1TU7A

Structure of onchocerca volvulus pi-class glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MSYKLTYFSIRGLAEPIRLFLVDQDIKFIDDRIAKDDFSSIKSQFQFGQLPCLYDGDQQIVQSGAILRHLARKYNLNGENEMETTYIDMFCEGVRDLHVKYTRMIYMAYETEKDPYIKSILPGELAKFEKLLATRGNGRNLILGDKISYADYALFEELDVHQILDPHCLDKFPLLKVFHQRMKDRPKLKEYCEKRDAAKVPVNGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 2
publication title Structure of the Major Cytosolic Glutathione S-Transferase from the Parasitic Nematode Onchocerca volvulus
pubmed doi rcsb
source organism Onchocerca volvulus
molecule tags Transferase
total genus 78
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1tu7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tu7A01
1MD4A 2X8GA 1Y25A 1B8XA 1ERVA 1V9WA 2HYXA 5JWQB 3DKSA 3QFBC 1AIUA 4TVEA 3HVXA 1MDKA 4DSSB 2TRXA 3H93A 3PH9A 2IMDA 3QMXA 3CSJA 1SKRB 2B7KA 2GZZA 3W6GA 4KF9A 2H1AA 1O6JA 3KIJA 3IAS2 3F0IA 2LNTA 3D6IA 3S9FA 4RI6A 4KH7A 1AXDA 2CQ9A 4FQUA 3CRUA 2EIOA 4WF4A 2DJJA 5E59A 1K3YA 2E7PA 3MAKA 2L6DA 1LJRA 3MSZA 4NAXA 3MNGA 1GNEA 1F3AA 3TRQA 1V57A 2F9SA 4NV5A 3BBYA 1XWBA 3IAM2 4MF7A 4MK3A 3QFAC 5GZZB 3GKMA 3EVIA 1QK8A 3F63A 3EU4A 4GXZA 2DSAA 2PMTA 4EVMA 4HDEA 2VD1A 1SL2B 2LS5A 1KNGA 1UVZA 3IRAA 4GLTA 1M99A 3KMOA 4IJIA 2FWGA 1G7OA 1PX7A 4AJ8A 3SBCA 2HSNB 3D22A 2FGXA 1A2LA 1O7UA 3P90A 2NBSA 1K0OA 4RUVA 3MDKA 5ECOB 2YJHA 3GNJA 3F4TA 3GSSA 1HNBA 5CNWA 1PKZA 1F3BA 1NHYA 2H72A 4KCAA 4EUYA 4EO3A 1Q98A 1JFUA 2DLXA 3ZFBA 3IBHA 1RQMA 1E2YA 2FUG2 2MMAA 3ZZXA 3GMFA 2CVDA 3DWVA 3U6VA 4K0GA 2OKAA 3WT1A 1SK1A 4X1UA 4XTSA 2LJAA 3ZRDA 3KMNA 2J23A 1Z7RA 3GSTA 1SENA 2XBIA 5IMVA 3KCMA 2HRKB 5L71A 4IW9A 2QC7A 3ERFA 4ZIJA 4E8HA 3DRNA 3RHCA 1ZMAA 1Z5YE 1PSQA 4OMVA 1G7EA 3TGZA 1ZCPA 1AAZA 1XW5A 1TU8A 3FZ9A 4GQCA 1T4ZA 2IMFA 3C1SA 2HZEB 2LRNA 2HRKA 2FY6A 4O7HA 3C71A 3UARA 2LNSA 1ZGNA 3APSA 3BCKA 5DVBA 1GL8A 4FYUA 5IIZA 1GUKA 1HQOA 2DJ0A 1FG4A 1XW9A 2RM6A 1V2AA 3PINA 1ST9A 2K8SA 3KTLA 1KEBA 5FT3A 3GA4A 2KUCA 2H8LA 4HI7A 2GDRA 1T1VA 4P3YB 2L6CA 2PUKC 3APOA 3ZYWA 5AIXA 2C0EA 4XRDA 4TR0A 3TKSA 4WR5A 5CRHA 6GSUA 1TDIA 4GQFA 4RQXA 4JZQA 3KEBA 1GSFA 4N30A 3VFIA 2DJKA 2CVKA 5DALB 1FOVA 22GSA 1EOHA 3ZLPA 5B6NA 5ECHB 1QGVA 2GQMA 1VF2A 2V32A 1HNAA 3UVHA 4ZILA 1Z6NA 4HJMA 3WGDA 2F8FA 1WRYA 5DALA 3TKPA 1TJDA 1OC3A 2IFQB 1A8LA 5JWRB 1XIYA 2HRFA 17GSA 2GT5A 1PMTA 2H6XA 3EYTA 2DIYA 2YZHA 1OC8A 2VL2A 1G0TA 3IK7A 3PR8A 4AGSA 5IMZA 3FW2A 5IPGA 4OD7A 3I69A 4BA7A 1R7HA 1MD3A 1WWJA 5JWOB 3TJGA 2YPMA 1PRXA 1F37A 1BQ7A 3UL3A 5IMFA 10GSA 1FW1A 1XZOA 4TOPA 2CT6A 1GUHA 3GN3A 1AUCA 1F9MA 5JCGA 5CYYA 8GSSA 1X9SB 2EIRA 2FNOA 2IL3A 4MZCA 5H5SA 3D4MA 3P8WA 4E8EA 2YANA 2YWNA 2DJ3A 5D8IA 2O85A 2VOCA 4KDUA 3CRTA 2IIYA 4POLA 2YV9A 1PX6A 3NZNA 4OO5A 1YF0A 2V41A 1K0DA 3CTFA 1NM3A 5J41A 3LGCA 3HJOA 3RBTA 1A2MA 5GAPD 2Z9SA 1TK0B 2R3XA 4IKHA 1ABAA 4XS1A 1JZRA 2GSSA 2NVLA 4EXJA 4L0UA 2X8HA 1FVKA 1A0RP 4OFNA 4YAVA 5DJLA 4ZBDA 3GH9A 2CV4A 3HZ4A 4TXOA 4ZL7A 3ZVJD 1I9DA 1TKDB 2B6MA 1EV4A 2JSZA 3LSZA 1XOAA 1A0FA 2KLXA 4MF6A 4ML1A 2V6KA 3TKSC 3VURA 4ZL9A 4F0CA 4MABA 3M3MA 2N5FA 1GLPA 5KEJA 3DEXA 1V58A 4MLYA 5DDLA 2TIRA 2YOIA 2VCZA 3L9VA 3IPZA 3KH9A 3F6DA 5HR1A 2E2MA 1U3AA 3N9JA 5ECPB 5A4WA 4V2MA 4G0LA 4YQUA 1Y6EA 4ECCA 3TKSE 5DCHA 4TN8A 4K1FA 1WJKA 2MBSA 3QCPA 4G2EA 4PX1A 1VGLA 3DIEA 3IE3A 3M1GA 3KZQA 1K0CA 4EL1A 3KXOA 2QGVA 1TK8B 3ISOA 2YWMA 1EEJA 1VF3A 5F0GA 2VL2C 2HSYA 5J4UA 1PN9A 3K8NA 1XXUA 3I6AA 5EVOA 4CHSA 3W8SA 2HXKA 5ECLB 4ACSA 3F3RA 2FA8A 3IK9A 4K0NA 3FR9A 4F0BA 1SU9A 4XS4A 3HA9A 2NDOA 5A5KA 5ECKB 1JHBA 3FKFA 2L5LA 1X9MB 2P5RA 1K3LA 2VO4A 1BJXA 5CREA 3UIWA 3HXSA 3TRXA 4WF5A 1FB0A 2VAFA 5ABRA 1OVNA 3TKRA 1X5EA 1WMJA 1GSSA 5A4UA 5G5FA 1AC1A 1NHOA 1WIKA 1TU7A 2HSMB 4G10A 1HNCA 2VUPA 1U6TA 4JBBA 2RUFA 2AAWA 3HCZA 1ZYEA 2VCWA 2C1YA 3UBKA 5KN0A 4MF5A 2PGTA 2UZ8A 4GWRA 3VK9A 2WCIA 3M9KA 3GV1A 2IMIA 4FYBA 2R5GA 3GX0A 3F8UA 3F6FA 1M2AA 2O87A 5GSTA 5KN3A 2ZNMA 3JCML 4ECBA 2L57A 2PN8A 1NSWA 5HFGA 3D0ZA 2JADA 3WGXA 5IMDA 2OE1A 5AN1A 4JR4A 1WOUA 4EC0A 3QAWA 2PVQA 4DSSA 2OJLA 3WD6A 2VCTA 5HFIA 3LJRA 3UMAA 1VRSD 4I2TA 3TB2A 1XBSA 2DJ2A 3G7JA 1EGRA 4N11A 4WETA 1LU4A 1GLQA 2G2QA 5GAND 4J2FA 3GTUB 3IHQA 1TP9A 3LEFA 3HD5A 2FLSA 5A4VA 1AQXA 3TOTA 3PGTA 2BMXA 4G9HA 5D93A 2HRNA 2OE0A 4L8EA 2MMNA 5DJMA 2F8AA 1F2EA 2ON7A 2LQQA 2D2ZA 1MTCA 1BYEA 3VWUA 1M9BA 1V98A 1UC7A 3IC4A 4TXVA 1XVQA 3QPMA 4AF2A 2JL4A 1H4OA 5JCUA 1FAAA 2A4VA 5LNKe 2FWEA 4ZXGA 1DUGA 1QQ2A 4TR1B 3DYRA 4K7OA 2VL3A 19GSA 2LJKA 2H0IA 2A2SA 4LL1B 3M8NA 3F4SA 5IMAA 1UA5A 1M7TA 2K9FA 5FHIA 4MJAA 2PERA 3FZ5A 4L5LA 4NPBA 4PXOA 4ZBBA 3APQA 1FB6A 3F4RA 3GFKA 3VPQA 5DQSA 3CMIA 2L4QA 2VM2A 3J7Yb 3C73A 1TRSA 2H73A 5G5EA 4V1Ag 4NV2A 4ZL8A 4AJ7A 4GSNA 1R26A 2H0HA 1ZYQB 2CVBA 4YQMA 3MWHA 2VLVA 4OO4A 3CTGA 3BCIA 1OAZA 3BD2A 3ZFLA 5AGYA 1EEMA 3M9JA 1SL0B 2DBCA 3DXBA 3UVTA 2V2GA 2VD0A 3CBUA 1OKDA 1KBNA 4OWYA 2C0FA 2CZ3A 2DJ1A 2RUEA 2YV7A 4FH8A 6GSXA 4HU9A 1O85A 2FA4A 2GQKA 3HY2A 1J9BA 1OKTA 2F51A 2XPEA 6GSWA 4TR4A 2JU5A 1FHEA 2DMMA 2VLTA 4IP6A 5IPHA 1DE2A 2HT9A 1XWCA 3VWXA 2PVOC 2OBKA 7GSSA 2H6YA 3ZTLA 3TJFA 4JR6A 1SYXA 1DSBA 2HZEA 1EZKA 3LFLA 1THOA 3GUSA 2NTOA 2WULA 1SD9A 2ALBA 1IYIA 2I1UA 3US3A 3LORA 1EP8A 3VWVA 1TRWA 2M80A 2GZYA 2L5OA 1B9XC 2IMEA 4KE3A 2YWOA 2V6OA 2RLIA 1SK0A 4JEDA 5HR0A 3CYNA 2GSRA 1J0FA 5GSSA 1XCCA 5IQYA 4OCEA 4QQ7A 2YCDA 4XS6A 2H75A 1PQNA 3H1NA 4JU5A 2H01A 2LJRA 4KSMA 3EMXA 4POMA 1SJZA 4TRXA 3D5JA 3D21A 1A2JA 4BVYB 3LYPA 3EE2A 4X43A 2H66A 2HRAA 4MPFA 2WB9A 4ID0A 2O7KA 5D9XA 1GSQA 14GSA 3GL3A 3A3TA 3VLNA 5ECIB 2B1LA 4ECIA 2MZCA 3LQ7A 5F06A 3F9UA 3LWAA 4KGIA 4EDZA 4K9ZA 5LD0A 1QFNA 1ZZYA 4BVYA 1GH2A 4BL7B 1PD21 2OADA 2IFQA 5ENUA 1QXHA 1XVWA 2H30A 6GSSA 1JLVA 2GLRA 1THXA 2VCXA 3Q74A 4GF0A 3ZL5A 1TI3A 4QL7A 1SJIA 3FRCA 1UN2A 1N8JA 1F6MC 2AUVA 3G7YA 1OC9B 4JRRA 3CSHA 3IXRA 1KTEA 2VM1A 4DSQA 2EC4A 3W8JA 4TR3A 2C4JA 2GT6A 1XWKA 5B7CA 1TRVA 2CA8A 2JZTA 5F05A 3R3EA 1E6BA 5EY6A 4MCUA 1M0UA 2DIZA 2K6VA 4ILFA 3RDWA 2E0QA 2N5AA 5ECQB 2HFDA 5CRWA 4OFTA 4IHUA 1TK5B 5ECSA 4LA1A 1GSUA 4JE1A 1GSYA 5B8BA 1TW9A 5HR2A 4WBJA 5D96A 1C72A 2IJYA 1Q4JA 3C7MA 2WRTA 4O5RA 1RK4A 4FO5A 2P5QA 5ID2B 3TJBA 11GSA 3IOSA 3UAPA 1I5GA 2M46A 4IELA 2RIIA 4ULXA 2YNXA 1ERTA 3GH6A 3FEUA 3QDNA 4Q5NA 3KTBA 4L5OA 2B5EA 1QUWA 5ID2A 3IC8A 4J57E 2X8CA 4NHWA 4G19A 3KM6A 5G1LA 2KHPA 4TKYA 4KUNA 3KGKA 4HJ2A 5C04A 5KN2A 3TCOA 2C3QA 3V1WA 1EP7A 3G9BA 1BAYA 3C1RA 4WKWA 2I9HA 2C3NA 2GSQA 5DQYA 4PNFA 4Q5QA 1K0NA 1YY7A 5AIVA 5B6MA 4QL9A 1ZL9A 3KJYA 1SD8A 1B9YC 1X0RA 1K0BA 4NXIA 5G31A 1W4VA 1TOFA 2JACA 4IN0A 1QMVA 2H6ZA 1PA3A 2TRCP 4IGJA 3M0FA 3QAVA 1X5DA 2R37A 2WGRA 4GCIA 3A2VA 1SKSB 4OFMA 1YZXA 5CO3A 4LL4B 1V40A 2CX4A 2ZCTA 3ZMKA 1JZOA 1K0AA 4H86A 4KDXA 2A2RA 4D73B 3CSIA 2DC5A 1JLWA 4F9ZA 4I97A 1S3CA 1GUMA 2I81A 4Z7XA 4PGTA 3UJ1A 1FVJA 1OE8A 1WP0A 4L0WA 3LG6A 3ERGA 2G0FA 4KW6A 2JSYA 5CRGA 1CQGA 5CP1A 1XOBA 4F03A 4LMWA 2CZ2A 5EPFA 5HR3A 3FHKA 2YZUA 2GTUA 2HI7A 4YH2A 2AYTA 4LLRA 3LYKA 1LBKA 2MMOA 2LRCA 3LXTA 3IDVA 4GSSA 2OE3A 2R2JA 1Z7PA 1A24A 2X99A 5G1KA 1PL1A 2OA7A 5D9TA 2E2GA 2HSMA 3ERWA 4RI7A 1SYRA 3EC3A 3KP9A 3GX8A 4POKA 1RW1A 2OBIA 5CRDA 3TUEA 4FYCA 4Q5FA 1EV9A 4PQ1A 2H70A 1S3DA 4GRFA 3O76A 2PWJA 2IMKA 5J9BA 2LRTA 5F8BA 4CDOA 4KX4A 2PU9C 4HOJA 1CQHA 1BX9A 2LUSA 4FIWA 2B1KA 1R4WA 4I2UA 5G30A 3ZVJA 5IMCA 1YQ1A 3EWLA 4ZB8A 4ISDA 4F82A 1ON4A 4DVCA 3EURA 3G7IA 4K6XA 1T8EB 2FHEA 2FWHA 12GSA 1GNWA 1R5AA 1XFLA 3ED3A 4HZ2A 2K18A 1DBYA 1BEDA 1O81A 3EMPA 1T3BA 4TW5A 1K0MA 3ZREA 2CX3A 4KB3A 4WBRD 3Q6OA 4IQAA 5B8AA 2REMA 3VWWA 1SKWB 3FYGA 3P2AA 4BWSA 3GTUA 3ME8A 1ZOFA 4K8MA 3GKXA 3L78A 1YEXA 5H5RA 3QR6A 3PPUA 5EL8A 2YJ7A 20GSA 3HJMA 1OE7A 6GSVA 1ILOA 3KD0A 4K7IA 3QOUA 1DE1A 4WEYA 2LKUA 3WYWA 1EWXA 1MEKA 5C00A 3E3EA 2P0GA 1SJ6A 3FZ4A 4I8BA 2C3TA 5IO2A 2WS2A 4IQ1A 3GL5A 4XHMA 4ZB6A 2HSHA 3DGQA 4PQHA 4HEA2 4TR1A 4YQVA 2MYGA 3GKNA 1X9WB 3HHVA 3AY8A 3C8EA 5ELAA 4LMVA 4K7NA 2GQLA 2RM5A 2L59A 2H1GA 4PURA 1YF1A 3DD3A 4KAEA 1B4PA 5G2ZA 3E9JB 3Q19A 2LSTA 4KDYA 3A2WA 4F2IA 3DMLA 4ZB9A 1ACVA 9GSSA 2XBQA 4PTSA 2MMZA 5E4WA 5DAKB 2KP2A 4MMMA 4YAPA 4HZ4A 1WE0A 1MDIA 5H5QA 3TJKA 4GTUA 5J9CA 2AB6A 2P31A 3WGEA 4V1Ap 3FR6A 1ML6A 3ZMLA 4MH3A 2H1DA 1R5PA 2K8VA 4K2DA 3OR5A 2IWTA 5DAKA 3HVSA 1GSDA 2PBJA 2FD3A 1URMA 2DMLA 3GIXA 3H4KA 1A8YA 18GSA 2C0DA 2GVPA 2C0GA 2BJXA 1TXXA 1YDKA 3HZ8A 4O32A 3F3QA 1PGTA 4KCEA 2B5XA 1B4QA 3O3TA 2C80A 2H74A 3KP8A 1A23A 2VLUA 1GRXA 2B5YA 4N0ZA 2HE3A 1N2AA 4MPGA 1GTIA 4HQSA 2JZRA 4MZWA 3ZIJA 4IP1A 3ME7A 2AJQB 4MA9A 1XW6A 2GZPA 3TDGA 3TOUA 1IYHA 2R4VA 4EE0A 2WZ9A 1T00A 2YP6A 3IA1A 1M9AA 4WR4A 3A5WA 1G6WA 5BMUA 3EU3A 4CW9A 3WT2A 2FWFA 4PNGA 4ECJA 4IVFA 2XC2A 1B48A 2V1MA 2GSTA 5D9WA 2VL9A 5COHA 4G0KA 2OACA 2QKEA 1EOGA 5DCGA 1VF4A 1U88A 2HLSA 1J08A 1S3AA 2R6KA 3HVVA 3NIVA 4N0VA 1M2BA 1XPVA 1SL1B 1MDJA 2I3YA 4USSA 4KA0A 4ZBAA 2EIQA 2KP1A 1PKWA 3FR3A 3L9UA 2I4AA 3R2QA 3SWLA 3L4NA 3D4TA 1EGOA 1JZDA 2L4CA 2JZSA 1O8XA 2M72A 1M2DA 1WPIA 3J7Yk 2BTOT 1JZWA 1U3IA 4PQIA 1AQWA 3CXGA 3GHAA 2ZUPA 2O8VB 2J9HA 1Z3EA 3H79A 4XCSA 2ON5A 2NPBA 4BL7A 1YEPA 5LCZA 2N5BA 2LQOA 1YJ6A 4WXTA 4KSOA 4MJBA 1U87A 3VI7A 3FZAA 1X5CA 3VPTA 4EDYA 13GSA 3DVWA 4XRAA 2HNLA 4HUAA 3HKRA 4NWYA 1OC9A 2B3SA 2WDUA 2VCVA 2QSIA 2AV4A 2IPAA 4OCFA 2F3MA 4GSTA 4HS1A 16GSA 3LXZA 2CAIA 6GSTA 2IN3A 2YN1A 3UOMA 2GS3A 3RPPA 1O8WA 2B7JA 1FO5A 2FCHA 1USBA 4MZBA 4NHZA 2LV3A 1YKCA 5F07A 2GGTA 1Z6MA 4TXOB 2ES7A 3Q18A 4IS0A 3HYPA 3QD9A 3IV4A 5IOWA 5CAXA 3NOFA 3IR4A 5HFKA 4V2LA 1NW2A 4MDCA 3L0HA 4DEJA 3UBLA 3RHBA 5J3RA 2KOKA 2H19A 4ML6A 1GWCA 3GYKA 5D73A 3GKKA 2CAQA 4KNDA 1T7PB 3U5RE 4O92A 3GURA 4I5QA 3BJ5A 4J56E 2XPDA 5HQPA 4BPYA 4NMUA 1ERWA 5ECMB 3UEMA 4N10A 2H1BA 4EF0A 3P7XA 5ELGA 1YKAA 2LEGA 1AW9A 4BVXB 3VI5A 4I6XA 4G0IA 1GSEA 4DSRA 3A2XA 3HDCA 1XWGA 2PPTA 3TRPA 2YWIA 3FK8A 1GP1A 3O6TA 4MJEA 3FY7A 5ECNB 4V2NA 1GULA 4X0XA 4MP4A 1GTUA 3RAZA 2HQTA 5FWGA 4BVXA 1TRUA 2C8UA 1GTBA 5J5NA 2AHEA 2VCQA 1PL2A 5ECRB 4PUAA 2VIMA 1TI1A 1T4YA 2H0GA 2H76A 4MJCA 2WFCA 1OYJA 2H71A 1O73A 1GTAA 1Z9HA 3RPNA 4PUFC 2LTKA 4XS4B 4HU7A 1ERUA 1HD2A 1AQVA 5D9VA 4HQZA 3L9SA 5IM9A 3DVXA 3HJPA 1W89A 4EKZA 5INYA 1XWAA 6GSYA 2O89A 3QAGA 4IBPA 2WJUA 3BOAA 5KN1A 4BWQA 3ZITA 4POBA 5IOXA 1HYUA 3EINA 2XHFA 3TKQA 3E0UA 5JCWA 1TTZA 1SK2A 3KH7A 2X64A 3ZIVA 1BG5A 4XIHA 3TJJA 4Q5RA 5AISA 4D73A 1VF1A 5IO0A 4AJ6A 3N5OA 4IJ3A 1K3OA 2MBTA 3H8QA 1H75A 3I9V2 3I43A 2HZFA 4MH2A 5DBQA 1G6YA 3GRXA 4RQRA
