1LBKA

Crystal structure of a recombinant glutathione transferase, created by replacing the last seven residues of each subunit of the human class pi isoenzyme with the additional c-terminal helix of human class alpha isoenzyme
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
208
structure length
208
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPMDEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase class pi chimaera (CODA)
publication title Engineering a new C-terminal tail in the H-site of human glutathione transferase P1-1: structural and functional consequences.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1lbkA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1lbkA01
3FHKA 4QL7A 2B1LA 1ERVA 3KP8A 4F9ZA 1M7TA 4KSMA 4V2MA 3HZ8A 5DQYA 1X9SB 4ZL8A 1XZOA 1UA5A 4XHMA 2XC2A 2YWNA 2GZZA 9GSSA 2KLXA 3QD9A 2LJAA 3KD0A 1S3DA 12GSA 2JSZA 3KTLA 3ZTLA 1GWCA 4MJBA 2NTOA 11GSA 2HZEA 2EIRA 2VAFA 2VCTA 1GLPA 4JR6A 1X5DA 3TJJA 2FD3A 1XBSA 1JZDA 2FA8A 3ZREA 1XW9A 2RM5A 3QDNA 6GSSA 4NV5A 5J9BA 3KCMA 3ZFBA 2VL2C 2K9FA 2YWIA 2JZSA 4XTSA 5HQPA 3BCKA 1A8YA 2VD0A 2ZNMA 2OJLA 4RI7A 7GSSA 1YQ1A 3F4TA 1F3AA 5DCGA 3UARA 4KE3A 3I69A 3KZQA 1K0CA 1F2EA 3AY8A 3FR3A 4JZQA 5G2ZA 4IN0A 3FYGA 2PMTA 4GF0A 1G7OA 4HOJA 2CVKA 1OE7A 1NHOA 2PERA 1YKCA 4F82A 2YWMA 2N5AA 5B6NA 1BX9A 1IYIA 4ZB6A 1TW9A 1K0AA 1U3IA 2E0QA 2DJ1A 4GSNA 2IN3A 2CVBA 1A2JA 3MAKA 2AHEA 2GS3A 1ON4A 1NW2A 4FH8A 2AYTA 1SL1B 2GVPA 5B7CA 1F6MC 4G10A 3UBLA 2L59A 1K0DA 3RHBA 1O8XA 2KUCA 3VI7A 2CZ3A 2PN8A 1KNGA 1SL0B 3KXOA 4PX1A 4HEA2 2AUVA 5IMZA 3J7Yb 1ABAA 3ZVJD 4Z7XA 1SD8A 2GQKA 3LG6A 4X0XA 2VCQA 3QAWA 3ZIJA 3PINA 2CVDA 4PURA 5LCZA 1ACVA 1E6BA 1TI1A 2GSTA 3H93A 3C1SA 5DBQA 1PN9A 6GSUA 5IO0A 1BG5A 1JZOA 4OO5A 2OE1A 2FLSA 2H6YA 2YN1A 4TVEA 5IPGA 2ON5A 3HVVA 4TOPA 4K2DA 3BCIA 1M2AA 3HHVA 6GSXA 1HD2A 2X8CA 1F37A 5CRHA 2B5YA 1WP0A 2N5FA 4AJ6A 1WJKA 2GGTA 1C72A 2NVLA 2H73A 4PXOA 2KP2A 4WEYA 4PNFA 5CP1A 2YANA 5H5RA 3ZMLA 1DBYA 4XRAA 1EV4A 2R3XA 1YKAA 3DEXA 1GNWA 4ID0A 3HZ4A 3D0ZA 2YWOA 5LNKe 4EC0A 3W6GA 4RI6A 4EKZA 2HSNB 1EOGA 4MF6A 1A24A 5JCUA 1YEPA 5DQSA 3UAPA 4ILFA 4WF4A 4KH7A 1WWJA 1SJIA 4I97A 1QK8A 3KTBA 2ZUPA 1USBA 2FY6A 4K0NA 2WS2A 2GLRA 2UZ8A 3VWXA 3GUSA 4MDCA 1B4QA 3N9JA 5F06A 1GNEA 3TJGA 3HDCA 3FZ5A 1PKWA 2VCXA 1JZWA 2LQOA 4OD7A 1OC3A 2I1UA 5G30A 4XIHA 3FKFA 4EO3A 4Q5RA 1S3AA 2HI7A 5JCGA 1RW1A 1VGLA 3FR6A 4POLA 2FWGA 3C8EA 4XCSA 4O7HA 1M0UA 6GSYA 5ID2B 3TOUA 1TXXA 2HRFA 2GZYA 5D93A 10GSA 1TDIA 5J3RA 3DKSA 4LA1A 4K7IA 3CSIA 2V2GA 4K1FA 4DEJA 2H66A 2H71A 3FY7A 5CRGA 5DCHA 4KB3A 3Q18A 3EURA 3IOSA 3DIEA 1E2YA 3D22A 3HA9A 4POKA 5AN1A 2B5XA 4KF9A 4OMVA 4PQIA 4MMMA 4ULXA 2H75A 4USSA 4DSRA 5HR1A 4ZXGA 3WGDA 5DJLA 3E0UA 3ZIVA 4KDXA 1HNCA 4MF5A 1I5GA 3GNJA 4HUAA 5ECQB 2OADA 1GSYA 2X8GA 2V6KA 1WIKA 1EZKA 1ZGNA 3TOTA 4MPFA 3R3EA 1U87A 3UBKA 2I9HA 1GSFA 3PH9A 1T1VA 1BYEA 2P31A 3DGQA 3GYKA 3ERGA 5DALB 1PL2A 5ABRA 1JLWA 2DMLA 3TCOA 3TJFA 2DJJA 5KN1A 1WE0A 2C0GA 1PQNA 1O85A 17GSA 2YV9A 1ZOFA 1KEBA 3RBTA 3M0FA 1UC7A 4J57E 20GSA 1MD4A 4IP1A 5ECOB 3C71A 5C04A 3RDWA 1T4YA 3A3TA 5ID2A 2MYGA 3L9UA 4MJCA 5B8BA 3O3TA 1TI3A 2JSYA 2V41A 4BA7A 5G5FA 4MH3A 2CX4A 3FZAA 3G7JA 1ILOA 3QFBC 2DJKA 1B9YC 4K7NA 4FQUA 1MD3A 4RQXA 1Z7PA 4GWRA 3VWUA 4MJAA 1FHEA 3CRTA 4MA9A 3TKSE 5CAXA 2OE0A 1XOBA 4TR4A 1QQ2A 3TDGA 3LYKA 3ME8A 3I9V2 5J4UA 2M72A 4HU9A 2LTKA 2ALBA 1NHYA 1YJ6A 4YQMA 1XW6A 1ZCPA 2GDRA 3D21A 5ECHB 3QAVA 2DJ0A 1K0BA 4L5OA 1QXHA 3HD5A 1U88A 1LBKA 5G5EA 1BEDA 5DALA 3HJOA 1YF0A 2QSIA 4G9HA 2CAIA 4MZCA 2VL3A 4TR0A 4XS4B 5ELAA 4MPGA 1J9BA 1V2AA 4HJMA 1ZYEA 3ZRDA 3VLNA 2VCWA 2IMIA 4I2UA 4IW9A 3F63A 5ECPB 4KSOA 3LXZA 2NDOA 3LYPA 5ECKB 3VWVA 4V1Ap 3RHCA 4L5LA 3KMNA 2BJXA 4TW5A 2HFDA 3ED3A 5G1KA 3VPQA 3Q19A 3W8JA 3GURA 4KCEA 5D9TA 4LLRA 1B4PA 3QAGA 2R5GA 2JU5A 1QFNA 4H86A 1T00A 2C3NA 1OC9B 5CO3A 4AGSA 2PVQA 3APOA 3FR9A 4LL4B 2VUPA 2HRNA 1F3BA 1W89A 5JWRB 2LSTA 1X5EA 2LNTA 5INYA 5FHIA 2O87A 6GSWA 1OAZA 3QFAC 4KNDA 4NHZA 2IL3A 5HR2A 2DMMA 1A0FA 3F4SA 1JLVA 5A4WA 3GX0A 2FA4A 4GSSA 3TGZA 4V2NA 3GL3A 1T3BA 1CQHA 4HZ2A 3QOUA 5GAND 1PRXA 1K3LA 2XPEA 2TRCP 2G0FA 1AAZA 2WGRA 3TRPA 3SBCA 3LXTA 3KEBA 2B3SA 5D96A 4O32A 5C00A 2GT5A 2WZ9A 4KUNA 4K8MA 3L9SA 4L0WA 3NIVA 1O8WA 2H1DA 4XS4A 3GV1A 3UVTA 3HKRA 3Q6OA 3EMPA 3WYWA 2C4JA 1GTBA 2I81A 2WJUA 1YDKA 4YAVA 4OO4A 2PBJA 4F0BA 4ECIA 3S9FA 2WULA 1XWBA 4D73B 3A2XA 3GX8A 1DE1A 3L78A 2L5OA 1X9WB 1PSQA 4N30A 4IJIA 3GH6A 2VO4A 1ML6A 3V1WA 4BPYA 1ST9A 1OC9A 4MK3A 2P5QA 3HVSA 4MH2A 1V40A 1GTIA 5A4VA 2H30A 4TN8A 1FVJA 4OFMA 2KP1A 2H1GA 2QKEA 1Z3EA 2JADA 5ECSA 3KMOA 2L6DA 2O89A 4CHSA 1AQVA 1URMA 2K6VA 1AUCA 3W8SA 1TP9A 3Q74A 4PUAA 2L4CA 1B48A 3IA1A 2K8SA 3IAS2 2EIQA 1TU7A 2RUFA 3IAM2 4ECJA 4I6XA 2MMOA 2DIYA 2HSHA 1UVZA 2F9SA 3GRXA 2OA7A 3IHQA 1SJ6A 1V9WA 2LRNA 1EP8A 2BTOT 2L5LA 1A2MA 3EVIA 4WBRD 1S3CA 3DD3A 4DSSA 1K0MA 3KH9A 3GH9A 1X0RA 3LWAA 1O81A 3GMFA 3IPZA 1M2DA 4TR3A 5J9CA 3GN3A 4LMWA 5ECLB 4GLTA 3C7MA 5AGYA 2H19A 5F0GA 4V1Ag 1FAAA 2MMZA 1PL1A 3LQ7A 1Z5YE 8GSSA 4HZ4A 5ECRB 4YQVA 2E7PA 2E2MA 2HLSA 1DE2A 1GUHA 2L57A 3GSTA 3F9UA 5EY6A 2H01A 2FGXA 2H72A 3ZITA 4D73A 4MP4A 2LJKA 3JCML 3F8UA 1XWGA 2F51A 3GKNA 5IMVA 2HZFA 1THXA 2WFCA 5F05A 5B8AA 2AV4A 3HCZA 2FWFA 3HJMA 4MJEA 3GIXA 1XWCA 3CTGA 2C3QA 3TRQA 1WOUA 2Z9SA 3M3MA 1M99A 1PA3A 5DVBA 4V2LA 4ZL9A 3DWVA 5IMAA 3A5WA 3P8WA 1EGOA 3IRAA 4X43A 3N5OA 1G6WA 5KEJA 2QGVA 4PQHA 4WXTA 4TRXA 2PWJA 3ME7A 3CBUA 3G7IA 2X64A 4YH2A 2E2GA 5HR0A 5CREA 3RAZA 4F2IA 1V57A 2HE3A 3ISOA 4HQSA 1Z6NA 1YF1A 4CW9A 4EUYA 5A4UA 2DBCA 3QPMA 2HQTA 4GCIA 1R4WA 3LJRA 2LQQA 1HYUA 1GSSA 5KN0A 2B6MA 1IYHA 2YPMA 2VLUA 2FHEA 2LUSA 5JCWA 3TKSA 4ECBA 3F3QA 3E9JB 2GQLA 5F8BA 2AB6A 3ERFA 4TXVA 3GTUB 4GRFA 1Z9HA 2DC5A 1ERWA 2LEGA 5LD0A 2OBKA 3H4KA 3C73A 2OACA 1AIUA 3UJ1A 1AQWA 2MBTA 5F07A 4K7OA 3WT1A 1I9DA 4PTSA 2WDUA 5D9XA 5EL8A 3EWLA 3GSSA 1EP7A 4JR4A 3GA4A 4POBA 1TRWA 5KN2A 5G31A 4XRDA 1SKRB 1SD9A 1JHBA 3F6DA 2AAWA 4WKWA 4MZWA 2REMA 1VF4A 5IM9A 2F8AA 2C0FA 3O76A 4MF7A 5D8IA 4EDYA 1QMVA 2VL9A 2V6OA 1A0RP 1R26A 1R5PA 2PU9C 3RPNA 4X1UA 2NPBA 3CTFA 4DSQA 2FCHA 3TB2A 2H0GA 2VCVA 2C80A 3F4RA 5COHA 3US3A 1K3OA 1SKWB 2DJ3A 2HYXA 3TJKA 4F03A 1N8JA 2CQ9A 1J0FA 1PD21 5FWGA 1XOAA 2X8HA 3U6VA 1DUGA 1GH2A 2X99A 4LL1B 2ES7A 3HJPA 1TOFA 2DSAA 3TRXA 4JRRA 2LS5A 1Y25A 2YJ7A 1H75A 4JU5A 1ZZYA 1O7UA 2VL2A 3C1RA 2H6ZA 5HFIA 2LKUA 5IQYA 3TKQA 1U3AA 4Q5NA 2IMDA 1TK0B 3PGTA 5DAKB 3WT2A 3GTUA 3EE2A 2H0HA 2H76A 3IC4A 1LJRA 4G0IA 1ZYQB 1OKTA 3OR5A 3IXRA 1A8LA 1QGVA 1B9XC 1YEXA 4NPBA 4BVYB 2O85A 1GTAA 1Z7RA 3H8QA 2KHPA 1ZMAA 4CDOA 1A2LA 4EF0A 3ZZXA 4FYBA 4ZB8A 3LEFA 4NMUA 1VRSD 4ACSA 1XCCA 2ZCTA 3DYRA 3RPPA 1TK5B 2IFQA 1O73A 18GSA 1PMTA 3MSZA 2GSSA 3F6FA 2EC4A 4MZBA 2CA8A 1ERTA 1G6YA 3GHAA 5DDLA 1SJZA 1XVWA 5B6MA 3BOAA 4FO5A 1HNAA 4ZBDA 2C8UA 2MMAA 2HT9A 1KBNA 4KW6A 4NV2A 3EYTA 2ON7A 4PQ1A 5EPFA 3EU4A 3CSJA 4L0UA 1Q98A 4TKYA 4LMVA 1KTEA 4IHUA 3TUEA 2B1KA 3LSZA 5ECMB 2A2SA 3NZNA 3CRUA 4ML1A 1V58A 4ISDA 2HSYA 16GSA 19GSA 3P7XA 5DAKA 1YZXA 2A2RA 1W4VA 2MBSA 3CSHA 1M9BA 4G2EA 3IK7A 1K3YA 4EDZA 2KOKA 1AQXA 3IDVA 1EV9A 3I6AA 4BVYA 3VWWA 3KIJA 3U5RE 5J41A 1WMJA 5IMDA 2RUEA 2M46A 1TKDB 2GTUA 4GXZA 1FB0A 2PPTA 5HR3A 2VIMA 3GKKA 4K9ZA 5CRDA 1X5CA 1WRYA 3L4NA 4EL1A 4WBJA 3WD6A 1WPIA 4I8BA 5ECIB 4E8HA 4OCFA 4O5RA 4HDEA 3DMLA 1SENA 1H4OA 5ELGA 2H1BA 1SK2A 4KX4A 1TRVA 2QC7A 3P90A 1EEJA 4HS1A 1GLQA 4DSSB 5H5SA 3GKXA 1O6JA 4ZIJA 3I43A 1MDKA 1GUKA 2XBQA 2YNXA 1GULA 2IMEA 2JZTA 4GSTA 2B7KA 5D73A 3H1NA 2YOIA 2B7JA 3LGCA 3L0HA 3O6TA 2DLXA 1TU8A 1GTUA 4J56E 2IIYA 5IOWA 2CZ2A 4PNGA 2YZHA 2IWTA 4OCEA 4HJ2A 3NOFA 4IVFA 4DVCA 1LU4A 2MMNA 4FIWA 1XWAA 5G1LA 2VM2A 3ZMKA 1EWXA 4TR1A 2I3YA 1XPVA 3QMXA 4ECCA 2I4AA 4XS1A 5DJMA 1GSDA 1DSBA 2LRCA 3SWLA 2D2ZA 5AISA 3DVWA 3IE3A 3DXBA 4IELA 2IPAA 3D4TA 3GL5A 3F0IA 2LV3A 3ZLPA 5JWOB 4G19A 5GSSA 2F3MA 1FG4A 4J2FA 1FVKA 4POMA 1A23A 3IR4A 4GQFA 2FWHA 2L6CA 4ZL7A 2P5RA 1PX7A 2IMKA 5KN3A 2J9HA 1T8EB 2CAQA 1PKZA 4GTUA 2OBIA 5IOXA 6GSTA 3TKRA 3GFKA 3UVHA 2WRTA 2H6XA 2H70A 4WETA 1K0OA 1Q4JA 2JACA 3KJYA 4N10A 4EXJA 13GSA 1AC1A 4KA0A 2H1AA 1ZL9A 1FW1A 2K8VA 4NAXA 1M9AA 3PPUA 2P0GA 2F8FA 4MCUA 1G0TA 4FYCA 2LNSA 2R4VA 2TIRA 3KP9A 4Q5FA 3DRNA 1RQMA 4KAEA 5JWQB 4YAPA 2HNLA 1T7PB 4WR4A 4IGJA 4HI7A 1MTCA 2VM1A 1SKSB 2PUKC 1SU9A 4IS0A 3VFIA 4OWYA 5AIVA 2HSMB 4QL9A 4N0ZA 3ZYWA 4BWSA 2GT6A 5CYYA 4I5QA 1XWKA 1OYJA 4N11A 3M9JA 3APSA 2A4VA 2VLTA 4WR5A 3DVXA 2GZPA 4BL7B 3UIWA 1Y6EA 2CX3A 5CNWA 3VURA 1R7HA 4Q5QA 3D5JA 4PGTA 3R2QA 4KDUA 2CT6A 3EC3A 4IP6A 3UEMA 4P3YB 1T4ZA 3ZVJA 3ZFLA 2OKAA 1M2BA 1TJDA 3CXGA 4L8EA 4F0CA 1GRXA 3FK8A 3L9VA 2V1MA 3A2VA 4NXIA 4ZBAA 2WCIA 5D9WA 4NHWA 2YV7A 3FRCA 1Z6MA 4KDYA 1PX6A 2IJYA 2JL4A 2R6KA 4N0VA 1X9MB 5E59A 3EU3A 2TRXA 2B5EA 4PUFC 2R2JA 3MNGA 1YY7A 2WB9A 1OKDA 5HFKA 2C3TA 1B8XA 14GSA 4G0LA 4RQRA 2H8LA 2DIZA 3QR6A 2V32A 1SYXA 2EIOA 3IC8A 4ZILA 1AW9A 3UMAA 1BQ7A 3M8NA 2FNOA 1OE8A 4E8EA 3P2AA 2C1YA 5AIXA 3FW2A 2FWEA 4IQ1A 3LORA 3IBHA 2RIIA 3QCPA 3FZ9A 4RUVA 2HSMA 4KGIA 2N5BA 5ENUA 2H0IA 1FOVA 1MDIA 2DJ2A 3UL3A 2HRKB 2YJHA 2XPDA 1VF1A 4I2TA 1TK8B 3J7Yk 2R37A 4BL7A 3A2WA 4WF5A 2IFQB 3VK9A 5IPHA 4BWQA 4JBBA 3IK9A 4OFTA 3VPTA 2HXKA 3MWHA 2XHFA 3WGEA 2K18A 2IMFA 4O92A 1GSQA 3FZ4A 2PVOC 1RK4A 2H74A 4TXOB 3FEUA 4EE0A 1K0NA 2YZUA 1OC8A 2NBSA 2VCZA 3TKPA 2PGTA 1XW5A 3F3RA 4QQ7A 5IO2A 2LJRA 2CV4A 2RLIA 2GSQA 2M80A 3WGXA 5L71A 4IQAA 1OVNA 4JE1A 2HRAA 5IIZA 1NM3A 1PGTA 1NSWA 3LFLA 1TTZA 4IJ3A 2OE3A 2C0DA 2GQMA 3BBYA 2XBIA 1TRSA 3BJ5A 2GSRA 1SK1A 1SK0A 3M9KA 1N2AA 3M1GA 5GAPD 5IMFA 4MABA 4ZBBA 5ECNB 3CMIA 5BMUA 4K6XA 3PR8A 5GZZB 2G2QA 2BMXA 1F9MA 1XVQA 4BVXB 4EVMA 4XS6A 3D4MA 3G9BA 2YP6A 3APQA 4GQCA 1FO5A 3E3EA 4OFNA 3HVXA 3K8NA 3HXSA 4AJ8A 1GP1A 2HRKA 3TJBA 4HU7A 5GSTA 4IBPA 4ML6A 1EOHA 3ERWA 4FYUA 1BJXA 1GSEA 3HY2A 2VLVA 5EVOA 3VI5A 4KCAA 1EGRA 3D6IA 4AF2A 1MEKA 4JEDA 1ERUA 1V98A 5H5QA 2C0EA 4TXOA 3UOMA 4IKHA 2AJQB 3ZL5A 4K0GA 2MZCA 4YQUA 1SL2B 4NWYA 2HZEB 1JZRA 1VF3A 1U6TA 3HYPA 5D9VA 5FT3A 3EINA 1QUWA 5J5NA 5A5KA 2VOCA 2L4QA 3H79A 1GSUA 1GUMA 1G7EA 5CRWA 1TRUA 3EMXA 5IMCA 1XIYA 1EEMA 4ZB9A 3MDKA 1JFUA 1AXDA 2JZRA 1CQGA 1MDJA 4AJ7A 3CYNA 1BAYA 3G7YA 2LRTA 3KH7A 3GKMA 3TKSC 3KM6A 1GL8A 1J08A 5E4WA 1HQOA 5HFGA 1XXUA 2VD1A 4MLYA 2YCDA 22GSA 2O8VB 4TR1B 6GSVA 2O7KA 1XFLA 3KGKA 1VF2A 1R5AA 1UN2A 4G0KA 4BVXA 3IV4A 2FUG2 1THOA 1HNBA 4HQZA 2RM6A 2J23A 1FB6A 3BD2A 1SYRA
