2VCXA

Complex structure of prostaglandin d2 synthase at 2.1a.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcxA01
1R26A 4ZB9A 4XS1A 3ZFBA 1GSSA 19GSA 2A2SA 2YJHA 3IBHA 2V2GA 1A8LA 3RBTA 2YANA 1EEJA 2C0GA 2J23A 3P90A 1I5GA 4JRRA 4ZILA 3EYTA 4BL7B 5G1KA 3TDGA 4L0UA 1M0UA 1THXA 2LV3A 1LBKA 4PX1A 3NZNA 2O87A 3GTUB 4NPBA 3VLNA 2GT6A 4JR4A 2K8VA 2H0IA 1GULA 3H4KA 2LJAA 5LNKe 2RLIA 4MABA 4WBJA 2R5GA 5IMDA 4P3YB 4ZB6A 2MMZA 3D5JA 3FRCA 1HD2A 2LRCA 2H73A 2V6OA 2NDOA 5B6MA 3UBLA 4WETA 4XRDA 2O89A 5KN0A 2HRKB 5KN2A 3QOUA 5C00A 4ECCA 4GWRA 1A24A 3TB2A 2VM1A 1A2MA 1Q4JA 2K9FA 3LYPA 2VCWA 3TJKA 1TK0B 5H5RA 4WF4A 4K1FA 5HR1A 1QXHA 1SJZA 3ME7A 3IK9A 3VURA 1Y25A 4MP4A 4KX4A 2H0GA 3LSZA 1K0MA 1AQXA 3UOMA 4K7IA 4LL4B 3TOUA 2EIRA 4OD7A 1WOUA 2I4AA 1E6BA 1GTBA 4LMVA 2VD1A 3QAGA 5C04A 4HDEA 3D4TA 1VF1A 1ERTA 3QFAC 3Q6OA 16GSA 3QCPA 3F3RA 4XS4B 1VF2A 2YOIA 1A23A 3SWLA 3IXRA 1GLQA 5IMCA 1T00A 3L0HA 5ID2A 1UVZA 1UA5A 3R3EA 2EC4A 2CZ3A 1XVWA 4HQZA 2LJRA 3PR8A 3HJOA 1BYEA 4OMVA 1ERWA 2P31A 4POKA 3QR6A 1OKDA 3CMIA 3WGXA 4DSSA 3UJ1A 2FCHA 2KP1A 3APSA 3TCOA 1F3BA 5B6NA 5A5KA 4F82A 1USBA 2FWGA 1FO5A 1LU4A 3HVSA 2HRFA 4K9ZA 5IM9A 1Q98A 1X5EA 1TJDA 2L5LA 1G6YA 3K8NA 3RAZA 4IJIA 1UN2A 1WE0A 2MBSA 5DJLA 4N30A 3CYNA 1X0RA 1T4YA 4FYCA 5D9TA 1F37A 2FUG2 1CQGA 17GSA 2CVBA 1TP9A 3GV1A 3A2XA 2VCQA 5LCZA 3HCZA 3PINA 2F8AA 1GSYA 2HZFA 2I9HA 2XC2A 4MZWA 2O7KA 4MMMA 1XVQA 4POBA 4ID0A 2M46A 4FH8A 3IPZA 1EP8A 2G2QA 3HYPA 3M0FA 3EVIA 1A2JA 3N9JA 3ZMKA 3D21A 6GSVA 3GRXA 20GSA 2FY6A 3FZ5A 3V1WA 1OKTA 2H1DA 3VWWA 3IHQA 3DGQA 4IBPA 4JBBA 5J9CA 3PGTA 4XTSA 5ECMB 2YWMA 4ZBDA 4G9HA 5JCUA 3O6TA 4H86A 2PU9C 4POMA 4MPGA 4TR0A 1QGVA 3LQ7A 5IMAA 1U6TA 1PL1A 4GLTA 4EDZA 2IMKA 3FZ9A 3GL3A 4O92A 4GSNA 3TKSA 2GVPA 2TRCP 1GTIA 1GUKA 3ZIJA 4CW9A 5DCHA 3MNGA 1ZOFA 2UZ8A 4KB3A 2HZEB 1G7OA 2WFCA 1R7HA 2YP6A 3R2QA 2BMXA 1XW6A 1B9XC 4NWYA 4KCEA 1B4QA 2FWHA 4K2DA 2FHEA 3GX8A 1FG4A 3F63A 3TKSE 2L6CA 1MEKA 3MDKA 4OO5A 3P8WA 2JL4A 3TRXA 2OA7A 4Q5FA 1SU9A 4OCFA 4V1Ag 4EE0A 3F9UA 3GH6A 2NPBA 4HZ4A 2GZZA 1VF4A 5DVBA 1O8WA 1OYJA 4BVXA 3GL5A 2DC5A 3DD3A 2YCDA 5JCWA 2OE1A 3LORA 2JZTA 1GUHA 3KD0A 1PSQA 1C72A 4PUFC 3HA9A 1OAZA 2B1LA 4TR4A 5CNWA 1A0FA 3MSZA 3A2WA 2KUCA 3GSSA 2IL3A 5ECNB 1AIUA 1ERUA 1EV4A 1HYUA 1Z5YE 3KH9A 2ZNMA 1U3AA 4IQAA 5G30A 4NV2A 1YKCA 1SKSB 2VCXA 5IPHA 3QDNA 1BJXA 1WWJA 4D73B 1ZMAA 2PPTA 1MD3A 5A4WA 2VL3A 2E0QA 3LGCA 2DJ2A 5DALB 1N2AA 4MZBA 4TXOA 1WRYA 3GH9A 3QPMA 2F8FA 1PRXA 1EGOA 1SJIA 1RK4A 2ZUPA 4PNGA 2K18A 4RQXA 2GDRA 2HSYA 2N5BA 2X8GA 2VLTA 1B48A 3RHBA 4YQUA 2IMFA 2IJYA 1GTUA 2ZCTA 2TRXA 4IHUA 7GSSA 2QSIA 1RQMA 5JCGA 1M9BA 1FAAA 1XWGA 2PBJA 3FEUA 3GNJA 5J4UA 5J41A 1PN9A 2MMAA 1V9WA 2CZ2A 2KOKA 4KDUA 1MDJA 3ZFLA 1FB6A 6GSYA 4WBRD 2DJ0A 1WMJA 3F4RA 2H74A 4CDOA 3KIJA 4TR3A 1ABAA 3VPQA 1Z7PA 3DRNA 3GSTA 4NHZA 1SYXA 2OJLA 3VI7A 4NHWA 2M80A 4WR4A 2V1MA 1T4ZA 1FOVA 4KDXA 4MZCA 4TRXA 1EV9A 4IVFA 4CHSA 2B6MA 2HI7A 4LA1A 3FR6A 1JZRA 3FKFA 3EE2A 1DUGA 1EP7A 2ALBA 4EDYA 3HJPA 4PGTA 1OE7A 2OACA 3IOSA 1ST9A 3G7YA 1TKDB 3IAM2 1W4VA 5A4VA 3C1SA 3RHCA 2AHEA 3C1RA 2GS3A 1K0AA 1AUCA 4L5LA 3ZZXA 5DAKB 4L0WA 1T7PB 4MPFA 4HU7A 1ACVA 3DKSA 4NV5A 1TW9A 3FW2A 1J08A 2F51A 5CRWA 2WDUA 3AY8A 4F03A 3FZAA 1AW9A 2JACA 4AJ7A 2NBSA 4I6XA 2VUPA 4N0ZA 4DVCA 4PXOA 1R5AA 2VD0A 4ZBBA 4YAVA 3M8NA 2C3TA 4BVYA 3ME8A 5ELAA 3KM6A 3DYRA 2H1BA 5DQYA 2VCTA 2NTOA 2HYXA 3E3EA 3TJBA 4YH2A 4MLYA 4KSOA 4AJ8A 2GGTA 1JHBA 1ZYEA 3H79A 3G7JA 4IGJA 4YQMA 4IS0A 2GZPA 1IYHA 2P5RA 5ELGA 3GIXA 2O85A 3DMLA 1NHOA 2GTUA 5F07A 1F2EA 3KEBA 2X64A 3VK9A 4XIHA 2L6DA 2IFQB 3GTUA 2YV9A 5ECRB 1O85A 2HXKA 2QGVA 4F2IA 5GAND 1VF3A 3BJ5A 1K3OA 5AISA 1TXXA 3GN3A 2OBIA 4PQIA 5IMFA 3L9SA 1HQOA 2H6YA 4JR6A 2C0DA 3VPTA 4ACSA 1A0RP 1U3IA 5G2ZA 5HR0A 4I5QA 2AJQB 5DCGA 2MBTA 3F4SA 3LXTA 4I2TA 2M72A 5A4UA 4K0GA 1B9YC 1YF1A 5HFGA 1G6WA 3J7Yb 2B5YA 4IW9A 5D9VA 3CRUA 1GWCA 1K0CA 2FWFA 2G0FA 1CQHA 3E9JB 3I69A 1O6JA 3HVXA 2PWJA 2D2ZA 2HLSA 2L4CA 2JSZA 2L4QA 2V32A 1GNEA 2R3XA 3BCKA 4N10A 4EXJA 2C3QA 2NVLA 2HRNA 3GYKA 1XW9A 4HEA2 2DIYA 4OFNA 3I43A 3ZRDA 4XS4A 1JZDA 2B5EA 3VWXA 4HS1A 4K6XA 4OFMA 1XXUA 4X43A 1ZYQB 5G5FA 1NM3A 1XBSA 3QAVA 6GSXA 2DJKA 5IOWA 3GUSA 1QQ2A 2FLSA 2LEGA 4KH7A 2MMOA 2L57A 4KA0A 3TKRA 3CSIA 4HU9A 2HT9A 1Z6NA 5IQYA 4USSA 1TK5B 2H0HA 1V40A 4TOPA 1OC9B 1XWBA 1XWKA 4KDYA 4WKWA 1Z6MA 3LEFA 4MJBA 1SL0B 1X5CA 3MWHA 5CP1A 1MDIA 5JWOB 2LQQA 1QK8A 1AAZA 4YQVA 1T8EB 2GSRA 3IAS2 2I81A 3E0UA 3EURA 2AYTA 3W6GA 4G10A 4ML6A 1TK8B 1TI3A 4K0NA 2VM2A 2HQTA 1J9BA 1ZGNA 3HXSA 2PERA 3G9BA 2X8CA 3TRQA 4ZL7A 1JZWA 1KNGA 3KP8A 4IN0A 1SL1B 1XIYA 1ML6A 2H75A 2V6KA 2A2RA 2XPDA 5L71A 2H72A 5BMUA 4WEYA 1HNAA 2VLUA 4I8BA 1GTAA 5CRDA 3ISOA 2H6XA 4XHMA 3EU4A 1HNBA 3H1NA 2C8UA 2RM5A 4MF7A 1ZCPA 2WJUA 4F0BA 4JZQA 1WJKA 4JU5A 1Z7RA 1DBYA 1AQWA 1BX9A 3HD5A 2FA4A 1M7TA 2IMEA 5AGYA 11GSA 1K0DA 1ZL9A 4ECJA 5D9XA 4BWSA 2H1GA 1G0TA 3SBCA 2WS2A 3GA4A 4HJMA 3CXGA 1YDKA 3VFIA 4EO3A 3GKMA 4MCUA 3TOTA 1SK0A 3WGEA 2GQLA 2HE3A 3HY2A 4FYUA 2HZEA 1AC1A 3A2VA 4PURA 2J9HA 2HFDA 3A5WA 2E2MA 2XHFA 2KP2A 3C7MA 2YPMA 4HZ2A 3KTLA 3UMAA 1I9DA 4EL1A 3TJGA 3FR9A 3FR3A 6GSSA 1SYRA 3BCIA 2I3YA 4O7HA 1YY7A 3DVXA 4FYBA 2XBIA 4GXZA 4N0VA 3F6DA 1AQVA 5G31A 4K7OA 5E59A 3QFBC 2PGTA 1MDKA 2VL2A 1R4WA 1V98A 2H76A 3KGKA 3C73A 4BVXB 1M2AA 3VWVA 3W8JA 1HNCA 3D22A 1XCCA 1GSEA 2HSMB 4KAEA 4POLA 2IN3A 1M9AA 1EWXA 3IR4A 4BWQA 4FO5A 3HKRA 2WULA 5CAXA 1YQ1A 5EVOA 5D8IA 4G0IA 1PL2A 2DJ1A 1F9MA 1OVNA 3BOAA 4YAPA 2JZSA 5IOXA 3KCMA 3LG6A 1SK1A 2MZCA 4D73A 9GSSA 1FW1A 4TN8A 1TRVA 1PMTA 5INYA 5J5NA 5DALA 3TUEA 1F3AA 5COHA 2I1UA 3QD9A 4EF0A 1G7EA 1EOGA 1NW2A 3IA1A 2PN8A 3LYKA 4GF0A 4OCEA 4PTSA 5HFKA 4TR1B 2ON7A 1PD21 2H6ZA 1SL2B 3M1GA 2H8LA 1O73A 3G7IA 3O76A 1XOAA 3C8EA 2H66A 2H1AA 1QUWA 2YZHA 2YWNA 1GUMA 2YZUA 5G1LA 3DVWA 3KMNA 4X0XA 2IPAA 4FIWA 3GX0A 4AGSA 2DJJA 2BTOT 4DSRA 5B7CA 5IO0A 1S3AA 2GT5A 1Y6EA 2R6KA 4ZL8A 4J56E 2WRTA 1OC8A 1B4PA 2VCVA 1BEDA 1X5DA 1PQNA 5F8BA 4EVMA 4AJ6A 5DJMA 1VRSD 4TW5A 4AF2A 2LNTA 1Z9HA 2LSTA 3N5OA 3RDWA 5ECPB 1XW5A 3P2AA 1KTEA 5KN1A 4Q5QA 1YF0A 4GSSA 2LJKA 2CAIA 5B8AA 2HSNB 1V57A 3M9JA 4LLRA 5D96A 2B5XA 4O5RA 1TRUA 1KBNA 1V58A 1XWCA 4Q5NA 3ERGA 4E8EA 1GSUA 6GSWA 1BAYA 3FY7A 4EKZA 1SENA 3TKSC 4DEJA 2P5QA 1DSBA 1SK2A 4ZBAA 1SD8A 6GSUA 2LUSA 5HR2A 1QMVA 1GL8A 1X9WB 5IPGA 4K7NA 4GCIA 3L9VA 3ZLPA 4V2NA 2DMLA 4I97A 5DAKA 4EUYA 3RPNA 4KNDA 3DWVA 1U87A 3UARA 2VIMA 4J2FA 2OE3A 5JWRB 4XS6A 2H70A 1LJRA 3JCML 1T3BA 3DIEA 4OO4A 5ECLB 4MF5A 4JE1A 5D9WA 4HOJA 2H01A 5CRHA 1SKWB 1R5PA 3Q18A 5ECKB 1J0FA 1T1VA 4NAXA 3A3TA 3IK7A 2EIQA 2A4VA 4V2LA 2O8VB 2EIOA 2CQ9A 1N8JA 1URMA 1WIKA 4IELA 3TKPA 3NIVA 3GKNA 1A2LA 5AIVA 3W8SA 5B8BA 2DSAA 3GKXA 2GQKA 2L59A 4BL7A 1X9SB 4BPYA 3KP9A 4JEDA 2GSTA 4ML1A 4MH2A 3D0ZA 2LRTA 2LRNA 1SJ6A 3D6IA 2FNOA 2IFQA 5ECQB 3ERFA 5JWQB 3L4NA 2V41A 5GZZB 1AXDA 2DLXA 3TRPA 2LQOA 1O8XA 2ES7A 3GURA 3EWLA 1K3YA 2PVQA 2YN1A 3ZVJA 2PMTA 4ULXA 4GQFA 2MYGA 3BD2A 4HQSA 1NSWA 5CREA 2YNXA 5CO3A 1WP0A 3QAWA 2HRKA 2CAQA 1E2YA 2IIYA 4MJEA 4MJAA 4RQRA 4GTUA 3UVHA 3FYGA 3NOFA 2B1KA 2C0EA 3QMXA 4G2EA 1TOFA 4QL7A 3WGDA 5KN3A 3FHKA 4GRFA 3EINA 4ZB8A 2WGRA 2XPEA 2MMNA 4N11A 5E4WA 3L78A 5DQSA 1EOHA 3FZ4A 1PKZA 2VL9A 2H71A 3WT1A 1UC7A 1GSQA 1ERVA 2FGXA 4G19A 2DBCA 4IP1A 1WPIA 1BG5A 1TU7A 3IV4A 3PPUA 2JSYA 2VAFA 2FA8A 4OWYA 1K0NA 1VGLA 5DBQA 3WT2A 4BVYB 3D4MA 3BBYA 1ILOA 12GSA 3LXZA 5ECHB 4ZXGA 2YWOA 4MH3A 3U5RE 2QKEA 5ID2B 2LKUA 1K0BA 1PKWA 3UAPA 4ZL9A 3EC3A 1W89A 3EMPA 4MK3A 3J7Yk 2AAWA 1XZOA 3Q19A 5KEJA 4L8EA 5HQPA 2IWTA 1FHEA 3M3MA 4LMWA 1RW1A 2PVOC 2GZYA 4DSSB 2YV7A 3IRAA 5FT3A 3I6AA 4KW6A 3C71A 5H5SA 1OE8A 3TJFA 1OC9A 2H19A 5EL8A 2GSSA 3F4TA 2X8HA 4F0CA 5GSSA 5EPFA 2AV4A 1KEBA 5ABRA 2CV4A 2VLVA 3OR5A 2LS5A 2R2JA 4MA9A 2CVDA 4J57E 1PX6A 3GKKA 4HJ2A 3ED3A 4PQHA 1O81A 1DE2A 2VOCA 4GQCA 1GNWA 3CTGA 2XBQA 1B8XA 5AIXA 5D73A 3ZIVA 1V2AA 1XFLA 1M2BA 1XWAA 1JLWA 2TIRA 3RPPA 3ERWA 18GSA 4XRAA 3IC8A 4HI7A 3VI5A 5GSTA 1GSDA 2DJ3A 8GSSA 2CX4A 3TKQA 2OKAA 3H8QA 3HDCA 4ZIJA 2AUVA 2C3NA 2GQMA 4KUNA 3KJYA 1GH2A 3TJJA 4ECBA 2C1YA 2KLXA 4V1Ap 3LJRA 3P7XA 2DMMA 3MAKA 1TRSA 4PUAA 5IMVA 1YKAA 3KZQA 3ZTLA 2CVKA 4RI6A 1F6MC 2OADA 4KE3A 3GHAA 3ZITA 2RM6A 3KXOA 1THOA 3FK8A 2HNLA 2LNSA 3H93A 5HFIA 1PA3A 2GLRA 5FHIA 2R37A 1K3LA 4KGIA 3DXBA 2QC7A 4FQUA 4KSMA 4IJ3A 2AB6A 3HZ8A 1MD4A 2B3SA 4X1UA 3UEMA 2LTKA 2Z9SA 3M9KA 3ZMLA 2VO4A 4V2MA 5ENUA 2WZ9A 5F0GA 3KTBA 4PNFA 2F3MA 4TKYA 2GSQA 3CBUA 1A8YA 4BA7A 3UVTA 1JLVA 1OC3A 1JFUA 5F06A 4MF6A 3U6VA 1FB0A 5LD0A 2HSHA 2WCIA 4XCSA 3PH9A 1FVKA 2P0GA 2OE0A 4OFTA 2E2GA 4G0LA 4G0KA 2RIIA 3GMFA 1GSFA 1GLPA 5IO2A 5D93A 2L5OA 2CT6A 3IDVA 5GAPD 1PGTA 2HSMA 1U88A 1BQ7A 1K0OA 2REMA 5CRGA 2BJXA 3HHVA 4ECIA 5ECIB 2H30A 5F05A 4HUAA 1GRXA 2R4VA 2JU5A 1TU8A 3HVVA 3ZYWA 1TDIA 1O7UA 3O3TA 2KHPA 1EZKA 4WF5A 1M2DA 2IMIA 2RUFA 4TVEA 5DDLA 2C4JA 2F9SA 22GSA 2B7KA 3S9FA 3KH7A 4TXOB 3CRTA 1TI1A 5CYYA 1YEXA 2WB9A 3CSHA 1JZOA 1H75A 4I2UA 4EC0A 10GSA 4QL9A 5ECSA 4TR1A 3HZ4A 2JADA 4F9ZA 4IQ1A 2IMDA 3EU3A 2PUKC 1FVJA 3EMXA 2JZRA 1GP1A 3F0IA 4ISDA 4TXVA 1EEMA 3HJMA 4WR5A 5IIZA 1YEPA 3UL3A 3KMOA 1QFNA 5IMZA 3ZL5A 5AN1A 1TTZA 3UIWA 3Q74A 3DEXA 3F6FA 3UBKA 2DIZA 2N5FA 2K8SA 4MDCA 4IP6A 2YJ7A 2CA8A 2C80A 5FWGA 3TGZA 3GFKA 4K8MA 13GSA 6GSTA 1DE1A 4NXIA 3F8UA 4Z7XA 1PX7A 1MTCA 3ZVJD 2ON5A 3LWAA 5J9BA 2OBKA 1X9MB 1SKRB 5G5EA 3WD6A 2X99A 3L9UA 4KCAA 4O32A 2VCZA 1S3DA 5HR3A 3I9V2 4Q5RA 2HRAA 2B7JA 4WXTA 4LL1B 5J3RA 4ILFA 1M99A 5EY6A 1Z3EA 2YWIA 4NMUA 2K6VA 1ON4A 4DSQA 3IE3A 1XOBA 1ZZYA 4PQ1A 4KF9A 2C0FA 3APQA 1YZXA 1IYIA 3APOA 4IKHA 2FD3A 3VWUA 1S3CA 5H5QA 5ECOB 2FWEA 3US3A 4RI7A 2RUEA 14GSA 1YJ6A 2E7PA 3F3QA 4QQ7A 3WYWA 1EGRA 4MJCA 3CSJA 4RUVA 2CX3A 1NHYA 1H4OA 3CTFA 3LFLA 2N5AA 3ZREA 3IC4A 4GSTA 1SD9A 2VL2C 4L5OA 1TRWA 4E8HA 1XPVA