chains in the Genus database with same CATH superfamily
1MD4A 2X8GA 1Y25A 1B8XA 1ERVA 1V9WA 2HYXA 5JWQB 3DKSA 3QFBC 1AIUA 4TVEA 3HVXA 1MDKA 4DSSB 2TRXA 3H93A 3PH9A 2IMDA 3QMXA 3CSJA 4K2XA 1SKRB 2B7KA 2GZZA 3W6GA 4KF9A 2H1AA 1O6JA 3KIJA 3IAS2 3F0IA 2LNTA 3D6IA 3S9FA 4RI6A 4KH7A 1AXDA 2CQ9A 4FQUA 3CRUA 2EIOA 2EFCA 4WF4A 2DJJA 5E59A 1K3YA 4ZB7A 2E7PA 4EIQA 3MAKA 2L6DA 1LJRA 3MSZA 4NAXA 3MNGA 1GNEA 4PI0C 1F3AA 3TRQA 1V57A 2F9SA 4NV5A 3BBYA 1XWBA 3IAM2 4MF7A 4MK3A 5KOXA 3QFAC 5GZZB 2WVXB 3GKMA 3EVIA 1QK8A 3F63A 3EU4A 4GXZA 2DSAA 2PMTA 4K5SA 4EVMA 4HDEA 2VD1A 1SL2B 2LS5A 1SVMA 1KNGA 1UVZA 3IRAA 4GLTA 1M99A 3KMOA 4IJIA 2FWGA 1G7OA 1PX7A 4AJ8A 3SBCA 2HSNB 3D22A 2FGXA 1A2LA 1O7UA 3P90A 2NBSA 4CY6A 1K0OA 4RUVA 3MDKA 5ECOB 2YJHA 3GNJA 3F4TA 3GSSA 1HNBA 5CNWA 1PKZA 1F3BA 1NHYA 2H72A 4KCAA 4EUYA 4EO3A 1Q98A 1JFUA 4O5QA 2DLXA 3ZFBA 3IBHA 1RQMA 1E2YA 2FUG2 2MMAA 3ZZXA 3GMFA 2CVDA 3DWVA 3U6VA 4K0GA 2OKAA 3WT1A 1SK1A 4X1UA 4XTSA 2LJAA 3ZRDA 3KMNA 2J23A 1Z7RA 4FXYP 3GSTA 1SENA 2XBIA 5IMVA 3KCMA 2HRKB 5L71A 4IW9A 2QC7A 3ERFA 4ZIJA 4E8HA 3DRNA 3RHCA 1ZMAA 1Z5YE 1PSQA 2QA2A 4OMVA 1G7EA 3TGZA 1ZCPA 5J4YA 1AAZA 1XW5A 1TU8A 3FZ9A 4GQCA 1T4ZA 2IMFA 3C1SA 2HZEB 2LRNA 2HRKA 2FY6A 4O7HA 3C71A 3UARA 2LNSA 1ZGNA 3APSA 3BCKA 5DVBA 1GL8A 4FYUA 5IIZA 1GUKA 1HQOA 2DJ0A 1FG4A 1XW9A 2RM6A 1V2AA 3PINA 1ST9A 2K8SA 3KTLA 1KEBA 5FT3A 3GA4A 2KUCA 2H8LA 4HI7A 2GDRA 1T1VA 4P3YB 2L6CA 2PUKC 3APOA 3ZYWA 5AIXA 2C0EA 4XRDA 4TR0A 3TKSA 2DKHA 4WR5A 5CRHA 4AKGA 3CQFA 6GSUA 1TDIA 4GQFA 4RQXA 4JZQA 3KEBA 1GSFA 4N30A 3VFIA 3HVNA 2DJKA 2CVKA 5DALB 1FOVA 4YKFA 22GSA 1EOHA 1ZYNA 3ZLPA 5B6NA 5ECHB 1QGVA 2GQMA 1VF2A 2V32A 1HNAA 3UVHA 4ZILA 1Z6NA 4HJMA 3RGBC 3WGDA 2F8FA 1WRYA 5DALA 3TKPA 1TJDA 2IFQB 1OC3A 1A8LA 5JWRB 1XIYA 1PN0A 2HRFA 17GSA 2GT5A 1PMTA 2H6XA 3EYTA 2DIYA 2YZHA 1OC8A 2VL2A 1G0TA 5A34B 3IK7A 3PR8A 4AGSA 5IMZA 3FW2A 5IPGA 4OD7A 3I69A 4BA7A 1R7HA 1MD3A 1WWJA 5JWOB 3TJGA 2YPMA 1PRXA 2UV8G 1F37A 1BQ7A 3UL3A 5IMFA 10GSA 1FW1A 1XZOA 4TOPA 5BRTA 1M3IA 2CT6A 1GUHA 5A34A 3GN3A 1AUCA 4YKGA 1F9MA 5JCGA 5CYYA 8GSSA 1X9SB 2EIRA 2FNOA 2IL3A 4MZCA 5H5SA 3D4MA 3P8WA 4E8EA 2YANA 2YWNA 2DJ3A 5D8IA 2O85A 5A1NB 2VOCA 4KDUA 3CRTA 2IIYA 4POLA 1FOHA 2YV9A 1PX6A 3NZNA 4OO5A 1YF0A 2V41A 1K0DA 3CTFA 1NM3A 5J41A 3LGCA 3HJOA 3RBTA 1A2MA 5GAPD 2Z9SA 2WW3A 1TK0B 2R3XA 4IKHA 1ABAA 4XS1A 1JZRA 2GSSA 2NVLA 4EXJA 4L0UA 2X8HA 1FVKA 1A0RP 4OFNA 4YAVA 5DJLA 4ZBDA 3GH9A 2CV4A 3HZ4A 4TXOA 4ZL7A 3ZVJD 1I9DA 1TKDB 2B6MA 1EV4A 2JSZA 3LSZA 1XOAA 1A0FA 2KLXA 4MF6A 4ML1A 2V6KA 3TKSC 3VURA 4ZL9A 4F0CA 4MABA 3M3MA 2N5FA 1GLPA 5KEJA 3DEXA 1V58A 5J40A 4MLYA 5DDLA 2TIRA 2YOIA 2VCZA 3L9VA 2O5VA 3IPZA 3KH9A 3F6DA 5HR1A 2E2MA 1U3AA 3N9JA 5ECPB 5A4WA 4V2MA 4G0LA 4YQUA 1Y6EA 4ECCA 3TKSE 5DCHA 4TN8A 4K1FA 1WJKA 2MBSA 3QCPA 4G2EA 4PX1A 1VGLA 3DIEA 3IE3A 3M1GA 3KZQA 1K0CA 4EL1A 3KXOA 2QGVA 3TU3B 4Z2TA 1TK8B 3ISOA 2YWMA 1EEJA 1VF3A 5F0GA 3CHXC 2VL2C 2HSYA 5J4UA 1PN9A 3K8NA 1XXUA 3I6AA 5EVOA 4CHSA 3W8SA 2HXKA 5ECLB 4ACSA 3F3RA 2FA8A 3IK9A 4K0NA 3FR9A 4F0BA 1SU9A 4XS4A 3HA9A 2NDOA 5A5KA 5ECKB 1JHBA 3FKFA 2L5LA 1X9MB 2P5RA 1K3LA 2VO4A 1BJXA 5CREA 3UIWA 3HXSA 3TRXA 4WF5A 1FB0A 2VAFA 5ABRA 1OVNA 3TKRA 1X5EA 1WMJA 1GSSA 5A4UA 5G5FA 1AC1A 1NHOA 1WIKA 1TU7A 2HSMB 4G10A 1HNCA 2VUPA 1U6TA 4JBBA 2RUFA 2AAWA 3HCZA 1ZYEA 2VCWA 4AI6A 2C1YA 3UBKA 5KN0A 4MF5A 2PGTA 2UZ8A 4GWRA 3VK9A 2WCIA 3M9KA 3GV1A 2IMIA 4FYBA 2R5GA 3GX0A 3F8UA 3F6FA 1M2AA 1ZYPA 2O87A 5GSTA 5KN3A 2ZNMA 3JCML 4ECBA 1SVOA 2L57A 2PN8A 1NSWA 5HFGA 3D0ZA 2JADA 3WGXA 5IMDA 2OE1A 5AN1A 4JR4A 1WOUA 4EC0A 3QAWA 2PVQA 4DSSA 2OJLA 4W66A 3WD6A 2VCTA 5HFIA 3LJRA 3UMAA 1VRSD 4I2TA 3TB2A 4G01A 1XBSA 2DJ2A 3G7JA 1EGRA 4N11A 4WETA 1LU4A 1GLQA 2G2QA 5GAND 4J2FA 3GTUB 3IHQA 1TP9A 3LEFA 3HD5A 2FLSA 5A4VA 1AQXA 3TOTA 3PGTA 2BMXA 4G9HA 5D93A 2HRNA 2OE0A 4L8EA 2MMNA 5DJMA 2F8AA 1F2EA 2ON7A 2LQQA 2D2ZA 1MTCA 1BYEA 3VWUA 1M9BA 1V98A 1UC7A 3IC4A 2WVXA 4O5UA 2WZSA 4TXVA 1XVQA 3QPMA 4AF2A 2JL4A 1H4OA 5JCUA 5J4VA 1FAAA 2A4VA 5LNKe 2FWEA 4ZXGA 1DUGA 1QQ2A 4TR1B 3DYRA 4K7OA 4A5PA 2VL3A 19GSA 2LJKA 2H0IA 2A2SA 4LL1B 3M8NA 3F4SA 5IMAA 1UA5A 1M7TA 2K9FA 5FHIA 4MJAA 2PERA 3FZ5A 4L5LA 4NPBA 4PXOA 4ZBBA 3APQA 1FB6A 4X4JA 2HSNA 3F4RA 3GFKA 3VPQA 5DQSA 3CMIA 2L4QA 2VM2A 3J7Yb 3C73A 1TRSA 2H73A 5G5EA 4V1Ag 4NV2A 2EFDA 4ZL8A 4AJ7A 4GSNA 1YEWC 1R26A 2H0HA 1ZYQB 2CVBA 4YQMA 3MWHA 2VLVA 4OO4A 3CTGA 3BCIA 1OAZA 3BD2A 3ZFLA 5AGYA 1EEMA 1N25A 3M9JA 1SL0B 2DBCA 3DXBA 3UVTA 2V2GA 2VD0A 3CBUA 1OKDA 1KBNA 4OWYA 2C0FA 1S3RA 2CZ3A 2DJ1A 2RUEA 1TXUA 2YV7A 4FH8A 6GSXA 1XG8A 4HU9A 1O85A 2FA4A 2GQKA 3HY2A 1J9BA 1OKTA 2F51A 2XPEA 6GSWA 4TR4A 2JU5A 1FHEA 2DMMA 2VLTA 4IP6A 5IPHA 1DE2A 2VKZG 2HT9A 1XWCA 3VWXA 2PVOC 2OBKA 7GSSA 3LW9A 2H6YA 3ZTLA 3TJFA 4JR6A 1SYXA 1DSBA 2HZEA 1EZKA 3LFLA 1THOA 3GUSA 2NTOA 2WULA 1SD9A 2ALBA 1IYIA 1S4BP 2I1UA 3US3A 3LORA 1EP8A 4CY8A 3VWVA 1TRWA 2M80A 2GZYA 2L5OA 1B9XC 2IMEA 4KE3A 2YWOA 2V6OA 2RLIA 1SK0A 4JEDA 5HR0A 3CYNA 2GSRA 1J0FA 5GSSA 1XCCA 5IQYA 4OCEA 4QQ7A 2YCDA 4XS6A 2H75A 1PQNA 3H1NA 4JU5A 4ICYA 2H01A 2LJRA 4KSMA 3EMXA 4POMA 1SJZA 4TRXA 3D5JA 3D21A 1A2JA 4BVYB 3LYPA 3EE2A 4X43A 2H66A 2HRAA 4MPFA 2WB9A 4AKXB 4ID0A 2O7KA 5D9XA 1GSQA 14GSA 3GL3A 3A3TA 3VLNA 5ECIB 2B1LA 4ECIA 2MZCA 3LQ7A 5F06A 3F9UA 3LWAA 4KGIA 4EDZA 4K9ZA 5LD0A 1QFNA 1ZZYA 4BVYA 1GH2A 4BL7B 1PD21 2OADA 2IFQA 5ENUA 1QXHA 4HSCX 1XVWA 2H30A 6GSSA 1JLVA 2GLRA 1THXA 2WW2A 2VCXA 3Q74A 2X4AA 4GF0A 3ZL5A 1TI3A 4QL7A 1SJIA 3FRCA 1UN2A 1N8JA 1F6MC 2AUVA 3G7YA 1OC9B 4JRRA 3CSHA 3IXRA 1KTEA 2VM1A 4DSQA 2EC4A 3W8JA 4TR3A 2C4JA 2GT6A 1XWKA 5B7CA 1TRVA 2CA8A 2JZTA 5F05A 3R3EA 1E6BA 5EY6A 4MCUA 1M0UA 2DIZA 2K6VA 2EFEA 4ILFA 3RDWA 2E0QA 2N5AA 5ECQB 2HFDA 5CRWA 4OFTA 4IHUA 1TK5B 5ECSA 2WW1A 2QA1A 4LA1A 5A1NA 1GSUA 4JE1A 1GSYA 2EFHA 5B8BA 1TW9A 5HR2A 4WBJA 5D96A 1C72A 1BG1A 2IJYA 1Q4JA 3C7MA 2WRTA 4O5RA 1RK4A 4FO5A 2P5QA 5ID2B 3TJBA 11GSA 3IOSA 3UAPA 1I5GA 2M46A 4IELA 2RIIA 3IHGA 4ULXA 2YNXA 1ERTA 3GH6A 3RFRC 4QMKA 3FEUA 3QDNA 4Z2UA 4Q5NA 2WVYA 3KTBA 4L5OA 2B5EA 1QUWA 5ID2A 1Y1UA 3IC8A 4J57E 4BIKA 2X8CA 4EIPA 4NHWA 4G19A 3KM6A 5G1LA 2KHPA 4TKYA 2O36A 4KUNA 3KGKA 4HJ2A 5C04A 5KN2A 3TCOA 2C3QA 3V1WA 1EP7A 3G9BA 1BAYA 3C1RA 4WKWA 2I9HA 2C3NA 2GSQA 5DQYA 4PNFA 4Q5QA 1K0NA 1YY7A 5AIVA 5B6MA 3FMWA 4QL9A 1ZL9A 3KJYA 1SD8A 1B9YC 1X0RA 1K0BA 4NXIA 5G31A 1W4VA 1TOFA 2JACA 4IN0A 1QMVA 2H6ZA 1PA3A 2TRCP 4IGJA 2A2PA 3M0FA 4PHZC 3QAVA 1X5DA 2R37A 2WGRA 4GCIA 3A2VA 1SKSB 4OFMA 1YZXA 5CO3A 4LL4B 1M3JA 1V40A 2CX4A 2ZCTA 3ZMKA 1JZOA 1K0AA 4H86A 4KDXA 2A2RA 2R0CA 4D73B 3CSIA 2DC5A 1JLWA 4F9ZA 4I97A 1S3CA 1GUMA 2I81A 4Z7XA 4PGTA 3UJ1A 1FVJA 1OE8A 1WP0A 3MIXA 4L0WA 3LG6A 3ERGA 2G0FA 4KW6A 2JSYA 5CRGA 1CQGA 5CP1A 1XOBA 4F03A 4LMWA 2CZ2A 5EPFA 5HR3A 3FHKA 2YZUA 2GTUA 2HI7A 4YH2A 2AYTA 4LLRA 3LYKA 1LBKA 2MMOA 2LRCA 3LXTA 3IDVA 4GSSA 2OE3A 2R2JA 1Z7PA 1A24A 2X99A 5G1KA 1PL1A 2OA7A 5D9TA 2E2GA 2HSMA 3ERWA 4RI7A 1SYRA 3EC3A 3KP9A 3GX8A 4POKA 1RW1A 2OBIA 5CRDA 3TUEA 4FYCA 4Q5FA 1EV9A 4PQ1A 2H70A 1S3DA 4GRFA 3O76A 2PWJA 2IMKA 5J9BA 2LRTA 5F8BA 4CDOA 4KX4A 3EPTA 2PU9C 4HOJA 1CQHA 1BX9A 2LUSA 4FIWA 4K5RA 2B1KA 1R4WA 4I2UA 5G30A 3ZVJA 5IMCA 2WVZA 4AKHA 1YQ1A 4GDFA 3EWLA 4ZB8A 4ISDA 3A5IA 4F82A 1ON4A 4DVCA 3EURA 3G7IA 4K6XA 1T8EB 2FHEA 2FWHA 12GSA 1GNWA 1R5AA 1XFLA 3ED3A 4HZ2A 2K18A 1DBYA 1BEDA 1O81A 3EMPA 1T3BA 3MYDA 4TW5A 4Z2RA 1K0MA 3ZREA 2CX3A 4KB3A 4WBRD 3Q6OA 4IQAA 5B8AA 2REMA 1YVLA 3VWWA 1SKWB 3FYGA 3P2AA 4BWSA 3GTUA 3ME8A 1ZOFA 4K8MA 3GKXA 3L78A 1YEXA 5H5RA 3QR6A 3PPUA 4MNNA 5EL8A 2YJ7A 20GSA 3HJMA 1OE7A 6GSVA 1ILOA 3KD0A 4K7IA 3QOUA 2X49A 1DE1A 4WEYA 2LKUA 3WYWA 1EWXA 1MEKA 5C00A 3E3EA 2P0GA 1SJ6A 2A4HA 3FZ4A 4I8BA 2C3TA 5IO2A 2WS2A 4IQ1A 3GL5A 4XHMA 4ZB6A 2HSHA 3DGQA 4PQHA 4HEA2 4TR1A 4YQVA 2MYGA 3GKNA 1X9WB 3HHVA 3AY8A 3C8EA 5ELAA 4LMVA 4K7NA 2GQLA 2RM5A 2L59A 2H1GA 4PURA 1YF1A 3DD3A 4KAEA 1B4PA 5G2ZA 3E9JB 3Q19A 2LSTA 4KDYA 3A2WA 4F2IA 3DMLA 4ZB9A 1ACVA 9GSSA 2XBQA 4PTSA 2MMZA 5E4WA 5DAKB 2KP2A 4MMMA 4YAPA 4HZ4A 1WE0A 1MDIA 5H5QA 3TJKA 4GTUA 5J9CA 2AB6A 2P31A 3WGEA 4V1Ap 3FR6A 1ML6A 3ZMLA 4MH3A 2H1DA 1R5PA 2K8VA 4K2DA 3OR5A 2IWTA 5DAKA 3HVSA 4E68A 1GSDA 2PBJA 2FD3A 1URMA 2DMLA 2DKIA 3GIXA 3H4KA 1A8YA 18GSA 2C0DA 2GVPA 2C0GA 2BJXA 1TXXA 1YDKA 3HZ8A 4O32A 3F3QA 1PGTA 4KCEA 2B5XA 1B4QA 3O3TA 2C80A 2H74A 3KP8A 5BMUB 1A23A 2VLUA 1GRXA 2B5YA 4N0ZA 2HE3A 1N2AA 3HMJG 4MPGA 1GTIA 4HQSA 2JZRA 4MZWA 3ZIJA 4IP1A 3ME7A 2AJQB 4MA9A 1XW6A 2GZPA 3TDGA 3TOUA 1IYHA 2R4VA 4EE0A 2WZ9A 1T00A 2YP6A 3IA1A 1M9AA 4WR4A 3A5WA 1G6WA 5BMUA 3EU3A 4CW9A 3WT2A 2FWFA 4PNGA 4ECJA 4IVFA 2XC2A 1B48A 2V1MA 2GSTA 5D9WA 2VL9A 5COHA 4G0KA 2OACA 2QKEA 1EOGA 5DCGA 1VF4A 1U88A 2HLSA 1J08A 1S3AA 2R6KA 3HVVA 3NIVA 4N0VA 1M2BA 1XPVA 1SL1B 1MDJA 2I3YA 4USSA 4KA0A 4ZBAA 2EIQA 2KP1A 1PKWA 2H1LA 