chains in the Genus database with same CATH superfamily
3FHKA 4QL7A 2B1LA 1ERVA 3KP8A 4F9ZA 1M7TA 4KSMA 3MYDA 4V2MA 3HZ8A 5DQYA 1X9SB 4ZL8A 1XZOA 1UA5A 4XHMA 2XC2A 2YWNA 2GZZA 9GSSA 2KLXA 3QD9A 4YKFA 2LJAA 3KD0A 1S3DA 12GSA 2JSZA 3KTLA 3ZTLA 1GWCA 4MJBA 2NTOA 11GSA 2HZEA 2EIRA 2VAFA 2VCTA 1GLPA 4JR6A 1X5DA 3TJJA 2FD3A 1XBSA 1JZDA 2FA8A 3ZREA 1XW9A 2RM5A 3QDNA 3FMWA 6GSSA 4NV5A 5J9BA 1XG8A 5A5HB 3KCMA 3ZFBA 2VL2C 2K9FA 2YWIA 4ZB7A 2JZSA 4XTSA 5HQPA 3BCKA 1A8YA 2VD0A 2ZNMA 2OJLA 4RI7A 7GSSA 1YQ1A 3F4TA 1F3AA 5DCGA 3UARA 4KE3A 3I69A 3KZQA 4BIKA 1K0CA 1F2EA 3AY8A 3FR3A 4JZQA 5G2ZA 4AKHA 4IN0A 3FYGA 2PMTA 4GF0A 1G7OA 4HOJA 2CVKA 1OE7A 1NHOA 2PERA 1YKCA 4F82A 2YWMA 2N5AA 2EFDA 5B6NA 1BX9A 1IYIA 4ZB6A 1TW9A 1K0AA 1U3IA 2E0QA 2DJ1A 4GSNA 2IN3A 3CQFA 2CVBA 1A2JA 3MAKA 2AHEA 2GS3A 1ON4A 1NW2A 4FH8A 2AYTA 1SL1B 2GVPA 5B7CA 1F6MC 4G10A 3UBLA 2L59A 1K0DA 3RHBA 1O8XA 2KUCA 3VI7A 2CZ3A 2PN8A 5KOWA 1KNGA 1SL0B 3KXOA 4PX1A 4HEA2 2AUVA 5IMZA 3J7Yb 1ABAA 3ZVJD 4Z7XA 1SD8A 2GQKA 3LG6A 4X0XA 2VCQA 3A5IA 3QAWA 3ZIJA 3PINA 2CVDA 4PURA 5LCZA 1ACVA 1E6BA 1TI1A 2GSTA 3H93A 3C1SA 5DBQA 1PN9A 5A5HA 6GSUA 5IO0A 1BG5A 1JZOA 4OO5A 2OE1A 2FLSA 2H6YA 2YN1A 4TVEA 5IPGA 2ON5A 3HVVA 4TOPA 4K2DA 3BCIA 1M2AA 3HHVA 6GSXA 1HD2A 2X8CA 1F37A 5CRHA 2B5YA 1WP0A 2N5FA 4AJ6A 4AKGA 1WJKA 2GGTA 1C72A 2NVLA 2H73A 4PXOA 2KP2A 4WEYA 4PNFA 5CP1A 2YANA 5H5RA 3ZMLA 1DBYA 4XRAA 1EV4A 2R3XA 1YKAA 3DEXA 1GNWA 4ID0A 3HZ4A 3D0ZA 2YWOA 5LNKe 4EC0A 3W6GA 4RI6A 4EKZA 2HSNB 1EOGA 4MF6A 1A24A 5JCUA 1YEPA 5DQSA 3UAPA 4ILFA 4WF4A 4KH7A 1WWJA 1SJIA 4I97A 1QK8A 3KTBA 2R0PA 2ZUPA 1USBA 2FY6A 4K0NA 2WS2A 2GLRA 2UZ8A 3VWXA 3GUSA 4MDCA 1B4QA 3N9JA 5F06A 1GNEA 3TJGA 3HDCA 3FZ5A 1PKWA 2VCXA 1JZWA 2LQOA 4OD7A 1OC3A 2I1UA 5G30A 4XIHA 3FKFA 4EO3A 4Q5RA 1S3AA 4AKIA 2HI7A 5JCGA 1RW1A 1VGLA 3FR6A 4POLA 2FWGA 3C8EA 4XCSA 4O7HA 1M0UA 6GSYA 5ID2B 3TOUA 1TXXA 4W66A 2HRFA 2GZYA 5D93A 10GSA 1TDIA 5J3RA 3DKSA 4LA1A 4K7IA 3CSIA 2V2GA 4K1FA 4DEJA 2H66A 2H71A 3FY7A 5CRGA 5DCHA 4KB3A 3Q18A 3EURA 3IOSA 3DIEA 1E2YA 3D22A 3HA9A 4POKA 5AN1A 2B5XA 4KF9A 4OMVA 4PQIA 4MMMA 4ULXA 2WW2A 2H75A 4USSA 4DSRA 5HR1A 1N25A 4ZXGA 3WGDA 5DJLA 3E0UA 3ZIVA 4KDXA 1HNCA 2HSNA 4MF5A 2QA2A 1I5GA 3GNJA 4HUAA 5ECQB 2OADA 1GSYA 2X8GA 2V6KA 1WIKA 1EZKA 1ZGNA 3TOTA 4MPFA 3R3EA 1U87A 3UBKA 2I9HA 1GSFA 2R0CA 3PH9A 1T1VA 1BYEA 2P31A 3DGQA 3GYKA 3ERGA 5DALB 1PL2A 5ABRA 1JLWA 2DMLA 3TCOA 3TJFA 2DJJA 5KN1A 1WE0A 2C0GA 1PQNA 1O85A 17GSA 2YV9A 3MIXA 1ZOFA 1KEBA 3RBTA 3M0FA 1UC7A 4J57E 20GSA 1MD4A 4IP1A 5ECOB 3C71A 5C04A 3RDWA 1T4YA 3A3TA 4PI2C 5ID2A 2MYGA 3L9UA 4MJCA 5B8BA 3O3TA 1TI3A 2WZSA 2JSYA 2V41A 4BA7A 5G5FA 4MH3A 2CX4A 3FZAA 3G7JA 1ILOA 3QFBC 2DJKA 1B9YC 2EFEA 4K7NA 4FQUA 1MD3A 4RQXA 1Z7PA 4GWRA 3VWUA 4MJAA 4PHZC 1FHEA 3CRTA 4MA9A 3TKSE 1ZYPA 5CAXA 2OE0A 1XOBA 4TR4A 1QQ2A 3TDGA 3LYKA 3ME8A 3I9V2 5J4UA 2M72A 4HU9A 2LTKA 2ALBA 1NHYA 1YJ6A 4YQMA 1XW6A 1ZCPA 2GDRA 3D21A 5ECHB 3QAVA 2DJ0A 3TU3B 1K0BA 4L5OA 1QXHA 3HD5A 1U88A 1LBKA 5G5EA 1BEDA 5DALA 3HJOA 1YF0A 2QSIA 4G9HA 2CAIA 4MZCA 2VL3A 4TR0A 4XS4B 5ELAA 4MPGA 1J9BA 1V2AA 4HJMA 1ZYEA 3ZRDA 4CY8A 3VLNA 2VCWA 2IMIA 4I2UA 4IW9A 3F63A 1Y1UA 5ECPB 4KSOA 3LXZA 2NDOA 3LYPA 5ECKB 3VWVA 4V1Ap 3RHCA 4L5LA 2EFCA 3KMNA 2BJXA 4TW5A 2HFDA 3ED3A 5G1KA 3VPQA 3Q19A 3W8JA 3GURA 4KCEA 5D9TA 4LLRA 4QMKA 1B4PA 3QAGA 2R5GA 2JU5A 1QFNA 4H86A 1T00A 2C3NA 1OC9B 5CO3A 4AGSA 2PVQA 3APOA 3FR9A 4LL4B 2VUPA 2HRNA 4EIQA 1F3BA 1W89A 5JWRB 2LSTA 1X5EA 2LNTA 5INYA 5FHIA 2O87A 6GSWA 1OAZA 3QFAC 4KNDA 3HMJG 4NHZA 2IL3A 5HR2A 2DMMA 1A0FA 3F4SA 1JLVA 5A4WA 3GX0A 2FA4A 1SVOA 4GSSA 3TGZA 4V2NA 3GL3A 1T3BA 1CQHA 4HZ2A 3QOUA 5GAND 1PRXA 1K3LA 2WVXB 2XPEA 2TRCP 2G0FA 1AAZA 2WGRA 3TRPA 3SBCA 3LXTA 3KEBA 2B3SA 5D96A 4O32A 5C00A 2GT5A 2WZ9A 4KUNA 4K8MA 3L9SA 4L0WA 3NIVA 1O8WA 2H1DA 4XS4A 3GV1A 3UVTA 3HKRA 3Q6OA 3EMPA 2DKIA 3WYWA 1M3JA 2C4JA 1GTBA 2I81A 2WJUA 1YDKA 4YAVA 4OO4A 2PBJA 4F0BA 4ECIA 3S9FA 2WULA 1XWBA 4D73B 3A2XA 3GX8A 1DE1A 3L78A 2L5OA 1X9WB 1PSQA 4CY6A 4N30A 4IJIA 3GH6A 2VO4A 1ML6A 3V1WA 4BPYA 4Z2UA 1ST9A 1OC9A 4MK3A 2QA1A 2P5QA 3HVSA 4MH2A 1V40A 1GTIA 5A4VA 2H30A 4TN8A 1FVJA 4OFMA 2KP1A 2H1GA 2QKEA 1Z3EA 2JADA 5ECSA 3KMOA 2L6DA 2O89A 4CHSA 1AQVA 1URMA 2K6VA 1AUCA 3W8SA 1TP9A 3Q74A 4PUAA 2L4CA 1B48A 3IA1A 2K8SA 3IAS2 2EIQA 1TU7A 2RUFA 3IAM2 4ECJA 4I6XA 2MMOA 2DIYA 2HSHA 1UVZA 2F9SA 3GRXA 2OA7A 2WVXA 3IHQA 1SJ6A 1V9WA 4AI6A 2LRNA 1EP8A 2BTOT 2L5LA 1A2MA 3EVIA 4WBRD 1S3CA 3DD3A 4DSSA 1K0MA 3KH9A 3GH9A 1X0RA 3LWAA 1O81A 3GMFA 3IPZA 1M2DA 4TR3A 5J9CA 3GN3A 4LMWA 2WW1A 1S3RA 5ECLB 4GLTA 3C7MA 4AKXB 5AGYA 4YKGA 2H19A 2H1LA 5F0GA 4V1Ag 1FAAA 2MMZA 1PL1A 3LQ7A 1Z5YE 8GSSA 4HZ4A 5ECRB 4YQVA 2E7PA 2E2MA 2HLSA 1DE2A 1GUHA 2L57A 3GSTA 3F9UA 5EY6A 2H01A 2FGXA 2H72A 3ZITA 4D73A 4MP4A 2EFHA 2LJKA 3JCML 3F8UA 1XWGA 2F51A 3GKNA 5IMVA 2HZFA 1THXA 2WFCA 5F05A 5B8AA 2AV4A 3HCZA 2FWFA 3HJMA 4MJEA 3GIXA 1XWCA 3CTGA 2C3QA 3TRQA 1WOUA 2Z9SA 3M3MA 1M99A 1PA3A 5DVBA 4V2LA 4ZL9A 3DWVA 5IMAA 3A5WA 3P8WA 1EGOA 3IRAA 4X43A 3N5OA 1G6WA 5KEJA 2QGVA 4PQHA 4WXTA 4TRXA 2PWJA 3ME7A 3CBUA 3G7IA 2X64A 4YH2A 2E2GA 5HR0A 5CREA 3RAZA 5J40A 4F2IA 1V57A 2HE3A 3ISOA 4HQSA 1Z6NA 2WVZA 1YF1A 2X4AA 4CW9A 4EUYA 5A4UA 2DBCA 3QPMA 2HQTA 4GCIA 1R4WA 3LJRA 2LQQA 1HYUA 4Z2RA 1GSSA 5KN0A 2B6MA 1IYHA 2YPMA 2VLUA 2FHEA 2LUSA 5JCWA 3TKSA 4ECBA 3F3QA 3E9JB 2GQLA 5F8BA 2AB6A 3ERFA 4TXVA 3GTUB 4GRFA 1Z9HA 2DC5A 1ERWA 2LEGA 5LD0A 2OBKA 3H4KA 1M3IA 3C73A 2OACA 1AIUA 3UJ1A 4MNNA 2WW3A 1AQWA 2MBTA 5F07A 4K7OA 3WT1A 1I9DA 4PTSA 2WDUA 5D9XA 5EL8A 3EWLA 3GSSA 1EP7A 4JR4A 3GA4A 4POBA 1TRWA 5KN2A 5G31A 4XRDA 1SKRB 1SD9A 1JHBA 3F6DA 2AAWA 4WKWA 4Z2TA 4MZWA 2REMA 1VF4A 5IM9A 2F8AA 2C0FA 3O76A 4MF7A 5D8IA 4EDYA 1QMVA 2VL9A 2WW0A 2V6OA 1A0RP 1R26A 1R5PA 2PU9C 3RPNA 4X1UA 2NPBA 3CTFA 4DSQA 2FCHA 3TB2A 3RFRC 4O5QA 2H0GA 2VCVA 2C80A 4PI0C 3LW9A 3F4RA 5COHA 3US3A 1K3OA 1SKWB 2DJ3A 2WVYA 2HYXA 3TJKA 4F03A 1N8JA 2CQ9A 1J0FA 1PD21 5FWGA 5A1NA 1XOAA 2X8HA 3U6VA 1DUGA 1GH2A 2X99A 2R0GA 4LL1B 2ES7A 3HJPA 1TOFA 2DSAA 3TRXA 4JRRA 2LS5A 1PN0A 1Y25A 2YJ7A 1H75A 4JU5A 1ZZYA 1O7UA 2VL2A 3C1RA 2H6ZA 4K5RA 5HFIA 2LKUA 5IQYA 3TKQA 1U3AA 4Q5NA 2IMDA 1TK0B 3PGTA 5DAKB 3WT2A 3GTUA 3EE2A 2H0HA 2H76A 3IC4A 1LJRA 4G0IA 1ZYQB 3IHGA 4GDFA 1OKTA 3OR5A 3IXRA 1A8LA 1QGVA 1B9XC 1YEXA 1I1IP 4NPBA 4BVYB 2O85A 1GTAA 1Z7RA 3H8QA 2KHPA 1ZMAA 4CDOA 1A2LA 4EF0A 1YEWC 3ZZXA 4FYBA 4ZB8A 3LEFA 4NMUA 1VRSD 4ACSA 1XCCA 2ZCTA 3DYRA 3RPPA 1TK5B 2IFQA 2X49A 1O73A 18GSA 1PMTA 3MSZA 2GSSA 3F6FA 2EC4A 4MZBA 2CA8A 1ERTA 1G6YA 3GHAA 5DDLA 1SJZA 1XVWA 5B6MA 3BOAA 4FO5A 1HNAA 4ZBDA 2C8UA 2MMAA 2HT9A 1KBNA 4KW6A 4NV2A 3EYTA 2ON7A 4PQ1A 5EPFA 3EU4A 3CSJA 4L0UA 1Q98A 4TKYA 4LMVA 1KTEA 4IHUA 3TUEA 2B1KA 3LSZA 5ECMB 2A2SA 3NZNA 3CRUA 4ML1A 1V58A 4ISDA 2HSYA 4HSCX 4O5UA 16GSA 19GSA 3P7XA 4EIPA 5DAKA 1YZXA 2A2RA 1W4VA 2MBSA 3CSHA 1M9BA 4G2EA 3IK7A 1K3YA 4EDZA 2KOKA 1AQXA 3IDVA 1EV9A 3I6AA 4BVYA 3VWWA 3KIJA 3U5RE 5J41A 1WMJA 5IMDA 2RUEA 2M46A 1TKDB 2GTUA 4GXZA 1FB0A 2PPTA 5HR3A 2VIMA 3GKKA 4K9ZA 5CRDA 2DKHA 1X5CA 1WRYA 3L4NA 4EL1A 4WBJA 3WD6A 1WPIA 4I8BA 5ECIB 4E8HA 4OCFA 3RGBC 4O5RA 4HDEA 3DMLA 1SENA 3HVNA 1H4OA 5ELGA 2H1BA 1SK2A 1SVLA 4KX4A 1TRVA 2QC7A 3P90A 1EEJA 4HS1A 1GLQA 4DSSB 5H5SA 3GKXA 1O6JA 4ZIJA 3I43A 1MDKA 1GUKA 2XBQA 2UV8G 2YNXA 1GULA 2IMEA 2JZTA 4GSTA 2B7KA 5D73A 3H1NA 2YOIA 2B7JA 3LGCA 3L0HA 3O6TA 2DLXA 1TU8A 1GTUA 4J56E 2IIYA 5IOWA 2CZ2A 4PNGA 2YZHA 2IWTA 4OCEA 4HJ2A 3NOFA 4IVFA 4DVCA 1LU4A 2MMNA 4FIWA 1XWAA 5G1LA 2VM2A 3ZMKA 1EWXA 4TR1A 2I3YA 1XPVA 3QMXA 4ECCA 2I4AA 4XS1A 5DJMA 1GSDA 1DSBA 2LRCA 3SWLA 2D2ZA 5AISA 3DVWA 3IE3A 3DXBA 4IELA 2IPAA 3D4TA 3GL5A 3F0IA 1FOHA 2LV3A 3ZLPA 5JWOB 4G19A 5GSSA 2F3MA 1FG4A 4J2FA 1FVKA 4POMA 1A23A 3IR4A 4GQFA 2FWHA 2L6CA 4ZL7A 1SVMA 2P5RA 1PX7A 2IMKA 5KN3A 2VKZG 2J9HA 1T8EB 2CAQA 1PKZA 4GTUA 2OBIA 5IOXA 6GSTA 3TKRA 3GFKA 3UVHA 4X4JA 2WRTA 2H6XA 2H70A 4WETA 1K0OA 1Q4JA 2JACA 3KJYA 4N10A 4EXJA 13GSA 1AC1A 4KA0A 2H1AA 1ZL9A 4G01A 1FW1A 2K8VA 4NAXA 1M9AA 3PPUA 2P0GA 2F8FA 4MCUA 1G0TA 4FYCA 2LNSA 2R4VA 2TIRA 3KP9A 4Q5FA 3DRNA 1RQMA 4KAEA 5JWQB 4YAPA 2HNLA 1T7PB 4WR4A 4IGJA 4HI7A 1MTCA 2VM1A 1SKSB 2PUKC 1SU9A 4IS0A 3VFIA 4OWYA 5AIVA 2HSMB 2O3EA 4QL9A 4N0ZA 3ZYWA 4BWSA 2GT6A 5CYYA 4I5QA 1XWKA 1OYJA 4N11A 3M9JA 3APSA 1S4BP 2A4VA 2VLTA 4WR5A 3DVXA 2GZPA 4BL7B 3UIWA 1Y6EA 2CX3A 5CNWA 3VURA 1R7HA 4Q5QA 3CHXC 3D5JA 4PGTA 3R2QA 4KDUA 2CT6A 3EC3A 4IP6A 3UEMA 4P3YB 1T4ZA 3ZVJA 3ZFLA 2OKAA 1M2BA 1TJDA 4N3ZA 3CXGA 4L8EA 4F0CA 1GRXA 3FK8A 3L9VA 2V1MA 3A2VA 4NXIA 4ZBAA 2WCIA 5D9WA 4NHWA 2YV7A 3FRCA 1Z6MA 4KDYA 1PX6A 2IJYA 2JL4A 2R6KA 4N0VA 1X9MB 5E59A 3EU3A 2TRXA 2B5EA 4PUFC 2R2JA 3MNGA 1YY7A 5A1NB 2WB9A 1OKDA 5HFKA 2C3TA 1B8XA 14GSA 4G0LA 4RQRA 2H8LA 2DIZA 3QR6A 2V32A 1SYXA 2EIOA 3IC8A 4ZILA 1AW9A 