chains in the Genus database with same CATH superfamily
1R26A 4ZB9A 4XS1A 3ZFBA 1GSSA 19GSA 2A2SA 2YJHA 3IBHA 2V2GA 1A8LA 3RBTA 2YANA 1EEJA 2C0GA 2J23A 3P90A 5J4VA 1I5GA 4JRRA 4ZILA 3EYTA 4BL7B 5G1KA 3TDGA 4L0UA 1M0UA 1THXA 2LV3A 1LBKA 4PX1A 3NZNA 1PN0A 2O87A 3GTUB 4NPBA 3VLNA 2GT6A 4JR4A 2K8VA 2H0IA 1GULA 3H4KA 2LJAA 5LNKe 2RLIA 4MABA 4WBJA 2R5GA 5IMDA 4P3YB 4ZB6A 2MMZA 3D5JA 3FRCA 1HD2A 2LRCA 2H73A 2V6OA 2NDOA 5B6MA 2WVYA 3UBLA 4WETA 4XRDA 2O89A 5KN0A 2HRKB 5KN2A 3QOUA 5C00A 4ECCA 4GWRA 1A24A 3TB2A 2VM1A 1A2MA 1Q4JA 2K9FA 3LYPA 2VCWA 3TJKA 1TK0B 5H5RA 4WF4A 4K1FA 5HR1A 1QXHA 1SJZA 3ME7A 3IK9A 3VURA 1Y25A 4MP4A 4KX4A 2H0GA 3LSZA 1K0MA 1AQXA 3UOMA 4K7IA 4LL4B 2DKIA 3TOUA 2EIRA 4OD7A 1WOUA 2I4AA 1E6BA 1GTBA 4LMVA 2VD1A 3QAGA 5C04A 4HDEA 3D4TA 1VF1A 1ERTA 3QFAC 3Q6OA 16GSA 3QCPA 4K5SA 3F3RA 4XS4B 1VF2A 2YOIA 1A23A 3SWLA 3IXRA 1GLQA 5IMCA 1T00A 3L0HA 5ID2A 1UVZA 1UA5A 3R3EA 2EC4A 2CZ3A 1XVWA 4HQZA 2LJRA 3PR8A 3HJOA 1BYEA 4OMVA 1ERWA 2P31A 4POKA 3QR6A 5A34B 1OKDA 3CMIA 3WGXA 4DSSA 3UJ1A 2FCHA 2KP1A 3APSA 3TCOA 1F3BA 5B6NA 5A5KA 4F82A 1USBA 2FWGA 1FO5A 1LU4A 3HVSA 2HRFA 4Z2TA 4K9ZA 5IM9A 1Q98A 1X5EA 4O5UA 1TJDA 2L5LA 1G6YA 3K8NA 3EPTA 3RAZA 4IJIA 1UN2A 1WE0A 2MBSA 5DJLA 4N30A 3CYNA 1X0RA 1T4YA 4FYCA 5D9TA 1F37A 2FUG2 1CQGA 17GSA 2CVBA 1TP9A 3GV1A 3A2XA 2VCQA 2WW2A 5LCZA 3HCZA 3PINA 2F8AA 1GSYA 2HZFA 2I9HA 2XC2A 4MZWA 2O7KA 4MMMA 1XVQA 4POBA 4ID0A 2M46A 4FH8A 3IPZA 1EP8A 2G2QA 3HYPA 3M0FA 3EVIA 1A2JA 3N9JA 3ZMKA 3D21A 6GSVA 3GRXA 20GSA 2FY6A 3FZ5A 3V1WA 1OKTA 2H1DA 3VWWA 3IHQA 3DGQA 4IBPA 4JBBA 5J9CA 3PGTA 4XTSA 5BRTA 5ECMB 2YWMA 4ZBDA 4G9HA 5JCUA 3O6TA 4H86A 2PU9C 4POMA 4MPGA 4TR0A 1QGVA 3LQ7A 5IMAA 1U6TA 1PL1A 4GLTA 4EDZA 2IMKA 3FZ9A 3GL3A 4O92A 4GSNA 3TKSA 2EFEA 2GVPA 2O36A 1S4BP 2TRCP 1GTIA 1GUKA 3ZIJA 4CW9A 5DCHA 3MNGA 1ZOFA 2UZ8A 4KB3A 2HZEB 1G7OA 2WFCA 1R7HA 2YP6A 4YKFA 4K2XA 3R2QA 2BMXA 1XW6A 1B9XC 4NWYA 4KCEA 1B4QA 2FWHA 4K2DA 2FHEA 3GX8A 1FG4A 3F63A 5A1NA 3TKSE 2L6CA 1MEKA 3MDKA 4OO5A 3P8WA 2JL4A 3TRXA 2OA7A 4Q5FA 1SU9A 4OCFA 4V1Ag 4EE0A 3F9UA 3GH6A 2NPBA 4HZ4A 2GZZA 1VF4A 5DVBA 1Y1UA 4G01A 1O8WA 1OYJA 4BVXA 3GL5A 2DC5A 3DD3A 3A5IA 2YCDA 5JCWA 2OE1A 3LORA 2JZTA 1GUHA 3KD0A 1PSQA 1C72A 4PUFC 3HA9A 1OAZA 2B1LA 4TR4A 5CNWA 2H1LA 2QA2A 1A0FA 3MSZA 3A2WA 2KUCA 3GSSA 2IL3A 5ECNB 1AIUA 1ERUA 1EV4A 1HYUA 1Z5YE 3KH9A 2ZNMA 1U3AA 4IQAA 5G30A 4NV2A 1YKCA 1SKSB 2VCXA 5IPHA 3QDNA 1BJXA 1WWJA 4D73B 1ZMAA 2PPTA 1MD3A 5A4WA 4HSCX 2VL3A 2E0QA 3LGCA 2DJ2A 5DALB 1N2AA 4MZBA 4TXOA 1WRYA 3GH9A 3QPMA 2F8FA 1PRXA 1EGOA 1SJIA 1RK4A 2ZUPA 4PNGA 2K18A 4RQXA 2GDRA 2HSYA 2N5BA 2X8GA 1BF5A 2VLTA 1B48A 3RHBA 4YQUA 2IMFA 2IJYA 1GTUA 2ZCTA 2TRXA 4IHUA 7GSSA 4QMKA 2QSIA 1RQMA 5JCGA 1M9BA 4N3ZA 1FAAA 1XWGA 2PBJA 3FEUA 3GNJA 5J4UA 5J41A 1PN9A 2MMAA 1V9WA 2CZ2A 2KOKA 4KDUA 1MDJA 3ZFLA 1FB6A 2O5VA 6GSYA 4WBRD 2DJ0A 1WMJA 3F4RA 4A5PA 2H74A 4CDOA 3KIJA 4TR3A 1ABAA 3VPQA 1Z7PA 3DRNA 3GSTA 4NHZA 1SYXA 2OJLA 3VI7A 4NHWA 2M80A 4WR4A 2V1MA 1T4ZA 1FOVA 4KDXA 4MZCA 4TRXA 1EV9A 4IVFA 4CHSA 2B6MA 2HI7A 4LA1A 3FR6A 1JZRA 3FKFA 3EE2A 1DUGA 1EP7A 2ALBA 4EDYA 3HJPA 4PGTA 1OE7A 4PHZC 2OACA 3IOSA 1ST9A 3G7YA 1TKDB 3IAM2 1W4VA 5A4VA 3C1SA 3RHCA 2AHEA 5J40A 3C1RA 2GS3A 1K0AA 1AUCA 4L5LA 3ZZXA 5DAKB 4L0WA 1T7PB 4MPFA 4HU7A 1ACVA 3DKSA 4NV5A 1TW9A 3FW2A 1J08A 2F51A 5CRWA 2WDUA 3AY8A 4F03A 3FZAA 1AW9A 2JACA 2WVXA 4AJ7A 4PI0C 2NBSA 4I6XA 2VUPA 4N0ZA 4DVCA 4PXOA 1R5AA 2VD0A 4ZBBA 4YAVA 3M8NA 2C3TA 4BVYA 3ME8A 5ELAA 3KM6A 3DYRA 2H1BA 5DQYA 2VCTA 2NTOA 2HYXA 3E3EA 3TJBA 4YH2A 4MLYA 4KSOA 4AJ8A 3RFRC 2GGTA 1JHBA 1ZYEA 3H79A 3G7JA 4IGJA 4YQMA 4IS0A 2GZPA 1IYHA 2P5RA 5ELGA 3GIXA 2O85A 3DMLA 1NHOA 2GTUA 5F07A 1F2EA 3KEBA 2X64A 3VK9A 4XIHA 2L6DA 2IFQB 3GTUA 2YV9A 5ECRB 1O85A 2HXKA 2QGVA 4F2IA 5GAND 5J4YA 2R0CA 1VF3A 3BJ5A 1XG8A 1K3OA 5AISA 4MNNA 3MYDA 1TXXA 3GN3A 2OBIA 4PQIA 5IMFA 3L9SA 1HQOA 2H6YA 4JR6A 2C0DA 3VPTA 4ACSA 1A0RP 1U3IA 5G2ZA 5HR0A 5KOWA 4I5QA 2AJQB 5DCGA 2MBTA 3F4SA 3LXTA 4I2TA 2M72A 5A4UA 4K0GA 1B9YC 1YF1A 5HFGA 1G6WA 3J7Yb 1YEWC 2B5YA 4IW9A 5D9VA 3CRUA 1GWCA 1K0CA 2FWFA 2G0FA 1CQHA 3E9JB 3I69A 1O6JA 3HVXA 2PWJA 2D2ZA 2HLSA 2L4CA 2JSZA 2L4QA 2V32A 1GNEA 2R3XA 3BCKA 4N10A 4EXJA 2C3QA 2NVLA 2HRNA 3GYKA 1XW9A 4HEA2 2DIYA 4OFNA 3I43A 3ZRDA 4XS4A 1JZDA 2B5EA 3VWXA 4HS1A 4K6XA 4OFMA 1XXUA 4X43A 5A5HB 4ICYA 2WW0A 1ZYQB 5G5FA 1NM3A 1SVMA 1XBSA 3QAVA 6GSXA 2DJKA 5IOWA 3GUSA 1QQ2A 4YKGA 2FLSA 5A34A 2LEGA 4KH7A 2MMOA 2L57A 4KA0A 3TKRA 3CSIA 4HU9A 2HT9A 1Z6NA 5IQYA 4USSA 1TK5B 3CQFA 2H0HA 1V40A 4TOPA 1OC9B 1XWBA 1XWKA 4KDYA 4WKWA 1Z6MA 3LEFA 4MJBA 1SL0B 1X5CA 3MWHA 5CP1A 1MDIA 5JWOB 2LQQA 1QK8A 1AAZA 4YQVA 1T8EB 2GSRA 3IAS2 2I81A 3E0UA 3EURA 2AYTA 3W6GA 4G10A 4ML6A 1TK8B 1TI3A 2VM2A 4K0NA 2HQTA 1J9BA 1ZGNA 3HXSA 2PERA 3G9BA 2X8CA 3TRQA 4ZL7A 1JZWA 1KNGA 3KP8A 4IN0A 1SL1B 1XIYA 1ML6A 2H75A 2V6KA 2A2RA 2XPDA 5L71A 2H72A 5BMUA 4WEYA 1HNAA 2VLUA 4I8BA 1GTAA 5CRDA 3ISOA 2H6XA 4XHMA 3EU4A 1HNBA 3H1NA 2C8UA 2RM5A 4MF7A 1ZCPA 2WJUA 4F0BA 4JZQA 1WJKA 4JU5A 1Z7RA 1DBYA 1AQWA 1BX9A 3HD5A 2FA4A 1M7TA 2IMEA 5AGYA 11GSA 1K0DA 1ZL9A 4ECJA 5D9XA 4BWSA 2H1GA 1G0TA 3SBCA 2WS2A 3GA4A 4HJMA 3CXGA 1YDKA 3VFIA 4EO3A 3GKMA 4MCUA 3TOTA 1SK0A 3WGEA 2GQLA 2HE3A 3HY2A 4FYUA 2HZEA 1AC1A 3A2VA 4PURA 2J9HA 2HFDA 3A5WA 2E2MA 2XHFA 2KP2A 3C7MA 2YPMA 4HZ2A 3KTLA 3UMAA 1I9DA 4EL1A 3TJGA 3FR9A 3FR3A 6GSSA 1SYRA 3BCIA 3FMWA 2I3YA 4O7HA 1YY7A 3DVXA 4FYBA 2XBIA 4GXZA 5A1NB 4N0VA 3F6DA 1AQVA 5G31A 4K7OA 5E59A 4EIQA 3QFBC 2PGTA 1MDKA 2VL2A 1R4WA 1V98A 2H76A 3KGKA 3C73A 4BVXB 1M2AA 3VWVA 3W8JA 1HNCA 3D22A 1XCCA 4GDFA 1GSEA 2HSMB 4KAEA 4POLA 2IN3A 1M9AA 1EWXA 3IR4A 4BWQA 4FO5A 3HKRA 2WULA 5CAXA 1YQ1A 2X4AA 5EVOA 5D8IA 4G0IA 1PL2A 2DJ1A 1F9MA 1OVNA 3BOAA 4YAPA 2JZSA 5IOXA 3KCMA 4EIPA 3LG6A 1SK1A 2MZCA 4D73A 9GSSA 1FW1A 4TN8A 1TRVA 1PMTA 5INYA 4O5QA 5J5NA 5DALA 3TUEA 1F3AA 5COHA 2I1UA 3QD9A 3LW9A 4EF0A 1G7EA 1EOGA 1NW2A 3IA1A 2PN8A 3LYKA 4GF0A 4OCEA 4PTSA 5HFKA 4TR1B 2ON7A 1PD21 4K5RA 2H6ZA 1SL2B 3M1GA 2H8LA 1O73A 3G7IA 3O76A 1XOAA 3C8EA 2H66A 2H1AA 1QUWA 2YZHA 2YWNA 1GUMA 2YZUA 5G1LA 3DVWA 3KMNA 4X0XA 2IPAA 4FIWA 3GX0A 4AGSA 2DJJA 2BTOT 4DSRA 3CWGA 5B7CA 5IO0A 1S3AA 2GT5A 1Y6EA 2R6KA 4ZL8A 4J56E 2WRTA 1OC8A 1B4PA 2VCVA 1BEDA 4CY8A 1X5DA 1PQNA 5F8BA 4EVMA 4AJ6A 5DJMA 1VRSD 4TW5A 4AF2A 2LNTA 1Z9HA 2LSTA 3N5OA 3RDWA 5ECPB 1XW5A 3P2AA 1KTEA 5KN1A 4Q5QA 1YF0A 4GSSA 2LJKA 2CAIA 5B8AA 2HSNB 1V57A 3M9JA 4LLRA 5D96A 2B5XA 4O5RA 1TRUA 1KBNA 1M3JA 1V58A 2WZSA 1XWCA 4Q5NA 3ERGA 4E8EA 1GSUA 6GSWA 1BAYA 3FY7A 4EKZA 1SENA 3TKSC 4DEJA 2P5QA 2VKZG 1DSBA 1SK2A 4ZBAA 1SD8A 6GSUA 2LUSA 5HR2A 1QMVA 1GL8A 1X9WB 5IPGA 4K7NA 4GCIA 3L9VA 3ZLPA 4V2NA 2DMLA 4I97A 5DAKA 4EUYA 3RPNA 4KNDA 3DWVA 1U87A 2WW3A 3UARA 2VIMA 4J2FA 2OE3A 5JWRB 4XS6A 2H70A 1BG1A 1LJRA 3JCML 1T3BA 3DIEA 4OO4A 5ECLB 4MF5A 2EFHA 5D9WA 4HOJA 4JE1A 2H01A 5CRHA 1SKWB 1R5PA 2WVXB 3Q18A 4BIKA 5ECKB 1J0FA 1T1VA 4NAXA 3A3TA 3IK7A 2EIQA 2A4VA 4V2LA 2O8VB 2EIOA 2CQ9A 1N8JA 1URMA 1WIKA 4IELA 3TKPA 1ZYPA 3NIVA 3GKNA 1A2LA 5AIVA 3W8SA 5B8BA 2DSAA 3GKXA 2GQKA 2L59A 3RGBC 4BL7A 1X9SB 4BPYA 3CHXC 3KP9A 1SVOA 4JEDA 2GSTA 4ML1A 4MH2A 3D0ZA 2LRTA 2LRNA 1SJ6A 3D6IA 2FNOA 2IFQA 5ECQB 3ERFA 5JWQB 3L4NA 2V41A 5GZZB 1AXDA 2DLXA 3TRPA 2LQOA 1O8XA 2ES7A 4E68A 3GURA 3EWLA 1K3YA 2PVQA 2YN1A 3ZVJA 2PMTA 4ULXA 4GQFA 2MYGA 3BD2A 4HQSA 1NSWA 5CREA 4FXYP 2YNXA 5CO3A 1WP0A 3QAWA 2HRKA 2CAQA 1E2YA 2IIYA 4MJEA 4MJAA 2O3EA 4RQRA 4GTUA 3UVHA 3FYGA 3NOFA 2B1KA 2C0EA 3QMXA 4G2EA 1TOFA 4QL7A 3WGDA 5KN3A 3FHKA 4GRFA 3EINA 4ZB8A 2WGRA 2XPEA 2MMNA 4N11A 5E4WA 3L78A 5DQSA 1EOHA 3FZ4A 1PKZA 2VL9A 2H71A 3WT1A 1UC7A 1GSQA 1ERVA 2FGXA 4G19A 2DBCA 4IP1A 1WPIA 1BG5A 1TU7A 3HMJG 3IV4A 3PPUA 2JSYA 2VAFA 2FA8A 4OWYA 1K0NA 3TU3B 1VGLA 5DBQA 3WT2A 4BVYB 4AKHA 3D4MA 3BBYA 1ILOA 12GSA 3LXZA 5ECHB 4ZXGA 2YWOA 4MH3A 3U5RE 5A5HA 2QKEA 5ID2B 2LKUA 1K0BA 4AKGA 1PKWA 3UAPA 4ZL9A 3EC3A 1W89A 3MIXA 3EMPA 4MK3A 3J7Yk 2AAWA 1XZOA 2UV8G 3Q19A 5KEJA 4L8EA 5HQPA 2IWTA 1FHEA 3M3MA 4LMWA 1RW1A 2PVOC 2GZYA 4DSSB 2YV7A 3IRAA 5FT3A 3I6AA 4KW6A 3C71A 5H5SA 1OE8A 3TJFA 1OC9A 2H19A 5EL8A 2GSSA 3F4TA 2X8HA 4F0CA 5GSSA 5EPFA 2AV4A 1KEBA 5ABRA 2CV4A 2VLVA 3OR5A 2LS5A 2R2JA 4MA9A 2CVDA 4J57E 1PX6A 3GKKA 4HJ2A 3ED3A 4PQHA 1O81A 1DE2A 2VOCA 4GQCA 1GNWA 3CTGA 2XBQA 2EFCA 1B8XA 5AIXA 5D73A 3ZIVA 1V2AA 1XFLA 1M2BA 1XWAA 1JLWA 2TIRA 3RPPA 3ERWA 18GSA 4XRAA 3IC8A 4HI7A 3VI5A 5GSTA 1GSDA 2DJ3A 8GSSA 2CX4A 5BMUB 2OKAA 3TKQA 3H8QA 3HDCA 4ZIJA 2AUVA 2C3NA 2GQMA 4KUNA 3KJYA 1N25A 1GH2A 3TJJA 4Z2UA 2A2PA 4X4JA 4ECBA 2C1YA 2KLXA 4V1Ap 3LJRA 2EFDA 3P7XA 2DMMA 5J47A 1ZYNA 3MAKA 1TRSA 4PUAA 5IMVA 1YKAA 3KZQA 3ZTLA 2CVKA 4RI6A 1F6MC 2OADA 4KE3A 3GHAA 3ZITA 2RM6A 2WW1A 3KXOA 1THOA 3FK8A 2HNLA 2LNSA 3H93A 5HFIA 2OT3A 1PA3A 2GLRA 5FHIA 2R37A 1K3LA 4KGIA 3DXBA 2QC7A 4FQUA 4KSMA 4IJ3A 2AB6A 3HZ8A 1MD4A 2B3SA 4X1UA 3UEMA 2LTKA 2Z9SA 3M9KA 3HVNA 3ZMLA 2VO4A 4V2MA 5ENUA 2WZ9A 5F0GA 2X49A 3KTBA 4PNFA 2F3MA 4TKYA 2GSQA 3CBUA 1A8YA 4BA7A 3UVTA 1JLVA 4AI6A 1OC3A 1JFUA 5F06A 4MF6A 3U6VA 1FB0A 5LD0A 2HSHA 1S3RA 1M3IA 2WCIA 4XCSA 3PH9A 1FVKA 2P0GA 2R0GA 2OE0A 4OFTA 2E2GA 4G0LA 4G0KA 2RIIA 3GMFA 1GSFA 1YVLA 1GLPA 5IO2A 5D93A 2L5OA 2CT6A 3IDVA 1FOHA 5GAPD 1PGTA 2HSMA 1U88A 1BQ7A 2DKHA 1SVLA 1K0OA 2REMA 5CRGA 2BJXA 3HHVA 4ECIA 5ECIB 2H30A 5F05A 4HUAA 1GRXA 2R4VA 2QA1A 2JU5A 1TU8A 3HVVA 3ZYWA 1TDIA 1O7UA 3O3TA 2KHPA 1EZKA 4WF5A 1M2DA 2IMIA 2RUFA 4AKXB 4TVEA 5DDLA 2C4JA 2F9SA 22GSA 2B7KA 3S9FA 3KH7A 4TXOB 3CRTA 1TI1A 5CYYA 1YEXA 2WB9A 3CSHA 1JZOA 1H75A 4I2UA 4EC0A 10GSA 4QL9A 5ECSA 4TR1A 3HZ4A 1TXUA 2JADA 4F9ZA 4IQ1A 2IMDA 3EU3A 2PUKC 1FVJA 3EMXA 2JZRA 1GP1A 3F0IA 4ISDA 4TXVA 1EEMA 3HJMA 4WR5A 5IIZA 1YEPA 3UL3A 3KMOA 1QFNA 5IMZA 3ZL5A 5AN1A 1TTZA 3UIWA 3Q74A 3DEXA 3F6FA 3UBKA 2DIZA 2N5FA 2K8SA 4MDCA 2A4HA 2YJ7A 4IP6A 2CA8A 2C80A 5FWGA 3TGZA 4ZB7A 3GFKA 4K8MA 13GSA 6GSTA 1DE1A 2WVZA 4NXIA 3F8UA 4Z7XA 4AKIA 1PX7A 1MTCA 3ZVJD 2ON5A 3LWAA 5J9BA 2OBKA 1X9MB 1SKRB 5G5EA 2HSNA 3WD6A 2X99A 3L9UA 4KCAA 4O32A 2VCZA 4Z2RA 1S3DA 5HR3A 3I9V2 4Q5RA 2HRAA 2B7JA 4WXTA 4LL1B 5J3RA 4ILFA 1M99A 5EY6A 1Z3EA 2YWIA 4NMUA 4CY6A 1I1IP 2K6VA 1ON4A 4DSQA 3IE3A 1PFOA 1XOBA 1ZZYA 4PQ1A 4KF9A 2C0FA 3APQA 5KOXA 1YZXA 4PI2C 1IYIA 3APOA 4IKHA 2FD3A 3VWUA 1S3CA 5H5QA 5ECOB 2FWEA 3US3A 4RI7A 2R0PA 2RUEA 3IHGA 14GSA 1YJ6A 2E7PA 3F3QA 4QQ7A 3WYWA 1EGRA 4MJCA 3CSJA 4RUVA 2CX3A 1NHYA 1H4OA 3CTFA 3LFLA 2N5AA 3ZREA 3IC4A 4W66A 4GSTA 1SD9A 2VL2C 4L5OA 1TRWA 4E8HA 1XPVA
