2VCXA

Complex structure of prostaglandin d2 synthase at 2.1a.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-REQUIRING PROSTAGLANDIN D SYNTHASE
publication title Novel Prostaglandin D Synthase Inhibitors Generated by Fragment-Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2vcxA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vcxA01
4EKZA 3G7IA 5A5KA 4XIHA 4ZB9A 5H5QA 5G5EA 1BJXA 3EVIA 3W8SA 1OE7A 6GSWA 3APSA 6GSUA 2VCTA 2YWMA 3GH9A 4KE3A 2OJLA 3HD5A 5IOWA 3F6DA 5DALB 1YZXA 1V98A 2ZCTA 2XHFA 3W8JA 3JCML 3CTGA 4FIWA 1J08A 3VI7A 4EUYA 1TK5B 3D21A 5HFKA 1Q4JA 3ZVJA 3VK9A 1FHEA 3RBTA 3N9JA 2H0IA 4IP1A 2VO4A 1Z7PA 1SL2B 3DWVA 2L5LA 1GSSA 2B5XA 3EU4A 4KH7A 2FD3A 4XTSA 5GAPD 1H75A 3VWXA 3C1RA 3J7Yk 3CRTA 3FKFA 1GSQA 5DDLA 5IIZA 1MDJA 2OKAA 1GLQA 2BTOT 3KJYA 2BJXA 2FA8A 2AJQB 2NTOA 4IW9A 4YQMA 1M2BA 4JR6A 2IFQA 6GSVA 1IYHA 3O3TA 2VD0A 5IPGA 3UBKA 2H75A 4POMA 4LA1A 1BX9A 2JU5A 5CREA 5J41A 2GZYA 4KB3A 1SENA 2O87A 1ZMAA 3WGDA 4PX1A 2I9HA 3ZLPA 1A24A 2VIMA 4HUAA 2VLVA 4WBJA 1EEMA 2O8VB 5CO3A 2VLTA 2AUVA 4ZBBA 2PWJA 2JZRA 5J3RA 4OO5A 4HQZA 4G19A 3TGZA 1QFNA 1EOGA 5JWQB 1ZYEA 1OKTA 3ZITA 3ERWA 4G0KA 3BBYA 4E8HA 1T1VA 2FY6A 1EP8A 2IN3A 4TR1A 1M2DA 1F2EA 3UVTA 1XZOA 1GWCA 1O6JA 2YPMA 1XWAA 2ES7A 3TDGA 1BEDA 4J2FA 5L71A 3R3EA 1K3YA 2GZZA 3W6GA 4MA9A 2YANA 2L4QA 2VAFA 4QQ7A 1S3DA 3Q6OA 1VRSD 3WGXA 1FVJA 5IOXA 2CV4A 3EMXA 4G10A 1OAZA 2H30A 2KOKA 4MJBA 4BVXB 2H0HA 2WGRA 4TXOB 3F6FA 2HLSA 1T3BA 2CZ3A 2O7KA 3HVXA 1FVKA 1RK4A 4MJCA 4G0LA 1FB0A 2R2JA 2GDRA 1Z5YE 3M3MA 5HR3A 3TJGA 1JZWA 2OBIA 4V1Ag 3GX0A 3IDVA 1SK1A 3FZ5A 5JWRB 2JL4A 3HVVA 4N0VA 1TU7A 1R5AA 3RAZA 2CQ9A 3P7XA 4HOJA 1O81A 5B7CA 4RQXA 2IPAA 1ZGNA 3EINA 3QR6A 1GSFA 3IK9A 1A2LA 1KTEA 1SJ6A 2J23A 4IGJA 2LV3A 4JU5A 4YAPA 1GUHA 3GFKA 3GH6A 3ERFA 1UN2A 4MABA 3ME7A 3IRAA 1NHYA 3CMIA 2A4VA 2IMEA 3LXTA 4FYBA 2LRNA 2YZUA 1TTZA 4D73A 5J4UA 1WPIA 4IVFA 1A0RP 2QGVA 1AAZA 1TRVA 3GMFA 3C7MA 1ST9A 3LEFA 3E9JB 1KEBA 1T00A 4KW6A 4V2MA 2H1GA 1YKCA 3FZ9A 4QL7A 3LG6A 1HYUA 1G6YA 5E59A 2P31A 1O8WA 4TN8A 4L5OA 5EPFA 5D8IA 2AHEA 3F63A 5A4WA 1WE0A 1VF2A 1NSWA 2WJUA 4OO4A 1U3IA 4DSSA 3RPPA 2DJ2A 4WETA 1PL1A 2O85A 4MZWA 4MDCA 4AF2A 2MYGA 3UIWA 2B7KA 4N30A 1N8JA 5GSTA 1PX7A 3HJPA 3EC3A 5DBQA 1K0DA 4MH3A 4OFMA 2MZCA 1RW1A 2WFCA 2X8GA 1EV4A 5J5NA 2H0GA 5ID2A 4GSTA 2AB6A 5ECRB 1MDIA 3FZAA 2ON7A 1PD21 4X0XA 7GSSA 3L4NA 2VL2C 2I4AA 3HXSA 3IC4A 5GZZB 4CW9A 5GAND 3PGTA 2H66A 5FHIA 2HRAA 4ID0A 4EVMA 1ON4A 2X64A 1MD3A 3MAKA 3KP8A 1W89A 4WR5A 3LWAA 3P8WA 4PUFC 3DXBA 2GT6A 2QC7A 2C0FA 4ZBAA 3LQ7A 5DALA 2PVOC 1ML6A 1PGTA 1M2AA 3DYRA 5KN1A 4GSSA 3GL5A 4RUVA 1GULA 2FWEA 1TKDB 5ECIB 3UJ1A 1B4PA 2VCVA 1J9BA 2PVQA 5IMFA 2X99A 3TKSA 2NVLA 1XW9A 4NHZA 1G6WA 1KNGA 2GS3A 2K6VA 3M8NA 3HCZA 2GTUA 2M80A 3ERGA 3IR4A 2HSMB 1QXHA 3UL3A 5DJMA 3TKQA 1CQGA 1YQ1A 1O8XA 2YNXA 2H1BA 1XW5A 2DLXA 1EGRA 3FR6A 1XBSA 1O7UA 1XWCA 3FZ4A 5ECLB 1KBNA 2VUPA 4JR4A 1SYRA 4ZXGA 4BVYA 1YKAA 2MMZA 3WD6A 3IA1A 3IPZA 3LJRA 2IJYA 3WT2A 1QMVA 1GTUA 1NW2A 3RHBA 2R3XA 5FWGA 1TK8B 1OYJA 8GSSA 1B9XC 3ZMKA 11GSA 3GRXA 4IQ1A 2H74A 3D6IA 1A23A 2ON5A 4WF4A 3VFIA 4ML6A 3L9UA 3I9V2 4O5RA 4ZL8A 3VLNA 4O32A 2YWNA 1F6MC 2CVKA 2VM2A 1BYEA 4MF5A 3TKSC 4RI6A 3OR5A 1AXDA 1OC8A 2DC5A 3UVHA 1UC7A 1U6TA 3TCOA 4CHSA 4KUNA 1X9MB 2YN1A 2EIRA 1R7HA 1ERTA 2A2RA 4TVEA 3QAWA 1G7OA 1PRXA 1GP1A 2WS2A 5C04A 4N11A 2OACA 4V2NA 1Q98A 5G1LA 3IBHA 3I6AA 1EWXA 3RPNA 4Q5FA 19GSA 1ZYQB 1TJDA 3KXOA 1K0BA 1WRYA 5G5FA 2HRNA 3LYPA 5J9BA 3EU3A 4ECJA 3F4SA 4PUAA 2GSSA 5C00A 3GURA 2B1KA 2IWTA 1SJIA 3L9VA 2B7JA 4PTSA 3SBCA 4GXZA 1ERVA 3K8NA 2V6OA 3VPTA 1ZL9A 2JADA 1WIKA 4FQUA 1Z3EA 5CAXA 4HQSA 3IAM2 2HE3A 4WR4A 4TR3A 3I69A 2G0FA 4N10A 5HR0A 4KDYA 1XFLA 4LL1B 12GSA 1Z9HA 3EURA 3MDKA 6GSYA 4OD7A 3DKSA 1XXUA 1ZZYA 4POLA 1B8XA 4PNFA 4KCEA 1WJKA 4G9HA 2HRKB 3KH9A 4K9ZA 4Z7XA 4KX4A 1B48A 2LNSA 4GSNA 5JCUA 4JEDA 1JZDA 5LD0A 1PL2A 3KM6A 3ZL5A 1GH2A 4IQAA 2I1UA 2WB9A 1DSBA 2H1AA 4K7NA 4L0UA 1GNEA 3ZIJA 5CRWA 4WXTA 3QDNA 2TRXA 3IXRA 1UVZA 4FO5A 1QUWA 1F3AA 4HZ4A 3GTUA 3HY2A 3ZIVA 4KCAA 5DAKB 4WF5A 2WZ9A 4PQHA 2M46A 2GQLA 3IK7A 3BCKA 1A2MA 5DQYA 4CDOA 2UZ8A 1I9DA 2B5EA 3GSSA 4G2EA 4E8EA 3GKXA 3LORA 2CA8A 1XOAA 5CRDA 3PPUA 2C3QA 2FHEA 1ILOA 2IMIA 1HD2A 5CP1A 4MZBA 1V40A 3KH7A 4TXVA 3GN3A 4TRXA 4ZL7A 6GSTA 4EC0A 4YAVA 4I6XA 3O6TA 4OFTA 3ZFBA 2FLSA 1YF1A 1TDIA 4IELA 4IJ3A 1F9MA 1PSQA 1W4VA 1TU8A 2AV4A 3FHKA 4L8EA 3TKSE 3ZTLA 1JFUA 2OA7A 1NM3A 5HFGA 4Q5QA 5LCZA 1Z7RA 1HNCA 3VWWA 18GSA 4KF9A 2LJAA 4K7IA 3UARA 4PQ1A 4K0GA 5DCGA 2C0DA 4IHUA 2H1DA 2V41A 1DE1A 4X43A 5CRHA 1V2AA 4MJEA 3AY8A 3BD2A 1OC3A 1XWGA 1Z6NA 2HSYA 5ECSA 1NHOA 1M9BA 1XPVA 2E7PA 5G1KA 4YH2A 2F8AA 3GYKA 4O7HA 2R37A 4PQIA 1T4YA 3KMOA 2LS5A 1ABAA 5ECHB 2VLUA 3QD9A 1X5DA 1JHBA 3NOFA 3HYPA 4IP6A 2FUG2 3KGKA 2HSMA 3Q19A 1U87A 3FW2A 3MWHA 3CSIA 2FWHA 2B1LA 2VL9A 1PN9A 2J9HA 3L0HA 2VCXA 1S3AA 5ECKB 5JCGA 1GUMA 5D9TA 3DIEA 3BJ5A 4IN0A 3GA4A 1GSYA 1EEJA 4POBA 1YJ6A 2GSRA 3GV1A 4MH2A 2TRCP 1AC1A 3L78A 1GTIA 3GL3A 4ZL9A 1SD9A 1TI1A 2DJ1A 3DGQA 5B6NA 2C3NA 2OE3A 3TJJA 4EDZA 2GZPA 3GKKA 1FOVA 5IO2A 4ACSA 2D2ZA 4BL7B 1XWKA 4I97A 3CYNA 3A2XA 2L6CA 3M9JA 4LMWA 3D4MA 3QFAC 1PKWA 4F0CA 1YF0A 3APQA 1GTBA 1SL1B 4MLYA 4FYUA 3HDCA 2KP1A 3G7YA 4PXOA 2HSHA 2LRTA 4OCEA 1LBKA 2VD1A 1A0FA 4TR0A 2WULA 5IMAA 3CTFA 2K18A 2XPEA 4NV2A 4DSQA 4GQCA 5ENUA 2DIZA 1A8LA 3EYTA 2HZEB 2XBQA 2YJHA 2B3SA 3TRQA 1QK8A 5IMVA 1SK0A 2G2QA 2IMFA 1PKZA 1BQ7A 1A2JA 3VURA 4JZQA 1DUGA 3CBUA 2FWFA 5G2ZA 4YQUA 5B6MA 4RQRA 3VWVA 3US3A 4P3YB 2VL3A 5IPHA 3F4RA 1VF4A 4Q5NA 9GSSA 5JCWA 3H1NA 6GSXA 1K0CA 2TIRA 5ECQB 2GQMA 1K3OA 2F9SA 3G7JA 5E4WA 2WRTA 1YEPA 4I2TA 5AGYA 1URMA 1ZCPA 5ECNB 2OE1A 3TUEA 3KEBA 2YV7A 1R26A 3WYWA 2KUCA 5FT3A 3G9BA 5DJLA 2CX3A 2GQKA 3FYGA 4RI7A 2BMXA 3KTLA 2L5OA 3F0IA 3D4TA 3CXGA 2VOCA 2ZNMA 2VCZA 3ZVJD 2N5AA 2M72A 3J7Yb 2LRCA 5G31A 2P0GA 1ERUA 3VWUA 3QCPA 22GSA 2JSYA 1USBA 1MEKA 3M0FA 4K7OA 1JZOA 2YWIA 5DVBA 4AJ6A 4GCIA 4HU7A 3E3EA 2GVPA 1AW9A 2HRKA 5ELGA 4K0NA 4LMVA 1YDKA 1LJRA 2C1YA 2B5YA 1EP7A 3GIXA 1CQHA 4LL4B 3IOSA 5IMCA 2PBJA 2KHPA 4ZIJA 3ZMLA 16GSA 4F2IA 4BPYA 3TJBA 3EE2A 2RUFA 4D73B 3DMLA 5EY6A 1O73A 2OE0A 2GGTA 1Z6MA 1LU4A 2K8SA 5D96A 3IV4A 1MD4A 1S3CA 4TR4A 1SKWB 3C8EA 2DJ3A 2R4VA 2C0EA 3MNGA 2HZFA 4NXIA 2LJRA 1OC9B 2PN8A 2QKEA 1R4WA 4MPFA 4KDUA 4IBPA 2DJJA 3RDWA 3VI5A 1TRWA 1C72A 4DSSB 1PX6A 2P5RA 3V1WA 2MBSA 3FRCA 3QOUA 4NWYA 2CVBA 3O76A 1HQOA 2IMKA 1OE8A 3DVWA 3IHQA 2X8CA 4USSA 5D73A 5CYYA 4NV5A 1ZOFA 1BG5A 1H4OA 3GUSA 4OWYA 3D22A 4KA0A 1XWBA 4ZBDA 2MBTA 5EVOA 3U5RE 3PINA 4GLTA 4ML1A 5HFIA 3ZREA 3GNJA 4V1Ap 2H72A 1FAAA 3F3QA 2HNLA 1XCCA 2E0QA 2WDUA 3KIJA 5H5RA 3BCIA 5CRGA 1M0UA 1J0FA 2LSTA 2C3TA 4F03A 4WEYA 1TOFA 4KSOA 4BVXA 2HRFA 4TXOA 4IKHA 2NBSA 2P5QA 3HA9A 1ACVA 1QGVA 3IE3A 2L59A 1K3LA 4PURA 3WT1A 1GLPA 5G30A 1DE2A 2QSIA 4ULXA 1M7TA 1O85A 1MTCA 2DIYA 2KLXA 3HJMA 5AIVA 2NPBA 2PUKC 3ME8A 4DSRA 1THXA 2VCWA 1AUCA 5BMUA 4F82A 1PQNA 1V9WA 4KAEA 2ALBA 3ED3A 4ILFA 3P90A 5ECMB 3CRUA 3A5WA 2N5BA 4I5QA 4XRDA 2YOIA 4ZB6A 5IMZA 5AN1A 1WOUA 4XHMA 2DJ0A 3UBLA 2JZSA 2FGXA 1TK0B 5H5SA 5ABRA 3H79A 2KP2A 2AAWA 2LNTA 3KP9A 2R6KA 2YWOA 2FCHA 3FR3A 1B9YC 2E2GA 4LLRA 1PA3A 2H76A 2PMTA 4KSMA 14GSA 2IL3A 4EE0A 1SYXA 5CNWA 1QQ2A 3PH9A 3MSZA 3KCMA 4EXJA 4ECIA 2E2MA 1GNWA 2GT5A 4BVYB 4TOPA 2H71A 3H93A 3KMNA 2YCDA 3F3RA 3UOMA 2H8LA 1R5PA 3ZFLA 3QPMA 3Q18A 5ECOB 1BAYA 2C4JA 5F06A 2RM5A 4HEA2 4BL7A 5IM9A 1SU9A 1AQVA 3TOTA 4NPBA 4L0WA 3S9FA 4FYCA 1F3BA 4F9ZA 4MP4A 2H70A 2CVDA 2RLIA 2L57A 5B8BA 4HJ2A 4MCUA 2YZHA 2AYTA 3TJKA 4ECBA 3TRPA 5F8BA 5KEJA 2LEGA 5COHA 4IS0A 4F0BA 1SL0B 3ZYWA 1VF3A 2RIIA 1T7PB 4PNGA 4X1UA 2H19A 4ECCA 1EGOA 2CT6A 4XS4B 2HZEA 2LUSA 3WGEA 2EIQA 3TJFA 4EF0A 3FEUA 2HFDA 4KGIA 4IJIA 3DD3A 2EC4A 4MF6A 2OBKA 2C80A 2LJKA 1U3AA 3HVSA 2MMNA 2I81A 4OCFA 4ISDA 4HDEA 2FA4A 1GSUA 13GSA 2XC2A 1UA5A 1SD8A 1EV9A 2DJKA 4GWRA 1X9WB 3D0ZA 2JSZA 1GRXA 1SK2A 2CX4A 1PMTA 5D9WA 1X5CA 1TRUA 3CSHA 3GX8A 4TKYA 1RQMA 3GKMA 3TKRA 6GSSA 3UMAA 3C73A 3A2WA 5HQPA 4MMMA 5D9VA 4MK3A 2GSTA 5KN0A 4EL1A 2DBCA 2A2SA 2H6YA 2IMDA 3KZQA 5HR2A 1IYIA 2CAQA 2WCIA 2I3YA 3R2QA 5J9CA 3CSJA 4WBRD 5KN3A 2PPTA 5AISA 4PGTA 1XIYA 2XBIA 4I2UA 2XPDA 4JE1A 5D93A 1YY7A 5LNKe 1AQXA 1JZRA 4GRFA 4Q5RA 4HS1A 3FR9A 4BA7A 4G0IA 4KNDA 2FNOA 1MDKA 1THOA 3KTBA 1SJZA 2IFQB 1K0MA 2F51A 1M9AA 1X0RA 1AIUA 2HXKA 2X8HA 4N0ZA 3M1GA 5IO0A 3TOUA 2Z9SA 2YJ7A 2VL2A 3APOA 4HZ2A 5A4VA 3ZRDA 3FY7A 4KDXA 4TW5A 4K8MA 3LXZA 1VF1A 1G0TA 2IIYA 5F0GA 5GSSA 3FK8A 4K2DA 3GTUB 3HHVA 5F05A 2DMLA 1OC9A 2LQOA 1I5GA 2HYXA 3D5JA 3QAVA 4DEJA 3ZZXA 3KD0A 4TR1B 3LYKA 1TXXA 1FW1A 2YV9A 3Q74A 3HZ4A 1K0NA 1X9SB 4I8BA 1GSEA 4MPGA 3H8QA 3E0UA 2H01A 3GSTA 4OFNA 5AIXA 3DVXA 2LQQA 5INYA 2O89A 1GTAA 5DCHA 10GSA 4HI7A 1GSDA 4J56E 5HR1A 4GTUA 3DRNA 4XCSA 2L6DA 1OVNA 3GKNA 1FB6A 1GUKA 4HU9A 2JACA 4AGSA 5KN2A 4O92A 2DMMA 4K1FA 2DSAA 1G7EA 1X5EA 4EDYA 1TI3A 2CAIA 2H6XA 2JZTA 4YQVA 3LGCA 2CZ2A 3TB2A 2L4CA 4J57E 2PGTA 4ZILA 4NHWA 1B4QA 5ELAA 2EIOA 2C8UA 2V6KA 1K0AA 3QFBC 4BWSA 1V57A 2VM1A 2PERA 3P2AA 3LFLA 4L5LA 4MZCA 2F8FA 1T8EB 3SWLA 3C1SA 5ECPB 5A4UA 3M9KA 1Y6EA 4OMVA 4ZB8A 3BOAA 1T4ZA 3IC8A 4GF0A 3GHAA 3QAGA 3QMXA 1TW9A 1FO5A 1YEXA 1V58A 2YP6A 2MMAA 4V2LA 1E2YA 17GSA 2GLRA 4GQFA 2H73A 4AJ7A 1HNAA 2C0GA 20GSA 3HKRA 2RUEA 2N5FA 3HZ8A 4WKWA 3ISOA 2K8VA 1XVWA 3H4KA 3NIVA 2RM6A 3HJOA 1K0OA 1JLWA 2GSQA 3A3TA 2F3MA 1OKDA 1GL8A 3TKPA 3VPQA 2V32A 1A8YA 2OADA 4H86A 4AJ8A 2H6ZA 5DQSA 1XVQA 1Y25A 3PR8A 1EOHA 2R5GA 1XW6A 1DBYA 1JLVA 5DAKA 1WMJA 2K9FA 1HNBA 3F9UA 1SKSB 1E6BA 3UAPA 4K6XA 2NDOA 1XOBA 3RHCA 5D9XA 5EL8A 3IAS2 1WWJA 4MJAA 2REMA 1TP9A 2ZUPA 4FH8A 4XS1A 3DEXA 4XS6A 2PU9C 4JRRA 2FWGA 1AQWA 3I43A 4POKA 3LSZA 3TRXA 2LTKA 4NMUA 4QL9A 1FG4A 1N2AA 4EO3A 1WP0A 3F4TA 4JBBA 5JWOB 3L9SA 2MMOA 3U6VA 3C71A 5IQYA 1ERWA 5B8AA 1EZKA 4MF7A 1M99A 5IMDA 3F8UA 4NAXA 1VGLA 4XS4A 5ID2B 5F07A 2V2GA 3A2VA 3EWLA 2HQTA 3N5OA 2HSNB 2HI7A 3NZNA 2VCQA 1SKRB 3EMPA 2LKUA 4DVCA 4HJMA 1F37A 1U88A 3UEMA 4BWQA 1TRSA 4XRAA 2B6MA 2HT9A 2V1MA