3UMAA 1BQ7A 3M8NA 2FNOA 5BMUB 1OE8A 4FXYP 5J4VA 4E8EA 1BG1A 3P2AA 2C1YA 5AIXA 3FW2A 2FWEA 4IQ1A 3LORA 3IBHA 2RIIA 3QCPA 3FZ9A 4RUVA 2HSMA 4KGIA 2N5BA 5ENUA 2H0IA 1FOVA 1MDIA 2DJ2A 3UL3A 2A2PA 2HRKB 2YJHA 2XPDA 1VF1A 4I2TA 1TK8B 3J7Yk 2R37A 4BL7A 3A2WA 4WF5A 2IFQB 3VK9A 5IPHA 4BWQA 4JBBA 3IK9A 4OFTA 3VPTA 2HXKA 3MWHA 2XHFA 3WGEA 2K18A 2IMFA 4O92A 1GSQA 3FZ4A 2PVOC 1RK4A 2H74A 4TXOB 3FEUA 4EE0A 1K0NA 2YZUA 1OC8A 2NBSA 2VCZA 3TKPA 2OT3A 2PGTA 1XW5A 3F3RA 4QQ7A 5IO2A 2LJRA 2CV4A 2RLIA 2GSQA 2M80A 3WGXA 5L71A 4IQAA 1OVNA 4JE1A 2HRAA 5IIZA 5J4YA 1NM3A 1PGTA 1NSWA 3LFLA 1TTZA 4IJ3A 2OE3A 2C0DA 2GQMA 3BBYA 2XBIA 1TRSA 3BJ5A 2GSRA 1SK1A 1SK0A 3M9KA 1N2AA 3M1GA 5GAPD 5IMFA 4MABA 4ZBBA 5ECNB 3CMIA 5BMUA 4K6XA 3PR8A 5GZZB 2G2QA 2BMXA 1F9MA 1XVQA 4BVXB 5A34B 4EVMA 4XS6A 3D4MA 3G9BA 2YP6A 4ICYA 3APQA 4GQCA 1FO5A 3E3EA 2O36A 4OFNA 3HVXA 3K8NA 5BRTA 3HXSA 1BF5A 4AJ8A 1GP1A 2HRKA 3TJBA 4HU7A 5GSTA 4IBPA 4ML6A 1EOHA 3ERWA 4FYUA 1BJXA 1GSEA 3HY2A 2VLVA 4K5SA 5EVOA 3VI5A 4KCAA 1EGRA 3CWGA 3D6IA 4AF2A 1MEKA 4JEDA 1ERUA 1V98A 5H5QA 2C0EA 4TXOA 3UOMA 4IKHA 2AJQB 3ZL5A 4K0GA 2MZCA 4YQUA 1SL2B 1PFOA 4NWYA 2HZEB 1JZRA 1VF3A 1U6TA 3HYPA 5D9VA 5FT3A 3EINA 1QUWA 5J5NA 5A5KA 2VOCA 2L4QA 3H79A 1GSUA 1GUMA 5KOXA 5CRWA 1TRUA 1G7EA 3EMXA 5IMCA 1XIYA 1EEMA 4ZB9A 3MDKA 1JFUA 1AXDA 5J47A 2JZRA 1CQGA 1MDJA 4AJ7A 4E68A 1YVLA 3CYNA 1BAYA 3G7YA 2LRTA 3GKMA 3KH7A 3TKSC 3KM6A 1GL8A 1J08A 5E4WA 1HQOA 5HFGA 1XXUA 2VD1A 4MLYA 2YCDA 22GSA 2O8VB 4TR1B 3EPTA 6GSVA 2O7KA 2O5VA 1XFLA 3KGKA 1VF2A 1R5AA 1UN2A 4K2XA 1TXUA 4G0KA 4BVXA 5A34A 3IV4A 4A5PA 2FUG2 1THOA 1HNBA 2A4HA 4HQZA 2RM6A 2J23A 1FB6A 3BD2A 1ZYNA 1SYRA
chains in the Genus database with same CATH topology
3FHKA 4QL7A 2B1LA 1ERVA 3KP8A 4F9ZA 1M7TA 4KSMA 3MYDA 4V2MA 3HZ8A 5DQYA 1X9SB 4ZL8A 1XZOA 1UA5A 4XHMA 2XC2A 2YWNA 2GZZA 9GSSA 2KLXA 3QD9A 4YKFA 2LJAA 3KD0A 1S3DA 12GSA 2JSZA 3KTLA 3ZTLA 1GWCA 4MJBA 2NTOA 11GSA 2HZEA 2EIRA 2VAFA 2VCTA 1GLPA 4JR6A 1X5DA 3TJJA 2FD3A 1XBSA 1JZDA 2FA8A 3ZREA 1XW9A 2RM5A 3QDNA 3FMWA 6GSSA 4NV5A 5J9BA 5A5HB 3KCMA 3ZFBA 2VL2C 2K9FA 2YWIA 4ZB7A 2JZSA 4XTSA 5HQPA 3BCKA 1A8YA 2VD0A 2ZNMA 2OJLA 4RI7A 7GSSA 1YQ1A 3F4TA 1F3AA 5DCGA 3UARA 4KE3A 3I69A 3KZQA 1K0CA 1F2EA 3AY8A 3FR3A 4JZQA 5G2ZA 4AKHA 4IN0A 3FYGA 2PMTA 4GF0A 1G7OA 4HOJA 2CVKA 1OE7A 1NHOA 2PERA 1YKCA 4F82A 2YWMA 2N5AA 2EFDA 5B6NA 1BX9A 1IYIA 4ZB6A 1TW9A 1K0AA 1U3IA 2E0QA 2DJ1A 4GSNA 2IN3A 2CVBA 1A2JA 3MAKA 2AHEA 2GS3A 1ON4A 1NW2A 4FH8A 2AYTA 1SL1B 2GVPA 5B7CA 1F6MC 4G10A 3UBLA 2L59A 1K0DA 3RHBA 1O8XA 2KUCA 3VI7A 2CZ3A 2PN8A 5KOWA 1KNGA 1SL0B 3KXOA 4PX1A 4HEA2 2AUVA 5IMZA 3J7Yb 1ABAA 3ZVJD 4Z7XA 1SD8A 2GQKA 3LG6A 4X0XA 2VCQA 3A5IA 3QAWA 3ZIJA 3PINA 2CVDA 4PURA 5LCZA 1ACVA 1E6BA 1TI1A 2GSTA 3H93A 3C1SA 5DBQA 1PN9A 5A5HA 6GSUA 5IO0A 1BG5A 1JZOA 4OO5A 2OE1A 2FLSA 2H6YA 2YN1A 4TVEA 5IPGA 2ON5A 3HVVA 4TOPA 4K2DA 3BCIA 1M2AA 3HHVA 6GSXA 1HD2A 2X8CA 1F37A 5CRHA 2B5YA 1WP0A 2N5FA 4AJ6A 4AKGA 1WJKA 2GGTA 1C72A 2NVLA 2H73A 4PXOA 2KP2A 4WEYA 4PNFA 5CP1A 2YANA 5H5RA 3ZMLA 1DBYA 4XRAA 1EV4A 2R3XA 1YKAA 3DEXA 1GNWA 4ID0A 3HZ4A 3D0ZA 2YWOA 5LNKe 4EC0A 3W6GA 4RI6A 4EKZA 2HSNB 1EOGA 4MF6A 1A24A 5JCUA 1YEPA 5DQSA 3UAPA 4ILFA 4WF4A 4KH7A 1WWJA 1SJIA 4I97A 1QK8A 3KTBA 2R0PA 2ZUPA 1USBA 2FY6A 4K0NA 2WS2A 2GLRA 2UZ8A 3VWXA 3GUSA 4MDCA 1B4QA 3N9JA 5F06A 1GNEA 3TJGA 3HDCA 3FZ5A 1PKWA 2VCXA 1JZWA 2LQOA 4OD7A 1OC3A 2I1UA 5G30A 4XIHA 3FKFA 4EO3A 4Q5RA 1S3AA 4AKIA 2HI7A 5JCGA 1RW1A 1VGLA 3FR6A 4POLA 2FWGA 3C8EA 4XCSA 4O7HA 1M0UA 6GSYA 5ID2B 3TOUA 1TXXA 4W66A 2HRFA 2GZYA 5D93A 10GSA 1TDIA 5J3RA 3DKSA 4LA1A 4K7IA 3CSIA 2V2GA 4K1FA 4DEJA 2H66A 2H71A 3FY7A 5CRGA 5DCHA 4KB3A 3Q18A 3EURA 3IOSA 3DIEA 1E2YA 3D22A 3HA9A 4POKA 5AN1A 2B5XA 4KF9A 4OMVA 4PQIA 4MMMA 4ULXA 2H75A 4USSA 4DSRA 5HR1A 1N25A 4ZXGA 3WGDA 5DJLA 3E0UA 3ZIVA 4KDXA 1HNCA 2HSNA 4MF5A 2QA2A 1I5GA 3GNJA 4HUAA 5ECQB 2OADA 1GSYA 2X8GA 2V6KA 1WIKA 1EZKA 1ZGNA 3TOTA 4MPFA 3R3EA 1U87A 3UBKA 2I9HA 1GSFA 2R0CA 3PH9A 1T1VA 1BYEA 2P31A 3DGQA 3GYKA 3ERGA 5DALB 1PL2A 5ABRA 1JLWA 2DMLA 3TCOA 3TJFA 2DJJA 5KN1A 1WE0A 2C0GA 1PQNA 1O85A 17GSA 2YV9A 3MIXA 1ZOFA 1KEBA 3RBTA 3M0FA 1UC7A 4J57E 20GSA 1MD4A 4IP1A 5ECOB 3C71A 5C04A 3RDWA 1T4YA 3A3TA 5ID2A 2MYGA 3L9UA 4MJCA 5B8BA 3O3TA 1TI3A 2JSYA 2V41A 4BA7A 5G5FA 4MH3A 2CX4A 3FZAA 3G7JA 1ILOA 3QFBC 2DJKA 1B9YC 2EFEA 4K7NA 4FQUA 1MD3A 4RQXA 1Z7PA 4GWRA 3VWUA 4MJAA 1FHEA 3CRTA 4MA9A 3TKSE 1ZYPA 5CAXA 2OE0A 1XOBA 4TR4A 1QQ2A 3TDGA 3LYKA 3ME8A 3I9V2 5J4UA 2M72A 4HU9A 2LTKA 2ALBA 1NHYA 1YJ6A 4YQMA 1XW6A 1ZCPA 2GDRA 3D21A 5ECHB 3QAVA 2DJ0A 3TU3B 1K0BA 4L5OA 1QXHA 3HD5A 1U88A 1LBKA 5G5EA 1BEDA 5DALA 3HJOA 1YF0A 2QSIA 4G9HA 2CAIA 4MZCA 2VL3A 4TR0A 4XS4B 5ELAA 4MPGA 1J9BA 1V2AA 4HJMA 1ZYEA 3ZRDA 4CY8A 3VLNA 2VCWA 2IMIA 4I2UA 4IW9A 3F63A 1Y1UA 5ECPB 4KSOA 3LXZA 2NDOA 3LYPA 5ECKB 3VWVA 4V1Ap 3RHCA 4L5LA 2EFCA 3KMNA 2BJXA 4TW5A 2HFDA 3ED3A 5G1KA 3VPQA 3Q19A 3W8JA 3GURA 4KCEA 5D9TA 4LLRA 4QMKA 1B4PA 3QAGA 2R5GA 2JU5A 1QFNA 4H86A 1T00A 2C3NA 1OC9B 5CO3A 4AGSA 2PVQA 3APOA 3FR9A 4LL4B 2VUPA 2HRNA 4EIQA 1F3BA 1W89A 5JWRB 2LSTA 1X5EA 2LNTA 5INYA 5FHIA 2O87A 6GSWA 1OAZA 3QFAC 4KNDA 3HMJG 4NHZA 2IL3A 5HR2A 2DMMA 1A0FA 3F4SA 1JLVA 5A4WA 3GX0A 2FA4A 1SVOA 4GSSA 3TGZA 4V2NA 3GL3A 1T3BA 1CQHA 4HZ2A 3QOUA 5GAND 1PRXA 1K3LA 2XPEA 2TRCP 2G0FA 1AAZA 2WGRA 3TRPA 3SBCA 3LXTA 3KEBA 2B3SA 5D96A 4O32A 5C00A 2GT5A 2WZ9A 4KUNA 4K8MA 3L9SA 4L0WA 3NIVA 1O8WA 2H1DA 4XS4A 3GV1A 3UVTA 3HKRA 3Q6OA 3EMPA 2DKIA 3WYWA 2C4JA 1GTBA 2I81A 2WJUA 1YDKA 4YAVA 4OO4A 2PBJA 4F0BA 4ECIA 3S9FA 2WULA 1XWBA 4D73B 3A2XA 3GX8A 1DE1A 3L78A 2L5OA 1X9WB 1PSQA 4CY6A 4N30A 4IJIA 3GH6A 2VO4A 1ML6A 3V1WA 4BPYA 4Z2UA 1ST9A 1OC9A 4MK3A 2QA1A 2P5QA 3HVSA 4MH2A 1V40A 1GTIA 5A4VA 2H30A 4TN8A 1FVJA 4OFMA 2KP1A 2H1GA 2QKEA 1Z3EA 2JADA 5ECSA 3KMOA 2L6DA 2O89A 4CHSA 1AQVA 1URMA 2K6VA 1AUCA 3W8SA 1TP9A 3Q74A 4PUAA 2L4CA 1B48A 3IA1A 2K8SA 3IAS2 2EIQA 1TU7A 2RUFA 3IAM2 4ECJA 4I6XA 2MMOA 2DIYA 2HSHA 1UVZA 2F9SA 3GRXA 2OA7A 3IHQA 1SJ6A 1V9WA 4AI6A 2LRNA 1EP8A 2BTOT 2L5LA 1A2MA 3EVIA 4WBRD 1S3CA 3DD3A 4DSSA 1K0MA 3KH9A 3GH9A 1X0RA 3LWAA 1O81A 3GMFA 3IPZA 1M2DA 4TR3A 5J9CA 3GN3A 4LMWA 5ECLB 4GLTA 3C7MA 4AKXB 5AGYA 4YKGA 2H19A 2H1LA 5F0GA 4V1Ag 1FAAA 2MMZA 1PL1A 3LQ7A 1Z5YE 8GSSA 4HZ4A 5ECRB 4YQVA 2E7PA 2E2MA 2HLSA 1DE2A 1GUHA 2L57A 3GSTA 3F9UA 5EY6A 2H01A 2FGXA 2H72A 3ZITA 4D73A 4MP4A 2EFHA 2LJKA 3JCML 3F8UA 1XWGA 2F51A 3GKNA 5IMVA 2HZFA 1THXA 2WFCA 5F05A 5B8AA 2AV4A 3HCZA 2FWFA 3HJMA 4MJEA 3GIXA 1XWCA 3CTGA 2C3QA 3TRQA 1WOUA 2Z9SA 3M3MA 1M99A 1PA3A 5DVBA 4V2LA 4ZL9A 3DWVA 5IMAA 3A5WA 3P8WA 1EGOA 3IRAA 4X43A 3N5OA 1G6WA 5KEJA 2QGVA 4PQHA 4WXTA 4TRXA 2PWJA 3ME7A 3CBUA 3G7IA 2X64A 4YH2A 2E2GA 5HR0A 5CREA 3RAZA 5J40A 4F2IA 1V57A 2HE3A 3ISOA 4HQSA 1Z6NA 1YF1A 2X4AA 4CW9A 4EUYA 5A4UA 2DBCA 3QPMA 2HQTA 4GCIA 1R4WA 3LJRA 2LQQA 1HYUA 4Z2RA 1GSSA 5KN0A 2B6MA 1IYHA 2YPMA 2VLUA 2FHEA 2LUSA 5JCWA 3TKSA 4ECBA 3F3QA 3E9JB 2GQLA 5F8BA 2AB6A 3ERFA 4TXVA 3GTUB 4GRFA 1Z9HA 2DC5A 1ERWA 2LEGA 5LD0A 2OBKA 3H4KA 3C73A 2OACA 1AIUA 3UJ1A 4MNNA 1AQWA 2MBTA 5F07A 4K7OA 3WT1A 1I9DA 4PTSA 2WDUA 5D9XA 5EL8A 3EWLA 3GSSA 1EP7A 4JR4A 3GA4A 4POBA 1TRWA 5KN2A 5G31A 4XRDA 1SKRB 1SD9A 1JHBA 3F6DA 2AAWA 4WKWA 4Z2TA 4MZWA 2REMA 1VF4A 5IM9A 2F8AA 2C0FA 3O76A 4MF7A 5D8IA 4EDYA 1QMVA 2VL9A 2V6OA 1A0RP 1R26A 1R5PA 2PU9C 3RPNA 4X1UA 2NPBA 3CTFA 4DSQA 2FCHA 3TB2A 4O5QA 2H0GA 2VCVA 2C80A 3LW9A 3F4RA 5COHA 3US3A 1K3OA 1SKWB 2DJ3A 2HYXA 3TJKA 4F03A 1N8JA 2CQ9A 1J0FA 1PD21 5FWGA 5A1NA 1XOAA 2X8HA 3U6VA 1DUGA 1GH2A 2X99A 2R0GA 4LL1B 2ES7A 3HJPA 1TOFA 2DSAA 3TRXA 4JRRA 2LS5A 1PN0A 1Y25A 2YJ7A 1H75A 4JU5A 1ZZYA 1O7UA 2VL2A 3C1RA 2H6ZA 4K5RA 5HFIA 2LKUA 5IQYA 3TKQA 1U3AA 4Q5NA 2IMDA 1TK0B 3PGTA 5DAKB 3WT2A 3GTUA 3EE2A 2H0HA 2H76A 3IC4A 1LJRA 4G0IA 1ZYQB 3IHGA 4GDFA 1OKTA 3OR5A 3IXRA 1A8LA 1QGVA 1B9XC 1YEXA 4NPBA 4BVYB 2O85A 1GTAA 1Z7RA 3H8QA 2KHPA 1ZMAA 4CDOA 1A2LA 4EF0A 3ZZXA 4FYBA 4ZB8A 3LEFA 4NMUA 1VRSD 4ACSA 1XCCA 2ZCTA 3DYRA 3RPPA 1TK5B 2IFQA 2X49A 1O73A 18GSA 1PMTA 3MSZA 2GSSA 3F6FA 2EC4A 4MZBA 2CA8A 1ERTA 1G6YA 3GHAA 5DDLA 1SJZA 1XVWA 5B6MA 3BOAA 4FO5A 1HNAA 4ZBDA 2C8UA 2MMAA 2HT9A 1KBNA 4KW6A 4NV2A 3EYTA 2ON7A 4PQ1A 5EPFA 3EU4A 3CSJA 4L0UA 1Q98A 4TKYA 4LMVA 1KTEA 4IHUA 3TUEA 2B1KA 3LSZA 5ECMB 2A2SA 3NZNA 3CRUA 4ML1A 1V58A 4ISDA 2HSYA 4O5UA 16GSA 19GSA 3P7XA 4EIPA 5DAKA 1YZXA 2A2RA 1W4VA 2MBSA 3CSHA 1M9BA 4G2EA 3IK7A 1K3YA 4EDZA 2KOKA 1AQXA 3IDVA 1EV9A 3I6AA 4BVYA 3VWWA 3KIJA 3U5RE 5J41A 1WMJA 5IMDA 2RUEA 2M46A 1TKDB 2GTUA 4GXZA 1FB0A 2PPTA 5HR3A 2VIMA 3GKKA 4K9ZA 5CRDA 2DKHA 1X5CA 1WRYA 3L4NA 4EL1A 4WBJA 3WD6A 1WPIA 4I8BA 5ECIB 4E8HA 4OCFA 4O5RA 4HDEA 3DMLA 1SENA 1H4OA 5ELGA 2H1BA 1SK2A 1SVLA 4KX4A 1TRVA 2QC7A 3P90A 1EEJA 4HS1A 1GLQA 4DSSB 5H5SA 3GKXA 1O6JA 4ZIJA 3I43A 1MDKA 1GUKA 2XBQA 2UV8G 2YNXA 1GULA 2IMEA 2JZTA 4GSTA 2B7KA 5D73A 3H1NA 2YOIA 2B7JA 3LGCA 3L0HA 3O6TA 2DLXA 1TU8A 1GTUA 4J56E 2IIYA 5IOWA 2CZ2A 4PNGA 2YZHA 2IWTA 4OCEA 4HJ2A 3NOFA 4IVFA 4DVCA 1LU4A 2MMNA 4FIWA 1XWAA 5G1LA 2VM2A 3ZMKA 1EWXA 4TR1A 2I3YA 1XPVA 3QMXA 4ECCA 2I4AA 4XS1A 5DJMA 1GSDA 1DSBA 2LRCA 3SWLA 2D2ZA 5AISA 3DVWA 3IE3A 3DXBA 4IELA 2IPAA 3D4TA 3GL5A 3F0IA 1FOHA 2LV3A 3ZLPA 5JWOB 4G19A 5GSSA 2F3MA 1FG4A 4J2FA 1FVKA 4POMA 1A23A 3IR4A 4GQFA 2FWHA 2L6CA 4ZL7A 1SVMA 2P5RA 1PX7A 2IMKA 5KN3A 2VKZG 2J9HA 1T8EB 2CAQA 1PKZA 4GTUA 2OBIA 5IOXA 6GSTA 3TKRA 3GFKA 3UVHA 4X4JA 2WRTA 2H6XA 2H70A 4WETA 1K0OA 1Q4JA 2JACA 3KJYA 4N10A 4EXJA 13GSA 1AC1A 4KA0A 2H1AA 1ZL9A 4G01A 1FW1A 2K8VA 4NAXA 1M9AA 3PPUA 2P0GA 2F8FA 4MCUA 1G0TA 4FYCA 2LNSA 2R4VA 2TIRA 3KP9A 4Q5FA 