1TU7A

Structure of onchocerca volvulus pi-class glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MSYKLTYFSIRGLAEPIRLFLVDQDIKFIDDRIAKDDFSSIKSQFQFGQLPCLYDGDQQIVQSGAILRHLARKYNLNGENEMETTYIDMFCEGVRDLHVKYTRMIYMAYETEKDPYIKSILPGELAKFEKLLATRGNGRNLILGDKISYADYALFEELDVHQILDPHCLDKFPLLKVFHQRMKDRPKLKEYCEKRDAAKVPVNGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 2
publication title Structure of the Major Cytosolic Glutathione S-Transferase from the Parasitic Nematode Onchocerca volvulus
pubmed doi rcsb
source organism Onchocerca volvulus
total genus 78
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1tu7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tu7A01
3IHQA 3PPUA 5AN1A 2HNLA 3IC8A 1O8WA 5G31A 5EL8A 3M0FA 3MWHA 1M2DA 1Q4JA 2EC4A 4KA0A 4BVYB 5DALB 1CQGA 1VF4A 3IR4A 2P31A 2V2GA 4H86A 1F9MA 1YDKA 3TRPA 4ID0A 3W8SA 2GTUA 1Z3EA 2IFQA 3Q74A 3VLNA 1Z6MA 3KXOA 4HJ2A 4OMVA 3APSA 4ISDA 3HXSA 5FHIA 4K7OA 2YANA 1PGTA 4DEJA 1XVWA 3GA4A 5IMFA 4BVXB 2IMIA 1FVJA 2FNOA 1SYXA 5CO3A 4POMA 5KEJA 4PNGA 3LQ7A 2B5XA 1URMA 5CP1A 5ECLB 1GSEA 3KTLA 2V1MA 1H75A 1GNWA 1SD9A 2MMOA 2H0HA 3N9JA 3KJYA 1X5EA 1ILOA 1K0CA 2VM1A 1SL2B 3RPPA 2X8CA 1YEXA 2K8SA 2IWTA 1EEMA 3GKKA 4WKWA 3C7MA 4DSRA 2LRTA 2CT6A 3TJKA 3DIEA 3RBTA 4TKYA 2K9FA 2LQOA 3HY2A 2HYXA 4KH7A 1A23A 4PUFC 1SJIA 1K3OA 4JEDA 2VAFA 3D0ZA 1THXA 2HXKA 2QGVA 1ZMAA 4IP6A 4ILFA 1USBA 5F07A 2ZNMA 4ZB9A 4NPBA 2X8GA 3WGXA 4IW9A 4I8BA 4O7HA 2KHPA 5GZZB 4F03A 5J4UA 4KNDA 4ZILA 2DSAA 1X5CA 1PSQA 5IIZA 3GTUB 3A2XA 1G7EA 1MDIA 1Z9HA 2H6XA 3LG6A 2IPAA 4OCEA 1TU8A 3QD9A 2HRAA 2YJ7A 3M9JA 4TR3A 3HVSA 4KW6A 1XFLA 1DBYA 4Q5RA 1ERVA 6GSSA 11GSA 1G7OA 2Z9SA 3KGKA 2I81A 2JU5A 4X43A 4PQIA 1JLVA 1TK8B 5D73A 4HS1A 2C3QA 3J7Yb 5HR2A 4MPFA 3TKSE 4MJEA 1QK8A 2MMNA 1XCCA 3LXTA 4PGTA 1PD21 2HSMA 2VL9A 1BAYA 4V1Ap 5HR0A 3FR3A 1AQXA 1XW6A 1WPIA 5G1KA 4ZB8A 3DD3A 3I69A 3D22A 2IMDA 1SL1B 1V2AA 2VIMA 1QQ2A 3WT2A 4IKHA 2M80A 3F9UA 3R3EA 3DRNA 2HZFA 4L8EA 3PH9A 5G1LA 3H1NA 3LWAA 4EVMA 1EGRA 9GSSA 3CSJA 2L4QA 4D73A 2GDRA 4OWYA 2J9HA 2XPDA 2VCXA 1B48A 4LLRA 7GSSA 3W8JA 1V58A 2YOIA 4KUNA 5JCUA 5CRWA 2GLRA 1JLWA 14GSA 2HRKA 2LNSA 2IMFA 1GP1A 4N11A 3G9BA 1U3IA 3DVXA 4LL1B 1SKSB 2DJ3A 4NXIA 3CRTA 1U87A 3M8NA 1K0DA 2OA7A 4E8HA 2DLXA 4NWYA 5DAKB 4XRAA 3MAKA 1GSQA 3EINA 4MH3A 1G6WA 1UC7A 2CAQA 4YAVA 3WYWA 4NV2A 2H70A 5IPHA 2FD3A 3UOMA 5CRGA 4X1UA 1MD4A 4EE0A 1EV9A 1PN9A 3I43A 5LCZA 4ML6A 1TXXA 4PNFA 2N5AA 1OKDA 2KUCA 2HFDA 4L5LA 4OFTA 2DJ1A 1UA5A 1XOAA 3QR6A 2YPMA 1KEBA 2H0GA 2PUKC 4GSTA 1SKWB 2PWJA 4KSMA 3UVTA 3ZVJD 1PMTA 5JWQB 4K7IA 4MH2A 1Z6NA 4HZ2A 3ZMLA 4IBPA 4ZL9A 2WDUA 2F51A 3D4MA 4Q5FA 2C0FA 2RM5A 3GKNA 1LU4A 3IPZA 2B5EA 1KTEA 1A2JA 5ECIB 1SK0A 16GSA 1ZCPA 1YKCA 3MDKA 3SBCA 4DVCA 4GQFA 4PTSA 4HJMA 4MLYA 3AY8A 4KDUA 1BX9A 2YWMA 4HDEA 3A5WA 3IOSA 1J08A 3L0HA 5CNWA 3GH9A 4ZB6A 5F05A 3DMLA 3FZ9A 1IYHA 4MDCA 2BJXA 1GH2A 4X0XA 2YN1A 1ERWA 4IN0A 3PGTA 2VL2A 1GULA 2MZCA 2EIRA 1FB0A 1O7UA 3ISOA 4Z7XA 3GHAA 2GQKA 2HZEB 1U6TA 1A2MA 2X99A 3QPMA 1NHYA 3GSSA 1SK2A 2DIYA 1NM3A 3CTGA 1R5AA 1JZOA 3QMXA 3WT1A 3CXGA 3KIJA 3GTUA 2HT9A 3TJFA 1A8YA 2B6MA 2L6CA 1O85A 3TB2A 1QXHA 1GUHA 4YH2A 3ME8A 1AQVA 2HSYA 5GAND 4L5OA 6GSVA 1SJ6A 3GX8A 3GL5A 2P0GA 1R4WA 1T4ZA 1T7PB 4IVFA 1KNGA 1NW2A 1XPVA 4QL9A 4K2DA 3KP9A 1I9DA 5B6NA 3GRXA 1UN2A 3PINA 4F0CA 5D9XA 3L78A 1THOA 1GLQA 1KBNA 2VOCA 3LXZA 2V32A 3DYRA 3C1SA 2B7JA 1K0OA 2QC7A 1G6YA 1GSDA 2HSMB 3KP8A 4GF0A 4K7NA 4J2FA 2RIIA 2I1UA 5L71A 3CSHA 4TR4A 4KDXA 3TKPA 5ECNB 4PXOA 5ECOB 2O89A 3KZQA 3ZREA 1U3AA 3Q6OA 2G2QA 2H76A 2F3MA 3BBYA 2CQ9A 3UL3A 1HYUA 2C1YA 2P5RA 2IN3A 5F8BA 2VD0A 1W4VA 5CRDA 2C0GA 3KD0A 4JU5A 2H19A 1WRYA 1WP0A 4MA9A 4D73B 2EIQA 5ECPB 1PX7A 1U88A 3EU4A 3VWWA 5HQPA 1TK5B 3KM6A 3ZIVA 1XOBA 4TVEA 2GZPA 1O81A 3WGDA 2KP2A 5DJMA 1X9SB 3GFKA 5ECSA 4IHUA 1OC8A 2B1LA 2H74A 2IMEA 1XW9A 1ON4A 5D9VA 2AJQB 1EP7A 5EVOA 1J9BA 2PVOC 1K0AA 1XWKA 1HD2A 4IJ3A 3U6VA 2YZHA 2WB9A 4MCUA 5DAKA 4NV5A 4I97A 1MD3A 2LJRA 3HZ4A 2NDOA 4BA7A 1JZWA 1VGLA 1I5GA 1T1VA 3C1RA 2NTOA 1MDKA 5IMDA 4YQVA 2B3SA 2VL2C 3HJOA 4F82A 2GT6A 3EYTA 1Z5YE 3HJMA 5B7CA 2NVLA 4MF7A 2DC5A 5ID2B 1G0TA 1PA3A 4EUYA 1BYEA 2IL3A 2A2SA 2YV7A 5DQSA 2RUFA 4ZBDA 3O6TA 3A2VA 2YV9A 1F2EA 5AIVA 1SENA 2ALBA 2D2ZA 2VLUA 5IMZA 3Q18A 1ML6A 1XWCA 4OCFA 5ECHB 2OE1A 3P8WA 4DSSA 5A4UA 4ECCA 3UBKA 2OACA 20GSA 2A4VA 2AB6A 3QCPA 4WF5A 2E0QA 2HE3A 3ZL5A 1X5DA 4FYCA 3H93A 4HQZA 3RPNA 1OVNA 4MK3A 1XWGA 2B5YA 2H73A 3WD6A 3A2WA 3ZITA 1TP9A 3I6AA 1VRSD 2G0FA 2OADA 5C00A 3ZVJA 1M0UA 4EC0A 2I9HA 1EEJA 2H6YA 5D8IA 5FWGA 2REMA 2FWGA 3APOA 1O73A 1YQ1A 5KN0A 3CMIA 4ZXGA 4EKZA 2HZEA 1E6BA 5EY6A 2JZRA 3FZ5A 3NZNA 3S9FA 2XC2A 4MJBA 3FZ4A 4N0VA 1BQ7A 3M3MA 3BJ5A 4MABA 1M99A 3UAPA 4JR6A 4ACSA 4KE3A 5J9CA 4EDZA 3IK7A 4WR5A 1A24A 4IQ1A 5CYYA 3CSIA 5ELGA 1V40A 4TOPA 4K1FA 4PQ1A 5F06A 3G7JA 3FKFA 2LJAA 3VK9A 1HNAA 2NPBA 5LD0A 3ZFLA 8GSSA 1JZRA 3LGCA 3FHKA 5F0GA 1M9BA 5COHA 3TKSC 2FY6A 4GXZA 1B9YC 1EOHA 1ABAA 5A4VA 2H01A 2L5OA 3F6DA 2JADA 6GSUA 3NIVA 1F3AA 4J57E 2YWIA 1F6MC 2GGTA 1ZYQB 3QAWA 3DVWA 2H71A 2O87A 2F8FA 2JL4A 1A0FA 3VWUA 2OJLA 5J5NA 2YP6A 5IO2A 4OO4A 2JSZA 3VPTA 2LRNA 1M2AA 5H5RA 3ZLPA 3GN3A 2TRCP 5ABRA 4I5QA 3ZZXA 2E7PA 3EWLA 4V2LA 4XHMA 1FVKA 2VCZA 1VF1A 2M46A 5IMCA 3IV4A 4Q5QA 3GURA 4KB3A 5HFKA 5C04A 5DCGA 2LS5A 4MF5A 2HSHA 1B4PA 4G9HA 3Q19A 1GLPA 1SYRA 3D5JA 5JCGA 4HUAA 4CDOA 4IS0A 4BWSA 3ZRDA 4N0ZA 3E0UA 3GUSA 2FWEA 1R5PA 2IJYA 3IAM2 1OE7A 2DJ2A 3EVIA 3US3A 2C8UA 1YKAA 4G0IA 4KCAA 4XRDA 4L0UA 5IMAA 1GTAA 4JBBA 3CBUA 5DQYA 2CZ2A 3FR6A 1ZGNA 3FZAA 5DVBA 5B8AA 1XW5A 4FQUA 2QSIA 4P3YB 2L59A 3TCOA 2NBSA 1GWCA 2HSNB 3VFIA 2VCWA 4N10A 2YWOA 3UVHA 1X9WB 4G0KA 2H6ZA 5HFGA 4QL7A 4XS6A 4ZIJA 2DJ0A 3PR8A 2CV4A 5D9TA 1BJXA 3WGEA 4EF0A 1OE8A 2GSTA 1ZZYA 5ID2A 5G5EA 2LV3A 4K8MA 4BPYA 3BCIA 1TJDA 3TJBA 2XBIA 4MMMA 1T00A 2N5BA 2ON5A 2GZZA 1OYJA 3N5OA 1ERUA 3GMFA 2YJHA 3EU3A 5ECKB 2FCHA 4POBA 3BCKA 5J3RA 4HEA2 2ZCTA 1MDJA 1RK4A 2L5LA 3KTBA 2BMXA 3APQA 5IQYA 4MJCA 3FR9A 1M9AA 5AIXA 1AC1A 1K0BA 2V6OA 2HQTA 4ULXA 13GSA 3TKRA 3LJRA 4DSSB 1SKRB 2B1KA 2LTKA 3ERFA 4O5RA 2FWHA 4GCIA 3EE2A 3R2QA 1ACVA 3F4RA 4ML1A 3H79A 4NHZA 2H0IA 1XVQA 4WETA 4TRXA 1TI3A 1LJRA 2MYGA 3FK8A 1EZKA 1TRSA 2DMLA 1EWXA 2V6KA 4E8EA 4JZQA 3KEBA 4HZ4A 3D6IA 3O3TA 1TOFA 2YZUA 3DGQA 4MJAA 1QGVA 4YQUA 5E59A 4HI7A 5A4WA 4XS1A 4WBRD 5IPGA 1TU7A 4OO5A 5GAPD 4FYBA 5KN1A 3GSTA 2YWNA 3C71A 3UIWA 2VUPA 4O92A 3LSZA 2L4CA 4V2MA 2F9SA 1T4YA 2WJUA 3GKXA 3EMXA 3ZYWA 1K0MA 1MEKA 2WS2A 4MZWA 1X0RA 3FW2A 3CYNA 1M7TA 4TN8A 3A3TA 3VPQA 2X8HA 1WWJA 2B7KA 1VF2A 2R37A 2GSSA 2FA8A 1EGOA 5CAXA 4BL7A 1AUCA 3M1GA 3KMNA 2GS3A 4AJ7A 1GTUA 4I2TA 3QFAC 1GRXA 1FHEA 3DWVA 2MMAA 2C0DA 2RLIA 1TTZA 3OR5A 5CRHA 4MP4A 4PURA 2PPTA 3EURA 5INYA 4NHWA 2H1DA 3V1WA 4LA1A 1TW9A 2XHFA 4FIWA 4PQHA 3HCZA 3H4KA 2VL3A 4GRFA 2O7KA 1OKTA 1GUMA 4KF9A 4TR0A 2GZYA 1Z7PA 5HR3A 3GX0A 1SD8A 3UMAA 1WIKA 2L57A 3ZTLA 2LRCA 2YNXA 4KAEA 6GSWA 5IOWA 4HOJA 1SK1A 5LNKe 1TK0B 2CVBA 4KDYA 2R3XA 4YAPA 3TOTA 1R26A 2HLSA 3ZIJA 4HU7A 2AV4A 1JHBA 1PRXA 3KCMA 2CZ3A 3TKSA 5B8BA 3C8EA 4CHSA 3F4SA 1AQWA 5G30A 3GV1A 3SWLA 4USSA 1MTCA 4GQCA 4K0GA 4RI6A 5ECMB 1SU9A 5AISA 1X9MB 3LEFA 2GSRA 2H1BA 2CVDA 2LQQA 1N2AA 3IDVA 1GSYA 1GUKA 1OC3A 4WXTA 1Q98A 3QOUA 2WFCA 3MSZA 3TRQA 4K0NA 4MPGA 3IXRA 2CX4A 5DCHA 1OC9A 2OBKA 3FYGA 4IP1A 3KH7A 5IO0A 2LUSA 4PX1A 4G19A 3HYPA 1FOVA 2MMZA 1C72A 1Y6EA 2R6KA 3UEMA 1GSFA 1HQOA 2C0EA 5CREA 1S3CA 3LYPA 4AJ8A 1XWAA 3VWVA 4G10A 2HRFA 3W6GA 2HRNA 4BWQA 3ME7A 2PN8A 1HNCA 2P5QA 5FT3A 4FYUA 10GSA 1T8EB 1ST9A 2C80A 1YF0A 4WEYA 2H1AA 2GVPA 3FRCA 2WCIA 3C73A 4I2UA 3M9KA 2AAWA 5BMUA 2H1GA 1RQMA 2OKAA 3F0IA 1Z7RA 2R4VA 3L4NA 4JRRA 3HKRA 3LORA 5H5QA 2RM6A 2WGRA 4RQXA 5B6MA 2L6DA 5ELAA 5JWOB 3FY7A 2XBQA 3QAGA 1K0NA 3ED3A 1BEDA 4ECJA 1GTBA 1QFNA 2OBIA 5D96A 3CRUA 4TR1B 4F9ZA 1DSBA 2UZ8A 2C3TA 1GNEA 18GSA 3IAS2 3D4TA 1FB6A 3VI5A 12GSA 3TKQA 3HHVA 2XPEA 4WBJA 2JACA 1PL2A 4EL1A 2C3NA 1BG5A 5IOXA 2VD1A 2I4AA 3VI7A 1AXDA 3KH9A 1LBKA 2YCDA 4ZBAA 2FGXA 1W89A 3ERWA 3ZFBA 1TRVA 3GH6A 1TRUA 3GNJA 4BL7B 2FUG2 2CX3A 4EO3A 4DSQA 2H75A 2E2MA 5ECRB 3UBLA 5KN3A 4XS4A 3VURA 4WR4A 1XBSA 1TKDB 1GL8A 4XIHA 4TXOA 4LMVA 4GSNA 5G5FA 4KX4A 1ZL9A 5J41A 2AHEA 2PU9C 4LL4B 2LJKA 1HNBA 5HFIA 1S3DA 3F3QA 1S3AA 4TW5A 2I3YA 4EDYA 3MNGA 5IMVA 1A8LA 5D9WA 4XCSA 1GTIA 1OAZA 3GKMA 3HA9A 2O85A 4WF4A 3TGZA 4JR4A 1O6JA 3EC3A 5A5KA 1DE1A 1H4OA 4IGJA 4AGSA 2AUVA 2VM2A 4XTSA 1WE0A 2CA8A 1VF3A 4F0BA 4CW9A 1A2LA 1R7HA 3QDNA 1SJZA 4GTUA 3E3EA 4ZL8A 2VCQA 5DJLA 3TJJA 4MF6A 5GSTA 1TRWA 4IQAA 5JWRB 3G7YA 3DXBA 4HU9A 3J7Yk 4ECBA 3F3RA 5GSSA 3IC4A 3K8NA 3TJGA 3I9V2 1CQHA 1DUGA 1E2YA 2PERA 4IJIA 4RQRA 3UJ1A 2X64A 4GLTA 2TIRA 2VO4A 2KOKA 5KN2A 3VWXA 4BVYA 5DALA 3IE3A 2H8LA 3LFLA 2R2JA 1QMVA 4HQSA 3L9UA 1ZYEA 4O32A 3HJPA 4N30A 2J23A 2ON7A 1EP8A 22GSA 1OC9B 1FW1A 1UVZA 1WMJA 1PKZA 4BVXA 4FH8A 2VCTA 2IFQB 4Q5NA 4L0WA 2JSYA 2WULA 1DE2A 2PBJA 1YZXA 1K3YA 3KMOA 2JZSA 2GQLA 4PUAA 1V98A 4GWRA 1TDIA 1WJKA 5E4WA 3BOAA 2KLXA 1PKWA 1YEPA 3F4TA 3H8QA 3GYKA 2VLTA 4ZL7A 4YQMA 4MZCA 2BTOT 3U5RE 3CTFA 2PMTA 2FLSA 4RUVA 3HD5A 2E2GA 1O8XA 1GSUA 4TXVA 3IK9A 2IMKA 4POKA 1B9XC 5J9BA 2QKEA 2A2RA 1PX6A 4OD7A 2ES7A 5IM9A 2H72A 1SL0B 1FG4A 2WZ9A 1J0FA 3RAZA 1XXUA 2TRXA 2OE3A 2R5GA 4AF2A 1B8XA 3JCML 2VCVA 4KSOA 4KCEA 2CVKA 4FO5A 1WOUA 3D21A 4F2IA 3TUEA 2LKUA 4TR1A 2RUEA 2GT5A 3EMPA 4RI7A 2H30A 2DIZA 6GSYA 5AGYA 17GSA 3ZMKA 2DBCA 3LYKA 2WRTA 2FWFA 3P90A 2FHEA 2PVQA 3UARA 2K18A 2FA4A 2OE0A 5ENUA 3G7IA 1JZDA 2MBTA 3QFBC 3DKSA 1AIUA 3GL3A 4V1Ag 5ECQB 1ERTA 19GSA 3FEUA 4K9ZA 2IIYA 1N8JA 2DJJA 5DDLA 4JE1A 4QQ7A 1IYIA 3NOFA 3HVXA 5HR1A 1F3BA 2AYTA 5JCWA 1FAAA 1V57A 4ECIA 2CAIA 2HI7A 2VLVA 3L9VA 3QAVA 1PQNA 2N5FA 2LSTA 4K6XA 1M2BA 1Y25A 3IBHA 1RW1A 1XZOA 2DJKA 3F6FA 1AW9A 4POLA 1FO5A 1XIYA 4G2EA 4NMUA 4EXJA 3E9JB 4OFMA 3GIXA 5G2ZA 4XS4B 4V2NA 3HVVA 2C4JA 3P7XA 3HDCA 4TXOB 1JFUA 4J56E 4AJ6A 3BD2A 2O8VB 3O76A 4LMWA 4MZBA 3IA1A 2DMMA 5D93A 2EIOA 1YF1A 4G0LA 3HZ8A 1V9WA 2H66A 1YJ6A 3RHCA 1NHOA 3RHBA 1NSWA 3L9SA 4OFNA 1GSSA 1YY7A 2GSQA 5EPFA 2JZTA 2ZUPA 2KP1A 2K6VA 3ERGA 1EOGA 3F63A 3F8UA 5H5SA 5DBQA 4ZBBA 3IRAA 4I6XA 1EV4A 4KGIA 3DEXA 4IELA 1B4QA 1XWBA 4GSSA 2PGTA 3TOUA 4NAXA 1PL1A 3TDGA 1QUWA 2V41A 2LNTA 2MBSA 6GSTA 1ZOFA 1F37A 1T3BA 3RDWA 2K8VA 2F8AA 2M72A 1AAZA 2HRKB 1A0RP 3P2AA 3TRXA 6GSXA 2GQMA 1TI1A 1K3LA 2LEGA
