4G19A

Crystal structure of the glutathione transferase gte1 from phanerochaete chrysosporium in complex with glutathione
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
AQPIVFYDIPSNERIKHSPWSPNTWKIRYALNYKGLKYKTEWVEYPDIAGVVQKLGGKPTEKTPDGRDHYTLPVIYDPNTKKVVEDSAAIAKYLDETYPDTPKLFPAGTDAFQAAFLDFAWPVLGFPVFMLVILDTANSLLPRSHDYFRSTREQKFGKKLEELATEEEWAKVEAGLAKLKGYLDANGKGNDLLLMGAQGGITYSDIQIASFFVWAKIIWGEGSEKWKRLISLHDGKWAQFYAQFTKFEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione transferase GTE1
publication title Characterization of a Phanerochaete chrysosporium Glutathione Transferase Reveals a Novel Structural and Functional Class with Ligandin Properties.
pubmed doi rcsb
source organism Phanerochaete chrysosporium
molecule tags Transferase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4g19A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g19A01
2PPTA 3IK9A 3GH9A 3VURA 2B5YA 1F3AA 1GTUA 1YEXA 5ECPB 3WT1A 4EDYA 3D0ZA 1GNWA 2L4QA 2OBKA 3W6GA 4HDEA 1K0CA 2H0HA 2YP6A 1GL8A 2XHFA 4AGSA 5EY6A 3CXGA 3IOSA 4LA1A 5DJMA 3A2XA 2FWHA 2WFCA 3EVIA 5BMUA 2J9HA 4PUFC 4POKA 5ECRB 4X43A 4K9ZA 4DSSB 4PNFA 1CQHA 3GNJA 3ERFA 2HYXA 2NVLA 2HT9A 1F3BA 4MK3A 1X5DA 5HR0A 1YQ1A 3RPNA 1U87A 3FR9A 1YKCA 1O85A 1OYJA 3IBHA 2AV4A 3BOAA 4KF9A 2VLVA 1TW9A 3LWAA 2OADA 4PUAA 1QXHA 1M9AA 1V9WA 1OVNA 4V2NA 1JZWA 1XWCA 4YQUA 4XS6A 1VF3A 1XVQA 1SL2B 18GSA 2DIYA 3QAGA 2FUG2 2ZCTA 3EYTA 4AJ8A 4FYBA 5C00A 3TGZA 4F0BA 2A2RA 1XW9A 4LL1B 5ID2A 2LRTA 2VCWA 2LNSA 1R7HA 6GSSA 4EF0A 1ABAA 1S3CA 1OKTA 4FYUA 3WT2A 4N30A 5J41A 2K8VA 2KOKA 1BX9A 3W8SA 17GSA 3C71A 1MDKA 4ACSA 3OR5A 2PU9C 1FB6A 2LEGA 4MF7A 1IYIA 4N0ZA 3TJJA 4JRRA 4CW9A 2EIRA 1PL2A 5DCHA 4XHMA 4K0NA 3QPMA 5JWRB 3CSJA 5KEJA 1ERVA 4YQVA 2I1UA 1R5PA 4F0CA 2HRFA 2LV3A 4AF2A 4DSSA 1MDIA 3LEFA 3KTLA 3EC3A 4N11A 1THOA 5KN3A 1ZL9A 5FWGA 4MZWA 1HNCA 3D6IA 4YAPA 3HYPA 6GSTA 1OC9B 5H5SA 3CTGA 4WF4A 3UBLA 2HZEB 1ERTA 3D4TA 2H76A 5IMAA 1GH2A 3KH7A 3UMAA 2DJJA 3GYKA 1EEJA 3F3QA 2FWFA 1UA5A 1TK5B 2JL4A 1XVWA 3C8EA 3HHVA 5HFIA 1OE8A 1XW5A 4IELA 4G9HA 1PA3A 3HZ4A 4FH8A 1ILOA 1JHBA 2NTOA 2VCTA 1G6WA 4ZL8A 4F2IA 4GTUA 3DRNA 2YV7A 1FW1A 4JEDA 2VLUA 1N2AA 4KX4A 3CYNA 1GUHA 5HQPA 3KZQA 1GUMA 1K3LA 16GSA 2WS2A 4HUAA 3EE2A 1K0MA 2GQMA 3VI7A 4MP4A 1QK8A 1GRXA 1ZCPA 2WULA 2HRKB 4V2MA 5D9VA 2JSYA 2WCIA 1H4OA 1WRYA 5IOWA 3TJKA 2WB9A 3VLNA 3VWVA 4J57E 3D5JA 4MA9A 2CAQA 2OE3A 2VLTA 2VCXA 3L9SA 1PX7A 2AHEA 1B9YC 3TB2A 3UOMA 2LKUA 1V98A 3ZVJD 1F9MA 3IK7A 1OC9A 2XPEA 2FA8A 4ZIJA 4MZCA 1MEKA 3ZVJA 2HZEA 2NDOA 3RHBA 1VGLA 2VCZA 2VM2A 3FR3A 4NV5A 5ECIB 4EL1A 4OCEA 2VL9A 1C72A 1K0OA 5IPHA 3GKKA 1M9BA 2C3QA 2G2QA 4LLRA 2YCDA 3DYRA 2YWOA 1AUCA 4IKHA 2MMOA 4FO5A 3TKSE 4NWYA 3A2WA 5CRDA 2P5QA 5E4WA 4I97A 1NM3A 2LRNA 3IRAA 2HLSA 4GXZA 3US3A 2L6CA 2KLXA 3ZRDA 2X64A 1YDKA 2I4AA 3CRTA 1NHYA 2YZHA 2H72A 3KP9A 3ZMLA 1O8XA 3GURA 3W8JA 3DXBA 4EO3A 1WMJA 2REMA 5A4UA 5CNWA 3D22A 3MWHA 4L5OA 1JFUA 3QD9A 2GZZA 4V2LA 4ML1A 2YWIA 3LXTA 3F3RA 3QOUA 3KMOA 2C0FA 3O76A 4IW9A 1LBKA 1TKDB 5CREA 3TKPA 2XBIA 2LQOA 3SWLA 1TRVA 2DSAA 1YF1A 3P2AA 11GSA 1HYUA 1K0NA 4OWYA 2PVOC 4J56E 3DIEA 4HU7A 5G2ZA 3ZFBA 3CRUA 4MJEA 1I9DA 3IHQA 1GSYA 1SYRA 3F9UA 5EVOA 1OAZA 3I9V2 2GS3A 1GP1A 2AB6A 4KE3A 4MJBA 4D73B 4KCAA 5ECSA 5ELAA 2P31A 4ILFA 2XBQA 2A4VA 3GN3A 2QSIA 4MF5A 4YH2A 2CT6A 1AXDA 5B6NA 3F63A 5ENUA 4F9ZA 3GX0A 1FB0A 1ML6A 4RQRA 2FD3A 3MAKA 2R5GA 1SD9A 2C4JA 4AJ6A 6GSXA 4GWRA 1EV9A 4KW6A 2V2GA 2O89A 3KCMA 1XWAA 1VF2A 5ECNB 5D96A 3J7Yk 1Z5YE 2XPDA 5G1KA 5G5EA 1QQ2A 1ZYEA 3BBYA 3KP8A 4WBRD 6GSWA 2QGVA 3G7JA 3FYGA 4WR4A 4O32A 3ZREA 4K8MA 1J9BA 2GT6A 2WRTA 4POLA 3GH6A 2MMAA 3HY2A 4TXVA 5JWQB 1X9SB 1FG4A 1UN2A 3TOTA 3UVHA 3J7Yb 4MPFA 1AW9A 2DBCA 5DVBA 2LQQA 3TCOA 2AJQB 4J2FA 4GRFA 1U88A 10GSA 1ST9A 5IMZA 1V40A 4ZILA 1TU8A 4BVXB 4BVYA 4OO4A 2BJXA 1ZOFA 3UARA 2LSTA 5INYA 4KDYA 5F8BA 3VWWA 2FA4A 1IYHA 3ZL5A 3EWLA 3L4NA 4D73A 4QQ7A 5D9XA 2YANA 2G0FA 2GZPA 2YJHA 1WIKA 2E0QA 1XBSA 4K7OA 4Z7XA 2H19A 3F4TA 1FHEA 2FWGA 1O7UA 2L57A 1XFLA 1GLPA 5AIXA 2M46A 19GSA 3GV1A 5KN2A 2PN8A 3IXRA 3MDKA 1XWKA 4EUYA 2DLXA 3IR4A 1O6JA 5DDLA 3A5WA 3I43A 1CQGA 3WYWA 4GQCA 3GKMA 4K7IA 2JACA 3ISOA 2IMIA 2B3SA 1TU7A 1AC1A 3HXSA 5F07A 2HRAA 1RK4A 4TVEA 3ZMKA 4L5LA 3KTBA 4PXOA 4OD7A 4MZBA 2VCQA 1B9XC 3E3EA 1DE2A 4X1UA 1XPVA 3PH9A 4JE1A 2HQTA 2H1DA 4XS1A 1I5GA 3TJFA 3TDGA 4X0XA 3ERWA 1LJRA 1GTAA 3LGCA 4MABA 2VD1A 4N10A 1O8WA 5CP1A 2H1AA 4IS0A 5CRWA 9GSSA 4BVXA 4ECCA 4PURA 5IOXA 4XRAA 1HNAA 1GULA 2TIRA 3ME8A 1HNBA 2LRCA 5AISA 1Z3EA 3FK8A 3FZ4A 3ED3A 3VPTA 4V1Ag 2E2GA 1V57A 3ZYWA 2B5EA 4OFTA 2B6MA 4GQFA 3EURA 2VO4A 4ZB8A 5F06A 4HJMA 1AQWA 14GSA 3HJOA 4PQ1A 3UAPA 3BJ5A 5COHA 3M3MA 1M2AA 2NBSA 1M0UA 4ZBDA 2V41A 4PGTA 4L8EA 2IMKA 4EC0A 3IC4A 4KSOA 1A2MA 2KHPA 2OJLA 2DMMA 4NHZA 4ECJA 5H5QA 4G10A 2O87A 2CZ3A 1F6MC 2KUCA 2JADA 1A8YA 1BEDA 5HFGA 3ZLPA 2H75A 2LNTA 5DQYA 5IQYA 4IGJA 2IIYA 3ME7A 3DMLA 2J23A 1EZKA 1PKZA 2HSMB 4HU9A 3M0FA 1NW2A 1Q98A 1X5EA 1GNEA 1ON4A 3SBCA 4MCUA 2AAWA 3PINA 5ECQB 2KP1A 1A23A 3DKSA 4TR1B 1B8XA 4LMWA 1SL1B 4JU5A 4HQZA 5CO3A 2GLRA 4WKWA 5GSTA 2HSHA 3TJGA 4QL7A 2IMDA 1VRSD 5A5KA 2CX3A 5J3RA 2F51A 1EGRA 1JZRA 1RW1A 5IPGA 3HJPA 1SJZA 2O7KA 4GCIA 3WGXA 1TRSA 5F0GA 1F37A 2VM1A 4IQAA 1OKDA 4E8EA 2F8AA 2O85A 3I69A 4POBA 3C1SA 1YJ6A 2X8GA 3P7XA 2O8VB 4KGIA 3G7IA 3R3EA 3DVXA 1HD2A 3UL3A 1SENA 5G5FA 1BYEA 3H4KA 1T7PB 1EOHA 3L0HA 5KN1A 4NV2A 2I9HA 3F6DA 2H0GA 2H6YA 5DCGA 3QAVA 1S3DA 2KP2A 2R6KA 1RQMA 3Q74A 4P3YB 3TKSA 4JR6A 4LL4B 4XTSA 5IMCA 3RDWA 3GL5A 5GAND 3LYPA 1EEMA 2B5XA 3VWXA 2HSMA 3DD3A 2L6DA 2YN1A 3KEBA 1MDJA 2H30A 3EU3A 4PQHA 3KIJA 4L0WA 5ECKB 2DJ0A 3GMFA 4KB3A 1TK8B 3DVWA 3VFIA 2IPAA 3M9KA 4G19A 2F3MA 3IPZA 1U3AA 4TR1A 2EIQA 1A2JA 2RUFA 3MNGA 1N8JA 1A8LA 1SL0B 4GSSA 4JZQA 4IQ1A 2B7JA 5AN1A 1XZOA 1KTEA 1TXXA 4MF6A 4FYCA 5HR1A 1Y6EA 2ZNMA 2XC2A 3ZTLA 5FHIA 5HR2A 3LG6A 4ZBAA 2NPBA 4NXIA 3TRPA 2L5OA 3N5OA 1M7TA 4ZXGA 1KEBA 4EKZA 3IAM2 3L9VA 4WXTA 2YV9A 2AUVA 3LJRA 1EGOA 3HJMA 3RAZA 4MJAA 6GSVA 3M8NA 3KGKA 2CX4A 1XWBA 1TOFA 4CHSA 2R3XA 3EMPA 3L78A 1AQXA 4KDUA 3KJYA 1SKRB 1K3OA 4LMVA 3RPPA 2GGTA 2ON5A 1G0TA 3H79A 2YNXA 2DJ2A 1X9WB 2MYGA 4TKYA 3ERGA 4MJCA 4WR5A 4BWSA 3HDCA 5JCWA 5JCUA 1PQNA 4ZBBA 3KH9A 2C0EA 4KUNA 3GA4A 1X5CA 4POMA 1M2BA 2HSNB 2YZUA 2P5RA 4BVYB 1FO5A 3GKNA 4L0UA 4MDCA 1GSUA 1WJKA 5KN0A 1WOUA 1Y25A 4YQMA 2CA8A 3HVSA 5IM9A 1FOVA 2CV4A 4EVMA 1XWGA 2DMLA 5GZZB 1BAYA 1ZMAA 5ECLB 3APOA 3E9JB 2PVQA 4O5RA 2HE3A 4IP1A 1XOAA 3IAS2 3DEXA 3G9BA 3LQ7A 3NZNA 3IC8A 2OKAA 1M99A 5D9TA 2C8UA 1AQVA 5C04A 1GTBA 3HA9A 8GSSA 2PERA 1EV4A 5D8IA 1AIUA 5CRHA 1ZYQB 2IWTA 4BPYA 1GUKA 2HNLA 4I2UA 2DJ1A 2R2JA 2CVKA 3U6VA 4FIWA 4NAXA 3GX8A 4ZL9A 4K7NA 4KAEA 4PTSA 3QFBC 2LS5A 2MBTA 5GSSA 1JLWA 1EWXA 3F0IA 1TRUA 2LUSA 2HRNA 1SYXA 4MPGA 1BJXA 4PQIA 4I2TA 2L5LA 1JLVA 4K0GA 1G7EA 1XXUA 4HQSA 1Z6NA 4MLYA 1TRWA 2HZFA 1Q4JA 2H73A 5B8AA 2QKEA 3LORA 2RLIA 2Z9SA 4ULXA 3HCZA 3HKRA 5LD0A 3KM6A 4WF5A 4QL9A 5LNKe 4BWQA 1GSQA 2GSSA 1LU4A 2CVDA 3LSZA 5G30A 4BA7A 3ZIVA 2CZ2A 5CYYA 5G1LA 2VL2C 2C0GA 4OMVA 2H8LA 1YF0A 1X0RA 1GTIA 3TKSC 1T3BA 2E7PA 2C0DA 2YJ7A 2GSRA 1PX6A 4GSNA 3QCPA 2GDRA 2I3YA 2FCHA 2JSZA 5IMDA 1K3YA 1GSFA 4Q5QA 4AJ7A 2GT5A 5J9BA 4XS4B 1K0AA 3GUSA 1Z7RA 4RI6A 1NHOA 1TDIA 2ON7A 1V2AA 4ID0A 4KDXA 4HZ2A 2CVBA 3F8UA 4F03A 4TOPA 1J08A 4G0LA 1VF4A 5JCGA 3Q18A 5LCZA 1EOGA 1VF1A 4WBJA 2YWMA 3FHKA 1SK0A 2H1GA 2H74A 3C1RA 1WPIA 1YKAA 5L71A 4IJ3A 2VOCA 3UVTA 2GTUA 2B1LA 1ACVA 1PGTA 5F05A 3A2VA 3EMXA 2V32A 3D4MA 4JR4A 1K0BA 1NSWA 2OA7A 2FY6A 3CTFA 3H93A 3CSIA 2M72A 3IE3A 1R5AA 5D73A 2H01A 4ML6A 1T4ZA 2IMFA 2LJRA 4E8HA 1SKSB 1TI1A 1FVJA 1JZOA 2IJYA 3F4RA 1DUGA 2HXKA 2GQLA 2FNOA 2HI7A 1TP9A 3F6FA 5DJLA 2FGXA 1XW6A 3IDVA 4ECIA 3L9UA 5ABRA 3QMXA 4MH2A 2PMTA 3VK9A 2H6XA 1A2LA 2JU5A 2GSTA 3WGEA 2V1MA 2D2ZA 5AGYA 4KNDA 2H66A 1B4QA 4WEYA 4XS4A 2M80A 1OE7A 1KBNA 1T8EB 3TRXA 5E59A 1B48A 3HVXA 1A0FA 2LJKA 2EC4A 4G0IA 4HEA2 2RM6A 1SK2A 3E0UA 3FZ5A 4RUVA 3VWUA 4YAVA 1F2EA 3FY7A 2K8SA 4HS1A 5EL8A 1S3AA 3O6TA 2K9FA 5IO2A 4TR3A 2PBJA 2LTKA 3VI5A 2VIMA 1UVZA 3Q6OA 3S9FA 3F4SA 4Q5NA 3HZ8A 1A24A 2P0GA 1WP0A 3C73A 2OACA 3DWVA 2OE1A 3R2QA 4BL7B 5J4UA 3IV4A 4PNGA 1XCCA 5B6MA 5HFKA 3QR6A 1T4YA 1PN9A 3WD6A 3O3TA 1E2YA 2N5BA 1H75A 1ZGNA 5CAXA 1SKWB 3G7YA 3UBKA 1JZDA 2OE0A 12GSA 4KSMA 4EXJA 2X99A 3WGDA 5ELGA 4XCSA 3GFKA 4KA0A 2MBSA 2TRXA 4RI7A 2EIOA 4FQUA 1BQ7A 7GSSA 4O92A 2QC7A 4HZ4A 1XIYA 3ZITA 4CDOA 2VL2A 2H70A 1ERWA 4IHUA 3GRXA 2FLSA 4N0VA 4IN0A 3JCML 6GSYA 4MH3A 2MMZA 2R37A 1BG5A 1PD21 1DSBA 2C3NA 4TR0A 2C80A 5D93A 3FZAA 2YWNA 5IO0A 2DJKA 2GZYA 1GSSA 5DALB 3A3TA 5CRGA 3QFAC 1TTZA 22GSA 2A2SA 1AAZA 5B7CA 3FEUA 1THXA 1R4WA 3Q19A 1FAAA 4IJIA 2HSYA 3I6AA 4KCEA 2WGRA 1PRXA 1GWCA 4G2EA 5IIZA 2UZ8A 2PGTA 3PPUA 6GSUA 4BL7A 3MSZA 4I8BA 2OBIA 1OC8A 2BTOT 4EE0A 1URMA 3EINA 3LXZA 1DE1A 3KMNA 4MMMA 3TRQA 3BCIA 1PSQA 2C3TA 2B7KA 5ECHB 1KNGA 3CSHA 3LYKA 1T00A 1UC7A 3TKQA 2RM5A 3ZZXA 3PGTA 4K2DA 1QFNA 2WDUA 4EDZA 2DIZA 4KH7A 1E6BA 4HJ2A 2MMNA 3LFLA 3H1NA 1ERUA 5A4WA 1QUWA 5EPFA 3AY8A 5D9WA 1G6YA 5IMVA 4OCFA 1O81A 4TRXA 4H86A 3FR6A 1W89A 3VPQA 1SK1A 2X8HA 1EP7A 4RQXA 3M1GA 5DQSA 3APQA 4OFNA 1TK0B 5FT3A 2C1YA 3C7MA 2PUKC 2PWJA 5J9CA 1TJDA 2H71A 4OO5A 5DALA 5B8BA 4USSA 3KXOA 4F82A 4GF0A 4ZB9A 3DGQA 2VD0A 2B1KA 1K0DA 2H1BA 2JZSA 4TXOB 4I5QA 1V58A 4ISDA 1U3IA 13GSA 3UJ1A 3NOFA 3TUEA 2ZUPA 2K6VA 2HRKA 1YY7A 2V6KA 4PX1A 1W4VA 5DAKB 4TR4A 2DC5A 2MZCA 4XIHA 1MD4A 2CAIA 3NIVA 1GSEA 4HOJA 2WJUA 2IL3A 2F8FA 2RUEA 5AIVA 2H6ZA 3IA1A 2JZRA 1DBYA 4NPBA 5G31A 1M2DA 4V1Ap 3PR8A 3TKRA 1PMTA 2YPMA 2FWEA 4TN8A 5HR3A 2VL3A 3GSSA 2VUPA 4ZL7A 4K1FA 2ALBA 3FW2A 2FHEA 3RHCA 3BCKA 5A4VA 1O73A 2K18A 3KD0A 2LJAA 3HVVA 1USBA 2HFDA 2R4VA 2TRCP 3TOUA 3FRCA 3M9JA 3APSA 2YOIA 1G7OA 3GIXA 1SU9A 4IVFA 3GSTA 3GTUB 1B4PA 3D21A 4NMUA 4GLTA 3P90A 2L4CA 1Z6MA 1EP8A 2IFQB 4DVCA 3H8QA 4DSRA 2IN3A 4TW5A 4JBBA 2GSQA 4DEJA 2AYTA 5H5RA 1A0RP 1T1VA 2I81A 3EU4A 2ES7A 3ZFLA 2N5AA 3GL3A 5GAPD 3UEMA 1SJ6A 1YZXA 1X9MB 4TXOA 1GLQA 4IP6A 1J0FA 1ZZYA 4O7HA 3UIWA 2H0IA 2RIIA 4Q5FA 2DJ3A 4ECBA 2F9SA 1XOBA 3QDNA 2BMXA 3HD5A 2VCVA 5DAKA 1HQOA 2E2MA 2L59A 1PL1A 4XRDA 5IMFA 3FZ9A 2CQ9A 3GKXA 1WWJA 2IMEA 4NHWA 4I6XA 3FKFA 2X8CA 1QMVA 2JZTA 2WZ9A 4HI7A 4IBPA 2VAFA 1OC3A 4OFMA 2GQKA 1SD8A 5ECMB 1SJIA 2V6OA 1U6TA 1Z9HA 2GVPA 1FVKA 3CBUA 1WE0A 4ZB6A 5J5NA 3P8WA 3CMIA 4DSQA 4K6XA 1GSDA 4GSTA 5JWOB 1YEPA 1R26A 1PKWA 3TJBA 5ECOB 1TI3A 3BD2A 3QAWA 1MTCA 1Z7PA 2N5FA 1MD3A 5DBQA 3GTUA 3N9JA 3GHAA 4Q5RA 2IFQA 4G0KA 3V1WA 3K8NA 3RBTA 5ID2B 20GSA 3U5RE 1QGVA 4WETA 3ZIJA
