3KMNA

Crystal structure of the human apo gst pi c47s/y108v double mutant
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASSLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIVTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Diuretic drug binding to human glutathione transferase P1-1: potential role of CYS101 revealed in the double mutant C47S/Y108V
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kmnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kmnA01
2KLXA 2H01A 3UVTA 3LYKA 3TOTA 5LCZA 3GA4A 3NIVA 1U3IA 4GWRA 5HR3A 1EGOA 1R5PA 5ECHB 3RAZA 1B8XA 1USBA 1UN2A 3TRXA 3ZYWA 1R5AA 3IK9A 4HDEA 2P5RA 3LYPA 2CVDA 4YQUA 3HHVA 2OKAA 1WWJA 1TK0B 4G10A 1XOBA 2OE1A 2VL2C 5EL8A 3EVIA 3V1WA 5AIXA 4MZWA 3HVVA 4QQ7A 2VO4A 1WOUA 4PURA 2XBIA 2LS5A 4AJ8A 2A4VA 1HNAA 2K18A 1GH2A 2HE3A 4KGIA 1BEDA 2GSQA 2GQLA 1TXXA 4WXTA 4HZ2A 2VCZA 2JSYA 3VWXA 5DBQA 4TW5A 4G0LA 1Z9HA 4IELA 2H72A 1YJ6A 1GL8A 3U5RE 3PH9A 4JE1A 4MCUA 1MEKA 3HY2A 4G0IA 3HYPA 5DCHA 2K6VA 2YCDA 2VD1A 4XRDA 1V57A 1F3BA 5G2ZA 1U88A 3DVXA 2MBSA 1E2YA 2GLRA 1A8YA 3R3EA 3KD0A 4JU5A 1ZZYA 3KH9A 4I6XA 3TKSA 2CVKA 2GS3A 2H0GA 3TCOA 2WS2A 4YAPA 3KXOA 1Z7PA 4RI7A 1VF2A 3UIWA 3FEUA 2QGVA 4MH2A 16GSA 1THXA 1TKDB 2MZCA 3EWLA 2IMDA 2OACA 1QK8A 3ZL5A 1MDIA 1GWCA 3GURA 1YZXA 1R4WA 1VRSD 4XCSA 2H70A 4KX4A 2AV4A 5FHIA 5KN2A 4HJ2A 1O7UA 1W4VA 2HZFA 5J41A 3DD3A 2BJXA 3ZREA 2REMA 1BYEA 4WETA 3L4NA 5A5KA 1PKZA 1JFUA 1X5EA 3BJ5A 1PA3A 1ML6A 5A4VA 1IYIA 1OC9A 2LJRA 2IFQB 1T8EB 2I4AA 3IC4A 3QR6A 2C8UA 4LMVA 3EE2A 2Z9SA 4L0WA 3DXBA 2ON5A 4F2IA 1TRSA 4BPYA 3AY8A 3F3QA 3WGDA 4WKWA 3IC8A 3MSZA 1K3YA 3RDWA 2GTUA 1GSQA 2B5YA 3D0ZA 3A3TA 4QL9A 5ECIB 3ZVJD 2B7JA 4IS0A 1MD4A 5EY6A 6GSWA 5A4UA 2GZYA 4CDOA 5H5SA 1TK8B 4H86A 3ME8A 1PN9A 2XPEA 4AJ7A 3L0HA 3MWHA 1JZDA 1HNCA 1BJXA 4MPFA 2H1GA 1YQ1A 3KJYA 4O7HA 4IJ3A 2GT6A 1Z7RA 4K0NA 3KTLA 3EMPA 3IOSA 5EPFA 1E6BA 1Q98A 4GSTA 3VWVA 4IP6A 2YWMA 3C1SA 4XS4B 4HI7A 1XW5A 3LSZA 1F3AA 2M46A 2KUCA 5ECKB 2B3SA 4EKZA 1DSBA 3Q19A 2RM5A 2VL2A 3UMAA 3GNJA 2V1MA 2CV4A 6GSXA 4FH8A 2PU9C 5CO3A 4XS4A 1B4QA 1EP8A 3NZNA 1XW9A 4MPGA 1XOAA 3ERWA 1SK0A 2YANA 4HU9A 1O81A 2H8LA 4TR1B 2E0QA 4IW9A 4BVXA 2FA4A 3ZIVA 2EC4A 4HEA2 4K6XA 1YF0A 3CRTA 4LL4B 4Q5FA 3TRPA 2KP2A 2YWIA 1T4YA 4MF5A 4OWYA 4AJ6A 4Q5RA 2R4VA 3HCZA 2L4CA 2TRCP 2VAFA 1WJKA 2YOIA 4V2LA 4MLYA 1GSDA 1I5GA 1ERUA 4YQMA 2JSZA 2PUKC 4IHUA 3KMNA 4ZL7A 3L9SA 4EUYA 2E2GA 2B1LA 3FRCA 5D9VA 1K0NA 2EIQA 4KCEA 1Z3EA 4V2MA 3F63A 4DSSA 2WZ9A 1XCCA 1NM3A 2HRKB 12GSA 4F0BA 4LL1B 3K8NA 2YN1A 4O5RA 1KNGA 3F6DA 1TRUA 4PTSA 4K8MA 1YKCA 2H1AA 2RM6A 3RHCA 3ISOA 4RI6A 1MD3A 1TK5B 1AQXA 4D73B 5CRHA 2HRKA 2VOCA 3RBTA 1SKRB 4LMWA 1X9SB 3IR4A 1M9AA 2HQTA 1SL2B 1TI3A 3E3EA 1FHEA 4X1UA 5D93A 4BA7A 2ON7A 4D73A 7GSSA 5HQPA 4MH3A 4TKYA 3M8NA 1O8XA 4KW6A 5J5NA 2H6YA 1QMVA 3QDNA 1OYJA 2LRNA 1KEBA 4F82A 5F05A 