chains in the Genus database with same CATH superfamily
3IHQA 3PPUA 5AN1A 2HNLA 3IC8A 1O8WA 5G31A 5EL8A 3M0FA 3MWHA 1M3JA 1M2DA 1Q4JA 2EC4A 4KA0A 4BVYB 5DALB 1CQGA 1VF4A 4Z2RA 3IR4A 2P31A 2V2GA 4H86A 1F9MA 1BG1A 1YDKA 3TRPA 4ID0A 3W8SA 2GTUA 1Z3EA 2IFQA 3Q74A 3VLNA 1Z6MA 4PI0C 3KXOA 4HJ2A 4OMVA 3APSA 4ISDA 3HXSA 5FHIA 4K7OA 2YANA 1PGTA 4DEJA 1XVWA 3GA4A 5IMFA 4BVXB 2IMIA 1FVJA 2FNOA 1SYXA 5CO3A 4POMA 5KEJA 4PNGA 3LQ7A 2B5XA 1URMA 5CP1A 5ECLB 1GSEA 3KTLA 2V1MA 1H75A 1GNWA 1SD9A 2MMOA 2H0HA 2A2PA 3N9JA 3KJYA 1X5EA 1ILOA 1K0CA 2VM1A 1SL2B 3RPPA 2X8CA 1YEXA 3CWGA 2K8SA 2IWTA 4K2XA 1EEMA 3GKKA 4WKWA 3C7MA 4DSRA 2LRTA 2CT6A 3TJKA 3DIEA 3RBTA 4TKYA 4ICYA 2K9FA 2LQOA 3HY2A 2HYXA 4KH7A 1A23A 3CHXC 4PUFC 1SJIA 1K3OA 4JEDA 5A1NA 2VAFA 3D0ZA 1THXA 2HXKA 2QGVA 5KOXA 1ZMAA 4IP6A 4ILFA 1USBA 5F07A 2ZNMA 3A5IA 4ZB9A 4NPBA 1ZYNA 2X8GA 3WGXA 4IW9A 4I8BA 4O7HA 4YKGA 2KHPA 5GZZB 4F03A 1PFOA 5J4UA 4KNDA 4ZILA 2DSAA 1X5CA 1PSQA 5IIZA 3GTUB 3A2XA 1G7EA 1MDIA 1Z9HA 1YVLA 2H6XA 3LG6A 2IPAA 4OCEA 1TU8A 3QD9A 2HRAA 2YJ7A 3M9JA 4TR3A 5A34B 3HVSA 4KW6A 1XFLA 1DBYA 4Q5RA 1ERVA 6GSSA 11GSA 1G7OA 2Z9SA 3KGKA 2I81A 2JU5A 4X43A 4PQIA 1JLVA 1TK8B 5D73A 4HS1A 2C3QA 3J7Yb 5HR2A 4MPFA 3TKSE 4MJEA 5J47A 1QK8A 2MMNA 1XCCA 3LXTA 4PGTA 1PD21 2HSMA 2VL9A 1BAYA 4V1Ap 5HR0A 3FR3A 1AQXA 1XW6A 1WPIA 5G1KA 4A5PA 4ZB8A 3DD3A 3I69A 3D22A 2IMDA 1SL1B 1V2AA 2VIMA 1QQ2A 3WT2A 4IKHA 4N3ZA 2M80A 3F9UA 3R3EA 3DRNA 2HZFA 4L8EA 3PH9A 5G1LA 3H1NA 3LWAA 4EVMA 1EGRA 9GSSA 3CSJA 2L4QA 4D73A 2GDRA 4OWYA 2J9HA 2XPDA 2VCXA 4ZB7A 1B48A 4LLRA 7GSSA 3W8JA 1V58A 2YOIA 4KUNA 5JCUA 5CRWA 2GLRA 1JLWA 14GSA 2HRKA 2LNSA 2IMFA 1GP1A 4N11A 3G9BA 1U3IA 3DVXA 4LL1B 1SKSB 2DJ3A 4NXIA 3CRTA 1U87A 3M8NA 1K0DA 2OA7A 4E8HA 2DLXA 4NWYA 5DAKB 4XRAA 3MAKA 1GSQA 3EINA 4MH3A 1G6WA 1UC7A 2CAQA 4YAVA 3WYWA 4NV2A 2H70A 5IPHA 2FD3A 3UOMA 5CRGA 4X1UA 1MD4A 4EE0A 1EV9A 1PN9A 3I43A 5LCZA 4ML6A 1TXXA 4PNFA 2N5AA 1OKDA 2KUCA 2HFDA 4L5LA 4OFTA 2DJ1A 1UA5A 1XOAA 3QR6A 2YPMA 1KEBA 2H0GA 2PUKC 4GSTA 1SKWB 2PWJA 4KSMA 3UVTA 3ZVJD 1PMTA 5JWQB 4K7IA 4MH2A 5J4YA 1Z6NA 4HZ2A 2DKIA 3ZMLA 4IBPA 4ZL9A 2WDUA 2F51A 3D4MA 4Q5FA 2C0FA 2RM5A 3GKNA 1LU4A 3IPZA 2B5EA 1KTEA 1A2JA 5ECIB 1SK0A 2WW2A 16GSA 1ZCPA 1YKCA 3MDKA 2O3EA 3SBCA 4DVCA 1YEWC 4GQFA 4PTSA 4HJMA 4MLYA 3AY8A 4KDUA 1BX9A 2YWMA 4HDEA 3A5WA 3IOSA 1J08A 3L0HA 5CNWA 3GH9A 4ZB6A 5F05A 3DMLA 3FZ9A 1IYHA 4MDCA 2BJXA 1GH2A 4X0XA 2YN1A 1ERWA 4IN0A 3PGTA 2VL2A 1GULA 2MZCA 1S4BP 2EIRA 1FB0A 1O7UA 5A1NB 3ISOA 4Z7XA 3GHAA 2GQKA 2HZEB 1U6TA 1A2MA 2X99A 3QPMA 1NHYA 3GSSA 1SK2A 2DIYA 1NM3A 3CTGA 1R5AA 1JZOA 3QMXA 2WVXA 3CXGA 3KIJA 3WT1A 3GTUA 2HT9A 3TJFA 1A8YA 2B6MA 2L6CA 1O85A 3TB2A 1QXHA 1GUHA 4YH2A 3ME8A 1AQVA 2HSYA 5GAND 4L5OA 6GSVA 1SJ6A 3GX8A 3GL5A 4EIQA 2P0GA 4E68A 1R4WA 1T4ZA 1T7PB 4IVFA 1KNGA 3CQFA 1N25A 1NW2A 1XPVA 4QL9A 4K2DA 3KP9A 1I9DA 5B6NA 3GRXA 2WVZA 1UN2A 3PINA 4F0CA 5D9XA 3L78A 1THOA 1GLQA 1KBNA 2VOCA 3MIXA 3LXZA 2V32A 3DYRA 3C1SA 2B7JA 1K0OA 2QC7A 1G6YA 1GSDA 2HSMB 3KP8A 4GF0A 4K7NA 4J2FA 2RIIA 2I1UA 5L71A 3CSHA 4TR4A 4KDXA 3TKPA 5ECNB 4PXOA 5ECOB 2O89A 3KZQA 3EPTA 3ZREA 1U3AA 5KOWA 3Q6OA 2G2QA 1SVMA 2H76A 4PI2C 2F3MA 3BBYA 2CQ9A 3UL3A 1HYUA 2C1YA 2P5RA 2IN3A 5F8BA 4Z2TA 2VD0A 1W4VA 5A5HB 5CRDA 2C0GA 3KD0A 4JU5A 2H19A 1WRYA 1WP0A 4MA9A 4D73B 2EIQA 5ECPB 1PX7A 1U88A 3EU4A 3VWWA 5HQPA 1TK5B 3KM6A 3ZIVA 1XOBA 4TVEA 2GZPA 1O81A 3WGDA 4FXYP 2KP2A 5DJMA 1X9SB 3FMWA 3GFKA 5ECSA 2HSNA 4IHUA 1OC8A 2DKHA 2B1LA 2H74A 2IMEA 1XW9A 1ON4A 5D9VA 2AJQB 1EP7A 5EVOA 1J9BA 2PVOC 1K0AA 3HMJG 1XWKA 1HD2A 4IJ3A 3U6VA 2YZHA 2WB9A 4MCUA 5DAKA 4NV5A 4I97A 2EFDA 1MD3A 2LJRA 3HZ4A 2NDOA 4BA7A 1JZWA 1VGLA 1I5GA 1T1VA 3C1RA 2NTOA 1MDKA 5IMDA 4YQVA 2B3SA 2VL2C 3HJOA 4F82A 2GT6A 3EYTA 1Z5YE 3HJMA 5B7CA 2NVLA 4MF7A 2DC5A 5ID2B 1G0TA 2EFCA 1PA3A 4EUYA 4PHZC 1BYEA 2IL3A 2A2SA 2YV7A 5DQSA 2RUFA 4ZBDA 3O6TA 3A2VA 2YV9A 1F2EA 5AIVA 1SENA 2ALBA 2D2ZA 2VLUA 5IMZA 3Q18A 1ML6A 1XWCA 4OCFA 5ECHB 2OE1A 3P8WA 4DSSA 3IHGA 5A4UA 4ECCA 3UBKA 2OACA 20GSA 2A4VA 2AB6A 3QCPA 4WF5A 2E0QA 2HE3A 3ZL5A 1X5DA 4FYCA 3H93A 4HQZA 3RPNA 1OVNA 4MK3A 1XWGA 2B5YA 2H73A 3WD6A 3A2WA 3ZITA 1TP9A 3I6AA 1VRSD 2G0FA 2OADA 5C00A 3ZVJA 1M0UA 4EC0A 2I9HA 1EEJA 2H6YA 5D8IA 5FWGA 2REMA 2FWGA 3APOA 1O73A 1YQ1A 4BIKA 5KN0A 3CMIA 4ZXGA 4EKZA 2HZEA 1E6BA 5EY6A 2JZRA 3FZ5A 3NZNA 3S9FA 2XC2A 4MJBA 3FZ4A 4N0VA 1BQ7A 3M3MA 3BJ5A 2QA2A 4MABA 1M99A 3UAPA 4JR6A 4ACSA 4KE3A 5J9CA 4EDZA 3IK7A 4WR5A 1A24A 4IQ1A 5CYYA 3CSIA 1I1IP 5ELGA 1V40A 4TOPA 4K1FA 4PQ1A 5F06A 3G7JA 3FKFA 2LJAA 2WVXB 3VK9A 1HNAA 2NPBA 5LD0A 3ZFLA 8GSSA 1JZRA 3LGCA 3FHKA 5F0GA 1M9BA 5COHA 3TKSC 2FY6A 4GXZA 1B9YC 1EOHA 1ABAA 5A4VA 2H01A 2L5OA 5J40A 3F6DA 2JADA 6GSUA 3NIVA 1F3AA 4J57E 2YWIA 1F6MC 2GGTA 1ZYQB 3QAWA 3DVWA 2H71A 2O87A 2F8FA 2JL4A 1A0FA 3VWUA 2OJLA 5J5NA 2YP6A 5IO2A 4OO4A 2JSZA 3VPTA 2LRNA 1M2AA 5H5RA 3ZLPA 3GN3A 2TRCP 5ABRA 4I5QA 3ZZXA 2E7PA 3EWLA 4V2LA 4XHMA 1FVKA 2VCZA 4MNNA 1VF1A 2M46A 5IMCA 3IV4A 4AI6A 4Q5QA 3GURA 4KB3A 5HFKA 5C04A 5DCGA 2LS5A 4MF5A 2HSHA 1B4PA 4G9HA 3Q19A 1GLPA 1SYRA 3D5JA 2R0CA 5JCGA 5A5HA 4HUAA 4CDOA 4IS0A 4BWSA 3ZRDA 4N0ZA 3E0UA 3GUSA 2FWEA 1R5PA 2IJYA 3IAM2 1OE7A 2DJ2A 3EVIA 3US3A 2C8UA 1YKAA 4G0IA 4KCAA 4XRDA 4L0UA 4O5QA 5IMAA 1GTAA 4JBBA 3CBUA 5DQYA 2CZ2A 3FR6A 1ZGNA 3FZAA 5DVBA 5B8AA 1XW5A 4AKHA 5J4VA 4FQUA 2QSIA 4P3YB 2L59A 3TCOA 2NBSA 1GWCA 2HSNB 3VFIA 2VCWA 4N10A 2YWOA 3UVHA 1X9WB 4G0KA 2H6ZA 5HFGA 3TU3B 4QL7A 4XS6A 4ZIJA 2DJ0A 3PR8A 2CV4A 5D9TA 1BJXA 3WGEA 4EF0A 1OE8A 2GSTA 1ZZYA 5ID2A 5G5EA 2LV3A 4K8MA 4BPYA 3BCIA 1TJDA 2X49A 3TJBA 2XBIA 4MMMA 1T00A 2N5BA 2ON5A 2GZZA 1OYJA 3N5OA 1ERUA 3GMFA 2YJHA 3EU3A 5ECKB 2FCHA 4POBA 3BCKA 5J3RA 4HEA2 2ZCTA 1MDJA 1RK4A 2L5LA 3KTBA 2BMXA 3APQA 5IQYA 4MJCA 3FR9A 1M9AA 5AIXA 1AC1A 1K0BA 2V6OA 4QMKA 2HQTA 4ULXA 13GSA 3TKRA 3LJRA 4DSSB 1SKRB 2B1KA 2LTKA 3ERFA 4O5RA 2FWHA 4GCIA 3EE2A 3R2QA 1ACVA 3F4RA 4ML1A 3H79A 4NHZA 2H0IA 1XVQA 3RFRC 4WETA 4TRXA 1TI3A 1LJRA 2MYGA 3FK8A 1EZKA 1TRSA 2DMLA 1EWXA 2V6KA 4E8EA 4JZQA 3KEBA 4HZ4A 3D6IA 3O3TA 1TOFA 2YZUA 3DGQA 4MJAA 1QGVA 4YQUA 5E59A 4HI7A 5A4WA 4XS1A 4WBRD 5IPGA 1TU7A 4OO5A 5GAPD 4FYBA 5KN1A 3GSTA 2YWNA 3C71A 3UIWA 2VUPA 4O92A 2O36A 3LSZA 2L4CA 4V2MA 2F9SA 1T4YA 2WJUA 3GKXA 3EMXA 3ZYWA 1K0MA 1MEKA 2WS2A 4MZWA 1X0RA 2WW0A 3FW2A 3CYNA 1M7TA 4TN8A 3A3TA 3VPQA 2X8HA 1WWJA 2B7KA 4G01A 1VF2A 2R37A 2GSSA 2FA8A 1EGOA 5CAXA 4BL7A 2R0PA 1AUCA 3KMNA 3M1GA 2GS3A 4AJ7A 1GTUA 4I2TA 3QFAC 1GRXA 1FHEA 3DWVA 2MMAA 2C0DA 2RLIA 1TTZA 3RGBC 3OR5A 5CRHA 4MP4A 1PN0A 4PURA 2PPTA 3EURA 5INYA 4NHWA 2H1DA 3V1WA 4LA1A 1TW9A 2XHFA 4FIWA 4PQHA 3HCZA 3H4KA 2VL3A 4GRFA 2O7KA 1OKTA 3LW9A 1GUMA 4KF9A 4TR0A 2GZYA 1Z7PA 5HR3A 3GX0A 1SD8A 3UMAA 1WIKA 2L57A 3ZTLA 4K5SA 2LRCA 2YNXA 4KAEA 6GSWA 5IOWA 4HOJA 1SK1A 5LNKe 1TK0B 2CVBA 4KDYA 2R3XA 4CY8A 4YAPA 3TOTA 1R26A 2HLSA 3ZIJA 4HU7A 2AV4A 1JHBA 2R0GA 1PRXA 3KCMA 2CZ3A 3TKSA 5B8BA 3C8EA 4CHSA 1ZYPA 3F4SA 1AQWA 5G30A 3GV1A 3SWLA 4USSA 1MTCA 4GQCA 4K0GA 1SVLA 4RI6A 5ECMB 1SU9A 5AISA 1X9MB 3LEFA 2GSRA 2H1BA 2CVDA 2LQQA 1N2AA 3IDVA 1GSYA 1GUKA 1OC3A 4WXTA 1Q98A 3QOUA 2WFCA 2EFHA 2VKZG 3MSZA 3TRQA 4K0NA 4MPGA 3IXRA 2CX4A 5DCHA 1OC9A 2OBKA 3FYGA 4IP1A 3KH7A 5IO0A 2LUSA 1TXUA 1Y1UA 4PX1A 4G19A 3HYPA 1FOVA 4YKFA 2MMZA 1C72A 1Y6EA 2R6KA 3UEMA 1GSFA 1HQOA 2C0EA 5CREA 1S3CA 3LYPA 4AJ8A 1XWAA 3VWVA 4G10A 2HRFA 3W6GA 2HRNA 1FOHA 4BWQA 3ME7A 2PN8A 1HNCA 2P5QA 5FT3A 4FYUA 10GSA 1T8EB 1ST9A 2C80A 1YF0A 4WEYA 2H1AA 2GVPA 3FRCA 2WCIA 3C73A 4I2UA 3M9KA 2AAWA 5BMUA 4EIPA 2H1GA 1RQMA 2OKAA 3F0IA 1Z7RA 2R4VA 4GDFA 3L4NA 4JRRA 3HKRA 3LORA 5H5QA 2RM6A 2WGRA 4RQXA 5B6MA 2L6DA 5ELAA 5JWOB 3FY7A 2XBQA 3QAGA 1K0NA 3ED3A 1BEDA 3HVNA 4ECJA 1GTBA 1QFNA 2OBIA 5D96A 3CRUA 4TR1B 4F9ZA 1DSBA 2UZ8A 2C3TA 1GNEA 18GSA 3IAS2 3D4TA 1FB6A 3VI5A 12GSA 3TKQA 3HHVA 2XPEA 4WBJA 4X4JA 2JACA 1PL2A 4EL1A 2C3NA 1BG5A 5IOXA 2VD1A 2I4AA 3VI7A 1AXDA 3KH9A 1LBKA 2YCDA 4ZBAA 2FGXA 1W89A 3ERWA 3ZFBA 1TRVA 3GH6A 1TRUA 3GNJA 4BL7B 2FUG2 2CX3A 4EO3A 4DSQA 2H75A 2E2MA 5ECRB 3UBLA 5KN3A 4XS4A 3VURA 4WR4A 1XBSA 1TKDB 1GL8A 4XIHA 4TXOA 4LMVA 4GSNA 5G5FA 4KX4A 1ZL9A 2WW1A 5J41A 2AHEA 4O5UA 2PU9C 4LL4B 2LJKA 1HNBA 5HFIA 1S3DA 3F3QA 1S3AA 4TW5A 2I3YA 4EDYA 1XG8A 3MNGA 2OT3A 5IMVA 1A8LA 5D9WA 4XCSA 1GTIA 1OAZA 3GKMA 3HA9A 2O85A 4WF4A 3TGZA 4JR4A 1O6JA 3EC3A 5A5KA 1DE1A 1H4OA 4IGJA 4W66A 1SVOA 4AGSA 2AUVA 2VM2A 4XTSA 2WZSA 1WE0A 2CA8A 1VF3A 4F0BA 4CW9A 1A2LA 1R7HA 3QDNA 4K5RA 1SJZA 4GTUA 3E3EA 4ZL8A 2VCQA 5DJLA 3TJJA 4MF6A 5GSTA 1TRWA 4IQAA 5JWRB 4AKIA 2UV8G 3G7YA 3DXBA 4HU9A 3J7Yk 4ECBA 3F3RA 2O5VA 5GSSA 3IC4A 3K8NA 3TJGA 3I9V2 1CQHA 1DUGA 1M3IA 1E2YA 2PERA 4IJIA 4RQRA 3UJ1A 2X64A 4GLTA 2TIRA 2VO4A 1BF5A 2KOKA 2X4AA 5KN2A 3VWXA 4BVYA 5DALA 3IE3A 2H8LA 3LFLA 2R2JA 1QMVA 4HQSA 3L9UA 1ZYEA 4O32A 3HJPA 4N30A 4AKGA 2A4HA 