3KMNA

Crystal structure of the human apo gst pi c47s/y108v double mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase P
publication title Diuretic drug binding to human glutathione transferase P1-1: potential role of CYS101 revealed in the double mutant C47S/Y108V
rcsb
source organism Homo sapiens
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kmnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kmnA01
4WBRD 1ZYEA 2X8HA 5COHA 1NM3A 3L78A 2YPMA 1M9AA 3LFLA 1E2YA 2I81A 2HSNB 3IK9A 3FW2A 4OFTA 4ZILA 1B4QA 4GTUA 3ZL5A 3IA1A 1XWKA 2HRAA 1Z7PA 1TP9A 3CYNA 5ABRA 3M9JA 3F8UA 4ZBDA 4AJ6A 5AN1A 3TB2A 1XVQA 1GNWA 4MP4A 2FNOA 3M3MA 3VI7A 2P0GA 1V98A 4TOPA 2ZUPA 2GT5A 3TJFA 1TRSA 2IJYA 1A0FA 4L5LA 2NTOA 5IMCA 4Q5RA 3UOMA 4ECJA 5ECRB 4MJAA 4IELA 2HYXA 3DXBA 3GX0A 4TR3A 2R2JA 4ML6A 4L8EA 4K6XA 1TU8A 1EWXA 2LJRA 2PMTA 5DAKA 2EIOA 4HEA2 3DYRA 1URMA 3EINA 1AQVA 2IFQB 2YZHA 4HZ4A 2WFCA 4GQFA 1PA3A 5J5NA 3ZFBA 3TKPA 2ON5A 5EY6A 2I4AA 3R3EA 1XWAA 1M2BA 22GSA 2XHFA 1XPVA 3KMOA 3GFKA 3HJOA 4RQXA 3ME8A 4P3YB 2HSMA 4KSOA 5AIXA 1PL2A 3APSA 1XWBA 2R4VA 1MDJA 1J9BA 4BWQA 4E8EA 3F9UA 4BVXA 1X0RA 1Z6MA 2CX3A 2YZUA 4POKA 8GSSA 3ZIVA 2GSTA 1JZRA 2VL2A 3FEUA 3KM6A 3QCPA 2HRKB 1FVKA 1AIUA 2JU5A 4YAVA 1K0CA 4ISDA 2FWFA 1S3CA 1SK1A 1VF1A 4TXOA 2FY6A 3KCMA 2PERA 5BMUA 5J9CA 4HJ2A 3ISOA 2YANA 3WGEA 2FWEA 1YF0A 2QGVA 2HI7A 1ERUA 3GNJA 1R5AA 2H0GA 2RUEA 4LA1A 4PQHA 1EOHA 4F2IA 3HCZA 1OC3A 2REMA 3L0HA 1F3AA 1Z9HA 2AHEA 3G7YA 3TKSE 1SD9A 3GKKA 4KX4A 4LMVA 2R3XA 17GSA 2V41A 2HRFA 2YWOA 2CQ9A 4POMA 2V1MA 4H86A 4DVCA 4GCIA 1K0AA 4EUYA 4OO5A 5C00A 4K2DA 1XOAA 1K3LA 1TK5B 5EL8A 3HVXA 1GTAA 4LL1B 2JACA 1H4OA 5FWGA 4IJIA 4YQVA 3RPNA 4AGSA 2VM2A 3FK8A 3VURA 2VCQA 2VCZA 4IHUA 2VD1A 5HR1A 3G7JA 2XBIA 4EE0A 3ZMLA 2DJKA 4JR6A 1NHYA 1J08A 2C0EA 2VL3A 5ECMB 4PNGA 5DQYA 2MBTA 1Q4JA 3LYPA 2OBKA 3GUSA 3NIVA 3O76A 4N30A 2OKAA 1ABAA 1O8WA 1G6WA 4IJ3A 6GSYA 1MDIA 3N5OA 9GSSA 4FYUA 1U87A 2CVDA 1BAYA 3F4SA 2HQTA 4GSTA 3KH9A 2B5EA 4OCEA 4Q5FA 3HKRA 2O8VB 1TRWA 1ZYQB 1XW6A 1DUGA 2HZEB 4MJEA 2DJJA 2CV4A 1BQ7A 2IL3A 5IMAA 3FZAA 3LSZA 1SL2B 2AUVA 2E2MA 1FVJA 2H75A 4O5RA 1CQGA 2EC4A 2V2GA 4F9ZA 2JZSA 3HVSA 5D9WA 3TKSA 5F05A 4ZL8A 1X5DA 5CRDA 4N0VA 2DLXA 1YEXA 1I9DA 4CW9A 2YV7A 3O6TA 5LCZA 2FGXA 5G31A 3HXSA 1TTZA 5B6MA 2BJXA 2DBCA 5J9BA 4HJMA 4XCSA 4HZ2A 1SYRA 4WKWA 3SWLA 3IV4A 4EVMA 1K0BA 2VLVA 4J2FA 3ED3A 1OKDA 2TRXA 1G6YA 3O3TA 1X5EA 2OA7A 2N5AA 3DRNA 2GZYA 4PXOA 3GV1A 3C8EA 4KSMA 1YDKA 1SKSB 3EURA 4OMVA 1EP8A 1SL0B 3GURA 1LU4A 3W6GA 3KTLA 3LGCA 3TOTA 6GSSA 3L9SA 3D6IA 3GKXA 4IQAA 5ECHB 3TRPA 2QC7A 4GQCA 3BCIA 3GSSA 2A4VA 3ZRDA 4GF0A 2VCTA 1USBA 5JCWA 1BEDA 2DIZA 3KJYA 3GN3A 1OAZA 2L4QA 2H66A 1PSQA 1TKDB 3CBUA 3CXGA 3GMFA 1K3OA 1GSQA 1G7EA 3EVIA 3H8QA 1U6TA 3UVHA 1BJXA 1QQ2A 1F3BA 2PU9C 2ZCTA 1NHOA 2RIIA 2C4JA 5G5FA 4F0CA 3QAGA 4Q5NA 2FA4A 16GSA 4L0UA 2YJHA 1A2LA 3WD6A 3D5JA 2E2GA 1SKWB 1SJIA 6GSVA 3CTGA 2XPDA 3V1WA 2DJ2A 1UC7A 4MH3A 2L6DA 3IPZA 3QMXA 4EF0A 1M99A 1GWCA 1XVWA 3C7MA 1MEKA 3F0IA 1ILOA 1ACVA 1A8LA 3HJMA 3HVVA 3QD9A 4WF5A 3LXZA 5G1LA 2HT9A 3VLNA 1T4YA 1G7OA 3Q18A 2R37A 3APQA 5KEJA 4O32A 3VPTA 4G0IA 2HZEA 4I97A 1DE2A 5H5SA 1M9BA 3TJKA 4HOJA 3TRXA 5IQYA 2LNTA 1EV9A 3A2VA 2OE1A 1QK8A 2IMDA 3K8NA 3CRUA 1DE1A 3GH6A 2OADA 2HXKA 1FW1A 4K0NA 4L0WA 2FD3A 2J9HA 1GULA 1S3AA 3ZLPA 5H5RA 3WGDA 5J41A 4JRRA 5J3RA 1XFLA 4MA9A 1ST9A 1Z7RA 3F4TA 3BD2A 4MCUA 3L9UA 2GSRA 2X64A 2X8CA 2B5XA 5G1KA 2DJ3A 1SK0A 2I9HA 1UA5A 3PPUA 2O85A 4V1Ap 2V6OA 5ID2B 3ZIJA 2K18A 4PQIA 3KMNA 1LJRA 1T4ZA 2B3SA 3E3EA 2F51A 3Q6OA 2H0IA 4XIHA 1A2MA 3KIJA 2RUFA 2LKUA 4EL1A 1GNEA 3KP9A 4O92A 2H0HA 2H6XA 4TR4A 4G0KA 4AJ7A 2Z9SA 5HQPA 2PVOC 2BTOT 1K0MA 4ECBA 1H75A 4MPGA 4D73B 3KH7A 1U3AA 5EPFA 3GKNA 1V9WA 1THOA 1B4PA 5AGYA 4TN8A 2VAFA 3MAKA 1SJ6A 4K9ZA 5GAND 1QFNA 4I5QA 4RQRA 3DVXA 5AIVA 1PRXA 2CX4A 4NV5A 1JFUA 1OVNA 3UJ1A 4GSNA 1GUMA 4HU7A 1V57A 4JR4A 1PX6A 2WRTA 2MBSA 2WB9A 1XIYA 1EOGA 4I2TA 5DBQA 3D22A 2C0FA 1FB0A 4USSA 3TDGA 1XCCA 3CMIA 4BPYA 1DSBA 1PX7A 3PR8A 4ZBAA 3CSJA 3P7XA 3SBCA 1B9YC 3R2QA 4OFMA 4CDOA 2F9SA 2A2SA 2CAQA 3KD0A 2JADA 5IO0A 3ZMKA 4AJ8A 3J7Yk 4EKZA 2QSIA 2O7KA 4XS4B 4YH2A 3IHQA 1PMTA 2LJKA 5DQSA 2ES7A 2WULA 3FZ5A 5GZZB 3TJBA 1VF4A 3FRCA 4K7IA 4K1FA 1GTIA 2LQQA 4GRFA 4KF9A 1XWGA 3F4RA 5CREA 5HFGA 1T00A 5IPHA 2GGTA 4ECCA 2DIYA 1XOBA 4I8BA 4POBA 5DALB 5F06A 3APOA 1X9SB 3TKRA 1R5PA 1AC1A 3H79A 3E0UA 1FOVA 2C80A 20GSA 5E4WA 3WT2A 5ECPB 2DMLA 2L5OA 1A23A 4FH8A 2H01A 4HQZA 3TOUA 4I6XA 5ID2A 2VO4A 3ERGA 1HQOA 1Y6EA 2DJ0A 4PTSA 3I9V2 3F3RA 2H71A 3HD5A 14GSA 2H6ZA 1SD8A 1ON4A 4V1Ag 1YF1A 3RDWA 3VFIA 2KP1A 2O89A 1XZOA 4RI7A 5HFKA 5CRHA 3HA9A 3UVTA 3GIXA 3G9BA 2H1DA 5IMZA 3IK7A 1FO5A 3WT1A 3VK9A 1XBSA 1V58A 4DSQA 1TRUA 2FCHA 1ZOFA 2JSYA 2VL9A 1S3DA 2LRTA 4KB3A 3WGXA 3UAPA 3EE2A 4KH7A 1X5CA 3IDVA 4CHSA 2WZ9A 1N2AA 1O85A 4D73A 1T7PB 4MZWA 2G0FA 2WDUA 3M9KA 4K8MA 4WXTA 1PGTA 3GTUB 2FUG2 2H74A 2GQMA 5CP1A 1AQXA 5DVBA 2F8FA 2I1UA 2M46A 2VM1A 2B1KA 4ACSA 4JE1A 1ZCPA 2H1BA 4KNDA 3IXRA 1SJZA 3M0FA 2WS2A 1B8XA 1TK0B 1KTEA 4O7HA 5GAPD 2B1LA 5CRWA 1JZWA 3FHKA 1ZZYA 4J56E 1GLQA 3GHAA 2MYGA 3LORA 3DWVA 2YWMA 1OC8A 5INYA 4DSSB 4G10A 3D21A 1TRVA 1SKRB 3A5WA 2X99A 3F63A 2P31A 5GSSA 3C71A 5D9VA 3HHVA 3PGTA 3J7Yb 4V2NA 4DEJA 5H5QA 3FR9A 1F6MC 4G19A 4XS4A 1AW9A 4KDYA 3RHCA 3QPMA 2X8GA 1E6BA 3M8NA 1QMVA 4N11A 4OD7A 4N10A 1R4WA 4MABA 1JZOA 4GXZA 2KOKA 1A2JA 4HQSA 3NZNA 1HNAA 2JZTA 2HSHA 2AYTA 2C0DA 2GVPA 4XTSA 3FR6A 2WJUA 3F6FA 3WYWA 3ZFLA 2R6KA 2YP6A 1J0FA 2V32A 1WE0A 6GSTA 3BOAA 2D2ZA 1OC9B 1NSWA 5DALA 2J23A 2P5RA 4WR5A 2GZPA 3VPQA 3D4TA 1BYEA 3TJGA 5HR3A 2CA8A 4Z7XA 11GSA 2XPEA 2H73A 1GP1A 3TJJA 2EIQA 1GSYA 2IMIA 1T8EB 4BL7B 4EC0A 2TRCP 1OE7A 4GWRA 5C04A 2XC2A 4ZBBA 5CAXA 4MPFA 3EMPA 4FO5A 5ECOB 4MJBA 3ZZXA 3Q19A 3KTBA 1QXHA 1TW9A 3EYTA 3IC8A 2H6YA 4ZIJA 3ZITA 1TU7A 2UZ8A 4IQ1A 4ZL9A 4FQUA 1F37A 3LQ7A 4ZL7A 2CVBA 3IRAA 4G9HA 1X9WB 4ID0A 3BCKA 1QGVA 2WCIA 5E59A 1Q98A 1A24A 1ZMAA 3DMLA 4WF4A 2CZ2A 5G30A 4NHZA 5ECQB 2HLSA 4EDYA 3UIWA 2P5QA 1RW1A 2HZFA 3G7IA 3GTUA 3UBKA 5CO3A 5DDLA 1Y25A 4IS0A 3FR3A 5CNWA 4BA7A 1AQWA 4OWYA 4ECIA 1UVZA 3ZYWA 3QAVA 2YOIA 5KN3A 2KUCA 2AV4A 3GRXA 4WBJA 2H1GA 2FWHA 2OE0A 2HFDA 5HR2A 1PKWA 5IOXA 5GSTA 3IBHA 3JCML 5HFIA 1O81A 1XXUA 4NHWA 4IKHA 2C3NA 5CYYA 1B48A 1Z5YE 5JWQB 4ZB9A 2GDRA 3DGQA 3HDCA 3UBLA 4DSSA 2NDOA 3VWVA 2JL4A 2VUPA 5J4UA 4ZB6A 4QL7A 1RQMA 4MZBA 1YJ6A 1WPIA 4F0BA 2CVKA 2YV9A 1PN9A 3KEBA 2JSZA 2IMKA 3TUEA 4LLRA 3FYGA 2PWJA 2R5GA 4EDZA 4K0GA 2B7JA 4IVFA 4QQ7A 4I2UA 1WRYA 4IP6A 2F3MA 1JLVA 3CRTA 4TKYA 4PNFA 2LSTA 4POLA 4BVYB 2H70A 2GT6A 5A4UA 2PUKC 2V6KA 5ECIB 2YWIA 2KHPA 1OC9A 5ELGA 4PGTA 4Q5QA 2G2QA 3GA4A 1SYXA 1PL1A 3HZ8A 3P2AA 1BX9A 2EIRA 1GTBA 6GSXA 12GSA 2ON7A 4PX1A 4BL7A 1OE8A 2LJAA 5JWRB 1Z3EA 1G0TA 19GSA 3H93A 2IPAA 3UEMA 3GYKA 3VWWA 1YZXA 2VLUA 3DVWA 1M2DA 4TVEA 2GQLA 3CSHA 1GSEA 1XW9A 1Z6NA 3S9FA 4MF6A 3RPPA 3W8JA 4MF7A 4J57E 3F6DA 2WGRA 5KN2A 4HDEA 2ALBA 1YKCA 3ERFA 1K0OA 1A8YA 2H76A 3C1SA 4K7NA 2PPTA 3QFAC 5IOWA 3US3A 3BBYA 1O6JA 1YQ1A 4JEDA 2RM5A 1TXXA 4IBPA 1MTCA 4FYCA 2N5FA 4RUVA 1EZKA 3VI5A 3MNGA 4GLTA 1R26A 2VLTA 4BWSA 3VWUA 3VWXA 4EXJA 5ECKB 2HSYA 5FHIA 4YQUA 4ML1A 3AY8A 1THXA 1PQNA 1EGRA 5D93A 6GSUA 3KZQA 4F03A 1WIKA 2LS5A 4FIWA 1OYJA 2IN3A 5ELAA 4KDUA 5ECSA 4ULXA 1K0DA 4TRXA 3ZREA 5EVOA 2C1YA 2BMXA 1KNGA 3FKFA 4XS1A 1HD2A 3LJRA 3EWLA 4KUNA 4NV2A 3EU3A 4TR1A 2CT6A 3UL3A 4YAPA 1CQHA 1WMJA 2LRNA 5JCUA 1EEJA 1VGLA 2GLRA 1T3BA 4HU9A 2GS3A 3ERWA 4TR0A 3LWAA 2N5BA 3RAZA 5HR0A 2IMFA 1MD3A 2HRNA 4PURA 2GSSA 1B9XC 5LD0A 4PUFC 2FWGA 1FB6A 2B7KA 5G2ZA 3TCOA 3DD3A 5FT3A 4MDCA 1O73A 4BVYA 3I43A 2LQOA 5JCGA 4LL4B 3D4MA 1UN2A 2K8SA 2MZCA 3NOFA 2L4CA 4IW9A 2L5LA 2LTKA 1X9MB 3N9JA 5IO2A 4MMMA 4PQ1A 1PKZA 1TK8B 5D8IA 1GLPA 4HS1A 2CAIA 2DSAA 2LNSA 2JZRA 1MDKA 4XRDA 5ECLB 5L71A 3L4NA 2M72A 3U5RE 4AF2A 3DIEA 3U6VA 2IWTA 3FY7A 2F8AA 2LUSA 1FAAA 2NPBA 2H30A 2OE3A 2IIYA 1GUKA 1YEPA 4V2LA 3FZ4A 1GSDA 2K8VA 1WWJA 2TIRA 2VCVA 5CRGA 1PD21 3TKQA 1TI1A 3HJPA 4WETA 4F82A 1AAZA 1I5GA 1YY7A 3QOUA 4TW5A 1VF3A 1SL1B 2YWNA 1XWCA 1XW5A 2VL2C 2K6VA 3GKMA 1BG5A 3EC3A 3P8WA 3QFBC 3CTFA 2C8UA 2I3YA 2MMOA 4G2EA 3HYPA 2YJ7A 3PINA 2MMAA 4MH2A 2DC5A 2H8LA 2FA8A 2H72A 1ERTA 2VCXA 2HE3A 2PGTA 3KGKA 4HI7A 3MDKA 1EP7A 1OKTA 2VOCA 4KA0A 4JU5A 5IMDA 1HNCA 5F8BA 1U3IA 1GSSA 5LNKe 2GSQA 18GSA 4XRAA 1V2AA 2IFQA 2LV3A 1C72A 1JHBA 5KN0A 4EO3A 1NW2A 4E8HA 3HZ4A 1QUWA 2VIMA 2NBSA 3I6AA 4FYBA 4MZCA 2PBJA 1GRXA 6GSWA 4WR4A 4MLYA 3KP8A 4JZQA 5KN1A 3IR4A 1K3YA 1ZGNA 2FLSA 3ME7A 3ZTLA 1GL8A 1T1VA 3ZVJD 1GUHA 4TXVA 4L5OA 1F9MA 1HNBA 4X0XA 4KCEA 1YKAA 4V2MA 2E0QA 4IN0A 5IM9A 2GZZA 3C73A 5ENUA 3RHBA 2GQKA 4NPBA 3IAM2 2AJQB 4LMWA 1F2EA 1MD4A 2HRKA 2LEGA 1ML6A 2DMMA 5DJMA 2YNXA 4NAXA 1VRSD 4N0ZA 1TDIA 4G0LA 4ZXGA 1SU9A 4OO4A 5IMFA 1WP0A 2VCWA 4ILFA 4X43A 5D9TA 3LYKA 4WEYA 3ZVJA 4ZB8A 5JWOB 5B7CA 1O8XA 2E7PA 2O87A 1JLWA 1EEMA 3D0ZA 1TJDA 2RM6A 1ERWA 3E9JB 4KW6A 1FHEA 10GSA 4OCFA 2CZ3A 4IP1A 5F07A 1JZDA 2AB6A 2NVLA 3LEFA 2M80A 1SENA 1AUCA 2AAWA 1SK2A 1R7HA 3GX8A 3GSTA 1EV4A 1VF2A 2OBIA 1LBKA 2YN1A 1V40A 1ERVA 2OJLA 3EU4A 3LXTA 4KDXA 3TKSC 3GH9A 2A2RA 1W89A 4OFNA 5A5KA 2XBQA 4KAEA 5B8BA 1GH2A 4RI6A 1U88A 3I69A 2PN8A 4HUAA 4YQMA 4XS6A 4IGJA 3IC4A 3W8SA 2IMEA 2FHEA 2K9FA 3GL3A 3TGZA 1IYIA 3QDNA 5F0GA 2GTUA 3IAS2 2B6MA 3A2XA 3MSZA 5DJLA 1HYUA 1K0NA 4MK3A 5IIZA 5A4VA 2H1AA 5B8AA 1N8JA 5B6NA 5DAKB 3PH9A 4JBBA 1W4VA 1IYHA 1EGOA 3QAWA 5D73A 3IOSA 2DJ1A 4XHMA 3EMXA 2KP2A 4TR1B 2B5YA 3UMAA 1M7TA 3HY2A 1DBYA 3FZ9A 2RLIA 5DCHA 4MJCA 2L6CA 3DKSA 2HSMB 3M1GA 2MMZA 1WJKA 2L59A 2ZNMA 4NMUA 1GTUA 3KXOA 3RBTA 1A0RP 4BVXB 2C3TA 5ECNB 1KEBA 3TRQA 1GSUA 2L57A 1ZL9A 5G5EA 4KE3A 3LG6A 4X1UA 4PUAA 3DEXA 4GSSA 2YCDA 3H1NA 4NXIA 1GSFA 5IPGA 1AXDA 7GSSA 4KCAA 2VD0A 5AISA 1O7UA 4TXOB 2KLXA 5DCGA 1FG4A 3H4KA 2LRCA 3GL5A 5D96A 5A4WA 3P90A 1WOUA 4K7OA 2MMNA 5IMVA 5D9XA 3QR6A 1TI3A 3Q74A 2OACA 3L9VA 4DSRA 13GSA 1M0UA 3MWHA 3UARA 2C0GA 1KBNA 4KGIA 3IE3A 3F3QA 3A3TA 3BJ5A 2PVQA 3CSIA 3A2WA 2H19A 2C3QA 3OR5A 4MF5A 4QL9A 3C1RA 2HNLA 2QKEA 1RK4A 1TOFA 1M2AA 4NWYA