chains in the Genus database with same CATH topology
1R26A 4ZB9A 4XS1A 3ZFBA 1GSSA 19GSA 2A2SA 2YJHA 3IBHA 2V2GA 1A8LA 3RBTA 2YANA 1EEJA 2C0GA 2J23A 3P90A 5J4VA 1I5GA 4JRRA 4ZILA 3EYTA 4BL7B 5G1KA 3TDGA 4L0UA 1M0UA 1THXA 2LV3A 1LBKA 4PX1A 3NZNA 1PN0A 2O87A 3GTUB 4NPBA 3VLNA 2GT6A 4JR4A 2K8VA 2H0IA 1GULA 3H4KA 2LJAA 5LNKe 2RLIA 4MABA 4WBJA 2R5GA 5IMDA 4P3YB 4ZB6A 2MMZA 3D5JA 3FRCA 1HD2A 2LRCA 2H73A 2V6OA 2NDOA 5B6MA 3UBLA 4WETA 4XRDA 2O89A 5KN0A 2HRKB 5KN2A 3QOUA 5C00A 4ECCA 4GWRA 1A24A 3TB2A 2VM1A 1A2MA 1Q4JA 2K9FA 3LYPA 2VCWA 3TJKA 1TK0B 5H5RA 4WF4A 4K1FA 5HR1A 1QXHA 1SJZA 3ME7A 3IK9A 3VURA 1Y25A 4MP4A 4KX4A 2H0GA 3LSZA 1K0MA 1AQXA 3UOMA 4K7IA 4LL4B 2DKIA 3TOUA 2EIRA 4OD7A 1WOUA 2I4AA 1E6BA 1GTBA 4LMVA 2VD1A 3QAGA 5C04A 4HDEA 3D4TA 1VF1A 1ERTA 3QFAC 3Q6OA 16GSA 3QCPA 4K5SA 3F3RA 4XS4B 1VF2A 2YOIA 1A23A 3SWLA 3IXRA 1GLQA 5IMCA 1T00A 3L0HA 5ID2A 1UVZA 1UA5A 3R3EA 2EC4A 2CZ3A 1XVWA 4HQZA 2LJRA 3PR8A 3HJOA 1BYEA 4OMVA 1ERWA 2P31A 4POKA 3QR6A 5A34B 1OKDA 3CMIA 3WGXA 4DSSA 3UJ1A 2FCHA 2KP1A 3APSA 3TCOA 1F3BA 5B6NA 5A5KA 4F82A 1USBA 2FWGA 1FO5A 1LU4A 3HVSA 2HRFA 4Z2TA 4K9ZA 5IM9A 1Q98A 1X5EA 4O5UA 1TJDA 2L5LA 1G6YA 3K8NA 3EPTA 3RAZA 4IJIA 1UN2A 1WE0A 2MBSA 5DJLA 4N30A 3CYNA 1X0RA 1T4YA 4FYCA 5D9TA 1F37A 2FUG2 1CQGA 17GSA 2CVBA 1TP9A 3GV1A 3A2XA 2VCQA 5LCZA 3HCZA 3PINA 2F8AA 1GSYA 2HZFA 2I9HA 2XC2A 4MZWA 2O7KA 4MMMA 1XVQA 4POBA 4ID0A 2M46A 4FH8A 3IPZA 1EP8A 2G2QA 3HYPA 3M0FA 3EVIA 1A2JA 3N9JA 3ZMKA 3D21A 6GSVA 3GRXA 20GSA 2FY6A 3FZ5A 3V1WA 1OKTA 2H1DA 3VWWA 3IHQA 3DGQA 4IBPA 4JBBA 5J9CA 3PGTA 4XTSA 5BRTA 5ECMB 2YWMA 4ZBDA 4G9HA 5JCUA 3O6TA 4H86A 2PU9C 4POMA 4MPGA 4TR0A 1QGVA 3LQ7A 5IMAA 1U6TA 1PL1A 4GLTA 4EDZA 2IMKA 3FZ9A 3GL3A 4O92A 4GSNA 3TKSA 2EFEA 2GVPA 2TRCP 1GTIA 1GUKA 3ZIJA 4CW9A 5DCHA 3MNGA 1ZOFA 2UZ8A 4KB3A 2HZEB 1G7OA 2WFCA 1R7HA 2YP6A 4YKFA 4K2XA 3R2QA 2BMXA 1XW6A 1B9XC 4NWYA 4KCEA 1B4QA 2FWHA 4K2DA 2FHEA 3GX8A 1FG4A 3F63A 5A1NA 3TKSE 2L6CA 1MEKA 3MDKA 4OO5A 3P8WA 2JL4A 3TRXA 2OA7A 4Q5FA 1SU9A 4OCFA 4V1Ag 4EE0A 3F9UA 3GH6A 2NPBA 4HZ4A 2GZZA 1VF4A 5DVBA 1Y1UA 4G01A 1O8WA 1OYJA 4BVXA 3GL5A 2DC5A 3DD3A 3A5IA 2YCDA 5JCWA 2OE1A 3LORA 2JZTA 1GUHA 3KD0A 1PSQA 1C72A 4PUFC 3HA9A 1OAZA 2B1LA 4TR4A 5CNWA 2H1LA 2QA2A 1A0FA 3MSZA 3A2WA 2KUCA 3GSSA 2IL3A 5ECNB 1AIUA 1ERUA 1EV4A 1HYUA 1Z5YE 3KH9A 2ZNMA 1U3AA 4IQAA 5G30A 4NV2A 1YKCA 1SKSB 2VCXA 5IPHA 3QDNA 1BJXA 1WWJA 4D73B 1ZMAA 2PPTA 1MD3A 5A4WA 2VL3A 2E0QA 3LGCA 2DJ2A 5DALB 1N2AA 4MZBA 4TXOA 1WRYA 3GH9A 3QPMA 2F8FA 1PRXA 1EGOA 1SJIA 1RK4A 2ZUPA 4PNGA 2K18A 4RQXA 2GDRA 2HSYA 2N5BA 2X8GA 1BF5A 2VLTA 1B48A 3RHBA 4YQUA 2IMFA 2IJYA 1GTUA 2ZCTA 2TRXA 4IHUA 7GSSA 4QMKA 2QSIA 1RQMA 5JCGA 1M9BA 4N3ZA 1FAAA 1XWGA 2PBJA 3FEUA 3GNJA 5J4UA 5J41A 1PN9A 2MMAA 1V9WA 2CZ2A 2KOKA 4KDUA 1MDJA 3ZFLA 1FB6A 2O5VA 6GSYA 4WBRD 2DJ0A 1WMJA 3F4RA 4A5PA 2H74A 4CDOA 3KIJA 4TR3A 1ABAA 3VPQA 1Z7PA 3DRNA 3GSTA 4NHZA 1SYXA 2OJLA 3VI7A 4NHWA 2M80A 4WR4A 2V1MA 1T4ZA 1FOVA 4KDXA 4MZCA 4TRXA 1EV9A 4IVFA 4CHSA 2B6MA 2HI7A 4LA1A 3FR6A 1JZRA 3FKFA 3EE2A 1DUGA 1EP7A 2ALBA 4EDYA 3HJPA 4PGTA 1OE7A 2OACA 3IOSA 1ST9A 3G7YA 1TKDB 3IAM2 1W4VA 5A4VA 3C1SA 3RHCA 2AHEA 5J40A 3C1RA 2GS3A 1K0AA 1AUCA 4L5LA 3ZZXA 5DAKB 4L0WA 1T7PB 4MPFA 4HU7A 1ACVA 3DKSA 4NV5A 1TW9A 3FW2A 1J08A 2F51A 5CRWA 2WDUA 3AY8A 4F03A 3FZAA 1AW9A 2JACA 4AJ7A 2NBSA 4I6XA 2VUPA 4N0ZA 4DVCA 4PXOA 1R5AA 2VD0A 4ZBBA 4YAVA 3M8NA 2C3TA 4BVYA 3ME8A 5ELAA 3KM6A 3DYRA 2H1BA 5DQYA 2VCTA 2NTOA 2HYXA 3E3EA 3TJBA 4YH2A 4MLYA 4KSOA 4AJ8A 2GGTA 1JHBA 1ZYEA 3H79A 3G7JA 4IGJA 4YQMA 4IS0A 2GZPA 1IYHA 2P5RA 5ELGA 3GIXA 2O85A 3DMLA 1NHOA 2GTUA 5F07A 1F2EA 3KEBA 2X64A 3VK9A 4XIHA 2L6DA 2IFQB 3GTUA 2YV9A 5ECRB 1O85A 2HXKA 2QGVA 4F2IA 5GAND 5J4YA 2R0CA 1VF3A 3BJ5A 1K3OA 5AISA 4MNNA 3MYDA 1TXXA 3GN3A 2OBIA 4PQIA 5IMFA 3L9SA 1HQOA 2H6YA 4JR6A 2C0DA 3VPTA 4ACSA 1A0RP 1U3IA 5G2ZA 5HR0A 5KOWA 4I5QA 2AJQB 5DCGA 2MBTA 3F4SA 3LXTA 4I2TA 2M72A 5A4UA 4K0GA 1B9YC 1YF1A 5HFGA 1G6WA 3J7Yb 2B5YA 4IW9A 5D9VA 3CRUA 1GWCA 1K0CA 2FWFA 2G0FA 1CQHA 3E9JB 3I69A 1O6JA 3HVXA 2PWJA 2D2ZA 2HLSA 2L4CA 2JSZA 2L4QA 2V32A 1GNEA 2R3XA 3BCKA 4N10A 4EXJA 2C3QA 2NVLA 2HRNA 3GYKA 1XW9A 4HEA2 2DIYA 4OFNA 3I43A 3ZRDA 4XS4A 1JZDA 2B5EA 3VWXA 4HS1A 4K6XA 4OFMA 1XXUA 4X43A 5A5HB 4ICYA 1ZYQB 5G5FA 1NM3A 1SVMA 1XBSA 3QAVA 6GSXA 2DJKA 5IOWA 3GUSA 1QQ2A 4YKGA 2FLSA 5A34A 2LEGA 4KH7A 2MMOA 2L57A 4KA0A 3TKRA 3CSIA 4HU9A 2HT9A 1Z6NA 5IQYA 4USSA 1TK5B 2H0HA 1V40A 4TOPA 1OC9B 1XWBA 1XWKA 4KDYA 4WKWA 1Z6MA 3LEFA 4MJBA 1SL0B 1X5CA 3MWHA 5CP1A 1MDIA 5JWOB 2LQQA 1QK8A 1AAZA 4YQVA 1T8EB 2GSRA 3IAS2 2I81A 3E0UA 3EURA 2AYTA 3W6GA 4G10A 4ML6A 1TK8B 1TI3A 2VM2A 4K0NA 2HQTA 1J9BA 1ZGNA 3HXSA 2PERA 3G9BA 2X8CA 3TRQA 4ZL7A 1JZWA 1KNGA 3KP8A 4IN0A 1SL1B 1XIYA 1ML6A 2H75A 2V6KA 2A2RA 2XPDA 5L71A 2H72A 5BMUA 4WEYA 1HNAA 2VLUA 4I8BA 1GTAA 5CRDA 3ISOA 2H6XA 4XHMA 3EU4A 1HNBA 3H1NA 2C8UA 2RM5A 4MF7A 1ZCPA 2WJUA 4F0BA 4JZQA 1WJKA 4JU5A 1Z7RA 1DBYA 1AQWA 1BX9A 3HD5A 2FA4A 1M7TA 2IMEA 5AGYA 11GSA 1K0DA 1ZL9A 4ECJA 5D9XA 4BWSA 2H1GA 1G0TA 3SBCA 2WS2A 3GA4A 4HJMA 3CXGA 1YDKA 3VFIA 4EO3A 3GKMA 4MCUA 3TOTA 1SK0A 3WGEA 2GQLA 2HE3A 3HY2A 4FYUA 2HZEA 1AC1A 3A2VA 4PURA 2J9HA 2HFDA 3A5WA 2E2MA 2XHFA 2KP2A 3C7MA 2YPMA 4HZ2A 3KTLA 3UMAA 1I9DA 4EL1A 3TJGA 3FR9A 3FR3A 6GSSA 1SYRA 3BCIA 3FMWA 2I3YA 4O7HA 1YY7A 3DVXA 4FYBA 2XBIA 4GXZA 5A1NB 4N0VA 3F6DA 1AQVA 5G31A 4K7OA 5E59A 4EIQA 3QFBC 2PGTA 1MDKA 2VL2A 1R4WA 1V98A 2H76A 3KGKA 3C73A 4BVXB 1M2AA 3VWVA 3W8JA 1HNCA 3D22A 1XCCA 4GDFA 1GSEA 2HSMB 4KAEA 4POLA 2IN3A 1M9AA 1EWXA 3IR4A 4BWQA 4FO5A 3HKRA 2WULA 5CAXA 1YQ1A 2X4AA 5EVOA 5D8IA 4G0IA 1PL2A 2DJ1A 1F9MA 1OVNA 3BOAA 4YAPA 2JZSA 5IOXA 3KCMA 4EIPA 3LG6A 1SK1A 2MZCA 4D73A 9GSSA 1FW1A 4TN8A 1TRVA 1PMTA 5INYA 4O5QA 5J5NA 5DALA 3TUEA 1F3AA 5COHA 2I1UA 3QD9A 3LW9A 4EF0A 1G7EA 1EOGA 1NW2A 3IA1A 2PN8A 3LYKA 4GF0A 4OCEA 4PTSA 5HFKA 4TR1B 2ON7A 1PD21 4K5RA 2H6ZA 1SL2B 3M1GA 2H8LA 1O73A 3G7IA 3O76A 1XOAA 3C8EA 2H66A 2H1AA 1QUWA 2YZHA 2YWNA 1GUMA 2YZUA 5G1LA 3DVWA 3KMNA 4X0XA 2IPAA 4FIWA 3GX0A 4AGSA 2DJJA 2BTOT 4DSRA 3CWGA 5B7CA 5IO0A 1S3AA 2GT5A 1Y6EA 2R6KA 4ZL8A 4J56E 2WRTA 1OC8A 1B4PA 2VCVA 1BEDA 4CY8A 1X5DA 1PQNA 5F8BA 4EVMA 4AJ6A 5DJMA 1VRSD 4TW5A 4AF2A 2LNTA 1Z9HA 2LSTA 3N5OA 3RDWA 5ECPB 1XW5A 3P2AA 1KTEA 5KN1A 4Q5QA 1YF0A 4GSSA 2LJKA 2CAIA 5B8AA 2HSNB 1V57A 3M9JA 4LLRA 5D96A 2B5XA 4O5RA 1TRUA 1KBNA 1V58A 1XWCA 4Q5NA 3ERGA 4E8EA 1GSUA 6GSWA 1BAYA 3FY7A 4EKZA 1SENA 3TKSC 4DEJA 2P5QA 2VKZG 1DSBA 1SK2A 4ZBAA 1SD8A 6GSUA 2LUSA 5HR2A 1QMVA 1GL8A 1X9WB 5IPGA 4K7NA 4GCIA 3L9VA 3ZLPA 4V2NA 2DMLA 4I97A 5DAKA 4EUYA 3RPNA 4KNDA 3DWVA 1U87A 3UARA 2VIMA 4J2FA 2OE3A 5JWRB 4XS6A 2H70A 1BG1A 1LJRA 3JCML 1T3BA 3DIEA 4OO4A 5ECLB 4MF5A 2EFHA 5D9WA 4HOJA 4JE1A 2H01A 5CRHA 1SKWB 1R5PA 3Q18A 5ECKB 1J0FA 1T1VA 4NAXA 3A3TA 3IK7A 2EIQA 2A4VA 4V2LA 2O8VB 2EIOA 2CQ9A 1N8JA 1URMA 1WIKA 4IELA 3TKPA 1ZYPA 3NIVA 3GKNA 1A2LA 5AIVA 3W8SA 5B8BA 2DSAA 3GKXA 2GQKA 2L59A 4BL7A 1X9SB 4BPYA 3KP9A 1SVOA 4JEDA 2GSTA 4ML1A 4MH2A 3D0ZA 2LRTA 2LRNA 1SJ6A 3D6IA 2FNOA 2IFQA 5ECQB 3ERFA 5JWQB 3L4NA 2V41A 5GZZB 1AXDA 2DLXA 3TRPA 2LQOA 1O8XA 2ES7A 4E68A 3GURA 3EWLA 1K3YA 2PVQA 2YN1A 3ZVJA 2PMTA 4ULXA 4GQFA 2MYGA 3BD2A 4HQSA 1NSWA 5CREA 2YNXA 5CO3A 1WP0A 3QAWA 2HRKA 2CAQA 1E2YA 2IIYA 4MJEA 4MJAA 4RQRA 4GTUA 3UVHA 3FYGA 3NOFA 2B1KA 2C0EA 3QMXA 4G2EA 1TOFA 4QL7A 3WGDA 5KN3A 3FHKA 4GRFA 3EINA 4ZB8A 2WGRA 2XPEA 2MMNA 4N11A 5E4WA 3L78A 5DQSA 1EOHA 3FZ4A 1PKZA 2VL9A 2H71A 3WT1A 1UC7A 1GSQA 1ERVA 2FGXA 4G19A 2DBCA 4IP1A 1WPIA 1BG5A 1TU7A 3HMJG 3IV4A 3PPUA 2JSYA 2VAFA 2FA8A 4OWYA 1K0NA 3TU3B 1VGLA 5DBQA 3WT2A 4BVYB 4AKHA 3D4MA 3BBYA 1ILOA 12GSA 3LXZA 5ECHB 4ZXGA 2YWOA 4MH3A 3U5RE 5A5HA 2QKEA 5ID2B 2LKUA 1K0BA 4AKGA 1PKWA 3UAPA 4ZL9A 3EC3A 1W89A 3MIXA 3EMPA 4MK3A 3J7Yk 2AAWA 1XZOA 2UV8G 3Q19A 5KEJA 4L8EA 5HQPA 2IWTA 1FHEA 3M3MA 4LMWA 1RW1A 2PVOC 2GZYA 4DSSB 2YV7A 3IRAA 5FT3A 3I6AA 4KW6A 3C71A 5H5SA 1OE8A 3TJFA 1OC9A 2H19A 5EL8A 2GSSA 3F4TA 2X8HA 4F0CA 5GSSA 5EPFA 2AV4A 1KEBA 5ABRA 2CV4A 2VLVA 3OR5A 2LS5A 2R2JA 4MA9A 2CVDA 4J57E 1PX6A 3GKKA 4HJ2A 3ED3A 4PQHA 1O81A 1DE2A 2VOCA 4GQCA 1GNWA 3CTGA 2XBQA 2EFCA 1B8XA 5AIXA 5D73A 3ZIVA 1V2AA 1XFLA 1M2BA 1XWAA 1JLWA 2TIRA 3RPPA 3ERWA 18GSA 4XRAA 3IC8A 4HI7A 3VI5A 5GSTA 1GSDA 2DJ3A 8GSSA 2CX4A 5BMUB 2OKAA 3TKQA 