3KMNA

Crystal structure of the human apo gst pi c47s/y108v double mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Diuretic drug binding to human glutathione transferase P1-1: potential role of CYS101 revealed in the double mutant C47S/Y108V
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kmnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kmnA01
4QL9A 1X9SB 3QAGA 3CXGA 3KEBA 1USBA 1FO5A 2N5BA 5EPFA 2DLXA 4POBA 3FY7A 3O3TA 1PA3A 4TR1B 3APQA 2C3NA 3HDCA 1HD2A 3VK9A 4I8BA 3ZRDA 3BBYA 1TRWA 2YV9A 3EE2A 5FWGA 4POMA 4OO4A 1K0BA 2JACA 5ELAA 5KEJA 3ERFA 1RW1A 2OBKA 2QGVA 4L8EA 1GTIA 2VLUA 3ERGA 1MDKA 4WBJA 1PKZA 4MABA 3GKKA 4K8MA 1QXHA 2FGXA 3HXSA 3G9BA 3MAKA 4JEDA 2R5GA 2HI7A 2YNXA 2V2GA 3TDGA 2IMKA 4BVXA 2P31A 2P0GA 3LGCA 4XRDA 4WF4A 1SK1A 1SK2A 2RM5A 2OJLA 4MZWA 2C0GA 3HVSA 5ECIB 1F6MC 1WJKA 2LJRA 1J0FA 4DSQA 3LG6A 5GZZB 4I97A 18GSA 4TR4A 3QAWA 1FAAA 2FA4A 3VPQA 2VL3A 3FHKA 1J9BA 4DSSB 1RQMA 2A2SA 2NDOA 4XS6A 5EL8A 1C72A 3TRQA 3QR6A 4WXTA 2YZUA 3GHAA 5IO0A 2E2GA 1X5DA 5DJLA 1LU4A 2H6YA 2H30A 3TJBA 5JWQB 2FWEA 3F3RA 2FUG2 3EC3A 1XWAA 2IWTA 2LRTA 3M9KA 1R26A 5CNWA 1OVNA 1YKCA 4XCSA 4NHWA 1DE1A 2I1UA 4YAPA 2H8LA 3UVTA 5ECLB 4I2UA 1T00A 2B6MA 1TRVA 12GSA 2I4AA 3G7JA 4E8EA 1KEBA 3FW2A 2DMLA 5HQPA 1G7EA 3UL3A 1GUHA 4FYCA 1M9BA 2H1AA 3BCIA 3CTFA 1BYEA 4OFMA 1XWGA 4J56E 4ZL7A 4N10A 1B8XA 3I6AA 3FK8A 4OMVA 1ML6A 2F8AA 4N0ZA 4O92A 1PRXA 2KOKA 2IMFA 2R37A 3C73A 2TRXA 3GN3A 4JR6A 2HRAA 4L0WA 1VF1A 4KNDA 4ZL8A 1EZKA 2L59A 1BX9A 3ZIVA 2KHPA 3M1GA 2OE0A 3IC4A 3KD0A 3P8WA 2H6XA 16GSA 3IAS2 5B8BA 5D8IA 2HSMA 2L6CA 5D9XA 3DXBA 5C04A 1FOVA 1HNBA 1FW1A 2L57A 3F8UA 4BWSA 3WGEA 3LYPA 2K8SA 1THXA 5ID2A 3FKFA 2YWOA 3A2XA 4IBPA 1MD4A 3EYTA 3GA4A 3I9V2 2LKUA 4YH2A 1A0RP 3J7Yb 1FHEA 9GSSA 3D4MA 2HQTA 3ZMKA 2HXKA 4MZBA 4LLRA 3ZFLA 1ON4A 2GT5A 1XWKA 2J9HA 2L4QA 1OYJA 2P5RA 1V9WA 3HZ4A 1ZL9A 2E2MA 2K18A 5GAND 4JE1A 3TRXA 3FR6A 4HJMA 4POLA 3WGDA 4MJBA 10GSA 4GSNA 1S3AA 3H4KA 3ERWA 1M0UA 2YP6A 4MDCA 5GSTA 5IMCA 2WZ9A 2YWIA 4AJ7A 22GSA 3P90A 5DALB 2VM1A 1H75A 3L0HA 3D0ZA 1M9AA 3CBUA 4GTUA 4K2DA 4YQUA 3R2QA 3ZITA 2H73A 3ZVJD 2H0HA 5JCUA 2DJKA 3W8JA 1K3LA 5G30A 1MEKA 4L0UA 3BJ5A 1B4PA 4TRXA 5DCHA 2H72A 3ISOA 3ZFBA 3CSJA 1IYIA 4HEA2 5AIVA 3GX8A 3VWXA 3EWLA 4KSOA 1ABAA 1GSUA 2XC2A 5J41A 2NPBA 5ENUA 1T7PB 3FEUA 5HR3A 1XWCA 2X8HA 4DEJA 2GS3A 2IMDA 3IV4A 2XHFA 1HQOA 3U6VA 1TI3A 2CZ2A 3W8SA 4K9ZA 4ZXGA 4AJ6A 2R6KA 2H75A 5F07A 3PH9A 5INYA 4FYBA 1AIUA 3GSSA 4YAVA 2WDUA 1NHYA 3DGQA 1Z6MA 2GTUA 4TR3A 1SJIA 13GSA 5F06A 4HQSA 3TRPA 5J3RA 3ZIJA 3ME7A 1TRSA 2F8FA 5D93A 2R4VA 5F0GA 1GTUA 3KM6A 2M46A 4GWRA 1ERTA 1V58A 1YQ1A 4PQHA 4Q5RA 1EOGA 2RUEA 3L9UA 2PMTA 4ZB8A 4X1UA 1XPVA 4EDYA 4Q5NA 3FRCA 4ID0A 4KCEA 2I3YA 1O8WA 3TKPA 1EP8A 3CRUA 1PKWA 4EE0A 3C71A 3TKSE 1M99A 2JZTA 5ECMB 4ZIJA 5IQYA 4TOPA 4MF6A 5IOXA 3HJOA 1WIKA 1XVWA 3O6TA 5IPGA 1K0NA 1TI1A 2LJKA 4BVXB 3K8NA 2GQKA 2FA8A 2H74A 1Y25A 4IKHA 3ED3A 5DAKA 2WB9A 5F8BA 1JLWA 3KMOA 1K0DA 1RK4A 3GX0A 3APSA 2JU5A 3SBCA 3KGKA 3F9UA 5DJMA 4LA1A 1OKTA 3RPNA 2J23A 3Q18A 2ZNMA 1JFUA 1YF1A 1DSBA 1NW2A 2FWGA 2QC7A 4WBRD 2C4JA 3GL3A 2BTOT 1TW9A 2PU9C 4Q5FA 2YWMA 2B5EA 1PN9A 2RM6A 2OE3A 5B6NA 2CAQA 2C3QA 2IFQA 5LCZA 1GRXA 4IP1A 3F63A 4TKYA 4YQVA 2H70A 2WULA 1E2YA 5G31A 1GUMA 1I9DA 3G7IA 2MBTA 1BEDA 1S3DA 4PX1A 1H4OA 1MTCA 2GSSA 6GSSA 1ERUA 2B3SA 1A23A 2B7KA 2IIYA 4HJ2A 5ECPB 4NV5A 4O7HA 1CQGA 4EUYA 2H6ZA 1F37A 2FNOA 3DVXA 3DKSA 5G5EA 2B5YA 1PD21 3HJMA 6GSXA 1XOAA 2HZFA 2FLSA 4OO5A 4EKZA 5CYYA 2OBIA 3APOA 1NSWA 2LUSA 4GCIA 3C8EA 3A2WA 1A0FA 2LS5A 4G2EA 1NM3A 2YJHA 3F6DA 2UZ8A 2HNLA 1B9XC 1GH2A 3S9FA 1PX6A 5B6MA 4JZQA 5C00A 4OCEA 2HSMB 2CZ3A 3CMIA 14GSA 1X9MB 1Y6EA 2NVLA 1ZOFA 3LSZA 1UN2A 2WCIA 4IS0A 5ID2B 3A5WA 1F3AA 1XCCA 3NIVA 1U87A 1KNGA 4V2MA 3LEFA 4WR5A 5LD0A 2B1KA 3GKMA 4PTSA 1TK8B 3ZZXA 2KLXA 3LFLA 1W89A 2JSYA 4BPYA 2I81A 4F9ZA 1ZGNA 3P7XA 2LQOA 1WP0A 1SKRB 2DC5A 4V1Ap 4F0BA 3D21A 3TKQA 1WPIA 3TKRA 2GLRA 2HYXA 1AQWA 4RQXA 4EC0A 5JWOB 1T4ZA 17GSA 1ZCPA 2FD3A 5ELGA 2CQ9A 3TUEA 3D6IA 2MMZA 2CV4A 1UC7A 5E4WA 5J5NA 4HOJA 1EV9A 2B5XA 4CHSA 2RLIA 3L4NA 3TJKA 1LJRA 1AQVA 3GURA 4PUFC 5IPHA 2VD0A 2PUKC 1S3CA 1R5AA 4IJIA 5FT3A 4IJ3A 3UIWA 2HRKA 4ECJA 2C0DA 2LNTA 1QUWA 5B7CA 3EU4A 4GSSA 2WJUA 3F4RA 4BL7A 4GQFA 1O7UA 1SL0B 3D5JA 1DBYA 2I9HA 2RIIA 4XHMA 1MD3A 3UAPA 4GXZA 3EVIA 4LMWA 2EC4A 5GAPD 2JSZA 3N5OA 3GH9A 4DSRA 3C1RA 3RDWA 2VUPA 4J57E 1VF2A 3IXRA 1IYHA 2YZHA 3L9VA 4TXOA 5KN1A 3F6FA 1T8EB 5BMUA 1SYXA 2NBSA 2AUVA 3U5RE 2DJ1A 3F4TA 4ZBAA 2JADA 4LL4B 2KP2A 1GNWA 4HU7A 4RI7A 2FWFA 1GSFA 2DIYA 4GRFA 1A8YA 1SJZA 1SL2B 3EU3A 2XBIA 3I69A 5JCGA 2X64A 3KJYA 3NZNA 2CX4A 4FO5A 1TDIA 1TRUA 1TP9A 4KGIA 2C3TA 1G0TA 2EIRA 3WT1A 3VURA 3ZYWA 2GQMA 4MZCA 2M72A 5IMAA 1YEXA 2OADA 3NOFA 1O8XA 1FB6A 4NAXA 5CRHA 1OKDA 3TJJA 3TKSA 5LNKe 2V6OA 5HFIA 1JLVA 2TIRA 1B48A 2LEGA 2V32A 4OFTA 4WR4A 2C0FA 1Z5YE 5CAXA 5IM9A 2AB6A 3TGZA 4FH8A 4HQZA 3LQ7A 1Z3EA 1TTZA 3PINA 3WGXA 1PQNA 5D96A 4ZBDA 1AUCA 3QCPA 1HNCA 2OA7A 2HFDA 1G6WA 2CT6A 1XIYA 4LMVA 4N11A 4EXJA 4HZ4A 1ZYQB 3HYPA 2HSNB 3IBHA 4MPFA 1ZMAA 5AGYA 5DAKB 2Z9SA 4WKWA 1VRSD 3HHVA 4KAEA 5FHIA 4QL7A 5CRGA 5G1LA 2AHEA 5DBQA 3ZREA 4NPBA 3J7Yk 2ON7A 5D9VA 3DRNA 4F2IA 1GUKA 4KE3A 2MZCA 2PERA 1TU7A 3L78A 1WWJA 3M9JA 3PPUA 1SYRA 2C8UA 1FVKA 3GKXA 1Z6NA 2JL4A 3CRTA 3HVVA 3TJGA 1FB0A 4ECIA 4I6XA 1URMA 2IFQB 2HZEA 2D2ZA 2N5FA 2LSTA 5ECOB 2P5QA 3HD5A 2IN3A 1VF3A 4ZB9A 3H93A 1YJ6A 3VWWA 3Q6OA 1WRYA 4RI6A 2H71A 5J9CA 4ZB6A 1G6YA 4KUNA 1UA5A 2DMMA 4D73A 4K7OA 1J08A 2EIQA 4PNFA 2YOIA 1GSEA 4K1FA 4PNGA 1AQXA 1K0OA 1GLQA 1K3OA 5DDLA 1TKDB 5IMDA 11GSA 2HE3A 3FZ5A 4CW9A 1ST9A 2H1BA 4V2LA 4G0IA 4TW5A 3IC8A 1JZOA 5KN2A 2CAIA 6GSWA 4KDXA 4RQRA 2DJ3A 3IPZA 3QAVA 3TB2A 3A3TA 4PXOA 4G19A 2LNSA 4MK3A 3ZL5A 3M0FA 4K0NA 3JCML 1T1VA 2PN8A 1PGTA 5ECHB 2XPDA 4KDYA 2B1LA 3BOAA 4IHUA 5ECSA 4LL1B 1LBKA 4MMMA 4FQUA 2GZPA 2RUFA 3KCMA 5HR1A 4MJEA 4X43A 3I43A 2TRCP 3HY2A 4IELA 1MDJA 3DMLA 5IMFA 5JWRB 3O76A 3HVXA 1GWCA 3TKSC 3GTUA 3IE3A 8GSSA 2L5OA 4F03A 2ALBA 1VF4A 1BG5A 1PL2A 2HSYA 4G0KA 2ZUPA 2XPEA 4KB3A 1XFLA 3FR3A 2E7PA 2XBQA 3HCZA 1BJXA 1ERVA 2PGTA 5JCWA 1XWBA 5CRWA 6GSUA 2OE1A 4KX4A 3R3EA 3VI5A 4KCAA 3LXZA 3QPMA 4HDEA 3US3A 2O85A 2LV3A 5KN0A 3DWVA 5ECNB 2X8CA 4XIHA 5H5SA 2WRTA 2HRKB 2GZYA 2IMIA 3PR8A 2C0EA 3CSHA 1A2JA 1T3BA 2VLVA 1UVZA 1TOFA 6GSYA 2K6VA 2AAWA 4OFNA 5ECRB 3P2AA 2YANA 5CP1A 3KP8A 4BL7B 3GKNA 4IW9A 3ZTLA 1M2AA 2MMNA 1U88A 4MF5A 1I5GA 5H5RA 1XW9A 5ABRA 3D22A 3H8QA 1OC9A 1WE0A 2CVDA 2L5LA 5E59A 1GTAA 5F05A 3SWLA 1OE8A 4JU5A 3VPTA 4TXOB 5H5QA 2KP1A 4OCFA 4IP6A 1YEPA 3UMAA 2YWNA 4NV2A 3F3QA 2V1MA 2R2JA 1R7HA 4KF9A 3IR4A 1T4YA 5HR0A 2O87A 3HA9A 4G0LA 3VWUA 2VO4A 2LRCA 4X0XA 5J9BA 3ZMLA 1CQHA 1SD8A 4XS4A 2YN1A 3EMPA 4PUAA 4TXVA 1FG4A 3F0IA 1SKSB 1W4VA 2HRNA 1TU8A 3LXTA 5G5FA 1SENA 4BWQA 5ECKB 1K0AA 1B9YC 5D73A 19GSA 1YF0A 4HI7A 2GSQA 3GL5A 3QMXA 1XZOA 1ZZYA 4XTSA 1JZWA 5B8AA 2V41A 2CVKA 4GF0A 4F82A 3KP9A 2IL3A 1KTEA 1X5EA 3TOUA 4TR0A 2MMAA 2HLSA 2C80A 2DBCA 2VCXA 1SJ6A 3IOSA 2K8VA 4MF7A 4ACSA 1AAZA 1X0RA 3TCOA 2HRFA 3RPPA 5D9WA 2X8GA 1NHOA 2A2RA 3V1WA 3RHBA 2VCZA 4RUVA 4HU9A 4CDOA 4MPGA 3AY8A 2AYTA 1KBNA 2GQLA 2VL2A 4QQ7A 7GSSA 1JZDA 3FZAA 2EIOA 5A5KA 4E8HA 3A2VA 3CSIA 4KW6A 4NWYA 3M3MA 5A4VA 20GSA 2DIZA 3WYWA 3UJ1A 5A4WA 3EURA 3IDVA 4L5LA 4POKA 1F3BA 5DQSA 5IMZA 1V98A 4BVYA 2DJ2A 1HYUA 2GZZA 4JBBA 4ILFA 4ECCA 1Z7RA 5GSSA 4MH2A 2G2QA 2VM2A 4AJ8A 3G7YA 5G2ZA 1OAZA 3E9JB 4BA7A 2HZEB 2ZCTA 4I5QA 1U6TA 4HUAA 4K6XA 1GNEA 1Q4JA 2FCHA 3UARA 3GRXA 1O6JA 2REMA 1QGVA 3IK7A 2YPMA 3UEMA 2MBSA 2PVQA 3KXOA 2BMXA 4D73B 4WF5A 1EGRA 3KMNA 2H0GA 2VCTA 2LRNA 2O8VB 2LTKA 5DVBA 1EWXA 3MWHA 1F2EA 1BAYA 1V2AA 5EVOA 2V6KA 2R3XA 1EP7A 2DJJA 2IPAA 4KH7A 1PSQA 4ZL9A 5G1KA 1R5PA 4J2FA 4TN8A 2CX3A 3H1NA 2LJAA 2F9SA 1THOA 1TK5B 1U3AA 3KZQA 4OWYA 1EV4A 2YCDA 1GL8A 2O89A 3DD3A 1XVQA 3GH6A 1ZYEA 4DVCA 4MJAA 2H01A 1YDKA 2IJYA 4ML6A 1TJDA 2G0FA 3RBTA 1R4WA 1SD9A 2VCVA 4TR1A 3C7MA 2H19A 2L4CA 3DEXA 2GT6A 4IQAA 2MYGA 6GSTA 1QK8A 3KH9A 3KTLA 3KIJA 2VAFA 1MDIA 1N8JA 2H76A 3GTUB 5COHA 4XS1A 1G7OA 3VFIA 2M80A 1HNAA 4G10A 1QQ2A 5IOWA 1DE2A 4NHZA 1Z9HA 2WS2A 3F4SA 1GP1A 3EINA 2F51A 1PL1A 5CO3A 1YZXA 1DUGA 1TXXA 4IQ1A 5DQYA 4MH3A 3Q74A 3TOTA 4AGSA 4HZ2A 2VL2C 1GSYA 1XBSA 4KSMA 3VLNA 2B7JA 1XW6A 1YKAA 1X5CA 3ME8A 1SK0A 3GYKA 2VOCA 2QSIA 3IAM2 5A4UA 4DSSA 1GSDA 1AW9A 3H79A 4PQ1A 2JZSA 5CREA 1YY7A 2VD1A 1K0CA 1WOUA 3MDKA 5J4UA 4K7NA 4Z7XA 1Q98A 1GTBA 1FVJA 2H1DA 4IVFA 4GQCA 5D9TA 2H1GA 4NXIA 5HFGA 5L71A 2WGRA 4IN0A 1OC9B 2FY6A 2CA8A 2AV4A 1V57A 1QFNA 3QOUA 2JZRA 2GSTA 3LORA 3QD9A 3FZ9A 2AJQB 1O85A 2YV7A 5IMVA 3BD2A 2GDRA 1ILOA 3DVWA 2BJXA 2PPTA 1N2AA 4NMUA 4G9HA 3KH7A 3QDNA 5KN3A 3FR9A 1XXUA 3GMFA 3VWVA 3GV1A 4L5OA 4XS4B 3HKRA 3UVHA 4F0CA 4MCUA 1JZRA 4H86A 2VIMA 2OACA 2NTOA 1VGLA 3E3EA 1SU9A 1V40A 2N5AA 2HT9A 1EEMA 4ECBA 3L9SA 4EL1A 3RHCA 5IO2A 3BCKA 1ACVA 3QFAC 4Q5QA 1EGOA 4ZILA 3PGTA 1EEJA 2ES7A 3QFBC 3FZ4A 4V2NA 2PVOC 4FYUA 1WMJA 1ERWA 6GSVA 2A4VA 4OD7A 2VLTA 1SKWB 3W6GA 1F9MA 4YQMA 4EDZA 4FIWA 1AC1A 4PURA 3ZLPA 4P3YB 2H0IA 2VCWA 3IHQA 1QMVA 3GSTA 1GULA 3UBLA 5HFKA 4PQIA 2E0QA 2GGTA 4JRRA 1A24A 1JHBA 2K9FA 3GIXA 3LYKA 3WT2A 3UOMA 2DSAA 1X9WB 1EOHA 1A2LA 2WFCA 2GVPA 3KTBA 3EMXA 4JR4A 3UBKA 4N30A 2FHEA 5EY6A 3OR5A 2ON5A 4MA9A 4KA0A 3MSZA 5CRDA 3LWAA 1BQ7A 2F3MA 3LJRA 1O81A 2VCQA 3DIEA 2OKAA 3IK9A 5AIXA 2GSRA 3RAZA 2C1YA 4USSA 5DALA 4BVYB 4EF0A 2PBJA 3GNJA 3M8NA 3FYGA 2X99A 1GSSA 4K0GA 1OE7A 1A8LA 4WETA 3TJFA 4MJCA 4KDUA 5ECQB 3D4TA 4GLTA 2O7KA 1SL1B 2QKEA 4MLYA 4EVMA 3VI7A 1GLPA 4ULXA 3ZVJA 1OC8A 1B4QA 3E0UA 1M7TA 3N9JA 1A2MA 5DCGA 1Z7PA 2FWHA 1AXDA 1M2BA 2CVBA 3HZ8A 3Q19A 4IGJA 2VL9A 4I2TA 2H66A 2MMOA 3WD6A 1O73A 1E6BA 2IMEA 4ISDA 4XRAA 4ZBBA 1K3YA 1XOBA 3MNGA 1K0MA 4K7IA 3HJPA 1M2DA 5AISA 3C1SA 1GSQA 4GSTA 3DYRA 2YJ7A 4MP4A 3CYNA 4ML1A 1TK0B 2L6DA 3GFKA 4EO3A 1PMTA 4AF2A 1PX7A 4HS1A 5AN1A 2DJ0A 2PWJA 3IRAA 4O5RA 4WEYA 1OC3A 5HR2A 1U3IA 3CTGA 5IIZA 4TVEA 2HSHA 3IA1A 4N0VA 4PGTA 2LQQA 4O32A 4V1Ag 1XW5A 2KUCA 3GUSA