chains in the Genus database with same CATH superfamily
4WBRD 1ZYEA 2X8HA 5COHA 1NM3A 3L78A 2YPMA 1M9AA 3MIXA 3LFLA 1E2YA 2I81A 2HSNB 3IK9A 3FW2A 4OFTA 4ZILA 1B4QA 4GTUA 3ZL5A 3IA1A 1XWKA 2HRAA 1Z7PA 1TP9A 3CYNA 5ABRA 3M9JA 3F8UA 4ZBDA 4AJ6A 3MYDA 5AN1A 3TB2A 1XVQA 1GNWA 4MP4A 2FNOA 3M3MA 3VI7A 2P0GA 1V98A 4TOPA 2ZUPA 3CHXC 2GT5A 3TJFA 1TRSA 2IJYA 1A0FA 4L5LA 2NTOA 5IMCA 4Q5RA 5A1NA 3UOMA 4ECJA 5ECRB 4MJAA 4IELA 2HYXA 3DXBA 3GX0A 4TR3A 2R2JA 4ML6A 4L8EA 4K6XA 1TU8A 1EWXA 2LJRA 2PMTA 5DAKA 2EIOA 4HEA2 3DYRA 1URMA 3EINA 1AQVA 2IFQB 2YZHA 4HZ4A 2WFCA 4GQFA 1PA3A 5J5NA 3ZFBA 3TKPA 2ON5A 2H1LA 5EY6A 2I4AA 4YKGA 3R3EA 1XWAA 3HMJG 1M2BA 22GSA 2XHFA 1XPVA 3KMOA 3GFKA 3HJOA 4RQXA 5J40A 3ME8A 2DKHA 4P3YB 2WVXB 2HSMA 3CWGA 4KSOA 5AIXA 1PL2A 3APSA 1XWBA 4ZB7A 2R4VA 1MDJA 1J9BA 4BWQA 4E8EA 3F9UA 4BVXA 1X0RA 1Z6MA 2CX3A 2YZUA 4POKA 8GSSA 3ZIVA 2GSTA 1JZRA 2VL2A 3FEUA 3KM6A 3QCPA 2HRKB 1FVKA 1AIUA 2JU5A 4YAVA 1K0CA 4ISDA 2FWFA 1S3CA 1SK1A 1VF1A 4TXOA 2FY6A 3KCMA 2PERA 5BMUA 5J9CA 4HJ2A 3ISOA 2YANA 3WGEA 2FWEA 1YF0A 2QGVA 2EFDA 2HI7A 1ERUA 3GNJA 1R5AA 2H0GA 2RUEA 4LA1A 4PI0C 4PQHA 1EOHA 4F2IA 3HCZA 2O36A 1OC3A 2REMA 3L0HA 1F3AA 1Z9HA 2AHEA 3G7YA 3TKSE 1SD9A 4AKXB 3GKKA 4KX4A 4LMVA 2R3XA 17GSA 2V41A 2HRFA 2HSNA 2YWOA 2CQ9A 4POMA 2V1MA 4H86A 4DVCA 4GCIA 1K0AA 4EUYA 4OO5A 5C00A 4K2DA 1XOAA 1YVLA 1K3LA 1TK5B 5EL8A 3HVXA 1GTAA 4LL1B 2JACA 1H4OA 5FWGA 1PN0A 4K5SA 2X49A 4IJIA 4YQVA 3RPNA 4AGSA 2VM2A 3FK8A 3VURA 2VCQA 2VCZA 4IHUA 2VD1A 5HR1A 3G7JA 2XBIA 4EE0A 4ICYA 3ZMLA 2DJKA 4JR6A 1NHYA 1J08A 2C0EA 2VL3A 5ECMB 4PNGA 5DQYA 2MBTA 1Q4JA 3LYPA 2OBKA 3GUSA 3NIVA 3O76A 4N30A 2OKAA 1ABAA 1O8WA 1G6WA 4IJ3A 6GSYA 1MDIA 3N5OA 9GSSA 4FYUA 3TU3B 1U87A 4EIPA 2CVDA 1BAYA 3F4SA 2HQTA 4GSTA 3KH9A 2B5EA 4OCEA 4Q5FA 3HKRA 2O8VB 1TRWA 1ZYQB 1XW6A 1DUGA 2HZEB 4MJEA 2DJJA 2CV4A 1BQ7A 2IL3A 5IMAA 3FZAA 3LSZA 1SL2B 2WVXA 2AUVA 2E2MA 1FVJA 2H75A 4O5RA 1CQGA 2EC4A 2V2GA 4F9ZA 2JZSA 3HVSA 5D9WA 3TKSA 5F05A 4EIQA 4ZL8A 1X5DA 5CRDA 4N0VA 2DLXA 1YEXA 1I9DA 4CW9A 2YV7A 3O6TA 5LCZA 2FGXA 5G31A 3HXSA 1TTZA 5B6MA 2BJXA 2DBCA 5J9BA 4HJMA 4XCSA 4HZ2A 1SYRA 4WKWA 3SWLA 3IV4A 4EVMA 1K0BA 2VLVA 4J2FA 3ED3A 4AKGA 4K5RA 1OKDA 2TRXA 1G6YA 3O3TA 1X5EA 2OA7A 2N5AA 3DRNA 3IHGA 2GZYA 4PXOA 3GV1A 3C8EA 4KSMA 1YDKA 1SKSB 3EURA 4OMVA 1EP8A 1SL0B 3GURA 1LU4A 3W6GA 3KTLA 3LGCA 3TOTA 6GSSA 3L9SA 3D6IA 3GKXA 4IQAA 5ECHB 3TRPA 2QC7A 4GQCA 3BCIA 1S4BP 3GSSA 2A4VA 3ZRDA 4GF0A 2VCTA 1USBA 5JCWA 1BEDA 2DIZA 3KJYA 3GN3A 1OAZA 2L4QA 2H66A 1PSQA 1TKDB 3CBUA 3CXGA 3GMFA 1K3OA 1GSQA 1G7EA 3EVIA 3H8QA 1U6TA 3UVHA 1BJXA 1QQ2A 1F3BA 3LW9A 2PU9C 2ZCTA 1NHOA 2RIIA 2C4JA 5G5FA 4F0CA 3QAGA 4Q5NA 2FA4A 16GSA 4L0UA 2YJHA 1A2LA 3WD6A 3D5JA 2E2GA 1SKWB 1SJIA 6GSVA 3CTGA 2XPDA 3V1WA 2DJ2A 1UC7A 4MH3A 2L6DA 3IPZA 3QMXA 4EF0A 1M99A 1GWCA 4AKIA 3A5IA 1XVWA 3C7MA 1MEKA 3F0IA 1ILOA 1ACVA 1A8LA 3HJMA 3HVVA 3QD9A 4WF5A 3LXZA 5G1LA 2HT9A 3VLNA 1PFOA 1T4YA 1G7OA 3Q18A 2R37A 3APQA 5KEJA 4O32A 3VPTA 4G0IA 2HZEA 4FXYP 4I97A 1DE2A 5H5SA 1M9BA 3TJKA 4HOJA 3TRXA 5IQYA 2LNTA 4MNNA 1EV9A 3A2VA 2OE1A 1QK8A 2IMDA 3K8NA 3CRUA 1DE1A 3GH6A 2OADA 2HXKA 1FW1A 4K0NA 4L0WA 2FD3A 2J9HA 1GULA 1S3AA 3ZLPA 5H5RA 3WGDA 5J41A 4JRRA 5J3RA 1XFLA 4MA9A 1ST9A 4G01A 1Z7RA 4Z2UA 3F4TA 5BMUB 5J4YA 3BD2A 4MCUA 3L9UA 2GSRA 2X64A 2X8CA 2B5XA 5G1KA 2DJ3A 1SK0A 2I9HA 1UA5A 3PPUA 2O85A 4V1Ap 2V6OA 5ID2B 5J47A 3ZIJA 2K18A 4PQIA 3KMNA 1LJRA 1T4ZA 2B3SA 1ZYNA 2OT3A 3E3EA 2F51A 3Q6OA 2H0IA 4XIHA 1A2MA 3KIJA 2RUFA 2LKUA 4EL1A 1GNEA 3KP9A 4O92A 2H0HA 2H6XA 4TR4A 4G0KA 4AJ7A 2Z9SA 5HQPA 2PVOC 2BTOT 1K0MA 4ECBA 1H75A 4MPGA 4D73B 3KH7A 1U3AA 5EPFA 3GKNA 1V9WA 1THOA 1B4PA 5AGYA 4TN8A 2VAFA 3MAKA 2WZSA 1SJ6A 4K9ZA 5GAND 1QFNA 4I5QA 4RQRA 3DVXA 5AIVA 1PRXA 2CX4A 4NV5A 1JFUA 1OVNA 3UJ1A 4GSNA 1GUMA 4HU7A 1V57A 4JR4A 1PX6A 2WRTA 2MBSA 2WB9A 1XIYA 4QMKA 1EOGA 4I2TA 5DBQA 3D22A 2C0FA 1FB0A 4USSA 3TDGA 4PI2C 1XCCA 1Y1UA 3CMIA 1YEWC 4BPYA 1DSBA 1PX7A 3PR8A 4AI6A 4ZBAA 3CSJA 3P7XA 3SBCA 1B9YC 1M3IA 3R2QA 4OFMA 4CDOA 2F9SA 2A2SA 2CAQA 3KD0A 2JADA 5IO0A 3ZMKA 4AJ8A 3J7Yk 4CY8A 4EKZA 2QSIA 2O7KA 4XS4B 4YH2A 3IHQA 1PMTA 2LJKA 5DQSA 2ES7A 2WULA 3FZ5A 5GZZB 3TJBA 1VF4A 3FRCA 5KOWA 1SVMA 4K7IA 4K1FA 1GTIA 2LQQA 4GRFA 4KF9A 1XWGA 3F4RA 5CREA 5HFGA 1T00A 1I1IP 2GGTA 4ECCA 5IPHA 2DIYA 1XOBA 2DKIA 4I8BA 4POBA 5DALB 5F06A 3APOA 1X9SB 3TKRA 1R5PA 1AC1A 3H79A 3E0UA 2R0CA 1FOVA 2C80A 20GSA 5E4WA 3WT2A 5ECPB 2DMLA 2L5OA 2QA2A 1A23A 4FH8A 2H01A 4HQZA 3TOUA 4I6XA 5ID2A 2VO4A 3ERGA 1HQOA 1Y6EA 2DJ0A 1BG1A 4PTSA 3I9V2 3F3RA 2H71A 3HD5A 14GSA 2H6ZA 1SD8A 1ON4A 4V1Ag 1YF1A 3RDWA 3VFIA 5KOXA 2KP1A 2O89A 1XZOA 4RI7A 5HFKA 5CRHA 3HA9A 3UVTA 3GIXA 3G9BA 2H1DA 5IMZA 3IK7A 1FO5A 3WT1A 3VK9A 1XBSA 1V58A 4DSQA 1TRUA 2FCHA 1ZOFA 2JSYA 2VL9A 1S3DA 2LRTA 4KB3A 3WGXA 3UAPA 3EE2A 4KH7A 1X5CA 3IDVA 4CHSA 2WZ9A 1N2AA 1O85A 4D73A 1T7PB 4MZWA 2G0FA 2WDUA 3M9KA 4K8MA 4WXTA 1PGTA 3GTUB 2FUG2 2H74A 2GQMA 5CP1A 1AQXA 5DVBA 2F8FA 2I1UA 2M46A 2VM1A 2B1KA 4ACSA 4JE1A 1ZCPA 2H1BA 4KNDA 3IXRA 1SJZA 3M0FA 2WS2A 1B8XA 1TK0B 1KTEA 4O7HA 5GAPD 2B1LA 5CRWA 1JZWA 3FHKA 1ZZYA 4J56E 1GLQA 3GHAA 2MYGA 3LORA 3DWVA 4K2XA 2YWMA 1OC8A 5INYA 4DSSB 4G10A 3D21A 2O5VA 1TRVA 1SKRB 3A5WA 2X99A 4A5PA 3F63A 2P31A 5GSSA 3C71A 5D9VA 3HHVA 3PGTA 3J7Yb 4V2NA 4DEJA 2A4HA 5H5QA 3FR9A 1F6MC 4G19A 4XS4A 1AW9A 4KDYA 3RHCA 3QPMA 2X8GA 1E6BA 3M8NA 1QMVA 4N11A 4OD7A 4N10A 1R4WA 4MABA 1JZOA 4GXZA 2KOKA 1A2JA 4HQSA 3NZNA 1HNAA 2JZTA 2HSHA 2AYTA 2C0DA 2GVPA 4XTSA 3FR6A 2WJUA 3F6FA 3WYWA 3ZFLA 2R6KA 2YP6A 1J0FA 2V32A 1WE0A 6GSTA 3BOAA 2D2ZA 1OC9B 1NSWA 5DALA 2J23A 2P5RA 4WR5A 2GZPA 3VPQA 3D4TA 1BYEA 3TJGA 5HR3A 2CA8A 4Z7XA 11GSA 2XPEA 2H73A 1GP1A 3TJJA 2EIQA 1GSYA 2IMIA 1T8EB 4BL7B 4EC0A 2TRCP 1OE7A 4GWRA 5C04A 2XC2A 4GDFA 4ZBBA 5CAXA 4MPFA 3EMPA 4FO5A 2WW0A 2R0PA 5ECOB 4MJBA 3ZZXA 3Q19A 3KTBA 3RFRC 1QXHA 1TW9A 3EYTA 3IC8A 2H6YA 4ZIJA 3ZITA 1TU7A 2UZ8A 4IQ1A 4ZL9A 4FQUA 1F37A 3LQ7A 4W66A 4ZL7A 2CVBA 3IRAA 4G9HA 1X9WB 4Z2TA 4ID0A 3BCKA 1QGVA 2WCIA 5E59A 1Q98A 1A24A 2X4AA 1ZMAA 3DMLA 4WF4A 2CZ2A 5G30A 4NHZA 5ECQB 2HLSA 4EDYA 3UIWA 2P5QA 1RW1A 2HZFA 3G7IA 3GTUA 3UBKA 5CO3A 5DDLA 1Y25A 4IS0A 3FR3A 5CNWA 4BA7A 1AQWA 4OWYA 4ECIA 1UVZA 3ZYWA 3QAVA 2YOIA 5KN3A 2KUCA 2AV4A 3GRXA 4WBJA 2H1GA 2FWHA 2OE0A 2HFDA 5HR2A 1PKWA 5IOXA 5GSTA 3IBHA 3JCML 5HFIA 1O81A 1XXUA 4NHWA 4Z2RA 4IKHA 2C3NA 4O5QA 5CYYA 1B48A 3FMWA 1Z5YE 5JWQB 4ZB9A 2GDRA 3DGQA 3HDCA 3UBLA 4DSSA 2NDOA 3VWVA 2JL4A 2VUPA 5J4UA 4ZB6A 4QL7A 1RQMA 4MZBA 1YJ6A 1WPIA 4F0BA 2CVKA 2YV9A 1PN9A 3KEBA 2JSZA 4N3ZA 2IMKA 3TUEA 4LLRA 3FYGA 2PWJA 2R5GA 4X4JA 4EDZA 4K0GA 2B7JA 4IVFA 4QQ7A 4I2UA 1WRYA 4IP6A 2F3MA 1JLVA 3CRTA 4TKYA 4PNFA 2LSTA 4POLA 4BVYB 2H70A 2GT6A 4PHZC 5A4UA 2PUKC 2V6KA 4CY6A 5ECIB 2YWIA 2KHPA 1OC9A 5ELGA 4AKHA 4PGTA 4Q5QA 2G2QA 3GA4A 1SYXA 1PL1A 3HZ8A 3P2AA 1BX9A 2EIRA 1GTBA 6GSXA 12GSA 2ON7A 4PX1A 4HSCX 4BL7A 1OE8A 2LJAA 5JWRB 1XG8A 1Z3EA 1G0TA 19GSA 3H93A 2IPAA 3UEMA 3GYKA 3VWWA 1YZXA 2VLUA 3DVWA 1M2DA 4TVEA 2GQLA 3CSHA 4E68A 1GSEA 1XW9A 1Z6NA 3S9FA 4MF6A 3RPPA 3W8JA 4MF7A 4J57E 3F6DA 2WGRA 5KN2A 4HDEA 2ALBA 1YKCA 3ERFA 1K0OA 1A8YA 2H76A 3C1SA 4K7NA 2PPTA 3HVNA 3QFAC 5IOWA 3US3A 3BBYA 1O6JA 1YQ1A 3RGBC 4JEDA 2RM5A 1TXXA 4IBPA 1MTCA 4FYCA 2N5FA 4RUVA 1EZKA 5BRTA 3VI5A 3MNGA 4GLTA 1R26A 2VLTA 4BWSA 3VWUA 3VWXA 4EXJA 5ECKB 5A34B 2HSYA 5FHIA 4YQUA 4ML1A 3AY8A 1THXA 1PQNA 1EGRA 5D93A 6GSUA 3KZQA 4F03A 1WIKA 2LS5A 4FIWA 1OYJA 2IN3A 5ELAA 4KDUA 5ECSA 4ULXA 1K0DA 4TRXA 3ZREA 1TXUA 5EVOA 2C1YA 2BMXA 1KNGA 3FKFA 4XS1A 1HD2A 3LJRA 3EWLA 4KUNA 4NV2A 3EU3A 4TR1A 2CT6A 3UL3A 1FOHA 4YAPA 1CQHA 1WMJA 2LRNA 5JCUA 1EEJA 1VGLA 2GLRA 1T3BA 4HU9A 2GS3A 3ERWA 4TR0A 3LWAA 2N5BA 3RAZA 5HR0A 2IMFA 2EFCA 1MD3A 2HRNA 2O3EA 4PURA 2GSSA 1B9XC 5LD0A 4PUFC 2FWGA 1FB6A 2B7KA 5G2ZA 3TCOA 3DD3A 5FT3A 4MDCA 1O73A 4BVYA 3I43A 2LQOA 2R0GA 5JCGA 4LL4B 3D4MA 1UN2A 2K8SA 2MZCA 3NOFA 2L4CA 4IW9A 2L5LA 2LTKA 1X9MB 3N9JA 5IO2A 4MMMA 4PQ1A 1PKZA 1TK8B 5D8IA 1GLPA 4HS1A 2CAIA 2DSAA 2LNSA 2JZRA 1MDKA 4XRDA 5ECLB 5L71A 3L4NA 2M72A 3U5RE 4AF2A 3DIEA 2VKZG 3U6VA 2IWTA 3FY7A 2F8AA 2LUSA 1FAAA 2NPBA 2H30A 2OE3A 2IIYA 1GUKA 1YEPA 4V2LA 3FZ4A 1GSDA 2K8VA 1WWJA 2TIRA 2VCVA 5CRGA 1PD21 3TKQA 1TI1A 1BF5A 3HJPA 4WETA 4F82A 1AAZA 1I5GA 1YY7A 3QOUA 4TW5A 1VF3A 1SL1B 2YWNA 1XWCA 1XW5A 2VL2C 2K6VA 3GKMA 1BG5A 3EC3A 3P8WA 3QFBC 3CTFA 2UV8G 2C8UA 2I3YA 4O5UA 2MMOA 4G2EA 3HYPA 2YJ7A 3PINA 2MMAA 4MH2A 2DC5A 2H8LA 5A34A 2FA8A 2H72A 1ERTA 2VCXA 2HE3A 2PGTA 3KGKA 4HI7A 3MDKA 1EP7A 1OKTA 2VOCA 4KA0A 2WVYA 4JU5A 5IMDA 1HNCA 5F8BA 1U3IA 2EFEA 1GSSA 5LNKe 2GSQA 18GSA 4XRAA 1V2AA 2IFQA 2LV3A 1C72A 1JHBA 5KN0A 4EO3A 1NW2A 4E8HA 3HZ4A 1QUWA 2VIMA 2NBSA 3I6AA 4FYBA 4MZCA 2PBJA 4BIKA 1GRXA 6GSWA 4WR4A 2WW1A 4MLYA 3KP8A 4JZQA 5KN1A 3IR4A 1K3YA 1M3JA 1ZGNA 2FLSA 3ME7A 3ZTLA 1GL8A 1T1VA 3ZVJD 1GUHA 1S3RA 4TXVA 4L5OA 1F9MA 1HNBA 4X0XA 4KCEA 1YKAA 4V2MA 2E0QA 4IN0A 5IM9A 2GZZA 3C73A 5ENUA 3RHBA 2GQKA 4NPBA 3IAM2 2AJQB 3EPTA 4LMWA 1F2EA 1MD4A 2HRKA 2LEGA 1ML6A 2DMMA 5DJMA 