2J23A 2ON7A 1EP8A 22GSA 1OC9B 1FW1A 1UVZA 1WMJA 1PKZA 4BVXA 4FH8A 2VCTA 2IFQB 4Q5NA 4L0WA 2JSYA 2WULA 1DE2A 2PBJA 1YZXA 1K3YA 3KMOA 2JZSA 2GQLA 4PUAA 1V98A 4CY6A 4GWRA 1TDIA 1WJKA 5E4WA 3BOAA 2KLXA 1PKWA 1YEPA 3F4TA 3H8QA 3GYKA 2VLTA 4ZL7A 4YQMA 4MZCA 2BTOT 2WVYA 5BRTA 3U5RE 3CTFA 2PMTA 2FLSA 4RUVA 1S3RA 3HD5A 2E2GA 1O8XA 1GSUA 4TXVA 3IK9A 2IMKA 4POKA 1B9XC 5J9BA 2QKEA 2A2RA 1PX6A 4OD7A 2ES7A 5IM9A 2H72A 1SL0B 1FG4A 2WZ9A 1J0FA 3RAZA 5BMUB 1XXUA 2TRXA 2QA1A 2OE3A 2R5GA 2H1LA 4AF2A 1B8XA 3JCML 2VCVA 4KSOA 4KCEA 2CVKA 4FO5A 1WOUA 3D21A 4F2IA 3TUEA 2LKUA 4TR1A 2EFEA 2RUEA 2GT5A 3EMPA 4RI7A 2H30A 2DIZA 6GSYA 5AGYA 17GSA 3ZMKA 2DBCA 3LYKA 4Z2UA 2WRTA 2FWFA 3P90A 2FHEA 2PVQA 4HSCX 3UARA 2K18A 2FA4A 2OE0A 5ENUA 3G7IA 1JZDA 2MBTA 3QFBC 3DKSA 1AIUA 3GL3A 4V1Ag 5ECQB 1ERTA 19GSA 3FEUA 4K9ZA 2IIYA 1N8JA 2DJJA 5DDLA 2WW3A 4JE1A 5A34A 4QQ7A 1IYIA 3NOFA 3HVXA 5HR1A 1F3BA 2AYTA 5JCWA 1FAAA 1V57A 4ECIA 2CAIA 2HI7A 2VLVA 3L9VA 3QAVA 1PQNA 2N5FA 2LSTA 4K6XA 1M2BA 1Y25A 3IBHA 1RW1A 1XZOA 2DJKA 3F6FA 1AW9A 4POLA 1FO5A 1XIYA 4G2EA 4NMUA 4EXJA 3E9JB 4OFMA 3GIXA 5G2ZA 4XS4B 4V2NA 3HVVA 2C4JA 3P7XA 3HDCA 4TXOB 1JFUA 4J56E 4AJ6A 3BD2A 2O8VB 3O76A 4LMWA 4MZBA 3IA1A 2DMMA 5D93A 2EIOA 1YF1A 4G0LA 3HZ8A 1V9WA 2H66A 1YJ6A 3RHCA 1NHOA 3RHBA 1NSWA 3L9SA 4OFNA 1GSSA 1YY7A 2GSQA 5EPFA 2JZTA 2ZUPA 2KP1A 2K6VA 3ERGA 1EOGA 3F63A 3F8UA 5H5SA 5DBQA 4ZBBA 3IRAA 4I6XA 1EV4A 4KGIA 3DEXA 4IELA 4AKXB 1B4QA 1XWBA 4GSSA 2PGTA 3TOUA 4NAXA 1PL1A 3TDGA 1QUWA 2V41A 3MYDA 2LNTA 2MBSA 6GSTA 1ZOFA 1F37A 1T3BA 3RDWA 2K8VA 2F8AA 2M72A 1AAZA 2HRKB 1A0RP 3P2AA 3TRXA 6GSXA 2GQMA 1TI1A 1K3LA 2LEGA
chains in the Genus database with same CATH topology
3IHQA 3PPUA 5AN1A 2HNLA 3IC8A 1O8WA 5G31A 5EL8A 3M0FA 3MWHA 1M2DA 1Q4JA 2EC4A 4KA0A 4BVYB 5DALB 1CQGA 1VF4A 4Z2RA 3IR4A 2P31A 2V2GA 4H86A 1F9MA 1BG1A 1YDKA 3TRPA 4ID0A 3W8SA 2GTUA 1Z3EA 2IFQA 3Q74A 3VLNA 1Z6MA 3KXOA 4HJ2A 4OMVA 3APSA 4ISDA 3HXSA 5FHIA 4K7OA 2YANA 1PGTA 4DEJA 1XVWA 3GA4A 5IMFA 4BVXB 2IMIA 1FVJA 2FNOA 1SYXA 5CO3A 4POMA 5KEJA 4PNGA 3LQ7A 2B5XA 1URMA 5CP1A 5ECLB 1GSEA 3KTLA 2V1MA 1H75A 1GNWA 1SD9A 2MMOA 2H0HA 2A2PA 3N9JA 3KJYA 1X5EA 1ILOA 1K0CA 2VM1A 1SL2B 3RPPA 2X8CA 1YEXA 3CWGA 2K8SA 2IWTA 4K2XA 1EEMA 3GKKA 4WKWA 3C7MA 4DSRA 2LRTA 2CT6A 3TJKA 3DIEA 3RBTA 4TKYA 4ICYA 2K9FA 2LQOA 3HY2A 2HYXA 4KH7A 1A23A 4PUFC 1SJIA 1K3OA 4JEDA 5A1NA 2VAFA 3D0ZA 1THXA 2HXKA 2QGVA 5KOXA 1ZMAA 4IP6A 4ILFA 1USBA 5F07A 2ZNMA 3A5IA 4ZB9A 4NPBA 1ZYNA 2X8GA 3WGXA 4IW9A 4I8BA 4O7HA 4YKGA 2KHPA 5GZZB 4F03A 5J4UA 4KNDA 4ZILA 2DSAA 1X5CA 1PSQA 5IIZA 3GTUB 3A2XA 1G7EA 1MDIA 1Z9HA 1YVLA 2H6XA 3LG6A 2IPAA 4OCEA 1TU8A 3QD9A 2HRAA 2YJ7A 3M9JA 4TR3A 5A34B 3HVSA 4KW6A 1XFLA 1DBYA 4Q5RA 1ERVA 6GSSA 11GSA 1G7OA 2Z9SA 3KGKA 2I81A 2JU5A 4X43A 4PQIA 1JLVA 1TK8B 5D73A 4HS1A 2C3QA 3J7Yb 5HR2A 4MPFA 3TKSE 4MJEA 5J47A 1QK8A 2MMNA 1XCCA 3LXTA 4PGTA 1PD21 2HSMA 2VL9A 1BAYA 4V1Ap 5HR0A 3FR3A 1AQXA 1XW6A 1WPIA 5G1KA 4A5PA 4ZB8A 3DD3A 3I69A 3D22A 2IMDA 1SL1B 1V2AA 2VIMA 1QQ2A 3WT2A 4IKHA 4N3ZA 2M80A 3F9UA 3R3EA 3DRNA 2HZFA 4L8EA 3PH9A 5G1LA 3H1NA 3LWAA 4EVMA 1EGRA 9GSSA 3CSJA 2L4QA 4D73A 2GDRA 4OWYA 2J9HA 2XPDA 2VCXA 4ZB7A 1B48A 4LLRA 7GSSA 3W8JA 1V58A 2YOIA 4KUNA 5JCUA 5CRWA 2GLRA 1JLWA 14GSA 2HRKA 2LNSA 2IMFA 1GP1A 4N11A 3G9BA 1U3IA 3DVXA 4LL1B 1SKSB 2DJ3A 4NXIA 3CRTA 1U87A 3M8NA 1K0DA 2OA7A 4E8HA 2DLXA 4NWYA 5DAKB 4XRAA 3MAKA 1GSQA 3EINA 4MH3A 1G6WA 1UC7A 2CAQA 4YAVA 3WYWA 4NV2A 2H70A 5IPHA 2FD3A 3UOMA 5CRGA 4X1UA 1MD4A 4EE0A 1EV9A 1PN9A 3I43A 5LCZA 4ML6A 1TXXA 4PNFA 2N5AA 1OKDA 2KUCA 2HFDA 4L5LA 4OFTA 2DJ1A 1UA5A 1XOAA 3QR6A 2YPMA 1KEBA 2H0GA 2PUKC 4GSTA 1SKWB 2PWJA 4KSMA 3UVTA 3ZVJD 1PMTA 5JWQB 4K7IA 4MH2A 5J4YA 1Z6NA 4HZ2A 2DKIA 3ZMLA 4IBPA 4ZL9A 2WDUA 2F51A 3D4MA 4Q5FA 2C0FA 2RM5A 3GKNA 1LU4A 3IPZA 2B5EA 1KTEA 1A2JA 5ECIB 1SK0A 16GSA 1ZCPA 1YKCA 3MDKA 3SBCA 4DVCA 4GQFA 4PTSA 4HJMA 4MLYA 3AY8A 4KDUA 1BX9A 2YWMA 4HDEA 3A5WA 3IOSA 1J08A 3L0HA 5CNWA 3GH9A 4ZB6A 5F05A 3DMLA 3FZ9A 1IYHA 4MDCA 2BJXA 1GH2A 4X0XA 2YN1A 1ERWA 4IN0A 3PGTA 2VL2A 1GULA 2MZCA 2EIRA 1FB0A 1O7UA 5A1NB 3ISOA 4Z7XA 3GHAA 2GQKA 2HZEB 1U6TA 1A2MA 2X99A 3QPMA 1NHYA 3GSSA 1SK2A 2DIYA 1NM3A 3CTGA 1R5AA 1JZOA 3QMXA 3WT1A 3CXGA 3KIJA 3GTUA 2HT9A 3TJFA 1A8YA 2B6MA 2L6CA 1O85A 3TB2A 1QXHA 1GUHA 4YH2A 3ME8A 1AQVA 2HSYA 5GAND 4L5OA 6GSVA 1SJ6A 3GX8A 3GL5A 4EIQA 2P0GA 4E68A 1R4WA 1T4ZA 1T7PB 4IVFA 1KNGA 1N25A 1NW2A 1XPVA 4QL9A 4K2DA 3KP9A 1I9DA 5B6NA 3GRXA 1UN2A 3PINA 4F0CA 5D9XA 3L78A 1THOA 1GLQA 1KBNA 2VOCA 3MIXA 3LXZA 2V32A 3DYRA 3C1SA 2B7JA 1K0OA 2QC7A 1G6YA 1GSDA 2HSMB 3KP8A 4GF0A 4K7NA 4J2FA 2RIIA 2I1UA 5L71A 3CSHA 4TR4A 4KDXA 3TKPA 5ECNB 4PXOA 5ECOB 2O89A 3KZQA 3EPTA 3ZREA 1U3AA 5KOWA 3Q6OA 2G2QA 1SVMA 2H76A 2F3MA 3BBYA 2CQ9A 3UL3A 1HYUA 2C1YA 2P5RA 2IN3A 5F8BA 4Z2TA 2VD0A 1W4VA 5A5HB 5CRDA 2C0GA 3KD0A 4JU5A 2H19A 1WRYA 1WP0A 4MA9A 4D73B 2EIQA 5ECPB 1PX7A 1U88A 3EU4A 3VWWA 5HQPA 1TK5B 3KM6A 3ZIVA 1XOBA 4TVEA 2GZPA 1O81A 3WGDA 2KP2A 5DJMA 1X9SB 3FMWA 3GFKA 5ECSA 2HSNA 4IHUA 1OC8A 2DKHA 2B1LA 2H74A 2IMEA 1XW9A 1ON4A 5D9VA 2AJQB 1EP7A 5EVOA 1J9BA 2PVOC 1K0AA 3HMJG 1XWKA 1HD2A 4IJ3A 3U6VA 2YZHA 2WB9A 4MCUA 5DAKA 4NV5A 4I97A 2EFDA 1MD3A 2LJRA 3HZ4A 2NDOA 4BA7A 1JZWA 1VGLA 1I5GA 1T1VA 3C1RA 2NTOA 1MDKA 5IMDA 4YQVA 2B3SA 2VL2C 3HJOA 4F82A 2GT6A 3EYTA 1Z5YE 3HJMA 5B7CA 2NVLA 4MF7A 2DC5A 5ID2B 1G0TA 2EFCA 1PA3A 4EUYA 1BYEA 2IL3A 2A2SA 2YV7A 5DQSA 2RUFA 4ZBDA 3O6TA 3A2VA 2YV9A 1F2EA 5AIVA 1SENA 2ALBA 2D2ZA 2VLUA 5IMZA 3Q18A 1ML6A 1XWCA 4OCFA 5ECHB 2OE1A 3P8WA 4DSSA 3IHGA 5A4UA 4ECCA 3UBKA 2OACA 20GSA 2A4VA 2AB6A 3QCPA 4WF5A 2E0QA 2HE3A 3ZL5A 1X5DA 4FYCA 3H93A 4HQZA 3RPNA 1OVNA 4MK3A 1XWGA 2B5YA 2H73A 3WD6A 3A2WA 3ZITA 1TP9A 3I6AA 1VRSD 2G0FA 2OADA 5C00A 3ZVJA 1M0UA 4EC0A 2I9HA 1EEJA 2H6YA 5D8IA 5FWGA 2REMA 2FWGA 3APOA 1O73A 1YQ1A 5KN0A 3CMIA 4ZXGA 4EKZA 2HZEA 1E6BA 5EY6A 2JZRA 3FZ5A 3NZNA 3S9FA 2XC2A 4MJBA 3FZ4A 4N0VA 1BQ7A 3M3MA 3BJ5A 2QA2A 4MABA 1M99A 3UAPA 4JR6A 4ACSA 4KE3A 5J9CA 4EDZA 3IK7A 4WR5A 1A24A 4IQ1A 5CYYA 3CSIA 5ELGA 1V40A 4TOPA 4K1FA 4PQ1A 5F06A 3G7JA 3FKFA 2LJAA 3VK9A 1HNAA 2NPBA 5LD0A 3ZFLA 8GSSA 1JZRA 3LGCA 3FHKA 5F0GA 1M9BA 5COHA 3TKSC 2FY6A 4GXZA 1B9YC 1EOHA 1ABAA 5A4VA 2H01A 2L5OA 5J40A 3F6DA 2JADA 6GSUA 3NIVA 1F3AA 4J57E 2YWIA 1F6MC 2GGTA 1ZYQB 3QAWA 3DVWA 2H71A 2O87A 2F8FA 2JL4A 1A0FA 3VWUA 2OJLA 5J5NA 2YP6A 5IO2A 4OO4A 2JSZA 3VPTA 2LRNA 1M2AA 5H5RA 3ZLPA 3GN3A 2TRCP 5ABRA 4I5QA 3ZZXA 2E7PA 3EWLA 4V2LA 4XHMA 1FVKA 2VCZA 4MNNA 1VF1A 2M46A 5IMCA 3IV4A 4AI6A 4Q5QA 3GURA 4KB3A 5HFKA 5C04A 5DCGA 2LS5A 4MF5A 2HSHA 1B4PA 4G9HA 3Q19A 1GLPA 1SYRA 3D5JA 2R0CA 5JCGA 5A5HA 4HUAA 4CDOA 4IS0A 4BWSA 3ZRDA 4N0ZA 3E0UA 3GUSA 2FWEA 1R5PA 2IJYA 3IAM2 1OE7A 2DJ2A 3EVIA 3US3A 2C8UA 1YKAA 4G0IA 4KCAA 4XRDA 4L0UA 4O5QA 5IMAA 1GTAA 4JBBA 3CBUA 5DQYA 2CZ2A 3FR6A 1ZGNA 3FZAA 5DVBA 5B8AA 1XW5A 4AKHA 5J4VA 4FQUA 2QSIA 4P3YB 2L59A 3TCOA 2NBSA 1GWCA 2HSNB 3VFIA 2VCWA 4N10A 2YWOA 3UVHA 1X9WB 4G0KA 2H6ZA 5HFGA 3TU3B 4QL7A 4XS6A 4ZIJA 2DJ0A 3PR8A 2CV4A 5D9TA 1BJXA 3WGEA 4EF0A 1OE8A 2GSTA 1ZZYA 5ID2A 5G5EA 2LV3A 4K8MA 4BPYA 3BCIA 1TJDA 2X49A 3TJBA 2XBIA 4MMMA 1T00A 2N5BA 2ON5A 2GZZA 1OYJA 3N5OA 1ERUA 3GMFA 2YJHA 3EU3A 5ECKB 2FCHA 4POBA 3BCKA 5J3RA 4HEA2 2ZCTA 1MDJA 1RK4A 2L5LA 3KTBA 2BMXA 3APQA 5IQYA 4MJCA 3FR9A 1M9AA 5AIXA 1AC1A 1K0BA 2V6OA 4QMKA 2HQTA 4ULXA 13GSA 3TKRA 3LJRA 4DSSB 1SKRB 2B1KA 2LTKA 3ERFA 4O5RA 2FWHA 4GCIA 3EE2A 3R2QA 1ACVA 3F4RA 4ML1A 3H79A 4NHZA 2H0IA 1XVQA 4WETA 4TRXA 1TI3A 1LJRA 2MYGA 3FK8A 1EZKA 1TRSA 2DMLA 1EWXA 2V6KA 4E8EA 4JZQA 3KEBA 4HZ4A 3D6IA 3O3TA 1TOFA 2YZUA 3DGQA 4MJAA 1QGVA 4YQUA 5E59A 4HI7A 5A4WA 4XS1A 4WBRD 5IPGA 1TU7A 4OO5A 5GAPD 4FYBA 5KN1A 3GSTA 2YWNA 3C71A 3UIWA 2VUPA 4O92A 3LSZA 2L4CA 4V2MA 2F9SA 1T4YA 2WJUA 3GKXA 3EMXA 3ZYWA 1K0MA 1MEKA 2WS2A 4MZWA 1X0RA 3FW2A 3CYNA 1M7TA 4TN8A 3A3TA 3VPQA 2X8HA 1WWJA 2B7KA 4G01A 1VF2A 2R37A 2GSSA 2FA8A 1EGOA 5CAXA 4BL7A 2R0PA 1AUCA 3M1GA 3KMNA 2GS3A 4AJ7A 1GTUA 4I2TA 3QFAC 1GRXA 1FHEA 3DWVA 2MMAA 2C0DA 2RLIA 1TTZA 3OR5A 5CRHA 4MP4A 1PN0A 4PURA 2PPTA 3EURA 5INYA 4NHWA 2H1DA 3V1WA 4LA1A 1TW9A 2XHFA 4FIWA 4PQHA 3HCZA 3H4KA 2VL3A 4GRFA 2O7KA 1OKTA 3LW9A 1GUMA 4KF9A 4TR0A 2GZYA 1Z7PA 5HR3A 3GX0A 1SD8A 3UMAA 1WIKA 2L57A 3ZTLA 4K5SA 2LRCA 2YNXA 4KAEA 6GSWA 5IOWA 4HOJA 1SK1A 5LNKe 1TK0B 2CVBA 4KDYA 2R3XA 4CY8A 4YAPA 3TOTA 1R26A 2HLSA 3ZIJA 4HU7A 2AV4A 1JHBA 2R0GA 1PRXA 3KCMA 2CZ3A 3TKSA 5B8BA 3C8EA 4CHSA 1ZYPA 3F4SA 1AQWA 5G30A 3GV1A 3SWLA 4USSA 1MTCA 4GQCA 4K0GA 1SVLA 4RI6A 5ECMB 1SU9A 5AISA 1X9MB 3LEFA 2GSRA 2H1BA 2CVDA 2LQQA 1N2AA 3IDVA 1GSYA 1GUKA 1OC3A 4WXTA 1Q98A 3QOUA 2WFCA 2EFHA 2VKZG 3MSZA 3TRQA 4K0NA 4MPGA 3IXRA 2CX4A 5DCHA 1OC9A 2OBKA 3FYGA 4IP1A 3KH7A 5IO0A 2LUSA 1TXUA 1Y1UA 4PX1A 4G19A 3HYPA 1FOVA 4YKFA 2MMZA 1C72A 1Y6EA 2R6KA 3UEMA 1GSFA 1HQOA 2C0EA 5CREA 1S3CA 3LYPA 4AJ8A 1XWAA 3VWVA 4G10A 2HRFA 3W6GA 2HRNA 1FOHA 4BWQA 3ME7A 2PN8A 1HNCA 2P5QA 5FT3A 4FYUA 10GSA 1T8EB 1ST9A 2C80A 1YF0A 4WEYA 2H1AA 2GVPA 3FRCA 2WCIA 3C73A 4I2UA 3M9KA 2AAWA 5BMUA 4EIPA 2H1GA 1RQMA 2OKAA 3F0IA 1Z7RA 2R4VA 4GDFA 3L4NA 4JRRA 3HKRA 3LORA 5H5QA 2RM6A 2WGRA 4RQXA 5B6MA 2L6DA 5ELAA 5JWOB 3FY7A 2XBQA 3QAGA 1K0NA 3ED3A 1BEDA 4ECJA 1GTBA 1QFNA 2OBIA 5D96A 3CRUA 4TR1B 4F9ZA 1DSBA 2UZ8A 2C3TA 1GNEA 18GSA 3IAS2 3D4TA 1FB6A 3VI5A 12GSA 3TKQA 3HHVA 2XPEA 4WBJA 4X4JA 2JACA 1PL2A 4EL1A 2C3NA 1BG5A 5IOXA 2VD1A 2I4AA 3VI7A 1AXDA 3KH9A 1LBKA 2YCDA 4ZBAA 2FGXA 1W89A 3ERWA 3ZFBA 1TRVA 3GH6A 1TRUA 3GNJA 4BL7B 2FUG2 2CX3A 4EO3A 4DSQA 2H75A 2E2MA 5ECRB 3UBLA 5KN3A 4XS4A 3VURA 4WR4A 1XBSA 1TKDB 1GL8A 4XIHA 4TXOA 