chains in the Genus database with same CATH superfamily
4QL9A 1X9SB 3QAGA 3CXGA 4A5PA 3KEBA 1USBA 2DKIA 1FO5A 2N5BA 5EPFA 2DLXA 4FXYP 4POBA 3FY7A 3O3TA 1PA3A 4TR1B 3APQA 2C3NA 3HDCA 1HD2A 3VK9A 2R0CA 4I8BA 3ZRDA 3BBYA 1TRWA 2YV9A 3EE2A 5FWGA 4POMA 4OO4A 1K0BA 4K5RA 2JACA 5ELAA 1TXUA 3ERFA 5KEJA 1RW1A 2OBKA 2QGVA 4L8EA 1GTIA 2VLUA 3ERGA 1MDKA 4WBJA 2QA2A 1PKZA 4MABA 3GKKA 4K8MA 1QXHA 2FGXA 3HXSA 3G9BA 3MAKA 4JEDA 2R5GA 2HI7A 2YNXA 2V2GA 3TDGA 2IMKA 4BVXA 2P31A 2P0GA 3LGCA 4XRDA 4WF4A 1SK1A 1SK2A 3EPTA 2RM5A 2OJLA 4MZWA 2C0GA 3HVSA 5ECIB 1F6MC 1WJKA 2LJRA 1J0FA 4DSQA 3LG6A 5GZZB 4I97A 18GSA 4TR4A 3QAWA 1FAAA 2FA4A 3VPQA 2VL3A 3FHKA 1J9BA 4DSSB 2X49A 1RQMA 2A2SA 2NDOA 4XS6A 5EL8A 1C72A 3TRQA 3QR6A 4WXTA 2YZUA 3GHAA 5IO0A 2E2GA 1X5DA 5DJLA 1LU4A 1Y1UA 2H6YA 2H30A 3TJBA 5JWQB 2FWEA 3F3RA 2FUG2 3EC3A 1XWAA 2IWTA 2LRTA 3M9KA 1R26A 5CNWA 1OVNA 1YKCA 4XCSA 4NHWA 1DE1A 2I1UA 4YAPA 2H8LA 3UVTA 5ECLB 4I2UA 5A5HA 1T00A 2B6MA 3CQFA 1TRVA 3RFRC 12GSA 2I4AA 3G7JA 4E8EA 1KEBA 3FW2A 2DMLA 5HQPA 1G7EA 3UL3A 1GUHA 4FYCA 1M9BA 2H1AA 3BCIA 3CTFA 1BYEA 4OFMA 1XWGA 5J4VA 4J56E 4ZL7A 4N10A 4QMKA 1B8XA 3I6AA 3FK8A 4OMVA 1ML6A 2F8AA 4N0ZA 4O92A 1PRXA 2KOKA 2IMFA 2R37A 3C73A 2TRXA 3GN3A 4JR6A 2HRAA 4L0WA 1VF1A 4KNDA 4ZL8A 1EZKA 2L59A 1BX9A 3ZIVA 2KHPA 3M1GA 2OE0A 3IC4A 3KD0A 3P8WA 2H6XA 16GSA 3IAS2 5B8BA 5D8IA 2HSMA 2L6CA 5D9XA 3DXBA 5C04A 1FOVA 1HNBA 1FW1A 2L57A 3F8UA 4BWSA 3WGEA 3LYPA 2K8SA 1THXA 5ID2A 3FKFA 4N3ZA 2YWOA 3A2XA 4IBPA 1MD4A 3EYTA 3GA4A 3I9V2 2LKUA 4YH2A 1A0RP 3J7Yb 1FHEA 9GSSA 2EFCA 3D4MA 2HQTA 3ZMKA 2HXKA 4MZBA 4LLRA 3ZFLA 1ON4A 2GT5A 1XWKA 2J9HA 2L4QA 1OYJA 2P5RA 1V9WA 3HZ4A 1ZL9A 2E2MA 2K18A 5GAND 4JE1A 3TRXA 3FR6A 4HJMA 4POLA 3WGDA 4MJBA 10GSA 4GSNA 1S3AA 3H4KA 4EIQA 3ERWA 1M0UA 1ZYNA 2YP6A 4MDCA 5GSTA 5IMCA 2WZ9A 2YWIA 4AJ7A 22GSA 3P90A 5DALB 2VM1A 1H75A 3L0HA 3D0ZA 1M9AA 3CBUA 4GTUA 4K2DA 5J47A 4YQUA 5KOXA 3R2QA 3ZITA 2H73A 3ZVJD 2H0HA 5JCUA 2DJKA 3W8JA 1K3LA 5G30A 1MEKA 4L0UA 4AKGA 3BJ5A 1B4PA 4TRXA 5DCHA 2H72A 3ISOA 3ZFBA 3CSJA 1IYIA 4HEA2 5AIVA 4CY8A 3GX8A 3VWXA 3EWLA 4KSOA 1ABAA 1GSUA 2XC2A 5J41A 2NPBA 5ENUA 1T7PB 3FEUA 2R0PA 5HR3A 1XWCA 2X8HA 4DEJA 2GS3A 2IMDA 3IV4A 2XHFA 1HQOA 3U6VA 1TI3A 2CZ2A 2EFEA 3W8SA 2WW1A 4K9ZA 4ZXGA 4AJ6A 2R6KA 2H75A 5F07A 3PH9A 5INYA 4FYBA 1AIUA 3GSSA 4YAVA 2WDUA 1NHYA 3DGQA 4AI6A 1M3JA 1Z6MA 2GTUA 4TR3A 1SJIA 13GSA 5F06A 4HQSA 3TRPA 5J3RA 3ZIJA 3ME7A 1TRSA 4AKIA 2F8FA 5D93A 2R4VA 5F0GA 1GTUA 3KM6A 2M46A 4GWRA 1ERTA 1V58A 1YQ1A 4PQHA 4Q5RA 1EOGA 2RUEA 3L9UA 2PMTA 4ZB8A 4X1UA 3HMJG 1XPVA 4EDYA 4Q5NA 3FRCA 4ID0A 4KCEA 2I3YA 4G01A 1O8WA 3FMWA 3TKPA 1EP8A 3CRUA 1PKWA 4EE0A 3C71A 3TKSE 1M99A 2JZTA 5ECMB 4ZIJA 5IQYA 4TOPA 4MF6A 5IOXA 3HJOA 1WIKA 1XVWA 3O6TA 5IPGA 1K0NA 1TI1A 2LJKA 4BVXB 3K8NA 2HSNA 2GQKA 2FA8A 2H74A 1Y25A 4IKHA 3ED3A 5DAKA 2WB9A 5F8BA 1JLWA 3KMOA 1K0DA 1RK4A 3GX0A 3APSA 2JU5A 3SBCA 3KGKA 3F9UA 5DJMA 4LA1A 1OKTA 3RPNA 2J23A 3Q18A 2ZNMA 1JFUA 1YF1A 1DSBA 1NW2A 2FWGA 2QC7A 4WBRD 2C4JA 3GL3A 2BTOT 1TW9A 1SVOA 2PU9C 4Q5FA 2YWMA 2B5EA 1PN9A 2RM6A 2OE3A 3LW9A 4MNNA 5B6NA 2CAQA 2C3QA 2IFQA 5LCZA 1GRXA 4IP1A 3F63A 4TKYA 4W66A 4YQVA 2H70A 2WULA 1E2YA 5G31A 1GUMA 1I9DA 3G7IA 2MBTA 1BEDA 1S3DA 4PX1A 1H4OA 1MTCA 2GSSA 3MYDA 6GSSA 1ERUA 5A5HB 2B3SA 1A23A 2B7KA 3HVNA 2IIYA 4HJ2A 5ECPB 4NV5A 4O7HA 1CQGA 4EUYA 2H6ZA 1N25A 1F37A 2FNOA 3DVXA 3DKSA 5G5EA 2B5YA 1PD21 3HJMA 2WVZA 4BIKA 6GSXA 1XOAA 2HZFA 2FLSA 4OO5A 4EKZA 5CYYA 2OBIA 3APOA 1NSWA 2LUSA 4GCIA 3C8EA 3A2WA 1A0FA 2LS5A 4G2EA 1NM3A 2YJHA 3F6DA 2UZ8A 2HNLA 1B9XC 1GH2A 3S9FA 1PX6A 5B6MA 4JZQA 5C00A 4OCEA 2HSMB 2CZ3A 3CMIA 14GSA 1X9MB 1Y6EA 2NVLA 1ZOFA 3LSZA 1UN2A 2WCIA 4IS0A 5ID2B 3A5WA 1F3AA 1XCCA 3NIVA 1U87A 1KNGA 4V2MA 3LEFA 4WR5A 5LD0A 4Z2UA 2B1KA 3GKMA 4PI2C 4PTSA 1TK8B 3ZZXA 2KLXA 3LFLA 1W89A 2JSYA 4BPYA 2I81A 4F9ZA 1ZGNA 3P7XA 2LQOA 1WP0A 1SKRB 2DC5A 4V1Ap 4X4JA 4F0BA 3D21A 3TKQA 1WPIA 3TKRA 2GLRA 2HYXA 1AQWA 4RQXA 4EC0A 5JWOB 1T4ZA 17GSA 1ZCPA 2FD3A 5ELGA 2CQ9A 3TUEA 3D6IA 2MMZA 2CV4A 1UC7A 5E4WA 5J5NA 4HOJA 1EV9A 2B5XA 4CHSA 2RLIA 3L4NA 3TJKA 1LJRA 1AQVA 3GURA 4PUFC 5IPHA 2VD0A 2PUKC 1S3CA 1R5AA 4IJIA 5FT3A 4IJ3A 3UIWA 2HRKA 4ECJA 2C0DA 2LNTA 1QUWA 5B7CA 3EU4A 4GSSA 2WJUA 3F4RA 4BL7A 4GQFA 1O7UA 1SL0B 3D5JA 1DBYA 4HSCX 2I9HA 2RIIA 4XHMA 1MD3A 3UAPA 4GXZA 3EVIA 4LMWA 2EC4A 5GAPD 2JSZA 3N5OA 3GH9A 4DSRA 3C1RA 3RDWA 2VUPA 4J57E 4EIPA 1VF2A 4ZB7A 3IXRA 1IYHA 2YZHA 3L9VA 4TXOA 1PFOA 5KN1A 3F6FA 1T8EB 5BMUA 1SYXA 2NBSA 2AUVA 3U5RE 2DJ1A 3F4TA 4ZBAA 2JADA 4LL4B 2KP2A 1GNWA 4HU7A 4RI7A 2FWFA 1GSFA 2DIYA 4GRFA 1A8YA 1SJZA 1SL2B 3EU3A 2XBIA 3I69A 5JCGA 2X64A 3KJYA 3NZNA 2CX4A 5A34A 5A1NA 4FO5A 1TDIA 1TRUA 1TP9A 2WVXA 4KGIA 2C3TA 1G0TA 2EIRA 3WT1A 3VURA 3ZYWA 2GQMA 4MZCA 2M72A 5IMAA 1YEXA 2OADA 3NOFA 1O8XA 1FB6A 4NAXA 5CRHA 1OKDA 3TJJA 3TKSA 5LNKe 2V6OA 5HFIA 1JLVA 2TIRA 1B48A 2O36A 4ICYA 2LEGA 2V32A 4OFTA 4WR4A 2C0FA 1Z5YE 5CAXA 5IM9A 2AB6A 3TGZA 4FH8A 4HQZA 3LQ7A 1Z3EA 1TTZA 3PINA 3WGXA 1PQNA 5D96A 4ZBDA 1AUCA 3QCPA 1HNCA 2OA7A 2EFDA 2HFDA 1G6WA 2CT6A 1XIYA 4LMVA 5KOWA 4N11A 4EXJA 4HZ4A 1ZYQB 3HYPA 2HSNB 3IBHA 4MPFA 1ZMAA 5AGYA 5DAKB 2VKZG 2Z9SA 4WKWA 1VRSD 3HHVA 4KAEA 5FHIA 4QL7A 5CRGA 5G1LA 2AHEA 5DBQA 3ZREA 4NPBA 3J7Yk 2ON7A 5D9VA 3DRNA 4F2IA 1GUKA 4KE3A 2MZCA 2PERA 1TU7A 3L78A 1WWJA 3M9JA 3PPUA 1SYRA 2C8UA 1FVKA 3GKXA 1Z6NA 2JL4A 3CRTA 3HVVA 2R0GA 3TJGA 1FB0A 4ECIA 4I6XA 1BF5A 4CY6A 1URMA 2IFQB 2HZEA 2D2ZA 2N5FA 2LSTA 3CHXC 5ECOB 2P5QA 3HD5A 2IN3A 1VF3A 4ZB9A 3H93A 1YJ6A 3VWWA 3Q6OA 1WRYA 4RI6A 2H71A 5J9CA 4ZB6A 1G6YA 4KUNA 1UA5A 2DMMA 4D73A 4K7OA 1J08A 2EIQA 4PNFA 2YOIA 1GSEA 2X4AA 4K1FA 4PNGA 1AQXA 1K0OA 1GLQA 1K3OA 5DDLA 1TKDB 5IMDA 11GSA 2HE3A 3FZ5A 4CW9A 1ST9A 2H1BA 4V2LA 4G0IA 4TW5A 3IC8A 1JZOA 5KN2A 2CAIA 6GSWA 4KDXA 4RQRA 2DJ3A 3IPZA 3QAVA 1XG8A 3TB2A 3A3TA 4PXOA 2WW0A 4G19A 2LNSA 4MK3A 3ZL5A 3M0FA 4K0NA 1ZYPA 3JCML 1T1VA 2PN8A 1PGTA 5ECHB 2XPDA 4KDYA 2B1LA 3BOAA 3IHGA 4IHUA 5ECSA 4LL1B 1LBKA 4MMMA 4FQUA 2GZPA 2RUFA 3KCMA 5HR1A 4MJEA 4X43A 3I43A 2TRCP 3HY2A 4IELA 1MDJA 3DMLA 5IMFA 5JWRB 3O76A 3HVXA 1GWCA 4YKFA 3TKSC 3GTUA 3IE3A 8GSSA 2L5OA 4F03A 2ALBA 1VF4A 1BG5A 1PL2A 2HSYA 4G0KA 2ZUPA 2XPEA 4KB3A 1XFLA 3FR3A 2E7PA 2XBQA 3HCZA 1BJXA 1ERVA 2A4HA 2PGTA 5JCWA 1XWBA 5CRWA 6GSUA 2OE1A 4KX4A 3R3EA 3VI5A 4KCAA 3LXZA 3QPMA 4HDEA 3US3A 2O85A 2LV3A 5KN0A 3DWVA 5ECNB 2X8CA 4XIHA 5H5SA 2WRTA 2HRKB 2GZYA 2IMIA 3PR8A 2C0EA 3CSHA 1A2JA 1T3BA 2VLVA 1UVZA 1TOFA 6GSYA 2K6VA 2AAWA 4OFNA 5ECRB 3P2AA 2YANA 5CP1A 3KP8A 4BL7B 3GKNA 4IW9A 3ZTLA 1M2AA 2MMNA 4K2XA 1U88A 2DKHA 4MF5A 1I5GA 5H5RA 1XW9A 2WZSA 5ABRA 3D22A 3H8QA 1OC9A 1WE0A 2CVDA 2L5LA 5E59A 1GTAA 5F05A 3SWLA 1OE8A 4JU5A 3VPTA 4TXOB 5H5QA 2KP1A 4OCFA 4IP6A 5BMUB 1YEPA 3UMAA 1YVLA 2YWNA 4NV2A 3F3QA 5J4YA 2V1MA 2EFHA 2R2JA 1R7HA 4KF9A 3IR4A 1T4YA 5HR0A 1I1IP 2O87A 3HA9A 4G0LA 3VWUA 2VO4A 2LRCA 1FOHA 4X0XA 5J9BA 3ZMLA 1CQHA 1SD8A 4XS4A 2YN1A 3EMPA 4PUAA 4TXVA 1FG4A 3F0IA 5A34B 1SKSB 5A1NB 1W4VA 2HRNA 1TU8A 3LXTA 5G5FA 1SENA 2WVXB 4BWQA 4Z2RA 5ECKB 1K0AA 4Z2TA 1B9YC 5D73A 19GSA 1YF0A 4HI7A 2GSQA 3GL5A 3QMXA 3TU3B 1XZOA 1ZZYA 4XTSA 1JZWA 5B8AA 2V41A 2CVKA 4GF0A 4F82A 3KP9A 2IL3A 1KTEA 1X5EA 4K5SA 3TOUA 4TR0A 2MMAA 2HLSA 2C80A 2DBCA 2VCXA 1SJ6A 3IOSA 2K8VA 4MF7A 4ACSA 1AAZA 1X0RA 3TCOA 2HRFA 3RPPA 4GDFA 5D9WA 2X8GA 1NHOA 2A2RA 3V1WA 3RHBA 2VCZA 4RUVA 4HU9A 4CDOA 4MPGA 3AY8A 2AYTA 1KBNA 2GQLA 2VL2A 4QQ7A 7GSSA 1JZDA 3FZAA 2EIOA 5A5KA 4PHZC 4E8HA 3A2VA 3CSIA 4KW6A 4NWYA 3M3MA 5A4VA 1PN0A 20GSA 2DIZA 4O5UA 3WYWA 3UJ1A 5A4WA 3EURA 3IDVA 4L5LA 4POKA 1F3BA 5DQSA 5IMZA 1V98A 4BVYA 2DJ2A 2H1LA 1HYUA 2GZZA 4JBBA 4ILFA 4ECCA 1Z7RA 5GSSA 4MH2A 2G2QA 2VM2A 4AJ8A 3G7YA 5G2ZA 1OAZA 3E9JB 4BA7A 4E68A 2HZEB 2ZCTA 4I5QA 1U6TA 4HUAA 4K6XA 3CWGA 1GNEA 1Q4JA 2FCHA 3UARA 3GRXA 1O6JA 2REMA 1QGVA 1SVMA 3IK7A 2YPMA 3UEMA 2MBSA 2PVQA 3KXOA 2BMXA 4D73B 4WF5A 1EGRA 3KMNA 2H0GA 2VCTA 2LRNA 2O8VB 2LTKA 5DVBA 1EWXA 3MWHA 1F2EA 1BAYA 1V2AA 5EVOA 2V6KA 2R3XA 1EP7A 2DJJA 2IPAA 4KH7A 1PSQA 4ZL9A 5G1KA 1R5PA 4J2FA 4TN8A 4O5QA 2O5VA 2CX3A 3H1NA 2LJAA 2F9SA 1THOA 1TK5B 1U3AA 3KZQA 4OWYA 1EV4A 2YCDA 1GL8A 2O89A 4AKHA 3DD3A 1XVQA 3GH6A 1ZYEA 4DVCA 4MJAA 3MIXA 2H01A 1YDKA 2IJYA 4ML6A 1TJDA 2G0FA 3RBTA 1R4WA 1SD9A 2VCVA 4TR1A 3C7MA 2H19A 2L4CA 3DEXA 2GT6A 4IQAA 2QA1A 2MYGA 6GSTA 1QK8A 3KH9A 3KTLA 3KIJA 2VAFA 1MDIA 1N8JA 2H76A 3GTUB 5COHA 4XS1A 1G7OA 3VFIA 2M80A 4YKGA 1HNAA 4G10A 1QQ2A 5IOWA 1DE2A 4NHZA 1Z9HA 2A2PA 2WS2A 3F4SA 1GP1A 3EINA 2F51A 1PL1A 5CO3A 1YZXA 1DUGA 1TXXA 4IQ1A 5DQYA 4MH3A 3Q74A 3TOTA 4AGSA 4HZ2A 2VL2C 1GSYA 1XBSA 4KSMA 3VLNA 2B7JA 1XW6A 1YKAA 1X5CA 3ME8A 1SK0A 3GYKA 2VOCA 2QSIA 3IAM2 5A4UA 4DSSA 1GSDA 1S3RA 1AW9A 3H79A 4PQ1A 2JZSA 5CREA 1YY7A 2VD1A 1K0CA 1WOUA 3MDKA 5J4UA 4K7NA 4Z7XA 1Q98A 1GTBA 1FVJA 2H1DA 4IVFA 4GQCA 5D9TA 2H1GA 4NXIA 5HFGA 5L71A 2WGRA 4IN0A 1OC9B 2FY6A 2CA8A 2O3EA 2AV4A 1V57A 1QFNA 3QOUA 2JZRA 2GSTA 3LORA 3QD9A 3FZ9A 2AJQB 1O85A 2YV7A 5IMVA 3BD2A 2GDRA 1ILOA 3DVWA 2BJXA 2PPTA 1N2AA 4NMUA 5J40A 4G9HA 3KH7A 3QDNA 2WW3A 5KN3A 3FR9A 1XXUA 3GMFA 3VWVA 3GV1A 4L5OA 4XS4B 3HKRA 3UVHA 4F0CA 4MCUA 1JZRA 2VIMA 4H86A 2OACA 2NTOA 1VGLA 3E3EA 1SU9A 1V40A 2N5AA 2HT9A 1EEMA 4ECBA 3A5IA 3L9SA 1M3IA 4EL1A 3RHCA 5IO2A 1BG1A 3BCKA 1ACVA 3QFAC 1SVLA 4Q5QA 1EGOA 2OT3A 4ZILA 3PGTA 1EEJA 2ES7A 3QFBC 3FZ4A 4V2NA 2PVOC 4FYUA 1WMJA 1ERWA 6GSVA 2A4VA 4OD7A 2VLTA 1SKWB 3W6GA 1F9MA 4YQMA 4EDZA 4FIWA 1AC1A 4PURA 3ZLPA 4P3YB 2H0IA 2VCWA 3IHQA 1QMVA 3GSTA 1GULA 3UBLA 5HFKA 4PQIA 2E0QA 2GGTA 4JRRA 1A24A 1JHBA 2K9FA 3GIXA 2WW2A 3LYKA 3WT2A 3UOMA 2DSAA 1X9WB 1EOHA 1S4BP 1A2LA 2WFCA 2GVPA 3KTBA 3EMXA 4JR4A 3UBKA 4N30A 2FHEA 2UV8G 5EY6A 3OR5A 2ON5A 4MA9A 4KA0A 3MSZA 5CRDA 2WVYA 3LWAA 1BQ7A 2F3MA 3LJRA 1YEWC 1O81A 2VCQA 3DIEA 2OKAA 3IK9A 5AIXA 2GSRA 3RAZA 2C1YA 4USSA 5DALA 4BVYB 4EF0A 2PBJA 3GNJA 3M8NA 3FYGA 2X99A 1GSSA 4K0GA 1OE7A 1A8LA 4WETA 3TJFA 4MJCA 4KDUA 5ECQB 3D4TA 4GLTA 2O7KA 1SL1B 2QKEA 4MLYA 4EVMA 3VI7A 1GLPA 4ULXA 3ZVJA 1OC8A 1B4QA 3E0UA 1M7TA 3N9JA 1A2MA 5DCGA 1Z7PA 2FWHA 1AXDA 1M2BA 2CVBA 3HZ8A 3Q19A 4IGJA 5BRTA 2VL9A 4I2TA 2H66A 2MMOA 3WD6A 1O73A 4AKXB 1E6BA 2IMEA 4ISDA 4XRAA 4ZBBA 1K3YA 1XOBA 3MNGA 1K0MA 4K7IA 3HJPA 1M2DA 4PI0C 5AISA 3C1SA 1GSQA 4GSTA 3DYRA 2YJ7A 4MP4A 3CYNA 4ML1A 1TK0B 2L6DA 3GFKA 4EO3A 1PMTA 4AF2A 1PX7A 4HS1A 5AN1A 2DJ0A 2PWJA 3IRAA 4O5RA 4WEYA 1OC3A 5HR2A 1U3IA 3CTGA 5IIZA 4TVEA 2HSHA 3IA1A 4N0VA 4PGTA 2LQQA 4O32A 4V1Ag 1XW5A 2KUCA 3RGBC 3GUSA