2YNXA 4NAXA 1VRSD 2WW3A 4N0ZA 1TDIA 4G0LA 4ZXGA 1SU9A 4OO4A 5IMFA 1WP0A 2VCWA 4ILFA 4X43A 5D9TA 3LYKA 4YKFA 4WEYA 3ZVJA 4ZB8A 5JWOB 5B7CA 1O8XA 2E7PA 2O87A 1JLWA 5A5HB 1EEMA 3D0ZA 1TJDA 2RM6A 1ERWA 3E9JB 2EFHA 1ZYPA 4KW6A 1FHEA 10GSA 4OCFA 2CZ3A 4IP1A 5F07A 1JZDA 2AB6A 2NVLA 3LEFA 2M80A 1SENA 1AUCA 2AAWA 1SK2A 1R7HA 3GX8A 3GSTA 1EV4A 1VF2A 2OBIA 1LBKA 2YN1A 1V40A 1ERVA 2OJLA 3EU4A 3LXTA 4KDXA 3TKSC 3GH9A 2A2RA 1W89A 4OFNA 5A5KA 2XBQA 4KAEA 5B8BA 1GH2A 4RI6A 1U88A 3I69A 2PN8A 4HUAA 4YQMA 4XS6A 4IGJA 3IC4A 3W8SA 2IMEA 2FHEA 2A2PA 2K9FA 3GL3A 2WVZA 3TGZA 1IYIA 5A1NB 3QDNA 5F0GA 2GTUA 2WW2A 3IAS2 2B6MA 3A2XA 3MSZA 5DJLA 1HYUA 1K0NA 4MK3A 5IIZA 5A4VA 2H1AA 5B8AA 1N8JA 5B6NA 5DAKB 3PH9A 4JBBA 1W4VA 1IYHA 1EGOA 3QAWA 5D73A 3IOSA 2DJ1A 4XHMA 3EMXA 2KP2A 4TR1B 2B5YA 3UMAA 1M7TA 3HY2A 1DBYA 3FZ9A 2RLIA 5DCHA 4MJCA 2L6CA 3DKSA 1SVLA 2HSMB 3M1GA 2MMZA 1WJKA 2L59A 2ZNMA 4NMUA 1GTUA 5J4VA 2QA1A 3KXOA 3CQFA 3RBTA 1A0RP 4BVXB 2C3TA 5ECNB 1KEBA 3TRQA 1GSUA 2L57A 1ZL9A 5G5EA 4KE3A 3LG6A 4X1UA 4PUAA 3DEXA 1N25A 4GSSA 2YCDA 3H1NA 4NXIA 1SVOA 1GSFA 5IPGA 1AXDA 7GSSA 4KCAA 2VD0A 5AISA 1O7UA 4TXOB 2KLXA 5DCGA 1FG4A 3H4KA 2LRCA 3GL5A 5D96A 5A4WA 3P90A 1WOUA 4K7OA 2MMNA 5IMVA 5D9XA 3QR6A 1TI3A 3Q74A 2OACA 3L9VA 4DSRA 13GSA 1M0UA 3MWHA 3UARA 2C0GA 1KBNA 4KGIA 3IE3A 3F3QA 3A3TA 5A5HA 3BJ5A 2PVQA 3CSIA 3A2WA 2H19A 2C3QA 3OR5A 4MF5A 4QL9A 3C1RA 2HNLA 2QKEA 1RK4A 1TOFA 1M2AA 4NWYA
chains in the Genus database with same CATH topology
4WBRD 1ZYEA 2X8HA 5COHA 1NM3A 3L78A 2YPMA 1M9AA 3MIXA 3LFLA 1E2YA 2I81A 2HSNB 3IK9A 3FW2A 4OFTA 4ZILA 1B4QA 4GTUA 3ZL5A 3IA1A 1XWKA 2HRAA 1Z7PA 1TP9A 3CYNA 5ABRA 3M9JA 3F8UA 4ZBDA 4AJ6A 3MYDA 5AN1A 3TB2A 1XVQA 1GNWA 4MP4A 2FNOA 3M3MA 3VI7A 2P0GA 1V98A 4TOPA 2ZUPA 2GT5A 3TJFA 1TRSA 2IJYA 1A0FA 4L5LA 2NTOA 5IMCA 4Q5RA 5A1NA 3UOMA 4ECJA 5ECRB 4MJAA 4IELA 2HYXA 3DXBA 3GX0A 4TR3A 2R2JA 4ML6A 4L8EA 4K6XA 1TU8A 1EWXA 2LJRA 2PMTA 5DAKA 2EIOA 4HEA2 3DYRA 1URMA 3EINA 1AQVA 2IFQB 2YZHA 4HZ4A 2WFCA 4GQFA 1PA3A 5J5NA 3ZFBA 3TKPA 2ON5A 2H1LA 5EY6A 2I4AA 4YKGA 3R3EA 1XWAA 3HMJG 1M2BA 22GSA 2XHFA 1XPVA 3KMOA 3GFKA 3HJOA 4RQXA 5J40A 3ME8A 2DKHA 4P3YB 2HSMA 3CWGA 4KSOA 5AIXA 1PL2A 3APSA 1XWBA 4ZB7A 2R4VA 1MDJA 1J9BA 4BWQA 4E8EA 3F9UA 4BVXA 1X0RA 1Z6MA 2CX3A 2YZUA 4POKA 8GSSA 3ZIVA 2GSTA 1JZRA 2VL2A 3FEUA 3KM6A 3QCPA 2HRKB 1FVKA 1AIUA 2JU5A 4YAVA 1K0CA 4ISDA 2FWFA 1S3CA 1SK1A 1VF1A 4TXOA 2FY6A 3KCMA 2PERA 5BMUA 5J9CA 4HJ2A 3ISOA 2YANA 3WGEA 2FWEA 1YF0A 2QGVA 2EFDA 2HI7A 1ERUA 3GNJA 1R5AA 2H0GA 2RUEA 4LA1A 4PQHA 1EOHA 4F2IA 3HCZA 1OC3A 2REMA 3L0HA 1F3AA 1Z9HA 2AHEA 3G7YA 3TKSE 1SD9A 4AKXB 3GKKA 4KX4A 4LMVA 2R3XA 17GSA 2V41A 2HRFA 2HSNA 2YWOA 2CQ9A 4POMA 2V1MA 4H86A 4DVCA 4GCIA 1K0AA 4EUYA 4OO5A 5C00A 4K2DA 1XOAA 1YVLA 1K3LA 1TK5B 5EL8A 3HVXA 1GTAA 4LL1B 2JACA 1H4OA 5FWGA 1PN0A 4K5SA 2X49A 4IJIA 4YQVA 3RPNA 4AGSA 2VM2A 3FK8A 3VURA 2VCQA 2VCZA 4IHUA 2VD1A 5HR1A 3G7JA 2XBIA 4EE0A 4ICYA 3ZMLA 2DJKA 4JR6A 1NHYA 1J08A 2C0EA 2VL3A 5ECMB 4PNGA 5DQYA 2MBTA 1Q4JA 3LYPA 2OBKA 3GUSA 3NIVA 3O76A 4N30A 2OKAA 1ABAA 1O8WA 1G6WA 4IJ3A 6GSYA 1MDIA 3N5OA 9GSSA 4FYUA 3TU3B 1U87A 4EIPA 2CVDA 1BAYA 3F4SA 2HQTA 4GSTA 3KH9A 2B5EA 4OCEA 4Q5FA 3HKRA 2O8VB 1TRWA 1ZYQB 1XW6A 1DUGA 2HZEB 4MJEA 2DJJA 2CV4A 1BQ7A 2IL3A 5IMAA 3FZAA 3LSZA 1SL2B 2AUVA 2E2MA 1FVJA 2H75A 4O5RA 1CQGA 2EC4A 2V2GA 4F9ZA 2JZSA 3HVSA 5D9WA 3TKSA 5F05A 4EIQA 4ZL8A 1X5DA 5CRDA 4N0VA 2DLXA 1YEXA 1I9DA 4CW9A 2YV7A 3O6TA 5LCZA 2FGXA 5G31A 3HXSA 1TTZA 5B6MA 2BJXA 2DBCA 5J9BA 4HJMA 4XCSA 4HZ2A 1SYRA 4WKWA 3SWLA 3IV4A 4EVMA 1K0BA 2VLVA 4J2FA 3ED3A 4AKGA 4K5RA 1OKDA 2TRXA 1G6YA 3O3TA 1X5EA 2OA7A 2N5AA 3DRNA 3IHGA 2GZYA 4PXOA 3GV1A 3C8EA 4KSMA 1YDKA 1SKSB 3EURA 4OMVA 1EP8A 1SL0B 3GURA 1LU4A 3W6GA 3KTLA 3LGCA 3TOTA 6GSSA 3L9SA 3D6IA 3GKXA 4IQAA 5ECHB 3TRPA 2QC7A 4GQCA 3BCIA 3GSSA 2A4VA 3ZRDA 4GF0A 2VCTA 1USBA 5JCWA 1BEDA 2DIZA 3KJYA 3GN3A 1OAZA 2L4QA 2H66A 1PSQA 1TKDB 3CBUA 3CXGA 3GMFA 1K3OA 1GSQA 1G7EA 3EVIA 3H8QA 1U6TA 3UVHA 1BJXA 1QQ2A 1F3BA 3LW9A 2PU9C 2ZCTA 1NHOA 2RIIA 2C4JA 5G5FA 4F0CA 3QAGA 4Q5NA 2FA4A 16GSA 4L0UA 2YJHA 1A2LA 3WD6A 3D5JA 2E2GA 1SKWB 1SJIA 6GSVA 3CTGA 2XPDA 3V1WA 2DJ2A 1UC7A 4MH3A 2L6DA 3IPZA 3QMXA 4EF0A 1M99A 1GWCA 4AKIA 3A5IA 1XVWA 3C7MA 1MEKA 3F0IA 1ILOA 1ACVA 1A8LA 3HJMA 3HVVA 3QD9A 4WF5A 3LXZA 5G1LA 2HT9A 3VLNA 1T4YA 1G7OA 3Q18A 2R37A 3APQA 5KEJA 4O32A 3VPTA 4G0IA 2HZEA 4I97A 1DE2A 5H5SA 1M9BA 3TJKA 4HOJA 3TRXA 5IQYA 2LNTA 4MNNA 1EV9A 3A2VA 2OE1A 1QK8A 2IMDA 3K8NA 3CRUA 1DE1A 3GH6A 2OADA 2HXKA 1FW1A 4K0NA 4L0WA 2FD3A 2J9HA 1GULA 1S3AA 3ZLPA 5H5RA 3WGDA 5J41A 4JRRA 5J3RA 1XFLA 4MA9A 1ST9A 4G01A 1Z7RA 4Z2UA 3F4TA 5BMUB 5J4YA 3BD2A 4MCUA 3L9UA 2GSRA 2X64A 2X8CA 2B5XA 5G1KA 2DJ3A 1SK0A 2I9HA 1UA5A 3PPUA 2O85A 4V1Ap 2V6OA 5ID2B 5J47A 3ZIJA 2K18A 4PQIA 3KMNA 1LJRA 1T4ZA 2B3SA 1ZYNA 2OT3A 3E3EA 2F51A 3Q6OA 2H0IA 4XIHA 1A2MA 3KIJA 2RUFA 2LKUA 4EL1A 1GNEA 3KP9A 4O92A 2H0HA 2H6XA 4TR4A 4G0KA 4AJ7A 2Z9SA 5HQPA 2PVOC 2BTOT 1K0MA 4ECBA 1H75A 4MPGA 4D73B 3KH7A 1U3AA 5EPFA 3GKNA 1V9WA 1THOA 1B4PA 5AGYA 4TN8A 2VAFA 3MAKA 1SJ6A 4K9ZA 5GAND 1QFNA 4I5QA 4RQRA 3DVXA 5AIVA 1PRXA 2CX4A 4NV5A 1JFUA 1OVNA 3UJ1A 4GSNA 1GUMA 4HU7A 1V57A 4JR4A 1PX6A 2WRTA 2MBSA 2WB9A 1XIYA 4QMKA 1EOGA 4I2TA 5DBQA 3D22A 2C0FA 1FB0A 4USSA 3TDGA 1XCCA 1Y1UA 3CMIA 4BPYA 1DSBA 1PX7A 3PR8A 4AI6A 4ZBAA 3CSJA 3P7XA 3SBCA 1B9YC 3R2QA 4OFMA 4CDOA 2F9SA 2A2SA 2CAQA 3KD0A 2JADA 5IO0A 3ZMKA 4AJ8A 3J7Yk 4CY8A 4EKZA 2QSIA 2O7KA 4XS4B 4YH2A 3IHQA 1PMTA 2LJKA 5DQSA 2ES7A 2WULA 3FZ5A 5GZZB 3TJBA 1VF4A 3FRCA 5KOWA 1SVMA 4K7IA 4K1FA 1GTIA 2LQQA 4GRFA 4KF9A 1XWGA 3F4RA 5CREA 5HFGA 1T00A 5IPHA 2GGTA 4ECCA 2DIYA 1XOBA 2DKIA 4I8BA 4POBA 5DALB 5F06A 3APOA 1X9SB 3TKRA 1R5PA 1AC1A 3H79A 3E0UA 2R0CA 1FOVA 2C80A 20GSA 5E4WA 3WT2A 5ECPB 2DMLA 2L5OA 2QA2A 1A23A 4FH8A 2H01A 4HQZA 3TOUA 4I6XA 5ID2A 2VO4A 3ERGA 1HQOA 1Y6EA 2DJ0A 1BG1A 4PTSA 3I9V2 3F3RA 2H71A 3HD5A 14GSA 2H6ZA 1SD8A 1ON4A 4V1Ag 1YF1A 3RDWA 3VFIA 5KOXA 2KP1A 2O89A 1XZOA 4RI7A 5HFKA 5CRHA 3HA9A 3UVTA 3GIXA 3G9BA 2H1DA 5IMZA 3IK7A 1FO5A 3WT1A 3VK9A 1XBSA 1V58A 4DSQA 1TRUA 2FCHA 1ZOFA 2JSYA 2VL9A 1S3DA 2LRTA 4KB3A 3WGXA 3UAPA 3EE2A 4KH7A 1X5CA 3IDVA 4CHSA 2WZ9A 1N2AA 1O85A 4D73A 1T7PB 4MZWA 2G0FA 2WDUA 3M9KA 4K8MA 4WXTA 1PGTA 3GTUB 2FUG2 2H74A 2GQMA 5CP1A 1AQXA 5DVBA 2F8FA 2I1UA 2M46A 2VM1A 2B1KA 4ACSA 4JE1A 1ZCPA 2H1BA 4KNDA 3IXRA 1SJZA 3M0FA 2WS2A 1B8XA 1TK0B 1KTEA 4O7HA 5GAPD 2B1LA 5CRWA 1JZWA 3FHKA 1ZZYA 4J56E 1GLQA 3GHAA 2MYGA 3LORA 3DWVA 4K2XA 2YWMA 1OC8A 5INYA 4DSSB 4G10A 3D21A 2O5VA 1TRVA 1SKRB 3A5WA 2X99A 4A5PA 3F63A 2P31A 5GSSA 3C71A 5D9VA 3HHVA 3PGTA 3J7Yb 4V2NA 4DEJA 2A4HA 5H5QA 3FR9A 1F6MC 4G19A 4XS4A 1AW9A 4KDYA 3RHCA 3QPMA 2X8GA 1E6BA 3M8NA 1QMVA 4N11A 4OD7A 4N10A 1R4WA 4MABA 1JZOA 4GXZA 2KOKA 1A2JA 4HQSA 3NZNA 1HNAA 2JZTA 2HSHA 2AYTA 2C0DA 2GVPA 4XTSA 3FR6A 2WJUA 3F6FA 3WYWA 3ZFLA 2R6KA 2YP6A 1J0FA 2V32A 1WE0A 6GSTA 3BOAA 2D2ZA 1OC9B 1NSWA 5DALA 2J23A 2P5RA 4WR5A 2GZPA 3VPQA 3D4TA 1BYEA 3TJGA 5HR3A 2CA8A 4Z7XA 11GSA 2XPEA 2H73A 1GP1A 3TJJA 2EIQA 1GSYA 2IMIA 1T8EB 4BL7B 4EC0A 2TRCP 1OE7A 4GWRA 5C04A 2XC2A 4GDFA 4ZBBA 5CAXA 4MPFA 3EMPA 4FO5A 2R0PA 5ECOB 4MJBA 3ZZXA 3Q19A 3KTBA 1QXHA 1TW9A 3EYTA 3IC8A 2H6YA 4ZIJA 3ZITA 1TU7A 2UZ8A 4IQ1A 4ZL9A 4FQUA 1F37A 3LQ7A 4W66A 4ZL7A 2CVBA 3IRAA 4G9HA 1X9WB 4Z2TA 4ID0A 3BCKA 1QGVA 2WCIA 5E59A 1Q98A 1A24A 2X4AA 1ZMAA 3DMLA 4WF4A 2CZ2A 5G30A 4NHZA 5ECQB 2HLSA 4EDYA 3UIWA 2P5QA 1RW1A 2HZFA 3G7IA 3GTUA 3UBKA 5CO3A 5DDLA 1Y25A 4IS0A 3FR3A 5CNWA 4BA7A 1AQWA 4OWYA 4ECIA 1UVZA 3ZYWA 3QAVA 2YOIA 5KN3A 2KUCA 2AV4A 3GRXA 4WBJA 2H1GA 2FWHA 2OE0A 2HFDA 5HR2A 1PKWA 5IOXA 5GSTA 3IBHA 3JCML 5HFIA 1O81A 1XXUA 4NHWA 4Z2RA 4IKHA 2C3NA 4O5QA 5CYYA 1B48A 3FMWA 1Z5YE 5JWQB 4ZB9A 2GDRA 3DGQA 3HDCA 3UBLA 4DSSA 2NDOA 3VWVA 2JL4A 2VUPA 5J4UA 4ZB6A 4QL7A 1RQMA 4MZBA 1YJ6A 1WPIA 4F0BA 2CVKA 2YV9A 1PN9A 3KEBA 2JSZA 4N3ZA 2IMKA 3TUEA 4LLRA 3FYGA 2PWJA 2R5GA 4X4JA 4EDZA 4K0GA 2B7JA 4IVFA 4QQ7A 4I2UA 1WRYA 4IP6A 2F3MA 1JLVA 3CRTA 4TKYA 4PNFA 2LSTA 4POLA 4BVYB 2H70A 2GT6A 5A4UA 2PUKC 2V6KA 4CY6A 5ECIB 2YWIA 2KHPA 1OC9A 5ELGA 4AKHA 4PGTA 4Q5QA 2G2QA 3GA4A 1SYXA 1PL1A 3HZ8A 3P2AA 1BX9A 2EIRA 1GTBA 6GSXA 12GSA 2ON7A 4PX1A 4BL7A 1OE8A 2LJAA 5JWRB 1Z3EA 1G0TA 19GSA 3H93A 2IPAA 3UEMA 3GYKA 3VWWA 1YZXA 2VLUA 3DVWA 1M2DA 4TVEA 2GQLA 3CSHA 4E68A 1GSEA 1XW9A 1Z6NA 3S9FA 4MF6A 3RPPA 3W8JA 4MF7A 4J57E 3F6DA 2WGRA 5KN2A 4HDEA 2ALBA 1YKCA 3ERFA 1K0OA 1A8YA 2H76A 3C1SA 4K7NA 2PPTA 3QFAC 5IOWA 3US3A 3BBYA 1O6JA 1YQ1A 4JEDA 2RM5A 1TXXA 4IBPA 1MTCA 4FYCA 2N5FA 4RUVA 1EZKA 5BRTA 3VI5A 3MNGA 4GLTA 1R26A 2VLTA 4BWSA 3VWUA 3VWXA 4EXJA 5ECKB 5A34B 2HSYA 5FHIA 4YQUA 4ML1A 3AY8A 1THXA 1PQNA 1EGRA 5D93A 6GSUA 3KZQA 4F03A 1WIKA 2LS5A 4FIWA 1OYJA 2IN3A 5ELAA 4KDUA 5ECSA 4ULXA 1K0DA 4TRXA 3ZREA 1TXUA 5EVOA 2C1YA 2BMXA 1KNGA 3FKFA 4XS1A 1HD2A 3LJRA 3EWLA 4KUNA 4NV2A 3EU3A 4TR1A 2CT6A 3UL3A 1FOHA 4YAPA 1CQHA 1WMJA 2LRNA 5JCUA 1EEJA 1VGLA 2GLRA 1T3BA 4HU9A 2GS3A 3ERWA 4TR0A 3LWAA 2N5BA 3RAZA 5HR0A 2IMFA 2EFCA 1MD3A 2HRNA 4PURA 2GSSA 1B9XC 5LD0A 4PUFC 2FWGA 1FB6A 2B7KA 5G2ZA 3TCOA 3DD3A 5FT3A 4MDCA 1O73A 4BVYA 3I43A 2LQOA 2R0GA 5JCGA 4LL4B 3D4MA 1UN2A 2K8SA 2MZCA 3NOFA 2L4CA 4IW9A 2L5LA 2LTKA 1X9MB 3N9JA 5IO2A 4MMMA 4PQ1A 1PKZA 1TK8B 5D8IA 1GLPA 4HS1A 2CAIA 2DSAA 2LNSA 2JZRA 1MDKA 4XRDA 5ECLB 5L71A 3L4NA 2M72A 3U5RE 4AF2A 3DIEA 2VKZG 3U6VA 2IWTA 3FY7A 2F8AA 2LUSA 1FAAA 2NPBA 2H30A 2OE3A 2IIYA 1GUKA 1YEPA 4V2LA 3FZ4A 1GSDA 2K8VA 1WWJA 2TIRA 2VCVA 5CRGA 1PD21 3TKQA 1TI1A 1BF5A 3HJPA 4WETA 4F82A 1AAZA 