3FR3A 5J47A 3L9UA 2I4AA 3R2QA 3SWLA 4N3ZA 3L4NA 3D4TA 1EGOA 1JZDA 2L4CA 2JZSA 1O8XA 2M72A 1M2DA 1WPIA 3J7Yk 2BTOT 1JZWA 1U3IA 2WW0A 4PQIA 1AQWA 3CXGA 3GHAA 2ZUPA 2O8VB 2J9HA 1Z3EA 3H79A 4XCSA 2ON5A 2NPBA 4BL7A 1YEPA 5LCZA 2N5BA 2LQOA 1YJ6A 4WXTA 4KSOA 4MJBA 1U87A 3VI7A 3FZAA 1X5CA 3VPTA 5KOWA 4EDYA 13GSA 3DVWA 4XRAA 2HNLA 4HUAA 3HKRA 4NWYA 1OC9A 2B3SA 2WDUA 2VCVA 3CWGA 2QSIA 1I1IP 2AV4A 2IPAA 4OCFA 2F3MA 4GSTA 4HS1A 16GSA 3LXZA 2CAIA 6GSTA 2IN3A 2YN1A 3UOMA 2GS3A 3RPPA 1O8WA 2B7JA 1FO5A 2FCHA 1USBA 4MZBA 4NHZA 2LV3A 1YKCA 5F07A 2GGTA 1Z6MA 2R0PA 4TXOB 2ES7A 4AKIA 3Q18A 4IS0A 3HYPA 3QD9A 3IV4A 5IOWA 5CAXA 3NOFA 3IR4A 5HFKA 4V2LA 1NW2A 4MDCA 3L0HA 4DEJA 3UBLA 3RHBA 5J3RA 2KOKA 2H19A 4ML6A 1GWCA 3GYKA 5D73A 5A5HB 3GKKA 2CAQA 4KNDA 1T7PB 3U5RE 4O92A 3GURA 4I5QA 3BJ5A 4J56E 2XPDA 2O3EA 5HQPA 1BF5A 4BPYA 4NMUA 1ERWA 5ECMB 3UEMA 4N10A 2H1BA 4EF0A 3P7XA 5ELGA 1YKAA 2LEGA 1AW9A 4BVXB 3VI5A 4I6XA 5A5HA 4G0IA 2R0GA 1GSEA 4DSRA 3A2XA 3HDCA 1XWGA 2PPTA 3TRPA 1PFOA 2YWIA 3FK8A 1GP1A 3O6TA 4MJEA 3FY7A 5ECNB 4V2NA 1GULA 4X0XA 4MP4A 1GTUA 3RAZA 2HQTA 5FWGA 4BVXA 1TRUA 2C8UA 1GTBA 5J5NA 2AHEA 2VCQA 1PL2A 5ECRB 4PUAA 2VIMA 1TI1A 1T4YA 2H0GA 2H76A 4MJCA 2WFCA 1OYJA 2H71A 1SVLA 1O73A 1GTAA 1Z9HA 3RPNA 4PUFC 2LTKA 4XS4B 4HU7A 1ERUA 1HD2A 2OT3A 1AQVA 5D9VA 4HQZA 3L9SA 5IM9A 3DVXA 3HJPA 1W89A 4EKZA 5INYA 1XWAA 6GSYA 2O89A 3QAGA 4IBPA 2WJUA 3BOAA 5KN1A 4PI2C 4BWQA 3ZITA 4POBA 5IOXA 1HYUA 3EINA 2XHFA 3TKQA 3E0UA 5JCWA 1TTZA 1SK2A 3KH7A 2X64A 3ZIVA 1BG5A 4XIHA 3TJJA 4Q5RA 5AISA 4D73A 1VF1A 5IO0A 4AJ6A 3N5OA 4IJ3A 1K3OA 2MBTA 3H8QA 1H75A 3I9V2 3I43A 2HZFA 4MH2A 5DBQA 1G6YA 3GRXA 4RQRA
chains in the Genus database with same CATH topology
1MD4A 2X8GA 1Y25A 1B8XA 1ERVA 1V9WA 2HYXA 5JWQB 3DKSA 3QFBC 1AIUA 4TVEA 3HVXA 1MDKA 4DSSB 2TRXA 3H93A 3PH9A 2IMDA 3QMXA 3CSJA 4K2XA 1SKRB 2B7KA 2GZZA 3W6GA 4KF9A 2H1AA 1O6JA 3KIJA 3IAS2 3F0IA 2LNTA 3D6IA 3S9FA 4RI6A 4KH7A 1AXDA 2CQ9A 4FQUA 3CRUA 2EIOA 2EFCA 4WF4A 2DJJA 5E59A 1K3YA 4ZB7A 2E7PA 4EIQA 3MAKA 2L6DA 1LJRA 3MSZA 4NAXA 3MNGA 1GNEA 1F3AA 3TRQA 1V57A 2F9SA 4NV5A 3BBYA 1XWBA 3IAM2 4MF7A 4MK3A 5KOXA 3QFAC 5GZZB 3GKMA 3EVIA 1QK8A 3F63A 3EU4A 4GXZA 2DSAA 2PMTA 4K5SA 4EVMA 4HDEA 2VD1A 1SL2B 2LS5A 1SVMA 1KNGA 1UVZA 3IRAA 4GLTA 1M99A 3KMOA 4IJIA 2FWGA 1G7OA 1PX7A 4AJ8A 3SBCA 2HSNB 3D22A 2FGXA 1A2LA 1O7UA 3P90A 2NBSA 4CY6A 1K0OA 4RUVA 3MDKA 5ECOB 2YJHA 3GNJA 3F4TA 3GSSA 1HNBA 5CNWA 1PKZA 1F3BA 1NHYA 2H72A 4KCAA 4EUYA 4EO3A 1Q98A 1JFUA 4O5QA 2DLXA 3ZFBA 3IBHA 1RQMA 1E2YA 2FUG2 2MMAA 3ZZXA 3GMFA 2CVDA 3DWVA 3U6VA 4K0GA 2OKAA 3WT1A 1SK1A 4X1UA 4XTSA 2LJAA 3ZRDA 3KMNA 2J23A 1Z7RA 3GSTA 1SENA 2XBIA 5IMVA 3KCMA 2HRKB 5L71A 4IW9A 2QC7A 3ERFA 4ZIJA 4E8HA 3DRNA 3RHCA 1ZMAA 1Z5YE 1PSQA 2QA2A 4OMVA 1G7EA 3TGZA 1ZCPA 5J4YA 1AAZA 1XW5A 1TU8A 3FZ9A 4GQCA 1T4ZA 2IMFA 3C1SA 2HZEB 2LRNA 2HRKA 2FY6A 4O7HA 3C71A 3UARA 2LNSA 1ZGNA 3APSA 3BCKA 5DVBA 1GL8A 4FYUA 5IIZA 1GUKA 1HQOA 2DJ0A 1FG4A 1XW9A 2RM6A 1V2AA 3PINA 1ST9A 2K8SA 3KTLA 1KEBA 5FT3A 3GA4A 2KUCA 2H8LA 4HI7A 2GDRA 1T1VA 4P3YB 2L6CA 2PUKC 3APOA 3ZYWA 5AIXA 2C0EA 4XRDA 4TR0A 3TKSA 2DKHA 4WR5A 5CRHA 4AKGA 6GSUA 1TDIA 4GQFA 4RQXA 4JZQA 3KEBA 1GSFA 4N30A 3VFIA 2DJKA 2CVKA 5DALB 1FOVA 4YKFA 22GSA 1EOHA 1ZYNA 3ZLPA 5B6NA 5ECHB 1QGVA 2GQMA 1VF2A 2V32A 1HNAA 3UVHA 4ZILA 1Z6NA 4HJMA 3WGDA 2F8FA 1WRYA 5DALA 3TKPA 1TJDA 1OC3A 2IFQB 1A8LA 5JWRB 1XIYA 1PN0A 2HRFA 17GSA 2GT5A 1PMTA 2H6XA 3EYTA 2DIYA 2YZHA 1OC8A 2VL2A 1G0TA 5A34B 3IK7A 3PR8A 4AGSA 5IMZA 3FW2A 5IPGA 4OD7A 3I69A 4BA7A 1R7HA 1MD3A 1WWJA 5JWOB 3TJGA 2YPMA 1PRXA 2UV8G 1F37A 1BQ7A 3UL3A 5IMFA 10GSA 1FW1A 1XZOA 4TOPA 5BRTA 2CT6A 1GUHA 5A34A 3GN3A 1AUCA 4YKGA 1F9MA 5JCGA 5CYYA 8GSSA 1X9SB 2EIRA 2FNOA 2IL3A 4MZCA 5H5SA 3D4MA 3P8WA 4E8EA 2YANA 2YWNA 2DJ3A 5D8IA 2O85A 5A1NB 2VOCA 4KDUA 3CRTA 2IIYA 4POLA 1FOHA 2YV9A 1PX6A 3NZNA 4OO5A 1YF0A 2V41A 1K0DA 3CTFA 1NM3A 5J41A 3LGCA 3HJOA 3RBTA 1A2MA 5GAPD 2Z9SA 1TK0B 2R3XA 4IKHA 1ABAA 4XS1A 1JZRA 2GSSA 2NVLA 4EXJA 4L0UA 2X8HA 1FVKA 1A0RP 4OFNA 4YAVA 5DJLA 4ZBDA 3GH9A 2CV4A 3HZ4A 4TXOA 4ZL7A 3ZVJD 1I9DA 1TKDB 2B6MA 1EV4A 2JSZA 3LSZA 1XOAA 1A0FA 2KLXA 4MF6A 4ML1A 2V6KA 3TKSC 3VURA 4ZL9A 4F0CA 4MABA 3M3MA 2N5FA 1GLPA 5KEJA 3DEXA 1V58A 5J40A 4MLYA 5DDLA 2TIRA 2YOIA 2VCZA 3L9VA 2O5VA 3IPZA 3KH9A 3F6DA 5HR1A 2E2MA 1U3AA 3N9JA 5ECPB 5A4WA 4V2MA 4G0LA 4YQUA 1Y6EA 4ECCA 3TKSE 5DCHA 4TN8A 4K1FA 1WJKA 2MBSA 3QCPA 4G2EA 4PX1A 1VGLA 3DIEA 3IE3A 3M1GA 3KZQA 1K0CA 4EL1A 3KXOA 2QGVA 3TU3B 4Z2TA 1TK8B 3ISOA 2YWMA 1EEJA 1VF3A 5F0GA 2VL2C 2HSYA 5J4UA 1PN9A 3K8NA 1XXUA 3I6AA 5EVOA 4CHSA 3W8SA 2HXKA 5ECLB 4ACSA 3F3RA 2FA8A 3IK9A 4K0NA 3FR9A 4F0BA 1SU9A 4XS4A 3HA9A 2NDOA 5A5KA 5ECKB 1JHBA 3FKFA 2L5LA 1X9MB 2P5RA 1K3LA 2VO4A 1BJXA 5CREA 3UIWA 3HXSA 3TRXA 4WF5A 1FB0A 2VAFA 5ABRA 1OVNA 3TKRA 1X5EA 1WMJA 1GSSA 5A4UA 5G5FA 1AC1A 1NHOA 1WIKA 1TU7A 2HSMB 4G10A 1HNCA 2VUPA 1U6TA 4JBBA 2RUFA 2AAWA 3HCZA 1ZYEA 2VCWA 4AI6A 2C1YA 3UBKA 5KN0A 4MF5A 2PGTA 2UZ8A 4GWRA 3VK9A 2WCIA 3M9KA 3GV1A 2IMIA 4FYBA 2R5GA 3GX0A 3F8UA 3F6FA 1M2AA 1ZYPA 2O87A 5GSTA 5KN3A 2ZNMA 3JCML 4ECBA 1SVOA 2L57A 2PN8A 1NSWA 5HFGA 3D0ZA 2JADA 3WGXA 5IMDA 2OE1A 5AN1A 4JR4A 1WOUA 4EC0A 3QAWA 2PVQA 4DSSA 2OJLA 4W66A 3WD6A 2VCTA 5HFIA 3LJRA 3UMAA 1VRSD 4I2TA 3TB2A 4G01A 1XBSA 2DJ2A 3G7JA 1EGRA 4N11A 4WETA 1LU4A 1GLQA 2G2QA 5GAND 4J2FA 3GTUB 3IHQA 1TP9A 3LEFA 3HD5A 2FLSA 5A4VA 1AQXA 3TOTA 3PGTA 2BMXA 4G9HA 5D93A 2HRNA 2OE0A 4L8EA 2MMNA 5DJMA 2F8AA 1F2EA 2ON7A 2LQQA 2D2ZA 1MTCA 1BYEA 3VWUA 1M9BA 1V98A 1UC7A 3IC4A 4O5UA 4TXVA 1XVQA 3QPMA 4AF2A 2JL4A 1H4OA 5JCUA 5J4VA 1FAAA 2A4VA 5LNKe 2FWEA 4ZXGA 1DUGA 1QQ2A 4TR1B 3DYRA 4K7OA 4A5PA 2VL3A 19GSA 2LJKA 2H0IA 2A2SA 4LL1B 3M8NA 3F4SA 5IMAA 1UA5A 1M7TA 2K9FA 5FHIA 4MJAA 2PERA 3FZ5A 4L5LA 4NPBA 4PXOA 4ZBBA 3APQA 1FB6A 4X4JA 2HSNA 3F4RA 3GFKA 3VPQA 5DQSA 3CMIA 2L4QA 2VM2A 3J7Yb 3C73A 1TRSA 2H73A 5G5EA 4V1Ag 4NV2A 2EFDA 4ZL8A 4AJ7A 4GSNA 1R26A 2H0HA 1ZYQB 2CVBA 4YQMA 3MWHA 2VLVA 4OO4A 3CTGA 3BCIA 1OAZA 3BD2A 3ZFLA 5AGYA 1EEMA 1N25A 3M9JA 1SL0B 2DBCA 3DXBA 3UVTA 2V2GA 2VD0A 3CBUA 1OKDA 1KBNA 4OWYA 2C0FA 2CZ3A 2DJ1A 2RUEA 1TXUA 2YV7A 4FH8A 6GSXA 4HU9A 1O85A 2FA4A 2GQKA 3HY2A 1J9BA 1OKTA 2F51A 2XPEA 6GSWA 4TR4A 2JU5A 1FHEA 2DMMA 2VLTA 4IP6A 5IPHA 1DE2A 2VKZG 2HT9A 1XWCA 3VWXA 2PVOC 2OBKA 7GSSA 3LW9A 2H6YA 3ZTLA 3TJFA 4JR6A 1SYXA 1DSBA 2HZEA 1EZKA 3LFLA 1THOA 3GUSA 2NTOA 2WULA 1SD9A 2ALBA 1IYIA 2I1UA 3US3A 3LORA 1EP8A 4CY8A 3VWVA 1TRWA 2M80A 2GZYA 2L5OA 1B9XC 2IMEA 4KE3A 2YWOA 2V6OA 2RLIA 1SK0A 4JEDA 5HR0A 3CYNA 2GSRA 1J0FA 5GSSA 1XCCA 5IQYA 4OCEA 4QQ7A 2YCDA 4XS6A 2H75A 1PQNA 3H1NA 4JU5A 4ICYA 2H01A 2LJRA 4KSMA 3EMXA 4POMA 1SJZA 4TRXA 3D5JA 3D21A 1A2JA 4BVYB 3LYPA 3EE2A 4X43A 2H66A 2HRAA 4MPFA 2WB9A 4AKXB 4ID0A 2O7KA 5D9XA 1GSQA 14GSA 3GL3A 3A3TA 3VLNA 5ECIB 2B1LA 4ECIA 2MZCA 3LQ7A 5F06A 3F9UA 3LWAA 4KGIA 4EDZA 4K9ZA 5LD0A 1QFNA 1ZZYA 4BVYA 1GH2A 4BL7B 1PD21 2OADA 2IFQA 5ENUA 1QXHA 1XVWA 2H30A 6GSSA 1JLVA 2GLRA 1THXA 2VCXA 3Q74A 2X4AA 4GF0A 3ZL5A 1TI3A 4QL7A 1SJIA 3FRCA 1UN2A 1N8JA 1F6MC 2AUVA 3G7YA 1OC9B 4JRRA 3CSHA 3IXRA 1KTEA 2VM1A 4DSQA 2EC4A 3W8JA 4TR3A 2C4JA 2GT6A 1XWKA 5B7CA 1TRVA 2CA8A 2JZTA 5F05A 3R3EA 1E6BA 5EY6A 4MCUA 1M0UA 2DIZA 2K6VA 2EFEA 4ILFA 3RDWA 2E0QA 2N5AA 5ECQB 2HFDA 5CRWA 4OFTA 4IHUA 1TK5B 5ECSA 2QA1A 4LA1A 5A1NA 1GSUA 4JE1A 1GSYA 2EFHA 5B8BA 1TW9A 5HR2A 4WBJA 5D96A 1C72A 1BG1A 2IJYA 1Q4JA 3C7MA 2WRTA 4O5RA 1RK4A 4FO5A 2P5QA 5ID2B 3TJBA 11GSA 3IOSA 3UAPA 1I5GA 2M46A 4IELA 2RIIA 3IHGA 4ULXA 2YNXA 1ERTA 3GH6A 4QMKA 3FEUA 3QDNA 4Z2UA 4Q5NA 3KTBA 4L5OA 2B5EA 1QUWA 5ID2A 1Y1UA 3IC8A 4J57E 2X8CA 4EIPA 4NHWA 4G19A 3KM6A 5G1LA 2KHPA 4TKYA 4KUNA 3KGKA 4HJ2A 5C04A 5KN2A 3TCOA 2C3QA 3V1WA 1EP7A 3G9BA 1BAYA 3C1RA 4WKWA 2I9HA 2C3NA 2GSQA 5DQYA 4PNFA 4Q5QA 1K0NA 1YY7A 5AIVA 5B6MA 3FMWA 4QL9A 1ZL9A 3KJYA 1SD8A 1B9YC 1X0RA 1K0BA 4NXIA 5G31A 1W4VA 1TOFA 2JACA 4IN0A 1QMVA 2H6ZA 1PA3A 2TRCP 4IGJA 2A2PA 3M0FA 3QAVA 1X5DA 2R37A 2WGRA 4GCIA 3A2VA 1SKSB 4OFMA 1YZXA 5CO3A 4LL4B 1V40A 2CX4A 2ZCTA 3ZMKA 1JZOA 1K0AA 4H86A 4KDXA 2A2RA 2R0CA 4D73B 3CSIA 2DC5A 1JLWA 4F9ZA 4I97A 1S3CA 1GUMA 2I81A 4Z7XA 4PGTA 3UJ1A 1FVJA 1OE8A 1WP0A 3MIXA 4L0WA 3LG6A 3ERGA 2G0FA 4KW6A 2JSYA 5CRGA 1CQGA 5CP1A 1XOBA 4F03A 4LMWA 2CZ2A 5EPFA 5HR3A 3FHKA 2YZUA 2GTUA 2HI7A 4YH2A 2AYTA 4LLRA 3LYKA 1LBKA 2MMOA 2LRCA 3LXTA 3IDVA 4GSSA 2OE3A 2R2JA 1Z7PA 1A24A 2X99A 5G1KA 1PL1A 2OA7A 5D9TA 2E2GA 2HSMA 3ERWA 4RI7A 1SYRA 3EC3A 3KP9A 3GX8A 4POKA 1RW1A 2OBIA 5CRDA 3TUEA 4FYCA 4Q5FA 1EV9A 4PQ1A 2H70A 1S3DA 4GRFA 3O76A 2PWJA 2IMKA 5J9BA 2LRTA 5F8BA 4CDOA 4KX4A 3EPTA 2PU9C 4HOJA 1CQHA 1BX9A 2LUSA 4FIWA 4K5RA 2B1KA 1R4WA 4I2UA 5G30A 3ZVJA 5IMCA 4AKHA 1YQ1A 4GDFA 3EWLA 4ZB8A 4ISDA 3A5IA 4F82A 1ON4A 4DVCA 3EURA 3G7IA 4K6XA 1T8EB 2FHEA 2FWHA 12GSA 1GNWA 1R5AA 1XFLA 3ED3A 4HZ2A 2K18A 1DBYA 1BEDA 1O81A 3EMPA 1T3BA 3MYDA 4TW5A 4Z2RA 1K0MA 3ZREA 2CX3A 4KB3A 4WBRD 3Q6OA 4IQAA 5B8AA 2REMA 1YVLA 3VWWA 1SKWB 3FYGA 3P2AA 4BWSA 3GTUA 3ME8A 1ZOFA 4K8MA 3GKXA 3L78A 1YEXA 5H5RA 3QR6A 3PPUA 4MNNA 5EL8A 2YJ7A 20GSA 3HJMA 1OE7A 6GSVA 1ILOA 3KD0A 4K7IA 3QOUA 2X49A 1DE1A 4WEYA 2LKUA 3WYWA 1EWXA 1MEKA 5C00A 3E3EA 2P0GA 1SJ6A 2A4HA 3FZ4A 4I8BA 2C3TA 5IO2A 2WS2A 4IQ1A 3GL5A 4XHMA 4ZB6A 2HSHA 3DGQA 4PQHA 4HEA2 4TR1A 4YQVA 2MYGA 3GKNA 1X9WB 3HHVA 3AY8A 3C8EA 5ELAA 4LMVA 4K7NA 2GQLA 2RM5A 2L59A 2H1GA 4PURA 1YF1A 3DD3A 4KAEA 1B4PA 5G2ZA 3E9JB 3Q19A 2LSTA 4KDYA 3A2WA 4F2IA 3DMLA 4ZB9A 1ACVA 9GSSA 2XBQA 4PTSA 2MMZA 5E4WA 5DAKB 2KP2A 4MMMA 4YAPA 4HZ4A 1WE0A 1MDIA 5H5QA 3TJKA 4GTUA 5J9CA 2AB6A 2P31A 3WGEA 4V1Ap 3FR6A 1ML6A 3ZMLA 