1Z6NA 4GRFA 2C1YA 2HRNA 3UJ1A 3CTGA 4X43A 6GSTA 4WR4A 4OMVA 2NDOA 1XW6A 2DMLA 1G7OA 1DE2A 3S9FA 3E9JB 2FWEA 1SL1B 1TP9A 5KEJA 1CQGA 1RK4A 1JZWA 4ML1A 2I1UA 4LA1A 2FA8A 3QAWA 5J3RA 3WYWA 4E8HA 5F06A 5ECPB 1G6WA 2C0FA 3TDGA 2VD0A 1GTBA 4EE0A 1XFLA 2L4QA 5E59A 4J2FA 1PMTA 4BWQA 5JCUA 1SJ6A 1C72A 5DCGA 3APOA 3FKFA 5JWQB 4KUNA 1GSSA 3HJPA 3F9UA 2L57A 1WPIA 4K9ZA 1EEJA 1ZCPA 2RLIA 4Q5NA 4G2EA 4HJMA 4GQFA 4MABA 5DAKA 5D9XA 1M2AA 1ZGNA 1JZRA 1YF1A 4MJBA 2P5QA 2JZSA 4PXOA 4MF7A 6GSVA 3VWWA 3M1GA 2YJ7A 2UZ8A 2J9HA 4ISDA 1OC3A 4ECIA 1M7TA 4ZB8A 1B48A 2C0GA 4TN8A 3CYNA 1Y25A 1QXHA 1AQVA 2K9FA 5L71A 3IDVA 2FUG2 5IMVA 1ZMAA 1GLQA 2DJ3A 1PD21 5DJMA 3GYKA 4XIHA 1GNEA 2KOKA 3KH7A 3IAS2 2I81A 5INYA 3RHBA 5G1KA 1GTIA 2LJKA 3G9BA 1SL0B 3KEBA 3HDCA 2DJKA 1LBKA 2IMFA 5D9TA 1GULA 2HSHA 4PUFC 1ACVA 2L59A 1RW1A 4POKA 1XZOA 2P0GA 3GH9A 1TTZA 2LRCA 1DBYA 4PNFA 3DKSA 2R2JA 3WD6A 4PQIA 4ECBA 2N5BA 1SENA 19GSA 2F8FA 3R2QA 3ZLPA 4L5OA 2QSIA 1FB0A 2N5FA 2NVLA 2X8HA 5D96A 3H8QA 3KIJA 3ZIJA 2GZPA 3LGCA 3J7Yb 4N30A 5DDLA 3EC3A 1Z6MA 1UA5A 2CT6A 3TB2A 1PKWA 2C4JA 3UBLA 2IL3A 3PGTA 1GLPA 4ECCA 1R26A 1A0FA 3F3RA 2GZZA 3IHQA 3A2VA 3F0IA 4KSOA 1VGLA 2ALBA 3EINA 4ID0A 5CRGA 1JLVA 4K2DA 3US3A 5A4WA 4IGJA 2R5GA 2QKEA 3KP9A 2R37A 2LUSA 3NOFA 4I5QA 4TRXA 3HJOA 1S3AA 2X99A 1TDIA 4GSNA 2DJJA 1OKDA 1THOA 2KP1A 3PINA 1AUCA 4CW9A 1HQOA 1YEPA 2O89A 5B8BA 3UEMA 3FZ5A 4TXVA 4FQUA 3CTFA 1GSUA 3GSSA 3Q6OA 1MDKA 2VUPA 1ILOA 5BMUA 2E2MA 4JEDA 2ZCTA 4HU7A 2H19A 2VLTA 1GTUA 2EIRA 1FB6A 1TRVA 1VF1A 2NPBA 3UL3A 1DUGA 5ECSA 2JACA 5KN0A 4L5LA 5D73A 1PGTA 5C00A 1EWXA 5CRWA 3W8JA 1SKWB 1PRXA 1SK2A 3D4TA 3G7YA 4XRAA 1WMJA 4LLRA 1H75A 1MTCA 3TGZA 1M9BA 3TJJA 2H75A 4WBJA 3LQ7A 4DEJA 4NWYA 3FR3A 2VL9A 3BCIA 3IRAA 20GSA 3UBKA 1K3LA 3ZVJA 2C80A 4RUVA 4OO5A 2PMTA 4JZQA 3G7JA 2CAIA 5AGYA 3APSA 5GSSA 2B7KA 1NHYA 3FYGA 4ZBBA 3D4MA 2X8CA 2TRXA 4ZXGA 4HOJA 4MDCA 4WF5A 1K0MA 3IK7A 1WIKA 4ZB9A 4HS1A 4XS6A 4K7NA 3KM6A 3LWAA 4WEYA 3MAKA 3VPQA 1TW9A 5KN3A 2CX4A 2LQQA 1YEXA 4ECJA 3ZTLA 4L0UA 3ZFBA 2YZUA 3RPPA 4F03A 5DQSA 2JZTA 2RIIA 5J9BA 10GSA 5J9CA 2OJLA 4KDUA 3Q18A 4G0KA 5HR1A 1V98A 1YKAA 3DEXA 1XWKA 2P31A 2IFQA 3I69A 4GTUA 1JZOA 3C73A 3FZ4A 3GV1A 3L78A 2V2GA 4NHWA 1OAZA 4ILFA 4MP4A 3CSHA 4PNGA 1FVKA 1PSQA 4IQAA 3BD2A 4NXIA 5C04A 2H30A 5LNKe 4IVFA 2G0FA 2H1BA 1AW9A 4BWSA 1PX6A 3A2WA 3IE3A 3M0FA 1A0RP 2PVOC 3CSJA 5HFKA 1Y6EA 2HRFA 1UC7A 3GKMA 3HZ4A 2MBTA 5DQYA 1SJZA 1AC1A 11GSA 3FW2A 2AHEA 1WP0A 1J9BA 2YNXA 2PVQA 1V9WA 2A2SA 5ECOB 2CZ3A 1F6MC 1TOFA 3LJRA 4TR4A 5IPGA 2JU5A 1X5DA 3P8WA 3LXZA 1TJDA 1T3BA 3VWUA 3W6GA 2TIRA 4HZ4A 3HVSA 4OFNA 1NW2A 2OBKA 2HXKA 4V1Ap 3FZ9A 1EV9A 3O6TA 1XWGA 1M99A 2YPMA 2EIOA 2O85A 1GSYA 2DSAA 2IIYA 1ZYEA 3F8UA 2IPAA 4OO4A 3N5OA 3CXGA 1B4PA 3O3TA 3H79A 1QQ2A 2YZHA 2B5EA 4PQHA 1SK1A 5ECQB 3W8SA 1G6YA 3GIXA 1VF4A 2O87A 3GX8A 4KAEA 4I8BA 5HFIA 