3DRNA 1RQMA 4KAEA 5JWQB 4YAPA 2HNLA 1T7PB 4WR4A 4IGJA 4HI7A 1MTCA 2VM1A 1SKSB 2PUKC 1SU9A 4IS0A 3VFIA 4OWYA 5AIVA 2HSMB 4QL9A 4N0ZA 3ZYWA 4BWSA 2GT6A 5CYYA 4I5QA 1XWKA 1OYJA 4N11A 3M9JA 3APSA 2A4VA 2VLTA 4WR5A 3DVXA 2GZPA 4BL7B 3UIWA 1Y6EA 2CX3A 5CNWA 3VURA 1R7HA 4Q5QA 3D5JA 4PGTA 3R2QA 4KDUA 2CT6A 3EC3A 4IP6A 3UEMA 4P3YB 1T4ZA 3ZVJA 3ZFLA 2OKAA 1M2BA 1TJDA 4N3ZA 3CXGA 4L8EA 4F0CA 1GRXA 3FK8A 3L9VA 2V1MA 3A2VA 4NXIA 4ZBAA 2WCIA 5D9WA 4NHWA 2YV7A 3FRCA 1Z6MA 4KDYA 1PX6A 2IJYA 2JL4A 2R6KA 4N0VA 1X9MB 5E59A 3EU3A 2TRXA 2B5EA 4PUFC 2R2JA 3MNGA 1YY7A 5A1NB 2WB9A 1OKDA 5HFKA 2C3TA 1B8XA 14GSA 4G0LA 4RQRA 2H8LA 2DIZA 3QR6A 2V32A 1SYXA 2EIOA 3IC8A 4ZILA 1AW9A 3UMAA 1BQ7A 3M8NA 2FNOA 5BMUB 1OE8A 5J4VA 4E8EA 1BG1A 3P2AA 2C1YA 5AIXA 3FW2A 2FWEA 4IQ1A 3LORA 3IBHA 2RIIA 3QCPA 3FZ9A 4RUVA 2HSMA 4KGIA 2N5BA 5ENUA 2H0IA 1FOVA 1MDIA 2DJ2A 3UL3A 2A2PA 2HRKB 2YJHA 2XPDA 1VF1A 4I2TA 1TK8B 3J7Yk 2R37A 4BL7A 3A2WA 4WF5A 2IFQB 3VK9A 5IPHA 4BWQA 4JBBA 3IK9A 4OFTA 3VPTA 2HXKA 3MWHA 2XHFA 3WGEA 2K18A 2IMFA 4O92A 1GSQA 3FZ4A 2PVOC 1RK4A 2H74A 4TXOB 3FEUA 4EE0A 1K0NA 2YZUA 1OC8A 2NBSA 2VCZA 3TKPA 2OT3A 2PGTA 1XW5A 3F3RA 4QQ7A 5IO2A 2LJRA 2CV4A 2RLIA 2GSQA 2M80A 3WGXA 5L71A 4IQAA 1OVNA 4JE1A 2HRAA 5IIZA 5J4YA 1NM3A 1PGTA 1NSWA 3LFLA 1TTZA 4IJ3A 2OE3A 2C0DA 2GQMA 3BBYA 2XBIA 1TRSA 3BJ5A 2GSRA 1SK1A 1SK0A 3M9KA 1N2AA 3M1GA 5GAPD 5IMFA 4MABA 4ZBBA 5ECNB 3CMIA 5BMUA 4K6XA 3PR8A 5GZZB 2G2QA 2BMXA 1F9MA 1XVQA 4BVXB 5A34B 4EVMA 4XS6A 3D4MA 3G9BA 2YP6A 4ICYA 3APQA 4GQCA 1FO5A 3E3EA 4OFNA 3HVXA 3K8NA 5BRTA 3HXSA 1BF5A 4AJ8A 1GP1A 2HRKA 3TJBA 4HU7A 5GSTA 4IBPA 4ML6A 1EOHA 3ERWA 4FYUA 1BJXA 1GSEA 3HY2A 2VLVA 4K5SA 5EVOA 3VI5A 4KCAA 1EGRA 3CWGA 3D6IA 4AF2A 1MEKA 4JEDA 1ERUA 1V98A 5H5QA 2C0EA 4TXOA 3UOMA 4IKHA 2AJQB 3ZL5A 4K0GA 2MZCA 4YQUA 1SL2B 4NWYA 2HZEB 1JZRA 1VF3A 1U6TA 3HYPA 5D9VA 5FT3A 3EINA 1QUWA 5J5NA 5A5KA 2VOCA 2L4QA 3H79A 1GSUA 1GUMA 5KOXA 5CRWA 1TRUA 1G7EA 3EMXA 5IMCA 1XIYA 1EEMA 4ZB9A 3MDKA 1JFUA 1AXDA 5J47A 2JZRA 1CQGA 1MDJA 4AJ7A 4E68A 1YVLA 3CYNA 1BAYA 3G7YA 2LRTA 3KH7A 3GKMA 3TKSC 3KM6A 1GL8A 1J08A 5E4WA 1HQOA 5HFGA 1XXUA 2VD1A 4MLYA 2YCDA 22GSA 2O8VB 4TR1B 3EPTA 6GSVA 2O7KA 2O5VA 1XFLA 3KGKA 1VF2A 1R5AA 1UN2A 4K2XA 1TXUA 4G0KA 4BVXA 5A34A 3IV4A 4A5PA 2FUG2 1THOA 1HNBA 2A4HA 4HQZA 2RM6A 2J23A 1FB6A 3BD2A 1ZYNA 1SYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHK A;  4QL7 A;  2B1L A;  1ERV A;  3KP8 A;  4F9Z A;  1M7T A;  4KSM A;  4V2M A;  3HZ8 A;  5DQY A;  1X9S B;  4ZL8 A;  1XZO A;  1UA5 A;  4XHM A;  2XC2 A;  2YWN A;  2GZZ A;  9GSS A;  2KLX A;  3QD9 A;  2LJA A;  3KD0 A;  1S3D A;  12GS A;  2JSZ A;  3KTL A;  3ZTL A;  1GWC A;  4MJB A;  2NTO A;  11GS A;  2HZE A;  2EIR A;  2VAF A;  2VCT A;  1GLP A;  4JR6 A;  1X5D A;  3TJJ A;  2FD3 A;  1XBS A;  1JZD A;  2FA8 A;  3ZRE A;  1XW9 A;  2RM5 A;  3QDN A;  6GSS A;  4NV5 A;  5J9B A;  3KCM A;  3ZFB A;  2VL2 C;  2K9F A;  2YWI A;  2JZS A;  4XTS A;  5HQP A;  3BCK A;  1A8Y A;  2VD0 A;  2ZNM A;  2OJL A;  4RI7 A;  7GSS A;  1YQ1 A;  3F4T A;  1F3A A;  5DCG A;  3UAR A;  4KE3 A;  3I69 A;  3KZQ A;  1K0C A;  1F2E A;  3AY8 A;  3FR3 A;  4JZQ A;  5G2Z A;  4IN0 A;  3FYG A;  2PMT A;  4GF0 A;  1G7O A;  4HOJ A;  2CVK A;  1OE7 A;  1NHO A;  2PER A;  1YKC A;  4F82 A;  2YWM A;  2N5A A;  5B6N A;  1BX9 A;  1IYI A;  4ZB6 A;  1TW9 A;  1K0A A;  1U3I A;  2E0Q A;  2DJ1 A;  4GSN A;  2IN3 A;  2CVB A;  1A2J A;  3MAK A;  2AHE A;  2GS3 A;  1ON4 A;  1NW2 A;  4FH8 A;  2AYT A;  1SL1 B;  2GVP A;  5B7C A;  1F6M C;  4G10 A;  3UBL A;  2L59 A;  1K0D A;  3RHB A;  1O8X A;  2KUC A;  3VI7 A;  2CZ3 A;  2PN8 A;  1KNG A;  1SL0 B;  3KXO A;  4PX1 A;  4HEA 2;  2AUV A;  5IMZ A;  3J7Y b;  1ABA A;  3ZVJ D;  4Z7X A;  1SD8 A;  2GQK A;  3LG6 A;  4X0X A;  2VCQ A;  3QAW A;  3ZIJ A;  3PIN A;  2CVD A;  4PUR A;  5LCZ A;  1ACV A;  1E6B A;  1TI1 A;  2GST A;  3H93 A;  3C1S A;  5DBQ A;  1PN9 A;  6GSU A;  5IO0 A;  1BG5 A;  1JZO A;  4OO5 A;  2OE1 A;  2FLS A;  2H6Y A;  2YN1 A;  4TVE A;  5IPG A;  2ON5 A;  3HVV A;  4TOP A;  4K2D A;  3BCI A;  1M2A A;  3HHV A;  6GSX A;  1HD2 A;  2X8C A;  1F37 A;  5CRH A;  2B5Y A;  1WP0 A;  2N5F A;  4AJ6 A;  1WJK A;  2GGT A;  1C72 A;  2NVL A;  2H73 A;  4PXO A;  2KP2 A;  4WEY A;  4PNF A;  5CP1 A;  2YAN A;  5H5R A;  3ZML A;  1DBY A;  4XRA A;  1EV4 A;  2R3X A;  1YKA A;  3DEX A;  1GNW A;  4ID0 A;  3HZ4 A;  3D0Z A;  2YWO A;  5LNK e;  4EC0 A;  3W6G A;  4RI6 A;  4EKZ A;  2HSN B;  1EOG A;  4MF6 A;  1A24 A;  5JCU A;  1YEP A;  5DQS A;  3UAP A;  4ILF A;  4WF4 A;  4KH7 A;  1WWJ A;  1SJI A;  4I97 A;  1QK8 A;  3KTB A;  2ZUP A;  1USB A;  2FY6 A;  4K0N A;  2WS2 A;  2GLR A;  2UZ8 A;  3VWX A;  3GUS A;  4MDC A;  1B4Q A;  3N9J A;  5F06 A;  1GNE A;  3TJG A;  3HDC A;  3FZ5 A;  1PKW A;  2VCX A;  1JZW A;  2LQO A;  4OD7 A;  1OC3 A;  2I1U A;  5G30 A;  4XIH A;  3FKF A;  4EO3 A;  4Q5R A;  1S3A A;  2HI7 A;  5JCG A;  1RW1 A;  1VGL A;  3FR6 A;  4POL A;  2FWG A;  3C8E A;  4XCS A;  4O7H A;  1M0U A;  6GSY A;  5ID2 B;  3TOU A;  1TXX A;  2HRF A;  2GZY A;  5D93 A;  10GS A;  1TDI A;  5J3R A;  3DKS A;  4LA1 A;  4K7I A;  3CSI A;  2V2G A;  4K1F A;  4DEJ A;  2H66 A;  2H71 A;  3FY7 A;  5CRG A;  5DCH A;  4KB3 A;  3Q18 A;  3EUR A;  3IOS A;  3DIE A;  1E2Y A;  3D22 A;  3HA9 A;  4POK A;  5AN1 A;  2B5X A;  4KF9 A;  4OMV A;  4PQI A;  4MMM A;  4ULX A;  2H75 A;  4USS A;  4DSR A;  5HR1 A;  4ZXG A;  3WGD A;  5DJL A;  3E0U A;  3ZIV A;  4KDX A;  1HNC A;  4MF5 A;  1I5G A;  3GNJ A;  4HUA A;  5ECQ B;  2OAD A;  1GSY A;  2X8G A;  2V6K A;  1WIK A;  1EZK A;  1ZGN A;  3TOT A;  4MPF A;  3R3E A;  1U87 A;  3UBK A;  2I9H A;  1GSF A;  3PH9 A;  1T1V A;  1BYE A;  2P31 A;  3DGQ A;  3GYK A;  3ERG A;  5DAL B;  1PL2 A;  5ABR A;  1JLW A;  2DML A;  3TCO A;  3TJF A;  2DJJ A;  5KN1 A;  1WE0 A;  2C0G A;  1PQN A;  1O85 A;  17GS A;  2YV9 A;  1ZOF A;  1KEB A;  3RBT A;  3M0F A;  1UC7 A;  4J57 E;  20GS A;  1MD4 A;  4IP1 A;  5ECO B;  3C71 A;  5C04 A;  3RDW A;  1T4Y A;  3A3T A;  5ID2 A;  2MYG A;  3L9U A;  4MJC A;  5B8B A;  3O3T A;  1TI3 A;  2JSY A;  2V41 A;  4BA7 A;  5G5F A;  4MH3 A;  2CX4 A;  3FZA A;  3G7J A;  1ILO A;  3QFB C;  2DJK A;  1B9Y C;  4K7N A;  4FQU A;  1MD3 A;  4RQX A;  1Z7P A;  4GWR A;  3VWU A;  4MJA A;  1FHE A;  3CRT A;  4MA9 A;  3TKS E;  5CAX A;  2OE0 A;  1XOB A;  4TR4 A;  1QQ2 A;  3TDG A;  3LYK A;  3ME8 A;  3I9V 2;  5J4U A;  2M72 A;  4HU9 A;  2LTK A;  2ALB A;  1NHY A;  1YJ6 A;  4YQM A;  1XW6 A;  1ZCP A;  2GDR A;  3D21 A;  5ECH B;  3QAV A;  2DJ0 A;  1K0B A;  4L5O A;  1QXH A;  3HD5 A;  1U88 A;  1LBK A;  5G5E A;  1BED A;  5DAL A;  3HJO A;  1YF0 A;  2QSI A;  4G9H A;  2CAI A;  4MZC A;  2VL3 A;  4TR0 A;  4XS4 B;  5ELA A;  4MPG A;  1J9B A;  1V2A A;  4HJM A;  1ZYE A;  3ZRD A;  3VLN A;  2VCW A;  2IMI A;  4I2U A;  4IW9 A;  3F63 A;  5ECP B;  4KSO A;  3LXZ A;  2NDO A;  3LYP A;  5ECK B;  3VWV A;  4V1A p;  3RHC A;  4L5L A;  3KMN A;  2BJX A;  4TW5 A;  2HFD A;  3ED3 A;  5G1K A;  3VPQ A;  3Q19 A;  3W8J A;  3GUR A;  4KCE A;  5D9T A;  4LLR A;  1B4P A;  3QAG A;  2R5G A;  2JU5 A;  1QFN A;  4H86 A;  1T00 A;  2C3N A;  1OC9 B;  5CO3 A;  4AGS A;  2PVQ A;  3APO A;  3FR9 A;  4LL4 B;  2VUP A;  2HRN A;  1F3B A;  1W89 A;  5JWR B;  2LST A;  1X5E A;  2LNT A;  5INY A;  5FHI A;  2O87 A;  6GSW A;  1OAZ A;  3QFA C;  4KND A;  4NHZ A;  2IL3 A;  5HR2 A;  2DMM A;  1A0F A;  3F4S A;  1JLV A;  5A4W A;  3GX0 A;  2FA4 A;  4GSS A;  3TGZ A;  4V2N A;  3GL3 A;  1T3B A;  1CQH A;  4HZ2 A;  3QOU A;  5GAN D;  1PRX A;  1K3L A;  2XPE A;  2TRC P;  2G0F A;  1AAZ A;  2WGR A;  3TRP A;  3SBC A;  3LXT A;  3KEB A;  2B3S A;  5D96 A;  4O32 A;  5C00 A;  2GT5 A;  2WZ9 A;  4KUN A;  4K8M A;  3L9S A;  4L0W A;  3NIV A;  1O8W A;  2H1D A;  4XS4 A;  3GV1 A;  3UVT A;  3HKR A;  3Q6O A;  3EMP A;  3WYW A;  2C4J A;  1GTB A;  2I81 A;  2WJU A;  1YDK A;  4YAV A;  4OO4 A;  2PBJ A;  4F0B A;  4ECI A;  3S9F A;  2WUL A;  1XWB A;  4D73 B;  3A2X A;  3GX8 A;  1DE1 A;  3L78 A;  2L5O A;  1X9W B;  1PSQ A;  4N30 A;  4IJI A;  3GH6 A;  2VO4 A;  1ML6 A;  3V1W A;  4BPY A;  1ST9 A;  1OC9 A;  4MK3 A;  2P5Q A;  3HVS A;  4MH2 A;  1V40 A;  1GTI A;  5A4V A;  2H30 A;  4TN8 A;  1FVJ A;  4OFM A;  2KP1 A;  2H1G A;  2QKE A;  1Z3E A;  2JAD A;  5ECS A;  3KMO A;  2L6D A;  2O89 A;  4CHS A;  1AQV A;  1URM A;  2K6V A;  1AUC A;  3W8S A;  1TP9 A;  3Q74 A;  4PUA A;  2L4C A;  1B48 A;  3IA1 A;  2K8S A;  3IAS 2;  2EIQ A;  1TU7 A;  2RUF A;  3IAM 2;  4ECJ A;  4I6X A;  2MMO A;  2DIY A;  2HSH A;  1UVZ A;  2F9S A;  3GRX A;  2OA7 A;  3IHQ A;  1SJ6 A;  1V9W A;  2LRN A;  1EP8 A;  2BTO T;  2L5L A;  1A2M A;  3EVI A;  4WBR D;  1S3C A;  3DD3 A;  4DSS A;  1K0M A;  3KH9 A;  3GH9 A;  1X0R A;  3LWA A;  1O81 A;  3GMF A;  3IPZ A;  1M2D A;  4TR3 A;  5J9C A;  3GN3 A;  4LMW A;  5ECL B;  4GLT A;  3C7M A;  5AGY A;  2H19 A;  5F0G A;  4V1A g;  1FAA A;  2MMZ A;  1PL1 A;  3LQ7 A;  1Z5Y E;  8GSS A;  4HZ4 A;  5ECR B;  4YQV A;  2E7P A;  2E2M A;  2HLS A;  1DE2 A;  1GUH A;  2L57 A;  3GST A;  3F9U A;  5EY6 A;  2H01 A;  2FGX A;  2H72 A;  3ZIT A;  4D73 A;  4MP4 A;  2LJK A;  3JCM L;  3F8U A;  1XWG A;  2F51 A;  3GKN A;  5IMV A;  2HZF A;  1THX A;  2WFC A;  5F05 A;  5B8A A;  2AV4 A;  3HCZ A;  2FWF A;  3HJM A;  4MJE A;  3GIX A;  1XWC A;  3CTG A;  2C3Q A;  3TRQ A;  1WOU A;  2Z9S A;  3M3M A;  1M99 A;  1PA3 A;  5DVB A;  4V2L A;  4ZL9 A;  3DWV A;  5IMA A;  3A5W A;  3P8W A;  1EGO A;  3IRA A;  4X43 A;  3N5O A;  1G6W A;  5KEJ A;  2QGV A;  4PQH A;  4WXT A;  4TRX A;  2PWJ A;  3ME7 A;  3CBU A;  3G7I A;  2X64 A;  4YH2 A;  2E2G A;  5HR0 A;  5CRE A;  3RAZ A;  4F2I A;  1V57 A;  2HE3 A;  3ISO A;  4HQS A;  1Z6N A;  