1LBKA

Crystal structure of a recombinant glutathione transferase, created by replacing the last seven residues of each subunit of the human class pi isoenzyme with the additional c-terminal helix of human class alpha isoenzyme
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
208
structure length
208
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPMDEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase class pi chimaera (CODA)
publication title Engineering a new C-terminal tail in the H-site of human glutathione transferase P1-1: structural and functional consequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1lbkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1lbkA01
4N10A 2L6CA 4K0GA 3LJRA 2J9HA 3A2XA 2NTOA 1OC3A 2FWHA 1MDKA 5AIVA 2B3SA 5B6NA 5E59A 4I97A 3UMAA 2ALBA 1EP8A 2NVLA 8GSSA 1NW2A 3G7JA 4IN0A 5ELAA 3EE2A 2YWIA 1EGRA 3HJOA 1TRVA 5AISA 4ECIA 4ECBA 3HJPA 6GSVA 1PN9A 1PD21 4IS0A 4XRDA 3GMFA 4L5OA 3FHKA 2PU9C 3BCKA 4KDUA 2H70A 1EOGA 4IELA 1Q98A 2PUKC 3D4TA 5HR1A 3I43A 1U87A 2B5XA 2PVOC 3FK8A 4BA7A 5DAKB 3H4KA 2RUEA 1XWCA 1SK2A 4RI6A 4V1Ap 2GS3A 2HSMB 3TCOA 3DYRA 2EC4A 3H1NA 3ZFBA 1VF4A 2HXKA 3C71A 3CXGA 3EINA 1Z7RA 2H1GA 3VI7A 1FVJA 3D0ZA 3HVVA 1UN2A 4MZWA 2OADA 1M0UA 2VCQA 4ZB6A 2M80A 5IMCA 1XW5A 3GKNA 6GSXA 2H1AA 1XOBA 4XIHA 4HI7A 1TP9A 4I5QA 1F3AA 3QFAC 2R2JA 2PMTA 3VK9A 3J7Yb 4EF0A 5IIZA 3ZMLA 2VL3A 2M46A 1TK0B 2BJXA 1BQ7A 1M2DA 2AV4A 1JZRA 4ID0A 4IBPA 1WMJA 1B48A 1SL1B 3IXRA 4HU9A 1O7UA 3ZMKA 2PWJA 2DIYA 2YJHA 1GRXA 9GSSA 4GF0A 5B8AA 1V58A 2H0GA 4HZ4A 3QPMA 3QD9A 5ECIB 4TXOA 2MBSA 4TR1A 1U3AA 3GNJA 5FHIA 1BX9A 1SYXA 4RQRA 1TRWA 1ERTA 3RHCA 2H01A 3P2AA 3RDWA 5ABRA 3EYTA 2DJ2A 4AJ7A 1R7HA 3GKXA 4OFNA 4P3YB 1MEKA 4PUAA 1TI1A 1DUGA 4WF5A 2DC5A 1ZOFA 3CRUA 2LQQA 3MSZA 5EVOA 4GSSA 4MJEA 4J2FA 5ENUA 4ECJA 3F4TA 11GSA 3BBYA 2LNTA 1SJIA 1AQVA 5IMDA 3M8NA 5G2ZA 2EIOA 2HQTA 3APOA 4L5LA 4K8MA 4PXOA 1SU9A 1RK4A 1XW6A 20GSA 1EWXA 4N11A 3GSSA 1EGOA 5HFKA 1VF2A 2JL4A 3L0HA 3HDCA 1AQXA 1EV4A 2WJUA 5IMVA 1A2MA 22GSA 1M2BA 2XBQA 4MMMA 4HZ2A 6GSSA 1ERUA 4I8BA 2H0IA 3IPZA 5B7CA 3VWUA 1K0CA 1GSYA 4MJAA 4FYBA 5E4WA 2G0FA 4KB3A 1V9WA 2RM6A 2KP1A 1AUCA 1U3IA 3LORA 1XBSA 4JU5A 2EIQA 1Z3EA 1FAAA 3NZNA 1TKDB 3CTGA 4ZXGA 3TOUA 4MDCA 1EV9A 1X9MB 2A2RA 1QGVA 4V1Ag 2X64A 2M72A 3UBKA 4Q5RA 3M9JA 3HXSA 1SK0A 2CAIA 2OBIA 3DXBA 2H6YA 3G7YA 5KN3A 1SK1A 2YWOA 2CX3A 1V2AA 1TK8B 4POKA 1LJRA 2HSNB 2RIIA 5J4UA 1K0BA 2C3TA 7GSSA 2CVDA 1HNAA 4HJ2A 5DQSA 5A4UA 4F03A 1SJZA 3KIJA 3EC3A 1F6MC 3A2WA 2DSAA 2YZUA 5IMFA 5AN1A 5KN2A 3E9JB 5C00A 2KHPA 2H1DA 6GSWA 2HSYA 4AF2A 2D2ZA 2N5BA 1E6BA 3MDKA 2L4CA 3L9UA 5AIXA 1A8LA 1QQ2A 2C0DA 3A3TA 4ML1A 4MH3A 4X43A 1UA5A 1EP7A 3GH6A 3D5JA 5G31A 4V2MA 5CREA 3GA4A 2C4JA 3DWVA 14GSA 1XWBA 3WD6A 4NHZA 2IMDA 1PSQA 3LYKA 2F51A 1BAYA 4POMA 3K8NA 2RLIA 4IW9A 4HQZA 2IPAA 4USSA 3MWHA 4J56E 3M0FA 2P31A 3CMIA 1AXDA 4F0CA 1SJ6A 1H75A 2N5FA 1OE7A 3KP9A 3E3EA 1DE2A 3DRNA 2LS5A 1PRXA 4KE3A 2XPEA 2B6MA 4JR6A 2L5LA 4TXOB 1GSSA 2VCVA 4TR1B 2GVPA 1G0TA 2CVKA 5IO2A 3VI5A 3U6VA 2O85A 3EWLA 4MF7A 2R6KA 1AQWA 5H5SA 2GQLA 4EVMA 1J0FA 3VPTA 4ACSA 4OFTA 1FB0A 2HSMA 4NV2A 1T00A 4ZBBA 1FOVA 3TRQA 5J3RA 3CRTA 5DDLA 3E0UA 5ELGA 1AAZA 1JLVA 1TDIA 2HRAA 3FR3A 2QKEA 2LV3A 3HJMA 1GNWA 1ST9A 1A0FA 2JZTA 2QGVA 2FNOA 2VAFA 2WZ9A 3QR6A 1U88A 4EL1A 2FWGA 4DSRA 3IRAA 4Q5FA 2K9FA 5BMUA 4KX4A 4MK3A 5L71A 2E0QA 2VL2C 4KCAA 3TKSC 3GYKA 4KH7A 3ZITA 4EKZA 1T3BA 2HRKA 2YWMA 1GP1A 2MMOA 3CTFA 1X9WB 1FB6A 1JZWA 3WYWA 2MMAA 5IPGA 2IL3A 4FYUA 3KMOA 4XS1A 4KCEA 3RAZA 2JSYA 3H79A 2GTUA 5D9XA 2IFQA 1MTCA 2P5QA 1X5DA 1A24A 3F6DA 1ILOA 4ML6A 2WDUA 1XVQA 3IK9A 2O87A 2H8LA 4BL7A 4IP1A 2YV9A 2H0HA 4PX1A 2I1UA 4F9ZA 4DSSB 4GQCA 1O8XA 3HVSA 2HFDA 4MPGA 5D9VA 3PH9A 5H5RA 3M9KA 1KBNA 2VCZA 1HYUA 2HZFA 4ILFA 3A5WA 2K8VA 5DQYA 3EMXA 2CA8A 1JZOA 5ECRB 2YZHA 2YPMA 4KF9A 2K6VA 4LL4B 1YJ6A 4NXIA 3KEBA 1A0RP 1Z7PA 2AHEA 2XBIA 2N5AA 4GQFA 3H93A 1OC9A 3ZL5A 3ZIJA 3C1SA 5DCGA 1K0NA 3QOUA 5J5NA 3UJ1A 2H66A 1SYRA 2IMKA 3EMPA 3UVHA 3V1WA 1J08A 2B7JA 1E2YA 2B5EA 3VWWA 5KN0A 4PQHA 1GSUA 2LJKA 3TJGA 3P90A 5A4VA 2MYGA 4HU7A 4ZILA 3F6FA 1TXXA 4GSNA 4NAXA 1X0RA 4EDZA 2PVQA 3KD0A 3G9BA 3IC8A 1GL8A 4NV5A 4TR3A 5D93A 1GUKA 2KP2A 5IO0A 5ECKB 4OFMA 2DMLA 3VPQA 3KGKA 2DLXA 5CP1A 5ECMB 4XRAA 3F8UA 4WETA 2LKUA 4FYCA 3A2VA 1Z6MA 5J9BA 4YQMA 3GL5A 2OJLA 5F8BA 4AGSA 3VWXA 4X0XA 3TRPA 1TJDA 4IP6A 3GTUB 2R37A 5ID2B 5ECOB 1K0AA 1PQNA 4LMWA 4PQ1A 2PN8A 1I9DA 2MMZA 3C7MA 1TU7A 2JZSA 4K1FA 4Q5QA 4POLA 3PGTA 2WRTA 3KM6A 1S3CA 4GWRA 1YY7A 4HDEA 4PQIA 3UARA 5D73A 4K7OA 2X8HA 2RUFA 2H72A 6GSTA 1SD8A 1M9BA 1USBA 5D9WA 1TW9A 2HRKB 1VF3A 6GSYA 1O8WA 2H76A 2MBTA 4V2NA 3IR4A 1ML6A 3FYGA 4MABA 2P0GA 1K3OA 2IMIA 3TDGA 2I3YA 2B1LA 1SKRB 1OYJA 3C8EA 2C0EA 5AGYA 4G10A 1HNCA 4HUAA 1GNEA 1B9XC 2IFQB 2GT5A 3C73A 4IJIA 4KAEA 3TUEA 3DMLA 3KH9A 4MPFA 5ECPB 5IOWA 4CW9A 3IBHA 1XPVA 1XFLA 5IPHA 4BL7B 2E2GA 5CRWA 4MF5A 4KDXA 3GX8A 4EUYA 3CSHA 4Z7XA 1R4WA 2JSZA 1FO5A 2QSIA 2UZ8A 4WF4A 2FWFA 1OKDA 2YN1A 5JCGA 1NHYA 1OVNA 2IMEA 3LWAA 4XTSA 2I81A 1A2JA 3KH7A 1MDJA 2HZEA 3HA9A 1YEPA 4OO5A 5JCWA 4G0LA 5H5QA 5DVBA 3TJKA 4G9HA 2V6KA 1R26A 1OC9B 2CAQA 3S9FA 3UOMA 2LNSA 5FWGA 5GAND 2F8FA 4F82A 1CQGA 4X1UA 4PTSA 4HS1A 3FW2A 5GSSA 2E7PA 4OCFA 2OACA 3HY2A 3F3RA 4KW6A 2GZYA 1BG5A 2YNXA 4TKYA 4IQAA 2VUPA 2FGXA 3R3EA 2HI7A 3QFBC 1S3AA 2KUCA 3HKRA 4I2UA 4G2EA 5G5EA 1O85A 2HLSA 2FHEA 4E8HA 2LJRA 3DVXA 3RPPA 5DJMA 2LRCA 4BWQA 2P5RA 2H71A 5ECQB 5F0GA 4ZBDA 5B8BA 2OE3A 2XPDA 4F2IA 3PR8A 3F9UA 3IAS2 3LEFA 4IGJA 5CRDA 1VGLA 3W6GA 2J23A 2YOIA 1GULA 1LBKA 2FY6A 3LG6A 1PX7A 2DMMA 4OCEA 4DSSA 5INYA 1PKWA 2VOCA 3IK7A 3KJYA 4EXJA 4WR4A 2BMXA 2WULA 3FZ9A 3PPUA 1JFUA 1XIYA 1SENA 4H86A 1YZXA 4JBBA 5DBQA 1GTIA 2GLRA 1TU8A 3HVXA 3FEUA 3NOFA 2LQOA 1ZCPA 3N5OA 4FH8A 1V40A 2FLSA 3ISOA 4K0NA 1GLPA 2ZNMA 2DJKA 2H73A 4GRFA 4WBRD 1ABAA 1PGTA 3ZVJD 3IV4A 1ZYQB 3IC4A 1RW1A 4AJ8A 3F63A 3EVIA 4KNDA 2FCHA 1SL0B 1PMTA 1XWGA 1YDKA 2VD1A 3GURA 1M2AA 2AAWA 3QDNA 1EEJA 1S3DA 3CSIA 2GGTA 2KLXA 4RI7A 2F9SA 2TRCP 2YANA 1AW9A 2AUVA 3HD5A 2YCDA 4K2DA 4KGIA 1V98A 3BOAA 3GN3A 1T4YA 4ZB8A 4IQ1A 3Q74A 5HQPA 3FR6A 2HZEB 4I2TA 2H74A 1GWCA 4WEYA 1XVWA 3GTUA 1ZMAA 5ID2A 1A23A 2HT9A 4PGTA 1WE0A 4MJBA 1DBYA 2R3XA 4CDOA 2CX4A 5HFGA 4BWSA 2C80A 4YQVA 3TKRA 4NMUA 4XS6A 3TKSA 5ECHB 2H6ZA 5G1LA 1O73A 1THXA 3LSZA 4Q5NA 2IIYA 2GSQA 5G1KA 2H6XA 4PNFA 2WGRA 3ERWA 3TJFA 4ZB9A 1ZGNA 2YP6A 1FVKA 5LNKe 3P7XA 1GUHA 2PERA 4QL9A 1F9MA 1KEBA 1SD9A 4PURA 2V1MA 4OWYA 1IYHA 2DJ3A 4DEJA 3EU4A 1BEDA 4ZL8A 2ZUPA 3US3A 2H75A 3LYPA 3IAM2 4E8EA 4OO4A 2JZRA 2CQ9A 2WB9A 2V32A 4RQXA 4ZIJA 4ZBAA 4J57E 3KCMA 3CSJA 2NBSA 4GCIA 3APQA 3OR5A 1X9SB 3DKSA 2X8GA 1B9YC 2VCTA 3FZ5A 4DVCA 4HEA2 3ZIVA 4AJ6A 1NHOA 1PA3A 3FRCA 3O76A 5J41A 1Z9HA 4EE0A 3TJJA 4G19A 1OKTA 1HQOA 3L9SA 2DJ0A 2OBKA 3FY7A 1GSFA 4F0BA 13GSA 4EDYA 2VCXA 1FW1A 1FG4A 2LRNA 5GSTA 4K9ZA 1Z5YE 3UBLA 5LD0A 3O3TA 2CZ3A 2GSSA 1UC7A 5JWQB 1GH2A 3ZZXA 4WXTA 2C8UA 1WP0A 2K18A 5HR0A 3IA1A 1GTUA 1B4PA 5D9TA 4DSQA 4MH2A 2F3MA 1W4VA 4YAVA 3F0IA 1U6TA 3TOTA 3CYNA 3TKSE 3D21A 4GSTA 4L8EA 2GZPA 2HSHA 2H19A 3HZ8A 1CQHA 3QMXA 4GLTA 2L4QA 4KA0A 2CVBA 2DJ1A 3HYPA 3KP8A 4JEDA 19GSA 1VRSD 3QCPA 2KOKA 2YJ7A 3Q18A 5D8IA 4N30A 3LXZA 2CZ2A 1NM3A 3RPNA 1T4ZA 3UEMA 1GSEA 4ZL9A 3ED3A 1EZKA 2PBJA 3GKKA 1Q4JA 4XHMA 4LA1A 3WT1A 4FQUA 3GX0A 5IMZA 4IHUA 3UL3A 1N8JA 3GKMA 1QXHA 1OC8A 4TVEA 4WR5A 4BPYA 3ZREA 1YKAA 5DJLA 3MAKA 1K3LA 1DSBA 4NPBA 5F05A 5ECLB 2A2SA 1V57A 2VIMA 4G0KA 4LMVA 16GSA 1OE8A 4O7HA 1XWKA 2E2MA 5DCHA 3TKPA 2VM1A 3D4MA 1KNGA 2LTKA 5C04A 5IMAA 5DALA 3FR9A 1K0MA 4MZCA 3DVWA 17GSA 3M1GA 1OAZA 1B4QA 3TB2A 3G7IA 2VLUA 1C72A 6GSUA 4G0IA 3DEXA 1B8XA 4RUVA 4GXZA 3ZTLA 4QQ7A 4MA9A 1AIUA 5HR3A 3KTBA 4ISDA 3TGZA 4ZL7A 3R2QA 1AC1A 2LRTA 2X8CA 2K8SA 4TN8A 4ULXA 3BD2A 5A5KA 2ES7A 2L59A 3FZ4A 4IJ3A 1GTBA 2OA7A 3F4SA 4XCSA 1Z6NA 1YEXA 2ZCTA 1PL1A 2OKAA 1BYEA 1M9AA 2GQMA 5CNWA 2RM5A 2AJQB 1ZZYA 2O7KA 4TW5A 5KEJA 2B7KA 3TJBA 1ACVA 4N0ZA 3GV1A 2GDRA 5IQYA 3IDVA 4V2LA 2ON7A 1R5AA 4JE1A 2GT6A 4BVXA 5CRGA 4XS4A 1XXUA 3GH9A 1G7EA 3ZYWA 2WFCA 3WGXA 1MDIA 3GIXA 5J9CA 4LLRA 1PL2A 2YV7A 1GSDA 1SKSB 2V41A 1DE1A 3BCIA 1XWAA 4KUNA 3RHBA 1H4OA 1F3BA 4POBA 3U5RE 1XCCA 3UIWA 1TI3A 4TR0A 2IN3A 4TXVA 4K7NA 1JZDA 4MJCA 2WCIA 2LSTA 2C3NA 1WIKA 4IVFA 3IHQA 2JU5A 2O89A 4D73A 4O92A 2QC7A 2HRFA 4TRXA 5B6MA 3ERGA 3D22A 5D96A 1GUMA 4KSMA 1I5GA 3I69A 2HYXA 2G2QA 2MMNA 3VFIA 4K6XA 1WOUA 3GSTA 3CBUA 3KMNA 1F37A 4GTUA 3M3MA 3ERFA 4YAPA 4MCUA 1ZL9A 2WS2A 2TIRA 5F06A 3DD3A 3LGCA 1MD4A 1TTZA 3W8SA 2R5GA 3D6IA 3JCML 2PPTA 2FA8A 4FO5A 1GTAA 2PGTA 1G6YA 1YKCA 1GLQA 4JZQA 4TR4A 1R5PA 5G5FA 3KXOA 5JWOB 4KDYA 2FD3A 1O81A 1HNBA 3UVTA 3QAGA 1A8YA 1M7TA 3L78A 4IKHA 5IM9A 2HE3A 1QK8A 2LEGA 2A4VA 4YQUA 1F2EA 2X99A 1FHEA 3UAPA 2GSTA 5IOXA 5A4WA 2AB6A 2VO4A 2REMA 5CRHA 5GAPD 5KN1A 3ZRDA 1XZOA 2VCWA 1K0OA 1JHBA 3DGQA 3NIVA 5DALB 1W89A 1JLWA 3LFLA 3DIEA 2O8VB 2VL9A 1TK5B 4HJMA 4MF6A 1X5EA 1BJXA 3W8JA 3VURA 4L0UA 3WT2A 1TOFA 3ZFLA 4BVYA 1ERVA 3KZQA 1ZYEA 2I4AA 4JR4A 3FKFA 1T7PB 3H8QA 1VF1A 2VD0A 5LCZA 2B1KA 12GSA 2LUSA 2MZCA 2L6DA 2XHFA 1PX6A 1KTEA 1G7OA 2CT6A 1PKZA 3F4RA 4WBJA 1Y25A 2JADA 3Q6OA 2IWTA 3ZVJA 4NHWA 2GSRA 1GSQA 3GHAA 1XW9A 4FIWA 1THOA 1A2LA 1EOHA 3GUSA 1J9BA 1ERWA 5HR2A 4EO3A 5FT3A 2FWEA 3L4NA 2OE1A 5EPFA 3LXTA 4BVXB 4MZBA 1QUWA 4XS4B 5JCUA 3HCZA 1XOAA 4WKWA 3I6AA 2H30A 2VLTA 4YH2A 2V6OA 3QAWA 3FZAA 1LU4A 2C1YA 3KTLA 3P8WA 2EIRA 2DIZA 3VWVA 2GQKA 3VLNA 5JWRB 5ECNB 1NSWA 1Y6EA 2C3QA 4N0VA 1X5CA 4PNGA 5DAKA 2VL2A 2HNLA 4MP4A 3IE3A 2LJAA 3ZLPA 5EY6A 1K3YA 3J7Yk 4OD7A 1WRYA 3GRXA 3HHVA 1HD2A 3EU3A 2FUG2 2DJJA 4D73B 3SBCA 2C0FA 3AY8A 3GFKA 4LL1B 2BTOT 2NDOA 1ON4A 3APSA 1TRUA 1WJKA 3ME8A 5HFIA 3RBTA 2TRXA 4PUFC 4I6XA 2FA4A 4ECCA 2L57A 3TRXA 4K7IA 5CAXA 3HZ4A 3O6TA 1IYIA 1URMA 3L9VA 2XC2A 4O5RA 2C0GA 1QMVA 3IOSA 2JACA 3MNGA 3LQ7A 1QFNA 4TOPA 2YWNA 2ON5A 3ME7A 1YF0A 3C1RA 5ECSA 3BJ5A 1TRSA 3QAVA 1UVZA 2R4VA 2HRNA 1O6JA 2L5OA 2H1BA 3WGDA 2DBCA 3F3QA 4QL7A 1K0DA 2B5YA 3GL3A 4CHSA 1SKWB 2GZZA 4OMVA 4EC0A 3Q19A 2F8AA 3I9V2 1N2AA 3TKQA 2VM2A 4L0WA 5CO3A 3EURA 1YQ1A 2Z9SA 2AYTA 3PINA 10GSA 2CV4A 18GSA 3WGEA 1T8EB 5F07A 2IMFA 1SL2B 2I9HA 4JRRA 5GZZB 2V2GA 2NPBA 4NWYA 3N9JA 4KSOA 1G6WA 5EL8A 4BVYB 2VLVA 5COHA 1T1VA 4HOJA 4O32A 1MD3A 3SWLA 1YF1A 1WWJA 1RQMA 4HQSA 4MLYA 5CYYA 5G30A 1M99A 2OE0A 1EEMA 1WPIA 2IJYA