4MH3A 2H1DA 1R5PA 2K8VA 4K2DA 3OR5A 2IWTA 5DAKA 3HVSA 4E68A 1GSDA 2PBJA 2FD3A 1URMA 2DMLA 2DKIA 3GIXA 3H4KA 1A8YA 18GSA 2C0DA 2GVPA 2C0GA 2BJXA 1TXXA 1YDKA 3HZ8A 4O32A 3F3QA 1PGTA 4KCEA 2B5XA 1B4QA 3O3TA 2C80A 2H74A 3KP8A 5BMUB 1A23A 2VLUA 1GRXA 2B5YA 4N0ZA 2HE3A 1N2AA 3HMJG 4MPGA 1GTIA 4HQSA 2JZRA 4MZWA 3ZIJA 4IP1A 3ME7A 2AJQB 4MA9A 1XW6A 2GZPA 3TDGA 3TOUA 1IYHA 2R4VA 4EE0A 2WZ9A 1T00A 2YP6A 3IA1A 1M9AA 4WR4A 3A5WA 1G6WA 5BMUA 3EU3A 4CW9A 3WT2A 2FWFA 4PNGA 4ECJA 4IVFA 2XC2A 1B48A 2V1MA 2GSTA 5D9WA 2VL9A 5COHA 4G0KA 2OACA 2QKEA 1EOGA 5DCGA 1VF4A 1U88A 2HLSA 1J08A 1S3AA 2R6KA 3HVVA 3NIVA 4N0VA 1M2BA 1XPVA 1SL1B 1MDJA 2I3YA 4USSA 4KA0A 4ZBAA 2EIQA 2KP1A 1PKWA 2H1LA 3FR3A 5J47A 3L9UA 2I4AA 3R2QA 3SWLA 4N3ZA 3L4NA 3D4TA 1EGOA 1JZDA 2L4CA 2JZSA 1O8XA 2M72A 1M2DA 1WPIA 3J7Yk 2BTOT 1JZWA 1U3IA 4PQIA 1AQWA 3CXGA 3GHAA 2ZUPA 2O8VB 2J9HA 1Z3EA 3H79A 4XCSA 2ON5A 2NPBA 4BL7A 1YEPA 5LCZA 2N5BA 2LQOA 1YJ6A 4WXTA 4KSOA 4MJBA 1U87A 3VI7A 3FZAA 1X5CA 3VPTA 5KOWA 4EDYA 13GSA 3DVWA 4XRAA 2HNLA 4HUAA 3HKRA 4NWYA 1OC9A 2B3SA 2WDUA 2VCVA 3CWGA 2QSIA 2AV4A 2IPAA 4OCFA 2F3MA 4GSTA 4HS1A 16GSA 3LXZA 2CAIA 6GSTA 2IN3A 2YN1A 3UOMA 2GS3A 3RPPA 1O8WA 2B7JA 1FO5A 2FCHA 1USBA 4MZBA 4NHZA 2LV3A 1YKCA 5F07A 2GGTA 1Z6MA 2R0PA 4TXOB 2ES7A 4AKIA 3Q18A 4IS0A 3HYPA 3QD9A 3IV4A 5IOWA 5CAXA 3NOFA 3IR4A 5HFKA 4V2LA 1NW2A 4MDCA 3L0HA 4DEJA 3UBLA 3RHBA 5J3RA 2KOKA 2H19A 4ML6A 1GWCA 3GYKA 5D73A 5A5HB 3GKKA 2CAQA 4KNDA 1T7PB 3U5RE 4O92A 3GURA 4I5QA 3BJ5A 4J56E 2XPDA 5HQPA 1BF5A 4BPYA 4NMUA 1ERWA 5ECMB 3UEMA 4N10A 2H1BA 4EF0A 3P7XA 5ELGA 1YKAA 2LEGA 1AW9A 4BVXB 3VI5A 4I6XA 5A5HA 4G0IA 2R0GA 1GSEA 4DSRA 3A2XA 3HDCA 1XWGA 2PPTA 3TRPA 2YWIA 3FK8A 1GP1A 3O6TA 4MJEA 3FY7A 5ECNB 4V2NA 1GULA 4X0XA 4MP4A 1GTUA 3RAZA 2HQTA 5FWGA 4BVXA 1TRUA 2C8UA 1GTBA 5J5NA 2AHEA 2VCQA 1PL2A 5ECRB 4PUAA 2VIMA 1TI1A 1T4YA 2H0GA 2H76A 4MJCA 2WFCA 1OYJA 2H71A 1SVLA 1O73A 1GTAA 1Z9HA 3RPNA 4PUFC 2LTKA 4XS4B 4HU7A 1ERUA 1HD2A 2OT3A 1AQVA 5D9VA 4HQZA 3L9SA 5IM9A 3DVXA 3HJPA 1W89A 4EKZA 5INYA 1XWAA 6GSYA 2O89A 3QAGA 4IBPA 2WJUA 3BOAA 5KN1A 4BWQA 3ZITA 4POBA 5IOXA 1HYUA 3EINA 2XHFA 3TKQA 3E0UA 5JCWA 1TTZA 1SK2A 3KH7A 2X64A 3ZIVA 1BG5A 4XIHA 3TJJA 4Q5RA 5AISA 4D73A 1VF1A 5IO0A 4AJ6A 3N5OA 4IJ3A 1K3OA 2MBTA 3H8QA 1H75A 3I9V2 3I43A 2HZFA 4MH2A 5DBQA 1G6YA 3GRXA 4RQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD4 A;  2X8G A;  1Y25 A;  1B8X A;  1ERV A;  1V9W A;  2HYX A;  5JWQ B;  3DKS A;  3QFB C;  1AIU A;  4TVE A;  3HVX A;  1MDK A;  4DSS B;  2TRX A;  3H93 A;  3PH9 A;  2IMD A;  3QMX A;  3CSJ A;  1SKR B;  2B7K A;  2GZZ A;  3W6G A;  4KF9 A;  2H1A A;  1O6J A;  3KIJ A;  3IAS 2;  3F0I A;  2LNT A;  3D6I A;  3S9F A;  4RI6 A;  4KH7 A;  1AXD A;  2CQ9 A;  4FQU A;  3CRU A;  2EIO A;  4WF4 A;  2DJJ A;  5E59 A;  1K3Y A;  2E7P A;  3MAK A;  2L6D A;  1LJR A;  3MSZ A;  4NAX A;  3MNG A;  1GNE A;  1F3A A;  3TRQ A;  1V57 A;  2F9S A;  4NV5 A;  3BBY A;  1XWB A;  3IAM 2;  4MF7 A;  4MK3 A;  3QFA C;  5GZZ B;  3GKM A;  3EVI A;  1QK8 A;  3F63 A;  3EU4 A;  4GXZ A;  2DSA A;  2PMT A;  4EVM A;  4HDE A;  2VD1 A;  1SL2 B;  2LS5 A;  1KNG A;  1UVZ A;  3IRA A;  4GLT A;  1M99 A;  3KMO A;  4IJI A;  2FWG A;  1G7O A;  1PX7 A;  4AJ8 A;  3SBC A;  2HSN B;  3D22 A;  2FGX A;  1A2L A;  1O7U A;  3P90 A;  2NBS A;  1K0O A;  4RUV A;  3MDK A;  5ECO B;  2YJH A;  3GNJ A;  3F4T A;  3GSS A;  1HNB A;  5CNW A;  1PKZ A;  1F3B A;  1NHY A;  2H72 A;  4KCA A;  4EUY A;  4EO3 A;  1Q98 A;  1JFU A;  2DLX A;  3ZFB A;  3IBH A;  1RQM A;  1E2Y A;  2FUG 2;  2MMA A;  3ZZX A;  3GMF A;  2CVD A;  3DWV A;  3U6V A;  4K0G A;  2OKA A;  3WT1 A;  1SK1 A;  4X1U A;  4XTS A;  2LJA A;  3ZRD A;  3KMN A;  2J23 A;  1Z7R A;  3GST A;  1SEN A;  2XBI A;  5IMV A;  3KCM A;  2HRK B;  5L71 A;  4IW9 A;  2QC7 A;  3ERF A;  4ZIJ A;  4E8H A;  3DRN A;  3RHC A;  1ZMA A;  1Z5Y E;  1PSQ A;  4OMV A;  1G7E A;  3TGZ A;  1ZCP A;  1AAZ A;  1XW5 A;  1TU8 A;  3FZ9 A;  4GQC A;  1T4Z A;  2IMF A;  3C1S A;  2HZE B;  2LRN A;  2HRK A;  2FY6 A;  4O7H A;  3C71 A;  3UAR A;  2LNS A;  1ZGN A;  3APS A;  3BCK A;  5DVB A;  1GL8 A;  4FYU A;  5IIZ A;  1GUK A;  1HQO A;  2DJ0 A;  1FG4 A;  1XW9 A;  2RM6 A;  1V2A A;  3PIN A;  1ST9 A;  2K8S A;  3KTL A;  1KEB A;  5FT3 A;  3GA4 A;  2KUC A;  2H8L A;  4HI7 A;  2GDR A;  1T1V A;  4P3Y B;  2L6C A;  2PUK C;  3APO A;  3ZYW A;  5AIX A;  2C0E A;  4XRD A;  4TR0 A;  3TKS A;  4WR5 A;  5CRH A;  6GSU A;  1TDI A;  4GQF A;  4RQX A;  4JZQ A;  3KEB A;  1GSF A;  4N30 A;  3VFI A;  2DJK A;  2CVK A;  5DAL B;  1FOV A;  22GS A;  1EOH A;  3ZLP A;  5B6N A;  5ECH B;  1QGV A;  2GQM A;  1VF2 A;  2V32 A;  1HNA A;  3UVH A;  4ZIL A;  1Z6N A;  4HJM A;  3WGD A;  2F8F A;  1WRY A;  5DAL A;  3TKP A;  1TJD A;  1OC3 A;  2IFQ B;  1A8L A;  5JWR B;  1XIY A;  2HRF A;  17GS A;  2GT5 A;  1PMT A;  2H6X A;  3EYT A;  2DIY A;  2YZH A;  1OC8 A;  2VL2 A;  1G0T A;  3IK7 A;  3PR8 A;  4AGS A;  5IMZ A;  3FW2 A;  5IPG A;  4OD7 A;  3I69 A;  4BA7 A;  1R7H A;  1MD3 A;  1WWJ A;  5JWO B;  3TJG A;  2YPM A;  1PRX A;  1F37 A;  1BQ7 A;  3UL3 A;  5IMF A;  10GS A;  1FW1 A;  1XZO A;  4TOP A;  2CT6 A;  1GUH A;  3GN3 A;  1AUC A;  1F9M A;  5JCG A;  5CYY A;  8GSS A;  1X9S B;  2EIR A;  2FNO A;  2IL3 A;  4MZC A;  5H5S A;  3D4M A;  3P8W A;  4E8E A;  2YAN A;  2YWN A;  2DJ3 A;  5D8I A;  2O85 A;  2VOC A;  4KDU A;  3CRT A;  2IIY A;  4POL A;  2YV9 A;  1PX6 A;  3NZN A;  4OO5 A;  1YF0 A;  2V41 A;  1K0D A;  3CTF A;  1NM3 A;  5J41 A;  3LGC A;  3HJO A;  3RBT A;  1A2M A;  5GAP D;  2Z9S A;  1TK0 B;  2R3X A;  4IKH A;  1ABA A;  4XS1 A;  1JZR A;  2GSS A;  2NVL A;  4EXJ A;  4L0U A;  2X8H A;  1FVK A;  1A0R P;  4OFN A;  4YAV A;  5DJL A;  4ZBD A;  3GH9 A;  2CV4 A;  3HZ4 A;  4TXO A;  4ZL7 A;  3ZVJ D;  1I9D A;  1TKD B;  2B6M A;  1EV4 A;  2JSZ A;  3LSZ A;  1XOA A;  1A0F A;  2KLX A;  4MF6 A;  4ML1 A;  2V6K A;  3TKS C;  3VUR A;  4ZL9 A;  4F0C A;  4MAB A;  3M3M A;  2N5F A;  1GLP A;  5KEJ A;  3DEX A;  1V58 A;  4MLY A;  5DDL A;  2TIR A;  2YOI A;  2VCZ A;  3L9V A;  3IPZ A;  3KH9 A;  3F6D A;  5HR1 A;  2E2M A;  1U3A A;  3N9J A;  5ECP B;  5A4W A;  4V2M A;  4G0L A;  4YQU A;  1Y6E A;  4ECC A;  3TKS E;  5DCH A;  4TN8 A;  4K1F A;  1WJK A;  2MBS A;  3QCP A;  4G2E A;  4PX1 A;  1VGL A;  3DIE A;  3IE3 A;  3M1G A;  3KZQ A;  1K0C A;  4EL1 A;  3KXO A;  2QGV A;  1TK8 B;  3ISO A;  2YWM A;  1EEJ A;  1VF3 A;  5F0G A;  2VL2 C;  2HSY A;  5J4U A;  1PN9 A;  3K8N A;  1XXU A;  3I6A A;  5EVO A;  4CHS A;  3W8S A;  2HXK A;  5ECL B;  4ACS A;  3F3R A;  2FA8 A;  3IK9 A;  4K0N A;  3FR9 A;  4F0B A;  1SU9 A;  4XS4 A;  3HA9 A;  2NDO A;  5A5K A;  5ECK B;  1JHB A;  3FKF A;  2L5L A;  1X9M B;  2P5R A;  1K3L A;  2VO4 A;  1BJX A;  5CRE A;  3UIW A;  3HXS A;  3TRX A;  4WF5 A;  1FB0 A;  2VAF A;  5ABR A;  1OVN A;  3TKR A;  1X5E A;  1WMJ A;  1GSS A;  5A4U A;  5G5F A;  1AC1 A;  1NHO A;  1WIK A;  1TU7 A;  2HSM B;  4G10 A;  1HNC A;  2VUP A;  1U6T A;  4JBB A;  2RUF A;  2AAW A;  3HCZ A;  1ZYE A;  2VCW A;  2C1Y A;  3UBK A;  5KN0 A;  4MF5 A;  2PGT A;  2UZ8 A;  4GWR A;  3VK9 A;  2WCI A;  3M9K A;  3GV1 A;  2IMI A;  4FYB A;  2R5G A;  3GX0 A;  3F8U A;  3F6F A;  1M2A A;  2O87 A;  5GST A;  5KN3 A;  2ZNM A;  3JCM L;  4ECB A;  2L57 A;  2PN8 A;  1NSW A;  5HFG A;  3D0Z A;  2JAD A;  3WGX A;  5IMD A;  2OE1 A;  5AN1 A;  4JR4 A;  1WOU A;  4EC0 A;  3QAW A;  2PVQ A;  4DSS A;  2OJL A;  3WD6 A;  2VCT A;  5HFI A;  3LJR A;  3UMA A;  1VRS D;  4I2T A;  3TB2 A;  1XBS A;  2DJ2 A;  3G7J A;  1EGR A;  4N11 A;  4WET A;  1LU4 A;  1GLQ A;  2G2Q A;  5GAN D;  4J2F A;  3GTU B;  3IHQ A;  1TP9 A;  3LEF A;  3HD5 A;  2FLS A;  5A4V A;  1AQX A;  3TOT A;  3PGT A;  2BMX A;  4G9H A;  5D93 A;  2HRN A;  2OE0 A;  4L8E A;  2MMN A;  5DJM A;  2F8A A;  1F2E A;  2ON7 A;  2LQQ A;  2D2Z A;  1MTC A;  1BYE A;  3VWU A;  1M9B A;  1V98 A;  1UC7 A;  3IC4 A;  4TXV A;  1XVQ A;  3QPM A;  4AF2 A;  2JL4 A;  1H4O A;  5JCU A;  1FAA A;  2A4V A;  5LNK e;  2FWE A;  4ZXG A;  1DUG A;  1QQ2 A;  4TR1 B;  3DYR A;  4K7O A;  2VL3 A;  19GS A;  2LJK A;  2H0I A;  2A2S A;  4LL1 B;  3M8N A;  3F4S A;  5IMA A;  1UA5 A;  1M7T A;  2K9F A;  5FHI A;  4MJA A;  2PER A;  3FZ5 A;  4L5L A;  4NPB A;  4PXO A;  4ZBB A;  3APQ A;  1FB6 A;  3F4R A;  3GFK A;  3VPQ A;  5DQS A;  3CMI A;  2L4Q A;  2VM2 A;  3J7Y b;  3C73 A;  1TRS A;  2H73 A;  5G5E A;  4V1A g;  4NV2 A;  4ZL8 A;  4AJ7 A;  4GSN A;  1R26 A;  2H0H A;  1ZYQ B;  2CVB A;  4YQM A;  3MWH A;  2VLV A;  4OO4 A;  3CTG A;  3BCI A;  1OAZ A;  3BD2 A;  3ZFL A;  5AGY A;  1EEM A;  3M9J A;  1SL0 B;  2DBC A;  3DXB A;  3UVT A;  2V2G A;  2VD0 A;  3CBU A;  1OKD A;  1KBN A;  4OWY A;  2C0F A;  2CZ3 A;  2DJ1 A;  2RUE A;  2YV7 A;  4FH8 A;  6GSX A;  4HU9 A;  1O85 A;  2FA4 A;  2GQK A;  3HY2 A;  1J9B A;  1OKT A;  2F51 A;  2XPE A;  6GSW A;  4TR4 A;  2JU5 A;  1FHE A;  2DMM A;  2VLT A;  4IP6 A;  5IPH A;  1DE2 A;  2HT9 A;  1XWC A;  3VWX A;  2PVO C;  2OBK A;  7GSS A;  2H6Y A;  3ZTL A;  3TJF A;  4JR6 A;  1SYX A;  1DSB A;  2HZE A;  1EZK A;  3LFL A;  1THO A;  3GUS A;  2NTO A;  2WUL A;  1SD9 A;  2ALB A;  1IYI A;  2I1U A;  3US3 A;  3LOR A;  1EP8 A;  3VWV A;  1TRW A;  2M80 A;  2GZY A;  2L5O A;  1B9X C;  2IME A;  4KE3 A;  2YWO A;  2V6O A;  2RLI A;  1SK0 A;  4JED A;  5HR0 A;  3CYN A;  2GSR A;  1J0F A;  5GSS A;  1XCC A;  5IQY A;  4OCE A;  4QQ7 A;  2YCD A;  4XS6 A;  2H75 A;  1PQN A;  3H1N A;  4JU5 A;  2H01 A;  2LJR A;  4KSM A;  3EMX A;  4POM A;  1SJZ A;  4TRX A;  3D5J A;  3D21 A;  1A2J A;  4BVY B;  3LYP A;  3EE2 A;  4X43 A;  2H66 A;  2HRA A;  4MPF A;  2WB9 A;  4ID0 A;  2O7K A;  5D9X A;  1GSQ A;  14GS A;  3GL3 A;  3A3T A;  3VLN A;  5ECI