1TU7A

Structure of onchocerca volvulus pi-class glutathione s-transferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
208
structure length
208
Chain Sequence
MSYKLTYFSIRGLAEPIRLFLVDQDIKFIDDRIAKDDFSSIKSQFQFGQLPCLYDGDQQIVQSGAILRHLARKYNLNGENEMETTYIDMFCEGVRDLHVKYTRMIYMAYETEKDPYIKSILPGELAKFEKLLATRGNGRNLILGDKISYADYALFEELDVHQILDPHCLDKFPLLKVFHQRMKDRPKLKEYCEKRDAAKVPVNGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase 2
publication title Structure of the Major Cytosolic Glutathione S-Transferase from the Parasitic Nematode Onchocerca volvulus
pubmed doi rcsb
source organism Onchocerca volvulus
molecule tags Transferase
total genus 78
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1tu7A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tu7A01
3H79A 3VK9A 5J3RA 3ZFBA 1AUCA 3D4MA 2GLRA 3MNGA 3D0ZA 5G2ZA 2VOCA 4E8HA 3EINA 3FEUA 2L6DA 2GSQA 3IC8A 2VL2C 1S3AA 5D8IA 3UMAA 2TRXA 1RK4A 4I8BA 3RPPA 5B6NA 4EVMA 5E59A 5ELAA 4J57E 3DGQA 3F9UA 4ZL7A 2YZUA 2VAFA 2HSMB 2HRNA 2V1MA 4F0CA 2CVKA 2MMOA 1XIYA 4I2UA 3FHKA 2K8SA 1TXXA 1EP8A 3U6VA 1SKRB 4JZQA 2CX4A 4YAVA 1EP7A 3KEBA 4HOJA 2BTOT 2LS5A 1TOFA 1O8XA 3S9FA 2LV3A 1TRVA 2E2GA 4ID0A 2AUVA 3DRNA 5J5NA 2E2MA 1XVQA 3RDWA 5E4WA 1Z7PA 1PMTA 4OO5A 17GSA 4ML6A 1DE2A 4BVXA 1AAZA 4PNFA 4LA1A 4PNGA 2JL4A 6GSTA 3E3EA 4GQCA 3C7MA 4K7NA 2IMFA 3UAPA 2OE3A 4AF2A 2DIZA 1FW1A 4XS6A 1UA5A 4TVEA 1AQVA 3F0IA 1OKDA 4GF0A 1SL0B 2WDUA 2XC2A 5CREA 2YJHA 3L78A 3CBUA 2CA8A 5INYA 3WT2A 4JE1A 4F03A 1G6YA 18GSA 2H73A 1MTCA 2H66A 3MWHA 2H75A 1V98A 2G0FA 2VUPA 3H8QA 3MAKA 4Q5FA 4ZB8A 5H5SA 1E6BA 1YZXA 3F3QA 5IQYA 1A8YA 4EL1A 4BVYB 4TR1A 3FRCA 1XXUA 3Q6OA 1FAAA 1YF0A 3VI7A 4JBBA 3F4RA 4I97A 3APQA 4O32A 2HT9A 1Z3EA 2IMEA 3CSJA 4WEYA 5HR2A 1PX7A 1HNCA 1QFNA 1ZYQB 4IN0A 2IN3A 1I5GA 3L9VA 1ZYEA 1OC9A 1MD3A 5DAKB 5DQYA 5G30A 2PMTA 2HRKB 5FHIA 5A4WA 3M8NA 3TCOA 3GHAA 4RQRA 3EMPA 2GS3A 4NAXA 2FWHA 2XHFA 2OKAA 4KUNA 4D73B 4HQZA 1GL8A 4LMWA 2L59A 3VWXA 1XWAA 3FZ9A 1YF1A 2YPMA 3BCIA 4PTSA 5KN2A 2VCQA 3GKXA 2IL3A 4G0IA 4ECBA 3E0UA 2YN1A 3ZLPA 5H5QA 4PUFC 1URMA 1EWXA 1ST9A 1VF3A 3IDVA 5CO3A 5IMCA 5D9XA 3D21A 5B7CA 2WB9A 3MSZA 2GQKA 4G10A 1F9MA 2YV9A 2V6KA 1N8JA 3EWLA 4MLYA 2YCDA 4RI6A 4POKA 4KE3A 1O7UA 4HEA2 4WXTA 3D4TA 4ECIA 5J41A 2HSMA 4J56E 3P8WA 4L8EA 3KM6A 5AN1A 3CMIA 1EZKA 5CP1A 2XPDA 4G19A 4BPYA 2IFQA 2FWFA 4KA0A 5EVOA 4HDEA 3AY8A 3ZRDA 3OR5A 3FYGA 3I69A 4AJ8A 2GT5A 1PRXA 3HJMA 1X5DA 4FIWA 4CHSA 5F0GA 1PKWA 1GUMA 4P3YB 4DSRA 1LBKA 10GSA 3GKNA 4ZL8A 3LG6A 3MDKA 5ECMB 4EF0A 2AB6A 2L4CA 1U3IA 2LRCA 1XWCA 2OA7A 1WJKA 6GSSA 3DVXA 4EE0A 2D2ZA 4WKWA 1T4ZA 1GNEA 4XS4B 4OD7A 3I9V2 4ZILA 1XPVA 1GSYA 1QXHA 2LSTA 4EO3A 4XIHA 1U6TA 1M9AA 4ZIJA 2DJKA 3KMNA 4K6XA 2ZNMA 3GUSA 1X0RA 2L5LA 1T3BA 3KP8A 3R3EA 2CQ9A 3EYTA 2YP6A 4O92A 4N0VA 2GGTA 3QFAC 5IMAA 4NXIA 3TB2A 1USBA 3APOA 9GSSA 4PQ1A 1U88A 1ABAA 3VWVA 1MDKA 2M80A 3IR4A 1JZDA 4KW6A 3J7Yb 3M9JA 5JCGA 3TDGA 4PX1A 4GTUA 6GSWA 3W8JA 1N2AA 2VCWA 3GRXA 4KGIA 2REMA 1Q98A 2IJYA 1IYHA 2DLXA 1NSWA 4EDYA 4Q5NA 2AHEA 2CVDA 3D22A 4F9ZA 1ERUA 3GIXA 1O6JA 1JLVA 1TU8A 2P5QA 4DVCA 3HJPA 4TKYA 5IMVA 5BMUA 4ACSA 3ZIJA 1PA3A 2FNOA 3QD9A 2H0GA 1UVZA 4PQHA 14GSA 4V2NA 1XW5A 4GXZA 5DAKA 3FR9A 1WWJA 2DJ2A 2K9FA 4ISDA 2XPEA 2F3MA 2HRKA 2YWOA 5GAND 5AIVA 4L0WA 1YKAA 1YEXA 4ECCA 3R2QA 3UARA 1SJZA 2I3YA 1ERTA 5FWGA 4MCUA 5D9WA 5JCUA 4D73A 3SWLA 4HU7A 3RHBA 1T8EB 2HZEB 5ID2A 2H1DA 3RHCA 3C1RA 4YQMA 4I5QA 1U3AA 2ZUPA 4JU5A 4MMMA 2BMXA 4OCEA 1GTBA 1B9YC 1G0TA 2OE0A 3TJFA 3F6DA 2N5BA 4AJ7A 3KMOA 3M0FA 4TRXA 4MJAA 3KCMA 2V6OA 4Z7XA 3KTLA 4MZWA 2H1AA 5F8BA 1AXDA 4G0LA 4IJIA 3WGXA 2NTOA 3GNJA 1YDKA 4MPGA 2OBIA 4TXVA 2O7KA 3TKRA 2CX3A 2OJLA 4IGJA 3ZZXA 3US3A 2I81A 2DC5A 3GYKA 4MJBA 4LL1B 4GWRA 1YEPA 3ISOA 1TK0B 3EC3A 2A4VA 2VCZA 3ERFA 5DVBA 1B4QA 2IMIA 4MABA 2B1LA 5IPGA 4Q5QA 2O8VB 4F82A 3VPTA 2YJ7A 3TKSA 2PBJA 3TGZA 4QL9A 2XBQA 6GSVA 3DYRA 2F51A 3GURA 2L57A 1NM3A 1NHOA 1ZGNA 1B9XC 2CVBA 2H6ZA 3UJ1A 3TJKA 1SYRA 4N10A 5G5FA 2EIRA 1EEMA 1TK8B 1KEBA 4MA9A 3KIJA 12GSA 3QOUA 1ZMAA 4MPFA 3ZVJA 2VL2A 2CT6A 3GKMA 4ILFA 1SKWB 2YWIA 2VCVA 2FLSA 1FHEA 4OWYA 4J2FA 2HQTA 4IP1A 2RM5A 4L5OA 4IJ3A 2NDOA 5IMZA 3CRTA 2V41A 1R5PA 4EKZA 2JZSA 2WJUA 1YJ6A 4TXOB 3I6AA 3UBLA 1MDJA 1Z6MA 3IK9A 1YKCA 1MEKA 2AJQB 4GRFA 2N5FA 2HSYA 2PVOC 3VPQA 5JCWA 3HHVA 5ELGA 3FZ5A 3RBTA 1JHBA 3FR6A 4XS4A 1EGRA 3I43A 2DBCA 2HSNB 2OADA 3M1GA 3GFKA 2KP2A 1TDIA 4K9ZA 3DXBA 1B8XA 3F6FA 2H1GA 2YV7A 2LQOA 3GTUB 2RLIA 1A8LA 2HZFA 5HR0A 1PN9A 4KH7A 2X64A 5HFIA 2PWJA 4KCAA 2DJ3A 1AC1A 4JRRA 3HZ8A 2C0FA 2YWNA 4TW5A 4TOPA 1OC3A 2HLSA 3CYNA 5IO2A 4TR4A 2EIOA 3BBYA 4OFMA 4YAPA 4N30A 1PKZA 4L5LA 1DSBA 2C3QA 2HXKA 2MBTA 6GSXA 1TJDA 2FD3A 2X8CA 2BJXA 1EEJA 4KX4A 1JZRA 2F9SA 4KSMA 3NOFA 4MDCA 2LJRA 2N5AA 2K6VA 5GZZB 1TK5B 1J9BA 4FH8A 1M9BA 3IV4A 4XS1A 2LRNA 4V1Ap 2DIYA 3NZNA 2GDRA 3ZIVA 5CYYA 5D9TA 3F8UA 3GX0A 5ECSA 3P2AA 5C00A 1BQ7A 1T1VA 4OCFA 3ZMKA 1SENA 3QR6A 2KLXA 2GSTA 5HQPA 3ZTLA 5AIXA 4HI7A 1SD9A 3DIEA 4XTSA 4FO5A 3KXOA 3IBHA 2JZRA 2GQLA 2B1KA 3A2VA 4AJ6A 4FYCA 2GQMA 3VI5A 3GV1A 4DEJA 1VGLA 1O85A 1JZOA 4GQFA 5CRDA 1WIKA 5ECLB 2HZEA 4KNDA 4IHUA 1I9DA 2FCHA 2FWGA 2WCIA 4LMVA 4K7IA 3A5WA 4ZBDA 4BL7B 4K1FA 4E8EA 2H19A 5D96A 2RIIA 2MMAA 1GSDA 3P7XA 3ZL5A 1GNWA 3WT1A 5A4VA 4IVFA 2O89A 1K0BA 1GUHA 1KNGA 1ZCPA 1GSFA 1SJIA 4Q5RA 1J0FA 2I1UA 1TP9A 4GCIA 3D5JA 5B6MA 3UEMA 2I4AA 5ECPB 1THXA 3TRPA 3TOTA 5CRWA 2H01A 3Q74A 3ME8A 5B8BA 3E9JB 3ZFLA 16GSA 5LCZA 2GZZA 4LLRA 1OE7A 2J23A 2GT6A 3QMXA 3PR8A 4IELA 4ZB6A 1GP1A 2L6CA 4KCEA 5F06A 4POLA 19GSA 1UC7A 2JADA 2VL9A 4HQSA 2HRAA 1G7OA 1GTAA 4OO4A 1FVKA 2MBSA 1HQOA 3TJBA 5EY6A 4KDYA 2HSHA 5ENUA 2LTKA 2LQQA 1WOUA 11GSA 3CTFA 1HYUA 4K2DA 3TOUA 3ERWA 2YNXA 3LWAA 2L4QA 1XWBA 2B5EA 2V2GA 2VM2A 4FYBA 2C80A 4TXOA 2NBSA 2KUCA 1DBYA 3BCKA 2JACA 1MD4A 3LYPA 4X0XA 3GX8A 3CTGA 5B8AA 5J9CA 3TRQA 4G9HA 2OE1A 3O76A 2HNLA 2HYXA 3TRXA 4IW9A 2VLVA 4IP6A 2LNSA 3Q18A 5DBQA 4MJEA 1DE1A 5DALB 4F0BA 1K3YA 2H30A 1SKSB 3LSZA 4CDOA 4YQUA 1FO5A 1K0OA 1VF4A 1W89A 3GTUA 4IQAA 4WR5A 1ACVA 5J9BA 2MYGA 2CZ3A 3G7JA 3IXRA 1SK2A 3W8SA 4I2TA 1PQNA 1NHYA 1CQGA 3K8NA 2VD1A 4MF7A 3GH9A 2C0GA 4I6XA 1GTIA 1DUGA 8GSSA 1ZL9A 2JZTA 4BA7A 4AGSA 2LUSA 2H74A 2JSZA 1Q4JA 4BVXB 1SU9A 4POMA 5IM9A 4ZBAA 1BG5A 2M72A 3F63A 1ZOFA 3C8EA 1EGOA 2HE3A 3IPZA 5KN3A 2VCXA 2YZHA 2VLTA 5IMDA 4YH2A 3C71A 4BVYA 1X5EA 3KP9A 3N5OA 1A0RP 2VD0A 4JR4A 1F3BA 2L5OA 2RUFA 3HCZA 2LJAA 4MZCA 2O85A 2OBKA 5IIZA 3QFBC 3KGKA 3TJJA 1UN2A 2PVQA 5JWRB 1K0AA 2R6KA 4K8MA 5LNKe 4GSTA 1XCCA 3IK7A 5GSSA 2RUEA 2HFDA 1FB6A 1F2EA 4NHZA 1X9MB 5AGYA 6GSYA 2B6MA 3HDCA 1SD8A 1G7EA 1TW9A 1SK0A 1F3AA 1T4YA 2FA4A 3N9JA 5A5KA 1WMJA 4TR1B 2GSSA 4NWYA 3H4KA 4HUAA 4K0NA 5ECNB 5HFGA 2DJJA 1B48A 1Z7RA 3ZVJD 1GULA 3IA1A 2EIQA 1OKTA 2MMZA 1XBSA 4TR3A 2R2JA 2VIMA 4XRAA 2ES7A 2R3XA 5G1KA 3IAM2 1B4PA 2ALBA 2IPAA 4PUAA 3GN3A 5A4UA 4RI7A 2H0IA 1ERWA 3A2XA 3G9BA 1LU4A 4GSSA 1ML6A 1GH2A 1T7PB 2J9HA 2TIRA 3QDNA 4K0GA 3TKPA 3UVTA 3IRAA 3FR3A 5C04A 3Q19A 1BAYA 3HYPA 4N0ZA 1TKDB 1W4VA 1E2YA 4O5RA 2UZ8A 2ON5A 1QUWA 2WRTA 1R7HA 1BEDA 1WE0A 3FZ4A 2DMLA 1MDIA 2IMDA 3FKFA 3DD3A 4USSA 4WETA 7GSSA 3IE3A 4NMUA 4ULXA 2F8FA 3H1NA 3PH9A 3IC4A 1G6WA 5G1LA 1AW9A 4IS0A 2CAIA 3QAVA 5F07A 2KHPA 2I9HA 1WP0A 2QGVA 3V1WA 1EOHA 2K18A 3APSA 1H4OA 2FA8A 3DWVA 1JZWA 2DMMA 3CXGA 4ECJA 2R4VA 4QL7A 3HXSA 3HKRA 3LJRA 5FT3A 4CW9A 2C0DA 2Z9SA 1K3OA 2VLUA 4MK3A 2O87A 2VO4A 1RW1A 2X8HA 3ZYWA 4OFTA 2VL3A 2C3NA 2AV4A 3QAGA 1U87A 3VLNA 2GSRA 5DALA 20GSA 3HZ4A 5HR1A 3TKSE 3EE2A 5D73A 3GA4A 4G0KA 2IFQB 3FK8A 2KOKA 4MJCA 1PX6A 1BJXA 3LGCA 3IOSA 1V57A 4KF9A 3GH6A 4RQXA 3GMFA 3WGEA 2PUKC 1X9SB 2LJKA 1S3CA 2FUG2 2HRFA 2H6XA 1SL1B 2C1YA 3L9SA 5ECKB 4ZXGA 3QPMA 1YQ1A 2CAQA 3C1SA 1GLQA 4HZ2A 1BX9A 3HJOA 2QSIA 3EVIA 2E0QA 3JCML 1A0FA 1WPIA 2YWMA 4WF4A 3EMXA 3HD5A 5ABRA 3TUEA 4ZB9A 1NW2A 1V2AA 1QGVA 1Z9HA 2V32A 1OVNA 3D6IA 4O7HA 2PU9C 1GLPA 3C73A 1CQHA 1Y6EA 3RPNA 2FY6A 3ME7A 1ERVA 1SL2B 4PXOA 1GSUA 1HD2A 3NIVA 5CNWA 2VM1A 1GSEA 5L71A 5AISA 1XWGA 4WBRD 1A23A 1GTUA 1VRSD 5KN1A 3WGDA 3VFIA 2DJ1A 2MZCA 3IHQA 1KTEA 1A2MA 1M99A 1HNAA 3LXTA 4K7OA 5DCHA 5G31A 2H1BA 2F8AA 3SBCA 2XBIA 3HVSA 4HJMA 5LD0A 3KJYA 2MMNA 1IYIA 1PD21 2WGRA 1V58A 4H86A 2DJ0A 2LRTA 1QK8A 3QCPA 2YOIA 3DEXA 1PL2A 1V9WA 2IWTA 1XW9A 1K3LA 5EL8A 5ECRB 1XOBA 3LFLA 4QQ7A 1WRYA 4IKHA 3O3TA 4KSOA 4XHMA 4X43A 3H93A 2X99A 1R5AA 1GUKA 3UBKA 2EC4A 2WZ9A 4YQVA 2OACA 4MF6A 1RQMA 5JWOB 1QMVA 4BWSA 1FVJA 1XZOA 3FY7A 4DSSB 4EUYA 4FQUA 1S3DA 4FYUA 4MP4A 3KTBA 4XCSA 2C0EA 1A24A 2GTUA 2JU5A 4V1Ag 2A2RA 3O6TA 3A2WA 2YANA 2CV4A 3F4SA 4MF5A 3VWWA 2P0GA 3LORA 5IMFA 4MZBA 1F6MC 1Z5YE 3L0HA 5ID2B 4GLTA 1ZZYA 4PURA 1A2JA 5CAXA 2ZCTA 3DVWA 4N11A 4JEDA 3PINA 1JFUA 4X1UA 1XWKA 3L9UA 1PL1A 1J08A 4NV5A 2WS2A 4TR0A 1SJ6A 2C3TA 4EXJA 3KH9A 3LEFA 4L0UA 5G5EA 1TU7A 3ERGA 1KBNA 3HA9A 3DKSA 1O81A 2WULA 4TN8A 3FZAA 5IOXA 5ECHB 2E7PA 2HI7A 2R5GA 3LXZA 4EDZA 3EURA 2IMKA 2NVLA 1TRSA 5H5RA 1LJRA 2QKEA 3PGTA 2VCTA 3RAZA 1OE8A 3KD0A 4DSQA 5ECQB 3ED3A 3M9KA 4RUVA 3UOMA 3CSIA 3KH7A 1EOGA 2B5YA 1H75A 5IOWA 1VF2A 4JR6A 1T00A 1R26A 4HJ2A 2WFCA 1HNBA 3L4NA 3GL5A 1K0DA 5GAPD 2IIYA 4OMVA 4KDXA 1Z6NA 2H76A 3UVHA 1R4WA 2H71A 2PN8A 3IAS2 1EV9A 3CRUA 2M46A 3G7YA 3TKQA 3ZMLA 1M2AA 3EU4A 1THOA 1M2DA 2A2SA 3GKKA 2B7KA 3GSTA 4OFNA 5D9VA 2H70A 2B7JA 4HZ4A 2LKUA 2C8UA 1FB0A 5IPHA 5KEJA 1K0NA 3BOAA 3GSSA 4EC0A 4WBJA 4HU9A 2H8LA 2JSYA 2TRCP 1C72A 1M2BA 1V40A 1K0CA 5CRHA 5F05A 5EPFA 1GSSA 2PGTA 2RM6A 4WF5A 2QC7A 3ZITA 1FOVA 1TTZA 2H72A 1O8WA 1QQ2A 1ILOA 4MH2A 3TJGA 6GSUA 3BJ5A 1F37A 2K8VA 4KAEA 4NHWA 1VF1A 2FHEA 2P5RA 1TI1A 1SK1A 5CRGA 3P90A 1X9WB 1XOAA 1A2LA 1FG4A 2LEGA 1AIUA 3HVXA 2C4JA 2AYTA 4MH3A 2PERA 4XRDA 1M7TA 3PPUA 1OYJA 5ECOB 3CSHA 5J4UA 22GSA 4LL4B 4G2EA 5KN0A 2ON7A 4IQ1A 2NPBA 4KB3A 3G7IA 1XW6A 4WR4A 5ECIB 3BD2A 3VWUA 4GSNA 4KDUA 4PQIA 5HR3A 1GSQA 1YY7A 2R37A 3EU3A 2CZ2A 2DSAA 3W6GA 5D93A 4ZBBA 4BL7A 1SYXA 5HFKA 5GSTA 5DJLA 3J7Yk 3UL3A 4PGTA 5DCGA 2FGXA 2GZYA 2P31A 4NV2A 3WD6A 4DSSA 2AAWA 1JLWA 1PSQA 1PGTA 3VURA 2FWEA 3UIWA 5DJMA 5IO0A 4F2IA 1EV4A 2B5XA 3QAWA 3U5RE 2H6YA 3HVVA 2GVPA 4V2LA 1AQWA 1XVWA 1XFLA 1GRXA 1M0UA 1OAZA 1OC9B 4HS1A 3ZREA 3LQ7A 5JWQB 1X5CA 1O73A 4ZL9A 2B3SA 3M3MA 3LYKA 1TI3A 4V2MA 1BYEA 1K0MA 1OC8A 5COHA 5DDLA 4POBA 3FW2A 5DQSA 2GZPA 2PPTA 3A3TA 13GSA 3HY2A 1TRWA 3DMLA 1ON4A 3KZQA 3GL3A 3WYWA 1TRUA 1Y25A 3TKSC 2H0HA 3F4TA 4IBPA 2KP1A 2LNTA 4BWQA 1GWCA 4ML1A 1AQXA 4NPBA 3F3RA 2X8GA 2G2QA