4LMVA 4GSNA 5G5FA 4KX4A 1ZL9A 5J41A 2AHEA 4O5UA 2PU9C 4LL4B 2LJKA 1HNBA 5HFIA 1S3DA 3F3QA 1S3AA 4TW5A 2I3YA 4EDYA 3MNGA 2OT3A 5IMVA 1A8LA 5D9WA 4XCSA 1GTIA 1OAZA 3GKMA 3HA9A 2O85A 4WF4A 3TGZA 4JR4A 1O6JA 3EC3A 5A5KA 1DE1A 1H4OA 4IGJA 4W66A 1SVOA 4AGSA 2AUVA 2VM2A 4XTSA 1WE0A 2CA8A 1VF3A 4F0BA 4CW9A 1A2LA 1R7HA 3QDNA 4K5RA 1SJZA 4GTUA 3E3EA 4ZL8A 2VCQA 5DJLA 3TJJA 4MF6A 5GSTA 1TRWA 4IQAA 5JWRB 4AKIA 2UV8G 3G7YA 3DXBA 4HU9A 3J7Yk 4ECBA 3F3RA 2O5VA 5GSSA 3IC4A 3K8NA 3TJGA 3I9V2 1CQHA 1DUGA 1E2YA 2PERA 4IJIA 4RQRA 3UJ1A 2X64A 4GLTA 2TIRA 2VO4A 1BF5A 2KOKA 2X4AA 5KN2A 3VWXA 4BVYA 5DALA 3IE3A 2H8LA 3LFLA 2R2JA 1QMVA 4HQSA 3L9UA 1ZYEA 4O32A 3HJPA 4N30A 4AKGA 2A4HA 2J23A 2ON7A 1EP8A 22GSA 1OC9B 1FW1A 1UVZA 1WMJA 1PKZA 4BVXA 4FH8A 2VCTA 2IFQB 4Q5NA 4L0WA 2JSYA 2WULA 1DE2A 2PBJA 1YZXA 1K3YA 3KMOA 2JZSA 2GQLA 4PUAA 1V98A 4CY6A 4GWRA 1TDIA 1WJKA 5E4WA 3BOAA 2KLXA 1PKWA 1YEPA 3F4TA 3H8QA 3GYKA 2VLTA 4ZL7A 4YQMA 4MZCA 2BTOT 5BRTA 3U5RE 3CTFA 2PMTA 2FLSA 4RUVA 3HD5A 2E2GA 1O8XA 1GSUA 4TXVA 3IK9A 2IMKA 4POKA 1B9XC 5J9BA 2QKEA 2A2RA 1PX6A 4OD7A 2ES7A 5IM9A 2H72A 1SL0B 1FG4A 2WZ9A 1J0FA 3RAZA 5BMUB 1XXUA 2TRXA 2QA1A 2OE3A 2R5GA 2H1LA 4AF2A 1B8XA 3JCML 2VCVA 4KSOA 4KCEA 2CVKA 4FO5A 1WOUA 3D21A 4F2IA 3TUEA 2LKUA 4TR1A 2EFEA 2RUEA 2GT5A 3EMPA 4RI7A 2H30A 2DIZA 6GSYA 5AGYA 17GSA 3ZMKA 2DBCA 3LYKA 4Z2UA 2WRTA 2FWFA 3P90A 2FHEA 2PVQA 3UARA 2K18A 2FA4A 2OE0A 5ENUA 3G7IA 1JZDA 2MBTA 3QFBC 3DKSA 1AIUA 3GL3A 4V1Ag 5ECQB 1ERTA 19GSA 3FEUA 4K9ZA 2IIYA 1N8JA 2DJJA 5DDLA 4JE1A 5A34A 4QQ7A 1IYIA 3NOFA 3HVXA 5HR1A 1F3BA 2AYTA 5JCWA 1FAAA 1V57A 4ECIA 2CAIA 2HI7A 2VLVA 3L9VA 3QAVA 1PQNA 2N5FA 2LSTA 4K6XA 1M2BA 1Y25A 3IBHA 1RW1A 1XZOA 2DJKA 3F6FA 1AW9A 4POLA 1FO5A 1XIYA 4G2EA 4NMUA 4EXJA 3E9JB 4OFMA 3GIXA 5G2ZA 4XS4B 4V2NA 3HVVA 2C4JA 3P7XA 3HDCA 4TXOB 1JFUA 4J56E 4AJ6A 3BD2A 2O8VB 3O76A 4LMWA 4MZBA 3IA1A 2DMMA 5D93A 2EIOA 1YF1A 4G0LA 3HZ8A 1V9WA 2H66A 1YJ6A 3RHCA 1NHOA 3RHBA 1NSWA 3L9SA 4OFNA 1GSSA 1YY7A 2GSQA 5EPFA 2JZTA 2ZUPA 2KP1A 2K6VA 3ERGA 1EOGA 3F63A 3F8UA 5H5SA 5DBQA 4ZBBA 3IRAA 4I6XA 1EV4A 4KGIA 3DEXA 4IELA 4AKXB 1B4QA 1XWBA 4GSSA 2PGTA 3TOUA 4NAXA 1PL1A 3TDGA 1QUWA 2V41A 3MYDA 2LNTA 2MBSA 6GSTA 1ZOFA 1F37A 1T3BA 3RDWA 2K8VA 2F8AA 2M72A 1AAZA 2HRKB 1A0RP 3P2AA 3TRXA 6GSXA 2GQMA 1TI1A 1K3LA 2LEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHQ A;  3PPU A;  5AN1 A;  2HNL A;  3IC8 A;  1O8W A;  5G31 A;  5EL8 A;  3M0F A;  3MWH A;  1M2D A;  1Q4J A;  2EC4 A;  4KA0 A;  4BVY B;  5DAL B;  1CQG A;  1VF4 A;  3IR4 A;  2P31 A;  2V2G A;  4H86 A;  1F9M A;  1YDK A;  3TRP A;  4ID0 A;  3W8S A;  2GTU A;  1Z3E A;  2IFQ A;  3Q74 A;  3VLN A;  1Z6M A;  3KXO A;  4HJ2 A;  4OMV A;  3APS A;  4ISD A;  3HXS A;  5FHI A;  4K7O A;  2YAN A;  1PGT A;  4DEJ A;  1XVW A;  3GA4 A;  5IMF A;  4BVX B;  2IMI A;  1FVJ A;  2FNO A;  1SYX A;  5CO3 A;  4POM A;  5KEJ A;  4PNG A;  3LQ7 A;  2B5X A;  1URM A;  5CP1 A;  5ECL B;  1GSE A;  3KTL A;  2V1M A;  1H75 A;  1GNW A;  1SD9 A;  2MMO A;  2H0H A;  3N9J A;  3KJY A;  1X5E A;  1ILO A;  1K0C A;  2VM1 A;  1SL2 B;  3RPP A;  2X8C A;  1YEX A;  2K8S A;  2IWT A;  1EEM A;  3GKK A;  4WKW A;  3C7M A;  4DSR A;  2LRT A;  2CT6 A;  3TJK A;  3DIE A;  3RBT A;  4TKY A;  2K9F A;  2LQO A;  3HY2 A;  2HYX A;  4KH7 A;  1A23 A;  4PUF C;  1SJI A;  1K3O A;  4JED A;  2VAF A;  3D0Z A;  1THX A;  2HXK A;  2QGV A;  1ZMA A;  4IP6 A;  4ILF A;  1USB A;  5F07 A;  2ZNM A;  4ZB9 A;  4NPB A;  2X8G A;  3WGX A;  4IW9 A;  4I8B A;  4O7H A;  2KHP A;  5GZZ B;  4F03 A;  5J4U A;  4KND A;  4ZIL A;  2DSA A;  1X5C A;  1PSQ A;  5IIZ A;  3GTU B;  3A2X A;  1G7E A;  1MDI A;  1Z9H A;  2H6X A;  3LG6 A;  2IPA A;  4OCE A;  1TU8 A;  3QD9 A;  2HRA A;  2YJ7 A;  3M9J A;  4TR3 A;  3HVS A;  4KW6 A;  1XFL A;  1DBY A;  4Q5R A;  1ERV A;  6GSS A;  11GS A;  1G7O A;  2Z9S A;  3KGK A;  2I81 A;  2JU5 A;  4X43 A;  4PQI A;  1JLV A;  1TK8 B;  5D73 A;  4HS1 A;  2C3Q A;  3J7Y b;  5HR2 A;  4MPF A;  3TKS E;  4MJE A;  1QK8 A;  2MMN A;  1XCC A;  3LXT A;  4PGT A;  1PD2 1;  2HSM A;  2VL9 A;  1BAY A;  4V1A p;  5HR0 A;  3FR3 A;  1AQX A;  1XW6 A;  1WPI A;  5G1K A;  4ZB8 A;  3DD3 A;  3I69 A;  3D22 A;  2IMD A;  1SL1 B;  1V2A A;  2VIM A;  1QQ2 A;  3WT2 A;  4IKH A;  2M80 A;  3F9U A;  3R3E A;  3DRN A;  2HZF A;  4L8E A;  3PH9 A;  5G1L A;  3H1N A;  3LWA A;  4EVM A;  1EGR A;  9GSS A;  3CSJ A;  2L4Q A;  4D73 A;  2GDR A;  4OWY A;  2J9H A;  2XPD A;  2VCX A;  1B48 A;  4LLR A;  7GSS A;  3W8J A;  1V58 A;  2YOI A;  4KUN A;  5JCU A;  5CRW A;  2GLR A;  1JLW A;  14GS A;  2HRK A;  2LNS A;  2IMF A;  1GP1 A;  4N11 A;  3G9B A;  1U3I A;  3DVX A;  4LL1 B;  1SKS B;  2DJ3 A;  4NXI A;  3CRT A;  1U87 A;  3M8N A;  1K0D A;  2OA7 A;  4E8H A;  2DLX A;  4NWY A;  5DAK B;  4XRA A;  3MAK A;  1GSQ A;  3EIN A;  4MH3 A;  1G6W A;  1UC7 A;  2CAQ A;  4YAV A;  3WYW A;  4NV2 A;  2H70 A;  5IPH A;  2FD3 A;  3UOM A;  5CRG A;  4X1U A;  1MD4 A;  4EE0 A;  1EV9 A;  1PN9 A;  3I43 A;  5LCZ A;  4ML6 A;  1TXX A;  4PNF A;  2N5A A;  1OKD A;  2KUC A;  2HFD A;  4L5L A;  4OFT A;  2DJ1 A;  1UA5 A;  1XOA A;  3QR6 A;  2YPM A;  1KEB A;  2H0G A;  2PUK C;  4GST A;  1SKW B;  2PWJ A;  4KSM A;  3UVT A;  3ZVJ D;  1PMT A;  5JWQ B;  4K7I A;  4MH2 A;  1Z6N A;  4HZ2 A;  3ZML A;  4IBP A;  4ZL9 A;  2WDU A;  2F51 A;  3D4M A;  4Q5F A;  2C0F A;  2RM5 A;  3GKN A;  1LU4 A;  3IPZ A;  2B5E A;  1KTE A;  1A2J A;  5ECI B;  1SK0 A;  16GS A;  1ZCP A;  1YKC A;  3MDK A;  3SBC A;  4DVC A;  4GQF A;  4PTS A;  4HJM A;  4MLY A;  3AY8 A;  4KDU A;  1BX9 A;  2YWM A;  4HDE A;  3A5W A;  3IOS A;  1J08 A;  3L0H A;  5CNW A;  3GH9 A;  4ZB6 A;  5F05 A;  3DML A;  3FZ9 A;  1IYH A;  4MDC A;  2BJX A;  1GH2 A;  4X0X A;  2YN1 A;  1ERW A;  4IN0 A;  3PGT A;  2VL2 A;  1GUL A;  2MZC A;  2EIR A;  1FB0 A;  1O7U A;  3ISO A;  4Z7X A;  3GHA A;  2GQK A;  2HZE B;  1U6T A;  1A2M A;  2X99 A;  3QPM A;  1NHY A;  3GSS A;  1SK2 A;  2DIY A;  1NM3 A;  3CTG A;  1R5A A;  1JZO A;  3QMX A;  3WT1 A;  3CXG A;  3KIJ A;  3GTU A;  2HT9 A;  3TJF A;  1A8Y A;  2B6M A;  2L6C A;  1O85 A;  3TB2 A;  1QXH A;  1GUH A;  4YH2 A;  3ME8 A;  1AQV A;  2HSY A;  5GAN D;  4L5O A;  6GSV A;  1SJ6 A;  3GX8 A;  3GL5 A;  2P0G A;  1R4W A;  1T4Z A;  1T7P B;  4IVF A;  1KNG A;  1NW2 A;  1XPV A;  4QL9 A;  4K2D A;  3KP9 A;  1I9D A;  5B6N A;  3GRX A;  1UN2 A;  3PIN A;  4F0C A;  5D9X A;  3L78 A;  1THO A;  1GLQ A;  1KBN A;  2VOC A;  3LXZ A;  2V32 A;  3DYR A;  3C1S A;  2B7J A;  1K0O A;  2QC7 A;  1G6Y A;  1GSD A;  2HSM B;  3KP8 A;  4GF0 A;  4K7N A;  4J2F A;  2RII A;  2I1U A;  5L71 A;  3CSH A;  4TR4 A;  4KDX A;  3TKP A;  5ECN B;  4PXO A;  5ECO B;  2O89 A;  3KZQ A;  3ZRE A;  1U3A A;  3Q6O A;  2G2Q A;  2H76 A;  2F3M A;  3BBY A;  2CQ9 A;  3UL3 A;  1HYU A;  2C1Y A;  2P5R A;  2IN3 A;  5F8B A;  2VD0 A;  1W4V A;  5CRD A;  2C0G A;  3KD0 A;  4JU5 A;  2H19 A;  1WRY A;  1WP0 A;  4MA9 A;  4D73 B;  2EIQ A;  5ECP B;  1PX7 A;  1U88 A;  3EU4 A;  3VWW A;  5HQP A;  1TK5 B;  3KM6 A;  3ZIV A;  1XOB A;  4TVE A;  2GZP A;  1O81 A;  3WGD A;  2KP2 A;  5DJM A;  1X9S B;  3GFK A;  5ECS A;  4IHU A;  1OC8 A;  2B1L A;  2H74 A;  2IME A;  1XW9 A;  1ON4 A;  5D9V A;  2AJQ B;  1EP7 A;  5EVO A;  1J9B A;  2PVO C;  1K0A A;  1XWK A;  1HD2 A;  4IJ3 A;  3U6V A;  2YZH A;  2WB9 A;  4MCU A;  5DAK A;  4NV5 A;  4I97 A;  1MD3 A;  2LJR A;  3HZ4 A;  2NDO A;  4BA7 A;  1JZW A;  1VGL A;  1I5G A;  1T1V A;  3C1R A;  2NTO A;  1MDK A;  5IMD A;  4YQV A;  2B3S A;  2VL2 C;  3HJO A;  4F82 A;  2GT6 A;  3EYT A;  1Z5Y E;  3HJM A;  5B7C A;  2NVL A;  4MF7 A;  2DC5 A;  5ID2 B;  1G0T A;  1PA3 A;  4EUY A;  1BYE A;  2IL3 A;  2A2S A;  2YV7 A;  5DQS A;  2RUF A;  4ZBD A;  3O6T A;  3A2V A;  2YV9 A;  1F2E A;  5AIV A;  1SEN A;  2ALB A;  2D2Z A;  2VLU A;  5IMZ A;  3Q18 A;  1ML6 A;  1XWC A;  4OCF A;  5ECH B;  2OE1 A;  3P8W A;  4DSS A;  5A4U A;  4ECC A;  3UBK A;  2OAC A;  20GS A;  2A4V A;  2AB6 A;  3QCP A;  4WF5 A;  2E0Q A;  2HE3 A;  3ZL5 A;  1X5D A;  4FYC A;  3H93 A;  4HQZ A;  3RPN A;  1OVN A;  4MK3 A;  1XWG A;  2B5Y A;  2H73 A;  3WD6 A;  3A2W A;  3ZIT A;  1TP9 A;  3I6A A;  1VRS D;  2G0F A;  2OAD A;  5C00 A;  3ZVJ A;  1M0U A;  4EC0 A;  2I9H A;  1EEJ A;  2H6Y A;  5D8I A;  5FWG A;  2REM A;  2FWG A;  3APO A;  1O73 A;  1YQ1 A;  5KN0 A;  3CMI A;  4ZXG A;  4EKZ A;  2HZE A;  1E6B A;  5EY6 A;  2JZR A;  3FZ5 A;  3NZN A;  3S9F A;  2XC2 A;  4MJB A;  3FZ4 A;  4N0V A;  1BQ7 A;  3M3M A;  3BJ5 A;  4MAB A;  1M99 A;  3UAP A;  4JR6 A;  4ACS A;  4KE3 A;  5J9C A;  4EDZ A;  3IK7 A;  4WR5 A;  1A24 A;  4IQ1 A;  5CYY A;  3CSI A;  5ELG A;  1V40 A;  4TOP A;  4K1F A;  4PQ1 A;  5F06 A;  3G7J A;  3FKF A;  2LJA A;  3VK9 A;  1HNA A;  2NPB A;  5LD0 A;  3ZFL A;  8GSS A;  1JZR A;  3LGC A;  3FHK A;  5F0G A;  1M9B A;  5COH A;  3TKS C;  2FY6 A;  4GXZ A;  1B9Y C;  1EOH A;  1ABA A;  5A4V A;  2H01 A;  2L5O A;  3F6D A;  2JAD A;  6GSU A;  3NIV A;  1F3A A;  4J57 E;  2YWI A;  1F6M C;  2GGT A;  1ZYQ B;  3QAW A;  3DVW A;  2H71 A;  2O87 A;  2F8F A;  2JL4 A;  1A0F A;  3VWU A;  2OJL A;  5J5N A;  2YP6 A;  5IO2 A;  4OO4 A;  2JSZ A;  3VPT A;  2LRN A;  1M2A A;  5H5R A;  3ZLP A;  3GN3 A;  2TRC P;  5ABR A;  4I5Q A;  3ZZX A;  2E7P A;  3EWL A;  4V2L A;  4XHM A;  1FVK A;  2VCZ A;  1VF1 A;  2M46 A;  5IMC A;  3IV4 A;  4Q5Q A;  3GUR A;  4KB3 A;  5HFK A;  5C04 A;  5DCG A;  2LS5 A;  4MF5 A;  2HSH A;  1B4P A;  4G9H A;  3Q19 A;  1GLP A;  1SYR A;  3D5J A;  5JCG A;  4HUA A;  4CDO A;  4IS0 A;  4BWS A;  3ZRD A;  4N0Z A;  3E0U A;  3GUS A;  2FWE A;  1R5P A;  2IJY A;  3IAM 2;  1OE7 A;  2DJ2 A;  3EVI A;  3US3 A;  2C8U A;  1YKA A;  4G0I A;  4KCA A;  4XRD A;  4L0U A;  