chains in the Genus database with same CATH superfamily
4EKZA 3G7IA 5A5KA 4XIHA 4ZB9A 5H5QA 5G5EA 1BJXA 3EVIA 3W8SA 1OE7A 6GSWA 3APSA 6GSUA 2VCTA 2YWMA 3GH9A 4KE3A 2OJLA 3HD5A 5IOWA 3F6DA 4GDFA 5DALB 1YZXA 1V98A 2ZCTA 2XHFA 3W8JA 3JCML 3CTGA 2QA1A 4FIWA 1J08A 1S3RA 3VI7A 4EUYA 1TK5B 3D21A 5HFKA 1Q4JA 3ZVJA 3VK9A 1FHEA 3RBTA 3N9JA 2H0IA 4IP1A 2VO4A 1Z7PA 1SL2B 4ZB7A 3DWVA 2L5LA 1GSSA 3EU4A 2B5XA 4KH7A 2FD3A 4XTSA 5GAPD 1H75A 3VWXA 3C1RA 3J7Yk 3CRTA 3FKFA 1GSQA 5DDLA 5IIZA 1MDJA 2OKAA 1GLQA 2BTOT 3KJYA 2BJXA 2FA8A 2AJQB 2NTOA 4IW9A 4YQMA 1M2BA 4JR6A 2IFQA 6GSVA 2EFCA 1IYHA 3O3TA 2VD0A 5IPGA 3UBKA 2H75A 4POMA 4LA1A 1BX9A 2JU5A 5CREA 5J41A 2GZYA 4KB3A 1SENA 2O87A 1ZMAA 3WGDA 4PX1A 2I9HA 3ZLPA 1A24A 2VIMA 4HUAA 2VLVA 4WBJA 1EEMA 2O8VB 2DKIA 5CO3A 2VLTA 2AUVA 4ZBBA 1ZYPA 2PWJA 2JZRA 5J3RA 4OO5A 4HQZA 4G19A 3TGZA 2X49A 1QFNA 1EOGA 5JWQB 1ZYEA 1OKTA 3ZITA 1I1IP 3ERWA 4G0KA 3BBYA 4E8HA 1T1VA 2FY6A 1EP8A 2IN3A 1PN0A 4TR1A 1M2DA 1F2EA 3UVTA 1XZOA 1GWCA 1O6JA 2YPMA 1XWAA 2ES7A 3TDGA 1BEDA 4J2FA 5L71A 3R3EA 1K3YA 2GZZA 4K5SA 5A34A 3W6GA 3RGBC 4MA9A 2YANA 2L4QA 2VAFA 4QQ7A 1S3DA 3Q6OA 1VRSD 3WGXA 1FVJA 5IOXA 2CV4A 3EMXA 4G10A 1OAZA 2H30A 2KOKA 4MJBA 4BVXB 2H0HA 2WGRA 4TXOB 3F6FA 2HLSA 2WW2A 1T3BA 2CZ3A 2O7KA 3HVXA 5A1NB 1FVKA 1RK4A 4MJCA 4G0LA 1FB0A 2R2JA 2GDRA 1Z5YE 3M3MA 5HR3A 3TJGA 1JZWA 2OBIA 4V1Ag 3GX0A 3IDVA 1SK1A 3FZ5A 5JWRB 2JL4A 3HVVA 4N0VA 1TU7A 1N25A 4ICYA 1R5AA 3RAZA 4PI0C 2CQ9A 3P7XA 4HOJA 1O81A 5B7CA 4RQXA 2IPAA 1ZGNA 3EINA 3QR6A 1GSFA 4HSCX 3IK9A 1A2LA 1KTEA 1SJ6A 2J23A 4IGJA 2LV3A 4JU5A 4YAPA 1GUHA 3GFKA 3GH6A 3ERFA 1UN2A 4MABA 3ME7A 3IRAA 2WW0A 1NHYA 5J4VA 3CMIA 2A4VA 2IMEA 3LXTA 4FYBA 2LRNA 2YZUA 1TTZA 4D73A 5J4UA 1WPIA 4IVFA 1A0RP 2QGVA 1AAZA 1TRVA 3GMFA 3C7MA 1ST9A 3LEFA 3E9JB 1KEBA 1T00A 4KW6A 4V2MA 2H1GA 1YKCA 3FZ9A 3LW9A 4QL7A 3LG6A 1HYUA 1G6YA 5E59A 2P31A 1O8WA 4TN8A 4L5OA 5EPFA 5D8IA 2AHEA 3F63A 5A4WA 1WE0A 1VF2A 1NSWA 2WJUA 4OO4A 1U3IA 3CHXC 4DSSA 3RPPA 2DJ2A 4WETA 1PL1A 2O85A 4MZWA 4MDCA 4AF2A 2MYGA 3UIWA 2B7KA 4N30A 1N8JA 5GSTA 4A5PA 1PX7A 3HJPA 3EC3A 5DBQA 2VKZG 1K0DA 4MH3A 4OFMA 2MZCA 1RW1A 2WFCA 2X8GA 1EV4A 5J5NA 2H0GA 5ID2A 4GSTA 2AB6A 5ECRB 1MDIA 2HSNA 3FZAA 2ON7A 1PD21 4X0XA 7GSSA 3L4NA 2VL2C 2I4AA 3HXSA 3IC4A 5GZZB 4CW9A 5GAND 3PGTA 2H66A 5FHIA 2HRAA 4ID0A 4EVMA 1ON4A 2X64A 1MD3A 3MAKA 3KP8A 1W89A 1YVLA 4WR5A 3LWAA 3P8WA 4PUFC 3DXBA 2GT6A 2QC7A 2C0FA 4ZBAA 3LQ7A 5DALA 2PVOC 2R0CA 1ML6A 1PGTA 1M2AA 3DYRA 5KN1A 4GSSA 3GL5A 4RUVA 4FXYP 1GULA 2FWEA 1TKDB 5ECIB 3UJ1A 1B4PA 2VCVA 1J9BA 1SVLA 2PVQA 5IMFA 2X99A 3TKSA 2NVLA 1XW9A 4NHZA 1G6WA 1KNGA 2GS3A 2K6VA 3M8NA 3HCZA 2GTUA 2M80A 3ERGA 4CY8A 3IR4A 2OT3A 4AKGA 2HSMB 1QXHA 3UL3A 5DJMA 3TKQA 1CQGA 1YQ1A 1O8XA 2YNXA 2H1BA 1XW5A 2DLXA 1EGRA 3FR6A 1XBSA 1O7UA 1XWCA 3FZ4A 5ECLB 1KBNA 2DKHA 2VUPA 4JR4A 1SYRA 4ZXGA 4BVYA 1YKAA 2MMZA 3WD6A 3IA1A 4Z2UA 3IPZA 3LJRA 2IJYA 3WT2A 1QMVA 1GTUA 1NW2A 3RHBA 4K5RA 2R3XA 5FWGA 1TK8B 1OYJA 8GSSA 1B9XC 2WVXB 3ZMKA 11GSA 3GRXA 4IQ1A 2H74A 3D6IA 1A23A 2ON5A 4WF4A 3VFIA 4ML6A 3L9UA 3I9V2 4O5RA 4ZL8A 3VLNA 4O32A 2YWNA 1F6MC 2CVKA 2VM2A 1BYEA 4MF5A 3TKSC 4K2XA 4RI6A 3MIXA 3OR5A 1AXDA 1OC8A 2DC5A 3UVHA 1UC7A 1U6TA 3TCOA 4CHSA 4KUNA 1X9MB 2YN1A 2EIRA 1R7HA 1ERTA 2A2RA 4TVEA 3QAWA 5KOXA 1G7OA 1PRXA 1GP1A 2WS2A 5C04A 4N11A 2OACA 4V2NA 1Q98A 5G1LA 3IBHA 3I6AA 1EWXA 3RPNA 4Q5FA 19GSA 1ZYQB 1TJDA 3KXOA 1K0BA 1WRYA 5G5FA 2HRNA 3LYPA 5J9BA 5J47A 3EU3A 4ECJA 3FMWA 3F4SA 4PUAA 2GSSA 5C00A 3GURA 2B1KA 2IWTA 1SJIA 3L9VA 2B7JA 4PTSA 4O5QA 3SBCA 4GXZA 2O36A 1ERVA 3K8NA 2V6OA 3VPTA 1ZL9A 2JADA 1WIKA 4FQUA 2R0GA 1Z3EA 2WZSA 5CAXA 4HQSA 3IAM2 4QMKA 2HE3A 4WR4A 4TR3A 3I69A 2G0FA 3TU3B 4N10A 5HR0A 4KDYA 1XFLA 4LL1B 12GSA 1Z9HA 3EURA 3MDKA 6GSYA 4OD7A 3DKSA 1Y1UA 1XXUA 1ZZYA 4POLA 1B8XA 4PNFA 4KCEA 1WJKA 4G9HA 2HRKB 3KH9A 4K9ZA 4Z7XA 4KX4A 1SVOA 1B48A 2LNSA 4GSNA 5JCUA 4JEDA 1JZDA 5LD0A 1PL2A 3KM6A 3ZL5A 1GH2A 4IQAA 2I1UA 2WB9A 1DSBA 2H1AA 4K7NA 4L0UA 1GNEA 3ZIJA 5CRWA 4WXTA 3QDNA 2TRXA 3IXRA 1UVZA 4FO5A 1QUWA 1F3AA 4HZ4A 3GTUA 3HY2A 3ZIVA 4KCAA 5DAKB 4WF5A 2WZ9A 4PQHA 2M46A 2GQLA 3IK7A 5KOWA 3BCKA 1A2MA 5DQYA 4CDOA 2UZ8A 1I9DA 2B5EA 3GSSA 4G2EA 4E8EA 3GKXA 3LORA 2CA8A 1XOAA 5CRDA 3PPUA 2R0PA 2C3QA 2FHEA 1ILOA 2IMIA 1HD2A 5CP1A 4MZBA 1V40A 3KH7A 4TXVA 3GN3A 4TRXA 5J4YA 4ZL7A 6GSTA 4EC0A 4YAVA 4I6XA 3O6TA 4OFTA 2H1LA 3ZFBA 2FLSA 1YF1A 1TDIA 4IELA 4IJ3A 1F9MA 1PSQA 1W4VA 1TU8A 2AV4A 3FHKA 4L8EA 3TKSE 3ZTLA 4N3ZA 2OA7A 1JFUA 1NM3A 5HFGA 4Q5QA 5LCZA 1Z7RA 1HNCA 3VWWA 18GSA 4KF9A 2LJAA 4K7IA 3UARA 4PQ1A 5BMUB 4K0GA 5DCGA 2C0DA 4IHUA 2H1DA 2V41A 1DE1A 4X43A 5CRHA 1V2AA 4MJEA 3AY8A 3BD2A 1OC3A 1XWGA 1Z6NA 2HSYA 1FOHA 5ECSA 1NHOA 1M9BA 1XPVA 2E7PA 5G1KA 4YH2A 2F8AA 3GYKA 4O7HA 2R37A 4PQIA 1T4YA 3KMOA 2LS5A 1ABAA 5ECHB 2VLUA 3QD9A 1X5DA 1JHBA 3NOFA 3HYPA 4IP6A 2FUG2 3KGKA 2HSMA 3Q19A 1U87A 3FW2A 3MWHA 3CSIA 2FWHA 2B1LA 2VL9A 1PN9A 2J9HA 3L0HA 2VCXA 1S3AA 5ECKB 5JCGA 1GUMA 5D9TA 3DIEA 3BJ5A 4IN0A 3GA4A 1GSYA 1EEJA 4POBA 1YJ6A 2GSRA 3GV1A 4MH2A 2TRCP 1AC1A 3L78A 1GTIA 5J40A 3GL3A 4ZL9A 1SD9A 1TI1A 2DJ1A 3DGQA 5B6NA 2C3NA 2OE3A 3TJJA 4EDZA 2GZPA 3GKKA 1FOVA 5IO2A 2WVXA 4ACSA 2D2ZA 4BL7B 2O3EA 1XWKA 4I97A 3CYNA 3A2XA 2L6CA 3M9JA 4LMWA 3D4MA 3QFAC 1PKWA 4F0CA 2EFDA 1YF0A 3APQA 1GTBA 1SL1B 2QA2A 4MLYA 4FYUA 3HDCA 2KP1A 3G7YA 4PXOA 2HSHA 2LRTA 4OCEA 1LBKA 2VD1A 1A0FA 4TR0A 2WULA 5IMAA 1XG8A 3CTFA 2K18A 2XPEA 4NV2A 4DSQA 4GQCA 5ENUA 2DIZA 1A8LA 3EYTA 2HZEB 2XBQA 2YJHA 2B3SA 3TRQA 1QK8A 5IMVA 1SK0A 2G2QA 2IMFA 1PKZA 3HVNA 1BQ7A 1A2JA 3VURA 4JZQA 1DUGA 3CBUA 2A4HA 2FWFA 5G2ZA 4YQUA 5B6MA 1SVMA 4RQRA 3VWVA 3US3A 4P3YB 2VL3A 5IPHA 3F4RA 1VF4A 4Q5NA 9GSSA 5JCWA 3H1NA 6GSXA 1K0CA 2TIRA 5ECQB 2GQMA 1K3OA 2F9SA 3G7JA 5E4WA 2WRTA 1YEPA 4I2TA 5AGYA 1URMA 1ZCPA 5ECNB 2OE1A 3TUEA 3KEBA 2YV7A 1R26A 3WYWA 2KUCA 5FT3A 3G9BA 5DJLA 2CX3A 2GQKA 3FYGA 4RI7A 2BMXA 3KTLA 2L5OA 3F0IA 3D4TA 3CXGA 2VOCA 2ZNMA 2VCZA 3ZVJD 2N5AA 2M72A 3J7Yb 2LRCA 1TXUA 5G31A 2P0GA 1ERUA 3VWUA 3QCPA 22GSA 2JSYA 1USBA 1MEKA 3M0FA 4K7OA 1JZOA 2YWIA 3RFRC 5DVBA 4AJ6A 4GCIA 4HU7A 3E3EA 2GVPA 1AW9A 2HRKA 5ELGA 4K0NA 4LMVA 1YDKA 1LJRA 2C1YA 2B5YA 1EP7A 3GIXA 1CQHA 4LL4B 3IOSA 5IMCA 2PBJA 2KHPA 4ZIJA 3ZMLA 16GSA 4X4JA 4F2IA 4BPYA 3TJBA 3EE2A 2RUFA 4D73B 3DMLA 5EY6A 4YKFA 1O73A 2OE0A 3IHGA 2GGTA 1Z6MA 1LU4A 2K8SA 5D96A 3IV4A 2EFHA 1YEWC 1MD4A 1S3CA 4TR4A 1SKWB 3C8EA 2DJ3A 2R4VA 2C0EA 3MNGA 2HZFA 4NXIA 2LJRA 1OC9B 2PN8A 2QKEA 1R4WA 4MPFA 4KDUA 4IBPA 2DJJA 3RDWA 3VI5A 1TRWA 1C72A 4DSSB 1PX6A 2P5RA 3V1WA 2MBSA 3FRCA 3QOUA 4NWYA 2CVBA 3O76A 1HQOA 2IMKA 1OE8A 3DVWA 3IHQA 2X8CA 4USSA 5D73A 5CYYA 4NV5A 1ZOFA 1BG5A 1H4OA 3GUSA 4OWYA 3D22A 4KA0A 1XWBA 4ZBDA 2MBTA 5EVOA 2O5VA 3U5RE 3PINA 4GLTA 4ML1A 5HFIA 3ZREA 3GNJA 4V1Ap 2H72A 1FAAA 3F3QA 2HNLA 1XCCA 2WVZA 2E0QA 2WDUA 3KIJA 5H5RA 3BCIA 5CRGA 1M0UA 1J0FA 2LSTA 2C3TA 4F03A 3MYDA 4WEYA 1TOFA 4KSOA 4BVXA 2HRFA 4TXOA 4IKHA 2NBSA 2P5QA 3HA9A 1ACVA 1QGVA 3IE3A 2L59A 1K3LA 4PURA 3WT1A 5A1NA 1GLPA 5G30A 1DE2A 2QSIA 4ULXA 1M7TA 1O85A 1MTCA 3CWGA 2DIYA 2KLXA 3HJMA 5AIVA 2NPBA 2PUKC 3ME8A 4DSRA 1THXA 2VCWA 1AUCA 5BMUA 4F82A 1PQNA 1V9WA 4KAEA 2ALBA 3ED3A 4ILFA 3P90A 5ECMB 3CRUA 3A5WA 2N5BA 4I5QA 4XRDA 2YOIA 4ZB6A 5IMZA 5AN1A 4MNNA 5A5HB 2A2PA 1WOUA 4XHMA 2DJ0A 3UBLA 2JZSA 2FGXA 1TK0B 5H5SA 5ABRA 3H79A 2KP2A 2AAWA 2LNTA 3KP9A 2UV8G 2R6KA 2YWOA 2FCHA 3FR3A 1B9YC 2E2GA 4LLRA 1PA3A 2H76A 2PMTA 4KSMA 14GSA 2IL3A 4EE0A 1SYXA 5CNWA 1QQ2A 3PH9A 3MSZA 1BG1A 3KCMA 4EXJA 4ECIA 2E2MA 1GNWA 2GT5A 4BVYB 4TOPA 2H71A 3H93A 3KMNA 2YCDA 3F3RA 3UOMA 2H8LA 1R5PA 3ZFLA 3QPMA 3Q18A 5ECOB 1BAYA 2C4JA 5F06A 2RM5A 4HEA2 4BL7A 5IM9A 1SU9A 1AQVA 3TOTA 4NPBA 4L0WA 3S9FA 4FYCA 1F3BA 4F9ZA 4MP4A 2H70A 2CVDA 2RLIA 2L57A 5B8BA 4HJ2A 4MCUA 2YZHA 2EFEA 2AYTA 3TJKA 4ECBA 3TRPA 5F8BA 4EIQA 5KEJA 2LEGA 5COHA 4IS0A 4BIKA 4F0BA 1SL0B 3ZYWA 1VF3A 2RIIA 1T7PB 4PNGA 4X1UA 2H19A 4ECCA 1EGOA 2CT6A 4W66A 4XS4B 2HZEA 2LUSA 3WGEA 2EIQA 2WW1A 3TJFA 4EF0A 4AKIA 3FEUA 2HFDA 4KGIA 4IJIA 3DD3A 2EC4A 4MF6A 2OBKA 2C80A 2LJKA 1U3AA 3HVSA 4AKXB 2MMNA 2I81A 4OCFA 4ISDA 4HDEA 2FA4A 1GSUA 13GSA 2XC2A 1UA5A 1SD8A 1EV9A 2DJKA 4GWRA 1X9WB 3D0ZA 2JSZA 1GRXA 1SK2A 2CX4A 1PMTA 4PHZC 5D9WA 1X5CA 1TRUA 3CSHA 3GX8A 4TKYA 1RQMA 3GKMA 3TKRA 6GSSA 3UMAA 2WW3A 4CY6A 3C73A 3A2WA 5HQPA 4MMMA 5D9VA 4MK3A 2GSTA 5KN0A 4EL1A 2DBCA 2A2SA 2H6YA 2IMDA 3KZQA 5HR2A 1IYIA 2CAQA 2WCIA 2I3YA 3R2QA 5J9CA 3CSJA 4WBRD 5KN3A 2PPTA 5AISA 4PGTA 1XIYA 2XBIA 4I2UA 2XPDA 4JE1A 5D93A 1YY7A 5LNKe 1AQXA 1JZRA 4GRFA 4Q5RA 4HS1A 3FR9A 4BA7A 4G0IA 4KNDA 2FNOA 1MDKA 1THOA 3KTBA 1SJZA 2IFQB 1K0MA 2F51A 1M9AA 1X0RA 1AIUA 2HXKA 2X8HA 4N0ZA 3M1GA 5IO0A 3TOUA 2Z9SA 2YJ7A 2VL2A 3APOA 4HZ2A 5A4VA 3ZRDA 3FY7A 4KDXA 4TW5A 4K8MA 3LXZA 1VF1A 1G0TA 2IIYA 5F0GA 5GSSA 3FK8A 4K2DA 3GTUB 4E68A 3HHVA 5F05A 2DMLA 1OC9A 4Z2RA 2LQOA 1I5GA 2HYXA 3D5JA 3QAVA 4DEJA 3ZZXA 3KD0A 4TR1B 3LYKA 1TXXA 1FW1A 2YV9A 3Q74A 3HZ4A 1K0NA 1BF5A 1X9SB 4I8BA 1GSEA 4MPGA 3H8QA 1PFOA 3E0UA 2H01A 3GSTA 4OFNA 5AIXA 3DVXA 2LQQA 4Z2TA 5INYA 2O89A 5A34B 1GTAA 5DCHA 10GSA 4HI7A 1GSDA 4J56E 5HR1A 4GTUA 1M3JA 1ZYNA 3DRNA 4XCSA 2L6DA 1OVNA 3GKNA 1FB6A 1GUKA 4HU9A 2JACA 4AGSA 5KN2A 4O92A 2DMMA 4K1FA 2DSAA 1G7EA 1X5EA 4EDYA 1TI3A 2CAIA 2H6XA 4O5UA 2JZTA 4YQVA 3LGCA 2CZ2A 3TB2A 2L4CA 4J57E 2PGTA 4ZILA 4NHWA 1B4QA 5ELAA 2EIOA 2C8UA 2V6KA 1K0AA 3QFBC 4BWSA 1V57A 2VM1A 2PERA 3P2AA 3LFLA 4L5LA 4MZCA 2F8FA 1T8EB 3SWLA 3C1SA 5ECPB 5A4UA 3M9KA 1Y6EA 4OMVA 4ZB8A 3BOAA 5A5HA 1T4ZA 3A5IA 3IC8A 4GF0A 3GHAA 3QAGA 3QMXA 1TW9A 1FO5A 3EPTA 1YEXA 1V58A 2YP6A 2MMAA 4V2LA 4YKGA 1E2YA 17GSA 2GLRA 4GQFA 2H73A 3CQFA 4AJ7A 1HNAA 2C0GA 20GSA 3HKRA 2RUEA 2N5FA 3HZ8A 4EIPA 3HMJG 4WKWA 3ISOA 2K8VA 1S4BP 1XVWA 3H4KA 3NIVA 2RM6A 3HJOA 1K0OA 1JLWA 2GSQA 3A3TA 2F3MA 1OKDA 1GL8A 3TKPA 3VPQA 2V32A 1A8YA 2OADA 4H86A 4AJ8A 2H6ZA 5DQSA 2WVYA 1XVQA 1Y25A 3PR8A 1EOHA 2R5GA 1XW6A 1DBYA 1JLVA 5DAKA 1WMJA 2K9FA 1HNBA 3F9UA 1SKSB 1E6BA 3UAPA 4K6XA 2NDOA 1XOBA 3RHCA 5D9XA 5EL8A 3IAS2 5BRTA 4PI2C 1WWJA 4MJAA 2REMA 4AI6A 1TP9A 2ZUPA 4FH8A 4XS1A 3DEXA 4XS6A 2PU9C 4JRRA 2FWGA 1AQWA 3I43A 4POKA 3LSZA 3TRXA 4G01A 2LTKA 4NMUA 4QL9A 1FG4A 1N2AA 4EO3A 1WP0A 3F4TA 4JBBA 5JWOB 3L9SA 2X4AA 2MMOA 3U6VA 3C71A 5IQYA 1ERWA 5B8AA 1EZKA 4MF7A 1M99A 5IMDA 3F8UA 4NAXA 1VGLA 4XS4A 5ID2B 5F07A 2V2GA 3A2VA 3EWLA 2HQTA 3N5OA 2HSNB 2HI7A 3NZNA 2VCQA 1SKRB 3EMPA 2LKUA 1M3IA 4DVCA 4HJMA 4AKHA 1F37A 1U88A 3UEMA 4BWQA 1TRSA 4XRAA 2B6MA 2HT9A 2V1MA