chains in the Genus database with same CATH superfamily
2PPTA 3IK9A 3GH9A 2EFDA 3VURA 2B5YA 1Y1UA 1F3AA 1GTUA 1YEXA 5ECPB 3WT1A 4EDYA 3D0ZA 1GNWA 2L4QA 2OBKA 3W6GA 4HDEA 1K0CA 2H0HA 2YP6A 1GL8A 2XHFA 4AGSA 5EY6A 3CXGA 3IOSA 4LA1A 5DJMA 3A2XA 2FWHA 2WFCA 3EVIA 5BMUA 2QA2A 2J9HA 4PUFC 4POKA 5ECRB 4X43A 4K9ZA 4DSSB 4PNFA 1CQHA 3GNJA 4MNNA 3ERFA 2HYXA 2NVLA 2HT9A 1F3BA 4MK3A 1X5DA 5HR0A 1YQ1A 3RPNA 1U87A 3FR9A 1YKCA 1O85A 1OYJA 3IBHA 2AV4A 3BOAA 4KF9A 1SVLA 2VLVA 1TW9A 3LWAA 2OADA 4PUAA 1QXHA 1M9AA 1V9WA 1OVNA 4V2NA 5A5HB 1JZWA 1XWCA 4YQUA 4XS6A 3RFRC 1VF3A 1XVQA 5BRTA 4EIPA 1SL2B 18GSA 2DIYA 3QAGA 2FUG2 2ZCTA 3EYTA 1ZYNA 4AJ8A 4FYBA 5C00A 3TGZA 4F0BA 2A2RA 3CWGA 1XW9A 4LL1B 2A2PA 5ID2A 2LRTA 2VCWA 2LNSA 1R7HA 6GSSA 1YVLA 4EF0A 1ABAA 1S3CA 1OKTA 4FYUA 3WT2A 4N30A 2O36A 5J41A 2K8VA 2KOKA 1BX9A 3W8SA 3IHGA 17GSA 3C71A 1MDKA 4ACSA 3OR5A 2PU9C 1FB6A 2LEGA 4MF7A 1IYIA 4N0ZA 3TJJA 4Z2RA 4JRRA 4CW9A 2EIRA 1PL2A 5DCHA 4XHMA 4K0NA 3QPMA 5JWRB 3CSJA 5KEJA 1ERVA 4YQVA 2I1UA 1R5PA 4F0CA 2HRFA 2LV3A 4AF2A 4DSSA 1MDIA 3LEFA 3KTLA 3EC3A 4N11A 1THOA 5KN3A 1ZL9A 5FWGA 4MZWA 1HNCA 3D6IA 4YAPA 3HYPA 6GSTA 1OC9B 5H5SA 2VKZG 3CTGA 4WF4A 3UBLA 3D4TA 2HZEB 1ERTA 2H76A 5IMAA 1GH2A 1PFOA 3KH7A 3UMAA 2DJJA 3GYKA 1EEJA 3F3QA 2FWFA 1UA5A 1TK5B 2JL4A 2WW1A 1XVWA 3C8EA 3HHVA 5A5HA 3HVNA 5HFIA 2QA1A 1OE8A 1XW5A 4IELA 4G9HA 1PA3A 3HZ4A 4FH8A 4Z2UA 1ILOA 1JHBA 2NTOA 2VCTA 1G6WA 4ZL8A 4F2IA 4GTUA 3DRNA 2YV7A 1FW1A 4JEDA 2VLUA 4CY8A 4PI2C 1N2AA 4KX4A 3CYNA 1GUHA 5HQPA 3KZQA 1GUMA 1K3LA 16GSA 2WS2A 4HUAA 3EE2A 1K0MA 2GQMA 3VI7A 4MP4A 1QK8A 1GRXA 1ZCPA 2WULA 2HRKB 4V2MA 5D9VA 2JSYA 2WCIA 1H4OA 1WRYA 5IOWA 3TJKA 2WB9A 3VLNA 3VWVA 4J57E 3D5JA 4MA9A 2CAQA 2OE3A 2VLTA 2VCXA 3L9SA 1PX7A 2AHEA 1B9YC 3TB2A 3UOMA 2LKUA 1V98A 3ZVJD 1F9MA 3IK7A 1OC9A 2XPEA 2FA8A 4ZIJA 4MZCA 1MEKA 3ZVJA 2HZEA 2NDOA 3RHBA 1VGLA 2VCZA 2VM2A 3FR3A 4NV5A 4PI0C 5ECIB 4EL1A 4OCEA 2VL9A 1C72A 1K0OA 5IPHA 3GKKA 1M9BA 2C3QA 2G2QA 4LLRA 2YCDA 3DYRA 2YWOA 1AUCA 4IKHA 2MMOA 4FO5A 3TKSE 4NWYA 3A2WA 5CRDA 2P5QA 5E4WA 4I97A 1NM3A 2LRNA 3IRAA 2HLSA 4GXZA 3US3A 2L6CA 2KLXA 3ZRDA 3A5IA 2X64A 1YDKA 2I4AA 3CRTA 1NHYA 2YZHA 2H72A 1SVOA 3KP9A 3ZMLA 1O8XA 3GURA 3W8JA 3DXBA 4EO3A 1WMJA 2REMA 5A4UA 5CNWA 3D22A 3MWHA 4L5OA 1JFUA 3QD9A 2GZZA 4V2LA 4ML1A 2YWIA 3LXTA 3F3RA 3QOUA 3KMOA 2C0FA 3O76A 4IW9A 1LBKA 1TKDB 5CREA 3TKPA 2XBIA 2LQOA 3SWLA 1TRVA 2DSAA 1YF1A 3P2AA 11GSA 2WVXB 1HYUA 4YKGA 1K0NA 4OWYA 2PVOC 4J56E 3DIEA 4HU7A 5G2ZA 3ZFBA 3CRUA 4MJEA 1I9DA 3IHQA 1GSYA 1SYRA 3F9UA 5EVOA 1OAZA 3I9V2 2GS3A 1GP1A 2AB6A 4KE3A 4MJBA 4D73B 4KCAA 2H1LA 5ECSA 5ELAA 2P31A 4ILFA 2XBQA 2A4VA 3GN3A 2QSIA 4MF5A 4YH2A 2CT6A 1AXDA 5B6NA 3F63A 5ENUA 4FXYP 4F9ZA 3GX0A 1FB0A 1ML6A 4RQRA 2FD3A 4AI6A 3MAKA 2R5GA 1SD9A 2C4JA 4AJ6A 6GSXA 4GWRA 1EV9A 4KW6A 2V2GA 2O89A 3KCMA 1XWAA 1VF2A 5ECNB 5D96A 3J7Yk 1Z5YE 2XPDA 5G1KA 5G5EA 4N3ZA 1QQ2A 1ZYEA 3BBYA 3KP8A 4WBRD 6GSWA 2QGVA 3G7JA 3FYGA 3CQFA 4WR4A 4O32A 3ZREA 4K8MA 1J9BA 2GT6A 2WRTA 4POLA 3GH6A 2MMAA 3HY2A 4TXVA 5JWQB 1X9SB 1FG4A 1UN2A 3TOTA 3UVHA 4HSCX 3J7Yb 4MPFA 1AW9A 2DBCA 5DVBA 2LQQA 3TCOA 2AJQB 4J2FA 4GRFA 1U88A 10GSA 1ST9A 5IMZA 1V40A 4ZILA 2HSNA 1TU8A 2WVXA 4BVXB 4BVYA 4OO4A 2BJXA 1ZOFA 3UARA 2LSTA 5INYA 4KDYA 5F8BA 1M3JA 3VWWA 2FA4A 1IYHA 3ZL5A 1YEWC 3EWLA 3L4NA 4D73A 4QQ7A 5D9XA 2YANA 2G0FA 2GZPA 2YJHA 1WIKA 2E0QA 1XBSA 4K7OA 4Z7XA 2WW3A 2H19A 3F4TA 3FMWA 1FHEA 2FWGA 1O7UA 2L57A 1XFLA 1GLPA 5AIXA 2M46A 19GSA 3GV1A 5KN2A 2PN8A 3IXRA 3MDKA 1XWKA 4EUYA 4Z2TA 2DLXA 1I1IP 1PN0A 3IR4A 1O6JA 4ICYA 5DDLA 3A5WA 3I43A 1CQGA 4PHZC 3WYWA 4GQCA 3GKMA 4K7IA 2JACA 3ISOA 2IMIA 2B3SA 4AKGA 1TU7A 1AC1A 3HXSA 5F07A 2HRAA 1RK4A 4TVEA 3ZMKA 4L5LA 3KTBA 4PXOA 4OD7A 4MZBA 2VCQA 1B9XC 3E3EA 1DE2A 4X1UA 1XPVA 3PH9A 4JE1A 2HQTA 2H1DA 4XS1A 1I5GA 3TJFA 3TDGA 4X0XA 3ERWA 1LJRA 1GTAA 3LGCA 4MABA 2VD1A 4N10A 1O8WA 5CP1A 2WVYA 2H1AA 4IS0A 5CRWA 9GSSA 4BVXA 4ECCA 4PURA 5IOXA 4XRAA 1HNAA 1GULA 2TIRA 3ME8A 1HNBA 2LRCA 5AISA 1Z3EA 3FK8A 3FZ4A 3ED3A 1N25A 3VPTA 4V1Ag 2E2GA 1V57A 3ZYWA 2B5EA 4OFTA 2B6MA 4GQFA 3EURA 2VO4A 4ZB8A 2R0CA 5F06A 4HJMA 1AQWA 14GSA 3HJOA 4PQ1A 3UAPA 3BJ5A 5COHA 3M3MA 1M2AA 2NBSA 1M0UA 4ZBDA 2V41A 4PGTA 4L8EA 2IMKA 4EC0A 3IC4A 4KSOA 1A2MA 2KHPA 2OJLA 2DMMA 4NHZA 4ECJA 5H5QA 4G10A 2O87A 2CZ3A 1F6MC 2KUCA 2JADA 1A8YA 1BEDA 5HFGA 3ZLPA 2H75A 2LNTA 5DQYA 4K5RA 5IQYA 4IGJA 2IIYA 3ME7A 3DMLA 2J23A 1EZKA 1PKZA 2HSMB 4HU9A 3M0FA 1NW2A 1Q98A 1X5EA 1GNEA 1ON4A 3SBCA 4MCUA 2AAWA 3PINA 5ECQB 2KP1A 1A23A 3DKSA 4TR1B 1B8XA 4LMWA 1SL1B 4JU5A 2EFEA 4HQZA 5CO3A 2GLRA 4WKWA 5GSTA 2HSHA 3TJGA 4QL7A 2IMDA 1VRSD 5A5KA 2CX3A 5J3RA 2F51A 1EGRA 1ZYPA 1JZRA 4AKIA 1RW1A 5IPGA 3HJPA 2X4AA 1SJZA 2O7KA 4GCIA 3WGXA 1TRSA 5F0GA 1F37A 2VM1A 4IQAA 1OKDA 4E8EA 2F8AA 2O85A 3I69A 4POBA 3C1SA 1YJ6A 2X8GA 3P7XA 2O8VB 4KGIA 3G7IA 3R3EA 3DVXA 1HD2A 3UL3A 1SENA 5G5FA 1BYEA 3H4KA 5J47A 1T7PB 1EOHA 3L0HA 5KN1A 4NV2A 2I9HA 3F6DA 2DKIA 2H0GA 2H6YA 5DCGA 3QAVA 1S3DA 2KP2A 2R6KA 1RQMA 3Q74A 4P3YB 5J4YA 3TKSA 4JR6A 4LL4B 4XTSA 5IMCA 3RDWA 3GL5A 5GAND 3LYPA 1EEMA 2B5XA 3HMJG 3VWXA 2HSMA 3DD3A 2L6DA 2YN1A 3KEBA 1MDJA 2H30A 3EU3A 4PQHA 3KIJA 4L0WA 5ECKB 1BF5A 2DJ0A 3GMFA 4KB3A 1TK8B 3DVWA 3VFIA 2IPAA 3M9KA 4G19A 2R0PA 2F3MA 3IPZA 1U3AA 4TR1A 2EIQA 2X49A 1A2JA 2RUFA 3MNGA 1N8JA 1A8LA 1SL0B 4GSSA 4JZQA 4IQ1A 2B7JA 5AN1A 1XZOA 2UV8G 1KTEA 1TXXA 4MF6A 4FYCA 5HR1A 1Y6EA 2ZNMA 2XC2A 3ZTLA 5FHIA 5HR2A 3LG6A 4ZBAA 2NPBA 4A5PA 4NXIA 3TRPA 2L5OA 3N5OA 1M7TA 4ZXGA 1KEBA 4EKZA 3IAM2 3L9VA 4WXTA 2YV9A 2AUVA 3LJRA 1EGOA 3HJMA 3RAZA 4MJAA 6GSVA 3M8NA 3KGKA 2CX4A 1XWBA 1TOFA 4O5UA 4CHSA 2R3XA 3EMPA 3L78A 1AQXA 4KDUA 3KJYA 1SKRB 1K3OA 4LMVA 3RPPA 2GGTA 2ON5A 1G0TA 3H79A 2YNXA 2DJ2A 1X9WB 2MYGA 4TKYA 3ERGA 4MJCA 4WR5A 4BWSA 3HDCA 5JCWA 1SVMA 5JCUA 1PQNA 4ZBBA 3KH9A 4ZB7A 2C0EA 4KUNA 3GA4A 1X5CA 4POMA 1M2BA 2HSNB 2YZUA 2P5RA 4BVYB 1FO5A 3GKNA 4L0UA 4MDCA 1GSUA 1WJKA 5KN0A 1WOUA 1Y25A 4YQMA 2CA8A 3HVSA 5IM9A 1FOVA 2CV4A 4EVMA 1XWGA 2DMLA 5GZZB 1BAYA 3EPTA 1ZMAA 5ECLB 3RGBC 3APOA 3E9JB 2PVQA 4O5RA 4AKXB 2HE3A 4IP1A 1XOAA 3IAS2 3DEXA 3G9BA 3LQ7A 3NZNA 3IC8A 2OKAA 1M99A 5D9TA 2C8UA 1AQVA 5C04A 1GTBA 3HA9A 8GSSA 2PERA 1EV4A 5D8IA 1AIUA 5CRHA 1ZYQB 2IWTA 4BPYA 1GUKA 2HNLA 2DKHA 2DJ1A 2R2JA 2CVKA 4I2UA 3U6VA 4FIWA 4NAXA 3GX8A 4K5SA 4ZL9A 4K7NA 4KAEA 4PTSA 3QFBC 2LS5A 2MBTA 5GSSA 1JLWA 1EWXA 3F0IA 1TRUA 2LUSA 2HRNA 1SYXA 4MPGA 1BJXA 4PQIA 4I2TA 2L5LA 1JLVA 4K0GA 1G7EA 1XXUA 4HQSA 1Z6NA 4MLYA 1TRWA 2HZFA 1Q4JA 2H73A 5B8AA 2QKEA 3LORA 2RLIA 2Z9SA 4ULXA 3HCZA 3HKRA 5LD0A 3KM6A 2O5VA 4WF5A 4O5QA 4K2XA 4QL9A 5LNKe 4BWQA 1GSQA 2GSSA 1LU4A 2CVDA 3LSZA 5G30A 4BA7A 3ZIVA 2CZ2A 5CYYA 5G1LA 2VL2C 2C0GA 4OMVA 2H8LA 1YF0A 1X0RA 1GTIA 3TKSC 1T3BA 2E7PA 2C0DA 2YJ7A 2GSRA 1BG1A 1PX6A 4GSNA 2GDRA 2I3YA 2JSZA 2FCHA 3QCPA 5IMDA 1K3YA 1GSFA 4Q5QA 4AJ7A 2GT5A 5J9BA 4XS4B 1K0AA 3GUSA 1Z7RA 4RI6A 1NHOA 1TDIA 2ON7A 1V2AA 4BIKA 4ID0A 4KDXA 4HZ2A 2CVBA 3MYDA 3F8UA 4F03A 4TOPA 1J08A 2R0GA 4G0LA 1VF4A 5JCGA 3Q18A 5LCZA 1EOGA 1VF1A 2WVZA 4WBJA 2YWMA 3FHKA 4G01A 1SK0A 2H1GA 2EFCA 2H74A 3C1RA 1WPIA 1YKAA 5L71A 4IJ3A 2VOCA 3UVTA 2GTUA 2B1LA 1ACVA 1PGTA 5F05A 3A2VA 3EMXA 2V32A 3D4MA 4JR4A 1K0BA 1NSWA 2OA7A 4QMKA 2FY6A 3CTFA 3H93A 3CSIA 2M72A 3IE3A 1R5AA 5D73A 2H01A 4ML6A 3CHXC 1T4ZA 2IMFA 2LJRA 4E8HA 1SKSB 1TI1A 1FVJA 1JZOA 2IJYA 3F4RA 1DUGA 2HXKA 2GQLA 2FNOA 2HI7A 1TP9A 3F6FA 5KOWA 5DJLA 2FGXA 4EIQA 1XW6A 3IDVA 4ECIA 3L9UA 5ABRA 3QMXA 4MH2A 2PMTA 3VK9A 2H6XA 2WW2A 1A2LA 2JU5A 2GSTA 3WGEA 2V1MA 2D2ZA 5AGYA 4KNDA 2H66A 1B4QA 4WEYA 4XS4A 2M80A 1OE7A 1KBNA 1T8EB 3TRXA 5E59A 1B48A 3HVXA 1A0FA 1S4BP 2LJKA 2EC4A 4G0IA 4HEA2 2RM6A 1SK2A 3E0UA 3FZ5A 4RUVA 3VWUA 4YAVA 3FY7A 1F2EA 2K8SA 4HS1A 5EL8A 1S3AA 3O6TA 2K9FA 5IO2A 4TR3A 2PBJA 2LTKA 3VI5A 2VIMA 1UVZA 3Q6OA 3S9FA 3F4SA 4Q5NA 3HZ8A 1A24A 2P0GA 1WP0A 3C73A 2OACA 3DWVA 2OE1A 3R2QA 4BL7B 5J4UA 1S3RA 3IV4A 4PNGA 1XCCA 5B6MA 5HFKA 3QR6A 1T4YA 1PN9A 3WD6A 3O3TA 1E2YA 2N5BA 1H75A 1ZGNA 5CAXA 1SKWB 3G7YA 3UBKA 1JZDA 2OE0A 12GSA 4KSMA 4EXJA 2X99A 3WGDA 5ELGA 4XCSA 3GFKA 4KA0A 2MBSA 2TRXA 4RI7A 2EIOA 4FQUA 1BQ7A 7GSSA 4O92A 2QC7A 4HZ4A 1XIYA 3ZITA 4CDOA 2VL2A 2H70A 4GDFA 1ERWA 4IHUA 3GRXA 2FLSA 4N0VA 4IN0A 3JCML 6GSYA 4MH3A 2MMZA 2R37A 1BG5A 1PD21 1DSBA 2C3NA 4TR0A 2C80A 5J4VA 5D93A 3FZAA 2YWNA 5IO0A 2DJKA 2GZYA 1GSSA 4W66A 3TU3B 5DALB 3A3TA 5CRGA 3QFAC 1TTZA 22GSA 2A2SA 1AAZA 5B7CA 3FEUA 1THXA 1R4WA 3Q19A 1FAAA 4IJIA 2HSYA 3I6AA 4KCEA 2WGRA 1PRXA 1GWCA 4G2EA 5IIZA 2UZ8A 2PGTA 3PPUA 6GSUA 4BL7A 3MSZA 4I8BA 2OBIA 1OC8A 1TXUA 2BTOT 5J40A 4EE0A 1URMA 3EINA 3LXZA 1DE1A 3KMNA 4MMMA 3TRQA 3BCIA 1PSQA 2C3TA 2B7KA 5ECHB 1KNGA 3CSHA 