1I5GA 1YY7A 3QOUA 4TW5A 1VF3A 1SL1B 2YWNA 1XWCA 1XW5A 2VL2C 2K6VA 3GKMA 1BG5A 3EC3A 3P8WA 3QFBC 3CTFA 2UV8G 2C8UA 2I3YA 4O5UA 2MMOA 4G2EA 3HYPA 2YJ7A 3PINA 2MMAA 4MH2A 2DC5A 2H8LA 5A34A 2FA8A 2H72A 1ERTA 2VCXA 2HE3A 2PGTA 3KGKA 4HI7A 3MDKA 1EP7A 1OKTA 2VOCA 4KA0A 4JU5A 5IMDA 1HNCA 5F8BA 1U3IA 2EFEA 1GSSA 5LNKe 2GSQA 18GSA 4XRAA 1V2AA 2IFQA 2LV3A 1C72A 1JHBA 5KN0A 4EO3A 1NW2A 4E8HA 3HZ4A 1QUWA 2VIMA 2NBSA 3I6AA 4FYBA 4MZCA 2PBJA 1GRXA 6GSWA 4WR4A 4MLYA 3KP8A 4JZQA 5KN1A 3IR4A 1K3YA 1ZGNA 2FLSA 3ME7A 3ZTLA 1GL8A 1T1VA 3ZVJD 1GUHA 4TXVA 4L5OA 1F9MA 1HNBA 4X0XA 4KCEA 1YKAA 4V2MA 2E0QA 4IN0A 5IM9A 2GZZA 3C73A 5ENUA 3RHBA 2GQKA 4NPBA 3IAM2 2AJQB 3EPTA 4LMWA 1F2EA 1MD4A 2HRKA 2LEGA 1ML6A 2DMMA 5DJMA 2YNXA 4NAXA 1VRSD 4N0ZA 1TDIA 4G0LA 4ZXGA 1SU9A 4OO4A 5IMFA 1WP0A 2VCWA 4ILFA 4X43A 5D9TA 3LYKA 4YKFA 4WEYA 3ZVJA 4ZB8A 5JWOB 5B7CA 1O8XA 2E7PA 2O87A 1JLWA 5A5HB 1EEMA 3D0ZA 1TJDA 2RM6A 1ERWA 3E9JB 2EFHA 1ZYPA 4KW6A 1FHEA 10GSA 4OCFA 2CZ3A 4IP1A 5F07A 1JZDA 2AB6A 2NVLA 3LEFA 2M80A 1SENA 1AUCA 2AAWA 1SK2A 1R7HA 3GX8A 3GSTA 1EV4A 1VF2A 2OBIA 1LBKA 2YN1A 1V40A 1ERVA 2OJLA 3EU4A 3LXTA 4KDXA 3TKSC 3GH9A 2A2RA 1W89A 4OFNA 5A5KA 2XBQA 4KAEA 5B8BA 1GH2A 4RI6A 1U88A 3I69A 2PN8A 4HUAA 4YQMA 4XS6A 4IGJA 3IC4A 3W8SA 2IMEA 2FHEA 2A2PA 2K9FA 3GL3A 3TGZA 1IYIA 5A1NB 3QDNA 5F0GA 2GTUA 3IAS2 2B6MA 3A2XA 3MSZA 5DJLA 1HYUA 1K0NA 4MK3A 5IIZA 5A4VA 2H1AA 5B8AA 1N8JA 5B6NA 5DAKB 3PH9A 4JBBA 1W4VA 1IYHA 1EGOA 3QAWA 5D73A 3IOSA 2DJ1A 4XHMA 3EMXA 2KP2A 4TR1B 2B5YA 3UMAA 1M7TA 3HY2A 1DBYA 3FZ9A 2RLIA 5DCHA 4MJCA 2L6CA 3DKSA 1SVLA 2HSMB 3M1GA 2MMZA 1WJKA 2L59A 2ZNMA 4NMUA 1GTUA 5J4VA 2QA1A 3KXOA 3RBTA 1A0RP 4BVXB 2C3TA 5ECNB 1KEBA 3TRQA 1GSUA 2L57A 1ZL9A 5G5EA 4KE3A 3LG6A 4X1UA 4PUAA 3DEXA 1N25A 4GSSA 2YCDA 3H1NA 4NXIA 1SVOA 1GSFA 5IPGA 1AXDA 7GSSA 4KCAA 2VD0A 5AISA 1O7UA 4TXOB 2KLXA 5DCGA 1FG4A 3H4KA 2LRCA 3GL5A 5D96A 5A4WA 3P90A 1WOUA 4K7OA 2MMNA 5IMVA 5D9XA 3QR6A 1TI3A 3Q74A 2OACA 3L9VA 4DSRA 13GSA 1M0UA 3MWHA 3UARA 2C0GA 1KBNA 4KGIA 3IE3A 3F3QA 3A3TA 5A5HA 3BJ5A 2PVQA 3CSIA 3A2WA 2H19A 2C3QA 3OR5A 4MF5A 4QL9A 3C1RA 2HNLA 2QKEA 1RK4A 1TOFA 1M2AA 4NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBR D;  1ZYE A;  2X8H A;  5COH A;  1NM3 A;  3L78 A;  2YPM A;  1M9A A;  3LFL A;  1E2Y A;  2I81 A;  2HSN B;  3IK9 A;  3FW2 A;  4OFT A;  4ZIL A;  1B4Q A;  4GTU A;  3ZL5 A;  3IA1 A;  1XWK A;  2HRA A;  1Z7P A;  1TP9 A;  3CYN A;  5ABR A;  3M9J A;  3F8U A;  4ZBD A;  4AJ6 A;  5AN1 A;  3TB2 A;  1XVQ A;  1GNW A;  4MP4 A;  2FNO A;  3M3M A;  3VI7 A;  2P0G A;  1V98 A;  4TOP A;  2ZUP A;  2GT5 A;  3TJF A;  1TRS A;  2IJY A;  1A0F A;  4L5L A;  2NTO A;  5IMC A;  4Q5R A;  3UOM A;  4ECJ A;  5ECR B;  4MJA A;  4IEL A;  2HYX A;  3DXB A;  3GX0 A;  4TR3 A;  2R2J A;  4ML6 A;  4L8E A;  4K6X A;  1TU8 A;  1EWX A;  2LJR A;  2PMT A;  5DAK A;  2EIO A;  4HEA 2;  3DYR A;  1URM A;  3EIN A;  1AQV A;  2IFQ B;  2YZH A;  4HZ4 A;  2WFC A;  4GQF A;  1PA3 A;  5J5N A;  3ZFB A;  3TKP A;  2ON5 A;  5EY6 A;  2I4A A;  3R3E A;  1XWA A;  1M2B A;  22GS A;  2XHF A;  1XPV A;  3KMO A;  3GFK A;  3HJO A;  4RQX A;  3ME8 A;  4P3Y B;  2HSM A;  4KSO A;  5AIX A;  1PL2 A;  3APS A;  1XWB A;  2R4V A;  1MDJ A;  1J9B A;  4BWQ A;  4E8E A;  3F9U A;  4BVX A;  1X0R A;  1Z6M A;  2CX3 A;  2YZU A;  4POK A;  8GSS A;  3ZIV A;  2GST A;  1JZR A;  2VL2 A;  3FEU A;  3KM6 A;  3QCP A;  2HRK B;  1FVK A;  1AIU A;  2JU5 A;  4YAV A;  1K0C A;  4ISD A;  2FWF A;  1S3C A;  1SK1 A;  1VF1 A;  4TXO A;  2FY6 A;  3KCM A;  2PER A;  5BMU A;  5J9C A;  4HJ2 A;  3ISO A;  2YAN A;  3WGE A;  2FWE A;  1YF0 A;  2QGV A;  2HI7 A;  1ERU A;  3GNJ A;  1R5A A;  2H0G A;  2RUE A;  4LA1 A;  4PQH A;  1EOH A;  4F2I A;  3HCZ A;  1OC3 A;  2REM A;  3L0H A;  1F3A A;  1Z9H A;  2AHE A;  3G7Y A;  3TKS E;  1SD9 A;  3GKK A;  4KX4 A;  4LMV A;  2R3X A;  17GS A;  2V41 A;  2HRF A;  2YWO A;  2CQ9 A;  4POM A;  2V1M A;  4H86 A;  4DVC A;  4GCI A;  1K0A A;  4EUY A;  4OO5 A;  5C00 A;  4K2D A;  1XOA A;  1K3L A;  1TK5 B;  5EL8 A;  3HVX A;  1GTA A;  4LL1 B;  2JAC A;  1H4O A;  5FWG A;  4IJI A;  4YQV A;  3RPN A;  4AGS A;  2VM2 A;  3FK8 A;  3VUR A;  2VCQ A;  2VCZ A;  4IHU A;  2VD1 A;  5HR1 A;  3G7J A;  2XBI A;  4EE0 A;  3ZML A;  2DJK A;  4JR6 A;  1NHY A;  1J08 A;  2C0E A;  2VL3 A;  5ECM B;  4PNG A;  5DQY A;  2MBT A;  1Q4J A;  3LYP A;  2OBK A;  3GUS A;  3NIV A;  3O76 A;  4N30 A;  2OKA A;  1ABA A;  1O8W A;  1G6W A;  4IJ3 A;  6GSY A;  1MDI A;  3N5O A;  9GSS A;  4FYU A;  1U87 A;  2CVD A;  1BAY A;  3F4S A;  2HQT A;  4GST A;  3KH9 A;  2B5E A;  4OCE A;  4Q5F A;  3HKR A;  2O8V B;  1TRW A;  1ZYQ B;  1XW6 A;  1DUG A;  2HZE B;  4MJE A;  2DJJ A;  2CV4 A;  1BQ7 A;  2IL3 A;  5IMA A;  3FZA A;  3LSZ A;  1SL2 B;  2AUV A;  2E2M A;  1FVJ A;  2H75 A;  4O5R A;  1CQG A;  2EC4 A;  2V2G A;  4F9Z A;  2JZS A;  3HVS A;  5D9W A;  3TKS A;  5F05 A;  4ZL8 A;  1X5D A;  5CRD A;  4N0V A;  2DLX A;  1YEX A;  1I9D A;  4CW9 A;  2YV7 A;  3O6T A;  5LCZ A;  2FGX A;  5G31 A;  3HXS A;  1TTZ A;  5B6M A;  2BJX A;  2DBC A;  5J9B A;  4HJM A;  4XCS A;  4HZ2 A;  1SYR A;  4WKW A;  3SWL A;  3IV4 A;  4EVM A;  1K0B A;  2VLV A;  4J2F A;  3ED3 A;  1OKD A;  2TRX A;  1G6Y A;  3O3T A;  1X5E A;  2OA7 A;  2N5A A;  3DRN A;  2GZY A;  4PXO A;  3GV1 A;  3C8E A;  4KSM A;  1YDK A;  1SKS B;  3EUR A;  4OMV A;  1EP8 A;  1SL0 B;  3GUR A;  1LU4 A;  3W6G A;  3KTL A;  3LGC A;  3TOT A;  6GSS A;  3L9S A;  3D6I A;  3GKX A;  4IQA A;  5ECH B;  3TRP A;  2QC7 A;  4GQC A;  3BCI A;  3GSS A;  2A4V A;  3ZRD A;  4GF0 A;  2VCT A;  1USB A;  5JCW A;  1BED A;  2DIZ A;  3KJY A;  3GN3 A;  1OAZ A;  2L4Q A;  2H66 A;  1PSQ A;  1TKD B;  3CBU A;  3CXG A;  3GMF A;  1K3O A;  1GSQ A;  1G7E A;  3EVI A;  3H8Q A;  1U6T A;  3UVH A;  1BJX A;  1QQ2 A;  1F3B A;  2PU9 C;  2ZCT A;  1NHO A;  2RII A;  2C4J A;  5G5F A;  4F0C A;  3QAG A;  4Q5N A;  2FA4 A;  16GS A;  4L0U A;  2YJH A;  1A2L A;  3WD6 A;  3D5J A;  2E2G A;  1SKW B;  1SJI A;  6GSV A;  3CTG A;  2XPD A;  3V1W A;  2DJ2 A;  1UC7 A;  4MH3 A;  2L6D A;  3IPZ A;  3QMX A;  4EF0 A;  1M99 A;  1GWC A;  1XVW A;  3C7M A;  1MEK A;  3F0I A;  1ILO A;  1ACV A;  1A8L A;  3HJM A;  3HVV A;  3QD9 A;  4WF5 A;  3LXZ A;  5G1L A;  2HT9 A;  3VLN A;  1T4Y A;  1G7O A;  3Q18 A;  2R37 A;  3APQ A;  5KEJ A;  4O32 A;  3VPT A;  4G0I A;  2HZE A;  4I97 A;  1DE2 A;  5H5S A;  1M9B A;  3TJK A;  4HOJ A;  3TRX A;  5IQY A;  2LNT A;  1EV9 A;  3A2V A;  2OE1 A;  1QK8 A;  2IMD A;  3K8N A;  3CRU A;  1DE1 A;  3GH6 A;  2OAD A;  2HXK A;  1FW1 A;  4K0N A;  4L0W A;  2FD3 A;  2J9H A;  1GUL A;  1S3A A;  3ZLP A;  5H5R A;  3WGD A;  5J41 A;  4JRR A;  5J3R A;  1XFL A;  4MA9 A;  1ST9 A;  1Z7R A;  3F4T A;  3BD2 A;  4MCU A;  3L9U A;  2GSR A;  2X64 A;  2X8C A;  2B5X A;  5G1K A;  2DJ3 A;  1SK0 A;  2I9H A;  1UA5 A;  3PPU A;  2O85 A;  4V1A p;  2V6O A;  5ID2 B;  3ZIJ A;  2K18 A;  4PQI A;  3KMN A;  1LJR A;  1T4Z A;  2B3S A;  3E3E A;  2F51 A;  3Q6O A;  2H0I A;  4XIH A;  1A2M A;  3KIJ A;  2RUF A;  2LKU A;  4EL1 A;  1GNE A;  3KP9 A;  4O92 A;  2H0H A;  2H6X A;  4TR4 A;  4G0K A;  4AJ7 A;  2Z9S A;  5HQP A;  2PVO C;  2BTO T;  1K0M A;  4ECB A;  1H75 A;  4MPG A;  4D73 B;  3KH7 A;  1U3A A;  5EPF A;  3GKN A;  1V9W A;  1THO A;  1B4P A;  5AGY A;  4TN8 A;  2VAF A;  3MAK A;  1SJ6 A;  4K9Z A;  5GAN D;  1QFN A;  4I5Q A;  4RQR A;  3DVX A;  5AIV A;  1PRX A;  2CX4 A;  4NV5 A;  1JFU A;  1OVN A;  3UJ1 A;  4GSN A;  1GUM A;  4HU7 A;  1V57 A;  4JR4 A;  1PX6 A;  2WRT A;  2MBS A;  2WB9 A;  1XIY A;  1EOG A;  4I2T A;  5DBQ A;  3D22 A;  2C0F A;  1FB0 A;  4USS A;  3TDG A;  1XCC A;  3CMI A;  4BPY A;  1DSB A;  1PX7 A;  3PR8 A;  4ZBA A;  3CSJ A;  3P7X A;  3SBC A;  1B9Y C;  3R2Q A;  4OFM A;  4CDO A;  2F9S A;  2A2S A;  2CAQ A;  3KD0 A;  2JAD A;  5IO0 A;  3ZMK A;  4AJ8 A;  3J7Y k;  4EKZ A;  2QSI A;  2O7K A;  4XS4 B;  4YH2 A;  3IHQ A;  1PMT A;  2LJK A;  5DQS A;  2ES7 A;  2WUL A;  3FZ5 A;  5GZZ B;  3TJB A;  1VF4 A;  3FRC A;  4K7I A;  4K1F A;  1GTI A;  2LQQ A;  4GRF A;  4KF9 A;  1XWG A;  3F4R A;  5CRE A;  5HFG A;  1T00 A;  5IPH A;  2GGT A;  4ECC A;  2DIY A;  1XOB A;  4I8B A;  4POB A;  5DAL B;  5F06 A;  3APO A;  1X9S B;  3TKR A;  1R5P A;  1AC1 A;  3H79 A;  3E0U A;  1FOV A;  2C80 A;  20GS A;  5E4W A;  3WT2 A;  5ECP B;  2DML A;  2L5O A;  1A23 A;  4FH8 A;  2H01 A;  4HQZ A;  3TOU A;  4I6X A;  5ID2 A;  2VO4 A;  3ERG A;  1HQO A;  1Y6E A;  2DJ0 A;  4PTS A;  3I9V 2;  3F3R A;  2H71 A;  3HD5 A;  14GS A;  2H6Z A;  1SD8 A;  1ON4 A;  4V1A g;  1YF1 A;  3RDW A;  3VFI A;  2KP1 A;  2O89 A;  1XZO A;  4RI7 A;  5HFK A;  5CRH A;  3HA9 A;  3UVT A;  3GIX A;  3G9B A;  2H1D A;  5IMZ A;  3IK7 A;  1FO5 A;  3WT1 A;  3VK9 A;  1XBS A;  1V58 A;  4DSQ A;  1TRU A;  2FCH A;  1ZOF A;  2JSY A;  2VL9 A;  1S3D A;  2LRT A;  4KB3 A;  3WGX A;  3UAP A;  3EE2 A;  4KH7 A;  1X5C A;  3IDV A;  4CHS A;  2WZ9 A;  1N2A A;  1O85 A;  4D73 A;  1T7P B;  4MZW A;  2G0F A;  2WDU A;  3M9K A;  4K8M A;  4WXT A;  1PGT A;  3GTU B;  2FUG 2;  2H74 A;  2GQM A;  5CP1 A;  1AQX A;  5DVB A;  2F8F A;  2I1U A;  2M46 A;  2VM1 A;  2B1K A;  4ACS A;  4JE1 A;  1ZCP A;  2H1B A;  4KND A;  3IXR A;  1SJZ A;  3M0F A;  2WS2 A;  1B8X A;  1TK0 B;  1KTE A;  4O7H A;  5GAP D;  2B1L A;  5CRW A;  1JZW A;  3FHK A;  1ZZY A;  4J56 E;  1GLQ A;  3GHA A;  2MYG A;  3LOR A;  3DWV A;  2YWM A;  1OC8 A;  5INY A;  4DSS B;  4G10 A;  3D21 A;  1TRV A;  1SKR B;  3A5W A;  2X99 A;  3F63 A;  2P31 A;  5GSS A;  3C71 A;  5D9V A;  3HHV A;  3PGT A;  3J7Y b;  4V2N A;  4DEJ A;  5H5Q A;  3FR9 A;  1F6M C;  4G19 A;  4XS4 A;  1AW9 A;  4KDY A;  3RHC A;  3QPM A;  