chains in the Genus database with same CATH topology
4EKZA 3G7IA 5A5KA 4XIHA 4ZB9A 5H5QA 5G5EA 1BJXA 3EVIA 3W8SA 1OE7A 6GSWA 3APSA 6GSUA 2VCTA 2YWMA 3GH9A 4KE3A 2OJLA 3HD5A 5IOWA 3F6DA 4GDFA 5DALB 1YZXA 1V98A 2ZCTA 2XHFA 3W8JA 3JCML 3CTGA 2QA1A 4FIWA 1J08A 3VI7A 4EUYA 1TK5B 3D21A 5HFKA 1Q4JA 3ZVJA 3VK9A 1FHEA 3RBTA 3N9JA 2H0IA 4IP1A 2VO4A 1Z7PA 1SL2B 4ZB7A 3DWVA 2L5LA 1GSSA 2B5XA 3EU4A 4KH7A 2FD3A 4XTSA 5GAPD 1H75A 3VWXA 3C1RA 3J7Yk 3CRTA 3FKFA 1GSQA 5DDLA 5IIZA 1MDJA 2OKAA 1GLQA 2BTOT 3KJYA 2BJXA 2FA8A 2AJQB 2NTOA 4IW9A 4YQMA 1M2BA 4JR6A 2IFQA 6GSVA 2EFCA 1IYHA 3O3TA 2VD0A 5IPGA 3UBKA 2H75A 4POMA 4LA1A 1BX9A 2JU5A 5CREA 5J41A 2GZYA 4KB3A 1SENA 2O87A 1ZMAA 3WGDA 4PX1A 2I9HA 3ZLPA 1A24A 2VIMA 4HUAA 2VLVA 4WBJA 1EEMA 2O8VB 2DKIA 5CO3A 2VLTA 2AUVA 4ZBBA 1ZYPA 2PWJA 2JZRA 5J3RA 4OO5A 4HQZA 4G19A 3TGZA 2X49A 1QFNA 1EOGA 5JWQB 1ZYEA 1OKTA 3ZITA 3ERWA 4G0KA 3BBYA 4E8HA 1T1VA 2FY6A 1EP8A 2IN3A 1PN0A 4TR1A 1M2DA 1F2EA 3UVTA 1XZOA 1GWCA 1O6JA 2YPMA 1XWAA 2ES7A 3TDGA 1BEDA 4J2FA 5L71A 3R3EA 1K3YA 2GZZA 4K5SA 5A34A 3W6GA 4MA9A 2YANA 2L4QA 2VAFA 4QQ7A 1S3DA 3Q6OA 1VRSD 3WGXA 1FVJA 5IOXA 2CV4A 3EMXA 4G10A 1OAZA 2H30A 2KOKA 4MJBA 4BVXB 2H0HA 2WGRA 4TXOB 3F6FA 2HLSA 1T3BA 2CZ3A 2O7KA 3HVXA 5A1NB 1FVKA 1RK4A 4MJCA 4G0LA 1FB0A 2R2JA 2GDRA 1Z5YE 3M3MA 5HR3A 3TJGA 1JZWA 2OBIA 4V1Ag 3GX0A 3IDVA 1SK1A 3FZ5A 5JWRB 2JL4A 3HVVA 4N0VA 1TU7A 1N25A 4ICYA 1R5AA 3RAZA 2CQ9A 3P7XA 4HOJA 1O81A 5B7CA 4RQXA 2IPAA 1ZGNA 3EINA 3QR6A 1GSFA 3IK9A 1A2LA 1KTEA 1SJ6A 2J23A 4IGJA 2LV3A 4JU5A 4YAPA 1GUHA 3GFKA 3GH6A 3ERFA 1UN2A 4MABA 3ME7A 3IRAA 1NHYA 5J4VA 3CMIA 2A4VA 2IMEA 3LXTA 4FYBA 2LRNA 2YZUA 1TTZA 4D73A 5J4UA 1WPIA 4IVFA 1A0RP 2QGVA 1AAZA 1TRVA 3GMFA 3C7MA 1ST9A 3LEFA 3E9JB 1KEBA 1T00A 4KW6A 4V2MA 2H1GA 1YKCA 3FZ9A 3LW9A 4QL7A 3LG6A 1HYUA 1G6YA 5E59A 2P31A 1O8WA 4TN8A 4L5OA 5EPFA 5D8IA 2AHEA 3F63A 5A4WA 1WE0A 1VF2A 1NSWA 2WJUA 4OO4A 1U3IA 4DSSA 3RPPA 2DJ2A 4WETA 1PL1A 2O85A 4MZWA 4MDCA 4AF2A 2MYGA 3UIWA 2B7KA 4N30A 1N8JA 5GSTA 4A5PA 1PX7A 3HJPA 3EC3A 5DBQA 2VKZG 1K0DA 4MH3A 4OFMA 2MZCA 1RW1A 2WFCA 2X8GA 1EV4A 5J5NA 2H0GA 5ID2A 4GSTA 2AB6A 5ECRB 1MDIA 2HSNA 3FZAA 2ON7A 1PD21 4X0XA 7GSSA 3L4NA 2VL2C 2I4AA 3HXSA 3IC4A 5GZZB 4CW9A 5GAND 3PGTA 2H66A 5FHIA 2HRAA 4ID0A 4EVMA 1ON4A 2X64A 1MD3A 3MAKA 3KP8A 1W89A 1YVLA 4WR5A 3LWAA 3P8WA 4PUFC 3DXBA 2GT6A 2QC7A 2C0FA 4ZBAA 3LQ7A 5DALA 2PVOC 2R0CA 1ML6A 1PGTA 1M2AA 3DYRA 5KN1A 4GSSA 3GL5A 4RUVA 1GULA 2FWEA 1TKDB 5ECIB 3UJ1A 1B4PA 2VCVA 1J9BA 1SVLA 2PVQA 5IMFA 2X99A 3TKSA 2NVLA 1XW9A 4NHZA 1G6WA 1KNGA 2GS3A 2K6VA 3M8NA 3HCZA 2GTUA 2M80A 3ERGA 4CY8A 3IR4A 2OT3A 4AKGA 2HSMB 1QXHA 3UL3A 5DJMA 3TKQA 1CQGA 1YQ1A 1O8XA 2YNXA 2H1BA 1XW5A 2DLXA 1EGRA 3FR6A 1XBSA 1O7UA 1XWCA 3FZ4A 5ECLB 1KBNA 2DKHA 2VUPA 4JR4A 1SYRA 4ZXGA 4BVYA 1YKAA 2MMZA 3WD6A 3IA1A 4Z2UA 3IPZA 3LJRA 2IJYA 3WT2A 1QMVA 1GTUA 1NW2A 3RHBA 4K5RA 2R3XA 5FWGA 1TK8B 1OYJA 8GSSA 1B9XC 3ZMKA 11GSA 3GRXA 4IQ1A 2H74A 3D6IA 1A23A 2ON5A 4WF4A 3VFIA 4ML6A 3L9UA 3I9V2 4O5RA 4ZL8A 3VLNA 4O32A 2YWNA 1F6MC 2CVKA 2VM2A 1BYEA 4MF5A 3TKSC 4K2XA 4RI6A 3MIXA 3OR5A 1AXDA 1OC8A 2DC5A 3UVHA 1UC7A 1U6TA 3TCOA 4CHSA 4KUNA 1X9MB 2YN1A 2EIRA 1R7HA 1ERTA 2A2RA 4TVEA 3QAWA 5KOXA 1G7OA 1PRXA 1GP1A 2WS2A 5C04A 4N11A 2OACA 4V2NA 1Q98A 5G1LA 3IBHA 3I6AA 1EWXA 3RPNA 4Q5FA 19GSA 1ZYQB 1TJDA 3KXOA 1K0BA 1WRYA 5G5FA 2HRNA 3LYPA 5J9BA 5J47A 3EU3A 4ECJA 3FMWA 3F4SA 4PUAA 2GSSA 5C00A 3GURA 2B1KA 2IWTA 1SJIA 3L9VA 2B7JA 4PTSA 4O5QA 3SBCA 4GXZA 1ERVA 3K8NA 2V6OA 3VPTA 1ZL9A 2JADA 1WIKA 4FQUA 2R0GA 1Z3EA 5CAXA 4HQSA 3IAM2 4QMKA 2HE3A 4WR4A 4TR3A 3I69A 2G0FA 3TU3B 4N10A 5HR0A 4KDYA 1XFLA 4LL1B 12GSA 1Z9HA 3EURA 3MDKA 6GSYA 4OD7A 3DKSA 1Y1UA 1XXUA 1ZZYA 4POLA 1B8XA 4PNFA 4KCEA 1WJKA 4G9HA 2HRKB 3KH9A 4K9ZA 4Z7XA 4KX4A 1SVOA 1B48A 2LNSA 4GSNA 5JCUA 4JEDA 1JZDA 5LD0A 1PL2A 3KM6A 3ZL5A 1GH2A 4IQAA 2I1UA 2WB9A 1DSBA 2H1AA 4K7NA 4L0UA 1GNEA 3ZIJA 5CRWA 4WXTA 3QDNA 2TRXA 3IXRA 1UVZA 4FO5A 1QUWA 1F3AA 4HZ4A 3GTUA 3HY2A 3ZIVA 4KCAA 5DAKB 4WF5A 2WZ9A 4PQHA 2M46A 2GQLA 3IK7A 5KOWA 3BCKA 1A2MA 5DQYA 4CDOA 2UZ8A 1I9DA 2B5EA 3GSSA 4G2EA 4E8EA 3GKXA 3LORA 2CA8A 1XOAA 5CRDA 3PPUA 2R0PA 2C3QA 2FHEA 1ILOA 2IMIA 1HD2A 5CP1A 4MZBA 1V40A 3KH7A 4TXVA 3GN3A 4TRXA 5J4YA 4ZL7A 6GSTA 4EC0A 4YAVA 4I6XA 3O6TA 4OFTA 2H1LA 3ZFBA 2FLSA 1YF1A 1TDIA 4IELA 4IJ3A 1F9MA 1PSQA 1W4VA 1TU8A 2AV4A 3FHKA 4L8EA 3TKSE 3ZTLA 4N3ZA 2OA7A 1JFUA 1NM3A 5HFGA 4Q5QA 5LCZA 1Z7RA 1HNCA 3VWWA 18GSA 4KF9A 2LJAA 4K7IA 3UARA 4PQ1A 5BMUB 4K0GA 5DCGA 2C0DA 4IHUA 2H1DA 2V41A 1DE1A 4X43A 5CRHA 1V2AA 4MJEA 3AY8A 3BD2A 1OC3A 1XWGA 1Z6NA 2HSYA 1FOHA 5ECSA 1NHOA 1M9BA 1XPVA 2E7PA 5G1KA 4YH2A 2F8AA 3GYKA 4O7HA 2R37A 4PQIA 1T4YA 3KMOA 2LS5A 1ABAA 5ECHB 2VLUA 3QD9A 1X5DA 1JHBA 3NOFA 3HYPA 4IP6A 2FUG2 3KGKA 2HSMA 3Q19A 1U87A 3FW2A 3MWHA 3CSIA 2FWHA 2B1LA 2VL9A 1PN9A 2J9HA 3L0HA 2VCXA 1S3AA 5ECKB 5JCGA 1GUMA 5D9TA 3DIEA 3BJ5A 4IN0A 3GA4A 1GSYA 1EEJA 4POBA 1YJ6A 2GSRA 3GV1A 4MH2A 2TRCP 1AC1A 3L78A 1GTIA 5J40A 3GL3A 4ZL9A 1SD9A 1TI1A 2DJ1A 3DGQA 5B6NA 2C3NA 2OE3A 3TJJA 4EDZA 2GZPA 3GKKA 1FOVA 5IO2A 4ACSA 2D2ZA 4BL7B 1XWKA 4I97A 3CYNA 3A2XA 2L6CA 3M9JA 4LMWA 3D4MA 3QFAC 1PKWA 4F0CA 2EFDA 1YF0A 3APQA 1GTBA 1SL1B 2QA2A 4MLYA 4FYUA 3HDCA 2KP1A 3G7YA 4PXOA 2HSHA 2LRTA 4OCEA 1LBKA 2VD1A 1A0FA 4TR0A 2WULA 5IMAA 3CTFA 2K18A 2XPEA 4NV2A 4DSQA 4GQCA 5ENUA 2DIZA 1A8LA 3EYTA 2HZEB 2XBQA 2YJHA 2B3SA 3TRQA 1QK8A 5IMVA 1SK0A 2G2QA 2IMFA 1PKZA 1BQ7A 1A2JA 3VURA 4JZQA 1DUGA 3CBUA 2A4HA 2FWFA 5G2ZA 4YQUA 5B6MA 1SVMA 4RQRA 3VWVA 3US3A 4P3YB 2VL3A 5IPHA 3F4RA 1VF4A 4Q5NA 9GSSA 5JCWA 3H1NA 6GSXA 1K0CA 2TIRA 5ECQB 2GQMA 1K3OA 2F9SA 3G7JA 5E4WA 2WRTA 1YEPA 4I2TA 5AGYA 1URMA 1ZCPA 5ECNB 2OE1A 3TUEA 3KEBA 2YV7A 1R26A 3WYWA 2KUCA 5FT3A 3G9BA 5DJLA 2CX3A 2GQKA 3FYGA 4RI7A 2BMXA 3KTLA 2L5OA 3F0IA 3D4TA 3CXGA 2VOCA 2ZNMA 2VCZA 3ZVJD 2N5AA 2M72A 3J7Yb 2LRCA 1TXUA 5G31A 2P0GA 1ERUA 3VWUA 3QCPA 22GSA 2JSYA 1USBA 1MEKA 3M0FA 4K7OA 1JZOA 2YWIA 5DVBA 4AJ6A 4GCIA 4HU7A 3E3EA 2GVPA 1AW9A 2HRKA 5ELGA 4K0NA 4LMVA 1YDKA 1LJRA 2C1YA 2B5YA 1EP7A 3GIXA 1CQHA 4LL4B 3IOSA 5IMCA 2PBJA 2KHPA 4ZIJA 3ZMLA 16GSA 4X4JA 4F2IA 4BPYA 3TJBA 3EE2A 2RUFA 4D73B 3DMLA 5EY6A 4YKFA 1O73A 2OE0A 3IHGA 2GGTA 1Z6MA 1LU4A 2K8SA 5D96A 3IV4A 2EFHA 1MD4A 1S3CA 4TR4A 1SKWB 3C8EA 2DJ3A 2R4VA 2C0EA 3MNGA 2HZFA 4NXIA 2LJRA 1OC9B 2PN8A 2QKEA 1R4WA 4MPFA 4KDUA 4IBPA 2DJJA 3RDWA 3VI5A 1TRWA 1C72A 4DSSB 1PX6A 2P5RA 3V1WA 2MBSA 3FRCA 3QOUA 4NWYA 2CVBA 3O76A 1HQOA 2IMKA 1OE8A 3DVWA 3IHQA 2X8CA 4USSA 5D73A 5CYYA 4NV5A 1ZOFA 1BG5A 1H4OA 3GUSA 4OWYA 3D22A 4KA0A 1XWBA 4ZBDA 2MBTA 5EVOA 2O5VA 3U5RE 3PINA 4GLTA 4ML1A 5HFIA 3ZREA 3GNJA 4V1Ap 2H72A 1FAAA 3F3QA 2HNLA 1XCCA 2E0QA 2WDUA 3KIJA 5H5RA 3BCIA 5CRGA 1M0UA 1J0FA 2LSTA 2C3TA 4F03A 3MYDA 4WEYA 1TOFA 4KSOA 4BVXA 2HRFA 4TXOA 4IKHA 2NBSA 2P5QA 3HA9A 1ACVA 1QGVA 3IE3A 2L59A 1K3LA 4PURA 3WT1A 5A1NA 1GLPA 5G30A 1DE2A 2QSIA 4ULXA 1M7TA 1O85A 1MTCA 3CWGA 2DIYA 2KLXA 3HJMA 5AIVA 2NPBA 2PUKC 3ME8A 4DSRA 1THXA 2VCWA 1AUCA 5BMUA 4F82A 1PQNA 1V9WA 4KAEA 2ALBA 3ED3A 4ILFA 3P90A 5ECMB 3CRUA 3A5WA 2N5BA 4I5QA 4XRDA 2YOIA 4ZB6A 5IMZA 5AN1A 4MNNA 5A5HB 2A2PA 1WOUA 4XHMA 2DJ0A 3UBLA 2JZSA 2FGXA 1TK0B 5H5SA 5ABRA 3H79A 2KP2A 2AAWA 2LNTA 3KP9A 2UV8G 2R6KA 2YWOA 2FCHA 3FR3A 1B9YC 2E2GA 4LLRA 1PA3A 2H76A 2PMTA 4KSMA 14GSA 2IL3A 4EE0A 1SYXA 5CNWA 1QQ2A 3PH9A 3MSZA 1BG1A 3KCMA 4EXJA 4ECIA 2E2MA 1GNWA 2GT5A 4BVYB 4TOPA 2H71A 3H93A 3KMNA 2YCDA 3F3RA 3UOMA 2H8LA 1R5PA 3ZFLA 3QPMA 3Q18A 5ECOB 1BAYA 2C4JA 5F06A 2RM5A 4HEA2 4BL7A 5IM9A 1SU9A 1AQVA 3TOTA 4NPBA 4L0WA 3S9FA 4FYCA 1F3BA 4F9ZA 4MP4A 2H70A 2CVDA 2RLIA 2L57A 5B8BA 4HJ2A 4MCUA 2YZHA 2EFEA 2AYTA 3TJKA 4ECBA 3TRPA 5F8BA 4EIQA 5KEJA 2LEGA 5COHA 4IS0A 4F0BA 1SL0B 3ZYWA 1VF3A 2RIIA 1T7PB 4PNGA 4X1UA 2H19A 4ECCA 1EGOA 2CT6A 4W66A 4XS4B 2HZEA 2LUSA 3WGEA 2EIQA 3TJFA 4EF0A 4AKIA 3FEUA 2HFDA 4KGIA 4IJIA 3DD3A 2EC4A 4MF6A 2OBKA 2C80A 2LJKA 1U3AA 3HVSA 4AKXB 2MMNA 2I81A 4OCFA 4ISDA 4HDEA 2FA4A 1GSUA 13GSA 2XC2A 1UA5A 1SD8A 1EV9A 2DJKA 4GWRA 1X9WB 3D0ZA 2JSZA 1GRXA 1SK2A 2CX4A 1PMTA 5D9WA 1X5CA 1TRUA 3CSHA 3GX8A 4TKYA 1RQMA 3GKMA 3TKRA 6GSSA 3UMAA 4CY6A 3C73A 3A2WA 5HQPA 