3LYKA 1T00A 1UC7A 3TKQA 2RM5A 3ZZXA 3PGTA 4K2DA 1QFNA 2WDUA 4EDZA 2DIZA 4KH7A 1E6BA 4HJ2A 2MMNA 3LFLA 3H1NA 1ERUA 5A4WA 5KOXA 1QUWA 5EPFA 3AY8A 5D9WA 1G6YA 5IMVA 4OCFA 1O81A 4TRXA 4H86A 3FR6A 1W89A 3VPQA 1SK1A 2X8HA 1EP7A 4RQXA 3M1GA 5DQSA 3APQA 4OFNA 1TK0B 5FT3A 2C1YA 3C7MA 4AKHA 2PUKC 2PWJA 5J9CA 1TJDA 2H71A 4OO5A 5DALA 5B8BA 4USSA 3KXOA 4F82A 4GF0A 4ZB9A 3DGQA 2VD0A 2B1KA 1K0DA 2H1BA 2JZSA 4TXOB 4I5QA 1V58A 4ISDA 1U3IA 13GSA 3UJ1A 3NOFA 3TUEA 2ZUPA 2K6VA 1XG8A 2HRKA 1YY7A 2V6KA 4PX1A 1W4VA 5DAKB 4TR4A 2DC5A 2MZCA 4XIHA 1MD4A 2CAIA 3NIVA 1GSEA 4HOJA 2WJUA 2IL3A 2F8FA 2RUEA 5AIVA 2H6ZA 3IA1A 2JZRA 1DBYA 4NPBA 5G31A 1M2DA 4V1Ap 3PR8A 3TKRA 1PMTA 2YPMA 2FWEA 4TN8A 5HR3A 2VL3A 3GSSA 1FOHA 2VUPA 4ZL7A 4K1FA 2ALBA 3FW2A 2FHEA 3RHCA 1M3IA 3BCKA 5A4VA 1O73A 2K18A 3KD0A 2LJAA 3HVVA 1USBA 2HFDA 2R4VA 4YKFA 2TRCP 3TOUA 3FRCA 3M9JA 3APSA 2EFHA 2YOIA 1G7OA 3GIXA 1SU9A 4IVFA 5A1NB 3GSTA 3GTUB 1B4PA 3D21A 4NMUA 4GLTA 3P90A 2L4CA 2OT3A 1Z6MA 1EP8A 2IFQB 5A34B 4X4JA 4DVCA 3H8QA 4DSRA 2IN3A 4TW5A 4JBBA 2GSQA 4DEJA 2AYTA 5H5RA 1A0RP 1T1VA 2I81A 3EU4A 2ES7A 3ZFLA 2N5AA 3GL3A 5GAPD 3UEMA 1SJ6A 4CY6A 1YZXA 1X9MB 4TXOA 1GLQA 4IP6A 1J0FA 2O3EA 1ZZYA 2A4HA 4O7HA 3UIWA 2H0IA 2RIIA 4Q5FA 2DJ3A 4ECBA 2F9SA 1XOBA 3QDNA 2BMXA 3HD5A 2VCVA 3LW9A 5DAKA 2WW0A 1HQOA 2E2MA 2L59A 5BMUB 1PL1A 4XRDA 5IMFA 3FZ9A 2CQ9A 3GKXA 1WWJA 2WZSA 2IMEA 4NHWA 4I6XA 3FKFA 2X8CA 1QMVA 2JZTA 2WZ9A 4HI7A 4IBPA 2VAFA 1OC3A 4OFMA 2GQKA 1SD8A 5ECMB 1SJIA 2V6OA 1U6TA 1Z9HA 2GVPA 1FVKA 3CBUA 1WE0A 4ZB6A 5J5NA 3P8WA 3CMIA 4DSQA 4K6XA 1GSDA 4GSTA 5JWOB 1YEPA 1R26A 1PKWA 3TJBA 5ECOB 1TI3A 3BD2A 3QAWA 1MTCA 1Z7PA 2N5FA 1MD3A 5DBQA 5A1NA 3GTUA 3N9JA 3GHAA 4E68A 4Q5RA 2IFQA 4G0KA 3V1WA 5A34A 3K8NA 3RBTA 3MIXA 5ID2B 20GSA 3U5RE 1QGVA 4WETA 3ZIJA
chains in the Genus database with same CATH topology
2PPTA 3IK9A 3GH9A 2EFDA 3VURA 2B5YA 1Y1UA 1F3AA 1GTUA 1YEXA 5ECPB 3WT1A 4EDYA 3D0ZA 1GNWA 2L4QA 2OBKA 3W6GA 4HDEA 1K0CA 2H0HA 2YP6A 1GL8A 2XHFA 4AGSA 5EY6A 3CXGA 3IOSA 4LA1A 5DJMA 3A2XA 2FWHA 2WFCA 3EVIA 5BMUA 2QA2A 2J9HA 4PUFC 4POKA 5ECRB 4X43A 4K9ZA 4DSSB 4PNFA 1CQHA 3GNJA 4MNNA 3ERFA 2HYXA 2NVLA 2HT9A 1F3BA 4MK3A 1X5DA 5HR0A 1YQ1A 3RPNA 1U87A 3FR9A 1YKCA 1O85A 1OYJA 3IBHA 2AV4A 3BOAA 4KF9A 1SVLA 2VLVA 1TW9A 3LWAA 2OADA 4PUAA 1QXHA 1M9AA 1V9WA 1OVNA 4V2NA 5A5HB 1JZWA 1XWCA 4YQUA 4XS6A 1VF3A 1XVQA 5BRTA 4EIPA 1SL2B 18GSA 2DIYA 3QAGA 2FUG2 2ZCTA 3EYTA 1ZYNA 4AJ8A 4FYBA 5C00A 3TGZA 4F0BA 2A2RA 3CWGA 1XW9A 4LL1B 2A2PA 5ID2A 2LRTA 2VCWA 2LNSA 1R7HA 6GSSA 1YVLA 4EF0A 1ABAA 1S3CA 1OKTA 4FYUA 3WT2A 4N30A 5J41A 2K8VA 2KOKA 1BX9A 3W8SA 3IHGA 17GSA 3C71A 1MDKA 4ACSA 3OR5A 2PU9C 1FB6A 2LEGA 4MF7A 1IYIA 4N0ZA 3TJJA 4Z2RA 4JRRA 4CW9A 2EIRA 1PL2A 5DCHA 4XHMA 4K0NA 3QPMA 5JWRB 3CSJA 5KEJA 1ERVA 4YQVA 2I1UA 1R5PA 4F0CA 2HRFA 2LV3A 4AF2A 4DSSA 1MDIA 3LEFA 3KTLA 3EC3A 4N11A 1THOA 5KN3A 1ZL9A 5FWGA 4MZWA 1HNCA 3D6IA 4YAPA 3HYPA 6GSTA 1OC9B 5H5SA 2VKZG 3CTGA 4WF4A 3UBLA 2HZEB 1ERTA 3D4TA 2H76A 5IMAA 1GH2A 3KH7A 3UMAA 2DJJA 3GYKA 1EEJA 3F3QA 2FWFA 1UA5A 1TK5B 2JL4A 1XVWA 3C8EA 3HHVA 5A5HA 5HFIA 2QA1A 1OE8A 1XW5A 4IELA 4G9HA 1PA3A 3HZ4A 4FH8A 4Z2UA 1ILOA 1JHBA 2NTOA 2VCTA 1G6WA 4ZL8A 4F2IA 4GTUA 3DRNA 2YV7A 1FW1A 4JEDA 2VLUA 4CY8A 1N2AA 4KX4A 3CYNA 1GUHA 5HQPA 3KZQA 1GUMA 1K3LA 16GSA 2WS2A 4HUAA 3EE2A 1K0MA 2GQMA 3VI7A 4MP4A 1QK8A 1GRXA 1ZCPA 2WULA 2HRKB 4V2MA 5D9VA 2JSYA 2WCIA 1H4OA 1WRYA 5IOWA 3TJKA 2WB9A 3VLNA 3VWVA 4J57E 3D5JA 4MA9A 2CAQA 2OE3A 2VLTA 2VCXA 3L9SA 1PX7A 2AHEA 1B9YC 3TB2A 3UOMA 2LKUA 1V98A 3ZVJD 1F9MA 3IK7A 1OC9A 2XPEA 2FA8A 4ZIJA 4MZCA 1MEKA 3ZVJA 2HZEA 2NDOA 3RHBA 1VGLA 2VCZA 2VM2A 3FR3A 4NV5A 5ECIB 4EL1A 4OCEA 2VL9A 1C72A 1K0OA 5IPHA 3GKKA 1M9BA 2C3QA 2G2QA 4LLRA 2YCDA 3DYRA 2YWOA 1AUCA 4IKHA 2MMOA 4FO5A 3TKSE 4NWYA 3A2WA 5CRDA 2P5QA 5E4WA 4I97A 1NM3A 2LRNA 3IRAA 2HLSA 4GXZA 3US3A 2L6CA 2KLXA 3ZRDA 3A5IA 2X64A 1YDKA 2I4AA 3CRTA 1NHYA 2YZHA 2H72A 1SVOA 3KP9A 3ZMLA 1O8XA 3GURA 3W8JA 3DXBA 4EO3A 1WMJA 2REMA 5A4UA 5CNWA 3D22A 3MWHA 4L5OA 1JFUA 3QD9A 2GZZA 4V2LA 4ML1A 2YWIA 3LXTA 3F3RA 3QOUA 3KMOA 2C0FA 3O76A 4IW9A 1LBKA 1TKDB 5CREA 3TKPA 2XBIA 2LQOA 3SWLA 1TRVA 2DSAA 1YF1A 3P2AA 11GSA 1HYUA 4YKGA 1K0NA 4OWYA 2PVOC 4J56E 3DIEA 4HU7A 5G2ZA 3ZFBA 3CRUA 4MJEA 1I9DA 3IHQA 1GSYA 1SYRA 3F9UA 5EVOA 1OAZA 3I9V2 2GS3A 1GP1A 2AB6A 4KE3A 4MJBA 4D73B 4KCAA 2H1LA 5ECSA 5ELAA 2P31A 4ILFA 2XBQA 2A4VA 3GN3A 2QSIA 4MF5A 4YH2A 2CT6A 1AXDA 5B6NA 3F63A 5ENUA 4F9ZA 3GX0A 1FB0A 1ML6A 4RQRA 2FD3A 4AI6A 3MAKA 2R5GA 1SD9A 2C4JA 4AJ6A 6GSXA 4GWRA 1EV9A 4KW6A 2V2GA 2O89A 3KCMA 1XWAA 1VF2A 5ECNB 5D96A 3J7Yk 1Z5YE 2XPDA 5G1KA 5G5EA 4N3ZA 1QQ2A 1ZYEA 3BBYA 3KP8A 4WBRD 6GSWA 2QGVA 3G7JA 3FYGA 4WR4A 4O32A 3ZREA 4K8MA 1J9BA 2GT6A 2WRTA 4POLA 3GH6A 2MMAA 3HY2A 4TXVA 5JWQB 1X9SB 1FG4A 1UN2A 3TOTA 3UVHA 3J7Yb 4MPFA 1AW9A 2DBCA 5DVBA 2LQQA 3TCOA 2AJQB 4J2FA 4GRFA 1U88A 10GSA 1ST9A 5IMZA 1V40A 4ZILA 2HSNA 1TU8A 4BVXB 4BVYA 4OO4A 2BJXA 1ZOFA 3UARA 2LSTA 5INYA 4KDYA 5F8BA 3VWWA 2FA4A 1IYHA 3ZL5A 3EWLA 3L4NA 4D73A 4QQ7A 5D9XA 2YANA 2G0FA 2GZPA 2YJHA 1WIKA 2E0QA 1XBSA 4K7OA 4Z7XA 2H19A 3F4TA 3FMWA 1FHEA 2FWGA 1O7UA 2L57A 1XFLA 1GLPA 5AIXA 2M46A 19GSA 3GV1A 5KN2A 2PN8A 3IXRA 3MDKA 1XWKA 4EUYA 4Z2TA 2DLXA 1PN0A 3IR4A 1O6JA 4ICYA 5DDLA 3A5WA 3I43A 1CQGA 3WYWA 4GQCA 3GKMA 4K7IA 2JACA 3ISOA 2IMIA 2B3SA 4AKGA 1TU7A 1AC1A 3HXSA 5F07A 2HRAA 1RK4A 4TVEA 3ZMKA 4L5LA 3KTBA 4PXOA 4OD7A 4MZBA 2VCQA 1B9XC 3E3EA 1DE2A 4X1UA 1XPVA 3PH9A 4JE1A 2HQTA 2H1DA 4XS1A 1I5GA 3TJFA 3TDGA 4X0XA 3ERWA 1LJRA 1GTAA 3LGCA 4MABA 2VD1A 4N10A 1O8WA 5CP1A 2H1AA 4IS0A 5CRWA 9GSSA 4BVXA 4ECCA 4PURA 5IOXA 4XRAA 1HNAA 1GULA 2TIRA 3ME8A 1HNBA 2LRCA 5AISA 1Z3EA 3FK8A 3FZ4A 3ED3A 1N25A 3VPTA 4V1Ag 2E2GA 1V57A 3ZYWA 2B5EA 4OFTA 2B6MA 4GQFA 3EURA 2VO4A 4ZB8A 2R0CA 5F06A 4HJMA 1AQWA 14GSA 3HJOA 4PQ1A 3UAPA 3BJ5A 5COHA 3M3MA 1M2AA 2NBSA 1M0UA 4ZBDA 2V41A 4PGTA 4L8EA 2IMKA 4EC0A 3IC4A 4KSOA 1A2MA 2KHPA 2OJLA 2DMMA 4NHZA 4ECJA 5H5QA 4G10A 2O87A 2CZ3A 1F6MC 2KUCA 2JADA 1A8YA 1BEDA 5HFGA 3ZLPA 2H75A 2LNTA 5DQYA 4K5RA 5IQYA 4IGJA 2IIYA 3ME7A 3DMLA 2J23A 1EZKA 1PKZA 2HSMB 4HU9A 3M0FA 1NW2A 1Q98A 1X5EA 1GNEA 1ON4A 3SBCA 4MCUA 2AAWA 3PINA 5ECQB 2KP1A 1A23A 3DKSA 4TR1B 1B8XA 4LMWA 1SL1B 4JU5A 2EFEA 4HQZA 5CO3A 2GLRA 4WKWA 5GSTA 2HSHA 3TJGA 4QL7A 2IMDA 1VRSD 5A5KA 2CX3A 5J3RA 2F51A 1EGRA 1ZYPA 1JZRA 4AKIA 1RW1A 5IPGA 3HJPA 2X4AA 1SJZA 2O7KA 4GCIA 3WGXA 1TRSA 5F0GA 1F37A 2VM1A 4IQAA 1OKDA 4E8EA 2F8AA 2O85A 3I69A 4POBA 3C1SA 1YJ6A 2X8GA 3P7XA 2O8VB 4KGIA 3G7IA 3R3EA 3DVXA 1HD2A 3UL3A 1SENA 5G5FA 1BYEA 3H4KA 5J47A 1T7PB 1EOHA 3L0HA 5KN1A 4NV2A 2I9HA 3F6DA 2DKIA 2H0GA 2H6YA 5DCGA 3QAVA 1S3DA 2KP2A 2R6KA 1RQMA 3Q74A 4P3YB 5J4YA 3TKSA 4JR6A 4LL4B 4XTSA 5IMCA 3RDWA 3GL5A 5GAND 3LYPA 1EEMA 2B5XA 3HMJG 3VWXA 2HSMA 3DD3A 2L6DA 2YN1A 3KEBA 1MDJA 2H30A 3EU3A 4PQHA 3KIJA 4L0WA 5ECKB 1BF5A 2DJ0A 3GMFA 4KB3A 1TK8B 3DVWA 3VFIA 2IPAA 3M9KA 4G19A 2R0PA 2F3MA 3IPZA 1U3AA 4TR1A 2EIQA 2X49A 1A2JA 2RUFA 3MNGA 1N8JA 1A8LA 1SL0B 4GSSA 4JZQA 4IQ1A 2B7JA 5AN1A 1XZOA 2UV8G 1KTEA 1TXXA 4MF6A 4FYCA 5HR1A 1Y6EA 2ZNMA 2XC2A 3ZTLA 5FHIA 5HR2A 3LG6A 4ZBAA 2NPBA 4A5PA 4NXIA 3TRPA 2L5OA 3N5OA 1M7TA 4ZXGA 1KEBA 4EKZA 3IAM2 3L9VA 4WXTA 2YV9A 2AUVA 3LJRA 1EGOA 3HJMA 3RAZA 4MJAA 6GSVA 3M8NA 3KGKA 2CX4A 1XWBA 1TOFA 4O5UA 4CHSA 2R3XA 3EMPA 3L78A 1AQXA 4KDUA 3KJYA 1SKRB 1K3OA 4LMVA 3RPPA 2GGTA 2ON5A 1G0TA 3H79A 2YNXA 2DJ2A 1X9WB 2MYGA 4TKYA 3ERGA 4MJCA 4WR5A 4BWSA 3HDCA 5JCWA 1SVMA 5JCUA 1PQNA 4ZBBA 3KH9A 4ZB7A 2C0EA 4KUNA 3GA4A 1X5CA 4POMA 1M2BA 2HSNB 2YZUA 2P5RA 4BVYB 1FO5A 3GKNA 4L0UA 4MDCA 1GSUA 1WJKA 5KN0A 1WOUA 1Y25A 4YQMA 2CA8A 3HVSA 5IM9A 1FOVA 2CV4A 4EVMA 1XWGA 2DMLA 5GZZB 1BAYA 3EPTA 1ZMAA 5ECLB 3APOA 3E9JB 2PVQA 4O5RA 4AKXB 2HE3A 4IP1A 1XOAA 3IAS2 3DEXA 3G9BA 3LQ7A 3NZNA 3IC8A 2OKAA 1M99A 5D9TA 2C8UA 1AQVA 5C04A 1GTBA 3HA9A 8GSSA 2PERA 1EV4A 5D8IA 1AIUA 5CRHA 1ZYQB 2IWTA 4BPYA 1GUKA 2HNLA 2DKHA 2DJ1A 2R2JA 2CVKA 4I2UA 3U6VA 4FIWA 4NAXA 3GX8A 4K5SA 4ZL9A 4K7NA 4KAEA 4PTSA 3QFBC 2LS5A 2MBTA 5GSSA 1JLWA 1EWXA 3F0IA 1TRUA 2LUSA 2HRNA 1SYXA 4MPGA 1BJXA 4PQIA 4I2TA 2L5LA 1JLVA 4K0GA 1G7EA 1XXUA 4HQSA 1Z6NA 4MLYA 1TRWA 2HZFA 1Q4JA 2H73A 5B8AA 2QKEA 3LORA 2RLIA 2Z9SA 4ULXA 3HCZA 3HKRA 5LD0A 3KM6A 2O5VA 4WF5A 4O5QA 4K2XA 4QL9A 5LNKe 4BWQA 1GSQA 2GSSA 1LU4A 2CVDA 3LSZA 5G30A 4BA7A 3ZIVA 2CZ2A 5CYYA 5G1LA 2VL2C 2C0GA 4OMVA 2H8LA 1YF0A 1X0RA 1GTIA 3TKSC 1T3BA 2E7PA 2C0DA 2YJ7A 2GSRA 1BG1A 1PX6A 4GSNA 2GDRA 2I3YA 2JSZA 2FCHA 3QCPA 5IMDA 1K3YA 1GSFA 4Q5QA 4AJ7A 2GT5A 5J9BA 4XS4B 1K0AA 3GUSA 1Z7RA 4RI6A 1NHOA 1TDIA 2ON7A 1V2AA 4ID0A 4KDXA 4HZ2A 2CVBA 3MYDA 3F8UA 4F03A 4TOPA 1J08A 2R0GA 4G0LA 1VF4A 5JCGA 3Q18A 5LCZA 1EOGA 1VF1A 4WBJA 2YWMA 3FHKA 4G01A 1SK0A 2H1GA 2EFCA 2H74A 3C1RA 1WPIA 1YKAA 5L71A 4IJ3A 2VOCA 3UVTA 2GTUA 2B1LA 1ACVA 1PGTA 5F05A 3A2VA 3EMXA 2V32A 3D4MA 4JR4A 1K0BA 1NSWA 2OA7A 4QMKA 2FY6A 3CTFA 3H93A 3CSIA 2M72A 3IE3A 1R5AA 5D73A 2H01A 4ML6A 1T4ZA 2IMFA 2LJRA 4E8HA 1SKSB 1TI1A 1FVJA 1JZOA 2IJYA 3F4RA 1DUGA 2HXKA 2GQLA 2FNOA 2HI7A 1TP9A 3F6FA 5KOWA 5DJLA 2FGXA 4EIQA 1XW6A 3IDVA 4ECIA 3L9UA 5ABRA 3QMXA 4MH2A 2PMTA 3VK9A 2H6XA 1A2LA 2JU5A 2GSTA 3WGEA 2V1MA 2D2ZA 5AGYA 4KNDA 2H66A 1B4QA 4WEYA 4XS4A 2M80A 1OE7A 1KBNA 1T8EB 3TRXA 5E59A 1B48A 3HVXA 1A0FA 2LJKA 2EC4A 4G0IA 4HEA2 2RM6A 1SK2A 3E0UA 3FZ5A 4RUVA 3VWUA 4YAVA 1F2EA 3FY7A 2K8SA 4HS1A 5EL8A 1S3AA 3O6TA 2K9FA 5IO2A 4TR3A 2PBJA 2LTKA 3VI5A 2VIMA 1UVZA 3Q6OA 3S9FA 3F4SA 4Q5NA 3HZ8A 1A24A 2P0GA 1WP0A 3C73A 2OACA 3DWVA 2OE1A 3R2QA 4BL7B 5J4UA 3IV4A 4PNGA 1XCCA 5B6MA 5HFKA 3QR6A 1T4YA 1PN9A 3WD6A 3O3TA 1E2YA 2N5BA 1H75A 