chains in the Genus database with same CATH superfamily
3H79A 3VK9A 5J3RA 3ZFBA 1AUCA 3D4MA 2GLRA 3MNGA 4EIPA 3D0ZA 5G2ZA 2VOCA 4E8HA 3EINA 3FEUA 2L6DA 2GSQA 4O5QA 3IC8A 2VL2C 1S3AA 5D8IA 3UMAA 2TRXA 1RK4A 4I8BA 3RPPA 5B6NA 4EVMA 5E59A 5ELAA 4ZB7A 4J57E 3DGQA 3F9UA 4ZL7A 2YZUA 2VAFA 2HSMB 2HRNA 2V1MA 4F0CA 2CVKA 2MMOA 1XIYA 4I2UA 3MYDA 3FHKA 2K8SA 1TXXA 1EP8A 3U6VA 1SKRB 4JZQA 2CX4A 4YAVA 1EP7A 2R0PA 3KEBA 4HOJA 2BTOT 2LS5A 1TOFA 1O8XA 3S9FA 2LV3A 3HMJG 1TRVA 2E2GA 4ID0A 2AUVA 3DRNA 5J5NA 2E2MA 1XVQA 3RDWA 5E4WA 1Z7PA 1PMTA 4OO5A 17GSA 4ML6A 4W66A 1DE2A 4BVXA 2EFDA 1AAZA 4PNFA 4LA1A 4PNGA 2JL4A 6GSTA 3E3EA 4GQCA 3C7MA 4K7NA 2IMFA 3UAPA 2OE3A 4AF2A 2WVZA 2DIZA 1FW1A 4XS6A 4Z2TA 1UA5A 4TVEA 1AQVA 3F0IA 1OKDA 4GF0A 1SL0B 2WDUA 2XC2A 5CREA 2YJHA 3L78A 3CBUA 2CA8A 5INYA 3WT2A 4JE1A 4F03A 1G6YA 18GSA 2H73A 1MTCA 2H66A 3MWHA 2H75A 1V98A 2G0FA 2VUPA 3H8QA 3MAKA 4Q5FA 4ZB8A 2WVXB 5H5SA 1E6BA 1YZXA 3F3QA 5IQYA 1A8YA 4EL1A 4BVYB 4TR1A 3FRCA 1XXUA 1BF5A 3Q6OA 1FAAA 1YF0A 3VI7A 4JBBA 3TU3B 3F4RA 4I97A 3APQA 4O32A 2HT9A 1Z3EA 2IMEA 3CSJA 4WEYA 5HR2A 1PX7A 1HNCA 1QFNA 1ZYQB 4IN0A 2IN3A 1I5GA 3L9VA 1ZYEA 1OC9A 1MD3A 5DAKB 5DQYA 5G30A 2PMTA 2HRKB 5FHIA 5A4WA 3M8NA 3TCOA 3GHAA 4RQRA 3FMWA 3EMPA 2GS3A 4NAXA 2FWHA 2XHFA 2OKAA 4KUNA 4Z2UA 4D73B 4HQZA 1GL8A 4LMWA 2L59A 3VWXA 1XWAA 3FZ9A 1YF1A 2YPMA 3HVNA 3BCIA 4PTSA 1ZYNA 5KN2A 2VCQA 3GKXA 2IL3A 4G0IA 4ECBA 3E0UA 2YN1A 2VKZG 3ZLPA 5H5QA 4PUFC 1URMA 1EWXA 1ST9A 1VF3A 3IDVA 5CO3A 5IMCA 5D9XA 3D21A 5B7CA 2WB9A 3MSZA 4X4JA 2GQKA 4G10A 1F9MA 2YV9A 2V6KA 1N8JA 3EWLA 4MLYA 2YCDA 4RI6A 4POKA 4KE3A 1O7UA 4HEA2 4WXTA 1YEWC 3D4TA 4EIQA 4ECIA 5J41A 2HSMA 4J56E 3P8WA 4L8EA 3KM6A 5AN1A 3CMIA 1EZKA 5CP1A 2XPDA 4G19A 4BPYA 2IFQA 2FWFA 4KA0A 5EVOA 4HDEA 3AY8A 3ZRDA 3OR5A 3FYGA 3I69A 4AKXB 4AJ8A 2GT5A 1PRXA 3HJMA 1X5DA 4FIWA 4CHSA 5F0GA 1PKWA 1GUMA 4P3YB 4DSRA 3CHXC 1LBKA 10GSA 3GKNA 4ZL8A 3LG6A 3MDKA 5ECMB 4EF0A 2AB6A 2L4CA 1U3IA 2LRCA 1XWCA 2OA7A 1WJKA 6GSSA 3DVXA 4EE0A 2D2ZA 4WKWA 1T4ZA 1GNEA 4XS4B 4OD7A 3I9V2 4ZILA 1XPVA 1GSYA 1QXHA 2LSTA 4EO3A 4XIHA 1U6TA 1M9AA 4ZIJA 2DJKA 3KMNA 4K6XA 2ZNMA 3GUSA 1X0RA 2L5LA 1T3BA 3LW9A 3KP8A 3R3EA 2CQ9A 3EYTA 4PHZC 3EPTA 2YP6A 4K5RA 4O92A 4N0VA 2GGTA 3QFAC 5IMAA 4NXIA 3TB2A 1USBA 3APOA 9GSSA 4PQ1A 1U88A 1ABAA 3VWVA 1MDKA 2M80A 3IR4A 1JZDA 4KW6A 3J7Yb 2WVXA 3M9JA 5JCGA 3TDGA 4PX1A 4GTUA 6GSWA 3W8JA 1N2AA 2VCWA 3GRXA 4KGIA 2REMA 2DKIA 1Q98A 2IJYA 1IYHA 2DLXA 1NSWA 4EDYA 4Q5NA 2AHEA 2CVDA 2QA1A 1SVOA 3D22A 2WW0A 4F9ZA 2EFHA 1ERUA 4N3ZA 3GIXA 1O6JA 1JLVA 1TU8A 2P5QA 4DVCA 3HJPA 3A5IA 4TKYA 5IMVA 5BMUA 4ACSA 3ZIJA 1PA3A 2FNOA 3QD9A 2H0GA 1UVZA 4PQHA 14GSA 5J4VA 4V2NA 1XW5A 5DAKA 3FR9A 1WWJA 2DJ2A 2K9FA 4GXZA 4ISDA 2XPEA 2F3MA 2HRKA 2YWOA 5GAND 5AIVA 4L0WA 1YKAA 1YEXA 4ECCA 3R2QA 3UARA 1YVLA 1SJZA 2I3YA 1ERTA 5FWGA 4MCUA 5D9WA 5JCUA 4D73A 3SWLA 4HU7A 3RHBA 1T8EB 2HZEB 5ID2A 2H1DA 3RHCA 3C1RA 4YQMA 4I5QA 1U3AA 2ZUPA 4JU5A 4MMMA 2BMXA 4OCEA 1GTBA 1B9YC 1G0TA 2OE0A 3TJFA 3F6DA 2N5BA 4AJ7A 3KMOA 3M0FA 4TRXA 4MJAA 3KCMA 2V6OA 4Z7XA 3KTLA 4MZWA 2H1AA 5F8BA 1AXDA 4G0LA 3IHGA 5A1NA 1XG8A 4IJIA 3WGXA 2NTOA 3GNJA 1YDKA 4MPGA 2OBIA 4TXVA 2O7KA 4G01A 3TKRA 2CX3A 2OJLA 4IGJA 3ZZXA 3US3A 2I81A 2DC5A 3GYKA 4MJBA 4LL1B 4GWRA 1YEPA 3ISOA 1TK0B 3EC3A 2A4VA 2VCZA 3ERFA 5DVBA 1B4QA 2IMIA 4MABA 2B1LA 5IPGA 4Q5QA 2O8VB 4F82A 3VPTA 2YJ7A 3TKSA 2PBJA 3TGZA 4QL9A 2XBQA 6GSVA 3DYRA 2F51A 3GURA 2L57A 1NM3A 1NHOA 4A5PA 1ZGNA 1B9XC 2CVBA 2X4AA 2H6ZA 3UJ1A 5J47A 3TJKA 1SYRA 4N10A 5G5FA 2EIRA 1EEMA 1TK8B 4GDFA 1KEBA 4MA9A 3KIJA 12GSA 3QOUA 1ZMAA 4MPFA 3ZVJA 2VL2A 2CT6A 3GKMA 4ILFA 1SKWB 1PN0A 2YWIA 2VCVA 2FLSA 1FHEA 4OWYA 4J2FA 2HQTA 4IP1A 2RM5A 4L5OA 4IJ3A 2NDOA 5IMZA 3CRTA 1PFOA 2V41A 1R5PA 4EKZA 2JZSA 2WJUA 1YJ6A 4TXOB 3I6AA 3UBLA 1MDJA 1Z6MA 3IK9A 1YKCA 1MEKA 2AJQB 4GRFA 2N5FA 2HSYA 2PVOC 3VPQA 5JCWA 3HHVA 5ELGA 3FZ5A 4CY6A 3RBTA 1JHBA 3FR6A 4XS4A 1EGRA 3I43A 2DBCA 2HSNB 2OADA 3M1GA 3GFKA 2KP2A 1TDIA 4K9ZA 3DXBA 1B8XA 3F6FA 5A5HB 2H1GA 2YV7A 2LQOA 3GTUB 1M3JA 2RLIA 1A8LA 2HZFA 5HR0A 1PN9A 4KH7A 2X64A 5HFIA 2PWJA 1SVLA 4KCAA 2DJ3A 1AC1A 4JRRA 3HZ8A 2C0FA 2YWNA 4TW5A 4TOPA 1OC3A 2HLSA 3CYNA 5IO2A 4TR4A 2EIOA 3BBYA 4OFMA 4YAPA 4N30A 1PKZA 4L5LA 1DSBA 2C3QA 2HXKA 2MBTA 6GSXA 1TJDA 2FD3A 2X8CA 2BJXA 1EEJA 4KX4A 1JZRA 2F9SA 2DKHA 4KSMA 3NOFA 4MDCA 2LJRA 2N5AA 2K6VA 5GZZB 1TK5B 1J9BA 4FH8A 1M9BA 3IV4A 4XS1A 2LRNA 4V1Ap 2DIYA 3NZNA 2GDRA 3ZIVA 5CYYA 5D9TA 3F8UA 3GX0A 5ECSA 3P2AA 5C00A 1BQ7A 1T1VA 4OCFA 3ZMKA 1SENA 3QR6A 2KLXA 2GSTA 5HQPA 3ZTLA 4Z2RA 5AIXA 4HI7A 1SD9A 3DIEA 4XTSA 4FO5A 3KXOA 3IBHA 2JZRA 2GQLA 2B1KA 3A2VA 4AJ6A 5KOXA 5J40A 4FYCA 2GQMA 3VI5A 3GV1A 4DEJA 1VGLA 1O85A 1JZOA 4GQFA 5CRDA 1WIKA 5ECLB 2HZEA 4KNDA 4IHUA 1I9DA 2FCHA 2FWGA 2WCIA 4LMVA 4K7IA 3A5WA 4ZBDA 4BL7B 4AI6A 4K1FA 4E8EA 2H19A 5D96A 2RIIA 2MMAA 1GSDA 3P7XA 3ZL5A 1GNWA 3WT1A 5A4VA 4IVFA 2O89A 1K0BA 2OT3A 1GUHA 1KNGA 1ZCPA 1GSFA 1SJIA 4Q5RA 1J0FA 2I1UA 1TP9A 4GCIA 4E68A 3D5JA 5B6MA 3UEMA 2I4AA 5ECPB 1THXA 3TRPA 3TOTA 5CRWA 2H01A 3Q74A 4PI0C 3ME8A 5B8BA 3E9JB 3ZFLA 16GSA 5LCZA 2GZZA 4LLRA 1OE7A 2J23A 1TXUA 2GT6A 3PR8A 3QMXA 4IELA 4ZB6A 1GP1A 2L6CA 4KCEA 5F06A 4POLA 19GSA 1UC7A 2JADA 2VL9A 4HQSA 2HRAA 1G7OA 1GTAA 4OO4A 1FVKA 2MBSA 1HQOA 3TJBA 5EY6A 4KDYA 2HSHA 5ENUA 2LTKA 2LQQA 1WOUA 5BRTA 11GSA 3CTFA 1HYUA 4K2DA 1ZYPA 3TOUA 3ERWA 2YNXA 2R0GA 3LWAA 2L4QA 1XWBA 2B5EA 2V2GA 2VM2A 4FYBA 2C80A 4TXOA 2NBSA 2KUCA 1DBYA 3BCKA 2JACA 1MD4A 3LYPA 4X0XA 3GX8A 3CTGA 5B8AA 1BG1A 5J9CA 5J4YA 3TRQA 4G9HA 2OE1A 3O76A 2HNLA 2HYXA 3TRXA 4IW9A 2VLVA 4IP6A 2LNSA 3Q18A 5DBQA 4MJEA 4AKHA 1DE1A 5DALB 4F0BA 1K3YA 2H30A 1SKSB 2HSNA 3LSZA 4CDOA 4YQUA 1FO5A 1K0OA 5A5HA 1VF4A 1W89A 3GTUA 4IQAA 2QA2A 4WR5A 1ACVA 5J9BA 2MYGA 2CZ3A 4FXYP 2WVYA 3G7JA 3IXRA 1SK2A 3W8SA 4I2TA 1PQNA 2WW2A 1NHYA 1CQGA 3K8NA 2VD1A 4MF7A 3GH9A 2C0GA 4I6XA 1GTIA 1DUGA 8GSSA 1ZL9A 2JZTA 4BA7A 4AGSA 4CY8A 2LUSA 2WZSA 2H74A 2JSZA 1Q4JA 4BVXB 1SU9A 4POMA 5IM9A 4ZBAA 1BG5A 2M72A 3F63A 1ZOFA 3C8EA 1EGOA 2HE3A 3IPZA 5KN3A 5A34B 5KOWA 2VCXA 2YZHA 2VLTA 5IMDA 4YH2A 3MIXA 3C71A 2O5VA 4BVYA 1X5EA 3KP9A 3N5OA 1A0RP 2VD0A 4JR4A 1F3BA 2L5OA 2RUFA 3HCZA 2LJAA 4MZCA 2O85A 2OBKA 5IIZA 3QFBC 3KGKA 3TJJA 1UN2A 2PVQA 5JWRB 2O3EA 1K0AA 2R6KA 4K8MA 5LNKe 4GSTA 1XCCA 3IK7A 1Y1UA 5GSSA 2RUEA 2HFDA 1FB6A 1F2EA 4NHZA 1X9MB 5AGYA 6GSYA 2B6MA 3HDCA 1SD8A 1G7EA 1TW9A 1SK0A 1F3AA 1T4YA 2FA4A 3N9JA 5A5KA 1WMJA 4TR1B 2GSSA 4NWYA 3H4KA 4HUAA 4K0NA 5ECNB 5HFGA 2DJJA 1B48A 1Z7RA 3ZVJD 1GULA 3IA1A 2EIQA 1OKTA 2MMZA 1XBSA 2A4HA 4TR3A 2R2JA 2VIMA 4XRAA 2ES7A 2R3XA 5G1KA 3IAM2 1B4PA 2ALBA 2IPAA 4PUAA 3GN3A 5A4UA 4RI7A 2H0IA 3A2XA 1ERWA 3G9BA 1LU4A 4GSSA 1ML6A 1GH2A 1T7PB 2J9HA 2TIRA 3QDNA 4K0GA 3TKPA 3UVTA 3IRAA 3FR3A 5C04A 3Q19A 1BAYA 3HYPA 4N0ZA 1TKDB 1W4VA 1E2YA 4O5RA 2UZ8A 2ON5A 1QUWA 2WRTA 1R7HA 1BEDA 1WE0A 3FZ4A 2DMLA 1I1IP 1MDIA 2IMDA 3FKFA 3DD3A 4USSA 4WETA 7GSSA 3IE3A 4NMUA 4ULXA 2F8FA 3H1NA 3PH9A 3IC4A 1G6WA 5G1LA 1AW9A 3RGBC 4IS0A 2CAIA 3QAVA 5F07A 2KHPA 2I9HA 1WP0A 2QGVA 3V1WA 1EOHA 2K18A 3APSA 1H4OA 2FA8A 3DWVA 1JZWA 2DMMA 3CXGA 4K5SA 4ECJA 2R4VA 4QL7A 3HXSA 3HKRA 3LJRA 5FT3A 4CW9A 2C0DA 2Z9SA 1K3OA 4YKGA 2VLUA 4MK3A 2O87A 2VO4A 1RW1A 2X8HA 3ZYWA 4OFTA 2VL3A 2C3NA 2AV4A 3QAGA 1U87A 3VLNA 2GSRA 5DALA 20GSA 3HZ4A 5HR1A 3TKSE 3EE2A 5D73A 3GA4A 4G0KA 2IFQB 3FK8A 2KOKA 4HSCX 4MJCA 1PX6A 1BJXA 1M3IA 3LGCA 3IOSA 1V57A 4KF9A 3GH6A 4RQXA 3GMFA 3WGEA 2PUKC 1X9SB 2LJKA 1S3CA 2FUG2 2HRFA 2H6XA 1SL1B 2C1YA 3L9SA 5ECKB 4ZXGA 3QPMA 1YQ1A 2CAQA 3C1SA 1GLQA 4HZ2A 1SVMA 1BX9A 3HJOA 2QSIA 3EVIA 2E0QA 3JCML 1A0FA 1WPIA 2YWMA 4BIKA 4WF4A 3EMXA 3HD5A 5ABRA 3TUEA 4ZB9A 1NW2A 1V2AA 1QGVA 1Z9HA 2V32A 1OVNA 3D6IA 4O7HA 2PU9C 1GLPA 3C73A 1CQHA 1Y6EA 3RPNA 5A34A 2FY6A 3ME7A 1ERVA 1SL2B 4K2XA 4PXOA 1GSUA 1HD2A 3NIVA 5CNWA 2VM1A 2UV8G 1GSEA 3CQFA 5L71A 5AISA 1XWGA 4WBRD 1A23A 1GTUA 1VRSD 5KN1A 3WGDA 4QMKA 2DJ1A 2MZCA 3VFIA 3IHQA 1KTEA 1A2MA 1M99A 1HNAA 3LXTA 4K7OA 5DCHA 5G31A 2H1BA 2F8AA 3SBCA 2XBIA 3HVSA 4HJMA 5LD0A 3KJYA 2MMNA 1IYIA 1PD21 2WGRA 1V58A 4H86A 2DJ0A 2LRTA 1QK8A 3QCPA 2YOIA 3DEXA 1S4BP 1PL2A 1V9WA 4AKIA 2IWTA 1XW9A 1K3LA 5EL8A 5ECRB 1XOBA 3LFLA 4QQ7A 1WRYA 4MNNA 4IKHA 3O3TA 4KSOA 4XHMA 4X43A 3H93A 2X99A 1R5AA 1GUKA 3UBKA 2EC4A 2WZ9A 4YQVA 2OACA 5BMUB 4MF6A 1RQMA 5JWOB 1QMVA 4BWSA 1FVJA 1XZOA 3FY7A 4DSSB 4EUYA 3RFRC 4FQUA 1S3DA 4FYUA 4MP4A 3KTBA 4XCSA 2C0EA 2WW1A 1A24A 2GTUA 2JU5A 4V1Ag 2A2RA 3O6TA 3A2WA 2YANA 2CV4A 3F4SA 4MF5A 2X49A 3VWWA 2P0GA 3LORA 5IMFA 4MZBA 1F6MC 1Z5YE 3L0HA 5ID2B 4GLTA 1ZZYA 4PURA 1A2JA 5CAXA 2ZCTA 3DVWA 4N11A 4JEDA 3PINA 1JFUA 4X1UA 1XWKA 3L9UA 1PL1A 1J08A 4NV5A 4O5UA 2WS2A 4TR0A 1SJ6A 2C3TA 4EXJA 3KH9A 3LEFA 4L0UA 5G5EA 1TU7A 3ERGA 1KBNA 5A1NB 