chains in the Genus database with same CATH superfamily
4N10A 2L6CA 4K0GA 3LJRA 2J9HA 3A2XA 2NTOA 1OC3A 2FWHA 1MDKA 5AIVA 2B3SA 5B6NA 5E59A 4I97A 3UMAA 2ALBA 1EP8A 2NVLA 8GSSA 1NW2A 3G7JA 4IN0A 5ELAA 3EE2A 2YWIA 1EGRA 3HJOA 1TRVA 5AISA 4ECIA 4ECBA 4A5PA 3HJPA 6GSVA 1PN9A 1PD21 4IS0A 4HSCX 4XRDA 3EPTA 3GMFA 4L5OA 3FHKA 2PU9C 3BCKA 4KDUA 2H70A 1EOGA 5J40A 4IELA 1Q98A 2PUKC 3D4TA 5HR1A 3I43A 1U87A 2B5XA 2PVOC 3FK8A 4BA7A 5DAKB 3H4KA 2RUEA 1XWCA 1SK2A 4RI6A 4V1Ap 2GS3A 2HSMB 3TCOA 3DYRA 1PFOA 2EC4A 2HSNA 3H1NA 3ZFBA 1VF4A 3MYDA 2HXKA 3C71A 3CXGA 1M3JA 3EINA 1Z7RA 2H1GA 3VI7A 1FVJA 4EIPA 3D0ZA 3HVVA 1UN2A 4MZWA 3MIXA 2OADA 1M0UA 2VCQA 4ZB6A 2M80A 4AI6A 5IMCA 1XW5A 5BMUB 3GKNA 6GSXA 2H1AA 1XOBA 4XIHA 4HI7A 1TP9A 4I5QA 1F3AA 3QFAC 2R2JA 2PMTA 3VK9A 3J7Yb 4EF0A 5IIZA 3ZMLA 2VL3A 2M46A 1TK0B 2BJXA 1BQ7A 1M2DA 2AV4A 1JZRA 4ID0A 4IBPA 1WMJA 1B48A 1SL1B 3IXRA 4HU9A 1O7UA 3ZMKA 2PWJA 2DIYA 2YJHA 1GRXA 9GSSA 4GF0A 5B8AA 1V58A 2H0GA 4HZ4A 3QPMA 3QD9A 5ECIB 4TXOA 2MBSA 4TR1A 1U3AA 3GNJA 5FHIA 1BX9A 1SYXA 4RQRA 1TRWA 1ERTA 3RHCA 1TXUA 2WW1A 2H01A 3P2AA 3RDWA 5ABRA 3EYTA 5A5HA 2DJ2A 4AJ7A 1R7HA 3GKXA 4OFNA 4P3YB 1MEKA 4QMKA 4PUAA 1TI1A 1DUGA 4WF5A 2DC5A 1ZOFA 3CRUA 2LQQA 4O5QA 3MSZA 5EVOA 4GSSA 4MJEA 4J2FA 5ENUA 4ECJA 1BF5A 3F4TA 11GSA 4Z2RA 3BBYA 2LNTA 1SJIA 4G01A 1AQVA 5IMDA 3M8NA 4CY8A 5G2ZA 2EIOA 2HQTA 3APOA 4L5LA 4K8MA 4PXOA 1SU9A 1RK4A 1XW6A 20GSA 1EWXA 4N11A 3GSSA 1EGOA 5HFKA 1VF2A 2JL4A 3L0HA 4X4JA 3HDCA 1AQXA 1EV4A 2WJUA 4EIQA 5IMVA 1A2MA 22GSA 1M2BA 2XBQA 4MMMA 4HZ2A 6GSSA 1ERUA 4I8BA 2H0IA 3IPZA 5B7CA 3VWUA 1K0CA 1GSYA 4MJAA 4FYBA 5E4WA 2G0FA 4GDFA 4KB3A 1V9WA 2RM6A 2DKHA 2KP1A 1AUCA 1U3IA 3LORA 1XBSA 4JU5A 2EIQA 1Z3EA 1FAAA 3NZNA 1TKDB 3CTGA 4ZXGA 3TOUA 4MDCA 1EV9A 1X9MB 2A2RA 1QGVA 4V1Ag 5J4VA 2X64A 2M72A 3UBKA 4Q5RA 3M9JA 3HXSA 1SK0A 2CAIA 2OBIA 3DXBA 2H6YA 3G7YA 5KN3A 1SK1A 2YWOA 2CX3A 1V2AA 1TK8B 4POKA 1LJRA 2HSNB 2RIIA 5J4UA 1K0BA 2C3TA 7GSSA 2CVDA 1ZYNA 1HNAA 4HJ2A 5DQSA 5A4UA 4F03A 1SJZA 3KIJA 3EC3A 1F6MC 3A2WA 2DSAA 2YZUA 5IMFA 5AN1A 5KN2A 3E9JB 5C00A 2KHPA 2H1DA 6GSWA 2HSYA 4AF2A 2D2ZA 2N5BA 1E6BA 3MDKA 2L4CA 2R0GA 3L9UA 5AIXA 1A8LA 1SVLA 1QQ2A 2C0DA 3A3TA 4ML1A 4MH3A 4X43A 1UA5A 4YKGA 1EP7A 5KOWA 3GH6A 3D5JA 5G31A 4V2MA 5CREA 3HMJG 3GA4A 2C4JA 3DWVA 14GSA 1XWBA 3WD6A 4NHZA 2IMDA 1PSQA 3LYKA 2F51A 1BAYA 4POMA 3K8NA 2RLIA 4IW9A 2IPAA 4HQZA 1BG1A 4USSA 3MWHA 4J56E 3M0FA 2P31A 3CMIA 1AXDA 4F0CA 1SJ6A 1H75A 2N5FA 1OE7A 3KP9A 3E3EA 1DE2A 3DRNA 2LS5A 1PRXA 4KE3A 2XPEA 2B6MA 4JR6A 2L5LA 4TXOB 1GSSA 2VCVA 4TR1B 2GVPA 1G0TA 2CVKA 5IO2A 3VI5A 3U6VA 2A4HA 2O85A 3EWLA 4MF7A 4Z2UA 5A5HB 2R6KA 4MNNA 1AQWA 5H5SA 2GQLA 4EVMA 1J0FA 4ICYA 3VPTA 4ACSA 2X4AA 4OFTA 1FB0A 2WZSA 2HSMA 4NV2A 1T00A 4ZBBA 1FOVA 3TRQA 5J3RA 3CRTA 5DDLA 3E0UA 5ELGA 1AAZA 1JLVA 1TDIA 2HRAA 3FR3A 2QKEA 2LV3A 3HJMA 1GNWA 1ST9A 1A0FA 2JZTA 2QGVA 2FNOA 2VAFA 2WZ9A 3QR6A 1U88A 4EL1A 2FWGA 4DSRA 5A34A 3IRAA 4Q5FA 2K9FA 5BMUA 4KX4A 4MK3A 5L71A 2E0QA 2VL2C 4KCAA 3TKSC 3GYKA 4KH7A 3ZITA 4EKZA 1T3BA 2HRKA 2YWMA 1GP1A 2MMOA 3CTFA 1X9WB 1FB6A 1JZWA 3WYWA 2MMAA 5IPGA 2IL3A 4FYUA 3KMOA 4XS1A 4KCEA 3RAZA 2JSYA 3H79A 2GTUA 2EFDA 5D9XA 3A5IA 2IFQA 1MTCA 2P5QA 1X5DA 1A24A 3F6DA 1ILOA 4ML6A 2WDUA 1XVQA 3IK9A 2O87A 2H8LA 4BL7A 4IP1A 2YV9A 2H0HA 4PX1A 2I1UA 4F9ZA 4DSSB 4GQCA 1O8XA 3HVSA 2HFDA 4MPGA 4YKFA 5D9VA 3PH9A 5H5RA 3M9KA 1KBNA 2VCZA 1HYUA 2HZFA 4ILFA 3A5WA 2K8VA 5DQYA 3EMXA 2CA8A 1JZOA 5ECRB 2YZHA 2YPMA 4KF9A 2K6VA 4LL4B 1YJ6A 4NXIA 3KEBA 1A0RP 1Z7PA 2AHEA 2XBIA 2N5AA 4GQFA 1PN0A 4K5SA 3H93A 1OC9A 3ZL5A 3ZIJA 3C1SA 5DCGA 1K0NA 3QOUA 5J5NA 3UJ1A 2H66A 1SYRA 2IMKA 3EMPA 3UVHA 3V1WA 1J08A 2B7JA 1E2YA 2B5EA 3VWWA 5KN0A 4PQHA 1GSUA 1SVMA 2LJKA 3TJGA 3P90A 5A4VA 2MYGA 4AKHA 4HU7A 4ZILA 3F6FA 1TXXA 4GSNA 4NAXA 1X0RA 4EDZA 2PVQA 3KD0A 3G9BA 3IC8A 1GL8A 4NV5A 4TR3A 5D93A 1GUKA 2KP2A 5IO0A 5ECKB 4OFMA 2DMLA 3VPQA 3KGKA 2DLXA 5CP1A 5ECMB 4XRAA 3F8UA 4WETA 2LKUA 4FYCA 3A2VA 1Z6MA 5J9BA 4YQMA 3GL5A 2OJLA 5F8BA 4AGSA 3VWXA 4X0XA 3TRPA 1TJDA 4IP6A 3GTUB 2R37A 5ID2B 5ECOB 1K0AA 1PQNA 4LMWA 4PQ1A 2PN8A 1I9DA 2MMZA 3C7MA 1TU7A 2JZSA 4K1FA 4Q5QA 4POLA 3PGTA 2WRTA 3KM6A 1S3CA 4GWRA 1YY7A 4HDEA 4PQIA 3UARA 5D73A 5A34B 4K7OA 2X8HA 2RUFA 2H72A 2WW0A 6GSTA 1SD8A 1M9BA 1USBA 5D9WA 1TW9A 2HRKB 1VF3A 6GSYA 1O8WA 2H76A 2MBTA 4V2NA 3IR4A 1ML6A 3FYGA 4MABA 2P0GA 1K3OA 2R0PA 2IMIA 3TDGA 2DKIA 2I3YA 2B1LA 1SKRB 1OYJA 3C8EA 2C0EA 5AGYA 4G10A 1HNCA 4HUAA 1GNEA 1B9XC 2IFQB 2GT5A 3C73A 4IJIA 1Y1UA 4KAEA 3TUEA 3DMLA 3KH9A 4MPFA 5ECPB 5IOWA 2WW3A 4CW9A 3IBHA 1XPVA 1XFLA 5IPHA 4BL7B 2E2GA 5CRWA 4MF5A 4KDXA 3GX8A 4EUYA 3CSHA 4Z7XA 1R4WA 2JSZA 1FO5A 2QSIA 2UZ8A 4WF4A 2FWFA 4BIKA 1OKDA 2YN1A 5JCGA 1NHYA 1OVNA 2IMEA 3LWAA 4XTSA 2I81A 1A2JA 3KH7A 1MDJA 2HZEA 3HA9A 1YEPA 4OO5A 5JCWA 4G0LA 5H5QA 2EFCA 5DVBA 3TJKA 4G9HA 2V6KA 1R26A 1OC9B 2CAQA 3S9FA 3UOMA 2LNSA 5FWGA 5GAND 2F8FA 4F82A 1CQGA 4X1UA 4PTSA 4HS1A 3FW2A 5GSSA 2E7PA 4OCFA 2OACA 3HY2A 3F3RA 4KW6A 2GZYA 1BG5A 2EFHA 2YNXA 4TKYA 4IQAA 2VUPA 2FGXA 3R3EA 2HI7A 3QFBC 1S3AA 2KUCA 3HKRA 4I2UA 4G2EA 5G5EA 1O85A 2HLSA 2FHEA 4E8HA 2LJRA 3DVXA 3RPPA 5DJMA 2LRCA 4BWQA 2P5RA 2H71A 5ECQB 5F0GA 4ZBDA 5B8BA 2OE3A 2XPDA 4F2IA 3PR8A 3F9UA 3IAS2 3LEFA 4IGJA 5CRDA 1VGLA 3W6GA 2J23A 2YOIA 2WVXA 1GULA 1LBKA 2FY6A 3LG6A 1PX7A 2DMMA 4OCEA 4DSSA 5INYA 1PKWA 2VOCA 3IK7A 3KJYA 5KOXA 4EXJA 4WR4A 2BMXA 2WULA 3FZ9A 3PPUA 2EFEA 1JFUA 1XIYA 1S4BP 1SENA 4H86A 1YZXA 4JBBA 5DBQA 1GTIA 2WVZA 2GLRA 1TU8A 3HVXA 3FEUA 3NOFA 2LQOA 1ZCPA 3N5OA 4FH8A 1V40A 2FLSA 3ISOA 4K0NA 1GLPA 2ZNMA 2DJKA 2H73A 5J47A 4GRFA 4WBRD 1ABAA 1PGTA 3ZVJD 3IV4A 1ZYQB 3IC4A 1RW1A 4AJ8A 3F63A 3EVIA 4KNDA 2FCHA 1SL0B 1PMTA 1XWGA 1YDKA 2VD1A 3GURA 1M2AA 2AAWA 3QDNA 1EEJA 1S3DA 3CSIA 2GGTA 2KLXA 4RI7A 2F9SA 2TRCP 2YANA 1AW9A 2AUVA 3HD5A 2YCDA 4K2DA 4KGIA 1V98A 3BOAA 3GN3A 1T4YA 4ZB8A 4IQ1A 3Q74A 5HQPA 3FR6A 2HZEB 4I2TA 2H74A 1GWCA 4WEYA 1XVWA 3GTUA 1ZMAA 5ID2A 1A23A 2HT9A 4PGTA 1WE0A 4MJBA 1DBYA 2R3XA 4CDOA 2CX4A 5HFGA 4BWSA 2C80A 4YQVA 3TKRA 4NMUA 4XS6A 3TKSA 1N25A 5ECHB 2H6ZA 5G1LA 1O73A 2OT3A 1THXA 3LSZA 4Q5NA 2IIYA 4O5UA 2GSQA 5G1KA 2H6XA 4PNFA 2WGRA 3RFRC 3ERWA 3TJFA 4ZB9A 1ZGNA 2YP6A 1FVKA 5LNKe 3P7XA 1GUHA 3CWGA 2X49A 2PERA 4QL9A 1F9MA 5J4YA 1KEBA 1SD9A 4PURA 2V1MA 2A2PA 4OWYA 1IYHA 2DJ3A 4DEJA 3EU4A 1BEDA 4ZL8A 2ZUPA 3US3A 2WVXB 4AKIA 2H75A 3LYPA 3IAM2 4E8EA 4OO4A 2JZRA 2CQ9A 2WB9A 2V32A 4RQXA 4ZIJA 4ZBAA 4J57E 3KCMA 3CSJA 2NBSA 3LW9A 4GCIA 3APQA 3OR5A 1X9SB 3DKSA 2X8GA 1B9YC 4PHZC 2VCTA 3FZ5A 5A1NA 4DVCA 4Z2TA 4HEA2 3ZIVA 4AJ6A 1NHOA 1PA3A 3FRCA 3O76A 5J41A 1Z9HA 4EE0A 3TJJA 4G19A 1OKTA 1HQOA 3L9SA 2DJ0A 2OBKA 3FY7A 1GSFA 4F0BA 13GSA 4EDYA 2VCXA 1FW1A 1FG4A 2LRNA 5GSTA 4K9ZA 1Z5YE 3UBLA 5LD0A 3O3TA 2CZ3A 2GSSA 1UC7A 5JWQB 1GH2A 3ZZXA 4WXTA 2C8UA 1WP0A 2K18A 5HR0A 3IA1A 1GTUA 1B4PA 5D9TA 4DSQA 4MH2A 3CQFA 2F3MA 1W4VA 4YAVA 3F0IA 2O3EA 1U6TA 3TOTA 3CYNA 3TKSE 3D21A 4GSTA 4L8EA 2GZPA 2HSHA 2H19A 3HZ8A 1CQHA 3QMXA 4GLTA 2L4QA 4KA0A 2CVBA 4AKXB 2DJ1A 3HYPA 3KP8A 4JEDA 19GSA 1VRSD 3QCPA 2KOKA 2YJ7A 3Q18A 5D8IA 4N30A 3LXZA 3IHGA 2CZ2A 1NM3A 3RPNA 1T4ZA 3UEMA 4PI0C 1GSEA 4ZL9A 3ED3A 1EZKA 2PBJA 3GKKA 1Q4JA 4XHMA 4LA1A 3WT1A 4FQUA 3GX0A 5IMZA 4IHUA 3UL3A 1N8JA 3GKMA 4E68A 1QXHA 1OC8A 4TVEA 4WR5A 4BPYA 3ZREA 1I1IP 4PI2C 1YKAA 5DJLA 3MAKA 1K3LA 1DSBA 4NPBA 5F05A 5ECLB 2A2SA 1V57A 2VIMA 4G0KA 4LMVA 16GSA 1OE8A 4O7HA 1XWKA 2E2MA 5DCHA 3TKPA 2VM1A 3D4MA 1KNGA 2LTKA 5C04A 4K2XA 5IMAA 5DALA 3FR9A 1K0MA 1ZYPA 4MZCA 3DVWA 17GSA 3M1GA 1OAZA 1B4QA 3TB2A 3G7IA 2VLUA 1C72A 6GSUA 4G0IA 3DEXA 3CHXC 1B8XA 4RUVA 4GXZA 3ZTLA 4QQ7A 2O36A 4MA9A 1AIUA 5HR3A 3KTBA 4ISDA 3TGZA 4ZL7A 3R2QA 1AC1A 2LRTA 2X8CA 2K8SA 4TN8A 4ULXA 3BD2A 5A5KA 2ES7A 2L59A 3FZ4A 4IJ3A 1GTBA 2OA7A 3F4SA 4XCSA 1Z6NA 1YEXA 2ZCTA 1PL1A 2OKAA 1BYEA 1M9AA 2GQMA 5CNWA 2RM5A 1FOHA 2AJQB 1ZZYA 2O7KA 4TW5A 5KEJA 2B7KA 3TJBA 2UV8G 1ACVA 4N0ZA 3GV1A 2GDRA 5IQYA 3IDVA 4V2LA 2ON7A 1R5AA 4JE1A 2GT6A 4BVXA 5CRGA 4XS4A 1XXUA 3GH9A 1G7EA 3ZYWA 5A1NB 2WFCA 3WGXA 1MDIA 3GIXA 5J9CA 4LLRA 1PL2A 2YV7A 1GSDA 1SKSB 2V41A 1DE1A 3BCIA 1XWAA 4KUNA 3RHBA 1H4OA 1F3BA 4POBA 4AKGA 3U5RE 2O5VA 1M3IA 1XCCA 1S3RA 3UIWA 1TI3A 4TR0A 2IN3A 2VKZG 4TXVA 4K7NA 1JZDA 4MJCA 2WCIA 2QA1A 2LSTA 2C3NA 1WIKA 4IVFA 3IHQA 2JU5A 2O89A 4D73A 4O92A 2QC7A 2HRFA 4TRXA 5B6MA 3ERGA 3D22A 5D96A 1GUMA 4KSMA 1I5GA 3I69A 2HYXA 2G2QA 2MMNA 3VFIA 4K6XA 1WOUA 3GSTA 3CBUA 3HVNA 1YVLA 1YEWC 5BRTA 3KMNA 1F37A 4GTUA 3M3MA 3ERFA 4YAPA 4MCUA 1ZL9A 2WS2A 2TIRA 5F06A 3DD3A 3LGCA 1MD4A 1TTZA 3W8SA 2R5GA 3D6IA 3JCML 2PPTA 2FA8A 4FO5A 1GTAA 2PGTA 1G6YA 1SVOA 1GLQA 1YKCA 4JZQA 1R5PA 4TR4A 5G5FA 2QA2A 3KXOA 5JWOB 4KDYA 2FD3A 1O81A 1HNBA 3UVTA 3QAGA 1A8YA 1M7TA 3L78A 4IKHA 5IM9A 2HE3A 1QK8A 2LEGA 2A4VA 4YQUA 1F2EA 2X99A 1FHEA 3UAPA 2GSTA 