chains in the Genus database with same CATH topology
4QL9A 1X9SB 3QAGA 3CXGA 4A5PA 3KEBA 1USBA 2DKIA 1FO5A 2N5BA 5EPFA 2DLXA 4POBA 3FY7A 3O3TA 1PA3A 4TR1B 3APQA 2C3NA 3HDCA 1HD2A 3VK9A 2R0CA 4I8BA 3ZRDA 3BBYA 1TRWA 2YV9A 3EE2A 5FWGA 4POMA 4OO4A 1K0BA 4K5RA 2JACA 5ELAA 1TXUA 3ERFA 5KEJA 1RW1A 2OBKA 2QGVA 4L8EA 1GTIA 2VLUA 3ERGA 1MDKA 4WBJA 2QA2A 1PKZA 4MABA 3GKKA 4K8MA 1QXHA 2FGXA 3HXSA 3G9BA 3MAKA 4JEDA 2R5GA 2HI7A 2YNXA 2V2GA 3TDGA 2IMKA 4BVXA 2P31A 2P0GA 3LGCA 4XRDA 4WF4A 1SK1A 1SK2A 3EPTA 2RM5A 2OJLA 4MZWA 2C0GA 3HVSA 5ECIB 1F6MC 1WJKA 2LJRA 1J0FA 4DSQA 3LG6A 5GZZB 4I97A 18GSA 4TR4A 3QAWA 1FAAA 2FA4A 3VPQA 2VL3A 3FHKA 1J9BA 4DSSB 2X49A 1RQMA 2A2SA 2NDOA 4XS6A 5EL8A 1C72A 3TRQA 3QR6A 4WXTA 2YZUA 3GHAA 5IO0A 2E2GA 1X5DA 5DJLA 1LU4A 1Y1UA 2H6YA 2H30A 3TJBA 5JWQB 2FWEA 3F3RA 2FUG2 3EC3A 1XWAA 2IWTA 2LRTA 3M9KA 1R26A 5CNWA 1OVNA 1YKCA 4XCSA 4NHWA 1DE1A 2I1UA 4YAPA 2H8LA 3UVTA 5ECLB 4I2UA 5A5HA 1T00A 2B6MA 1TRVA 12GSA 2I4AA 3G7JA 4E8EA 1KEBA 3FW2A 2DMLA 5HQPA 1G7EA 3UL3A 1GUHA 4FYCA 1M9BA 2H1AA 3BCIA 3CTFA 1BYEA 4OFMA 1XWGA 5J4VA 4J56E 4ZL7A 4N10A 4QMKA 1B8XA 3I6AA 3FK8A 4OMVA 1ML6A 2F8AA 4N0ZA 4O92A 1PRXA 2KOKA 2IMFA 2R37A 3C73A 2TRXA 3GN3A 4JR6A 2HRAA 4L0WA 1VF1A 4KNDA 4ZL8A 1EZKA 2L59A 1BX9A 3ZIVA 2KHPA 3M1GA 2OE0A 3IC4A 3KD0A 3P8WA 2H6XA 16GSA 3IAS2 5B8BA 5D8IA 2HSMA 2L6CA 5D9XA 3DXBA 5C04A 1FOVA 1HNBA 1FW1A 2L57A 3F8UA 4BWSA 3WGEA 3LYPA 2K8SA 1THXA 5ID2A 3FKFA 4N3ZA 2YWOA 3A2XA 4IBPA 1MD4A 3EYTA 3GA4A 3I9V2 2LKUA 4YH2A 1A0RP 3J7Yb 1FHEA 9GSSA 2EFCA 3D4MA 2HQTA 3ZMKA 2HXKA 4MZBA 4LLRA 3ZFLA 1ON4A 2GT5A 1XWKA 2J9HA 2L4QA 1OYJA 2P5RA 1V9WA 3HZ4A 1ZL9A 2E2MA 2K18A 5GAND 4JE1A 3TRXA 3FR6A 4HJMA 4POLA 3WGDA 4MJBA 10GSA 4GSNA 1S3AA 3H4KA 4EIQA 3ERWA 1M0UA 1ZYNA 2YP6A 4MDCA 5GSTA 5IMCA 2WZ9A 2YWIA 4AJ7A 22GSA 3P90A 5DALB 2VM1A 1H75A 3L0HA 3D0ZA 1M9AA 3CBUA 4GTUA 4K2DA 5J47A 4YQUA 5KOXA 3R2QA 3ZITA 2H73A 3ZVJD 2H0HA 5JCUA 2DJKA 3W8JA 1K3LA 5G30A 1MEKA 4L0UA 4AKGA 3BJ5A 1B4PA 4TRXA 5DCHA 2H72A 3ISOA 3ZFBA 3CSJA 1IYIA 4HEA2 5AIVA 4CY8A 3GX8A 3VWXA 3EWLA 4KSOA 1ABAA 1GSUA 2XC2A 5J41A 2NPBA 5ENUA 1T7PB 3FEUA 2R0PA 5HR3A 1XWCA 2X8HA 4DEJA 2GS3A 2IMDA 3IV4A 2XHFA 1HQOA 3U6VA 1TI3A 2CZ2A 2EFEA 3W8SA 4K9ZA 4ZXGA 4AJ6A 2R6KA 2H75A 5F07A 3PH9A 5INYA 4FYBA 1AIUA 3GSSA 4YAVA 2WDUA 1NHYA 3DGQA 4AI6A 1Z6MA 2GTUA 4TR3A 1SJIA 13GSA 5F06A 4HQSA 3TRPA 5J3RA 3ZIJA 3ME7A 1TRSA 4AKIA 2F8FA 5D93A 2R4VA 5F0GA 1GTUA 3KM6A 2M46A 4GWRA 1ERTA 1V58A 1YQ1A 4PQHA 4Q5RA 1EOGA 2RUEA 3L9UA 2PMTA 4ZB8A 4X1UA 3HMJG 1XPVA 4EDYA 4Q5NA 3FRCA 4ID0A 4KCEA 2I3YA 4G01A 1O8WA 3FMWA 3TKPA 1EP8A 3CRUA 1PKWA 4EE0A 3C71A 3TKSE 1M99A 2JZTA 5ECMB 4ZIJA 5IQYA 4TOPA 4MF6A 5IOXA 3HJOA 1WIKA 1XVWA 3O6TA 5IPGA 1K0NA 1TI1A 2LJKA 4BVXB 3K8NA 2HSNA 2GQKA 2FA8A 2H74A 1Y25A 4IKHA 3ED3A 5DAKA 2WB9A 5F8BA 1JLWA 3KMOA 1K0DA 1RK4A 3GX0A 3APSA 2JU5A 3SBCA 3KGKA 3F9UA 5DJMA 4LA1A 1OKTA 3RPNA 2J23A 3Q18A 2ZNMA 1JFUA 1YF1A 1DSBA 1NW2A 2FWGA 2QC7A 4WBRD 2C4JA 3GL3A 2BTOT 1TW9A 1SVOA 2PU9C 4Q5FA 2YWMA 2B5EA 1PN9A 2RM6A 2OE3A 3LW9A 4MNNA 5B6NA 2CAQA 2C3QA 2IFQA 5LCZA 1GRXA 4IP1A 3F63A 4TKYA 4W66A 4YQVA 2H70A 2WULA 1E2YA 5G31A 1GUMA 1I9DA 3G7IA 2MBTA 1BEDA 1S3DA 4PX1A 1H4OA 1MTCA 2GSSA 3MYDA 6GSSA 1ERUA 5A5HB 2B3SA 1A23A 2B7KA 2IIYA 4HJ2A 5ECPB 4NV5A 4O7HA 1CQGA 4EUYA 2H6ZA 1N25A 1F37A 2FNOA 3DVXA 3DKSA 5G5EA 2B5YA 1PD21 3HJMA 6GSXA 1XOAA 2HZFA 2FLSA 4OO5A 4EKZA 5CYYA 2OBIA 3APOA 1NSWA 2LUSA 4GCIA 3C8EA 3A2WA 1A0FA 2LS5A 4G2EA 1NM3A 2YJHA 3F6DA 2UZ8A 2HNLA 1B9XC 1GH2A 3S9FA 1PX6A 5B6MA 4JZQA 5C00A 4OCEA 2HSMB 2CZ3A 3CMIA 14GSA 1X9MB 1Y6EA 2NVLA 1ZOFA 3LSZA 1UN2A 2WCIA 4IS0A 5ID2B 3A5WA 1F3AA 1XCCA 3NIVA 1U87A 1KNGA 4V2MA 3LEFA 4WR5A 5LD0A 4Z2UA 2B1KA 3GKMA 4PTSA 1TK8B 3ZZXA 2KLXA 3LFLA 1W89A 2JSYA 4BPYA 2I81A 4F9ZA 1ZGNA 3P7XA 2LQOA 1WP0A 1SKRB 2DC5A 4V1Ap 4X4JA 4F0BA 3D21A 3TKQA 1WPIA 3TKRA 2GLRA 2HYXA 1AQWA 4RQXA 4EC0A 5JWOB 1T4ZA 17GSA 1ZCPA 2FD3A 5ELGA 2CQ9A 3TUEA 3D6IA 2MMZA 2CV4A 1UC7A 5E4WA 5J5NA 4HOJA 1EV9A 2B5XA 4CHSA 2RLIA 3L4NA 3TJKA 1LJRA 1AQVA 3GURA 4PUFC 5IPHA 2VD0A 2PUKC 1S3CA 1R5AA 4IJIA 5FT3A 4IJ3A 3UIWA 2HRKA 4ECJA 2C0DA 2LNTA 1QUWA 5B7CA 3EU4A 4GSSA 2WJUA 3F4RA 4BL7A 4GQFA 1O7UA 1SL0B 3D5JA 1DBYA 2I9HA 2RIIA 4XHMA 1MD3A 3UAPA 4GXZA 3EVIA 4LMWA 2EC4A 5GAPD 2JSZA 3N5OA 3GH9A 4DSRA 3C1RA 3RDWA 2VUPA 4J57E 4EIPA 1VF2A 4ZB7A 3IXRA 1IYHA 2YZHA 3L9VA 4TXOA 5KN1A 3F6FA 1T8EB 5BMUA 1SYXA 2NBSA 2AUVA 3U5RE 2DJ1A 3F4TA 4ZBAA 2JADA 4LL4B 2KP2A 1GNWA 4HU7A 4RI7A 2FWFA 1GSFA 2DIYA 4GRFA 1A8YA 1SJZA 1SL2B 3EU3A 2XBIA 3I69A 5JCGA 2X64A 3KJYA 3NZNA 2CX4A 5A34A 5A1NA 4FO5A 1TDIA 1TRUA 1TP9A 4KGIA 2C3TA 1G0TA 2EIRA 3WT1A 3VURA 3ZYWA 2GQMA 4MZCA 2M72A 5IMAA 1YEXA 2OADA 3NOFA 1O8XA 1FB6A 4NAXA 5CRHA 1OKDA 3TJJA 3TKSA 5LNKe 2V6OA 5HFIA 1JLVA 2TIRA 1B48A 4ICYA 2LEGA 2V32A 4OFTA 4WR4A 2C0FA 1Z5YE 5CAXA 5IM9A 2AB6A 3TGZA 4FH8A 4HQZA 3LQ7A 1Z3EA 1TTZA 3PINA 3WGXA 1PQNA 5D96A 4ZBDA 1AUCA 3QCPA 1HNCA 2OA7A 2EFDA 2HFDA 1G6WA 2CT6A 1XIYA 4LMVA 5KOWA 4N11A 4EXJA 4HZ4A 1ZYQB 3HYPA 2HSNB 3IBHA 4MPFA 1ZMAA 5AGYA 5DAKB 2VKZG 2Z9SA 4WKWA 1VRSD 3HHVA 4KAEA 5FHIA 4QL7A 5CRGA 5G1LA 2AHEA 5DBQA 3ZREA 4NPBA 3J7Yk 2ON7A 5D9VA 3DRNA 4F2IA 1GUKA 4KE3A 2MZCA 2PERA 1TU7A 3L78A 1WWJA 3M9JA 3PPUA 1SYRA 2C8UA 1FVKA 3GKXA 1Z6NA 2JL4A 3CRTA 3HVVA 2R0GA 3TJGA 1FB0A 4ECIA 4I6XA 1BF5A 4CY6A 1URMA 2IFQB 2HZEA 2D2ZA 2N5FA 2LSTA 5ECOB 2P5QA 3HD5A 2IN3A 1VF3A 4ZB9A 3H93A 1YJ6A 3VWWA 3Q6OA 1WRYA 4RI6A 2H71A 5J9CA 4ZB6A 1G6YA 4KUNA 1UA5A 2DMMA 4D73A 4K7OA 1J08A 2EIQA 4PNFA 2YOIA 1GSEA 2X4AA 4K1FA 4PNGA 1AQXA 1K0OA 1GLQA 1K3OA 5DDLA 1TKDB 5IMDA 11GSA 2HE3A 3FZ5A 4CW9A 1ST9A 2H1BA 4V2LA 4G0IA 4TW5A 3IC8A 1JZOA 5KN2A 2CAIA 6GSWA 4KDXA 4RQRA 2DJ3A 3IPZA 3QAVA 3TB2A 3A3TA 4PXOA 4G19A 2LNSA 4MK3A 3ZL5A 3M0FA 4K0NA 1ZYPA 3JCML 1T1VA 2PN8A 1PGTA 5ECHB 2XPDA 4KDYA 2B1LA 3BOAA 3IHGA 4IHUA 5ECSA 4LL1B 1LBKA 4MMMA 4FQUA 2GZPA 2RUFA 3KCMA 5HR1A 4MJEA 4X43A 3I43A 2TRCP 3HY2A 4IELA 1MDJA 3DMLA 5IMFA 5JWRB 3O76A 3HVXA 1GWCA 4YKFA 3TKSC 3GTUA 3IE3A 8GSSA 2L5OA 4F03A 2ALBA 1VF4A 1BG5A 1PL2A 2HSYA 4G0KA 2ZUPA 2XPEA 4KB3A 1XFLA 3FR3A 2E7PA 2XBQA 3HCZA 1BJXA 1ERVA 2A4HA 2PGTA 5JCWA 1XWBA 5CRWA 6GSUA 2OE1A 4KX4A 3R3EA 3VI5A 4KCAA 3LXZA 3QPMA 4HDEA 3US3A 2O85A 2LV3A 5KN0A 3DWVA 5ECNB 2X8CA 4XIHA 5H5SA 2WRTA 2HRKB 2GZYA 2IMIA 3PR8A 2C0EA 3CSHA 1A2JA 1T3BA 2VLVA 1UVZA 1TOFA 6GSYA 2K6VA 2AAWA 4OFNA 5ECRB 3P2AA 2YANA 5CP1A 3KP8A 4BL7B 3GKNA 4IW9A 3ZTLA 1M2AA 2MMNA 4K2XA 1U88A 2DKHA 4MF5A 1I5GA 5H5RA 1XW9A 5ABRA 3D22A 3H8QA 1OC9A 1WE0A 2CVDA 2L5LA 5E59A 1GTAA 5F05A 3SWLA 1OE8A 4JU5A 3VPTA 4TXOB 5H5QA 2KP1A 4OCFA 4IP6A 5BMUB 1YEPA 3UMAA 1YVLA 2YWNA 4NV2A 3F3QA 5J4YA 2V1MA 2EFHA 2R2JA 1R7HA 4KF9A 3IR4A 1T4YA 5HR0A 2O87A 3HA9A 4G0LA 3VWUA 2VO4A 2LRCA 1FOHA 4X0XA 5J9BA 3ZMLA 1CQHA 1SD8A 4XS4A 2YN1A 3EMPA 4PUAA 4TXVA 1FG4A 3F0IA 5A34B 1SKSB 5A1NB 1W4VA 2HRNA 1TU8A 3LXTA 5G5FA 1SENA 4BWQA 4Z2RA 5ECKB 1K0AA 4Z2TA 1B9YC 5D73A 19GSA 1YF0A 4HI7A 2GSQA 3GL5A 3QMXA 3TU3B 1XZOA 1ZZYA 4XTSA 1JZWA 5B8AA 2V41A 2CVKA 4GF0A 4F82A 3KP9A 2IL3A 1KTEA 1X5EA 4K5SA 3TOUA 4TR0A 2MMAA 2HLSA 2C80A 2DBCA 2VCXA 1SJ6A 3IOSA 2K8VA 4MF7A 4ACSA 1AAZA 1X0RA 3TCOA 2HRFA 3RPPA 4GDFA 5D9WA 2X8GA 1NHOA 2A2RA 3V1WA 3RHBA 2VCZA 4RUVA 4HU9A 4CDOA 4MPGA 3AY8A 2AYTA 1KBNA 2GQLA 2VL2A 4QQ7A 7GSSA 1JZDA 3FZAA 2EIOA 5A5KA 4E8HA 3A2VA 3CSIA 4KW6A 4NWYA 3M3MA 5A4VA 1PN0A 20GSA 2DIZA 4O5UA 3WYWA 3UJ1A 5A4WA 3EURA 3IDVA 4L5LA 4POKA 1F3BA 5DQSA 5IMZA 1V98A 4BVYA 2DJ2A 2H1LA 1HYUA 2GZZA 4JBBA 4ILFA 4ECCA 1Z7RA 5GSSA 4MH2A 2G2QA 2VM2A 4AJ8A 3G7YA 5G2ZA 1OAZA 3E9JB 4BA7A 4E68A 2HZEB 2ZCTA 4I5QA 1U6TA 4HUAA 4K6XA 3CWGA 1GNEA 1Q4JA 2FCHA 3UARA 3GRXA 1O6JA 2REMA 1QGVA 1SVMA 3IK7A 2YPMA 3UEMA 2MBSA 2PVQA 3KXOA 2BMXA 4D73B 4WF5A 1EGRA 3KMNA 2H0GA 2VCTA 2LRNA 2O8VB 2LTKA 5DVBA 1EWXA 3MWHA 1F2EA 1BAYA 1V2AA 5EVOA 2V6KA 2R3XA 1EP7A 2DJJA 2IPAA 4KH7A 1PSQA 4ZL9A 5G1KA 1R5PA 4J2FA 4TN8A 4O5QA 2O5VA 2CX3A 3H1NA 2LJAA 2F9SA 1THOA 1TK5B 1U3AA 3KZQA 4OWYA 1EV4A 2YCDA 1GL8A 2O89A 4AKHA 3DD3A 1XVQA 3GH6A 1ZYEA 4DVCA 4MJAA 3MIXA 2H01A 1YDKA 2IJYA 4ML6A 1TJDA 2G0FA 3RBTA 1R4WA 1SD9A 2VCVA 4TR1A 3C7MA 2H19A 2L4CA 