1YF1 A;  4CW9 A;  4EUY A;  5A4U A;  2DBC A;  3QPM A;  2HQT A;  4GCI A;  1R4W A;  3LJR A;  2LQQ A;  1HYU A;  1GSS A;  5KN0 A;  2B6M A;  1IYH A;  2YPM A;  2VLU A;  2FHE A;  2LUS A;  5JCW A;  3TKS A;  4ECB A;  3F3Q A;  3E9J B;  2GQL A;  5F8B A;  2AB6 A;  3ERF A;  4TXV A;  3GTU B;  4GRF A;  1Z9H A;  2DC5 A;  1ERW A;  2LEG A;  5LD0 A;  2OBK A;  3H4K A;  3C73 A;  2OAC A;  1AIU A;  3UJ1 A;  1AQW A;  2MBT A;  5F07 A;  4K7O A;  3WT1 A;  1I9D A;  4PTS A;  2WDU A;  5D9X A;  5EL8 A;  3EWL A;  3GSS A;  1EP7 A;  4JR4 A;  3GA4 A;  4POB A;  1TRW A;  5KN2 A;  5G31 A;  4XRD A;  1SKR B;  1SD9 A;  1JHB A;  3F6D A;  2AAW A;  4WKW A;  4MZW A;  2REM A;  1VF4 A;  5IM9 A;  2F8A A;  2C0F A;  3O76 A;  4MF7 A;  5D8I A;  4EDY A;  1QMV A;  2VL9 A;  2V6O A;  1A0R P;  1R26 A;  1R5P A;  2PU9 C;  3RPN A;  4X1U A;  2NPB A;  3CTF A;  4DSQ A;  2FCH A;  3TB2 A;  2H0G A;  2VCV A;  2C80 A;  3F4R A;  5COH A;  3US3 A;  1K3O A;  1SKW B;  2DJ3 A;  2HYX A;  3TJK A;  4F03 A;  1N8J A;  2CQ9 A;  1J0F A;  1PD2 1;  5FWG A;  1XOA A;  2X8H A;  3U6V A;  1DUG A;  1GH2 A;  2X99 A;  4LL1 B;  2ES7 A;  3HJP A;  1TOF A;  2DSA A;  3TRX A;  4JRR A;  2LS5 A;  1Y25 A;  2YJ7 A;  1H75 A;  4JU5 A;  1ZZY A;  1O7U A;  2VL2 A;  3C1R A;  2H6Z A;  5HFI A;  2LKU A;  5IQY A;  3TKQ A;  1U3A A;  4Q5N A;  2IMD A;  1TK0 B;  3PGT A;  5DAK B;  3WT2 A;  3GTU A;  3EE2 A;  2H0H A;  2H76 A;  3IC4 A;  1LJR A;  4G0I A;  1ZYQ B;  1OKT A;  3OR5 A;  3IXR A;  1A8L A;  1QGV A;  1B9X C;  1YEX A;  4NPB A;  4BVY B;  2O85 A;  1GTA A;  1Z7R A;  3H8Q A;  2KHP A;  1ZMA A;  4CDO A;  1A2L A;  4EF0 A;  3ZZX A;  4FYB A;  4ZB8 A;  3LEF A;  4NMU A;  1VRS D;  4ACS A;  1XCC A;  2ZCT A;  3DYR A;  3RPP A;  1TK5 B;  2IFQ A;  1O73 A;  18GS A;  1PMT A;  3MSZ A;  2GSS A;  3F6F A;  2EC4 A;  4MZB A;  2CA8 A;  1ERT A;  1G6Y A;  3GHA A;  5DDL A;  1SJZ A;  1XVW A;  5B6M A;  3BOA A;  4FO5 A;  1HNA A;  4ZBD A;  2C8U A;  2MMA A;  2HT9 A;  1KBN A;  4KW6 A;  4NV2 A;  3EYT A;  2ON7 A;  4PQ1 A;  5EPF A;  3EU4 A;  3CSJ A;  4L0U A;  1Q98 A;  4TKY A;  4LMV A;  1KTE A;  4IHU A;  3TUE A;  2B1K A;  3LSZ A;  5ECM B;  2A2S A;  3NZN A;  3CRU A;  4ML1 A;  1V58 A;  4ISD A;  2HSY A;  16GS A;  19GS A;  3P7X A;  5DAK A;  1YZX A;  2A2R A;  1W4V A;  2MBS A;  3CSH A;  1M9B A;  4G2E A;  3IK7 A;  1K3Y A;  4EDZ A;  2KOK A;  1AQX A;  3IDV A;  1EV9 A;  3I6A A;  4BVY A;  3VWW A;  3KIJ A;  3U5R E;  5J41 A;  1WMJ A;  5IMD A;  2RUE A;  2M46 A;  1TKD B;  2GTU A;  4GXZ A;  1FB0 A;  2PPT A;  5HR3 A;  2VIM A;  3GKK A;  4K9Z A;  5CRD A;  1X5C A;  1WRY A;  3L4N A;  4EL1 A;  4WBJ A;  3WD6 A;  1WPI A;  4I8B A;  5ECI B;  4E8H A;  4OCF A;  4O5R A;  4HDE A;  3DML A;  1SEN A;  1H4O A;  5ELG A;  2H1B A;  1SK2 A;  4KX4 A;  1TRV A;  2QC7 A;  3P90 A;  1EEJ A;  4HS1 A;  1GLQ A;  4DSS B;  5H5S A;  3GKX A;  1O6J A;  4ZIJ A;  3I43 A;  1MDK A;  1GUK A;  2XBQ A;  2YNX A;  1GUL A;  2IME A;  2JZT A;  4GST A;  2B7K A;  5D73 A;  3H1N A;  2YOI A;  2B7J A;  3LGC A;  3L0H A;  3O6T A;  2DLX A;  1TU8 A;  1GTU A;  4J56 E;  2IIY A;  5IOW A;  2CZ2 A;  4PNG A;  2YZH A;  2IWT A;  4OCE A;  4HJ2 A;  3NOF A;  4IVF A;  4DVC A;  1LU4 A;  2MMN A;  4FIW A;  1XWA A;  5G1L A;  2VM2 A;  3ZMK A;  1EWX A;  4TR1 A;  2I3Y A;  1XPV A;  3QMX A;  4ECC A;  2I4A A;  4XS1 A;  5DJM A;  1GSD A;  1DSB A;  2LRC A;  3SWL A;  2D2Z A;  5AIS A;  3DVW A;  3IE3 A;  3DXB A;  4IEL A;  2IPA A;  3D4T A;  3GL5 A;  3F0I A;  2LV3 A;  3ZLP A;  5JWO B;  4G19 A;  5GSS A;  2F3M A;  1FG4 A;  4J2F A;  1FVK A;  4POM A;  1A23 A;  3IR4 A;  4GQF A;  2FWH A;  2L6C A;  4ZL7 A;  2P5R A;  1PX7 A;  2IMK A;  5KN3 A;  2J9H A;  1T8E B;  2CAQ A;  1PKZ A;  4GTU A;  2OBI A;  5IOX A;  6GST A;  3TKR A;  3GFK A;  3UVH A;  2WRT A;  2H6X A;  2H70 A;  4WET A;  1K0O A;  1Q4J A;  2JAC A;  3KJY A;  4N10 A;  4EXJ A;  13GS A;  1AC1 A;  4KA0 A;  2H1A A;  1ZL9 A;  1FW1 A;  2K8V A;  4NAX A;  1M9A A;  3PPU A;  2P0G A;  2F8F A;  4MCU A;  1G0T A;  4FYC A;  2LNS A;  2R4V A;  2TIR A;  3KP9 A;  4Q5F A;  3DRN A;  1RQM A;  4KAE A;  5JWQ B;  4YAP A;  2HNL A;  1T7P B;  4WR4 A;  4IGJ A;  4HI7 A;  1MTC A;  2VM1 A;  1SKS B;  2PUK C;  1SU9 A;  4IS0 A;  3VFI A;  4OWY A;  5AIV A;  2HSM B;  4QL9 A;  4N0Z A;  3ZYW A;  4BWS A;  2GT6 A;  5CYY A;  4I5Q A;  1XWK A;  1OYJ A;  4N11 A;  3M9J A;  3APS A;  2A4V A;  2VLT A;  4WR5 A;  3DVX A;  2GZP A;  4BL7 B;  3UIW A;  1Y6E A;  2CX3 A;  5CNW A;  3VUR A;  1R7H A;  4Q5Q A;  3D5J A;  4PGT A;  3R2Q A;  4KDU A;  2CT6 A;  3EC3 A;  4IP6 A;  3UEM A;  4P3Y B;  1T4Z A;  3ZVJ A;  3ZFL A;  2OKA A;  1M2B A;  1TJD A;  3CXG A;  4L8E A;  4F0C A;  1GRX A;  3FK8 A;  3L9V A;  2V1M A;  3A2V A;  4NXI A;  4ZBA A;  2WCI A;  5D9W A;  4NHW A;  2YV7 A;  3FRC A;  1Z6M A;  4KDY A;  1PX6 A;  2IJY A;  2JL4 A;  2R6K A;  4N0V A;  1X9M B;  5E59 A;  3EU3 A;  2TRX A;  2B5E A;  4PUF C;  2R2J A;  3MNG A;  1YY7 A;  2WB9 A;  1OKD A;  5HFK A;  2C3T A;  1B8X A;  14GS A;  4G0L A;  4RQR A;  2H8L A;  2DIZ A;  3QR6 A;  2V32 A;  1SYX A;  2EIO A;  3IC8 A;  4ZIL A;  1AW9 A;  3UMA A;  1BQ7 A;  3M8N A;  2FNO A;  1OE8 A;  4E8E A;  3P2A A;  2C1Y A;  5AIX A;  3FW2 A;  2FWE A;  4IQ1 A;  3LOR A;  3IBH A;  2RII A;  3QCP A;  3FZ9 A;  4RUV A;  2HSM A;  4KGI A;  2N5B A;  5ENU A;  2H0I A;  1FOV A;  1MDI A;  2DJ2 A;  3UL3 A;  2HRK B;  2YJH A;  2XPD A;  1VF1 A;  4I2T A;  1TK8 B;  3J7Y k;  2R37 A;  4BL7 A;  3A2W A;  4WF5 A;  2IFQ B;  3VK9 A;  5IPH A;  4BWQ A;  4JBB A;  3IK9 A;  4OFT A;  3VPT A;  2HXK A;  3MWH A;  2XHF A;  3WGE A;  2K18 A;  2IMF A;  4O92 A;  1GSQ A;  3FZ4 A;  2PVO C;  1RK4 A;  2H74 A;  4TXO B;  3FEU A;  4EE0 A;  1K0N A;  2YZU A;  1OC8 A;  2NBS A;  2VCZ A;  3TKP A;  2PGT A;  1XW5 A;  3F3R A;  4QQ7 A;  5IO2 A;  2LJR A;  2CV4 A;  2RLI A;  2GSQ A;  2M80 A;  3WGX A;  5L71 A;  4IQA A;  1OVN A;  4JE1 A;  2HRA A;  5IIZ A;  1NM3 A;  1PGT A;  1NSW A;  3LFL A;  1TTZ A;  4IJ3 A;  2OE3 A;  2C0D A;  2GQM A;  3BBY A;  2XBI A;  1TRS A;  3BJ5 A;  2GSR A;  1SK1 A;  1SK0 A;  3M9K A;  1N2A A;  3M1G A;  5GAP D;  5IMF A;  4MAB A;  4ZBB A;  5ECN B;  3CMI A;  5BMU A;  4K6X A;  3PR8 A;  5GZZ B;  2G2Q A;  2BMX A;  1F9M A;  1XVQ A;  4BVX B;  4EVM A;  4XS6 A;  3D4M A;  3G9B A;  2YP6 A;  3APQ A;  4GQC A;  1FO5 A;  3E3E A;  4OFN A;  3HVX A;  3K8N A;  3HXS A;  4AJ8 A;  1GP1 A;  2HRK A;  3TJB A;  4HU7 A;  5GST A;  4IBP A;  4ML6 A;  1EOH A;  3ERW A;  4FYU A;  1BJX A;  1GSE A;  3HY2 A;  2VLV A;  5EVO A;  3VI5 A;  4KCA A;  1EGR A;  3D6I A;  4AF2 A;  1MEK A;  4JED A;  1ERU A;  1V98 A;  5H5Q A;  2C0E A;  4TXO A;  3UOM A;  4IKH A;  2AJQ B;  3ZL5 A;  4K0G A;  2MZC A;  4YQU A;  1SL2 B;  4NWY A;  2HZE B;  1JZR A;  1VF3 A;  1U6T A;  3HYP A;  5D9V A;  5FT3 A;  3EIN A;  1QUW A;  5J5N A;  5A5K A;  2VOC A;  2L4Q A;  3H79 A;  1GSU A;  1GUM A;  1G7E A;  5CRW A;  1TRU A;  3EMX A;  5IMC A;  1XIY A;  1EEM A;  4ZB9 A;  3MDK A;  1JFU A;  1AXD A;  2JZR A;  1CQG A;  1MDJ A;  4AJ7 A;  3CYN A;  1BAY A;  3G7Y A;  2LRT A;  3KH7 A;  3GKM A;  3TKS C;  3KM6 A;  1GL8 A;  1J08 A;  5E4W A;  1HQO A;  5HFG A;  1XXU A;  2VD1 A;  4MLY A;  2YCD A;  22GS A;  2O8V B;  4TR1 B;  6GSV A;  2O7K A;  1XFL A;  3KGK A;  1VF2 A;  1R5A A;  1UN2 A;  4G0K A;  4BVX A;  3IV4 A;  2FUG 2;  1THO A;  1HNB A;  4HQZ A;  2RM6 A;  2J23 A;  1FB6 A;  3BD2 A;  1SYR A; 
#chains in the Genus database with same CATH topology
 3FHK A;  4QL7 A;  2B1L A;  1ERV A;  3KP8 A;  4F9Z A;  1M7T A;  4KSM A;  3MYD A;  4V2M A;  3HZ8 A;  5DQY A;  1X9S B;  4ZL8 A;  1XZO A;  1UA5 A;  4XHM A;  2XC2 A;  2YWN A;  2GZZ A;  9GSS A;  2KLX A;  3QD9 A;  4YKF A;  2LJA A;  3KD0 A;  1S3D A;  12GS A;  2JSZ A;  3KTL A;  3ZTL A;  1GWC A;  4MJB A;  2NTO A;  11GS A;  2HZE A;  2EIR A;  2VAF A;  2VCT A;  1GLP A;  4JR6 A;  1X5D A;  3TJJ A;  2FD3 A;  1XBS A;  1JZD A;  2FA8 A;  3ZRE A;  1XW9 A;  2RM5 A;  3QDN A;  3FMW A;  6GSS A;  4NV5 A;  5J9B A;  1XG8 A;  5A5H B;  3KCM A;  3ZFB A;  2VL2 C;  2K9F A;  2YWI A;  4ZB7 A;  2JZS A;  4XTS A;  5HQP A;  3BCK A;  1A8Y A;  2VD0 A;  2ZNM A;  2OJL A;  4RI7 A;  7GSS A;  1YQ1 A;  3F4T A;  1F3A A;  5DCG A;  3UAR A;  4KE3 A;  3I69 A;  3KZQ A;  4BIK A;  1K0C A;  1F2E A;  3AY8 A;  3FR3 A;  4JZQ A;  5G2Z A;  4AKH A;  4IN0 A;  3FYG A;  2PMT A;  4GF0 A;  1G7O A;  4HOJ A;  2CVK A;  1OE7 A;  1NHO A;  2PER A;  1YKC A;  4F82 A;  2YWM A;  2N5A A;  2EFD A;  5B6N A;  1BX9 A;  1IYI A;  4ZB6 A;  1TW9 A;  1K0A A;  1U3I A;  2E0Q A;  2DJ1 A;  4GSN A;  2IN3 A;  3CQF A;  2CVB A;  1A2J A;  3MAK A;  2AHE A;  2GS3 A;  1ON4 A;  1NW2 A;  4FH8 A;  2AYT A;  1SL1 B;  2GVP A;  5B7C A;  1F6M C;  4G10 A;  3UBL A;  2L59 A;  1K0D A;  3RHB A;  1O8X A;  2KUC A;  3VI7 A;  2CZ3 A;  2PN8 A;  5KOW A;  1KNG A;  1SL0 B;  3KXO A;  4PX1 A;  4HEA 2;  2AUV A;  5IMZ A;  3J7Y b;  1ABA A;  3ZVJ D;  4Z7X A;  1SD8 A;  2GQK A;  3LG6 A;  4X0X A;  2VCQ A;  3A5I A;  3QAW A;  3ZIJ A;  3PIN A;  2CVD A;  4PUR A;  5LCZ A;  1ACV A;  1E6B A;  1TI1 A;  2GST A;  3H93 A;  3C1S A;  5DBQ A;  1PN9 A;  5A5H A;  6GSU A;  5IO0 A;  1BG5 A;  1JZO A;  4OO5 A;  2OE1 A;  2FLS A;  2H6Y A;  2YN1 A;  4TVE A;  5IPG A;  2ON5 A;  3HVV A;  4TOP A;  4K2D A;  3BCI A;  1M2A A;  3HHV A;  6GSX A;  1HD2 A;  2X8C A;  1F37 A;  5CRH A;  2B5Y A;  1WP0 A;  2N5F A;  4AJ6 A;  4AKG A;  1WJK A;  2GGT A;  1C72 A;  2NVL A;  2H73 A;  4PXO A;  2KP2 A;  4WEY A;  4PNF A;  5CP1 A;  2YAN A;  5H5R A;  3ZML A;  1DBY A;  4XRA A;  1EV4 A;  2R3X A;  1YKA A;  3DEX A;  1GNW A;  4ID0 A;  3HZ4 A;  3D0Z A;  2YWO A;  5LNK e;  4EC0 A;  3W6G A;  4RI6 A;  4EKZ A;  2HSN B;  1EOG A;  4MF6 A;  1A24 A;  5JCU A;  1YEP A;  5DQS A;  3UAP A;  4ILF