4MMMA 5D9VA 4MK3A 2GSTA 5KN0A 4EL1A 2DBCA 2A2SA 2H6YA 2IMDA 3KZQA 5HR2A 1IYIA 2CAQA 2WCIA 2I3YA 3R2QA 5J9CA 3CSJA 4WBRD 5KN3A 2PPTA 5AISA 4PGTA 1XIYA 2XBIA 4I2UA 2XPDA 4JE1A 5D93A 1YY7A 5LNKe 1AQXA 1JZRA 4GRFA 4Q5RA 4HS1A 3FR9A 4BA7A 4G0IA 4KNDA 2FNOA 1MDKA 1THOA 3KTBA 1SJZA 2IFQB 1K0MA 2F51A 1M9AA 1X0RA 1AIUA 2HXKA 2X8HA 4N0ZA 3M1GA 5IO0A 3TOUA 2Z9SA 2YJ7A 2VL2A 3APOA 4HZ2A 5A4VA 3ZRDA 3FY7A 4KDXA 4TW5A 4K8MA 3LXZA 1VF1A 1G0TA 2IIYA 5F0GA 5GSSA 3FK8A 4K2DA 3GTUB 4E68A 3HHVA 5F05A 2DMLA 1OC9A 4Z2RA 2LQOA 1I5GA 2HYXA 3D5JA 3QAVA 4DEJA 3ZZXA 3KD0A 4TR1B 3LYKA 1TXXA 1FW1A 2YV9A 3Q74A 3HZ4A 1K0NA 1BF5A 1X9SB 4I8BA 1GSEA 4MPGA 3H8QA 3E0UA 2H01A 3GSTA 4OFNA 5AIXA 3DVXA 2LQQA 4Z2TA 5INYA 2O89A 5A34B 1GTAA 5DCHA 10GSA 4HI7A 1GSDA 4J56E 5HR1A 4GTUA 1ZYNA 3DRNA 4XCSA 2L6DA 1OVNA 3GKNA 1FB6A 1GUKA 4HU9A 2JACA 4AGSA 5KN2A 4O92A 2DMMA 4K1FA 2DSAA 1G7EA 1X5EA 4EDYA 1TI3A 2CAIA 2H6XA 4O5UA 2JZTA 4YQVA 3LGCA 2CZ2A 3TB2A 2L4CA 4J57E 2PGTA 4ZILA 4NHWA 1B4QA 5ELAA 2EIOA 2C8UA 2V6KA 1K0AA 3QFBC 4BWSA 1V57A 2VM1A 2PERA 3P2AA 3LFLA 4L5LA 4MZCA 2F8FA 1T8EB 3SWLA 3C1SA 5ECPB 5A4UA 3M9KA 1Y6EA 4OMVA 4ZB8A 3BOAA 5A5HA 1T4ZA 3A5IA 3IC8A 4GF0A 3GHAA 3QAGA 3QMXA 1TW9A 1FO5A 3EPTA 1YEXA 1V58A 2YP6A 2MMAA 4V2LA 4YKGA 1E2YA 17GSA 2GLRA 4GQFA 2H73A 4AJ7A 1HNAA 2C0GA 20GSA 3HKRA 2RUEA 2N5FA 3HZ8A 4EIPA 3HMJG 4WKWA 3ISOA 2K8VA 1XVWA 3H4KA 3NIVA 2RM6A 3HJOA 1K0OA 1JLWA 2GSQA 3A3TA 2F3MA 1OKDA 1GL8A 3TKPA 3VPQA 2V32A 1A8YA 2OADA 4H86A 4AJ8A 2H6ZA 5DQSA 1XVQA 1Y25A 3PR8A 1EOHA 2R5GA 1XW6A 1DBYA 1JLVA 5DAKA 1WMJA 2K9FA 1HNBA 3F9UA 1SKSB 1E6BA 3UAPA 4K6XA 2NDOA 1XOBA 3RHCA 5D9XA 5EL8A 3IAS2 5BRTA 1WWJA 4MJAA 2REMA 4AI6A 1TP9A 2ZUPA 4FH8A 4XS1A 3DEXA 4XS6A 2PU9C 4JRRA 2FWGA 1AQWA 3I43A 4POKA 3LSZA 3TRXA 4G01A 2LTKA 4NMUA 4QL9A 1FG4A 1N2AA 4EO3A 1WP0A 3F4TA 4JBBA 5JWOB 3L9SA 2X4AA 2MMOA 3U6VA 3C71A 5IQYA 1ERWA 5B8AA 1EZKA 4MF7A 1M99A 5IMDA 3F8UA 4NAXA 1VGLA 4XS4A 5ID2B 5F07A 2V2GA 3A2VA 3EWLA 2HQTA 3N5OA 2HSNB 2HI7A 3NZNA 2VCQA 1SKRB 3EMPA 2LKUA 4DVCA 4HJMA 4AKHA 1F37A 1U88A 3UEMA 4BWQA 1TRSA 4XRAA 2B6MA 2HT9A 2V1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EKZ A;  3G7I A;  5A5K A;  4XIH A;  4ZB9 A;  5H5Q A;  5G5E A;  1BJX A;  3EVI A;  3W8S A;  1OE7 A;  6GSW A;  3APS A;  6GSU A;  2VCT A;  2YWM A;  3GH9 A;  4KE3 A;  2OJL A;  3HD5 A;  5IOW A;  3F6D A;  5DAL B;  1YZX A;  1V98 A;  2ZCT A;  2XHF A;  3W8J A;  3JCM L;  3CTG A;  4FIW A;  1J08 A;  3VI7 A;  4EUY A;  1TK5 B;  3D21 A;  5HFK A;  1Q4J A;  3ZVJ A;  3VK9 A;  1FHE A;  3RBT A;  3N9J A;  2H0I A;  4IP1 A;  2VO4 A;  1Z7P A;  1SL2 B;  3DWV A;  2L5L A;  1GSS A;  2B5X A;  3EU4 A;  4KH7 A;  2FD3 A;  4XTS A;  5GAP D;  1H75 A;  3VWX A;  3C1R A;  3J7Y k;  3CRT A;  3FKF A;  1GSQ A;  5DDL A;  5IIZ A;  1MDJ A;  2OKA A;  1GLQ A;  2BTO T;  3KJY A;  2BJX A;  2FA8 A;  2AJQ B;  2NTO A;  4IW9 A;  4YQM A;  1M2B A;  4JR6 A;  2IFQ A;  6GSV A;  1IYH A;  3O3T A;  2VD0 A;  5IPG A;  3UBK A;  2H75 A;  4POM A;  4LA1 A;  1BX9 A;  2JU5 A;  5CRE A;  5J41 A;  2GZY A;  4KB3 A;  1SEN A;  2O87 A;  1ZMA A;  3WGD A;  4PX1 A;  2I9H A;  3ZLP A;  1A24 A;  2VIM A;  4HUA A;  2VLV A;  4WBJ A;  1EEM A;  2O8V B;  5CO3 A;  2VLT A;  2AUV A;  4ZBB A;  2PWJ A;  2JZR A;  5J3R A;  4OO5 A;  4HQZ A;  4G19 A;  3TGZ A;  1QFN A;  1EOG A;  5JWQ B;  1ZYE A;  1OKT A;  3ZIT A;  3ERW A;  4G0K A;  3BBY A;  4E8H A;  1T1V A;  2FY6 A;  1EP8 A;  2IN3 A;  4TR1 A;  1M2D A;  1F2E A;  3UVT A;  1XZO A;  1GWC A;  1O6J A;  2YPM A;  1XWA A;  2ES7 A;  3TDG A;  1BED A;  4J2F A;  5L71 A;  3R3E A;  1K3Y A;  2GZZ A;  3W6G A;  4MA9 A;  2YAN A;  2L4Q A;  2VAF A;  4QQ7 A;  1S3D A;  3Q6O A;  1VRS D;  3WGX A;  1FVJ A;  5IOX A;  2CV4 A;  3EMX A;  4G10 A;  1OAZ A;  2H30 A;  2KOK A;  4MJB A;  4BVX B;  2H0H A;  2WGR A;  4TXO B;  3F6F A;  2HLS A;  1T3B A;  2CZ3 A;  2O7K A;  3HVX A;  1FVK A;  1RK4 A;  4MJC A;  4G0L A;  1FB0 A;  2R2J A;  2GDR A;  1Z5Y E;  3M3M A;  5HR3 A;  3TJG A;  1JZW A;  2OBI A;  4V1A g;  3GX0 A;  3IDV A;  1SK1 A;  3FZ5 A;  5JWR B;  2JL4 A;  3HVV A;  4N0V A;  1TU7 A;  1R5A A;  3RAZ A;  2CQ9 A;  3P7X A;  4HOJ A;  1O81 A;  5B7C A;  4RQX A;  2IPA A;  1ZGN A;  3EIN A;  3QR6 A;  1GSF A;  3IK9 A;  1A2L A;  1KTE A;  1SJ6 A;  2J23 A;  4IGJ A;  2LV3 A;  4JU5 A;  4YAP A;  1GUH A;  3GFK A;  3GH6 A;  3ERF A;  1UN2 A;  4MAB A;  3ME7 A;  3IRA A;  1NHY A;  3CMI A;  2A4V A;  2IME A;  3LXT A;  4FYB A;  2LRN A;  2YZU A;  1TTZ A;  4D73 A;  5J4U A;  1WPI A;  4IVF A;  1A0R P;  2QGV A;  1AAZ A;  1TRV A;  3GMF A;  3C7M A;  1ST9 A;  3LEF A;  3E9J B;  1KEB A;  1T00 A;  4KW6 A;  4V2M A;  2H1G A;  1YKC A;  3FZ9 A;  4QL7 A;  3LG6 A;  1HYU A;  1G6Y A;  5E59 A;  2P31 A;  1O8W A;  4TN8 A;  4L5O A;  5EPF A;  5D8I A;  2AHE A;  3F63 A;  5A4W A;  1WE0 A;  1VF2 A;  1NSW A;  2WJU A;  4OO4 A;  1U3I A;  4DSS A;  3RPP A;  2DJ2 A;  4WET A;  1PL1 A;  2O85 A;  4MZW A;  4MDC A;  4AF2 A;  2MYG A;  3UIW A;  2B7K A;  4N30 A;  1N8J A;  5GST A;  1PX7 A;  3HJP A;  3EC3 A;  5DBQ A;  1K0D A;  4MH3 A;  4OFM A;  2MZC A;  1RW1 A;  2WFC A;  2X8G A;  1EV4 A;  5J5N A;  2H0G A;  5ID2 A;  4GST A;  2AB6 A;  5ECR B;  1MDI A;  3FZA A;  2ON7 A;  1PD2 1;  4X0X A;  7GSS A;  3L4N A;  2VL2 C;  2I4A A;  3HXS A;  3IC4 A;  5GZZ B;  4CW9 A;  5GAN D;  3PGT A;  2H66 A;  5FHI A;  2HRA A;  4ID0 A;  4EVM A;  1ON4 A;  2X64 A;  1MD3 A;  3MAK A;  3KP8 A;  1W89 A;  4WR5 A;  3LWA A;  3P8W A;  4PUF C;  3DXB A;  2GT6 A;  2QC7 A;  2C0F A;  4ZBA A;  3LQ7 A;  5DAL A;  2PVO C;  1ML6 A;  1PGT A;  1M2A A;  3DYR A;  5KN1 A;  4GSS A;  3GL5 A;  4RUV A;  1GUL A;  2FWE A;  1TKD B;  5ECI B;  3UJ1 A;  1B4P A;  2VCV A;  1J9B A;  2PVQ A;  5IMF A;  2X99 A;  3TKS A;  2NVL A;  1XW9 A;  4NHZ A;  1G6W A;  1KNG A;  2GS3 A;  2K6V A;  3M8N A;  3HCZ A;  2GTU A;  2M80 A;  3ERG A;  3IR4 A;  2HSM B;  1QXH A;  3UL3 A;  5DJM A;  3TKQ A;  1CQG A;  1YQ1 A;  1O8X A;  2YNX A;  2H1B A;  1XW5 A;  2DLX A;  1EGR A;  3FR6 A;  1XBS A;  1O7U A;  1XWC A;  3FZ4 A;  5ECL B;  1KBN A;  2VUP A;  4JR4 A;  1SYR A;  4ZXG A;  4BVY A;  1YKA A;  2MMZ A;  3WD6 A;  3IA1 A;  3IPZ A;  3LJR A;  2IJY A;  3WT2 A;  1QMV A;  1GTU A;  1NW2 A;  3RHB A;  2R3X A;  5FWG A;  1TK8 B;  1OYJ A;  8GSS A;  1B9X C;  3ZMK A;  11GS A;  3GRX A;  4IQ1 A;  2H74 A;  3D6I A;  1A23 A;  2ON5 A;  4WF4 A;  3VFI A;  4ML6 A;  3L9U A;  3I9V 2;  4O5R A;  4ZL8 A;  3VLN A;  4O32 A;  2YWN A;  1F6M C;  2CVK A;  2VM2 A;  1BYE A;  4MF5 A;  3TKS C;  4RI6 A;  3OR5 A;  1AXD A;  1OC8 A;  2DC5 A;  3UVH A;  1UC7 A;  1U6T A;  3TCO A;  4CHS A;  4KUN A;  1X9M B;  2YN1 A;  2EIR A;  1R7H A;  1ERT A;  2A2R A;  4TVE A;  3QAW A;  1G7O A;  1PRX A;  1GP1 A;  2WS2 A;  5C04 A;  4N11 A;  2OAC A;  4V2N A;  1Q98 A;  5G1L A;  3IBH A;  3I6A A;  1EWX A;  3RPN A;  4Q5F A;  19GS A;  1ZYQ B;  1TJD A;  3KXO A;  1K0B A;  1WRY A;  5G5F A;  2HRN A;  3LYP A;  5J9B A;  3EU3 A;  4ECJ A;  3F4S A;  4PUA A;  2GSS A;  5C00 A;  3GUR A;  2B1K A;  2IWT A;  1SJI A;  3L9V A;  2B7J A;  4PTS A;  3SBC A;  4GXZ A;  1ERV A;  3K8N A;  2V6O A;  3VPT A;  1ZL9 A;  2JAD A;  1WIK A;  4FQU A;  1Z3E A;  5CAX A;  4HQS A;  3IAM 2;  2HE3 A;  4WR4 A;  4TR3 A;  3I69 A;  2G0F A;  4N10 A;  5HR0 A;  4KDY A;  1XFL A;  4LL1 B;  12GS A;  1Z9H A;  3EUR A;  3MDK A;  6GSY A;  4OD7 A;  3DKS A;  1XXU A;  1ZZY A;  4POL A;  1B8X A;  4PNF A;  4KCE A;  1WJK A;  4G9H A;  2HRK B;  3KH9 A;  4K9Z A;  4Z7X A;  4KX4 A;  1B48 A;  2LNS A;  4GSN A;  5JCU A;  4JED A;  1JZD A;  5LD0 A;  1PL2 A;  3KM6 A;  3ZL5 A;  1GH2 A;  4IQA A;  2I1U A;  2WB9 A;  1DSB A;  2H1A A;  4K7N A;  4L0U A;  1GNE A;  3ZIJ A;  5CRW A;  4WXT A;  3QDN A;  2TRX A;  3IXR A;  1UVZ A;  4FO5 A;  1QUW A;  1F3A A;  4HZ4 A;  3GTU A;  3HY2 A;  3ZIV A;  4KCA A;  5DAK B;  4WF5 A;  2WZ9 A;  4PQH A;  2M46 A;  2GQL A;  3IK7 A;  3BCK A;  1A2M A;  5DQY A;  4CDO A;  2UZ8 A;  1I9D A;  2B5E A;  3GSS A;  4G2E A;  4E8E A;  3GKX A;  3LOR A;  2CA8 A;  1XOA A;  5CRD A;  3PPU A;  2C3Q A;  2FHE A;  1ILO A;  2IMI A;  1HD2 A;  5CP1 A;  4MZB A;  1V40 A;  3KH7 A;  4TXV A;  3GN3 A;  4TRX A;  4ZL7 A;  6GST A;  4EC0 A;  4YAV A;  4I6X A;  3O6T A;  4OFT A;  3ZFB A;  2FLS A;  1YF1 A;  1TDI A;  4IEL A;  4IJ3 A;  1F9M A;  1PSQ A;  1W4V A;  1TU8 A;  2AV4 A;  3FHK A;  4L8E A;  3TKS E;  3ZTL A;  1JFU A;  2OA7 A;  1NM3 A;  5HFG A;  4Q5Q A;  5LCZ A;  1Z7R A;  1HNC A;  3VWW A;  18GS A;  4KF9 A;  2LJA A;  4K7I A;  3UAR A;  4PQ1 A;  4K0G A;  5DCG A;  2C0D A;  4IHU A;  2H1D A;  2V41 A;  1DE1 A;  4X43 A;  5CRH A;  1V2A A;  4MJE A;  3AY8 A;  3BD2 A;  1OC3 A;  1XWG A;  1Z6N A;  2HSY A;  5ECS A;  1NHO A;  1M9B A;  1XPV A;  2E7P A;  5G1K A;  4YH2 A;  2F8A A;  3GYK A;  4O7H A;  2R37 A;  4PQI A;  1T4Y A;  3KMO A;  2LS5 A;  1ABA A;  5ECH B;  2VLU A;  3QD9 A;  1X5D A;  1JHB A;  3NOF A;  3HYP A;  4IP6 A;  2FUG 2;  3KGK A;  2HSM A;  3Q19 A;  1U87 A;  3FW2 A;  3MWH A;  3CSI A;  2FWH A;  2B1L A;  2VL9 A;  1PN9 A;  2J9H A;  3L0H A;  2VCX A;  1S3A A;  5ECK B;  5JCG A;  1GUM A;  5D9T A;  3DIE A;  3BJ5 A;  4IN0 A;  3GA4 A;  1GSY A;  1EEJ A;  4POB A;  1YJ6 A;  2GSR A;  3GV1 A;  4MH2 A;  2TRC P;  1AC1 A;  3L78 A;  1GTI A;  3GL3 A;  4ZL9 A;  1SD9 A;  1TI1 A;  2DJ1 A;  3DGQ A;  5B6N A;  2C3N A;  2OE3 A;  3TJJ A;  4EDZ A;  2GZP A;  3GKK A;  1FOV A;  5IO2 A;  4ACS A;  2D2Z A;  4BL7 B;  1XWK A;  4I97 A;  3CYN A;  3A2X A;  2L6C A;  3M9J A;  4LMW A;  3D4M A;  3QFA C;  1PKW A;  4F0C A;  1YF0 A;  3APQ A;  1GTB A;  1SL1 B;  4MLY A;  4FYU A;  3HDC A;  2KP1 A;  3G7Y A;  4PXO A;  2HSH A;  2LRT A;  4OCE A;  1LBK A;  2VD1 A;  