5IOXA 2R0CA 5A4WA 2AB6A 2VO4A 2REMA 5CRHA 5GAPD 5KN1A 3ZRDA 1XZOA 2VCWA 1K0OA 1JHBA 3DGQA 3NIVA 5DALB 1W89A 4K5RA 4W66A 1JLWA 3LFLA 3DIEA 2O8VB 2VL9A 1TK5B 1XG8A 4HJMA 4CY6A 3TU3B 4MF6A 1X5EA 1BJXA 3W8JA 3VURA 4L0UA 3WT2A 1TOFA 3ZFLA 4BVYA 1ERVA 3KZQA 1ZYEA 2I4AA 4JR4A 3FKFA 1T7PB 3H8QA 1VF1A 2VD0A 5LCZA 2B1KA 12GSA 2LUSA 2MZCA 2L6DA 2XHFA 1PX6A 1KTEA 1G7OA 2CT6A 1PKZA 3F4RA 4WBJA 1Y25A 2JADA 3Q6OA 2IWTA 3ZVJA 4NHWA 2GSRA 1GSQA 3GHAA 1XW9A 4FIWA 1THOA 1A2LA 1EOHA 3GUSA 1J9BA 1ERWA 5HR2A 4EO3A 5FT3A 2FWEA 3L4NA 2OE1A 5EPFA 3LXTA 4BVXB 4MZBA 1QUWA 4XS4B 5JCUA 3HCZA 1XOAA 4ZB7A 4WKWA 3I6AA 2H30A 2VLTA 4YH2A 2V6OA 3QAWA 3FZAA 1LU4A 2C1YA 3KTLA 3P8WA 2EIRA 2DIZA 3VWVA 2GQKA 3VLNA 5JWRB 5ECNB 1NSWA 2WVYA 1Y6EA 2C3QA 4N0VA 1X5CA 4PNGA 4N3ZA 5DAKA 2VL2A 2HNLA 4MP4A 3IE3A 2LJAA 3ZLPA 5EY6A 1K3YA 3J7Yk 4OD7A 1WRYA 3GRXA 3HHVA 1HD2A 3EU3A 2FUG2 2DJJA 2WW2A 4D73B 3SBCA 4FXYP 2C0FA 3AY8A 3GFKA 4LL1B 2BTOT 2NDOA 1ON4A 3APSA 1TRUA 1WJKA 3ME8A 5HFIA 3RBTA 2TRXA 4PUFC 4I6XA 2FA4A 4ECCA 2L57A 3TRXA 4K7IA 5CAXA 3HZ4A 3O6TA 1IYIA 1URMA 2XC2A 3L9VA 4O5RA 2C0GA 1QMVA 3IOSA 2JACA 3MNGA 3LQ7A 1QFNA 4TOPA 2YWNA 2ON5A 3ME7A 1YF0A 3C1RA 5ECSA 3BJ5A 1TRSA 3QAVA 1UVZA 2R4VA 2HRNA 1O6JA 2L5OA 2H1BA 3WGDA 2DBCA 3F3QA 4QL7A 1K0DA 2B5YA 3GL3A 4CHSA 3RGBC 1SKWB 2GZZA 4OMVA 4EC0A 3Q19A 2F8AA 3I9V2 1N2AA 3TKQA 2VM2A 4L0WA 5CO3A 3EURA 1YQ1A 2Z9SA 2AYTA 3PINA 10GSA 2CV4A 18GSA 3WGEA 1T8EB 5F07A 2IMFA 1SL2B 2H1LA 2I9HA 4JRRA 5GZZB 2V2GA 3FMWA 2NPBA 4NWYA 3N9JA 4KSOA 1G6WA 5EL8A 4BVYB 2VLVA 5COHA 1T1VA 4HOJA 4O32A 1MD3A 3SWLA 1YF1A 1WWJA 1RQMA 4HQSA 4MLYA 5CYYA 5G30A 1M99A 2OE0A 1EEMA 1WPIA 2IJYA
chains in the Genus database with same CATH topology
4N10A 2L6CA 4K0GA 3LJRA 2J9HA 3A2XA 2NTOA 1OC3A 2FWHA 1MDKA 5AIVA 2B3SA 5B6NA 5E59A 4I97A 3UMAA 2ALBA 1EP8A 2NVLA 8GSSA 1NW2A 3G7JA 4IN0A 5ELAA 3EE2A 2YWIA 1EGRA 3HJOA 1TRVA 5AISA 4ECIA 4ECBA 4A5PA 3HJPA 6GSVA 1PN9A 1PD21 4IS0A 4XRDA 3EPTA 3GMFA 4L5OA 3FHKA 2PU9C 3BCKA 4KDUA 2H70A 1EOGA 5J40A 4IELA 1Q98A 2PUKC 3D4TA 5HR1A 3I43A 1U87A 2B5XA 2PVOC 3FK8A 4BA7A 5DAKB 3H4KA 2RUEA 1XWCA 1SK2A 4RI6A 4V1Ap 2GS3A 2HSMB 3TCOA 3DYRA 2EC4A 2HSNA 3H1NA 3ZFBA 1VF4A 3MYDA 2HXKA 3C71A 3CXGA 3EINA 1Z7RA 2H1GA 3VI7A 1FVJA 4EIPA 3D0ZA 3HVVA 1UN2A 4MZWA 3MIXA 2OADA 1M0UA 2VCQA 4ZB6A 2M80A 4AI6A 5IMCA 1XW5A 5BMUB 3GKNA 6GSXA 2H1AA 1XOBA 4XIHA 4HI7A 1TP9A 4I5QA 1F3AA 3QFAC 2R2JA 2PMTA 3VK9A 3J7Yb 4EF0A 5IIZA 3ZMLA 2VL3A 2M46A 1TK0B 2BJXA 1BQ7A 1M2DA 2AV4A 1JZRA 4ID0A 4IBPA 1WMJA 1B48A 1SL1B 3IXRA 4HU9A 1O7UA 3ZMKA 2PWJA 2DIYA 2YJHA 1GRXA 9GSSA 4GF0A 5B8AA 1V58A 2H0GA 4HZ4A 3QPMA 3QD9A 5ECIB 4TXOA 2MBSA 4TR1A 1U3AA 3GNJA 5FHIA 1BX9A 1SYXA 4RQRA 1TRWA 1ERTA 3RHCA 1TXUA 2H01A 3P2AA 3RDWA 5ABRA 3EYTA 5A5HA 2DJ2A 4AJ7A 1R7HA 3GKXA 4OFNA 4P3YB 1MEKA 4QMKA 4PUAA 1TI1A 1DUGA 4WF5A 2DC5A 1ZOFA 3CRUA 2LQQA 4O5QA 3MSZA 5EVOA 4GSSA 4MJEA 4J2FA 5ENUA 4ECJA 1BF5A 3F4TA 11GSA 4Z2RA 3BBYA 2LNTA 1SJIA 4G01A 1AQVA 5IMDA 3M8NA 4CY8A 5G2ZA 2EIOA 2HQTA 3APOA 4L5LA 4K8MA 4PXOA 1SU9A 1RK4A 1XW6A 20GSA 1EWXA 4N11A 3GSSA 1EGOA 5HFKA 1VF2A 2JL4A 3L0HA 4X4JA 3HDCA 1AQXA 1EV4A 2WJUA 4EIQA 5IMVA 1A2MA 22GSA 1M2BA 2XBQA 4MMMA 4HZ2A 6GSSA 1ERUA 4I8BA 2H0IA 3IPZA 5B7CA 3VWUA 1K0CA 1GSYA 4MJAA 4FYBA 5E4WA 2G0FA 4GDFA 4KB3A 1V9WA 2RM6A 2DKHA 2KP1A 1AUCA 1U3IA 3LORA 1XBSA 4JU5A 2EIQA 1Z3EA 1FAAA 3NZNA 1TKDB 3CTGA 4ZXGA 3TOUA 4MDCA 1EV9A 1X9MB 2A2RA 1QGVA 4V1Ag 5J4VA 2X64A 2M72A 3UBKA 4Q5RA 3M9JA 3HXSA 1SK0A 2CAIA 2OBIA 3DXBA 2H6YA 3G7YA 5KN3A 1SK1A 2YWOA 2CX3A 1V2AA 1TK8B 4POKA 1LJRA 2HSNB 2RIIA 5J4UA 1K0BA 2C3TA 7GSSA 2CVDA 1ZYNA 1HNAA 4HJ2A 5DQSA 5A4UA 4F03A 1SJZA 3KIJA 3EC3A 1F6MC 3A2WA 2DSAA 2YZUA 5IMFA 5AN1A 5KN2A 3E9JB 5C00A 2KHPA 2H1DA 6GSWA 2HSYA 4AF2A 2D2ZA 2N5BA 1E6BA 3MDKA 2L4CA 2R0GA 3L9UA 5AIXA 1A8LA 1SVLA 1QQ2A 2C0DA 3A3TA 4ML1A 4MH3A 4X43A 1UA5A 4YKGA 1EP7A 5KOWA 3GH6A 3D5JA 5G31A 4V2MA 5CREA 3HMJG 3GA4A 2C4JA 3DWVA 14GSA 1XWBA 3WD6A 4NHZA 2IMDA 1PSQA 3LYKA 2F51A 1BAYA 4POMA 3K8NA 2RLIA 4IW9A 2IPAA 4HQZA 1BG1A 4USSA 3MWHA 4J56E 3M0FA 2P31A 3CMIA 1AXDA 4F0CA 1SJ6A 1H75A 2N5FA 1OE7A 3KP9A 3E3EA 1DE2A 3DRNA 2LS5A 1PRXA 4KE3A 2XPEA 2B6MA 4JR6A 2L5LA 4TXOB 1GSSA 2VCVA 4TR1B 2GVPA 1G0TA 2CVKA 5IO2A 3VI5A 3U6VA 2A4HA 2O85A 3EWLA 4MF7A 4Z2UA 5A5HB 2R6KA 4MNNA 1AQWA 5H5SA 2GQLA 4EVMA 1J0FA 4ICYA 3VPTA 4ACSA 2X4AA 4OFTA 1FB0A 2HSMA 4NV2A 1T00A 4ZBBA 1FOVA 3TRQA 5J3RA 3CRTA 5DDLA 3E0UA 5ELGA 1AAZA 1JLVA 1TDIA 2HRAA 3FR3A 2QKEA 2LV3A 3HJMA 1GNWA 1ST9A 1A0FA 2JZTA 2QGVA 2FNOA 2WZ9A 2VAFA 3QR6A 1U88A 4EL1A 2FWGA 4DSRA 5A34A 3IRAA 4Q5FA 2K9FA 5BMUA 4KX4A 4MK3A 5L71A 2E0QA 2VL2C 4KCAA 3TKSC 3GYKA 4KH7A 3ZITA 4EKZA 1T3BA 2HRKA 2YWMA 1GP1A 2MMOA 3CTFA 1X9WB 1FB6A 1JZWA 3WYWA 2MMAA 5IPGA 2IL3A 4FYUA 3KMOA 4XS1A 4KCEA 3RAZA 2JSYA 3H79A 2GTUA 2EFDA 5D9XA 3A5IA 2IFQA 1MTCA 2P5QA 1X5DA 1A24A 3F6DA 1ILOA 4ML6A 2WDUA 1XVQA 3IK9A 2O87A 2H8LA 4BL7A 4IP1A 2YV9A 2H0HA 4PX1A 2I1UA 4F9ZA 4DSSB 4GQCA 1O8XA 3HVSA 2HFDA 4MPGA 4YKFA 5D9VA 3PH9A 5H5RA 3M9KA 1KBNA 2VCZA 1HYUA 2HZFA 4ILFA 3A5WA 2K8VA 5DQYA 3EMXA 2CA8A 1JZOA 5ECRB 2YZHA 2YPMA 4KF9A 2K6VA 4LL4B 1YJ6A 4NXIA 3KEBA 1A0RP 1Z7PA 2AHEA 2XBIA 2N5AA 4GQFA 1PN0A 4K5SA 3H93A 1OC9A 3ZL5A 3ZIJA 3C1SA 5DCGA 1K0NA 3QOUA 5J5NA 3UJ1A 2H66A 1SYRA 2IMKA 3EMPA 3UVHA 3V1WA 1J08A 2B7JA 1E2YA 2B5EA 3VWWA 5KN0A 4PQHA 1GSUA 1SVMA 2LJKA 3TJGA 3P90A 5A4VA 2MYGA 4AKHA 4HU7A 4ZILA 3F6FA 1TXXA 4GSNA 4NAXA 1X0RA 4EDZA 2PVQA 3KD0A 3G9BA 3IC8A 1GL8A 4NV5A 4TR3A 5D93A 1GUKA 2KP2A 5IO0A 5ECKB 4OFMA 2DMLA 3VPQA 3KGKA 2DLXA 5CP1A 5ECMB 4XRAA 3F8UA 4WETA 2LKUA 4FYCA 3A2VA 1Z6MA 5J9BA 4YQMA 3GL5A 2OJLA 5F8BA 4AGSA 3VWXA 4X0XA 3TRPA 1TJDA 4IP6A 3GTUB 2R37A 5ID2B 5ECOB 1K0AA 1PQNA 4LMWA 4PQ1A 2PN8A 1I9DA 2MMZA 3C7MA 1TU7A 2JZSA 4K1FA 4Q5QA 4POLA 3PGTA 2WRTA 3KM6A 1S3CA 4GWRA 1YY7A 4HDEA 4PQIA 3UARA 5D73A 5A34B 4K7OA 2X8HA 2RUFA 2H72A 6GSTA 1SD8A 1M9BA 1USBA 5D9WA 1TW9A 2HRKB 1VF3A 6GSYA 1O8WA 2H76A 2MBTA 4V2NA 3IR4A 1ML6A 3FYGA 4MABA 2P0GA 1K3OA 2R0PA 2IMIA 3TDGA 2DKIA 2I3YA 2B1LA 1SKRB 1OYJA 3C8EA 2C0EA 5AGYA 4G10A 1HNCA 4HUAA 1GNEA 1B9XC 2IFQB 2GT5A 3C73A 4IJIA 1Y1UA 4KAEA 3TUEA 3DMLA 3KH9A 4MPFA 5ECPB 5IOWA 4CW9A 3IBHA 1XPVA 1XFLA 5IPHA 4BL7B 2E2GA 5CRWA 4MF5A 4KDXA 3GX8A 4EUYA 3CSHA 4Z7XA 1R4WA 2JSZA 1FO5A 2QSIA 2UZ8A 4WF4A 2FWFA 1OKDA 2YN1A 5JCGA 1NHYA 1OVNA 2IMEA 3LWAA 4XTSA 2I81A 1A2JA 3KH7A 1MDJA 2HZEA 3HA9A 1YEPA 4OO5A 5JCWA 4G0LA 5H5QA 2EFCA 5DVBA 3TJKA 4G9HA 2V6KA 1R26A 1OC9B 2CAQA 3S9FA 3UOMA 2LNSA 5FWGA 5GAND 2F8FA 4F82A 1CQGA 4X1UA 4PTSA 4HS1A 3FW2A 5GSSA 2E7PA 4OCFA 2OACA 3HY2A 3F3RA 4KW6A 2GZYA 1BG5A 2EFHA 2YNXA 4TKYA 4IQAA 2VUPA 2FGXA 3R3EA 2HI7A 3QFBC 1S3AA 2KUCA 3HKRA 4I2UA 4G2EA 5G5EA 1O85A 2HLSA 2FHEA 4E8HA 2LJRA 3DVXA 3RPPA 5DJMA 2LRCA 4BWQA 2P5RA 2H71A 5ECQB 5F0GA 4ZBDA 5B8BA 2OE3A 2XPDA 4F2IA 3PR8A 3F9UA 3IAS2 3LEFA 4IGJA 5CRDA 1VGLA 3W6GA 2J23A 2YOIA 1GULA 1LBKA 2FY6A 3LG6A 1PX7A 2DMMA 4OCEA 4DSSA 5INYA 1PKWA 2VOCA 3IK7A 3KJYA 5KOXA 4EXJA 4WR4A 2BMXA 2WULA 3FZ9A 3PPUA 2EFEA 1JFUA 1XIYA 1SENA 4H86A 1YZXA 4JBBA 5DBQA 1GTIA 2GLRA 1TU8A 3HVXA 3FEUA 3NOFA 2LQOA 1ZCPA 3N5OA 4FH8A 1V40A 2FLSA 3ISOA 4K0NA 1GLPA 2ZNMA 2DJKA 2H73A 5J47A 4GRFA 4WBRD 1ABAA 1PGTA 3ZVJD 3IV4A 1ZYQB 3IC4A 1RW1A 4AJ8A 3F63A 3EVIA 4KNDA 2FCHA 1SL0B 1PMTA 1XWGA 1YDKA 2VD1A 3GURA 1M2AA 2AAWA 3QDNA 1EEJA 1S3DA 3CSIA 2GGTA 2KLXA 4RI7A 2F9SA 2TRCP 2YANA 1AW9A 2AUVA 3HD5A 2YCDA 4K2DA 4KGIA 1V98A 3BOAA 3GN3A 1T4YA 4ZB8A 4IQ1A 3Q74A 5HQPA 3FR6A 2HZEB 4I2TA 2H74A 1GWCA 4WEYA 1XVWA 3GTUA 1ZMAA 5ID2A 1A23A 2HT9A 4PGTA 1WE0A 4MJBA 1DBYA 2R3XA 4CDOA 2CX4A 5HFGA 4BWSA 2C80A 4YQVA 3TKRA 4NMUA 4XS6A 3TKSA 1N25A 5ECHB 2H6ZA 5G1LA 1O73A 2OT3A 1THXA 3LSZA 4Q5NA 2IIYA 4O5UA 2GSQA 5G1KA 2H6XA 4PNFA 2WGRA 3ERWA 3TJFA 4ZB9A 1ZGNA 2YP6A 1FVKA 5LNKe 3P7XA 1GUHA 3CWGA 2X49A 2PERA 4QL9A 1F9MA 5J4YA 1KEBA 1SD9A 4PURA 2V1MA 2A2PA 4OWYA 1IYHA 2DJ3A 4DEJA 3EU4A 1BEDA 4ZL8A 2ZUPA 3US3A 4AKIA 2H75A 3LYPA 3IAM2 4E8EA 4OO4A 2JZRA 2CQ9A 2WB9A 2V32A 4RQXA 4ZIJA 4ZBAA 4J57E 3KCMA 3CSJA 2NBSA 3LW9A 4GCIA 3APQA 3OR5A 1X9SB 3DKSA 2X8GA 1B9YC 2VCTA 3FZ5A 5A1NA 4DVCA 4Z2TA 4HEA2 3ZIVA 4AJ6A 1NHOA 1PA3A 3FRCA 3O76A 5J41A 1Z9HA 4EE0A 3TJJA 4G19A 1OKTA 1HQOA 3L9SA 2DJ0A 2OBKA 3FY7A 1GSFA 4F0BA 13GSA 4EDYA 2VCXA 1FW1A 1FG4A 2LRNA 5GSTA 4K9ZA 1Z5YE 3UBLA 5LD0A 3O3TA 2CZ3A 2GSSA 1UC7A 5JWQB 1GH2A 3ZZXA 4WXTA 2C8UA 1WP0A 2K18A 5HR0A 3IA1A 1GTUA 1B4PA 5D9TA 4DSQA 4MH2A 2F3MA 1W4VA 4YAVA 3F0IA 1U6TA 3TOTA 3CYNA 3TKSE 3D21A 4GSTA 4L8EA 2GZPA 2HSHA 2H19A 3HZ8A 1CQHA 3QMXA 4GLTA 2L4QA 4KA0A 2CVBA 4AKXB 2DJ1A 3HYPA 3KP8A 4JEDA 19GSA 1VRSD 3QCPA 2KOKA 2YJ7A 3Q18A 5D8IA 4N30A 3LXZA 3IHGA 2CZ2A 1NM3A 3RPNA 1T4ZA 3UEMA 1GSEA 4ZL9A 3ED3A 1EZKA 2PBJA 3GKKA 1Q4JA 4XHMA 4LA1A 3WT1A 4FQUA 3GX0A 5IMZA 4IHUA 3UL3A 1N8JA 4E68A 3GKMA 1QXHA 1OC8A 4TVEA 4WR5A 4BPYA 3ZREA 1YKAA 5DJLA 3MAKA 1K3LA 1DSBA 4NPBA 5F05A 5ECLB 2A2SA 1V57A 2VIMA 4G0KA 4LMVA 16GSA 1OE8A 4O7HA 1XWKA 2E2MA 5DCHA 3TKPA 2VM1A 3D4MA 1KNGA 2LTKA 5C04A 4K2XA 5IMAA 5DALA 3FR9A 1K0MA 1ZYPA 4MZCA 3DVWA 17GSA 3M1GA 1OAZA 1B4QA 3TB2A 3G7IA 2VLUA 1C72A 6GSUA 4G0IA 3DEXA 1B8XA 4RUVA 4GXZA 3ZTLA 4QQ7A 4MA9A 1AIUA 5HR3A 3KTBA 4ISDA 3TGZA 4ZL7A 3R2QA 1AC1A 2LRTA 2X8CA 2K8SA 4TN8A 4ULXA 3BD2A 5A5KA 2ES7A 2L59A 3FZ4A 4IJ3A 1GTBA 2OA7A 3F4SA 4XCSA 1Z6NA 1YEXA 2ZCTA 1PL1A 2OKAA 1BYEA 1M9AA 2GQMA 5CNWA 2RM5A 1FOHA 2AJQB 1ZZYA 2O7KA 4TW5A 5KEJA 2B7KA 3TJBA 2UV8G 1ACVA 4N0ZA 3GV1A 2GDRA 5IQYA 3IDVA 4V2LA 2ON7A 1R5AA 4JE1A 2GT6A 4BVXA 5CRGA 4XS4A 1XXUA 3GH9A 1G7EA 3ZYWA 5A1NB 2WFCA 3WGXA 1MDIA 3GIXA 5J9CA 4LLRA 1PL2A 2YV7A 