3HA9A 3DKSA 1O81A 2WULA 4TN8A 3FZAA 5IOXA 5ECHB 3CWGA 2E7PA 2HI7A 2R5GA 3LXZA 4EDZA 3EURA 2IMKA 2NVLA 1TRSA 5H5RA 1FOHA 1LJRA 2QKEA 3PGTA 2VCTA 3RAZA 1OE8A 3KD0A 4DSQA 5ECQB 3ED3A 3M9KA 4RUVA 3UOMA 3CSIA 3KH7A 2O36A 1EOGA 2B5YA 1H75A 5IOWA 1VF2A 4JR6A 1T00A 1R26A 4HJ2A 2WFCA 1HNBA 3L4NA 3GL5A 1K0DA 5GAPD 2IIYA 4OMVA 4KDXA 1Z6NA 2H76A 3UVHA 1R4WA 2H71A 2PN8A 3IAS2 1EV9A 3CRUA 2M46A 3G7YA 3TKQA 3ZMLA 1M2AA 3EU4A 1THOA 1M2DA 2A2SA 3GKKA 2B7KA 3GSTA 4OFNA 5D9VA 2H70A 2B7JA 4HZ4A 2LKUA 2C8UA 1FB0A 5IPHA 5KEJA 1K0NA 3BOAA 1N25A 3GSSA 4EC0A 4WBJA 2EFEA 4HU9A 2H8LA 2JSYA 2TRCP 1C72A 1M2BA 1V40A 1K0CA 5CRHA 2A2PA 5F05A 5EPFA 1S3RA 1GSSA 2PGTA 2RM6A 4WF5A 2QC7A 3ZITA 1FOVA 1TTZA 2H72A 1O8WA 1QQ2A 1ILOA 4MH2A 2EFCA 6GSUA 3BJ5A 4YKFA 3TJGA 1F37A 2K8VA 4KAEA 4NHWA 1VF1A 2FHEA 2P5RA 1TI1A 1SK1A 5CRGA 3P90A 1X9WB 1XOAA 1A2LA 1FG4A 2LEGA 1AIUA 3HVXA 2C4JA 2AYTA 2WW3A 4MH3A 2PERA 4XRDA 1M7TA 3PPUA 1OYJA 5ECOB 3CSHA 5J4UA 22GSA 4LL4B 4G2EA 5KN0A 2ON7A 4IQ1A 2NPBA 4KB3A 3G7IA 1XW6A 4WR4A 5ECIB 3BD2A 3VWUA 4GSNA 4KDUA 4PQIA 5HR3A 1GSQA 1YY7A 2R37A 3EU3A 2CZ2A 2DSAA 3W6GA 5D93A 4ZBBA 4BL7A 1SYXA 5HFKA 5GSTA 5DJLA 3J7Yk 3UL3A 4PGTA 5DCGA 2H1LA 2FGXA 2GZYA 2P31A 4NV2A 3WD6A 4DSSA 2AAWA 1JLWA 1PSQA 1PGTA 3VURA 2FWEA 4ICYA 3UIWA 5DJMA 5IO0A 4F2IA 1EV4A 2B5XA 3QAWA 3U5RE 2H6YA 3HVVA 2GVPA 4V2LA 1AQWA 1XVWA 1XFLA 1GRXA 1M0UA 1OAZA 1OC9B 4HS1A 3ZREA 3LQ7A 5JWQB 1X5CA 1O73A 4ZL9A 2B3SA 3M3MA 4AKGA 3LYKA 1TI3A 4V2MA 4PI2C 1BYEA 1K0MA 1OC8A 5COHA 5DDLA 4POBA 3FW2A 5DQSA 2GZPA 2PPTA 3A3TA 13GSA 3HY2A 1TRWA 3DMLA 1ON4A 3KZQA 3GL3A 3WYWA 1TRUA 1Y25A 3TKSC 2H0HA 3F4TA 4IBPA 2KP1A 2LNTA 4BWQA 2R0CA 1GWCA 4ML1A 1AQXA 4NPBA 3F3RA 2X8GA 2G2QA
chains in the Genus database with same CATH topology
3H79A 3VK9A 5J3RA 3ZFBA 1AUCA 3D4MA 2GLRA 3MNGA 4EIPA 3D0ZA 5G2ZA 2VOCA 4E8HA 3EINA 3FEUA 2L6DA 2GSQA 4O5QA 3IC8A 2VL2C 1S3AA 5D8IA 3UMAA 2TRXA 1RK4A 4I8BA 3RPPA 5B6NA 4EVMA 5E59A 5ELAA 4ZB7A 4J57E 3DGQA 3F9UA 4ZL7A 2YZUA 2VAFA 2HSMB 2HRNA 2V1MA 4F0CA 2CVKA 2MMOA 1XIYA 4I2UA 3MYDA 3FHKA 2K8SA 1TXXA 1EP8A 3U6VA 1SKRB 4JZQA 2CX4A 4YAVA 1EP7A 2R0PA 3KEBA 4HOJA 2BTOT 2LS5A 1TOFA 1O8XA 3S9FA 2LV3A 3HMJG 1TRVA 2E2GA 4ID0A 2AUVA 3DRNA 5J5NA 2E2MA 1XVQA 3RDWA 5E4WA 1Z7PA 1PMTA 4OO5A 17GSA 4ML6A 4W66A 1DE2A 4BVXA 2EFDA 1AAZA 4PNFA 4LA1A 4PNGA 2JL4A 6GSTA 3E3EA 4GQCA 3C7MA 4K7NA 2IMFA 3UAPA 2OE3A 4AF2A 2DIZA 1FW1A 4XS6A 4Z2TA 1UA5A 4TVEA 1AQVA 3F0IA 1OKDA 4GF0A 1SL0B 2WDUA 2XC2A 5CREA 2YJHA 3L78A 3CBUA 2CA8A 5INYA 3WT2A 4JE1A 4F03A 1G6YA 18GSA 2H73A 1MTCA 2H66A 3MWHA 2H75A 1V98A 2G0FA 2VUPA 3H8QA 3MAKA 4Q5FA 4ZB8A 5H5SA 1E6BA 1YZXA 3F3QA 5IQYA 1A8YA 4EL1A 4BVYB 4TR1A 3FRCA 1XXUA 1BF5A 3Q6OA 1FAAA 1YF0A 3VI7A 4JBBA 3TU3B 3F4RA 4I97A 3APQA 4O32A 2HT9A 1Z3EA 2IMEA 3CSJA 4WEYA 5HR2A 1PX7A 1HNCA 1QFNA 1ZYQB 4IN0A 2IN3A 1I5GA 3L9VA 1ZYEA 1OC9A 1MD3A 5DAKB 5DQYA 5G30A 2PMTA 2HRKB 5FHIA 5A4WA 3M8NA 3TCOA 3GHAA 4RQRA 3FMWA 3EMPA 2GS3A 4NAXA 2FWHA 2XHFA 2OKAA 4KUNA 4Z2UA 4D73B 4HQZA 1GL8A 4LMWA 2L59A 3VWXA 1XWAA 3FZ9A 1YF1A 2YPMA 3BCIA 4PTSA 1ZYNA 5KN2A 2VCQA 3GKXA 2IL3A 4G0IA 4ECBA 3E0UA 2YN1A 2VKZG 3ZLPA 5H5QA 4PUFC 1URMA 1EWXA 1ST9A 1VF3A 3IDVA 5CO3A 5IMCA 5D9XA 3D21A 5B7CA 2WB9A 3MSZA 4X4JA 2GQKA 4G10A 1F9MA 2YV9A 2V6KA 1N8JA 3EWLA 4MLYA 2YCDA 4RI6A 4POKA 4KE3A 1O7UA 4HEA2 4WXTA 3D4TA 4EIQA 4ECIA 5J41A 2HSMA 4J56E 3P8WA 4L8EA 3KM6A 5AN1A 3CMIA 1EZKA 5CP1A 2XPDA 4G19A 4BPYA 2IFQA 2FWFA 4KA0A 5EVOA 4HDEA 3AY8A 3ZRDA 3OR5A 3FYGA 3I69A 4AKXB 4AJ8A 2GT5A 1PRXA 3HJMA 1X5DA 4FIWA 4CHSA 5F0GA 1PKWA 1GUMA 4P3YB 4DSRA 1LBKA 10GSA 3GKNA 4ZL8A 3LG6A 3MDKA 5ECMB 4EF0A 2AB6A 2L4CA 1U3IA 2LRCA 1XWCA 2OA7A 1WJKA 6GSSA 3DVXA 4EE0A 2D2ZA 4WKWA 1T4ZA 1GNEA 4XS4B 4OD7A 3I9V2 4ZILA 1XPVA 1GSYA 1QXHA 2LSTA 4EO3A 4XIHA 1U6TA 1M9AA 4ZIJA 2DJKA 3KMNA 4K6XA 2ZNMA 3GUSA 1X0RA 2L5LA 1T3BA 3LW9A 3KP8A 3R3EA 2CQ9A 3EYTA 3EPTA 2YP6A 4K5RA 4O92A 4N0VA 2GGTA 3QFAC 5IMAA 4NXIA 3TB2A 1USBA 3APOA 9GSSA 4PQ1A 1U88A 1ABAA 3VWVA 1MDKA 2M80A 3IR4A 1JZDA 4KW6A 3J7Yb 3M9JA 5JCGA 3TDGA 4PX1A 4GTUA 6GSWA 3W8JA 1N2AA 2VCWA 3GRXA 4KGIA 2REMA 2DKIA 1Q98A 2IJYA 1IYHA 2DLXA 1NSWA 4EDYA 4Q5NA 2AHEA 2CVDA 2QA1A 1SVOA 3D22A 4F9ZA 2EFHA 1ERUA 4N3ZA 3GIXA 1O6JA 1JLVA 1TU8A 2P5QA 4DVCA 3HJPA 3A5IA 4TKYA 5IMVA 5BMUA 4ACSA 3ZIJA 1PA3A 2FNOA 3QD9A 2H0GA 1UVZA 4PQHA 14GSA 5J4VA 4V2NA 1XW5A 5DAKA 3FR9A 1WWJA 2DJ2A 2K9FA 4GXZA 4ISDA 2XPEA 2F3MA 2HRKA 2YWOA 5GAND 5AIVA 4L0WA 1YKAA 1YEXA 4ECCA 3R2QA 3UARA 1YVLA 1SJZA 2I3YA 1ERTA 5FWGA 4MCUA 5D9WA 5JCUA 4D73A 3SWLA 4HU7A 3RHBA 1T8EB 2HZEB 5ID2A 2H1DA 3RHCA 3C1RA 4YQMA 4I5QA 1U3AA 2ZUPA 4JU5A 4MMMA 2BMXA 4OCEA 1GTBA 1B9YC 1G0TA 2OE0A 3TJFA 3F6DA 2N5BA 4AJ7A 3KMOA 3M0FA 4TRXA 4MJAA 3KCMA 2V6OA 4Z7XA 3KTLA 4MZWA 2H1AA 5F8BA 1AXDA 4G0LA 3IHGA 5A1NA 4IJIA 3WGXA 2NTOA 3GNJA 1YDKA 4MPGA 2OBIA 4TXVA 2O7KA 4G01A 3TKRA 2CX3A 2OJLA 4IGJA 3ZZXA 3US3A 2I81A 2DC5A 3GYKA 4MJBA 4LL1B 4GWRA 1YEPA 3ISOA 1TK0B 3EC3A 2A4VA 2VCZA 3ERFA 5DVBA 1B4QA 2IMIA 4MABA 2B1LA 5IPGA 4Q5QA 2O8VB 4F82A 3VPTA 2YJ7A 3TKSA 2PBJA 3TGZA 4QL9A 2XBQA 6GSVA 3DYRA 2F51A 3GURA 2L57A 1NM3A 1NHOA 4A5PA 1ZGNA 1B9XC 2CVBA 2X4AA 2H6ZA 3UJ1A 5J47A 3TJKA 1SYRA 4N10A 5G5FA 2EIRA 1EEMA 1TK8B 4GDFA 1KEBA 4MA9A 3KIJA 12GSA 3QOUA 1ZMAA 4MPFA 3ZVJA 2VL2A 2CT6A 3GKMA 4ILFA 1SKWB 1PN0A 2YWIA 2VCVA 2FLSA 1FHEA 4OWYA 4J2FA 2HQTA 4IP1A 2RM5A 4L5OA 4IJ3A 2NDOA 5IMZA 3CRTA 2V41A 1R5PA 4EKZA 2JZSA 2WJUA 1YJ6A 4TXOB 3I6AA 3UBLA 1MDJA 1Z6MA 3IK9A 1YKCA 1MEKA 2AJQB 4GRFA 2N5FA 2HSYA 2PVOC 3VPQA 5JCWA 3HHVA 5ELGA 3FZ5A 4CY6A 3RBTA 1JHBA 3FR6A 4XS4A 1EGRA 3I43A 2DBCA 2HSNB 2OADA 3M1GA 3GFKA 2KP2A 1TDIA 4K9ZA 3DXBA 1B8XA 3F6FA 5A5HB 2H1GA 2YV7A 2LQOA 3GTUB 2RLIA 1A8LA 2HZFA 5HR0A 1PN9A 4KH7A 2X64A 5HFIA 2PWJA 1SVLA 4KCAA 2DJ3A 1AC1A 4JRRA 3HZ8A 2C0FA 2YWNA 4TW5A 4TOPA 1OC3A 2HLSA 3CYNA 5IO2A 4TR4A 2EIOA 3BBYA 4OFMA 4YAPA 4N30A 1PKZA 4L5LA 1DSBA 2C3QA 2HXKA 2MBTA 6GSXA 1TJDA 2FD3A 2X8CA 2BJXA 1EEJA 4KX4A 1JZRA 2F9SA 2DKHA 4KSMA 3NOFA 4MDCA 2LJRA 2N5AA 2K6VA 5GZZB 1TK5B 1J9BA 4FH8A 1M9BA 3IV4A 4XS1A 2LRNA 4V1Ap 2DIYA 3NZNA 2GDRA 3ZIVA 5CYYA 5D9TA 3F8UA 3GX0A 5ECSA 3P2AA 5C00A 1BQ7A 1T1VA 4OCFA 3ZMKA 1SENA 3QR6A 2KLXA 2GSTA 5HQPA 3ZTLA 4Z2RA 5AIXA 4HI7A 1SD9A 3DIEA 4XTSA 4FO5A 3KXOA 3IBHA 2JZRA 2GQLA 2B1KA 3A2VA 4AJ6A 5KOXA 5J40A 4FYCA 2GQMA 3VI5A 3GV1A 4DEJA 1VGLA 1O85A 1JZOA 4GQFA 5CRDA 1WIKA 5ECLB 2HZEA 4KNDA 4IHUA 1I9DA 2FCHA 2FWGA 2WCIA 4LMVA 4K7IA 3A5WA 4ZBDA 4BL7B 4AI6A 4K1FA 4E8EA 2H19A 5D96A 2RIIA 2MMAA 1GSDA 3P7XA 3ZL5A 1GNWA 3WT1A 5A4VA 4IVFA 2O89A 1K0BA 2OT3A 1GUHA 1KNGA 1ZCPA 1GSFA 1SJIA 4Q5RA 1J0FA 2I1UA 1TP9A 4GCIA 4E68A 3D5JA 5B6MA 3UEMA 2I4AA 5ECPB 1THXA 3TRPA 3TOTA 5CRWA 2H01A 3Q74A 3ME8A 5B8BA 3E9JB 3ZFLA 16GSA 5LCZA 2GZZA 4LLRA 1OE7A 2J23A 1TXUA 2GT6A 3PR8A 3QMXA 4IELA 4ZB6A 1GP1A 2L6CA 4KCEA 5F06A 4POLA 19GSA 1UC7A 2JADA 2VL9A 4HQSA 2HRAA 1G7OA 1GTAA 4OO4A 1FVKA 2MBSA 1HQOA 3TJBA 5EY6A 4KDYA 2HSHA 5ENUA 2LTKA 2LQQA 1WOUA 5BRTA 11GSA 3CTFA 1HYUA 4K2DA 1ZYPA 3TOUA 3ERWA 2YNXA 2R0GA 3LWAA 2L4QA 1XWBA 2B5EA 2V2GA 2VM2A 4FYBA 2C80A 4TXOA 2NBSA 2KUCA 1DBYA 3BCKA 2JACA 1MD4A 3LYPA 4X0XA 3GX8A 3CTGA 5B8AA 1BG1A 5J9CA 5J4YA 3TRQA 4G9HA 2OE1A 3O76A 2HNLA 2HYXA 3TRXA 4IW9A 2VLVA 4IP6A 2LNSA 3Q18A 5DBQA 4MJEA 4AKHA 1DE1A 5DALB 4F0BA 1K3YA 2H30A 1SKSB 2HSNA 3LSZA 4CDOA 4YQUA 1FO5A 1K0OA 5A5HA 1VF4A 1W89A 3GTUA 4IQAA 2QA2A 4WR5A 1ACVA 5J9BA 2MYGA 2CZ3A 3G7JA 3IXRA 1SK2A 3W8SA 4I2TA 1PQNA 1NHYA 1CQGA 3K8NA 2VD1A 4MF7A 3GH9A 2C0GA 4I6XA 1GTIA 1DUGA 8GSSA 1ZL9A 2JZTA 4BA7A 4AGSA 4CY8A 2LUSA 2H74A 2JSZA 1Q4JA 4BVXB 1SU9A 4POMA 5IM9A 4ZBAA 1BG5A 2M72A 3F63A 1ZOFA 3C8EA 1EGOA 2HE3A 3IPZA 5KN3A 5A34B 5KOWA 2VCXA 2YZHA 2VLTA 5IMDA 4YH2A 3MIXA 3C71A 2O5VA 4BVYA 1X5EA 3KP9A 3N5OA 1A0RP 2VD0A 4JR4A 1F3BA 2L5OA 2RUFA 3HCZA 2LJAA 4MZCA 2O85A 2OBKA 5IIZA 3QFBC 3KGKA 3TJJA 1UN2A 2PVQA 5JWRB 1K0AA 2R6KA 4K8MA 5LNKe 4GSTA 1XCCA 3IK7A 1Y1UA 5GSSA 2RUEA 2HFDA 1FB6A 1F2EA 4NHZA 1X9MB 5AGYA 6GSYA 2B6MA 3HDCA 1SD8A 1G7EA 1TW9A 1SK0A 1F3AA 1T4YA 2FA4A 3N9JA 5A5KA 1WMJA 4TR1B 2GSSA 4NWYA 3H4KA 4HUAA 4K0NA 5ECNB 5HFGA 2DJJA 1B48A 1Z7RA 3ZVJD 1GULA 3IA1A 2EIQA 1OKTA 2MMZA 1XBSA 2A4HA 4TR3A 2R2JA 2VIMA 4XRAA 2ES7A 2R3XA 5G1KA 3IAM2 1B4PA 2ALBA 2IPAA 4PUAA 3GN3A 5A4UA 4RI7A 2H0IA 3A2XA 1ERWA 3G9BA 1LU4A 4GSSA 1ML6A 1GH2A 1T7PB 2J9HA 2TIRA 3QDNA 4K0GA 3TKPA 3UVTA 3IRAA 3FR3A 5C04A 3Q19A 1BAYA 3HYPA 4N0ZA 1TKDB 1W4VA 1E2YA 4O5RA 2UZ8A 2ON5A 1QUWA 2WRTA 1R7HA 1BEDA 1WE0A 3FZ4A 2DMLA 1MDIA 2IMDA 3FKFA 3DD3A 4USSA 4WETA 7GSSA 3IE3A 4NMUA 4ULXA 2F8FA 3H1NA 3PH9A 3IC4A 1G6WA 5G1LA 1AW9A 4IS0A 2CAIA 3QAVA 5F07A 2KHPA 2I9HA 1WP0A 2QGVA 3V1WA 1EOHA 2K18A 3APSA 1H4OA 2FA8A 3DWVA 1JZWA 2DMMA 3CXGA 4K5SA 4ECJA 2R4VA 4QL7A 3HXSA 3HKRA 3LJRA 5FT3A 4CW9A 2C0DA 2Z9SA 1K3OA 4YKGA 2VLUA 4MK3A 2O87A 2VO4A 1RW1A 2X8HA 3ZYWA 4OFTA 2VL3A 2C3NA 2AV4A 3QAGA 1U87A 3VLNA 2GSRA 5DALA 20GSA 3HZ4A 5HR1A 3TKSE 3EE2A 5D73A 3GA4A 4G0KA 2IFQB 3FK8A 2KOKA 4MJCA 1PX6A 1BJXA 3LGCA 3IOSA 1V57A 4KF9A 3GH6A 4RQXA 3GMFA 3WGEA 2PUKC 1X9SB 2LJKA 1S3CA 2FUG2 2HRFA 2H6XA 1SL1B 2C1YA 3L9SA 5ECKB 4ZXGA 3QPMA 1YQ1A 2CAQA 3C1SA 1GLQA 4HZ2A 1SVMA 1BX9A 3HJOA 2QSIA 3EVIA 2E0QA 3JCML 1A0FA 1WPIA 2YWMA 4WF4A 3EMXA 3HD5A 5ABRA 3TUEA 4ZB9A 1NW2A 1V2AA 1QGVA 1Z9HA 2V32A 1OVNA 3D6IA 4O7HA 2PU9C 1GLPA 3C73A 1CQHA 1Y6EA 3RPNA 5A34A 2FY6A 3ME7A 1ERVA 1SL2B 4K2XA 4PXOA 1GSUA 1HD2A 3NIVA 5CNWA 2VM1A 2UV8G 1GSEA 5L71A 5AISA 1XWGA 4WBRD 1A23A 1GTUA 1VRSD 5KN1A 3WGDA 4QMKA 2DJ1A 2MZCA 3VFIA 3IHQA 1KTEA 1A2MA 1M99A 1HNAA 3LXTA 4K7OA 5DCHA 5G31A 2H1BA 2F8AA 3SBCA 2XBIA 3HVSA 4HJMA 5LD0A 