3H8QA 3HDCA 4ZIJA 2AUVA 2C3NA 2GQMA 4KUNA 3KJYA 1N25A 1GH2A 3TJJA 4Z2UA 2A2PA 4X4JA 4ECBA 2C1YA 2KLXA 4V1Ap 3LJRA 2EFDA 3P7XA 2DMMA 5J47A 1ZYNA 3MAKA 1TRSA 4PUAA 5IMVA 1YKAA 3KZQA 3ZTLA 2CVKA 4RI6A 1F6MC 2OADA 4KE3A 3GHAA 3ZITA 2RM6A 3KXOA 1THOA 3FK8A 2HNLA 2LNSA 3H93A 5HFIA 2OT3A 1PA3A 2GLRA 5FHIA 2R37A 1K3LA 4KGIA 3DXBA 2QC7A 4FQUA 4KSMA 4IJ3A 2AB6A 3HZ8A 1MD4A 2B3SA 4X1UA 3UEMA 2LTKA 2Z9SA 3M9KA 3ZMLA 2VO4A 4V2MA 5ENUA 2WZ9A 5F0GA 2X49A 3KTBA 4PNFA 2F3MA 4TKYA 2GSQA 3CBUA 1A8YA 4BA7A 3UVTA 1JLVA 4AI6A 1OC3A 1JFUA 5F06A 4MF6A 3U6VA 1FB0A 5LD0A 2HSHA 2WCIA 4XCSA 3PH9A 1FVKA 2P0GA 2R0GA 2OE0A 4OFTA 2E2GA 4G0LA 4G0KA 2RIIA 3GMFA 1GSFA 1YVLA 1GLPA 5IO2A 5D93A 2L5OA 2CT6A 3IDVA 1FOHA 5GAPD 1PGTA 2HSMA 1U88A 1BQ7A 2DKHA 1SVLA 1K0OA 2REMA 5CRGA 2BJXA 3HHVA 4ECIA 5ECIB 2H30A 5F05A 4HUAA 1GRXA 2R4VA 2QA1A 2JU5A 1TU8A 3HVVA 3ZYWA 1TDIA 1O7UA 3O3TA 2KHPA 1EZKA 4WF5A 1M2DA 2IMIA 2RUFA 4AKXB 4TVEA 5DDLA 2C4JA 2F9SA 22GSA 2B7KA 3S9FA 3KH7A 4TXOB 3CRTA 1TI1A 5CYYA 1YEXA 2WB9A 3CSHA 1JZOA 1H75A 4I2UA 4EC0A 10GSA 4QL9A 5ECSA 4TR1A 3HZ4A 1TXUA 2JADA 4F9ZA 4IQ1A 2IMDA 3EU3A 2PUKC 1FVJA 3EMXA 2JZRA 1GP1A 3F0IA 4ISDA 4TXVA 1EEMA 3HJMA 4WR5A 5IIZA 1YEPA 3UL3A 3KMOA 1QFNA 5IMZA 3ZL5A 5AN1A 1TTZA 3UIWA 3Q74A 3DEXA 3F6FA 3UBKA 2DIZA 2N5FA 2K8SA 4MDCA 2A4HA 2YJ7A 4IP6A 2CA8A 2C80A 5FWGA 3TGZA 4ZB7A 3GFKA 4K8MA 13GSA 6GSTA 1DE1A 4NXIA 3F8UA 4Z7XA 4AKIA 1PX7A 1MTCA 3ZVJD 2ON5A 3LWAA 5J9BA 2OBKA 1X9MB 1SKRB 5G5EA 2HSNA 3WD6A 2X99A 3L9UA 4KCAA 4O32A 2VCZA 4Z2RA 1S3DA 5HR3A 3I9V2 4Q5RA 2HRAA 2B7JA 4WXTA 4LL1B 5J3RA 4ILFA 1M99A 5EY6A 1Z3EA 2YWIA 4NMUA 4CY6A 2K6VA 1ON4A 4DSQA 3IE3A 1XOBA 1ZZYA 4PQ1A 4KF9A 2C0FA 3APQA 5KOXA 1YZXA 1IYIA 3APOA 4IKHA 2FD3A 3VWUA 1S3CA 5H5QA 5ECOB 2FWEA 3US3A 4RI7A 2R0PA 2RUEA 3IHGA 14GSA 1YJ6A 2E7PA 3F3QA 4QQ7A 3WYWA 1EGRA 4MJCA 3CSJA 4RUVA 2CX3A 1NHYA 1H4OA 3CTFA 3LFLA 2N5AA 3ZREA 3IC4A 4W66A 4GSTA 1SD9A 2VL2C 4L5OA 1TRWA 4E8HA 1XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R26 A;  4ZB9 A;  4XS1 A;  3ZFB A;  1GSS A;  19GS A;  2A2S A;  2YJH A;  3IBH A;  2V2G A;  1A8L A;  3RBT A;  2YAN A;  1EEJ A;  2C0G A;  2J23 A;  3P90 A;  1I5G A;  4JRR A;  4ZIL A;  3EYT A;  4BL7 B;  5G1K A;  3TDG A;  4L0U A;  1M0U A;  1THX A;  2LV3 A;  1LBK A;  4PX1 A;  3NZN A;  2O87 A;  3GTU B;  4NPB A;  3VLN A;  2GT6 A;  4JR4 A;  2K8V A;  2H0I A;  1GUL A;  3H4K A;  2LJA A;  5LNK e;  2RLI A;  4MAB A;  4WBJ A;  2R5G A;  5IMD A;  4P3Y B;  4ZB6 A;  2MMZ A;  3D5J A;  3FRC A;  1HD2 A;  2LRC A;  2H73 A;  2V6O A;  2NDO A;  5B6M A;  3UBL A;  4WET A;  4XRD A;  2O89 A;  5KN0 A;  2HRK B;  5KN2 A;  3QOU A;  5C00 A;  4ECC A;  4GWR A;  1A24 A;  3TB2 A;  2VM1 A;  1A2M A;  1Q4J A;  2K9F A;  3LYP A;  2VCW A;  3TJK A;  1TK0 B;  5H5R A;  4WF4 A;  4K1F A;  5HR1 A;  1QXH A;  1SJZ A;  3ME7 A;  3IK9 A;  3VUR A;  1Y25 A;  4MP4 A;  4KX4 A;  2H0G A;  3LSZ A;  1K0M A;  1AQX A;  3UOM A;  4K7I A;  4LL4 B;  3TOU A;  2EIR A;  4OD7 A;  1WOU A;  2I4A A;  1E6B A;  1GTB A;  4LMV A;  2VD1 A;  3QAG A;  5C04 A;  4HDE A;  3D4T A;  1VF1 A;  1ERT A;  3QFA C;  3Q6O A;  16GS A;  3QCP A;  3F3R A;  4XS4 B;  1VF2 A;  2YOI A;  1A23 A;  3SWL A;  3IXR A;  1GLQ A;  5IMC A;  1T00 A;  3L0H A;  5ID2 A;  1UVZ A;  1UA5 A;  3R3E A;  2EC4 A;  2CZ3 A;  1XVW A;  4HQZ A;  2LJR A;  3PR8 A;  3HJO A;  1BYE A;  4OMV A;  1ERW A;  2P31 A;  4POK A;  3QR6 A;  1OKD A;  3CMI A;  3WGX A;  4DSS A;  3UJ1 A;  2FCH A;  2KP1 A;  3APS A;  3TCO A;  1F3B A;  5B6N A;  5A5K A;  4F82 A;  1USB A;  2FWG A;  1FO5 A;  1LU4 A;  3HVS A;  2HRF A;  4K9Z A;  5IM9 A;  1Q98 A;  1X5E A;  1TJD A;  2L5L A;  1G6Y A;  3K8N A;  3RAZ A;  4IJI A;  1UN2 A;  1WE0 A;  2MBS A;  5DJL A;  4N30 A;  3CYN A;  1X0R A;  1T4Y A;  4FYC A;  5D9T A;  1F37 A;  2FUG 2;  1CQG A;  17GS A;  2CVB A;  1TP9 A;  3GV1 A;  3A2X A;  2VCQ A;  5LCZ A;  3HCZ A;  3PIN A;  2F8A A;  1GSY A;  2HZF A;  2I9H A;  2XC2 A;  4MZW A;  2O7K A;  4MMM A;  1XVQ A;  4POB A;  4ID0 A;  2M46 A;  4FH8 A;  3IPZ A;  1EP8 A;  2G2Q A;  3HYP A;  3M0F A;  3EVI A;  1A2J A;  3N9J A;  3ZMK A;  3D21 A;  6GSV A;  3GRX A;  20GS A;  2FY6 A;  3FZ5 A;  3V1W A;  1OKT A;  2H1D A;  3VWW A;  3IHQ A;  3DGQ A;  4IBP A;  4JBB A;  5J9C A;  3PGT A;  4XTS A;  5ECM B;  2YWM A;  4ZBD A;  4G9H A;  5JCU A;  3O6T A;  4H86 A;  2PU9 C;  4POM A;  4MPG A;  4TR0 A;  1QGV A;  3LQ7 A;  5IMA A;  1U6T A;  1PL1 A;  4GLT A;  4EDZ A;  2IMK A;  3FZ9 A;  3GL3 A;  4O92 A;  4GSN A;  3TKS A;  2GVP A;  2TRC P;  1GTI A;  1GUK A;  3ZIJ A;  4CW9 A;  5DCH A;  3MNG A;  1ZOF A;  2UZ8 A;  4KB3 A;  2HZE B;  1G7O A;  2WFC A;  1R7H A;  2YP6 A;  3R2Q A;  2BMX A;  1XW6 A;  1B9X C;  4NWY A;  4KCE A;  1B4Q A;  2FWH A;  4K2D A;  2FHE A;  3GX8 A;  1FG4 A;  3F63 A;  3TKS E;  2L6C A;  1MEK A;  3MDK A;  4OO5 A;  3P8W A;  2JL4 A;  3TRX A;  2OA7 A;  4Q5F A;  1SU9 A;  4OCF A;  4V1A g;  4EE0 A;  3F9U A;  3GH6 A;  2NPB A;  4HZ4 A;  2GZZ A;  1VF4 A;  5DVB A;  1O8W A;  1OYJ A;  4BVX A;  3GL5 A;  2DC5 A;  3DD3 A;  2YCD A;  5JCW A;  2OE1 A;  3LOR A;  2JZT A;  1GUH A;  3KD0 A;  1PSQ A;  1C72 A;  4PUF C;  3HA9 A;  1OAZ A;  2B1L A;  4TR4 A;  5CNW A;  1A0F A;  3MSZ A;  3A2W A;  2KUC A;  3GSS A;  2IL3 A;  5ECN B;  1AIU A;  1ERU A;  1EV4 A;  1HYU A;  1Z5Y E;  3KH9 A;  2ZNM A;  1U3A A;  4IQA A;  5G30 A;  4NV2 A;  1YKC A;  1SKS B;  2VCX A;  5IPH A;  3QDN A;  1BJX A;  1WWJ A;  4D73 B;  1ZMA A;  2PPT A;  1MD3 A;  5A4W A;  2VL3 A;  2E0Q A;  3LGC A;  2DJ2 A;  5DAL B;  1N2A A;  4MZB A;  4TXO A;  1WRY A;  3GH9 A;  3QPM A;  2F8F A;  1PRX A;  1EGO A;  1SJI A;  1RK4 A;  2ZUP A;  4PNG A;  2K18 A;  4RQX A;  2GDR A;  2HSY A;  2N5B A;  2X8G A;  2VLT A;  1B48 A;  3RHB A;  4YQU A;  2IMF A;  2IJY A;  1GTU A;  2ZCT A;  2TRX A;  4IHU A;  7GSS A;  2QSI A;  1RQM A;  5JCG A;  1M9B A;  1FAA A;  1XWG A;  2PBJ A;  3FEU A;  3GNJ A;  5J4U A;  5J41 A;  1PN9 A;  2MMA A;  1V9W A;  2CZ2 A;  2KOK A;  4KDU A;  1MDJ A;  3ZFL A;  1FB6 A;  6GSY A;  4WBR D;  2DJ0 A;  1WMJ A;  3F4R A;  2H74 A;  4CDO A;  3KIJ A;  4TR3 A;  1ABA A;  3VPQ A;  1Z7P A;  3DRN A;  3GST A;  4NHZ A;  1SYX A;  2OJL A;  3VI7 A;  4NHW A;  2M80 A;  4WR4 A;  2V1M A;  1T4Z A;  1FOV A;  4KDX A;  4MZC A;  4TRX A;  1EV9 A;  4IVF A;  4CHS A;  2B6M A;  2HI7 A;  4LA1 A;  3FR6 A;  1JZR A;  3FKF A;  3EE2 A;  1DUG A;  1EP7 A;  2ALB A;  4EDY A;  3HJP A;  4PGT A;  1OE7 A;  2OAC A;  3IOS A;  1ST9 A;  3G7Y A;  1TKD B;  3IAM 2;  1W4V A;  5A4V A;  3C1S A;  3RHC A;  2AHE A;  3C1R A;  2GS3 A;  1K0A A;  1AUC A;  4L5L A;  3ZZX A;  5DAK B;  4L0W A;  1T7P B;  4MPF A;  4HU7 A;  1ACV A;  3DKS A;  4NV5 A;  1TW9 A;  3FW2 A;  1J08 A;  2F51 A;  5CRW A;  2WDU A;  3AY8 A;  4F03 A;  3FZA A;  1AW9 A;  2JAC A;  4AJ7 A;  2NBS A;  4I6X A;  2VUP A;  4N0Z A;  4DVC A;  4PXO A;  1R5A A;  2VD0 A;  4ZBB A;  4YAV A;  3M8N A;  2C3T A;  4BVY A;  3ME8 A;  5ELA A;  3KM6 A;  3DYR A;  2H1B A;  5DQY A;  2VCT A;  2NTO A;  2HYX A;  3E3E A;  3TJB A;  4YH2 A;  4MLY A;  4KSO A;  4AJ8 A;  2GGT A;  1JHB A;  1ZYE A;  3H79 A;  3G7J A;  4IGJ A;  4YQM A;  4IS0 A;  2GZP A;  1IYH A;  2P5R A;  5ELG A;  3GIX A;  2O85 A;  3DML A;  1NHO A;  2GTU A;  5F07 A;  1F2E A;  3KEB A;  2X64 A;  3VK9 A;  4XIH A;  2L6D A;  2IFQ B;  3GTU A;  2YV9 A;  5ECR B;  1O85 A;  2HXK A;  2QGV A;  4F2I A;  5GAN D;  1VF3 A;  3BJ5 A;  1K3O A;  5AIS A;  1TXX A;  3GN3 A;  2OBI A;  4PQI A;  5IMF A;  3L9S A;  1HQO A;  2H6Y A;  4JR6 A;  2C0D A;  3VPT A;  4ACS A;  1A0R P;  1U3I A;  5G2Z A;  5HR0 A;  4I5Q A;  2AJQ B;  5DCG A;  2MBT A;  3F4S A;  3LXT A;  4I2T A;  2M72 A;  5A4U A;  4K0G A;  1B9Y C;  1YF1 A;  5HFG A;  1G6W A;  3J7Y b;  2B5Y A;  4IW9 A;  5D9V A;  3CRU A;  1GWC A;  1K0C A;  2FWF A;  2G0F A;  1CQH A;  3E9J B;  3I69 A;  1O6J A;  3HVX A;  2PWJ A;  2D2Z A;  2HLS A;  2L4C A;  2JSZ A;  2L4Q A;  2V32 A;  1GNE A;  2R3X A;  3BCK A;  4N10 A;  4EXJ A;  2C3Q A;  2NVL A;  2HRN A;  3GYK A;  1XW9 A;  4HEA 2;  2DIY A;  4OFN A;  3I43 A;  3ZRD A;  4XS4 A;  1JZD A;  2B5E A;  3VWX A;  4HS1 A;  4K6X A;  4OFM A;  1XXU A;  4X43 A;  1ZYQ B;  5G5F A;  1NM3 A;  1XBS A;  3QAV A;  6GSX A;  2DJK A;  5IOW A;  3GUS A;  1QQ2 A;  2FLS A;  2LEG A;  4KH7 A;  2MMO A;  2L57 A;  4KA0 A;  3TKR A;  3CSI A;  4HU9 A;  2HT9 A;  1Z6N A;  5IQY A;  4USS A;  1TK5 B;  2H0H A;  1V40 A;  4TOP A;  1OC9 B;  1XWB A;  1XWK A;  4KDY A;  4WKW A;  1Z6M A;  3LEF A;  4MJB A;  1SL0 B;  1X5C A;  3MWH A;  5CP1 A;  1MDI A;  5JWO B;  2LQQ A;  1QK8 A;  1AAZ A;  4YQV A;  1T8E B;  2GSR A;  3IAS 2;  2I81 A;  3E0U A;  3EUR A;  2AYT A;  3W6G A;  4G10 A;  4ML6 A;  1TK8 B;  1TI3 A;  4K0N A;  2VM2 A;  2HQT A;  1J9B A;  1ZGN A;  3HXS A;  2PER A;  3G9B A;  2X8C A;  3TRQ A;  4ZL7 A;  1JZW A;  1KNG A;  3KP8 A;  4IN0 A;  1SL1 B;  1XIY A;  1ML6 A;  2H75 A;  2V6K A;  2A2R A;  2XPD A;  5L71 A;  2H72 A;  5BMU A;  4WEY A;  1HNA A;  2VLU A;  4I8B A;  1GTA A;  5CRD A;  3ISO A;  2H6X A;  4XHM A;  3EU4 A;  1HNB A;  3H1N A;  2C8U A;  2RM5 A;  4MF7 A;  1ZCP A;  2WJU A;  4F0B A;  4JZQ A;  1WJK A;  4JU5 A;  1Z7R A;  1DBY A;  1AQW A;  1BX9 A;  3HD5 A;  2FA4 A;  1M7T A;  2IME A;  5AGY A;  11GS A;  1K0D A;  1ZL9 A;  4ECJ A;  5D9X A;  4BWS A;  2H1G A;  1G0T A;  3SBC A;  2WS2 A;  3GA4 A;  4HJM A;  3CXG A;  1YDK A;  3VFI A;  4EO3 A;  3GKM A;  4MCU A;  3TOT A;  1SK0 A;  3WGE A;  2GQL A;  2HE3 A;  3HY2 A;  4FYU A;  2HZE A;  1AC1 A;  3A2V A;  4PUR A;  2J9H A;  2HFD A;  3A5W A;  2E2M A;  2XHF A;  2KP2 A;  3C7M A;  2YPM A;  4HZ2 A;  3KTL A;  3UMA A;  1I9D A;  4EL1 A;  3TJG A;  3FR9 