B;  2B1L A;  4ECI A;  2MZC A;  3LQ7 A;  5F06 A;  3F9U A;  3LWA A;  4KGI A;  4EDZ A;  4K9Z A;  5LD0 A;  1QFN A;  1ZZY A;  4BVY A;  1GH2 A;  4BL7 B;  1PD2 1;  2OAD A;  2IFQ A;  5ENU A;  1QXH A;  1XVW A;  2H30 A;  6GSS A;  1JLV A;  2GLR A;  1THX A;  2VCX A;  3Q74 A;  4GF0 A;  3ZL5 A;  1TI3 A;  4QL7 A;  1SJI A;  3FRC A;  1UN2 A;  1N8J A;  1F6M C;  2AUV A;  3G7Y A;  1OC9 B;  4JRR A;  3CSH A;  3IXR A;  1KTE A;  2VM1 A;  4DSQ A;  2EC4 A;  3W8J A;  4TR3 A;  2C4J A;  2GT6 A;  1XWK A;  5B7C A;  1TRV A;  2CA8 A;  2JZT A;  5F05 A;  3R3E A;  1E6B A;  5EY6 A;  4MCU A;  1M0U A;  2DIZ A;  2K6V A;  4ILF A;  3RDW A;  2E0Q A;  2N5A A;  5ECQ B;  2HFD A;  5CRW A;  4OFT A;  4IHU A;  1TK5 B;  5ECS A;  4LA1 A;  1GSU A;  4JE1 A;  1GSY A;  5B8B A;  1TW9 A;  5HR2 A;  4WBJ A;  5D96 A;  1C72 A;  2IJY A;  1Q4J A;  3C7M A;  2WRT A;  4O5R A;  1RK4 A;  4FO5 A;  2P5Q A;  5ID2 B;  3TJB A;  11GS A;  3IOS A;  3UAP A;  1I5G A;  2M46 A;  4IEL A;  2RII A;  4ULX A;  2YNX A;  1ERT A;  3GH6 A;  3FEU A;  3QDN A;  4Q5N A;  3KTB A;  4L5O A;  2B5E A;  1QUW A;  5ID2 A;  3IC8 A;  4J57 E;  2X8C A;  4NHW A;  4G19 A;  3KM6 A;  5G1L A;  2KHP A;  4TKY A;  4KUN A;  3KGK A;  4HJ2 A;  5C04 A;  5KN2 A;  3TCO A;  2C3Q A;  3V1W A;  1EP7 A;  3G9B A;  1BAY A;  3C1R A;  4WKW A;  2I9H A;  2C3N A;  2GSQ A;  5DQY A;  4PNF A;  4Q5Q A;  1K0N A;  1YY7 A;  5AIV A;  5B6M A;  4QL9 A;  1ZL9 A;  3KJY A;  1SD8 A;  1B9Y C;  1X0R A;  1K0B A;  4NXI A;  5G31 A;  1W4V A;  1TOF A;  2JAC A;  4IN0 A;  1QMV A;  2H6Z A;  1PA3 A;  2TRC P;  4IGJ A;  3M0F A;  3QAV A;  1X5D A;  2R37 A;  2WGR A;  4GCI A;  3A2V A;  1SKS B;  4OFM A;  1YZX A;  5CO3 A;  4LL4 B;  1V40 A;  2CX4 A;  2ZCT A;  3ZMK A;  1JZO A;  1K0A A;  4H86 A;  4KDX A;  2A2R A;  4D73 B;  3CSI A;  2DC5 A;  1JLW A;  4F9Z A;  4I97 A;  1S3C A;  1GUM A;  2I81 A;  4Z7X A;  4PGT A;  3UJ1 A;  1FVJ A;  1OE8 A;  1WP0 A;  4L0W A;  3LG6 A;  3ERG A;  2G0F A;  4KW6 A;  2JSY A;  5CRG A;  1CQG A;  5CP1 A;  1XOB A;  4F03 A;  4LMW A;  2CZ2 A;  5EPF A;  5HR3 A;  3FHK A;  2YZU A;  2GTU A;  2HI7 A;  4YH2 A;  2AYT A;  4LLR A;  3LYK A;  1LBK A;  2MMO A;  2LRC A;  3LXT A;  3IDV A;  4GSS A;  2OE3 A;  2R2J A;  1Z7P A;  1A24 A;  2X99 A;  5G1K A;  1PL1 A;  2OA7 A;  5D9T A;  2E2G A;  2HSM A;  3ERW A;  4RI7 A;  1SYR A;  3EC3 A;  3KP9 A;  3GX8 A;  4POK A;  1RW1 A;  2OBI A;  5CRD A;  3TUE A;  4FYC A;  4Q5F A;  1EV9 A;  4PQ1 A;  2H70 A;  1S3D A;  4GRF A;  3O76 A;  2PWJ A;  2IMK A;  5J9B A;  2LRT A;  5F8B A;  4CDO A;  4KX4 A;  2PU9 C;  4HOJ A;  1CQH A;  1BX9 A;  2LUS A;  4FIW A;  2B1K A;  1R4W A;  4I2U A;  5G30 A;  3ZVJ A;  5IMC A;  1YQ1 A;  3EWL A;  4ZB8 A;  4ISD A;  4F82 A;  1ON4 A;  4DVC A;  3EUR A;  3G7I A;  4K6X A;  1T8E B;  2FHE A;  2FWH A;  12GS A;  1GNW A;  1R5A A;  1XFL A;  3ED3 A;  4HZ2 A;  2K18 A;  1DBY A;  1BED A;  1O81 A;  3EMP A;  1T3B A;  4TW5 A;  1K0M A;  3ZRE A;  2CX3 A;  4KB3 A;  4WBR D;  3Q6O A;  4IQA A;  5B8A A;  2REM A;  3VWW A;  1SKW B;  3FYG A;  3P2A A;  4BWS A;  3GTU A;  3ME8 A;  1ZOF A;  4K8M A;  3GKX A;  3L78 A;  1YEX A;  5H5R A;  3QR6 A;  3PPU A;  5EL8 A;  2YJ7 A;  20GS A;  3HJM A;  1OE7 A;  6GSV A;  1ILO A;  3KD0 A;  4K7I A;  3QOU A;  1DE1 A;  4WEY A;  2LKU A;  3WYW A;  1EWX A;  1MEK A;  5C00 A;  3E3E A;  2P0G A;  1SJ6 A;  3FZ4 A;  4I8B A;  2C3T A;  5IO2 A;  2WS2 A;  4IQ1 A;  3GL5 A;  4XHM A;  4ZB6 A;  2HSH A;  3DGQ A;  4PQH A;  4HEA 2;  4TR1 A;  4YQV A;  2MYG A;  3GKN A;  1X9W B;  3HHV A;  3AY8 A;  3C8E A;  5ELA A;  4LMV A;  4K7N A;  2GQL A;  2RM5 A;  2L59 A;  2H1G A;  4PUR A;  1YF1 A;  3DD3 A;  4KAE A;  1B4P A;  5G2Z A;  3E9J B;  3Q19 A;  2LST A;  4KDY A;  3A2W A;  4F2I A;  3DML A;  4ZB9 A;  1ACV A;  9GSS A;  2XBQ A;  4PTS A;  2MMZ A;  5E4W A;  5DAK B;  2KP2 A;  4MMM A;  4YAP A;  4HZ4 A;  1WE0 A;  1MDI A;  5H5Q A;  3TJK A;  4GTU A;  5J9C A;  2AB6 A;  2P31 A;  3WGE A;  4V1A p;  3FR6 A;  1ML6 A;  3ZML A;  4MH3 A;  2H1D A;  1R5P A;  2K8V A;  4K2D A;  3OR5 A;  2IWT A;  5DAK A;  3HVS A;  1GSD A;  2PBJ A;  2FD3 A;  1URM A;  2DML A;  3GIX A;  3H4K A;  1A8Y A;  18GS A;  2C0D A;  2GVP A;  2C0G A;  2BJX A;  1TXX A;  1YDK A;  3HZ8 A;  4O32 A;  3F3Q A;  1PGT A;  4KCE A;  2B5X A;  1B4Q A;  3O3T A;  2C80 A;  2H74 A;  3KP8 A;  1A23 A;  2VLU A;  1GRX A;  2B5Y A;  4N0Z A;  2HE3 A;  1N2A A;  4MPG A;  1GTI A;  4HQS A;  2JZR A;  4MZW A;  3ZIJ A;  4IP1 A;  3ME7 A;  2AJQ B;  4MA9 A;  1XW6 A;  2GZP A;  3TDG A;  3TOU A;  1IYH A;  2R4V A;  4EE0 A;  2WZ9 A;  1T00 A;  2YP6 A;  3IA1 A;  1M9A A;  4WR4 A;  3A5W A;  1G6W A;  5BMU A;  3EU3 A;  4CW9 A;  3WT2 A;  2FWF A;  4PNG A;  4ECJ A;  4IVF A;  2XC2 A;  1B48 A;  2V1M A;  2GST A;  5D9W A;  2VL9 A;  5COH A;  4G0K A;  2OAC A;  2QKE A;  1EOG A;  5DCG A;  1VF4 A;  1U88 A;  2HLS A;  1J08 A;  1S3A A;  2R6K A;  3HVV A;  3NIV A;  4N0V A;  1M2B A;  1XPV A;  1SL1 B;  1MDJ A;  2I3Y A;  4USS A;  4KA0 A;  4ZBA A;  2EIQ A;  2KP1 A;  1PKW A;  3FR3 A;  3L9U A;  2I4A A;  3R2Q A;  3SWL A;  3L4N A;  3D4T A;  1EGO A;  1JZD A;  2L4C A;  2JZS A;  1O8X A;  2M72 A;  1M2D A;  1WPI A;  3J7Y k;  2BTO T;  1JZW A;  1U3I A;  4PQI A;  1AQW A;  3CXG A;  3GHA A;  2ZUP A;  2O8V B;  2J9H A;  1Z3E A;  3H79 A;  4XCS A;  2ON5 A;  2NPB A;  4BL7 A;  1YEP A;  5LCZ A;  2N5B A;  2LQO A;  1YJ6 A;  4WXT A;  4KSO A;  4MJB A;  1U87 A;  3VI7 A;  3FZA A;  1X5C A;  3VPT A;  4EDY A;  13GS A;  3DVW A;  4XRA A;  2HNL A;  4HUA A;  3HKR A;  4NWY A;  1OC9 A;  2B3S A;  2WDU A;  2VCV A;  2QSI A;  2AV4 A;  2IPA A;  4OCF A;  2F3M A;  4GST A;  4HS1 A;  16GS A;  3LXZ A;  2CAI A;  6GST A;  2IN3 A;  2YN1 A;  3UOM A;  2GS3 A;  3RPP A;  1O8W A;  2B7J A;  1FO5 A;  2FCH A;  1USB A;  4MZB A;  4NHZ A;  2LV3 A;  1YKC A;  5F07 A;  2GGT A;  1Z6M A;  4TXO B;  2ES7 A;  3Q18 A;  4IS0 A;  3HYP A;  3QD9 A;  3IV4 A;  5IOW A;  5CAX A;  3NOF A;  3IR4 A;  5HFK A;  4V2L A;  1NW2 A;  4MDC A;  3L0H A;  4DEJ A;  3UBL A;  3RHB A;  5J3R A;  2KOK A;  2H19 A;  4ML6 A;  1GWC A;  3GYK A;  5D73 A;  3GKK A;  2CAQ A;  4KND A;  1T7P B;  3U5R E;  4O92 A;  3GUR A;  4I5Q A;  3BJ5 A;  4J56 E;  2XPD A;  5HQP A;  4BPY A;  4NMU A;  1ERW A;  5ECM B;  3UEM A;  4N10 A;  2H1B A;  4EF0 A;  3P7X A;  5ELG A;  1YKA A;  2LEG A;  1AW9 A;  4BVX B;  3VI5 A;  4I6X A;  4G0I A;  1GSE A;  4DSR A;  3A2X A;  3HDC A;  1XWG A;  2PPT A;  3TRP A;  2YWI A;  3FK8 A;  1GP1 A;  3O6T A;  4MJE A;  3FY7 A;  5ECN B;  4V2N A;  1GUL A;  4X0X A;  4MP4 A;  1GTU A;  3RAZ A;  2HQT A;  5FWG A;  4BVX A;  1TRU A;  2C8U A;  1GTB A;  5J5N A;  2AHE A;  2VCQ A;  1PL2 A;  5ECR B;  4PUA A;  2VIM A;  1TI1 A;  1T4Y A;  2H0G A;  2H76 A;  4MJC A;  2WFC A;  1OYJ A;  2H71 A;  1O73 A;  1GTA A;  1Z9H A;  3RPN A;  4PUF C;  2LTK A;  4XS4 B;  4HU7 A;  1ERU A;  1HD2 A;  1AQV A;  5D9V A;  4HQZ A;  3L9S A;  5IM9 A;  3DVX A;  3HJP A;  1W89 A;  4EKZ A;  5INY A;  1XWA A;  6GSY A;  2O89 A;  3QAG A;  4IBP A;  2WJU A;  3BOA A;  5KN1 A;  4BWQ A;  3ZIT A;  4POB A;  5IOX A;  1HYU A;  3EIN A;  2XHF A;  3TKQ A;  3E0U A;  5JCW A;  1TTZ A;  1SK2 A;  3KH7 A;  2X64 A;  3ZIV A;  1BG5 A;  4XIH A;  3TJJ A;  4Q5R A;  5AIS A;  4D73 A;  1VF1 A;  5IO0 A;  4AJ6 A;  3N5O A;  4IJ3 A;  1K3O A;  2MBT A;  3H8Q A;  1H75 A;  3I9V 2;  3I43 A;  2HZF A;  4MH2 A;  5DBQ A;  1G6Y A;  3GRX A;  4RQR A; 
#chains in the Genus database with same CATH topology
 1MD4 A;  2X8G A;  1Y25 A;  1B8X A;  1ERV A;  1V9W A;  2HYX A;  5JWQ B;  3DKS A;  3QFB C;  1AIU A;  4TVE A;  3HVX A;  1MDK A;  4DSS B;  2TRX A;  3H93 A;  3PH9 A;  2IMD A;  3QMX A;  3CSJ A;  4K2X A;  1SKR B;  2B7K A;  2GZZ A;  3W6G A;  4KF9 A;  2H1A A;  1O6J A;  3KIJ A;  3IAS 2;  3F0I A;  2LNT A;  3D6I A;  3S9F A;  4RI6 A;  4KH7 A;  1AXD A;  2CQ9 A;  4FQU A;  3CRU A;  2EIO A;  2EFC A;  4WF4 A;  2DJJ A;  5E59 A;  1K3Y A;  4ZB7 A;  2E7P A;  4EIQ A;  3MAK A;  2L6D A;  1LJR A;  3MSZ A;  4NAX A;  3MNG A;  1GNE A;  4PI0 C;  1F3A A;  3TRQ A;  1V57 A;  2F9S A;  4NV5 A;  3BBY A;  1XWB A;  3IAM 2;  4MF7 A;  4MK3 A;  5KOX A;  3QFA C;  5GZZ B;  2WVX B;  3GKM A;  3EVI A;  1QK8 A;  3F63 A;  3EU4 A;  4GXZ A;  2DSA A;  2PMT A;  4K5S A;  4EVM A;  4HDE A;  2VD1 A;  1SL2 B;  2LS5 A;  1SVM A;  1KNG A;  1UVZ A;  3IRA A;  4GLT A;  1M99 A;  3KMO A;  4IJI A;  2FWG A;  1G7O A;  1PX7 A;  4AJ8 A;  3SBC A;  2HSN B;  3D22 A;  2FGX A;  1A2L A;  1O7U A;  3P90 A;  2NBS A;  4CY6 A;  1K0O A;  4RUV A;  3MDK A;  5ECO B;  2YJH A;  3GNJ A;  3F4T A;  3GSS A;  1HNB A;  5CNW A;  1PKZ A;  1F3B A;  1NHY A;  2H72 A;  4KCA A;  4EUY A;  4EO3 A;  1Q98 A;  1JFU A;  4O5Q A;  2DLX A;  3ZFB A;  3IBH A;  1RQM A;  1E2Y A;  2FUG 2;  2MMA A;  3ZZX A;  3GMF A;  2CVD A;  3DWV A;  3U6V A;  4K0G A;  2OKA A;  3WT1 A;  1SK1 A;  4X1U A;  4XTS A;  2LJA A;  3ZRD A;  3KMN A;  2J23 A;  1Z7R A;  4FXY P;  3GST A;  1SEN A;  2XBI A;  5IMV A;  3KCM A;  2HRK B;  5L71 A;  4IW9 A;  2QC7 A;  3ERF A;  4ZIJ A;  4E8H A;  3DRN A;  3RHC A;  1ZMA A;  1Z5Y E;  1PSQ A;  2QA2 A;  4OMV A;  1G7E A;  3TGZ A;  1ZCP A;  5J4Y A;  1AAZ A;  1XW5 A;  1TU8 A;  3FZ9 A;  4GQC A;  1T4Z A;  2IMF A;  3C1S A;  2HZE B;  2LRN A;  2HRK A;  2FY6 A;  4O7H A;  3C71 A;  3UAR A;  2LNS A;  1ZGN A;  3APS A;  3BCK A;  5DVB A;  1GL8 A;  4FYU A;  5IIZ A;  1GUK A;  1HQO A;  2DJ0 A;  1FG4 A;  1XW9 A;  2RM6 A;  1V2A A;  3PIN A;  1ST9 A;  2K8S A;  3KTL A;  1KEB A;  5FT3 A;  3GA4 A;  2KUC A;  2H8L A;  4HI7 A;  2GDR A;  1T1V A;  4P3Y B;  2L6C A;  2PUK C;  3APO A;  3ZYW A;  5AIX A;  2C0E A;  4XRD A;  4TR0 A;  3TKS A;  2DKH A;  4WR5 A;  5CRH A;  4AKG A;  3CQF A;  6GSU A;  1TDI A;  4GQF A;  4RQX A;  4JZQ A;  3KEB A;  1GSF A;  