1GSDA 1SKSB 2V41A 1DE1A 3BCIA 1XWAA 4KUNA 3RHBA 1H4OA 1F3BA 4POBA 4AKGA 3U5RE 2O5VA 1XCCA 3UIWA 1TI3A 4TR0A 2IN3A 2VKZG 4TXVA 4K7NA 1JZDA 4MJCA 2WCIA 2QA1A 2LSTA 2C3NA 1WIKA 4IVFA 3IHQA 2JU5A 2O89A 4D73A 4O92A 2QC7A 2HRFA 4TRXA 5B6MA 3ERGA 3D22A 5D96A 1GUMA 4KSMA 1I5GA 3I69A 2HYXA 2G2QA 2MMNA 3VFIA 4K6XA 1WOUA 3GSTA 3CBUA 1YVLA 5BRTA 3KMNA 1F37A 4GTUA 3M3MA 3ERFA 4YAPA 4MCUA 1ZL9A 2WS2A 2TIRA 5F06A 3DD3A 3LGCA 1MD4A 1TTZA 3W8SA 2R5GA 3D6IA 3JCML 2PPTA 2FA8A 4FO5A 1GTAA 2PGTA 1G6YA 1SVOA 1GLQA 1YKCA 4JZQA 1R5PA 4TR4A 5G5FA 2QA2A 3KXOA 5JWOB 4KDYA 2FD3A 1O81A 1HNBA 3UVTA 3QAGA 1A8YA 1M7TA 3L78A 4IKHA 5IM9A 2HE3A 1QK8A 2LEGA 2A4VA 4YQUA 1F2EA 2X99A 1FHEA 3UAPA 2GSTA 5IOXA 2R0CA 5A4WA 2AB6A 2VO4A 2REMA 5CRHA 5GAPD 5KN1A 3ZRDA 1XZOA 2VCWA 1K0OA 1JHBA 3DGQA 3NIVA 5DALB 1W89A 4K5RA 4W66A 1JLWA 3LFLA 3DIEA 2O8VB 2VL9A 1TK5B 4HJMA 4CY6A 3TU3B 4MF6A 1X5EA 1BJXA 3W8JA 3VURA 4L0UA 3WT2A 1TOFA 3ZFLA 4BVYA 1ERVA 3KZQA 1ZYEA 2I4AA 4JR4A 3FKFA 1T7PB 3H8QA 1VF1A 2VD0A 5LCZA 2B1KA 12GSA 2LUSA 2MZCA 2L6DA 2XHFA 1PX6A 1KTEA 1G7OA 2CT6A 1PKZA 3F4RA 4WBJA 1Y25A 2JADA 3Q6OA 2IWTA 3ZVJA 4NHWA 2GSRA 1GSQA 3GHAA 1XW9A 4FIWA 1THOA 1A2LA 1EOHA 3GUSA 1J9BA 1ERWA 5HR2A 4EO3A 5FT3A 2FWEA 3L4NA 2OE1A 5EPFA 3LXTA 4BVXB 4MZBA 1QUWA 4XS4B 5JCUA 3HCZA 1XOAA 4ZB7A 4WKWA 3I6AA 2H30A 2VLTA 4YH2A 2V6OA 3QAWA 3FZAA 1LU4A 2C1YA 3KTLA 3P8WA 2EIRA 2DIZA 3VWVA 2GQKA 3VLNA 5JWRB 5ECNB 1NSWA 1Y6EA 2C3QA 4N0VA 1X5CA 4PNGA 4N3ZA 5DAKA 2VL2A 2HNLA 4MP4A 3IE3A 2LJAA 3ZLPA 5EY6A 1K3YA 3J7Yk 4OD7A 1WRYA 3GRXA 3HHVA 1HD2A 3EU3A 2FUG2 2DJJA 4D73B 3SBCA 2C0FA 3AY8A 3GFKA 4LL1B 2BTOT 2NDOA 1ON4A 3APSA 1TRUA 1WJKA 3ME8A 5HFIA 3RBTA 2TRXA 4PUFC 4I6XA 2FA4A 4ECCA 2L57A 3TRXA 4K7IA 5CAXA 3HZ4A 3O6TA 1IYIA 1URMA 3L9VA 2XC2A 4O5RA 2C0GA 1QMVA 3IOSA 2JACA 3MNGA 3LQ7A 1QFNA 4TOPA 2YWNA 2ON5A 3ME7A 1YF0A 3C1RA 5ECSA 3BJ5A 1TRSA 3QAVA 1UVZA 2R4VA 2HRNA 1O6JA 2L5OA 2H1BA 3WGDA 2DBCA 3F3QA 4QL7A 1K0DA 2B5YA 3GL3A 4CHSA 1SKWB 2GZZA 4OMVA 4EC0A 3Q19A 2F8AA 3I9V2 1N2AA 3TKQA 2VM2A 4L0WA 5CO3A 3EURA 1YQ1A 2Z9SA 2AYTA 3PINA 10GSA 2CV4A 18GSA 3WGEA 1T8EB 5F07A 2IMFA 1SL2B 2H1LA 2I9HA 4JRRA 5GZZB 2V2GA 3FMWA 2NPBA 4NWYA 3N9JA 4KSOA 1G6WA 5EL8A 4BVYB 2VLVA 5COHA 1T1VA 4HOJA 4O32A 1MD3A 3SWLA 1YF1A 1WWJA 1RQMA 4HQSA 4MLYA 5CYYA 5G30A 1M99A 2OE0A 1EEMA 1WPIA 2IJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N10 A;  2L6C A;  4K0G A;  3LJR A;  2J9H A;  3A2X A;  2NTO A;  1OC3 A;  2FWH A;  1MDK A;  5AIV A;  2B3S A;  5B6N A;  5E59 A;  4I97 A;  3UMA A;  2ALB A;  1EP8 A;  2NVL A;  8GSS A;  1NW2 A;  3G7J A;  4IN0 A;  5ELA A;  3EE2 A;  2YWI A;  1EGR A;  3HJO A;  1TRV A;  5AIS A;  4ECI A;  4ECB A;  3HJP A;  6GSV A;  1PN9 A;  1PD2 1;  4IS0 A;  4XRD A;  3GMF A;  4L5O A;  3FHK A;  2PU9 C;  3BCK A;  4KDU A;  2H70 A;  1EOG A;  4IEL A;  1Q98 A;  2PUK C;  3D4T A;  5HR1 A;  3I43 A;  1U87 A;  2B5X A;  2PVO C;  3FK8 A;  4BA7 A;  5DAK B;  3H4K A;  2RUE A;  1XWC A;  1SK2 A;  4RI6 A;  4V1A p;  2GS3 A;  2HSM B;  3TCO A;  3DYR A;  2EC4 A;  3H1N A;  3ZFB A;  1VF4 A;  2HXK A;  3C71 A;  3CXG A;  3EIN A;  1Z7R A;  2H1G A;  3VI7 A;  1FVJ A;  3D0Z A;  3HVV A;  1UN2 A;  4MZW A;  2OAD A;  1M0U A;  2VCQ A;  4ZB6 A;  2M80 A;  5IMC A;  1XW5 A;  3GKN A;  6GSX A;  2H1A A;  1XOB A;  4XIH A;  4HI7 A;  1TP9 A;  4I5Q A;  1F3A A;  3QFA C;  2R2J A;  2PMT A;  3VK9 A;  3J7Y b;  4EF0 A;  5IIZ A;  3ZML A;  2VL3 A;  2M46 A;  1TK0 B;  2BJX A;  1BQ7 A;  1M2D A;  2AV4 A;  1JZR A;  4ID0 A;  4IBP A;  1WMJ A;  1B48 A;  1SL1 B;  3IXR A;  4HU9 A;  1O7U A;  3ZMK A;  2PWJ A;  2DIY A;  2YJH A;  1GRX A;  9GSS A;  4GF0 A;  5B8A A;  1V58 A;  2H0G A;  4HZ4 A;  3QPM A;  3QD9 A;  5ECI B;  4TXO A;  2MBS A;  4TR1 A;  1U3A A;  3GNJ A;  5FHI A;  1BX9 A;  1SYX A;  4RQR A;  1TRW A;  1ERT A;  3RHC A;  2H01 A;  3P2A A;  3RDW A;  5ABR A;  3EYT A;  2DJ2 A;  4AJ7 A;  1R7H A;  3GKX A;  4OFN A;  4P3Y B;  1MEK A;  4PUA A;  1TI1 A;  1DUG A;  4WF5 A;  2DC5 A;  1ZOF A;  3CRU A;  2LQQ A;  3MSZ A;  5EVO A;  4GSS A;  4MJE A;  4J2F A;  5ENU A;  4ECJ A;  3F4T A;  11GS A;  3BBY A;  2LNT A;  1SJI A;  1AQV A;  5IMD A;  3M8N A;  5G2Z A;  2EIO A;  2HQT A;  3APO A;  4L5L A;  4K8M A;  4PXO A;  1SU9 A;  1RK4 A;  1XW6 A;  20GS A;  1EWX A;  4N11 A;  3GSS A;  1EGO A;  5HFK A;  1VF2 A;  2JL4 A;  3L0H A;  3HDC A;  1AQX A;  1EV4 A;  2WJU A;  5IMV A;  1A2M A;  22GS A;  1M2B A;  2XBQ A;  4MMM A;  4HZ2 A;  6GSS A;  1ERU A;  4I8B A;  2H0I A;  3IPZ A;  5B7C A;  3VWU A;  1K0C A;  1GSY A;  4MJA A;  4FYB A;  5E4W A;  2G0F A;  4KB3 A;  1V9W A;  2RM6 A;  2KP1 A;  1AUC A;  1U3I A;  3LOR A;  1XBS A;  4JU5 A;  2EIQ A;  1Z3E A;  1FAA A;  3NZN A;  1TKD B;  3CTG A;  4ZXG A;  3TOU A;  4MDC A;  1EV9 A;  1X9M B;  2A2R A;  1QGV A;  4V1A g;  2X64 A;  2M72 A;  3UBK A;  4Q5R A;  3M9J A;  3HXS A;  1SK0 A;  2CAI A;  2OBI A;  3DXB A;  2H6Y A;  3G7Y A;  5KN3 A;  1SK1 A;  2YWO A;  2CX3 A;  1V2A A;  1TK8 B;  4POK A;  1LJR A;  2HSN B;  2RII A;  5J4U A;  1K0B A;  2C3T A;  7GSS A;  2CVD A;  1HNA A;  4HJ2 A;  5DQS A;  5A4U A;  4F03 A;  1SJZ A;  3KIJ A;  3EC3 A;  1F6M C;  3A2W A;  2DSA A;  2YZU A;  5IMF A;  5AN1 A;  5KN2 A;  3E9J B;  5C00 A;  2KHP A;  2H1D A;  6GSW A;  2HSY A;  4AF2 A;  2D2Z A;  2N5B A;  1E6B A;  3MDK A;  2L4C A;  3L9U A;  5AIX A;  1A8L A;  1QQ2 A;  2C0D A;  3A3T A;  4ML1 A;  4MH3 A;  4X43 A;  1UA5 A;  1EP7 A;  3GH6 A;  3D5J A;  5G31 A;  4V2M A;  5CRE A;  3GA4 A;  2C4J A;  3DWV A;  14GS A;  1XWB A;  3WD6 A;  4NHZ A;  2IMD A;  1PSQ A;  3LYK A;  2F51 A;  1BAY A;  4POM A;  3K8N A;  2RLI A;  4IW9 A;  4HQZ A;  2IPA A;  4USS A;  3MWH A;  4J56 E;  3M0F A;  2P31 A;  3CMI A;  1AXD A;  4F0C A;  1SJ6 A;  1H75 A;  2N5F A;  1OE7 A;  3KP9 A;  3E3E A;  1DE2 A;  3DRN A;  2LS5 A;  1PRX A;  4KE3 A;  2XPE A;  2B6M A;  4JR6 A;  2L5L A;  4TXO B;  1GSS A;  2VCV A;  4TR1 B;  2GVP A;  1G0T A;  2CVK A;  5IO2 A;  3VI5 A;  3U6V A;  2O85 A;  3EWL A;  4MF7 A;  2R6K A;  1AQW A;  5H5S A;  2GQL A;  4EVM A;  1J0F A;  3VPT A;  4ACS A;  4OFT A;  1FB0 A;  2HSM A;  4NV2 A;  1T00 A;  4ZBB A;  1FOV A;  3TRQ A;  5J3R A;  3CRT A;  5DDL A;  3E0U A;  5ELG A;  1AAZ A;  1JLV A;  1TDI A;  2HRA A;  3FR3 A;  2QKE A;  2LV3 A;  3HJM A;  1GNW A;  1ST9 A;  1A0F A;  2JZT A;  2QGV A;  2FNO A;  2VAF A;  2WZ9 A;  3QR6 A;  1U88 A;  4EL1 A;  2FWG A;  4DSR A;  3IRA A;  4Q5F A;  2K9F A;  5BMU A;  4KX4 A;  4MK3 A;  5L71 A;  2E0Q A;  2VL2 C;  4KCA A;  3TKS C;  3GYK A;  4KH7 A;  3ZIT A;  4EKZ A;  1T3B A;  2HRK A;  2YWM A;  1GP1 A;  2MMO A;  3CTF A;  1X9W B;  1FB6 A;  1JZW A;  3WYW A;  2MMA A;  5IPG A;  2IL3 A;  4FYU A;  3KMO A;  4XS1 A;  4KCE A;  3RAZ A;  2JSY A;  3H79 A;  2GTU A;  5D9X A;  2IFQ A;  1MTC A;  2P5Q A;  1X5D A;  1A24 A;  3F6D A;  1ILO A;  4ML6 A;  2WDU A;  1XVQ A;  3IK9 A;  2O87 A;  2H8L A;  4BL7 A;  4IP1 A;  2YV9 A;  2H0H A;  4PX1 A;  2I1U A;  4F9Z A;  4DSS B;  4GQC A;  1O8X A;  3HVS A;  2HFD A;  4MPG A;  5D9V A;  3PH9 A;  5H5R A;  3M9K A;  1KBN A;  2VCZ A;  1HYU A;  2HZF A;  4ILF A;  3A5W A;  2K8V A;  5DQY A;  3EMX A;  2CA8 A;  1JZO A;  5ECR B;  2YZH A;  2YPM A;  4KF9 A;  2K6V A;  4LL4 B;  1YJ6 A;  4NXI A;  3KEB A;  1A0R P;  1Z7P A;  2AHE A;  2XBI A;  2N5A A;  4GQF A;  3H93 A;  1OC9 A;  3ZL5 A;  3ZIJ A;  3C1S A;  5DCG A;  1K0N A;  3QOU A;  5J5N A;  3UJ1 A;  2H66 A;  1SYR A;  2IMK A;  3EMP A;  3UVH A;  3V1W A;  1J08 A;  2B7J A;  1E2Y A;  2B5E A;  3VWW A;  5KN0 A;  4PQH A;  1GSU A;  2LJK A;  3TJG A;  3P90 A;  5A4V A;  2MYG A;  4HU7 A;  4ZIL A;  3F6F A;  1TXX A;  4GSN A;  4NAX A;  1X0R A;  4EDZ A;  2PVQ A;  3KD0 A;  3G9B A;  3IC8 A;  1GL8 A;  4NV5 A;  4TR3 A;  5D93 A;  1GUK A;  2KP2 A;  5IO0 A;  5ECK B;  4OFM A;  2DML A;  3VPQ A;  3KGK A;  2DLX A;  5CP1 A;  5ECM B;  4XRA A;  3F8U A;  4WET A;  2LKU A;  4FYC A;  3A2V A;  1Z6M A;  5J9B A;  4YQM A;  3GL5 A;  2OJL A;  5F8B A;  4AGS A;  3VWX A;  4X0X A;  3TRP A;  1TJD A;  4IP6 A;  3GTU B;  2R37 A;  5ID2 B;  5ECO B;  1K0A A;  1PQN A;  4LMW A;  4PQ1 A;  2PN8 A;  1I9D A;  2MMZ A;  3C7M A;  1TU7 A;  2JZS A;  4K1F A;  4Q5Q A;  4POL A;  3PGT A;  2WRT A;  3KM6 A;  1S3C A;  4GWR A;  1YY7 A;  4HDE A;  4PQI A;  3UAR A;  5D73 A;  4K7O A;  2X8H A;  2RUF A;  2H72 A;  6GST A;  1SD8 A;  1M9B A;  1USB A;  5D9W A;  1TW9 A;  2HRK B;  1VF3 A;  6GSY A;  1O8W A;  2H76 A;  2MBT A;  4V2N A;  3IR4 A;  1ML6 A;  3FYG A;  4MAB A;  2P0G A;  1K3O A;  2IMI A;  3TDG A;  2I3Y A;  2B1L A;  1SKR B;  1OYJ A;  3C8E A;  2C0E A;  5AGY A;  4G10 A;  1HNC A;  4HUA A;  1GNE A;  1B9X C;  2IFQ B;  2GT5 A;  3C73 A;  4IJI A;  4KAE A;  3TUE A;  3DML A;  3KH9 A;  4MPF A;  5ECP B;  5IOW A;  4CW9 A;  3IBH A;  1XPV A;  1XFL A;  5IPH A;  4BL7 B;  2E2G A;  5CRW A;  4MF5 A;  4KDX A;  3GX8 A;  4EUY A;  3CSH A;  4Z7X A;  1R4W A;  2JSZ A;  1FO5 A;  2QSI A;  2UZ8 A;  4WF4 A;  2FWF A;  1OKD A;  2YN1 A;  5JCG A;  1NHY A;  1OVN A;  2IME A;  3LWA A;  4XTS A;  2I81 A;  1A2J A;  3KH7 A;  1MDJ A;  2HZE A;  3HA9 A;  1YEP A;  4OO5 A;  5JCW A;  4G0L A;  5H5Q A;  5DVB A;  3TJK A;  4G9H A;  2V6K A;  1R26 A;  1OC9 B;  2CAQ A;  3S9F A;  3UOM A;  2LNS A;  5FWG A;  5GAN D;  2F8F A;  4F82 A;  1CQG A;  4X1U A;  4PTS A;  4HS1 A;  3FW2 A;  5GSS A;  2E7P A;  4OCF A;  2OAC A;  3HY2 A;  3F3R A;  4KW6 A;  2GZY A;  1BG5 A;  2YNX A;  4TKY A;  4IQA A;  2VUP A;  2FGX A;  3R3E A;  2HI7 A;  3QFB C;  1S3A A;  2KUC A;  3HKR A;  4I2U A;  4G2E A;  5G5E A;  1O85 A;  2HLS A;  2FHE A;  4E8H A;  2LJR A;  3DVX A;  3RPP A;  5DJM A;  2LRC A;  4BWQ A;  2P5R A;  2H71 A;  5ECQ B;  5F0G A;  4ZBD A;  5B8B A;  2OE3 A;  2XPD A;  4F2I A;  3PR8 