3KJYA 2MMNA 1IYIA 1PD21 2WGRA 1V58A 4H86A 2DJ0A 2LRTA 1QK8A 3QCPA 2YOIA 3DEXA 1PL2A 1V9WA 4AKIA 2IWTA 1XW9A 1K3LA 5EL8A 5ECRB 1XOBA 3LFLA 4QQ7A 1WRYA 4MNNA 4IKHA 3O3TA 4KSOA 4XHMA 4X43A 3H93A 2X99A 1R5AA 1GUKA 3UBKA 2EC4A 2WZ9A 4YQVA 2OACA 5BMUB 4MF6A 1RQMA 5JWOB 1QMVA 4BWSA 1FVJA 1XZOA 3FY7A 4DSSB 4EUYA 4FQUA 1S3DA 4FYUA 4MP4A 3KTBA 4XCSA 2C0EA 1A24A 2GTUA 2JU5A 4V1Ag 2A2RA 3O6TA 3A2WA 2YANA 2CV4A 3F4SA 4MF5A 2X49A 3VWWA 2P0GA 3LORA 5IMFA 4MZBA 1F6MC 1Z5YE 3L0HA 5ID2B 4GLTA 1ZZYA 4PURA 1A2JA 5CAXA 2ZCTA 3DVWA 4N11A 4JEDA 3PINA 1JFUA 4X1UA 1XWKA 3L9UA 1PL1A 1J08A 4NV5A 4O5UA 2WS2A 4TR0A 1SJ6A 2C3TA 4EXJA 3KH9A 3LEFA 4L0UA 5G5EA 1TU7A 3ERGA 1KBNA 5A1NB 3HA9A 3DKSA 1O81A 2WULA 4TN8A 3FZAA 5IOXA 5ECHB 3CWGA 2E7PA 2HI7A 2R5GA 3LXZA 4EDZA 3EURA 2IMKA 2NVLA 1TRSA 5H5RA 1FOHA 1LJRA 2QKEA 3PGTA 2VCTA 3RAZA 1OE8A 3KD0A 4DSQA 5ECQB 3ED3A 3M9KA 4RUVA 3UOMA 3CSIA 3KH7A 1EOGA 2B5YA 1H75A 5IOWA 1VF2A 4JR6A 1T00A 1R26A 4HJ2A 2WFCA 1HNBA 3L4NA 3GL5A 1K0DA 5GAPD 2IIYA 4OMVA 4KDXA 1Z6NA 2H76A 3UVHA 1R4WA 2H71A 2PN8A 3IAS2 1EV9A 3CRUA 2M46A 3G7YA 3TKQA 3ZMLA 1M2AA 3EU4A 1THOA 1M2DA 2A2SA 3GKKA 2B7KA 3GSTA 4OFNA 5D9VA 2H70A 2B7JA 4HZ4A 2LKUA 2C8UA 1FB0A 5IPHA 5KEJA 1K0NA 3BOAA 1N25A 3GSSA 4EC0A 4WBJA 2EFEA 4HU9A 2H8LA 2JSYA 2TRCP 1C72A 1M2BA 1V40A 1K0CA 5CRHA 2A2PA 5F05A 5EPFA 1GSSA 2PGTA 2RM6A 4WF5A 2QC7A 3ZITA 1FOVA 1TTZA 2H72A 1O8WA 1QQ2A 1ILOA 4MH2A 2EFCA 6GSUA 3BJ5A 4YKFA 3TJGA 1F37A 2K8VA 4KAEA 4NHWA 1VF1A 2FHEA 2P5RA 1TI1A 1SK1A 5CRGA 3P90A 1X9WB 1XOAA 1A2LA 1FG4A 2LEGA 1AIUA 3HVXA 2C4JA 2AYTA 4MH3A 2PERA 4XRDA 1M7TA 3PPUA 1OYJA 5ECOB 3CSHA 5J4UA 22GSA 4LL4B 4G2EA 5KN0A 2ON7A 4IQ1A 2NPBA 4KB3A 3G7IA 1XW6A 4WR4A 5ECIB 3BD2A 3VWUA 4GSNA 4KDUA 4PQIA 5HR3A 1GSQA 1YY7A 2R37A 3EU3A 2CZ2A 2DSAA 3W6GA 5D93A 4ZBBA 4BL7A 1SYXA 5HFKA 5GSTA 5DJLA 3J7Yk 3UL3A 4PGTA 5DCGA 2H1LA 2FGXA 2GZYA 2P31A 4NV2A 3WD6A 4DSSA 2AAWA 1JLWA 1PSQA 1PGTA 3VURA 2FWEA 4ICYA 3UIWA 5DJMA 5IO0A 4F2IA 1EV4A 2B5XA 3QAWA 3U5RE 2H6YA 3HVVA 2GVPA 4V2LA 1AQWA 1XVWA 1XFLA 1GRXA 1M0UA 1OAZA 1OC9B 4HS1A 3ZREA 3LQ7A 5JWQB 1X5CA 1O73A 4ZL9A 2B3SA 3M3MA 4AKGA 3LYKA 1TI3A 4V2MA 1BYEA 1K0MA 1OC8A 5COHA 5DDLA 4POBA 3FW2A 5DQSA 2GZPA 2PPTA 3A3TA 13GSA 3HY2A 1TRWA 3DMLA 3KZQA 1ON4A 3GL3A 3WYWA 1TRUA 1Y25A 3TKSC 2H0HA 3F4TA 4IBPA 2KP1A 2LNTA 4BWQA 2R0CA 1GWCA 4ML1A 1AQXA 4NPBA 3F3RA 2X8GA 2G2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H79 A;  3VK9 A;  5J3R A;  3ZFB A;  1AUC A;  3D4M A;  2GLR A;  3MNG A;  3D0Z A;  5G2Z A;  2VOC A;  4E8H A;  3EIN A;  3FEU A;  2L6D A;  2GSQ A;  3IC8 A;  2VL2 C;  1S3A A;  5D8I A;  3UMA A;  2TRX A;  1RK4 A;  4I8B A;  3RPP A;  5B6N A;  4EVM A;  5E59 A;  5ELA A;  4J57 E;  3DGQ A;  3F9U A;  4ZL7 A;  2YZU A;  2VAF A;  2HSM B;  2HRN A;  2V1M A;  4F0C A;  2CVK A;  2MMO A;  1XIY A;  4I2U A;  3FHK A;  2K8S A;  1TXX A;  1EP8 A;  3U6V A;  1SKR B;  4JZQ A;  2CX4 A;  4YAV A;  1EP7 A;  3KEB A;  4HOJ A;  2BTO T;  2LS5 A;  1TOF A;  1O8X A;  3S9F A;  2LV3 A;  1TRV A;  2E2G A;  4ID0 A;  2AUV A;  3DRN A;  5J5N A;  2E2M A;  1XVQ A;  3RDW A;  5E4W A;  1Z7P A;  1PMT A;  4OO5 A;  17GS A;  4ML6 A;  1DE2 A;  4BVX A;  1AAZ A;  4PNF A;  4LA1 A;  4PNG A;  2JL4 A;  6GST A;  3E3E A;  4GQC A;  3C7M A;  4K7N A;  2IMF A;  3UAP A;  2OE3 A;  4AF2 A;  2DIZ A;  1FW1 A;  4XS6 A;  1UA5 A;  4TVE A;  1AQV A;  3F0I A;  1OKD A;  4GF0 A;  1SL0 B;  2WDU A;  2XC2 A;  5CRE A;  2YJH A;  3L78 A;  3CBU A;  2CA8 A;  5INY A;  3WT2 A;  4JE1 A;  4F03 A;  1G6Y A;  18GS A;  2H73 A;  1MTC A;  2H66 A;  3MWH A;  2H75 A;  1V98 A;  2G0F A;  2VUP A;  3H8Q A;  3MAK A;  4Q5F A;  4ZB8 A;  5H5S A;  1E6B A;  1YZX A;  3F3Q A;  5IQY A;  1A8Y A;  4EL1 A;  4BVY B;  4TR1 A;  3FRC A;  1XXU A;  3Q6O A;  1FAA A;  1YF0 A;  3VI7 A;  4JBB A;  3F4R A;  4I97 A;  3APQ A;  4O32 A;  2HT9 A;  1Z3E A;  2IME A;  3CSJ A;  4WEY A;  5HR2 A;  1PX7 A;  1HNC A;  1QFN A;  1ZYQ B;  4IN0 A;  2IN3 A;  1I5G A;  3L9V A;  1ZYE A;  1OC9 A;  1MD3 A;  5DAK B;  5DQY A;  5G30 A;  2PMT A;  2HRK B;  5FHI A;  5A4W A;  3M8N A;  3TCO A;  3GHA A;  4RQR A;  3EMP A;  2GS3 A;  4NAX A;  2FWH A;  2XHF A;  2OKA A;  4KUN A;  4D73 B;  4HQZ A;  1GL8 A;  4LMW A;  2L59 A;  3VWX A;  1XWA A;  3FZ9 A;  1YF1 A;  2YPM A;  3BCI A;  4PTS A;  5KN2 A;  2VCQ A;  3GKX A;  2IL3 A;  4G0I A;  4ECB A;  3E0U A;  2YN1 A;  3ZLP A;  5H5Q A;  4PUF C;  1URM A;  1EWX A;  1ST9 A;  1VF3 A;  3IDV A;  5CO3 A;  5IMC A;  5D9X A;  3D21 A;  5B7C A;  2WB9 A;  3MSZ A;  2GQK A;  4G10 A;  1F9M A;  2YV9 A;  2V6K A;  1N8J A;  3EWL A;  4MLY A;  2YCD A;  4RI6 A;  4POK A;  4KE3 A;  1O7U A;  4HEA 2;  4WXT A;  3D4T A;  4ECI A;  5J41 A;  2HSM A;  4J56 E;  3P8W A;  4L8E A;  3KM6 A;  5AN1 A;  3CMI A;  1EZK A;  5CP1 A;  2XPD A;  4G19 A;  4BPY A;  2IFQ A;  2FWF A;  4KA0 A;  5EVO A;  4HDE A;  3AY8 A;  3ZRD A;  3OR5 A;  3FYG A;  3I69 A;  4AJ8 A;  2GT5 A;  1PRX A;  3HJM A;  1X5D A;  4FIW A;  4CHS A;  5F0G A;  1PKW A;  1GUM A;  4P3Y B;  4DSR A;  1LBK A;  10GS A;  3GKN A;  4ZL8 A;  3LG6 A;  3MDK A;  5ECM B;  4EF0 A;  2AB6 A;  2L4C A;  1U3I A;  2LRC A;  1XWC A;  2OA7 A;  1WJK A;  6GSS A;  3DVX A;  4EE0 A;  2D2Z A;  4WKW A;  1T4Z A;  1GNE A;  4XS4 B;  4OD7 A;  3I9V 2;  4ZIL A;  1XPV A;  1GSY A;  1QXH A;  2LST A;  4EO3 A;  4XIH A;  1U6T A;  1M9A A;  4ZIJ A;  2DJK A;  3KMN A;  4K6X A;  2ZNM A;  3GUS A;  1X0R A;  2L5L A;  1T3B A;  3KP8 A;  3R3E A;  2CQ9 A;  3EYT A;  2YP6 A;  4O92 A;  4N0V A;  2GGT A;  3QFA C;  5IMA A;  4NXI A;  3TB2 A;  1USB A;  3APO A;  9GSS A;  4PQ1 A;  1U88 A;  1ABA A;  3VWV A;  1MDK A;  2M80 A;  3IR4 A;  1JZD A;  4KW6 A;  3J7Y b;  3M9J A;  5JCG A;  3TDG A;  4PX1 A;  4GTU A;  6GSW A;  3W8J A;  1N2A A;  2VCW A;  3GRX A;  4KGI A;  2REM A;  1Q98 A;  2IJY A;  1IYH A;  2DLX A;  1NSW A;  4EDY A;  4Q5N A;  2AHE A;  2CVD A;  3D22 A;  4F9Z A;  1ERU A;  3GIX A;  1O6J A;  1JLV A;  1TU8 A;  2P5Q A;  4DVC A;  3HJP A;  4TKY A;  5IMV A;  5BMU A;  4ACS A;  3ZIJ A;  1PA3 A;  2FNO A;  3QD9 A;  2H0G A;  1UVZ A;  4PQH A;  14GS A;  4V2N A;  1XW5 A;  4GXZ A;  5DAK A;  3FR9 A;  1WWJ A;  2DJ2 A;  2K9F A;  4ISD A;  2XPE A;  2F3M A;  2HRK A;  2YWO A;  5GAN D;  5AIV A;  4L0W A;  1YKA A;  1YEX A;  4ECC A;  3R2Q A;  3UAR A;  1SJZ A;  2I3Y A;  1ERT A;  5FWG A;  4MCU A;  5D9W A;  5JCU A;  4D73 A;  3SWL A;  4HU7 A;  3RHB A;  1T8E B;  2HZE B;  5ID2 A;  2H1D A;  3RHC A;  3C1R A;  4YQM A;  4I5Q A;  1U3A A;  2ZUP A;  4JU5 A;  4MMM A;  2BMX A;  4OCE A;  1GTB A;  1B9Y C;  1G0T A;  2OE0 A;  3TJF A;  3F6D A;  2N5B A;  4AJ7 A;  3KMO A;  3M0F A;  4TRX A;  4MJA A;  3KCM A;  2V6O A;  4Z7X A;  3KTL A;  4MZW A;  2H1A A;  5F8B A;  1AXD A;  4G0L A;  4IJI A;  3WGX A;  2NTO A;  3GNJ A;  1YDK A;  4MPG A;  2OBI A;  4TXV A;  2O7K A;  3TKR A;  2CX3 A;  2OJL A;  4IGJ A;  3ZZX A;  3US3 A;  2I81 A;  2DC5 A;  3GYK A;  4MJB A;  4LL1 B;  4GWR A;  1YEP A;  3ISO A;  1TK0 B;  3EC3 A;  2A4V A;  2VCZ A;  3ERF A;  5DVB A;  1B4Q A;  2IMI A;  4MAB A;  2B1L A;  5IPG A;  4Q5Q A;  2O8V B;  4F82 A;  3VPT A;  2YJ7 A;  3TKS A;  2PBJ A;  3TGZ A;  4QL9 A;  2XBQ A;  6GSV A;  3DYR A;  2F51 A;  3GUR A;  2L57 A;  1NM3 A;  1NHO A;  1ZGN A;  1B9X C;  2CVB A;  2H6Z A;  3UJ1 A;  3TJK A;  1SYR A;  4N10 A;  5G5F A;  2EIR A;  1EEM A;  1TK8 B;  1KEB A;  4MA9 A;  3KIJ A;  12GS A;  3QOU A;  1ZMA A;  4MPF A;  3ZVJ A;  2VL2 A;  2CT6 A;  3GKM A;  4ILF A;  1SKW B;  2YWI A;  2VCV A;  2FLS A;  1FHE A;  4OWY A;  4J2F A;  2HQT A;  4IP1 A;  2RM5 A;  4L5O A;  4IJ3 A;  2NDO A;  5IMZ A;  3CRT A;  2V41 A;  1R5P A;  4EKZ A;  2JZS A;  2WJU A;  1YJ6 A;  4TXO B;  3I6A A;  3UBL A;  1MDJ A;  1Z6M A;  3IK9 A;  1YKC A;  1MEK A;  2AJQ B;  4GRF A;  2N5F A;  2HSY A;  2PVO C;  3VPQ A;  5JCW A;  3HHV A;  5ELG A;  3FZ5 A;  3RBT A;  1JHB A;  3FR6 A;  4XS4 A;  1EGR A;  3I43 A;  2DBC A;  2HSN B;  2OAD A;  3M1G A;  3GFK A;  2KP2 A;  1TDI A;  4K9Z A;  3DXB A;  1B8X A;  3F6F A;  2H1G A;  2YV7 A;  2LQO A;  3GTU B;  2RLI A;  1A8L A;  2HZF A;  5HR0 A;  1PN9 A;  4KH7 A;  2X64 A;  5HFI A;  2PWJ A;  4KCA A;  2DJ3 A;  1AC1 A;  4JRR A;  3HZ8 A;  2C0F A;  2YWN A;  4TW5 A;  4TOP A;  1OC3 A;  2HLS A;  3CYN A;  5IO2 A;  4TR4 A;  2EIO A;  3BBY A;  4OFM A;  4YAP A;  4N30 A;  1PKZ A;  4L5L A;  1DSB A;  2C3Q A;  2HXK A;  2MBT A;  6GSX A;  1TJD A;  2FD3 A;  2X8C A;  2BJX A;  1EEJ A;  4KX4 A;  1JZR A;  2F9S A;  4KSM A;  3NOF A;  4MDC A;  2LJR A;  2N5A A;  2K6V A;  5GZZ B;  1TK5 B;  1J9B A;  4FH8 A;  1M9B A;  3IV4 A;  4XS1 A;  2LRN A;  4V1A p;  2DIY A;  3NZN A;  2GDR A;  3ZIV A;  5CYY A;  5D9T A;  3F8U A;  3GX0 A;  5ECS A;  3P2A A;  5C00 A;  1BQ7 A;  1T1V A;  4OCF A;  3ZMK A;  1SEN A;  3QR6 A;  2KLX A;  2GST A;  5HQP A;  3ZTL A;  5AIX A;  4HI7 A;  1SD9 A;  3DIE A;  4XTS A;  4FO5 A;  3KXO A;  3IBH A;  2JZR A;  2GQL A;  2B1K A;  3A2V A;  4AJ6 A;  4FYC A;  2GQM A;  3VI5 A;  3GV1 A;  4DEJ A;  1VGL A;  1O85 A;  1JZO A;  4GQF A;  5CRD A;  1WIK A;  5ECL B;  2HZE A;  4KND A;  4IHU A;  1I9D A;  2FCH A;  2FWG A;  2WCI A;  4LMV A;  4K7I A;  3A5W A;  4ZBD A;  4BL7 B;  4K1F A;  4E8E A;  2H19 A;  5D96 A;  2RII A;  2MMA A;  1GSD A;  3P7X A;  3ZL5 A;  1GNW A;  3WT1 A;  5A4V A;  4IVF A;  2O89 A;  1K0B A;  1GUH A;  1KNG A;  1ZCP A;  1GSF A;  1SJI A;  4Q5R A;  1J0F A;  2I1U A;  1TP9 A;  4GCI A;  3D5J A;  5B6M A;  3UEM A;  2I4A A;  5ECP B;  1THX A;  3TRP A;  3TOT A;  5CRW A;  2H01 A;  3Q74 A;  3ME8 A;  5B8B A;  3E9J B;  3ZFL A;  16GS A;  5LCZ A;  2GZZ A;  4LLR A;  1OE7 A;  2J23 A;  2GT6 A;  3QMX A;  3PR8 A;  4IEL A;  4ZB6 A;  1GP1 A;  2L6C A;  4KCE A;  5F06 A;  4POL A;  19GS A;  1UC7 A;  2JAD A;  