1ZGNA 5CAXA 1SKWB 3G7YA 3UBKA 1JZDA 2OE0A 12GSA 4KSMA 4EXJA 2X99A 3WGDA 5ELGA 4XCSA 3GFKA 4KA0A 2MBSA 2TRXA 4RI7A 2EIOA 4FQUA 1BQ7A 7GSSA 4O92A 2QC7A 4HZ4A 1XIYA 3ZITA 4CDOA 2VL2A 2H70A 4GDFA 1ERWA 4IHUA 3GRXA 2FLSA 4N0VA 4IN0A 3JCML 6GSYA 4MH3A 2MMZA 2R37A 1BG5A 1PD21 1DSBA 2C3NA 4TR0A 2C80A 5J4VA 5D93A 3FZAA 2YWNA 5IO0A 2DJKA 2GZYA 1GSSA 4W66A 3TU3B 5DALB 3A3TA 5CRGA 3QFAC 1TTZA 22GSA 2A2SA 1AAZA 5B7CA 3FEUA 1THXA 1R4WA 3Q19A 1FAAA 4IJIA 2HSYA 3I6AA 4KCEA 2WGRA 1PRXA 1GWCA 4G2EA 5IIZA 2UZ8A 2PGTA 3PPUA 6GSUA 4BL7A 3MSZA 4I8BA 2OBIA 1OC8A 1TXUA 2BTOT 5J40A 4EE0A 1URMA 3EINA 3LXZA 1DE1A 3KMNA 4MMMA 3TRQA 3BCIA 1PSQA 2C3TA 2B7KA 5ECHB 1KNGA 3CSHA 3LYKA 1T00A 1UC7A 3TKQA 2RM5A 3ZZXA 3PGTA 4K2DA 1QFNA 2WDUA 4EDZA 2DIZA 4KH7A 1E6BA 4HJ2A 2MMNA 3LFLA 3H1NA 1ERUA 5A4WA 5KOXA 1QUWA 5EPFA 3AY8A 5D9WA 1G6YA 5IMVA 4OCFA 1O81A 4TRXA 4H86A 3FR6A 1W89A 3VPQA 1SK1A 2X8HA 1EP7A 4RQXA 3M1GA 5DQSA 3APQA 4OFNA 1TK0B 5FT3A 2C1YA 3C7MA 4AKHA 2PUKC 2PWJA 5J9CA 1TJDA 2H71A 4OO5A 5DALA 5B8BA 4USSA 3KXOA 4F82A 4GF0A 4ZB9A 3DGQA 2VD0A 2B1KA 1K0DA 2H1BA 2JZSA 4TXOB 4I5QA 1V58A 4ISDA 1U3IA 13GSA 3UJ1A 3NOFA 3TUEA 2ZUPA 2K6VA 2HRKA 1YY7A 2V6KA 4PX1A 1W4VA 5DAKB 4TR4A 2DC5A 2MZCA 4XIHA 1MD4A 2CAIA 3NIVA 1GSEA 4HOJA 2WJUA 2IL3A 2F8FA 2RUEA 5AIVA 2H6ZA 3IA1A 2JZRA 1DBYA 4NPBA 5G31A 1M2DA 4V1Ap 3PR8A 3TKRA 1PMTA 2YPMA 2FWEA 4TN8A 5HR3A 2VL3A 3GSSA 1FOHA 2VUPA 4ZL7A 4K1FA 2ALBA 3FW2A 2FHEA 3RHCA 3BCKA 5A4VA 1O73A 2K18A 3KD0A 2LJAA 3HVVA 1USBA 2HFDA 2R4VA 4YKFA 2TRCP 3TOUA 3FRCA 3M9JA 3APSA 2EFHA 2YOIA 1G7OA 3GIXA 1SU9A 4IVFA 5A1NB 3GSTA 3GTUB 1B4PA 3D21A 4NMUA 4GLTA 3P90A 2L4CA 2OT3A 1Z6MA 1EP8A 2IFQB 5A34B 4X4JA 4DVCA 3H8QA 4DSRA 2IN3A 4TW5A 4JBBA 2GSQA 4DEJA 2AYTA 5H5RA 1A0RP 1T1VA 2I81A 3EU4A 2ES7A 3ZFLA 2N5AA 3GL3A 5GAPD 3UEMA 1SJ6A 4CY6A 1YZXA 1X9MB 4TXOA 1GLQA 4IP6A 1J0FA 1ZZYA 2A4HA 4O7HA 3UIWA 2H0IA 2RIIA 4Q5FA 2DJ3A 4ECBA 2F9SA 1XOBA 3QDNA 3LW9A 2BMXA 2VCVA 3HD5A 5DAKA 1HQOA 2E2MA 2L59A 5BMUB 1PL1A 4XRDA 5IMFA 3FZ9A 2CQ9A 3GKXA 1WWJA 2IMEA 4NHWA 4I6XA 3FKFA 2X8CA 1QMVA 2JZTA 2WZ9A 4HI7A 4IBPA 2VAFA 1OC3A 4OFMA 2GQKA 1SD8A 5ECMB 1SJIA 2V6OA 1U6TA 1Z9HA 2GVPA 1FVKA 3CBUA 1WE0A 4ZB6A 5J5NA 3P8WA 3CMIA 4DSQA 4K6XA 1GSDA 4GSTA 5JWOB 1YEPA 1R26A 1PKWA 3TJBA 5ECOB 1TI3A 3BD2A 3QAWA 1MTCA 1Z7PA 2N5FA 1MD3A 5DBQA 5A1NA 3GTUA 3N9JA 3GHAA 4E68A 4Q5RA 2IFQA 4G0KA 3V1WA 5A34A 3K8NA 3RBTA 3MIXA 5ID2B 20GSA 3U5RE 1QGVA 4WETA 3ZIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPT A;  3IK9 A;  3GH9 A;  3VUR A;  2B5Y A;  1F3A A;  1GTU A;  1YEX A;  5ECP B;  3WT1 A;  4EDY A;  3D0Z A;  1GNW A;  2L4Q A;  2OBK A;  3W6G A;  4HDE A;  1K0C A;  2H0H A;  2YP6 A;  1GL8 A;  2XHF A;  4AGS A;  5EY6 A;  3CXG A;  3IOS A;  4LA1 A;  5DJM A;  3A2X A;  2FWH A;  2WFC A;  3EVI A;  5BMU A;  2J9H A;  4PUF C;  4POK A;  5ECR B;  4X43 A;  4K9Z A;  4DSS B;  4PNF A;  1CQH A;  3GNJ A;  3ERF A;  2HYX A;  2NVL A;  2HT9 A;  1F3B A;  4MK3 A;  1X5D A;  5HR0 A;  1YQ1 A;  3RPN A;  1U87 A;  3FR9 A;  1YKC A;  1O85 A;  1OYJ A;  3IBH A;  2AV4 A;  3BOA A;  4KF9 A;  2VLV A;  1TW9 A;  3LWA A;  2OAD A;  4PUA A;  1QXH A;  1M9A A;  1V9W A;  1OVN A;  4V2N A;  1JZW A;  1XWC A;  4YQU A;  4XS6 A;  1VF3 A;  1XVQ A;  1SL2 B;  18GS A;  2DIY A;  3QAG A;  2FUG 2;  2ZCT A;  3EYT A;  4AJ8 A;  4FYB A;  5C00 A;  3TGZ A;  4F0B A;  2A2R A;  1XW9 A;  4LL1 B;  5ID2 A;  2LRT A;  2VCW A;  2LNS A;  1R7H A;  6GSS A;  4EF0 A;  1ABA A;  1S3C A;  1OKT A;  4FYU A;  3WT2 A;  4N30 A;  5J41 A;  2K8V A;  2KOK A;  1BX9 A;  3W8S A;  17GS A;  3C71 A;  1MDK A;  4ACS A;  3OR5 A;  2PU9 C;  1FB6 A;  2LEG A;  4MF7 A;  1IYI A;  4N0Z A;  3TJJ A;  4JRR A;  4CW9 A;  2EIR A;  1PL2 A;  5DCH A;  4XHM A;  4K0N A;  3QPM A;  5JWR B;  3CSJ A;  5KEJ A;  1ERV A;  4YQV A;  2I1U A;  1R5P A;  4F0C A;  2HRF A;  2LV3 A;  4AF2 A;  4DSS A;  1MDI A;  3LEF A;  3KTL A;  3EC3 A;  4N11 A;  1THO A;  5KN3 A;  1ZL9 A;  5FWG A;  4MZW A;  1HNC A;  3D6I A;  4YAP A;  3HYP A;  6GST A;  1OC9 B;  5H5S A;  3CTG A;  4WF4 A;  3UBL A;  2HZE B;  1ERT A;  3D4T A;  2H76 A;  5IMA A;  1GH2 A;  3KH7 A;  3UMA A;  2DJJ A;  3GYK A;  1EEJ A;  3F3Q A;  2FWF A;  1UA5 A;  1TK5 B;  2JL4 A;  1XVW A;  3C8E A;  3HHV A;  5HFI A;  1OE8 A;  1XW5 A;  4IEL A;  4G9H A;  1PA3 A;  3HZ4 A;  4FH8 A;  1ILO A;  1JHB A;  2NTO A;  2VCT A;  1G6W A;  4ZL8 A;  4F2I A;  4GTU A;  3DRN A;  2YV7 A;  1FW1 A;  4JED A;  2VLU A;  1N2A A;  4KX4 A;  3CYN A;  1GUH A;  5HQP A;  3KZQ A;  1GUM A;  1K3L A;  16GS A;  2WS2 A;  4HUA A;  3EE2 A;  1K0M A;  2GQM A;  3VI7 A;  4MP4 A;  1QK8 A;  1GRX A;  1ZCP A;  2WUL A;  2HRK B;  4V2M A;  5D9V A;  2JSY A;  2WCI A;  1H4O A;  1WRY A;  5IOW A;  3TJK A;  2WB9 A;  3VLN A;  3VWV A;  4J57 E;  3D5J A;  4MA9 A;  2CAQ A;  2OE3 A;  2VLT A;  2VCX A;  3L9S A;  1PX7 A;  2AHE A;  1B9Y C;  3TB2 A;  3UOM A;  2LKU A;  1V98 A;  3ZVJ D;  1F9M A;  3IK7 A;  1OC9 A;  2XPE A;  2FA8 A;  4ZIJ A;  4MZC A;  1MEK A;  3ZVJ A;  2HZE A;  2NDO A;  3RHB A;  1VGL A;  2VCZ A;  2VM2 A;  3FR3 A;  4NV5 A;  5ECI B;  4EL1 A;  4OCE A;  2VL9 A;  1C72 A;  1K0O A;  5IPH A;  3GKK A;  1M9B A;  2C3Q A;  2G2Q A;  4LLR A;  2YCD A;  3DYR A;  2YWO A;  1AUC A;  4IKH A;  2MMO A;  4FO5 A;  3TKS E;  4NWY A;  3A2W A;  5CRD A;  2P5Q A;  5E4W A;  4I97 A;  1NM3 A;  2LRN A;  3IRA A;  2HLS A;  4GXZ A;  3US3 A;  2L6C A;  2KLX A;  3ZRD A;  2X64 A;  1YDK A;  2I4A A;  3CRT A;  1NHY A;  2YZH A;  2H72 A;  3KP9 A;  3ZML A;  1O8X A;  3GUR A;  3W8J A;  3DXB A;  4EO3 A;  1WMJ A;  2REM A;  5A4U A;  5CNW A;  3D22 A;  3MWH A;  4L5O A;  1JFU A;  3QD9 A;  2GZZ A;  4V2L A;  4ML1 A;  2YWI A;  3LXT A;  3F3R A;  3QOU A;  3KMO A;  2C0F A;  3O76 A;  4IW9 A;  1LBK A;  1TKD B;  5CRE A;  3TKP A;  2XBI A;  2LQO A;  3SWL A;  1TRV A;  2DSA A;  1YF1 A;  3P2A A;  11GS A;  1HYU A;  1K0N A;  4OWY A;  2PVO C;  4J56 E;  3DIE A;  4HU7 A;  5G2Z A;  3ZFB A;  3CRU A;  4MJE A;  1I9D A;  3IHQ A;  1GSY A;  1SYR A;  3F9U A;  5EVO A;  1OAZ A;  3I9V 2;  2GS3 A;  1GP1 A;  2AB6 A;  4KE3 A;  4MJB A;  4D73 B;  4KCA A;  5ECS A;  5ELA A;  2P31 A;  4ILF A;  2XBQ A;  2A4V A;  3GN3 A;  2QSI A;  4MF5 A;  4YH2 A;  2CT6 A;  1AXD A;  5B6N A;  3F63 A;  5ENU A;  4F9Z A;  3GX0 A;  1FB0 A;  1ML6 A;  4RQR A;  2FD3 A;  3MAK A;  2R5G A;  1SD9 A;  2C4J A;  4AJ6 A;  6GSX A;  4GWR A;  1EV9 A;  4KW6 A;  2V2G A;  2O89 A;  3KCM A;  1XWA A;  1VF2 A;  5ECN B;  5D96 A;  3J7Y k;  1Z5Y E;  2XPD A;  5G1K A;  5G5E A;  1QQ2 A;  1ZYE A;  3BBY A;  3KP8 A;  4WBR D;  6GSW A;  2QGV A;  3G7J A;  3FYG A;  4WR4 A;  4O32 A;  3ZRE A;  4K8M A;  1J9B A;  2GT6 A;  2WRT A;  4POL A;  3GH6 A;  2MMA A;  3HY2 A;  4TXV A;  5JWQ B;  1X9S B;  1FG4 A;  1UN2 A;  3TOT A;  3UVH A;  3J7Y b;  4MPF A;  1AW9 A;  2DBC A;  5DVB A;  2LQQ A;  3TCO A;  2AJQ B;  4J2F A;  4GRF A;  1U88 A;  10GS A;  1ST9 A;  5IMZ A;  1V40 A;  4ZIL A;  1TU8 A;  4BVX B;  4BVY A;  4OO4 A;  2BJX A;  1ZOF A;  3UAR A;  2LST A;  5INY A;  4KDY A;  5F8B A;  3VWW A;  2FA4 A;  1IYH A;  3ZL5 A;  3EWL A;  3L4N A;  4D73 A;  4QQ7 A;  5D9X A;  2YAN A;  2G0F A;  2GZP A;  2YJH A;  1WIK A;  2E0Q A;  1XBS A;  4K7O A;  4Z7X A;  2H19 A;  3F4T A;  1FHE A;  2FWG A;  1O7U A;  2L57 A;  1XFL A;  1GLP A;  5AIX A;  2M46 A;  19GS A;  3GV1 A;  5KN2 A;  2PN8 A;  3IXR A;  3MDK A;  1XWK A;  4EUY A;  2DLX A;  3IR4 A;  1O6J A;  5DDL A;  3A5W A;  3I43 A;  1CQG A;  3WYW A;  4GQC A;  3GKM A;  4K7I A;  2JAC A;  3ISO A;  2IMI A;  2B3S A;  1TU7 A;  1AC1 A;  3HXS A;  5F07 A;  2HRA A;  1RK4 A;  4TVE A;  3ZMK A;  4L5L A;  3KTB A;  4PXO A;  4OD7 A;  4MZB A;  2VCQ A;  1B9X C;  3E3E A;  1DE2 A;  4X1U A;  1XPV A;  3PH9 A;  4JE1 A;  2HQT A;  2H1D A;  4XS1 A;  1I5G A;  3TJF A;  3TDG A;  4X0X A;  3ERW A;  1LJR A;  1GTA A;  3LGC A;  4MAB A;  2VD1 A;  4N10 A;  1O8W A;  5CP1 A;  2H1A A;  4IS0 A;  5CRW A;  9GSS A;  4BVX A;  4ECC A;  4PUR A;  5IOX A;  4XRA A;  1HNA A;  1GUL A;  2TIR A;  3ME8 A;  1HNB A;  2LRC A;  5AIS A;  1Z3E A;  3FK8 A;  3FZ4 A;  3ED3 A;  3VPT A;  4V1A g;  2E2G A;  1V57 A;  3ZYW A;  2B5E A;  4OFT A;  2B6M A;  4GQF A;  3EUR A;  2VO4 A;  4ZB8 A;  5F06 A;  4HJM A;  1AQW A;  14GS A;  3HJO A;  4PQ1 A;  3UAP A;  3BJ5 A;  5COH A;  3M3M A;  1M2A A;  2NBS A;  1M0U A;  4ZBD A;  2V41 A;  4PGT A;  4L8E A;  2IMK A;  4EC0 A;  3IC4 A;  4KSO A;  1A2M A;  2KHP A;  2OJL A;  2DMM A;  4NHZ A;  4ECJ A;  5H5Q A;  4G10 A;  2O87 A;  2CZ3 A;  1F6M C;  2KUC A;  2JAD A;  1A8Y A;  1BED A;  5HFG A;  3ZLP A;  2H75 A;  2LNT A;  5DQY A;  5IQY A;  4IGJ A;  2IIY A;  3ME7 A;  3DML A;  2J23 A;  1EZK A;  1PKZ A;  2HSM B;  4HU9 A;  3M0F A;  1NW2 A;  1Q98 A;  1X5E A;  1GNE A;  1ON4 A;  3SBC A;  4MCU A;  2AAW A;  3PIN A;  5ECQ B;  2KP1 A;  1A23 A;  3DKS A;  4TR1 B;  1B8X A;  4LMW A;  1SL1 B;  4JU5 A;  4HQZ A;  5CO3 A;  2GLR A;  4WKW A;  5GST A;  2HSH A;  3TJG A;  4QL7 A;  2IMD A;  1VRS D;  5A5K A;  2CX3 A;  5J3R A;  2F51 A;  1EGR A;  1JZR A;  1RW1 A;  5IPG A;  3HJP A;  1SJZ A;  2O7K A;  4GCI A;  3WGX A;  1TRS A;  5F0G A;  1F37 A;  2VM1 A;  4IQA A;  1OKD A;  4E8E A;  2F8A A;  2O85 A;  3I69 A;  4POB A;  3C1S A;  1YJ6 A;  2X8G A;  3P7X A;  2O8V B;  4KGI A;  3G7I A;  3R3E A;  3DVX A;  1HD2 A;  3UL3 A;  1SEN A;  5G5F A;  1BYE A;  3H4K A;  1T7P B;  1EOH A;  3L0H A;  5KN1 A;  4NV2 A;  2I9H A;  3F6D A;  2H0G A;  2H6Y A;  5DCG A;  3QAV A;  1S3D A;  2KP2 A;  2R6K A;  1RQM A;  3Q74 A;  4P3Y B;  3TKS A;  4JR6 A;  4LL4 B;  4XTS A;  5IMC A;  3RDW A;  3GL5 A;  5GAN D;  3LYP A;  1EEM A;  2B5X A;  3VWX A;  2HSM A;  3DD3 A;  2L6D A;  2YN1 A;  3KEB A;  1MDJ A;  2H30 A;  3EU3 A;  4PQH A;  3KIJ A;  4L0W A;  5ECK B;  