A;  3F9U A;  3IAS 2;  3LEF A;  4IGJ A;  5CRD A;  1VGL A;  3W6G A;  2J23 A;  2YOI A;  1GUL A;  1LBK A;  2FY6 A;  3LG6 A;  1PX7 A;  2DMM A;  4OCE A;  4DSS A;  5INY A;  1PKW A;  2VOC A;  3IK7 A;  3KJY A;  4EXJ A;  4WR4 A;  2BMX A;  2WUL A;  3FZ9 A;  3PPU A;  1JFU A;  1XIY A;  1SEN A;  4H86 A;  1YZX A;  4JBB A;  5DBQ A;  1GTI A;  2GLR A;  1TU8 A;  3HVX A;  3FEU A;  3NOF A;  2LQO A;  1ZCP A;  3N5O A;  4FH8 A;  1V40 A;  2FLS A;  3ISO A;  4K0N A;  1GLP A;  2ZNM A;  2DJK A;  2H73 A;  4GRF A;  4WBR D;  1ABA A;  1PGT A;  3ZVJ D;  3IV4 A;  1ZYQ B;  3IC4 A;  1RW1 A;  4AJ8 A;  3F63 A;  3EVI A;  4KND A;  2FCH A;  1SL0 B;  1PMT A;  1XWG A;  1YDK A;  2VD1 A;  3GUR A;  1M2A A;  2AAW A;  3QDN A;  1EEJ A;  1S3D A;  3CSI A;  2GGT A;  2KLX A;  4RI7 A;  2F9S A;  2TRC P;  2YAN A;  1AW9 A;  2AUV A;  3HD5 A;  2YCD A;  4K2D A;  4KGI A;  1V98 A;  3BOA A;  3GN3 A;  1T4Y A;  4ZB8 A;  4IQ1 A;  3Q74 A;  5HQP A;  3FR6 A;  2HZE B;  4I2T A;  2H74 A;  1GWC A;  4WEY A;  1XVW A;  3GTU A;  1ZMA A;  5ID2 A;  1A23 A;  2HT9 A;  4PGT A;  1WE0 A;  4MJB A;  1DBY A;  2R3X A;  4CDO A;  2CX4 A;  5HFG A;  4BWS A;  2C80 A;  4YQV A;  3TKR A;  4NMU A;  4XS6 A;  3TKS A;  5ECH B;  2H6Z A;  5G1L A;  1O73 A;  1THX A;  3LSZ A;  4Q5N A;  2IIY A;  2GSQ A;  5G1K A;  2H6X A;  4PNF A;  2WGR A;  3ERW A;  3TJF A;  4ZB9 A;  1ZGN A;  2YP6 A;  1FVK A;  5LNK e;  3P7X A;  1GUH A;  2PER A;  4QL9 A;  1F9M A;  1KEB A;  1SD9 A;  4PUR A;  2V1M A;  4OWY A;  1IYH A;  2DJ3 A;  4DEJ A;  3EU4 A;  1BED A;  4ZL8 A;  2ZUP A;  3US3 A;  2H75 A;  3LYP A;  3IAM 2;  4E8E A;  4OO4 A;  2JZR A;  2CQ9 A;  2WB9 A;  2V32 A;  4RQX A;  4ZIJ A;  4ZBA A;  4J57 E;  3KCM A;  3CSJ A;  2NBS A;  4GCI A;  3APQ A;  3OR5 A;  1X9S B;  3DKS A;  2X8G A;  1B9Y C;  2VCT A;  3FZ5 A;  4DVC A;  4HEA 2;  3ZIV A;  4AJ6 A;  1NHO A;  1PA3 A;  3FRC A;  3O76 A;  5J41 A;  1Z9H A;  4EE0 A;  3TJJ A;  4G19 A;  1OKT A;  1HQO A;  3L9S A;  2DJ0 A;  2OBK A;  3FY7 A;  1GSF A;  4F0B A;  13GS A;  4EDY A;  2VCX A;  1FW1 A;  1FG4 A;  2LRN A;  5GST A;  4K9Z A;  1Z5Y E;  3UBL A;  5LD0 A;  3O3T A;  2CZ3 A;  2GSS A;  1UC7 A;  5JWQ B;  1GH2 A;  3ZZX A;  4WXT A;  2C8U A;  1WP0 A;  2K18 A;  5HR0 A;  3IA1 A;  1GTU A;  1B4P A;  5D9T A;  4DSQ A;  4MH2 A;  2F3M A;  1W4V A;  4YAV A;  3F0I A;  1U6T A;  3TOT A;  3CYN A;  3TKS E;  3D21 A;  4GST A;  4L8E A;  2GZP A;  2HSH A;  2H19 A;  3HZ8 A;  1CQH A;  3QMX A;  4GLT A;  2L4Q A;  4KA0 A;  2CVB A;  2DJ1 A;  3HYP A;  3KP8 A;  4JED A;  19GS A;  1VRS D;  3QCP A;  2KOK A;  2YJ7 A;  3Q18 A;  5D8I A;  4N30 A;  3LXZ A;  2CZ2 A;  1NM3 A;  3RPN A;  1T4Z A;  3UEM A;  1GSE A;  4ZL9 A;  3ED3 A;  1EZK A;  2PBJ A;  3GKK A;  1Q4J A;  4XHM A;  4LA1 A;  3WT1 A;  4FQU A;  3GX0 A;  5IMZ A;  4IHU A;  3UL3 A;  1N8J A;  3GKM A;  1QXH A;  1OC8 A;  4TVE A;  4WR5 A;  4BPY A;  3ZRE A;  1YKA A;  5DJL A;  3MAK A;  1K3L A;  1DSB A;  4NPB A;  5F05 A;  5ECL B;  2A2S A;  1V57 A;  2VIM A;  4G0K A;  4LMV A;  16GS A;  1OE8 A;  4O7H A;  1XWK A;  2E2M A;  5DCH A;  3TKP A;  2VM1 A;  3D4M A;  1KNG A;  2LTK A;  5C04 A;  5IMA A;  5DAL A;  3FR9 A;  1K0M A;  4MZC A;  3DVW A;  17GS A;  3M1G A;  1OAZ A;  1B4Q A;  3TB2 A;  3G7I A;  2VLU A;  1C72 A;  6GSU A;  4G0I A;  3DEX A;  1B8X A;  4RUV A;  4GXZ A;  3ZTL A;  4QQ7 A;  4MA9 A;  1AIU A;  5HR3 A;  3KTB A;  4ISD A;  3TGZ A;  4ZL7 A;  3R2Q A;  1AC1 A;  2LRT A;  2X8C A;  2K8S A;  4TN8 A;  4ULX A;  3BD2 A;  5A5K A;  2ES7 A;  2L59 A;  3FZ4 A;  4IJ3 A;  1GTB A;  2OA7 A;  3F4S A;  4XCS A;  1Z6N A;  1YEX A;  2ZCT A;  1PL1 A;  2OKA A;  1BYE A;  1M9A A;  2GQM A;  5CNW A;  2RM5 A;  2AJQ B;  1ZZY A;  2O7K A;  4TW5 A;  5KEJ A;  2B7K A;  3TJB A;  1ACV A;  4N0Z A;  3GV1 A;  2GDR A;  5IQY A;  3IDV A;  4V2L A;  2ON7 A;  1R5A A;  4JE1 A;  2GT6 A;  4BVX A;  5CRG A;  4XS4 A;  1XXU A;  3GH9 A;  1G7E A;  3ZYW A;  2WFC A;  3WGX A;  1MDI A;  3GIX A;  5J9C A;  4LLR A;  1PL2 A;  2YV7 A;  1GSD A;  1SKS B;  2V41 A;  1DE1 A;  3BCI A;  1XWA A;  4KUN A;  3RHB A;  1H4O A;  1F3B A;  4POB A;  3U5R E;  1XCC A;  3UIW A;  1TI3 A;  4TR0 A;  2IN3 A;  4TXV A;  4K7N A;  1JZD A;  4MJC A;  2WCI A;  2LST A;  2C3N A;  1WIK A;  4IVF A;  3IHQ A;  2JU5 A;  2O89 A;  4D73 A;  4O92 A;  2QC7 A;  2HRF A;  4TRX A;  5B6M A;  3ERG A;  3D22 A;  5D96 A;  1GUM A;  4KSM A;  1I5G A;  3I69 A;  2HYX A;  2G2Q A;  2MMN A;  3VFI A;  4K6X A;  1WOU A;  3GST A;  3CBU A;  3KMN A;  1F37 A;  4GTU A;  3M3M A;  3ERF A;  4YAP A;  4MCU A;  1ZL9 A;  2WS2 A;  2TIR A;  5F06 A;  3DD3 A;  3LGC A;  1MD4 A;  1TTZ A;  3W8S A;  2R5G A;  3D6I A;  3JCM L;  2PPT A;  2FA8 A;  4FO5 A;  1GTA A;  2PGT A;  1G6Y A;  1YKC A;  1GLQ A;  4JZQ A;  4TR4 A;  1R5P A;  5G5F A;  3KXO A;  5JWO B;  4KDY A;  2FD3 A;  1O81 A;  1HNB A;  3UVT A;  3QAG A;  1A8Y A;  1M7T A;  3L78 A;  4IKH A;  5IM9 A;  2HE3 A;  1QK8 A;  2LEG A;  2A4V A;  4YQU A;  1F2E A;  2X99 A;  1FHE A;  3UAP A;  2GST A;  5IOX A;  5A4W A;  2AB6 A;  2VO4 A;  2REM A;  5CRH A;  5GAP D;  5KN1 A;  3ZRD A;  1XZO A;  2VCW A;  1K0O A;  1JHB A;  3DGQ A;  3NIV A;  5DAL B;  1W89 A;  1JLW A;  3LFL A;  3DIE A;  2O8V B;  2VL9 A;  1TK5 B;  4HJM A;  4MF6 A;  1X5E A;  1BJX A;  3W8J A;  3VUR A;  4L0U A;  3WT2 A;  1TOF A;  3ZFL A;  4BVY A;  1ERV A;  3KZQ A;  1ZYE A;  2I4A A;  4JR4 A;  3FKF A;  1T7P B;  3H8Q A;  1VF1 A;  2VD0 A;  5LCZ A;  2B1K A;  12GS A;  2LUS A;  2MZC A;  2L6D A;  2XHF A;  1PX6 A;  1KTE A;  1G7O A;  2CT6 A;  1PKZ A;  3F4R A;  4WBJ A;  1Y25 A;  2JAD A;  3Q6O A;  2IWT A;  3ZVJ A;  4NHW A;  2GSR A;  1GSQ A;  3GHA A;  1XW9 A;  4FIW A;  1THO A;  1A2L A;  1EOH A;  3GUS A;  1J9B A;  1ERW A;  5HR2 A;  4EO3 A;  5FT3 A;  2FWE A;  3L4N A;  2OE1 A;  5EPF A;  3LXT A;  4BVX B;  4MZB A;  1QUW A;  4XS4 B;  5JCU A;  3HCZ A;  1XOA A;  4WKW A;  3I6A A;  2H30 A;  2VLT A;  4YH2 A;  2V6O A;  3QAW A;  3FZA A;  1LU4 A;  2C1Y A;  3KTL A;  3P8W A;  2EIR A;  2DIZ A;  3VWV A;  2GQK A;  3VLN A;  5JWR B;  5ECN B;  1NSW A;  1Y6E A;  2C3Q A;  4N0V A;  1X5C A;  4PNG A;  5DAK A;  2VL2 A;  2HNL A;  4MP4 A;  3IE3 A;  2LJA A;  3ZLP A;  5EY6 A;  1K3Y A;  3J7Y k;  4OD7 A;  1WRY A;  3GRX A;  3HHV A;  1HD2 A;  3EU3 A;  2FUG 2;  2DJJ A;  4D73 B;  3SBC A;  2C0F A;  3AY8 A;  3GFK A;  4LL1 B;  2BTO T;  2NDO A;  1ON4 A;  3APS A;  1TRU A;  1WJK A;  3ME8 A;  5HFI A;  3RBT A;  2TRX A;  4PUF C;  4I6X A;  2FA4 A;  4ECC A;  2L57 A;  3TRX A;  4K7I A;  5CAX A;  3HZ4 A;  3O6T A;  1IYI A;  1URM A;  3L9V A;  2XC2 A;  4O5R A;  2C0G A;  1QMV A;  3IOS A;  2JAC A;  3MNG A;  3LQ7 A;  1QFN A;  4TOP A;  2YWN A;  2ON5 A;  3ME7 A;  1YF0 A;  3C1R A;  5ECS A;  3BJ5 A;  1TRS A;  3QAV A;  1UVZ A;  2R4V A;  2HRN A;  1O6J A;  2L5O A;  2H1B A;  3WGD A;  2DBC A;  3F3Q A;  4QL7 A;  1K0D A;  2B5Y A;  3GL3 A;  4CHS A;  1SKW B;  2GZZ A;  4OMV A;  4EC0 A;  3Q19 A;  2F8A A;  3I9V 2;  1N2A A;  3TKQ A;  2VM2 A;  4L0W A;  5CO3 A;  3EUR A;  1YQ1 A;  2Z9S A;  2AYT A;  3PIN A;  10GS A;  2CV4 A;  18GS A;  3WGE A;  1T8E B;  5F07 A;  2IMF A;  1SL2 B;  2I9H A;  4JRR A;  5GZZ B;  2V2G A;  2NPB A;  4NWY A;  3N9J A;  4KSO A;  1G6W A;  5EL8 A;  4BVY B;  2VLV A;  5COH A;  1T1V A;  4HOJ A;  4O32 A;  1MD3 A;  3SWL A;  1YF1 A;  1WWJ A;  1RQM A;  4HQS A;  4MLY A;  5CYY A;  5G30 A;  1M99 A;  2OE0 A;  1EEM A;  1WPI A;  2IJY A; 
#chains in the Genus database with same CATH topology
 4N10 A;  2L6C A;  4K0G A;  3LJR A;  2J9H A;  3A2X A;  2NTO A;  1OC3 A;  2FWH A;  1MDK A;  5AIV A;  2B3S A;  5B6N A;  5E59 A;  4I97 A;  3UMA A;  2ALB A;  1EP8 A;  2NVL A;  8GSS A;  1NW2 A;  3G7J A;  4IN0 A;  5ELA A;  3EE2 A;  2YWI A;  1EGR A;  3HJO A;  1TRV A;  5AIS A;  4ECI A;  4ECB A;  4A5P A;  3HJP A;  6GSV A;  1PN9 A;  1PD2 1;  4IS0 A;  4HSC X;  4XRD A;  3EPT A;  3GMF A;  4L5O A;  3FHK A;  2PU9 C;  3BCK A;  4KDU A;  2H70 A;  1EOG A;  5J40 A;  4IEL A;  1Q98 A;  2PUK C;  3D4T A;  5HR1 A;  3I43 A;  1U87 A;  2B5X A;  2PVO C;  3FK8 A;  4BA7 A;  5DAK B;  3H4K A;  2RUE A;  1XWC A;  1SK2 A;  4RI6 A;  4V1A p;  2GS3 A;  2HSM B;  3TCO A;  3DYR A;  1PFO A;  2EC4 A;  2HSN A;  3H1N A;  3ZFB A;  1VF4 A;  3MYD A;  2HXK A;  3C71 A;  3CXG A;  1M3J A;  3EIN A;  1Z7R A;  2H1G A;  3VI7 A;  1FVJ A;  4EIP A;  3D0Z A;  3HVV A;  1UN2 A;  4MZW A;  3MIX A;  2OAD A;  1M0U A;  2VCQ A;  4ZB6 A;  2M80 A;  4AI6 A;  5IMC A;  1XW5 A;  5BMU B;  3GKN A;  6GSX A;  2H1A A;  1XOB A;  4XIH A;  4HI7 A;  1TP9 A;  4I5Q A;  1F3A A;  3QFA C;  2R2J A;  2PMT A;  3VK9 A;  3J7Y b;  4EF0 A;  5IIZ A;  3ZML A;  2VL3 A;  2M46 A;  1TK0 B;  2BJX A;  1BQ7 A;  1M2D A;  2AV4 A;  1JZR A;  4ID0 A;  4IBP A;  1WMJ A;  1B48 A;  1SL1 B;  3IXR A;  4HU9 A;  1O7U A;  3ZMK A;  2PWJ A;  2DIY A;  2YJH A;  1GRX A;  9GSS A;  4GF0 A;  5B8A A;  1V58 A;  2H0G A;  4HZ4 A;  3QPM A;  3QD9 A;  5ECI B;  4TXO A;  2MBS A;  4TR1 A;  1U3A A;  3GNJ A;  5FHI A;  1BX9 A;  1SYX A;  4RQR A;  1TRW A;  1ERT A;  3RHC A;  1TXU A;  2WW1 A;  2H01 A;  3P2A A;  3RDW A;  5ABR A;  3EYT A;  5A5H A;  2DJ2 A;  4AJ7 A;  1R7H A;  3GKX A;  4OFN A;  4P3Y B;  1MEK A;  4QMK A;  4PUA A;  1TI1 A;  1DUG A;  4WF5 A;  2DC5 A;  1ZOF A;  3CRU A;  2LQQ A;  4O5Q A;  3MSZ A;  5EVO A;  4GSS A;  4MJE A;  4J2F A;  5ENU A;  4ECJ A;  1BF5 A;  3F4T A;  11GS A;  4Z2R A;  3BBY A;  2LNT A;  1SJI A;  4G01 A;  1AQV A;  5IMD A;  3M8N A;  4CY8 A;  5G2Z A;  2EIO A;  2HQT A;  3APO A;  4L5L A;  4K8M A;  4PXO A;  1SU9 A;  1RK4 A;  1XW6 A;  20GS A;  1EWX A;  4N11 A;  3GSS A;  1EGO A;  5HFK A;  1VF2 A;  2JL4 A;  3L0H A;  4X4J A;  3HDC A;  1AQX A;  1EV4 A;  2WJU A;  4EIQ A;  5IMV A;  1A2M A;  22GS A;  1M2B A;  2XBQ A;  4MMM A;  4HZ2 