2VL9 A;  4HQS A;  2HRA A;  1G7O A;  1GTA A;  4OO4 A;  1FVK A;  2MBS A;  1HQO A;  3TJB A;  5EY6 A;  4KDY A;  2HSH A;  5ENU A;  2LTK A;  2LQQ A;  1WOU A;  11GS A;  3CTF A;  1HYU A;  4K2D A;  3TOU A;  3ERW A;  2YNX A;  3LWA A;  2L4Q A;  1XWB A;  2B5E A;  2V2G A;  2VM2 A;  4FYB A;  2C80 A;  4TXO A;  2NBS A;  2KUC A;  1DBY A;  3BCK A;  2JAC A;  1MD4 A;  3LYP A;  4X0X A;  3GX8 A;  3CTG A;  5B8A A;  5J9C A;  3TRQ A;  4G9H A;  2OE1 A;  3O76 A;  2HNL A;  2HYX A;  3TRX A;  4IW9 A;  2VLV A;  4IP6 A;  2LNS A;  3Q18 A;  5DBQ A;  4MJE A;  1DE1 A;  5DAL B;  4F0B A;  1K3Y A;  2H30 A;  1SKS B;  3LSZ A;  4CDO A;  4YQU A;  1FO5 A;  1K0O A;  1VF4 A;  1W89 A;  3GTU A;  4IQA A;  4WR5 A;  1ACV A;  5J9B A;  2MYG A;  2CZ3 A;  3G7J A;  3IXR A;  1SK2 A;  3W8S A;  4I2T A;  1PQN A;  1NHY A;  1CQG A;  3K8N A;  2VD1 A;  4MF7 A;  3GH9 A;  2C0G A;  4I6X A;  1GTI A;  1DUG A;  8GSS A;  1ZL9 A;  2JZT A;  4BA7 A;  4AGS A;  2LUS A;  2H74 A;  2JSZ A;  1Q4J A;  4BVX B;  1SU9 A;  4POM A;  5IM9 A;  4ZBA A;  1BG5 A;  2M72 A;  3F63 A;  1ZOF A;  3C8E A;  1EGO A;  2HE3 A;  3IPZ A;  5KN3 A;  2VCX A;  2YZH A;  2VLT A;  5IMD A;  4YH2 A;  3C71 A;  4BVY A;  1X5E A;  3KP9 A;  3N5O A;  1A0R P;  2VD0 A;  4JR4 A;  1F3B A;  2L5O A;  2RUF A;  3HCZ A;  2LJA A;  4MZC A;  2O85 A;  2OBK A;  5IIZ A;  3QFB C;  3KGK A;  3TJJ A;  1UN2 A;  2PVQ A;  5JWR B;  1K0A A;  2R6K A;  4K8M A;  5LNK e;  4GST A;  1XCC A;  3IK7 A;  5GSS A;  2RUE A;  2HFD A;  1FB6 A;  1F2E A;  4NHZ A;  1X9M B;  5AGY A;  6GSY A;  2B6M A;  3HDC A;  1SD8 A;  1G7E A;  1TW9 A;  1SK0 A;  1F3A A;  1T4Y A;  2FA4 A;  3N9J A;  5A5K A;  1WMJ A;  4TR1 B;  2GSS A;  4NWY A;  3H4K A;  4HUA A;  4K0N A;  5ECN B;  5HFG A;  2DJJ A;  1B48 A;  1Z7R A;  3ZVJ D;  1GUL A;  3IA1 A;  2EIQ A;  1OKT A;  2MMZ A;  1XBS A;  4TR3 A;  2R2J A;  2VIM A;  4XRA A;  2ES7 A;  2R3X A;  5G1K A;  3IAM 2;  1B4P A;  2ALB A;  2IPA A;  4PUA A;  3GN3 A;  5A4U A;  4RI7 A;  2H0I A;  1ERW A;  3A2X A;  3G9B A;  1LU4 A;  4GSS A;  1ML6 A;  1GH2 A;  1T7P B;  2J9H A;  2TIR A;  3QDN A;  4K0G A;  3TKP A;  3UVT A;  3IRA A;  3FR3 A;  5C04 A;  3Q19 A;  1BAY A;  3HYP A;  4N0Z A;  1TKD B;  1W4V A;  1E2Y A;  4O5R A;  2UZ8 A;  2ON5 A;  1QUW A;  2WRT A;  1R7H A;  1BED A;  1WE0 A;  3FZ4 A;  2DML A;  1MDI A;  2IMD A;  3FKF A;  3DD3 A;  4USS A;  4WET A;  7GSS A;  3IE3 A;  4NMU A;  4ULX A;  2F8F A;  3H1N A;  3PH9 A;  3IC4 A;  1G6W A;  5G1L A;  1AW9 A;  4IS0 A;  2CAI A;  3QAV A;  5F07 A;  2KHP A;  2I9H A;  1WP0 A;  2QGV A;  3V1W A;  1EOH A;  2K18 A;  3APS A;  1H4O A;  2FA8 A;  3DWV A;  1JZW A;  2DMM A;  3CXG A;  4ECJ A;  2R4V A;  4QL7 A;  3HXS A;  3HKR A;  3LJR A;  5FT3 A;  4CW9 A;  2C0D A;  2Z9S A;  1K3O A;  2VLU A;  4MK3 A;  2O87 A;  2VO4 A;  1RW1 A;  2X8H A;  3ZYW A;  4OFT A;  2VL3 A;  2C3N A;  2AV4 A;  3QAG A;  1U87 A;  3VLN A;  2GSR A;  5DAL A;  20GS A;  3HZ4 A;  5HR1 A;  3TKS E;  3EE2 A;  5D73 A;  3GA4 A;  4G0K A;  2IFQ B;  3FK8 A;  2KOK A;  4MJC A;  1PX6 A;  1BJX A;  3LGC A;  3IOS A;  1V57 A;  4KF9 A;  3GH6 A;  4RQX A;  3GMF A;  3WGE A;  2PUK C;  1X9S B;  2LJK A;  1S3C A;  2FUG 2;  2HRF A;  2H6X A;  1SL1 B;  2C1Y A;  3L9S A;  5ECK B;  4ZXG A;  3QPM A;  1YQ1 A;  2CAQ A;  3C1S A;  1GLQ A;  4HZ2 A;  1BX9 A;  3HJO A;  2QSI A;  3EVI A;  2E0Q A;  3JCM L;  1A0F A;  1WPI A;  2YWM A;  4WF4 A;  3EMX A;  3HD5 A;  5ABR A;  3TUE A;  4ZB9 A;  1NW2 A;  1V2A A;  1QGV A;  1Z9H A;  2V32 A;  1OVN A;  3D6I A;  4O7H A;  2PU9 C;  1GLP A;  3C73 A;  1CQH A;  1Y6E A;  3RPN A;  2FY6 A;  3ME7 A;  1ERV A;  1SL2 B;  4PXO A;  1GSU A;  1HD2 A;  3NIV A;  5CNW A;  2VM1 A;  1GSE A;  5L71 A;  5AIS A;  1XWG A;  4WBR D;  1A23 A;  1GTU A;  1VRS D;  5KN1 A;  3WGD A;  3VFI A;  2DJ1 A;  2MZC A;  3IHQ A;  1KTE A;  1A2M A;  1M99 A;  1HNA A;  3LXT A;  4K7O A;  5DCH A;  5G31 A;  2H1B A;  2F8A A;  3SBC A;  2XBI A;  3HVS A;  4HJM A;  5LD0 A;  3KJY A;  2MMN A;  1IYI A;  1PD2 1;  2WGR A;  1V58 A;  4H86 A;  2DJ0 A;  2LRT A;  1QK8 A;  3QCP A;  2YOI A;  3DEX A;  1PL2 A;  1V9W A;  2IWT A;  1XW9 A;  1K3L A;  5EL8 A;  5ECR B;  1XOB A;  3LFL A;  4QQ7 A;  1WRY A;  4IKH A;  3O3T A;  4KSO A;  4XHM A;  4X43 A;  3H93 A;  2X99 A;  1R5A A;  1GUK A;  3UBK A;  2EC4 A;  2WZ9 A;  4YQV A;  2OAC A;  4MF6 A;  1RQM A;  5JWO B;  1QMV A;  4BWS A;  1FVJ A;  1XZO A;  3FY7 A;  4DSS B;  4EUY A;  4FQU A;  1S3D A;  4FYU A;  4MP4 A;  3KTB A;  4XCS A;  2C0E A;  1A24 A;  2GTU A;  2JU5 A;  4V1A g;  2A2R A;  3O6T A;  3A2W A;  2YAN A;  2CV4 A;  3F4S A;  4MF5 A;  3VWW A;  2P0G A;  3LOR A;  5IMF A;  4MZB A;  1F6M C;  1Z5Y E;  3L0H A;  5ID2 B;  4GLT A;  1ZZY A;  4PUR A;  1A2J A;  5CAX A;  2ZCT A;  3DVW A;  4N11 A;  4JED A;  3PIN A;  1JFU A;  4X1U A;  1XWK A;  3L9U A;  1PL1 A;  1J08 A;  4NV5 A;  2WS2 A;  4TR0 A;  1SJ6 A;  2C3T A;  4EXJ A;  3KH9 A;  3LEF A;  4L0U A;  5G5E A;  1TU7 A;  3ERG A;  1KBN A;  3HA9 A;  3DKS A;  1O81 A;  2WUL A;  4TN8 A;  3FZA A;  5IOX A;  5ECH B;  2E7P A;  2HI7 A;  2R5G A;  3LXZ A;  4EDZ A;  3EUR A;  2IMK A;  2NVL A;  1TRS A;  5H5R A;  1LJR A;  2QKE A;  3PGT A;  2VCT A;  3RAZ A;  1OE8 A;  3KD0 A;  4DSQ A;  5ECQ B;  3ED3 A;  3M9K A;  4RUV A;  3UOM A;  3CSI A;  3KH7 A;  1EOG A;  2B5Y A;  1H75 A;  5IOW A;  1VF2 A;  4JR6 A;  1T00 A;  1R26 A;  4HJ2 A;  2WFC A;  1HNB A;  3L4N A;  3GL5 A;  1K0D A;  5GAP D;  2IIY A;  4OMV A;  4KDX A;  1Z6N A;  2H76 A;  3UVH A;  1R4W A;  2H71 A;  2PN8 A;  3IAS 2;  1EV9 A;  3CRU A;  2M46 A;  3G7Y A;  3TKQ A;  3ZML A;  1M2A A;  3EU4 A;  1THO A;  1M2D A;  2A2S A;  3GKK A;  2B7K A;  3GST A;  4OFN A;  5D9V A;  2H70 A;  2B7J A;  4HZ4 A;  2LKU A;  2C8U A;  1FB0 A;  5IPH A;  5KEJ A;  1K0N A;  3BOA A;  3GSS A;  4EC0 A;  4WBJ A;  4HU9 A;  2H8L A;  2JSY A;  2TRC P;  1C72 A;  1M2B A;  1V40 A;  1K0C A;  5CRH A;  5F05 A;  5EPF A;  1GSS A;  2PGT A;  2RM6 A;  4WF5 A;  2QC7 A;  3ZIT A;  1FOV A;  1TTZ A;  2H72 A;  1O8W A;  1QQ2 A;  1ILO A;  4MH2 A;  3TJG A;  6GSU A;  3BJ5 A;  1F37 A;  2K8V A;  4KAE A;  4NHW A;  1VF1 A;  2FHE A;  2P5R A;  1TI1 A;  1SK1 A;  5CRG A;  3P90 A;  1X9W B;  1XOA A;  1A2L A;  1FG4 A;  2LEG A;  1AIU A;  3HVX A;  2C4J A;  2AYT A;  4MH3 A;  2PER A;  4XRD A;  1M7T A;  3PPU A;  1OYJ A;  5ECO B;  3CSH A;  5J4U A;  22GS A;  4LL4 B;  4G2E A;  5KN0 A;  2ON7 A;  4IQ1 A;  2NPB A;  4KB3 A;  3G7I A;  1XW6 A;  4WR4 A;  5ECI B;  3BD2 A;  3VWU A;  4GSN A;  4KDU A;  4PQI A;  5HR3 A;  1GSQ A;  1YY7 A;  2R37 A;  3EU3 A;  2CZ2 A;  2DSA A;  3W6G A;  5D93 A;  4ZBB A;  4BL7 A;  1SYX A;  5HFK A;  5GST A;  5DJL A;  3J7Y k;  3UL3 A;  4PGT A;  5DCG A;  2FGX A;  2GZY A;  2P31 A;  4NV2 A;  3WD6 A;  4DSS A;  2AAW A;  1JLW A;  1PSQ A;  1PGT A;  3VUR A;  2FWE A;  3UIW A;  5DJM A;  5IO0 A;  4F2I A;  1EV4 A;  2B5X A;  3QAW A;  3U5R E;  2H6Y A;  3HVV A;  2GVP A;  4V2L A;  1AQW A;  1XVW A;  1XFL A;  1GRX A;  1M0U A;  1OAZ A;  1OC9 B;  4HS1 A;  3ZRE A;  3LQ7 A;  5JWQ B;  1X5C A;  1O73 A;  4ZL9 A;  2B3S A;  3M3M A;  3LYK A;  1TI3 A;  4V2M A;  1BYE A;  1K0M A;  1OC8 A;  5COH A;  5DDL A;  4POB A;  3FW2 A;  5DQS A;  2GZP A;  2PPT A;  3A3T A;  13GS A;  3HY2 A;  1TRW A;  3DML A;  1ON4 A;  3KZQ A;  3GL3 A;  3WYW A;  1TRU A;  1Y25 A;  3TKS C;  2H0H A;  3F4T A;  4IBP A;  2KP1 A;  2LNT A;  4BWQ A;  1GWC A;  4ML1 A;  1AQX A;  4NPB A;  3F3R A;  2X8G A;  2G2Q A; 
#chains in the Genus database with same CATH topology
 3H79 A;  3VK9 A;  5J3R A;  3ZFB A;  1AUC A;  3D4M A;  2GLR A;  3MNG A;  4EIP A;  3D0Z A;  5G2Z A;  2VOC A;  4E8H A;  3EIN A;  3FEU A;  2L6D A;  2GSQ A;  4O5Q A;  3IC8 A;  2VL2 C;  1S3A A;  5D8I A;  3UMA A;  2TRX A;  1RK4 A;  4I8B A;  3RPP A;  5B6N A;  4EVM A;  5E59 A;  5ELA A;  4ZB7 A;  4J57 E;  3DGQ A;  3F9U A;  4ZL7 A;  2YZU A;  2VAF A;  2HSM B;  2HRN A;  2V1M A;  4F0C A;  2CVK A;  2MMO A;  1XIY A;  4I2U A;  3MYD A;  3FHK A;  2K8S A;  1TXX A;  1EP8 A;  3U6V A;  1SKR B;  4JZQ A;  2CX4 A;  4YAV A;  1EP7 A;  2R0P A;  3KEB A;  4HOJ A;  2BTO T;  2LS5 A;  1TOF A;  1O8X A;  3S9F A;  2LV3 A;  3HMJ G;  1TRV A;  2E2G A;  4ID0 A;  2AUV A;  3DRN A;  5J5N A;  2E2M A;  1XVQ A;  3RDW A;  5E4W A;  1Z7P A;  1PMT A;  4OO5 A;  17GS A;  4ML6 A;  4W66 A;  1DE2 A;  4BVX A;  2EFD A;  1AAZ A;  4PNF A;  4LA1 A;  4PNG A;  2JL4 A;  6GST A;  3E3E A;  4GQC A;  3C7M A;  4K7N A;  2IMF A;  3UAP A;  2OE3 A;  4AF2 A;  2WVZ A;  2DIZ A;  1FW1 A;  4XS6 A;  4Z2T A;  1UA5 A;  4TVE A;  1AQV A;  3F0I A;  1OKD A;  4GF0 A;  1SL0 B;  2WDU A;  2XC2 A;  5CRE A;  2YJH A;  3L78 A;  3CBU A;  2CA8 A;  5INY A;  3WT2 A;  4JE1 A;  4F03 A;  1G6Y A;  18GS A;  2H73 A;  1MTC A;  2H66 A;  3MWH A;  2H75 A;  1V98 A;  2G0F A;  2VUP A;  3H8Q A;  3MAK A;  4Q5F A;  4ZB8 A;  2WVX B;  5H5S A;  1E6B A;  1YZX A;  3F3Q A;  5IQY A;  1A8Y A;  4EL1 A;  4BVY B;  4TR1 A;  3FRC A;  1XXU A;  1BF5 A;  3Q6O A;  1FAA A;  1YF0 A;  3VI7 A;  4JBB A;  3TU3 B;  3F4R A;  4I97 A;  3APQ A;  4O32 A;  2HT9 A;  1Z3E A;  2IME A;  3CSJ A;  4WEY A;  5HR2 A;  1PX7 A;  1HNC A;  1QFN A;  1ZYQ B;  4IN0 A;  2IN3 A;  1I5G A;  3L9V A;  1ZYE A;  1OC9 A;  1MD3 A;  5DAK B;  5DQY A;  5G30 A;  2PMT A;  2HRK B;  5FHI A;  5A4W A;  3M8N A;  3TCO A;  3GHA A;  4RQR A;  3FMW A;  3EMP A;  2GS3 A;  4NAX A;  2FWH A;  2XHF A;  2OKA A;  4KUN A;  4Z2U A;  4D73 B;  4HQZ A;  1GL8 A;  4LMW A;  2L59 A;  3VWX A;  1XWA A;  3FZ9 A;  1YF1 A;  2YPM A;  3HVN A;  3BCI A;  4PTS A;  1ZYN A;  5KN2 A;  2VCQ A;  3GKX A;  2IL3 A;  4G0I A;  4ECB A;  3E0U A;  2YN1 A;  2VKZ G;  3ZLP A;  5H5Q A;  4PUF C;  1URM A;  1EWX A;  1ST9 A;  1VF3 A;  3IDV A;  5CO3 A;  5IMC A;  5D9X A;  3D21 A;  5B7C A;  2WB9 A;  3MSZ A;  