1A0F A;  4TR0 A;  2WUL A;  5IMA A;  3CTF A;  2K18 A;  2XPE A;  4NV2 A;  4DSQ A;  4GQC A;  5ENU A;  2DIZ A;  1A8L A;  3EYT A;  2HZE B;  2XBQ A;  2YJH A;  2B3S A;  3TRQ A;  1QK8 A;  5IMV A;  1SK0 A;  2G2Q A;  2IMF A;  1PKZ A;  1BQ7 A;  1A2J A;  3VUR A;  4JZQ A;  1DUG A;  3CBU A;  2FWF A;  5G2Z A;  4YQU A;  5B6M A;  4RQR A;  3VWV A;  3US3 A;  4P3Y B;  2VL3 A;  5IPH A;  3F4R A;  1VF4 A;  4Q5N A;  9GSS A;  5JCW A;  3H1N A;  6GSX A;  1K0C A;  2TIR A;  5ECQ B;  2GQM A;  1K3O A;  2F9S A;  3G7J A;  5E4W A;  2WRT A;  1YEP A;  4I2T A;  5AGY A;  1URM A;  1ZCP A;  5ECN B;  2OE1 A;  3TUE A;  3KEB A;  2YV7 A;  1R26 A;  3WYW A;  2KUC A;  5FT3 A;  3G9B A;  5DJL A;  2CX3 A;  2GQK A;  3FYG A;  4RI7 A;  2BMX A;  3KTL A;  2L5O A;  3F0I A;  3D4T A;  3CXG A;  2VOC A;  2ZNM A;  2VCZ A;  3ZVJ D;  2N5A A;  2M72 A;  3J7Y b;  2LRC A;  5G31 A;  2P0G A;  1ERU A;  3VWU A;  3QCP A;  22GS A;  2JSY A;  1USB A;  1MEK A;  3M0F A;  4K7O A;  1JZO A;  2YWI A;  5DVB A;  4AJ6 A;  4GCI A;  4HU7 A;  3E3E A;  2GVP A;  1AW9 A;  2HRK A;  5ELG A;  4K0N A;  4LMV A;  1YDK A;  1LJR A;  2C1Y A;  2B5Y A;  1EP7 A;  3GIX A;  1CQH A;  4LL4 B;  3IOS A;  5IMC A;  2PBJ A;  2KHP A;  4ZIJ A;  3ZML A;  16GS A;  4F2I A;  4BPY A;  3TJB A;  3EE2 A;  2RUF A;  4D73 B;  3DML A;  5EY6 A;  1O73 A;  2OE0 A;  2GGT A;  1Z6M A;  1LU4 A;  2K8S A;  5D96 A;  3IV4 A;  1MD4 A;  1S3C A;  4TR4 A;  1SKW B;  3C8E A;  2DJ3 A;  2R4V A;  2C0E A;  3MNG A;  2HZF A;  4NXI A;  2LJR A;  1OC9 B;  2PN8 A;  2QKE A;  1R4W A;  4MPF A;  4KDU A;  4IBP A;  2DJJ A;  3RDW A;  3VI5 A;  1TRW A;  1C72 A;  4DSS B;  1PX6 A;  2P5R A;  3V1W A;  2MBS A;  3FRC A;  3QOU A;  4NWY A;  2CVB A;  3O76 A;  1HQO A;  2IMK A;  1OE8 A;  3DVW A;  3IHQ A;  2X8C A;  4USS A;  5D73 A;  5CYY A;  4NV5 A;  1ZOF A;  1BG5 A;  1H4O A;  3GUS A;  4OWY A;  3D22 A;  4KA0 A;  1XWB A;  4ZBD A;  2MBT A;  5EVO A;  3U5R E;  3PIN A;  4GLT A;  4ML1 A;  5HFI A;  3ZRE A;  3GNJ A;  4V1A p;  2H72 A;  1FAA A;  3F3Q A;  2HNL A;  1XCC A;  2E0Q A;  2WDU A;  3KIJ A;  5H5R A;  3BCI A;  5CRG A;  1M0U A;  1J0F A;  2LST A;  2C3T A;  4F03 A;  4WEY A;  1TOF A;  4KSO A;  4BVX A;  2HRF A;  4TXO A;  4IKH A;  2NBS A;  2P5Q A;  3HA9 A;  1ACV A;  1QGV A;  3IE3 A;  2L59 A;  1K3L A;  4PUR A;  3WT1 A;  1GLP A;  5G30 A;  1DE2 A;  2QSI A;  4ULX A;  1M7T A;  1O85 A;  1MTC A;  2DIY A;  2KLX A;  3HJM A;  5AIV A;  2NPB A;  2PUK C;  3ME8 A;  4DSR A;  1THX A;  2VCW A;  1AUC A;  5BMU A;  4F82 A;  1PQN A;  1V9W A;  4KAE A;  2ALB A;  3ED3 A;  4ILF A;  3P90 A;  5ECM B;  3CRU A;  3A5W A;  2N5B A;  4I5Q A;  4XRD A;  2YOI A;  4ZB6 A;  5IMZ A;  5AN1 A;  1WOU A;  4XHM A;  2DJ0 A;  3UBL A;  2JZS A;  2FGX A;  1TK0 B;  5H5S A;  5ABR A;  3H79 A;  2KP2 A;  2AAW A;  2LNT A;  3KP9 A;  2R6K A;  2YWO A;  2FCH A;  3FR3 A;  1B9Y C;  2E2G A;  4LLR A;  1PA3 A;  2H76 A;  2PMT A;  4KSM A;  14GS A;  2IL3 A;  4EE0 A;  1SYX A;  5CNW A;  1QQ2 A;  3PH9 A;  3MSZ A;  3KCM A;  4EXJ A;  4ECI A;  2E2M A;  1GNW A;  2GT5 A;  4BVY B;  4TOP A;  2H71 A;  3H93 A;  3KMN A;  2YCD A;  3F3R A;  3UOM A;  2H8L A;  1R5P A;  3ZFL A;  3QPM A;  3Q18 A;  5ECO B;  1BAY A;  2C4J A;  5F06 A;  2RM5 A;  4HEA 2;  4BL7 A;  5IM9 A;  1SU9 A;  1AQV A;  3TOT A;  4NPB A;  4L0W A;  3S9F A;  4FYC A;  1F3B A;  4F9Z A;  4MP4 A;  2H70 A;  2CVD A;  2RLI A;  2L57 A;  5B8B A;  4HJ2 A;  4MCU A;  2YZH A;  2AYT A;  3TJK A;  4ECB A;  3TRP A;  5F8B A;  5KEJ A;  2LEG A;  5COH A;  4IS0 A;  4F0B A;  1SL0 B;  3ZYW A;  1VF3 A;  2RII A;  1T7P B;  4PNG A;  4X1U A;  2H19 A;  4ECC A;  1EGO A;  2CT6 A;  4XS4 B;  2HZE A;  2LUS A;  3WGE A;  2EIQ A;  3TJF A;  4EF0 A;  3FEU A;  2HFD A;  4KGI A;  4IJI A;  3DD3 A;  2EC4 A;  4MF6 A;  2OBK A;  2C80 A;  2LJK A;  1U3A A;  3HVS A;  2MMN A;  2I81 A;  4OCF A;  4ISD A;  4HDE A;  2FA4 A;  1GSU A;  13GS A;  2XC2 A;  1UA5 A;  1SD8 A;  1EV9 A;  2DJK A;  4GWR A;  1X9W B;  3D0Z A;  2JSZ A;  1GRX A;  1SK2 A;  2CX4 A;  1PMT A;  5D9W A;  1X5C A;  1TRU A;  3CSH A;  3GX8 A;  4TKY A;  1RQM A;  3GKM A;  3TKR A;  6GSS A;  3UMA A;  3C73 A;  3A2W A;  5HQP A;  4MMM A;  5D9V A;  4MK3 A;  2GST A;  5KN0 A;  4EL1 A;  2DBC A;  2A2S A;  2H6Y A;  2IMD A;  3KZQ A;  5HR2 A;  1IYI A;  2CAQ A;  2WCI A;  2I3Y A;  3R2Q A;  5J9C A;  3CSJ A;  4WBR D;  5KN3 A;  2PPT A;  5AIS A;  4PGT A;  1XIY A;  2XBI A;  4I2U A;  2XPD A;  4JE1 A;  5D93 A;  1YY7 A;  5LNK e;  1AQX A;  1JZR A;  4GRF A;  4Q5R A;  4HS1 A;  3FR9 A;  4BA7 A;  4G0I A;  4KND A;  2FNO A;  1MDK A;  1THO A;  3KTB A;  1SJZ A;  2IFQ B;  1K0M A;  2F51 A;  1M9A A;  1X0R A;  1AIU A;  2HXK A;  2X8H A;  4N0Z A;  3M1G A;  5IO0 A;  3TOU A;  2Z9S A;  2YJ7 A;  2VL2 A;  3APO A;  4HZ2 A;  5A4V A;  3ZRD A;  3FY7 A;  4KDX A;  4TW5 A;  4K8M A;  3LXZ A;  1VF1 A;  1G0T A;  2IIY A;  5F0G A;  5GSS A;  3FK8 A;  4K2D A;  3GTU B;  3HHV A;  5F05 A;  2DML A;  1OC9 A;  2LQO A;  1I5G A;  2HYX A;  3D5J A;  3QAV A;  4DEJ A;  3ZZX A;  3KD0 A;  4TR1 B;  3LYK A;  1TXX A;  1FW1 A;  2YV9 A;  3Q74 A;  3HZ4 A;  1K0N A;  1X9S B;  4I8B A;  1GSE A;  4MPG A;  3H8Q A;  3E0U A;  2H01 A;  3GST A;  4OFN A;  5AIX A;  3DVX A;  2LQQ A;  5INY A;  2O89 A;  1GTA A;  5DCH A;  10GS A;  4HI7 A;  1GSD A;  4J56 E;  5HR1 A;  4GTU A;  3DRN A;  4XCS A;  2L6D A;  1OVN A;  3GKN A;  1FB6 A;  1GUK A;  4HU9 A;  2JAC A;  4AGS A;  5KN2 A;  4O92 A;  2DMM A;  4K1F A;  2DSA A;  1G7E A;  1X5E A;  4EDY A;  1TI3 A;  2CAI A;  2H6X A;  2JZT A;  4YQV A;  3LGC A;  2CZ2 A;  3TB2 A;  2L4C A;  4J57 E;  2PGT A;  4ZIL A;  4NHW A;  1B4Q A;  5ELA A;  2EIO A;  2C8U A;  2V6K A;  1K0A A;  3QFB C;  4BWS A;  1V57 A;  2VM1 A;  2PER A;  3P2A A;  3LFL A;  4L5L A;  4MZC A;  2F8F A;  1T8E B;  3SWL A;  3C1S A;  5ECP B;  5A4U A;  3M9K A;  1Y6E A;  4OMV A;  4ZB8 A;  3BOA A;  1T4Z A;  3IC8 A;  4GF0 A;  3GHA A;  3QAG A;  3QMX A;  1TW9 A;  1FO5 A;  1YEX A;  1V58 A;  2YP6 A;  2MMA A;  4V2L A;  1E2Y A;  17GS A;  2GLR A;  4GQF A;  2H73 A;  4AJ7 A;  1HNA A;  2C0G A;  20GS A;  3HKR A;  2RUE A;  2N5F A;  3HZ8 A;  4WKW A;  3ISO A;  2K8V A;  1XVW A;  3H4K A;  3NIV A;  2RM6 A;  3HJO A;  1K0O A;  1JLW A;  2GSQ A;  3A3T A;  2F3M A;  1OKD A;  1GL8 A;  3TKP A;  3VPQ A;  2V32 A;  1A8Y A;  2OAD A;  4H86 A;  4AJ8 A;  2H6Z A;  5DQS A;  1XVQ A;  1Y25 A;  3PR8 A;  1EOH A;  2R5G A;  1XW6 A;  1DBY A;  1JLV A;  5DAK A;  1WMJ A;  2K9F A;  1HNB A;  3F9U A;  1SKS B;  1E6B A;  3UAP A;  4K6X A;  2NDO A;  1XOB A;  3RHC A;  5D9X A;  5EL8 A;  3IAS 2;  1WWJ A;  4MJA A;  2REM A;  1TP9 A;  2ZUP A;  4FH8 A;  4XS1 A;  3DEX A;  4XS6 A;  2PU9 C;  4JRR A;  2FWG A;  1AQW A;  3I43 A;  4POK A;  3LSZ A;  3TRX A;  2LTK A;  4NMU A;  4QL9 A;  1FG4 A;  1N2A A;  4EO3 A;  1WP0 A;  3F4T A;  4JBB A;  5JWO B;  3L9S A;  2MMO A;  3U6V A;  3C71 A;  5IQY A;  1ERW A;  5B8A A;  1EZK A;  4MF7 A;  1M99 A;  5IMD A;  3F8U A;  4NAX A;  1VGL A;  4XS4 A;  5ID2 B;  5F07 A;  2V2G A;  3A2V A;  3EWL A;  2HQT A;  3N5O A;  2HSN B;  2HI7 A;  3NZN A;  2VCQ A;  1SKR B;  3EMP A;  2LKU A;  4DVC A;  4HJM A;  1F37 A;  1U88 A;  3UEM A;  4BWQ A;  1TRS A;  4XRA A;  2B6M A;  2HT9 A;  2V1M A; 
#chains in the Genus database with same CATH topology
 4EKZ A;  3G7I A;  5A5K A;  4XIH A;  4ZB9 A;  5H5Q A;  5G5E A;  1BJX A;  3EVI A;  3W8S A;  1OE7 A;  6GSW A;  3APS A;  6GSU A;  2VCT A;  2YWM A;  3GH9 A;  4KE3 A;  2OJL A;  3HD5 A;  5IOW A;  3F6D A;  4GDF A;  5DAL B;  1YZX A;  1V98 A;  2ZCT A;  2XHF A;  3W8J A;  3JCM L;  3CTG A;  2QA1 A;  4FIW A;  1J08 A;  1S3R A;  3VI7 A;  4EUY A;  1TK5 B;  3D21 A;  5HFK A;  1Q4J A;  3ZVJ A;  3VK9 A;  1FHE A;  3RBT A;  3N9J A;  2H0I A;  4IP1 A;  2VO4 A;  1Z7P A;  1SL2 B;  4ZB7 A;  3DWV A;  2L5L A;  1GSS A;  3EU4 A;  2B5X A;  4KH7 A;  2FD3 A;  4XTS A;  5GAP D;  1H75 A;  3VWX A;  3C1R A;  3J7Y k;  3CRT A;  3FKF A;  1GSQ A;  5DDL A;  5IIZ A;  1MDJ A;  2OKA A;  1GLQ A;  2BTO T;  3KJY A;  2BJX A;  2FA8 A;  2AJQ B;  2NTO A;  4IW9 A;  4YQM A;  1M2B A;  4JR6 A;  2IFQ A;  6GSV A;  2EFC A;  1IYH A;  3O3T A;  2VD0 A;  5IPG A;  3UBK A;  2H75 A;  4POM A;  4LA1 A;  1BX9 A;  2JU5 A;  5CRE A;  5J41 A;  2GZY A;  4KB3 A;  1SEN A;  2O87 A;  1ZMA A;  3WGD A;  4PX1 A;  2I9H A;  3ZLP A;  1A24 A;  2VIM A;  4HUA A;  2VLV A;  4WBJ A;  1EEM A;  2O8V B;  2DKI A;  5CO3 A;  2VLT A;  2AUV A;  4ZBB A;  1ZYP A;  2PWJ A;  2JZR A;  5J3R A;  4OO5 A;  4HQZ A;  4G19 A;  3TGZ A;  2X49 A;  1QFN A;  1EOG A;  5JWQ B;  1ZYE A;  1OKT A;  3ZIT A;  1I1I P;  3ERW A;  4G0K A;  3BBY A;  4E8H A;  1T1V A;  2FY6 A;  1EP8 A;  2IN3 A;  1PN0 A;  4TR1 A;  1M2D A;  1F2E A;  3UVT A;  1XZO A;  1GWC A;  1O6J A;  2YPM A;  1XWA A;  2ES7 A;  3TDG A;  1BED A;  4J2F A;  5L71 A;  3R3E A;  1K3Y A;  2GZZ A;  4K5S A;  5A34 A;  3W6G A;  3RGB C;  4MA9 A;  2YAN A;  2L4Q A;  2VAF A;  4QQ7 A;  1S3D A;  3Q6O A;  1VRS D;  3WGX A;  1FVJ A;  5IOX A;  2CV4 A;  3EMX A;  4G10 A;  1OAZ A;  2H30 A;  2KOK A;  4MJB A;  4BVX B;  2H0H A;  2WGR A;  4TXO B;  3F6F A;  2HLS A;  2WW2 A;  1T3B A;  2CZ3 A;  2O7K A;  3HVX A;  5A1N B;  1FVK A;  1RK4 A;  4MJC A;  4G0L A;  1FB0 A;  2R2J A;  2GDR A;  1Z5Y E;  3M3M A;  5HR3 A;  3TJG A;  1JZW A;  2OBI A;  4V1A g;  3GX0 A;  3IDV A;  1SK1 A;  3FZ5 A;  5JWR B;  2JL4 A;  3HVV A;  4N0V A;  1TU7 A;  1N25 A;  4ICY A;  1R5A A;  3RAZ A;  4PI0 C;  2CQ9 A;  3P7X A;  4HOJ A;  1O81 A;  5B7C A;  4RQX A;  2IPA A;  1ZGN A;  3EIN A;  3QR6 A;  1GSF A;  4HSC X;  3IK9 A;  1A2L A;  1KTE A;  1SJ6 A;  2J23 A;  4IGJ A;  2LV3 A;  4JU5 A;  4YAP A;  1GUH A;  3GFK A;  3GH6 A;  3ERF A;  1UN2 A;  4MAB A;  3ME7 A;  3IRA A;  2WW0 