A;  6GSS A;  1ERU A;  4I8B A;  2H0I A;  3IPZ A;  5B7C A;  3VWU A;  1K0C A;  1GSY A;  4MJA A;  4FYB A;  5E4W A;  2G0F A;  4GDF A;  4KB3 A;  1V9W A;  2RM6 A;  2DKH A;  2KP1 A;  1AUC A;  1U3I A;  3LOR A;  1XBS A;  4JU5 A;  2EIQ A;  1Z3E A;  1FAA A;  3NZN A;  1TKD B;  3CTG A;  4ZXG A;  3TOU A;  4MDC A;  1EV9 A;  1X9M B;  2A2R A;  1QGV A;  4V1A g;  5J4V A;  2X64 A;  2M72 A;  3UBK A;  4Q5R A;  3M9J A;  3HXS A;  1SK0 A;  2CAI A;  2OBI A;  3DXB A;  2H6Y A;  3G7Y A;  5KN3 A;  1SK1 A;  2YWO A;  2CX3 A;  1V2A A;  1TK8 B;  4POK A;  1LJR A;  2HSN B;  2RII A;  5J4U A;  1K0B A;  2C3T A;  7GSS A;  2CVD A;  1ZYN A;  1HNA A;  4HJ2 A;  5DQS A;  5A4U A;  4F03 A;  1SJZ A;  3KIJ A;  3EC3 A;  1F6M C;  3A2W A;  2DSA A;  2YZU A;  5IMF A;  5AN1 A;  5KN2 A;  3E9J B;  5C00 A;  2KHP A;  2H1D A;  6GSW A;  2HSY A;  4AF2 A;  2D2Z A;  2N5B A;  1E6B A;  3MDK A;  2L4C A;  2R0G A;  3L9U A;  5AIX A;  1A8L A;  1SVL A;  1QQ2 A;  2C0D A;  3A3T A;  4ML1 A;  4MH3 A;  4X43 A;  1UA5 A;  4YKG A;  1EP7 A;  5KOW A;  3GH6 A;  3D5J A;  5G31 A;  4V2M A;  5CRE A;  3HMJ G;  3GA4 A;  2C4J A;  3DWV A;  14GS A;  1XWB A;  3WD6 A;  4NHZ A;  2IMD A;  1PSQ A;  3LYK A;  2F51 A;  1BAY A;  4POM A;  3K8N A;  2RLI A;  4IW9 A;  2IPA A;  4HQZ A;  1BG1 A;  4USS A;  3MWH A;  4J56 E;  3M0F A;  2P31 A;  3CMI A;  1AXD A;  4F0C A;  1SJ6 A;  1H75 A;  2N5F A;  1OE7 A;  3KP9 A;  3E3E A;  1DE2 A;  3DRN A;  2LS5 A;  1PRX A;  4KE3 A;  2XPE A;  2B6M A;  4JR6 A;  2L5L A;  4TXO B;  1GSS A;  2VCV A;  4TR1 B;  2GVP A;  1G0T A;  2CVK A;  5IO2 A;  3VI5 A;  3U6V A;  2A4H A;  2O85 A;  3EWL A;  4MF7 A;  4Z2U A;  5A5H B;  2R6K A;  4MNN A;  1AQW A;  5H5S A;  2GQL A;  4EVM A;  1J0F A;  4ICY A;  3VPT A;  4ACS A;  2X4A A;  4OFT A;  1FB0 A;  2WZS A;  2HSM A;  4NV2 A;  1T00 A;  4ZBB A;  1FOV A;  3TRQ A;  5J3R A;  3CRT A;  5DDL A;  3E0U A;  5ELG A;  1AAZ A;  1JLV A;  1TDI A;  2HRA A;  3FR3 A;  2QKE A;  2LV3 A;  3HJM A;  1GNW A;  1ST9 A;  1A0F A;  2JZT A;  2QGV A;  2FNO A;  2VAF A;  2WZ9 A;  3QR6 A;  1U88 A;  4EL1 A;  2FWG A;  4DSR A;  5A34 A;  3IRA A;  4Q5F A;  2K9F A;  5BMU A;  4KX4 A;  4MK3 A;  5L71 A;  2E0Q A;  2VL2 C;  4KCA A;  3TKS C;  3GYK A;  4KH7 A;  3ZIT A;  4EKZ A;  1T3B A;  2HRK A;  2YWM A;  1GP1 A;  2MMO A;  3CTF A;  1X9W B;  1FB6 A;  1JZW A;  3WYW A;  2MMA A;  5IPG A;  2IL3 A;  4FYU A;  3KMO A;  4XS1 A;  4KCE A;  3RAZ A;  2JSY A;  3H79 A;  2GTU A;  2EFD A;  5D9X A;  3A5I A;  2IFQ A;  1MTC A;  2P5Q A;  1X5D A;  1A24 A;  3F6D A;  1ILO A;  4ML6 A;  2WDU A;  1XVQ A;  3IK9 A;  2O87 A;  2H8L A;  4BL7 A;  4IP1 A;  2YV9 A;  2H0H A;  4PX1 A;  2I1U A;  4F9Z A;  4DSS B;  4GQC A;  1O8X A;  3HVS A;  2HFD A;  4MPG A;  4YKF A;  5D9V A;  3PH9 A;  5H5R A;  3M9K A;  1KBN A;  2VCZ A;  1HYU A;  2HZF A;  4ILF A;  3A5W A;  2K8V A;  5DQY A;  3EMX A;  2CA8 A;  1JZO A;  5ECR B;  2YZH A;  2YPM A;  4KF9 A;  2K6V A;  4LL4 B;  1YJ6 A;  4NXI A;  3KEB A;  1A0R P;  1Z7P A;  2AHE A;  2XBI A;  2N5A A;  4GQF A;  1PN0 A;  4K5S A;  3H93 A;  1OC9 A;  3ZL5 A;  3ZIJ A;  3C1S A;  5DCG A;  1K0N A;  3QOU A;  5J5N A;  3UJ1 A;  2H66 A;  1SYR A;  2IMK A;  3EMP A;  3UVH A;  3V1W A;  1J08 A;  2B7J A;  1E2Y A;  2B5E A;  3VWW A;  5KN0 A;  4PQH A;  1GSU A;  1SVM A;  2LJK A;  3TJG A;  3P90 A;  5A4V A;  2MYG A;  4AKH A;  4HU7 A;  4ZIL A;  3F6F A;  1TXX A;  4GSN A;  4NAX A;  1X0R A;  4EDZ A;  2PVQ A;  3KD0 A;  3G9B A;  3IC8 A;  1GL8 A;  4NV5 A;  4TR3 A;  5D93 A;  1GUK A;  2KP2 A;  5IO0 A;  5ECK B;  4OFM A;  2DML A;  3VPQ A;  3KGK A;  2DLX A;  5CP1 A;  5ECM B;  4XRA A;  3F8U A;  4WET A;  2LKU A;  4FYC A;  3A2V A;  1Z6M A;  5J9B A;  4YQM A;  3GL5 A;  2OJL A;  5F8B A;  4AGS A;  3VWX A;  4X0X A;  3TRP A;  1TJD A;  4IP6 A;  3GTU B;  2R37 A;  5ID2 B;  5ECO B;  1K0A A;  1PQN A;  4LMW A;  4PQ1 A;  2PN8 A;  1I9D A;  2MMZ A;  3C7M A;  1TU7 A;  2JZS A;  4K1F A;  4Q5Q A;  4POL A;  3PGT A;  2WRT A;  3KM6 A;  1S3C A;  4GWR A;  1YY7 A;  4HDE A;  4PQI A;  3UAR A;  5D73 A;  5A34 B;  4K7O A;  2X8H A;  2RUF A;  2H72 A;  2WW0 A;  6GST A;  1SD8 A;  1M9B A;  1USB A;  5D9W A;  1TW9 A;  2HRK B;  1VF3 A;  6GSY A;  1O8W A;  2H76 A;  2MBT A;  4V2N A;  3IR4 A;  1ML6 A;  3FYG A;  4MAB A;  2P0G A;  1K3O A;  2R0P A;  2IMI A;  3TDG A;  2DKI A;  2I3Y A;  2B1L A;  1SKR B;  1OYJ A;  3C8E A;  2C0E A;  5AGY A;  4G10 A;  1HNC A;  4HUA A;  1GNE A;  1B9X C;  2IFQ B;  2GT5 A;  3C73 A;  4IJI A;  1Y1U A;  4KAE A;  3TUE A;  3DML A;  3KH9 A;  4MPF A;  5ECP B;  5IOW A;  2WW3 A;  4CW9 A;  3IBH A;  1XPV A;  1XFL A;  5IPH A;  4BL7 B;  2E2G A;  5CRW A;  4MF5 A;  4KDX A;  3GX8 A;  4EUY A;  3CSH A;  4Z7X A;  1R4W A;  2JSZ A;  1FO5 A;  2QSI A;  2UZ8 A;  4WF4 A;  2FWF A;  4BIK A;  1OKD A;  2YN1 A;  5JCG A;  1NHY A;  1OVN A;  2IME A;  3LWA A;  4XTS A;  2I81 A;  1A2J A;  3KH7 A;  1MDJ A;  2HZE A;  3HA9 A;  1YEP A;  4OO5 A;  5JCW A;  4G0L A;  5H5Q A;  2EFC A;  5DVB A;  3TJK A;  4G9H A;  2V6K A;  1R26 A;  1OC9 B;  2CAQ A;  3S9F A;  3UOM A;  2LNS A;  5FWG A;  5GAN D;  2F8F A;  4F82 A;  1CQG A;  4X1U A;  4PTS A;  4HS1 A;  3FW2 A;  5GSS A;  2E7P A;  4OCF A;  2OAC A;  3HY2 A;  3F3R A;  4KW6 A;  2GZY A;  1BG5 A;  2EFH A;  2YNX A;  4TKY A;  4IQA A;  2VUP A;  2FGX A;  3R3E A;  2HI7 A;  3QFB C;  1S3A A;  2KUC A;  3HKR A;  4I2U A;  4G2E A;  5G5E A;  1O85 A;  2HLS A;  2FHE A;  4E8H A;  2LJR A;  3DVX A;  3RPP A;  5DJM A;  2LRC A;  4BWQ A;  2P5R A;  2H71 A;  5ECQ B;  5F0G A;  4ZBD A;  5B8B A;  2OE3 A;  2XPD A;  4F2I A;  3PR8 A;  3F9U A;  3IAS 2;  3LEF A;  4IGJ A;  5CRD A;  1VGL A;  3W6G A;  2J23 A;  2YOI A;  2WVX A;  1GUL A;  1LBK A;  2FY6 A;  3LG6 A;  1PX7 A;  2DMM A;  4OCE A;  4DSS A;  5INY A;  1PKW A;  2VOC A;  3IK7 A;  3KJY A;  5KOX A;  4EXJ A;  4WR4 A;  2BMX A;  2WUL A;  3FZ9 A;  3PPU A;  2EFE A;  1JFU A;  1XIY A;  1S4B P;  1SEN A;  4H86 A;  1YZX A;  4JBB A;  5DBQ A;  1GTI A;  2WVZ A;  2GLR A;  1TU8 A;  3HVX A;  3FEU A;  3NOF A;  2LQO A;  1ZCP A;  3N5O A;  4FH8 A;  1V40 A;  2FLS A;  3ISO A;  4K0N A;  1GLP A;  2ZNM A;  2DJK A;  2H73 A;  5J47 A;  4GRF A;  4WBR D;  1ABA A;  1PGT A;  3ZVJ D;  3IV4 A;  1ZYQ B;  3IC4 A;  1RW1 A;  4AJ8 A;  3F63 A;  3EVI A;  4KND A;  2FCH A;  1SL0 B;  1PMT A;  1XWG A;  1YDK A;  2VD1 A;  3GUR A;  1M2A A;  2AAW A;  3QDN A;  1EEJ A;  1S3D A;  3CSI A;  2GGT A;  2KLX A;  4RI7 A;  2F9S A;  2TRC P;  2YAN A;  1AW9 A;  2AUV A;  3HD5 A;  2YCD A;  4K2D A;  4KGI A;  1V98 A;  3BOA A;  3GN3 A;  1T4Y A;  4ZB8 A;  4IQ1 A;  3Q74 A;  5HQP A;  3FR6 A;  2HZE B;  4I2T A;  2H74 A;  1GWC A;  4WEY A;  1XVW A;  3GTU A;  1ZMA A;  5ID2 A;  1A23 A;  2HT9 A;  4PGT A;  1WE0 A;  4MJB A;  1DBY A;  2R3X A;  4CDO A;  2CX4 A;  5HFG A;  4BWS A;  2C80 A;  4YQV A;  3TKR A;  4NMU A;  4XS6 A;  3TKS A;  1N25 A;  5ECH B;  2H6Z A;  5G1L A;  1O73 A;  2OT3 A;  1THX A;  3LSZ A;  4Q5N A;  2IIY A;  4O5U A;  2GSQ A;  5G1K A;  2H6X A;  4PNF A;  2WGR A;  3RFR C;  3ERW A;  3TJF A;  4ZB9 A;  1ZGN A;  2YP6 A;  1FVK A;  5LNK e;  3P7X A;  1GUH A;  3CWG A;  2X49 A;  2PER A;  4QL9 A;  1F9M A;  5J4Y A;  1KEB A;  1SD9 A;  4PUR A;  2V1M A;  2A2P A;  4OWY A;  1IYH A;  2DJ3 A;  4DEJ A;  3EU4 A;  1BED A;  4ZL8 A;  2ZUP A;  3US3 A;  2WVX B;  4AKI A;  2H75 A;  3LYP A;  3IAM 2;  4E8E A;  4OO4 A;  2JZR A;  2CQ9 A;  2WB9 A;  2V32 A;  4RQX A;  4ZIJ A;  4ZBA A;  4J57 E;  3KCM A;  3CSJ A;  2NBS A;  3LW9 A;  4GCI A;  3APQ A;  3OR5 A;  1X9S B;  3DKS A;  2X8G A;  1B9Y C;  4PHZ C;  2VCT A;  3FZ5 A;  5A1N A;  4DVC A;  4Z2T A;  4HEA 2;  3ZIV A;  4AJ6 A;  1NHO A;  1PA3 A;  3FRC A;  3O76 A;  5J41 A;  1Z9H A;  4EE0 A;  3TJJ A;  4G19 A;  1OKT A;  1HQO A;  3L9S A;  2DJ0 A;  2OBK A;  3FY7 A;  1GSF A;  4F0B A;  13GS A;  4EDY A;  2VCX A;  1FW1 A;  1FG4 A;  2LRN A;  5GST A;  4K9Z A;  1Z5Y E;  3UBL A;  5LD0 A;  3O3T A;  2CZ3 A;  2GSS A;  1UC7 A;  5JWQ B;  1GH2 A;  3ZZX A;  4WXT A;  2C8U A;  1WP0 A;  2K18 A;  5HR0 A;  3IA1 A;  1GTU A;  1B4P A;  5D9T A;  4DSQ A;  4MH2 A;  3CQF A;  2F3M A;  1W4V A;  4YAV A;  3F0I A;  2O3E A;  1U6T A;  3TOT A;  3CYN A;  3TKS E;  3D21 A;  4GST A;  4L8E A;  2GZP A;  2HSH A;  2H19 A;  3HZ8 A;  1CQH A;  3QMX A;  4GLT A;  2L4Q A;  4KA0 A;  2CVB A;  4AKX B;  2DJ1 A;  3HYP A;  3KP8 A;  4JED A;  19GS A;  1VRS D;  3QCP A;  2KOK A;  2YJ7 A;  3Q18 A;  5D8I A;  4N30 A;  3LXZ A;  3IHG A;  2CZ2 A;  1NM3 A;  3RPN A;  1T4Z A;  3UEM A;  4PI0 C;  1GSE A;  4ZL9 A;  3ED3 A;  1EZK A;  2PBJ A;  3GKK A;  1Q4J A;  4XHM A;  4LA1 A;  3WT1 A;  4FQU A;  3GX0 A;  5IMZ A;  4IHU A;  3UL3 A;  1N8J A;  3GKM A;  4E68 A;  1QXH A;  1OC8 A;  4TVE A;  4WR5 A;  4BPY A;  3ZRE A;  1I1I P;  4PI2 C;  1YKA A;  5DJL A;  3MAK A;  1K3L A;  1DSB A;  4NPB A;  5F05 A;  5ECL B;  2A2S A;  1V57 A;  2VIM A;  4G0K A;  4LMV A;  16GS A;  1OE8 A;  4O7H A;  1XWK A;  2E2M A;  5DCH A;  3TKP A;  2VM1 A;  3D4M A;  1KNG A;  2LTK A;  5C04 A;  4K2X A;  5IMA A;  5DAL A;  3FR9 A;  1K0M A;  1ZYP A;  4MZC A;  3DVW A;  17GS A;  3M1G A;  1OAZ A;  1B4Q A;  3TB2 A;  3G7I A;  2VLU A;  1C72 A;  6GSU A;  4G0I A;  3DEX A;  3CHX C;  1B8X A;  4RUV A;  4GXZ A;  3ZTL A;  4QQ7 A;  2O36 A;  4MA9 A;  1AIU A;  5HR3 A;  3KTB A;  4ISD A;  3TGZ A;  4ZL7 A;  3R2Q A;  1AC1 A;  2LRT A;  2X8C A;  2K8S A;  4TN8 A;  4ULX A;  3BD2 A;  5A5K A;  2ES7 A;  2L59 A;  3FZ4 A;  4IJ3 A;  1GTB A;  2OA7 A;  3F4S A;  4XCS A;  1Z6N A;  1YEX A;  2ZCT A;  1PL1 A;  2OKA A;  1BYE A;  1M9A A;  2GQM A;  5CNW A;  2RM5 A;  1FOH A;  2AJQ B;  1ZZY A;  2O7K A;  4TW5 A;  5KEJ A;  2B7K A;  3TJB A;  2UV8 G;  1ACV A;  4N0Z A;  3GV1 A;  2GDR A;  5IQY A;  3IDV A;  4V2L A;  2ON7 A;  1R5A A;  4JE1 A;  