4TR1A 1R7HA 2VCVA 3DGQA 5D9WA 1HD2A 3ZFLA 3PPUA 3EU4A 4ZBDA 1Q4JA 3IPZA 4HQSA 3VURA 2WULA 1BAYA 2PGTA 2YV9A 4X0XA 2HSMB 4MJEA 5CP1A 5IO0A 1VF3A 4RQRA 5HFGA 2MMNA 2PPTA 4FIWA 4N0ZA 3UAPA 3JCML 1AXDA 1T4ZA 3LG6A 3F4TA 3GTUB 1KTEA 3Q74A 4J57E 2LEGA 1FO5A 3TJBA 1PX7A 2B1KA 2L5OA 3WT2A 2A2RA 2F8AA 3M3MA 5IOXA 4JRRA 2N5AA 3GTUA 2X64A 4IKHA 3HZ8A 5GSTA 2H6XA 1K0OA 1OE7A 2AYTA 2YP6A 2C3QA 3VI7A 3GFKA 4WF4A 1M2DA 4XTSA 1XXUA 4RQXA 2L5LA 5DALB 4KA0A 5G31A 2IWTA 3UARA 1AQWA 2YJHA 3RPNA 4KB3A 2OA7A 5DALA 2DBCA 4XHMA 2WRTA 3L9UA 4KCAA 4JR6A 3GX0A 1CQHA 2FWHA 4F9ZA 3VK9A 5AISA 1ZOFA 3QAGA 4YQVA 3LEFA 4ZILA 2H76A 1XVWA 2AB6A 3U6VA 2AJQB 1JHBA 2GDRA 4BVYB 1EGRA 1MDJA 4BL7B 5E4WA 4WBRD 2C3TA 3UOMA 2XC2A 2B5XA 2XHFA 2K8VA 1RQMA 3BCKA 2DIYA 2MMZA 5H5QA 2L6DA 2LTKA 2V6KA 1BX9A 2GSTA 1ERTA 3IXRA 4BVYA 9GSSA 1FVJA 5CAXA 4MJAA 4TR0A 3FY7A 3TJGA 2DIZA 3I43A 3GH6A 1TI1A 1QGVA 5HR0A 1FW1A 1TU7A 2YV7A 1OE8A 3WGXA 2BTOT 4HUAA 3KMOA 3M9JA 2VLUA 4QL7A 3TKRA 1SJIA 3M9KA 5EVOA 3CMIA 2GQKA 3GUSA 4G19A 2X8GA 2HI7A 2MMOA 2GT5A 1FAAA 3QOUA 5JWRB 3A5WA 1Z5YE 1K0CA 2ZUPA 4K0GA 2ZNMA 4FYCA 5IM9A 3C8EA 1EV4A 4GF0A 2IMKA 2V41A 3PR8A 2HLSA 2HSNB 3HKRA 2O7KA 2C3NA 2LV3A 2O8VB 5IMCA 2VLVA 1PL2A 2LRTA 3F6FA 5IOWA 1F9MA 1U87A 1ABAA 1F37A 3VPTA 1XIYA 3BBYA 2JL4A 2CQ9A 2H0HA 2GGTA 1GP1A 5AN1A 2GQMA 2V6OA 1K0AA 4P3YB 2CAQA 1EOHA 3IBHA 5G1LA 1ERWA 4GQCA 1XWCA 4ZIJA 3ZMKA 4EL1A 2LNSA 4MK3A 2H71A 3FHKA 4DVCA 1QUWA 3G7IA 4EO3A 2V32A 4POLA 1HNBA 2KHPA 1S3CA 3FZAA 2FD3A 3GN3A 3WGEA 2FY6A 3HJMA 4USSA 2NBSA 3D21A 3FR6A 2LSTA 3I9V2 4OFTA 3EURA 3GKKA 8GSSA 3IV4A 2L6CA 1UVZA 3QCPA 22GSA 1OKTA 4MMMA 2HNLA 1K0DA 4CHSA 2VIMA 2GSSA 3OR5A 2FWFA 1GUKA 5IMDA 3IAM2 4MF6A 1V40A 4K1FA 3TRQA 5D8IA 1HYUA 14GSA 1B9YC 4KDYA 4KF9A 3QFAC 4TOPA 4IN0A 2M72A 2VM1A 5GZZB 2XBQA 6GSYA 4N0VA 3TKQA 2DJ1A 3FK8A 5ECNB 3CRUA 2NTOA 3H1NA 3I6AA 3J7Yk 1A2LA 4I2TA 2RUFA 5B6MA 5ELAA 1GNWA 2LJAA 3DRNA 4L8EA 1SD9A 3VI5A 2JADA 2IMEA 5F8BA 4N10A 5ECMB 1EP7A 1AAZA 4I2UA 4IQ1A 4ZL9A 2BMXA 1PQNA 2LNTA 5LD0A 2CVBA 5F0GA 4ULXA 4IP1A 3TJKA 1NSWA 1N2AA 2IMIA 3GMFA 4KNDA 5GAND 3DMLA 3HXSA 3EU3A 4EDZA 4GSSA 5HR2A 2I9HA 1J0FA 3KZQA 2DC5A 1OC9B 5G5FA 3FR9A 4Q5QA 4FO5A 2FWGA 1I9DA 3IA1A 1T7PB 1TRWA 4POMA 2H1DA 2I3YA 2QC7A 4Z7XA 2WB9A 2FCHA 4ACSA 1X0RA 4OCFA 4FYUA 4OD7A 1V58A 2F51A 5B8AA 5DVBA 1XVQA 3D6IA 5COHA 3H4KA 3L9VA 4N11A 4G9HA 3HD5A 5CYYA 1QFNA 3SWLA 2HFDA 1ON4A 3C1RA 4OCEA 18GSA 5IQYA 3EMXA 3WT1A 2M80A 1O73A 2VCXA 5GAPD 1XBSA 2VL3A 3ZRDA 1S3DA 4ZB6A 1WRYA 2OE3A 1O6JA 2OADA 3EYTA 3P2AA 1LU4A 4NHZA 3QPMA 3UVHA 3GSTA 4MJCA 3VLNA 1PL1A 5JCGA 3KCMA 4AF2A 3CSIA 2MYGA 4OFMA 5G30A 17GSA 2DMMA 2AUVA 2H0IA 3O76A 5IMAA 1O85A 1OVNA 4O32A 4NPBA 4KE3A 4J56E 4EC0A 5B7CA 2CZ2A 1W89A 4ZBAA 4FYBA 1SYRA 4TVEA 1XWBA 3MDKA 3LFLA 1X5CA 1GRXA 4KH7A 1GSFA 2PERA 5ECRB 2K8SA 4EDYA 1M0UA 1X9MB 1A23A 1EZKA 1ST9A 4PUAA 