A;  3FR3 A;  6GSS A;  1SYR A;  3BCI A;  2I3Y A;  4O7H A;  1YY7 A;  3DVX A;  4FYB A;  2XBI A;  4GXZ A;  4N0V A;  3F6D A;  1AQV A;  5G31 A;  4K7O A;  5E59 A;  3QFB C;  2PGT A;  1MDK A;  2VL2 A;  1R4W A;  1V98 A;  2H76 A;  3KGK A;  3C73 A;  4BVX B;  1M2A A;  3VWV A;  3W8J A;  1HNC A;  3D22 A;  1XCC A;  1GSE A;  2HSM B;  4KAE A;  4POL A;  2IN3 A;  1M9A A;  1EWX A;  3IR4 A;  4BWQ A;  4FO5 A;  3HKR A;  2WUL A;  5CAX A;  1YQ1 A;  5EVO A;  5D8I A;  4G0I A;  1PL2 A;  2DJ1 A;  1F9M A;  1OVN A;  3BOA A;  4YAP A;  2JZS A;  5IOX A;  3KCM A;  3LG6 A;  1SK1 A;  2MZC A;  4D73 A;  9GSS A;  1FW1 A;  4TN8 A;  1TRV A;  1PMT A;  5INY A;  5J5N A;  5DAL A;  3TUE A;  1F3A A;  5COH A;  2I1U A;  3QD9 A;  4EF0 A;  1G7E A;  1EOG A;  1NW2 A;  3IA1 A;  2PN8 A;  3LYK A;  4GF0 A;  4OCE A;  4PTS A;  5HFK A;  4TR1 B;  2ON7 A;  1PD2 1;  2H6Z A;  1SL2 B;  3M1G A;  2H8L A;  1O73 A;  3G7I A;  3O76 A;  1XOA A;  3C8E A;  2H66 A;  2H1A A;  1QUW A;  2YZH A;  2YWN A;  1GUM A;  2YZU A;  5G1L A;  3DVW A;  3KMN A;  4X0X A;  2IPA A;  4FIW A;  3GX0 A;  4AGS A;  2DJJ A;  2BTO T;  4DSR A;  5B7C A;  5IO0 A;  1S3A A;  2GT5 A;  1Y6E A;  2R6K A;  4ZL8 A;  4J56 E;  2WRT A;  1OC8 A;  1B4P A;  2VCV A;  1BED A;  1X5D A;  1PQN A;  5F8B A;  4EVM A;  4AJ6 A;  5DJM A;  1VRS D;  4TW5 A;  4AF2 A;  2LNT A;  1Z9H A;  2LST A;  3N5O A;  3RDW A;  5ECP B;  1XW5 A;  3P2A A;  1KTE A;  5KN1 A;  4Q5Q A;  1YF0 A;  4GSS A;  2LJK A;  2CAI A;  5B8A A;  2HSN B;  1V57 A;  3M9J A;  4LLR A;  5D96 A;  2B5X A;  4O5R A;  1TRU A;  1KBN A;  1V58 A;  1XWC A;  4Q5N A;  3ERG A;  4E8E A;  1GSU A;  6GSW A;  1BAY A;  3FY7 A;  4EKZ A;  1SEN A;  3TKS C;  4DEJ A;  2P5Q A;  1DSB A;  1SK2 A;  4ZBA A;  1SD8 A;  6GSU A;  2LUS A;  5HR2 A;  1QMV A;  1GL8 A;  1X9W B;  5IPG A;  4K7N A;  4GCI A;  3L9V A;  3ZLP A;  4V2N A;  2DML A;  4I97 A;  5DAK A;  4EUY A;  3RPN A;  4KND A;  3DWV A;  1U87 A;  3UAR A;  2VIM A;  4J2F A;  2OE3 A;  5JWR B;  4XS6 A;  2H70 A;  1LJR A;  3JCM L;  1T3B A;  3DIE A;  4OO4 A;  5ECL B;  4MF5 A;  4JE1 A;  5D9W A;  4HOJ A;  2H01 A;  5CRH A;  1SKW B;  1R5P A;  3Q18 A;  5ECK B;  1J0F A;  1T1V A;  4NAX A;  3A3T A;  3IK7 A;  2EIQ A;  2A4V A;  4V2L A;  2O8V B;  2EIO A;  2CQ9 A;  1N8J A;  1URM A;  1WIK A;  4IEL A;  3TKP A;  3NIV A;  3GKN A;  1A2L A;  5AIV A;  3W8S A;  5B8B A;  2DSA A;  3GKX A;  2GQK A;  2L59 A;  4BL7 A;  1X9S B;  4BPY A;  3KP9 A;  4JED A;  2GST A;  4ML1 A;  4MH2 A;  3D0Z A;  2LRT A;  2LRN A;  1SJ6 A;  3D6I A;  2FNO A;  2IFQ A;  5ECQ B;  3ERF A;  5JWQ B;  3L4N A;  2V41 A;  5GZZ B;  1AXD A;  2DLX A;  3TRP A;  2LQO A;  1O8X A;  2ES7 A;  3GUR A;  3EWL A;  1K3Y A;  2PVQ A;  2YN1 A;  3ZVJ A;  2PMT A;  4ULX A;  4GQF A;  2MYG A;  3BD2 A;  4HQS A;  1NSW A;  5CRE A;  2YNX A;  5CO3 A;  1WP0 A;  3QAW A;  2HRK A;  2CAQ A;  1E2Y A;  2IIY A;  4MJE A;  4MJA A;  4RQR A;  4GTU A;  3UVH A;  3FYG A;  3NOF A;  2B1K A;  2C0E A;  3QMX A;  4G2E A;  1TOF A;  4QL7 A;  3WGD A;  5KN3 A;  3FHK A;  4GRF A;  3EIN A;  4ZB8 A;  2WGR A;  2XPE A;  2MMN A;  4N11 A;  5E4W A;  3L78 A;  5DQS A;  1EOH A;  3FZ4 A;  1PKZ A;  2VL9 A;  2H71 A;  3WT1 A;  1UC7 A;  1GSQ A;  1ERV A;  2FGX A;  4G19 A;  2DBC A;  4IP1 A;  1WPI A;  1BG5 A;  1TU7 A;  3IV4 A;  3PPU A;  2JSY A;  2VAF A;  2FA8 A;  4OWY A;  1K0N A;  1VGL A;  5DBQ A;  3WT2 A;  4BVY B;  3D4M A;  3BBY A;  1ILO A;  12GS A;  3LXZ A;  5ECH B;  4ZXG A;  2YWO A;  4MH3 A;  3U5R E;  2QKE A;  5ID2 B;  2LKU A;  1K0B A;  1PKW A;  3UAP A;  4ZL9 A;  3EC3 A;  1W89 A;  3EMP A;  4MK3 A;  3J7Y k;  2AAW A;  1XZO A;  3Q19 A;  5KEJ A;  4L8E A;  5HQP A;  2IWT A;  1FHE A;  3M3M A;  4LMW A;  1RW1 A;  2PVO C;  2GZY A;  4DSS B;  2YV7 A;  3IRA A;  5FT3 A;  3I6A A;  4KW6 A;  3C71 A;  5H5S A;  1OE8 A;  3TJF A;  1OC9 A;  2H19 A;  5EL8 A;  2GSS A;  3F4T A;  2X8H A;  4F0C A;  5GSS A;  5EPF A;  2AV4 A;  1KEB A;  5ABR A;  2CV4 A;  2VLV A;  3OR5 A;  2LS5 A;  2R2J A;  4MA9 A;  2CVD A;  4J57 E;  1PX6 A;  3GKK A;  4HJ2 A;  3ED3 A;  4PQH A;  1O81 A;  1DE2 A;  2VOC A;  4GQC A;  1GNW A;  3CTG A;  2XBQ A;  1B8X A;  5AIX A;  5D73 A;  3ZIV A;  1V2A A;  1XFL A;  1M2B A;  1XWA A;  1JLW A;  2TIR A;  3RPP A;  3ERW A;  18GS A;  4XRA A;  3IC8 A;  4HI7 A;  3VI5 A;  5GST A;  1GSD A;  2DJ3 A;  8GSS A;  2CX4 A;  3TKQ A;  2OKA A;  3H8Q A;  3HDC A;  4ZIJ A;  2AUV A;  2C3N A;  2GQM A;  4KUN A;  3KJY A;  1GH2 A;  3TJJ A;  4ECB A;  2C1Y A;  2KLX A;  4V1A p;  3LJR A;  3P7X A;  2DMM A;  3MAK A;  1TRS A;  4PUA A;  5IMV A;  1YKA A;  3KZQ A;  3ZTL A;  2CVK A;  4RI6 A;  1F6M C;  2OAD A;  4KE3 A;  3GHA A;  3ZIT A;  2RM6 A;  3KXO A;  1THO A;  3FK8 A;  2HNL A;  2LNS A;  3H93 A;  5HFI A;  1PA3 A;  2GLR A;  5FHI A;  2R37 A;  1K3L A;  4KGI A;  3DXB A;  2QC7 A;  4FQU A;  4KSM A;  4IJ3 A;  2AB6 A;  3HZ8 A;  1MD4 A;  2B3S A;  4X1U A;  3UEM A;  2LTK A;  2Z9S A;  3M9K A;  3ZML A;  2VO4 A;  4V2M A;  5ENU A;  2WZ9 A;  5F0G A;  3KTB A;  4PNF A;  2F3M A;  4TKY A;  2GSQ A;  3CBU A;  1A8Y A;  4BA7 A;  3UVT A;  1JLV A;  1OC3 A;  1JFU A;  5F06 A;  4MF6 A;  3U6V A;  1FB0 A;  5LD0 A;  2HSH A;  2WCI A;  4XCS A;  3PH9 A;  1FVK A;  2P0G A;  2OE0 A;  4OFT A;  2E2G A;  4G0L A;  4G0K A;  2RII A;  3GMF A;  1GSF A;  1GLP A;  5IO2 A;  5D93 A;  2L5O A;  2CT6 A;  3IDV A;  5GAP D;  1PGT A;  2HSM A;  1U88 A;  1BQ7 A;  1K0O A;  2REM A;  5CRG A;  2BJX A;  3HHV A;  4ECI A;  5ECI B;  2H30 A;  5F05 A;  4HUA A;  1GRX A;  2R4V A;  2JU5 A;  1TU8 A;  3HVV A;  3ZYW A;  1TDI A;  1O7U A;  3O3T A;  2KHP A;  1EZK A;  4WF5 A;  1M2D A;  2IMI A;  2RUF A;  4TVE A;  5DDL A;  2C4J A;  2F9S A;  22GS A;  2B7K A;  3S9F A;  3KH7 A;  4TXO B;  3CRT A;  1TI1 A;  5CYY A;  1YEX A;  2WB9 A;  3CSH A;  1JZO A;  1H75 A;  4I2U A;  4EC0 A;  10GS A;  4QL9 A;  5ECS A;  4TR1 A;  3HZ4 A;  2JAD A;  4F9Z A;  4IQ1 A;  2IMD A;  3EU3 A;  2PUK C;  1FVJ A;  3EMX A;  2JZR A;  1GP1 A;  3F0I A;  4ISD A;  4TXV A;  1EEM A;  3HJM A;  4WR5 A;  5IIZ A;  1YEP A;  3UL3 A;  3KMO A;  1QFN A;  5IMZ A;  3ZL5 A;  5AN1 A;  1TTZ A;  3UIW A;  3Q74 A;  3DEX A;  3F6F A;  3UBK A;  2DIZ A;  2N5F A;  2K8S A;  4MDC A;  4IP6 A;  2YJ7 A;  2CA8 A;  2C80 A;  5FWG A;  3TGZ A;  3GFK A;  4K8M A;  13GS A;  6GST A;  1DE1 A;  4NXI A;  3F8U A;  4Z7X A;  1PX7 A;  1MTC A;  3ZVJ D;  2ON5 A;  3LWA A;  5J9B A;  2OBK A;  1X9M B;  1SKR B;  5G5E A;  3WD6 A;  2X99 A;  3L9U A;  4KCA A;  4O32 A;  2VCZ A;  1S3D A;  5HR3 A;  3I9V 2;  4Q5R A;  2HRA A;  2B7J A;  4WXT A;  4LL1 B;  5J3R A;  4ILF A;  1M99 A;  5EY6 A;  1Z3E A;  2YWI A;  4NMU A;  2K6V A;  1ON4 A;  4DSQ A;  3IE3 A;  1XOB A;  1ZZY A;  4PQ1 A;  4KF9 A;  2C0F A;  3APQ A;  1YZX A;  1IYI A;  3APO A;  4IKH A;  2FD3 A;  3VWU A;  1S3C A;  5H5Q A;  5ECO B;  2FWE A;  3US3 A;  4RI7 A;  2RUE A;  14GS A;  1YJ6 A;  2E7P A;  3F3Q A;  4QQ7 A;  3WYW A;  1EGR A;  4MJC A;  3CSJ A;  4RUV A;  2CX3 A;  1NHY A;  1H4O A;  3CTF A;  3LFL A;  2N5A A;  3ZRE A;  3IC4 A;  4GST A;  1SD9 A;  2VL2 C;  4L5O A;  1TRW A;  4E8H A;  1XPV A; 
#chains in the Genus database with same CATH topology
 1R26 A;  4ZB9 A;  4XS1 A;  3ZFB A;  1GSS A;  19GS A;  2A2S A;  2YJH A;  3IBH A;  2V2G A;  1A8L A;  3RBT A;  2YAN A;  1EEJ A;  2C0G A;  2J23 A;  3P90 A;  5J4V A;  1I5G A;  4JRR A;  4ZIL A;  3EYT A;  4BL7 B;  5G1K A;  3TDG A;  4L0U A;  1M0U A;  1THX A;  2LV3 A;  1LBK A;  4PX1 A;  3NZN A;  1PN0 A;  2O87 A;  3GTU B;  4NPB A;  3VLN A;  2GT6 A;  4JR4 A;  2K8V A;  2H0I A;  1GUL A;  3H4K A;  2LJA A;  5LNK e;  2RLI A;  4MAB A;  4WBJ A;  2R5G A;  5IMD A;  4P3Y B;  4ZB6 A;  2MMZ A;  3D5J A;  3FRC A;  1HD2 A;  2LRC A;  2H73 A;  2V6O A;  2NDO A;  5B6M A;  2WVY A;  3UBL A;  4WET A;  4XRD A;  2O89 A;  5KN0 A;  2HRK B;  5KN2 A;  3QOU A;  5C00 A;  4ECC A;  4GWR A;  1A24 A;  3TB2 A;  2VM1 A;  1A2M A;  1Q4J A;  2K9F A;  3LYP A;  2VCW A;  3TJK A;  1TK0 B;  5H5R A;  4WF4 A;  4K1F A;  5HR1 A;  1QXH A;  1SJZ A;  3ME7 A;  3IK9 A;  3VUR A;  1Y25 A;  4MP4 A;  4KX4 A;  2H0G A;  3LSZ A;  1K0M A;  1AQX A;  3UOM A;  4K7I A;  4LL4 B;  2DKI A;  3TOU A;  2EIR A;  4OD7 A;  1WOU A;  2I4A A;  1E6B A;  1GTB A;  4LMV A;  2VD1 A;  3QAG A;  5C04 A;  4HDE A;  3D4T A;  1VF1 A;  1ERT A;  3QFA C;  3Q6O A;  16GS A;  3QCP A;  4K5S A;  3F3R A;  4XS4 B;  1VF2 A;  2YOI A;  1A23 A;  3SWL A;  3IXR A;  1GLQ A;  5IMC A;  1T00 A;  3L0H A;  5ID2 A;  1UVZ A;  1UA5 A;  3R3E A;  2EC4 A;  2CZ3 A;  1XVW A;  4HQZ A;  2LJR A;  3PR8 A;  3HJO A;  1BYE A;  4OMV A;  1ERW A;  2P31 A;  4POK A;  3QR6 A;  5A34 B;  1OKD A;  3CMI A;  3WGX A;  4DSS A;  3UJ1 A;  2FCH A;  2KP1 A;  3APS A;  3TCO A;  1F3B A;  5B6N A;  5A5K A;  4F82 A;  1USB A;  2FWG A;  1FO5 A;  1LU4 A;  3HVS A;  2HRF A;  4Z2T A;  4K9Z A;  5IM9 A;  1Q98 A;  1X5E A;  4O5U A;  1TJD A;  2L5L A;  1G6Y A;  3K8N A;  3EPT A;  3RAZ A;  4IJI A;  1UN2 A;  1WE0 A;  2MBS A;  5DJL A;  4N30 A;  3CYN A;  1X0R A;  1T4Y A;  4FYC A;  5D9T A;  1F37 A;  2FUG 2;  1CQG A;  17GS A;  2CVB A;  1TP9 A;  3GV1 A;  3A2X A;  2VCQ A;  2WW2 A;  5LCZ A;  3HCZ A;  3PIN A;  2F8A A;  1GSY A;  2HZF A;  2I9H A;  2XC2 A;  4MZW A;  2O7K A;  4MMM A;  1XVQ A;  4POB A;  4ID0 A;  2M46 A;  4FH8 A;  3IPZ A;  1EP8 A;  2G2Q A;  3HYP A;  3M0F A;  3EVI A;  1A2J A;  3N9J A;  3ZMK A;  3D21 A;  6GSV A;  3GRX A;  20GS A;  2FY6 A;  3FZ5 A;  3V1W A;  1OKT A;  2H1D A;  3VWW A;  3IHQ A;  3DGQ A;  4IBP A;  4JBB A;  5J9C A;  3PGT A;  4XTS A;  5BRT A;  5ECM B;  2YWM A;  4ZBD A;  4G9H A;  5JCU A;  3O6T A;  4H86 A;  2PU9 C;  4POM A;  4MPG A;  4TR0 A;  1QGV A;  3LQ7 A;  5IMA A;  1U6T A;  