3GST A;  3EMX A;  4XHM A;  1FOV A;  3IAS 2;  2XPD A;  4V2N A;  3GX0 A;  3DVX A;  3VPT A;  1PD2 1;  2L6C A;  2MMA A;  3IK9 A;  3DML A;  1SKS B;  2DJ0 A;  4K5R A;  2NDO A;  3HVV A;  3IBH A;  4KDY A;  2LV3 A;  4IJI A;  3EVI A;  5D9V A;  4RI7 A;  4EUY A;  1ZMA A;  4JED A;  3CSJ A;  1PA3 A;  2IIY A;  18GS A;  4JR6 A;  3RHC A;  2TRX A;  3HZ8 A;  4MF6 A;  4O92 A;  2P5R A;  4F9Z A;  4KE3 A;  3L4N A;  4RQR A;  3A5W A;  1K0N A;  3D4M A;  3WYW A;  2H1G A;  5CRW A;  2H66 A;  5DCG A;  2L57 A;  1LBK A;  1MDK A;  1GTI A;  3MIX A;  2E2G A;  1ERW A;  2H1L A;  4LLR A;  4AKI A;  1O73 A;  2H74 A;  1R5P A;  1THO A;  2YPM A;  3KH9 A;  1QUW A;  5DQS A;  2O7K A;  1N2A A;  3VWU A;  1GSE A;  2EIQ A;  5DQY A;  1XOA A;  2CZ3 A;  4K5S A;  1SL1 B;  2WJU A;  1A23 A;  5A5H A;  3QAW A;  5A34 B;  4O5R A;  5GAN D;  3MAK A;  1ZYE A;  3FZ9 A;  4ILF A;  5DVB A;  5GZZ B;  5A1N B;  4OFT A;  4J2F A;  1GUL A;  1H4O A;  3EU4 A;  3GKM A;  1V40 A;  1FB6 A;  1TRW A;  1XBS A;  5EVO A;  2DJ2 A;  2OAC A;  2GGT A;  5GST A;  4DSQ A;  4ECI A;  1H75 A;  2RII A;  3P90 A;  3HJM A;  1VF2 A;  4K8M A;  1GL8 A;  3EUR A;  6GSS A;  3GKN A;  3G7I A;  4G0K A;  2PVQ A;  2YN1 A;  4FO5 A;  4Q5F A;  1ERV A;  1A8L A;  4ZB6 A;  2XBQ A;  1X9W B;  4XS1 A;  2KP1 A;  2R0C A;  1OC9 B;  4RQX A;  1R26 A;  4OMV A;  5J47 A;  2H0G A;  1PX6 A;  1SVL A;  3KXO A;  4N0V A;  4K2X A;  2UZ8 A;  2P5Q A;  1GUK A;  4V2M A;  3LXZ A;  2B1K A;  2GS3 A;  3FZ5 A;  4ZBD A;  3GUR A;  1CQH A;  4XIH A;  3UOM A;  1KTE A;  3WGX A;  4Q5N A;  1EV4 A;  2AHE A;  3OR5 A;  3QCP A;  4IJ3 A;  3W8S A;  3KZQ A;  5J9C A;  2WS2 A;  2CV4 A;  3ZVJ A;  4IBP A;  2V41 A;  2CVK A;  3UBK A;  3FW2 A;  2VCV A;  2WRT A;  3GMF A;  3HDC A;  4LA1 A;  1JHB A;  3ZYW A;  3VK9 A;  1NHO A;  3FHK A;  2N5B A;  3GKK A;  5E4W A;  3RDW A;  2I81 A;  4Q5R A;  3TUE A;  2ALB A;  1Q4J A;  2YJ7 A;  2PER A;  1Z6N A;  2VLV A;  1JZW A;  3G7Y A;  3Q19 A;  2VLU A;  2O85 A;  3F3R A;  2ON7 A;  4MH3 A;  4IS0 A;  2X49 A;  3SBC A;  5DBQ A;  2L5O A;  1GSY A;  3N9J A;  4KSO A;  1JLV A;  2HSM B;  2HZF A;  3C1R A;  2HLS A;  1GWC A;  2OBK A;  3HJP A;  2HRF A;  4KA0 A;  1XWG A;  4TOP A;  2H8L A;  3TRX A;  2GDR A;  4ZB8 A;  5AGY A;  3NZN A;  1XW5 A;  2GQM A;  5ENU A;  1NSW A;  3FR9 A;  5IMD A;  3IPZ A;  4BA7 A;  5IQY A;  4ML6 A;  1Y1U A;  4YQM A;  2G2Q A;  5C04 A;  5ID2 B;  5HFG A;  4AKG A;  1EEM A;  2DBC A;  1PKZ A;  4JE1 A;  4XS4 B;  1PRX A;  1WMJ A;  1EOH A;  4X1U A;  4GLT A;  1A0F A;  1SD8 A;  1BAY A;  4OO5 A;  3HYP A;  1SL0 B;  1V57 A;  2RUE A;  3D22 A;  2FY6 A;  10GS A;  2VD1 A;  3CSI A;  2M72 A;  3ERF A;  1E6B A;  2IN3 A;  2BMX A;  4GST A;  2MYG A;  3UBL A;  3ZL5 A;  1O8X A;  3W6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...