3VFIA 3TKPA 2CA8A 5JWOB 3ZMLA 13GSA 4K7OA 5CNWA 3H93A 4EF0A 1KBNA 2E7PA 2VCWA 4BVXB 5H5RA 3ED3A 4V2NA 5DJLA 1T1VA 5IMFA 3GL5A 1TU8A 1SKSB 3DYRA 3DVWA 1K0BA 2RUEA 4NV2A 2PN8A 3HA9A 2HT9A 1F2EA 5ABRA 5KN1A 2R6KA 3E0UA 1EEMA 5ELGA 1G0TA 1AIUA 1A24A 4DSSB 4O92A 2D2ZA 1EOGA 3QD9A 4PQ1A 1SYXA 4KDXA 3GHAA 1WE0A 2HSMA 4ZL8A 2FNOA 3LXTA 1DE1A 1YDKA 4NAXA 4XS1A 1BG5A 4JBBA 4GCIA 2IJYA 4TR3A 3ERGA 2B6MA 1O8WA 2ES7A 3CBUA 2H74A 1K3OA 1B9XC 5FWGA 1A2JA 1BQ7A 4MZBA 5FT3A 3A2XA 3GKXA 3TOUA 3ERFA 5ECLB 3SBCA 2VCTA 3GKNA 1FOVA 3QFBC 2WJUA 4TXOB 2IN3A 5JCWA 3F4SA 2CX3A 3KTBA 5F07A 4E8EA 2AAWA 1A2MA 2LKUA 3DWVA 1ERVA 3ZITA 4JR4A 1U6TA 3C71A 2C0EA 4MZCA 4TXOA 1GUHA 2FLSA 4PX1A 1OC8A 2WCIA 2LQOA 5AIVA 3TKSE 1XPVA 2FHEA 2FGXA 3TKSC 1GUMA 4GLTA 3N9JA 4NMUA 1JLWA 2XPDA 3KP8A 2R3XA 3P90A 2H73A 4K7IA 4YH2A 4EXJA 4POBA 6GSSA 2J23A 4V1Ag 5IO2A 1IYHA 2YWNA 3TUEA 4KSMA 6GSUA 2MMAA 1ZYQB 1U3AA 2JZRA 4NV5A 1SU9A 2HYXA 5J4UA 1GTAA 3APQA 4DSQA 3P7XA 3GL3A 2G2QA 4BL7A 5G5EA 3ME7A 3ZZXA 1M2BA 1X9WB 5DAKB 5IMZA 1J08A 4GXZA 2WDUA 5B6NA 4F0CA 1T00A 1A8LA 5CREA 3KGKA 2F3MA 5IIZA 1N8JA 1NHOA 2H6ZA 4MA9A 3HVXA 1SD8A 3TJFA 2OBIA 5ID2B 4WR5A 3C7MA 2PBJA 2HRAA 2WFCA 1G7EA 3MNGA 1YY7A 1V2AA 2HSYA 4IJIA 4IBPA 3GRXA 5ID2A 2GSRA 5ENUA 5IPHA 4PGTA 2DLXA 2HZEB 1H4OA 2WGRA 2OE0A 5CRDA 4EVMA 3QMXA 4YAVA 2VM2A 1FG4A 3D5JA 4HQZA 2DJ2A 3BOAA 4ML6A 1ZL9A 2DJ0A 3LORA 2F9SA 2HZEA 4DSRA 3QAVA 2C0DA 2PWJA 1LJRA 1URMA 2H66A 3F4RA 2VCQA 1XWAA 3DIEA 4I97A 2GVPA 4AGSA 1GSEA 2YWOA 3D22A
chains in the Genus database with same CATH superfamily
2KLXA 2H01A 3UVTA 3LYKA 3TOTA 5LCZA 3GA4A 3NIVA 1U3IA 4GWRA 5HR3A 1EGOA 1R5PA 5ECHB 3RAZA 1B8XA 1USBA 1UN2A 3TRXA 3ZYWA 1R5AA 3IK9A 4HDEA 2P5RA 3LYPA 2CVDA 4YQUA 3HHVA 2OKAA 1WWJA 1TK0B 4G10A 1XOBA 2OE1A 2VL2C 5EL8A 3EVIA 3V1WA 5AIXA 3RFRC 4MZWA 3HVVA 4QQ7A 5KOXA 2VO4A 1WOUA 4PURA 2XBIA 2LS5A 4AJ8A 2A4VA 1HNAA 2K18A 1GH2A 2HE3A 4KGIA 1BEDA 2GSQA 2GQLA 1ZYPA 1TXXA 4WXTA 4HZ2A 2VCZA 2JSYA 3VWXA 5DBQA 4TW5A 4G0LA 1Z9HA 4IELA 2H72A 1M3IA 1YJ6A 1GL8A 3U5RE 3PH9A 4Z2RA 4JE1A 4MCUA 1MEKA 3HY2A 4G0IA 3HYPA 5DCHA 2K6VA 2YCDA 2VD1A 4XRDA 1V57A 1F3BA 5G2ZA 1U88A 3DVXA 2MBSA 1E2YA 2GLRA 1A8YA 3R3EA 3KD0A 4JU5A 1ZZYA 3KH9A 4ZB7A 4I6XA 3TKSA 2CVKA 2GS3A 1SVLA 2H0GA 3TCOA 2WS2A 4YAPA 3KXOA 1Z7PA 4RI7A 1VF2A 3UIWA 3FEUA 2QGVA 4MH2A 16GSA 1THXA 1TKDB 2MZCA 3EWLA 2IMDA 2OACA 1QK8A 3ZL5A 1MDIA 1GWCA 3GURA 1YZXA 4Z2TA 1R4WA 2EFHA 4BIKA 1VRSD 4XCSA 2H70A 4KX4A 2AV4A 5FHIA 5KN2A 4HJ2A 1O7UA 1W4VA 2HZFA 5J41A 3DD3A 2BJXA 3ZREA 2REMA 1BYEA 4WETA 3L4NA 5A5KA 1PKZA 1JFUA 1X5EA 3BJ5A 1PA3A 1ML6A 5A4VA 1IYIA 3MYDA 1OC9A 2LJRA 2IFQB 1T8EB 2I4AA 3IC4A 3QR6A 2C8UA 4LMVA 3EE2A 2Z9SA 2QA2A 4L0WA 3DXBA 2ON5A 4F2IA 1TRSA 4BPYA 3AY8A 3F3QA 3WGDA 4WKWA 3IC8A 3MSZA 1K3YA 3RDWA 2GTUA 1GSQA 2B5YA 3D0ZA 3A3TA 4FXYP 4QL9A 5ECIB 3ZVJD 2B7JA 2O3EA 4IS0A 1MD4A 