2GT6 A;  4BVX A;  5CRG A;  4XS4 A;  1XXU A;  3GH9 A;  1G7E A;  3ZYW A;  5A1N B;  2WFC A;  3WGX A;  1MDI A;  3GIX A;  5J9C A;  4LLR A;  1PL2 A;  2YV7 A;  1GSD A;  1SKS B;  2V41 A;  1DE1 A;  3BCI A;  1XWA A;  4KUN A;  3RHB A;  1H4O A;  1F3B A;  4POB A;  4AKG A;  3U5R E;  2O5V A;  1M3I A;  1XCC A;  1S3R A;  3UIW A;  1TI3 A;  4TR0 A;  2IN3 A;  2VKZ G;  4TXV A;  4K7N A;  1JZD A;  4MJC A;  2WCI A;  2QA1 A;  2LST A;  2C3N A;  1WIK A;  4IVF A;  3IHQ A;  2JU5 A;  2O89 A;  4D73 A;  4O92 A;  2QC7 A;  2HRF A;  4TRX A;  5B6M A;  3ERG A;  3D22 A;  5D96 A;  1GUM A;  4KSM A;  1I5G A;  3I69 A;  2HYX A;  2G2Q A;  2MMN A;  3VFI A;  4K6X A;  1WOU A;  3GST A;  3CBU A;  3HVN A;  1YVL A;  1YEW C;  5BRT A;  3KMN A;  1F37 A;  4GTU A;  3M3M A;  3ERF A;  4YAP A;  4MCU A;  1ZL9 A;  2WS2 A;  2TIR A;  5F06 A;  3DD3 A;  3LGC A;  1MD4 A;  1TTZ A;  3W8S A;  2R5G A;  3D6I A;  3JCM L;  2PPT A;  2FA8 A;  4FO5 A;  1GTA A;  2PGT A;  1G6Y A;  1SVO A;  1GLQ A;  1YKC A;  4JZQ A;  1R5P A;  4TR4 A;  5G5F A;  2QA2 A;  3KXO A;  5JWO B;  4KDY A;  2FD3 A;  1O81 A;  1HNB A;  3UVT A;  3QAG A;  1A8Y A;  1M7T A;  3L78 A;  4IKH A;  5IM9 A;  2HE3 A;  1QK8 A;  2LEG A;  2A4V A;  4YQU A;  1F2E A;  2X99 A;  1FHE A;  3UAP A;  2GST A;  5IOX A;  2R0C A;  5A4W A;  2AB6 A;  2VO4 A;  2REM A;  5CRH A;  5GAP D;  5KN1 A;  3ZRD A;  1XZO A;  2VCW A;  1K0O A;  1JHB A;  3DGQ A;  3NIV A;  5DAL B;  1W89 A;  4K5R A;  4W66 A;  1JLW A;  3LFL A;  3DIE A;  2O8V B;  2VL9 A;  1TK5 B;  1XG8 A;  4HJM A;  4CY6 A;  3TU3 B;  4MF6 A;  1X5E A;  1BJX A;  3W8J A;  3VUR A;  4L0U A;  3WT2 A;  1TOF A;  3ZFL A;  4BVY A;  1ERV A;  3KZQ A;  1ZYE A;  2I4A A;  4JR4 A;  3FKF A;  1T7P B;  3H8Q A;  1VF1 A;  2VD0 A;  5LCZ A;  2B1K A;  12GS A;  2LUS A;  2MZC A;  2L6D A;  2XHF A;  1PX6 A;  1KTE A;  1G7O A;  2CT6 A;  1PKZ A;  3F4R A;  4WBJ A;  1Y25 A;  2JAD A;  3Q6O A;  2IWT A;  3ZVJ A;  4NHW A;  2GSR A;  1GSQ A;  3GHA A;  1XW9 A;  4FIW A;  1THO A;  1A2L A;  1EOH A;  3GUS A;  1J9B A;  1ERW A;  5HR2 A;  4EO3 A;  5FT3 A;  2FWE A;  3L4N A;  2OE1 A;  5EPF A;  3LXT A;  4BVX B;  4MZB A;  1QUW A;  4XS4 B;  5JCU A;  3HCZ A;  1XOA A;  4ZB7 A;  4WKW A;  3I6A A;  2H30 A;  2VLT A;  4YH2 A;  2V6O A;  3QAW A;  3FZA A;  1LU4 A;  2C1Y A;  3KTL A;  3P8W A;  2EIR A;  2DIZ A;  3VWV A;  2GQK A;  3VLN A;  5JWR B;  5ECN B;  1NSW A;  2WVY A;  1Y6E A;  2C3Q A;  4N0V A;  1X5C A;  4PNG A;  4N3Z A;  5DAK A;  2VL2 A;  2HNL A;  4MP4 A;  3IE3 A;  2LJA A;  3ZLP A;  5EY6 A;  1K3Y A;  3J7Y k;  4OD7 A;  1WRY A;  3GRX A;  3HHV A;  1HD2 A;  3EU3 A;  2FUG 2;  2DJJ A;  2WW2 A;  4D73 B;  3SBC A;  4FXY P;  2C0F A;  3AY8 A;  3GFK A;  4LL1 B;  2BTO T;  2NDO A;  1ON4 A;  3APS A;  1TRU A;  1WJK A;  3ME8 A;  5HFI A;  3RBT A;  2TRX A;  4PUF C;  4I6X A;  2FA4 A;  4ECC A;  2L57 A;  3TRX A;  4K7I A;  5CAX A;  3HZ4 A;  3O6T A;  1IYI A;  1URM A;  2XC2 A;  3L9V A;  4O5R A;  2C0G A;  1QMV A;  3IOS A;  2JAC A;  3MNG A;  3LQ7 A;  1QFN A;  4TOP A;  2YWN A;  2ON5 A;  3ME7 A;  1YF0 A;  3C1R A;  5ECS A;  3BJ5 A;  1TRS A;  3QAV A;  1UVZ A;  2R4V A;  2HRN A;  1O6J A;  2L5O A;  2H1B A;  3WGD A;  2DBC A;  3F3Q A;  4QL7 A;  1K0D A;  2B5Y A;  3GL3 A;  4CHS A;  3RGB C;  1SKW B;  2GZZ A;  4OMV A;  4EC0 A;  3Q19 A;  2F8A A;  3I9V 2;  1N2A A;  3TKQ A;  2VM2 A;  4L0W A;  5CO3 A;  3EUR A;  1YQ1 A;  2Z9S A;  2AYT A;  3PIN A;  10GS A;  2CV4 A;  18GS A;  3WGE A;  1T8E B;  5F07 A;  2IMF A;  1SL2 B;  2H1L A;  2I9H A;  4JRR A;  5GZZ B;  2V2G A;  3FMW A;  2NPB A;  4NWY A;  3N9J A;  4KSO A;  1G6W A;  5EL8 A;  4BVY B;  2VLV A;  5COH A;  1T1V A;  4HOJ A;  4O32 A;  1MD3 A;  3SWL A;  1YF1 A;  1WWJ A;  1RQM A;  4HQS A;  4MLY A;  5CYY A;  5G30 A;  1M99 A;  2OE0 A;  1EEM A;  1WPI A;  2IJY A; 
#chains in the Genus database with same CATH homology
 4N10 A;  2L6C A;  4K0G A;  3LJR A;  2J9H A;  3A2X A;  2NTO A;  1OC3 A;  2FWH A;  1MDK A;  5AIV A;  2B3S A;  5B6N A;  5E59 A;  4I97 A;  3UMA A;  2ALB A;  1EP8 A;  2NVL A;  8GSS A;  1NW2 A;  3G7J A;  4IN0 A;  5ELA A;  3EE2 A;  2YWI A;  1EGR A;  3HJO A;  1TRV A;  5AIS A;  4ECI A;  4ECB A;  4A5P A;  3HJP A;  6GSV A;  1PN9 A;  1PD2 1;  4IS0 A;  4XRD A;  3EPT A;  3GMF A;  4L5O A;  3FHK A;  2PU9 C;  3BCK A;  4KDU A;  2H70 A;  1EOG A;  5J40 A;  4IEL A;  1Q98 A;  2PUK C;  3D4T A;  5HR1 A;  3I43 A;  1U87 A;  2B5X A;  2PVO C;  3FK8 A;  4BA7 A;  5DAK B;  3H4K A;  2RUE A;  1XWC A;  1SK2 A;  4RI6 A;  4V1A p;  2GS3 A;  2HSM B;  3TCO A;  3DYR A;  2EC4 A;  2HSN A;  3H1N A;  3ZFB A;  1VF4 A;  3MYD A;  2HXK A;  3C71 A;  3CXG A;  3EIN A;  1Z7R A;  2H1G A;  3VI7 A;  1FVJ A;  4EIP A;  3D0Z A;  3HVV A;  1UN2 A;  4MZW A;  3MIX A;  2OAD A;  1M0U A;  2VCQ A;  4ZB6 A;  2M80 A;  4AI6 A;  5IMC A;  1XW5 A;  5BMU B;  3GKN A;  6GSX A;  2H1A A;  1XOB A;  4XIH A;  4HI7 A;  1TP9 A;  4I5Q A;  1F3A A;  3QFA C;  2R2J A;  2PMT A;  3VK9 A;  3J7Y b;  4EF0 A;  5IIZ A;  3ZML A;  2VL3 A;  2M46 A;  1TK0 B;  2BJX A;  1BQ7 A;  1M2D A;  2AV4 A;  1JZR A;  4ID0 A;  4IBP A;  1WMJ A;  1B48 A;  1SL1 B;  3IXR A;  4HU9 A;  1O7U A;  3ZMK A;  2PWJ A;  2DIY A;  2YJH A;  1GRX A;  9GSS A;  4GF0 A;  5B8A A;  1V58 A;  2H0G A;  4HZ4 A;  3QPM A;  3QD9 A;  5ECI B;  4TXO A;  2MBS A;  4TR1 A;  1U3A A;  3GNJ A;  5FHI A;  1BX9 A;  1SYX A;  4RQR A;  1TRW A;  1ERT A;  3RHC A;  1TXU A;  2H01 A;  3P2A A;  3RDW A;  5ABR A;  3EYT A;  5A5H A;  2DJ2 A;  4AJ7 A;  1R7H A;  3GKX A;  4OFN A;  4P3Y B;  1MEK A;  4QMK A;  4PUA A;  1TI1 A;  1DUG A;  4WF5 A;  2DC5 A;  1ZOF A;  3CRU A;  2LQQ A;  4O5Q A;  3MSZ A;  5EVO A;  4GSS A;  4MJE A;  4J2F A;  5ENU A;  4ECJ A;  1BF5 A;  3F4T A;  11GS A;  4Z2R A;  3BBY A;  2LNT A;  1SJI A;  4G01 A;  1AQV A;  5IMD A;  3M8N A;  4CY8 A;  5G2Z A;  2EIO A;  2HQT A;  3APO A;  4L5L A;  4K8M A;  4PXO A;  1SU9 A;  1RK4 A;  1XW6 A;  20GS A;  1EWX A;  4N11 A;  3GSS A;  1EGO A;  5HFK A;  1VF2 A;  2JL4 A;  3L0H A;  4X4J A;  3HDC A;  1AQX A;  1EV4 A;  2WJU A;  4EIQ A;  5IMV A;  1A2M A;  22GS A;  1M2B A;  2XBQ A;  4MMM A;  4HZ2 A;  6GSS A;  1ERU A;  4I8B A;  2H0I A;  3IPZ A;  5B7C A;  3VWU A;  1K0C A;  1GSY A;  4MJA A;  4FYB A;  5E4W A;  2G0F A;  4GDF A;  4KB3 A;  1V9W A;  2RM6 A;  2DKH A;  2KP1 A;  1AUC A;  1U3I A;  3LOR A;  1XBS A;  4JU5 A;  2EIQ A;  1Z3E A;  1FAA A;  3NZN A;  1TKD B;  3CTG A;  4ZXG A;  3TOU A;  4MDC A;  1EV9 A;  1X9M B;  2A2R A;  1QGV A;  4V1A g;  5J4V A;  2X64 A;  2M72 A;  3UBK A;  4Q5R A;  3M9J A;  3HXS A;  1SK0 A;  2CAI A;  2OBI A;  3DXB A;  2H6Y A;  3G7Y A;  5KN3 A;  1SK1 A;  2YWO A;  2CX3 A;  1V2A A;  1TK8 B;  4POK A;  1LJR A;  2HSN B;  2RII A;  5J4U A;  1K0B A;  2C3T A;  7GSS A;  2CVD A;  1ZYN A;  1HNA A;  4HJ2 A;  5DQS A;  5A4U A;  4F03 A;  1SJZ A;  3KIJ A;  3EC3 A;  1F6M C;  3A2W A;  2DSA A;  2YZU A;  5IMF A;  5AN1 A;  5KN2 A;  3E9J B;  5C00 A;  2KHP A;  2H1D A;  6GSW A;  2HSY A;  4AF2 A;  2D2Z A;  2N5B A;  1E6B A;  3MDK A;  2L4C A;  2R0G A;  3L9U A;  5AIX A;  1A8L A;  1SVL A;  1QQ2 A;  2C0D A;  3A3T A;  4ML1 A;  4MH3 A;  4X43 A;  1UA5 A;  4YKG A;  1EP7 A;  5KOW A;  3GH6 A;  3D5J A;  5G31 A;  4V2M A;  5CRE A;  3HMJ G;  3GA4 A;  2C4J A;  3DWV A;  14GS A;  1XWB A;  3WD6 A;  4NHZ A;  2IMD A;  1PSQ A;  3LYK A;  2F51 A;  1BAY A;  4POM A;  3K8N A;  2RLI A;  4IW9 A;  2IPA A;  4HQZ A;  1BG1 A;  4USS A;  3MWH A;  4J56 E;  3M0F A;  2P31 A;  3CMI A;  1AXD A;  4F0C A;  1SJ6 A;  1H75 A;  2N5F A;  1OE7 A;  3KP9 A;  3E3E A;  1DE2 A;  3DRN A;  2LS5 A;  1PRX A;  4KE3 A;  2XPE A;  2B6M A;  4JR6 A;  2L5L A;  4TXO B;  1GSS A;  2VCV A;  4TR1 B;  2GVP A;  1G0T A;  2CVK A;  5IO2 A;  3VI5 A;  3U6V A;  2A4H A;  2O85 A;  3EWL A;  4MF7 A;  4Z2U A;  5A5H B;  2R6K A;  4MNN A;  1AQW A;  5H5S A;  2GQL A;  4EVM A;  1J0F A;  4ICY A;  3VPT A;  4ACS A;  2X4A A;  4OFT A;  1FB0 A;  2HSM A;  4NV2 A;  1T00 A;  4ZBB A;  1FOV A;  3TRQ A;  5J3R A;  3CRT A;  5DDL A;  3E0U A;  5ELG A;  1AAZ A;  1JLV A;  1TDI A;  2HRA A;  3FR3 A;  2QKE A;  2LV3 A;  3HJM A;  1GNW A;  1ST9 A;  1A0F A;  2JZT A;  2QGV A;  2FNO A;  2WZ9 A;  2VAF A;  3QR6 A;  1U88 A;  4EL1 A;  2FWG A;  4DSR A;  5A34 A;  3IRA A;  4Q5F A;  2K9F A;  5BMU A;  4KX4 A;  4MK3 A;  5L71 A;  2E0Q A;  2VL2 C;  4KCA A;  3TKS C;  3GYK A;  4KH7 A;  3ZIT A;  4EKZ A;  1T3B A;  2HRK A;  2YWM A;  1GP1 A;  2MMO A;  3CTF A;  1X9W B;  1FB6 A;  1JZW A;  3WYW A;  2MMA A;  5IPG A;  2IL3 A;  4FYU A;  3KMO A;  4XS1 A;  4KCE A;  3RAZ A;  2JSY A;  3H79 A;  2GTU A;  2EFD A;  5D9X A;  3A5I A;  2IFQ A;  1MTC A;  2P5Q A;  1X5D A;  1A24 A;  3F6D A;  1ILO A;  4ML6 A;  2WDU A;  1XVQ A;  3IK9 A;  2O87 A;  2H8L A;  4BL7 A;  4IP1 A;  2YV9 A;  2H0H A;  4PX1 A;  2I1U A;  4F9Z A;  4DSS B;  4GQC A;  1O8X A;  3HVS A;  2HFD A;  4MPG A;  4YKF A;  5D9V A;  3PH9 A;  5H5R A;  3M9K A;  1KBN A;  2VCZ A;  1HYU A;  2HZF A;  4ILF A;  3A5W A;  2K8V A;  5DQY A;  3EMX A;  2CA8 A;  1JZO A;  5ECR B;  2YZH A;  2YPM A;  4KF9 A;  2K6V A;  4LL4 B;  1YJ6 A;  4NXI A;  3KEB A;  1A0R P;  1Z7P A;  2AHE A;  2XBI A;  2N5A A;  4GQF A;  1PN0 A;  4K5S A;  3H93 A;  1OC9 A;  3ZL5 A;  3ZIJ A;  3C1S A;  5DCG A;  1K0N A;  3QOU A;  5J5N A;  3UJ1 A;  2H66 A;  1SYR A;  2IMK A;  3EMP A;  3UVH A;  3V1W A;  1J08 A;  2B7J A;  1E2Y A;  2B5E A;  3VWW A;  5KN0 A;  4PQH A;  1GSU A;  1SVM A;  2LJK A;  3TJG A;  3P90 A;  5A4V A;  2MYG A;  4AKH A;  4HU7 A;  4ZIL A;  3F6F A;  1TXX A;  4GSN A;  4NAX A;  1X0R A;  4EDZ A;  2PVQ A;  3KD0 A;  3G9B A;  3IC8 A;  1GL8 A;  4NV5 A;  4TR3 A;  5D93 A;  1GUK A;  2KP2 A;  5IO0 A;  5ECK B;  4OFM A;  2DML A;  3VPQ A;  3KGK A;  2DLX A;  5CP1 A;  5ECM B;  4XRA A;  