3DEXA 2GT6A 4IQAA 2QA1A 2MYGA 6GSTA 1QK8A 3KH9A 3KTLA 3KIJA 2VAFA 1MDIA 1N8JA 2H76A 3GTUB 5COHA 4XS1A 1G7OA 3VFIA 2M80A 4YKGA 1HNAA 4G10A 1QQ2A 5IOWA 1DE2A 4NHZA 1Z9HA 2A2PA 2WS2A 3F4SA 1GP1A 3EINA 2F51A 1PL1A 5CO3A 1YZXA 1DUGA 1TXXA 4IQ1A 5DQYA 4MH3A 3Q74A 3TOTA 4AGSA 4HZ2A 2VL2C 1GSYA 1XBSA 4KSMA 3VLNA 2B7JA 1XW6A 1YKAA 1X5CA 3ME8A 1SK0A 3GYKA 2VOCA 2QSIA 3IAM2 5A4UA 4DSSA 1GSDA 1AW9A 3H79A 4PQ1A 2JZSA 5CREA 1YY7A 2VD1A 1K0CA 1WOUA 3MDKA 5J4UA 4K7NA 4Z7XA 1Q98A 1GTBA 1FVJA 2H1DA 4IVFA 4GQCA 5D9TA 2H1GA 4NXIA 5HFGA 5L71A 2WGRA 4IN0A 1OC9B 2FY6A 2CA8A 2AV4A 1V57A 1QFNA 3QOUA 2JZRA 2GSTA 3LORA 3QD9A 3FZ9A 2AJQB 1O85A 2YV7A 5IMVA 3BD2A 2GDRA 1ILOA 3DVWA 2BJXA 2PPTA 1N2AA 4NMUA 5J40A 4G9HA 3KH7A 3QDNA 5KN3A 3FR9A 1XXUA 3GMFA 3VWVA 3GV1A 4L5OA 4XS4B 3HKRA 3UVHA 4F0CA 4MCUA 1JZRA 2VIMA 4H86A 2OACA 2NTOA 1VGLA 3E3EA 1SU9A 1V40A 2N5AA 2HT9A 1EEMA 4ECBA 3A5IA 3L9SA 4EL1A 3RHCA 5IO2A 1BG1A 3BCKA 1ACVA 3QFAC 1SVLA 4Q5QA 1EGOA 2OT3A 4ZILA 3PGTA 1EEJA 2ES7A 3QFBC 3FZ4A 4V2NA 2PVOC 4FYUA 1WMJA 1ERWA 6GSVA 2A4VA 4OD7A 2VLTA 1SKWB 3W6GA 1F9MA 4YQMA 4EDZA 4FIWA 1AC1A 4PURA 3ZLPA 4P3YB 2H0IA 2VCWA 3IHQA 1QMVA 3GSTA 1GULA 3UBLA 5HFKA 4PQIA 2E0QA 2GGTA 4JRRA 1A24A 1JHBA 2K9FA 3GIXA 3LYKA 3WT2A 3UOMA 2DSAA 1X9WB 1EOHA 1A2LA 2WFCA 2GVPA 3KTBA 3EMXA 4JR4A 3UBKA 4N30A 2FHEA 2UV8G 5EY6A 3OR5A 2ON5A 4MA9A 4KA0A 3MSZA 5CRDA 3LWAA 1BQ7A 2F3MA 3LJRA 1O81A 2VCQA 3DIEA 2OKAA 3IK9A 5AIXA 2GSRA 3RAZA 2C1YA 4USSA 5DALA 4BVYB 4EF0A 2PBJA 3GNJA 3M8NA 3FYGA 2X99A 1GSSA 4K0GA 1OE7A 1A8LA 4WETA 3TJFA 4MJCA 4KDUA 5ECQB 3D4TA 4GLTA 2O7KA 1SL1B 2QKEA 4MLYA 4EVMA 3VI7A 1GLPA 4ULXA 3ZVJA 1OC8A 1B4QA 3E0UA 1M7TA 3N9JA 1A2MA 5DCGA 1Z7PA 2FWHA 1AXDA 1M2BA 2CVBA 3HZ8A 3Q19A 4IGJA 5BRTA 2VL9A 4I2TA 2H66A 2MMOA 3WD6A 1O73A 4AKXB 1E6BA 2IMEA 4ISDA 4XRAA 4ZBBA 1K3YA 1XOBA 3MNGA 1K0MA 4K7IA 3HJPA 1M2DA 5AISA 3C1SA 1GSQA 4GSTA 3DYRA 2YJ7A 4MP4A 3CYNA 4ML1A 1TK0B 2L6DA 3GFKA 4EO3A 1PMTA 4AF2A 1PX7A 4HS1A 5AN1A 2DJ0A 2PWJA 3IRAA 4O5RA 4WEYA 1OC3A 5HR2A 1U3IA 3CTGA 5IIZA 4TVEA 2HSHA 3IA1A 4N0VA 4PGTA 2LQQA 4O32A 4V1Ag 1XW5A 2KUCA 3GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL9 A;  1X9S B;  3QAG A;  3CXG A;  3KEB A;  1USB A;  1FO5 A;  2N5B A;  5EPF A;  2DLX A;  4POB A;  3FY7 A;  3O3T A;  1PA3 A;  4TR1 B;  3APQ A;  2C3N A;  3HDC A;  1HD2 A;  3VK9 A;  4I8B A;  3ZRD A;  3BBY A;  1TRW A;  2YV9 A;  3EE2 A;  5FWG A;  4POM A;  4OO4 A;  1K0B A;  2JAC A;  5ELA A;  5KEJ A;  3ERF A;  1RW1 A;  2OBK A;  2QGV A;  4L8E A;  1GTI A;  2VLU A;  3ERG A;  1MDK A;  4WBJ A;  1PKZ A;  4MAB A;  3GKK A;  4K8M A;  1QXH A;  2FGX A;  3HXS A;  3G9B A;  3MAK A;  4JED A;  2R5G A;  2HI7 A;  2YNX A;  2V2G A;  3TDG A;  2IMK A;  4BVX A;  2P31 A;  2P0G A;  3LGC A;  4XRD A;  4WF4 A;  1SK1 A;  1SK2 A;  2RM5 A;  2OJL A;  4MZW A;  2C0G A;  3HVS A;  5ECI B;  1F6M C;  1WJK A;  2LJR A;  1J0F A;  4DSQ A;  3LG6 A;  5GZZ B;  4I97 A;  18GS A;  4TR4 A;  3QAW A;  1FAA A;  2FA4 A;  3VPQ A;  2VL3 A;  3FHK A;  1J9B A;  4DSS B;  1RQM A;  2A2S A;  2NDO A;  4XS6 A;  5EL8 A;  1C72 A;  3TRQ A;  3QR6 A;  4WXT A;  2YZU A;  3GHA A;  5IO0 A;  2E2G A;  1X5D A;  5DJL A;  1LU4 A;  2H6Y A;  2H30 A;  3TJB A;  5JWQ B;  2FWE A;  3F3R A;  2FUG 2;  3EC3 A;  1XWA A;  2IWT A;  2LRT A;  3M9K A;  1R26 A;  5CNW A;  1OVN A;  1YKC A;  4XCS A;  4NHW A;  1DE1 A;  2I1U A;  4YAP A;  2H8L A;  3UVT A;  5ECL B;  4I2U A;  1T00 A;  2B6M A;  1TRV A;  12GS A;  2I4A A;  3G7J A;  4E8E A;  1KEB A;  3FW2 A;  2DML A;  5HQP A;  1G7E A;  3UL3 A;  1GUH A;  4FYC A;  1M9B A;  2H1A A;  3BCI A;  3CTF A;  1BYE A;  4OFM A;  1XWG A;  4J56 E;  4ZL7 A;  4N10 A;  1B8X A;  3I6A A;  3FK8 A;  4OMV A;  1ML6 A;  2F8A A;  4N0Z A;  4O92 A;  1PRX A;  2KOK A;  2IMF A;  2R37 A;  3C73 A;  2TRX A;  3GN3 A;  4JR6 A;  2HRA A;  4L0W A;  1VF1 A;  4KND A;  4ZL8 A;  1EZK A;  2L59 A;  1BX9 A;  3ZIV A;  2KHP A;  3M1G A;  2OE0 A;  3IC4 A;  3KD0 A;  3P8W A;  2H6X A;  16GS A;  3IAS 2;  5B8B A;  5D8I A;  2HSM A;  2L6C A;  5D9X A;  3DXB A;  5C04 A;  1FOV A;  1HNB A;  1FW1 A;  2L57 A;  3F8U A;  4BWS A;  3WGE A;  3LYP A;  2K8S A;  1THX A;  5ID2 A;  3FKF A;  2YWO A;  3A2X A;  4IBP A;  1MD4 A;  3EYT A;  3GA4 A;  3I9V 2;  2LKU A;  4YH2 A;  1A0R P;  3J7Y b;  1FHE A;  9GSS A;  3D4M A;  2HQT A;  3ZMK A;  2HXK A;  4MZB A;  4LLR A;  3ZFL A;  1ON4 A;  2GT5 A;  1XWK A;  2J9H A;  2L4Q A;  1OYJ A;  2P5R A;  1V9W A;  3HZ4 A;  1ZL9 A;  2E2M A;  2K18 A;  5GAN D;  4JE1 A;  3TRX A;  3FR6 A;  4HJM A;  4POL A;  3WGD A;  4MJB A;  10GS A;  4GSN A;  1S3A A;  3H4K A;  3ERW A;  1M0U A;  2YP6 A;  4MDC A;  5GST A;  5IMC A;  2WZ9 A;  2YWI A;  4AJ7 A;  22GS A;  3P90 A;  5DAL B;  2VM1 A;  1H75 A;  3L0H A;  3D0Z A;  1M9A A;  3CBU A;  4GTU A;  4K2D A;  4YQU A;  3R2Q A;  3ZIT A;  2H73 A;  3ZVJ D;  2H0H A;  5JCU A;  2DJK A;  3W8J A;  1K3L A;  5G30 A;  1MEK A;  4L0U A;  3BJ5 A;  1B4P A;  4TRX A;  5DCH A;  2H72 A;  3ISO A;  3ZFB A;  3CSJ A;  1IYI A;  4HEA 2;  5AIV A;  3GX8 A;  3VWX A;  3EWL A;  4KSO A;  1ABA A;  1GSU A;  2XC2 A;  5J41 A;  2NPB A;  5ENU A;  1T7P B;  3FEU A;  5HR3 A;  1XWC A;  2X8H A;  4DEJ A;  2GS3 A;  2IMD A;  3IV4 A;  2XHF A;  1HQO A;  3U6V A;  1TI3 A;  2CZ2 A;  3W8S A;  4K9Z A;  4ZXG A;  4AJ6 A;  2R6K A;  2H75 A;  5F07 A;  3PH9 A;  5INY A;  4FYB A;  1AIU A;  3GSS A;  4YAV A;  2WDU A;  1NHY A;  3DGQ A;  1Z6M A;  2GTU A;  4TR3 A;  1SJI A;  13GS A;  5F06 A;  4HQS A;  3TRP A;  5J3R A;  3ZIJ A;  3ME7 A;  1TRS A;  2F8F A;  5D93 A;  2R4V A;  5F0G A;  1GTU A;  3KM6 A;  2M46 A;  4GWR A;  1ERT A;  1V58 A;  1YQ1 A;  4PQH A;  4Q5R A;  1EOG A;  2RUE A;  3L9U A;  2PMT A;  4ZB8 A;  4X1U A;  1XPV A;  4EDY A;  4Q5N A;  3FRC A;  4ID0 A;  4KCE A;  2I3Y A;  1O8W A;  3TKP A;  1EP8 A;  3CRU A;  1PKW A;  4EE0 A;  3C71 A;  3TKS E;  1M99 A;  2JZT A;  5ECM B;  4ZIJ A;  5IQY A;  4TOP A;  4MF6 A;  5IOX A;  3HJO A;  1WIK A;  1XVW A;  3O6T A;  5IPG A;  1K0N A;  1TI1 A;  2LJK A;  4BVX B;  3K8N A;  2GQK A;  2FA8 A;  2H74 A;  1Y25 A;  4IKH A;  3ED3 A;  5DAK A;  2WB9 A;  5F8B A;  1JLW A;  3KMO A;  1K0D A;  1RK4 A;  3GX0 A;  3APS A;  2JU5 A;  3SBC A;  3KGK A;  3F9U A;  5DJM A;  4LA1 A;  1OKT A;  3RPN A;  2J23 A;  3Q18 A;  2ZNM A;  1JFU A;  1YF1 A;  1DSB A;  1NW2 A;  2FWG A;  2QC7 A;  4WBR D;  2C4J A;  3GL3 A;  2BTO T;  1TW9 A;  2PU9 C;  4Q5F A;  2YWM A;  2B5E A;  1PN9 A;  2RM6 A;  2OE3 A;  5B6N A;  2CAQ A;  2C3Q A;  2IFQ A;  5LCZ A;  1GRX A;  4IP1 A;  3F63 A;  4TKY A;  4YQV A;  2H70 A;  2WUL A;  1E2Y A;  5G31 A;  1GUM A;  1I9D A;  3G7I A;  2MBT A;  1BED A;  1S3D A;  4PX1 A;  1H4O A;  1MTC A;  2GSS A;  6GSS A;  1ERU A;  2B3S A;  1A23 A;  2B7K A;  2IIY A;  4HJ2 A;  5ECP B;  4NV5 A;  4O7H A;  1CQG A;  4EUY A;  2H6Z A;  1F37 A;  2FNO A;  3DVX A;  3DKS A;  5G5E A;  2B5Y A;  1PD2 1;  3HJM A;  6GSX A;  1XOA A;  2HZF A;  2FLS A;  4OO5 A;  4EKZ A;  5CYY A;  2OBI A;  3APO A;  1NSW A;  2LUS A;  4GCI A;  3C8E A;  3A2W A;  1A0F A;  2LS5 A;  4G2E A;  1NM3 A;  2YJH A;  3F6D A;  2UZ8 A;  2HNL A;  1B9X C;  1GH2 A;  3S9F A;  1PX6 A;  5B6M A;  4JZQ A;  5C00 A;  4OCE A;  2HSM B;  2CZ3 A;  3CMI A;  14GS A;  1X9M B;  1Y6E A;  2NVL A;  1ZOF A;  3LSZ A;  1UN2 A;  2WCI A;  4IS0 A;  5ID2 B;  3A5W A;  1F3A A;  1XCC A;  3NIV A;  1U87 A;  1KNG A;  4V2M A;  3LEF A;  4WR5 A;  5LD0 A;  2B1K A;  3GKM A;  4PTS A;  1TK8 B;  3ZZX A;  2KLX A;  3LFL A;  1W89 A;  2JSY A;  4BPY A;  2I81 A;  4F9Z A;  1ZGN A;  3P7X A;  2LQO A;  1WP0 A;  1SKR B;  2DC5 A;  4V1A p;  4F0B A;  3D21 A;  3TKQ A;  1WPI A;  3TKR A;  2GLR A;  2HYX A;  1AQW A;  4RQX A;  4EC0 A;  5JWO B;  1T4Z A;  17GS A;  1ZCP A;  2FD3 A;  5ELG A;  2CQ9 A;  3TUE A;  3D6I A;  2MMZ A;  2CV4 A;  1UC7 A;  5E4W A;  5J5N A;  4HOJ A;  1EV9 A;  2B5X A;  4CHS A;  2RLI A;  3L4N A;  3TJK A;  1LJR A;  1AQV A;  3GUR A;  4PUF C;  5IPH A;  2VD0 A;  2PUK C;  1S3C A;  1R5A A;  4IJI A;  5FT3 A;  4IJ3 A;  3UIW A;  2HRK A;  4ECJ A;  2C0D A;  2LNT A;  1QUW A;  5B7C A;  3EU4 A;  4GSS A;  2WJU A;  3F4R A;  4BL7 A;  4GQF A;  1O7U A;  1SL0 B;  3D5J A;  1DBY A;  2I9H A;  2RII A;  4XHM A;  1MD3 A;  3UAP A;  4GXZ A;  3EVI A;  4LMW A;  2EC4 A;  5GAP D;  2JSZ A;  3N5O A;  3GH9 A;  4DSR A;  3C1R A;  3RDW A;  2VUP A;  4J57 E;  1VF2 A;  3IXR A;  1IYH A;  2YZH A;  3L9V A;  4TXO A;  5KN1 A;  3F6F A;  1T8E B;  5BMU A;  1SYX A;  2NBS A;  2AUV A;  3U5R E;  2DJ1 A;  3F4T A;  4ZBA A;  2JAD A;  4LL4 B;  2KP2 A;  1GNW A;  4HU7 A;  4RI7 A;  2FWF A;  1GSF A;  2DIY A;  4GRF A;  1A8Y A;  1SJZ A;  1SL2 B;  3EU3 A;  2XBI A;  3I69 A;  5JCG A;  2X64 A;  3KJY A;  3NZN A;  2CX4 A;  4FO5 A;  1TDI A;  1TRU A;  1TP9 A;  4KGI A;  2C3T A;  1G0T A;  2EIR A;  3WT1 A;  3VUR A;  3ZYW A;  2GQM A;  4MZC A;  2M72 A;  5IMA A;  1YEX A;  2OAD A;  3NOF A;  1O8X A;  1FB6 A;  4NAX A;  5CRH A;  1OKD A;  3TJJ A;  3TKS A;  5LNK e;  2V6O A;  5HFI A;  1JLV A;  2TIR A;  1B48 A;  2LEG A;  2V32 A;  4OFT A;  4WR4 A;  2C0F A;  1Z5Y E;  5CAX A;  5IM9 A;  2AB6 A;  3TGZ A;  4FH8 A;  4HQZ A;  3LQ7 A;  1Z3E A;  1TTZ A;  3PIN A;  3WGX A;  1PQN A;  5D96 A;  4ZBD A;  1AUC A;  3QCP A;  1HNC A;  2OA7 A;  2HFD A;  1G6W A;  2CT6 A;  1XIY A;  4LMV A;  4N11 A;  4EXJ A;  4HZ4 A;  1ZYQ B;  3HYP A;  2HSN B;  3IBH A;  4MPF A;  1ZMA A;  5AGY A;  5DAK B;  2Z9S A;  4WKW A;  1VRS D;  3HHV A;  4KAE A;  5FHI A;  4QL7 A;  5CRG A;  5G1L A;  2AHE A;  5DBQ A;  3ZRE A;  4NPB A;  3J7Y k;  2ON7 A;  5D9V A;  3DRN A;  4F2I A;  1GUK A;  4KE3 A;  2MZC A;  2PER A;  1TU7 A;  3L78 A;  1WWJ A;  3M9J A;  3PPU A;  1SYR A;  2C8U A;  