5EY6A 6GSWA 5A4UA 2GZYA 4CDOA 5H5SA 1TK8B 4H86A 3ME8A 1PN9A 2XPEA 4AJ7A 3L0HA 3MWHA 1JZDA 1HNCA 1BJXA 4MPFA 2H1GA 1YQ1A 3KJYA 4O7HA 2A4HA 4IJ3A 2GT6A 1Z7RA 2VKZG 4K0NA 4HSCX 3KTLA 3EMPA 3IOSA 5EPFA 4E68A 1E6BA 1Q98A 4GSTA 3VWVA 4IP6A 2YWMA 3C1SA 4XS4B 4HI7A 2WW2A 1XW5A 3LSZA 1F3AA 2M46A 2KUCA 5ECKB 2B3SA 4EKZA 1DSBA 3Q19A 2RM5A 2VL2A 3UMAA 3GNJA 2V1MA 2CV4A 1PFOA 6GSXA 4FH8A 2PU9C 5CO3A 4XS4A 2WVXB 1B4QA 1EP8A 3NZNA 1XW9A 4MPGA 1XOAA 3ERWA 5BRTA 4AKXB 1SK0A 2YANA 4HU9A 1O81A 2H8LA 4TR1B 2E0QA 4IW9A 4BVXA 2FA4A 3ZIVA 2EC4A 4HEA2 3LW9A 4K6XA 1YF0A 3CRTA 4LL4B 4Q5FA 3TRPA 2KP2A 2YWIA 1T4YA 4MF5A 4OWYA 4AJ6A 2EFEA 4Q5RA 2R4VA 3HCZA 2L4CA 2TRCP 2VAFA 1WJKA 2YOIA 4V2LA 4MLYA 1GSDA 1I5GA 1ERUA 4YQMA 2JSZA 2PUKC 4IHUA 4X4JA 3KMNA 4ZL7A 3L9SA 4EUYA 2E2GA 2B1LA 3FRCA 4O5UA 5D9VA 1K0NA 2EIQA 4ICYA 1Z3EA 4KCEA 4V2MA 3F63A 4DSSA 2WZ9A 1XCCA 1NM3A 2HRKB 12GSA 4F0BA 4LL1B 3K8NA 2YN1A 4O5RA 1KNGA 3F6DA 1TRUA 4PTSA 4K8MA 1YKCA 2H1AA 2RM6A 3RHCA 3ISOA 4RI6A 1MD3A 1TK5B 1AQXA 4D73B 5CRHA 2HRKA 2VOCA 3RBTA 1SKRB 4LMWA 1X9SB 3IR4A 1M9AA 2HQTA 1SL2B 1TI3A 3E3EA 1FHEA 4X1UA 5D93A 4BA7A 2ON7A 4D73A 7GSSA 5HQPA 4MH3A 4TKYA 3M8NA 1O8XA 4KW6A 5J5NA 2H6YA 1QMVA 3QDNA 1OYJA 2LRNA 1KEBA 4F82A 5F05A 1Z6NA 4GRFA 2C1YA 2HRNA 3UJ1A 3CTGA 4X43A 6GSTA 4WR4A 4OMVA 2NDOA 1XW6A 2DMLA 1G7OA 1DE2A 3S9FA 3E9JB 2FWEA 1SL1B 1TP9A 5KEJA 1CQGA 2DKIA 1RK4A 1JZWA 4ML1A 2I1UA 4LA1A 2FA8A 3HVNA 3QAWA 5J3RA 3WYWA 4E8HA 5F06A 5ECPB 1G6WA 2C0FA 3TDGA 2VD0A 1GTBA 4EE0A 1XFLA 2L4QA 5E59A 4J2FA 1PMTA 4BWQA 5JCUA 5J47A 1SJ6A 1C72A 5DCGA 3APOA 3FKFA 5JWQB 4KUNA 1GSSA 3HJPA 3F9UA 2L57A 1WPIA 4K9ZA 1EEJA 1ZCPA 5J4YA 2RLIA 4Q5NA 4G2EA 4HJMA 4GQFA 4MABA 5DAKA 5D9XA 1M2AA 1ZGNA 1JZRA 1YF1A 4CY6A 4MJBA 2P5QA 2JZSA 4PXOA 4MF7A 6GSVA 3VWWA 3EPTA 3M1GA 2YJ7A 2UZ8A 2J9HA 4ISDA 1OC3A 4ECIA 1M7TA 2R0GA 4ZB8A 1B48A 2C0GA 4TN8A 3CYNA 1Y25A 1BF5A 1QXHA 1AQVA 2K9FA 5L71A 3IDVA 2FUG2 5IMVA 5KOWA 1ZMAA 1GLQA 2DJ3A 1PD21 5DJMA 3GYKA 4XIHA 1GNEA 2KOKA 3KH7A 3IAS2 2I81A 5INYA 3RHBA 5G1KA 1GTIA 2LJKA 3G9BA 1SL0B 3KEBA 3HDCA 2DJKA 1LBKA 2IMFA 5D9TA 1GULA 2HSHA 4PUFC 1ACVA 2L59A 1RW1A 4POKA 1XZOA 2P0GA 3GH9A 1TTZA 2LRCA 1DBYA 4PNFA 3DKSA 2R2JA 3WD6A 4PQIA 4ECBA 2N5BA 1SENA 4YKFA 19GSA 4CY8A 2F8FA 3R2QA 3ZLPA 4L5OA 2QSIA 1FB0A 2N5FA 2NVLA 2X8HA 5D96A 3H8QA 3KIJA 1PN0A 2GZPA 3ZIJA 3LGCA 3J7Yb 4N30A 5DDLA 3EC3A 1Z6MA 1UA5A 2CT6A 3TB2A 1PKWA 2C4JA 3UBLA 2IL3A 3PGTA 1GLPA 4ECCA 1R26A 1A0FA 3F3RA 2GZZA 3IHQA 3A2VA 3F0IA 4KSOA 1VGLA 2ALBA 3EINA 4ID0A 5CRGA 1JLVA 4K2DA 3US3A 2H1LA 5A4WA 4IGJA 2R5GA 2QKEA 3KP9A 2R37A 2LUSA 3NOFA 4I5QA 4TRXA 3HJOA 1S3AA 2X99A 5BMUB 1TDIA 4GSNA 2DJJA 1OKDA 1THOA 2KP1A 3PINA 1AUCA 4CW9A 1HQOA 1YEPA 2O89A 5B8BA 3UEMA 2WVYA 3FZ5A 4TXVA 4FQUA 3CTFA 1GSUA 3GSSA 3Q6OA 1MDKA 2VUPA 1ILOA 5BMUA 2E2MA 4JEDA 2ZCTA 4HU7A 2H19A 2VLTA 1GTUA 2EIRA 1FB6A 1TRVA 1VF1A 