5IMA A;  1GTA A;  4JBB A;  3CBU A;  5DQY A;  2CZ2 A;  3FR6 A;  1ZGN A;  3FZA A;  5DVB A;  5B8A A;  1XW5 A;  4FQU A;  2QSI A;  4P3Y B;  2L59 A;  3TCO A;  2NBS A;  1GWC A;  2HSN B;  3VFI A;  2VCW A;  4N10 A;  2YWO A;  3UVH A;  1X9W B;  4G0K A;  2H6Z A;  5HFG A;  4QL7 A;  4XS6 A;  4ZIJ A;  2DJ0 A;  3PR8 A;  2CV4 A;  5D9T A;  1BJX A;  3WGE A;  4EF0 A;  1OE8 A;  2GST A;  1ZZY A;  5ID2 A;  5G5E A;  2LV3 A;  4K8M A;  4BPY A;  3BCI A;  1TJD A;  3TJB A;  2XBI A;  4MMM A;  1T00 A;  2N5B A;  2ON5 A;  2GZZ A;  1OYJ A;  3N5O A;  1ERU A;  3GMF A;  2YJH A;  3EU3 A;  5ECK B;  2FCH A;  4POB A;  3BCK A;  5J3R A;  4HEA 2;  2ZCT A;  1MDJ A;  1RK4 A;  2L5L A;  3KTB A;  2BMX A;  3APQ A;  5IQY A;  4MJC A;  3FR9 A;  1M9A A;  5AIX A;  1AC1 A;  1K0B A;  2V6O A;  2HQT A;  4ULX A;  13GS A;  3TKR A;  3LJR A;  4DSS B;  1SKR B;  2B1K A;  2LTK A;  3ERF A;  4O5R A;  2FWH A;  4GCI A;  3EE2 A;  3R2Q A;  1ACV A;  3F4R A;  4ML1 A;  3H79 A;  4NHZ A;  2H0I A;  1XVQ A;  4WET A;  4TRX A;  1TI3 A;  1LJR A;  2MYG A;  3FK8 A;  1EZK A;  1TRS A;  2DML A;  1EWX A;  2V6K A;  4E8E A;  4JZQ A;  3KEB A;  4HZ4 A;  3D6I A;  3O3T A;  1TOF A;  2YZU A;  3DGQ A;  4MJA A;  1QGV A;  4YQU A;  5E59 A;  4HI7 A;  5A4W A;  4XS1 A;  4WBR D;  5IPG A;  1TU7 A;  4OO5 A;  5GAP D;  4FYB A;  5KN1 A;  3GST A;  2YWN A;  3C71 A;  3UIW A;  2VUP A;  4O92 A;  3LSZ A;  2L4C A;  4V2M A;  2F9S A;  1T4Y A;  2WJU A;  3GKX A;  3EMX A;  3ZYW A;  1K0M A;  1MEK A;  2WS2 A;  4MZW A;  1X0R A;  3FW2 A;  3CYN A;  1M7T A;  4TN8 A;  3A3T A;  3VPQ A;  2X8H A;  1WWJ A;  2B7K A;  1VF2 A;  2R37 A;  2GSS A;  2FA8 A;  1EGO A;  5CAX A;  4BL7 A;  1AUC A;  3M1G A;  3KMN A;  2GS3 A;  4AJ7 A;  1GTU A;  4I2T A;  3QFA C;  1GRX A;  1FHE A;  3DWV A;  2MMA A;  2C0D A;  2RLI A;  1TTZ A;  3OR5 A;  5CRH A;  4MP4 A;  4PUR A;  2PPT A;  3EUR A;  5INY A;  4NHW A;  2H1D A;  3V1W A;  4LA1 A;  1TW9 A;  2XHF A;  4FIW A;  4PQH A;  3HCZ A;  3H4K A;  2VL3 A;  4GRF A;  2O7K A;  1OKT A;  1GUM A;  4KF9 A;  4TR0 A;  2GZY A;  1Z7P A;  5HR3 A;  3GX0 A;  1SD8 A;  3UMA A;  1WIK A;  2L57 A;  3ZTL A;  2LRC A;  2YNX A;  4KAE A;  6GSW A;  5IOW A;  4HOJ A;  1SK1 A;  5LNK e;  1TK0 B;  2CVB A;  4KDY A;  2R3X A;  4YAP A;  3TOT A;  1R26 A;  2HLS A;  3ZIJ A;  4HU7 A;  2AV4 A;  1JHB A;  1PRX A;  3KCM A;  2CZ3 A;  3TKS A;  5B8B A;  3C8E A;  4CHS A;  3F4S A;  1AQW A;  5G30 A;  3GV1 A;  3SWL A;  4USS A;  1MTC A;  4GQC A;  4K0G A;  4RI6 A;  5ECM B;  1SU9 A;  5AIS A;  1X9M B;  3LEF A;  2GSR A;  2H1B A;  2CVD A;  2LQQ A;  1N2A A;  3IDV A;  1GSY A;  1GUK A;  1OC3 A;  4WXT A;  1Q98 A;  3QOU A;  2WFC A;  3MSZ A;  3TRQ A;  4K0N A;  4MPG A;  3IXR A;  2CX4 A;  5DCH A;  1OC9 A;  2OBK A;  3FYG A;  4IP1 A;  3KH7 A;  5IO0 A;  2LUS A;  4PX1 A;  4G19 A;  3HYP A;  1FOV A;  2MMZ A;  1C72 A;  1Y6E A;  2R6K A;  3UEM A;  1GSF A;  1HQO A;  2C0E A;  5CRE A;  1S3C A;  3LYP A;  4AJ8 A;  1XWA A;  3VWV A;  4G10 A;  2HRF A;  3W6G A;  2HRN A;  4BWQ A;  3ME7 A;  2PN8 A;  1HNC A;  2P5Q A;  5FT3 A;  4FYU A;  10GS A;  1T8E B;  1ST9 A;  2C80 A;  1YF0 A;  4WEY A;  2H1A A;  2GVP A;  3FRC A;  2WCI A;  3C73 A;  4I2U A;  3M9K A;  2AAW A;  5BMU A;  2H1G A;  1RQM A;  2OKA A;  3F0I A;  1Z7R A;  2R4V A;  3L4N A;  4JRR A;  3HKR A;  3LOR A;  5H5Q A;  2RM6 A;  2WGR A;  4RQX A;  5B6M A;  2L6D A;  5ELA A;  5JWO B;  3FY7 A;  2XBQ A;  3QAG A;  1K0N A;  3ED3 A;  1BED A;  4ECJ A;  1GTB A;  1QFN A;  2OBI A;  5D96 A;  3CRU A;  4TR1 B;  4F9Z A;  1DSB A;  2UZ8 A;  2C3T A;  1GNE A;  18GS A;  3IAS 2;  3D4T A;  1FB6 A;  3VI5 A;  12GS A;  3TKQ A;  3HHV A;  2XPE A;  4WBJ A;  2JAC A;  1PL2 A;  4EL1 A;  2C3N A;  1BG5 A;  5IOX A;  2VD1 A;  2I4A A;  3VI7 A;  1AXD A;  3KH9 A;  1LBK A;  2YCD A;  4ZBA A;  2FGX A;  1W89 A;  3ERW A;  3ZFB A;  1TRV A;  3GH6 A;  1TRU A;  3GNJ A;  4BL7 B;  2FUG 2;  2CX3 A;  4EO3 A;  4DSQ A;  2H75 A;  2E2M A;  5ECR B;  3UBL A;  5KN3 A;  4XS4 A;  3VUR A;  4WR4 A;  1XBS A;  1TKD B;  1GL8 A;  4XIH A;  4TXO A;  4LMV A;  4GSN A;  5G5F A;  4KX4 A;  1ZL9 A;  5J41 A;  2AHE A;  2PU9 C;  4LL4 B;  2LJK A;  1HNB A;  5HFI A;  1S3D A;  3F3Q A;  1S3A A;  4TW5 A;  2I3Y A;  4EDY A;  3MNG A;  5IMV A;  1A8L A;  5D9W A;  4XCS A;  1GTI A;  1OAZ A;  3GKM A;  3HA9 A;  2O85 A;  4WF4 A;  3TGZ A;  4JR4 A;  1O6J A;  3EC3 A;  5A5K A;  1DE1 A;  1H4O A;  4IGJ A;  4AGS A;  2AUV A;  2VM2 A;  4XTS A;  1WE0 A;  2CA8 A;  1VF3 A;  4F0B A;  4CW9 A;  1A2L A;  1R7H A;  3QDN A;  1SJZ A;  4GTU A;  3E3E A;  4ZL8 A;  2VCQ A;  5DJL A;  3TJJ A;  4MF6 A;  5GST A;  1TRW A;  4IQA A;  5JWR B;  3G7Y A;  3DXB A;  4HU9 A;  3J7Y k;  4ECB A;  3F3R A;  5GSS A;  3IC4 A;  3K8N A;  3TJG A;  3I9V 2;  1CQH A;  1DUG A;  1E2Y A;  2PER A;  4IJI A;  4RQR A;  3UJ1 A;  2X64 A;  4GLT A;  2TIR A;  2VO4 A;  2KOK A;  5KN2 A;  3VWX A;  4BVY A;  5DAL A;  3IE3 A;  2H8L A;  3LFL A;  2R2J A;  1QMV A;  4HQS A;  3L9U A;  1ZYE A;  4O32 A;  3HJP A;  4N30 A;  2J23 A;  2ON7 A;  1EP8 A;  22GS A;  1OC9 B;  1FW1 A;  1UVZ A;  1WMJ A;  1PKZ A;  4BVX A;  4FH8 A;  2VCT A;  2IFQ B;  4Q5N A;  4L0W A;  2JSY A;  2WUL A;  1DE2 A;  2PBJ A;  1YZX A;  1K3Y A;  3KMO A;  2JZS A;  2GQL A;  4PUA A;  1V98 A;  4GWR A;  1TDI A;  1WJK A;  5E4W A;  3BOA A;  2KLX A;  1PKW A;  1YEP A;  3F4T A;  3H8Q A;  3GYK A;  2VLT A;  4ZL7 A;  4YQM A;  4MZC A;  2BTO T;  3U5R E;  3CTF A;  2PMT A;  2FLS A;  4RUV A;  3HD5 A;  2E2G A;  1O8X A;  1GSU A;  4TXV A;  3IK9 A;  2IMK A;  4POK A;  1B9X C;  5J9B A;  2QKE A;  2A2R A;  1PX6 A;  4OD7 A;  2ES7 A;  5IM9 A;  2H72 A;  1SL0 B;  1FG4 A;  2WZ9 A;  1J0F A;  3RAZ A;  1XXU A;  2TRX A;  2OE3 A;  2R5G A;  4AF2 A;  1B8X A;  3JCM L;  2VCV A;  4KSO A;  4KCE A;  2CVK A;  4FO5 A;  1WOU A;  3D21 A;  4F2I A;  3TUE A;  2LKU A;  4TR1 A;  2RUE A;  2GT5 A;  3EMP A;  4RI7 A;  2H30 A;  2DIZ A;  6GSY A;  5AGY A;  17GS A;  3ZMK A;  2DBC A;  3LYK A;  2WRT A;  2FWF A;  3P90 A;  2FHE A;  2PVQ A;  3UAR A;  2K18 A;  2FA4 A;  2OE0 A;  5ENU A;  3G7I A;  1JZD A;  2MBT A;  3QFB C;  3DKS A;  1AIU A;  3GL3 A;  4V1A g;  5ECQ B;  1ERT A;  19GS A;  3FEU A;  4K9Z A;  2IIY A;  1N8J A;  2DJJ A;  5DDL A;  4JE1 A;  4QQ7 A;  1IYI A;  3NOF A;  3HVX A;  5HR1 A;  1F3B A;  2AYT A;  5JCW A;  1FAA A;  1V57 A;  4ECI A;  2CAI A;  2HI7 A;  2VLV A;  3L9V A;  3QAV A;  1PQN A;  2N5F A;  2LST A;  4K6X A;  1M2B A;  1Y25 A;  3IBH A;  1RW1 A;  1XZO A;  2DJK A;  3F6F A;  1AW9 A;  4POL A;  1FO5 A;  1XIY A;  4G2E A;  4NMU A;  4EXJ A;  3E9J B;  4OFM A;  3GIX A;  5G2Z A;  4XS4 B;  4V2N A;  3HVV A;  2C4J A;  3P7X A;  3HDC A;  4TXO B;  1JFU A;  4J56 E;  4AJ6 A;  3BD2 A;  2O8V B;  3O76 A;  4LMW A;  4MZB A;  3IA1 A;  2DMM A;  5D93 A;  2EIO A;  1YF1 A;  4G0L A;  3HZ8 A;  1V9W A;  2H66 A;  1YJ6 A;  3RHC A;  1NHO A;  3RHB A;  1NSW A;  3L9S A;  4OFN A;  1GSS A;  1YY7 A;  2GSQ A;  5EPF A;  2JZT A;  2ZUP A;  2KP1 A;  2K6V A;  3ERG A;  1EOG A;  3F63 A;  3F8U A;  5H5S A;  5DBQ A;  4ZBB A;  3IRA A;  4I6X A;  1EV4 A;  4KGI A;  3DEX A;  4IEL A;  1B4Q A;  1XWB A;  4GSS A;  2PGT A;  3TOU A;  4NAX A;  1PL1 A;  3TDG A;  1QUW A;  2V41 A;  2LNT A;  2MBS A;  6GST A;  1ZOF A;  1F37 A;  1T3B A;  3RDW A;  2K8V A;  2F8A A;  2M72 A;  1AAZ A;  2HRK B;  1A0R P;  3P2A A;  3TRX A;  6GSX A;  2GQM A;  1TI1 A;  1K3L A;  2LEG A; 
#chains in the Genus database with same CATH topology
 3IHQ A;  3PPU A;  5AN1 A;  2HNL A;  3IC8 A;  1O8W A;  5G31 A;  5EL8 A;  3M0F A;  3MWH A;  1M3J A;  1M2D A;  1Q4J A;  2EC4 A;  4KA0 A;  4BVY B;  5DAL B;  1CQG A;  1VF4 A;  4Z2R A;  3IR4 A;  2P31 A;  2V2G A;  4H86 A;  1F9M A;  1BG1 A;  1YDK A;  3TRP A;  4ID0 A;  3W8S A;  2GTU A;  1Z3E A;  2IFQ A;  3Q74 A;  3VLN A;  1Z6M A;  4PI0 C;  3KXO A;  4HJ2 A;  4OMV A;  3APS A;  4ISD A;  3HXS A;  5FHI A;  4K7O A;  2YAN A;  1PGT A;  4DEJ A;  1XVW A;  3GA4 A;  5IMF A;  4BVX B;  2IMI A;  1FVJ A;  2FNO A;  1SYX A;  5CO3 A;  4POM A;  5KEJ A;  4PNG A;  3LQ7 A;  2B5X A;  1URM A;  5CP1 A;  5ECL B;  1GSE A;  3KTL A;  2V1M A;  1H75 A;  1GNW A;  1SD9 A;  2MMO A;  2H0H A;  2A2P A;  3N9J A;  3KJY A;  1X5E A;  1ILO A;  1K0C A;  2VM1 A;  1SL2 B;  3RPP A;  2X8C A;  1YEX A;  3CWG A;  2K8S A;  2IWT A;  4K2X A;  1EEM A;  3GKK A;  4WKW A;  3C7M A;  4DSR A;  2LRT A;  2CT6 A;  3TJK A;  3DIE A;  3RBT A;  4TKY A;  4ICY A;  2K9F A;  2LQO A;  3HY2 A;  2HYX A;  4KH7 A;  1A23 A;  3CHX C;  4PUF C;  1SJI A;  1K3O A;  4JED A;  5A1N A;  2VAF A;  3D0Z A;  1THX A;  2HXK A;  2QGV A;  5KOX A;  1ZMA A;  4IP6 A;  4ILF A;  1USB A;  5F07 A;  2ZNM A;  3A5I A;  4ZB9 A;  4NPB A;  1ZYN A;  2X8G A;  3WGX A;  4IW9 A;  4I8B A;  4O7H A;  4YKG A;  2KHP A;  5GZZ B;  4F03 A;  1PFO A;  5J4U A;  4KND A;  4ZIL A;  2DSA A;  1X5C A;  1PSQ A;  5IIZ A;  3GTU B;  3A2X A;  1G7E A;  1MDI A;  1Z9H A;  1YVL A;  2H6X A;  3LG6 A;  2IPA A;  4OCE A;  1TU8 A;  3QD9 A;  2HRA A;  2YJ7 A;  3M9J A;  4TR3 A;  5A34 B;  3HVS A;  4KW6 A;  1XFL A;  1DBY A;  4Q5R A;  1ERV A;  6GSS A;  11GS A;  1G7O A;  2Z9S A;  3KGK A;  2I81 A;  2JU5 A;  4X43 A;  4PQI A;  1JLV A;  1TK8 B;  5D73 A;  4HS1 A;  2C3Q A;  3J7Y b;  5HR2 A;  4MPF A;  3TKS E;  4MJE A;  5J47 A;  1QK8 A;  2MMN A;  1XCC A;  3LXT A;  4PGT A;  1PD2 1;  2HSM A;  2VL9 A;  1BAY A;  4V1A p;  5HR0 A;  3FR3 A;  1AQX A;  1XW6 A;  1WPI A;  5G1K A;  4A5P A;  4ZB8 A;  3DD3 A;  3I69 A;  3D22 A;  2IMD A;  1SL1 B;  1V2A A;  2VIM A;  1QQ2 A;  3WT2 A;  4IKH A;  4N3Z A;  2M80 A;  3F9U A;  3R3E A;  3DRN A;  2HZF A;  4L8E A;  3PH9 A;  5G1L A;  3H1N A;  3LWA A;  4EVM A;  1EGR A;  9GSS A;  3CSJ A;  2L4Q A;  4D73 A;  2GDR A;  4OWY A;  2J9H A;  2XPD A;  2VCX A;  4ZB7 A;  