4X4J A;  2GQK A;  4G10 A;  1F9M A;  2YV9 A;  2V6K A;  1N8J A;  3EWL A;  4MLY A;  2YCD A;  4RI6 A;  4POK A;  4KE3 A;  1O7U A;  4HEA 2;  4WXT A;  1YEW C;  3D4T A;  4EIQ A;  4ECI A;  5J41 A;  2HSM A;  4J56 E;  3P8W A;  4L8E A;  3KM6 A;  5AN1 A;  3CMI A;  1EZK A;  5CP1 A;  2XPD A;  4G19 A;  4BPY A;  2IFQ A;  2FWF A;  4KA0 A;  5EVO A;  4HDE A;  3AY8 A;  3ZRD A;  3OR5 A;  3FYG A;  3I69 A;  4AKX B;  4AJ8 A;  2GT5 A;  1PRX A;  3HJM A;  1X5D A;  4FIW A;  4CHS A;  5F0G A;  1PKW A;  1GUM A;  4P3Y B;  4DSR A;  3CHX C;  1LBK A;  10GS A;  3GKN A;  4ZL8 A;  3LG6 A;  3MDK A;  5ECM B;  4EF0 A;  2AB6 A;  2L4C A;  1U3I A;  2LRC A;  1XWC A;  2OA7 A;  1WJK A;  6GSS A;  3DVX A;  4EE0 A;  2D2Z A;  4WKW A;  1T4Z A;  1GNE A;  4XS4 B;  4OD7 A;  3I9V 2;  4ZIL A;  1XPV A;  1GSY A;  1QXH A;  2LST A;  4EO3 A;  4XIH A;  1U6T A;  1M9A A;  4ZIJ A;  2DJK A;  3KMN A;  4K6X A;  2ZNM A;  3GUS A;  1X0R A;  2L5L A;  1T3B A;  3LW9 A;  3KP8 A;  3R3E A;  2CQ9 A;  3EYT A;  4PHZ C;  3EPT A;  2YP6 A;  4K5R A;  4O92 A;  4N0V A;  2GGT A;  3QFA C;  5IMA A;  4NXI A;  3TB2 A;  1USB A;  3APO A;  9GSS A;  4PQ1 A;  1U88 A;  1ABA A;  3VWV A;  1MDK A;  2M80 A;  3IR4 A;  1JZD A;  4KW6 A;  3J7Y b;  2WVX A;  3M9J A;  5JCG A;  3TDG A;  4PX1 A;  4GTU A;  6GSW A;  3W8J A;  1N2A A;  2VCW A;  3GRX A;  4KGI A;  2REM A;  2DKI A;  1Q98 A;  2IJY A;  1IYH A;  2DLX A;  1NSW A;  4EDY A;  4Q5N A;  2AHE A;  2CVD A;  2QA1 A;  1SVO A;  3D22 A;  2WW0 A;  4F9Z A;  2EFH A;  1ERU A;  4N3Z A;  3GIX A;  1O6J A;  1JLV A;  1TU8 A;  2P5Q A;  4DVC A;  3HJP A;  3A5I A;  4TKY A;  5IMV A;  5BMU A;  4ACS A;  3ZIJ A;  1PA3 A;  2FNO A;  3QD9 A;  2H0G A;  1UVZ A;  4PQH A;  14GS A;  5J4V A;  4V2N A;  1XW5 A;  5DAK A;  3FR9 A;  1WWJ A;  2DJ2 A;  2K9F A;  4GXZ A;  4ISD A;  2XPE A;  2F3M A;  2HRK A;  2YWO A;  5GAN D;  5AIV A;  4L0W A;  1YKA A;  1YEX A;  4ECC A;  3R2Q A;  3UAR A;  1YVL A;  1SJZ A;  2I3Y A;  1ERT A;  5FWG A;  4MCU A;  5D9W A;  5JCU A;  4D73 A;  3SWL A;  4HU7 A;  3RHB A;  1T8E B;  2HZE B;  5ID2 A;  2H1D A;  3RHC A;  3C1R A;  4YQM A;  4I5Q A;  1U3A A;  2ZUP A;  4JU5 A;  4MMM A;  2BMX A;  4OCE A;  1GTB A;  1B9Y C;  1G0T A;  2OE0 A;  3TJF A;  3F6D A;  2N5B A;  4AJ7 A;  3KMO A;  3M0F A;  4TRX A;  4MJA A;  3KCM A;  2V6O A;  4Z7X A;  3KTL A;  4MZW A;  2H1A A;  5F8B A;  1AXD A;  4G0L A;  3IHG A;  5A1N A;  1XG8 A;  4IJI A;  3WGX A;  2NTO A;  3GNJ A;  1YDK A;  4MPG A;  2OBI A;  4TXV A;  2O7K A;  4G01 A;  3TKR A;  2CX3 A;  2OJL A;  4IGJ A;  3ZZX A;  3US3 A;  2I81 A;  2DC5 A;  3GYK A;  4MJB A;  4LL1 B;  4GWR A;  1YEP A;  3ISO A;  1TK0 B;  3EC3 A;  2A4V A;  2VCZ A;  3ERF A;  5DVB A;  1B4Q A;  2IMI A;  4MAB A;  2B1L A;  5IPG A;  4Q5Q A;  2O8V B;  4F82 A;  3VPT A;  2YJ7 A;  3TKS A;  2PBJ A;  3TGZ A;  4QL9 A;  2XBQ A;  6GSV A;  3DYR A;  2F51 A;  3GUR A;  2L57 A;  1NM3 A;  1NHO A;  4A5P A;  1ZGN A;  1B9X C;  2CVB A;  2X4A A;  2H6Z A;  3UJ1 A;  5J47 A;  3TJK A;  1SYR A;  4N10 A;  5G5F A;  2EIR A;  1EEM A;  1TK8 B;  4GDF A;  1KEB A;  4MA9 A;  3KIJ A;  12GS A;  3QOU A;  1ZMA A;  4MPF A;  3ZVJ A;  2VL2 A;  2CT6 A;  3GKM A;  4ILF A;  1SKW B;  1PN0 A;  2YWI A;  2VCV A;  2FLS A;  1FHE A;  4OWY A;  4J2F A;  2HQT A;  4IP1 A;  2RM5 A;  4L5O A;  4IJ3 A;  2NDO A;  5IMZ A;  3CRT A;  1PFO A;  2V41 A;  1R5P A;  4EKZ A;  2JZS A;  2WJU A;  1YJ6 A;  4TXO B;  3I6A A;  3UBL A;  1MDJ A;  1Z6M A;  3IK9 A;  1YKC A;  1MEK A;  2AJQ B;  4GRF A;  2N5F A;  2HSY A;  2PVO C;  3VPQ A;  5JCW A;  3HHV A;  5ELG A;  3FZ5 A;  4CY6 A;  3RBT A;  1JHB A;  3FR6 A;  4XS4 A;  1EGR A;  3I43 A;  2DBC A;  2HSN B;  2OAD A;  3M1G A;  3GFK A;  2KP2 A;  1TDI A;  4K9Z A;  3DXB A;  1B8X A;  3F6F A;  5A5H B;  2H1G A;  2YV7 A;  2LQO A;  3GTU B;  1M3J A;  2RLI A;  1A8L A;  2HZF A;  5HR0 A;  1PN9 A;  4KH7 A;  2X64 A;  5HFI A;  2PWJ A;  1SVL A;  4KCA A;  2DJ3 A;  1AC1 A;  4JRR A;  3HZ8 A;  2C0F A;  2YWN A;  4TW5 A;  4TOP A;  1OC3 A;  2HLS A;  3CYN A;  5IO2 A;  4TR4 A;  2EIO A;  3BBY A;  4OFM A;  4YAP A;  4N30 A;  1PKZ A;  4L5L A;  1DSB A;  2C3Q A;  2HXK A;  2MBT A;  6GSX A;  1TJD A;  2FD3 A;  2X8C A;  2BJX A;  1EEJ A;  4KX4 A;  1JZR A;  2F9S A;  2DKH A;  4KSM A;  3NOF A;  4MDC A;  2LJR A;  2N5A A;  2K6V A;  5GZZ B;  1TK5 B;  1J9B A;  4FH8 A;  1M9B A;  3IV4 A;  4XS1 A;  2LRN A;  4V1A p;  2DIY A;  3NZN A;  2GDR A;  3ZIV A;  5CYY A;  5D9T A;  3F8U A;  3GX0 A;  5ECS A;  3P2A A;  5C00 A;  1BQ7 A;  1T1V A;  4OCF A;  3ZMK A;  1SEN A;  3QR6 A;  2KLX A;  2GST A;  5HQP A;  3ZTL A;  4Z2R A;  5AIX A;  4HI7 A;  1SD9 A;  3DIE A;  4XTS A;  4FO5 A;  3KXO A;  3IBH A;  2JZR A;  2GQL A;  2B1K A;  3A2V A;  4AJ6 A;  5KOX A;  5J40 A;  4FYC A;  2GQM A;  3VI5 A;  3GV1 A;  4DEJ A;  1VGL A;  1O85 A;  1JZO A;  4GQF A;  5CRD A;  1WIK A;  5ECL B;  2HZE A;  4KND A;  4IHU A;  1I9D A;  2FCH A;  2FWG A;  2WCI A;  4LMV A;  4K7I A;  3A5W A;  4ZBD A;  4BL7 B;  4AI6 A;  4K1F A;  4E8E A;  2H19 A;  5D96 A;  2RII A;  2MMA A;  1GSD A;  3P7X A;  3ZL5 A;  1GNW A;  3WT1 A;  5A4V A;  4IVF A;  2O89 A;  1K0B A;  2OT3 A;  1GUH A;  1KNG A;  1ZCP A;  1GSF A;  1SJI A;  4Q5R A;  1J0F A;  2I1U A;  1TP9 A;  4GCI A;  4E68 A;  3D5J A;  5B6M A;  3UEM A;  2I4A A;  5ECP B;  1THX A;  3TRP A;  3TOT A;  5CRW A;  2H01 A;  3Q74 A;  4PI0 C;  3ME8 A;  5B8B A;  3E9J B;  3ZFL A;  16GS A;  5LCZ A;  2GZZ A;  4LLR A;  1OE7 A;  2J23 A;  1TXU A;  2GT6 A;  3PR8 A;  3QMX A;  4IEL A;  4ZB6 A;  1GP1 A;  2L6C A;  4KCE A;  5F06 A;  4POL A;  19GS A;  1UC7 A;  2JAD A;  2VL9 A;  4HQS A;  2HRA A;  1G7O A;  1GTA A;  4OO4 A;  1FVK A;  2MBS A;  1HQO A;  3TJB A;  5EY6 A;  4KDY A;  2HSH A;  5ENU A;  2LTK A;  2LQQ A;  1WOU A;  5BRT A;  11GS A;  3CTF A;  1HYU A;  4K2D A;  1ZYP A;  3TOU A;  3ERW A;  2YNX A;  2R0G A;  3LWA A;  2L4Q A;  1XWB A;  2B5E A;  2V2G A;  2VM2 A;  4FYB A;  2C80 A;  4TXO A;  2NBS A;  2KUC A;  1DBY A;  3BCK A;  2JAC A;  1MD4 A;  3LYP A;  4X0X A;  3GX8 A;  3CTG A;  5B8A A;  1BG1 A;  5J9C A;  5J4Y A;  3TRQ A;  4G9H A;  2OE1 A;  3O76 A;  2HNL A;  2HYX A;  3TRX A;  4IW9 A;  2VLV A;  4IP6 A;  2LNS A;  3Q18 A;  5DBQ A;  4MJE A;  4AKH A;  1DE1 A;  5DAL B;  4F0B A;  1K3Y A;  2H30 A;  1SKS B;  2HSN A;  3LSZ A;  4CDO A;  4YQU A;  1FO5 A;  1K0O A;  5A5H A;  1VF4 A;  1W89 A;  3GTU A;  4IQA A;  2QA2 A;  4WR5 A;  1ACV A;  5J9B A;  2MYG A;  2CZ3 A;  4FXY P;  2WVY A;  3G7J A;  3IXR A;  1SK2 A;  3W8S A;  4I2T A;  1PQN A;  2WW2 A;  1NHY A;  1CQG A;  3K8N A;  2VD1 A;  4MF7 A;  3GH9 A;  2C0G A;  4I6X A;  1GTI A;  1DUG A;  8GSS A;  1ZL9 A;  2JZT A;  4BA7 A;  4AGS A;  4CY8 A;  2LUS A;  2WZS A;  2H74 A;  2JSZ A;  1Q4J A;  4BVX B;  1SU9 A;  4POM A;  5IM9 A;  4ZBA A;  1BG5 A;  2M72 A;  3F63 A;  1ZOF A;  3C8E A;  1EGO A;  2HE3 A;  3IPZ A;  5KN3 A;  5A34 B;  5KOW A;  2VCX A;  2YZH A;  2VLT A;  5IMD A;  4YH2 A;  3MIX A;  3C71 A;  2O5V A;  4BVY A;  1X5E A;  3KP9 A;  3N5O A;  1A0R P;  2VD0 A;  4JR4 A;  1F3B A;  2L5O A;  2RUF A;  3HCZ A;  2LJA A;  4MZC A;  2O85 A;  2OBK A;  5IIZ A;  3QFB C;  3KGK A;  3TJJ A;  1UN2 A;  2PVQ A;  5JWR B;  2O3E A;  1K0A A;  2R6K A;  4K8M A;  5LNK e;  4GST A;  1XCC A;  3IK7 A;  1Y1U A;  5GSS A;  2RUE A;  2HFD A;  1FB6 A;  1F2E A;  4NHZ A;  1X9M B;  5AGY A;  6GSY A;  2B6M A;  3HDC A;  1SD8 A;  1G7E A;  1TW9 A;  1SK0 A;  1F3A A;  1T4Y A;  2FA4 A;  3N9J A;  5A5K A;  1WMJ A;  4TR1 B;  2GSS A;  4NWY A;  3H4K A;  4HUA A;  4K0N A;  5ECN B;  5HFG A;  2DJJ A;  1B48 A;  1Z7R A;  3ZVJ D;  1GUL A;  3IA1 A;  2EIQ A;  1OKT A;  2MMZ A;  1XBS A;  2A4H A;  4TR3 A;  2R2J A;  2VIM A;  4XRA A;  2ES7 A;  2R3X A;  5G1K A;  3IAM 2;  1B4P A;  2ALB A;  2IPA A;  4PUA A;  3GN3 A;  5A4U A;  4RI7 A;  2H0I A;  3A2X A;  1ERW A;  3G9B A;  1LU4 A;  4GSS A;  1ML6 A;  1GH2 A;  1T7P B;  2J9H A;  2TIR A;  3QDN A;  4K0G A;  3TKP A;  3UVT A;  3IRA A;  3FR3 A;  5C04 A;  3Q19 A;  1BAY A;  3HYP A;  4N0Z A;  1TKD B;  1W4V A;  1E2Y A;  4O5R A;  2UZ8 A;  2ON5 A;  1QUW A;  2WRT A;  1R7H A;  1BED A;  1WE0 A;  3FZ4 A;  2DML A;  1I1I P;  1MDI A;  2IMD A;  3FKF A;  3DD3 A;  4USS A;  4WET A;  7GSS A;  3IE3 A;  4NMU A;  4ULX A;  2F8F A;  3H1N A;  3PH9 A;  3IC4 A;  1G6W A;  5G1L A;  1AW9 A;  3RGB C;  4IS0 A;  2CAI A;  3QAV A;  5F07 A;  2KHP A;  2I9H A;  1WP0 A;  2QGV A;  3V1W A;  1EOH A;  2K18 A;  3APS A;  1H4O A;  2FA8 A;  3DWV A;  1JZW A;  2DMM A;  3CXG A;  4K5S A;  4ECJ A;  2R4V A;  4QL7 A;  3HXS A;  3HKR A;  3LJR A;  5FT3 A;  4CW9 A;  2C0D A;  2Z9S A;  1K3O A;  4YKG A;  2VLU A;  4MK3 A;  2O87 A;  2VO4 A;  1RW1 A;  2X8H A;  3ZYW A;  4OFT A;  2VL3 A;  2C3N A;  2AV4 A;  3QAG A;  1U87 A;  3VLN A;  2GSR A;  5DAL A;  20GS A;  3HZ4 A;  5HR1 A;  3TKS E;  3EE2 A;  5D73 A;  3GA4 A;  4G0K A;  2IFQ B;  3FK8 A;  2KOK A;  4HSC X;  4MJC A;  1PX6 A;  1BJX A;  1M3I A;  3LGC A;  3IOS A;  1V57 A;  4KF9 A;  3GH6 A;  4RQX A;  3GMF A;  3WGE A;  2PUK C;  1X9S B;  2LJK A;  1S3C A;  2FUG 2;  2HRF A;  2H6X A;  1SL1 B;  2C1Y A;  3L9S A;  5ECK B;  4ZXG A;  3QPM A;  1YQ1 A;  2CAQ A;  3C1S A;  1GLQ A;  4HZ2 A;  1SVM A;  1BX9 A;  3HJO A;  2QSI A;  3EVI A;  2E0Q A;  3JCM L;  1A0F A;  1WPI A;  2YWM A;  4BIK A;  4WF4 A;  3EMX A;  3HD5 A;  5ABR A;  3TUE A;  4ZB9 A;  1NW2 A;  1V2A A;  1QGV A;  1Z9H A;  2V32 A;  1OVN A;  3D6I A;  4O7H A;  2PU9 C;  1GLP A;  3C73 A;  1CQH A;  1Y6E A;  3RPN A;  5A34 A;  2FY6 A;  3ME7 A;  1ERV A;  1SL2 B;  4K2X A;  4PXO A;  1GSU A;  1HD2 A;  3NIV A;  5CNW A;  2VM1 A;  2UV8 G;  1GSE A;  3CQF A;  5L71 A;  5AIS A;  1XWG A;  4WBR D;  1A23 A;  1GTU A;  1VRS D;  5KN1 A;  3WGD A;  4QMK A;  2DJ1 A;  2MZC A;  3VFI A;  3IHQ A;  1KTE A;  