4N30 A;  3VFI A;  3HVN A;  2DJK A;  2CVK A;  5DAL B;  1FOV A;  4YKF A;  22GS A;  1EOH A;  1ZYN A;  3ZLP A;  5B6N A;  5ECH B;  1QGV A;  2GQM A;  1VF2 A;  2V32 A;  1HNA A;  3UVH A;  4ZIL A;  1Z6N A;  4HJM A;  3RGB C;  3WGD A;  2F8F A;  1WRY A;  5DAL A;  3TKP A;  1TJD A;  2IFQ B;  1OC3 A;  1A8L A;  5JWR B;  1XIY A;  1PN0 A;  2HRF A;  17GS A;  2GT5 A;  1PMT A;  2H6X A;  3EYT A;  2DIY A;  2YZH A;  1OC8 A;  2VL2 A;  1G0T A;  5A34 B;  3IK7 A;  3PR8 A;  4AGS A;  5IMZ A;  3FW2 A;  5IPG A;  4OD7 A;  3I69 A;  4BA7 A;  1R7H A;  1MD3 A;  1WWJ A;  5JWO B;  3TJG A;  2YPM A;  1PRX A;  2UV8 G;  1F37 A;  1BQ7 A;  3UL3 A;  5IMF A;  10GS A;  1FW1 A;  1XZO A;  4TOP A;  5BRT A;  1M3I A;  2CT6 A;  1GUH A;  5A34 A;  3GN3 A;  1AUC A;  4YKG A;  1F9M A;  5JCG A;  5CYY A;  8GSS A;  1X9S B;  2EIR A;  2FNO A;  2IL3 A;  4MZC A;  5H5S A;  3D4M A;  3P8W A;  4E8E A;  2YAN A;  2YWN A;  2DJ3 A;  5D8I A;  2O85 A;  5A1N B;  2VOC A;  4KDU A;  3CRT A;  2IIY A;  4POL A;  1FOH A;  2YV9 A;  1PX6 A;  3NZN A;  4OO5 A;  1YF0 A;  2V41 A;  1K0D A;  3CTF A;  1NM3 A;  5J41 A;  3LGC A;  3HJO A;  3RBT A;  1A2M A;  5GAP D;  2Z9S A;  2WW3 A;  1TK0 B;  2R3X A;  4IKH A;  1ABA A;  4XS1 A;  1JZR A;  2GSS A;  2NVL A;  4EXJ A;  4L0U A;  2X8H A;  1FVK A;  1A0R P;  4OFN A;  4YAV A;  5DJL A;  4ZBD A;  3GH9 A;  2CV4 A;  3HZ4 A;  4TXO A;  4ZL7 A;  3ZVJ D;  1I9D A;  1TKD B;  2B6M A;  1EV4 A;  2JSZ A;  3LSZ A;  1XOA A;  1A0F A;  2KLX A;  4MF6 A;  4ML1 A;  2V6K A;  3TKS C;  3VUR A;  4ZL9 A;  4F0C A;  4MAB A;  3M3M A;  2N5F A;  1GLP A;  5KEJ A;  3DEX A;  1V58 A;  5J40 A;  4MLY A;  5DDL A;  2TIR A;  2YOI A;  2VCZ A;  3L9V A;  2O5V A;  3IPZ A;  3KH9 A;  3F6D A;  5HR1 A;  2E2M A;  1U3A A;  3N9J A;  5ECP B;  5A4W A;  4V2M A;  4G0L A;  4YQU A;  1Y6E A;  4ECC A;  3TKS E;  5DCH A;  4TN8 A;  4K1F A;  1WJK A;  2MBS A;  3QCP A;  4G2E A;  4PX1 A;  1VGL A;  3DIE A;  3IE3 A;  3M1G A;  3KZQ A;  1K0C A;  4EL1 A;  3KXO A;  2QGV A;  3TU3 B;  4Z2T A;  1TK8 B;  3ISO A;  2YWM A;  1EEJ A;  1VF3 A;  5F0G A;  3CHX C;  2VL2 C;  2HSY A;  5J4U A;  1PN9 A;  3K8N A;  1XXU A;  3I6A A;  5EVO A;  4CHS A;  3W8S A;  2HXK A;  5ECL B;  4ACS A;  3F3R A;  2FA8 A;  3IK9 A;  4K0N A;  3FR9 A;  4F0B A;  1SU9 A;  4XS4 A;  3HA9 A;  2NDO A;  5A5K A;  5ECK B;  1JHB A;  3FKF A;  2L5L A;  1X9M B;  2P5R A;  1K3L A;  2VO4 A;  1BJX A;  5CRE A;  3UIW A;  3HXS A;  3TRX A;  4WF5 A;  1FB0 A;  2VAF A;  5ABR A;  1OVN A;  3TKR A;  1X5E A;  1WMJ A;  1GSS A;  5A4U A;  5G5F A;  1AC1 A;  1NHO A;  1WIK A;  1TU7 A;  2HSM B;  4G10 A;  1HNC A;  2VUP A;  1U6T A;  4JBB A;  2RUF A;  2AAW A;  3HCZ A;  1ZYE A;  2VCW A;  4AI6 A;  2C1Y A;  3UBK A;  5KN0 A;  4MF5 A;  2PGT A;  2UZ8 A;  4GWR A;  3VK9 A;  2WCI A;  3M9K A;  3GV1 A;  2IMI A;  4FYB A;  2R5G A;  3GX0 A;  3F8U A;  3F6F A;  1M2A A;  1ZYP A;  2O87 A;  5GST A;  5KN3 A;  2ZNM A;  3JCM L;  4ECB A;  1SVO A;  2L57 A;  2PN8 A;  1NSW A;  5HFG A;  3D0Z A;  2JAD A;  3WGX A;  5IMD A;  2OE1 A;  5AN1 A;  4JR4 A;  1WOU A;  4EC0 A;  3QAW A;  2PVQ A;  4DSS A;  2OJL A;  4W66 A;  3WD6 A;  2VCT A;  5HFI A;  3LJR A;  3UMA A;  1VRS D;  4I2T A;  3TB2 A;  4G01 A;  1XBS A;  2DJ2 A;  3G7J A;  1EGR A;  4N11 A;  4WET A;  1LU4 A;  1GLQ A;  2G2Q A;  5GAN D;  4J2F A;  3GTU B;  3IHQ A;  1TP9 A;  3LEF A;  3HD5 A;  2FLS A;  5A4V A;  1AQX A;  3TOT A;  3PGT A;  2BMX A;  4G9H A;  5D93 A;  2HRN A;  2OE0 A;  4L8E A;  2MMN A;  5DJM A;  2F8A A;  1F2E A;  2ON7 A;  2LQQ A;  2D2Z A;  1MTC A;  1BYE A;  3VWU A;  1M9B A;  1V98 A;  1UC7 A;  3IC4 A;  2WVX A;  4O5U A;  2WZS A;  4TXV A;  1XVQ A;  3QPM A;  4AF2 A;  2JL4 A;  1H4O A;  5JCU A;  5J4V A;  1FAA A;  2A4V A;  5LNK e;  2FWE A;  4ZXG A;  1DUG A;  1QQ2 A;  4TR1 B;  3DYR A;  4K7O A;  4A5P A;  2VL3 A;  19GS A;  2LJK A;  2H0I A;  2A2S A;  4LL1 B;  3M8N A;  3F4S A;  5IMA A;  1UA5 A;  1M7T A;  2K9F A;  5FHI A;  4MJA A;  2PER A;  3FZ5 A;  4L5L A;  4NPB A;  4PXO A;  4ZBB A;  3APQ A;  1FB6 A;  4X4J A;  2HSN A;  3F4R A;  3GFK A;  3VPQ A;  5DQS A;  3CMI A;  2L4Q A;  2VM2 A;  3J7Y b;  3C73 A;  1TRS A;  2H73 A;  5G5E A;  4V1A g;  4NV2 A;  2EFD A;  4ZL8 A;  4AJ7 A;  4GSN A;  1YEW C;  1R26 A;  2H0H A;  1ZYQ B;  2CVB A;  4YQM A;  3MWH A;  2VLV A;  4OO4 A;  3CTG A;  3BCI A;  1OAZ A;  3BD2 A;  3ZFL A;  5AGY A;  1EEM A;  1N25 A;  3M9J A;  1SL0 B;  2DBC A;  3DXB A;  3UVT A;  2V2G A;  2VD0 A;  3CBU A;  1OKD A;  1KBN A;  4OWY A;  2C0F A;  1S3R A;  2CZ3 A;  2DJ1 A;  2RUE A;  1TXU A;  2YV7 A;  4FH8 A;  6GSX A;  1XG8 A;  4HU9 A;  1O85 A;  2FA4 A;  2GQK A;  3HY2 A;  1J9B A;  1OKT A;  2F51 A;  2XPE A;  6GSW A;  4TR4 A;  2JU5 A;  1FHE A;  2DMM A;  2VLT A;  4IP6 A;  5IPH A;  1DE2 A;  2VKZ G;  2HT9 A;  1XWC A;  3VWX A;  2PVO C;  2OBK A;  7GSS A;  3LW9 A;  2H6Y A;  3ZTL A;  3TJF A;  4JR6 A;  1SYX A;  1DSB A;  2HZE A;  1EZK A;  3LFL A;  1THO A;  3GUS A;  2NTO A;  2WUL A;  1SD9 A;  2ALB A;  1IYI A;  1S4B P;  2I1U A;  3US3 A;  3LOR A;  1EP8 A;  4CY8 A;  3VWV A;  1TRW A;  2M80 A;  2GZY A;  2L5O A;  1B9X C;  2IME A;  4KE3 A;  2YWO A;  2V6O A;  2RLI A;  1SK0 A;  4JED A;  5HR0 A;  3CYN A;  2GSR A;  1J0F A;  5GSS A;  1XCC A;  5IQY A;  4OCE A;  4QQ7 A;  2YCD A;  4XS6 A;  2H75 A;  1PQN A;  3H1N A;  4JU5 A;  4ICY A;  2H01 A;  2LJR A;  4KSM A;  3EMX A;  4POM A;  1SJZ A;  4TRX A;  3D5J A;  3D21 A;  1A2J A;  4BVY B;  3LYP A;  3EE2 A;  4X43 A;  2H66 A;  2HRA A;  4MPF A;  2WB9 A;  4AKX B;  4ID0 A;  2O7K A;  5D9X A;  1GSQ A;  14GS A;  3GL3 A;  3A3T A;  3VLN A;  5ECI B;  2B1L A;  4ECI A;  2MZC A;  3LQ7 A;  5F06 A;  3F9U A;  3LWA A;  4KGI A;  4EDZ A;  4K9Z A;  5LD0 A;  1QFN A;  1ZZY A;  4BVY A;  1GH2 A;  4BL7 B;  1PD2 1;  2OAD A;  2IFQ A;  5ENU A;  1QXH A;  4HSC X;  1XVW A;  2H30 A;  6GSS A;  1JLV A;  2GLR A;  1THX A;  2WW2 A;  2VCX A;  3Q74 A;  2X4A A;  4GF0 A;  3ZL5 A;  1TI3 A;  4QL7 A;  1SJI A;  3FRC A;  1UN2 A;  1N8J A;  1F6M C;  2AUV A;  3G7Y A;  1OC9 B;  4JRR A;  3CSH A;  3IXR A;  1KTE A;  2VM1 A;  4DSQ A;  2EC4 A;  3W8J A;  4TR3 A;  2C4J A;  2GT6 A;  1XWK A;  5B7C A;  1TRV A;  2CA8 A;  2JZT A;  5F05 A;  3R3E A;  1E6B A;  5EY6 A;  4MCU A;  1M0U A;  2DIZ A;  2K6V A;  2EFE A;  4ILF A;  3RDW A;  2E0Q A;  2N5A A;  5ECQ B;  2HFD A;  5CRW A;  4OFT A;  4IHU A;  1TK5 B;  5ECS A;  2WW1 A;  2QA1 A;  4LA1 A;  5A1N A;  1GSU A;  4JE1 A;  1GSY A;  2EFH A;  5B8B A;  1TW9 A;  5HR2 A;  4WBJ A;  5D96 A;  1C72 A;  1BG1 A;  2IJY A;  1Q4J A;  3C7M A;  2WRT A;  4O5R A;  1RK4 A;  4FO5 A;  2P5Q A;  5ID2 B;  3TJB A;  11GS A;  3IOS A;  3UAP A;  1I5G A;  2M46 A;  4IEL A;  2RII A;  3IHG A;  4ULX A;  2YNX A;  1ERT A;  3GH6 A;  3RFR C;  4QMK A;  3FEU A;  3QDN A;  4Z2U A;  4Q5N A;  2WVY A;  3KTB A;  4L5O A;  2B5E A;  1QUW A;  5ID2 A;  1Y1U A;  3IC8 A;  4J57 E;  4BIK A;  2X8C A;  4EIP A;  4NHW A;  4G19 A;  3KM6 A;  5G1L A;  2KHP A;  4TKY A;  2O36 A;  4KUN A;  3KGK A;  4HJ2 A;  5C04 A;  5KN2 A;  3TCO A;  2C3Q A;  3V1W A;  1EP7 A;  3G9B A;  1BAY A;  3C1R A;  4WKW A;  2I9H A;  2C3N A;  2GSQ A;  5DQY A;  4PNF A;  4Q5Q A;  1K0N A;  1YY7 A;  5AIV A;  5B6M A;  3FMW A;  4QL9 A;  1ZL9 A;  3KJY A;  1SD8 A;  1B9Y C;  1X0R A;  1K0B A;  4NXI A;  5G31 A;  1W4V A;  1TOF A;  2JAC A;  4IN0 A;  1QMV A;  2H6Z A;  1PA3 A;  2TRC P;  4IGJ A;  2A2P A;  3M0F A;  4PHZ C;  3QAV A;  1X5D A;  2R37 A;  2WGR A;  4GCI A;  3A2V A;  1SKS B;  4OFM A;  1YZX A;  5CO3 A;  4LL4 B;  1M3J A;  1V40 A;  2CX4 A;  2ZCT A;  3ZMK A;  1JZO A;  1K0A A;  4H86 A;  4KDX A;  2A2R A;  2R0C A;  4D73 B;  3CSI A;  2DC5 A;  1JLW A;  4F9Z A;  4I97 A;  1S3C A;  1GUM A;  2I81 A;  4Z7X A;  4PGT A;  3UJ1 A;  1FVJ A;  1OE8 A;  1WP0 A;  3MIX A;  4L0W A;  3LG6 A;  3ERG A;  2G0F A;  4KW6 A;  2JSY A;  5CRG A;  1CQG A;  5CP1 A;  1XOB A;  4F03 A;  4LMW A;  2CZ2 A;  5EPF A;  5HR3 A;  3FHK A;  2YZU A;  2GTU A;  2HI7 A;  4YH2 A;  2AYT A;  4LLR A;  3LYK A;  1LBK A;  2MMO A;  2LRC A;  3LXT A;  3IDV A;  4GSS A;  2OE3 A;  2R2J A;  1Z7P A;  1A24 A;  2X99 A;  5G1K A;  1PL1 A;  2OA7 A;  5D9T A;  2E2G A;  2HSM A;  3ERW A;  4RI7 A;  1SYR A;  3EC3 A;  3KP9 A;  3GX8 A;  4POK A;  1RW1 A;  2OBI A;  5CRD A;  3TUE A;  4FYC A;  4Q5F A;  1EV9 A;  4PQ1 A;  2H70 A;  1S3D A;  4GRF A;  3O76 A;  2PWJ A;  2IMK A;  5J9B A;  2LRT A;  5F8B A;  4CDO A;  4KX4 A;  3EPT A;  2PU9 C;  4HOJ A;  1CQH A;  1BX9 A;  2LUS A;  4FIW A;  4K5R A;  2B1K A;  1R4W A;  4I2U A;  5G30 A;  3ZVJ A;  5IMC A;  2WVZ A;  4AKH A;  1YQ1 A;  4GDF A;  3EWL A;  4ZB8 A;  4ISD A;  3A5I A;  4F82 A;  1ON4 A;  4DVC A;  3EUR A;  3G7I A;  4K6X A;  1T8E B;  2FHE A;  2FWH A;  12GS A;  1GNW A;  1R5A A;  1XFL A;  3ED3 A;  4HZ2 A;  2K18 A;  1DBY A;  1BED A;  1O81 A;  3EMP A;  1T3B A;  3MYD A;  4TW5 A;  4Z2R A;  1K0M A;  3ZRE A;  2CX3 A;  4KB3 A;  4WBR D;  3Q6O A;  4IQA A;  5B8A A;  2REM A;  1YVL A;  3VWW A;  1SKW B;  3FYG A;  3P2A A;  4BWS A;  3GTU A;  3ME8 A;  1ZOF A;  4K8M A;  3GKX A;  3L78 A;  1YEX A;  5H5R A;  3QR6 A;  3PPU A;  4MNN A;  5EL8 A;  2YJ7 A;  20GS A;  3HJM A;  1OE7 A;  6GSV A;  1ILO A;  3KD0 A;  4K7I A;  3QOU A;  2X49 A;  1DE1 A;  4WEY A;  2LKU A;  3WYW A;  1EWX A;  1MEK A;  5C00 A;  3E3E A;  2P0G A;  1SJ6 A;  2A4H A;  3FZ4 A;  4I8B A;  2C3T A;  5IO2 A;  2WS2 A;  4IQ1 A;  3GL5 A;  4XHM A;  4ZB6 A;  2HSH A;  3DGQ A;  4PQH A;  4HEA 2;  4TR1 A;  4YQV A;  2MYG A;  3GKN A;  1X9W B;  3HHV A;  3AY8 A;  3C8E A;  5ELA A;  4LMV A;  4K7N A;  2GQL A;  2RM5 A;  2L59 A;  2H1G A;  4PUR A;  1YF1 A;  3DD3 A;  4KAE A;  1B4P A;  5G2Z A;  3E9J B;  3Q19 A;  2LST A;  4KDY A;  3A2W A;  4F2I A;  3DML A;  4ZB9 A;  1ACV A;  9GSS A;  2XBQ A;  