1B48 A;  4LLR A;  7GSS A;  3W8J A;  1V58 A;  2YOI A;  4KUN A;  5JCU A;  5CRW A;  2GLR A;  1JLW A;  14GS A;  2HRK A;  2LNS A;  2IMF A;  1GP1 A;  4N11 A;  3G9B A;  1U3I A;  3DVX A;  4LL1 B;  1SKS B;  2DJ3 A;  4NXI A;  3CRT A;  1U87 A;  3M8N A;  1K0D A;  2OA7 A;  4E8H A;  2DLX A;  4NWY A;  5DAK B;  4XRA A;  3MAK A;  1GSQ A;  3EIN A;  4MH3 A;  1G6W A;  1UC7 A;  2CAQ A;  4YAV A;  3WYW A;  4NV2 A;  2H70 A;  5IPH A;  2FD3 A;  3UOM A;  5CRG A;  4X1U A;  1MD4 A;  4EE0 A;  1EV9 A;  1PN9 A;  3I43 A;  5LCZ A;  4ML6 A;  1TXX A;  4PNF A;  2N5A A;  1OKD A;  2KUC A;  2HFD A;  4L5L A;  4OFT A;  2DJ1 A;  1UA5 A;  1XOA A;  3QR6 A;  2YPM A;  1KEB A;  2H0G A;  2PUK C;  4GST A;  1SKW B;  2PWJ A;  4KSM A;  3UVT A;  3ZVJ D;  1PMT A;  5JWQ B;  4K7I A;  4MH2 A;  5J4Y A;  1Z6N A;  4HZ2 A;  2DKI A;  3ZML A;  4IBP A;  4ZL9 A;  2WDU A;  2F51 A;  3D4M A;  4Q5F A;  2C0F A;  2RM5 A;  3GKN A;  1LU4 A;  3IPZ A;  2B5E A;  1KTE A;  1A2J A;  5ECI B;  1SK0 A;  2WW2 A;  16GS A;  1ZCP A;  1YKC A;  3MDK A;  2O3E A;  3SBC A;  4DVC A;  1YEW C;  4GQF A;  4PTS A;  4HJM A;  4MLY A;  3AY8 A;  4KDU A;  1BX9 A;  2YWM A;  4HDE A;  3A5W A;  3IOS A;  1J08 A;  3L0H A;  5CNW A;  3GH9 A;  4ZB6 A;  5F05 A;  3DML A;  3FZ9 A;  1IYH A;  4MDC A;  2BJX A;  1GH2 A;  4X0X A;  2YN1 A;  1ERW A;  4IN0 A;  3PGT A;  2VL2 A;  1GUL A;  2MZC A;  1S4B P;  2EIR A;  1FB0 A;  1O7U A;  5A1N B;  3ISO A;  4Z7X A;  3GHA A;  2GQK A;  2HZE B;  1U6T A;  1A2M A;  2X99 A;  3QPM A;  1NHY A;  3GSS A;  1SK2 A;  2DIY A;  1NM3 A;  3CTG A;  1R5A A;  1JZO A;  3QMX A;  2WVX A;  3CXG A;  3KIJ A;  3WT1 A;  3GTU A;  2HT9 A;  3TJF A;  1A8Y A;  2B6M A;  2L6C A;  1O85 A;  3TB2 A;  1QXH A;  1GUH A;  4YH2 A;  3ME8 A;  1AQV A;  2HSY A;  5GAN D;  4L5O A;  6GSV A;  1SJ6 A;  3GX8 A;  3GL5 A;  4EIQ A;  2P0G A;  4E68 A;  1R4W A;  1T4Z A;  1T7P B;  4IVF A;  1KNG A;  3CQF A;  1N25 A;  1NW2 A;  1XPV A;  4QL9 A;  4K2D A;  3KP9 A;  1I9D A;  5B6N A;  3GRX A;  2WVZ A;  1UN2 A;  3PIN A;  4F0C A;  5D9X A;  3L78 A;  1THO A;  1GLQ A;  1KBN A;  2VOC A;  3MIX A;  3LXZ A;  2V32 A;  3DYR A;  3C1S A;  2B7J A;  1K0O A;  2QC7 A;  1G6Y A;  1GSD A;  2HSM B;  3KP8 A;  4GF0 A;  4K7N A;  4J2F A;  2RII A;  2I1U A;  5L71 A;  3CSH A;  4TR4 A;  4KDX A;  3TKP A;  5ECN B;  4PXO A;  5ECO B;  2O89 A;  3KZQ A;  3EPT A;  3ZRE A;  1U3A A;  5KOW A;  3Q6O A;  2G2Q A;  1SVM A;  2H76 A;  4PI2 C;  2F3M A;  3BBY A;  2CQ9 A;  3UL3 A;  1HYU A;  2C1Y A;  2P5R A;  2IN3 A;  5F8B A;  4Z2T A;  2VD0 A;  1W4V A;  5A5H B;  5CRD A;  2C0G A;  3KD0 A;  4JU5 A;  2H19 A;  1WRY A;  1WP0 A;  4MA9 A;  4D73 B;  2EIQ A;  5ECP B;  1PX7 A;  1U88 A;  3EU4 A;  3VWW A;  5HQP A;  1TK5 B;  3KM6 A;  3ZIV A;  1XOB A;  4TVE A;  2GZP A;  1O81 A;  3WGD A;  4FXY P;  2KP2 A;  5DJM A;  1X9S B;  3FMW A;  3GFK A;  5ECS A;  2HSN A;  4IHU A;  1OC8 A;  2DKH A;  2B1L A;  2H74 A;  2IME A;  1XW9 A;  1ON4 A;  5D9V A;  2AJQ B;  1EP7 A;  5EVO A;  1J9B A;  2PVO C;  1K0A A;  3HMJ G;  1XWK A;  1HD2 A;  4IJ3 A;  3U6V A;  2YZH A;  2WB9 A;  4MCU A;  5DAK A;  4NV5 A;  4I97 A;  2EFD A;  1MD3 A;  2LJR A;  3HZ4 A;  2NDO A;  4BA7 A;  1JZW A;  1VGL A;  1I5G A;  1T1V A;  3C1R A;  2NTO A;  1MDK A;  5IMD A;  4YQV A;  2B3S A;  2VL2 C;  3HJO A;  4F82 A;  2GT6 A;  3EYT A;  1Z5Y E;  3HJM A;  5B7C A;  2NVL A;  4MF7 A;  2DC5 A;  5ID2 B;  1G0T A;  2EFC A;  1PA3 A;  4EUY A;  4PHZ C;  1BYE A;  2IL3 A;  2A2S A;  2YV7 A;  5DQS A;  2RUF A;  4ZBD A;  3O6T A;  3A2V A;  2YV9 A;  1F2E A;  5AIV A;  1SEN A;  2ALB A;  2D2Z A;  2VLU A;  5IMZ A;  3Q18 A;  1ML6 A;  1XWC A;  4OCF A;  5ECH B;  2OE1 A;  3P8W A;  4DSS A;  3IHG A;  5A4U A;  4ECC A;  3UBK A;  2OAC A;  20GS A;  2A4V A;  2AB6 A;  3QCP A;  4WF5 A;  2E0Q A;  2HE3 A;  3ZL5 A;  1X5D A;  4FYC A;  3H93 A;  4HQZ A;  3RPN A;  1OVN A;  4MK3 A;  1XWG A;  2B5Y A;  2H73 A;  3WD6 A;  3A2W A;  3ZIT A;  1TP9 A;  3I6A A;  1VRS D;  2G0F A;  2OAD A;  5C00 A;  3ZVJ A;  1M0U A;  4EC0 A;  2I9H A;  1EEJ A;  2H6Y A;  5D8I A;  5FWG A;  2REM A;  2FWG A;  3APO A;  1O73 A;  1YQ1 A;  4BIK A;  5KN0 A;  3CMI A;  4ZXG A;  4EKZ A;  2HZE A;  1E6B A;  5EY6 A;  2JZR A;  3FZ5 A;  3NZN A;  3S9F A;  2XC2 A;  4MJB A;  3FZ4 A;  4N0V A;  1BQ7 A;  3M3M A;  3BJ5 A;  2QA2 A;  4MAB A;  1M99 A;  3UAP A;  4JR6 A;  4ACS A;  4KE3 A;  5J9C A;  4EDZ A;  3IK7 A;  4WR5 A;  1A24 A;  4IQ1 A;  5CYY A;  3CSI A;  1I1I P;  5ELG A;  1V40 A;  4TOP A;  4K1F A;  4PQ1 A;  5F06 A;  3G7J A;  3FKF A;  2LJA A;  2WVX B;  3VK9 A;  1HNA A;  2NPB A;  5LD0 A;  3ZFL A;  8GSS A;  1JZR A;  3LGC A;  3FHK A;  5F0G A;  1M9B A;  5COH A;  3TKS C;  2FY6 A;  4GXZ A;  1B9Y C;  1EOH A;  1ABA A;  5A4V A;  2H01 A;  2L5O A;  5J40 A;  3F6D A;  2JAD A;  6GSU A;  3NIV A;  1F3A A;  4J57 E;  2YWI A;  1F6M C;  2GGT A;  1ZYQ B;  3QAW A;  3DVW A;  2H71 A;  2O87 A;  2F8F A;  2JL4 A;  1A0F A;  3VWU A;  2OJL A;  5J5N A;  2YP6 A;  5IO2 A;  4OO4 A;  2JSZ A;  3VPT A;  2LRN A;  1M2A A;  5H5R A;  3ZLP A;  3GN3 A;  2TRC P;  5ABR A;  4I5Q A;  3ZZX A;  2E7P A;  3EWL A;  4V2L A;  4XHM A;  1FVK A;  2VCZ A;  4MNN A;  1VF1 A;  2M46 A;  5IMC A;  3IV4 A;  4AI6 A;  4Q5Q A;  3GUR A;  4KB3 A;  5HFK A;  5C04 A;  5DCG A;  2LS5 A;  4MF5 A;  2HSH A;  1B4P A;  4G9H A;  3Q19 A;  1GLP A;  1SYR A;  3D5J A;  2R0C A;  5JCG A;  5A5H A;  4HUA A;  4CDO A;  4IS0 A;  4BWS A;  3ZRD A;  4N0Z A;  3E0U A;  3GUS A;  2FWE A;  1R5P A;  2IJY A;  3IAM 2;  1OE7 A;  2DJ2 A;  3EVI A;  3US3 A;  2C8U A;  1YKA A;  4G0I A;  4KCA A;  4XRD A;  4L0U A;  4O5Q A;  5IMA A;  1GTA A;  4JBB A;  3CBU A;  5DQY A;  2CZ2 A;  3FR6 A;  1ZGN A;  3FZA A;  5DVB A;  5B8A A;  1XW5 A;  4AKH A;  5J4V A;  4FQU A;  2QSI A;  4P3Y B;  2L59 A;  3TCO A;  2NBS A;  1GWC A;  2HSN B;  3VFI A;  2VCW A;  4N10 A;  2YWO A;  3UVH A;  1X9W B;  4G0K A;  2H6Z A;  5HFG A;  3TU3 B;  4QL7 A;  4XS6 A;  4ZIJ A;  2DJ0 A;  3PR8 A;  2CV4 A;  5D9T A;  1BJX A;  3WGE A;  4EF0 A;  1OE8 A;  2GST A;  1ZZY A;  5ID2 A;  5G5E A;  2LV3 A;  4K8M A;  4BPY A;  3BCI A;  1TJD A;  2X49 A;  3TJB A;  2XBI A;  4MMM A;  1T00 A;  2N5B A;  2ON5 A;  2GZZ A;  1OYJ A;  3N5O A;  1ERU A;  3GMF A;  2YJH A;  3EU3 A;  5ECK B;  2FCH A;  4POB A;  3BCK A;  5J3R A;  4HEA 2;  2ZCT A;  1MDJ A;  1RK4 A;  2L5L A;  3KTB A;  2BMX A;  3APQ A;  5IQY A;  4MJC A;  3FR9 A;  1M9A A;  5AIX A;  1AC1 A;  1K0B A;  2V6O A;  4QMK A;  2HQT A;  4ULX A;  13GS A;  3TKR A;  3LJR A;  4DSS B;  1SKR B;  2B1K A;  2LTK A;  3ERF A;  4O5R A;  2FWH A;  4GCI A;  3EE2 A;  3R2Q A;  1ACV A;  3F4R A;  4ML1 A;  3H79 A;  4NHZ A;  2H0I A;  1XVQ A;  3RFR C;  4WET A;  4TRX A;  1TI3 A;  1LJR A;  2MYG A;  3FK8 A;  1EZK A;  1TRS A;  2DML A;  1EWX A;  2V6K A;  4E8E A;  4JZQ A;  3KEB A;  4HZ4 A;  3D6I A;  3O3T A;  1TOF A;  2YZU A;  3DGQ A;  4MJA A;  1QGV A;  4YQU A;  5E59 A;  4HI7 A;  5A4W A;  4XS1 A;  4WBR D;  5IPG A;  1TU7 A;  4OO5 A;  5GAP D;  4FYB A;  5KN1 A;  3GST A;  2YWN A;  3C71 A;  3UIW A;  2VUP A;  4O92 A;  2O36 A;  3LSZ A;  2L4C A;  4V2M A;  2F9S A;  1T4Y A;  2WJU A;  3GKX A;  3EMX A;  3ZYW A;  1K0M A;  1MEK A;  2WS2 A;  4MZW A;  1X0R A;  2WW0 A;  3FW2 A;  3CYN A;  1M7T A;  4TN8 A;  3A3T A;  3VPQ A;  2X8H A;  1WWJ A;  2B7K A;  4G01 A;  1VF2 A;  2R37 A;  2GSS A;  2FA8 A;  1EGO A;  5CAX A;  4BL7 A;  2R0P A;  1AUC A;  3KMN A;  3M1G A;  2GS3 A;  4AJ7 A;  1GTU A;  4I2T A;  3QFA C;  1GRX A;  1FHE A;  3DWV A;  2MMA A;  2C0D A;  2RLI A;  1TTZ A;  3RGB C;  3OR5 A;  5CRH A;  4MP4 A;  1PN0 A;  4PUR A;  2PPT A;  3EUR A;  5INY A;  4NHW A;  2H1D A;  3V1W A;  4LA1 A;  1TW9 A;  2XHF A;  4FIW A;  4PQH A;  3HCZ A;  3H4K A;  2VL3 A;  4GRF A;  2O7K A;  1OKT A;  3LW9 A;  1GUM A;  4KF9 A;  4TR0 A;  2GZY A;  1Z7P A;  5HR3 A;  3GX0 A;  1SD8 A;  3UMA A;  1WIK A;  2L57 A;  3ZTL A;  4K5S A;  2LRC A;  2YNX A;  4KAE A;  6GSW A;  5IOW A;  4HOJ A;  1SK1 A;  5LNK e;  1TK0 B;  2CVB A;  4KDY A;  2R3X A;  4CY8 A;  4YAP A;  3TOT A;  1R26 A;  2HLS A;  3ZIJ A;  4HU7 A;  2AV4 A;  1JHB A;  2R0G A;  1PRX A;  3KCM A;  2CZ3 A;  3TKS A;  5B8B A;  3C8E A;  4CHS A;  1ZYP A;  3F4S A;  1AQW A;  5G30 A;  3GV1 A;  3SWL A;  4USS A;  1MTC A;  4GQC A;  4K0G A;  1SVL A;  4RI6 A;  5ECM B;  1SU9 A;  5AIS A;  1X9M B;  3LEF A;  2GSR A;  2H1B A;  2CVD A;  2LQQ A;  1N2A A;  3IDV A;  1GSY A;  1GUK A;  1OC3 A;  4WXT A;  1Q98 A;  3QOU A;  2WFC A;  2EFH A;  2VKZ G;  3MSZ A;  3TRQ A;  4K0N A;  4MPG A;  3IXR A;  2CX4 A;  5DCH A;  1OC9 A;  2OBK A;  3FYG A;  4IP1 A;  3KH7 A;  5IO0 A;  2LUS A;  1TXU A;  1Y1U A;  4PX1 A;  4G19 A;  3HYP A;  1FOV A;  4YKF A;  2MMZ A;  1C72 A;  1Y6E A;  2R6K A;  3UEM A;  1GSF A;  1HQO A;  2C0E A;  5CRE A;  1S3C A;  3LYP A;  4AJ8 A;  1XWA A;  3VWV A;  4G10 A;  2HRF A;  3W6G A;  2HRN A;  1FOH A;  4BWQ A;  3ME7 A;  2PN8 A;  1HNC A;  2P5Q A;  5FT3 A;  4FYU A;  10GS A;  1T8E B;  1ST9 A;  2C80 A;  1YF0 A;  4WEY A;  2H1A A;  2GVP A;  3FRC A;  2WCI A;  3C73 A;  4I2U A;  3M9K A;  2AAW A;  5BMU A;  4EIP A;  2H1G A;  1RQM A;  2OKA A;  3F0I A;  1Z7R A;  2R4V A;  4GDF A;  3L4N A;  4JRR A;  3HKR A;  3LOR A;  5H5Q A;  2RM6 A;  2WGR A;  4RQX A;  5B6M A;  2L6D A;  5ELA A;  5JWO B;  3FY7 A;  2XBQ A;  3QAG A;  1K0N A;  3ED3 A;  1BED A;  3HVN A;  4ECJ A;  1GTB A;  1QFN A;  2OBI A;  5D96 A;  3CRU A;  4TR1 B;  4F9Z A;  1DSB A;  2UZ8 A;  2C3T A;  1GNE A;  18GS A;  3IAS 2;  3D4T A;  1FB6 A;  3VI5 A;  12GS A;  3TKQ A;  3HHV A;  2XPE A;  4WBJ A;  4X4J A;  2JAC A;  1PL2 A;  4EL1 A;  2C3N A;  1BG5 A;  5IOX A;  2VD1 A;  2I4A A;  3VI7 A;  1AXD A;  3KH9 A;  1LBK A;  2YCD A;  4ZBA A;  2FGX A;  1W89 A;  3ERW A;  3ZFB A;  1TRV A;  3GH6 A;  