1FVK A;  3GKX A;  1Z6N A;  2JL4 A;  3CRT A;  3HVV A;  3TJG A;  1FB0 A;  4ECI A;  4I6X A;  1URM A;  2IFQ B;  2HZE A;  2D2Z A;  2N5F A;  2LST A;  5ECO B;  2P5Q A;  3HD5 A;  2IN3 A;  1VF3 A;  4ZB9 A;  3H93 A;  1YJ6 A;  3VWW A;  3Q6O A;  1WRY A;  4RI6 A;  2H71 A;  5J9C A;  4ZB6 A;  1G6Y A;  4KUN A;  1UA5 A;  2DMM A;  4D73 A;  4K7O A;  1J08 A;  2EIQ A;  4PNF A;  2YOI A;  1GSE A;  4K1F A;  4PNG A;  1AQX A;  1K0O A;  1GLQ A;  1K3O A;  5DDL A;  1TKD B;  5IMD A;  11GS A;  2HE3 A;  3FZ5 A;  4CW9 A;  1ST9 A;  2H1B A;  4V2L A;  4G0I A;  4TW5 A;  3IC8 A;  1JZO A;  5KN2 A;  2CAI A;  6GSW A;  4KDX A;  4RQR A;  2DJ3 A;  3IPZ A;  3QAV A;  3TB2 A;  3A3T A;  4PXO A;  4G19 A;  2LNS A;  4MK3 A;  3ZL5 A;  3M0F A;  4K0N A;  3JCM L;  1T1V A;  2PN8 A;  1PGT A;  5ECH B;  2XPD A;  4KDY A;  2B1L A;  3BOA A;  4IHU A;  5ECS A;  4LL1 B;  1LBK A;  4MMM A;  4FQU A;  2GZP A;  2RUF A;  3KCM A;  5HR1 A;  4MJE A;  4X43 A;  3I43 A;  2TRC P;  3HY2 A;  4IEL A;  1MDJ A;  3DML A;  5IMF A;  5JWR B;  3O76 A;  3HVX A;  1GWC A;  3TKS C;  3GTU A;  3IE3 A;  8GSS A;  2L5O A;  4F03 A;  2ALB A;  1VF4 A;  1BG5 A;  1PL2 A;  2HSY A;  4G0K A;  2ZUP A;  2XPE A;  4KB3 A;  1XFL A;  3FR3 A;  2E7P A;  2XBQ A;  3HCZ A;  1BJX A;  1ERV A;  2PGT A;  5JCW A;  1XWB A;  5CRW A;  6GSU A;  2OE1 A;  4KX4 A;  3R3E A;  3VI5 A;  4KCA A;  3LXZ A;  3QPM A;  4HDE A;  3US3 A;  2O85 A;  2LV3 A;  5KN0 A;  3DWV A;  5ECN B;  2X8C A;  4XIH A;  5H5S A;  2WRT A;  2HRK B;  2GZY A;  2IMI A;  3PR8 A;  2C0E A;  3CSH A;  1A2J A;  1T3B A;  2VLV A;  1UVZ A;  1TOF A;  6GSY A;  2K6V A;  2AAW A;  4OFN A;  5ECR B;  3P2A A;  2YAN A;  5CP1 A;  3KP8 A;  4BL7 B;  3GKN A;  4IW9 A;  3ZTL A;  1M2A A;  2MMN A;  1U88 A;  4MF5 A;  1I5G A;  5H5R A;  1XW9 A;  5ABR A;  3D22 A;  3H8Q A;  1OC9 A;  1WE0 A;  2CVD A;  2L5L A;  5E59 A;  1GTA A;  5F05 A;  3SWL A;  1OE8 A;  4JU5 A;  3VPT A;  4TXO B;  5H5Q A;  2KP1 A;  4OCF A;  4IP6 A;  1YEP A;  3UMA A;  2YWN A;  4NV2 A;  3F3Q A;  2V1M A;  2R2J A;  1R7H A;  4KF9 A;  3IR4 A;  1T4Y A;  5HR0 A;  2O87 A;  3HA9 A;  4G0L A;  3VWU A;  2VO4 A;  2LRC A;  4X0X A;  5J9B A;  3ZML A;  1CQH A;  1SD8 A;  4XS4 A;  2YN1 A;  3EMP A;  4PUA A;  4TXV A;  1FG4 A;  3F0I A;  1SKS B;  1W4V A;  2HRN A;  1TU8 A;  3LXT A;  5G5F A;  1SEN A;  4BWQ A;  5ECK B;  1K0A A;  1B9Y C;  5D73 A;  19GS A;  1YF0 A;  4HI7 A;  2GSQ A;  3GL5 A;  3QMX A;  1XZO A;  1ZZY A;  4XTS A;  1JZW A;  5B8A A;  2V41 A;  2CVK A;  4GF0 A;  4F82 A;  3KP9 A;  2IL3 A;  1KTE A;  1X5E A;  3TOU A;  4TR0 A;  2MMA A;  2HLS A;  2C80 A;  2DBC A;  2VCX A;  1SJ6 A;  3IOS A;  2K8V A;  4MF7 A;  4ACS A;  1AAZ A;  1X0R A;  3TCO A;  2HRF A;  3RPP A;  5D9W A;  2X8G A;  1NHO A;  2A2R A;  3V1W A;  3RHB A;  2VCZ A;  4RUV A;  4HU9 A;  4CDO A;  4MPG A;  3AY8 A;  2AYT A;  1KBN A;  2GQL A;  2VL2 A;  4QQ7 A;  7GSS A;  1JZD A;  3FZA A;  2EIO A;  5A5K A;  4E8H A;  3A2V A;  3CSI A;  4KW6 A;  4NWY A;  3M3M A;  5A4V A;  20GS A;  2DIZ A;  3WYW A;  3UJ1 A;  5A4W A;  3EUR A;  3IDV A;  4L5L A;  4POK A;  1F3B A;  5DQS A;  5IMZ A;  1V98 A;  4BVY A;  2DJ2 A;  1HYU A;  2GZZ A;  4JBB A;  4ILF A;  4ECC A;  1Z7R A;  5GSS A;  4MH2 A;  2G2Q A;  2VM2 A;  4AJ8 A;  3G7Y A;  5G2Z A;  1OAZ A;  3E9J B;  4BA7 A;  2HZE B;  2ZCT A;  4I5Q A;  1U6T A;  4HUA A;  4K6X A;  1GNE A;  1Q4J A;  2FCH A;  3UAR A;  3GRX A;  1O6J A;  2REM A;  1QGV A;  3IK7 A;  2YPM A;  3UEM A;  2MBS A;  2PVQ A;  3KXO A;  2BMX A;  4D73 B;  4WF5 A;  1EGR A;  3KMN A;  2H0G A;  2VCT A;  2LRN A;  2O8V B;  2LTK A;  5DVB A;  1EWX A;  3MWH A;  1F2E A;  1BAY A;  1V2A A;  5EVO A;  2V6K A;  2R3X A;  1EP7 A;  2DJJ A;  2IPA A;  4KH7 A;  1PSQ A;  4ZL9 A;  5G1K A;  1R5P A;  4J2F A;  4TN8 A;  2CX3 A;  3H1N A;  2LJA A;  2F9S A;  1THO A;  1TK5 B;  1U3A A;  3KZQ A;  4OWY A;  1EV4 A;  2YCD A;  1GL8 A;  2O89 A;  3DD3 A;  1XVQ A;  3GH6 A;  1ZYE A;  4DVC A;  4MJA A;  2H01 A;  1YDK A;  2IJY A;  4ML6 A;  1TJD A;  2G0F A;  3RBT A;  1R4W A;  1SD9 A;  2VCV A;  4TR1 A;  3C7M A;  2H19 A;  2L4C A;  3DEX A;  2GT6 A;  4IQA A;  2MYG A;  6GST A;  1QK8 A;  3KH9 A;  3KTL A;  3KIJ A;  2VAF A;  1MDI A;  1N8J A;  2H76 A;  3GTU B;  5COH A;  4XS1 A;  1G7O A;  3VFI A;  2M80 A;  1HNA A;  4G10 A;  1QQ2 A;  5IOW A;  1DE2 A;  4NHZ A;  1Z9H A;  2WS2 A;  3F4S A;  1GP1 A;  3EIN A;  2F51 A;  1PL1 A;  5CO3 A;  1YZX A;  1DUG A;  1TXX A;  4IQ1 A;  5DQY A;  4MH3 A;  3Q74 A;  3TOT A;  4AGS A;  4HZ2 A;  2VL2 C;  1GSY A;  1XBS A;  4KSM A;  3VLN A;  2B7J A;  1XW6 A;  1YKA A;  1X5C A;  3ME8 A;  1SK0 A;  3GYK A;  2VOC A;  2QSI A;  3IAM 2;  5A4U A;  4DSS A;  1GSD A;  1AW9 A;  3H79 A;  4PQ1 A;  2JZS A;  5CRE A;  1YY7 A;  2VD1 A;  1K0C A;  1WOU A;  3MDK A;  5J4U A;  4K7N A;  4Z7X A;  1Q98 A;  1GTB A;  1FVJ A;  2H1D A;  4IVF A;  4GQC A;  5D9T A;  2H1G A;  4NXI A;  5HFG A;  5L71 A;  2WGR A;  4IN0 A;  1OC9 B;  2FY6 A;  2CA8 A;  2AV4 A;  1V57 A;  1QFN A;  3QOU A;  2JZR A;  2GST A;  3LOR A;  3QD9 A;  3FZ9 A;  2AJQ B;  1O85 A;  2YV7 A;  5IMV A;  3BD2 A;  2GDR A;  1ILO A;  3DVW A;  2BJX A;  2PPT A;  1N2A A;  4NMU A;  4G9H A;  3KH7 A;  3QDN A;  5KN3 A;  3FR9 A;  1XXU A;  3GMF A;  3VWV A;  3GV1 A;  4L5O A;  4XS4 B;  3HKR A;  3UVH A;  4F0C A;  4MCU A;  1JZR A;  4H86 A;  2VIM A;  2OAC A;  2NTO A;  1VGL A;  3E3E A;  1SU9 A;  1V40 A;  2N5A A;  2HT9 A;  1EEM A;  4ECB A;  3L9S A;  4EL1 A;  3RHC A;  5IO2 A;  3BCK A;  1ACV A;  3QFA C;  4Q5Q A;  1EGO A;  4ZIL A;  3PGT A;  1EEJ A;  2ES7 A;  3QFB C;  3FZ4 A;  4V2N A;  2PVO C;  4FYU A;  1WMJ A;  1ERW A;  6GSV A;  2A4V A;  4OD7 A;  2VLT A;  1SKW B;  3W6G A;  1F9M A;  4YQM A;  4EDZ A;  4FIW A;  1AC1 A;  4PUR A;  3ZLP A;  4P3Y B;  2H0I A;  2VCW A;  3IHQ A;  1QMV A;  3GST A;  1GUL A;  3UBL A;  5HFK A;  4PQI A;  2E0Q A;  2GGT A;  4JRR A;  1A24 A;  1JHB A;  2K9F A;  3GIX A;  3LYK A;  3WT2 A;  3UOM A;  2DSA A;  1X9W B;  1EOH A;  1A2L A;  2WFC A;  2GVP A;  3KTB A;  3EMX A;  4JR4 A;  3UBK A;  4N30 A;  2FHE A;  5EY6 A;  3OR5 A;  2ON5 A;  4MA9 A;  4KA0 A;  3MSZ A;  5CRD A;  3LWA A;  1BQ7 A;  2F3M A;  3LJR A;  1O81 A;  2VCQ A;  3DIE A;  2OKA A;  3IK9 A;  5AIX A;  2GSR A;  3RAZ A;  2C1Y A;  4USS A;  5DAL A;  4BVY B;  4EF0 A;  2PBJ A;  3GNJ A;  3M8N A;  3FYG A;  2X99 A;  1GSS A;  4K0G A;  1OE7 A;  1A8L A;  4WET A;  3TJF A;  4MJC A;  4KDU A;  5ECQ B;  3D4T A;  4GLT A;  2O7K A;  1SL1 B;  2QKE A;  4MLY A;  4EVM A;  3VI7 A;  1GLP A;  4ULX A;  3ZVJ A;  1OC8 A;  1B4Q A;  3E0U A;  1M7T A;  3N9J A;  1A2M A;  5DCG A;  1Z7P A;  2FWH A;  1AXD A;  1M2B A;  2CVB A;  3HZ8 A;  3Q19 A;  4IGJ A;  2VL9 A;  4I2T A;  2H66 A;  2MMO A;  3WD6 A;  1O73 A;  1E6B A;  2IME A;  4ISD A;  4XRA A;  4ZBB A;  1K3Y A;  1XOB A;  3MNG A;  1K0M A;  4K7I A;  3HJP A;  1M2D A;  5AIS A;  3C1S A;  1GSQ A;  4GST A;  3DYR A;  2YJ7 A;  4MP4 A;  3CYN A;  4ML1 A;  1TK0 B;  2L6D A;  3GFK A;  4EO3 A;  1PMT A;  4AF2 A;  1PX7 A;  4HS1 A;  5AN1 A;  2DJ0 A;  2PWJ A;  3IRA A;  4O5R A;  4WEY A;  1OC3 A;  5HR2 A;  1U3I A;  3CTG A;  5IIZ A;  4TVE A;  2HSH A;  3IA1 A;  4N0V A;  4PGT A;  2LQQ A;  4O32 A;  4V1A g;  1XW5 A;  2KUC A;  3GUS A; 
#chains in the Genus database with same CATH topology
 4QL9 A;  1X9S B;  3QAG A;  3CXG A;  4A5P A;  3KEB A;  1USB A;  2DKI A;  1FO5 A;  2N5B A;  5EPF A;  2DLX A;  4FXY P;  4POB A;  3FY7 A;  3O3T A;  1PA3 A;  4TR1 B;  3APQ A;  2C3N A;  3HDC A;  1HD2 A;  3VK9 A;  2R0C A;  4I8B A;  3ZRD A;  3BBY A;  1TRW A;  2YV9 A;  3EE2 A;  5FWG A;  4POM A;  4OO4 A;  1K0B A;  4K5R A;  2JAC A;  5ELA A;  1TXU A;  3ERF A;  5KEJ A;  1RW1 A;  2OBK A;  2QGV A;  4L8E A;  1GTI A;  2VLU A;  3ERG A;  1MDK A;  4WBJ A;  2QA2 A;  1PKZ A;  4MAB A;  3GKK A;  4K8M A;  1QXH A;  2FGX A;  3HXS A;  3G9B A;  3MAK A;  4JED A;  2R5G A;  2HI7 A;  2YNX A;  2V2G A;  3TDG A;  2IMK A;  4BVX A;  2P31 A;  2P0G A;  3LGC A;  4XRD A;  4WF4 A;  1SK1 A;  1SK2 A;  3EPT A;  2RM5 A;  2OJL A;  4MZW A;  2C0G A;  3HVS A;  5ECI B;  1F6M C;  1WJK A;  2LJR A;  1J0F A;  4DSQ A;  3LG6 A;  5GZZ B;  4I97 A;  18GS A;  4TR4 A;  3QAW A;  1FAA A;  2FA4 A;  3VPQ A;  2VL3 A;  3FHK A;  1J9B A;  4DSS B;  2X49 A;  1RQM A;  2A2S A;  2NDO A;  4XS6 A;  5EL8 A;  1C72 A;  3TRQ A;  3QR6 A;  4WXT A;  2YZU A;  3GHA A;  5IO0 A;  2E2G A;  1X5D A;  5DJL A;  1LU4 A;  1Y1U A;  2H6Y A;  2H30 A;  3TJB A;  5JWQ B;  2FWE A;  3F3R A;  2FUG 2;  3EC3 A;  1XWA A;  2IWT A;  2LRT A;  3M9K A;  1R26 A;  5CNW A;  1OVN A;  1YKC A;  4XCS A;  4NHW A;  1DE1 A;  2I1U A;  4YAP A;  2H8L A;  3UVT A;  5ECL B;  4I2U A;  5A5H A;  1T00 A;  2B6M A;  3CQF A;  1TRV A;  3RFR C;  12GS A;  2I4A A;  3G7J A;  4E8E A;  1KEB A;  3FW2 A;  2DML A;  5HQP A;  1G7E A;  3UL3 A;  1GUH A;  4FYC A;  1M9B A;  2H1A A;  3BCI A;  3CTF A;  1BYE A;  4OFM A;  1XWG A;  5J4V A;  4J56 E;  4ZL7 A;  4N10 A;  4QMK A;  1B8X A;  3I6A A;  3FK8 A;  4OMV A;  1ML6 A;  2F8A A;  4N0Z A;  4O92 A;  1PRX A;  2KOK A;  2IMF A;  2R37 A;  3C73 A;  2TRX A;  3GN3 A;  4JR6 A;  2HRA A;  4L0W A;  1VF1 A;  4KND A;  4ZL8 A;  1EZK A;  2L59 A;  1BX9 A;  3ZIV A;  2KHP A;  3M1G A;  2OE0 A;  3IC4 A;  3KD0 A;  3P8W A;  2H6X A;  16GS A;  3IAS 2;  5B8B A;  5D8I A;  2HSM A;  2L6C A;  5D9X A;  3DXB A;  5C04 A;  1FOV A;  1HNB A;  1FW1 A;  2L57 A;  3F8U A;  4BWS A;  3WGE A;  3LYP A;  2K8S A;  1THX A;  5ID2 A;  3FKF A;  4N3Z A;  2YWO A;  3A2X A;  4IBP A;  1MD4 A;  3EYT A;  3GA4 A;  3I9V 2;  2LKU A;  4YH2 A;  1A0R P;  3J7Y b;  1FHE A;  9GSS A;  2EFC A;  3D4M A;  2HQT A;  3ZMK A;  2HXK A;  4MZB A;  4LLR A;  3ZFL A;  1ON4 A;  2GT5 A;  1XWK A;  2J9H A;  2L4Q