A;  1NHY A;  5J4V A;  3CMI A;  2A4V A;  2IME A;  3LXT A;  4FYB A;  2LRN A;  2YZU A;  1TTZ A;  4D73 A;  5J4U A;  1WPI A;  4IVF A;  1A0R P;  2QGV A;  1AAZ A;  1TRV A;  3GMF A;  3C7M A;  1ST9 A;  3LEF A;  3E9J B;  1KEB A;  1T00 A;  4KW6 A;  4V2M A;  2H1G A;  1YKC A;  3FZ9 A;  3LW9 A;  4QL7 A;  3LG6 A;  1HYU A;  1G6Y A;  5E59 A;  2P31 A;  1O8W A;  4TN8 A;  4L5O A;  5EPF A;  5D8I A;  2AHE A;  3F63 A;  5A4W A;  1WE0 A;  1VF2 A;  1NSW A;  2WJU A;  4OO4 A;  1U3I A;  3CHX C;  4DSS A;  3RPP A;  2DJ2 A;  4WET A;  1PL1 A;  2O85 A;  4MZW A;  4MDC A;  4AF2 A;  2MYG A;  3UIW A;  2B7K A;  4N30 A;  1N8J A;  5GST A;  4A5P A;  1PX7 A;  3HJP A;  3EC3 A;  5DBQ A;  2VKZ G;  1K0D A;  4MH3 A;  4OFM A;  2MZC A;  1RW1 A;  2WFC A;  2X8G A;  1EV4 A;  5J5N A;  2H0G A;  5ID2 A;  4GST A;  2AB6 A;  5ECR B;  1MDI A;  2HSN A;  3FZA A;  2ON7 A;  1PD2 1;  4X0X A;  7GSS A;  3L4N A;  2VL2 C;  2I4A A;  3HXS A;  3IC4 A;  5GZZ B;  4CW9 A;  5GAN D;  3PGT A;  2H66 A;  5FHI A;  2HRA A;  4ID0 A;  4EVM A;  1ON4 A;  2X64 A;  1MD3 A;  3MAK A;  3KP8 A;  1W89 A;  1YVL A;  4WR5 A;  3LWA A;  3P8W A;  4PUF C;  3DXB A;  2GT6 A;  2QC7 A;  2C0F A;  4ZBA A;  3LQ7 A;  5DAL A;  2PVO C;  2R0C A;  1ML6 A;  1PGT A;  1M2A A;  3DYR A;  5KN1 A;  4GSS A;  3GL5 A;  4RUV A;  4FXY P;  1GUL A;  2FWE A;  1TKD B;  5ECI B;  3UJ1 A;  1B4P A;  2VCV A;  1J9B A;  1SVL A;  2PVQ A;  5IMF A;  2X99 A;  3TKS A;  2NVL A;  1XW9 A;  4NHZ A;  1G6W A;  1KNG A;  2GS3 A;  2K6V A;  3M8N A;  3HCZ A;  2GTU A;  2M80 A;  3ERG A;  4CY8 A;  3IR4 A;  2OT3 A;  4AKG A;  2HSM B;  1QXH A;  3UL3 A;  5DJM A;  3TKQ A;  1CQG A;  1YQ1 A;  1O8X A;  2YNX A;  2H1B A;  1XW5 A;  2DLX A;  1EGR A;  3FR6 A;  1XBS A;  1O7U A;  1XWC A;  3FZ4 A;  5ECL B;  1KBN A;  2DKH A;  2VUP A;  4JR4 A;  1SYR A;  4ZXG A;  4BVY A;  1YKA A;  2MMZ A;  3WD6 A;  3IA1 A;  4Z2U A;  3IPZ A;  3LJR A;  2IJY A;  3WT2 A;  1QMV A;  1GTU A;  1NW2 A;  3RHB A;  4K5R A;  2R3X A;  5FWG A;  1TK8 B;  1OYJ A;  8GSS A;  1B9X C;  2WVX B;  3ZMK A;  11GS A;  3GRX A;  4IQ1 A;  2H74 A;  3D6I A;  1A23 A;  2ON5 A;  4WF4 A;  3VFI A;  4ML6 A;  3L9U A;  3I9V 2;  4O5R A;  4ZL8 A;  3VLN A;  4O32 A;  2YWN A;  1F6M C;  2CVK A;  2VM2 A;  1BYE A;  4MF5 A;  3TKS C;  4K2X A;  4RI6 A;  3MIX A;  3OR5 A;  1AXD A;  1OC8 A;  2DC5 A;  3UVH A;  1UC7 A;  1U6T A;  3TCO A;  4CHS A;  4KUN A;  1X9M B;  2YN1 A;  2EIR A;  1R7H A;  1ERT A;  2A2R A;  4TVE A;  3QAW A;  5KOX A;  1G7O A;  1PRX A;  1GP1 A;  2WS2 A;  5C04 A;  4N11 A;  2OAC A;  4V2N A;  1Q98 A;  5G1L A;  3IBH A;  3I6A A;  1EWX A;  3RPN A;  4Q5F A;  19GS A;  1ZYQ B;  1TJD A;  3KXO A;  1K0B A;  1WRY A;  5G5F A;  2HRN A;  3LYP A;  5J9B A;  5J47 A;  3EU3 A;  4ECJ A;  3FMW A;  3F4S A;  4PUA A;  2GSS A;  5C00 A;  3GUR A;  2B1K A;  2IWT A;  1SJI A;  3L9V A;  2B7J A;  4PTS A;  4O5Q A;  3SBC A;  4GXZ A;  2O36 A;  1ERV A;  3K8N A;  2V6O A;  3VPT A;  1ZL9 A;  2JAD A;  1WIK A;  4FQU A;  2R0G A;  1Z3E A;  2WZS A;  5CAX A;  4HQS A;  3IAM 2;  4QMK A;  2HE3 A;  4WR4 A;  4TR3 A;  3I69 A;  2G0F A;  3TU3 B;  4N10 A;  5HR0 A;  4KDY A;  1XFL A;  4LL1 B;  12GS A;  1Z9H A;  3EUR A;  3MDK A;  6GSY A;  4OD7 A;  3DKS A;  1Y1U A;  1XXU A;  1ZZY A;  4POL A;  1B8X A;  4PNF A;  4KCE A;  1WJK A;  4G9H A;  2HRK B;  3KH9 A;  4K9Z A;  4Z7X A;  4KX4 A;  1SVO A;  1B48 A;  2LNS A;  4GSN A;  5JCU A;  4JED A;  1JZD A;  5LD0 A;  1PL2 A;  3KM6 A;  3ZL5 A;  1GH2 A;  4IQA A;  2I1U A;  2WB9 A;  1DSB A;  2H1A A;  4K7N A;  4L0U A;  1GNE A;  3ZIJ A;  5CRW A;  4WXT A;  3QDN A;  2TRX A;  3IXR A;  1UVZ A;  4FO5 A;  1QUW A;  1F3A A;  4HZ4 A;  3GTU A;  3HY2 A;  3ZIV A;  4KCA A;  5DAK B;  4WF5 A;  2WZ9 A;  4PQH A;  2M46 A;  2GQL A;  3IK7 A;  5KOW A;  3BCK A;  1A2M A;  5DQY A;  4CDO A;  2UZ8 A;  1I9D A;  2B5E A;  3GSS A;  4G2E A;  4E8E A;  3GKX A;  3LOR A;  2CA8 A;  1XOA A;  5CRD A;  3PPU A;  2R0P A;  2C3Q A;  2FHE A;  1ILO A;  2IMI A;  1HD2 A;  5CP1 A;  4MZB A;  1V40 A;  3KH7 A;  4TXV A;  3GN3 A;  4TRX A;  5J4Y A;  4ZL7 A;  6GST A;  4EC0 A;  4YAV A;  4I6X A;  3O6T A;  4OFT A;  2H1L A;  3ZFB A;  2FLS A;  1YF1 A;  1TDI A;  4IEL A;  4IJ3 A;  1F9M A;  1PSQ A;  1W4V A;  1TU8 A;  2AV4 A;  3FHK A;  4L8E A;  3TKS E;  3ZTL A;  4N3Z A;  2OA7 A;  1JFU A;  1NM3 A;  5HFG A;  4Q5Q A;  5LCZ A;  1Z7R A;  1HNC A;  3VWW A;  18GS A;  4KF9 A;  2LJA A;  4K7I A;  3UAR A;  4PQ1 A;  5BMU B;  4K0G A;  5DCG A;  2C0D A;  4IHU A;  2H1D A;  2V41 A;  1DE1 A;  4X43 A;  5CRH A;  1V2A A;  4MJE A;  3AY8 A;  3BD2 A;  1OC3 A;  1XWG A;  1Z6N A;  2HSY A;  1FOH A;  5ECS A;  1NHO A;  1M9B A;  1XPV A;  2E7P A;  5G1K A;  4YH2 A;  2F8A A;  3GYK A;  4O7H A;  2R37 A;  4PQI A;  1T4Y A;  3KMO A;  2LS5 A;  1ABA A;  5ECH B;  2VLU A;  3QD9 A;  1X5D A;  1JHB A;  3NOF A;  3HYP A;  4IP6 A;  2FUG 2;  3KGK A;  2HSM A;  3Q19 A;  1U87 A;  3FW2 A;  3MWH A;  3CSI A;  2FWH A;  2B1L A;  2VL9 A;  1PN9 A;  2J9H A;  3L0H A;  2VCX A;  1S3A A;  5ECK B;  5JCG A;  1GUM A;  5D9T A;  3DIE A;  3BJ5 A;  4IN0 A;  3GA4 A;  1GSY A;  1EEJ A;  4POB A;  1YJ6 A;  2GSR A;  3GV1 A;  4MH2 A;  2TRC P;  1AC1 A;  3L78 A;  1GTI A;  5J40 A;  3GL3 A;  4ZL9 A;  1SD9 A;  1TI1 A;  2DJ1 A;  3DGQ A;  5B6N A;  2C3N A;  2OE3 A;  3TJJ A;  4EDZ A;  2GZP A;  3GKK A;  1FOV A;  5IO2 A;  2WVX A;  4ACS A;  2D2Z A;  4BL7 B;  2O3E A;  1XWK A;  4I97 A;  3CYN A;  3A2X A;  2L6C A;  3M9J A;  4LMW A;  3D4M A;  3QFA C;  1PKW A;  4F0C A;  2EFD A;  1YF0 A;  3APQ A;  1GTB A;  1SL1 B;  2QA2 A;  4MLY A;  4FYU A;  3HDC A;  2KP1 A;  3G7Y A;  4PXO A;  2HSH A;  2LRT A;  4OCE A;  1LBK A;  2VD1 A;  1A0F A;  4TR0 A;  2WUL A;  5IMA A;  1XG8 A;  3CTF A;  2K18 A;  2XPE A;  4NV2 A;  4DSQ A;  4GQC A;  5ENU A;  2DIZ A;  1A8L A;  3EYT A;  2HZE B;  2XBQ A;  2YJH A;  2B3S A;  3TRQ A;  1QK8 A;  5IMV A;  1SK0 A;  2G2Q A;  2IMF A;  1PKZ A;  3HVN A;  1BQ7 A;  1A2J A;  3VUR A;  4JZQ A;  1DUG A;  3CBU A;  2A4H A;  2FWF A;  5G2Z A;  4YQU A;  5B6M A;  1SVM A;  4RQR A;  3VWV A;  3US3 A;  4P3Y B;  2VL3 A;  5IPH A;  3F4R A;  1VF4 A;  4Q5N A;  9GSS A;  5JCW A;  3H1N A;  6GSX A;  1K0C A;  2TIR A;  5ECQ B;  2GQM A;  1K3O A;  2F9S A;  3G7J A;  5E4W A;  2WRT A;  1YEP A;  4I2T A;  5AGY A;  1URM A;  1ZCP A;  5ECN B;  2OE1 A;  3TUE A;  3KEB A;  2YV7 A;  1R26 A;  3WYW A;  2KUC A;  5FT3 A;  3G9B A;  5DJL A;  2CX3 A;  2GQK A;  3FYG A;  4RI7 A;  2BMX A;  3KTL A;  2L5O A;  3F0I A;  3D4T A;  3CXG A;  2VOC A;  2ZNM A;  2VCZ A;  3ZVJ D;  2N5A A;  2M72 A;  3J7Y b;  2LRC A;  1TXU A;  5G31 A;  2P0G A;  1ERU A;  3VWU A;  3QCP A;  22GS A;  2JSY A;  1USB A;  1MEK A;  3M0F A;  4K7O A;  1JZO A;  2YWI A;  3RFR C;  5DVB A;  4AJ6 A;  4GCI A;  4HU7 A;  3E3E A;  2GVP A;  1AW9 A;  2HRK A;  5ELG A;  4K0N A;  4LMV A;  1YDK A;  1LJR A;  2C1Y A;  2B5Y A;  1EP7 A;  3GIX A;  1CQH A;  4LL4 B;  3IOS A;  5IMC A;  2PBJ A;  2KHP A;  4ZIJ A;  3ZML A;  16GS A;  4X4J A;  4F2I A;  4BPY A;  3TJB A;  3EE2 A;  2RUF A;  4D73 B;  3DML A;  5EY6 A;  4YKF A;  1O73 A;  2OE0 A;  3IHG A;  2GGT A;  1Z6M A;  1LU4 A;  2K8S A;  5D96 A;  3IV4 A;  2EFH A;  1YEW C;  1MD4 A;  1S3C A;  4TR4 A;  1SKW B;  3C8E A;  2DJ3 A;  2R4V A;  2C0E A;  3MNG A;  2HZF A;  4NXI A;  2LJR A;  1OC9 B;  2PN8 A;  2QKE A;  1R4W A;  4MPF A;  4KDU A;  4IBP A;  2DJJ A;  3RDW A;  3VI5 A;  1TRW A;  1C72 A;  4DSS B;  1PX6 A;  2P5R A;  3V1W A;  2MBS A;  3FRC A;  3QOU A;  4NWY A;  2CVB A;  3O76 A;  1HQO A;  2IMK A;  1OE8 A;  3DVW A;  3IHQ A;  2X8C A;  4USS A;  5D73 A;  5CYY A;  4NV5 A;  1ZOF A;  1BG5 A;  1H4O A;  3GUS A;  4OWY A;  3D22 A;  4KA0 A;  1XWB A;  4ZBD A;  2MBT A;  5EVO A;  2O5V A;  3U5R E;  3PIN A;  4GLT A;  4ML1 A;  5HFI A;  3ZRE A;  3GNJ A;  4V1A p;  2H72 A;  1FAA A;  3F3Q A;  2HNL A;  1XCC A;  2WVZ A;  2E0Q A;  2WDU A;  3KIJ A;  5H5R A;  3BCI A;  5CRG A;  1M0U A;  1J0F A;  2LST A;  2C3T A;  4F03 A;  3MYD A;  4WEY A;  1TOF A;  4KSO A;  4BVX A;  2HRF A;  4TXO A;  4IKH A;  2NBS A;  2P5Q A;  3HA9 A;  1ACV A;  1QGV A;  3IE3 A;  2L59 A;  1K3L A;  4PUR A;  3WT1 A;  5A1N A;  1GLP A;  5G30 A;  1DE2 A;  2QSI A;  4ULX A;  1M7T A;  1O85 A;  1MTC A;  3CWG A;  2DIY A;  2KLX A;  3HJM A;  5AIV A;  2NPB A;  2PUK C;  3ME8 A;  4DSR A;  1THX A;  2VCW A;  1AUC A;  5BMU A;  4F82 A;  1PQN A;  1V9W A;  4KAE A;  2ALB A;  3ED3 A;  4ILF A;  3P90 A;  5ECM B;  3CRU A;  3A5W A;  2N5B A;  4I5Q A;  4XRD A;  2YOI A;  4ZB6 A;  5IMZ A;  5AN1 A;  4MNN A;  5A5H B;  2A2P A;  1WOU A;  4XHM A;  2DJ0 A;  3UBL A;  2JZS A;  2FGX A;  1TK0 B;  5H5S A;  5ABR A;  3H79 A;  2KP2 A;  2AAW A;  2LNT A;  3KP9 A;  2UV8 G;  2R6K A;  2YWO A;  2FCH A;  3FR3 A;  1B9Y C;  2E2G A;  4LLR A;  1PA3 A;  2H76 A;  2PMT A;  4KSM A;  14GS A;  2IL3 A;  4EE0 A;  1SYX A;  5CNW A;  1QQ2 A;  3PH9 A;  3MSZ A;  1BG1 A;  3KCM A;  4EXJ A;  4ECI A;  2E2M A;  1GNW A;  2GT5 A;  4BVY B;  4TOP A;  2H71 A;  3H93 A;  3KMN A;  2YCD A;  3F3R A;  3UOM A;  2H8L A;  1R5P A;  3ZFL A;  3QPM A;  3Q18 A;  5ECO B;  1BAY A;  2C4J A;  5F06 A;  2RM5 A;  4HEA 2;  4BL7 A;  5IM9 A;  1SU9 A;  1AQV A;  3TOT A;  4NPB A;  4L0W A;  3S9F A;  4FYC A;  1F3B A;  4F9Z A;  4MP4 A;  2H70 A;  2CVD A;  2RLI A;  2L57 A;  5B8B A;  4HJ2 A;  4MCU A;  2YZH A;  2EFE A;  2AYT A;  3TJK A;  4ECB A;  3TRP A;  5F8B A;  4EIQ A;  5KEJ A;  2LEG A;  5COH A;  4IS0 A;  4BIK A;  4F0B A;  1SL0 B;  3ZYW A;  1VF3 A;  2RII A;  1T7P B;  4PNG A;  4X1U A;  2H19 A;  4ECC A;  1EGO A;  2CT6 A;  4W66 A;  4XS4 B;  2HZE A;  2LUS A;  3WGE A;  2EIQ A;  2WW1 A;  3TJF A;  4EF0 A;  4AKI A;  3FEU A;  2HFD A;  4KGI A;  4IJI A;  3DD3 A;  2EC4 