1TRU A;  3GNJ A;  4BL7 B;  2FUG 2;  2CX3 A;  4EO3 A;  4DSQ A;  2H75 A;  2E2M A;  5ECR B;  3UBL A;  5KN3 A;  4XS4 A;  3VUR A;  4WR4 A;  1XBS A;  1TKD B;  1GL8 A;  4XIH A;  4TXO A;  4LMV A;  4GSN A;  5G5F A;  4KX4 A;  1ZL9 A;  2WW1 A;  5J41 A;  2AHE A;  4O5U A;  2PU9 C;  4LL4 B;  2LJK A;  1HNB A;  5HFI A;  1S3D A;  3F3Q A;  1S3A A;  4TW5 A;  2I3Y A;  4EDY A;  1XG8 A;  3MNG A;  2OT3 A;  5IMV A;  1A8L A;  5D9W A;  4XCS A;  1GTI A;  1OAZ A;  3GKM A;  3HA9 A;  2O85 A;  4WF4 A;  3TGZ A;  4JR4 A;  1O6J A;  3EC3 A;  5A5K A;  1DE1 A;  1H4O A;  4IGJ A;  4W66 A;  1SVO A;  4AGS A;  2AUV A;  2VM2 A;  4XTS A;  2WZS A;  1WE0 A;  2CA8 A;  1VF3 A;  4F0B A;  4CW9 A;  1A2L A;  1R7H A;  3QDN A;  4K5R A;  1SJZ A;  4GTU A;  3E3E A;  4ZL8 A;  2VCQ A;  5DJL A;  3TJJ A;  4MF6 A;  5GST A;  1TRW A;  4IQA A;  5JWR B;  4AKI A;  2UV8 G;  3G7Y A;  3DXB A;  4HU9 A;  3J7Y k;  4ECB A;  3F3R A;  2O5V A;  5GSS A;  3IC4 A;  3K8N A;  3TJG A;  3I9V 2;  1CQH A;  1DUG A;  1M3I A;  1E2Y A;  2PER A;  4IJI A;  4RQR A;  3UJ1 A;  2X64 A;  4GLT A;  2TIR A;  2VO4 A;  1BF5 A;  2KOK A;  2X4A A;  5KN2 A;  3VWX A;  4BVY A;  5DAL A;  3IE3 A;  2H8L A;  3LFL A;  2R2J A;  1QMV A;  4HQS A;  3L9U A;  1ZYE A;  4O32 A;  3HJP A;  4N30 A;  4AKG A;  2A4H A;  2J23 A;  2ON7 A;  1EP8 A;  22GS A;  1OC9 B;  1FW1 A;  1UVZ A;  1WMJ A;  1PKZ A;  4BVX A;  4FH8 A;  2VCT A;  2IFQ B;  4Q5N A;  4L0W A;  2JSY A;  2WUL A;  1DE2 A;  2PBJ A;  1YZX A;  1K3Y A;  3KMO A;  2JZS A;  2GQL A;  4PUA A;  1V98 A;  4CY6 A;  4GWR A;  1TDI A;  1WJK A;  5E4W A;  3BOA A;  2KLX A;  1PKW A;  1YEP A;  3F4T A;  3H8Q A;  3GYK A;  2VLT A;  4ZL7 A;  4YQM A;  4MZC A;  2BTO T;  2WVY A;  5BRT A;  3U5R E;  3CTF A;  2PMT A;  2FLS A;  4RUV A;  1S3R A;  3HD5 A;  2E2G A;  1O8X A;  1GSU A;  4TXV A;  3IK9 A;  2IMK A;  4POK A;  1B9X C;  5J9B A;  2QKE A;  2A2R A;  1PX6 A;  4OD7 A;  2ES7 A;  5IM9 A;  2H72 A;  1SL0 B;  1FG4 A;  2WZ9 A;  1J0F A;  3RAZ A;  5BMU B;  1XXU A;  2TRX A;  2QA1 A;  2OE3 A;  2R5G A;  2H1L A;  4AF2 A;  1B8X A;  3JCM L;  2VCV A;  4KSO A;  4KCE A;  2CVK A;  4FO5 A;  1WOU A;  3D21 A;  4F2I A;  3TUE A;  2LKU A;  4TR1 A;  2EFE A;  2RUE A;  2GT5 A;  3EMP A;  4RI7 A;  2H30 A;  2DIZ A;  6GSY A;  5AGY A;  17GS A;  3ZMK A;  2DBC A;  3LYK A;  4Z2U A;  2WRT A;  2FWF A;  3P90 A;  2FHE A;  2PVQ A;  4HSC X;  3UAR A;  2K18 A;  2FA4 A;  2OE0 A;  5ENU A;  3G7I A;  1JZD A;  2MBT A;  3QFB C;  3DKS A;  1AIU A;  3GL3 A;  4V1A g;  5ECQ B;  1ERT A;  19GS A;  3FEU A;  4K9Z A;  2IIY A;  1N8J A;  2DJJ A;  5DDL A;  2WW3 A;  4JE1 A;  5A34 A;  4QQ7 A;  1IYI A;  3NOF A;  3HVX A;  5HR1 A;  1F3B A;  2AYT A;  5JCW A;  1FAA A;  1V57 A;  4ECI A;  2CAI A;  2HI7 A;  2VLV A;  3L9V A;  3QAV A;  1PQN A;  2N5F A;  2LST A;  4K6X A;  1M2B A;  1Y25 A;  3IBH A;  1RW1 A;  1XZO A;  2DJK A;  3F6F A;  1AW9 A;  4POL A;  1FO5 A;  1XIY A;  4G2E A;  4NMU A;  4EXJ A;  3E9J B;  4OFM A;  3GIX A;  5G2Z A;  4XS4 B;  4V2N A;  3HVV A;  2C4J A;  3P7X A;  3HDC A;  4TXO B;  1JFU A;  4J56 E;  4AJ6 A;  3BD2 A;  2O8V B;  3O76 A;  4LMW A;  4MZB A;  3IA1 A;  2DMM A;  5D93 A;  2EIO A;  1YF1 A;  4G0L A;  3HZ8 A;  1V9W A;  2H66 A;  1YJ6 A;  3RHC A;  1NHO A;  3RHB A;  1NSW A;  3L9S A;  4OFN A;  1GSS A;  1YY7 A;  2GSQ A;  5EPF A;  2JZT A;  2ZUP A;  2KP1 A;  2K6V A;  3ERG A;  1EOG A;  3F63 A;  3F8U A;  5H5S A;  5DBQ A;  4ZBB A;  3IRA A;  4I6X A;  1EV4 A;  4KGI A;  3DEX A;  4IEL A;  4AKX B;  1B4Q A;  1XWB A;  4GSS A;  2PGT A;  3TOU A;  4NAX A;  1PL1 A;  3TDG A;  1QUW A;  2V41 A;  3MYD A;  2LNT A;  2MBS A;  6GST A;  1ZOF A;  1F37 A;  1T3B A;  3RDW A;  2K8V A;  2F8A A;  2M72 A;  1AAZ A;  2HRK B;  1A0R P;  3P2A A;  3TRX A;  6GSX A;  2GQM A;  1TI1 A;  1K3L A;  2LEG A; 
#chains in the Genus database with same CATH homology
 3IHQ A;  3PPU A;  5AN1 A;  2HNL A;  3IC8 A;  1O8W A;  5G31 A;  5EL8 A;  3M0F A;  3MWH A;  1M2D A;  1Q4J A;  2EC4 A;  4KA0 A;  4BVY B;  5DAL B;  1CQG A;  1VF4 A;  4Z2R A;  3IR4 A;  2P31 A;  2V2G A;  4H86 A;  1F9M A;  1BG1 A;  1YDK A;  3TRP A;  4ID0 A;  3W8S A;  2GTU A;  1Z3E A;  2IFQ A;  3Q74 A;  3VLN A;  1Z6M A;  3KXO A;  4HJ2 A;  4OMV A;  3APS A;  4ISD A;  3HXS A;  5FHI A;  4K7O A;  2YAN A;  1PGT A;  4DEJ A;  1XVW A;  3GA4 A;  5IMF A;  4BVX B;  2IMI A;  1FVJ A;  2FNO A;  1SYX A;  5CO3 A;  4POM A;  5KEJ A;  4PNG A;  3LQ7 A;  2B5X A;  1URM A;  5CP1 A;  5ECL B;  1GSE A;  3KTL A;  2V1M A;  1H75 A;  1GNW A;  1SD9 A;  2MMO A;  2H0H A;  2A2P A;  3N9J A;  3KJY A;  1X5E A;  1ILO A;  1K0C A;  2VM1 A;  1SL2 B;  3RPP A;  2X8C A;  1YEX A;  3CWG A;  2K8S A;  2IWT A;  4K2X A;  1EEM A;  3GKK A;  4WKW A;  3C7M A;  4DSR A;  2LRT A;  2CT6 A;  3TJK A;  3DIE A;  3RBT A;  4TKY A;  4ICY A;  2K9F A;  2LQO A;  3HY2 A;  2HYX A;  4KH7 A;  1A23 A;  4PUF C;  1SJI A;  1K3O A;  4JED A;  5A1N A;  2VAF A;  3D0Z A;  1THX A;  2HXK A;  2QGV A;  5KOX A;  1ZMA A;  4IP6 A;  4ILF A;  1USB A;  5F07 A;  2ZNM A;  3A5I A;  4ZB9 A;  4NPB A;  1ZYN A;  2X8G A;  3WGX A;  4IW9 A;  4I8B A;  4O7H A;  4YKG A;  2KHP A;  5GZZ B;  4F03 A;  5J4U A;  4KND A;  4ZIL A;  2DSA A;  1X5C A;  1PSQ A;  5IIZ A;  3GTU B;  3A2X A;  1G7E A;  1MDI A;  1Z9H A;  1YVL A;  2H6X A;  3LG6 A;  2IPA A;  4OCE A;  1TU8 A;  3QD9 A;  2HRA A;  2YJ7 A;  3M9J A;  4TR3 A;  5A34 B;  3HVS A;  4KW6 A;  1XFL A;  1DBY A;  4Q5R A;  1ERV A;  6GSS A;  11GS A;  1G7O A;  2Z9S A;  3KGK A;  2I81 A;  2JU5 A;  4X43 A;  4PQI A;  1JLV A;  1TK8 B;  5D73 A;  4HS1 A;  2C3Q A;  3J7Y b;  5HR2 A;  4MPF A;  3TKS E;  4MJE A;  5J47 A;  1QK8 A;  2MMN A;  1XCC A;  3LXT A;  4PGT A;  1PD2 1;  2HSM A;  2VL9 A;  1BAY A;  4V1A p;  5HR0 A;  3FR3 A;  1AQX A;  1XW6 A;  1WPI A;  5G1K A;  4A5P A;  4ZB8 A;  3DD3 A;  3I69 A;  3D22 A;  2IMD A;  1SL1 B;  1V2A A;  2VIM A;  1QQ2 A;  3WT2 A;  4IKH A;  4N3Z A;  2M80 A;  3F9U A;  3R3E A;  3DRN A;  2HZF A;  4L8E A;  3PH9 A;  5G1L A;  3H1N A;  3LWA A;  4EVM A;  1EGR A;  9GSS A;  3CSJ A;  2L4Q A;  4D73 A;  2GDR A;  4OWY A;  2J9H A;  2XPD A;  2VCX A;  4ZB7 A;  1B48 A;  4LLR A;  7GSS A;  3W8J A;  1V58 A;  2YOI A;  4KUN A;  5JCU A;  5CRW A;  2GLR A;  1JLW A;  14GS A;  2HRK A;  2LNS A;  2IMF A;  1GP1 A;  4N11 A;  3G9B A;  1U3I A;  3DVX A;  4LL1 B;  1SKS B;  2DJ3 A;  4NXI A;  3CRT A;  1U87 A;  3M8N A;  1K0D A;  2OA7 A;  4E8H A;  2DLX A;  4NWY A;  5DAK B;  4XRA A;  3MAK A;  1GSQ A;  3EIN A;  4MH3 A;  1G6W A;  1UC7 A;  2CAQ A;  4YAV A;  3WYW A;  4NV2 A;  2H70 A;  5IPH A;  2FD3 A;  3UOM A;  5CRG A;  4X1U A;  1MD4 A;  4EE0 A;  1EV9 A;  1PN9 A;  3I43 A;  5LCZ A;  4ML6 A;  1TXX A;  4PNF A;  2N5A A;  1OKD A;  2KUC A;  2HFD A;  4L5L A;  4OFT A;  2DJ1 A;  1UA5 A;  1XOA A;  3QR6 A;  2YPM A;  1KEB A;  2H0G A;  2PUK C;  4GST A;  1SKW B;  2PWJ A;  4KSM A;  3UVT A;  3ZVJ D;  1PMT A;  5JWQ B;  4K7I A;  4MH2 A;  5J4Y A;  1Z6N A;  4HZ2 A;  2DKI A;  3ZML A;  4IBP A;  4ZL9 A;  2WDU A;  2F51 A;  3D4M A;  4Q5F A;  2C0F A;  2RM5 A;  3GKN A;  1LU4 A;  3IPZ A;  2B5E A;  1KTE A;  1A2J A;  5ECI B;  1SK0 A;  16GS A;  1ZCP A;  1YKC A;  3MDK A;  3SBC A;  4DVC A;  4GQF A;  4PTS A;  4HJM A;  4MLY A;  3AY8 A;  4KDU A;  1BX9 A;  2YWM A;  4HDE A;  3A5W A;  3IOS A;  1J08 A;  3L0H A;  5CNW A;  3GH9 A;  4ZB6 A;  5F05 A;  3DML A;  3FZ9 A;  1IYH A;  4MDC A;  2BJX A;  1GH2 A;  4X0X A;  2YN1 A;  1ERW A;  4IN0 A;  3PGT A;  2VL2 A;  1GUL A;  2MZC A;  2EIR A;  1FB0 A;  1O7U A;  5A1N B;  3ISO A;  4Z7X A;  3GHA A;  2GQK A;  2HZE B;  1U6T A;  1A2M A;  2X99 A;  3QPM A;  1NHY A;  3GSS A;  1SK2 A;  2DIY A;  1NM3 A;  3CTG A;  1R5A A;  1JZO A;  3QMX A;  3WT1 A;  3CXG A;  3KIJ A;  3GTU A;  2HT9 A;  3TJF A;  1A8Y A;  2B6M A;  2L6C A;  1O85 A;  3TB2 A;  1QXH A;  1GUH A;  4YH2 A;  3ME8 A;  1AQV A;  2HSY A;  5GAN D;  4L5O A;  6GSV A;  1SJ6 A;  3GX8 A;  3GL5 A;  4EIQ A;  2P0G A;  4E68 A;  1R4W A;  1T4Z A;  1T7P B;  4IVF A;  1KNG A;  1N25 A;  1NW2 A;  1XPV A;  4QL9 A;  4K2D A;  3KP9 A;  1I9D A;  5B6N A;  3GRX A;  1UN2 A;  3PIN A;  4F0C A;  5D9X A;  3L78 A;  1THO A;  1GLQ A;  1KBN A;  2VOC A;  3MIX A;  3LXZ A;  2V32 A;  3DYR A;  3C1S A;  2B7J A;  1K0O A;  2QC7 A;  1G6Y A;  1GSD A;  2HSM B;  3KP8 A;  4GF0 A;  4K7N A;  4J2F A;  2RII A;  2I1U A;  5L71 A;  3CSH A;  4TR4 A;  4KDX A;  3TKP A;  5ECN B;  4PXO A;  5ECO B;  2O89 A;  3KZQ A;  3EPT A;  3ZRE A;  1U3A A;  5KOW A;  3Q6O A;  2G2Q A;  1SVM A;  2H76 A;  2F3M A;  3BBY A;  2CQ9 A;  3UL3 A;  1HYU A;  2C1Y A;  2P5R A;  2IN3 A;  5F8B A;  4Z2T A;  2VD0 A;  1W4V A;  5A5H B;  5CRD A;  2C0G A;  3KD0 A;  4JU5 A;  2H19 A;  1WRY A;  1WP0 A;  4MA9 A;  4D73 B;  2EIQ A;  5ECP B;  1PX7 A;  1U88 A;  3EU4 A;  3VWW A;  5HQP A;  1TK5 B;  3KM6 A;  3ZIV A;  1XOB A;  4TVE A;  2GZP A;  1O81 A;  3WGD A;  2KP2 A;  5DJM A;  1X9S B;  3FMW A;  3GFK A;  5ECS A;  2HSN A;  4IHU A;  1OC8 A;  2DKH A;  2B1L A;  2H74 A;  2IME A;  1XW9 A;  1ON4 A;  5D9V A;  2AJQ B;  1EP7 A;  5EVO A;  1J9B A;  2PVO C;  1K0A A;  3HMJ G;  1XWK A;  1HD2 A;  4IJ3 A;  3U6V A;  2YZH A;  2WB9 A;  4MCU A;  5DAK A;  4NV5 A;  4I97 A;  2EFD A;  1MD3 A;  2LJR A;  3HZ4 A;  2NDO A;  4BA7 A;  1JZW A;  1VGL A;  1I5G A;  1T1V A;  3C1R A;  2NTO A;  1MDK A;  5IMD A;  4YQV A;  2B3S A;  2VL2 C;  3HJO A;  4F82 A;  2GT6 A;  3EYT A;  1Z5Y E;  3HJM A;  5B7C A;  2NVL A;  4MF7 A;  2DC5 A;  5ID2 B;  1G0T A;  2EFC A;  1PA3 A;  4EUY A;  1BYE A;  2IL3 A;  2A2S A;  2YV7 A;  5DQS A;  2RUF A;  4ZBD A;  3O6T A;  3A2V A;  2YV9 A;  1F2E A;  5AIV A;  1SEN A;  2ALB A;  2D2Z A;  2VLU A;  5IMZ A;  3Q18 A;  1ML6 A;  1XWC A;  4OCF A;  5ECH B;  2OE1 A;  3P8W A;  4DSS A;  3IHG A;  5A4U