2NPBA 3UL3A 1DUGA 5ECSA 3CWGA 2JACA 5KN0A 4L5LA 5D73A 1PGTA 2DKHA 5A34B 5C00A 1S3RA 1EWXA 5CRWA 3W8JA 1SKWB 1PRXA 1SK2A 3D4TA 3G7YA 4XRAA 1WMJA 4LLRA 1H75A 1MTCA 3TGZA 1M9BA 3TJJA 2H75A 4WBJA 3LQ7A 4DEJA 4NWYA 5A34A 3BCIA 3FR3A 2VL9A 3IRAA 20GSA 3UBKA 1K3LA 3ZVJA 2C80A 4RUVA 4OO5A 2PMTA 4JZQA 3G7JA 2CAIA 5AGYA 3APSA 5GSSA 2B7KA 1NHYA 3TU3B 3FYGA 1N25A 4ZBBA 3D4MA 2X8CA 2TRXA 4ZXGA 4HOJA 4MDCA 4WF5A 1K0MA 3IK7A 1WIKA 4ZB9A 4HS1A 4AKIA 4XS6A 4K7NA 3KM6A 3LWAA 4WEYA 3MAKA 3VPQA 1TW9A 1TXUA 5KN3A 2CX4A 2LQQA 1YEXA 4ECJA 3ZTLA 4L0UA 4AKGA 3ZFBA 2YZUA 3RPPA 4F03A 5DQSA 4PHZC 2JZTA 2RIIA 5J9BA 1Y1UA 10GSA 5J9CA 2OJLA 4KDUA 3Q18A 4G0KA 5HR1A 2A2PA 1V98A 1YKAA 3DEXA 1XWKA 2P31A 2IFQA 3I69A 4GTUA 1JZOA 3C73A 3FZ4A 1BG1A 3GV1A 3L78A 2V2GA 4NHWA 1OAZA 4ILFA 4MP4A 3CSHA 4PNGA 1FVKA 1PSQA 4IQAA 3BD2A 4NXIA 5C04A 2H30A 5LNKe 4IVFA 2G0FA 2H1BA 1AW9A 4BWSA 1PX6A 3A2WA 3IE3A 3M0FA 1A0RP 2PVOC 3CSJA 5HFKA 1Y6EA 2HRFA 1UC7A 3GKMA 3HZ4A 2MBTA 5DQYA 1SJZA 3IHGA 2WVZA 1AC1A 3FMWA 11GSA 3FW2A 2AHEA 1WP0A 1J9BA 2YNXA 2PVQA 1V9WA 2A2SA 5ECOB 2CZ3A 1F6MC 1TOFA 3LJRA 4TR4A 5IPGA 2JU5A 1X5DA 3P8WA 3LXZA 1TJDA 1T3BA 3VWUA 3W6GA 2TIRA 4HZ4A 3HVSA 4OFNA 1NW2A 2OBKA 2HXKA 4V1Ap 3FZ9A 2X49A 1EV9A 3O6TA 1XWGA 1M99A 2YPMA 2EIOA 2O85A 1GSYA 2DSAA 2IIYA 1ZYEA 3F8UA 2IPAA 4Z2UA 4OO4A 3N5OA 3CXGA 1B4PA 2WVXA 3O3TA 3H79A 1QQ2A 2YZHA 2B5EA 4PQHA 1SK1A 5A5HB 5ECQB 3W8SA 1G6YA 3GIXA 1VF4A 2O87A 2UV8G 3GX8A 4KAEA 4I8BA 5HFIA 4TR1A 1R7HA 2VCVA 1YVLA 3DGQA 5D9WA 1HD2A 3ZFLA 5A5HA 3PPUA 3EU4A 4ZBDA 1Q4JA 3IPZA 4HQSA 3VURA 2WULA 1BAYA 2PGTA 2YV9A 4X0XA 2HSMB 4MJEA 5CP1A 5IO0A 1VF3A 4RQRA 5HFGA 2MMNA 2WW1A 2PPTA 4FIWA 4N0ZA 3UAPA 3JCML 2X4AA 1AXDA 1T4ZA 3LG6A 3F4TA 3GTUB 1KTEA 3Q74A 4J57E 2LEGA 1FO5A 3TJBA 1PX7A 2B1KA 2L5OA 3WT2A 2A2RA 2F8AA 3M3MA 5IOXA 4JRRA 3MIXA 2N5AA 3GTUA 2X64A 4IKHA 3HZ8A 4K5RA 5GSTA 2H6XA 1K0OA 1OE7A 2AYTA 2YP6A 2C3QA 3VI7A 3GFKA 4WF4A 1M2DA 4XTSA 1XXUA 4RQXA 2L5LA 5DALB 4KA0A 5G31A 2IWTA 3UARA 1AQWA 2YJHA 3RPNA 4KB3A 2OA7A 5DALA 2DBCA 4XHMA 2WRTA 3L9UA 4KCAA 4JR6A 3GX0A 1I1IP 1CQHA 2FWHA 4F9ZA 3VK9A 4G01A 5AISA 1ZOFA 3QAGA 4YQVA 3LEFA 4ZILA 2H76A 1XVWA 2O5VA 2AB6A 3U6VA 4MNNA 2AJQB 1JHBA 2GDRA 4BVYB 1SVOA 1EGRA 1MDJA 4BL7B 5E4WA 4WBRD 2C3TA 3UOMA 2XC2A 2B5XA 4GDFA 2XHFA 2K8VA 1RQMA 3BCKA 2DIYA 2MMZA 5H5QA 2L6DA 2LTKA 2V6KA 1BX9A 2GSTA 1ERTA 3IXRA 4BVYA 9GSSA 1FVJA 5CAXA 4MJAA 3A5IA 4TR0A 3FY7A 3TJGA 2DIZA 3I43A 3GH6A 1TI1A 1QGVA 5HR0A 1FW1A 1TU7A 2YV7A 1OE8A 3CQFA 3WGXA 2BTOT 4HUAA 3KMOA 3M9JA 2VLUA 4QL7A 3TKRA 1SJIA 3M9KA 5EVOA 3CMIA 2GQKA 3GUSA 4G19A 2X8GA 2HI7A 2MMOA 2GT5A 1FAAA 3QOUA 5JWRB 3A5WA 1Z5YE 1K0CA 2ZUPA 4K0GA 2ZNMA 2WW3A 4FYCA 5IM9A 3C8EA 1EV4A 4GF0A 2IMKA 2V41A 3PR8A 2HLSA 2HSNB 3HKRA 2O7KA 2C3NA 2LV3A 2O8VB 5IMCA 2VLVA 1PL2A 4EIPA 2LRTA 3F6FA 3RGBC 5IOWA 1F9MA 2R0PA 1U87A 2HSNA 1ABAA 1F37A 3VPTA 