2DJ0 A;  3GMF A;  4KB3 A;  1TK8 B;  3DVW A;  3VFI A;  2IPA A;  3M9K A;  4G19 A;  2F3M A;  3IPZ A;  1U3A A;  4TR1 A;  2EIQ A;  1A2J A;  2RUF A;  3MNG A;  1N8J A;  1A8L A;  1SL0 B;  4GSS A;  4JZQ A;  4IQ1 A;  2B7J A;  5AN1 A;  1XZO A;  1KTE A;  1TXX A;  4MF6 A;  4FYC A;  5HR1 A;  1Y6E A;  2ZNM A;  2XC2 A;  3ZTL A;  5FHI A;  5HR2 A;  3LG6 A;  4ZBA A;  2NPB A;  4NXI A;  3TRP A;  2L5O A;  3N5O A;  1M7T A;  4ZXG A;  1KEB A;  4EKZ A;  3IAM 2;  3L9V A;  4WXT A;  2YV9 A;  2AUV A;  3LJR A;  1EGO A;  3HJM A;  3RAZ A;  4MJA A;  6GSV A;  3M8N A;  3KGK A;  2CX4 A;  1XWB A;  1TOF A;  4CHS A;  2R3X A;  3EMP A;  3L78 A;  1AQX A;  4KDU A;  3KJY A;  1SKR B;  1K3O A;  4LMV A;  3RPP A;  2GGT A;  2ON5 A;  1G0T A;  3H79 A;  2YNX A;  2DJ2 A;  1X9W B;  2MYG A;  4TKY A;  3ERG A;  4MJC A;  4WR5 A;  4BWS A;  3HDC A;  5JCW A;  5JCU A;  1PQN A;  4ZBB A;  3KH9 A;  2C0E A;  4KUN A;  3GA4 A;  1X5C A;  4POM A;  1M2B A;  2HSN B;  2YZU A;  2P5R A;  4BVY B;  1FO5 A;  3GKN A;  4L0U A;  4MDC A;  1GSU A;  1WJK A;  5KN0 A;  1WOU A;  1Y25 A;  4YQM A;  2CA8 A;  3HVS A;  5IM9 A;  1FOV A;  2CV4 A;  4EVM A;  1XWG A;  2DML A;  5GZZ B;  1BAY A;  1ZMA A;  5ECL B;  3APO A;  3E9J B;  2PVQ A;  4O5R A;  2HE3 A;  4IP1 A;  1XOA A;  3IAS 2;  3DEX A;  3G9B A;  3LQ7 A;  3NZN A;  3IC8 A;  2OKA A;  1M99 A;  5D9T A;  2C8U A;  1AQV A;  5C04 A;  1GTB A;  3HA9 A;  8GSS A;  2PER A;  1EV4 A;  5D8I A;  1AIU A;  5CRH A;  1ZYQ B;  2IWT A;  4BPY A;  1GUK A;  2HNL A;  4I2U A;  2DJ1 A;  2R2J A;  2CVK A;  3U6V A;  4FIW A;  4NAX A;  3GX8 A;  4ZL9 A;  4K7N A;  4KAE A;  4PTS A;  3QFB C;  2LS5 A;  2MBT A;  5GSS A;  1JLW A;  1EWX A;  3F0I A;  1TRU A;  2LUS A;  2HRN A;  1SYX A;  4MPG A;  1BJX A;  4PQI A;  4I2T A;  2L5L A;  1JLV A;  4K0G A;  1G7E A;  1XXU A;  4HQS A;  1Z6N A;  4MLY A;  1TRW A;  2HZF A;  1Q4J A;  2H73 A;  5B8A A;  2QKE A;  3LOR A;  2RLI A;  2Z9S A;  4ULX A;  3HCZ A;  3HKR A;  5LD0 A;  3KM6 A;  4WF5 A;  4QL9 A;  5LNK e;  4BWQ A;  1GSQ A;  2GSS A;  1LU4 A;  2CVD A;  3LSZ A;  5G30 A;  4BA7 A;  3ZIV A;  2CZ2 A;  5CYY A;  5G1L A;  2VL2 C;  2C0G A;  4OMV A;  2H8L A;  1YF0 A;  1X0R A;  1GTI A;  3TKS C;  1T3B A;  2E7P A;  2C0D A;  2YJ7 A;  2GSR A;  1PX6 A;  4GSN A;  3QCP A;  2GDR A;  2I3Y A;  2FCH A;  2JSZ A;  5IMD A;  1K3Y A;  1GSF A;  4Q5Q A;  4AJ7 A;  2GT5 A;  5J9B A;  4XS4 B;  1K0A A;  3GUS A;  1Z7R A;  4RI6 A;  1NHO A;  1TDI A;  2ON7 A;  1V2A A;  4ID0 A;  4KDX A;  4HZ2 A;  2CVB A;  3F8U A;  4F03 A;  4TOP A;  1J08 A;  4G0L A;  1VF4 A;  5JCG A;  3Q18 A;  5LCZ A;  1EOG A;  1VF1 A;  4WBJ A;  2YWM A;  3FHK A;  1SK0 A;  2H1G A;  2H74 A;  3C1R A;  1WPI A;  1YKA A;  5L71 A;  4IJ3 A;  2VOC A;  3UVT A;  2GTU A;  2B1L A;  1ACV A;  1PGT A;  5F05 A;  3A2V A;  3EMX A;  2V32 A;  3D4M A;  4JR4 A;  1K0B A;  1NSW A;  2OA7 A;  2FY6 A;  3CTF A;  3H93 A;  3CSI A;  2M72 A;  3IE3 A;  1R5A A;  5D73 A;  2H01 A;  4ML6 A;  1T4Z A;  2IMF A;  2LJR A;  4E8H A;  1SKS B;  1TI1 A;  1FVJ A;  1JZO A;  2IJY A;  3F4R A;  1DUG A;  2HXK A;  2GQL A;  2FNO A;  2HI7 A;  1TP9 A;  3F6F A;  5DJL A;  2FGX A;  1XW6 A;  3IDV A;  4ECI A;  3L9U A;  5ABR A;  3QMX A;  4MH2 A;  2PMT A;  3VK9 A;  2H6X A;  1A2L A;  2JU5 A;  2GST A;  3WGE A;  2V1M A;  2D2Z A;  5AGY A;  4KND A;  2H66 A;  1B4Q A;  4WEY A;  4XS4 A;  2M80 A;  1OE7 A;  1KBN A;  1T8E B;  3TRX A;  5E59 A;  1B48 A;  3HVX A;  1A0F A;  2LJK A;  2EC4 A;  4G0I A;  4HEA 2;  2RM6 A;  1SK2 A;  3E0U A;  3FZ5 A;  4RUV A;  3VWU A;  4YAV A;  1F2E A;  3FY7 A;  2K8S A;  4HS1 A;  5EL8 A;  1S3A A;  3O6T A;  2K9F A;  5IO2 A;  4TR3 A;  2PBJ A;  2LTK A;  3VI5 A;  2VIM A;  1UVZ A;  3Q6O A;  3S9F A;  3F4S A;  4Q5N A;  3HZ8 A;  1A24 A;  2P0G A;  1WP0 A;  3C73 A;  2OAC A;  3DWV A;  2OE1 A;  3R2Q A;  4BL7 B;  5J4U A;  3IV4 A;  4PNG A;  1XCC A;  5B6M A;  5HFK A;  3QR6 A;  1T4Y A;  1PN9 A;  3WD6 A;  3O3T A;  1E2Y A;  2N5B A;  1H75 A;  1ZGN A;  5CAX A;  1SKW B;  3G7Y A;  3UBK A;  1JZD A;  2OE0 A;  12GS A;  4KSM A;  4EXJ A;  2X99 A;  3WGD A;  5ELG A;  4XCS A;  3GFK A;  4KA0 A;  2MBS A;  2TRX A;  4RI7 A;  2EIO A;  4FQU A;  1BQ7 A;  7GSS A;  4O92 A;  2QC7 A;  4HZ4 A;  1XIY A;  3ZIT A;  4CDO A;  2VL2 A;  2H70 A;  1ERW A;  4IHU A;  3GRX A;  2FLS A;  4N0V A;  4IN0 A;  3JCM L;  6GSY A;  4MH3 A;  2MMZ A;  2R37 A;  1BG5 A;  1PD2 1;  1DSB A;  2C3N A;  4TR0 A;  2C80 A;  5D93 A;  3FZA A;  2YWN A;  5IO0 A;  2DJK A;  2GZY A;  1GSS A;  5DAL B;  3A3T A;  5CRG A;  3QFA C;  1TTZ A;  22GS A;  2A2S A;  1AAZ A;  5B7C A;  3FEU A;  1THX A;  1R4W A;  3Q19 A;  1FAA A;  4IJI A;  2HSY A;  3I6A A;  4KCE A;  2WGR A;  1PRX A;  1GWC A;  4G2E A;  5IIZ A;  2UZ8 A;  2PGT A;  3PPU A;  6GSU A;  4BL7 A;  3MSZ A;  4I8B A;  2OBI A;  1OC8 A;  2BTO T;  4EE0 A;  1URM A;  3EIN A;  3LXZ A;  1DE1 A;  3KMN A;  4MMM A;  3TRQ A;  3BCI A;  1PSQ A;  2C3T A;  2B7K A;  5ECH B;  1KNG A;  3CSH A;  3LYK A;  1T00 A;  1UC7 A;  3TKQ A;  2RM5 A;  3ZZX A;  3PGT A;  4K2D A;  1QFN A;  2WDU A;  4EDZ A;  2DIZ A;  4KH7 A;  1E6B A;  4HJ2 A;  2MMN A;  3LFL A;  3H1N A;  1ERU A;  5A4W A;  1QUW A;  5EPF A;  3AY8 A;  5D9W A;  1G6Y A;  5IMV A;  4OCF A;  1O81 A;  4TRX A;  4H86 A;  3FR6 A;  1W89 A;  3VPQ A;  1SK1 A;  2X8H A;  1EP7 A;  4RQX A;  3M1G A;  5DQS A;  3APQ A;  4OFN A;  1TK0 B;  5FT3 A;  2C1Y A;  3C7M A;  2PUK C;  2PWJ A;  5J9C A;  1TJD A;  2H71 A;  4OO5 A;  5DAL A;  5B8B A;  4USS A;  3KXO A;  4F82 A;  4GF0 A;  4ZB9 A;  3DGQ A;  2VD0 A;  2B1K A;  1K0D A;  2H1B A;  2JZS A;  4TXO B;  4I5Q A;  1V58 A;  4ISD A;  1U3I A;  13GS A;  3UJ1 A;  3NOF A;  3TUE A;  2ZUP A;  2K6V A;  2HRK A;  1YY7 A;  2V6K A;  4PX1 A;  1W4V A;  5DAK B;  4TR4 A;  2DC5 A;  2MZC A;  4XIH A;  1MD4 A;  2CAI A;  3NIV A;  1GSE A;  4HOJ A;  2WJU A;  2IL3 A;  2F8F A;  2RUE A;  5AIV A;  2H6Z A;  3IA1 A;  2JZR A;  1DBY A;  4NPB A;  5G31 A;  1M2D A;  4V1A p;  3PR8 A;  3TKR A;  1PMT A;  2YPM A;  2FWE A;  4TN8 A;  5HR3 A;  2VL3 A;  3GSS A;  2VUP A;  4ZL7 A;  4K1F A;  2ALB A;  3FW2 A;  2FHE A;  3RHC A;  3BCK A;  5A4V A;  1O73 A;  2K18 A;  3KD0 A;  2LJA A;  3HVV A;  1USB A;  2HFD A;  2R4V A;  2TRC P;  3TOU A;  3FRC A;  3M9J A;  3APS A;  2YOI A;  1G7O A;  3GIX A;  1SU9 A;  4IVF A;  3GST A;  3GTU B;  1B4P A;  3D21 A;  4NMU A;  4GLT A;  3P90 A;  2L4C A;  1Z6M A;  1EP8 A;  2IFQ B;  4DVC A;  3H8Q A;  4DSR A;  2IN3 A;  4TW5 A;  4JBB A;  2GSQ A;  4DEJ A;  2AYT A;  5H5R A;  1A0R P;  1T1V A;  2I81 A;  3EU4 A;  2ES7 A;  3ZFL A;  2N5A A;  3GL3 A;  5GAP D;  3UEM A;  1SJ6 A;  1YZX A;  1X9M B;  4TXO A;  1GLQ A;  4IP6 A;  1J0F A;  1ZZY A;  4O7H A;  3UIW A;  2H0I A;  2RII A;  4Q5F A;  2DJ3 A;  4ECB A;  2F9S A;  1XOB A;  3QDN A;  2BMX A;  3HD5 A;  2VCV A;  5DAK A;  1HQO A;  2E2M A;  2L59 A;  1PL1 A;  4XRD A;  5IMF A;  3FZ9 A;  2CQ9 A;  3GKX A;  1WWJ A;  2IME A;  4NHW A;  4I6X A;  3FKF A;  2X8C A;  1QMV A;  2JZT A;  2WZ9 A;  4HI7 A;  4IBP A;  2VAF A;  1OC3 A;  4OFM A;  2GQK A;  1SD8 A;  5ECM B;  1SJI A;  2V6O A;  1U6T A;  1Z9H A;  2GVP A;  1FVK A;  3CBU A;  1WE0 A;  4ZB6 A;  5J5N A;  3P8W A;  3CMI A;  4DSQ A;  4K6X A;  1GSD A;  4GST A;  5JWO B;  1YEP A;  1R26 A;  1PKW A;  3TJB A;  5ECO B;  1TI3 A;  3BD2 A;  3QAW A;  1MTC A;  1Z7P A;  2N5F A;  1MD3 A;  5DBQ A;  3GTU A;  3N9J A;  3GHA A;  4Q5R A;  2IFQ A;  4G0K A;  3V1W A;  3K8N A;  3RBT A;  5ID2 B;  20GS A;  3U5R E;  1QGV A;  4WET A;  3ZIJ A; 
#chains in the Genus database with same CATH topology
 2PPT A;  3IK9 A;  3GH9 A;  2EFD A;  3VUR A;  2B5Y A;  1Y1U A;  1F3A A;  1GTU A;  1YEX A;  5ECP B;  3WT1 A;  4EDY A;  3D0Z A;  1GNW A;  2L4Q A;  2OBK A;  3W6G A;  4HDE A;  1K0C A;  2H0H A;  2YP6 A;  1GL8 A;  2XHF A;  4AGS A;  5EY6 A;  3CXG A;  3IOS A;  4LA1 A;  5DJM A;  3A2X A;  2FWH A;  2WFC A;  3EVI A;  5BMU A;  2QA2 A;  2J9H A;  4PUF C;  4POK A;  5ECR B;  4X43 A;  4K9Z A;  4DSS B;  4PNF A;  1CQH A;  3GNJ A;  4MNN A;  3ERF A;  2HYX A;  2NVL A;  2HT9 A;  1F3B A;  4MK3 A;  1X5D A;  5HR0 A;  1YQ1 A;  3RPN A;  1U87 A;  3FR9 A;  1YKC A;  1O85 A;  1OYJ A;  3IBH A;  2AV4 A;  3BOA A;  4KF9 A;  1SVL A;  2VLV A;  1TW9 A;  3LWA A;  2OAD A;  4PUA A;  1QXH A;  1M9A A;  1V9W A;  1OVN A;  4V2N A;  5A5H B;  1JZW A;  1XWC A;  4YQU A;  4XS6 A;  3RFR C;  1VF3 A;  1XVQ A;  5BRT A;  4EIP A;  1SL2 B;  18GS A;  2DIY A;  3QAG A;  2FUG 2;  2ZCT A;  3EYT A;  1ZYN A;  4AJ8 A;  4FYB A;  5C00 A;  3TGZ A;  4F0B A;  2A2R A;  3CWG A;  1XW9 A;  4LL1 B;  2A2P A;  5ID2 A;  2LRT A;  2VCW A;  2LNS A;  1R7H A;  6GSS A;  1YVL A;  4EF0 A;  1ABA A;  1S3C A;  1OKT A;  4FYU A;  3WT2 A;  4N30 A;  2O36 A;  5J41 A;  2K8V A;  2KOK A;  1BX9 A;  3W8S A;  3IHG A;  17GS A;  3C71 A;  1MDK A;  4ACS A;  3OR5 A;  2PU9 C;  1FB6 A;  2LEG A;  4MF7 A;  1IYI A;  4N0Z A;  3TJJ A;  4Z2R A;  4JRR A;  4CW9 A;  2EIR A;  1PL2 A;  5DCH A;  4XHM A;  4K0N A;  3QPM A;  5JWR B;  3CSJ A;  5KEJ A;  1ERV A;  4YQV A;  2I1U A;  1R5P A;  4F0C A;  2HRF A;  2LV3 A;  4AF2 A;  4DSS A;  1MDI A;  3LEF A;  3KTL A;  3EC3 A;  4N11 A;  1THO A;  5KN3 A;  1ZL9 A;  5FWG A;  4MZW A;  1HNC A;  3D6I A;  4YAP A;  3HYP A;  6GST A;  1OC9 B;  5H5S A;  2VKZ G;  3CTG A;  4WF4 A;  3UBL A;  3D4T A;  2HZE B;  1ERT A;  2H76 A;  5IMA A;  1GH2 A;  1PFO A;  3KH7 A;  3UMA A;  2DJJ A;  3GYK A;  1EEJ A;  3F3Q A;  2FWF A;  1UA5 A;  1TK5 B;  2JL4 A;  2WW1 A;  1XVW A;  3C8E A;  3HHV A;  5A5H A;  3HVN A;  5HFI A;  2QA1 A;  1OE8 A;  1XW5 A;  4IEL A;  4G9H A;  1PA3 A;  3HZ4 A;  4FH8 A;  4Z2U A;  1ILO A;  1JHB A;  2NTO A;  2VCT A;  1G6W A;  4ZL8 A;  4F2I A;  4GTU A;  3DRN A;  2YV7 A;  1FW1 A;  4JED A;  2VLU A;  4CY8 A;  4PI2 C;  1N2A A;  4KX4 A;  3CYN A;  