A;  1OYJ A;  2P5R A;  1V9W A;  3HZ4 A;  1ZL9 A;  2E2M A;  2K18 A;  5GAN D;  4JE1 A;  3TRX A;  3FR6 A;  4HJM A;  4POL A;  3WGD A;  4MJB A;  10GS A;  4GSN A;  1S3A A;  3H4K A;  4EIQ A;  3ERW A;  1M0U A;  1ZYN A;  2YP6 A;  4MDC A;  5GST A;  5IMC A;  2WZ9 A;  2YWI A;  4AJ7 A;  22GS A;  3P90 A;  5DAL B;  2VM1 A;  1H75 A;  3L0H A;  3D0Z A;  1M9A A;  3CBU A;  4GTU A;  4K2D A;  5J47 A;  4YQU A;  5KOX A;  3R2Q A;  3ZIT A;  2H73 A;  3ZVJ D;  2H0H A;  5JCU A;  2DJK A;  3W8J A;  1K3L A;  5G30 A;  1MEK A;  4L0U A;  4AKG A;  3BJ5 A;  1B4P A;  4TRX A;  5DCH A;  2H72 A;  3ISO A;  3ZFB A;  3CSJ A;  1IYI A;  4HEA 2;  5AIV A;  4CY8 A;  3GX8 A;  3VWX A;  3EWL A;  4KSO A;  1ABA A;  1GSU A;  2XC2 A;  5J41 A;  2NPB A;  5ENU A;  1T7P B;  3FEU A;  2R0P A;  5HR3 A;  1XWC A;  2X8H A;  4DEJ A;  2GS3 A;  2IMD A;  3IV4 A;  2XHF A;  1HQO A;  3U6V A;  1TI3 A;  2CZ2 A;  2EFE A;  3W8S A;  2WW1 A;  4K9Z A;  4ZXG A;  4AJ6 A;  2R6K A;  2H75 A;  5F07 A;  3PH9 A;  5INY A;  4FYB A;  1AIU A;  3GSS A;  4YAV A;  2WDU A;  1NHY A;  3DGQ A;  4AI6 A;  1M3J A;  1Z6M A;  2GTU A;  4TR3 A;  1SJI A;  13GS A;  5F06 A;  4HQS A;  3TRP A;  5J3R A;  3ZIJ A;  3ME7 A;  1TRS A;  4AKI A;  2F8F A;  5D93 A;  2R4V A;  5F0G A;  1GTU A;  3KM6 A;  2M46 A;  4GWR A;  1ERT A;  1V58 A;  1YQ1 A;  4PQH A;  4Q5R A;  1EOG A;  2RUE A;  3L9U A;  2PMT A;  4ZB8 A;  4X1U A;  3HMJ G;  1XPV A;  4EDY A;  4Q5N A;  3FRC A;  4ID0 A;  4KCE A;  2I3Y A;  4G01 A;  1O8W A;  3FMW A;  3TKP A;  1EP8 A;  3CRU A;  1PKW A;  4EE0 A;  3C71 A;  3TKS E;  1M99 A;  2JZT A;  5ECM B;  4ZIJ A;  5IQY A;  4TOP A;  4MF6 A;  5IOX A;  3HJO A;  1WIK A;  1XVW A;  3O6T A;  5IPG A;  1K0N A;  1TI1 A;  2LJK A;  4BVX B;  3K8N A;  2HSN A;  2GQK A;  2FA8 A;  2H74 A;  1Y25 A;  4IKH A;  3ED3 A;  5DAK A;  2WB9 A;  5F8B A;  1JLW A;  3KMO A;  1K0D A;  1RK4 A;  3GX0 A;  3APS A;  2JU5 A;  3SBC A;  3KGK A;  3F9U A;  5DJM A;  4LA1 A;  1OKT A;  3RPN A;  2J23 A;  3Q18 A;  2ZNM A;  1JFU A;  1YF1 A;  1DSB A;  1NW2 A;  2FWG A;  2QC7 A;  4WBR D;  2C4J A;  3GL3 A;  2BTO T;  1TW9 A;  1SVO A;  2PU9 C;  4Q5F A;  2YWM A;  2B5E A;  1PN9 A;  2RM6 A;  2OE3 A;  3LW9 A;  4MNN A;  5B6N A;  2CAQ A;  2C3Q A;  2IFQ A;  5LCZ A;  1GRX A;  4IP1 A;  3F63 A;  4TKY A;  4W66 A;  4YQV A;  2H70 A;  2WUL A;  1E2Y A;  5G31 A;  1GUM A;  1I9D A;  3G7I A;  2MBT A;  1BED A;  1S3D A;  4PX1 A;  1H4O A;  1MTC A;  2GSS A;  3MYD A;  6GSS A;  1ERU A;  5A5H B;  2B3S A;  1A23 A;  2B7K A;  3HVN A;  2IIY A;  4HJ2 A;  5ECP B;  4NV5 A;  4O7H A;  1CQG A;  4EUY A;  2H6Z A;  1N25 A;  1F37 A;  2FNO A;  3DVX A;  3DKS A;  5G5E A;  2B5Y A;  1PD2 1;  3HJM A;  2WVZ A;  4BIK A;  6GSX A;  1XOA A;  2HZF A;  2FLS A;  4OO5 A;  4EKZ A;  5CYY A;  2OBI A;  3APO A;  1NSW A;  2LUS A;  4GCI A;  3C8E A;  3A2W A;  1A0F A;  2LS5 A;  4G2E A;  1NM3 A;  2YJH A;  3F6D A;  2UZ8 A;  2HNL A;  1B9X C;  1GH2 A;  3S9F A;  1PX6 A;  5B6M A;  4JZQ A;  5C00 A;  4OCE A;  2HSM B;  2CZ3 A;  3CMI A;  14GS A;  1X9M B;  1Y6E A;  2NVL A;  1ZOF A;  3LSZ A;  1UN2 A;  2WCI A;  4IS0 A;  5ID2 B;  3A5W A;  1F3A A;  1XCC A;  3NIV A;  1U87 A;  1KNG A;  4V2M A;  3LEF A;  4WR5 A;  5LD0 A;  4Z2U A;  2B1K A;  3GKM A;  4PI2 C;  4PTS A;  1TK8 B;  3ZZX A;  2KLX A;  3LFL A;  1W89 A;  2JSY A;  4BPY A;  2I81 A;  4F9Z A;  1ZGN A;  3P7X A;  2LQO A;  1WP0 A;  1SKR B;  2DC5 A;  4V1A p;  4X4J A;  4F0B A;  3D21 A;  3TKQ A;  1WPI A;  3TKR A;  2GLR A;  2HYX A;  1AQW A;  4RQX A;  4EC0 A;  5JWO B;  1T4Z A;  17GS A;  1ZCP A;  2FD3 A;  5ELG A;  2CQ9 A;  3TUE A;  3D6I A;  2MMZ A;  2CV4 A;  1UC7 A;  5E4W A;  5J5N A;  4HOJ A;  1EV9 A;  2B5X A;  4CHS A;  2RLI A;  3L4N A;  3TJK A;  1LJR A;  1AQV A;  3GUR A;  4PUF C;  5IPH A;  2VD0 A;  2PUK C;  1S3C A;  1R5A A;  4IJI A;  5FT3 A;  4IJ3 A;  3UIW A;  2HRK A;  4ECJ A;  2C0D A;  2LNT A;  1QUW A;  5B7C A;  3EU4 A;  4GSS A;  2WJU A;  3F4R A;  4BL7 A;  4GQF A;  1O7U A;  1SL0 B;  3D5J A;  1DBY A;  4HSC X;  2I9H A;  2RII A;  4XHM A;  1MD3 A;  3UAP A;  4GXZ A;  3EVI A;  4LMW A;  2EC4 A;  5GAP D;  2JSZ A;  3N5O A;  3GH9 A;  4DSR A;  3C1R A;  3RDW A;  2VUP A;  4J57 E;  4EIP A;  1VF2 A;  4ZB7 A;  3IXR A;  1IYH A;  2YZH A;  3L9V A;  4TXO A;  1PFO A;  5KN1 A;  3F6F A;  1T8E B;  5BMU A;  1SYX A;  2NBS A;  2AUV A;  3U5R E;  2DJ1 A;  3F4T A;  4ZBA A;  2JAD A;  4LL4 B;  2KP2 A;  1GNW A;  4HU7 A;  4RI7 A;  2FWF A;  1GSF A;  2DIY A;  4GRF A;  1A8Y A;  1SJZ A;  1SL2 B;  3EU3 A;  2XBI A;  3I69 A;  5JCG A;  2X64 A;  3KJY A;  3NZN A;  2CX4 A;  5A34 A;  5A1N A;  4FO5 A;  1TDI A;  1TRU A;  1TP9 A;  2WVX A;  4KGI A;  2C3T A;  1G0T A;  2EIR A;  3WT1 A;  3VUR A;  3ZYW A;  2GQM A;  4MZC A;  2M72 A;  5IMA A;  1YEX A;  2OAD A;  3NOF A;  1O8X A;  1FB6 A;  4NAX A;  5CRH A;  1OKD A;  3TJJ A;  3TKS A;  5LNK e;  2V6O A;  5HFI A;  1JLV A;  2TIR A;  1B48 A;  2O36 A;  4ICY A;  2LEG A;  2V32 A;  4OFT A;  4WR4 A;  2C0F A;  1Z5Y E;  5CAX A;  5IM9 A;  2AB6 A;  3TGZ A;  4FH8 A;  4HQZ A;  3LQ7 A;  1Z3E A;  1TTZ A;  3PIN A;  3WGX A;  1PQN A;  5D96 A;  4ZBD A;  1AUC A;  3QCP A;  1HNC A;  2OA7 A;  2EFD A;  2HFD A;  1G6W A;  2CT6 A;  1XIY A;  4LMV A;  5KOW A;  4N11 A;  4EXJ A;  4HZ4 A;  1ZYQ B;  3HYP A;  2HSN B;  3IBH A;  4MPF A;  1ZMA A;  5AGY A;  5DAK B;  2VKZ G;  2Z9S A;  4WKW A;  1VRS D;  3HHV A;  4KAE A;  5FHI A;  4QL7 A;  5CRG A;  5G1L A;  2AHE A;  5DBQ A;  3ZRE A;  4NPB A;  3J7Y k;  2ON7 A;  5D9V A;  3DRN A;  4F2I A;  1GUK A;  4KE3 A;  2MZC A;  2PER A;  1TU7 A;  3L78 A;  1WWJ A;  3M9J A;  3PPU A;  1SYR A;  2C8U A;  1FVK A;  3GKX A;  1Z6N A;  2JL4 A;  3CRT A;  3HVV A;  2R0G A;  3TJG A;  1FB0 A;  4ECI A;  4I6X A;  1BF5 A;  4CY6 A;  1URM A;  2IFQ B;  2HZE A;  2D2Z A;  2N5F A;  2LST A;  3CHX C;  5ECO B;  2P5Q A;  3HD5 A;  2IN3 A;  1VF3 A;  4ZB9 A;  3H93 A;  1YJ6 A;  3VWW A;  3Q6O A;  1WRY A;  4RI6 A;  2H71 A;  5J9C A;  4ZB6 A;  1G6Y A;  4KUN A;  1UA5 A;  2DMM A;  4D73 A;  4K7O A;  1J08 A;  2EIQ A;  4PNF A;  2YOI A;  1GSE A;  2X4A A;  4K1F A;  4PNG A;  1AQX A;  1K0O A;  1GLQ A;  1K3O A;  5DDL A;  1TKD B;  5IMD A;  11GS A;  2HE3 A;  3FZ5 A;  4CW9 A;  1ST9 A;  2H1B A;  4V2L A;  4G0I A;  4TW5 A;  3IC8 A;  1JZO A;  5KN2 A;  2CAI A;  6GSW A;  4KDX A;  4RQR A;  2DJ3 A;  3IPZ A;  3QAV A;  1XG8 A;  3TB2 A;  3A3T A;  4PXO A;  2WW0 A;  4G19 A;  2LNS A;  4MK3 A;  3ZL5 A;  3M0F A;  4K0N A;  1ZYP A;  3JCM L;  1T1V A;  2PN8 A;  1PGT A;  5ECH B;  2XPD A;  4KDY A;  2B1L A;  3BOA A;  3IHG A;  4IHU A;  5ECS A;  4LL1 B;  1LBK A;  4MMM A;  4FQU A;  2GZP A;  2RUF A;  3KCM A;  5HR1 A;  4MJE A;  4X43 A;  3I43 A;  2TRC P;  3HY2 A;  4IEL A;  1MDJ A;  3DML A;  5IMF A;  5JWR B;  3O76 A;  3HVX A;  1GWC A;  4YKF A;  3TKS C;  3GTU A;  3IE3 A;  8GSS A;  2L5O A;  4F03 A;  2ALB A;  1VF4 A;  1BG5 A;  1PL2 A;  2HSY A;  4G0K A;  2ZUP A;  2XPE A;  4KB3 A;  1XFL A;  3FR3 A;  2E7P A;  2XBQ A;  3HCZ A;  1BJX A;  1ERV A;  2A4H A;  2PGT A;  5JCW A;  1XWB A;  5CRW A;  6GSU A;  2OE1 A;  4KX4 A;  3R3E A;  3VI5 A;  4KCA A;  3LXZ A;  3QPM A;  4HDE A;  3US3 A;  2O85 A;  2LV3 A;  5KN0 A;  3DWV A;  5ECN B;  2X8C A;  4XIH A;  5H5S A;  2WRT A;  2HRK B;  2GZY A;  2IMI A;  3PR8 A;  2C0E A;  3CSH A;  1A2J A;  1T3B A;  2VLV A;  1UVZ A;  1TOF A;  6GSY A;  2K6V A;  2AAW A;  4OFN A;  5ECR B;  3P2A A;  2YAN A;  5CP1 A;  3KP8 A;  4BL7 B;  3GKN A;  4IW9 A;  3ZTL A;  1M2A A;  2MMN A;  4K2X A;  1U88 A;  2DKH A;  4MF5 A;  1I5G A;  5H5R A;  1XW9 A;  2WZS A;  5ABR A;  3D22 A;  3H8Q A;  1OC9 A;  1WE0 A;  2CVD A;  2L5L A;  5E59 A;  1GTA A;  5F05 A;  3SWL A;  1OE8 A;  4JU5 A;  3VPT A;  4TXO B;  5H5Q A;  2KP1 A;  4OCF A;  4IP6 A;  5BMU B;  1YEP A;  3UMA A;  1YVL A;  2YWN A;  4NV2 A;  3F3Q A;  5J4Y A;  2V1M A;  2EFH A;  2R2J A;  1R7H A;  4KF9 A;  3IR4 A;  1T4Y A;  5HR0 A;  1I1I P;  2O87 A;  3HA9 A;  4G0L A;  3VWU A;  2VO4 A;  2LRC A;  1FOH A;  4X0X A;  5J9B A;  3ZML A;  1CQH A;  1SD8 A;  4XS4 A;  2YN1 A;  3EMP A;  4PUA A;  4TXV A;  1FG4 A;  3F0I A;  5A34 B;  1SKS B;  5A1N B;  1W4V A;  2HRN A;  1TU8 A;  3LXT A;  5G5F A;  1SEN A;  2WVX B;  4BWQ A;  4Z2R A;  5ECK B;  1K0A A;  4Z2T A;  1B9Y C;  5D73 A;  19GS A;  1YF0 A;  4HI7 A;  2GSQ A;  3GL5 A;  3QMX A;  3TU3 B;  1XZO A;  1ZZY A;  4XTS A;  1JZW A;  5B8A A;  2V41 A;  2CVK A;  4GF0 A;  4F82 A;  3KP9 A;  2IL3 A;  1KTE A;  1X5E A;  4K5S A;  3TOU A;  4TR0 A;  2MMA A;  2HLS A;  2C80 A;  2DBC A;  2VCX A;  1SJ6 A;  3IOS A;  2K8V A;  4MF7 A;  4ACS A;  1AAZ A;  1X0R A;  3TCO A;  2HRF A;  3RPP A;  4GDF A;  5D9W A;  2X8G A;  1NHO A;  2A2R A;  3V1W A;  3RHB A;  2VCZ A;  4RUV A;  4HU9 A;  4CDO A;  4MPG A;  3AY8 A;  2AYT A;  1KBN A;  2GQL A;  2VL2 A;  4QQ7 A;  7GSS A;  1JZD A;  3FZA A;  2EIO A;  5A5K A;  4PHZ C;  4E8H A;  3A2V A;  3CSI A;  4KW6 A;  4NWY A;  3M3M A;  5A4V A;  1PN0 A;  20GS A;  2DIZ A;  4O5U A;  3WYW A;  3UJ1 A;  5A4W A;  3EUR A;  3IDV A;  4L5L A;  4POK A;  1F3B A;  5DQS A;  5IMZ A;  1V98 A;  4BVY A;  2DJ2 A;  2H1L A;  1HYU A;  2GZZ A;  4JBB A;  4ILF A;  4ECC A;  1Z7R A;  5GSS A;  4MH2 A;  2G2Q A;  2VM2 A;  4AJ8 A;  3G7Y A;  5G2Z A;  1OAZ A;  3E9J B;  4BA7 A;  4E68 A;  2HZE B;  2ZCT A;  4I5Q A;  1U6T A;  4HUA A;  4K6X A;  3CWG A;  1GNE A;  1Q4J A;  2FCH A;  3UAR A;  3GRX A;  1O6J A;  2REM A;  1QGV A;  1SVM A;  3IK7 A;  2YPM A;  3UEM A;  2MBS A;  2PVQ A;  3KXO A;  2BMX A;  4D73 B;  4WF5 A;  1EGR A;  3KMN A;  2H0G A;  2VCT A;  2LRN A;  2O8V B;  2LTK A;  5DVB A;  1EWX A;  3MWH A;  1F2E A;  1BAY A;  1V2A A;  5EVO A;  2V6K A;  2R3X A;  1EP7 A;  2DJJ A;  2IPA A;  4KH7 A;  1PSQ A;  4ZL9 