2X8G A;  1E6B A;  3M8N A;  1QMV A;  4N11 A;  4OD7 A;  4N10 A;  1R4W A;  4MAB A;  1JZO A;  4GXZ A;  2KOK A;  1A2J A;  4HQS A;  3NZN A;  1HNA A;  2JZT A;  2HSH A;  2AYT A;  2C0D A;  2GVP A;  4XTS A;  3FR6 A;  2WJU A;  3F6F A;  3WYW A;  3ZFL A;  2R6K A;  2YP6 A;  1J0F A;  2V32 A;  1WE0 A;  6GST A;  3BOA A;  2D2Z A;  1OC9 B;  1NSW A;  5DAL A;  2J23 A;  2P5R A;  4WR5 A;  2GZP A;  3VPQ A;  3D4T A;  1BYE A;  3TJG A;  5HR3 A;  2CA8 A;  4Z7X A;  11GS A;  2XPE A;  2H73 A;  1GP1 A;  3TJJ A;  2EIQ A;  1GSY A;  2IMI A;  1T8E B;  4BL7 B;  4EC0 A;  2TRC P;  1OE7 A;  4GWR A;  5C04 A;  2XC2 A;  4ZBB A;  5CAX A;  4MPF A;  3EMP A;  4FO5 A;  5ECO B;  4MJB A;  3ZZX A;  3Q19 A;  3KTB A;  1QXH A;  1TW9 A;  3EYT A;  3IC8 A;  2H6Y A;  4ZIJ A;  3ZIT A;  1TU7 A;  2UZ8 A;  4IQ1 A;  4ZL9 A;  4FQU A;  1F37 A;  3LQ7 A;  4ZL7 A;  2CVB A;  3IRA A;  4G9H A;  1X9W B;  4ID0 A;  3BCK A;  1QGV A;  2WCI A;  5E59 A;  1Q98 A;  1A24 A;  1ZMA A;  3DML A;  4WF4 A;  2CZ2 A;  5G30 A;  4NHZ A;  5ECQ B;  2HLS A;  4EDY A;  3UIW A;  2P5Q A;  1RW1 A;  2HZF A;  3G7I A;  3GTU A;  3UBK A;  5CO3 A;  5DDL A;  1Y25 A;  4IS0 A;  3FR3 A;  5CNW A;  4BA7 A;  1AQW A;  4OWY A;  4ECI A;  1UVZ A;  3ZYW A;  3QAV A;  2YOI A;  5KN3 A;  2KUC A;  2AV4 A;  3GRX A;  4WBJ A;  2H1G A;  2FWH A;  2OE0 A;  2HFD A;  5HR2 A;  1PKW A;  5IOX A;  5GST A;  3IBH A;  3JCM L;  5HFI A;  1O81 A;  1XXU A;  4NHW A;  4IKH A;  2C3N A;  5CYY A;  1B48 A;  1Z5Y E;  5JWQ B;  4ZB9 A;  2GDR A;  3DGQ A;  3HDC A;  3UBL A;  4DSS A;  2NDO A;  3VWV A;  2JL4 A;  2VUP A;  5J4U A;  4ZB6 A;  4QL7 A;  1RQM A;  4MZB A;  1YJ6 A;  1WPI A;  4F0B A;  2CVK A;  2YV9 A;  1PN9 A;  3KEB A;  2JSZ A;  2IMK A;  3TUE A;  4LLR A;  3FYG A;  2PWJ A;  2R5G A;  4EDZ A;  4K0G A;  2B7J A;  4IVF A;  4QQ7 A;  4I2U A;  1WRY A;  4IP6 A;  2F3M A;  1JLV A;  3CRT A;  4TKY A;  4PNF A;  2LST A;  4POL A;  4BVY B;  2H70 A;  2GT6 A;  5A4U A;  2PUK C;  2V6K A;  5ECI B;  2YWI A;  2KHP A;  1OC9 A;  5ELG A;  4PGT A;  4Q5Q A;  2G2Q A;  3GA4 A;  1SYX A;  1PL1 A;  3HZ8 A;  3P2A A;  1BX9 A;  2EIR A;  1GTB A;  6GSX A;  12GS A;  2ON7 A;  4PX1 A;  4BL7 A;  1OE8 A;  2LJA A;  5JWR B;  1Z3E A;  1G0T A;  19GS A;  3H93 A;  2IPA A;  3UEM A;  3GYK A;  3VWW A;  1YZX A;  2VLU A;  3DVW A;  1M2D A;  4TVE A;  2GQL A;  3CSH A;  1GSE A;  1XW9 A;  1Z6N A;  3S9F A;  4MF6 A;  3RPP A;  3W8J A;  4MF7 A;  4J57 E;  3F6D A;  2WGR A;  5KN2 A;  4HDE A;  2ALB A;  1YKC A;  3ERF A;  1K0O A;  1A8Y A;  2H76 A;  3C1S A;  4K7N A;  2PPT A;  3QFA C;  5IOW A;  3US3 A;  3BBY A;  1O6J A;  1YQ1 A;  4JED A;  2RM5 A;  1TXX A;  4IBP A;  1MTC A;  4FYC A;  2N5F A;  4RUV A;  1EZK A;  3VI5 A;  3MNG A;  4GLT A;  1R26 A;  2VLT A;  4BWS A;  3VWU A;  3VWX A;  4EXJ A;  5ECK B;  2HSY A;  5FHI A;  4YQU A;  4ML1 A;  3AY8 A;  1THX A;  1PQN A;  1EGR A;  5D93 A;  6GSU A;  3KZQ A;  4F03 A;  1WIK A;  2LS5 A;  4FIW A;  1OYJ A;  2IN3 A;  5ELA A;  4KDU A;  5ECS A;  4ULX A;  1K0D A;  4TRX A;  3ZRE A;  5EVO A;  2C1Y A;  2BMX A;  1KNG A;  3FKF A;  4XS1 A;  1HD2 A;  3LJR A;  3EWL A;  4KUN A;  4NV2 A;  3EU3 A;  4TR1 A;  2CT6 A;  3UL3 A;  4YAP A;  1CQH A;  1WMJ A;  2LRN A;  5JCU A;  1EEJ A;  1VGL A;  2GLR A;  1T3B A;  4HU9 A;  2GS3 A;  3ERW A;  4TR0 A;  3LWA A;  2N5B A;  3RAZ A;  5HR0 A;  2IMF A;  1MD3 A;  2HRN A;  4PUR A;  2GSS A;  1B9X C;  5LD0 A;  4PUF C;  2FWG A;  1FB6 A;  2B7K A;  5G2Z A;  3TCO A;  3DD3 A;  5FT3 A;  4MDC A;  1O73 A;  4BVY A;  3I43 A;  2LQO A;  5JCG A;  4LL4 B;  3D4M A;  1UN2 A;  2K8S A;  2MZC A;  3NOF A;  2L4C A;  4IW9 A;  2L5L A;  2LTK A;  1X9M B;  3N9J A;  5IO2 A;  4MMM A;  4PQ1 A;  1PKZ A;  1TK8 B;  5D8I A;  1GLP A;  4HS1 A;  2CAI A;  2DSA A;  2LNS A;  2JZR A;  1MDK A;  4XRD A;  5ECL B;  5L71 A;  3L4N A;  2M72 A;  3U5R E;  4AF2 A;  3DIE A;  3U6V A;  2IWT A;  3FY7 A;  2F8A A;  2LUS A;  1FAA A;  2NPB A;  2H30 A;  2OE3 A;  2IIY A;  1GUK A;  1YEP A;  4V2L A;  3FZ4 A;  1GSD A;  2K8V A;  1WWJ A;  2TIR A;  2VCV A;  5CRG A;  1PD2 1;  3TKQ A;  1TI1 A;  3HJP A;  4WET A;  4F82 A;  1AAZ A;  1I5G A;  1YY7 A;  3QOU A;  4TW5 A;  1VF3 A;  1SL1 B;  2YWN A;  1XWC A;  1XW5 A;  2VL2 C;  2K6V A;  3GKM A;  1BG5 A;  3EC3 A;  3P8W A;  3QFB C;  3CTF A;  2C8U A;  2I3Y A;  2MMO A;  4G2E A;  3HYP A;  2YJ7 A;  3PIN A;  2MMA A;  4MH2 A;  2DC5 A;  2H8L A;  2FA8 A;  2H72 A;  1ERT A;  2VCX A;  2HE3 A;  2PGT A;  3KGK A;  4HI7 A;  3MDK A;  1EP7 A;  1OKT A;  2VOC A;  4KA0 A;  4JU5 A;  5IMD A;  1HNC A;  5F8B A;  1U3I A;  1GSS A;  5LNK e;  2GSQ A;  18GS A;  4XRA A;  1V2A A;  2IFQ A;  2LV3 A;  1C72 A;  1JHB A;  5KN0 A;  4EO3 A;  1NW2 A;  4E8H A;  3HZ4 A;  1QUW A;  2VIM A;  2NBS A;  3I6A A;  4FYB A;  4MZC A;  2PBJ A;  1GRX A;  6GSW A;  4WR4 A;  4MLY A;  3KP8 A;  4JZQ A;  5KN1 A;  3IR4 A;  1K3Y A;  1ZGN A;  2FLS A;  3ME7 A;  3ZTL A;  1GL8 A;  1T1V A;  3ZVJ D;  1GUH A;  4TXV A;  4L5O A;  1F9M A;  1HNB A;  4X0X A;  4KCE A;  1YKA A;  4V2M A;  2E0Q A;  4IN0 A;  5IM9 A;  2GZZ A;  3C73 A;  5ENU A;  3RHB A;  2GQK A;  4NPB A;  3IAM 2;  2AJQ B;  4LMW A;  1F2E A;  1MD4 A;  2HRK A;  2LEG A;  1ML6 A;  2DMM A;  5DJM A;  2YNX A;  4NAX A;  1VRS D;  4N0Z A;  1TDI A;  4G0L A;  4ZXG A;  1SU9 A;  4OO4 A;  5IMF A;  1WP0 A;  2VCW A;  4ILF A;  4X43 A;  5D9T A;  3LYK A;  4WEY A;  3ZVJ A;  4ZB8 A;  5JWO B;  5B7C A;  1O8X A;  2E7P A;  2O87 A;  1JLW A;  1EEM A;  3D0Z A;  1TJD A;  2RM6 A;  1ERW A;  3E9J B;  4KW6 A;  1FHE A;  10GS A;  4OCF A;  2CZ3 A;  4IP1 A;  5F07 A;  1JZD A;  2AB6 A;  2NVL A;  3LEF A;  2M80 A;  1SEN A;  1AUC A;  2AAW A;  1SK2 A;  1R7H A;  3GX8 A;  3GST A;  1EV4 A;  1VF2 A;  2OBI A;  1LBK A;  2YN1 A;  1V40 A;  1ERV A;  2OJL A;  3EU4 A;  3LXT A;  4KDX A;  3TKS C;  3GH9 A;  2A2R A;  1W89 A;  4OFN A;  5A5K A;  2XBQ A;  4KAE A;  5B8B A;  1GH2 A;  4RI6 A;  1U88 A;  3I69 A;  2PN8 A;  4HUA A;  4YQM A;  4XS6 A;  4IGJ A;  3IC4 A;  3W8S A;  2IME A;  2FHE A;  2K9F A;  3GL3 A;  3TGZ A;  1IYI A;  3QDN A;  5F0G A;  2GTU A;  3IAS 2;  2B6M A;  3A2X A;  3MSZ A;  5DJL A;  1HYU A;  1K0N A;  4MK3 A;  5IIZ A;  5A4V A;  2H1A A;  5B8A A;  1N8J A;  5B6N A;  5DAK B;  3PH9 A;  4JBB A;  1W4V A;  1IYH A;  1EGO A;  3QAW A;  5D73 A;  3IOS A;  2DJ1 A;  4XHM A;  3EMX A;  2KP2 A;  4TR1 B;  2B5Y A;  3UMA A;  1M7T A;  3HY2 A;  1DBY A;  3FZ9 A;  2RLI A;  5DCH A;  4MJC A;  2L6C A;  3DKS A;  2HSM B;  3M1G A;  2MMZ A;  1WJK A;  2L59 A;  2ZNM A;  4NMU A;  1GTU A;  3KXO A;  3RBT A;  1A0R P;  4BVX B;  2C3T A;  5ECN B;  1KEB A;  3TRQ A;  1GSU A;  2L57 A;  1ZL9 A;  5G5E A;  4KE3 A;  3LG6 A;  4X1U A;  4PUA A;  3DEX A;  4GSS A;  2YCD A;  3H1N A;  4NXI A;  1GSF A;  5IPG A;  1AXD A;  7GSS A;  4KCA A;  2VD0 A;  5AIS A;  1O7U A;  4TXO B;  2KLX A;  5DCG A;  1FG4 A;  3H4K A;  2LRC A;  3GL5 A;  5D96 A;  5A4W A;  3P90 A;  1WOU A;  4K7O A;  2MMN A;  5IMV A;  5D9X A;  3QR6 A;  1TI3 A;  3Q74 A;  2OAC A;  3L9V A;  4DSR A;  13GS A;  1M0U A;  3MWH A;  3UAR A;  2C0G A;  1KBN A;  4KGI A;  3IE3 A;  3F3Q A;  3A3T A;  3BJ5 A;  2PVQ A;  3CSI A;  3A2W A;  2H19 A;  2C3Q A;  3OR5 A;  4MF5 A;  4QL9 A;  3C1R A;  2HNL A;  2QKE A;  1RK4 A;  1TOF A;  1M2A A;  4NWY A; 
#chains in the Genus database with same CATH topology
 4WBR D;  1ZYE A;  2X8H A;  5COH A;  1NM3 A;  3L78 A;  2YPM A;  1M9A A;  3MIX A;  3LFL A;  1E2Y A;  2I81 A;  2HSN B;  3IK9 A;  3FW2 A;  4OFT A;  4ZIL A;  1B4Q A;  4GTU A;  3ZL5 A;  3IA1 A;  1XWK A;  2HRA A;  1Z7P A;  1TP9 A;  3CYN A;  5ABR A;  3M9J A;  3F8U A;  4ZBD A;  4AJ6 A;  3MYD A;  5AN1 A;  3TB2 A;  1XVQ A;  1GNW A;  4MP4 A;  2FNO A;  3M3M A;  3VI7 A;  2P0G A;  1V98 A;  4TOP A;  2ZUP A;  3CHX C;  2GT5 A;  3TJF A;  1TRS A;  2IJY A;  1A0F A;  4L5L A;  2NTO A;  5IMC A;  4Q5R A;  5A1N A;  3UOM A;  4ECJ A;  5ECR B;  4MJA A;  4IEL A;  2HYX A;  3DXB A;  3GX0 A;  4TR3 A;  2R2J A;  4ML6 A;  4L8E A;  4K6X A;  1TU8 A;  1EWX A;  2LJR A;  2PMT A;  5DAK A;  2EIO A;  4HEA 2;  3DYR A;  1URM A;  3EIN A;  1AQV A;  2IFQ B;  2YZH A;  4HZ4 A;  2WFC A;  4GQF A;  1PA3 A;  5J5N A;  3ZFB A;  3TKP A;  2ON5 A;  2H1L A;  5EY6 A;  2I4A A;  4YKG A;  3R3E A;  1XWA A;  3HMJ G;  1M2B A;  22GS A;  2XHF A;  1XPV A;  3KMO A;  3GFK A;  3HJO A;  4RQX A;  5J40 A;  3ME8 A;  2DKH A;  4P3Y B;  2WVX B;  2HSM A;  3CWG A;  4KSO A;  5AIX A;  1PL2 A;  3APS A;  1XWB A;  4ZB7 A;  2R4V A;  1MDJ A;  1J9B A;  4BWQ A;  4E8E A;  3F9U A;  4BVX A;  1X0R A;  1Z6M A;  2CX3 A;  2YZU A;  4POK A;  8GSS A;  3ZIV A;  2GST A;  1JZR A;  2VL2 A;  3FEU A;  3KM6 A;  3QCP A;  2HRK B;  1FVK A;  1AIU A;  2JU5 A;  4YAV A;  1K0C A;  4ISD A;  2FWF A;  1S3C A;  1SK1 A;  1VF1 A;  4TXO A;  2FY6 A;  3KCM A;  2PER A;  5BMU A;  5J9C A;  4HJ2 A;  3ISO A;  2YAN A;  3WGE A;  2FWE A;  1YF0 A;  2QGV A;  2EFD A;  2HI7 A;  1ERU A;  3GNJ A;  1R5A A;  2H0G A;  2RUE A;  4LA1 A;  4PI0 C;  4PQH A;  1EOH A;  4F2I A;  3HCZ A;  2O36 A;  1OC3 A;  2REM A;  3L0H A;  1F3A A;  1Z9H A;  2AHE A;  3G7Y A;  3TKS E;  1SD9 A;  4AKX B;  3GKK A;  4KX4 A;  4LMV A;  2R3X A;  17GS A;  2V41 A;  2HRF A;  2HSN A;  2YWO A;  2CQ9 A;  4POM A;  2V1M A;  4H86 A;  4DVC A;  4GCI A;  1K0A A;  4EUY A;  4OO5 A;  5C00 A;  4K2D A;  1XOA A;  1YVL A;  1K3L A;  1TK5 B;  5EL8 A;  3HVX A;  1GTA A;  4LL1 B;  2JAC A;  1H4O A;  5FWG A;  1PN0 A;  4K5S A;  2X49 A;  4IJI A;  4YQV A;  3RPN A;  4AGS A;  2VM2 A;  3FK8 A;  3VUR A;  2VCQ A;  2VCZ A;  4IHU A;  2VD1 A;  5HR1 A;  3G7J A;  2XBI A;  4EE0 A;  4ICY A;  3ZML A;  2DJK A;  4JR6 A;  1NHY A;  1J08 A;  2C0E A;  2VL3 A;  5ECM B;  4PNG A;  5DQY A;  2MBT A;  1Q4J A;  3LYP A;  2OBK A;  3GUS