1PL1 A;  4GLT A;  4EDZ A;  2IMK A;  3FZ9 A;  3GL3 A;  4O92 A;  4GSN A;  3TKS A;  2EFE A;  2GVP A;  2O36 A;  1S4B P;  2TRC P;  1GTI A;  1GUK A;  3ZIJ A;  4CW9 A;  5DCH A;  3MNG A;  1ZOF A;  2UZ8 A;  4KB3 A;  2HZE B;  1G7O A;  2WFC A;  1R7H A;  2YP6 A;  4YKF A;  4K2X A;  3R2Q A;  2BMX A;  1XW6 A;  1B9X C;  4NWY A;  4KCE A;  1B4Q A;  2FWH A;  4K2D A;  2FHE A;  3GX8 A;  1FG4 A;  3F63 A;  5A1N A;  3TKS E;  2L6C A;  1MEK A;  3MDK A;  4OO5 A;  3P8W A;  2JL4 A;  3TRX A;  2OA7 A;  4Q5F A;  1SU9 A;  4OCF A;  4V1A g;  4EE0 A;  3F9U A;  3GH6 A;  2NPB A;  4HZ4 A;  2GZZ A;  1VF4 A;  5DVB A;  1Y1U A;  4G01 A;  1O8W A;  1OYJ A;  4BVX A;  3GL5 A;  2DC5 A;  3DD3 A;  3A5I A;  2YCD A;  5JCW A;  2OE1 A;  3LOR A;  2JZT A;  1GUH A;  3KD0 A;  1PSQ A;  1C72 A;  4PUF C;  3HA9 A;  1OAZ A;  2B1L A;  4TR4 A;  5CNW A;  2H1L A;  2QA2 A;  1A0F A;  3MSZ A;  3A2W A;  2KUC A;  3GSS A;  2IL3 A;  5ECN B;  1AIU A;  1ERU A;  1EV4 A;  1HYU A;  1Z5Y E;  3KH9 A;  2ZNM A;  1U3A A;  4IQA A;  5G30 A;  4NV2 A;  1YKC A;  1SKS B;  2VCX A;  5IPH A;  3QDN A;  1BJX A;  1WWJ A;  4D73 B;  1ZMA A;  2PPT A;  1MD3 A;  5A4W A;  4HSC X;  2VL3 A;  2E0Q A;  3LGC A;  2DJ2 A;  5DAL B;  1N2A A;  4MZB A;  4TXO A;  1WRY A;  3GH9 A;  3QPM A;  2F8F A;  1PRX A;  1EGO A;  1SJI A;  1RK4 A;  2ZUP A;  4PNG A;  2K18 A;  4RQX A;  2GDR A;  2HSY A;  2N5B A;  2X8G A;  1BF5 A;  2VLT A;  1B48 A;  3RHB A;  4YQU A;  2IMF A;  2IJY A;  1GTU A;  2ZCT A;  2TRX A;  4IHU A;  7GSS A;  4QMK A;  2QSI A;  1RQM A;  5JCG A;  1M9B A;  4N3Z A;  1FAA A;  1XWG A;  2PBJ A;  3FEU A;  3GNJ A;  5J4U A;  5J41 A;  1PN9 A;  2MMA A;  1V9W A;  2CZ2 A;  2KOK A;  4KDU A;  1MDJ A;  3ZFL A;  1FB6 A;  2O5V A;  6GSY A;  4WBR D;  2DJ0 A;  1WMJ A;  3F4R A;  4A5P A;  2H74 A;  4CDO A;  3KIJ A;  4TR3 A;  1ABA A;  3VPQ A;  1Z7P A;  3DRN A;  3GST A;  4NHZ A;  1SYX A;  2OJL A;  3VI7 A;  4NHW A;  2M80 A;  4WR4 A;  2V1M A;  1T4Z A;  1FOV A;  4KDX A;  4MZC A;  4TRX A;  1EV9 A;  4IVF A;  4CHS A;  2B6M A;  2HI7 A;  4LA1 A;  3FR6 A;  1JZR A;  3FKF A;  3EE2 A;  1DUG A;  1EP7 A;  2ALB A;  4EDY A;  3HJP A;  4PGT A;  1OE7 A;  4PHZ C;  2OAC A;  3IOS A;  1ST9 A;  3G7Y A;  1TKD B;  3IAM 2;  1W4V A;  5A4V A;  3C1S A;  3RHC A;  2AHE A;  5J40 A;  3C1R A;  2GS3 A;  1K0A A;  1AUC A;  4L5L A;  3ZZX A;  5DAK B;  4L0W A;  1T7P B;  4MPF A;  4HU7 A;  1ACV A;  3DKS A;  4NV5 A;  1TW9 A;  3FW2 A;  1J08 A;  2F51 A;  5CRW A;  2WDU A;  3AY8 A;  4F03 A;  3FZA A;  1AW9 A;  2JAC A;  2WVX A;  4AJ7 A;  4PI0 C;  2NBS A;  4I6X A;  2VUP A;  4N0Z A;  4DVC A;  4PXO A;  1R5A A;  2VD0 A;  4ZBB A;  4YAV A;  3M8N A;  2C3T A;  4BVY A;  3ME8 A;  5ELA A;  3KM6 A;  3DYR A;  2H1B A;  5DQY A;  2VCT A;  2NTO A;  2HYX A;  3E3E A;  3TJB A;  4YH2 A;  4MLY A;  4KSO A;  4AJ8 A;  3RFR C;  2GGT A;  1JHB A;  1ZYE A;  3H79 A;  3G7J A;  4IGJ A;  4YQM A;  4IS0 A;  2GZP A;  1IYH A;  2P5R A;  5ELG A;  3GIX A;  2O85 A;  3DML A;  1NHO A;  2GTU A;  5F07 A;  1F2E A;  3KEB A;  2X64 A;  3VK9 A;  4XIH A;  2L6D A;  2IFQ B;  3GTU A;  2YV9 A;  5ECR B;  1O85 A;  2HXK A;  2QGV A;  4F2I A;  5GAN D;  5J4Y A;  2R0C A;  1VF3 A;  3BJ5 A;  1XG8 A;  1K3O A;  5AIS A;  4MNN A;  3MYD A;  1TXX A;  3GN3 A;  2OBI A;  4PQI A;  5IMF A;  3L9S A;  1HQO A;  2H6Y A;  4JR6 A;  2C0D A;  3VPT A;  4ACS A;  1A0R P;  1U3I A;  5G2Z A;  5HR0 A;  5KOW A;  4I5Q A;  2AJQ B;  5DCG A;  2MBT A;  3F4S A;  3LXT A;  4I2T A;  2M72 A;  5A4U A;  4K0G A;  1B9Y C;  1YF1 A;  5HFG A;  1G6W A;  3J7Y b;  1YEW C;  2B5Y A;  4IW9 A;  5D9V A;  3CRU A;  1GWC A;  1K0C A;  2FWF A;  2G0F A;  1CQH A;  3E9J B;  3I69 A;  1O6J A;  3HVX A;  2PWJ A;  2D2Z A;  2HLS A;  2L4C A;  2JSZ A;  2L4Q A;  2V32 A;  1GNE A;  2R3X A;  3BCK A;  4N10 A;  4EXJ A;  2C3Q A;  2NVL A;  2HRN A;  3GYK A;  1XW9 A;  4HEA 2;  2DIY A;  4OFN A;  3I43 A;  3ZRD A;  4XS4 A;  1JZD A;  2B5E A;  3VWX A;  4HS1 A;  4K6X A;  4OFM A;  1XXU A;  4X43 A;  5A5H B;  4ICY A;  2WW0 A;  1ZYQ B;  5G5F A;  1NM3 A;  1SVM A;  1XBS A;  3QAV A;  6GSX A;  2DJK A;  5IOW A;  3GUS A;  1QQ2 A;  4YKG A;  2FLS A;  5A34 A;  2LEG A;  4KH7 A;  2MMO A;  2L57 A;  4KA0 A;  3TKR A;  3CSI A;  4HU9 A;  2HT9 A;  1Z6N A;  5IQY A;  4USS A;  1TK5 B;  3CQF A;  2H0H A;  1V40 A;  4TOP A;  1OC9 B;  1XWB A;  1XWK A;  4KDY A;  4WKW A;  1Z6M A;  3LEF A;  4MJB A;  1SL0 B;  1X5C A;  3MWH A;  5CP1 A;  1MDI A;  5JWO B;  2LQQ A;  1QK8 A;  1AAZ A;  4YQV A;  1T8E B;  2GSR A;  3IAS 2;  2I81 A;  3E0U A;  3EUR A;  2AYT A;  3W6G A;  4G10 A;  4ML6 A;  1TK8 B;  1TI3 A;  2VM2 A;  4K0N A;  2HQT A;  1J9B A;  1ZGN A;  3HXS A;  2PER A;  3G9B A;  2X8C A;  3TRQ A;  4ZL7 A;  1JZW A;  1KNG A;  3KP8 A;  4IN0 A;  1SL1 B;  1XIY A;  1ML6 A;  2H75 A;  2V6K A;  2A2R A;  2XPD A;  5L71 A;  2H72 A;  5BMU A;  4WEY A;  1HNA A;  2VLU A;  4I8B A;  1GTA A;  5CRD A;  3ISO A;  2H6X A;  4XHM A;  3EU4 A;  1HNB A;  3H1N A;  2C8U A;  2RM5 A;  4MF7 A;  1ZCP A;  2WJU A;  4F0B A;  4JZQ A;  1WJK A;  4JU5 A;  1Z7R A;  1DBY A;  1AQW A;  1BX9 A;  3HD5 A;  2FA4 A;  1M7T A;  2IME A;  5AGY A;  11GS A;  1K0D A;  1ZL9 A;  4ECJ A;  5D9X A;  4BWS A;  2H1G A;  1G0T A;  3SBC A;  2WS2 A;  3GA4 A;  4HJM A;  3CXG A;  1YDK A;  3VFI A;  4EO3 A;  3GKM A;  4MCU A;  3TOT A;  1SK0 A;  3WGE A;  2GQL A;  2HE3 A;  3HY2 A;  4FYU A;  2HZE A;  1AC1 A;  3A2V A;  4PUR A;  2J9H A;  2HFD A;  3A5W A;  2E2M A;  2XHF A;  2KP2 A;  3C7M A;  2YPM A;  4HZ2 A;  3KTL A;  3UMA A;  1I9D A;  4EL1 A;  3TJG A;  3FR9 A;  3FR3 A;  6GSS A;  1SYR A;  3BCI A;  3FMW A;  2I3Y A;  4O7H A;  1YY7 A;  3DVX A;  4FYB A;  2XBI A;  4GXZ A;  5A1N B;  4N0V A;  3F6D A;  1AQV A;  5G31 A;  4K7O A;  5E59 A;  4EIQ A;  3QFB C;  2PGT A;  1MDK A;  2VL2 A;  1R4W A;  1V98 A;  2H76 A;  3KGK A;  3C73 A;  4BVX B;  1M2A A;  3VWV A;  3W8J A;  1HNC A;  3D22 A;  1XCC A;  4GDF A;  1GSE A;  2HSM B;  4KAE A;  4POL A;  2IN3 A;  1M9A A;  1EWX A;  3IR4 A;  4BWQ A;  4FO5 A;  3HKR A;  2WUL A;  5CAX A;  1YQ1 A;  2X4A A;  5EVO A;  5D8I A;  4G0I A;  1PL2 A;  2DJ1 A;  1F9M A;  1OVN A;  3BOA A;  4YAP A;  2JZS A;  5IOX A;  3KCM A;  4EIP A;  3LG6 A;  1SK1 A;  2MZC A;  4D73 A;  9GSS A;  1FW1 A;  4TN8 A;  1TRV A;  1PMT A;  5INY A;  4O5Q A;  5J5N A;  5DAL A;  3TUE A;  1F3A A;  5COH A;  2I1U A;  3QD9 A;  3LW9 A;  4EF0 A;  1G7E A;  1EOG A;  1NW2 A;  3IA1 A;  2PN8 A;  3LYK A;  4GF0 A;  4OCE A;  4PTS A;  5HFK A;  4TR1 B;  2ON7 A;  1PD2 1;  4K5R A;  2H6Z A;  1SL2 B;  3M1G A;  2H8L A;  1O73 A;  3G7I A;  3O76 A;  1XOA A;  3C8E A;  2H66 A;  2H1A A;  1QUW A;  2YZH A;  2YWN A;  1GUM A;  2YZU A;  5G1L A;  3DVW A;  3KMN A;  4X0X A;  2IPA A;  4FIW A;  3GX0 A;  4AGS A;  2DJJ A;  2BTO T;  4DSR A;  3CWG A;  5B7C A;  5IO0 A;  1S3A A;  2GT5 A;  1Y6E A;  2R6K A;  4ZL8 A;  4J56 E;  2WRT A;  1OC8 A;  1B4P A;  2VCV A;  1BED A;  4CY8 A;  1X5D A;  1PQN A;  5F8B A;  4EVM A;  4AJ6 A;  5DJM A;  1VRS D;  4TW5 A;  4AF2 A;  2LNT A;  1Z9H A;  2LST A;  3N5O A;  3RDW A;  5ECP B;  1XW5 A;  3P2A A;  1KTE A;  5KN1 A;  4Q5Q A;  1YF0 A;  4GSS A;  2LJK A;  2CAI A;  5B8A A;  2HSN B;  1V57 A;  3M9J A;  4LLR A;  5D96 A;  2B5X A;  4O5R A;  1TRU A;  1KBN A;  1M3J A;  1V58 A;  2WZS A;  1XWC A;  4Q5N A;  3ERG A;  4E8E A;  1GSU A;  6GSW A;  1BAY A;  3FY7 A;  4EKZ A;  1SEN A;  3TKS C;  4DEJ A;  2P5Q A;  2VKZ G;  1DSB A;  1SK2 A;  4ZBA A;  1SD8 A;  6GSU A;  2LUS A;  5HR2 A;  1QMV A;  1GL8 A;  1X9W B;  5IPG A;  4K7N A;  4GCI A;  3L9V A;  3ZLP A;  4V2N A;  2DML A;  4I97 A;  5DAK A;  4EUY A;  3RPN A;  4KND A;  3DWV A;  1U87 A;  2WW3 A;  3UAR A;  2VIM A;  4J2F A;  2OE3 A;  5JWR B;  4XS6 A;  2H70 A;  1BG1 A;  1LJR A;  3JCM L;  1T3B A;  3DIE A;  4OO4 A;  5ECL B;  4MF5 A;  2EFH A;  5D9W A;  4HOJ A;  4JE1 A;  2H01 A;  5CRH A;  1SKW B;  1R5P A;  2WVX B;  3Q18 A;  4BIK A;  5ECK B;  1J0F A;  1T1V A;  4NAX A;  3A3T A;  3IK7 A;  2EIQ A;  2A4V A;  4V2L A;  2O8V B;  2EIO A;  2CQ9 A;  1N8J A;  1URM A;  1WIK A;  4IEL A;  3TKP A;  1ZYP A;  3NIV A;  3GKN A;  1A2L A;  5AIV A;  3W8S A;  5B8B A;  2DSA A;  3GKX A;  2GQK A;  2L59 A;  3RGB C;  4BL7 A;  1X9S B;  4BPY A;  3CHX C;  3KP9 A;  1SVO A;  4JED A;  2GST A;  4ML1 A;  4MH2 A;  3D0Z A;  2LRT A;  2LRN A;  1SJ6 A;  3D6I A;  2FNO A;  2IFQ A;  5ECQ B;  3ERF A;  5JWQ B;  3L4N A;  2V41 A;  5GZZ B;  1AXD A;  2DLX A;  3TRP A;  2LQO A;  1O8X A;  2ES7 A;  4E68 A;  3GUR A;  3EWL A;  1K3Y A;  2PVQ A;  2YN1 A;  3ZVJ A;  2PMT A;  4ULX A;  4GQF A;  2MYG A;  3BD2 A;  4HQS A;  1NSW A;  5CRE A;  4FXY P;  2YNX A;  5CO3 A;  1WP0 A;  3QAW A;  2HRK A;  2CAQ A;  1E2Y A;  2IIY A;  4MJE A;  4MJA A;  2O3E A;  4RQR A;  4GTU A;  3UVH A;  3FYG A;  3NOF A;  2B1K A;  2C0E A;  3QMX A;  4G2E A;  1TOF A;  4QL7 A;  3WGD A;  5KN3 A;  3FHK A;  4GRF A;  3EIN A;  4ZB8 A;  2WGR A;  2XPE A;  2MMN A;  4N11 A;  5E4W A;  3L78 A;  5DQS A;  1EOH A;  3FZ4 A;  1PKZ A;  2VL9 A;  2H71 A;  3WT1 A;  1UC7 A;  1GSQ A;  1ERV A;  2FGX A;  4G19 A;  2DBC A;  4IP1 A;  1WPI A;  1BG5 A;  1TU7 A;  3HMJ G;  3IV4 A;  3PPU A;  2JSY A;  2VAF A;  2FA8 A;  4OWY A;  1K0N A;  3TU3 B;  1VGL A;  5DBQ A;  3WT2 A;  4BVY B;  4AKH A;  3D4M A;  3BBY A;  1ILO A;  12GS A;  3LXZ A;  5ECH B;  4ZXG A;  2YWO A;  4MH3 A;  3U5R E;  5A5H A;  2QKE A;  5ID2 B;  2LKU A;  1K0B A;  4AKG A;  1PKW A;  3UAP A;  4ZL9 A;  3EC3 A;  1W89 A;  3MIX A;  3EMP A;  4MK3 A;  3J7Y k;  2AAW A;  1XZO A;  2UV8 G;  3Q19 A;  5KEJ A;  4L8E A;  5HQP A;  2IWT A;  1FHE A;  3M3M A;  4LMW A;  1RW1 A;  2PVO C;  2GZY A;  4DSS B;  2YV7 A;  3IRA A;  5FT3 A;  3I6A A;  4KW6 A;  