1XIYA 3BBYA 2JL4A 2CQ9A 2H0HA 2GGTA 1GP1A 5AN1A 4PI2C 2GQMA 2V6OA 1K0AA 4P3YB 2CAQA 1EOHA 3IBHA 5G1LA 1ERWA 4GQCA 1XWCA 4ZIJA 3ZMKA 4EL1A 2LNSA 4PI0C 4MK3A 2H71A 3FHKA 4DVCA 1QUWA 3G7IA 4EO3A 2V32A 4POLA 1HNBA 2KHPA 1S3CA 3FZAA 2FD3A 3GN3A 3WGEA 2FY6A 3HJMA 4USSA 2NBSA 4K5SA 3D21A 3FR6A 2R0CA 2LSTA 3I9V2 4OFTA 3EURA 3GKKA 8GSSA 3IV4A 2L6CA 1UVZA 3QCPA 22GSA 1S4BP 1OKTA 4MMMA 2HNLA 1K0DA 4CHSA 2VIMA 2GSSA 3OR5A 2FWFA 1GUKA 5IMDA 3IAM2 4MF6A 1V40A 4N3ZA 4K1FA 3TRQA 5D8IA 1HYUA 14GSA 1B9YC 4KDYA 4KF9A 3QFAC 4TOPA 4IN0A 2M72A 2VM1A 5GZZB 2XBQA 4O5QA 6GSYA 4N0VA 3TKQA 2DJ1A 3FK8A 5ECNB 3CRUA 2NTOA 3H1NA 3I6AA 3J7Yk 5A1NB 1A2LA 4I2TA 2RUFA 5B6MA 5ELAA 1GNWA 2LJAA 3DRNA 4L8EA 1SD9A 3VI5A 2JADA 2IMEA 5F8BA 4N10A 5ECMB 1EP7A 1AAZA 4I2UA 4IQ1A 4ZL9A 2BMXA 5A1NA 1PQNA 2LNTA 5LD0A 2CVBA 5F0GA 4ULXA 4IP1A 3TJKA 1NSWA 1N2AA 2IMIA 3GMFA 4KNDA 5GAND 3DMLA 3HXSA 3EU3A 4EDZA 4EIQA 4GSSA 5HR2A 2I9HA 1J0FA 3KZQA 2DC5A 1OC9B 5G5FA 3FR9A 4Q5QA 4FO5A 2FWGA 1I9DA 3IA1A 1T7PB 1TRWA 4POMA 3CHXC 1SVMA 2H1DA 2I3YA 2QC7A 4Z7XA 2WB9A 2FCHA 4ACSA 1X0RA 4AI6A 4OCFA 4FYUA 4OD7A 1V58A 2F51A 5B8AA 2OT3A 5DVBA 1XVQA 3D6IA 5COHA 3H4KA 3L9VA 4N11A 4G9HA 3HD5A 5CYYA 1QFNA 3SWLA 2HFDA 1ON4A 3C1RA 4OCEA 18GSA 5IQYA 3EMXA 3WT1A 2M80A 1O73A 2VCXA 3HMJG 5GAPD 1XBSA 2VL3A 3ZRDA 4K2XA 1S3DA 4ZB6A 1WRYA 2OE3A 1O6JA 2OADA 3EYTA 3P2AA 1LU4A 4NHZA 3QPMA 3UVHA 3GSTA 4MJCA 3VLNA 1PL1A 5JCGA 3KCMA 4AF2A 3CSIA 2MYGA 1ZYNA 4OFMA 5G30A 17GSA 2DMMA 1FOHA 2AUVA 2H0IA 3O76A 5IMAA 1O85A 1OVNA 4O32A 4NPBA 4KE3A 4J56E 4EC0A 5B7CA 2CZ2A 1W89A 4ZBAA 4FYBA 1SYRA 1M3JA 4TVEA 1XWBA 3MDKA 3LFLA 1X5CA 1GRXA 4KH7A 1GSFA 2PERA 5ECRB 2K8SA 4EDYA 1M0UA 1X9MB 1A23A 1EZKA 1ST9A 4PUAA 3VFIA 3TKPA 2CA8A 5JWOB 3ZMLA 13GSA 4K7OA 5CNWA 3H93A 4EF0A 1KBNA 2E7PA 2VCWA 4BVXB 5H5RA 3ED3A 4V2NA 5DJLA 1T1VA 5IMFA 3GL5A 1TU8A 1SKSB 3DYRA 3DVWA 1K0BA 2QA1A 2RUEA 4NV2A 2PN8A 4QMKA 4AKHA 3HA9A 2HT9A 1F2EA 5ABRA 5KN1A 2R6KA 3E0UA 5J4VA 1EEMA 5J40A 5ELGA 1G0TA 1AIUA 1A24A 4DSSB 4O92A 2D2ZA 1EOGA 3QD9A 4PQ1A 1SYXA 4KDXA 3GHAA 1WE0A 2HSMA 4ZL8A 2FNOA 3LXTA 1DE1A 1YDKA 4NAXA 4XS1A 1BG5A 4JBBA 4GCIA 2IJYA 1XG8A 4TR3A 3ERGA 2EFCA 2B6MA 1O8WA 2ES7A 3CBUA 2H74A 1K3OA 1B9XC 5FWGA 1A2JA 1BQ7A 4MZBA 5FT3A 2WW0A 3A2XA 3GKXA 3TOUA 3ERFA 5ECLB 3SBCA 2VCTA 3GKNA 1FOVA 3QFBC 2WJUA 4TXOB 2IN3A 5JCWA 3F4SA 2CX3A 3KTBA 5F07A 4E8EA 2AAWA 1A2MA 2LKUA 3DWVA 1ERVA 3ZITA 4JR4A 1U6TA 3C71A 2C0EA 4MZCA 4TXOA 1GUHA 2FLSA 4PX1A 1OC8A 2WCIA 2LQOA 5AIVA 3TKSE 1XPVA 2FHEA 2FGXA 3TKSC 1GUMA 4GLTA 3N9JA 4NMUA 1JLWA 2XPDA 4A5PA 3KP8A 2R3XA 3P90A 2H73A 4K7IA 4YH2A 4EXJA 4POBA 6GSSA 2J23A 4V1Ag 5IO2A 1IYHA 2YWNA 3TUEA 4KSMA 6GSUA 2MMAA 1ZYQB 2O36A 1U3AA 2JZRA 4NV5A 1SU9A 2HYXA 5J4UA 1GTAA 3APQA 4DSQA 4YKGA 3P7XA 4W66A 3GL3A 2G2QA 4BL7A 5G5EA 3ME7A 3ZZXA 1M2BA 1X9WB 5DAKB 5IMZA 1J08A 4GXZA 2WDUA 5B6NA 4F0CA 1T00A 1A8LA 