3F8U A;  4WET A;  2LKU A;  4FYC A;  3A2V A;  1Z6M A;  5J9B A;  4YQM A;  3GL5 A;  2OJL A;  5F8B A;  4AGS A;  3VWX A;  4X0X A;  3TRP A;  1TJD A;  4IP6 A;  3GTU B;  2R37 A;  5ID2 B;  5ECO B;  1K0A A;  1PQN A;  4LMW A;  4PQ1 A;  2PN8 A;  1I9D A;  2MMZ A;  3C7M A;  1TU7 A;  2JZS A;  4K1F A;  4Q5Q A;  4POL A;  3PGT A;  2WRT A;  3KM6 A;  1S3C A;  4GWR A;  1YY7 A;  4HDE A;  4PQI A;  3UAR A;  5D73 A;  5A34 B;  4K7O A;  2X8H A;  2RUF A;  2H72 A;  6GST A;  1SD8 A;  1M9B A;  1USB A;  5D9W A;  1TW9 A;  2HRK B;  1VF3 A;  6GSY A;  1O8W A;  2H76 A;  2MBT A;  4V2N A;  3IR4 A;  1ML6 A;  3FYG A;  4MAB A;  2P0G A;  1K3O A;  2R0P A;  2IMI A;  3TDG A;  2DKI A;  2I3Y A;  2B1L A;  1SKR B;  1OYJ A;  3C8E A;  2C0E A;  5AGY A;  4G10 A;  1HNC A;  4HUA A;  1GNE A;  1B9X C;  2IFQ B;  2GT5 A;  3C73 A;  4IJI A;  1Y1U A;  4KAE A;  3TUE A;  3DML A;  3KH9 A;  4MPF A;  5ECP B;  5IOW A;  4CW9 A;  3IBH A;  1XPV A;  1XFL A;  5IPH A;  4BL7 B;  2E2G A;  5CRW A;  4MF5 A;  4KDX A;  3GX8 A;  4EUY A;  3CSH A;  4Z7X A;  1R4W A;  2JSZ A;  1FO5 A;  2QSI A;  2UZ8 A;  4WF4 A;  2FWF A;  1OKD A;  2YN1 A;  5JCG A;  1NHY A;  1OVN A;  2IME A;  3LWA A;  4XTS A;  2I81 A;  1A2J A;  3KH7 A;  1MDJ A;  2HZE A;  3HA9 A;  1YEP A;  4OO5 A;  5JCW A;  4G0L A;  5H5Q A;  2EFC A;  5DVB A;  3TJK A;  4G9H A;  2V6K A;  1R26 A;  1OC9 B;  2CAQ A;  3S9F A;  3UOM A;  2LNS A;  5FWG A;  5GAN D;  2F8F A;  4F82 A;  1CQG A;  4X1U A;  4PTS A;  4HS1 A;  3FW2 A;  5GSS A;  2E7P A;  4OCF A;  2OAC A;  3HY2 A;  3F3R A;  4KW6 A;  2GZY A;  1BG5 A;  2EFH A;  2YNX A;  4TKY A;  4IQA A;  2VUP A;  2FGX A;  3R3E A;  2HI7 A;  3QFB C;  1S3A A;  2KUC A;  3HKR A;  4I2U A;  4G2E A;  5G5E A;  1O85 A;  2HLS A;  2FHE A;  4E8H A;  2LJR A;  3DVX A;  3RPP A;  5DJM A;  2LRC A;  4BWQ A;  2P5R A;  2H71 A;  5ECQ B;  5F0G A;  4ZBD A;  5B8B A;  2OE3 A;  2XPD A;  4F2I A;  3PR8 A;  3F9U A;  3IAS 2;  3LEF A;  4IGJ A;  5CRD A;  1VGL A;  3W6G A;  2J23 A;  2YOI A;  1GUL A;  1LBK A;  2FY6 A;  3LG6 A;  1PX7 A;  2DMM A;  4OCE A;  4DSS A;  5INY A;  1PKW A;  2VOC A;  3IK7 A;  3KJY A;  5KOX A;  4EXJ A;  4WR4 A;  2BMX A;  2WUL A;  3FZ9 A;  3PPU A;  2EFE A;  1JFU A;  1XIY A;  1SEN A;  4H86 A;  1YZX A;  4JBB A;  5DBQ A;  1GTI A;  2GLR A;  1TU8 A;  3HVX A;  3FEU A;  3NOF A;  2LQO A;  1ZCP A;  3N5O A;  4FH8 A;  1V40 A;  2FLS A;  3ISO A;  4K0N A;  1GLP A;  2ZNM A;  2DJK A;  2H73 A;  5J47 A;  4GRF A;  4WBR D;  1ABA A;  1PGT A;  3ZVJ D;  3IV4 A;  1ZYQ B;  3IC4 A;  1RW1 A;  4AJ8 A;  3F63 A;  3EVI A;  4KND A;  2FCH A;  1SL0 B;  1PMT A;  1XWG A;  1YDK A;  2VD1 A;  3GUR A;  1M2A A;  2AAW A;  3QDN A;  1EEJ A;  1S3D A;  3CSI A;  2GGT A;  2KLX A;  4RI7 A;  2F9S A;  2TRC P;  2YAN A;  1AW9 A;  2AUV A;  3HD5 A;  2YCD A;  4K2D A;  4KGI A;  1V98 A;  3BOA A;  3GN3 A;  1T4Y A;  4ZB8 A;  4IQ1 A;  3Q74 A;  5HQP A;  3FR6 A;  2HZE B;  4I2T A;  2H74 A;  1GWC A;  4WEY A;  1XVW A;  3GTU A;  1ZMA A;  5ID2 A;  1A23 A;  2HT9 A;  4PGT A;  1WE0 A;  4MJB A;  1DBY A;  2R3X A;  4CDO A;  2CX4 A;  5HFG A;  4BWS A;  2C80 A;  4YQV A;  3TKR A;  4NMU A;  4XS6 A;  3TKS A;  1N25 A;  5ECH B;  2H6Z A;  5G1L A;  1O73 A;  2OT3 A;  1THX A;  3LSZ A;  4Q5N A;  2IIY A;  4O5U A;  2GSQ A;  5G1K A;  2H6X A;  4PNF A;  2WGR A;  3ERW A;  3TJF A;  4ZB9 A;  1ZGN A;  2YP6 A;  1FVK A;  5LNK e;  3P7X A;  1GUH A;  3CWG A;  2X49 A;  2PER A;  4QL9 A;  1F9M A;  5J4Y A;  1KEB A;  1SD9 A;  4PUR A;  2V1M A;  2A2P A;  4OWY A;  1IYH A;  2DJ3 A;  4DEJ A;  3EU4 A;  1BED A;  4ZL8 A;  2ZUP A;  3US3 A;  4AKI A;  2H75 A;  3LYP A;  3IAM 2;  4E8E A;  4OO4 A;  2JZR A;  2CQ9 A;  2WB9 A;  2V32 A;  4RQX A;  4ZIJ A;  4ZBA A;  4J57 E;  3KCM A;  3CSJ A;  2NBS A;  3LW9 A;  4GCI A;  3APQ A;  3OR5 A;  1X9S B;  3DKS A;  2X8G A;  1B9Y C;  2VCT A;  3FZ5 A;  5A1N A;  4DVC A;  4Z2T A;  4HEA 2;  3ZIV A;  4AJ6 A;  1NHO A;  1PA3 A;  3FRC A;  3O76 A;  5J41 A;  1Z9H A;  4EE0 A;  3TJJ A;  4G19 A;  1OKT A;  1HQO A;  3L9S A;  2DJ0 A;  2OBK A;  3FY7 A;  1GSF A;  4F0B A;  13GS A;  4EDY A;  2VCX A;  1FW1 A;  1FG4 A;  2LRN A;  5GST A;  4K9Z A;  1Z5Y E;  3UBL A;  5LD0 A;  3O3T A;  2CZ3 A;  2GSS A;  1UC7 A;  5JWQ B;  1GH2 A;  3ZZX A;  4WXT A;  2C8U A;  1WP0 A;  2K18 A;  5HR0 A;  3IA1 A;  1GTU A;  1B4P A;  5D9T A;  4DSQ A;  4MH2 A;  2F3M A;  1W4V A;  4YAV A;  3F0I A;  1U6T A;  3TOT A;  3CYN A;  3TKS E;  3D21 A;  4GST A;  4L8E A;  2GZP A;  2HSH A;  2H19 A;  3HZ8 A;  1CQH A;  3QMX A;  4GLT A;  2L4Q A;  4KA0 A;  2CVB A;  4AKX B;  2DJ1 A;  3HYP A;  3KP8 A;  4JED A;  19GS A;  1VRS D;  3QCP A;  2KOK A;  2YJ7 A;  3Q18 A;  5D8I A;  4N30 A;  3LXZ A;  3IHG A;  2CZ2 A;  1NM3 A;  3RPN A;  1T4Z A;  3UEM A;  1GSE A;  4ZL9 A;  3ED3 A;  1EZK A;  2PBJ A;  3GKK A;  1Q4J A;  4XHM A;  4LA1 A;  3WT1 A;  4FQU A;  3GX0 A;  5IMZ A;  4IHU A;  3UL3 A;  1N8J A;  4E68 A;  3GKM A;  1QXH A;  1OC8 A;  4TVE A;  4WR5 A;  4BPY A;  3ZRE A;  1YKA A;  5DJL A;  3MAK A;  1K3L A;  1DSB A;  4NPB A;  5F05 A;  5ECL B;  2A2S A;  1V57 A;  2VIM A;  4G0K A;  4LMV A;  16GS A;  1OE8 A;  4O7H A;  1XWK A;  2E2M A;  5DCH A;  3TKP A;  2VM1 A;  3D4M A;  1KNG A;  2LTK A;  5C04 A;  4K2X A;  5IMA A;  5DAL A;  3FR9 A;  1K0M A;  1ZYP A;  4MZC A;  3DVW A;  17GS A;  3M1G A;  1OAZ A;  1B4Q A;  3TB2 A;  3G7I A;  2VLU A;  1C72 A;  6GSU A;  4G0I A;  3DEX A;  1B8X A;  4RUV A;  4GXZ A;  3ZTL A;  4QQ7 A;  4MA9 A;  1AIU A;  5HR3 A;  3KTB A;  4ISD A;  3TGZ A;  4ZL7 A;  3R2Q A;  1AC1 A;  2LRT A;  2X8C A;  2K8S A;  4TN8 A;  4ULX A;  3BD2 A;  5A5K A;  2ES7 A;  2L59 A;  3FZ4 A;  4IJ3 A;  1GTB A;  2OA7 A;  3F4S A;  4XCS A;  1Z6N A;  1YEX A;  2ZCT A;  1PL1 A;  2OKA A;  1BYE A;  1M9A A;  2GQM A;  5CNW A;  2RM5 A;  1FOH A;  2AJQ B;  1ZZY A;  2O7K A;  4TW5 A;  5KEJ A;  2B7K A;  3TJB A;  2UV8 G;  1ACV A;  4N0Z A;  3GV1 A;  2GDR A;  5IQY A;  3IDV A;  4V2L A;  2ON7 A;  1R5A A;  4JE1 A;  2GT6 A;  4BVX A;  5CRG A;  4XS4 A;  1XXU A;  3GH9 A;  1G7E A;  3ZYW A;  5A1N B;  2WFC A;  3WGX A;  1MDI A;  3GIX A;  5J9C A;  4LLR A;  1PL2 A;  2YV7 A;  1GSD A;  1SKS B;  2V41 A;  1DE1 A;  3BCI A;  1XWA A;  4KUN A;  3RHB A;  1H4O A;  1F3B A;  4POB A;  4AKG A;  3U5R E;  2O5V A;  1XCC A;  3UIW A;  1TI3 A;  4TR0 A;  2IN3 A;  2VKZ G;  4TXV A;  4K7N A;  1JZD A;  4MJC A;  2WCI A;  2QA1 A;  2LST A;  2C3N A;  1WIK A;  4IVF A;  3IHQ A;  2JU5 A;  2O89 A;  4D73 A;  4O92 A;  2QC7 A;  2HRF A;  4TRX A;  5B6M A;  3ERG A;  3D22 A;  5D96 A;  1GUM A;  4KSM A;  1I5G A;  3I69 A;  2HYX A;  2G2Q A;  2MMN A;  3VFI A;  4K6X A;  1WOU A;  3GST A;  3CBU A;  1YVL A;  5BRT A;  3KMN A;  1F37 A;  4GTU A;  3M3M A;  3ERF A;  4YAP A;  4MCU A;  1ZL9 A;  2WS2 A;  2TIR A;  5F06 A;  3DD3 A;  3LGC A;  1MD4 A;  1TTZ A;  3W8S A;  2R5G A;  3D6I A;  3JCM L;  2PPT A;  2FA8 A;  4FO5 A;  1GTA A;  2PGT A;  1G6Y A;  1SVO A;  1GLQ A;  1YKC A;  4JZQ A;  1R5P A;  4TR4 A;  5G5F A;  2QA2 A;  3KXO A;  5JWO B;  4KDY A;  2FD3 A;  1O81 A;  1HNB A;  3UVT A;  3QAG A;  1A8Y A;  1M7T A;  3L78 A;  4IKH A;  5IM9 A;  2HE3 A;  1QK8 A;  2LEG A;  2A4V A;  4YQU A;  1F2E A;  2X99 A;  1FHE A;  3UAP A;  2GST A;  5IOX A;  2R0C A;  5A4W A;  2AB6 A;  2VO4 A;  2REM A;  5CRH A;  5GAP D;  5KN1 A;  3ZRD A;  1XZO A;  2VCW A;  1K0O A;  1JHB A;  3DGQ A;  3NIV A;  5DAL B;  1W89 A;  4K5R A;  4W66 A;  1JLW A;  3LFL A;  3DIE A;  2O8V B;  2VL9 A;  1TK5 B;  4HJM A;  4CY6 A;  3TU3 B;  4MF6 A;  1X5E A;  1BJX A;  3W8J A;  3VUR A;  4L0U A;  3WT2 A;  1TOF A;  3ZFL A;  4BVY A;  1ERV A;  3KZQ A;  1ZYE A;  2I4A A;  4JR4 A;  3FKF A;  1T7P B;  3H8Q A;  1VF1 A;  2VD0 A;  5LCZ A;  2B1K A;  12GS A;  2LUS A;  2MZC A;  2L6D A;  2XHF A;  1PX6 A;  1KTE A;  1G7O A;  2CT6 A;  1PKZ A;  3F4R A;  4WBJ A;  1Y25 A;  2JAD A;  3Q6O A;  2IWT A;  3ZVJ A;  4NHW A;  2GSR A;  1GSQ A;  3GHA A;  1XW9 A;  4FIW A;  1THO A;  1A2L A;  1EOH A;  3GUS A;  1J9B A;  1ERW A;  5HR2 A;  4EO3 A;  5FT3 A;  2FWE A;  3L4N A;  2OE1 A;  5EPF A;  3LXT A;  4BVX B;  4MZB A;  1QUW A;  4XS4 B;  5JCU A;  3HCZ A;  1XOA A;  4ZB7 A;  4WKW A;  3I6A A;  2H30 A;  2VLT A;  4YH2 A;  2V6O A;  3QAW A;  3FZA A;  1LU4 A;  2C1Y A;  3KTL A;  3P8W A;  2EIR A;  2DIZ A;  3VWV A;  2GQK A;  3VLN A;  5JWR B;  5ECN B;  1NSW A;  1Y6E A;  2C3Q A;  4N0V A;  1X5C A;  4PNG A;  4N3Z A;  5DAK A;  2VL2 A;  2HNL A;  4MP4 A;  3IE3 A;  2LJA A;  3ZLP A;  5EY6 A;  1K3Y A;  3J7Y k;  4OD7 A;  1WRY A;  3GRX A;  3HHV A;  1HD2 A;  3EU3 A;  2FUG 2;  2DJJ A;  4D73 B;  3SBC A;  2C0F A;  3AY8 A;  3GFK A;  4LL1 B;  2BTO T;  2NDO A;  1ON4 A;  3APS A;  1TRU A;  1WJK A;  3ME8 A;  5HFI A;  3RBT A;  2TRX A;  4PUF C;  4I6X A;  2FA4 A;  4ECC A;  2L57 A;  3TRX A;  4K7I A;  5CAX A;  3HZ4 A;  3O6T A;  1IYI A;  1URM A;  3L9V A;  2XC2 A;  4O5R A;  2C0G A;  1QMV A;  3IOS A;  2JAC A;  3MNG A;  3LQ7 A;  1QFN A;  4TOP A;  2YWN A;  2ON5 A;  3ME7 A;  1YF0 A;  3C1R A;  5ECS A;  3BJ5 A;  1TRS A;  3QAV A;  1UVZ A;  2R4V A;  2HRN A;  1O6J A;  2L5O A;  2H1B A;  3WGD A;  2DBC A;  3F3Q A;  4QL7 A;  1K0D A;  2B5Y A;  3GL3 A;  4CHS A;  1SKW B;  2GZZ A;  4OMV A;  4EC0 A;  3Q19 A;  2F8A A;  3I9V 2;  1N2A A;  3TKQ A;  2VM2 A;  4L0W A;  5CO3 A;  3EUR A;  1YQ1 A;  2Z9S A;  2AYT A;  3PIN A;  10GS A;  2CV4 A;  18GS A;  3WGE A;  1T8E B;  5F07 A;  2IMF A;  1SL2 B;  2H1L A;  2I9H A;  4JRR A;  5GZZ B;  2V2G A;  3FMW A;  2NPB A;  4NWY A;  3N9J A;  4KSO A;  1G6W A;  5EL8 A;  4BVY B;  2VLV A;  5COH A;  1T1V A;  4HOJ A;  4O32 A;  1MD3 A;  3SWL A;  1YF1 A;  1WWJ A;  1RQM A;  4HQS A;  4MLY A;  5CYY A;  5G30 A;  1M99 A;  2OE0 A;  1EEM A;  1WPI A;  2IJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...