A;  4WF4 A;  4KH7 A;  1WWJ A;  1SJI A;  4I97 A;  1QK8 A;  3KTB A;  2R0P A;  2ZUP A;  1USB A;  2FY6 A;  4K0N A;  2WS2 A;  2GLR A;  2UZ8 A;  3VWX A;  3GUS A;  4MDC A;  1B4Q A;  3N9J A;  5F06 A;  1GNE A;  3TJG A;  3HDC A;  3FZ5 A;  1PKW A;  2VCX A;  1JZW A;  2LQO A;  4OD7 A;  1OC3 A;  2I1U A;  5G30 A;  4XIH A;  3FKF A;  4EO3 A;  4Q5R A;  1S3A A;  4AKI A;  2HI7 A;  5JCG A;  1RW1 A;  1VGL A;  3FR6 A;  4POL A;  2FWG A;  3C8E A;  4XCS A;  4O7H A;  1M0U A;  6GSY A;  5ID2 B;  3TOU A;  1TXX A;  4W66 A;  2HRF A;  2GZY A;  5D93 A;  10GS A;  1TDI A;  5J3R A;  3DKS A;  4LA1 A;  4K7I A;  3CSI A;  2V2G A;  4K1F A;  4DEJ A;  2H66 A;  2H71 A;  3FY7 A;  5CRG A;  5DCH A;  4KB3 A;  3Q18 A;  3EUR A;  3IOS A;  3DIE A;  1E2Y A;  3D22 A;  3HA9 A;  4POK A;  5AN1 A;  2B5X A;  4KF9 A;  4OMV A;  4PQI A;  4MMM A;  4ULX A;  2WW2 A;  2H75 A;  4USS A;  4DSR A;  5HR1 A;  1N25 A;  4ZXG A;  3WGD A;  5DJL A;  3E0U A;  3ZIV A;  4KDX A;  1HNC A;  2HSN A;  4MF5 A;  2QA2 A;  1I5G A;  3GNJ A;  4HUA A;  5ECQ B;  2OAD A;  1GSY A;  2X8G A;  2V6K A;  1WIK A;  1EZK A;  1ZGN A;  3TOT A;  4MPF A;  3R3E A;  1U87 A;  3UBK A;  2I9H A;  1GSF A;  2R0C A;  3PH9 A;  1T1V A;  1BYE A;  2P31 A;  3DGQ A;  3GYK A;  3ERG A;  5DAL B;  1PL2 A;  5ABR A;  1JLW A;  2DML A;  3TCO A;  3TJF A;  2DJJ A;  5KN1 A;  1WE0 A;  2C0G A;  1PQN A;  1O85 A;  17GS A;  2YV9 A;  3MIX A;  1ZOF A;  1KEB A;  3RBT A;  3M0F A;  1UC7 A;  4J57 E;  20GS A;  1MD4 A;  4IP1 A;  5ECO B;  3C71 A;  5C04 A;  3RDW A;  1T4Y A;  3A3T A;  4PI2 C;  5ID2 A;  2MYG A;  3L9U A;  4MJC A;  5B8B A;  3O3T A;  1TI3 A;  2WZS A;  2JSY A;  2V41 A;  4BA7 A;  5G5F A;  4MH3 A;  2CX4 A;  3FZA A;  3G7J A;  1ILO A;  3QFB C;  2DJK A;  1B9Y C;  2EFE A;  4K7N A;  4FQU A;  1MD3 A;  4RQX A;  1Z7P A;  4GWR A;  3VWU A;  4MJA A;  4PHZ C;  1FHE A;  3CRT A;  4MA9 A;  3TKS E;  1ZYP A;  5CAX A;  2OE0 A;  1XOB A;  4TR4 A;  1QQ2 A;  3TDG A;  3LYK A;  3ME8 A;  3I9V 2;  5J4U A;  2M72 A;  4HU9 A;  2LTK A;  2ALB A;  1NHY A;  1YJ6 A;  4YQM A;  1XW6 A;  1ZCP A;  2GDR A;  3D21 A;  5ECH B;  3QAV A;  2DJ0 A;  3TU3 B;  1K0B A;  4L5O A;  1QXH A;  3HD5 A;  1U88 A;  1LBK A;  5G5E A;  1BED A;  5DAL A;  3HJO A;  1YF0 A;  2QSI A;  4G9H A;  2CAI A;  4MZC A;  2VL3 A;  4TR0 A;  4XS4 B;  5ELA A;  4MPG A;  1J9B A;  1V2A A;  4HJM A;  1ZYE A;  3ZRD A;  4CY8 A;  3VLN A;  2VCW A;  2IMI A;  4I2U A;  4IW9 A;  3F63 A;  1Y1U A;  5ECP B;  4KSO A;  3LXZ A;  2NDO A;  3LYP A;  5ECK B;  3VWV A;  4V1A p;  3RHC A;  4L5L A;  2EFC A;  3KMN A;  2BJX A;  4TW5 A;  2HFD A;  3ED3 A;  5G1K A;  3VPQ A;  3Q19 A;  3W8J A;  3GUR A;  4KCE A;  5D9T A;  4LLR A;  4QMK A;  1B4P A;  3QAG A;  2R5G A;  2JU5 A;  1QFN A;  4H86 A;  1T00 A;  2C3N A;  1OC9 B;  5CO3 A;  4AGS A;  2PVQ A;  3APO A;  3FR9 A;  4LL4 B;  2VUP A;  2HRN A;  4EIQ A;  1F3B A;  1W89 A;  5JWR B;  2LST A;  1X5E A;  2LNT A;  5INY A;  5FHI A;  2O87 A;  6GSW A;  1OAZ A;  3QFA C;  4KND A;  3HMJ G;  4NHZ A;  2IL3 A;  5HR2 A;  2DMM A;  1A0F A;  3F4S A;  1JLV A;  5A4W A;  3GX0 A;  2FA4 A;  1SVO A;  4GSS A;  3TGZ A;  4V2N A;  3GL3 A;  1T3B A;  1CQH A;  4HZ2 A;  3QOU A;  5GAN D;  1PRX A;  1K3L A;  2WVX B;  2XPE A;  2TRC P;  2G0F A;  1AAZ A;  2WGR A;  3TRP A;  3SBC A;  3LXT A;  3KEB A;  2B3S A;  5D96 A;  4O32 A;  5C00 A;  2GT5 A;  2WZ9 A;  4KUN A;  4K8M A;  3L9S A;  4L0W A;  3NIV A;  1O8W A;  2H1D A;  4XS4 A;  3GV1 A;  3UVT A;  3HKR A;  3Q6O A;  3EMP A;  2DKI A;  3WYW A;  1M3J A;  2C4J A;  1GTB A;  2I81 A;  2WJU A;  1YDK A;  4YAV A;  4OO4 A;  2PBJ A;  4F0B A;  4ECI A;  3S9F A;  2WUL A;  1XWB A;  4D73 B;  3A2X A;  3GX8 A;  1DE1 A;  3L78 A;  2L5O A;  1X9W B;  1PSQ A;  4CY6 A;  4N30 A;  4IJI A;  3GH6 A;  2VO4 A;  1ML6 A;  3V1W A;  4BPY A;  4Z2U A;  1ST9 A;  1OC9 A;  4MK3 A;  2QA1 A;  2P5Q A;  3HVS A;  4MH2 A;  1V40 A;  1GTI A;  5A4V A;  2H30 A;  4TN8 A;  1FVJ A;  4OFM A;  2KP1 A;  2H1G A;  2QKE A;  1Z3E A;  2JAD A;  5ECS A;  3KMO A;  2L6D A;  2O89 A;  4CHS A;  1AQV A;  1URM A;  2K6V A;  1AUC A;  3W8S A;  1TP9 A;  3Q74 A;  4PUA A;  2L4C A;  1B48 A;  3IA1 A;  2K8S A;  3IAS 2;  2EIQ A;  1TU7 A;  2RUF A;  3IAM 2;  4ECJ A;  4I6X A;  2MMO A;  2DIY A;  2HSH A;  1UVZ A;  2F9S A;  3GRX A;  2OA7 A;  2WVX A;  3IHQ A;  1SJ6 A;  1V9W A;  4AI6 A;  2LRN A;  1EP8 A;  2BTO T;  2L5L A;  1A2M A;  3EVI A;  4WBR D;  1S3C A;  3DD3 A;  4DSS A;  1K0M A;  3KH9 A;  3GH9 A;  1X0R A;  3LWA A;  1O81 A;  3GMF A;  3IPZ A;  1M2D A;  4TR3 A;  5J9C A;  3GN3 A;  4LMW A;  2WW1 A;  1S3R A;  5ECL B;  4GLT A;  3C7M A;  4AKX B;  5AGY A;  4YKG A;  2H19 A;  2H1L A;  5F0G A;  4V1A g;  1FAA A;  2MMZ A;  1PL1 A;  3LQ7 A;  1Z5Y E;  8GSS A;  4HZ4 A;  5ECR B;  4YQV A;  2E7P A;  2E2M A;  2HLS A;  1DE2 A;  1GUH A;  2L57 A;  3GST A;  3F9U A;  5EY6 A;  2H01 A;  2FGX A;  2H72 A;  3ZIT A;  4D73 A;  4MP4 A;  2EFH A;  2LJK A;  3JCM L;  3F8U A;  1XWG A;  2F51 A;  3GKN A;  5IMV A;  2HZF A;  1THX A;  2WFC A;  5F05 A;  5B8A A;  2AV4 A;  3HCZ A;  2FWF A;  3HJM A;  4MJE A;  3GIX A;  1XWC A;  3CTG A;  2C3Q A;  3TRQ A;  1WOU A;  2Z9S A;  3M3M A;  1M99 A;  1PA3 A;  5DVB A;  4V2L A;  4ZL9 A;  3DWV A;  5IMA A;  3A5W A;  3P8W A;  1EGO A;  3IRA A;  4X43 A;  3N5O A;  1G6W A;  5KEJ A;  2QGV A;  4PQH A;  4WXT A;  4TRX A;  2PWJ A;  3ME7 A;  3CBU A;  3G7I A;  2X64 A;  4YH2 A;  2E2G A;  5HR0 A;  5CRE A;  3RAZ A;  5J40 A;  4F2I A;  1V57 A;  2HE3 A;  3ISO A;  4HQS A;  1Z6N A;  2WVZ A;  1YF1 A;  2X4A A;  4CW9 A;  4EUY A;  5A4U A;  2DBC A;  3QPM A;  2HQT A;  4GCI A;  1R4W A;  3LJR A;  2LQQ A;  1HYU A;  4Z2R A;  1GSS A;  5KN0 A;  2B6M A;  1IYH A;  2YPM A;  2VLU A;  2FHE A;  2LUS A;  5JCW A;  3TKS A;  4ECB A;  3F3Q A;  3E9J B;  2GQL A;  5F8B A;  2AB6 A;  3ERF A;  4TXV A;  3GTU B;  4GRF A;  1Z9H A;  2DC5 A;  1ERW A;  2LEG A;  5LD0 A;  2OBK A;  3H4K A;  1M3I A;  3C73 A;  2OAC A;  1AIU A;  3UJ1 A;  4MNN A;  2WW3 A;  1AQW A;  2MBT A;  5F07 A;  4K7O A;  3WT1 A;  1I9D A;  4PTS A;  2WDU A;  5D9X A;  5EL8 A;  3EWL A;  3GSS A;  1EP7 A;  4JR4 A;  3GA4 A;  4POB A;  1TRW A;  5KN2 A;  5G31 A;  4XRD A;  1SKR B;  1SD9 A;  1JHB A;  3F6D A;  2AAW A;  4WKW A;  4Z2T A;  4MZW A;  2REM A;  1VF4 A;  5IM9 A;  2F8A A;  2C0F A;  3O76 A;  4MF7 A;  5D8I A;  4EDY A;  1QMV A;  2VL9 A;  2WW0 A;  2V6O A;  1A0R P;  1R26 A;  1R5P A;  2PU9 C;  3RPN A;  4X1U A;  2NPB A;  3CTF A;  4DSQ A;  2FCH A;  3TB2 A;  3RFR C;  4O5Q A;  2H0G A;  2VCV A;  2C80 A;  4PI0 C;  3LW9 A;  3F4R A;  5COH A;  3US3 A;  1K3O A;  1SKW B;  2DJ3 A;  2WVY A;  2HYX A;  3TJK A;  4F03 A;  1N8J A;  2CQ9 A;  1J0F A;  1PD2 1;  5FWG A;  5A1N A;  1XOA A;  2X8H A;  3U6V A;  1DUG A;  1GH2 A;  2X99 A;  2R0G A;  4LL1 B;  2ES7 A;  3HJP A;  1TOF A;  2DSA A;  3TRX A;  4JRR A;  2LS5 A;  1PN0 A;  1Y25 A;  2YJ7 A;  1H75 A;  4JU5 A;  1ZZY A;  1O7U A;  2VL2 A;  3C1R A;  2H6Z A;  4K5R A;  5HFI A;  2LKU A;  5IQY A;  3TKQ A;  1U3A A;  4Q5N A;  2IMD A;  1TK0 B;  3PGT A;  5DAK B;  3WT2 A;  3GTU A;  3EE2 A;  2H0H A;  2H76 A;  3IC4 A;  1LJR A;  4G0I A;  1ZYQ B;  3IHG A;  4GDF A;  1OKT A;  3OR5 A;  3IXR A;  1A8L A;  1QGV A;  1B9X C;  1YEX A;  1I1I P;  4NPB A;  4BVY B;  2O85 A;  1GTA A;  1Z7R A;  3H8Q A;  2KHP A;  1ZMA A;  4CDO A;  1A2L A;  4EF0 A;  1YEW C;  3ZZX A;  4FYB A;  4ZB8 A;  3LEF A;  4NMU A;  1VRS D;  4ACS A;  1XCC A;  2ZCT A;  3DYR A;  3RPP A;  1TK5 B;  2IFQ A;  2X49 A;  1O73 A;  18GS A;  1PMT A;  3MSZ A;  2GSS A;  3F6F A;  2EC4 A;  4MZB A;  2CA8 A;  1ERT A;  1G6Y A;  3GHA A;  5DDL A;  1SJZ A;  1XVW A;  5B6M A;  3BOA A;  4FO5 A;  1HNA A;  4ZBD A;  2C8U A;  2MMA A;  2HT9 A;  1KBN A;  4KW6 A;  4NV2 A;  3EYT A;  2ON7 A;  4PQ1 A;  5EPF A;  3EU4 A;  3CSJ A;  4L0U A;  1Q98 A;  4TKY A;  4LMV A;  1KTE A;  4IHU A;  3TUE A;  2B1K A;  3LSZ A;  5ECM B;  2A2S A;  3NZN A;  3CRU A;  4ML1 A;  1V58 A;  4ISD A;  2HSY A;  4HSC X;  4O5U A;  16GS A;  19GS A;  3P7X A;  4EIP A;  5DAK A;  1YZX A;  2A2R A;  1W4V A;  2MBS A;  3CSH A;  1M9B A;  4G2E A;  3IK7 A;  1K3Y A;  4EDZ A;  2KOK A;  1AQX A;  3IDV A;  1EV9 A;  3I6A A;  4BVY A;  3VWW A;  3KIJ A;  3U5R E;  5J41 A;  1WMJ A;  5IMD A;  2RUE A;  2M46 A;  1TKD B;  2GTU A;  4GXZ A;  1FB0 A;  2PPT A;  5HR3 A;  2VIM A;  3GKK A;  4K9Z A;  5CRD A;  2DKH A;  1X5C A;  1WRY A;  3L4N A;  4EL1 A;  4WBJ A;  3WD6 A;  1WPI A;  4I8B A;  5ECI B;  4E8H A;  4OCF A;  3RGB C;  4O5R A;  4HDE A;  3DML A;  1SEN A;  3HVN A;  1H4O A;  5ELG A;  2H1B A;  1SK2 A;  1SVL A;  4KX4 A;  1TRV A;  2QC7 A;  3P90 A;  1EEJ A;  4HS1 A;  1GLQ A;  4DSS B;  5H5S A;  3GKX A;  1O6J A;  4ZIJ A;  3I43 A;  1MDK A;  1GUK A;  2XBQ A;  2UV8 G;  2YNX A;  1GUL A;  2IME A;  2JZT A;  4GST A;  2B7K A;  5D73 A;  3H1N A;  2YOI A;  2B7J A;  3LGC A;  3L0H A;  3O6T A;  2DLX A;  1TU8 A;  1GTU A;  4J56 E;  2IIY A;  5IOW A;  2CZ2 A;  4PNG A;  2YZH A;  2IWT A;  4OCE A;  4HJ2 A;  3NOF A;  4IVF A;  4DVC A;  1LU4 A;  2MMN A;  4FIW A;  1XWA A;  5G1L A;  2VM2 A;  3ZMK A;  1EWX A;  4TR1 A;  2I3Y A;  1XPV A;  3QMX A;  4ECC A;  2I4A A;  4XS1 A;  5DJM A;  1GSD A;  1DSB A;  2LRC A;  3SWL A;  2D2Z A;  5AIS A;  3DVW A;  3IE3 A;  3DXB A;  4IEL A;  2IPA A;  3D4T A;  3GL5 A;  3F0I A;  1FOH A;  2LV3 A;  3ZLP A;  5JWO B;  4G19 A;  5GSS A;  2F3M A;  1FG4 A;  4J2F A;  1FVK A;  4POM A;  1A23 A;  3IR4 A;  4GQF A;  2FWH A;  2L6C A;  4ZL7 A;  1SVM A;  2P5R A;  1PX7 A;  2IMK A;  5KN3 A;  2VKZ G;  2J9H A;  1T8E B;  2CAQ A;  1PKZ A;  4GTU A;  2OBI A;  5IOX A;  6GST A;  3TKR A;  3GFK A;  3UVH A;  4X4J A;  2WRT A;  2H6X A;  2H70 A;  4WET A;  1K0O A;  1Q4J A;  2JAC A;  3KJY A;  4N10 A;  4EXJ A;  13GS A;  1AC1 A;  