1GUH A;  5HQP A;  3KZQ A;  1GUM A;  1K3L A;  16GS A;  2WS2 A;  4HUA A;  3EE2 A;  1K0M A;  2GQM A;  3VI7 A;  4MP4 A;  1QK8 A;  1GRX A;  1ZCP A;  2WUL A;  2HRK B;  4V2M A;  5D9V A;  2JSY A;  2WCI A;  1H4O A;  1WRY A;  5IOW A;  3TJK A;  2WB9 A;  3VLN A;  3VWV A;  4J57 E;  3D5J A;  4MA9 A;  2CAQ A;  2OE3 A;  2VLT A;  2VCX A;  3L9S A;  1PX7 A;  2AHE A;  1B9Y C;  3TB2 A;  3UOM A;  2LKU A;  1V98 A;  3ZVJ D;  1F9M A;  3IK7 A;  1OC9 A;  2XPE A;  2FA8 A;  4ZIJ A;  4MZC A;  1MEK A;  3ZVJ A;  2HZE A;  2NDO A;  3RHB A;  1VGL A;  2VCZ A;  2VM2 A;  3FR3 A;  4NV5 A;  4PI0 C;  5ECI B;  4EL1 A;  4OCE A;  2VL9 A;  1C72 A;  1K0O A;  5IPH A;  3GKK A;  1M9B A;  2C3Q A;  2G2Q A;  4LLR A;  2YCD A;  3DYR A;  2YWO A;  1AUC A;  4IKH A;  2MMO A;  4FO5 A;  3TKS E;  4NWY A;  3A2W A;  5CRD A;  2P5Q A;  5E4W A;  4I97 A;  1NM3 A;  2LRN A;  3IRA A;  2HLS A;  4GXZ A;  3US3 A;  2L6C A;  2KLX A;  3ZRD A;  3A5I A;  2X64 A;  1YDK A;  2I4A A;  3CRT A;  1NHY A;  2YZH A;  2H72 A;  1SVO A;  3KP9 A;  3ZML A;  1O8X A;  3GUR A;  3W8J A;  3DXB A;  4EO3 A;  1WMJ A;  2REM A;  5A4U A;  5CNW A;  3D22 A;  3MWH A;  4L5O A;  1JFU A;  3QD9 A;  2GZZ A;  4V2L A;  4ML1 A;  2YWI A;  3LXT A;  3F3R A;  3QOU A;  3KMO A;  2C0F A;  3O76 A;  4IW9 A;  1LBK A;  1TKD B;  5CRE A;  3TKP A;  2XBI A;  2LQO A;  3SWL A;  1TRV A;  2DSA A;  1YF1 A;  3P2A A;  11GS A;  2WVX B;  1HYU A;  4YKG A;  1K0N A;  4OWY A;  2PVO C;  4J56 E;  3DIE A;  4HU7 A;  5G2Z A;  3ZFB A;  3CRU A;  4MJE A;  1I9D A;  3IHQ A;  1GSY A;  1SYR A;  3F9U A;  5EVO A;  1OAZ A;  3I9V 2;  2GS3 A;  1GP1 A;  2AB6 A;  4KE3 A;  4MJB A;  4D73 B;  4KCA A;  2H1L A;  5ECS A;  5ELA A;  2P31 A;  4ILF A;  2XBQ A;  2A4V A;  3GN3 A;  2QSI A;  4MF5 A;  4YH2 A;  2CT6 A;  1AXD A;  5B6N A;  3F63 A;  5ENU A;  4FXY P;  4F9Z A;  3GX0 A;  1FB0 A;  1ML6 A;  4RQR A;  2FD3 A;  4AI6 A;  3MAK A;  2R5G A;  1SD9 A;  2C4J A;  4AJ6 A;  6GSX A;  4GWR A;  1EV9 A;  4KW6 A;  2V2G A;  2O89 A;  3KCM A;  1XWA A;  1VF2 A;  5ECN B;  5D96 A;  3J7Y k;  1Z5Y E;  2XPD A;  5G1K A;  5G5E A;  4N3Z A;  1QQ2 A;  1ZYE A;  3BBY A;  3KP8 A;  4WBR D;  6GSW A;  2QGV A;  3G7J A;  3FYG A;  3CQF A;  4WR4 A;  4O32 A;  3ZRE A;  4K8M A;  1J9B A;  2GT6 A;  2WRT A;  4POL A;  3GH6 A;  2MMA A;  3HY2 A;  4TXV A;  5JWQ B;  1X9S B;  1FG4 A;  1UN2 A;  3TOT A;  3UVH A;  4HSC X;  3J7Y b;  4MPF A;  1AW9 A;  2DBC A;  5DVB A;  2LQQ A;  3TCO A;  2AJQ B;  4J2F A;  4GRF A;  1U88 A;  10GS A;  1ST9 A;  5IMZ A;  1V40 A;  4ZIL A;  2HSN A;  1TU8 A;  2WVX A;  4BVX B;  4BVY A;  4OO4 A;  2BJX A;  1ZOF A;  3UAR A;  2LST A;  5INY A;  4KDY A;  5F8B A;  1M3J A;  3VWW A;  2FA4 A;  1IYH A;  3ZL5 A;  1YEW C;  3EWL A;  3L4N A;  4D73 A;  4QQ7 A;  5D9X A;  2YAN A;  2G0F A;  2GZP A;  2YJH A;  1WIK A;  2E0Q A;  1XBS A;  4K7O A;  4Z7X A;  2WW3 A;  2H19 A;  3F4T A;  3FMW A;  1FHE A;  2FWG A;  1O7U A;  2L57 A;  1XFL A;  1GLP A;  5AIX A;  2M46 A;  19GS A;  3GV1 A;  5KN2 A;  2PN8 A;  3IXR A;  3MDK A;  1XWK A;  4EUY A;  4Z2T A;  2DLX A;  1I1I P;  1PN0 A;  3IR4 A;  1O6J A;  4ICY A;  5DDL A;  3A5W A;  3I43 A;  1CQG A;  4PHZ C;  3WYW A;  4GQC A;  3GKM A;  4K7I A;  2JAC A;  3ISO A;  2IMI A;  2B3S A;  4AKG A;  1TU7 A;  1AC1 A;  3HXS A;  5F07 A;  2HRA A;  1RK4 A;  4TVE A;  3ZMK A;  4L5L A;  3KTB A;  4PXO A;  4OD7 A;  4MZB A;  2VCQ A;  1B9X C;  3E3E A;  1DE2 A;  4X1U A;  1XPV A;  3PH9 A;  4JE1 A;  2HQT A;  2H1D A;  4XS1 A;  1I5G A;  3TJF A;  3TDG A;  4X0X A;  3ERW A;  1LJR A;  1GTA A;  3LGC A;  4MAB A;  2VD1 A;  4N10 A;  1O8W A;  5CP1 A;  2WVY A;  2H1A A;  4IS0 A;  5CRW A;  9GSS A;  4BVX A;  4ECC A;  4PUR A;  5IOX A;  4XRA A;  1HNA A;  1GUL A;  2TIR A;  3ME8 A;  1HNB A;  2LRC A;  5AIS A;  1Z3E A;  3FK8 A;  3FZ4 A;  3ED3 A;  1N25 A;  3VPT A;  4V1A g;  2E2G A;  1V57 A;  3ZYW A;  2B5E A;  4OFT A;  2B6M A;  4GQF A;  3EUR A;  2VO4 A;  4ZB8 A;  2R0C A;  5F06 A;  4HJM A;  1AQW A;  14GS A;  3HJO A;  4PQ1 A;  3UAP A;  3BJ5 A;  5COH A;  3M3M A;  1M2A A;  2NBS A;  1M0U A;  4ZBD A;  2V41 A;  4PGT A;  4L8E A;  2IMK A;  4EC0 A;  3IC4 A;  4KSO A;  1A2M A;  2KHP A;  2OJL A;  2DMM A;  4NHZ A;  4ECJ A;  5H5Q A;  4G10 A;  2O87 A;  2CZ3 A;  1F6M C;  2KUC A;  2JAD A;  1A8Y A;  1BED A;  5HFG A;  3ZLP A;  2H75 A;  2LNT A;  5DQY A;  4K5R A;  5IQY A;  4IGJ A;  2IIY A;  3ME7 A;  3DML A;  2J23 A;  1EZK A;  1PKZ A;  2HSM B;  4HU9 A;  3M0F A;  1NW2 A;  1Q98 A;  1X5E A;  1GNE A;  1ON4 A;  3SBC A;  4MCU A;  2AAW A;  3PIN A;  5ECQ B;  2KP1 A;  1A23 A;  3DKS A;  4TR1 B;  1B8X A;  4LMW A;  1SL1 B;  4JU5 A;  2EFE A;  4HQZ A;  5CO3 A;  2GLR A;  4WKW A;  5GST A;  2HSH A;  3TJG A;  4QL7 A;  2IMD A;  1VRS D;  5A5K A;  2CX3 A;  5J3R A;  2F51 A;  1EGR A;  1ZYP A;  1JZR A;  4AKI A;  1RW1 A;  5IPG A;  3HJP A;  2X4A A;  1SJZ A;  2O7K A;  4GCI A;  3WGX A;  1TRS A;  5F0G A;  1F37 A;  2VM1 A;  4IQA A;  1OKD A;  4E8E A;  2F8A A;  2O85 A;  3I69 A;  4POB A;  3C1S A;  1YJ6 A;  2X8G A;  3P7X A;  2O8V B;  4KGI A;  3G7I A;  3R3E A;  3DVX A;  1HD2 A;  3UL3 A;  1SEN A;  5G5F A;  1BYE A;  3H4K A;  5J47 A;  1T7P B;  1EOH A;  3L0H A;  5KN1 A;  4NV2 A;  2I9H A;  3F6D A;  2DKI A;  2H0G A;  2H6Y A;  5DCG A;  3QAV A;  1S3D A;  2KP2 A;  2R6K A;  1RQM A;  3Q74 A;  4P3Y B;  5J4Y A;  3TKS A;  4JR6 A;  4LL4 B;  4XTS A;  5IMC A;  3RDW A;  3GL5 A;  5GAN D;  3LYP A;  1EEM A;  2B5X A;  3HMJ G;  3VWX A;  2HSM A;  3DD3 A;  2L6D A;  2YN1 A;  3KEB A;  1MDJ A;  2H30 A;  3EU3 A;  4PQH A;  3KIJ A;  4L0W A;  5ECK B;  1BF5 A;  2DJ0 A;  3GMF A;  4KB3 A;  1TK8 B;  3DVW A;  3VFI A;  2IPA A;  3M9K A;  4G19 A;  2R0P A;  2F3M A;  3IPZ A;  1U3A A;  4TR1 A;  2EIQ A;  2X49 A;  1A2J A;  2RUF A;  3MNG A;  1N8J A;  1A8L A;  1SL0 B;  4GSS A;  4JZQ A;  4IQ1 A;  2B7J A;  5AN1 A;  1XZO A;  2UV8 G;  1KTE A;  1TXX A;  4MF6 A;  4FYC A;  5HR1 A;  1Y6E A;  2ZNM A;  2XC2 A;  3ZTL A;  5FHI A;  5HR2 A;  3LG6 A;  4ZBA A;  2NPB A;  4A5P A;  4NXI A;  3TRP A;  2L5O A;  3N5O A;  1M7T A;  4ZXG A;  1KEB A;  4EKZ A;  3IAM 2;  3L9V A;  4WXT A;  2YV9 A;  2AUV A;  3LJR A;  1EGO A;  3HJM A;  3RAZ A;  4MJA A;  6GSV A;  3M8N A;  3KGK A;  2CX4 A;  1XWB A;  1TOF A;  4O5U A;  4CHS A;  2R3X A;  3EMP A;  3L78 A;  1AQX A;  4KDU A;  3KJY A;  1SKR B;  1K3O A;  4LMV A;  3RPP A;  2GGT A;  2ON5 A;  1G0T A;  3H79 A;  2YNX A;  2DJ2 A;  1X9W B;  2MYG A;  4TKY A;  3ERG A;  4MJC A;  4WR5 A;  4BWS A;  3HDC A;  5JCW A;  1SVM A;  5JCU A;  1PQN A;  4ZBB A;  3KH9 A;  4ZB7 A;  2C0E A;  4KUN A;  3GA4 A;  1X5C A;  4POM A;  1M2B A;  2HSN B;  2YZU A;  2P5R A;  4BVY B;  1FO5 A;  3GKN A;  4L0U A;  4MDC A;  1GSU A;  1WJK A;  5KN0 A;  1WOU A;  1Y25 A;  4YQM A;  2CA8 A;  3HVS A;  5IM9 A;  1FOV A;  2CV4 A;  4EVM A;  1XWG A;  2DML A;  5GZZ B;  1BAY A;  3EPT A;  1ZMA A;  5ECL B;  3RGB C;  3APO A;  3E9J B;  2PVQ A;  4O5R A;  4AKX B;  2HE3 A;  4IP1 A;  1XOA A;  3IAS 2;  3DEX A;  3G9B A;  3LQ7 A;  3NZN A;  3IC8 A;  2OKA A;  1M99 A;  5D9T A;  2C8U A;  1AQV A;  5C04 A;  1GTB A;  3HA9 A;  8GSS A;  2PER A;  1EV4 A;  5D8I A;  1AIU A;  5CRH A;  1ZYQ B;  2IWT A;  4BPY A;  1GUK A;  2HNL A;  2DKH A;  2DJ1 A;  2R2J A;  2CVK A;  4I2U A;  3U6V A;  4FIW A;  4NAX A;  3GX8 A;  4K5S A;  4ZL9 A;  4K7N A;  4KAE A;  4PTS A;  3QFB C;  2LS5 A;  2MBT A;  5GSS A;  1JLW A;  1EWX A;  3F0I A;  1TRU A;  2LUS A;  2HRN A;  1SYX A;  4MPG A;  1BJX A;  4PQI A;  4I2T A;  2L5L A;  1JLV A;  4K0G A;  1G7E A;  1XXU A;  4HQS A;  1Z6N A;  4MLY A;  1TRW A;  2HZF A;  1Q4J A;  2H73 A;  5B8A A;  2QKE A;  3LOR A;  2RLI A;  2Z9S A;  4ULX A;  3HCZ A;  3HKR A;  5LD0 A;  3KM6 A;  2O5V A;  4WF5 A;  4O5Q A;  4K2X A;  4QL9 A;  5LNK e;  4BWQ A;  1GSQ A;  2GSS A;  1LU4 A;  2CVD A;  3LSZ A;  5G30 A;  4BA7 A;  3ZIV A;  2CZ2 A;  5CYY A;  5G1L A;  2VL2 C;  2C0G A;  4OMV A;  2H8L A;  1YF0 A;  1X0R A;  1GTI A;  3TKS C;  1T3B A;  2E7P A;  2C0D A;  2YJ7 A;  2GSR A;  1BG1 A;  1PX6 A;  4GSN A;  2GDR A;  2I3Y A;  2JSZ A;  2FCH A;  3QCP A;  5IMD A;  1K3Y A;  1GSF A;  4Q5Q A;  4AJ7 A;  2GT5 A;  5J9B A;  4XS4 B;  1K0A A;  3GUS A;  1Z7R A;  4RI6 A;  1NHO A;  1TDI A;  2ON7 A;  1V2A A;  4BIK A;  4ID0 A;  4KDX A;  4HZ2 A;  2CVB A;  3MYD A;  3F8U A;  4F03 A;  4TOP A;  1J08 A;  2R0G A;  4G0L A;  1VF4 A;  5JCG A;  3Q18 A;  5LCZ A;  1EOG A;  1VF1 A;  2WVZ A;  4WBJ A;  2YWM A;  3FHK A;  4G01 A;  1SK0 A;  2H1G A;  2EFC A;  2H74 A;  3C1R A;  1WPI A;  1YKA A;  5L71 A;  4IJ3 A;  2VOC A;  3UVT A;  2GTU A;  2B1L A;  1ACV A;  1PGT A;  5F05 A;  3A2V A;  3EMX A;  2V32 A;  3D4M A;  4JR4 A;  1K0B A;  1NSW A;  2OA7 A;  4QMK A;  2FY6 A;  3CTF A;  3H93 A;  3CSI A;  2M72 A;  3IE3 A;  1R5A A;  5D73 A;  2H01 A;  4ML6 A;  3CHX C;  1T4Z A;  2IMF A;  2LJR A;  4E8H A;  1SKS B;  1TI1 A;  1FVJ A;  1JZO A;  2IJY A;  3F4R A;  1DUG A;  2HXK A;  2GQL A;  2FNO A;  2HI7 A;  1TP9 A;  3F6F A;  5KOW A;  5DJL A;  2FGX A;  4EIQ A;  1XW6 A;  3IDV A;  4ECI A;  3L9U A;  5ABR A;  3QMX A;  4MH2 A;  2PMT A;  3VK9 A;  2H6X A;  2WW2 A;  1A2L A;  2JU5 A;  2GST A;  3WGE A;  2V1M A;  2D2Z A;  5AGY A;  4KND A;  2H66 A;  1B4Q A;  4WEY A;  4XS4 A;  2M80 A;  1OE7 A;  1KBN A;  1T8E B;  3TRX A;  5E59 A;  1B48 A;  3HVX A;  1A0F A;  1S4B P;  2LJK A;  2EC4 A;  4G0I A;  4HEA 2;  2RM6 A;  1SK2 A;  3E0U A;  3FZ5 A;  4RUV A;  3VWU A;  4YAV A;  3FY7 A;  1F2E A;  2K8S A;  4HS1 A;  5EL8 A;  1S3A A;  3O6T A;  2K9F A;  5IO2 A;  4TR3 A;  2PBJ A;  2LTK A;  3VI5 A;  2VIM A;  1UVZ A;  3Q6O A;  3S9F A;  3F4S A;  4Q5N A;  3HZ8 A;  1A24 A;  2P0G A;  1WP0 A;  3C73 A;  2OAC A;  3DWV A;  2OE1 A;  3R2Q A;  4BL7 B;  5J4U A;  1S3R A;  3IV4 A;  4PNG A;  1XCC A;  5B6M A;  5HFK A;  3QR6 