4PTS A;  2MMZ A;  5E4W A;  5DAK B;  2KP2 A;  4MMM A;  4YAP A;  4HZ4 A;  1WE0 A;  1MDI A;  5H5Q A;  3TJK A;  4GTU A;  5J9C A;  2AB6 A;  2P31 A;  3WGE A;  4V1A p;  3FR6 A;  1ML6 A;  3ZML A;  4MH3 A;  2H1D A;  1R5P A;  2K8V A;  4K2D A;  3OR5 A;  2IWT A;  5DAK A;  3HVS A;  4E68 A;  1GSD A;  2PBJ A;  2FD3 A;  1URM A;  2DML A;  2DKI A;  3GIX A;  3H4K A;  1A8Y A;  18GS A;  2C0D A;  2GVP A;  2C0G A;  2BJX A;  1TXX A;  1YDK A;  3HZ8 A;  4O32 A;  3F3Q A;  1PGT A;  4KCE A;  2B5X A;  1B4Q A;  3O3T A;  2C80 A;  2H74 A;  3KP8 A;  5BMU B;  1A23 A;  2VLU A;  1GRX A;  2B5Y A;  4N0Z A;  2HE3 A;  1N2A A;  3HMJ G;  4MPG A;  1GTI A;  4HQS A;  2JZR A;  4MZW A;  3ZIJ A;  4IP1 A;  3ME7 A;  2AJQ B;  4MA9 A;  1XW6 A;  2GZP A;  3TDG A;  3TOU A;  1IYH A;  2R4V A;  4EE0 A;  2WZ9 A;  1T00 A;  2YP6 A;  3IA1 A;  1M9A A;  4WR4 A;  3A5W A;  1G6W A;  5BMU A;  3EU3 A;  4CW9 A;  3WT2 A;  2FWF A;  4PNG A;  4ECJ A;  4IVF A;  2XC2 A;  1B48 A;  2V1M A;  2GST A;  5D9W A;  2VL9 A;  5COH A;  4G0K A;  2OAC A;  2QKE A;  1EOG A;  5DCG A;  1VF4 A;  1U88 A;  2HLS A;  1J08 A;  1S3A A;  2R6K A;  3HVV A;  3NIV A;  4N0V A;  1M2B A;  1XPV A;  1SL1 B;  1MDJ A;  2I3Y A;  4USS A;  4KA0 A;  4ZBA A;  2EIQ A;  2KP1 A;  1PKW A;  2H1L A;  3FR3 A;  5J47 A;  3L9U A;  2I4A A;  3R2Q A;  3SWL A;  4N3Z A;  3L4N A;  3D4T A;  1EGO A;  1JZD A;  2L4C A;  2JZS A;  1O8X A;  2M72 A;  1M2D A;  1WPI A;  3J7Y k;  2BTO T;  1JZW A;  1U3I A;  2WW0 A;  4PQI A;  1AQW A;  3CXG A;  3GHA A;  2ZUP A;  2O8V B;  2J9H A;  1Z3E A;  3H79 A;  4XCS A;  2ON5 A;  2NPB A;  4BL7 A;  1YEP A;  5LCZ A;  2N5B A;  2LQO A;  1YJ6 A;  4WXT A;  4KSO A;  4MJB A;  1U87 A;  3VI7 A;  3FZA A;  1X5C A;  3VPT A;  5KOW A;  4EDY A;  13GS A;  3DVW A;  4XRA A;  2HNL A;  4HUA A;  3HKR A;  4NWY A;  1OC9 A;  2B3S A;  2WDU A;  2VCV A;  3CWG A;  2QSI A;  1I1I P;  2AV4 A;  2IPA A;  4OCF A;  2F3M A;  4GST A;  4HS1 A;  16GS A;  3LXZ A;  2CAI A;  6GST A;  2IN3 A;  2YN1 A;  3UOM A;  2GS3 A;  3RPP A;  1O8W A;  2B7J A;  1FO5 A;  2FCH A;  1USB A;  4MZB A;  4NHZ A;  2LV3 A;  1YKC A;  5F07 A;  2GGT A;  1Z6M A;  2R0P A;  4TXO B;  2ES7 A;  4AKI A;  3Q18 A;  4IS0 A;  3HYP A;  3QD9 A;  3IV4 A;  5IOW A;  5CAX A;  3NOF A;  3IR4 A;  5HFK A;  4V2L A;  1NW2 A;  4MDC A;  3L0H A;  4DEJ A;  3UBL A;  3RHB A;  5J3R A;  2KOK A;  2H19 A;  4ML6 A;  1GWC A;  3GYK A;  5D73 A;  5A5H B;  3GKK A;  2CAQ A;  4KND A;  1T7P B;  3U5R E;  4O92 A;  3GUR A;  4I5Q A;  3BJ5 A;  4J56 E;  2XPD A;  2O3E A;  5HQP A;  1BF5 A;  4BPY A;  4NMU A;  1ERW A;  5ECM B;  3UEM A;  4N10 A;  2H1B A;  4EF0 A;  3P7X A;  5ELG A;  1YKA A;  2LEG A;  1AW9 A;  4BVX B;  3VI5 A;  4I6X A;  5A5H A;  4G0I A;  2R0G A;  1GSE A;  4DSR A;  3A2X A;  3HDC A;  1XWG A;  2PPT A;  3TRP A;  1PFO A;  2YWI A;  3FK8 A;  1GP1 A;  3O6T A;  4MJE A;  3FY7 A;  5ECN B;  4V2N A;  1GUL A;  4X0X A;  4MP4 A;  1GTU A;  3RAZ A;  2HQT A;  5FWG A;  4BVX A;  1TRU A;  2C8U A;  1GTB A;  5J5N A;  2AHE A;  2VCQ A;  1PL2 A;  5ECR B;  4PUA A;  2VIM A;  1TI1 A;  1T4Y A;  2H0G A;  2H76 A;  4MJC A;  2WFC A;  1OYJ A;  2H71 A;  1SVL A;  1O73 A;  1GTA A;  1Z9H A;  3RPN A;  4PUF C;  2LTK A;  4XS4 B;  4HU7 A;  1ERU A;  1HD2 A;  2OT3 A;  1AQV A;  5D9V A;  4HQZ A;  3L9S A;  5IM9 A;  3DVX A;  3HJP A;  1W89 A;  4EKZ A;  5INY A;  1XWA A;  6GSY A;  2O89 A;  3QAG A;  4IBP A;  2WJU A;  3BOA A;  5KN1 A;  4PI2 C;  4BWQ A;  3ZIT A;  4POB A;  5IOX A;  1HYU A;  3EIN A;  2XHF A;  3TKQ A;  3E0U A;  5JCW A;  1TTZ A;  1SK2 A;  3KH7 A;  2X64 A;  3ZIV A;  1BG5 A;  4XIH A;  3TJJ A;  4Q5R A;  5AIS A;  4D73 A;  1VF1 A;  5IO0 A;  4AJ6 A;  3N5O A;  4IJ3 A;  1K3O A;  2MBT A;  3H8Q A;  1H75 A;  3I9V 2;  3I43 A;  2HZF A;  4MH2 A;  5DBQ A;  1G6Y A;  3GRX A;  4RQR A; 
#chains in the Genus database with same CATH homology
 1MD4 A;  2X8G A;  1Y25 A;  1B8X A;  1ERV A;  1V9W A;  2HYX A;  5JWQ B;  3DKS A;  3QFB C;  1AIU A;  4TVE A;  3HVX A;  1MDK A;  4DSS B;  2TRX A;  3H93 A;  3PH9 A;  2IMD A;  3QMX A;  3CSJ A;  4K2X A;  1SKR B;  2B7K A;  2GZZ A;  3W6G A;  4KF9 A;  2H1A A;  1O6J A;  3KIJ A;  3IAS 2;  3F0I A;  2LNT A;  3D6I A;  3S9F A;  4RI6 A;  4KH7 A;  1AXD A;  2CQ9 A;  4FQU A;  3CRU A;  2EIO A;  2EFC A;  4WF4 A;  2DJJ A;  5E59 A;  1K3Y A;  4ZB7 A;  2E7P A;  4EIQ A;  3MAK A;  2L6D A;  1LJR A;  3MSZ A;  4NAX A;  3MNG A;  1GNE A;  1F3A A;  3TRQ A;  1V57 A;  2F9S A;  4NV5 A;  3BBY A;  1XWB A;  3IAM 2;  4MF7 A;  4MK3 A;  5KOX A;  3QFA C;  5GZZ B;  3GKM A;  3EVI A;  1QK8 A;  3F63 A;  3EU4 A;  4GXZ A;  2DSA A;  2PMT A;  4K5S A;  4EVM A;  4HDE A;  2VD1 A;  1SL2 B;  2LS5 A;  1SVM A;  1KNG A;  1UVZ A;  3IRA A;  4GLT A;  1M99 A;  3KMO A;  4IJI A;  2FWG A;  1G7O A;  1PX7 A;  4AJ8 A;  3SBC A;  2HSN B;  3D22 A;  2FGX A;  1A2L A;  1O7U A;  3P90 A;  2NBS A;  4CY6 A;  1K0O A;  4RUV A;  3MDK A;  5ECO B;  2YJH A;  3GNJ A;  3F4T A;  3GSS A;  1HNB A;  5CNW A;  1PKZ A;  1F3B A;  1NHY A;  2H72 A;  4KCA A;  4EUY A;  4EO3 A;  1Q98 A;  1JFU A;  4O5Q A;  2DLX A;  3ZFB A;  3IBH A;  1RQM A;  1E2Y A;  2FUG 2;  2MMA A;  3ZZX A;  3GMF A;  2CVD A;  3DWV A;  3U6V A;  4K0G A;  2OKA A;  3WT1 A;  1SK1 A;  4X1U A;  4XTS A;  2LJA A;  3ZRD A;  3KMN A;  2J23 A;  1Z7R A;  3GST A;  1SEN A;  2XBI A;  5IMV A;  3KCM A;  2HRK B;  5L71 A;  4IW9 A;  2QC7 A;  3ERF A;  4ZIJ A;  4E8H A;  3DRN A;  3RHC A;  1ZMA A;  1Z5Y E;  1PSQ A;  2QA2 A;  4OMV A;  1G7E A;  3TGZ A;  1ZCP A;  5J4Y A;  1AAZ A;  1XW5 A;  1TU8 A;  3FZ9 A;  4GQC A;  1T4Z A;  2IMF A;  3C1S A;  2HZE B;  2LRN A;  2HRK A;  2FY6 A;  4O7H A;  3C71 A;  3UAR A;  2LNS A;  1ZGN A;  3APS A;  3BCK A;  5DVB A;  1GL8 A;  4FYU A;  5IIZ A;  1GUK A;  1HQO A;  2DJ0 A;  1FG4 A;  1XW9 A;  2RM6 A;  1V2A A;  3PIN A;  1ST9 A;  2K8S A;  3KTL A;  1KEB A;  5FT3 A;  3GA4 A;  2KUC A;  2H8L A;  4HI7 A;  2GDR A;  1T1V A;  4P3Y B;  2L6C A;  2PUK C;  3APO A;  3ZYW A;  5AIX A;  2C0E A;  4XRD A;  4TR0 A;  3TKS A;  2DKH A;  4WR5 A;  5CRH A;  4AKG A;  6GSU A;  1TDI A;  4GQF A;  4RQX A;  4JZQ A;  3KEB A;  1GSF A;  4N30 A;  3VFI A;  2DJK A;  2CVK A;  5DAL B;  1FOV A;  4YKF A;  22GS A;  1EOH A;  1ZYN A;  3ZLP A;  5B6N A;  5ECH B;  1QGV A;  2GQM A;  1VF2 A;  2V32 A;  1HNA A;  3UVH A;  4ZIL A;  1Z6N A;  4HJM A;  3WGD A;  2F8F A;  1WRY A;  5DAL A;  3TKP A;  1TJD A;  1OC3 A;  2IFQ B;  1A8L A;  5JWR B;  1XIY A;  1PN0 A;  2HRF A;  17GS A;  2GT5 A;  1PMT A;  2H6X A;  3EYT A;  2DIY A;  2YZH A;  1OC8 A;  2VL2 A;  1G0T A;  5A34 B;  3IK7 A;  3PR8 A;  4AGS A;  5IMZ A;  3FW2 A;  5IPG A;  4OD7 A;  3I69 A;  4BA7 A;  1R7H A;  1MD3 A;  1WWJ A;  5JWO B;  3TJG A;  2YPM A;  1PRX A;  2UV8 G;  1F37 A;  1BQ7 A;  3UL3 A;  5IMF A;  10GS A;  1FW1 A;  1XZO A;  4TOP A;  5BRT A;  2CT6 A;  1GUH A;  5A34 A;  3GN3 A;  1AUC A;  4YKG A;  1F9M A;  5JCG A;  5CYY A;  8GSS A;  1X9S B;  2EIR A;  2FNO A;  2IL3 A;  4MZC A;  5H5S A;  3D4M A;  3P8W A;  4E8E A;  2YAN A;  2YWN A;  2DJ3 A;  5D8I A;  2O85 A;  5A1N B;  2VOC A;  4KDU A;  3CRT A;  2IIY A;  4POL A;  1FOH A;  2YV9 A;  1PX6 A;  3NZN A;  4OO5 A;  1YF0 A;  2V41 A;  1K0D A;  3CTF A;  1NM3 A;  5J41 A;  3LGC A;  3HJO A;  3RBT A;  1A2M A;  5GAP D;  2Z9S A;  1TK0 B;  2R3X A;  4IKH A;  1ABA A;  4XS1 A;  1JZR A;  2GSS A;  2NVL A;  4EXJ A;  4L0U A;  2X8H A;  1FVK A;  1A0R P;  4OFN A;  4YAV A;  5DJL A;  4ZBD A;  3GH9 A;  2CV4 A;  3HZ4 A;  4TXO A;  4ZL7 A;  3ZVJ D;  1I9D A;  1TKD B;  2B6M A;  1EV4 A;  2JSZ A;  3LSZ A;  1XOA A;  1A0F A;  2KLX A;  4MF6 A;  4ML1 A;  2V6K A;  3TKS C;  3VUR A;  4ZL9 A;  4F0C A;  4MAB A;  3M3M A;  2N5F A;  1GLP A;  5KEJ A;  3DEX A;  1V58 A;  5J40 A;  4MLY A;  5DDL A;  2TIR A;  2YOI A;  2VCZ A;  3L9V A;  2O5V A;  3IPZ A;  3KH9 A;  3F6D A;  5HR1 A;  2E2M A;  1U3A A;  3N9J A;  5ECP B;  5A4W A;  4V2M A;  4G0L A;  4YQU A;  1Y6E A;  4ECC A;  3TKS E;  5DCH A;  4TN8 A;  4K1F A;  1WJK A;  2MBS A;  3QCP A;  4G2E A;  4PX1 A;  1VGL A;  3DIE A;  3IE3 A;  3M1G A;  3KZQ A;  1K0C A;  4EL1 A;  3KXO A;  2QGV A;  3TU3 B;  4Z2T A;  1TK8 B;  3ISO A;  2YWM A;  1EEJ A;  1VF3 A;  5F0G A;  2VL2 C;  2HSY A;  5J4U A;  1PN9 A;  3K8N A;  1XXU A;  3I6A A;  5EVO A;  4CHS A;  3W8S A;  2HXK A;  5ECL B;  4ACS A;  3F3R A;  2FA8 A;  3IK9 A;  4K0N A;  3FR9 A;  4F0B A;  1SU9 A;  4XS4 A;  3HA9 A;  2NDO A;  5A5K A;  5ECK B;  1JHB A;  3FKF A;  2L5L A;  1X9M B;  2P5R A;  1K3L A;  2VO4 A;  1BJX A;  5CRE A;  3UIW A;  3HXS A;  3TRX A;  4WF5 A;  1FB0 A;  2VAF A;  5ABR A;  1OVN A;  3TKR A;  1X5E A;  1WMJ A;  1GSS A;  5A4U A;  5G5F A;  1AC1 A;  1NHO A;  1WIK A;  1TU7 A;  2HSM B;  4G10 A;  1HNC A;  2VUP A;  1U6T A;  4JBB A;  2RUF A;  2AAW A;  3HCZ A;  1ZYE A;  2VCW A;  4AI6 A;  2C1Y A;  3UBK A;  5KN0 A;  4MF5 A;  2PGT A;  2UZ8 A;  4GWR A;  3VK9 A;  2WCI A;  3M9K A;  3GV1 A;  2IMI A;  4FYB A;  2R5G A;  3GX0 A;  3F8U A;  3F6F A;  1M2A A;  1ZYP A;  2O87 A;  5GST A;  5KN3 A;  2ZNM A;  3JCM L;  4ECB A;  1SVO A;  2L57 A;  2PN8 A;  1NSW A;  5HFG A;  3D0Z A;  2JAD A;  3WGX A;  5IMD A;  2OE1 A;  5AN1 A;  4JR4 A;  1WOU A;  4EC0 A;  3QAW A;  2PVQ A;  4DSS A;  2OJL A;  4W66 A;  3WD6 A;  2VCT A;  5HFI A;  3LJR A;  3UMA A;  1VRS D;  4I2T A;  3TB2 A;  4G01 A;  1XBS A;  2DJ2 A;  3G7J A;  1EGR A;  4N11 A;  4WET A;  1LU4 A;  1GLQ A;  2G2Q A;  5GAN D;  4J2F A;  3GTU B;  3IHQ A;  1TP9 A;  3LEF A;  3HD5 A;  2FLS A;  5A4V A;  1AQX A;  3TOT A;  3PGT A;  2BMX A;  4G9H A;  5D93 A;  2HRN A;  2OE0 A;  4L8E A;  2MMN A;  5DJM A;  2F8A A;  1F2E A;  2ON7 A;  2LQQ A;  2D2Z A;  1MTC A;  1BYE A;  3VWU A;  1M9B A;  1V98 A;  1UC7 A;  3IC4 A;  4O5U A;  4TXV A;  1XVQ A;  3QPM A;  4AF2 A;  