A;  4MF6 A;  2OBK A;  2C80 A;  2LJK A;  1U3A A;  3HVS A;  4AKX B;  2MMN A;  2I81 A;  4OCF A;  4ISD A;  4HDE A;  2FA4 A;  1GSU A;  13GS A;  2XC2 A;  1UA5 A;  1SD8 A;  1EV9 A;  2DJK A;  4GWR A;  1X9W B;  3D0Z A;  2JSZ A;  1GRX A;  1SK2 A;  2CX4 A;  1PMT A;  4PHZ C;  5D9W A;  1X5C A;  1TRU A;  3CSH A;  3GX8 A;  4TKY A;  1RQM A;  3GKM A;  3TKR A;  6GSS A;  3UMA A;  2WW3 A;  4CY6 A;  3C73 A;  3A2W A;  5HQP A;  4MMM A;  5D9V A;  4MK3 A;  2GST A;  5KN0 A;  4EL1 A;  2DBC A;  2A2S A;  2H6Y A;  2IMD A;  3KZQ A;  5HR2 A;  1IYI A;  2CAQ A;  2WCI A;  2I3Y A;  3R2Q A;  5J9C A;  3CSJ A;  4WBR D;  5KN3 A;  2PPT A;  5AIS A;  4PGT A;  1XIY A;  2XBI A;  4I2U A;  2XPD A;  4JE1 A;  5D93 A;  1YY7 A;  5LNK e;  1AQX A;  1JZR A;  4GRF A;  4Q5R A;  4HS1 A;  3FR9 A;  4BA7 A;  4G0I A;  4KND A;  2FNO A;  1MDK A;  1THO A;  3KTB A;  1SJZ A;  2IFQ B;  1K0M A;  2F51 A;  1M9A A;  1X0R A;  1AIU A;  2HXK A;  2X8H A;  4N0Z A;  3M1G A;  5IO0 A;  3TOU A;  2Z9S A;  2YJ7 A;  2VL2 A;  3APO A;  4HZ2 A;  5A4V A;  3ZRD A;  3FY7 A;  4KDX A;  4TW5 A;  4K8M A;  3LXZ A;  1VF1 A;  1G0T A;  2IIY A;  5F0G A;  5GSS A;  3FK8 A;  4K2D A;  3GTU B;  4E68 A;  3HHV A;  5F05 A;  2DML A;  1OC9 A;  4Z2R A;  2LQO A;  1I5G A;  2HYX A;  3D5J A;  3QAV A;  4DEJ A;  3ZZX A;  3KD0 A;  4TR1 B;  3LYK A;  1TXX A;  1FW1 A;  2YV9 A;  3Q74 A;  3HZ4 A;  1K0N A;  1BF5 A;  1X9S B;  4I8B A;  1GSE A;  4MPG A;  3H8Q A;  1PFO A;  3E0U A;  2H01 A;  3GST A;  4OFN A;  5AIX A;  3DVX A;  2LQQ A;  4Z2T A;  5INY A;  2O89 A;  5A34 B;  1GTA A;  5DCH A;  10GS A;  4HI7 A;  1GSD A;  4J56 E;  5HR1 A;  4GTU A;  1M3J A;  1ZYN A;  3DRN A;  4XCS A;  2L6D A;  1OVN A;  3GKN A;  1FB6 A;  1GUK A;  4HU9 A;  2JAC A;  4AGS A;  5KN2 A;  4O92 A;  2DMM A;  4K1F A;  2DSA A;  1G7E A;  1X5E A;  4EDY A;  1TI3 A;  2CAI A;  2H6X A;  4O5U A;  2JZT A;  4YQV A;  3LGC A;  2CZ2 A;  3TB2 A;  2L4C A;  4J57 E;  2PGT A;  4ZIL A;  4NHW A;  1B4Q A;  5ELA A;  2EIO A;  2C8U A;  2V6K A;  1K0A A;  3QFB C;  4BWS A;  1V57 A;  2VM1 A;  2PER A;  3P2A A;  3LFL A;  4L5L A;  4MZC A;  2F8F A;  1T8E B;  3SWL A;  3C1S A;  5ECP B;  5A4U A;  3M9K A;  1Y6E A;  4OMV A;  4ZB8 A;  3BOA A;  5A5H A;  1T4Z A;  3A5I A;  3IC8 A;  4GF0 A;  3GHA A;  3QAG A;  3QMX A;  1TW9 A;  1FO5 A;  3EPT A;  1YEX A;  1V58 A;  2YP6 A;  2MMA A;  4V2L A;  4YKG A;  1E2Y A;  17GS A;  2GLR A;  4GQF A;  2H73 A;  3CQF A;  4AJ7 A;  1HNA A;  2C0G A;  20GS A;  3HKR A;  2RUE A;  2N5F A;  3HZ8 A;  4EIP A;  3HMJ G;  4WKW A;  3ISO A;  2K8V A;  1S4B P;  1XVW A;  3H4K A;  3NIV A;  2RM6 A;  3HJO A;  1K0O A;  1JLW A;  2GSQ A;  3A3T A;  2F3M A;  1OKD A;  1GL8 A;  3TKP A;  3VPQ A;  2V32 A;  1A8Y A;  2OAD A;  4H86 A;  4AJ8 A;  2H6Z A;  5DQS A;  2WVY A;  1XVQ A;  1Y25 A;  3PR8 A;  1EOH A;  2R5G A;  1XW6 A;  1DBY A;  1JLV A;  5DAK A;  1WMJ A;  2K9F A;  1HNB A;  3F9U A;  1SKS B;  1E6B A;  3UAP A;  4K6X A;  2NDO A;  1XOB A;  3RHC A;  5D9X A;  5EL8 A;  3IAS 2;  5BRT A;  4PI2 C;  1WWJ A;  4MJA A;  2REM A;  4AI6 A;  1TP9 A;  2ZUP A;  4FH8 A;  4XS1 A;  3DEX A;  4XS6 A;  2PU9 C;  4JRR A;  2FWG A;  1AQW A;  3I43 A;  4POK A;  3LSZ A;  3TRX A;  4G01 A;  2LTK A;  4NMU A;  4QL9 A;  1FG4 A;  1N2A A;  4EO3 A;  1WP0 A;  3F4T A;  4JBB A;  5JWO B;  3L9S A;  2X4A A;  2MMO A;  3U6V A;  3C71 A;  5IQY A;  1ERW A;  5B8A A;  1EZK A;  4MF7 A;  1M99 A;  5IMD A;  3F8U A;  4NAX A;  1VGL A;  4XS4 A;  5ID2 B;  5F07 A;  2V2G A;  3A2V A;  3EWL A;  2HQT A;  3N5O A;  2HSN B;  2HI7 A;  3NZN A;  2VCQ A;  1SKR B;  3EMP A;  2LKU A;  1M3I A;  4DVC A;  4HJM A;  4AKH A;  1F37 A;  1U88 A;  3UEM A;  4BWQ A;  1TRS A;  4XRA A;  2B6M A;  2HT9 A;  2V1M A; 
#chains in the Genus database with same CATH homology
 4EKZ A;  3G7I A;  5A5K A;  4XIH A;  4ZB9 A;  5H5Q A;  5G5E A;  1BJX A;  3EVI A;  3W8S A;  1OE7 A;  6GSW A;  3APS A;  6GSU A;  2VCT A;  2YWM A;  3GH9 A;  4KE3 A;  2OJL A;  3HD5 A;  5IOW A;  3F6D A;  4GDF A;  5DAL B;  1YZX A;  1V98 A;  2ZCT A;  2XHF A;  3W8J A;  3JCM L;  3CTG A;  2QA1 A;  4FIW A;  1J08 A;  3VI7 A;  4EUY A;  1TK5 B;  3D21 A;  5HFK A;  1Q4J A;  3ZVJ A;  3VK9 A;  1FHE A;  3RBT A;  3N9J A;  2H0I A;  4IP1 A;  2VO4 A;  1Z7P A;  1SL2 B;  4ZB7 A;  3DWV A;  2L5L A;  1GSS A;  2B5X A;  3EU4 A;  4KH7 A;  2FD3 A;  4XTS A;  5GAP D;  1H75 A;  3VWX A;  3C1R A;  3J7Y k;  3CRT A;  3FKF A;  1GSQ A;  5DDL A;  5IIZ A;  1MDJ A;  2OKA A;  1GLQ A;  2BTO T;  3KJY A;  2BJX A;  2FA8 A;  2AJQ B;  2NTO A;  4IW9 A;  4YQM A;  1M2B A;  4JR6 A;  2IFQ A;  6GSV A;  2EFC A;  1IYH A;  3O3T A;  2VD0 A;  5IPG A;  3UBK A;  2H75 A;  4POM A;  4LA1 A;  1BX9 A;  2JU5 A;  5CRE A;  5J41 A;  2GZY A;  4KB3 A;  1SEN A;  2O87 A;  1ZMA A;  3WGD A;  4PX1 A;  2I9H A;  3ZLP A;  1A24 A;  2VIM A;  4HUA A;  2VLV A;  4WBJ A;  1EEM A;  2O8V B;  2DKI A;  5CO3 A;  2VLT A;  2AUV A;  4ZBB A;  1ZYP A;  2PWJ A;  2JZR A;  5J3R A;  4OO5 A;  4HQZ A;  4G19 A;  3TGZ A;  2X49 A;  1QFN A;  1EOG A;  5JWQ B;  1ZYE A;  1OKT A;  3ZIT A;  3ERW A;  4G0K A;  3BBY A;  4E8H A;  1T1V A;  2FY6 A;  1EP8 A;  2IN3 A;  1PN0 A;  4TR1 A;  1M2D A;  1F2E A;  3UVT A;  1XZO A;  1GWC A;  1O6J A;  2YPM A;  1XWA A;  2ES7 A;  3TDG A;  1BED A;  4J2F A;  5L71 A;  3R3E A;  1K3Y A;  2GZZ A;  4K5S A;  5A34 A;  3W6G A;  4MA9 A;  2YAN A;  2L4Q A;  2VAF A;  4QQ7 A;  1S3D A;  3Q6O A;  1VRS D;  3WGX A;  1FVJ A;  5IOX A;  2CV4 A;  3EMX A;  4G10 A;  1OAZ A;  2H30 A;  2KOK A;  4MJB A;  4BVX B;  2H0H A;  2WGR A;  4TXO B;  3F6F A;  2HLS A;  1T3B A;  2CZ3 A;  2O7K A;  3HVX A;  5A1N B;  1FVK A;  1RK4 A;  4MJC A;  4G0L A;  1FB0 A;  2R2J A;  2GDR A;  1Z5Y E;  3M3M A;  5HR3 A;  3TJG A;  1JZW A;  2OBI A;  4V1A g;  3GX0 A;  3IDV A;  1SK1 A;  3FZ5 A;  5JWR B;  2JL4 A;  3HVV A;  4N0V A;  1TU7 A;  1N25 A;  4ICY A;  1R5A A;  3RAZ A;  2CQ9 A;  3P7X A;  4HOJ A;  1O81 A;  5B7C A;  4RQX A;  2IPA A;  1ZGN A;  3EIN A;  3QR6 A;  1GSF A;  3IK9 A;  1A2L A;  1KTE A;  1SJ6 A;  2J23 A;  4IGJ A;  2LV3 A;  4JU5 A;  4YAP A;  1GUH A;  3GFK A;  3GH6 A;  3ERF A;  1UN2 A;  4MAB A;  3ME7 A;  3IRA A;  1NHY A;  5J4V A;  3CMI A;  2A4V A;  2IME A;  3LXT A;  4FYB A;  2LRN A;  2YZU A;  1TTZ A;  4D73 A;  5J4U A;  1WPI A;  4IVF A;  1A0R P;  2QGV A;  1AAZ A;  1TRV A;  3GMF A;  3C7M A;  1ST9 A;  3LEF A;  3E9J B;  1KEB A;  1T00 A;  4KW6 A;  4V2M A;  2H1G A;  1YKC A;  3FZ9 A;  3LW9 A;  4QL7 A;  3LG6 A;  1HYU A;  1G6Y A;  5E59 A;  2P31 A;  1O8W A;  4TN8 A;  4L5O A;  5EPF A;  5D8I A;  2AHE A;  3F63 A;  5A4W A;  1WE0 A;  1VF2 A;  1NSW A;  2WJU A;  4OO4 A;  1U3I A;  4DSS A;  3RPP A;  2DJ2 A;  4WET A;  1PL1 A;  2O85 A;  4MZW A;  4MDC A;  4AF2 A;  2MYG A;  3UIW A;  2B7K A;  4N30 A;  1N8J A;  5GST A;  4A5P A;  1PX7 A;  3HJP A;  3EC3 A;  5DBQ A;  2VKZ G;  1K0D A;  4MH3 A;  4OFM A;  2MZC A;  1RW1 A;  2WFC A;  2X8G A;  1EV4 A;  5J5N A;  2H0G A;  5ID2 A;  4GST A;  2AB6 A;  5ECR B;  1MDI A;  2HSN A;  3FZA A;  2ON7 A;  1PD2 1;  4X0X A;  7GSS A;  3L4N A;  2VL2 C;  2I4A A;  3HXS A;  3IC4 A;  5GZZ B;  4CW9 A;  5GAN D;  3PGT A;  2H66 A;  5FHI A;  2HRA A;  4ID0 A;  4EVM A;  1ON4 A;  2X64 A;  1MD3 A;  3MAK A;  3KP8 A;  1W89 A;  1YVL A;  4WR5 A;  3LWA A;  3P8W A;  4PUF C;  3DXB A;  2GT6 A;  2QC7 A;  2C0F A;  4ZBA A;  3LQ7 A;  5DAL A;  2PVO C;  2R0C A;  1ML6 A;  1PGT A;  1M2A A;  3DYR A;  5KN1 A;  4GSS A;  3GL5 A;  4RUV A;  1GUL A;  2FWE A;  1TKD B;  5ECI B;  3UJ1 A;  1B4P A;  2VCV A;  1J9B A;  1SVL A;  2PVQ A;  5IMF A;  2X99 A;  3TKS A;  2NVL A;  1XW9 A;  4NHZ A;  1G6W A;  1KNG A;  2GS3 A;  2K6V A;  3M8N A;  3HCZ A;  2GTU A;  2M80 A;  3ERG A;  4CY8 A;  3IR4 A;  2OT3 A;  4AKG A;  2HSM B;  1QXH A;  3UL3 A;  5DJM A;  3TKQ A;  1CQG A;  1YQ1 A;  1O8X A;  2YNX A;  2H1B A;  1XW5 A;  2DLX A;  1EGR A;  3FR6 A;  1XBS A;  1O7U A;  1XWC A;  3FZ4 A;  5ECL B;  1KBN A;  2DKH A;  2VUP A;  4JR4 A;  1SYR A;  4ZXG A;  4BVY A;  1YKA A;  2MMZ A;  3WD6 A;  3IA1 A;  4Z2U A;  3IPZ A;  3LJR A;  2IJY A;  3WT2 A;  1QMV A;  1GTU A;  1NW2 A;  3RHB A;  4K5R A;  2R3X A;  5FWG A;  1TK8 B;  1OYJ A;  8GSS A;  1B9X C;  3ZMK A;  11GS A;  3GRX A;  4IQ1 A;  2H74 A;  3D6I A;  1A23 A;  2ON5 A;  4WF4 A;  3VFI A;  4ML6 A;  3L9U A;  3I9V 2;  4O5R A;  4ZL8 A;  3VLN A;  4O32 A;  2YWN A;  1F6M C;  2CVK A;  2VM2 A;  1BYE A;  4MF5 A;  3TKS C;  4K2X A;  4RI6 A;  3MIX A;  3OR5 A;  1AXD A;  1OC8 A;  2DC5 A;  3UVH A;  1UC7 A;  1U6T A;  3TCO A;  4CHS A;  4KUN A;  1X9M B;  2YN1 A;  2EIR A;  1R7H A;  1ERT A;  2A2R A;  4TVE A;  3QAW A;  5KOX A;  1G7O A;  1PRX A;  1GP1 A;  2WS2 A;  5C04 A;  4N11 A;  2OAC A;  4V2N A;  1Q98 A;  5G1L A;  3IBH A;  3I6A A;  1EWX A;  3RPN A;  4Q5F A;  19GS A;  1ZYQ B;  1TJD A;  3KXO A;  1K0B A;  1WRY A;  5G5F A;  2HRN A;  3LYP A;  5J9B A;  5J47 A;  3EU3 A;  4ECJ A;  3FMW A;  3F4S A;  4PUA A;  2GSS A;  5C00 A;  3GUR A;  2B1K A;  2IWT A;  1SJI A;  3L9V A;  2B7J A;  4PTS A;  4O5Q A;  3SBC A;  4GXZ A;  1ERV A;  3K8N A;  2V6O A;  3VPT A;  1ZL9 A;  2JAD A;  1WIK A;  4FQU A;  2R0G A;  1Z3E A;  5CAX A;  4HQS A;  3IAM 2;  4QMK A;  2HE3 A;  4WR4 A;  4TR3 A;  3I69 A;  2G0F A;  3TU3 B;  4N10 A;  5HR0 A;  4KDY A;  1XFL A;  4LL1 B;  12GS A;  1Z9H A;  3EUR A;  3MDK A;  6GSY A;  4OD7 A;  3DKS A;  1Y1U A;  1XXU A;  1ZZY A;  4POL A;  1B8X A;  4PNF A;  4KCE A;  1WJK A;  4G9H A;  2HRK B;  3KH9 A;  4K9Z A;  4Z7X A;  4KX4 A;  1SVO A;  1B48 A;  2LNS A;  4GSN A;  5JCU A;  4JED A;  1JZD A;  5LD0 A;  1PL2 A;  3KM6 A;  3ZL5 A;  1GH2 A;  4IQA A;  2I1U A;  2WB9 A;  1DSB A;  2H1A A;  4K7N A;  4L0U A;  1GNE A;  3ZIJ A;  5CRW A;  4WXT A;  3QDN A;  