A;  5G1K A;  1R5P A;  4J2F A;  4TN8 A;  4O5Q A;  2O5V A;  2CX3 A;  3H1N A;  2LJA A;  2F9S A;  1THO A;  1TK5 B;  1U3A A;  3KZQ A;  4OWY A;  1EV4 A;  2YCD A;  1GL8 A;  2O89 A;  4AKH A;  3DD3 A;  1XVQ A;  3GH6 A;  1ZYE A;  4DVC A;  4MJA A;  3MIX A;  2H01 A;  1YDK A;  2IJY A;  4ML6 A;  1TJD A;  2G0F A;  3RBT A;  1R4W A;  1SD9 A;  2VCV A;  4TR1 A;  3C7M A;  2H19 A;  2L4C A;  3DEX A;  2GT6 A;  4IQA A;  2QA1 A;  2MYG A;  6GST A;  1QK8 A;  3KH9 A;  3KTL A;  3KIJ A;  2VAF A;  1MDI A;  1N8J A;  2H76 A;  3GTU B;  5COH A;  4XS1 A;  1G7O A;  3VFI A;  2M80 A;  4YKG A;  1HNA A;  4G10 A;  1QQ2 A;  5IOW A;  1DE2 A;  4NHZ A;  1Z9H A;  2A2P A;  2WS2 A;  3F4S A;  1GP1 A;  3EIN A;  2F51 A;  1PL1 A;  5CO3 A;  1YZX A;  1DUG A;  1TXX A;  4IQ1 A;  5DQY A;  4MH3 A;  3Q74 A;  3TOT A;  4AGS A;  4HZ2 A;  2VL2 C;  1GSY A;  1XBS A;  4KSM A;  3VLN A;  2B7J A;  1XW6 A;  1YKA A;  1X5C A;  3ME8 A;  1SK0 A;  3GYK A;  2VOC A;  2QSI A;  3IAM 2;  5A4U A;  4DSS A;  1GSD A;  1S3R A;  1AW9 A;  3H79 A;  4PQ1 A;  2JZS A;  5CRE A;  1YY7 A;  2VD1 A;  1K0C A;  1WOU A;  3MDK A;  5J4U A;  4K7N A;  4Z7X A;  1Q98 A;  1GTB A;  1FVJ A;  2H1D A;  4IVF A;  4GQC A;  5D9T A;  2H1G A;  4NXI A;  5HFG A;  5L71 A;  2WGR A;  4IN0 A;  1OC9 B;  2FY6 A;  2CA8 A;  2O3E A;  2AV4 A;  1V57 A;  1QFN A;  3QOU A;  2JZR A;  2GST A;  3LOR A;  3QD9 A;  3FZ9 A;  2AJQ B;  1O85 A;  2YV7 A;  5IMV A;  3BD2 A;  2GDR A;  1ILO A;  3DVW A;  2BJX A;  2PPT A;  1N2A A;  4NMU A;  5J40 A;  4G9H A;  3KH7 A;  3QDN A;  2WW3 A;  5KN3 A;  3FR9 A;  1XXU A;  3GMF A;  3VWV A;  3GV1 A;  4L5O A;  4XS4 B;  3HKR A;  3UVH A;  4F0C A;  4MCU A;  1JZR A;  2VIM A;  4H86 A;  2OAC A;  2NTO A;  1VGL A;  3E3E A;  1SU9 A;  1V40 A;  2N5A A;  2HT9 A;  1EEM A;  4ECB A;  3A5I A;  3L9S A;  1M3I A;  4EL1 A;  3RHC A;  5IO2 A;  1BG1 A;  3BCK A;  1ACV A;  3QFA C;  1SVL A;  4Q5Q A;  1EGO A;  2OT3 A;  4ZIL A;  3PGT A;  1EEJ A;  2ES7 A;  3QFB C;  3FZ4 A;  4V2N A;  2PVO C;  4FYU A;  1WMJ A;  1ERW A;  6GSV A;  2A4V A;  4OD7 A;  2VLT A;  1SKW B;  3W6G A;  1F9M A;  4YQM A;  4EDZ A;  4FIW A;  1AC1 A;  4PUR A;  3ZLP A;  4P3Y B;  2H0I A;  2VCW A;  3IHQ A;  1QMV A;  3GST A;  1GUL A;  3UBL A;  5HFK A;  4PQI A;  2E0Q A;  2GGT A;  4JRR A;  1A24 A;  1JHB A;  2K9F A;  3GIX A;  2WW2 A;  3LYK A;  3WT2 A;  3UOM A;  2DSA A;  1X9W B;  1EOH A;  1S4B P;  1A2L A;  2WFC A;  2GVP A;  3KTB A;  3EMX A;  4JR4 A;  3UBK A;  4N30 A;  2FHE A;  2UV8 G;  5EY6 A;  3OR5 A;  2ON5 A;  4MA9 A;  4KA0 A;  3MSZ A;  5CRD A;  2WVY A;  3LWA A;  1BQ7 A;  2F3M A;  3LJR A;  1YEW C;  1O81 A;  2VCQ A;  3DIE A;  2OKA A;  3IK9 A;  5AIX A;  2GSR A;  3RAZ A;  2C1Y A;  4USS A;  5DAL A;  4BVY B;  4EF0 A;  2PBJ A;  3GNJ A;  3M8N A;  3FYG A;  2X99 A;  1GSS A;  4K0G A;  1OE7 A;  1A8L A;  4WET A;  3TJF A;  4MJC A;  4KDU A;  5ECQ B;  3D4T A;  4GLT A;  2O7K A;  1SL1 B;  2QKE A;  4MLY A;  4EVM A;  3VI7 A;  1GLP A;  4ULX A;  3ZVJ A;  1OC8 A;  1B4Q A;  3E0U A;  1M7T A;  3N9J A;  1A2M A;  5DCG A;  1Z7P A;  2FWH A;  1AXD A;  1M2B A;  2CVB A;  3HZ8 A;  3Q19 A;  4IGJ A;  5BRT A;  2VL9 A;  4I2T A;  2H66 A;  2MMO A;  3WD6 A;  1O73 A;  4AKX B;  1E6B A;  2IME A;  4ISD A;  4XRA A;  4ZBB A;  1K3Y A;  1XOB A;  3MNG A;  1K0M A;  4K7I A;  3HJP A;  1M2D A;  4PI0 C;  5AIS A;  3C1S A;  1GSQ A;  4GST A;  3DYR A;  2YJ7 A;  4MP4 A;  3CYN A;  4ML1 A;  1TK0 B;  2L6D A;  3GFK A;  4EO3 A;  1PMT A;  4AF2 A;  1PX7 A;  4HS1 A;  5AN1 A;  2DJ0 A;  2PWJ A;  3IRA A;  4O5R A;  4WEY A;  1OC3 A;  5HR2 A;  1U3I A;  3CTG A;  5IIZ A;  4TVE A;  2HSH A;  3IA1 A;  4N0V A;  4PGT A;  2LQQ A;  4O32 A;  4V1A g;  1XW5 A;  2KUC A;  3RGB C;  3GUS A; 
#chains in the Genus database with same CATH homology
 4QL9 A;  1X9S B;  3QAG A;  3CXG A;  4A5P A;  3KEB A;  1USB A;  2DKI A;  1FO5 A;  2N5B A;  5EPF A;  2DLX A;  4POB A;  3FY7 A;  3O3T A;  1PA3 A;  4TR1 B;  3APQ A;  2C3N A;  3HDC A;  1HD2 A;  3VK9 A;  2R0C A;  4I8B A;  3ZRD A;  3BBY A;  1TRW A;  2YV9 A;  3EE2 A;  5FWG A;  4POM A;  4OO4 A;  1K0B A;  4K5R A;  2JAC A;  5ELA A;  1TXU A;  3ERF A;  5KEJ A;  1RW1 A;  2OBK A;  2QGV A;  4L8E A;  1GTI A;  2VLU A;  3ERG A;  1MDK A;  4WBJ A;  2QA2 A;  1PKZ A;  4MAB A;  3GKK A;  4K8M A;  1QXH A;  2FGX A;  3HXS A;  3G9B A;  3MAK A;  4JED A;  2R5G A;  2HI7 A;  2YNX A;  2V2G A;  3TDG A;  2IMK A;  4BVX A;  2P31 A;  2P0G A;  3LGC A;  4XRD A;  4WF4 A;  1SK1 A;  1SK2 A;  3EPT A;  2RM5 A;  2OJL A;  4MZW A;  2C0G A;  3HVS A;  5ECI B;  1F6M C;  1WJK A;  2LJR A;  1J0F A;  4DSQ A;  3LG6 A;  5GZZ B;  4I97 A;  18GS A;  4TR4 A;  3QAW A;  1FAA A;  2FA4 A;  3VPQ A;  2VL3 A;  3FHK A;  1J9B A;  4DSS B;  2X49 A;  1RQM A;  2A2S A;  2NDO A;  4XS6 A;  5EL8 A;  1C72 A;  3TRQ A;  3QR6 A;  4WXT A;  2YZU A;  3GHA A;  5IO0 A;  2E2G A;  1X5D A;  5DJL A;  1LU4 A;  1Y1U A;  2H6Y A;  2H30 A;  3TJB A;  5JWQ B;  2FWE A;  3F3R A;  2FUG 2;  3EC3 A;  1XWA A;  2IWT A;  2LRT A;  3M9K A;  1R26 A;  5CNW A;  1OVN A;  1YKC A;  4XCS A;  4NHW A;  1DE1 A;  2I1U A;  4YAP A;  2H8L A;  3UVT A;  5ECL B;  4I2U A;  5A5H A;  1T00 A;  2B6M A;  1TRV A;  12GS A;  2I4A A;  3G7J A;  4E8E A;  1KEB A;  3FW2 A;  2DML A;  5HQP A;  1G7E A;  3UL3 A;  1GUH A;  4FYC A;  1M9B A;  2H1A A;  3BCI A;  3CTF A;  1BYE A;  4OFM A;  1XWG A;  5J4V A;  4J56 E;  4ZL7 A;  4N10 A;  4QMK A;  1B8X A;  3I6A A;  3FK8 A;  4OMV A;  1ML6 A;  2F8A A;  4N0Z A;  4O92 A;  1PRX A;  2KOK A;  2IMF A;  2R37 A;  3C73 A;  2TRX A;  3GN3 A;  4JR6 A;  2HRA A;  4L0W A;  1VF1 A;  4KND A;  4ZL8 A;  1EZK A;  2L59 A;  1BX9 A;  3ZIV A;  2KHP A;  3M1G A;  2OE0 A;  3IC4 A;  3KD0 A;  3P8W A;  2H6X A;  16GS A;  3IAS 2;  5B8B A;  5D8I A;  2HSM A;  2L6C A;  5D9X A;  3DXB A;  5C04 A;  1FOV A;  1HNB A;  1FW1 A;  2L57 A;  3F8U A;  4BWS A;  3WGE A;  3LYP A;  2K8S A;  1THX A;  5ID2 A;  3FKF A;  4N3Z A;  2YWO A;  3A2X A;  4IBP A;  1MD4 A;  3EYT A;  3GA4 A;  3I9V 2;  2LKU A;  4YH2 A;  1A0R P;  3J7Y b;  1FHE A;  9GSS A;  2EFC A;  3D4M A;  2HQT A;  3ZMK A;  2HXK A;  4MZB A;  4LLR A;  3ZFL A;  1ON4 A;  2GT5 A;  1XWK A;  2J9H A;  2L4Q A;  1OYJ A;  2P5R A;  1V9W A;  3HZ4 A;  1ZL9 A;  2E2M A;  2K18 A;  5GAN D;  4JE1 A;  3TRX A;  3FR6 A;  4HJM A;  4POL A;  3WGD A;  4MJB A;  10GS A;  4GSN A;  1S3A A;  3H4K A;  4EIQ A;  3ERW A;  1M0U A;  1ZYN A;  2YP6 A;  4MDC A;  5GST A;  5IMC A;  2WZ9 A;  2YWI A;  4AJ7 A;  22GS A;  3P90 A;  5DAL B;  2VM1 A;  1H75 A;  3L0H A;  3D0Z A;  1M9A A;  3CBU A;  4GTU A;  4K2D A;  5J47 A;  4YQU A;  5KOX A;  3R2Q A;  3ZIT A;  2H73 A;  3ZVJ D;  2H0H A;  5JCU A;  2DJK A;  3W8J A;  1K3L A;  5G30 A;  1MEK A;  4L0U A;  4AKG A;  3BJ5 A;  1B4P A;  4TRX A;  5DCH A;  2H72 A;  3ISO A;  3ZFB A;  3CSJ A;  1IYI A;  4HEA 2;  5AIV A;  4CY8 A;  3GX8 A;  3VWX A;  3EWL A;  4KSO A;  1ABA A;  1GSU A;  2XC2 A;  5J41 A;  2NPB A;  5ENU A;  1T7P B;  3FEU A;  2R0P A;  5HR3 A;  1XWC A;  2X8H A;  4DEJ A;  2GS3 A;  2IMD A;  3IV4 A;  2XHF A;  1HQO A;  3U6V A;  1TI3 A;  2CZ2 A;  2EFE A;  3W8S A;  4K9Z A;  4ZXG A;  4AJ6 A;  2R6K A;  2H75 A;  5F07 A;  3PH9 A;  5INY A;  4FYB A;  1AIU A;  3GSS A;  4YAV A;  2WDU A;  1NHY A;  3DGQ A;  4AI6 A;  1Z6M A;  2GTU A;  4TR3 A;  1SJI A;  13GS A;  5F06 A;  4HQS A;  3TRP A;  5J3R A;  3ZIJ A;  3ME7 A;  1TRS A;  4AKI A;  2F8F A;  5D93 A;  2R4V A;  5F0G A;  1GTU A;  3KM6 A;  2M46 A;  4GWR A;  1ERT A;  1V58 A;  1YQ1 A;  4PQH A;  4Q5R A;  1EOG A;  2RUE A;  3L9U A;  2PMT A;  4ZB8 A;  4X1U A;  3HMJ G;  1XPV A;  4EDY A;  4Q5N A;  3FRC A;  4ID0 A;  4KCE A;  2I3Y A;  4G01 A;  1O8W A;  3FMW A;  3TKP A;  1EP8 A;  3CRU A;  1PKW A;  4EE0 A;  3C71 A;  3TKS E;  1M99 A;  2JZT A;  5ECM B;  4ZIJ A;  5IQY A;  4TOP A;  4MF6 A;  5IOX A;  3HJO A;  1WIK A;  1XVW A;  3O6T A;  5IPG A;  1K0N A;  1TI1 A;  2LJK A;  4BVX B;  3K8N A;  2HSN A;  2GQK A;  2FA8 A;  2H74 A;  1Y25 A;  4IKH A;  3ED3 A;  5DAK A;  2WB9 A;  5F8B A;  1JLW A;  3KMO A;  1K0D A;  1RK4 A;  3GX0 A;  3APS A;  2JU5 A;  3SBC A;  3KGK A;  3F9U A;  5DJM A;  4LA1 A;  1OKT A;  3RPN A;  2J23 A;  3Q18 A;  2ZNM A;  1JFU A;  1YF1 A;  1DSB A;  1NW2 A;  2FWG A;  2QC7 A;  4WBR D;  2C4J A;  3GL3 A;  2BTO T;  1TW9 A;  1SVO A;  2PU9 C;  4Q5F A;  2YWM A;  2B5E A;  1PN9 A;  2RM6 A;  2OE3 A;  3LW9 A;  4MNN A;  5B6N A;  2CAQ A;  2C3Q A;  2IFQ A;  5LCZ A;  1GRX A;  4IP1 A;  3F63 A;  4TKY A;  4W66 A;  4YQV A;  2H70 A;  2WUL A;  1E2Y A;  5G31 A;  1GUM A;  1I9D A;  3G7I A;  2MBT A;  1BED A;  1S3D A;  4PX1 A;  1H4O A;  1MTC A;  2GSS A;  3MYD A;  6GSS A;  1ERU A;  5A5H B;  2B3S A;  1A23 A;  2B7K A;  2IIY A;  4HJ2 A;  5ECP B;  4NV5 A;  4O7H A;  1CQG A;  4EUY A;  2H6Z A;  1N25 A;  1F37 A;  2FNO A;  3DVX A;  3DKS A;  5G5E A;  2B5Y A;  1PD2 1;  3HJM A;  6GSX A;  1XOA A;  2HZF A;  2FLS A;  4OO5 A;  4EKZ A;  5CYY A;  2OBI A;  3APO A;  1NSW A;  2LUS A;  4GCI A;  3C8E A;  3A2W A;  1A0F A;  2LS5 A;  4G2E A;  1NM3 A;  2YJH A;  3F6D A;  2UZ8 A;  2HNL A;  1B9X C;  1GH2 A;  3S9F A;  1PX6 A;  5B6M A;  4JZQ A;  5C00 A;  4OCE A;  2HSM B;  2CZ3 A;  3CMI A;  14GS A;  1X9M B;  1Y6E A;  2NVL A;  1ZOF A;  3LSZ A;  1UN2 A;  2WCI A;  4IS0 A;  5ID2 B;  3A5W A;  1F3A A;  1XCC A;  3NIV A;  1U87 A;  1KNG A;  4V2M A;  3LEF A;  4WR5 A;  5LD0 A;  4Z2U A;  2B1K A;  3GKM A;  4PTS A;  1TK8 B;  3ZZX A;  2KLX A;  3LFL A;  1W89 A;  2JSY A;  4BPY A;  2I81 A;  4F9Z A;  1ZGN A;  3P7X A;  2LQO A;  1WP0 A;  1SKR B;  2DC5 A;  4V1A p;  4X4J A;  4F0B A;  3D21 A;  3TKQ A;  1WPI A;  3TKR A;  2GLR A;  2HYX A;  1AQW A;  4RQX A;  4EC0 A;  5JWO B;  1T4Z A;  17GS A;  1ZCP A;  2FD3 A;  