A;  3NIV A;  3O76 A;  4N30 A;  2OKA A;  1ABA A;  1O8W A;  1G6W A;  4IJ3 A;  6GSY A;  1MDI A;  3N5O A;  9GSS A;  4FYU A;  3TU3 B;  1U87 A;  4EIP A;  2CVD A;  1BAY A;  3F4S A;  2HQT A;  4GST A;  3KH9 A;  2B5E A;  4OCE A;  4Q5F A;  3HKR A;  2O8V B;  1TRW A;  1ZYQ B;  1XW6 A;  1DUG A;  2HZE B;  4MJE A;  2DJJ A;  2CV4 A;  1BQ7 A;  2IL3 A;  5IMA A;  3FZA A;  3LSZ A;  1SL2 B;  2WVX A;  2AUV A;  2E2M A;  1FVJ A;  2H75 A;  4O5R A;  1CQG A;  2EC4 A;  2V2G A;  4F9Z A;  2JZS A;  3HVS A;  5D9W A;  3TKS A;  5F05 A;  4EIQ A;  4ZL8 A;  1X5D A;  5CRD A;  4N0V A;  2DLX A;  1YEX A;  1I9D A;  4CW9 A;  2YV7 A;  3O6T A;  5LCZ A;  2FGX A;  5G31 A;  3HXS A;  1TTZ A;  5B6M A;  2BJX A;  2DBC A;  5J9B A;  4HJM A;  4XCS A;  4HZ2 A;  1SYR A;  4WKW A;  3SWL A;  3IV4 A;  4EVM A;  1K0B A;  2VLV A;  4J2F A;  3ED3 A;  4AKG A;  4K5R A;  1OKD A;  2TRX A;  1G6Y A;  3O3T A;  1X5E A;  2OA7 A;  2N5A A;  3DRN A;  3IHG A;  2GZY A;  4PXO A;  3GV1 A;  3C8E A;  4KSM A;  1YDK A;  1SKS B;  3EUR A;  4OMV A;  1EP8 A;  1SL0 B;  3GUR A;  1LU4 A;  3W6G A;  3KTL A;  3LGC A;  3TOT A;  6GSS A;  3L9S A;  3D6I A;  3GKX A;  4IQA A;  5ECH B;  3TRP A;  2QC7 A;  4GQC A;  3BCI A;  1S4B P;  3GSS A;  2A4V A;  3ZRD A;  4GF0 A;  2VCT A;  1USB A;  5JCW A;  1BED A;  2DIZ A;  3KJY A;  3GN3 A;  1OAZ A;  2L4Q A;  2H66 A;  1PSQ A;  1TKD B;  3CBU A;  3CXG A;  3GMF A;  1K3O A;  1GSQ A;  1G7E A;  3EVI A;  3H8Q A;  1U6T A;  3UVH A;  1BJX A;  1QQ2 A;  1F3B A;  3LW9 A;  2PU9 C;  2ZCT A;  1NHO A;  2RII A;  2C4J A;  5G5F A;  4F0C A;  3QAG A;  4Q5N A;  2FA4 A;  16GS A;  4L0U A;  2YJH A;  1A2L A;  3WD6 A;  3D5J A;  2E2G A;  1SKW B;  1SJI A;  6GSV A;  3CTG A;  2XPD A;  3V1W A;  2DJ2 A;  1UC7 A;  4MH3 A;  2L6D A;  3IPZ A;  3QMX A;  4EF0 A;  1M99 A;  1GWC A;  4AKI A;  3A5I A;  1XVW A;  3C7M A;  1MEK A;  3F0I A;  1ILO A;  1ACV A;  1A8L A;  3HJM A;  3HVV A;  3QD9 A;  4WF5 A;  3LXZ A;  5G1L A;  2HT9 A;  3VLN A;  1PFO A;  1T4Y A;  1G7O A;  3Q18 A;  2R37 A;  3APQ A;  5KEJ A;  4O32 A;  3VPT A;  4G0I A;  2HZE A;  4FXY P;  4I97 A;  1DE2 A;  5H5S A;  1M9B A;  3TJK A;  4HOJ A;  3TRX A;  5IQY A;  2LNT A;  4MNN A;  1EV9 A;  3A2V A;  2OE1 A;  1QK8 A;  2IMD A;  3K8N A;  3CRU A;  1DE1 A;  3GH6 A;  2OAD A;  2HXK A;  1FW1 A;  4K0N A;  4L0W A;  2FD3 A;  2J9H A;  1GUL A;  1S3A A;  3ZLP A;  5H5R A;  3WGD A;  5J41 A;  4JRR A;  5J3R A;  1XFL A;  4MA9 A;  1ST9 A;  4G01 A;  1Z7R A;  4Z2U A;  3F4T A;  5BMU B;  5J4Y A;  3BD2 A;  4MCU A;  3L9U A;  2GSR A;  2X64 A;  2X8C A;  2B5X A;  5G1K A;  2DJ3 A;  1SK0 A;  2I9H A;  1UA5 A;  3PPU A;  2O85 A;  4V1A p;  2V6O A;  5ID2 B;  5J47 A;  3ZIJ A;  2K18 A;  4PQI A;  3KMN A;  1LJR A;  1T4Z A;  2B3S A;  1ZYN A;  2OT3 A;  3E3E A;  2F51 A;  3Q6O A;  2H0I A;  4XIH A;  1A2M A;  3KIJ A;  2RUF A;  2LKU A;  4EL1 A;  1GNE A;  3KP9 A;  4O92 A;  2H0H A;  2H6X A;  4TR4 A;  4G0K A;  4AJ7 A;  2Z9S A;  5HQP A;  2PVO C;  2BTO T;  1K0M A;  4ECB A;  1H75 A;  4MPG A;  4D73 B;  3KH7 A;  1U3A A;  5EPF A;  3GKN A;  1V9W A;  1THO A;  1B4P A;  5AGY A;  4TN8 A;  2VAF A;  3MAK A;  2WZS A;  1SJ6 A;  4K9Z A;  5GAN D;  1QFN A;  4I5Q A;  4RQR A;  3DVX A;  5AIV A;  1PRX A;  2CX4 A;  4NV5 A;  1JFU A;  1OVN A;  3UJ1 A;  4GSN A;  1GUM A;  4HU7 A;  1V57 A;  4JR4 A;  1PX6 A;  2WRT A;  2MBS A;  2WB9 A;  1XIY A;  4QMK A;  1EOG A;  4I2T A;  5DBQ A;  3D22 A;  2C0F A;  1FB0 A;  4USS A;  3TDG A;  4PI2 C;  1XCC A;  1Y1U A;  3CMI A;  1YEW C;  4BPY A;  1DSB A;  1PX7 A;  3PR8 A;  4AI6 A;  4ZBA A;  3CSJ A;  3P7X A;  3SBC A;  1B9Y C;  1M3I A;  3R2Q A;  4OFM A;  4CDO A;  2F9S A;  2A2S A;  2CAQ A;  3KD0 A;  2JAD A;  5IO0 A;  3ZMK A;  4AJ8 A;  3J7Y k;  4CY8 A;  4EKZ A;  2QSI A;  2O7K A;  4XS4 B;  4YH2 A;  3IHQ A;  1PMT A;  2LJK A;  5DQS A;  2ES7 A;  2WUL A;  3FZ5 A;  5GZZ B;  3TJB A;  1VF4 A;  3FRC A;  5KOW A;  1SVM A;  4K7I A;  4K1F A;  1GTI A;  2LQQ A;  4GRF A;  4KF9 A;  1XWG A;  3F4R A;  5CRE A;  5HFG A;  1T00 A;  1I1I P;  2GGT A;  4ECC A;  5IPH A;  2DIY A;  1XOB A;  2DKI A;  4I8B A;  4POB A;  5DAL B;  5F06 A;  3APO A;  1X9S B;  3TKR A;  1R5P A;  1AC1 A;  3H79 A;  3E0U A;  2R0C A;  1FOV A;  2C80 A;  20GS A;  5E4W A;  3WT2 A;  5ECP B;  2DML A;  2L5O A;  2QA2 A;  1A23 A;  4FH8 A;  2H01 A;  4HQZ A;  3TOU A;  4I6X A;  5ID2 A;  2VO4 A;  3ERG A;  1HQO A;  1Y6E A;  2DJ0 A;  1BG1 A;  4PTS A;  3I9V 2;  3F3R A;  2H71 A;  3HD5 A;  14GS A;  2H6Z A;  1SD8 A;  1ON4 A;  4V1A g;  1YF1 A;  3RDW A;  3VFI A;  5KOX A;  2KP1 A;  2O89 A;  1XZO A;  4RI7 A;  5HFK A;  5CRH A;  3HA9 A;  3UVT A;  3GIX A;  3G9B A;  2H1D A;  5IMZ A;  3IK7 A;  1FO5 A;  3WT1 A;  3VK9 A;  1XBS A;  1V58 A;  4DSQ A;  1TRU A;  2FCH A;  1ZOF A;  2JSY A;  2VL9 A;  1S3D A;  2LRT A;  4KB3 A;  3WGX A;  3UAP A;  3EE2 A;  4KH7 A;  1X5C A;  3IDV A;  4CHS A;  2WZ9 A;  1N2A A;  1O85 A;  4D73 A;  1T7P B;  4MZW A;  2G0F A;  2WDU A;  3M9K A;  4K8M A;  4WXT A;  1PGT A;  3GTU B;  2FUG 2;  2H74 A;  2GQM A;  5CP1 A;  1AQX A;  5DVB A;  2F8F A;  2I1U A;  2M46 A;  2VM1 A;  2B1K A;  4ACS A;  4JE1 A;  1ZCP A;  2H1B A;  4KND A;  3IXR A;  1SJZ A;  3M0F A;  2WS2 A;  1B8X A;  1TK0 B;  1KTE A;  4O7H A;  5GAP D;  2B1L A;  5CRW A;  1JZW A;  3FHK A;  1ZZY A;  4J56 E;  1GLQ A;  3GHA A;  2MYG A;  3LOR A;  3DWV A;  4K2X A;  2YWM A;  1OC8 A;  5INY A;  4DSS B;  4G10 A;  3D21 A;  2O5V A;  1TRV A;  1SKR B;  3A5W A;  2X99 A;  4A5P A;  3F63 A;  2P31 A;  5GSS A;  3C71 A;  5D9V A;  3HHV A;  3PGT A;  3J7Y b;  4V2N A;  4DEJ A;  2A4H A;  5H5Q A;  3FR9 A;  1F6M C;  4G19 A;  4XS4 A;  1AW9 A;  4KDY A;  3RHC A;  3QPM A;  2X8G A;  1E6B A;  3M8N A;  1QMV A;  4N11 A;  4OD7 A;  4N10 A;  1R4W A;  4MAB A;  1JZO A;  4GXZ A;  2KOK A;  1A2J A;  4HQS A;  3NZN A;  1HNA A;  2JZT A;  2HSH A;  2AYT A;  2C0D A;  2GVP A;  4XTS A;  3FR6 A;  2WJU A;  3F6F A;  3WYW A;  3ZFL A;  2R6K A;  2YP6 A;  1J0F A;  2V32 A;  1WE0 A;  6GST A;  3BOA A;  2D2Z A;  1OC9 B;  1NSW A;  5DAL A;  2J23 A;  2P5R A;  4WR5 A;  2GZP A;  3VPQ A;  3D4T A;  1BYE A;  3TJG A;  5HR3 A;  2CA8 A;  4Z7X A;  11GS A;  2XPE A;  2H73 A;  1GP1 A;  3TJJ A;  2EIQ A;  1GSY A;  2IMI A;  1T8E B;  4BL7 B;  4EC0 A;  2TRC P;  1OE7 A;  4GWR A;  5C04 A;  2XC2 A;  4GDF A;  4ZBB A;  5CAX A;  4MPF A;  3EMP A;  4FO5 A;  2WW0 A;  2R0P A;  5ECO B;  4MJB A;  3ZZX A;  3Q19 A;  3KTB A;  3RFR C;  1QXH A;  1TW9 A;  3EYT A;  3IC8 A;  2H6Y A;  4ZIJ A;  3ZIT A;  1TU7 A;  2UZ8 A;  4IQ1 A;  4ZL9 A;  4FQU A;  1F37 A;  3LQ7 A;  4W66 A;  4ZL7 A;  2CVB A;  3IRA A;  4G9H A;  1X9W B;  4Z2T A;  4ID0 A;  3BCK A;  1QGV A;  2WCI A;  5E59 A;  1Q98 A;  1A24 A;  2X4A A;  1ZMA A;  3DML A;  4WF4 A;  2CZ2 A;  5G30 A;  4NHZ A;  5ECQ B;  2HLS A;  4EDY A;  3UIW A;  2P5Q A;  1RW1 A;  2HZF A;  3G7I A;  3GTU A;  3UBK A;  5CO3 A;  5DDL A;  1Y25 A;  4IS0 A;  3FR3 A;  5CNW A;  4BA7 A;  1AQW A;  4OWY A;  4ECI A;  1UVZ A;  3ZYW A;  3QAV A;  2YOI A;  5KN3 A;  2KUC A;  2AV4 A;  3GRX A;  4WBJ A;  2H1G A;  2FWH A;  2OE0 A;  2HFD A;  5HR2 A;  1PKW A;  5IOX A;  5GST A;  3IBH A;  3JCM L;  5HFI A;  1O81 A;  1XXU A;  4NHW A;  4Z2R A;  4IKH A;  2C3N A;  4O5Q A;  5CYY A;  1B48 A;  3FMW A;  1Z5Y E;  5JWQ B;  4ZB9 A;  2GDR A;  3DGQ A;  3HDC A;  3UBL A;  4DSS A;  2NDO A;  3VWV A;  2JL4 A;  2VUP A;  5J4U A;  4ZB6 A;  4QL7 A;  1RQM A;  4MZB A;  1YJ6 A;  1WPI A;  4F0B A;  2CVK A;  2YV9 A;  1PN9 A;  3KEB A;  2JSZ A;  4N3Z A;  2IMK A;  3TUE A;  4LLR A;  3FYG A;  2PWJ A;  2R5G A;  4X4J A;  4EDZ A;  4K0G A;  2B7J A;  4IVF A;  4QQ7 A;  4I2U A;  1WRY A;  4IP6 A;  2F3M A;  1JLV A;  3CRT A;  4TKY A;  4PNF A;  2LST A;  4POL A;  4BVY B;  2H70 A;  2GT6 A;  4PHZ C;  5A4U A;  2PUK C;  2V6K A;  4CY6 A;  5ECI B;  2YWI A;  2KHP A;  1OC9 A;  5ELG A;  4AKH A;  4PGT A;  4Q5Q A;  2G2Q A;  3GA4 A;  1SYX A;  1PL1 A;  3HZ8 A;  3P2A A;  1BX9 A;  2EIR A;  1GTB A;  6GSX A;  12GS A;  2ON7 A;  4PX1 A;  4HSC X;  4BL7 A;  1OE8 A;  2LJA A;  5JWR B;  1XG8 A;  1Z3E A;  1G0T A;  19GS A;  3H93 A;  2IPA A;  3UEM A;  3GYK A;  3VWW A;  1YZX A;  2VLU A;  3DVW A;  1M2D A;  4TVE A;  2GQL A;  3CSH A;  4E68 A;  1GSE A;  1XW9 A;  1Z6N A;  3S9F A;  4MF6 A;  3RPP A;  3W8J A;  4MF7 A;  4J57 E;  3F6D A;  2WGR A;  5KN2 A;  4HDE A;  2ALB A;  1YKC A;  3ERF A;  1K0O A;  1A8Y A;  2H76 A;  3C1S A;  4K7N A;  2PPT A;  3HVN A;  3QFA C;  5IOW A;  3US3 A;  3BBY A;  1O6J A;  1YQ1 A;  3RGB C;  4JED A;  2RM5 A;  1TXX A;  4IBP A;  1MTC A;  4FYC A;  2N5F A;  4RUV A;  1EZK A;  5BRT A;  3VI5 A;  3MNG A;  4GLT A;  1R26 A;  2VLT A;  4BWS A;  3VWU A;  3VWX A;  4EXJ A;  5ECK B;  5A34 B;  2HSY A;  5FHI A;  4YQU A;  4ML1 A;  3AY8 A;  1THX A;  1PQN A;  1EGR A;  5D93 A;  6GSU A;  3KZQ A;  4F03 A;  1WIK A;  2LS5 A;  4FIW A;  1OYJ A;  2IN3 A;  5ELA A;  4KDU A;  5ECS A;  4ULX A;  1K0D A;  4TRX A;  3ZRE A;  1TXU A;  5EVO A;  2C1Y A;  2BMX A;  1KNG A;  3FKF A;  4XS1 A;  1HD2 A;  3LJR A;  3EWL A;  4KUN A;  4NV2 A;  3EU3 A;  4TR1 A;  2CT6 A;  3UL3 A;  1FOH A;  4YAP A;  1CQH A;  1WMJ A;  2LRN A;  5JCU A;  1EEJ A;  1VGL A;  2GLR A;  1T3B A;  4HU9 A;  2GS3 A;  3ERW A;  4TR0 A;  3LWA A;  2N5B A;  3RAZ A;  5HR0 A;  2IMF A;  2EFC A;  1MD3 A;  2HRN A;  2O3E A;  4PUR A;  2GSS A;  1B9X C;  5LD0 A;  4PUF C;  2FWG A;  1FB6 A;  2B7K A;  5G2Z A;  3TCO A;  3DD3 A;  5FT3 A;  4MDC A;  1O73 A;  4BVY A;  3I43 A;  2LQO A;  2R0G A;  5JCG A;  4LL4 B;  3D4M A;  1UN2 A;  2K8S A;  2MZC A;  3NOF A;  2L4C A;  4IW9 A;  2L5L A;  2LTK A;  1X9M B;  3N9J A;  5IO2 A;  4MMM A;  4PQ1 A;  1PKZ A;  1TK8 B;  5D8I A;  1GLP A;  4HS1 A;  2CAI A;  2DSA A;  2LNS A;  2JZR