A;  4ECC A;  3UBK A;  2OAC A;  20GS A;  2A4V A;  2AB6 A;  3QCP A;  4WF5 A;  2E0Q A;  2HE3 A;  3ZL5 A;  1X5D A;  4FYC A;  3H93 A;  4HQZ A;  3RPN A;  1OVN A;  4MK3 A;  1XWG A;  2B5Y A;  2H73 A;  3WD6 A;  3A2W A;  3ZIT A;  1TP9 A;  3I6A A;  1VRS D;  2G0F A;  2OAD A;  5C00 A;  3ZVJ A;  1M0U A;  4EC0 A;  2I9H A;  1EEJ A;  2H6Y A;  5D8I A;  5FWG A;  2REM A;  2FWG A;  3APO A;  1O73 A;  1YQ1 A;  5KN0 A;  3CMI A;  4ZXG A;  4EKZ A;  2HZE A;  1E6B A;  5EY6 A;  2JZR A;  3FZ5 A;  3NZN A;  3S9F A;  2XC2 A;  4MJB A;  3FZ4 A;  4N0V A;  1BQ7 A;  3M3M A;  3BJ5 A;  2QA2 A;  4MAB A;  1M99 A;  3UAP A;  4JR6 A;  4ACS A;  4KE3 A;  5J9C A;  4EDZ A;  3IK7 A;  4WR5 A;  1A24 A;  4IQ1 A;  5CYY A;  3CSI A;  5ELG A;  1V40 A;  4TOP A;  4K1F A;  4PQ1 A;  5F06 A;  3G7J A;  3FKF A;  2LJA A;  3VK9 A;  1HNA A;  2NPB A;  5LD0 A;  3ZFL A;  8GSS A;  1JZR A;  3LGC A;  3FHK A;  5F0G A;  1M9B A;  5COH A;  3TKS C;  2FY6 A;  4GXZ A;  1B9Y C;  1EOH A;  1ABA A;  5A4V A;  2H01 A;  2L5O A;  5J40 A;  3F6D A;  2JAD A;  6GSU A;  3NIV A;  1F3A A;  4J57 E;  2YWI A;  1F6M C;  2GGT A;  1ZYQ B;  3QAW A;  3DVW A;  2H71 A;  2O87 A;  2F8F A;  2JL4 A;  1A0F A;  3VWU A;  2OJL A;  5J5N A;  2YP6 A;  5IO2 A;  4OO4 A;  2JSZ A;  3VPT A;  2LRN A;  1M2A A;  5H5R A;  3ZLP A;  3GN3 A;  2TRC P;  5ABR A;  4I5Q A;  3ZZX A;  2E7P A;  3EWL A;  4V2L A;  4XHM A;  1FVK A;  2VCZ A;  4MNN A;  1VF1 A;  2M46 A;  5IMC A;  3IV4 A;  4AI6 A;  4Q5Q A;  3GUR A;  4KB3 A;  5HFK A;  5C04 A;  5DCG A;  2LS5 A;  4MF5 A;  2HSH A;  1B4P A;  4G9H A;  3Q19 A;  1GLP A;  1SYR A;  3D5J A;  2R0C A;  5JCG A;  5A5H A;  4HUA A;  4CDO A;  4IS0 A;  4BWS A;  3ZRD A;  4N0Z A;  3E0U A;  3GUS A;  2FWE A;  1R5P A;  2IJY A;  3IAM 2;  1OE7 A;  2DJ2 A;  3EVI A;  3US3 A;  2C8U A;  1YKA A;  4G0I A;  4KCA A;  4XRD A;  4L0U A;  4O5Q A;  5IMA A;  1GTA A;  4JBB A;  3CBU A;  5DQY A;  2CZ2 A;  3FR6 A;  1ZGN A;  3FZA A;  5DVB A;  5B8A A;  1XW5 A;  4AKH A;  5J4V A;  4FQU A;  2QSI A;  4P3Y B;  2L59 A;  3TCO A;  2NBS A;  1GWC A;  2HSN B;  3VFI A;  2VCW A;  4N10 A;  2YWO A;  3UVH A;  1X9W B;  4G0K A;  2H6Z A;  5HFG A;  3TU3 B;  4QL7 A;  4XS6 A;  4ZIJ A;  2DJ0 A;  3PR8 A;  2CV4 A;  5D9T A;  1BJX A;  3WGE A;  4EF0 A;  1OE8 A;  2GST A;  1ZZY A;  5ID2 A;  5G5E A;  2LV3 A;  4K8M A;  4BPY A;  3BCI A;  1TJD A;  2X49 A;  3TJB A;  2XBI A;  4MMM A;  1T00 A;  2N5B A;  2ON5 A;  2GZZ A;  1OYJ A;  3N5O A;  1ERU A;  3GMF A;  2YJH A;  3EU3 A;  5ECK B;  2FCH A;  4POB A;  3BCK A;  5J3R A;  4HEA 2;  2ZCT A;  1MDJ A;  1RK4 A;  2L5L A;  3KTB A;  2BMX A;  3APQ A;  5IQY A;  4MJC A;  3FR9 A;  1M9A A;  5AIX A;  1AC1 A;  1K0B A;  2V6O A;  4QMK A;  2HQT A;  4ULX A;  13GS A;  3TKR A;  3LJR A;  4DSS B;  1SKR B;  2B1K A;  2LTK A;  3ERF A;  4O5R A;  2FWH A;  4GCI A;  3EE2 A;  3R2Q A;  1ACV A;  3F4R A;  4ML1 A;  3H79 A;  4NHZ A;  2H0I A;  1XVQ A;  4WET A;  4TRX A;  1TI3 A;  1LJR A;  2MYG A;  3FK8 A;  1EZK A;  1TRS A;  2DML A;  1EWX A;  2V6K A;  4E8E A;  4JZQ A;  3KEB A;  4HZ4 A;  3D6I A;  3O3T A;  1TOF A;  2YZU A;  3DGQ A;  4MJA A;  1QGV A;  4YQU A;  5E59 A;  4HI7 A;  5A4W A;  4XS1 A;  4WBR D;  5IPG A;  1TU7 A;  4OO5 A;  5GAP D;  4FYB A;  5KN1 A;  3GST A;  2YWN A;  3C71 A;  3UIW A;  2VUP A;  4O92 A;  3LSZ A;  2L4C A;  4V2M A;  2F9S A;  1T4Y A;  2WJU A;  3GKX A;  3EMX A;  3ZYW A;  1K0M A;  1MEK A;  2WS2 A;  4MZW A;  1X0R A;  3FW2 A;  3CYN A;  1M7T A;  4TN8 A;  3A3T A;  3VPQ A;  2X8H A;  1WWJ A;  2B7K A;  4G01 A;  1VF2 A;  2R37 A;  2GSS A;  2FA8 A;  1EGO A;  5CAX A;  4BL7 A;  2R0P A;  1AUC A;  3M1G A;  3KMN A;  2GS3 A;  4AJ7 A;  1GTU A;  4I2T A;  3QFA C;  1GRX A;  1FHE A;  3DWV A;  2MMA A;  2C0D A;  2RLI A;  1TTZ A;  3OR5 A;  5CRH A;  4MP4 A;  1PN0 A;  4PUR A;  2PPT A;  3EUR A;  5INY A;  4NHW A;  2H1D A;  3V1W A;  4LA1 A;  1TW9 A;  2XHF A;  4FIW A;  4PQH A;  3HCZ A;  3H4K A;  2VL3 A;  4GRF A;  2O7K A;  1OKT A;  3LW9 A;  1GUM A;  4KF9 A;  4TR0 A;  2GZY A;  1Z7P A;  5HR3 A;  3GX0 A;  1SD8 A;  3UMA A;  1WIK A;  2L57 A;  3ZTL A;  4K5S A;  2LRC A;  2YNX A;  4KAE A;  6GSW A;  5IOW A;  4HOJ A;  1SK1 A;  5LNK e;  1TK0 B;  2CVB A;  4KDY A;  2R3X A;  4CY8 A;  4YAP A;  3TOT A;  1R26 A;  2HLS A;  3ZIJ A;  4HU7 A;  2AV4 A;  1JHB A;  2R0G A;  1PRX A;  3KCM A;  2CZ3 A;  3TKS A;  5B8B A;  3C8E A;  4CHS A;  1ZYP A;  3F4S A;  1AQW A;  5G30 A;  3GV1 A;  3SWL A;  4USS A;  1MTC A;  4GQC A;  4K0G A;  1SVL A;  4RI6 A;  5ECM B;  1SU9 A;  5AIS A;  1X9M B;  3LEF A;  2GSR A;  2H1B A;  2CVD A;  2LQQ A;  1N2A A;  3IDV A;  1GSY A;  1GUK A;  1OC3 A;  4WXT A;  1Q98 A;  3QOU A;  2WFC A;  2EFH A;  2VKZ G;  3MSZ A;  3TRQ A;  4K0N A;  4MPG A;  3IXR A;  2CX4 A;  5DCH A;  1OC9 A;  2OBK A;  3FYG A;  4IP1 A;  3KH7 A;  5IO0 A;  2LUS A;  1TXU A;  1Y1U A;  4PX1 A;  4G19 A;  3HYP A;  1FOV A;  4YKF A;  2MMZ A;  1C72 A;  1Y6E A;  2R6K A;  3UEM A;  1GSF A;  1HQO A;  2C0E A;  5CRE A;  1S3C A;  3LYP A;  4AJ8 A;  1XWA A;  3VWV A;  4G10 A;  2HRF A;  3W6G A;  2HRN A;  1FOH A;  4BWQ A;  3ME7 A;  2PN8 A;  1HNC A;  2P5Q A;  5FT3 A;  4FYU A;  10GS A;  1T8E B;  1ST9 A;  2C80 A;  1YF0 A;  4WEY A;  2H1A A;  2GVP A;  3FRC A;  2WCI A;  3C73 A;  4I2U A;  3M9K A;  2AAW A;  5BMU A;  4EIP A;  2H1G A;  1RQM A;  2OKA A;  3F0I A;  1Z7R A;  2R4V A;  4GDF A;  3L4N A;  4JRR A;  3HKR A;  3LOR A;  5H5Q A;  2RM6 A;  2WGR A;  4RQX A;  5B6M A;  2L6D A;  5ELA A;  5JWO B;  3FY7 A;  2XBQ A;  3QAG A;  1K0N A;  3ED3 A;  1BED A;  4ECJ A;  1GTB A;  1QFN A;  2OBI A;  5D96 A;  3CRU A;  4TR1 B;  4F9Z A;  1DSB A;  2UZ8 A;  2C3T A;  1GNE A;  18GS A;  3IAS 2;  3D4T A;  1FB6 A;  3VI5 A;  12GS A;  3TKQ A;  3HHV A;  2XPE A;  4WBJ A;  4X4J A;  2JAC A;  1PL2 A;  4EL1 A;  2C3N A;  1BG5 A;  5IOX A;  2VD1 A;  2I4A A;  3VI7 A;  1AXD A;  3KH9 A;  1LBK A;  2YCD A;  4ZBA A;  2FGX A;  1W89 A;  3ERW A;  3ZFB A;  1TRV A;  3GH6 A;  1TRU A;  3GNJ A;  4BL7 B;  2FUG 2;  2CX3 A;  4EO3 A;  4DSQ A;  2H75 A;  2E2M A;  5ECR B;  3UBL A;  5KN3 A;  4XS4 A;  3VUR A;  4WR4 A;  1XBS A;  1TKD B;  1GL8 A;  4XIH A;  4TXO A;  4LMV A;  4GSN A;  5G5F A;  4KX4 A;  1ZL9 A;  5J41 A;  2AHE A;  4O5U A;  2PU9 C;  4LL4 B;  2LJK A;  1HNB A;  5HFI A;  1S3D A;  3F3Q A;  1S3A A;  4TW5 A;  2I3Y A;  4EDY A;  3MNG A;  2OT3 A;  5IMV A;  1A8L A;  5D9W A;  4XCS A;  1GTI A;  1OAZ A;  3GKM A;  3HA9 A;  2O85 A;  4WF4 A;  3TGZ A;  4JR4 A;  1O6J A;  3EC3 A;  5A5K A;  1DE1 A;  1H4O A;  4IGJ A;  4W66 A;  1SVO A;  4AGS A;  2AUV A;  2VM2 A;  4XTS A;  1WE0 A;  2CA8 A;  1VF3 A;  4F0B A;  4CW9 A;  1A2L A;  1R7H A;  3QDN A;  4K5R A;  1SJZ A;  4GTU A;  3E3E A;  4ZL8 A;  2VCQ A;  5DJL A;  3TJJ A;  4MF6 A;  5GST A;  1TRW A;  4IQA A;  5JWR B;  4AKI A;  2UV8 G;  3G7Y A;  3DXB A;  4HU9 A;  3J7Y k;  4ECB A;  3F3R A;  2O5V A;  5GSS A;  3IC4 A;  3K8N A;  3TJG A;  3I9V 2;  1CQH A;  1DUG A;  1E2Y A;  2PER A;  4IJI A;  4RQR A;  3UJ1 A;  2X64 A;  4GLT A;  2TIR A;  2VO4 A;  1BF5 A;  2KOK A;  2X4A A;  5KN2 A;  3VWX A;  4BVY A;  5DAL A;  3IE3 A;  2H8L A;  3LFL A;  2R2J A;  1QMV A;  4HQS A;  3L9U A;  1ZYE A;  4O32 A;  3HJP A;  4N30 A;  4AKG A;  2A4H A;  2J23 A;  2ON7 A;  1EP8 A;  22GS A;  1OC9 B;  1FW1 A;  1UVZ A;  1WMJ A;  1PKZ A;  4BVX A;  4FH8 A;  2VCT A;  2IFQ B;  4Q5N A;  4L0W A;  2JSY A;  2WUL A;  1DE2 A;  2PBJ A;  1YZX A;  1K3Y A;  3KMO A;  2JZS A;  2GQL A;  4PUA A;  1V98 A;  4CY6 A;  4GWR A;  1TDI A;  1WJK A;  5E4W A;  3BOA A;  2KLX A;  1PKW A;  1YEP A;  3F4T A;  3H8Q A;  3GYK A;  2VLT A;  4ZL7 A;  4YQM A;  4MZC A;  2BTO T;  5BRT A;  3U5R E;  3CTF A;  2PMT A;  2FLS A;  4RUV A;  3HD5 A;  2E2G A;  1O8X A;  1GSU A;  4TXV A;  3IK9 A;  2IMK A;  4POK A;  1B9X C;  5J9B A;  2QKE A;  2A2R A;  1PX6 A;  4OD7 A;  2ES7 A;  5IM9 A;  2H72 A;  1SL0 B;  1FG4 A;  2WZ9 A;  1J0F A;  3RAZ A;  5BMU B;  1XXU A;  2TRX A;  2QA1 A;  2OE3 A;  2R5G A;  2H1L A;  4AF2 A;  1B8X A;  3JCM L;  2VCV A;  4KSO A;  4KCE A;  2CVK A;  4FO5 A;  1WOU A;  3D21 A;  4F2I A;  3TUE A;  2LKU A;  4TR1 A;  2EFE A;  2RUE A;  2GT5 A;  3EMP A;  4RI7 A;  2H30 A;  2DIZ A;  6GSY A;  5AGY A;  17GS A;  3ZMK A;  2DBC A;  3LYK A;  4Z2U A;  2WRT A;  2FWF A;  3P90 A;  2FHE A;  2PVQ A;  3UAR A;  2K18 A;  2FA4 A;  2OE0 A;  5ENU A;  3G7I A;  1JZD A;  2MBT A;  3QFB C;  3DKS A;  1AIU A;  3GL3 A;  4V1A g;  5ECQ B;  1ERT A;  19GS A;  3FEU A;  4K9Z A;  2IIY A;  1N8J A;  2DJJ A;  5DDL A;  4JE1 A;  5A34 A;  4QQ7 A;  1IYI A;  3NOF A;  3HVX A;  5HR1 A;  1F3B A;  2AYT A;  5JCW A;  1FAA A;  1V57 A;  4ECI A;  2CAI A;  2HI7 A;  2VLV A;  3L9V A;  3QAV A;  1PQN A;  2N5F A;  2LST A;  4K6X A;  1M2B A;  1Y25 A;  3IBH A;  1RW1 A;  1XZO A;  2DJK A;  3F6F A;  1AW9 A;  4POL A;  1FO5 A;  1XIY A;  4G2E A;  4NMU A;  4EXJ A;  3E9J B;  4OFM A;  3GIX A;  5G2Z A;  4XS4 B;  4V2N A;  3HVV A;  2C4J A;  3P7X A;  3HDC A;  4TXO B;  1JFU A;  4J56 E;  4AJ6 A;  3BD2 A;  2O8V B;  3O76 A;  4LMW A;  4MZB A;  3IA1 A;  2DMM A;  5D93 A;  2EIO A;  1YF1 A;  4G0L A;  3HZ8 A;  1V9W A;  2H66 A;  1YJ6 A;  3RHC A;  1NHO A;  3RHB A;  1NSW A;  3L9S A;  4OFN A;  1GSS A;  1YY7 A;  2GSQ A;  5EPF A;  2JZT A;  2ZUP A;  2KP1 A;  2K6V A;  3ERG A;  1EOG A;  3F63 A;  3F8U A;  5H5S A;  5DBQ A;  4ZBB A;  3IRA A;  4I6X A;  1EV4 A;  4KGI A;  3DEX A;  4IEL A;  4AKX B;  1B4Q A;  1XWB A;  4GSS A;  2PGT A;  3TOU A;  4NAX A;  1PL1 A;  3TDG A;  1QUW A;  2V41 A;  3MYD A;  2LNT A;  2MBS A;  6GST A;  1ZOF A;  1F37 A;  1T3B A;  3RDW A;  2K8V A;  2F8A A;  2M72 A;  1AAZ A;  2HRK B;  1A0R P;  3P2A A;  3TRX A;  6GSX A;  2GQM A;  1TI1 A;  1K3L A;  2LEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...