4KA0 A;  2H1A A;  1ZL9 A;  4G01 A;  1FW1 A;  2K8V A;  4NAX A;  1M9A A;  3PPU A;  2P0G A;  2F8F A;  4MCU A;  1G0T A;  4FYC A;  2LNS A;  2R4V A;  2TIR A;  3KP9 A;  4Q5F A;  3DRN A;  1RQM A;  4KAE A;  5JWQ B;  4YAP A;  2HNL A;  1T7P B;  4WR4 A;  4IGJ A;  4HI7 A;  1MTC A;  2VM1 A;  1SKS B;  2PUK C;  1SU9 A;  4IS0 A;  3VFI A;  4OWY A;  5AIV A;  2HSM B;  2O3E A;  4QL9 A;  4N0Z A;  3ZYW A;  4BWS A;  2GT6 A;  5CYY A;  4I5Q A;  1XWK A;  1OYJ A;  4N11 A;  3M9J A;  3APS A;  1S4B P;  2A4V A;  2VLT A;  4WR5 A;  3DVX A;  2GZP A;  4BL7 B;  3UIW A;  1Y6E A;  2CX3 A;  5CNW A;  3VUR A;  1R7H A;  4Q5Q A;  3CHX C;  3D5J A;  4PGT A;  3R2Q A;  4KDU A;  2CT6 A;  3EC3 A;  4IP6 A;  3UEM A;  4P3Y B;  1T4Z A;  3ZVJ A;  3ZFL A;  2OKA A;  1M2B A;  1TJD A;  4N3Z A;  3CXG A;  4L8E A;  4F0C A;  1GRX A;  3FK8 A;  3L9V A;  2V1M A;  3A2V A;  4NXI A;  4ZBA A;  2WCI A;  5D9W A;  4NHW A;  2YV7 A;  3FRC A;  1Z6M A;  4KDY A;  1PX6 A;  2IJY A;  2JL4 A;  2R6K A;  4N0V A;  1X9M B;  5E59 A;  3EU3 A;  2TRX A;  2B5E A;  4PUF C;  2R2J A;  3MNG A;  1YY7 A;  5A1N B;  2WB9 A;  1OKD A;  5HFK A;  2C3T A;  1B8X A;  14GS A;  4G0L A;  4RQR A;  2H8L A;  2DIZ A;  3QR6 A;  2V32 A;  1SYX A;  2EIO A;  3IC8 A;  4ZIL A;  1AW9 A;  3UMA A;  1BQ7 A;  3M8N A;  2FNO A;  5BMU B;  1OE8 A;  4FXY P;  5J4V A;  4E8E A;  1BG1 A;  3P2A A;  2C1Y A;  5AIX A;  3FW2 A;  2FWE A;  4IQ1 A;  3LOR A;  3IBH A;  2RII A;  3QCP A;  3FZ9 A;  4RUV A;  2HSM A;  4KGI A;  2N5B A;  5ENU A;  2H0I A;  1FOV A;  1MDI A;  2DJ2 A;  3UL3 A;  2A2P A;  2HRK B;  2YJH A;  2XPD A;  1VF1 A;  4I2T A;  1TK8 B;  3J7Y k;  2R37 A;  4BL7 A;  3A2W A;  4WF5 A;  2IFQ B;  3VK9 A;  5IPH A;  4BWQ A;  4JBB A;  3IK9 A;  4OFT A;  3VPT A;  2HXK A;  3MWH A;  2XHF A;  3WGE A;  2K18 A;  2IMF A;  4O92 A;  1GSQ A;  3FZ4 A;  2PVO C;  1RK4 A;  2H74 A;  4TXO B;  3FEU A;  4EE0 A;  1K0N A;  2YZU A;  1OC8 A;  2NBS A;  2VCZ A;  3TKP A;  2OT3 A;  2PGT A;  1XW5 A;  3F3R A;  4QQ7 A;  5IO2 A;  2LJR A;  2CV4 A;  2RLI A;  2GSQ A;  2M80 A;  3WGX A;  5L71 A;  4IQA A;  1OVN A;  4JE1 A;  2HRA A;  5IIZ A;  5J4Y A;  1NM3 A;  1PGT A;  1NSW A;  3LFL A;  1TTZ A;  4IJ3 A;  2OE3 A;  2C0D A;  2GQM A;  3BBY A;  2XBI A;  1TRS A;  3BJ5 A;  2GSR A;  1SK1 A;  1SK0 A;  3M9K A;  1N2A A;  3M1G A;  5GAP D;  5IMF A;  4MAB A;  4ZBB A;  5ECN B;  3CMI A;  5BMU A;  4K6X A;  3PR8 A;  5GZZ B;  2G2Q A;  2BMX A;  1F9M A;  1XVQ A;  4BVX B;  5A34 B;  4EVM A;  4XS6 A;  3D4M A;  3G9B A;  2YP6 A;  4ICY A;  3APQ A;  4GQC A;  1FO5 A;  3E3E A;  2O36 A;  4OFN A;  3HVX A;  3K8N A;  5BRT A;  3HXS A;  1BF5 A;  4AJ8 A;  1GP1 A;  2HRK A;  3TJB A;  4HU7 A;  5GST A;  4IBP A;  4ML6 A;  1EOH A;  3ERW A;  4FYU A;  1BJX A;  1GSE A;  3HY2 A;  2VLV A;  4K5S A;  5EVO A;  3VI5 A;  4KCA A;  1EGR A;  3CWG A;  3D6I A;  4AF2 A;  1MEK A;  4JED A;  1ERU A;  1V98 A;  5H5Q A;  2C0E A;  4TXO A;  3UOM A;  4IKH A;  2AJQ B;  3ZL5 A;  4K0G A;  2MZC A;  4YQU A;  1SL2 B;  1PFO A;  4NWY A;  2HZE B;  1JZR A;  1VF3 A;  1U6T A;  3HYP A;  5D9V A;  5FT3 A;  3EIN A;  1QUW A;  5J5N A;  5A5K A;  2VOC A;  2L4Q A;  3H79 A;  1GSU A;  1GUM A;  5KOX A;  5CRW A;  1TRU A;  1G7E A;  3EMX A;  5IMC A;  1XIY A;  1EEM A;  4ZB9 A;  3MDK A;  1JFU A;  1AXD A;  5J47 A;  2JZR A;  1CQG A;  1MDJ A;  4AJ7 A;  4E68 A;  1YVL A;  3CYN A;  1BAY A;  3G7Y A;  2LRT A;  3GKM A;  3KH7 A;  3TKS C;  3KM6 A;  1GL8 A;  1J08 A;  5E4W A;  1HQO A;  5HFG A;  1XXU A;  2VD1 A;  4MLY A;  2YCD A;  22GS A;  2O8V B;  4TR1 B;  3EPT A;  6GSV A;  2O7K A;  2O5V A;  1XFL A;  3KGK A;  1VF2 A;  1R5A A;  1UN2 A;  4K2X A;  1TXU A;  4G0K A;  4BVX A;  5A34 A;  3IV4 A;  4A5P A;  2FUG 2;  1THO A;  1HNB A;  2A4H A;  4HQZ A;  2RM6 A;  2J23 A;  1FB6 A;  3BD2 A;  1ZYN A;  1SYR A; 
#chains in the Genus database with same CATH homology
 3FHK A;  4QL7 A;  2B1L A;  1ERV A;  3KP8 A;  4F9Z A;  1M7T A;  4KSM A;  3MYD A;  4V2M A;  3HZ8 A;  5DQY A;  1X9S B;  4ZL8 A;  1XZO A;  1UA5 A;  4XHM A;  2XC2 A;  2YWN A;  2GZZ A;  9GSS A;  2KLX A;  3QD9 A;  4YKF A;  2LJA A;  3KD0 A;  1S3D A;  12GS A;  2JSZ A;  3KTL A;  3ZTL A;  1GWC A;  4MJB A;  2NTO A;  11GS A;  2HZE A;  2EIR A;  2VAF A;  2VCT A;  1GLP A;  4JR6 A;  1X5D A;  3TJJ A;  2FD3 A;  1XBS A;  1JZD A;  2FA8 A;  3ZRE A;  1XW9 A;  2RM5 A;  3QDN A;  3FMW A;  6GSS A;  4NV5 A;  5J9B A;  5A5H B;  3KCM A;  3ZFB A;  2VL2 C;  2K9F A;  2YWI A;  4ZB7 A;  2JZS A;  4XTS A;  5HQP A;  3BCK A;  1A8Y A;  2VD0 A;  2ZNM A;  2OJL A;  4RI7 A;  7GSS A;  1YQ1 A;  3F4T A;  1F3A A;  5DCG A;  3UAR A;  4KE3 A;  3I69 A;  3KZQ A;  1K0C A;  1F2E A;  3AY8 A;  3FR3 A;  4JZQ A;  5G2Z A;  4AKH A;  4IN0 A;  3FYG A;  2PMT A;  4GF0 A;  1G7O A;  4HOJ A;  2CVK A;  1OE7 A;  1NHO A;  2PER A;  1YKC A;  4F82 A;  2YWM A;  2N5A A;  2EFD A;  5B6N A;  1BX9 A;  1IYI A;  4ZB6 A;  1TW9 A;  1K0A A;  1U3I A;  2E0Q A;  2DJ1 A;  4GSN A;  2IN3 A;  2CVB A;  1A2J A;  3MAK A;  2AHE A;  2GS3 A;  1ON4 A;  1NW2 A;  4FH8 A;  2AYT A;  1SL1 B;  2GVP A;  5B7C A;  1F6M C;  4G10 A;  3UBL A;  2L59 A;  1K0D A;  3RHB A;  1O8X A;  2KUC A;  3VI7 A;  2CZ3 A;  2PN8 A;  5KOW A;  1KNG A;  1SL0 B;  3KXO A;  4PX1 A;  4HEA 2;  2AUV A;  5IMZ A;  3J7Y b;  1ABA A;  3ZVJ D;  4Z7X A;  1SD8 A;  2GQK A;  3LG6 A;  4X0X A;  2VCQ A;  3A5I A;  3QAW A;  3ZIJ A;  3PIN A;  2CVD A;  4PUR A;  5LCZ A;  1ACV A;  1E6B A;  1TI1 A;  2GST A;  3H93 A;  3C1S A;  5DBQ A;  1PN9 A;  5A5H A;  6GSU A;  5IO0 A;  1BG5 A;  1JZO A;  4OO5 A;  2OE1 A;  2FLS A;  2H6Y A;  2YN1 A;  4TVE A;  5IPG A;  2ON5 A;  3HVV A;  4TOP A;  4K2D A;  3BCI A;  1M2A A;  3HHV A;  6GSX A;  1HD2 A;  2X8C A;  1F37 A;  5CRH A;  2B5Y A;  1WP0 A;  2N5F A;  4AJ6 A;  4AKG A;  1WJK A;  2GGT A;  1C72 A;  2NVL A;  2H73 A;  4PXO A;  2KP2 A;  4WEY A;  4PNF A;  5CP1 A;  2YAN A;  5H5R A;  3ZML A;  1DBY A;  4XRA A;  1EV4 A;  2R3X A;  1YKA A;  3DEX A;  1GNW A;  4ID0 A;  3HZ4 A;  3D0Z A;  2YWO A;  5LNK e;  4EC0 A;  3W6G A;  4RI6 A;  4EKZ A;  2HSN B;  1EOG A;  4MF6 A;  1A24 A;  5JCU A;  1YEP A;  5DQS A;  3UAP A;  4ILF A;  4WF4 A;  4KH7 A;  1WWJ A;  1SJI A;  4I97 A;  1QK8 A;  3KTB A;  2R0P A;  2ZUP A;  1USB A;  2FY6 A;  4K0N A;  2WS2 A;  2GLR A;  2UZ8 A;  3VWX A;  3GUS A;  4MDC A;  1B4Q A;  3N9J A;  5F06 A;  1GNE A;  3TJG A;  3HDC A;  3FZ5 A;  1PKW A;  2VCX A;  1JZW A;  2LQO A;  4OD7 A;  1OC3 A;  2I1U A;  5G30 A;  4XIH A;  3FKF A;  4EO3 A;  4Q5R A;  1S3A A;  4AKI A;  2HI7 A;  5JCG A;  1RW1 A;  1VGL A;  3FR6 A;  4POL A;  2FWG A;  3C8E A;  4XCS A;  4O7H A;  1M0U A;  6GSY A;  5ID2 B;  3TOU A;  1TXX A;  4W66 A;  2HRF A;  2GZY A;  5D93 A;  10GS A;  1TDI A;  5J3R A;  3DKS A;  4LA1 A;  4K7I A;  3CSI A;  2V2G A;  4K1F A;  4DEJ A;  2H66 A;  2H71 A;  3FY7 A;  5CRG A;  5DCH A;  4KB3 A;  3Q18 A;  3EUR A;  3IOS A;  3DIE A;  1E2Y A;  3D22 A;  3HA9 A;  4POK A;  5AN1 A;  2B5X A;  4KF9 A;  4OMV A;  4PQI A;  4MMM A;  4ULX A;  2H75 A;  4USS A;  4DSR A;  5HR1 A;  1N25 A;  4ZXG A;  3WGD A;  5DJL A;  3E0U A;  3ZIV A;  4KDX A;  1HNC A;  2HSN A;  4MF5 A;  2QA2 A;  1I5G A;  3GNJ A;  4HUA A;  5ECQ B;  2OAD A;  1GSY A;  2X8G A;  2V6K A;  1WIK A;  1EZK A;  1ZGN A;  3TOT A;  4MPF A;  3R3E A;  1U87 A;  3UBK A;  2I9H A;  1GSF A;  2R0C A;  3PH9 A;  1T1V A;  1BYE A;  2P31 A;  3DGQ A;  3GYK A;  3ERG A;  5DAL B;  1PL2 A;  5ABR A;  1JLW A;  2DML A;  3TCO A;  3TJF A;  2DJJ A;  5KN1 A;  1WE0 A;  2C0G A;  1PQN A;  1O85 A;  17GS A;  2YV9 A;  3MIX A;  1ZOF A;  1KEB A;  3RBT A;  3M0F A;  1UC7 A;  4J57 E;  20GS A;  1MD4 A;  4IP1 A;  5ECO B;  3C71 A;  5C04 A;  3RDW A;  1T4Y A;  3A3T A;  5ID2 A;  2MYG A;  3L9U A;  4MJC A;  5B8B A;  3O3T A;  1TI3 A;  2JSY A;  2V41 A;  4BA7 A;  5G5F A;  4MH3 A;  2CX4 A;  3FZA A;  3G7J A;  1ILO A;  3QFB C;  2DJK A;  1B9Y C;  2EFE A;  4K7N A;  4FQU A;  1MD3 A;  4RQX A;  1Z7P A;  4GWR A;  3VWU A;  4MJA A;  1FHE A;  3CRT A;  4MA9 A;  3TKS E;  1ZYP A;  5CAX A;  2OE0 A;  1XOB A;  4TR4 A;  1QQ2 A;  3TDG A;  3LYK A;  3ME8 A;  3I9V 2;  5J4U A;  2M72 A;  4HU9 A;  2LTK A;  2ALB A;  1NHY A;  1YJ6 A;  4YQM A;  1XW6 A;  1ZCP A;  2GDR A;  3D21 A;  5ECH B;  3QAV A;  2DJ0 A;  3TU3 B;  1K0B A;  4L5O A;  1QXH A;  3HD5 A;  1U88 A;  1LBK A;  5G5E A;  1BED A;  5DAL A;  3HJO A;  1YF0 A;  2QSI A;  4G9H A;  2CAI A;  4MZC A;  2VL3 A;  4TR0 A;  4XS4 B;  5ELA A;  4MPG A;  1J9B A;  1V2A A;  4HJM A;  1ZYE A;  3ZRD A;  4CY8 A;  3VLN A;  2VCW A;  2IMI A;  4I2U A;  4IW9 A;  3F63 A;  1Y1U A;  5ECP B;  4KSO A;  3LXZ A;  2NDO A;  3LYP A;  5ECK B;  3VWV A;  4V1A p;  3RHC A;  4L5L A;  2EFC A;  3KMN A;  2BJX A;  4TW5 A;  2HFD A;  3ED3 A;  5G1K A;  3VPQ A;  3Q19 A;  3W8J A;  3GUR A;  4KCE A;  5D9T A;  4LLR A;  4QMK A;  1B4P A;  3QAG A;  2R5G A;  2JU5 A;  1QFN A;  4H86 A;  1T00 A;  2C3N A;  1OC9 B;  5CO3 A;  4AGS A;  2PVQ A;  3APO A;  3FR9 A;  4LL4 B;  2VUP A;  2HRN A;  4EIQ A;  1F3B A;  1W89 A;  5JWR B;  2LST A;  1X5E A;  2LNT A;  5INY A;  5FHI A;  2O87 A;  6GSW A;  1OAZ A;  3QFA C;  4KND A;  3HMJ G;  4NHZ A;  2IL3 A;  5HR2 A;  2DMM A;  1A0F A;  3F4S A;  1JLV A;  5A4W A;  3GX0 A;  2FA4 A;  1SVO A;  4GSS A;  3TGZ A;  4V2N A;  3GL3 A;  1T3B A;  1CQH A;  4HZ2 A;  3QOU A;  5GAN D;  1PRX A;  1K3L A;  2XPE A;  2TRC P;  2G0F A;  1AAZ A;  2WGR A;  3TRP A;  3SBC A;  3LXT A;  3KEB A;  2B3S A;  5D96 A;  4O32 A;  5C00 A;  2GT5 A;  2WZ9 A;  4KUN A;  4K8M A;  3L9S A;  4L0W A;  3NIV A;  1O8W A;  2H1D A;  4XS4 A;  3GV1 A;  3UVT A;  3HKR A;  3Q6O A;  3EMP A;  2DKI A;  3WYW A;  2C4J A;  1GTB A;  2I81 A;  2WJU A;  1YDK A;  4YAV A;  4OO4 A;  2PBJ A;  4F0B A;  4ECI A;  3S9F A;  2WUL A;  1XWB A;  4D73 B;  