A;  1MDK A;  4XRD A;  5ECL B;  5L71 A;  3L4N A;  2M72 A;  3U5R E;  4AF2 A;  3DIE A;  2VKZ G;  3U6V A;  2IWT A;  3FY7 A;  2F8A A;  2LUS A;  1FAA A;  2NPB A;  2H30 A;  2OE3 A;  2IIY A;  1GUK A;  1YEP A;  4V2L A;  3FZ4 A;  1GSD A;  2K8V A;  1WWJ A;  2TIR A;  2VCV A;  5CRG A;  1PD2 1;  3TKQ A;  1TI1 A;  1BF5 A;  3HJP A;  4WET A;  4F82 A;  1AAZ A;  1I5G A;  1YY7 A;  3QOU A;  4TW5 A;  1VF3 A;  1SL1 B;  2YWN A;  1XWC A;  1XW5 A;  2VL2 C;  2K6V A;  3GKM A;  1BG5 A;  3EC3 A;  3P8W A;  3QFB C;  3CTF A;  2UV8 G;  2C8U A;  2I3Y A;  4O5U A;  2MMO A;  4G2E A;  3HYP A;  2YJ7 A;  3PIN A;  2MMA A;  4MH2 A;  2DC5 A;  2H8L A;  5A34 A;  2FA8 A;  2H72 A;  1ERT A;  2VCX A;  2HE3 A;  2PGT A;  3KGK A;  4HI7 A;  3MDK A;  1EP7 A;  1OKT A;  2VOC A;  4KA0 A;  2WVY A;  4JU5 A;  5IMD A;  1HNC A;  5F8B A;  1U3I A;  2EFE A;  1GSS A;  5LNK e;  2GSQ A;  18GS A;  4XRA A;  1V2A A;  2IFQ A;  2LV3 A;  1C72 A;  1JHB A;  5KN0 A;  4EO3 A;  1NW2 A;  4E8H A;  3HZ4 A;  1QUW A;  2VIM A;  2NBS A;  3I6A A;  4FYB A;  4MZC A;  2PBJ A;  4BIK A;  1GRX A;  6GSW A;  4WR4 A;  2WW1 A;  4MLY A;  3KP8 A;  4JZQ A;  5KN1 A;  3IR4 A;  1K3Y A;  1M3J A;  1ZGN A;  2FLS A;  3ME7 A;  3ZTL A;  1GL8 A;  1T1V A;  3ZVJ D;  1GUH A;  1S3R A;  4TXV A;  4L5O A;  1F9M A;  1HNB A;  4X0X A;  4KCE A;  1YKA A;  4V2M A;  2E0Q A;  4IN0 A;  5IM9 A;  2GZZ A;  3C73 A;  5ENU A;  3RHB A;  2GQK A;  4NPB A;  3IAM 2;  2AJQ B;  3EPT A;  4LMW A;  1F2E A;  1MD4 A;  2HRK A;  2LEG A;  1ML6 A;  2DMM A;  5DJM A;  2YNX A;  4NAX A;  1VRS D;  2WW3 A;  4N0Z A;  1TDI A;  4G0L A;  4ZXG A;  1SU9 A;  4OO4 A;  5IMF A;  1WP0 A;  2VCW A;  4ILF A;  4X43 A;  5D9T A;  3LYK A;  4YKF A;  4WEY A;  3ZVJ A;  4ZB8 A;  5JWO B;  5B7C A;  1O8X A;  2E7P A;  2O87 A;  1JLW A;  5A5H B;  1EEM A;  3D0Z A;  1TJD A;  2RM6 A;  1ERW A;  3E9J B;  2EFH A;  1ZYP A;  4KW6 A;  1FHE A;  10GS A;  4OCF A;  2CZ3 A;  4IP1 A;  5F07 A;  1JZD A;  2AB6 A;  2NVL A;  3LEF A;  2M80 A;  1SEN A;  1AUC A;  2AAW A;  1SK2 A;  1R7H A;  3GX8 A;  3GST A;  1EV4 A;  1VF2 A;  2OBI A;  1LBK A;  2YN1 A;  1V40 A;  1ERV A;  2OJL A;  3EU4 A;  3LXT A;  4KDX A;  3TKS C;  3GH9 A;  2A2R A;  1W89 A;  4OFN A;  5A5K A;  2XBQ A;  4KAE A;  5B8B A;  1GH2 A;  4RI6 A;  1U88 A;  3I69 A;  2PN8 A;  4HUA A;  4YQM A;  4XS6 A;  4IGJ A;  3IC4 A;  3W8S A;  2IME A;  2FHE A;  2A2P A;  2K9F A;  3GL3 A;  2WVZ A;  3TGZ A;  1IYI A;  5A1N B;  3QDN A;  5F0G A;  2GTU A;  2WW2 A;  3IAS 2;  2B6M A;  3A2X A;  3MSZ A;  5DJL A;  1HYU A;  1K0N A;  4MK3 A;  5IIZ A;  5A4V A;  2H1A A;  5B8A A;  1N8J A;  5B6N A;  5DAK B;  3PH9 A;  4JBB A;  1W4V A;  1IYH A;  1EGO A;  3QAW A;  5D73 A;  3IOS A;  2DJ1 A;  4XHM A;  3EMX A;  2KP2 A;  4TR1 B;  2B5Y A;  3UMA A;  1M7T A;  3HY2 A;  1DBY A;  3FZ9 A;  2RLI A;  5DCH A;  4MJC A;  2L6C A;  3DKS A;  1SVL A;  2HSM B;  3M1G A;  2MMZ A;  1WJK A;  2L59 A;  2ZNM A;  4NMU A;  1GTU A;  5J4V A;  2QA1 A;  3KXO A;  3CQF A;  3RBT A;  1A0R P;  4BVX B;  2C3T A;  5ECN B;  1KEB A;  3TRQ A;  1GSU A;  2L57 A;  1ZL9 A;  5G5E A;  4KE3 A;  3LG6 A;  4X1U A;  4PUA A;  3DEX A;  1N25 A;  4GSS A;  2YCD A;  3H1N A;  4NXI A;  1SVO A;  1GSF A;  5IPG A;  1AXD A;  7GSS A;  4KCA A;  2VD0 A;  5AIS A;  1O7U A;  4TXO B;  2KLX A;  5DCG A;  1FG4 A;  3H4K A;  2LRC A;  3GL5 A;  5D96 A;  5A4W A;  3P90 A;  1WOU A;  4K7O A;  2MMN A;  5IMV A;  5D9X A;  3QR6 A;  1TI3 A;  3Q74 A;  2OAC A;  3L9V A;  4DSR A;  13GS A;  1M0U A;  3MWH A;  3UAR A;  2C0G A;  1KBN A;  4KGI A;  3IE3 A;  3F3Q A;  3A3T A;  5A5H A;  3BJ5 A;  2PVQ A;  3CSI A;  3A2W A;  2H19 A;  2C3Q A;  3OR5 A;  4MF5 A;  4QL9 A;  3C1R A;  2HNL A;  2QKE A;  1RK4 A;  1TOF A;  1M2A A;  4NWY A; 
#chains in the Genus database with same CATH homology
 4WBR D;  1ZYE A;  2X8H A;  5COH A;  1NM3 A;  3L78 A;  2YPM A;  1M9A A;  3MIX A;  3LFL A;  1E2Y A;  2I81 A;  2HSN B;  3IK9 A;  3FW2 A;  4OFT A;  4ZIL A;  1B4Q A;  4GTU A;  3ZL5 A;  3IA1 A;  1XWK A;  2HRA A;  1Z7P A;  1TP9 A;  3CYN A;  5ABR A;  3M9J A;  3F8U A;  4ZBD A;  4AJ6 A;  3MYD A;  5AN1 A;  3TB2 A;  1XVQ A;  1GNW A;  4MP4 A;  2FNO A;  3M3M A;  3VI7 A;  2P0G A;  1V98 A;  4TOP A;  2ZUP A;  2GT5 A;  3TJF A;  1TRS A;  2IJY A;  1A0F A;  4L5L A;  2NTO A;  5IMC A;  4Q5R A;  5A1N A;  3UOM A;  4ECJ A;  5ECR B;  4MJA A;  4IEL A;  2HYX A;  3DXB A;  3GX0 A;  4TR3 A;  2R2J A;  4ML6 A;  4L8E A;  4K6X A;  1TU8 A;  1EWX A;  2LJR A;  2PMT A;  5DAK A;  2EIO A;  4HEA 2;  3DYR A;  1URM A;  3EIN A;  1AQV A;  2IFQ B;  2YZH A;  4HZ4 A;  2WFC A;  4GQF A;  1PA3 A;  5J5N A;  3ZFB A;  3TKP A;  2ON5 A;  2H1L A;  5EY6 A;  2I4A A;  4YKG A;  3R3E A;  1XWA A;  3HMJ G;  1M2B A;  22GS A;  2XHF A;  1XPV A;  3KMO A;  3GFK A;  3HJO A;  4RQX A;  5J40 A;  3ME8 A;  2DKH A;  4P3Y B;  2HSM A;  3CWG A;  4KSO A;  5AIX A;  1PL2 A;  3APS A;  1XWB A;  4ZB7 A;  2R4V A;  1MDJ A;  1J9B A;  4BWQ A;  4E8E A;  3F9U A;  4BVX A;  1X0R A;  1Z6M A;  2CX3 A;  2YZU A;  4POK A;  8GSS A;  3ZIV A;  2GST A;  1JZR A;  2VL2 A;  3FEU A;  3KM6 A;  3QCP A;  2HRK B;  1FVK A;  1AIU A;  2JU5 A;  4YAV A;  1K0C A;  4ISD A;  2FWF A;  1S3C A;  1SK1 A;  1VF1 A;  4TXO A;  2FY6 A;  3KCM A;  2PER A;  5BMU A;  5J9C A;  4HJ2 A;  3ISO A;  2YAN A;  3WGE A;  2FWE A;  1YF0 A;  2QGV A;  2EFD A;  2HI7 A;  1ERU A;  3GNJ A;  1R5A A;  2H0G A;  2RUE A;  4LA1 A;  4PQH A;  1EOH A;  4F2I A;  3HCZ A;  1OC3 A;  2REM A;  3L0H A;  1F3A A;  1Z9H A;  2AHE A;  3G7Y A;  3TKS E;  1SD9 A;  4AKX B;  3GKK A;  4KX4 A;  4LMV A;  2R3X A;  17GS A;  2V41 A;  2HRF A;  2HSN A;  2YWO A;  2CQ9 A;  4POM A;  2V1M A;  4H86 A;  4DVC A;  4GCI A;  1K0A A;  4EUY A;  4OO5 A;  5C00 A;  4K2D A;  1XOA A;  1YVL A;  1K3L A;  1TK5 B;  5EL8 A;  3HVX A;  1GTA A;  4LL1 B;  2JAC A;  1H4O A;  5FWG A;  1PN0 A;  4K5S A;  2X49 A;  4IJI A;  4YQV A;  3RPN A;  4AGS A;  2VM2 A;  3FK8 A;  3VUR A;  2VCQ A;  2VCZ A;  4IHU A;  2VD1 A;  5HR1 A;  3G7J A;  2XBI A;  4EE0 A;  4ICY A;  3ZML A;  2DJK A;  4JR6 A;  1NHY A;  1J08 A;  2C0E A;  2VL3 A;  5ECM B;  4PNG A;  5DQY A;  2MBT A;  1Q4J A;  3LYP A;  2OBK A;  3GUS A;  3NIV A;  3O76 A;  4N30 A;  2OKA A;  1ABA A;  1O8W A;  1G6W A;  4IJ3 A;  6GSY A;  1MDI A;  3N5O A;  9GSS A;  4FYU A;  3TU3 B;  1U87 A;  4EIP A;  2CVD A;  1BAY A;  3F4S A;  2HQT A;  4GST A;  3KH9 A;  2B5E A;  4OCE A;  4Q5F A;  3HKR A;  2O8V B;  1TRW A;  1ZYQ B;  1XW6 A;  1DUG A;  2HZE B;  4MJE A;  2DJJ A;  2CV4 A;  1BQ7 A;  2IL3 A;  5IMA A;  3FZA A;  3LSZ A;  1SL2 B;  2AUV A;  2E2M A;  1FVJ A;  2H75 A;  4O5R A;  1CQG A;  2EC4 A;  2V2G A;  4F9Z A;  2JZS A;  3HVS A;  5D9W A;  3TKS A;  5F05 A;  4EIQ A;  4ZL8 A;  1X5D A;  5CRD A;  4N0V A;  2DLX A;  1YEX A;  1I9D A;  4CW9 A;  2YV7 A;  3O6T A;  5LCZ A;  2FGX A;  5G31 A;  3HXS A;  1TTZ A;  5B6M A;  2BJX A;  2DBC A;  5J9B A;  4HJM A;  4XCS A;  4HZ2 A;  1SYR A;  4WKW A;  3SWL A;  3IV4 A;  4EVM A;  1K0B A;  2VLV A;  4J2F A;  3ED3 A;  4AKG A;  4K5R A;  1OKD A;  2TRX A;  1G6Y A;  3O3T A;  1X5E A;  2OA7 A;  2N5A A;  3DRN A;  3IHG A;  2GZY A;  4PXO A;  3GV1 A;  3C8E A;  4KSM A;  1YDK A;  1SKS B;  3EUR A;  4OMV A;  1EP8 A;  1SL0 B;  3GUR A;  1LU4 A;  3W6G A;  3KTL A;  3LGC A;  3TOT A;  6GSS A;  3L9S A;  3D6I A;  3GKX A;  4IQA A;  5ECH B;  3TRP A;  2QC7 A;  4GQC A;  3BCI A;  3GSS A;  2A4V A;  3ZRD A;  4GF0 A;  2VCT A;  1USB A;  5JCW A;  1BED A;  2DIZ A;  3KJY A;  3GN3 A;  1OAZ A;  2L4Q A;  2H66 A;  1PSQ A;  1TKD B;  3CBU A;  3CXG A;  3GMF A;  1K3O A;  1GSQ A;  1G7E A;  3EVI A;  3H8Q A;  1U6T A;  3UVH A;  1BJX A;  1QQ2 A;  1F3B A;  3LW9 A;  2PU9 C;  2ZCT A;  1NHO A;  2RII A;  2C4J A;  5G5F A;  4F0C A;  3QAG A;  4Q5N A;  2FA4 A;  16GS A;  4L0U A;  2YJH A;  1A2L A;  3WD6 A;  3D5J A;  2E2G A;  1SKW B;  1SJI A;  6GSV A;  3CTG A;  2XPD A;  3V1W A;  2DJ2 A;  1UC7 A;  4MH3 A;  2L6D A;  3IPZ A;  3QMX A;  4EF0 A;  1M99 A;  1GWC A;  4AKI A;  3A5I A;  1XVW A;  3C7M A;  1MEK A;  3F0I A;  1ILO A;  1ACV A;  1A8L A;  3HJM A;  3HVV A;  3QD9 A;  4WF5 A;  3LXZ A;  5G1L A;  2HT9 A;  3VLN A;  1T4Y A;  1G7O A;  3Q18 A;  2R37 A;  3APQ A;  5KEJ A;  4O32 A;  3VPT A;  4G0I A;  2HZE A;  4I97 A;  1DE2 A;  5H5S A;  1M9B A;  3TJK A;  4HOJ A;  3TRX A;  5IQY A;  2LNT A;  4MNN A;  1EV9 A;  3A2V A;  2OE1 A;  1QK8 A;  2IMD A;  3K8N A;  3CRU A;  1DE1 A;  3GH6 A;  2OAD A;  2HXK A;  1FW1 A;  4K0N A;  4L0W A;  2FD3 A;  2J9H A;  1GUL A;  1S3A A;  3ZLP A;  5H5R A;  3WGD A;  5J41 A;  4JRR A;  5J3R A;  1XFL A;  4MA9 A;  1ST9 A;  4G01 A;  1Z7R A;  4Z2U A;  3F4T A;  5BMU B;  5J4Y A;  3BD2 A;  4MCU A;  3L9U A;  2GSR A;  2X64 A;  2X8C A;  2B5X A;  5G1K A;  2DJ3 A;  1SK0 A;  2I9H A;  1UA5 A;  3PPU A;  2O85 A;  4V1A p;  2V6O A;  5ID2 B;  5J47 A;  3ZIJ A;  2K18 A;  4PQI A;  3KMN A;  1LJR A;  1T4Z A;  2B3S A;  1ZYN A;  2OT3 A;  3E3E A;  2F51 A;  3Q6O A;  2H0I A;  4XIH A;  1A2M A;  3KIJ A;  2RUF A;  2LKU A;  4EL1 A;  1GNE A;  3KP9 A;  4O92 A;  2H0H A;  2H6X A;  4TR4 A;  4G0K A;  4AJ7 A;  2Z9S A;  5HQP A;  2PVO C;  2BTO T;  1K0M A;  4ECB A;  1H75 A;  4MPG A;  4D73 B;  3KH7 A;  1U3A A;  5EPF A;  3GKN A;  1V9W A;  1THO A;  1B4P A;  5AGY A;  4TN8 A;  2VAF A;  3MAK A;  1SJ6 A;  4K9Z A;  5GAN D;  1QFN A;  4I5Q A;  4RQR A;  3DVX A;  5AIV A;  1PRX A;  2CX4 A;  4NV5 A;  1JFU A;  1OVN A;  3UJ1 A;  4GSN A;  1GUM A;  4HU7 A;  1V57 A;  4JR4 A;  1PX6 A;  2WRT A;  2MBS A;  2WB9 A;  1XIY A;  4QMK A;  1EOG A;  4I2T A;  5DBQ A;  3D22 A;  2C0F A;  1FB0 A;  4USS A;  3TDG A;  1XCC A;  1Y1U A;  3CMI A;  4BPY A;  1DSB A;  1PX7 A;  3PR8 A;  4AI6 A;  4ZBA A;  3CSJ A;  3P7X A;  3SBC A;  1B9Y C;  