1A2M A;  1M99 A;  1HNA A;  3LXT A;  4K7O A;  5DCH A;  5G31 A;  2H1B A;  2F8A A;  3SBC A;  2XBI A;  3HVS A;  4HJM A;  5LD0 A;  3KJY A;  2MMN A;  1IYI A;  1PD2 1;  2WGR A;  1V58 A;  4H86 A;  2DJ0 A;  2LRT A;  1QK8 A;  3QCP A;  2YOI A;  3DEX A;  1S4B P;  1PL2 A;  1V9W A;  4AKI A;  2IWT A;  1XW9 A;  1K3L A;  5EL8 A;  5ECR B;  1XOB A;  3LFL A;  4QQ7 A;  1WRY A;  4MNN A;  4IKH A;  3O3T A;  4KSO A;  4XHM A;  4X43 A;  3H93 A;  2X99 A;  1R5A A;  1GUK A;  3UBK A;  2EC4 A;  2WZ9 A;  4YQV A;  2OAC A;  5BMU B;  4MF6 A;  1RQM A;  5JWO B;  1QMV A;  4BWS A;  1FVJ A;  1XZO A;  3FY7 A;  4DSS B;  4EUY A;  3RFR C;  4FQU A;  1S3D A;  4FYU A;  4MP4 A;  3KTB A;  4XCS A;  2C0E A;  2WW1 A;  1A24 A;  2GTU A;  2JU5 A;  4V1A g;  2A2R A;  3O6T A;  3A2W A;  2YAN A;  2CV4 A;  3F4S A;  4MF5 A;  2X49 A;  3VWW A;  2P0G A;  3LOR A;  5IMF A;  4MZB A;  1F6M C;  1Z5Y E;  3L0H A;  5ID2 B;  4GLT A;  1ZZY A;  4PUR A;  1A2J A;  5CAX A;  2ZCT A;  3DVW A;  4N11 A;  4JED A;  3PIN A;  1JFU A;  4X1U A;  1XWK A;  3L9U A;  1PL1 A;  1J08 A;  4NV5 A;  4O5U A;  2WS2 A;  4TR0 A;  1SJ6 A;  2C3T A;  4EXJ A;  3KH9 A;  3LEF A;  4L0U A;  5G5E A;  1TU7 A;  3ERG A;  1KBN A;  5A1N B;  3HA9 A;  3DKS A;  1O81 A;  2WUL A;  4TN8 A;  3FZA A;  5IOX A;  5ECH B;  3CWG A;  2E7P A;  2HI7 A;  2R5G A;  3LXZ A;  4EDZ A;  3EUR A;  2IMK A;  2NVL A;  1TRS A;  5H5R A;  1FOH A;  1LJR A;  2QKE A;  3PGT A;  2VCT A;  3RAZ A;  1OE8 A;  3KD0 A;  4DSQ A;  5ECQ B;  3ED3 A;  3M9K A;  4RUV A;  3UOM A;  3CSI A;  3KH7 A;  2O36 A;  1EOG A;  2B5Y A;  1H75 A;  5IOW A;  1VF2 A;  4JR6 A;  1T00 A;  1R26 A;  4HJ2 A;  2WFC A;  1HNB A;  3L4N A;  3GL5 A;  1K0D A;  5GAP D;  2IIY A;  4OMV A;  4KDX A;  1Z6N A;  2H76 A;  3UVH A;  1R4W A;  2H71 A;  2PN8 A;  3IAS 2;  1EV9 A;  3CRU A;  2M46 A;  3G7Y A;  3TKQ A;  3ZML A;  1M2A A;  3EU4 A;  1THO A;  1M2D A;  2A2S A;  3GKK A;  2B7K A;  3GST A;  4OFN A;  5D9V A;  2H70 A;  2B7J A;  4HZ4 A;  2LKU A;  2C8U A;  1FB0 A;  5IPH A;  5KEJ A;  1K0N A;  3BOA A;  1N25 A;  3GSS A;  4EC0 A;  4WBJ A;  2EFE A;  4HU9 A;  2H8L A;  2JSY A;  2TRC P;  1C72 A;  1M2B A;  1V40 A;  1K0C A;  5CRH A;  2A2P A;  5F05 A;  5EPF A;  1S3R A;  1GSS A;  2PGT A;  2RM6 A;  4WF5 A;  2QC7 A;  3ZIT A;  1FOV A;  1TTZ A;  2H72 A;  1O8W A;  1QQ2 A;  1ILO A;  4MH2 A;  2EFC A;  6GSU A;  3BJ5 A;  4YKF A;  3TJG A;  1F37 A;  2K8V A;  4KAE A;  4NHW A;  1VF1 A;  2FHE A;  2P5R A;  1TI1 A;  1SK1 A;  5CRG A;  3P90 A;  1X9W B;  1XOA A;  1A2L A;  1FG4 A;  2LEG A;  1AIU A;  3HVX A;  2C4J A;  2AYT A;  2WW3 A;  4MH3 A;  2PER A;  4XRD A;  1M7T A;  3PPU A;  1OYJ A;  5ECO B;  3CSH A;  5J4U A;  22GS A;  4LL4 B;  4G2E A;  5KN0 A;  2ON7 A;  4IQ1 A;  2NPB A;  4KB3 A;  3G7I A;  1XW6 A;  4WR4 A;  5ECI B;  3BD2 A;  3VWU A;  4GSN A;  4KDU A;  4PQI A;  5HR3 A;  1GSQ A;  1YY7 A;  2R37 A;  3EU3 A;  2CZ2 A;  2DSA A;  3W6G A;  5D93 A;  4ZBB A;  4BL7 A;  1SYX A;  5HFK A;  5GST A;  5DJL A;  3J7Y k;  3UL3 A;  4PGT A;  5DCG A;  2H1L A;  2FGX A;  2GZY A;  2P31 A;  4NV2 A;  3WD6 A;  4DSS A;  2AAW A;  1JLW A;  1PSQ A;  1PGT A;  3VUR A;  2FWE A;  4ICY A;  3UIW A;  5DJM A;  5IO0 A;  4F2I A;  1EV4 A;  2B5X A;  3QAW A;  3U5R E;  2H6Y A;  3HVV A;  2GVP A;  4V2L A;  1AQW A;  1XVW A;  1XFL A;  1GRX A;  1M0U A;  1OAZ A;  1OC9 B;  4HS1 A;  3ZRE A;  3LQ7 A;  5JWQ B;  1X5C A;  1O73 A;  4ZL9 A;  2B3S A;  3M3M A;  4AKG A;  3LYK A;  1TI3 A;  4V2M A;  4PI2 C;  1BYE A;  1K0M A;  1OC8 A;  5COH A;  5DDL A;  4POB A;  3FW2 A;  5DQS A;  2GZP A;  2PPT A;  3A3T A;  13GS A;  3HY2 A;  1TRW A;  3DML A;  1ON4 A;  3KZQ A;  3GL3 A;  3WYW A;  1TRU A;  1Y25 A;  3TKS C;  2H0H A;  3F4T A;  4IBP A;  2KP1 A;  2LNT A;  4BWQ A;  2R0C A;  1GWC A;  4ML1 A;  1AQX A;  4NPB A;  3F3R A;  2X8G A;  2G2Q A; 
#chains in the Genus database with same CATH homology
 3H79 A;  3VK9 A;  5J3R A;  3ZFB A;  1AUC A;  3D4M A;  2GLR A;  3MNG A;  4EIP A;  3D0Z A;  5G2Z A;  2VOC A;  4E8H A;  3EIN A;  3FEU A;  2L6D A;  2GSQ A;  4O5Q A;  3IC8 A;  2VL2 C;  1S3A A;  5D8I A;  3UMA A;  2TRX A;  1RK4 A;  4I8B A;  3RPP A;  5B6N A;  4EVM A;  5E59 A;  5ELA A;  4ZB7 A;  4J57 E;  3DGQ A;  3F9U A;  4ZL7 A;  2YZU A;  2VAF A;  2HSM B;  2HRN A;  2V1M A;  4F0C A;  2CVK A;  2MMO A;  1XIY A;  4I2U A;  3MYD A;  3FHK A;  2K8S A;  1TXX A;  1EP8 A;  3U6V A;  1SKR B;  4JZQ A;  2CX4 A;  4YAV A;  1EP7 A;  2R0P A;  3KEB A;  4HOJ A;  2BTO T;  2LS5 A;  1TOF A;  1O8X A;  3S9F A;  2LV3 A;  3HMJ G;  1TRV A;  2E2G A;  4ID0 A;  2AUV A;  3DRN A;  5J5N A;  2E2M A;  1XVQ A;  3RDW A;  5E4W A;  1Z7P A;  1PMT A;  4OO5 A;  17GS A;  4ML6 A;  4W66 A;  1DE2 A;  4BVX A;  2EFD A;  1AAZ A;  4PNF A;  4LA1 A;  4PNG A;  2JL4 A;  6GST A;  3E3E A;  4GQC A;  3C7M A;  4K7N A;  2IMF A;  3UAP A;  2OE3 A;  4AF2 A;  2DIZ A;  1FW1 A;  4XS6 A;  4Z2T A;  1UA5 A;  4TVE A;  1AQV A;  3F0I A;  1OKD A;  4GF0 A;  1SL0 B;  2WDU A;  2XC2 A;  5CRE A;  2YJH A;  3L78 A;  3CBU A;  2CA8 A;  5INY A;  3WT2 A;  4JE1 A;  4F03 A;  1G6Y A;  18GS A;  2H73 A;  1MTC A;  2H66 A;  3MWH A;  2H75 A;  1V98 A;  2G0F A;  2VUP A;  3H8Q A;  3MAK A;  4Q5F A;  4ZB8 A;  5H5S A;  1E6B A;  1YZX A;  3F3Q A;  5IQY A;  1A8Y A;  4EL1 A;  4BVY B;  4TR1 A;  3FRC A;  1XXU A;  1BF5 A;  3Q6O A;  1FAA A;  1YF0 A;  3VI7 A;  4JBB A;  3TU3 B;  3F4R A;  4I97 A;  3APQ A;  4O32 A;  2HT9 A;  1Z3E A;  2IME A;  3CSJ A;  4WEY A;  5HR2 A;  1PX7 A;  1HNC A;  1QFN A;  1ZYQ B;  4IN0 A;  2IN3 A;  1I5G A;  3L9V A;  1ZYE A;  1OC9 A;  1MD3 A;  5DAK B;  5DQY A;  5G30 A;  2PMT A;  2HRK B;  5FHI A;  5A4W A;  3M8N A;  3TCO A;  3GHA A;  4RQR A;  3FMW A;  3EMP A;  2GS3 A;  4NAX A;  2FWH A;  2XHF A;  2OKA A;  4KUN A;  4Z2U A;  4D73 B;  4HQZ A;  1GL8 A;  4LMW A;  2L59 A;  3VWX A;  1XWA A;  3FZ9 A;  1YF1 A;  2YPM A;  3BCI A;  4PTS A;  1ZYN A;  5KN2 A;  2VCQ A;  3GKX A;  2IL3 A;  4G0I A;  4ECB A;  3E0U A;  2YN1 A;  2VKZ G;  3ZLP A;  5H5Q A;  4PUF C;  1URM A;  1EWX A;  1ST9 A;  1VF3 A;  3IDV A;  5CO3 A;  5IMC A;  5D9X A;  3D21 A;  5B7C A;  2WB9 A;  3MSZ A;  4X4J A;  2GQK A;  4G10 A;  1F9M A;  2YV9 A;  2V6K A;  1N8J A;  3EWL A;  4MLY A;  2YCD A;  4RI6 A;  4POK A;  4KE3 A;  1O7U A;  4HEA 2;  4WXT A;  3D4T A;  4EIQ A;  4ECI A;  5J41 A;  2HSM A;  4J56 E;  3P8W A;  4L8E A;  3KM6 A;  5AN1 A;  3CMI A;  1EZK A;  5CP1 A;  2XPD A;  4G19 A;  4BPY A;  2IFQ A;  2FWF A;  4KA0 A;  5EVO A;  4HDE A;  3AY8 A;  3ZRD A;  3OR5 A;  3FYG A;  3I69 A;  4AKX B;  4AJ8 A;  2GT5 A;  1PRX A;  3HJM A;  1X5D A;  4FIW A;  4CHS A;  5F0G A;  1PKW A;  1GUM A;  4P3Y B;  4DSR A;  1LBK A;  10GS A;  3GKN A;  4ZL8 A;  3LG6 A;  3MDK A;  5ECM B;  4EF0 A;  2AB6 A;  2L4C A;  1U3I A;  2LRC A;  1XWC A;  2OA7 A;  1WJK A;  6GSS A;  3DVX A;  4EE0 A;  2D2Z A;  4WKW A;  1T4Z A;  1GNE A;  4XS4 B;  4OD7 A;  3I9V 2;  4ZIL A;  1XPV A;  1GSY A;  1QXH A;  2LST A;  4EO3 A;  4XIH A;  1U6T A;  1M9A A;  4ZIJ A;  2DJK A;  3KMN A;  4K6X A;  2ZNM A;  3GUS A;  1X0R A;  2L5L A;  1T3B A;  3LW9 A;  3KP8 A;  3R3E A;  2CQ9 A;  3EYT A;  3EPT A;  2YP6 A;  4K5R A;  4O92 A;  4N0V A;  2GGT A;  3QFA C;  5IMA A;  4NXI A;  3TB2 A;  1USB A;  3APO A;  9GSS A;  4PQ1 A;  1U88 A;  1ABA A;  3VWV A;  1MDK A;  2M80 A;  3IR4 A;  1JZD A;  4KW6 A;  3J7Y b;  3M9J A;  5JCG A;  3TDG A;  4PX1 A;  4GTU A;  6GSW A;  3W8J A;  1N2A A;  2VCW A;  3GRX A;  4KGI A;  2REM A;  2DKI A;  1Q98 A;  2IJY A;  1IYH A;  2DLX A;  1NSW A;  4EDY A;  4Q5N A;  2AHE A;  2CVD A;  2QA1 A;  1SVO A;  3D22 A;  4F9Z A;  2EFH A;  1ERU A;  4N3Z A;  3GIX A;  1O6J A;  1JLV A;  1TU8 A;  2P5Q A;  4DVC A;  3HJP A;  3A5I A;  4TKY A;  5IMV A;  5BMU A;  4ACS A;  3ZIJ A;  1PA3 A;  2FNO A;  3QD9 A;  2H0G A;  1UVZ A;  4PQH A;  14GS A;  5J4V A;  4V2N A;  1XW5 A;  5DAK A;  3FR9 A;  1WWJ A;  2DJ2 A;  2K9F A;  4GXZ A;  4ISD A;  2XPE A;  2F3M A;  2HRK A;  2YWO A;  5GAN D;  5AIV A;  4L0W A;  1YKA A;  1YEX A;  4ECC A;  3R2Q A;  3UAR A;  1YVL A;  1SJZ A;  2I3Y A;  1ERT A;  5FWG A;  4MCU A;  5D9W A;  5JCU A;  4D73 A;  3SWL A;  4HU7 A;  3RHB A;  1T8E B;  2HZE B;  5ID2 A;  2H1D A;  3RHC A;  3C1R A;  4YQM A;  4I5Q A;  1U3A A;  2ZUP A;  4JU5 A;  4MMM A;  2BMX A;  4OCE A;  1GTB A;  1B9Y C;  1G0T A;  2OE0 A;  3TJF A;  3F6D A;  2N5B A;  4AJ7 A;  3KMO A;  3M0F A;  4TRX A;  4MJA A;  3KCM A;  2V6O A;  4Z7X A;  3KTL A;  4MZW A;  2H1A A;  5F8B A;  1AXD A;  4G0L A;  3IHG A;  5A1N A;  4IJI A;  3WGX A;  2NTO A;  3GNJ A;  1YDK A;  4MPG A;  2OBI A;  4TXV A;  2O7K A;  4G01 A;  3TKR A;  2CX3 A;  2OJL A;  4IGJ A;  3ZZX A;  3US3 A;  2I81 A;  2DC5 A;  3GYK A;  4MJB A;  4LL1 B;  4GWR A;  1YEP A;  3ISO A;  1TK0 B;  3EC3 A;  2A4V A;  2VCZ A;  3ERF A;  5DVB A;  1B4Q A;  2IMI A;  4MAB A;  2B1L A;  5IPG A;  4Q5Q A;  2O8V B;  4F82 A;  3VPT A;  2YJ7 A;  3TKS A;  2PBJ A;  3TGZ A;  4QL9 A;  2XBQ A;  6GSV A;  3DYR A;  2F51 A;  3GUR A;  2L57 A;  1NM3 A;  1NHO A;  4A5P A;  1ZGN A;  1B9X C;  2CVB A;  2X4A A;  2H6Z A;  3UJ1 A;  5J47 A;  3TJK A;  1SYR A;  4N10 A;  5G5F A;  2EIR A;  1EEM A;  1TK8 B;  4GDF A;  1KEB A;  4MA9 A;  3KIJ A;  12GS A;  3QOU A;  1ZMA A;  4MPF A;  3ZVJ A;  2VL2 A;  2CT6 A;  3GKM A;  4ILF A;  1SKW B;  1PN0 A;  2YWI A;  2VCV A;  2FLS A;  1FHE A;  4OWY A;  4J2F A;  2HQT A;  4IP1 A;  2RM5 A;  4L5O A;  4IJ3 A;  2NDO A;  5IMZ A;  3CRT A;  2V41 A;  1R5P A;  4EKZ A;  2JZS A;  2WJU A;  1YJ6 A;  4TXO B;  3I6A A;  3UBL A;  1MDJ A;  1Z6M A;  3IK9 A;  1YKC A;  1MEK A;  2AJQ B;  4GRF A;  2N5F A;  2HSY A;  2PVO C;  3VPQ A;  5JCW A;  3HHV A;  5ELG A;  3FZ5 A;  4CY6 A;  3RBT A;  1JHB A;  3FR6 A;  4XS4 A;  1EGR A;  3I43 A;  2DBC A;  2HSN B;  2OAD A;  3M1G A;  3GFK