2JL4 A;  1H4O A;  5JCU A;  5J4V A;  1FAA A;  2A4V A;  5LNK e;  2FWE A;  4ZXG A;  1DUG A;  1QQ2 A;  4TR1 B;  3DYR A;  4K7O A;  4A5P A;  2VL3 A;  19GS A;  2LJK A;  2H0I A;  2A2S A;  4LL1 B;  3M8N A;  3F4S A;  5IMA A;  1UA5 A;  1M7T A;  2K9F A;  5FHI A;  4MJA A;  2PER A;  3FZ5 A;  4L5L A;  4NPB A;  4PXO A;  4ZBB A;  3APQ A;  1FB6 A;  4X4J A;  2HSN A;  3F4R A;  3GFK A;  3VPQ A;  5DQS A;  3CMI A;  2L4Q A;  2VM2 A;  3J7Y b;  3C73 A;  1TRS A;  2H73 A;  5G5E A;  4V1A g;  4NV2 A;  2EFD A;  4ZL8 A;  4AJ7 A;  4GSN A;  1R26 A;  2H0H A;  1ZYQ B;  2CVB A;  4YQM A;  3MWH A;  2VLV A;  4OO4 A;  3CTG A;  3BCI A;  1OAZ A;  3BD2 A;  3ZFL A;  5AGY A;  1EEM A;  1N25 A;  3M9J A;  1SL0 B;  2DBC A;  3DXB A;  3UVT A;  2V2G A;  2VD0 A;  3CBU A;  1OKD A;  1KBN A;  4OWY A;  2C0F A;  2CZ3 A;  2DJ1 A;  2RUE A;  1TXU A;  2YV7 A;  4FH8 A;  6GSX A;  4HU9 A;  1O85 A;  2FA4 A;  2GQK A;  3HY2 A;  1J9B A;  1OKT A;  2F51 A;  2XPE A;  6GSW A;  4TR4 A;  2JU5 A;  1FHE A;  2DMM A;  2VLT A;  4IP6 A;  5IPH A;  1DE2 A;  2VKZ G;  2HT9 A;  1XWC A;  3VWX A;  2PVO C;  2OBK A;  7GSS A;  3LW9 A;  2H6Y A;  3ZTL A;  3TJF A;  4JR6 A;  1SYX A;  1DSB A;  2HZE A;  1EZK A;  3LFL A;  1THO A;  3GUS A;  2NTO A;  2WUL A;  1SD9 A;  2ALB A;  1IYI A;  2I1U A;  3US3 A;  3LOR A;  1EP8 A;  4CY8 A;  3VWV A;  1TRW A;  2M80 A;  2GZY A;  2L5O A;  1B9X C;  2IME A;  4KE3 A;  2YWO A;  2V6O A;  2RLI A;  1SK0 A;  4JED A;  5HR0 A;  3CYN A;  2GSR A;  1J0F A;  5GSS A;  1XCC A;  5IQY A;  4OCE A;  4QQ7 A;  2YCD A;  4XS6 A;  2H75 A;  1PQN A;  3H1N A;  4JU5 A;  4ICY A;  2H01 A;  2LJR A;  4KSM A;  3EMX A;  4POM A;  1SJZ A;  4TRX A;  3D5J A;  3D21 A;  1A2J A;  4BVY B;  3LYP A;  3EE2 A;  4X43 A;  2H66 A;  2HRA A;  4MPF A;  2WB9 A;  4AKX B;  4ID0 A;  2O7K A;  5D9X A;  1GSQ A;  14GS A;  3GL3 A;  3A3T A;  3VLN A;  5ECI B;  2B1L A;  4ECI A;  2MZC A;  3LQ7 A;  5F06 A;  3F9U A;  3LWA A;  4KGI A;  4EDZ A;  4K9Z A;  5LD0 A;  1QFN A;  1ZZY A;  4BVY A;  1GH2 A;  4BL7 B;  1PD2 1;  2OAD A;  2IFQ A;  5ENU A;  1QXH A;  1XVW A;  2H30 A;  6GSS A;  1JLV A;  2GLR A;  1THX A;  2VCX A;  3Q74 A;  2X4A A;  4GF0 A;  3ZL5 A;  1TI3 A;  4QL7 A;  1SJI A;  3FRC A;  1UN2 A;  1N8J A;  1F6M C;  2AUV A;  3G7Y A;  1OC9 B;  4JRR A;  3CSH A;  3IXR A;  1KTE A;  2VM1 A;  4DSQ A;  2EC4 A;  3W8J A;  4TR3 A;  2C4J A;  2GT6 A;  1XWK A;  5B7C A;  1TRV A;  2CA8 A;  2JZT A;  5F05 A;  3R3E A;  1E6B A;  5EY6 A;  4MCU A;  1M0U A;  2DIZ A;  2K6V A;  2EFE A;  4ILF A;  3RDW A;  2E0Q A;  2N5A A;  5ECQ B;  2HFD A;  5CRW A;  4OFT A;  4IHU A;  1TK5 B;  5ECS A;  2QA1 A;  4LA1 A;  5A1N A;  1GSU A;  4JE1 A;  1GSY A;  2EFH A;  5B8B A;  1TW9 A;  5HR2 A;  4WBJ A;  5D96 A;  1C72 A;  1BG1 A;  2IJY A;  1Q4J A;  3C7M A;  2WRT A;  4O5R A;  1RK4 A;  4FO5 A;  2P5Q A;  5ID2 B;  3TJB A;  11GS A;  3IOS A;  3UAP A;  1I5G A;  2M46 A;  4IEL A;  2RII A;  3IHG A;  4ULX A;  2YNX A;  1ERT A;  3GH6 A;  4QMK A;  3FEU A;  3QDN A;  4Z2U A;  4Q5N A;  3KTB A;  4L5O A;  2B5E A;  1QUW A;  5ID2 A;  1Y1U A;  3IC8 A;  4J57 E;  2X8C A;  4EIP A;  4NHW A;  4G19 A;  3KM6 A;  5G1L A;  2KHP A;  4TKY A;  4KUN A;  3KGK A;  4HJ2 A;  5C04 A;  5KN2 A;  3TCO A;  2C3Q A;  3V1W A;  1EP7 A;  3G9B A;  1BAY A;  3C1R A;  4WKW A;  2I9H A;  2C3N A;  2GSQ A;  5DQY A;  4PNF A;  4Q5Q A;  1K0N A;  1YY7 A;  5AIV A;  5B6M A;  3FMW A;  4QL9 A;  1ZL9 A;  3KJY A;  1SD8 A;  1B9Y C;  1X0R A;  1K0B A;  4NXI A;  5G31 A;  1W4V A;  1TOF A;  2JAC A;  4IN0 A;  1QMV A;  2H6Z A;  1PA3 A;  2TRC P;  4IGJ A;  2A2P A;  3M0F A;  3QAV A;  1X5D A;  2R37 A;  2WGR A;  4GCI A;  3A2V A;  1SKS B;  4OFM A;  1YZX A;  5CO3 A;  4LL4 B;  1V40 A;  2CX4 A;  2ZCT A;  3ZMK A;  1JZO A;  1K0A A;  4H86 A;  4KDX A;  2A2R A;  2R0C A;  4D73 B;  3CSI A;  2DC5 A;  1JLW A;  4F9Z A;  4I97 A;  1S3C A;  1GUM A;  2I81 A;  4Z7X A;  4PGT A;  3UJ1 A;  1FVJ A;  1OE8 A;  1WP0 A;  3MIX A;  4L0W A;  3LG6 A;  3ERG A;  2G0F A;  4KW6 A;  2JSY A;  5CRG A;  1CQG A;  5CP1 A;  1XOB A;  4F03 A;  4LMW A;  2CZ2 A;  5EPF A;  5HR3 A;  3FHK A;  2YZU A;  2GTU A;  2HI7 A;  4YH2 A;  2AYT A;  4LLR A;  3LYK A;  1LBK A;  2MMO A;  2LRC A;  3LXT A;  3IDV A;  4GSS A;  2OE3 A;  2R2J A;  1Z7P A;  1A24 A;  2X99 A;  5G1K A;  1PL1 A;  2OA7 A;  5D9T A;  2E2G A;  2HSM A;  3ERW A;  4RI7 A;  1SYR A;  3EC3 A;  3KP9 A;  3GX8 A;  4POK A;  1RW1 A;  2OBI A;  5CRD A;  3TUE A;  4FYC A;  4Q5F A;  1EV9 A;  4PQ1 A;  2H70 A;  1S3D A;  4GRF A;  3O76 A;  2PWJ A;  2IMK A;  5J9B A;  2LRT A;  5F8B A;  4CDO A;  4KX4 A;  3EPT A;  2PU9 C;  4HOJ A;  1CQH A;  1BX9 A;  2LUS A;  4FIW A;  4K5R A;  2B1K A;  1R4W A;  4I2U A;  5G30 A;  3ZVJ A;  5IMC A;  4AKH A;  1YQ1 A;  4GDF A;  3EWL A;  4ZB8 A;  4ISD A;  3A5I A;  4F82 A;  1ON4 A;  4DVC A;  3EUR A;  3G7I A;  4K6X A;  1T8E B;  2FHE A;  2FWH A;  12GS A;  1GNW A;  1R5A A;  1XFL A;  3ED3 A;  4HZ2 A;  2K18 A;  1DBY A;  1BED A;  1O81 A;  3EMP A;  1T3B A;  3MYD A;  4TW5 A;  4Z2R A;  1K0M A;  3ZRE A;  2CX3 A;  4KB3 A;  4WBR D;  3Q6O A;  4IQA A;  5B8A A;  2REM A;  1YVL A;  3VWW A;  1SKW B;  3FYG A;  3P2A A;  4BWS A;  3GTU A;  3ME8 A;  1ZOF A;  4K8M A;  3GKX A;  3L78 A;  1YEX A;  5H5R A;  3QR6 A;  3PPU A;  4MNN A;  5EL8 A;  2YJ7 A;  20GS A;  3HJM A;  1OE7 A;  6GSV A;  1ILO A;  3KD0 A;  4K7I A;  3QOU A;  2X49 A;  1DE1 A;  4WEY A;  2LKU A;  3WYW A;  1EWX A;  1MEK A;  5C00 A;  3E3E A;  2P0G A;  1SJ6 A;  2A4H A;  3FZ4 A;  4I8B A;  2C3T A;  5IO2 A;  2WS2 A;  4IQ1 A;  3GL5 A;  4XHM A;  4ZB6 A;  2HSH A;  3DGQ A;  4PQH A;  4HEA 2;  4TR1 A;  4YQV A;  2MYG A;  3GKN A;  1X9W B;  3HHV A;  3AY8 A;  3C8E A;  5ELA A;  4LMV A;  4K7N A;  2GQL A;  2RM5 A;  2L59 A;  2H1G A;  4PUR A;  1YF1 A;  3DD3 A;  4KAE A;  1B4P A;  5G2Z A;  3E9J B;  3Q19 A;  2LST A;  4KDY A;  3A2W A;  4F2I A;  3DML A;  4ZB9 A;  1ACV A;  9GSS A;  2XBQ A;  4PTS A;  2MMZ A;  5E4W A;  5DAK B;  2KP2 A;  4MMM A;  4YAP A;  4HZ4 A;  1WE0 A;  1MDI A;  5H5Q A;  3TJK A;  4GTU A;  5J9C A;  2AB6 A;  2P31 A;  3WGE A;  4V1A p;  3FR6 A;  1ML6 A;  3ZML A;  4MH3 A;  2H1D A;  1R5P A;  2K8V A;  4K2D A;  3OR5 A;  2IWT A;  5DAK A;  3HVS A;  4E68 A;  1GSD A;  2PBJ A;  2FD3 A;  1URM A;  2DML A;  2DKI A;  3GIX A;  3H4K A;  1A8Y A;  18GS A;  2C0D A;  2GVP A;  2C0G A;  2BJX A;  1TXX A;  1YDK A;  3HZ8 A;  4O32 A;  3F3Q A;  1PGT A;  4KCE A;  2B5X A;  1B4Q A;  3O3T A;  2C80 A;  2H74 A;  3KP8 A;  5BMU B;  1A23 A;  2VLU A;  1GRX A;  2B5Y A;  4N0Z A;  2HE3 A;  1N2A A;  3HMJ G;  4MPG A;  1GTI A;  4HQS A;  2JZR A;  4MZW A;  3ZIJ A;  4IP1 A;  3ME7 A;  2AJQ B;  4MA9 A;  1XW6 A;  2GZP A;  3TDG A;  3TOU A;  1IYH A;  2R4V A;  4EE0 A;  2WZ9 A;  1T00 A;  2YP6 A;  3IA1 A;  1M9A A;  4WR4 A;  3A5W A;  1G6W A;  5BMU A;  3EU3 A;  4CW9 A;  3WT2 A;  2FWF A;  4PNG A;  4ECJ A;  4IVF A;  2XC2 A;  1B48 A;  2V1M A;  2GST A;  5D9W A;  2VL9 A;  5COH A;  4G0K A;  2OAC A;  2QKE A;  1EOG A;  5DCG A;  1VF4 A;  1U88 A;  2HLS A;  1J08 A;  1S3A A;  2R6K A;  3HVV A;  3NIV A;  4N0V A;  1M2B A;  1XPV A;  1SL1 B;  1MDJ A;  2I3Y A;  4USS A;  4KA0 A;  4ZBA A;  2EIQ A;  2KP1 A;  1PKW A;  2H1L A;  3FR3 A;  5J47 A;  3L9U A;  2I4A A;  3R2Q A;  3SWL A;  4N3Z A;  3L4N A;  3D4T A;  1EGO A;  1JZD A;  2L4C A;  2JZS A;  1O8X A;  2M72 A;  1M2D A;  1WPI A;  3J7Y k;  2BTO T;  1JZW A;  1U3I A;  4PQI A;  1AQW A;  3CXG A;  3GHA A;  2ZUP A;  2O8V B;  2J9H A;  1Z3E A;  3H79 A;  4XCS A;  2ON5 A;  2NPB A;  4BL7 A;  1YEP A;  5LCZ A;  2N5B A;  2LQO A;  1YJ6 A;  4WXT A;  4KSO A;  4MJB A;  1U87 A;  3VI7 A;  3FZA A;  1X5C A;  3VPT A;  5KOW A;  4EDY A;  13GS A;  3DVW A;  4XRA A;  2HNL A;  4HUA A;  3HKR A;  4NWY A;  1OC9 A;  2B3S A;  2WDU A;  2VCV A;  3CWG A;  2QSI A;  2AV4 A;  2IPA A;  4OCF A;  2F3M A;  4GST A;  4HS1 A;  16GS A;  3LXZ A;  2CAI A;  6GST A;  2IN3 A;  2YN1 A;  3UOM A;  2GS3 A;  3RPP A;  1O8W A;  2B7J A;  1FO5 A;  2FCH A;  1USB A;  4MZB A;  4NHZ A;  2LV3 A;  1YKC A;  5F07 A;  2GGT A;  1Z6M A;  2R0P A;  4TXO B;  2ES7 A;  4AKI A;  3Q18 A;  4IS0 A;  3HYP A;  3QD9 A;  3IV4 A;  5IOW A;  5CAX A;  3NOF A;  3IR4 A;  5HFK A;  4V2L A;  1NW2 A;  4MDC A;  3L0H A;  4DEJ A;  3UBL A;  3RHB A;  5J3R A;  2KOK A;  2H19 A;  4ML6 A;  1GWC A;  3GYK A;  5D73 A;  5A5H B;  3GKK A;  2CAQ A;  4KND A;  1T7P B;  3U5R E;  4O92 A;  3GUR A;  4I5Q A;  3BJ5 A;  4J56 E;  2XPD A;  5HQP A;  1BF5 A;  4BPY A;  4NMU A;  1ERW A;  5ECM B;  3UEM A;  4N10 A;  2H1B A;  4EF0 A;  3P7X A;  5ELG A;  1YKA A;  2LEG A;  1AW9 A;  4BVX B;  3VI5 A;  4I6X A;  5A5H A;  4G0I A;  2R0G A;  1GSE A;  4DSR A;  3A2X A;  3HDC A;  1XWG A;  2PPT A;  3TRP A;  2YWI A;  3FK8 A;  1GP1 A;  3O6T A;  4MJE A;  3FY7 A;  5ECN B;  4V2N A;  1GUL A;  4X0X A;  4MP4 A;  1GTU A;  3RAZ A;  2HQT A;  5FWG A;  4BVX A;  1TRU A;  2C8U A;  1GTB A;  5J5N A;  2AHE A;  2VCQ A;  1PL2 A;  5ECR B;  4PUA A;  2VIM A;  1TI1 A;  1T4Y A;  2H0G A;  2H76 A;  4MJC A;  2WFC A;  1OYJ A;  2H71 A;  1SVL A;  1O73 A;  1GTA A;  1Z9H A;  3RPN A;  4PUF C;  2LTK A;  4XS4 B;  4HU7 A;  1ERU A;  1HD2 A;  2OT3 A;  1AQV A;  5D9V A;  4HQZ A;  3L9S A;  5IM9 A;  3DVX A;  3HJP A;  1W89 A;  4EKZ A;  5INY A;  1XWA A;  6GSY A;  2O89 A;  3QAG A;  4IBP A;  2WJU A;  3BOA A;  5KN1 A;  4BWQ A;  3ZIT A;  4POB A;  5IOX A;  1HYU A;  3EIN A;  2XHF A;  3TKQ A;  3E0U A;  5JCW A;  1TTZ A;  1SK2 A;  3KH7 A;  2X64 A;  3ZIV A;  1BG5 A;  4XIH A;  3TJJ A;  4Q5R A;  5AIS A;  4D73 A;  1VF1 A;  5IO0 A;  4AJ6 A;  3N5O A;  4IJ3 A;  1K3O A;  2MBT A;  3H8Q A;  1H75 A;  3I9V 2;  3I43 A;  2HZF A;  4MH2 A;  5DBQ A;  1G6Y A;  3GRX A;  4RQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...