A;  1T4Y A;  1PN9 A;  3WD6 A;  3O3T A;  1E2Y A;  2N5B A;  1H75 A;  1ZGN A;  5CAX A;  1SKW B;  3G7Y A;  3UBK A;  1JZD A;  2OE0 A;  12GS A;  4KSM A;  4EXJ A;  2X99 A;  3WGD A;  5ELG A;  4XCS A;  3GFK A;  4KA0 A;  2MBS A;  2TRX A;  4RI7 A;  2EIO A;  4FQU A;  1BQ7 A;  7GSS A;  4O92 A;  2QC7 A;  4HZ4 A;  1XIY A;  3ZIT A;  4CDO A;  2VL2 A;  2H70 A;  4GDF A;  1ERW A;  4IHU A;  3GRX A;  2FLS A;  4N0V A;  4IN0 A;  3JCM L;  6GSY A;  4MH3 A;  2MMZ A;  2R37 A;  1BG5 A;  1PD2 1;  1DSB A;  2C3N A;  4TR0 A;  2C80 A;  5J4V A;  5D93 A;  3FZA A;  2YWN A;  5IO0 A;  2DJK A;  2GZY A;  1GSS A;  4W66 A;  3TU3 B;  5DAL B;  3A3T A;  5CRG A;  3QFA C;  1TTZ A;  22GS A;  2A2S A;  1AAZ A;  5B7C A;  3FEU A;  1THX A;  1R4W A;  3Q19 A;  1FAA A;  4IJI A;  2HSY A;  3I6A A;  4KCE A;  2WGR A;  1PRX A;  1GWC A;  4G2E A;  5IIZ A;  2UZ8 A;  2PGT A;  3PPU A;  6GSU A;  4BL7 A;  3MSZ A;  4I8B A;  2OBI A;  1OC8 A;  1TXU A;  2BTO T;  5J40 A;  4EE0 A;  1URM A;  3EIN A;  3LXZ A;  1DE1 A;  3KMN A;  4MMM A;  3TRQ A;  3BCI A;  1PSQ A;  2C3T A;  2B7K A;  5ECH B;  1KNG A;  3CSH A;  3LYK A;  1T00 A;  1UC7 A;  3TKQ A;  2RM5 A;  3ZZX A;  3PGT A;  4K2D A;  1QFN A;  2WDU A;  4EDZ A;  2DIZ A;  4KH7 A;  1E6B A;  4HJ2 A;  2MMN A;  3LFL A;  3H1N A;  1ERU A;  5A4W A;  5KOX A;  1QUW A;  5EPF A;  3AY8 A;  5D9W A;  1G6Y A;  5IMV A;  4OCF A;  1O81 A;  4TRX A;  4H86 A;  3FR6 A;  1W89 A;  3VPQ A;  1SK1 A;  2X8H A;  1EP7 A;  4RQX A;  3M1G A;  5DQS A;  3APQ A;  4OFN A;  1TK0 B;  5FT3 A;  2C1Y A;  3C7M A;  4AKH A;  2PUK C;  2PWJ A;  5J9C A;  1TJD A;  2H71 A;  4OO5 A;  5DAL A;  5B8B A;  4USS A;  3KXO A;  4F82 A;  4GF0 A;  4ZB9 A;  3DGQ A;  2VD0 A;  2B1K A;  1K0D A;  2H1B A;  2JZS A;  4TXO B;  4I5Q A;  1V58 A;  4ISD A;  1U3I A;  13GS A;  3UJ1 A;  3NOF A;  3TUE A;  2ZUP A;  2K6V A;  1XG8 A;  2HRK A;  1YY7 A;  2V6K A;  4PX1 A;  1W4V A;  5DAK B;  4TR4 A;  2DC5 A;  2MZC A;  4XIH A;  1MD4 A;  2CAI A;  3NIV A;  1GSE A;  4HOJ A;  2WJU A;  2IL3 A;  2F8F A;  2RUE A;  5AIV A;  2H6Z A;  3IA1 A;  2JZR A;  1DBY A;  4NPB A;  5G31 A;  1M2D A;  4V1A p;  3PR8 A;  3TKR A;  1PMT A;  2YPM A;  2FWE A;  4TN8 A;  5HR3 A;  2VL3 A;  3GSS A;  1FOH A;  2VUP A;  4ZL7 A;  4K1F A;  2ALB A;  3FW2 A;  2FHE A;  3RHC A;  1M3I A;  3BCK A;  5A4V A;  1O73 A;  2K18 A;  3KD0 A;  2LJA A;  3HVV A;  1USB A;  2HFD A;  2R4V A;  4YKF A;  2TRC P;  3TOU A;  3FRC A;  3M9J A;  3APS A;  2EFH A;  2YOI A;  1G7O A;  3GIX A;  1SU9 A;  4IVF A;  5A1N B;  3GST A;  3GTU B;  1B4P A;  3D21 A;  4NMU A;  4GLT A;  3P90 A;  2L4C A;  2OT3 A;  1Z6M A;  1EP8 A;  2IFQ B;  5A34 B;  4X4J A;  4DVC A;  3H8Q A;  4DSR A;  2IN3 A;  4TW5 A;  4JBB A;  2GSQ A;  4DEJ A;  2AYT A;  5H5R A;  1A0R P;  1T1V A;  2I81 A;  3EU4 A;  2ES7 A;  3ZFL A;  2N5A A;  3GL3 A;  5GAP D;  3UEM A;  1SJ6 A;  4CY6 A;  1YZX A;  1X9M B;  4TXO A;  1GLQ A;  4IP6 A;  1J0F A;  2O3E A;  1ZZY A;  2A4H A;  4O7H A;  3UIW A;  2H0I A;  2RII A;  4Q5F A;  2DJ3 A;  4ECB A;  2F9S A;  1XOB A;  3QDN A;  2BMX A;  3HD5 A;  2VCV A;  3LW9 A;  5DAK A;  2WW0 A;  1HQO A;  2E2M A;  2L59 A;  5BMU B;  1PL1 A;  4XRD A;  5IMF A;  3FZ9 A;  2CQ9 A;  3GKX A;  1WWJ A;  2WZS A;  2IME A;  4NHW A;  4I6X A;  3FKF A;  2X8C A;  1QMV A;  2JZT A;  2WZ9 A;  4HI7 A;  4IBP A;  2VAF A;  1OC3 A;  4OFM A;  2GQK A;  1SD8 A;  5ECM B;  1SJI A;  2V6O A;  1U6T A;  1Z9H A;  2GVP A;  1FVK A;  3CBU A;  1WE0 A;  4ZB6 A;  5J5N A;  3P8W A;  3CMI A;  4DSQ A;  4K6X A;  1GSD A;  4GST A;  5JWO B;  1YEP A;  1R26 A;  1PKW A;  3TJB A;  5ECO B;  1TI3 A;  3BD2 A;  3QAW A;  1MTC A;  1Z7P A;  2N5F A;  1MD3 A;  5DBQ A;  5A1N A;  3GTU A;  3N9J A;  3GHA A;  4E68 A;  4Q5R A;  2IFQ A;  4G0K A;  3V1W A;  5A34 A;  3K8N A;  3RBT A;  3MIX A;  5ID2 B;  20GS A;  3U5R E;  1QGV A;  4WET A;  3ZIJ A; 
#chains in the Genus database with same CATH homology
 2PPT A;  3IK9 A;  3GH9 A;  2EFD A;  3VUR A;  2B5Y A;  1Y1U A;  1F3A A;  1GTU A;  1YEX A;  5ECP B;  3WT1 A;  4EDY A;  3D0Z A;  1GNW A;  2L4Q A;  2OBK A;  3W6G A;  4HDE A;  1K0C A;  2H0H A;  2YP6 A;  1GL8 A;  2XHF A;  4AGS A;  5EY6 A;  3CXG A;  3IOS A;  4LA1 A;  5DJM A;  3A2X A;  2FWH A;  2WFC A;  3EVI A;  5BMU A;  2QA2 A;  2J9H A;  4PUF C;  4POK A;  5ECR B;  4X43 A;  4K9Z A;  4DSS B;  4PNF A;  1CQH A;  3GNJ A;  4MNN A;  3ERF A;  2HYX A;  2NVL A;  2HT9 A;  1F3B A;  4MK3 A;  1X5D A;  5HR0 A;  1YQ1 A;  3RPN A;  1U87 A;  3FR9 A;  1YKC A;  1O85 A;  1OYJ A;  3IBH A;  2AV4 A;  3BOA A;  4KF9 A;  1SVL A;  2VLV A;  1TW9 A;  3LWA A;  2OAD A;  4PUA A;  1QXH A;  1M9A A;  1V9W A;  1OVN A;  4V2N A;  5A5H B;  1JZW A;  1XWC A;  4YQU A;  4XS6 A;  1VF3 A;  1XVQ A;  5BRT A;  4EIP A;  1SL2 B;  18GS A;  2DIY A;  3QAG A;  2FUG 2;  2ZCT A;  3EYT A;  1ZYN A;  4AJ8 A;  4FYB A;  5C00 A;  3TGZ A;  4F0B A;  2A2R A;  3CWG A;  1XW9 A;  4LL1 B;  2A2P A;  5ID2 A;  2LRT A;  2VCW A;  2LNS A;  1R7H A;  6GSS A;  1YVL A;  4EF0 A;  1ABA A;  1S3C A;  1OKT A;  4FYU A;  3WT2 A;  4N30 A;  5J41 A;  2K8V A;  2KOK A;  1BX9 A;  3W8S A;  3IHG A;  17GS A;  3C71 A;  1MDK A;  4ACS A;  3OR5 A;  2PU9 C;  1FB6 A;  2LEG A;  4MF7 A;  1IYI A;  4N0Z A;  3TJJ A;  4Z2R A;  4JRR A;  4CW9 A;  2EIR A;  1PL2 A;  5DCH A;  4XHM A;  4K0N A;  3QPM A;  5JWR B;  3CSJ A;  5KEJ A;  1ERV A;  4YQV A;  2I1U A;  1R5P A;  4F0C A;  2HRF A;  2LV3 A;  4AF2 A;  4DSS A;  1MDI A;  3LEF A;  3KTL A;  3EC3 A;  4N11 A;  1THO A;  5KN3 A;  1ZL9 A;  5FWG A;  4MZW A;  1HNC A;  3D6I A;  4YAP A;  3HYP A;  6GST A;  1OC9 B;  5H5S A;  2VKZ G;  3CTG A;  4WF4 A;  3UBL A;  2HZE B;  1ERT A;  3D4T A;  2H76 A;  5IMA A;  1GH2 A;  3KH7 A;  3UMA A;  2DJJ A;  3GYK A;  1EEJ A;  3F3Q A;  2FWF A;  1UA5 A;  1TK5 B;  2JL4 A;  1XVW A;  3C8E A;  3HHV A;  5A5H A;  5HFI A;  2QA1 A;  1OE8 A;  1XW5 A;  4IEL A;  4G9H A;  1PA3 A;  3HZ4 A;  4FH8 A;  4Z2U A;  1ILO A;  1JHB A;  2NTO A;  2VCT A;  1G6W A;  4ZL8 A;  4F2I A;  4GTU A;  3DRN A;  2YV7 A;  1FW1 A;  4JED A;  2VLU A;  4CY8 A;  1N2A A;  4KX4 A;  3CYN A;  1GUH A;  5HQP A;  3KZQ A;  1GUM A;  1K3L A;  16GS A;  2WS2 A;  4HUA A;  3EE2 A;  1K0M A;  2GQM A;  3VI7 A;  4MP4 A;  1QK8 A;  1GRX A;  1ZCP A;  2WUL A;  2HRK B;  4V2M A;  5D9V A;  2JSY A;  2WCI A;  1H4O A;  1WRY A;  5IOW A;  3TJK A;  2WB9 A;  3VLN A;  3VWV A;  4J57 E;  3D5J A;  4MA9 A;  2CAQ A;  2OE3 A;  2VLT A;  2VCX A;  3L9S A;  1PX7 A;  2AHE A;  1B9Y C;  3TB2 A;  3UOM A;  2LKU A;  1V98 A;  3ZVJ D;  1F9M A;  3IK7 A;  1OC9 A;  2XPE A;  2FA8 A;  4ZIJ A;  4MZC A;  1MEK A;  3ZVJ A;  2HZE A;  2NDO A;  3RHB A;  1VGL A;  2VCZ A;  2VM2 A;  3FR3 A;  4NV5 A;  5ECI B;  4EL1 A;  4OCE A;  2VL9 A;  1C72 A;  1K0O A;  5IPH A;  3GKK A;  1M9B A;  2C3Q A;  2G2Q A;  4LLR A;  2YCD A;  3DYR A;  2YWO A;  1AUC A;  4IKH A;  2MMO A;  4FO5 A;  3TKS E;  4NWY A;  3A2W A;  5CRD A;  2P5Q A;  5E4W A;  4I97 A;  1NM3 A;  2LRN A;  3IRA A;  2HLS A;  4GXZ A;  3US3 A;  2L6C A;  2KLX A;  3ZRD A;  3A5I A;  2X64 A;  1YDK A;  2I4A A;  3CRT A;  1NHY A;  2YZH A;  2H72 A;  1SVO A;  3KP9 A;  3ZML A;  1O8X A;  3GUR A;  3W8J A;  3DXB A;  4EO3 A;  1WMJ A;  2REM A;  5A4U A;  5CNW A;  3D22 A;  3MWH A;  4L5O A;  1JFU A;  3QD9 A;  2GZZ A;  4V2L A;  4ML1 A;  2YWI A;  3LXT A;  3F3R A;  3QOU A;  3KMO A;  2C0F A;  3O76 A;  4IW9 A;  1LBK A;  1TKD B;  5CRE A;  3TKP A;  2XBI A;  2LQO A;  3SWL A;  1TRV A;  2DSA A;  1YF1 A;  3P2A A;  11GS A;  1HYU A;  4YKG A;  1K0N A;  4OWY A;  2PVO C;  4J56 E;  3DIE A;  4HU7 A;  5G2Z A;  3ZFB A;  3CRU A;  4MJE A;  1I9D A;  3IHQ A;  1GSY A;  1SYR A;  3F9U A;  5EVO A;  1OAZ A;  3I9V 2;  2GS3 A;  1GP1 A;  2AB6 A;  4KE3 A;  4MJB A;  4D73 B;  4KCA A;  2H1L A;  5ECS A;  5ELA A;  2P31 A;  4ILF A;  2XBQ A;  2A4V A;  3GN3 A;  2QSI A;  4MF5 A;  4YH2 A;  2CT6 A;  1AXD A;  5B6N A;  3F63 A;  5ENU A;  4F9Z A;  3GX0 A;  1FB0 A;  1ML6 A;  4RQR A;  2FD3 A;  4AI6 A;  3MAK A;  2R5G A;  1SD9 A;  2C4J A;  4AJ6 A;  6GSX A;  4GWR A;  1EV9 A;  4KW6 A;  2V2G A;  2O89 A;  3KCM A;  1XWA A;  1VF2 A;  5ECN B;  5D96 A;  3J7Y k;  1Z5Y E;  2XPD A;  5G1K A;  5G5E A;  4N3Z A;  1QQ2 A;  1ZYE A;  3BBY A;  3KP8 A;  4WBR D;  6GSW A;  2QGV A;  3G7J A;  3FYG A;  4WR4 A;  4O32 A;  3ZRE A;  4K8M A;  1J9B A;  2GT6 A;  2WRT A;  4POL A;  3GH6 A;  2MMA A;  3HY2 A;  4TXV A;  5JWQ B;  1X9S B;  1FG4 A;  1UN2 A;  3TOT A;  3UVH A;  3J7Y b;  4MPF A;  1AW9 A;  2DBC A;  5DVB A;  2LQQ A;  3TCO A;  2AJQ B;  4J2F A;  4GRF A;  1U88 A;  10GS A;  1ST9 A;  5IMZ A;  1V40 A;  4ZIL A;  2HSN A;  1TU8 A;  4BVX B;  4BVY A;  4OO4 A;  2BJX A;  1ZOF A;  3UAR A;  2LST A;  5INY A;  4KDY A;  5F8B A;  3VWW A;  2FA4 A;  1IYH A;  3ZL5 A;  3EWL A;  3L4N A;  4D73 A;  4QQ7 A;  5D9X A;  2YAN A;  2G0F A;  2GZP A;  2YJH A;  1WIK A;  2E0Q A;  1XBS A;  4K7O A;  4Z7X A;  2H19 A;  3F4T A;  3FMW A;  1FHE A;  2FWG A;  1O7U A;  2L57 A;  1XFL A;  1GLP A;  5AIX A;  2M46 A;  19GS A;  3GV1 A;  5KN2 A;  2PN8 A;  3IXR A;  3MDK A;  1XWK A;  4EUY A;  4Z2T A;  2DLX A;  1PN0 A;  3IR4 A;  1O6J A;  4ICY A;  5DDL A;  3A5W A;  3I43 A;  1CQG A;  3WYW A;  4GQC A;  3GKM A;  4K7I A;  2JAC A;  3ISO A;  2IMI A;  2B3S A;  4AKG A;  1TU7 A;  1AC1 A;  3HXS A;  5F07 A;  2HRA A;  1RK4 A;  4TVE A;  3ZMK A;  4L5L A;  3KTB A;  4PXO A;  4OD7 A;  4MZB A;  2VCQ A;  1B9X C;  3E3E A;  1DE2 A;  4X1U A;  1XPV A;  3PH9 A;  4JE1 A;  2HQT A;  2H1D A;  4XS1 A;  1I5G A;  3TJF A;  3TDG A;  4X0X A;  3ERW A;  1LJR A;  1GTA A;  3LGC A;  4MAB A;  2VD1 A;  4N10 A;  1O8W A;  5CP1 A;  2H1A A;  4IS0 A;  5CRW A;  9GSS A;  4BVX A;  4ECC A;  4PUR A;  5IOX A;  4XRA A;  1HNA A;  1GUL A;  2TIR A;  3ME8 A;  1HNB A;  2LRC A;  5AIS A;  1Z3E A;  3FK8 A;  