A;  2KP2 A;  1TDI A;  4K9Z A;  3DXB A;  1B8X A;  3F6F A;  5A5H B;  2H1G A;  2YV7 A;  2LQO A;  3GTU B;  2RLI A;  1A8L A;  2HZF A;  5HR0 A;  1PN9 A;  4KH7 A;  2X64 A;  5HFI A;  2PWJ A;  1SVL A;  4KCA A;  2DJ3 A;  1AC1 A;  4JRR A;  3HZ8 A;  2C0F A;  2YWN A;  4TW5 A;  4TOP A;  1OC3 A;  2HLS A;  3CYN A;  5IO2 A;  4TR4 A;  2EIO A;  3BBY A;  4OFM A;  4YAP A;  4N30 A;  1PKZ A;  4L5L A;  1DSB A;  2C3Q A;  2HXK A;  2MBT A;  6GSX A;  1TJD A;  2FD3 A;  2X8C A;  2BJX A;  1EEJ A;  4KX4 A;  1JZR A;  2F9S A;  2DKH A;  4KSM A;  3NOF A;  4MDC A;  2LJR A;  2N5A A;  2K6V A;  5GZZ B;  1TK5 B;  1J9B A;  4FH8 A;  1M9B A;  3IV4 A;  4XS1 A;  2LRN A;  4V1A p;  2DIY A;  3NZN A;  2GDR A;  3ZIV A;  5CYY A;  5D9T A;  3F8U A;  3GX0 A;  5ECS A;  3P2A A;  5C00 A;  1BQ7 A;  1T1V A;  4OCF A;  3ZMK A;  1SEN A;  3QR6 A;  2KLX A;  2GST A;  5HQP A;  3ZTL A;  4Z2R A;  5AIX A;  4HI7 A;  1SD9 A;  3DIE A;  4XTS A;  4FO5 A;  3KXO A;  3IBH A;  2JZR A;  2GQL A;  2B1K A;  3A2V A;  4AJ6 A;  5KOX A;  5J40 A;  4FYC A;  2GQM A;  3VI5 A;  3GV1 A;  4DEJ A;  1VGL A;  1O85 A;  1JZO A;  4GQF A;  5CRD A;  1WIK A;  5ECL B;  2HZE A;  4KND A;  4IHU A;  1I9D A;  2FCH A;  2FWG A;  2WCI A;  4LMV A;  4K7I A;  3A5W A;  4ZBD A;  4BL7 B;  4AI6 A;  4K1F A;  4E8E A;  2H19 A;  5D96 A;  2RII A;  2MMA A;  1GSD A;  3P7X A;  3ZL5 A;  1GNW A;  3WT1 A;  5A4V A;  4IVF A;  2O89 A;  1K0B A;  2OT3 A;  1GUH A;  1KNG A;  1ZCP A;  1GSF A;  1SJI A;  4Q5R A;  1J0F A;  2I1U A;  1TP9 A;  4GCI A;  4E68 A;  3D5J A;  5B6M A;  3UEM A;  2I4A A;  5ECP B;  1THX A;  3TRP A;  3TOT A;  5CRW A;  2H01 A;  3Q74 A;  3ME8 A;  5B8B A;  3E9J B;  3ZFL A;  16GS A;  5LCZ A;  2GZZ A;  4LLR A;  1OE7 A;  2J23 A;  1TXU A;  2GT6 A;  3PR8 A;  3QMX A;  4IEL A;  4ZB6 A;  1GP1 A;  2L6C A;  4KCE A;  5F06 A;  4POL A;  19GS A;  1UC7 A;  2JAD A;  2VL9 A;  4HQS A;  2HRA A;  1G7O A;  1GTA A;  4OO4 A;  1FVK A;  2MBS A;  1HQO A;  3TJB A;  5EY6 A;  4KDY A;  2HSH A;  5ENU A;  2LTK A;  2LQQ A;  1WOU A;  5BRT A;  11GS A;  3CTF A;  1HYU A;  4K2D A;  1ZYP A;  3TOU A;  3ERW A;  2YNX A;  2R0G A;  3LWA A;  2L4Q A;  1XWB A;  2B5E A;  2V2G A;  2VM2 A;  4FYB A;  2C80 A;  4TXO A;  2NBS A;  2KUC A;  1DBY A;  3BCK A;  2JAC A;  1MD4 A;  3LYP A;  4X0X A;  3GX8 A;  3CTG A;  5B8A A;  1BG1 A;  5J9C A;  5J4Y A;  3TRQ A;  4G9H A;  2OE1 A;  3O76 A;  2HNL A;  2HYX A;  3TRX A;  4IW9 A;  2VLV A;  4IP6 A;  2LNS A;  3Q18 A;  5DBQ A;  4MJE A;  4AKH A;  1DE1 A;  5DAL B;  4F0B A;  1K3Y A;  2H30 A;  1SKS B;  2HSN A;  3LSZ A;  4CDO A;  4YQU A;  1FO5 A;  1K0O A;  5A5H A;  1VF4 A;  1W89 A;  3GTU A;  4IQA A;  2QA2 A;  4WR5 A;  1ACV A;  5J9B A;  2MYG A;  2CZ3 A;  3G7J A;  3IXR A;  1SK2 A;  3W8S A;  4I2T A;  1PQN A;  1NHY A;  1CQG A;  3K8N A;  2VD1 A;  4MF7 A;  3GH9 A;  2C0G A;  4I6X A;  1GTI A;  1DUG A;  8GSS A;  1ZL9 A;  2JZT A;  4BA7 A;  4AGS A;  4CY8 A;  2LUS A;  2H74 A;  2JSZ A;  1Q4J A;  4BVX B;  1SU9 A;  4POM A;  5IM9 A;  4ZBA A;  1BG5 A;  2M72 A;  3F63 A;  1ZOF A;  3C8E A;  1EGO A;  2HE3 A;  3IPZ A;  5KN3 A;  5A34 B;  5KOW A;  2VCX A;  2YZH A;  2VLT A;  5IMD A;  4YH2 A;  3MIX A;  3C71 A;  2O5V A;  4BVY A;  1X5E A;  3KP9 A;  3N5O A;  1A0R P;  2VD0 A;  4JR4 A;  1F3B A;  2L5O A;  2RUF A;  3HCZ A;  2LJA A;  4MZC A;  2O85 A;  2OBK A;  5IIZ A;  3QFB C;  3KGK A;  3TJJ A;  1UN2 A;  2PVQ A;  5JWR B;  1K0A A;  2R6K A;  4K8M A;  5LNK e;  4GST A;  1XCC A;  3IK7 A;  1Y1U A;  5GSS A;  2RUE A;  2HFD A;  1FB6 A;  1F2E A;  4NHZ A;  1X9M B;  5AGY A;  6GSY A;  2B6M A;  3HDC A;  1SD8 A;  1G7E A;  1TW9 A;  1SK0 A;  1F3A A;  1T4Y A;  2FA4 A;  3N9J A;  5A5K A;  1WMJ A;  4TR1 B;  2GSS A;  4NWY A;  3H4K A;  4HUA A;  4K0N A;  5ECN B;  5HFG A;  2DJJ A;  1B48 A;  1Z7R A;  3ZVJ D;  1GUL A;  3IA1 A;  2EIQ A;  1OKT A;  2MMZ A;  1XBS A;  2A4H A;  4TR3 A;  2R2J A;  2VIM A;  4XRA A;  2ES7 A;  2R3X A;  5G1K A;  3IAM 2;  1B4P A;  2ALB A;  2IPA A;  4PUA A;  3GN3 A;  5A4U A;  4RI7 A;  2H0I A;  3A2X A;  1ERW A;  3G9B A;  1LU4 A;  4GSS A;  1ML6 A;  1GH2 A;  1T7P B;  2J9H A;  2TIR A;  3QDN A;  4K0G A;  3TKP A;  3UVT A;  3IRA A;  3FR3 A;  5C04 A;  3Q19 A;  1BAY A;  3HYP A;  4N0Z A;  1TKD B;  1W4V A;  1E2Y A;  4O5R A;  2UZ8 A;  2ON5 A;  1QUW A;  2WRT A;  1R7H A;  1BED A;  1WE0 A;  3FZ4 A;  2DML A;  1MDI A;  2IMD A;  3FKF A;  3DD3 A;  4USS A;  4WET A;  7GSS A;  3IE3 A;  4NMU A;  4ULX A;  2F8F A;  3H1N A;  3PH9 A;  3IC4 A;  1G6W A;  5G1L A;  1AW9 A;  4IS0 A;  2CAI A;  3QAV A;  5F07 A;  2KHP A;  2I9H A;  1WP0 A;  2QGV A;  3V1W A;  1EOH A;  2K18 A;  3APS A;  1H4O A;  2FA8 A;  3DWV A;  1JZW A;  2DMM A;  3CXG A;  4K5S A;  4ECJ A;  2R4V A;  4QL7 A;  3HXS A;  3HKR A;  3LJR A;  5FT3 A;  4CW9 A;  2C0D A;  2Z9S A;  1K3O A;  4YKG A;  2VLU A;  4MK3 A;  2O87 A;  2VO4 A;  1RW1 A;  2X8H A;  3ZYW A;  4OFT A;  2VL3 A;  2C3N A;  2AV4 A;  3QAG A;  1U87 A;  3VLN A;  2GSR A;  5DAL A;  20GS A;  3HZ4 A;  5HR1 A;  3TKS E;  3EE2 A;  5D73 A;  3GA4 A;  4G0K A;  2IFQ B;  3FK8 A;  2KOK A;  4MJC A;  1PX6 A;  1BJX A;  3LGC A;  3IOS A;  1V57 A;  4KF9 A;  3GH6 A;  4RQX A;  3GMF A;  3WGE A;  2PUK C;  1X9S B;  2LJK A;  1S3C A;  2FUG 2;  2HRF A;  2H6X A;  1SL1 B;  2C1Y A;  3L9S A;  5ECK B;  4ZXG A;  3QPM A;  1YQ1 A;  2CAQ A;  3C1S A;  1GLQ A;  4HZ2 A;  1SVM A;  1BX9 A;  3HJO A;  2QSI A;  3EVI A;  2E0Q A;  3JCM L;  1A0F A;  1WPI A;  2YWM A;  4WF4 A;  3EMX A;  3HD5 A;  5ABR A;  3TUE A;  4ZB9 A;  1NW2 A;  1V2A A;  1QGV A;  1Z9H A;  2V32 A;  1OVN A;  3D6I A;  4O7H A;  2PU9 C;  1GLP A;  3C73 A;  1CQH A;  1Y6E A;  3RPN A;  5A34 A;  2FY6 A;  3ME7 A;  1ERV A;  1SL2 B;  4K2X A;  4PXO A;  1GSU A;  1HD2 A;  3NIV A;  5CNW A;  2VM1 A;  2UV8 G;  1GSE A;  5L71 A;  5AIS A;  1XWG A;  4WBR D;  1A23 A;  1GTU A;  1VRS D;  5KN1 A;  3WGD A;  4QMK A;  2DJ1 A;  2MZC A;  3VFI A;  3IHQ A;  1KTE A;  1A2M A;  1M99 A;  1HNA A;  3LXT A;  4K7O A;  5DCH A;  5G31 A;  2H1B A;  2F8A A;  3SBC A;  2XBI A;  3HVS A;  4HJM A;  5LD0 A;  3KJY A;  2MMN A;  1IYI A;  1PD2 1;  2WGR A;  1V58 A;  4H86 A;  2DJ0 A;  2LRT A;  1QK8 A;  3QCP A;  2YOI A;  3DEX A;  1PL2 A;  1V9W A;  4AKI A;  2IWT A;  1XW9 A;  1K3L A;  5EL8 A;  5ECR B;  1XOB A;  3LFL A;  4QQ7 A;  1WRY A;  4MNN A;  4IKH A;  3O3T A;  4KSO A;  4XHM A;  4X43 A;  3H93 A;  2X99 A;  1R5A A;  1GUK A;  3UBK A;  2EC4 A;  2WZ9 A;  4YQV A;  2OAC A;  5BMU B;  4MF6 A;  1RQM A;  5JWO B;  1QMV A;  4BWS A;  1FVJ A;  1XZO A;  3FY7 A;  4DSS B;  4EUY A;  4FQU A;  1S3D A;  4FYU A;  4MP4 A;  3KTB A;  4XCS A;  2C0E A;  1A24 A;  2GTU A;  2JU5 A;  4V1A g;  2A2R A;  3O6T A;  3A2W A;  2YAN A;  2CV4 A;  3F4S A;  4MF5 A;  2X49 A;  3VWW A;  2P0G A;  3LOR A;  5IMF A;  4MZB A;  1F6M C;  1Z5Y E;  3L0H A;  5ID2 B;  4GLT A;  1ZZY A;  4PUR A;  1A2J A;  5CAX A;  2ZCT A;  3DVW A;  4N11 A;  4JED A;  3PIN A;  1JFU A;  4X1U A;  1XWK A;  3L9U A;  1PL1 A;  1J08 A;  4NV5 A;  4O5U A;  2WS2 A;  4TR0 A;  1SJ6 A;  2C3T A;  4EXJ A;  3KH9 A;  3LEF A;  4L0U A;  5G5E A;  1TU7 A;  3ERG A;  1KBN A;  5A1N B;  3HA9 A;  3DKS A;  1O81 A;  2WUL A;  4TN8 A;  3FZA A;  5IOX A;  5ECH B;  3CWG A;  2E7P A;  2HI7 A;  2R5G A;  3LXZ A;  4EDZ A;  3EUR A;  2IMK A;  2NVL A;  1TRS A;  5H5R A;  1FOH A;  1LJR A;  2QKE A;  3PGT A;  2VCT A;  3RAZ A;  1OE8 A;  3KD0 A;  4DSQ A;  5ECQ B;  3ED3 A;  3M9K A;  4RUV A;  3UOM A;  3CSI A;  3KH7 A;  1EOG A;  2B5Y A;  1H75 A;  5IOW A;  1VF2 A;  4JR6 A;  1T00 A;  1R26 A;  4HJ2 A;  2WFC A;  1HNB A;  3L4N A;  3GL5 A;  1K0D A;  5GAP D;  2IIY A;  4OMV A;  4KDX A;  1Z6N A;  2H76 A;  3UVH A;  1R4W A;  2H71 A;  2PN8 A;  3IAS 2;  1EV9 A;  3CRU A;  2M46 A;  3G7Y A;  3TKQ A;  3ZML A;  1M2A A;  3EU4 A;  1THO A;  1M2D A;  2A2S A;  3GKK A;  2B7K A;  3GST A;  4OFN A;  5D9V A;  2H70 A;  2B7J A;  4HZ4 A;  2LKU A;  2C8U A;  1FB0 A;  5IPH A;  5KEJ A;  1K0N A;  3BOA A;  1N25 A;  3GSS A;  4EC0 A;  4WBJ A;  2EFE A;  4HU9 A;  2H8L A;  2JSY A;  2TRC P;  1C72 A;  1M2B A;  1V40 A;  1K0C A;  5CRH A;  2A2P A;  5F05 A;  5EPF A;  1GSS A;  2PGT A;  2RM6 A;  4WF5 A;  2QC7 A;  3ZIT A;  1FOV A;  1TTZ A;  2H72 A;  1O8W A;  1QQ2 A;  1ILO A;  4MH2 A;  2EFC A;  6GSU A;  3BJ5 A;  4YKF A;  3TJG A;  1F37 A;  2K8V A;  4KAE A;  4NHW A;  1VF1 A;  2FHE A;  2P5R A;  1TI1 A;  1SK1 A;  5CRG A;  3P90 A;  1X9W B;  1XOA A;  1A2L A;  1FG4 A;  2LEG A;  1AIU A;  3HVX A;  2C4J A;  2AYT A;  4MH3 A;  2PER A;  4XRD A;  1M7T A;  3PPU A;  1OYJ A;  5ECO B;  3CSH A;  5J4U A;  22GS A;  4LL4 B;  4G2E A;  5KN0 A;  2ON7 A;  4IQ1 A;  2NPB A;  4KB3 A;  3G7I A;  1XW6 A;  4WR4 A;  5ECI B;  3BD2 A;  3VWU A;  4GSN A;  4KDU A;  4PQI A;  5HR3 A;  1GSQ A;  1YY7 A;  2R37 A;  3EU3 A;  2CZ2 A;  2DSA A;  3W6G A;  5D93 A;  4ZBB A;  4BL7 A;  1SYX A;  5HFK A;  5GST A;  5DJL A;  3J7Y k;  3UL3 A;  4PGT A;  5DCG A;  2H1L A;  2FGX A;  2GZY A;  2P31 A;  4NV2 A;  3WD6 A;  4DSS A;  2AAW A;  1JLW A;  1PSQ A;  1PGT A;  3VUR A;  2FWE A;  4ICY A;  3UIW A;  5DJM A;  5IO0 A;  4F2I A;  1EV4 A;  2B5X A;  3QAW A;  3U5R E;  2H6Y A;  3HVV A;  2GVP A;  4V2L A;  1AQW A;  1XVW A;  1XFL A;  1GRX A;  1M0U A;  1OAZ A;  1OC9 B;  4HS1 A;  3ZRE A;  3LQ7 A;  5JWQ B;  1X5C A;  1O73 A;  4ZL9 A;  2B3S A;  3M3M A;  4AKG A;  3LYK A;  1TI3 A;  4V2M A;  1BYE A;  1K0M A;  1OC8 A;  5COH A;  5DDL A;  4POB A;  3FW2 A;  5DQS A;  2GZP A;  2PPT A;  3A3T A;  13GS A;  3HY2 A;  1TRW A;  3DML A;  3KZQ A;  1ON4 A;  3GL3 A;  3WYW A;  1TRU A;  1Y25 A;  3TKS C;  2H0H A;  3F4T A;  4IBP A;  2KP1 A;  2LNT A;  4BWQ A;  2R0C A;  1GWC A;  4ML1 A;  1AQX A;  4NPB A;  3F3R A;  2X8G A;  2G2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...