3C71 A;  5H5S A;  1OE8 A;  3TJF A;  1OC9 A;  2H19 A;  5EL8 A;  2GSS A;  3F4T A;  2X8H A;  4F0C A;  5GSS A;  5EPF A;  2AV4 A;  1KEB A;  5ABR A;  2CV4 A;  2VLV A;  3OR5 A;  2LS5 A;  2R2J A;  4MA9 A;  2CVD A;  4J57 E;  1PX6 A;  3GKK A;  4HJ2 A;  3ED3 A;  4PQH A;  1O81 A;  1DE2 A;  2VOC A;  4GQC A;  1GNW A;  3CTG A;  2XBQ A;  2EFC A;  1B8X A;  5AIX A;  5D73 A;  3ZIV A;  1V2A A;  1XFL A;  1M2B A;  1XWA A;  1JLW A;  2TIR A;  3RPP A;  3ERW A;  18GS A;  4XRA A;  3IC8 A;  4HI7 A;  3VI5 A;  5GST A;  1GSD A;  2DJ3 A;  8GSS A;  2CX4 A;  5BMU B;  2OKA A;  3TKQ A;  3H8Q A;  3HDC A;  4ZIJ A;  2AUV A;  2C3N A;  2GQM A;  4KUN A;  3KJY A;  1N25 A;  1GH2 A;  3TJJ A;  4Z2U A;  2A2P A;  4X4J A;  4ECB A;  2C1Y A;  2KLX A;  4V1A p;  3LJR A;  2EFD A;  3P7X A;  2DMM A;  5J47 A;  1ZYN A;  3MAK A;  1TRS A;  4PUA A;  5IMV A;  1YKA A;  3KZQ A;  3ZTL A;  2CVK A;  4RI6 A;  1F6M C;  2OAD A;  4KE3 A;  3GHA A;  3ZIT A;  2RM6 A;  2WW1 A;  3KXO A;  1THO A;  3FK8 A;  2HNL A;  2LNS A;  3H93 A;  5HFI A;  2OT3 A;  1PA3 A;  2GLR A;  5FHI A;  2R37 A;  1K3L A;  4KGI A;  3DXB A;  2QC7 A;  4FQU A;  4KSM A;  4IJ3 A;  2AB6 A;  3HZ8 A;  1MD4 A;  2B3S A;  4X1U A;  3UEM A;  2LTK A;  2Z9S A;  3M9K A;  3HVN A;  3ZML A;  2VO4 A;  4V2M A;  5ENU A;  2WZ9 A;  5F0G A;  2X49 A;  3KTB A;  4PNF A;  2F3M A;  4TKY A;  2GSQ A;  3CBU A;  1A8Y A;  4BA7 A;  3UVT A;  1JLV A;  4AI6 A;  1OC3 A;  1JFU A;  5F06 A;  4MF6 A;  3U6V A;  1FB0 A;  5LD0 A;  2HSH A;  1S3R A;  1M3I A;  2WCI A;  4XCS A;  3PH9 A;  1FVK A;  2P0G A;  2R0G A;  2OE0 A;  4OFT A;  2E2G A;  4G0L A;  4G0K A;  2RII A;  3GMF A;  1GSF A;  1YVL A;  1GLP A;  5IO2 A;  5D93 A;  2L5O A;  2CT6 A;  3IDV A;  1FOH A;  5GAP D;  1PGT A;  2HSM A;  1U88 A;  1BQ7 A;  2DKH A;  1SVL A;  1K0O A;  2REM A;  5CRG A;  2BJX A;  3HHV A;  4ECI A;  5ECI B;  2H30 A;  5F05 A;  4HUA A;  1GRX A;  2R4V A;  2QA1 A;  2JU5 A;  1TU8 A;  3HVV A;  3ZYW A;  1TDI A;  1O7U A;  3O3T A;  2KHP A;  1EZK A;  4WF5 A;  1M2D A;  2IMI A;  2RUF A;  4AKX B;  4TVE A;  5DDL A;  2C4J A;  2F9S A;  22GS A;  2B7K A;  3S9F A;  3KH7 A;  4TXO B;  3CRT A;  1TI1 A;  5CYY A;  1YEX A;  2WB9 A;  3CSH A;  1JZO A;  1H75 A;  4I2U A;  4EC0 A;  10GS A;  4QL9 A;  5ECS A;  4TR1 A;  3HZ4 A;  1TXU A;  2JAD A;  4F9Z A;  4IQ1 A;  2IMD A;  3EU3 A;  2PUK C;  1FVJ A;  3EMX A;  2JZR A;  1GP1 A;  3F0I A;  4ISD A;  4TXV A;  1EEM A;  3HJM A;  4WR5 A;  5IIZ A;  1YEP A;  3UL3 A;  3KMO A;  1QFN A;  5IMZ A;  3ZL5 A;  5AN1 A;  1TTZ A;  3UIW A;  3Q74 A;  3DEX A;  3F6F A;  3UBK A;  2DIZ A;  2N5F A;  2K8S A;  4MDC A;  2A4H A;  2YJ7 A;  4IP6 A;  2CA8 A;  2C80 A;  5FWG A;  3TGZ A;  4ZB7 A;  3GFK A;  4K8M A;  13GS A;  6GST A;  1DE1 A;  2WVZ A;  4NXI A;  3F8U A;  4Z7X A;  4AKI A;  1PX7 A;  1MTC A;  3ZVJ D;  2ON5 A;  3LWA A;  5J9B A;  2OBK A;  1X9M B;  1SKR B;  5G5E A;  2HSN A;  3WD6 A;  2X99 A;  3L9U A;  4KCA A;  4O32 A;  2VCZ A;  4Z2R A;  1S3D A;  5HR3 A;  3I9V 2;  4Q5R A;  2HRA A;  2B7J A;  4WXT A;  4LL1 B;  5J3R A;  4ILF A;  1M99 A;  5EY6 A;  1Z3E A;  2YWI A;  4NMU A;  4CY6 A;  1I1I P;  2K6V A;  1ON4 A;  4DSQ A;  3IE3 A;  1PFO A;  1XOB A;  1ZZY A;  4PQ1 A;  4KF9 A;  2C0F A;  3APQ A;  5KOX A;  1YZX A;  4PI2 C;  1IYI A;  3APO A;  4IKH A;  2FD3 A;  3VWU A;  1S3C A;  5H5Q A;  5ECO B;  2FWE A;  3US3 A;  4RI7 A;  2R0P A;  2RUE A;  3IHG A;  14GS A;  1YJ6 A;  2E7P A;  3F3Q A;  4QQ7 A;  3WYW A;  1EGR A;  4MJC A;  3CSJ A;  4RUV A;  2CX3 A;  1NHY A;  1H4O A;  3CTF A;  3LFL A;  2N5A A;  3ZRE A;  3IC4 A;  4W66 A;  4GST A;  1SD9 A;  2VL2 C;  4L5O A;  1TRW A;  4E8H A;  1XPV A; 
#chains in the Genus database with same CATH homology
 1R26 A;  4ZB9 A;  4XS1 A;  3ZFB A;  1GSS A;  19GS A;  2A2S A;  2YJH A;  3IBH A;  2V2G A;  1A8L A;  3RBT A;  2YAN A;  1EEJ A;  2C0G A;  2J23 A;  3P90 A;  5J4V A;  1I5G A;  4JRR A;  4ZIL A;  3EYT A;  4BL7 B;  5G1K A;  3TDG A;  4L0U A;  1M0U A;  1THX A;  2LV3 A;  1LBK A;  4PX1 A;  3NZN A;  1PN0 A;  2O87 A;  3GTU B;  4NPB A;  3VLN A;  2GT6 A;  4JR4 A;  2K8V A;  2H0I A;  1GUL A;  3H4K A;  2LJA A;  5LNK e;  2RLI A;  4MAB A;  4WBJ A;  2R5G A;  5IMD A;  4P3Y B;  4ZB6 A;  2MMZ A;  3D5J A;  3FRC A;  1HD2 A;  2LRC A;  2H73 A;  2V6O A;  2NDO A;  5B6M A;  3UBL A;  4WET A;  4XRD A;  2O89 A;  5KN0 A;  2HRK B;  5KN2 A;  3QOU A;  5C00 A;  4ECC A;  4GWR A;  1A24 A;  3TB2 A;  2VM1 A;  1A2M A;  1Q4J A;  2K9F A;  3LYP A;  2VCW A;  3TJK A;  1TK0 B;  5H5R A;  4WF4 A;  4K1F A;  5HR1 A;  1QXH A;  1SJZ A;  3ME7 A;  3IK9 A;  3VUR A;  1Y25 A;  4MP4 A;  4KX4 A;  2H0G A;  3LSZ A;  1K0M A;  1AQX A;  3UOM A;  4K7I A;  4LL4 B;  2DKI A;  3TOU A;  2EIR A;  4OD7 A;  1WOU A;  2I4A A;  1E6B A;  1GTB A;  4LMV A;  2VD1 A;  3QAG A;  5C04 A;  4HDE A;  3D4T A;  1VF1 A;  1ERT A;  3QFA C;  3Q6O A;  16GS A;  3QCP A;  4K5S A;  3F3R A;  4XS4 B;  1VF2 A;  2YOI A;  1A23 A;  3SWL A;  3IXR A;  1GLQ A;  5IMC A;  1T00 A;  3L0H A;  5ID2 A;  1UVZ A;  1UA5 A;  3R3E A;  2EC4 A;  2CZ3 A;  1XVW A;  4HQZ A;  2LJR A;  3PR8 A;  3HJO A;  1BYE A;  4OMV A;  1ERW A;  2P31 A;  4POK A;  3QR6 A;  5A34 B;  1OKD A;  3CMI A;  3WGX A;  4DSS A;  3UJ1 A;  2FCH A;  2KP1 A;  3APS A;  3TCO A;  1F3B A;  5B6N A;  5A5K A;  4F82 A;  1USB A;  2FWG A;  1FO5 A;  1LU4 A;  3HVS A;  2HRF A;  4Z2T A;  4K9Z A;  5IM9 A;  1Q98 A;  1X5E A;  4O5U A;  1TJD A;  2L5L A;  1G6Y A;  3K8N A;  3EPT A;  3RAZ A;  4IJI A;  1UN2 A;  1WE0 A;  2MBS A;  5DJL A;  4N30 A;  3CYN A;  1X0R A;  1T4Y A;  4FYC A;  5D9T A;  1F37 A;  2FUG 2;  1CQG A;  17GS A;  2CVB A;  1TP9 A;  3GV1 A;  3A2X A;  2VCQ A;  5LCZ A;  3HCZ A;  3PIN A;  2F8A A;  1GSY A;  2HZF A;  2I9H A;  2XC2 A;  4MZW A;  2O7K A;  4MMM A;  1XVQ A;  4POB A;  4ID0 A;  2M46 A;  4FH8 A;  3IPZ A;  1EP8 A;  2G2Q A;  3HYP A;  3M0F A;  3EVI A;  1A2J A;  3N9J A;  3ZMK A;  3D21 A;  6GSV A;  3GRX A;  20GS A;  2FY6 A;  3FZ5 A;  3V1W A;  1OKT A;  2H1D A;  3VWW A;  3IHQ A;  3DGQ A;  4IBP A;  4JBB A;  5J9C A;  3PGT A;  4XTS A;  5BRT A;  5ECM B;  2YWM A;  4ZBD A;  4G9H A;  5JCU A;  3O6T A;  4H86 A;  2PU9 C;  4POM A;  4MPG A;  4TR0 A;  1QGV A;  3LQ7 A;  5IMA A;  1U6T A;  1PL1 A;  4GLT A;  4EDZ A;  2IMK A;  3FZ9 A;  3GL3 A;  4O92 A;  4GSN A;  3TKS A;  2EFE A;  2GVP A;  2TRC P;  1GTI A;  1GUK A;  3ZIJ A;  4CW9 A;  5DCH A;  3MNG A;  1ZOF A;  2UZ8 A;  4KB3 A;  2HZE B;  1G7O A;  2WFC A;  1R7H A;  2YP6 A;  4YKF A;  4K2X A;  3R2Q A;  2BMX A;  1XW6 A;  1B9X C;  4NWY A;  4KCE A;  1B4Q A;  2FWH A;  4K2D A;  2FHE A;  3GX8 A;  1FG4 A;  3F63 A;  5A1N A;  3TKS E;  2L6C A;  1MEK A;  3MDK A;  4OO5 A;  3P8W A;  2JL4 A;  3TRX A;  2OA7 A;  4Q5F A;  1SU9 A;  4OCF A;  4V1A g;  4EE0 A;  3F9U A;  3GH6 A;  2NPB A;  4HZ4 A;  2GZZ A;  1VF4 A;  5DVB A;  1Y1U A;  4G01 A;  1O8W A;  1OYJ A;  4BVX A;  3GL5 A;  2DC5 A;  3DD3 A;  3A5I A;  2YCD A;  5JCW A;  2OE1 A;  3LOR A;  2JZT A;  1GUH A;  3KD0 A;  1PSQ A;  1C72 A;  4PUF C;  3HA9 A;  1OAZ A;  2B1L A;  4TR4 A;  5CNW A;  2H1L A;  2QA2 A;  1A0F A;  3MSZ A;  3A2W A;  2KUC A;  3GSS A;  2IL3 A;  5ECN B;  1AIU A;  1ERU A;  1EV4 A;  1HYU A;  1Z5Y E;  3KH9 A;  2ZNM A;  1U3A A;  4IQA A;  5G30 A;  4NV2 A;  1YKC A;  1SKS B;  2VCX A;  5IPH A;  3QDN A;  1BJX A;  1WWJ A;  4D73 B;  1ZMA A;  2PPT A;  1MD3 A;  5A4W A;  2VL3 A;  2E0Q A;  3LGC A;  2DJ2 A;  5DAL B;  1N2A A;  4MZB A;  4TXO A;  1WRY A;  3GH9 A;  3QPM A;  2F8F A;  1PRX A;  1EGO A;  1SJI A;  1RK4 A;  2ZUP A;  4PNG A;  2K18 A;  4RQX A;  2GDR A;  2HSY A;  2N5B A;  2X8G A;  1BF5 A;  2VLT A;  1B48 A;  3RHB A;  4YQU A;  2IMF A;  2IJY A;  1GTU A;  2ZCT A;  2TRX A;  4IHU A;  7GSS A;  4QMK A;  2QSI A;  1RQM A;  5JCG A;  1M9B A;  4N3Z A;  1FAA A;  1XWG A;  2PBJ A;  3FEU A;  3GNJ A;  5J4U A;  5J41 A;  1PN9 A;  2MMA A;  1V9W A;  2CZ2 A;  2KOK A;  4KDU A;  1MDJ A;  3ZFL A;  1FB6 A;  2O5V A;  6GSY A;  4WBR D;  2DJ0 A;  1WMJ A;  3F4R A;  4A5P A;  2H74 A;  4CDO A;  3KIJ A;  4TR3 A;  1ABA A;  3VPQ A;  1Z7P A;  3DRN A;  3GST A;  4NHZ A;  1SYX A;  2OJL A;  3VI7 A;  4NHW A;  2M80 A;  4WR4 A;  2V1M A;  1T4Z A;  1FOV A;  4KDX A;  4MZC A;  4TRX A;  1EV9 A;  4IVF A;  4CHS A;  2B6M A;  2HI7 A;  4LA1 A;  3FR6 A;  1JZR A;  3FKF A;  3EE2 A;  1DUG A;  1EP7 A;  2ALB A;  4EDY A;  3HJP A;  4PGT A;  1OE7 A;  2OAC A;  3IOS A;  1ST9 A;  3G7Y A;  1TKD B;  3IAM 2;  1W4V A;  5A4V A;  3C1S A;  3RHC A;  2AHE A;  5J40 A;  3C1R A;  2GS3 A;  1K0A A;  1AUC A;  4L5L A;  3ZZX A;  5DAK B;  4L0W A;  1T7P B;  4MPF A;  4HU7 A;  1ACV A;  3DKS A;  4NV5 A;  1TW9 A;  3FW2 A;  1J08 A;  2F51 A;  5CRW A;  2WDU A;  3AY8 A;  4F03 A;  3FZA A;  1AW9 A;  2JAC A;  4AJ7 A;  2NBS A;  4I6X A;  2VUP A;  4N0Z A;  4DVC A;  4PXO A;  1R5A A;  2VD0 A;  4ZBB A;  4YAV A;  3M8N A;  2C3T A;  4BVY A;  3ME8 A;  5ELA A;  3KM6 A;  3DYR A;  2H1B A;  5DQY A;  2VCT A;  2NTO A;  2HYX A;  3E3E A;  3TJB A;  4YH2 A;  4MLY A;  4KSO A;  4AJ8 A;  2GGT A;  1JHB A;  1ZYE A;  3H79 A;  3G7J A;  4IGJ A;  4YQM A;  4IS0 A;  2GZP A;  1IYH A;  2P5R A;  5ELG A;  3GIX A;  2O85 A;  3DML A;  1NHO A;  2GTU A;  5F07 A;  1F2E A;  3KEB A;  2X64 A;  3VK9 A;  4XIH A;  2L6D A;  2IFQ B;  3GTU A;  2YV9 A;  5ECR B;  1O85 A;  2HXK A;  2QGV A;  4F2I A;  5GAN D;  5J4Y A;  2R0C A;  1VF3 A;  3BJ5 A;  1K3O A;  5AIS A;  4MNN A;  3MYD A;  1TXX A;  3GN3 A;  2OBI A;  4PQI A;  5IMF A;  3L9S A;  1HQO A;  2H6Y A;  4JR6 A;  2C0D A;  3VPT A;  4ACS A;  1A0R P;  1U3I A;  5G2Z A;  5HR0 A;  5KOW A;  4I5Q A;  2AJQ B;  5DCG A;  2MBT A;  3F4S A;  3LXT A;  4I2T A;  2M72 A;  5A4U A;  4K0G A;  1B9Y C;  