3FZ4 A;  3ED3 A;  1N25 A;  3VPT A;  4V1A g;  2E2G A;  1V57 A;  3ZYW A;  2B5E A;  4OFT A;  2B6M A;  4GQF A;  3EUR A;  2VO4 A;  4ZB8 A;  2R0C A;  5F06 A;  4HJM A;  1AQW A;  14GS A;  3HJO A;  4PQ1 A;  3UAP A;  3BJ5 A;  5COH A;  3M3M A;  1M2A A;  2NBS A;  1M0U A;  4ZBD A;  2V41 A;  4PGT A;  4L8E A;  2IMK A;  4EC0 A;  3IC4 A;  4KSO A;  1A2M A;  2KHP A;  2OJL A;  2DMM A;  4NHZ A;  4ECJ A;  5H5Q A;  4G10 A;  2O87 A;  2CZ3 A;  1F6M C;  2KUC A;  2JAD A;  1A8Y A;  1BED A;  5HFG A;  3ZLP A;  2H75 A;  2LNT A;  5DQY A;  4K5R A;  5IQY A;  4IGJ A;  2IIY A;  3ME7 A;  3DML A;  2J23 A;  1EZK A;  1PKZ A;  2HSM B;  4HU9 A;  3M0F A;  1NW2 A;  1Q98 A;  1X5E A;  1GNE A;  1ON4 A;  3SBC A;  4MCU A;  2AAW A;  3PIN A;  5ECQ B;  2KP1 A;  1A23 A;  3DKS A;  4TR1 B;  1B8X A;  4LMW A;  1SL1 B;  4JU5 A;  2EFE A;  4HQZ A;  5CO3 A;  2GLR A;  4WKW A;  5GST A;  2HSH A;  3TJG A;  4QL7 A;  2IMD A;  1VRS D;  5A5K A;  2CX3 A;  5J3R A;  2F51 A;  1EGR A;  1ZYP A;  1JZR A;  4AKI A;  1RW1 A;  5IPG A;  3HJP A;  2X4A A;  1SJZ A;  2O7K A;  4GCI A;  3WGX A;  1TRS A;  5F0G A;  1F37 A;  2VM1 A;  4IQA A;  1OKD A;  4E8E A;  2F8A A;  2O85 A;  3I69 A;  4POB A;  3C1S A;  1YJ6 A;  2X8G A;  3P7X A;  2O8V B;  4KGI A;  3G7I A;  3R3E A;  3DVX A;  1HD2 A;  3UL3 A;  1SEN A;  5G5F A;  1BYE A;  3H4K A;  5J47 A;  1T7P B;  1EOH A;  3L0H A;  5KN1 A;  4NV2 A;  2I9H A;  3F6D A;  2DKI A;  2H0G A;  2H6Y A;  5DCG A;  3QAV A;  1S3D A;  2KP2 A;  2R6K A;  1RQM A;  3Q74 A;  4P3Y B;  5J4Y A;  3TKS A;  4JR6 A;  4LL4 B;  4XTS A;  5IMC A;  3RDW A;  3GL5 A;  5GAN D;  3LYP A;  1EEM A;  2B5X A;  3HMJ G;  3VWX A;  2HSM A;  3DD3 A;  2L6D A;  2YN1 A;  3KEB A;  1MDJ A;  2H30 A;  3EU3 A;  4PQH A;  3KIJ A;  4L0W A;  5ECK B;  1BF5 A;  2DJ0 A;  3GMF A;  4KB3 A;  1TK8 B;  3DVW A;  3VFI A;  2IPA A;  3M9K A;  4G19 A;  2R0P A;  2F3M A;  3IPZ A;  1U3A A;  4TR1 A;  2EIQ A;  2X49 A;  1A2J A;  2RUF A;  3MNG A;  1N8J A;  1A8L A;  1SL0 B;  4GSS A;  4JZQ A;  4IQ1 A;  2B7J A;  5AN1 A;  1XZO A;  2UV8 G;  1KTE A;  1TXX A;  4MF6 A;  4FYC A;  5HR1 A;  1Y6E A;  2ZNM A;  2XC2 A;  3ZTL A;  5FHI A;  5HR2 A;  3LG6 A;  4ZBA A;  2NPB A;  4A5P A;  4NXI A;  3TRP A;  2L5O A;  3N5O A;  1M7T A;  4ZXG A;  1KEB A;  4EKZ A;  3IAM 2;  3L9V A;  4WXT A;  2YV9 A;  2AUV A;  3LJR A;  1EGO A;  3HJM A;  3RAZ A;  4MJA A;  6GSV A;  3M8N A;  3KGK A;  2CX4 A;  1XWB A;  1TOF A;  4O5U A;  4CHS A;  2R3X A;  3EMP A;  3L78 A;  1AQX A;  4KDU A;  3KJY A;  1SKR B;  1K3O A;  4LMV A;  3RPP A;  2GGT A;  2ON5 A;  1G0T A;  3H79 A;  2YNX A;  2DJ2 A;  1X9W B;  2MYG A;  4TKY A;  3ERG A;  4MJC A;  4WR5 A;  4BWS A;  3HDC A;  5JCW A;  1SVM A;  5JCU A;  1PQN A;  4ZBB A;  3KH9 A;  4ZB7 A;  2C0E A;  4KUN A;  3GA4 A;  1X5C A;  4POM A;  1M2B A;  2HSN B;  2YZU A;  2P5R A;  4BVY B;  1FO5 A;  3GKN A;  4L0U A;  4MDC A;  1GSU A;  1WJK A;  5KN0 A;  1WOU A;  1Y25 A;  4YQM A;  2CA8 A;  3HVS A;  5IM9 A;  1FOV A;  2CV4 A;  4EVM A;  1XWG A;  2DML A;  5GZZ B;  1BAY A;  3EPT A;  1ZMA A;  5ECL B;  3APO A;  3E9J B;  2PVQ A;  4O5R A;  4AKX B;  2HE3 A;  4IP1 A;  1XOA A;  3IAS 2;  3DEX A;  3G9B A;  3LQ7 A;  3NZN A;  3IC8 A;  2OKA A;  1M99 A;  5D9T A;  2C8U A;  1AQV A;  5C04 A;  1GTB A;  3HA9 A;  8GSS A;  2PER A;  1EV4 A;  5D8I A;  1AIU A;  5CRH A;  1ZYQ B;  2IWT A;  4BPY A;  1GUK A;  2HNL A;  2DKH A;  2DJ1 A;  2R2J A;  2CVK A;  4I2U A;  3U6V A;  4FIW A;  4NAX A;  3GX8 A;  4K5S A;  4ZL9 A;  4K7N A;  4KAE A;  4PTS A;  3QFB C;  2LS5 A;  2MBT A;  5GSS A;  1JLW A;  1EWX A;  3F0I A;  1TRU A;  2LUS A;  2HRN A;  1SYX A;  4MPG A;  1BJX A;  4PQI A;  4I2T A;  2L5L A;  1JLV A;  4K0G A;  1G7E A;  1XXU A;  4HQS A;  1Z6N A;  4MLY A;  1TRW A;  2HZF A;  1Q4J A;  2H73 A;  5B8A A;  2QKE A;  3LOR A;  2RLI A;  2Z9S A;  4ULX A;  3HCZ A;  3HKR A;  5LD0 A;  3KM6 A;  2O5V A;  4WF5 A;  4O5Q A;  4K2X A;  4QL9 A;  5LNK e;  4BWQ A;  1GSQ A;  2GSS A;  1LU4 A;  2CVD A;  3LSZ A;  5G30 A;  4BA7 A;  3ZIV A;  2CZ2 A;  5CYY A;  5G1L A;  2VL2 C;  2C0G A;  4OMV A;  2H8L A;  1YF0 A;  1X0R A;  1GTI A;  3TKS C;  1T3B A;  2E7P A;  2C0D A;  2YJ7 A;  2GSR A;  1BG1 A;  1PX6 A;  4GSN A;  2GDR A;  2I3Y A;  2JSZ A;  2FCH A;  3QCP A;  5IMD A;  1K3Y A;  1GSF A;  4Q5Q A;  4AJ7 A;  2GT5 A;  5J9B A;  4XS4 B;  1K0A A;  3GUS A;  1Z7R A;  4RI6 A;  1NHO A;  1TDI A;  2ON7 A;  1V2A A;  4ID0 A;  4KDX A;  4HZ2 A;  2CVB A;  3MYD A;  3F8U A;  4F03 A;  4TOP A;  1J08 A;  2R0G A;  4G0L A;  1VF4 A;  5JCG A;  3Q18 A;  5LCZ A;  1EOG A;  1VF1 A;  4WBJ A;  2YWM A;  3FHK A;  4G01 A;  1SK0 A;  2H1G A;  2EFC A;  2H74 A;  3C1R A;  1WPI A;  1YKA A;  5L71 A;  4IJ3 A;  2VOC A;  3UVT A;  2GTU A;  2B1L A;  1ACV A;  1PGT A;  5F05 A;  3A2V A;  3EMX A;  2V32 A;  3D4M A;  4JR4 A;  1K0B A;  1NSW A;  2OA7 A;  4QMK A;  2FY6 A;  3CTF A;  3H93 A;  3CSI A;  2M72 A;  3IE3 A;  1R5A A;  5D73 A;  2H01 A;  4ML6 A;  1T4Z A;  2IMF A;  2LJR A;  4E8H A;  1SKS B;  1TI1 A;  1FVJ A;  1JZO A;  2IJY A;  3F4R A;  1DUG A;  2HXK A;  2GQL A;  2FNO A;  2HI7 A;  1TP9 A;  3F6F A;  5KOW A;  5DJL A;  2FGX A;  4EIQ A;  1XW6 A;  3IDV A;  4ECI A;  3L9U A;  5ABR A;  3QMX A;  4MH2 A;  2PMT A;  3VK9 A;  2H6X A;  1A2L A;  2JU5 A;  2GST A;  3WGE A;  2V1M A;  2D2Z A;  5AGY A;  4KND A;  2H66 A;  1B4Q A;  4WEY A;  4XS4 A;  2M80 A;  1OE7 A;  1KBN A;  1T8E B;  3TRX A;  5E59 A;  1B48 A;  3HVX A;  1A0F A;  2LJK A;  2EC4 A;  4G0I A;  4HEA 2;  2RM6 A;  1SK2 A;  3E0U A;  3FZ5 A;  4RUV A;  3VWU A;  4YAV A;  1F2E A;  3FY7 A;  2K8S A;  4HS1 A;  5EL8 A;  1S3A A;  3O6T A;  2K9F A;  5IO2 A;  4TR3 A;  2PBJ A;  2LTK A;  3VI5 A;  2VIM A;  1UVZ A;  3Q6O A;  3S9F A;  3F4S A;  4Q5N A;  3HZ8 A;  1A24 A;  2P0G A;  1WP0 A;  3C73 A;  2OAC A;  3DWV A;  2OE1 A;  3R2Q A;  4BL7 B;  5J4U A;  3IV4 A;  4PNG A;  1XCC A;  5B6M A;  5HFK A;  3QR6 A;  1T4Y A;  1PN9 A;  3WD6 A;  3O3T A;  1E2Y A;  2N5B A;  1H75 A;  1ZGN A;  5CAX A;  1SKW B;  3G7Y A;  3UBK A;  1JZD A;  2OE0 A;  12GS A;  4KSM A;  4EXJ A;  2X99 A;  3WGD A;  5ELG A;  4XCS A;  3GFK A;  4KA0 A;  2MBS A;  2TRX A;  4RI7 A;  2EIO A;  4FQU A;  1BQ7 A;  7GSS A;  4O92 A;  2QC7 A;  4HZ4 A;  1XIY A;  3ZIT A;  4CDO A;  2VL2 A;  2H70 A;  4GDF A;  1ERW A;  4IHU A;  3GRX A;  2FLS A;  4N0V A;  4IN0 A;  3JCM L;  6GSY A;  4MH3 A;  2MMZ A;  2R37 A;  1BG5 A;  1PD2 1;  1DSB A;  2C3N A;  4TR0 A;  2C80 A;  5J4V A;  5D93 A;  3FZA A;  2YWN A;  5IO0 A;  2DJK A;  2GZY A;  1GSS A;  4W66 A;  3TU3 B;  5DAL B;  3A3T A;  5CRG A;  3QFA C;  1TTZ A;  22GS A;  2A2S A;  1AAZ A;  5B7C A;  3FEU A;  1THX A;  1R4W A;  3Q19 A;  1FAA A;  4IJI A;  2HSY A;  3I6A A;  4KCE A;  2WGR A;  1PRX A;  1GWC A;  4G2E A;  5IIZ A;  2UZ8 A;  2PGT A;  3PPU A;  6GSU A;  4BL7 A;  3MSZ A;  4I8B A;  2OBI A;  1OC8 A;  1TXU A;  2BTO T;  5J40 A;  4EE0 A;  1URM A;  3EIN A;  3LXZ A;  1DE1 A;  3KMN A;  4MMM A;  3TRQ A;  3BCI A;  1PSQ A;  2C3T A;  2B7K A;  5ECH B;  1KNG A;  3CSH A;  3LYK A;  1T00 A;  1UC7 A;  3TKQ A;  2RM5 A;  3ZZX A;  3PGT A;  4K2D A;  1QFN A;  2WDU A;  4EDZ A;  2DIZ A;  4KH7 A;  1E6B A;  4HJ2 A;  2MMN A;  3LFL A;  3H1N A;  1ERU A;  5A4W A;  5KOX A;  1QUW A;  5EPF A;  3AY8 A;  5D9W A;  1G6Y A;  5IMV A;  4OCF A;  1O81 A;  4TRX A;  4H86 A;  3FR6 A;  1W89 A;  3VPQ A;  1SK1 A;  2X8H A;  1EP7 A;  4RQX A;  3M1G A;  5DQS A;  3APQ A;  4OFN A;  1TK0 B;  5FT3 A;  2C1Y A;  3C7M A;  4AKH A;  2PUK C;  2PWJ A;  5J9C A;  1TJD A;  2H71 A;  4OO5 A;  5DAL A;  5B8B A;  4USS A;  3KXO A;  4F82 A;  4GF0 A;  4ZB9 A;  3DGQ A;  2VD0 A;  2B1K A;  1K0D A;  2H1B A;  2JZS A;  4TXO B;  4I5Q A;  1V58 A;  4ISD A;  1U3I A;  13GS A;  3UJ1 A;  3NOF A;  3TUE A;  2ZUP A;  2K6V A;  2HRK A;  1YY7 A;  2V6K A;  4PX1 A;  1W4V A;  5DAK B;  4TR4 A;  2DC5 A;  2MZC A;  4XIH A;  1MD4 A;  2CAI A;  3NIV A;  1GSE A;  4HOJ A;  2WJU A;  2IL3 A;  2F8F A;  2RUE A;  5AIV A;  2H6Z A;  3IA1 A;  2JZR A;  1DBY A;  4NPB A;  5G31 A;  1M2D A;  4V1A p;  3PR8 A;  3TKR A;  1PMT A;  2YPM A;  2FWE A;  4TN8 A;  5HR3 A;  2VL3 A;  3GSS A;  1FOH A;  2VUP A;  4ZL7 A;  4K1F A;  2ALB A;  3FW2 A;  2FHE A;  3RHC A;  3BCK A;  5A4V A;  1O73 A;  2K18 A;  3KD0 A;  2LJA A;  3HVV A;  1USB A;  2HFD A;  2R4V A;  4YKF A;  2TRC P;  3TOU A;  3FRC A;  3M9J A;  3APS A;  2EFH A;  2YOI A;  1G7O A;  3GIX A;  1SU9 A;  4IVF A;  5A1N B;  3GST A;  3GTU B;  1B4P A;  3D21 A;  4NMU A;  4GLT A;  3P90 A;  2L4C A;  2OT3 A;  1Z6M A;  1EP8 A;  2IFQ B;  5A34 B;  4X4J A;  4DVC A;  3H8Q A;  4DSR A;  2IN3 A;  4TW5 A;  4JBB A;  2GSQ A;  4DEJ A;  2AYT A;  5H5R A;  1A0R P;  1T1V A;  2I81 A;  3EU4 A;  2ES7 A;  3ZFL A;  2N5A A;  3GL3 A;  5GAP D;  3UEM A;  1SJ6 A;  4CY6 A;  1YZX A;  1X9M B;  4TXO A;  1GLQ A;  4IP6 A;  1J0F A;  1ZZY A;  2A4H A;  4O7H A;  3UIW A;  2H0I A;  2RII A;  4Q5F A;  2DJ3 A;  4ECB A;  2F9S A;  1XOB A;  3QDN A;  3LW9 A;  2BMX A;  2VCV A;  3HD5 A;  5DAK A;  1HQO A;  2E2M A;  2L59 A;  5BMU B;  1PL1 A;  4XRD A;  5IMF A;  3FZ9 A;  2CQ9 A;  3GKX A;  1WWJ A;  2IME A;  4NHW A;  4I6X A;  3FKF A;  2X8C A;  1QMV A;  2JZT A;  2WZ9 A;  4HI7 A;  4IBP A;  2VAF A;  1OC3 A;  4OFM A;  2GQK A;  1SD8 A;  5ECM B;  1SJI A;  2V6O A;  1U6T A;  1Z9H A;  2GVP A;  1FVK A;  3CBU A;  1WE0 A;  4ZB6 A;  5J5N A;  3P8W A;  3CMI A;  4DSQ A;  4K6X A;  1GSD A;  4GST A;  5JWO B;  1YEP A;  1R26 A;  1PKW A;  3TJB A;  5ECO B;  1TI3 A;  3BD2 A;  3QAW A;  1MTC A;  1Z7P A;  2N5F A;  1MD3 A;  5DBQ A;  5A1N A;  3GTU A;  3N9J A;  3GHA A;  4E68 A;  4Q5R A;  2IFQ A;  4G0K A;  3V1W A;  5A34 A;  3K8N A;  3RBT A;  3MIX A;  5ID2 B;  20GS A;  3U5R E;  1QGV A;  4WET A;  3ZIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...