3A2X A;  3GX8 A;  1DE1 A;  3L78 A;  2L5O A;  1X9W B;  1PSQ A;  4CY6 A;  4N30 A;  4IJI A;  3GH6 A;  2VO4 A;  1ML6 A;  3V1W A;  4BPY A;  4Z2U A;  1ST9 A;  1OC9 A;  4MK3 A;  2QA1 A;  2P5Q A;  3HVS A;  4MH2 A;  1V40 A;  1GTI A;  5A4V A;  2H30 A;  4TN8 A;  1FVJ A;  4OFM A;  2KP1 A;  2H1G A;  2QKE A;  1Z3E A;  2JAD A;  5ECS A;  3KMO A;  2L6D A;  2O89 A;  4CHS A;  1AQV A;  1URM A;  2K6V A;  1AUC A;  3W8S A;  1TP9 A;  3Q74 A;  4PUA A;  2L4C A;  1B48 A;  3IA1 A;  2K8S A;  3IAS 2;  2EIQ A;  1TU7 A;  2RUF A;  3IAM 2;  4ECJ A;  4I6X A;  2MMO A;  2DIY A;  2HSH A;  1UVZ A;  2F9S A;  3GRX A;  2OA7 A;  3IHQ A;  1SJ6 A;  1V9W A;  4AI6 A;  2LRN A;  1EP8 A;  2BTO T;  2L5L A;  1A2M A;  3EVI A;  4WBR D;  1S3C A;  3DD3 A;  4DSS A;  1K0M A;  3KH9 A;  3GH9 A;  1X0R A;  3LWA A;  1O81 A;  3GMF A;  3IPZ A;  1M2D A;  4TR3 A;  5J9C A;  3GN3 A;  4LMW A;  5ECL B;  4GLT A;  3C7M A;  4AKX B;  5AGY A;  4YKG A;  2H19 A;  2H1L A;  5F0G A;  4V1A g;  1FAA A;  2MMZ A;  1PL1 A;  3LQ7 A;  1Z5Y E;  8GSS A;  4HZ4 A;  5ECR B;  4YQV A;  2E7P A;  2E2M A;  2HLS A;  1DE2 A;  1GUH A;  2L57 A;  3GST A;  3F9U A;  5EY6 A;  2H01 A;  2FGX A;  2H72 A;  3ZIT A;  4D73 A;  4MP4 A;  2EFH A;  2LJK A;  3JCM L;  3F8U A;  1XWG A;  2F51 A;  3GKN A;  5IMV A;  2HZF A;  1THX A;  2WFC A;  5F05 A;  5B8A A;  2AV4 A;  3HCZ A;  2FWF A;  3HJM A;  4MJE A;  3GIX A;  1XWC A;  3CTG A;  2C3Q A;  3TRQ A;  1WOU A;  2Z9S A;  3M3M A;  1M99 A;  1PA3 A;  5DVB A;  4V2L A;  4ZL9 A;  3DWV A;  5IMA A;  3A5W A;  3P8W A;  1EGO A;  3IRA A;  4X43 A;  3N5O A;  1G6W A;  5KEJ A;  2QGV A;  4PQH A;  4WXT A;  4TRX A;  2PWJ A;  3ME7 A;  3CBU A;  3G7I A;  2X64 A;  4YH2 A;  2E2G A;  5HR0 A;  5CRE A;  3RAZ A;  5J40 A;  4F2I A;  1V57 A;  2HE3 A;  3ISO A;  4HQS A;  1Z6N A;  1YF1 A;  2X4A A;  4CW9 A;  4EUY A;  5A4U A;  2DBC A;  3QPM A;  2HQT A;  4GCI A;  1R4W A;  3LJR A;  2LQQ A;  1HYU A;  4Z2R A;  1GSS A;  5KN0 A;  2B6M A;  1IYH A;  2YPM A;  2VLU A;  2FHE A;  2LUS A;  5JCW A;  3TKS A;  4ECB A;  3F3Q A;  3E9J B;  2GQL A;  5F8B A;  2AB6 A;  3ERF A;  4TXV A;  3GTU B;  4GRF A;  1Z9H A;  2DC5 A;  1ERW A;  2LEG A;  5LD0 A;  2OBK A;  3H4K A;  3C73 A;  2OAC A;  1AIU A;  3UJ1 A;  4MNN A;  1AQW A;  2MBT A;  5F07 A;  4K7O A;  3WT1 A;  1I9D A;  4PTS A;  2WDU A;  5D9X A;  5EL8 A;  3EWL A;  3GSS A;  1EP7 A;  4JR4 A;  3GA4 A;  4POB A;  1TRW A;  5KN2 A;  5G31 A;  4XRD A;  1SKR B;  1SD9 A;  1JHB A;  3F6D A;  2AAW A;  4WKW A;  4Z2T A;  4MZW A;  2REM A;  1VF4 A;  5IM9 A;  2F8A A;  2C0F A;  3O76 A;  4MF7 A;  5D8I A;  4EDY A;  1QMV A;  2VL9 A;  2V6O A;  1A0R P;  1R26 A;  1R5P A;  2PU9 C;  3RPN A;  4X1U A;  2NPB A;  3CTF A;  4DSQ A;  2FCH A;  3TB2 A;  4O5Q A;  2H0G A;  2VCV A;  2C80 A;  3LW9 A;  3F4R A;  5COH A;  3US3 A;  1K3O A;  1SKW B;  2DJ3 A;  2HYX A;  3TJK A;  4F03 A;  1N8J A;  2CQ9 A;  1J0F A;  1PD2 1;  5FWG A;  5A1N A;  1XOA A;  2X8H A;  3U6V A;  1DUG A;  1GH2 A;  2X99 A;  2R0G A;  4LL1 B;  2ES7 A;  3HJP A;  1TOF A;  2DSA A;  3TRX A;  4JRR A;  2LS5 A;  1PN0 A;  1Y25 A;  2YJ7 A;  1H75 A;  4JU5 A;  1ZZY A;  1O7U A;  2VL2 A;  3C1R A;  2H6Z A;  4K5R A;  5HFI A;  2LKU A;  5IQY A;  3TKQ A;  1U3A A;  4Q5N A;  2IMD A;  1TK0 B;  3PGT A;  5DAK B;  3WT2 A;  3GTU A;  3EE2 A;  2H0H A;  2H76 A;  3IC4 A;  1LJR A;  4G0I A;  1ZYQ B;  3IHG A;  4GDF A;  1OKT A;  3OR5 A;  3IXR A;  1A8L A;  1QGV A;  1B9X C;  1YEX A;  4NPB A;  4BVY B;  2O85 A;  1GTA A;  1Z7R A;  3H8Q A;  2KHP A;  1ZMA A;  4CDO A;  1A2L A;  4EF0 A;  3ZZX A;  4FYB A;  4ZB8 A;  3LEF A;  4NMU A;  1VRS D;  4ACS A;  1XCC A;  2ZCT A;  3DYR A;  3RPP A;  1TK5 B;  2IFQ A;  2X49 A;  1O73 A;  18GS A;  1PMT A;  3MSZ A;  2GSS A;  3F6F A;  2EC4 A;  4MZB A;  2CA8 A;  1ERT A;  1G6Y A;  3GHA A;  5DDL A;  1SJZ A;  1XVW A;  5B6M A;  3BOA A;  4FO5 A;  1HNA A;  4ZBD A;  2C8U A;  2MMA A;  2HT9 A;  1KBN A;  4KW6 A;  4NV2 A;  3EYT A;  2ON7 A;  4PQ1 A;  5EPF A;  3EU4 A;  3CSJ A;  4L0U A;  1Q98 A;  4TKY A;  4LMV A;  1KTE A;  4IHU A;  3TUE A;  2B1K A;  3LSZ A;  5ECM B;  2A2S A;  3NZN A;  3CRU A;  4ML1 A;  1V58 A;  4ISD A;  2HSY A;  4O5U A;  16GS A;  19GS A;  3P7X A;  4EIP A;  5DAK A;  1YZX A;  2A2R A;  1W4V A;  2MBS A;  3CSH A;  1M9B A;  4G2E A;  3IK7 A;  1K3Y A;  4EDZ A;  2KOK A;  1AQX A;  3IDV A;  1EV9 A;  3I6A A;  4BVY A;  3VWW A;  3KIJ A;  3U5R E;  5J41 A;  1WMJ A;  5IMD A;  2RUE A;  2M46 A;  1TKD B;  2GTU A;  4GXZ A;  1FB0 A;  2PPT A;  5HR3 A;  2VIM A;  3GKK A;  4K9Z A;  5CRD A;  2DKH A;  1X5C A;  1WRY A;  3L4N A;  4EL1 A;  4WBJ A;  3WD6 A;  1WPI A;  4I8B A;  5ECI B;  4E8H A;  4OCF A;  4O5R A;  4HDE A;  3DML A;  1SEN A;  1H4O A;  5ELG A;  2H1B A;  1SK2 A;  1SVL A;  4KX4 A;  1TRV A;  2QC7 A;  3P90 A;  1EEJ A;  4HS1 A;  1GLQ A;  4DSS B;  5H5S A;  3GKX A;  1O6J A;  4ZIJ A;  3I43 A;  1MDK A;  1GUK A;  2XBQ A;  2UV8 G;  2YNX A;  1GUL A;  2IME A;  2JZT A;  4GST A;  2B7K A;  5D73 A;  3H1N A;  2YOI A;  2B7J A;  3LGC A;  3L0H A;  3O6T A;  2DLX A;  1TU8 A;  1GTU A;  4J56 E;  2IIY A;  5IOW A;  2CZ2 A;  4PNG A;  2YZH A;  2IWT A;  4OCE A;  4HJ2 A;  3NOF A;  4IVF A;  4DVC A;  1LU4 A;  2MMN A;  4FIW A;  1XWA A;  5G1L A;  2VM2 A;  3ZMK A;  1EWX A;  4TR1 A;  2I3Y A;  1XPV A;  3QMX A;  4ECC A;  2I4A A;  4XS1 A;  5DJM A;  1GSD A;  1DSB A;  2LRC A;  3SWL A;  2D2Z A;  5AIS A;  3DVW A;  3IE3 A;  3DXB A;  4IEL A;  2IPA A;  3D4T A;  3GL5 A;  3F0I A;  1FOH A;  2LV3 A;  3ZLP A;  5JWO B;  4G19 A;  5GSS A;  2F3M A;  1FG4 A;  4J2F A;  1FVK A;  4POM A;  1A23 A;  3IR4 A;  4GQF A;  2FWH A;  2L6C A;  4ZL7 A;  1SVM A;  2P5R A;  1PX7 A;  2IMK A;  5KN3 A;  2VKZ G;  2J9H A;  1T8E B;  2CAQ A;  1PKZ A;  4GTU A;  2OBI A;  5IOX A;  6GST A;  3TKR A;  3GFK A;  3UVH A;  4X4J A;  2WRT A;  2H6X A;  2H70 A;  4WET A;  1K0O A;  1Q4J A;  2JAC A;  3KJY A;  4N10 A;  4EXJ A;  13GS A;  1AC1 A;  4KA0 A;  2H1A A;  1ZL9 A;  4G01 A;  1FW1 A;  2K8V A;  4NAX A;  1M9A A;  3PPU A;  2P0G A;  2F8F A;  4MCU A;  1G0T A;  4FYC A;  2LNS A;  2R4V A;  2TIR A;  3KP9 A;  4Q5F A;  3DRN A;  1RQM A;  4KAE A;  5JWQ B;  4YAP A;  2HNL A;  1T7P B;  4WR4 A;  4IGJ A;  4HI7 A;  1MTC A;  2VM1 A;  1SKS B;  2PUK C;  1SU9 A;  4IS0 A;  3VFI A;  4OWY A;  5AIV A;  2HSM B;  4QL9 A;  4N0Z A;  3ZYW A;  4BWS A;  2GT6 A;  5CYY A;  4I5Q A;  1XWK A;  1OYJ A;  4N11 A;  3M9J A;  3APS A;  2A4V A;  2VLT A;  4WR5 A;  3DVX A;  2GZP A;  4BL7 B;  3UIW A;  1Y6E A;  2CX3 A;  5CNW A;  3VUR A;  1R7H A;  4Q5Q A;  3D5J A;  4PGT A;  3R2Q A;  4KDU A;  2CT6 A;  3EC3 A;  4IP6 A;  3UEM A;  4P3Y B;  1T4Z A;  3ZVJ A;  3ZFL A;  2OKA A;  1M2B A;  1TJD A;  4N3Z A;  3CXG A;  4L8E A;  4F0C A;  1GRX A;  3FK8 A;  3L9V A;  2V1M A;  3A2V A;  4NXI A;  4ZBA A;  2WCI A;  5D9W A;  4NHW A;  2YV7 A;  3FRC A;  1Z6M A;  4KDY A;  1PX6 A;  2IJY A;  2JL4 A;  2R6K A;  4N0V A;  1X9M B;  5E59 A;  3EU3 A;  2TRX A;  2B5E A;  4PUF C;  2R2J A;  3MNG A;  1YY7 A;  5A1N B;  2WB9 A;  1OKD A;  5HFK A;  2C3T A;  1B8X A;  14GS A;  4G0L A;  4RQR A;  2H8L A;  2DIZ A;  3QR6 A;  2V32 A;  1SYX A;  2EIO A;  3IC8 A;  4ZIL A;  1AW9 A;  3UMA A;  1BQ7 A;  3M8N A;  2FNO A;  5BMU B;  1OE8 A;  5J4V A;  4E8E A;  1BG1 A;  3P2A A;  2C1Y A;  5AIX A;  3FW2 A;  2FWE A;  4IQ1 A;  3LOR A;  3IBH A;  2RII A;  3QCP A;  3FZ9 A;  4RUV A;  2HSM A;  4KGI A;  2N5B A;  5ENU A;  2H0I A;  1FOV A;  1MDI A;  2DJ2 A;  3UL3 A;  2A2P A;  2HRK B;  2YJH A;  2XPD A;  1VF1 A;  4I2T A;  1TK8 B;  3J7Y k;  2R37 A;  4BL7 A;  3A2W A;  4WF5 A;  2IFQ B;  3VK9 A;  5IPH A;  4BWQ A;  4JBB A;  3IK9 A;  4OFT A;  3VPT A;  2HXK A;  3MWH A;  2XHF A;  3WGE A;  2K18 A;  2IMF A;  4O92 A;  1GSQ A;  3FZ4 A;  2PVO C;  1RK4 A;  2H74 A;  4TXO B;  3FEU A;  4EE0 A;  1K0N A;  2YZU A;  1OC8 A;  2NBS A;  2VCZ A;  3TKP A;  2OT3 A;  2PGT A;  1XW5 A;  3F3R A;  4QQ7 A;  5IO2 A;  2LJR A;  2CV4 A;  2RLI A;  2GSQ A;  2M80 A;  3WGX A;  5L71 A;  4IQA A;  1OVN A;  4JE1 A;  2HRA A;  5IIZ A;  5J4Y A;  1NM3 A;  1PGT A;  1NSW A;  3LFL A;  1TTZ A;  4IJ3 A;  2OE3 A;  2C0D A;  2GQM A;  3BBY A;  2XBI A;  1TRS A;  3BJ5 A;  2GSR A;  1SK1 A;  1SK0 A;  3M9K A;  1N2A A;  3M1G A;  5GAP D;  5IMF A;  4MAB A;  4ZBB A;  5ECN B;  3CMI A;  5BMU A;  4K6X A;  3PR8 A;  5GZZ B;  2G2Q A;  2BMX A;  1F9M A;  1XVQ A;  4BVX B;  5A34 B;  4EVM A;  4XS6 A;  3D4M A;  3G9B A;  2YP6 A;  4ICY A;  3APQ A;  4GQC A;  1FO5 A;  3E3E A;  4OFN A;  3HVX A;  3K8N A;  5BRT A;  3HXS A;  1BF5 A;  4AJ8 A;  1GP1 A;  2HRK A;  3TJB A;  4HU7 A;  5GST A;  4IBP A;  4ML6 A;  1EOH A;  3ERW A;  4FYU A;  1BJX A;  1GSE A;  3HY2 A;  2VLV A;  4K5S A;  5EVO A;  3VI5 A;  4KCA A;  1EGR A;  3CWG A;  3D6I A;  4AF2 A;  1MEK A;  4JED A;  1ERU A;  1V98 A;  5H5Q A;  2C0E A;  4TXO A;  3UOM A;  4IKH A;  2AJQ B;  3ZL5 A;  4K0G A;  2MZC A;  4YQU A;  1SL2 B;  4NWY A;  2HZE B;  1JZR A;  1VF3 A;  1U6T A;  3HYP A;  5D9V A;  5FT3 A;  3EIN A;  1QUW A;  5J5N A;  5A5K A;  2VOC A;  2L4Q A;  3H79 A;  1GSU A;  1GUM A;  5KOX A;  5CRW A;  1TRU A;  1G7E A;  3EMX A;  5IMC A;  1XIY A;  1EEM A;  4ZB9 A;  3MDK A;  1JFU A;  1AXD A;  5J47 A;  2JZR A;  1CQG A;  1MDJ A;  4AJ7 A;  4E68 A;  1YVL A;  3CYN A;  1BAY A;  3G7Y A;  2LRT A;  3KH7 A;  3GKM A;  3TKS C;  3KM6 A;  1GL8 A;  1J08 A;  5E4W A;  1HQO A;  5HFG A;  1XXU A;  2VD1 A;  4MLY A;  2YCD A;  22GS A;  2O8V B;  4TR1 B;  3EPT A;  6GSV A;  2O7K A;  2O5V A;  1XFL A;  3KGK A;  1VF2 A;  1R5A A;  1UN2 A;  4K2X A;  1TXU A;  4G0K A;  4BVX A;  5A34 A;  3IV4 A;  4A5P A;  2FUG 2;  1THO A;  1HNB A;  2A4H A;  4HQZ A;  2RM6 A;  2J23 A;  1FB6 A;  3BD2 A;  1ZYN A;  1SYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...