1YF1 A;  5HFG A;  1G6W A;  3J7Y b;  2B5Y A;  4IW9 A;  5D9V A;  3CRU A;  1GWC A;  1K0C A;  2FWF A;  2G0F A;  1CQH A;  3E9J B;  3I69 A;  1O6J A;  3HVX A;  2PWJ A;  2D2Z A;  2HLS A;  2L4C A;  2JSZ A;  2L4Q A;  2V32 A;  1GNE A;  2R3X A;  3BCK A;  4N10 A;  4EXJ A;  2C3Q A;  2NVL A;  2HRN A;  3GYK A;  1XW9 A;  4HEA 2;  2DIY A;  4OFN A;  3I43 A;  3ZRD A;  4XS4 A;  1JZD A;  2B5E A;  3VWX A;  4HS1 A;  4K6X A;  4OFM A;  1XXU A;  4X43 A;  5A5H B;  4ICY A;  1ZYQ B;  5G5F A;  1NM3 A;  1SVM A;  1XBS A;  3QAV A;  6GSX A;  2DJK A;  5IOW A;  3GUS A;  1QQ2 A;  4YKG A;  2FLS A;  5A34 A;  2LEG A;  4KH7 A;  2MMO A;  2L57 A;  4KA0 A;  3TKR A;  3CSI A;  4HU9 A;  2HT9 A;  1Z6N A;  5IQY A;  4USS A;  1TK5 B;  2H0H A;  1V40 A;  4TOP A;  1OC9 B;  1XWB A;  1XWK A;  4KDY A;  4WKW A;  1Z6M A;  3LEF A;  4MJB A;  1SL0 B;  1X5C A;  3MWH A;  5CP1 A;  1MDI A;  5JWO B;  2LQQ A;  1QK8 A;  1AAZ A;  4YQV A;  1T8E B;  2GSR A;  3IAS 2;  2I81 A;  3E0U A;  3EUR A;  2AYT A;  3W6G A;  4G10 A;  4ML6 A;  1TK8 B;  1TI3 A;  2VM2 A;  4K0N A;  2HQT A;  1J9B A;  1ZGN A;  3HXS A;  2PER A;  3G9B A;  2X8C A;  3TRQ A;  4ZL7 A;  1JZW A;  1KNG A;  3KP8 A;  4IN0 A;  1SL1 B;  1XIY A;  1ML6 A;  2H75 A;  2V6K A;  2A2R A;  2XPD A;  5L71 A;  2H72 A;  5BMU A;  4WEY A;  1HNA A;  2VLU A;  4I8B A;  1GTA A;  5CRD A;  3ISO A;  2H6X A;  4XHM A;  3EU4 A;  1HNB A;  3H1N A;  2C8U A;  2RM5 A;  4MF7 A;  1ZCP A;  2WJU A;  4F0B A;  4JZQ A;  1WJK A;  4JU5 A;  1Z7R A;  1DBY A;  1AQW A;  1BX9 A;  3HD5 A;  2FA4 A;  1M7T A;  2IME A;  5AGY A;  11GS A;  1K0D A;  1ZL9 A;  4ECJ A;  5D9X A;  4BWS A;  2H1G A;  1G0T A;  3SBC A;  2WS2 A;  3GA4 A;  4HJM A;  3CXG A;  1YDK A;  3VFI A;  4EO3 A;  3GKM A;  4MCU A;  3TOT A;  1SK0 A;  3WGE A;  2GQL A;  2HE3 A;  3HY2 A;  4FYU A;  2HZE A;  1AC1 A;  3A2V A;  4PUR A;  2J9H A;  2HFD A;  3A5W A;  2E2M A;  2XHF A;  2KP2 A;  3C7M A;  2YPM A;  4HZ2 A;  3KTL A;  3UMA A;  1I9D A;  4EL1 A;  3TJG A;  3FR9 A;  3FR3 A;  6GSS A;  1SYR A;  3BCI A;  3FMW A;  2I3Y A;  4O7H A;  1YY7 A;  3DVX A;  4FYB A;  2XBI A;  4GXZ A;  5A1N B;  4N0V A;  3F6D A;  1AQV A;  5G31 A;  4K7O A;  5E59 A;  4EIQ A;  3QFB C;  2PGT A;  1MDK A;  2VL2 A;  1R4W A;  1V98 A;  2H76 A;  3KGK A;  3C73 A;  4BVX B;  1M2A A;  3VWV A;  3W8J A;  1HNC A;  3D22 A;  1XCC A;  4GDF A;  1GSE A;  2HSM B;  4KAE A;  4POL A;  2IN3 A;  1M9A A;  1EWX A;  3IR4 A;  4BWQ A;  4FO5 A;  3HKR A;  2WUL A;  5CAX A;  1YQ1 A;  2X4A A;  5EVO A;  5D8I A;  4G0I A;  1PL2 A;  2DJ1 A;  1F9M A;  1OVN A;  3BOA A;  4YAP A;  2JZS A;  5IOX A;  3KCM A;  4EIP A;  3LG6 A;  1SK1 A;  2MZC A;  4D73 A;  9GSS A;  1FW1 A;  4TN8 A;  1TRV A;  1PMT A;  5INY A;  4O5Q A;  5J5N A;  5DAL A;  3TUE A;  1F3A A;  5COH A;  2I1U A;  3QD9 A;  3LW9 A;  4EF0 A;  1G7E A;  1EOG A;  1NW2 A;  3IA1 A;  2PN8 A;  3LYK A;  4GF0 A;  4OCE A;  4PTS A;  5HFK A;  4TR1 B;  2ON7 A;  1PD2 1;  4K5R A;  2H6Z A;  1SL2 B;  3M1G A;  2H8L A;  1O73 A;  3G7I A;  3O76 A;  1XOA A;  3C8E A;  2H66 A;  2H1A A;  1QUW A;  2YZH A;  2YWN A;  1GUM A;  2YZU A;  5G1L A;  3DVW A;  3KMN A;  4X0X A;  2IPA A;  4FIW A;  3GX0 A;  4AGS A;  2DJJ A;  2BTO T;  4DSR A;  3CWG A;  5B7C A;  5IO0 A;  1S3A A;  2GT5 A;  1Y6E A;  2R6K A;  4ZL8 A;  4J56 E;  2WRT A;  1OC8 A;  1B4P A;  2VCV A;  1BED A;  4CY8 A;  1X5D A;  1PQN A;  5F8B A;  4EVM A;  4AJ6 A;  5DJM A;  1VRS D;  4TW5 A;  4AF2 A;  2LNT A;  1Z9H A;  2LST A;  3N5O A;  3RDW A;  5ECP B;  1XW5 A;  3P2A A;  1KTE A;  5KN1 A;  4Q5Q A;  1YF0 A;  4GSS A;  2LJK A;  2CAI A;  5B8A A;  2HSN B;  1V57 A;  3M9J A;  4LLR A;  5D96 A;  2B5X A;  4O5R A;  1TRU A;  1KBN A;  1V58 A;  1XWC A;  4Q5N A;  3ERG A;  4E8E A;  1GSU A;  6GSW A;  1BAY A;  3FY7 A;  4EKZ A;  1SEN A;  3TKS C;  4DEJ A;  2P5Q A;  2VKZ G;  1DSB A;  1SK2 A;  4ZBA A;  1SD8 A;  6GSU A;  2LUS A;  5HR2 A;  1QMV A;  1GL8 A;  1X9W B;  5IPG A;  4K7N A;  4GCI A;  3L9V A;  3ZLP A;  4V2N A;  2DML A;  4I97 A;  5DAK A;  4EUY A;  3RPN A;  4KND A;  3DWV A;  1U87 A;  3UAR A;  2VIM A;  4J2F A;  2OE3 A;  5JWR B;  4XS6 A;  2H70 A;  1BG1 A;  1LJR A;  3JCM L;  1T3B A;  3DIE A;  4OO4 A;  5ECL B;  4MF5 A;  2EFH A;  5D9W A;  4HOJ A;  4JE1 A;  2H01 A;  5CRH A;  1SKW B;  1R5P A;  3Q18 A;  5ECK B;  1J0F A;  1T1V A;  4NAX A;  3A3T A;  3IK7 A;  2EIQ A;  2A4V A;  4V2L A;  2O8V B;  2EIO A;  2CQ9 A;  1N8J A;  1URM A;  1WIK A;  4IEL A;  3TKP A;  1ZYP A;  3NIV A;  3GKN A;  1A2L A;  5AIV A;  3W8S A;  5B8B A;  2DSA A;  3GKX A;  2GQK A;  2L59 A;  4BL7 A;  1X9S B;  4BPY A;  3KP9 A;  1SVO A;  4JED A;  2GST A;  4ML1 A;  4MH2 A;  3D0Z A;  2LRT A;  2LRN A;  1SJ6 A;  3D6I A;  2FNO A;  2IFQ A;  5ECQ B;  3ERF A;  5JWQ B;  3L4N A;  2V41 A;  5GZZ B;  1AXD A;  2DLX A;  3TRP A;  2LQO A;  1O8X A;  2ES7 A;  4E68 A;  3GUR A;  3EWL A;  1K3Y A;  2PVQ A;  2YN1 A;  3ZVJ A;  2PMT A;  4ULX A;  4GQF A;  2MYG A;  3BD2 A;  4HQS A;  1NSW A;  5CRE A;  2YNX A;  5CO3 A;  1WP0 A;  3QAW A;  2HRK A;  2CAQ A;  1E2Y A;  2IIY A;  4MJE A;  4MJA A;  4RQR A;  4GTU A;  3UVH A;  3FYG A;  3NOF A;  2B1K A;  2C0E A;  3QMX A;  4G2E A;  1TOF A;  4QL7 A;  3WGD A;  5KN3 A;  3FHK A;  4GRF A;  3EIN A;  4ZB8 A;  2WGR A;  2XPE A;  2MMN A;  4N11 A;  5E4W A;  3L78 A;  5DQS A;  1EOH A;  3FZ4 A;  1PKZ A;  2VL9 A;  2H71 A;  3WT1 A;  1UC7 A;  1GSQ A;  1ERV A;  2FGX A;  4G19 A;  2DBC A;  4IP1 A;  1WPI A;  1BG5 A;  1TU7 A;  3HMJ G;  3IV4 A;  3PPU A;  2JSY A;  2VAF A;  2FA8 A;  4OWY A;  1K0N A;  3TU3 B;  1VGL A;  5DBQ A;  3WT2 A;  4BVY B;  4AKH A;  3D4M A;  3BBY A;  1ILO A;  12GS A;  3LXZ A;  5ECH B;  4ZXG A;  2YWO A;  4MH3 A;  3U5R E;  5A5H A;  2QKE A;  5ID2 B;  2LKU A;  1K0B A;  4AKG A;  1PKW A;  3UAP A;  4ZL9 A;  3EC3 A;  1W89 A;  3MIX A;  3EMP A;  4MK3 A;  3J7Y k;  2AAW A;  1XZO A;  2UV8 G;  3Q19 A;  5KEJ A;  4L8E A;  5HQP A;  2IWT A;  1FHE A;  3M3M A;  4LMW A;  1RW1 A;  2PVO C;  2GZY A;  4DSS B;  2YV7 A;  3IRA A;  5FT3 A;  3I6A A;  4KW6 A;  3C71 A;  5H5S A;  1OE8 A;  3TJF A;  1OC9 A;  2H19 A;  5EL8 A;  2GSS A;  3F4T A;  2X8H A;  4F0C A;  5GSS A;  5EPF A;  2AV4 A;  1KEB A;  5ABR A;  2CV4 A;  2VLV A;  3OR5 A;  2LS5 A;  2R2J A;  4MA9 A;  2CVD A;  4J57 E;  1PX6 A;  3GKK A;  4HJ2 A;  3ED3 A;  4PQH A;  1O81 A;  1DE2 A;  2VOC A;  4GQC A;  1GNW A;  3CTG A;  2XBQ A;  2EFC A;  1B8X A;  5AIX A;  5D73 A;  3ZIV A;  1V2A A;  1XFL A;  1M2B A;  1XWA A;  1JLW A;  2TIR A;  3RPP A;  3ERW A;  18GS A;  4XRA A;  3IC8 A;  4HI7 A;  3VI5 A;  5GST A;  1GSD A;  2DJ3 A;  8GSS A;  2CX4 A;  5BMU B;  2OKA A;  3TKQ A;  3H8Q A;  3HDC A;  4ZIJ A;  2AUV A;  2C3N A;  2GQM A;  4KUN A;  3KJY A;  1N25 A;  1GH2 A;  3TJJ A;  4Z2U A;  2A2P A;  4X4J A;  4ECB A;  2C1Y A;  2KLX A;  4V1A p;  3LJR A;  2EFD A;  3P7X A;  2DMM A;  5J47 A;  1ZYN A;  3MAK A;  1TRS A;  4PUA A;  5IMV A;  1YKA A;  3KZQ A;  3ZTL A;  2CVK A;  4RI6 A;  1F6M C;  2OAD A;  4KE3 A;  3GHA A;  3ZIT A;  2RM6 A;  3KXO A;  1THO A;  3FK8 A;  2HNL A;  2LNS A;  3H93 A;  5HFI A;  2OT3 A;  1PA3 A;  2GLR A;  5FHI A;  2R37 A;  1K3L A;  4KGI A;  3DXB A;  2QC7 A;  4FQU A;  4KSM A;  4IJ3 A;  2AB6 A;  3HZ8 A;  1MD4 A;  2B3S A;  4X1U A;  3UEM A;  2LTK A;  2Z9S A;  3M9K A;  3ZML A;  2VO4 A;  4V2M A;  5ENU A;  2WZ9 A;  5F0G A;  2X49 A;  3KTB A;  4PNF A;  2F3M A;  4TKY A;  2GSQ A;  3CBU A;  1A8Y A;  4BA7 A;  3UVT A;  1JLV A;  4AI6 A;  1OC3 A;  1JFU A;  5F06 A;  4MF6 A;  3U6V A;  1FB0 A;  5LD0 A;  2HSH A;  2WCI A;  4XCS A;  3PH9 A;  1FVK A;  2P0G A;  2R0G A;  2OE0 A;  4OFT A;  2E2G A;  4G0L A;  4G0K A;  2RII A;  3GMF A;  1GSF A;  1YVL A;  1GLP A;  5IO2 A;  5D93 A;  2L5O A;  2CT6 A;  3IDV A;  1FOH A;  5GAP D;  1PGT A;  2HSM A;  1U88 A;  1BQ7 A;  2DKH A;  1SVL A;  1K0O A;  2REM A;  5CRG A;  2BJX A;  3HHV A;  4ECI A;  5ECI B;  2H30 A;  5F05 A;  4HUA A;  1GRX A;  2R4V A;  2QA1 A;  2JU5 A;  1TU8 A;  3HVV A;  3ZYW A;  1TDI A;  1O7U A;  3O3T A;  2KHP A;  1EZK A;  4WF5 A;  1M2D A;  2IMI A;  2RUF A;  4AKX B;  4TVE A;  5DDL A;  2C4J A;  2F9S A;  22GS A;  2B7K A;  3S9F A;  3KH7 A;  4TXO B;  3CRT A;  1TI1 A;  5CYY A;  1YEX A;  2WB9 A;  3CSH A;  1JZO A;  1H75 A;  4I2U A;  4EC0 A;  10GS A;  4QL9 A;  5ECS A;  4TR1 A;  3HZ4 A;  1TXU A;  2JAD A;  4F9Z A;  4IQ1 A;  2IMD A;  3EU3 A;  2PUK C;  1FVJ A;  3EMX A;  2JZR A;  1GP1 A;  3F0I A;  4ISD A;  4TXV A;  1EEM A;  3HJM A;  4WR5 A;  5IIZ A;  1YEP A;  3UL3 A;  3KMO A;  1QFN A;  5IMZ A;  3ZL5 A;  5AN1 A;  1TTZ A;  3UIW A;  3Q74 A;  3DEX A;  3F6F A;  3UBK A;  2DIZ A;  2N5F A;  2K8S A;  4MDC A;  2A4H A;  2YJ7 A;  4IP6 A;  2CA8 A;  2C80 A;  5FWG A;  3TGZ A;  4ZB7 A;  3GFK A;  4K8M A;  13GS A;  6GST A;  1DE1 A;  4NXI A;  3F8U A;  4Z7X A;  4AKI A;  1PX7 A;  1MTC A;  3ZVJ D;  2ON5 A;  3LWA A;  5J9B A;  2OBK A;  1X9M B;  1SKR B;  5G5E A;  2HSN A;  3WD6 A;  2X99 A;  3L9U A;  4KCA A;  4O32 A;  2VCZ A;  4Z2R A;  1S3D A;  5HR3 A;  3I9V 2;  4Q5R A;  2HRA A;  2B7J A;  4WXT A;  4LL1 B;  5J3R A;  4ILF A;  1M99 A;  5EY6 A;  1Z3E A;  2YWI A;  4NMU A;  4CY6 A;  2K6V A;  1ON4 A;  4DSQ A;  3IE3 A;  1XOB A;  1ZZY A;  4PQ1 A;  4KF9 A;  2C0F A;  3APQ A;  5KOX A;  1YZX A;  1IYI A;  3APO A;  4IKH A;  2FD3 A;  3VWU A;  1S3C A;  5H5Q A;  5ECO B;  2FWE A;  3US3 A;  4RI7 A;  2R0P A;  2RUE A;  3IHG A;  14GS A;  1YJ6 A;  2E7P A;  3F3Q A;  4QQ7 A;  3WYW A;  1EGR A;  4MJC A;  3CSJ A;  4RUV A;  2CX3 A;  1NHY A;  1H4O A;  3CTF A;  3LFL A;  2N5A A;  3ZRE A;  3IC4 A;  4W66 A;  4GST A;  1SD9 A;  2VL2 C;  4L5O A;  1TRW A;  4E8H A;  1XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...