5ELG A;  2CQ9 A;  3TUE A;  3D6I A;  2MMZ A;  2CV4 A;  1UC7 A;  5E4W A;  5J5N A;  4HOJ A;  1EV9 A;  2B5X A;  4CHS A;  2RLI A;  3L4N A;  3TJK A;  1LJR A;  1AQV A;  3GUR A;  4PUF C;  5IPH A;  2VD0 A;  2PUK C;  1S3C A;  1R5A A;  4IJI A;  5FT3 A;  4IJ3 A;  3UIW A;  2HRK A;  4ECJ A;  2C0D A;  2LNT A;  1QUW A;  5B7C A;  3EU4 A;  4GSS A;  2WJU A;  3F4R A;  4BL7 A;  4GQF A;  1O7U A;  1SL0 B;  3D5J A;  1DBY A;  2I9H A;  2RII A;  4XHM A;  1MD3 A;  3UAP A;  4GXZ A;  3EVI A;  4LMW A;  2EC4 A;  5GAP D;  2JSZ A;  3N5O A;  3GH9 A;  4DSR A;  3C1R A;  3RDW A;  2VUP A;  4J57 E;  4EIP A;  1VF2 A;  4ZB7 A;  3IXR A;  1IYH A;  2YZH A;  3L9V A;  4TXO A;  5KN1 A;  3F6F A;  1T8E B;  5BMU A;  1SYX A;  2NBS A;  2AUV A;  3U5R E;  2DJ1 A;  3F4T A;  4ZBA A;  2JAD A;  4LL4 B;  2KP2 A;  1GNW A;  4HU7 A;  4RI7 A;  2FWF A;  1GSF A;  2DIY A;  4GRF A;  1A8Y A;  1SJZ A;  1SL2 B;  3EU3 A;  2XBI A;  3I69 A;  5JCG A;  2X64 A;  3KJY A;  3NZN A;  2CX4 A;  5A34 A;  5A1N A;  4FO5 A;  1TDI A;  1TRU A;  1TP9 A;  4KGI A;  2C3T A;  1G0T A;  2EIR A;  3WT1 A;  3VUR A;  3ZYW A;  2GQM A;  4MZC A;  2M72 A;  5IMA A;  1YEX A;  2OAD A;  3NOF A;  1O8X A;  1FB6 A;  4NAX A;  5CRH A;  1OKD A;  3TJJ A;  3TKS A;  5LNK e;  2V6O A;  5HFI A;  1JLV A;  2TIR A;  1B48 A;  4ICY A;  2LEG A;  2V32 A;  4OFT A;  4WR4 A;  2C0F A;  1Z5Y E;  5CAX A;  5IM9 A;  2AB6 A;  3TGZ A;  4FH8 A;  4HQZ A;  3LQ7 A;  1Z3E A;  1TTZ A;  3PIN A;  3WGX A;  1PQN A;  5D96 A;  4ZBD A;  1AUC A;  3QCP A;  1HNC A;  2OA7 A;  2EFD A;  2HFD A;  1G6W A;  2CT6 A;  1XIY A;  4LMV A;  5KOW A;  4N11 A;  4EXJ A;  4HZ4 A;  1ZYQ B;  3HYP A;  2HSN B;  3IBH A;  4MPF A;  1ZMA A;  5AGY A;  5DAK B;  2VKZ G;  2Z9S A;  4WKW A;  1VRS D;  3HHV A;  4KAE A;  5FHI A;  4QL7 A;  5CRG A;  5G1L A;  2AHE A;  5DBQ A;  3ZRE A;  4NPB A;  3J7Y k;  2ON7 A;  5D9V A;  3DRN A;  4F2I A;  1GUK A;  4KE3 A;  2MZC A;  2PER A;  1TU7 A;  3L78 A;  1WWJ A;  3M9J A;  3PPU A;  1SYR A;  2C8U A;  1FVK A;  3GKX A;  1Z6N A;  2JL4 A;  3CRT A;  3HVV A;  2R0G A;  3TJG A;  1FB0 A;  4ECI A;  4I6X A;  1BF5 A;  4CY6 A;  1URM A;  2IFQ B;  2HZE A;  2D2Z A;  2N5F A;  2LST A;  5ECO B;  2P5Q A;  3HD5 A;  2IN3 A;  1VF3 A;  4ZB9 A;  3H93 A;  1YJ6 A;  3VWW A;  3Q6O A;  1WRY A;  4RI6 A;  2H71 A;  5J9C A;  4ZB6 A;  1G6Y A;  4KUN A;  1UA5 A;  2DMM A;  4D73 A;  4K7O A;  1J08 A;  2EIQ A;  4PNF A;  2YOI A;  1GSE A;  2X4A A;  4K1F A;  4PNG A;  1AQX A;  1K0O A;  1GLQ A;  1K3O A;  5DDL A;  1TKD B;  5IMD A;  11GS A;  2HE3 A;  3FZ5 A;  4CW9 A;  1ST9 A;  2H1B A;  4V2L A;  4G0I A;  4TW5 A;  3IC8 A;  1JZO A;  5KN2 A;  2CAI A;  6GSW A;  4KDX A;  4RQR A;  2DJ3 A;  3IPZ A;  3QAV A;  3TB2 A;  3A3T A;  4PXO A;  4G19 A;  2LNS A;  4MK3 A;  3ZL5 A;  3M0F A;  4K0N A;  1ZYP A;  3JCM L;  1T1V A;  2PN8 A;  1PGT A;  5ECH B;  2XPD A;  4KDY A;  2B1L A;  3BOA A;  3IHG A;  4IHU A;  5ECS A;  4LL1 B;  1LBK A;  4MMM A;  4FQU A;  2GZP A;  2RUF A;  3KCM A;  5HR1 A;  4MJE A;  4X43 A;  3I43 A;  2TRC P;  3HY2 A;  4IEL A;  1MDJ A;  3DML A;  5IMF A;  5JWR B;  3O76 A;  3HVX A;  1GWC A;  4YKF A;  3TKS C;  3GTU A;  3IE3 A;  8GSS A;  2L5O A;  4F03 A;  2ALB A;  1VF4 A;  1BG5 A;  1PL2 A;  2HSY A;  4G0K A;  2ZUP A;  2XPE A;  4KB3 A;  1XFL A;  3FR3 A;  2E7P A;  2XBQ A;  3HCZ A;  1BJX A;  1ERV A;  2A4H A;  2PGT A;  5JCW A;  1XWB A;  5CRW A;  6GSU A;  2OE1 A;  4KX4 A;  3R3E A;  3VI5 A;  4KCA A;  3LXZ A;  3QPM A;  4HDE A;  3US3 A;  2O85 A;  2LV3 A;  5KN0 A;  3DWV A;  5ECN B;  2X8C A;  4XIH A;  5H5S A;  2WRT A;  2HRK B;  2GZY A;  2IMI A;  3PR8 A;  2C0E A;  3CSH A;  1A2J A;  1T3B A;  2VLV A;  1UVZ A;  1TOF A;  6GSY A;  2K6V A;  2AAW A;  4OFN A;  5ECR B;  3P2A A;  2YAN A;  5CP1 A;  3KP8 A;  4BL7 B;  3GKN A;  4IW9 A;  3ZTL A;  1M2A A;  2MMN A;  4K2X A;  1U88 A;  2DKH A;  4MF5 A;  1I5G A;  5H5R A;  1XW9 A;  5ABR A;  3D22 A;  3H8Q A;  1OC9 A;  1WE0 A;  2CVD A;  2L5L A;  5E59 A;  1GTA A;  5F05 A;  3SWL A;  1OE8 A;  4JU5 A;  3VPT A;  4TXO B;  5H5Q A;  2KP1 A;  4OCF A;  4IP6 A;  5BMU B;  1YEP A;  3UMA A;  1YVL A;  2YWN A;  4NV2 A;  3F3Q A;  5J4Y A;  2V1M A;  2EFH A;  2R2J A;  1R7H A;  4KF9 A;  3IR4 A;  1T4Y A;  5HR0 A;  2O87 A;  3HA9 A;  4G0L A;  3VWU A;  2VO4 A;  2LRC A;  1FOH A;  4X0X A;  5J9B A;  3ZML A;  1CQH A;  1SD8 A;  4XS4 A;  2YN1 A;  3EMP A;  4PUA A;  4TXV A;  1FG4 A;  3F0I A;  5A34 B;  1SKS B;  5A1N B;  1W4V A;  2HRN A;  1TU8 A;  3LXT A;  5G5F A;  1SEN A;  4BWQ A;  4Z2R A;  5ECK B;  1K0A A;  4Z2T A;  1B9Y C;  5D73 A;  19GS A;  1YF0 A;  4HI7 A;  2GSQ A;  3GL5 A;  3QMX A;  3TU3 B;  1XZO A;  1ZZY A;  4XTS A;  1JZW A;  5B8A A;  2V41 A;  2CVK A;  4GF0 A;  4F82 A;  3KP9 A;  2IL3 A;  1KTE A;  1X5E A;  4K5S A;  3TOU A;  4TR0 A;  2MMA A;  2HLS A;  2C80 A;  2DBC A;  2VCX A;  1SJ6 A;  3IOS A;  2K8V A;  4MF7 A;  4ACS A;  1AAZ A;  1X0R A;  3TCO A;  2HRF A;  3RPP A;  4GDF A;  5D9W A;  2X8G A;  1NHO A;  2A2R A;  3V1W A;  3RHB A;  2VCZ A;  4RUV A;  4HU9 A;  4CDO A;  4MPG A;  3AY8 A;  2AYT A;  1KBN A;  2GQL A;  2VL2 A;  4QQ7 A;  7GSS A;  1JZD A;  3FZA A;  2EIO A;  5A5K A;  4E8H A;  3A2V A;  3CSI A;  4KW6 A;  4NWY A;  3M3M A;  5A4V A;  1PN0 A;  20GS A;  2DIZ A;  4O5U A;  3WYW A;  3UJ1 A;  5A4W A;  3EUR A;  3IDV A;  4L5L A;  4POK A;  1F3B A;  5DQS A;  5IMZ A;  1V98 A;  4BVY A;  2DJ2 A;  2H1L A;  1HYU A;  2GZZ A;  4JBB A;  4ILF A;  4ECC A;  1Z7R A;  5GSS A;  4MH2 A;  2G2Q A;  2VM2 A;  4AJ8 A;  3G7Y A;  5G2Z A;  1OAZ A;  3E9J B;  4BA7 A;  4E68 A;  2HZE B;  2ZCT A;  4I5Q A;  1U6T A;  4HUA A;  4K6X A;  3CWG A;  1GNE A;  1Q4J A;  2FCH A;  3UAR A;  3GRX A;  1O6J A;  2REM A;  1QGV A;  1SVM A;  3IK7 A;  2YPM A;  3UEM A;  2MBS A;  2PVQ A;  3KXO A;  2BMX A;  4D73 B;  4WF5 A;  1EGR A;  3KMN A;  2H0G A;  2VCT A;  2LRN A;  2O8V B;  2LTK A;  5DVB A;  1EWX A;  3MWH A;  1F2E A;  1BAY A;  1V2A A;  5EVO A;  2V6K A;  2R3X A;  1EP7 A;  2DJJ A;  2IPA A;  4KH7 A;  1PSQ A;  4ZL9 A;  5G1K A;  1R5P A;  4J2F A;  4TN8 A;  4O5Q A;  2O5V A;  2CX3 A;  3H1N A;  2LJA A;  2F9S A;  1THO A;  1TK5 B;  1U3A A;  3KZQ A;  4OWY A;  1EV4 A;  2YCD A;  1GL8 A;  2O89 A;  4AKH A;  3DD3 A;  1XVQ A;  3GH6 A;  1ZYE A;  4DVC A;  4MJA A;  3MIX A;  2H01 A;  1YDK A;  2IJY A;  4ML6 A;  1TJD A;  2G0F A;  3RBT A;  1R4W A;  1SD9 A;  2VCV A;  4TR1 A;  3C7M A;  2H19 A;  2L4C A;  3DEX A;  2GT6 A;  4IQA A;  2QA1 A;  2MYG A;  6GST A;  1QK8 A;  3KH9 A;  3KTL A;  3KIJ A;  2VAF A;  1MDI A;  1N8J A;  2H76 A;  3GTU B;  5COH A;  4XS1 A;  1G7O A;  3VFI A;  2M80 A;  4YKG A;  1HNA A;  4G10 A;  1QQ2 A;  5IOW A;  1DE2 A;  4NHZ A;  1Z9H A;  2A2P A;  2WS2 A;  3F4S A;  1GP1 A;  3EIN A;  2F51 A;  1PL1 A;  5CO3 A;  1YZX A;  1DUG A;  1TXX A;  4IQ1 A;  5DQY A;  4MH3 A;  3Q74 A;  3TOT A;  4AGS A;  4HZ2 A;  2VL2 C;  1GSY A;  1XBS A;  4KSM A;  3VLN A;  2B7J A;  1XW6 A;  1YKA A;  1X5C A;  3ME8 A;  1SK0 A;  3GYK A;  2VOC A;  2QSI A;  3IAM 2;  5A4U A;  4DSS A;  1GSD A;  1AW9 A;  3H79 A;  4PQ1 A;  2JZS A;  5CRE A;  1YY7 A;  2VD1 A;  1K0C A;  1WOU A;  3MDK A;  5J4U A;  4K7N A;  4Z7X A;  1Q98 A;  1GTB A;  1FVJ A;  2H1D A;  4IVF A;  4GQC A;  5D9T A;  2H1G A;  4NXI A;  5HFG A;  5L71 A;  2WGR A;  4IN0 A;  1OC9 B;  2FY6 A;  2CA8 A;  2AV4 A;  1V57 A;  1QFN A;  3QOU A;  2JZR A;  2GST A;  3LOR A;  3QD9 A;  3FZ9 A;  2AJQ B;  1O85 A;  2YV7 A;  5IMV A;  3BD2 A;  2GDR A;  1ILO A;  3DVW A;  2BJX A;  2PPT A;  1N2A A;  4NMU A;  5J40 A;  4G9H A;  3KH7 A;  3QDN A;  5KN3 A;  3FR9 A;  1XXU A;  3GMF A;  3VWV A;  3GV1 A;  4L5O A;  4XS4 B;  3HKR A;  3UVH A;  4F0C A;  4MCU A;  1JZR A;  2VIM A;  4H86 A;  2OAC A;  2NTO A;  1VGL A;  3E3E A;  1SU9 A;  1V40 A;  2N5A A;  2HT9 A;  1EEM A;  4ECB A;  3A5I A;  3L9S A;  4EL1 A;  3RHC A;  5IO2 A;  1BG1 A;  3BCK A;  1ACV A;  3QFA C;  1SVL A;  4Q5Q A;  1EGO A;  2OT3 A;  4ZIL A;  3PGT A;  1EEJ A;  2ES7 A;  3QFB C;  3FZ4 A;  4V2N A;  2PVO C;  4FYU A;  1WMJ A;  1ERW A;  6GSV A;  2A4V A;  4OD7 A;  2VLT A;  1SKW B;  3W6G A;  1F9M A;  4YQM A;  4EDZ A;  4FIW A;  1AC1 A;  4PUR A;  3ZLP A;  4P3Y B;  2H0I A;  2VCW A;  3IHQ A;  1QMV A;  3GST A;  1GUL A;  3UBL A;  5HFK A;  4PQI A;  2E0Q A;  2GGT A;  4JRR A;  1A24 A;  1JHB A;  2K9F A;  3GIX A;  3LYK A;  3WT2 A;  3UOM A;  2DSA A;  1X9W B;  1EOH A;  1A2L A;  2WFC A;  2GVP A;  3KTB A;  3EMX A;  4JR4 A;  3UBK A;  4N30 A;  2FHE A;  2UV8 G;  5EY6 A;  3OR5 A;  2ON5 A;  4MA9 A;  4KA0 A;  3MSZ A;  5CRD A;  3LWA A;  1BQ7 A;  2F3M A;  3LJR A;  1O81 A;  2VCQ A;  3DIE A;  2OKA A;  3IK9 A;  5AIX A;  2GSR A;  3RAZ A;  2C1Y A;  4USS A;  5DAL A;  4BVY B;  4EF0 A;  2PBJ A;  3GNJ A;  3M8N A;  3FYG A;  2X99 A;  1GSS A;  4K0G A;  1OE7 A;  1A8L A;  4WET A;  3TJF A;  4MJC A;  4KDU A;  5ECQ B;  3D4T A;  4GLT A;  2O7K A;  1SL1 B;  2QKE A;  4MLY A;  4EVM A;  3VI7 A;  1GLP A;  4ULX A;  3ZVJ A;  1OC8 A;  1B4Q A;  3E0U A;  1M7T A;  3N9J A;  1A2M A;  5DCG A;  1Z7P A;  2FWH A;  1AXD A;  1M2B A;  2CVB A;  3HZ8 A;  3Q19 A;  4IGJ A;  5BRT A;  2VL9 A;  4I2T A;  2H66 A;  2MMO A;  3WD6 A;  1O73 A;  4AKX B;  1E6B A;  2IME A;  4ISD A;  4XRA A;  4ZBB A;  1K3Y A;  1XOB A;  3MNG A;  1K0M A;  4K7I A;  3HJP A;  1M2D A;  5AIS A;  3C1S A;  1GSQ A;  4GST A;  3DYR A;  2YJ7 A;  4MP4 A;  3CYN A;  4ML1 A;  1TK0 B;  2L6D A;  3GFK A;  4EO3 A;  1PMT A;  4AF2 A;  1PX7 A;  4HS1 A;  5AN1 A;  2DJ0 A;  2PWJ A;  3IRA A;  4O5R A;  4WEY A;  1OC3 A;  5HR2 A;  1U3I A;  3CTG A;  5IIZ A;  4TVE A;  2HSH A;  3IA1 A;  4N0V A;  4PGT A;  2LQQ A;  4O32 A;  4V1A g;  1XW5 A;  2KUC A;  3GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...