2TRX A;  3IXR A;  1UVZ A;  4FO5 A;  1QUW A;  1F3A A;  4HZ4 A;  3GTU A;  3HY2 A;  3ZIV A;  4KCA A;  5DAK B;  4WF5 A;  2WZ9 A;  4PQH A;  2M46 A;  2GQL A;  3IK7 A;  5KOW A;  3BCK A;  1A2M A;  5DQY A;  4CDO A;  2UZ8 A;  1I9D A;  2B5E A;  3GSS A;  4G2E A;  4E8E A;  3GKX A;  3LOR A;  2CA8 A;  1XOA A;  5CRD A;  3PPU A;  2R0P A;  2C3Q A;  2FHE A;  1ILO A;  2IMI A;  1HD2 A;  5CP1 A;  4MZB A;  1V40 A;  3KH7 A;  4TXV A;  3GN3 A;  4TRX A;  5J4Y A;  4ZL7 A;  6GST A;  4EC0 A;  4YAV A;  4I6X A;  3O6T A;  4OFT A;  2H1L A;  3ZFB A;  2FLS A;  1YF1 A;  1TDI A;  4IEL A;  4IJ3 A;  1F9M A;  1PSQ A;  1W4V A;  1TU8 A;  2AV4 A;  3FHK A;  4L8E A;  3TKS E;  3ZTL A;  4N3Z A;  2OA7 A;  1JFU A;  1NM3 A;  5HFG A;  4Q5Q A;  5LCZ A;  1Z7R A;  1HNC A;  3VWW A;  18GS A;  4KF9 A;  2LJA A;  4K7I A;  3UAR A;  4PQ1 A;  5BMU B;  4K0G A;  5DCG A;  2C0D A;  4IHU A;  2H1D A;  2V41 A;  1DE1 A;  4X43 A;  5CRH A;  1V2A A;  4MJE A;  3AY8 A;  3BD2 A;  1OC3 A;  1XWG A;  1Z6N A;  2HSY A;  1FOH A;  5ECS A;  1NHO A;  1M9B A;  1XPV A;  2E7P A;  5G1K A;  4YH2 A;  2F8A A;  3GYK A;  4O7H A;  2R37 A;  4PQI A;  1T4Y A;  3KMO A;  2LS5 A;  1ABA A;  5ECH B;  2VLU A;  3QD9 A;  1X5D A;  1JHB A;  3NOF A;  3HYP A;  4IP6 A;  2FUG 2;  3KGK A;  2HSM A;  3Q19 A;  1U87 A;  3FW2 A;  3MWH A;  3CSI A;  2FWH A;  2B1L A;  2VL9 A;  1PN9 A;  2J9H A;  3L0H A;  2VCX A;  1S3A A;  5ECK B;  5JCG A;  1GUM A;  5D9T A;  3DIE A;  3BJ5 A;  4IN0 A;  3GA4 A;  1GSY A;  1EEJ A;  4POB A;  1YJ6 A;  2GSR A;  3GV1 A;  4MH2 A;  2TRC P;  1AC1 A;  3L78 A;  1GTI A;  5J40 A;  3GL3 A;  4ZL9 A;  1SD9 A;  1TI1 A;  2DJ1 A;  3DGQ A;  5B6N A;  2C3N A;  2OE3 A;  3TJJ A;  4EDZ A;  2GZP A;  3GKK A;  1FOV A;  5IO2 A;  4ACS A;  2D2Z A;  4BL7 B;  1XWK A;  4I97 A;  3CYN A;  3A2X A;  2L6C A;  3M9J A;  4LMW A;  3D4M A;  3QFA C;  1PKW A;  4F0C A;  2EFD A;  1YF0 A;  3APQ A;  1GTB A;  1SL1 B;  2QA2 A;  4MLY A;  4FYU A;  3HDC A;  2KP1 A;  3G7Y A;  4PXO A;  2HSH A;  2LRT A;  4OCE A;  1LBK A;  2VD1 A;  1A0F A;  4TR0 A;  2WUL A;  5IMA A;  3CTF A;  2K18 A;  2XPE A;  4NV2 A;  4DSQ A;  4GQC A;  5ENU A;  2DIZ A;  1A8L A;  3EYT A;  2HZE B;  2XBQ A;  2YJH A;  2B3S A;  3TRQ A;  1QK8 A;  5IMV A;  1SK0 A;  2G2Q A;  2IMF A;  1PKZ A;  1BQ7 A;  1A2J A;  3VUR A;  4JZQ A;  1DUG A;  3CBU A;  2A4H A;  2FWF A;  5G2Z A;  4YQU A;  5B6M A;  1SVM A;  4RQR A;  3VWV A;  3US3 A;  4P3Y B;  2VL3 A;  5IPH A;  3F4R A;  1VF4 A;  4Q5N A;  9GSS A;  5JCW A;  3H1N A;  6GSX A;  1K0C A;  2TIR A;  5ECQ B;  2GQM A;  1K3O A;  2F9S A;  3G7J A;  5E4W A;  2WRT A;  1YEP A;  4I2T A;  5AGY A;  1URM A;  1ZCP A;  5ECN B;  2OE1 A;  3TUE A;  3KEB A;  2YV7 A;  1R26 A;  3WYW A;  2KUC A;  5FT3 A;  3G9B A;  5DJL A;  2CX3 A;  2GQK A;  3FYG A;  4RI7 A;  2BMX A;  3KTL A;  2L5O A;  3F0I A;  3D4T A;  3CXG A;  2VOC A;  2ZNM A;  2VCZ A;  3ZVJ D;  2N5A A;  2M72 A;  3J7Y b;  2LRC A;  1TXU A;  5G31 A;  2P0G A;  1ERU A;  3VWU A;  3QCP A;  22GS A;  2JSY A;  1USB A;  1MEK A;  3M0F A;  4K7O A;  1JZO A;  2YWI A;  5DVB A;  4AJ6 A;  4GCI A;  4HU7 A;  3E3E A;  2GVP A;  1AW9 A;  2HRK A;  5ELG A;  4K0N A;  4LMV A;  1YDK A;  1LJR A;  2C1Y A;  2B5Y A;  1EP7 A;  3GIX A;  1CQH A;  4LL4 B;  3IOS A;  5IMC A;  2PBJ A;  2KHP A;  4ZIJ A;  3ZML A;  16GS A;  4X4J A;  4F2I A;  4BPY A;  3TJB A;  3EE2 A;  2RUF A;  4D73 B;  3DML A;  5EY6 A;  4YKF A;  1O73 A;  2OE0 A;  3IHG A;  2GGT A;  1Z6M A;  1LU4 A;  2K8S A;  5D96 A;  3IV4 A;  2EFH A;  1MD4 A;  1S3C A;  4TR4 A;  1SKW B;  3C8E A;  2DJ3 A;  2R4V A;  2C0E A;  3MNG A;  2HZF A;  4NXI A;  2LJR A;  1OC9 B;  2PN8 A;  2QKE A;  1R4W A;  4MPF A;  4KDU A;  4IBP A;  2DJJ A;  3RDW A;  3VI5 A;  1TRW A;  1C72 A;  4DSS B;  1PX6 A;  2P5R A;  3V1W A;  2MBS A;  3FRC A;  3QOU A;  4NWY A;  2CVB A;  3O76 A;  1HQO A;  2IMK A;  1OE8 A;  3DVW A;  3IHQ A;  2X8C A;  4USS A;  5D73 A;  5CYY A;  4NV5 A;  1ZOF A;  1BG5 A;  1H4O A;  3GUS A;  4OWY A;  3D22 A;  4KA0 A;  1XWB A;  4ZBD A;  2MBT A;  5EVO A;  2O5V A;  3U5R E;  3PIN A;  4GLT A;  4ML1 A;  5HFI A;  3ZRE A;  3GNJ A;  4V1A p;  2H72 A;  1FAA A;  3F3Q A;  2HNL A;  1XCC A;  2E0Q A;  2WDU A;  3KIJ A;  5H5R A;  3BCI A;  5CRG A;  1M0U A;  1J0F A;  2LST A;  2C3T A;  4F03 A;  3MYD A;  4WEY A;  1TOF A;  4KSO A;  4BVX A;  2HRF A;  4TXO A;  4IKH A;  2NBS A;  2P5Q A;  3HA9 A;  1ACV A;  1QGV A;  3IE3 A;  2L59 A;  1K3L A;  4PUR A;  3WT1 A;  5A1N A;  1GLP A;  5G30 A;  1DE2 A;  2QSI A;  4ULX A;  1M7T A;  1O85 A;  1MTC A;  3CWG A;  2DIY A;  2KLX A;  3HJM A;  5AIV A;  2NPB A;  2PUK C;  3ME8 A;  4DSR A;  1THX A;  2VCW A;  1AUC A;  5BMU A;  4F82 A;  1PQN A;  1V9W A;  4KAE A;  2ALB A;  3ED3 A;  4ILF A;  3P90 A;  5ECM B;  3CRU A;  3A5W A;  2N5B A;  4I5Q A;  4XRD A;  2YOI A;  4ZB6 A;  5IMZ A;  5AN1 A;  4MNN A;  5A5H B;  2A2P A;  1WOU A;  4XHM A;  2DJ0 A;  3UBL A;  2JZS A;  2FGX A;  1TK0 B;  5H5S A;  5ABR A;  3H79 A;  2KP2 A;  2AAW A;  2LNT A;  3KP9 A;  2UV8 G;  2R6K A;  2YWO A;  2FCH A;  3FR3 A;  1B9Y C;  2E2G A;  4LLR A;  1PA3 A;  2H76 A;  2PMT A;  4KSM A;  14GS A;  2IL3 A;  4EE0 A;  1SYX A;  5CNW A;  1QQ2 A;  3PH9 A;  3MSZ A;  1BG1 A;  3KCM A;  4EXJ A;  4ECI A;  2E2M A;  1GNW A;  2GT5 A;  4BVY B;  4TOP A;  2H71 A;  3H93 A;  3KMN A;  2YCD A;  3F3R A;  3UOM A;  2H8L A;  1R5P A;  3ZFL A;  3QPM A;  3Q18 A;  5ECO B;  1BAY A;  2C4J A;  5F06 A;  2RM5 A;  4HEA 2;  4BL7 A;  5IM9 A;  1SU9 A;  1AQV A;  3TOT A;  4NPB A;  4L0W A;  3S9F A;  4FYC A;  1F3B A;  4F9Z A;  4MP4 A;  2H70 A;  2CVD A;  2RLI A;  2L57 A;  5B8B A;  4HJ2 A;  4MCU A;  2YZH A;  2EFE A;  2AYT A;  3TJK A;  4ECB A;  3TRP A;  5F8B A;  4EIQ A;  5KEJ A;  2LEG A;  5COH A;  4IS0 A;  4F0B A;  1SL0 B;  3ZYW A;  1VF3 A;  2RII A;  1T7P B;  4PNG A;  4X1U A;  2H19 A;  4ECC A;  1EGO A;  2CT6 A;  4W66 A;  4XS4 B;  2HZE A;  2LUS A;  3WGE A;  2EIQ A;  3TJF A;  4EF0 A;  4AKI A;  3FEU A;  2HFD A;  4KGI A;  4IJI A;  3DD3 A;  2EC4 A;  4MF6 A;  2OBK A;  2C80 A;  2LJK A;  1U3A A;  3HVS A;  4AKX B;  2MMN A;  2I81 A;  4OCF A;  4ISD A;  4HDE A;  2FA4 A;  1GSU A;  13GS A;  2XC2 A;  1UA5 A;  1SD8 A;  1EV9 A;  2DJK A;  4GWR A;  1X9W B;  3D0Z A;  2JSZ A;  1GRX A;  1SK2 A;  2CX4 A;  1PMT A;  5D9W A;  1X5C A;  1TRU A;  3CSH A;  3GX8 A;  4TKY A;  1RQM A;  3GKM A;  3TKR A;  6GSS A;  3UMA A;  4CY6 A;  3C73 A;  3A2W A;  5HQP A;  4MMM A;  5D9V A;  4MK3 A;  2GST A;  5KN0 A;  4EL1 A;  2DBC A;  2A2S A;  2H6Y A;  2IMD A;  3KZQ A;  5HR2 A;  1IYI A;  2CAQ A;  2WCI A;  2I3Y A;  3R2Q A;  5J9C A;  3CSJ A;  4WBR D;  5KN3 A;  2PPT A;  5AIS A;  4PGT A;  1XIY A;  2XBI A;  4I2U A;  2XPD A;  4JE1 A;  5D93 A;  1YY7 A;  5LNK e;  1AQX A;  1JZR A;  4GRF A;  4Q5R A;  4HS1 A;  3FR9 A;  4BA7 A;  4G0I A;  4KND A;  2FNO A;  1MDK A;  1THO A;  3KTB A;  1SJZ A;  2IFQ B;  1K0M A;  2F51 A;  1M9A A;  1X0R A;  1AIU A;  2HXK A;  2X8H A;  4N0Z A;  3M1G A;  5IO0 A;  3TOU A;  2Z9S A;  2YJ7 A;  2VL2 A;  3APO A;  4HZ2 A;  5A4V A;  3ZRD A;  3FY7 A;  4KDX A;  4TW5 A;  4K8M A;  3LXZ A;  1VF1 A;  1G0T A;  2IIY A;  5F0G A;  5GSS A;  3FK8 A;  4K2D A;  3GTU B;  4E68 A;  3HHV A;  5F05 A;  2DML A;  1OC9 A;  4Z2R A;  2LQO A;  1I5G A;  2HYX A;  3D5J A;  3QAV A;  4DEJ A;  3ZZX A;  3KD0 A;  4TR1 B;  3LYK A;  1TXX A;  1FW1 A;  2YV9 A;  3Q74 A;  3HZ4 A;  1K0N A;  1BF5 A;  1X9S B;  4I8B A;  1GSE A;  4MPG A;  3H8Q A;  3E0U A;  2H01 A;  3GST A;  4OFN A;  5AIX A;  3DVX A;  2LQQ A;  4Z2T A;  5INY A;  2O89 A;  5A34 B;  1GTA A;  5DCH A;  10GS A;  4HI7 A;  1GSD A;  4J56 E;  5HR1 A;  4GTU A;  1ZYN A;  3DRN A;  4XCS A;  2L6D A;  1OVN A;  3GKN A;  1FB6 A;  1GUK A;  4HU9 A;  2JAC A;  4AGS A;  5KN2 A;  4O92 A;  2DMM A;  4K1F A;  2DSA A;  1G7E A;  1X5E A;  4EDY A;  1TI3 A;  2CAI A;  2H6X A;  4O5U A;  2JZT A;  4YQV A;  3LGC A;  2CZ2 A;  3TB2 A;  2L4C A;  4J57 E;  2PGT A;  4ZIL A;  4NHW A;  1B4Q A;  5ELA A;  2EIO A;  2C8U A;  2V6K A;  1K0A A;  3QFB C;  4BWS A;  1V57 A;  2VM1 A;  2PER A;  3P2A A;  3LFL A;  4L5L A;  4MZC A;  2F8F A;  1T8E B;  3SWL A;  3C1S A;  5ECP B;  5A4U A;  3M9K A;  1Y6E A;  4OMV A;  4ZB8 A;  3BOA A;  5A5H A;  1T4Z A;  3A5I A;  3IC8 A;  4GF0 A;  3GHA A;  3QAG A;  3QMX A;  1TW9 A;  1FO5 A;  3EPT A;  1YEX A;  1V58 A;  2YP6 A;  2MMA A;  4V2L A;  4YKG A;  1E2Y A;  17GS A;  2GLR A;  4GQF A;  2H73 A;  4AJ7 A;  1HNA A;  2C0G A;  20GS A;  3HKR A;  2RUE A;  2N5F A;  3HZ8 A;  4EIP A;  3HMJ G;  4WKW A;  3ISO A;  2K8V A;  1XVW A;  3H4K A;  3NIV A;  2RM6 A;  3HJO A;  1K0O A;  1JLW A;  2GSQ A;  3A3T A;  2F3M A;  1OKD A;  1GL8 A;  3TKP A;  3VPQ A;  2V32 A;  1A8Y A;  2OAD A;  4H86 A;  4AJ8 A;  2H6Z A;  5DQS A;  1XVQ A;  1Y25 A;  3PR8 A;  1EOH A;  2R5G A;  1XW6 A;  1DBY A;  1JLV A;  5DAK A;  1WMJ A;  2K9F A;  1HNB A;  3F9U A;  1SKS B;  1E6B A;  3UAP A;  4K6X A;  2NDO A;  1XOB A;  3RHC A;  5D9X A;  5EL8 A;  3IAS 2;  5BRT A;  1WWJ A;  4MJA A;  2REM A;  4AI6 A;  1TP9 A;  2ZUP A;  4FH8 A;  4XS1 A;  3DEX A;  4XS6 A;  2PU9 C;  4JRR A;  2FWG A;  1AQW A;  3I43 A;  4POK A;  3LSZ A;  3TRX A;  4G01 A;  2LTK A;  4NMU A;  4QL9 A;  1FG4 A;  1N2A A;  4EO3 A;  1WP0 A;  3F4T A;  4JBB A;  5JWO B;  3L9S A;  2X4A A;  2MMO A;  3U6V A;  3C71 A;  5IQY A;  1ERW A;  5B8A A;  1EZK A;  4MF7 A;  1M99 A;  5IMD A;  3F8U A;  4NAX A;  1VGL A;  4XS4 A;  5ID2 B;  5F07 A;  2V2G A;  3A2V A;  3EWL A;  2HQT A;  3N5O A;  2HSN B;  2HI7 A;  3NZN A;  2VCQ A;  1SKR B;  3EMP A;  2LKU A;  4DVC A;  4HJM A;  4AKH A;  1F37 A;  1U88 A;  3UEM A;  4BWQ A;  1TRS A;  4XRA A;  2B6M A;  2HT9 A;  2V1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...