3R2Q A;  4OFM A;  4CDO A;  2F9S A;  2A2S A;  2CAQ A;  3KD0 A;  2JAD A;  5IO0 A;  3ZMK A;  4AJ8 A;  3J7Y k;  4CY8 A;  4EKZ A;  2QSI A;  2O7K A;  4XS4 B;  4YH2 A;  3IHQ A;  1PMT A;  2LJK A;  5DQS A;  2ES7 A;  2WUL A;  3FZ5 A;  5GZZ B;  3TJB A;  1VF4 A;  3FRC A;  5KOW A;  1SVM A;  4K7I A;  4K1F A;  1GTI A;  2LQQ A;  4GRF A;  4KF9 A;  1XWG A;  3F4R A;  5CRE A;  5HFG A;  1T00 A;  5IPH A;  2GGT A;  4ECC A;  2DIY A;  1XOB A;  2DKI A;  4I8B A;  4POB A;  5DAL B;  5F06 A;  3APO A;  1X9S B;  3TKR A;  1R5P A;  1AC1 A;  3H79 A;  3E0U A;  2R0C A;  1FOV A;  2C80 A;  20GS A;  5E4W A;  3WT2 A;  5ECP B;  2DML A;  2L5O A;  2QA2 A;  1A23 A;  4FH8 A;  2H01 A;  4HQZ A;  3TOU A;  4I6X A;  5ID2 A;  2VO4 A;  3ERG A;  1HQO A;  1Y6E A;  2DJ0 A;  1BG1 A;  4PTS A;  3I9V 2;  3F3R A;  2H71 A;  3HD5 A;  14GS A;  2H6Z A;  1SD8 A;  1ON4 A;  4V1A g;  1YF1 A;  3RDW A;  3VFI A;  5KOX A;  2KP1 A;  2O89 A;  1XZO A;  4RI7 A;  5HFK A;  5CRH A;  3HA9 A;  3UVT A;  3GIX A;  3G9B A;  2H1D A;  5IMZ A;  3IK7 A;  1FO5 A;  3WT1 A;  3VK9 A;  1XBS A;  1V58 A;  4DSQ A;  1TRU A;  2FCH A;  1ZOF A;  2JSY A;  2VL9 A;  1S3D A;  2LRT A;  4KB3 A;  3WGX A;  3UAP A;  3EE2 A;  4KH7 A;  1X5C A;  3IDV A;  4CHS A;  2WZ9 A;  1N2A A;  1O85 A;  4D73 A;  1T7P B;  4MZW A;  2G0F A;  2WDU A;  3M9K A;  4K8M A;  4WXT A;  1PGT A;  3GTU B;  2FUG 2;  2H74 A;  2GQM A;  5CP1 A;  1AQX A;  5DVB A;  2F8F A;  2I1U A;  2M46 A;  2VM1 A;  2B1K A;  4ACS A;  4JE1 A;  1ZCP A;  2H1B A;  4KND A;  3IXR A;  1SJZ A;  3M0F A;  2WS2 A;  1B8X A;  1TK0 B;  1KTE A;  4O7H A;  5GAP D;  2B1L A;  5CRW A;  1JZW A;  3FHK A;  1ZZY A;  4J56 E;  1GLQ A;  3GHA A;  2MYG A;  3LOR A;  3DWV A;  4K2X A;  2YWM A;  1OC8 A;  5INY A;  4DSS B;  4G10 A;  3D21 A;  2O5V A;  1TRV A;  1SKR B;  3A5W A;  2X99 A;  4A5P A;  3F63 A;  2P31 A;  5GSS A;  3C71 A;  5D9V A;  3HHV A;  3PGT A;  3J7Y b;  4V2N A;  4DEJ A;  2A4H A;  5H5Q A;  3FR9 A;  1F6M C;  4G19 A;  4XS4 A;  1AW9 A;  4KDY A;  3RHC A;  3QPM A;  2X8G A;  1E6B A;  3M8N A;  1QMV A;  4N11 A;  4OD7 A;  4N10 A;  1R4W A;  4MAB A;  1JZO A;  4GXZ A;  2KOK A;  1A2J A;  4HQS A;  3NZN A;  1HNA A;  2JZT A;  2HSH A;  2AYT A;  2C0D A;  2GVP A;  4XTS A;  3FR6 A;  2WJU A;  3F6F A;  3WYW A;  3ZFL A;  2R6K A;  2YP6 A;  1J0F A;  2V32 A;  1WE0 A;  6GST A;  3BOA A;  2D2Z A;  1OC9 B;  1NSW A;  5DAL A;  2J23 A;  2P5R A;  4WR5 A;  2GZP A;  3VPQ A;  3D4T A;  1BYE A;  3TJG A;  5HR3 A;  2CA8 A;  4Z7X A;  11GS A;  2XPE A;  2H73 A;  1GP1 A;  3TJJ A;  2EIQ A;  1GSY A;  2IMI A;  1T8E B;  4BL7 B;  4EC0 A;  2TRC P;  1OE7 A;  4GWR A;  5C04 A;  2XC2 A;  4GDF A;  4ZBB A;  5CAX A;  4MPF A;  3EMP A;  4FO5 A;  2R0P A;  5ECO B;  4MJB A;  3ZZX A;  3Q19 A;  3KTB A;  1QXH A;  1TW9 A;  3EYT A;  3IC8 A;  2H6Y A;  4ZIJ A;  3ZIT A;  1TU7 A;  2UZ8 A;  4IQ1 A;  4ZL9 A;  4FQU A;  1F37 A;  3LQ7 A;  4W66 A;  4ZL7 A;  2CVB A;  3IRA A;  4G9H A;  1X9W B;  4Z2T A;  4ID0 A;  3BCK A;  1QGV A;  2WCI A;  5E59 A;  1Q98 A;  1A24 A;  2X4A A;  1ZMA A;  3DML A;  4WF4 A;  2CZ2 A;  5G30 A;  4NHZ A;  5ECQ B;  2HLS A;  4EDY A;  3UIW A;  2P5Q A;  1RW1 A;  2HZF A;  3G7I A;  3GTU A;  3UBK A;  5CO3 A;  5DDL A;  1Y25 A;  4IS0 A;  3FR3 A;  5CNW A;  4BA7 A;  1AQW A;  4OWY A;  4ECI A;  1UVZ A;  3ZYW A;  3QAV A;  2YOI A;  5KN3 A;  2KUC A;  2AV4 A;  3GRX A;  4WBJ A;  2H1G A;  2FWH A;  2OE0 A;  2HFD A;  5HR2 A;  1PKW A;  5IOX A;  5GST A;  3IBH A;  3JCM L;  5HFI A;  1O81 A;  1XXU A;  4NHW A;  4Z2R A;  4IKH A;  2C3N A;  4O5Q A;  5CYY A;  1B48 A;  3FMW A;  1Z5Y E;  5JWQ B;  4ZB9 A;  2GDR A;  3DGQ A;  3HDC A;  3UBL A;  4DSS A;  2NDO A;  3VWV A;  2JL4 A;  2VUP A;  5J4U A;  4ZB6 A;  4QL7 A;  1RQM A;  4MZB A;  1YJ6 A;  1WPI A;  4F0B A;  2CVK A;  2YV9 A;  1PN9 A;  3KEB A;  2JSZ A;  4N3Z A;  2IMK A;  3TUE A;  4LLR A;  3FYG A;  2PWJ A;  2R5G A;  4X4J A;  4EDZ A;  4K0G A;  2B7J A;  4IVF A;  4QQ7 A;  4I2U A;  1WRY A;  4IP6 A;  2F3M A;  1JLV A;  3CRT A;  4TKY A;  4PNF A;  2LST A;  4POL A;  4BVY B;  2H70 A;  2GT6 A;  5A4U A;  2PUK C;  2V6K A;  4CY6 A;  5ECI B;  2YWI A;  2KHP A;  1OC9 A;  5ELG A;  4AKH A;  4PGT A;  4Q5Q A;  2G2Q A;  3GA4 A;  1SYX A;  1PL1 A;  3HZ8 A;  3P2A A;  1BX9 A;  2EIR A;  1GTB A;  6GSX A;  12GS A;  2ON7 A;  4PX1 A;  4BL7 A;  1OE8 A;  2LJA A;  5JWR B;  1Z3E A;  1G0T A;  19GS A;  3H93 A;  2IPA A;  3UEM A;  3GYK A;  3VWW A;  1YZX A;  2VLU A;  3DVW A;  1M2D A;  4TVE A;  2GQL A;  3CSH A;  4E68 A;  1GSE A;  1XW9 A;  1Z6N A;  3S9F A;  4MF6 A;  3RPP A;  3W8J A;  4MF7 A;  4J57 E;  3F6D A;  2WGR A;  5KN2 A;  4HDE A;  2ALB A;  1YKC A;  3ERF A;  1K0O A;  1A8Y A;  2H76 A;  3C1S A;  4K7N A;  2PPT A;  3QFA C;  5IOW A;  3US3 A;  3BBY A;  1O6J A;  1YQ1 A;  4JED A;  2RM5 A;  1TXX A;  4IBP A;  1MTC A;  4FYC A;  2N5F A;  4RUV A;  1EZK A;  5BRT A;  3VI5 A;  3MNG A;  4GLT A;  1R26 A;  2VLT A;  4BWS A;  3VWU A;  3VWX A;  4EXJ A;  5ECK B;  5A34 B;  2HSY A;  5FHI A;  4YQU A;  4ML1 A;  3AY8 A;  1THX A;  1PQN A;  1EGR A;  5D93 A;  6GSU A;  3KZQ A;  4F03 A;  1WIK A;  2LS5 A;  4FIW A;  1OYJ A;  2IN3 A;  5ELA A;  4KDU A;  5ECS A;  4ULX A;  1K0D A;  4TRX A;  3ZRE A;  1TXU A;  5EVO A;  2C1Y A;  2BMX A;  1KNG A;  3FKF A;  4XS1 A;  1HD2 A;  3LJR A;  3EWL A;  4KUN A;  4NV2 A;  3EU3 A;  4TR1 A;  2CT6 A;  3UL3 A;  1FOH A;  4YAP A;  1CQH A;  1WMJ A;  2LRN A;  5JCU A;  1EEJ A;  1VGL A;  2GLR A;  1T3B A;  4HU9 A;  2GS3 A;  3ERW A;  4TR0 A;  3LWA A;  2N5B A;  3RAZ A;  5HR0 A;  2IMF A;  2EFC A;  1MD3 A;  2HRN A;  4PUR A;  2GSS A;  1B9X C;  5LD0 A;  4PUF C;  2FWG A;  1FB6 A;  2B7K A;  5G2Z A;  3TCO A;  3DD3 A;  5FT3 A;  4MDC A;  1O73 A;  4BVY A;  3I43 A;  2LQO A;  2R0G A;  5JCG A;  4LL4 B;  3D4M A;  1UN2 A;  2K8S A;  2MZC A;  3NOF A;  2L4C A;  4IW9 A;  2L5L A;  2LTK A;  1X9M B;  3N9J A;  5IO2 A;  4MMM A;  4PQ1 A;  1PKZ A;  1TK8 B;  5D8I A;  1GLP A;  4HS1 A;  2CAI A;  2DSA A;  2LNS A;  2JZR A;  1MDK A;  4XRD A;  5ECL B;  5L71 A;  3L4N A;  2M72 A;  3U5R E;  4AF2 A;  3DIE A;  2VKZ G;  3U6V A;  2IWT A;  3FY7 A;  2F8A A;  2LUS A;  1FAA A;  2NPB A;  2H30 A;  2OE3 A;  2IIY A;  1GUK A;  1YEP A;  4V2L A;  3FZ4 A;  1GSD A;  2K8V A;  1WWJ A;  2TIR A;  2VCV A;  5CRG A;  1PD2 1;  3TKQ A;  1TI1 A;  1BF5 A;  3HJP A;  4WET A;  4F82 A;  1AAZ A;  1I5G A;  1YY7 A;  3QOU A;  4TW5 A;  1VF3 A;  1SL1 B;  2YWN A;  1XWC A;  1XW5 A;  2VL2 C;  2K6V A;  3GKM A;  1BG5 A;  3EC3 A;  3P8W A;  3QFB C;  3CTF A;  2UV8 G;  2C8U A;  2I3Y A;  4O5U A;  2MMO A;  4G2E A;  3HYP A;  2YJ7 A;  3PIN A;  2MMA A;  4MH2 A;  2DC5 A;  2H8L A;  5A34 A;  2FA8 A;  2H72 A;  1ERT A;  2VCX A;  2HE3 A;  2PGT A;  3KGK A;  4HI7 A;  3MDK A;  1EP7 A;  1OKT A;  2VOC A;  4KA0 A;  4JU5 A;  5IMD A;  1HNC A;  5F8B A;  1U3I A;  2EFE A;  1GSS A;  5LNK e;  2GSQ A;  18GS A;  4XRA A;  1V2A A;  2IFQ A;  2LV3 A;  1C72 A;  1JHB A;  5KN0 A;  4EO3 A;  1NW2 A;  4E8H A;  3HZ4 A;  1QUW A;  2VIM A;  2NBS A;  3I6A A;  4FYB A;  4MZC A;  2PBJ A;  1GRX A;  6GSW A;  4WR4 A;  4MLY A;  3KP8 A;  4JZQ A;  5KN1 A;  3IR4 A;  1K3Y A;  1ZGN A;  2FLS A;  3ME7 A;  3ZTL A;  1GL8 A;  1T1V A;  3ZVJ D;  1GUH A;  4TXV A;  4L5O A;  1F9M A;  1HNB A;  4X0X A;  4KCE A;  1YKA A;  4V2M A;  2E0Q A;  4IN0 A;  5IM9 A;  2GZZ A;  3C73 A;  5ENU A;  3RHB A;  2GQK A;  4NPB A;  3IAM 2;  2AJQ B;  3EPT A;  4LMW A;  1F2E A;  1MD4 A;  2HRK A;  2LEG A;  1ML6 A;  2DMM A;  5DJM A;  2YNX A;  4NAX A;  1VRS D;  4N0Z A;  1TDI A;  4G0L A;  4ZXG A;  1SU9 A;  4OO4 A;  5IMF A;  1WP0 A;  2VCW A;  4ILF A;  4X43 A;  5D9T A;  3LYK A;  4YKF A;  4WEY A;  3ZVJ A;  4ZB8 A;  5JWO B;  5B7C A;  1O8X A;  2E7P A;  2O87 A;  1JLW A;  5A5H B;  1EEM A;  3D0Z A;  1TJD A;  2RM6 A;  1ERW A;  3E9J B;  2EFH A;  1ZYP A;  4KW6 A;  1FHE A;  10GS A;  4OCF A;  2CZ3 A;  4IP1 A;  5F07 A;  1JZD A;  2AB6 A;  2NVL A;  3LEF A;  2M80 A;  1SEN A;  1AUC A;  2AAW A;  1SK2 A;  1R7H A;  3GX8 A;  3GST A;  1EV4 A;  1VF2 A;  2OBI A;  1LBK A;  2YN1 A;  1V40 A;  1ERV A;  2OJL A;  3EU4 A;  3LXT A;  4KDX A;  3TKS C;  3GH9 A;  2A2R A;  1W89 A;  4OFN A;  5A5K A;  2XBQ A;  4KAE A;  5B8B A;  1GH2 A;  4RI6 A;  1U88 A;  3I69 A;  2PN8 A;  4HUA A;  4YQM A;  4XS6 A;  4IGJ A;  3IC4 A;  3W8S A;  2IME A;  2FHE A;  2A2P A;  2K9F A;  3GL3 A;  3TGZ A;  1IYI A;  5A1N B;  3QDN A;  5F0G A;  2GTU A;  3IAS 2;  2B6M A;  3A2X A;  3MSZ A;  5DJL A;  1HYU A;  1K0N A;  4MK3 A;  5IIZ A;  5A4V A;  2H1A A;  5B8A A;  1N8J A;  5B6N A;  5DAK B;  3PH9 A;  4JBB A;  1W4V A;  1IYH A;  1EGO A;  3QAW A;  5D73 A;  3IOS A;  2DJ1 A;  4XHM A;  3EMX A;  2KP2 A;  4TR1 B;  2B5Y A;  3UMA A;  1M7T A;  3HY2 A;  1DBY A;  3FZ9 A;  2RLI A;  5DCH A;  4MJC A;  2L6C A;  3DKS A;  1SVL A;  2HSM B;  3M1G A;  2MMZ A;  1WJK A;  2L59 A;  2ZNM A;  4NMU A;  1GTU A;  5J4V A;  2QA1 A;  3KXO A;  3RBT A;  1A0R P;  4BVX B;  2C3T A;  5ECN B;  1KEB A;  3TRQ A;  1GSU A;  2L57 A;  1ZL9 A;  5G5E A;  4KE3 A;  3LG6 A;  4X1U A;  4PUA A;  3DEX A;  1N25 A;  4GSS A;  2YCD A;  3H1N A;  4NXI A;  1SVO A;  1GSF A;  5IPG A;  1AXD A;  7GSS A;  4KCA A;  2VD0 A;  5AIS A;  1O7U A;  4TXO B;  2KLX A;  5DCG A;  1FG4 A;  3H4K A;  2LRC A;  3GL5 A;  5D96 A;  5A4W A;  3P90 A;  1WOU A;  4K7O A;  2MMN A;  5IMV A;  5D9X A;  3QR6 A;  1TI3 A;  3Q74 A;  2OAC A;  3L9V A;  4DSR A;  13GS A;  1M0U A;  3MWH A;  3UAR A;  2C0G A;  1KBN A;  4KGI A;  3IE3 A;  3F3Q A;  3A3T A;  5A5H A;  3BJ5 A;  2PVQ A;  3CSI A;  3A2W A;  2H19 A;  2C3Q A;  3OR5 A;  4MF5 A;  4QL9 A;  3C1R A;  2HNL A;  2QKE A;  1RK4 A;  1TOF A;  1M2A A;  4NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...