5CREA 2EFDA 3KGKA 2F3MA 5IIZA 1N8JA 1NHOA 2H6ZA 4MA9A 1YEWC 3HVXA 1SD8A 3TJFA 2OBIA 5ID2B 4WR5A 2WZSA 3C7MA 2PBJA 2HRAA 2WFCA 1G7EA 3MNGA 1YY7A 1V2AA 2HSYA 4IJIA 4IBPA 3GRXA 5ID2A 2GSRA 5ENUA 5IPHA 4PGTA 2DLXA 2HZEB 1H4OA 2WGRA 2OE0A 5CRDA 4EVMA 3QMXA 4YAVA 2VM2A 1FG4A 3D5JA 4HQZA 2DJ2A 3BOAA 4ML6A 1ZL9A 2DJ0A 3LORA 2F9SA 2HZEA 4DSRA 3QAVA 2C0DA 2PWJA 1LJRA 1URMA 2H66A 3F4RA 2VCQA 1XWAA 3DIEA 4I97A 2GVPA 4AGSA 1GSEA 2YWOA 3D22A
chains in the Genus database with same CATH topology
2KLXA 2H01A 3UVTA 3LYKA 3TOTA 5LCZA 3GA4A 3NIVA 1U3IA 4GWRA 5HR3A 1EGOA 1R5PA 5ECHB 3RAZA 1B8XA 1USBA 1UN2A 3TRXA 3ZYWA 1R5AA 3IK9A 4HDEA 2P5RA 3LYPA 2CVDA 4YQUA 3HHVA 2OKAA 1WWJA 1TK0B 4G10A 1XOBA 2OE1A 2VL2C 5EL8A 3EVIA 3V1WA 5AIXA 4MZWA 3HVVA 4QQ7A 5KOXA 2VO4A 1WOUA 4PURA 2XBIA 2LS5A 4AJ8A 2A4VA 1HNAA 2K18A 1GH2A 2HE3A 4KGIA 1BEDA 2GSQA 2GQLA 1ZYPA 1TXXA 4WXTA 4HZ2A 2VCZA 2JSYA 3VWXA 5DBQA 4TW5A 4G0LA 1Z9HA 4IELA 2H72A 1YJ6A 1GL8A 3U5RE 3PH9A 4Z2RA 4JE1A 4MCUA 1MEKA 3HY2A 4G0IA 3HYPA 5DCHA 2K6VA 2YCDA 2VD1A 4XRDA 1V57A 1F3BA 5G2ZA 1U88A 3DVXA 2MBSA 1E2YA 2GLRA 1A8YA 3R3EA 3KD0A 4JU5A 1ZZYA 3KH9A 4ZB7A 4I6XA 3TKSA 2CVKA 2GS3A 1SVLA 2H0GA 3TCOA 2WS2A 4YAPA 3KXOA 1Z7PA 4RI7A 1VF2A 3UIWA 3FEUA 2QGVA 4MH2A 16GSA 1THXA 1TKDB 2MZCA 3EWLA 2IMDA 2OACA 1QK8A 3ZL5A 1MDIA 1GWCA 3GURA 1YZXA 4Z2TA 1R4WA 2EFHA 1VRSD 4XCSA 2H70A 4KX4A 2AV4A 5FHIA 5KN2A 4HJ2A 1O7UA 1W4VA 2HZFA 5J41A 3DD3A 2BJXA 3ZREA 2REMA 1BYEA 4WETA 3L4NA 5A5KA 1PKZA 1JFUA 1X5EA 3BJ5A 1PA3A 1ML6A 5A4VA 1IYIA 3MYDA 1OC9A 2LJRA 2IFQB 1T8EB 2I4AA 3IC4A 3QR6A 2C8UA 4LMVA 3EE2A 2Z9SA 2QA2A 4L0WA 3DXBA 2ON5A 4F2IA 1TRSA 4BPYA 3AY8A 3F3QA 3WGDA 4WKWA 3IC8A 3MSZA 1K3YA 3RDWA 2GTUA 1GSQA 2B5YA 3D0ZA 3A3TA 4QL9A 5ECIB 3ZVJD 2B7JA 4IS0A 1MD4A 5EY6A 6GSWA 5A4UA 2GZYA 4CDOA 5H5SA 1TK8B 4H86A 3ME8A 1PN9A 2XPEA 4AJ7A 3L0HA 3MWHA 1JZDA 1HNCA 1BJXA 4MPFA 2H1GA 1YQ1A 3KJYA 4O7HA 2A4HA 4IJ3A 2GT6A 1Z7RA 2VKZG 4K0NA 3KTLA 3EMPA 3IOSA 5EPFA 4E68A 1E6BA 1Q98A 4GSTA 3VWVA 4IP6A 2YWMA 3C1SA 4XS4B 4HI7A 1XW5A 3LSZA 1F3AA 2M46A 2KUCA 5ECKB 2B3SA 4EKZA 1DSBA 3Q19A 2RM5A 2VL2A 3UMAA 3GNJA 2V1MA 2CV4A 6GSXA 4FH8A 2PU9C 5CO3A 4XS4A 1B4QA 1EP8A 3NZNA 1XW9A 4MPGA 1XOAA 3ERWA 5BRTA 4AKXB 1SK0A 2YANA 4HU9A 1O81A 2H8LA 4TR1B 2E0QA 4IW9A 4BVXA 2FA4A 3ZIVA 2EC4A 4HEA2 3LW9A 4K6XA 1YF0A 3CRTA 4LL4B 4Q5FA 3TRPA 2KP2A 2YWIA 1T4YA 4MF5A 4OWYA 4AJ6A 2EFEA 4Q5RA 2R4VA 3HCZA 2L4CA 2TRCP 2VAFA 1WJKA 2YOIA 4V2LA 4MLYA 1GSDA 1I5GA 1ERUA 4YQMA 2JSZA 2PUKC 4IHUA 4X4JA 3KMNA 4ZL7A 3L9SA 4EUYA 2E2GA 2B1LA 3FRCA 4O5UA 5D9VA 1K0NA 2EIQA 4ICYA 1Z3EA 4KCEA 4V2MA 3F63A 4DSSA 2WZ9A 1XCCA 1NM3A 2HRKB 12GSA 4F0BA 4LL1B 3K8NA 2YN1A 4O5RA 1KNGA 3F6DA 1TRUA 4PTSA 4K8MA 1YKCA 2H1AA 2RM6A 3RHCA 3ISOA 4RI6A 1MD3A 1TK5B 1AQXA 4D73B 5CRHA 2HRKA 2VOCA 3RBTA 1SKRB 4LMWA 1X9SB 3IR4A 1M9AA 2HQTA 1SL2B 1TI3A 3E3EA 1FHEA 4X1UA 5D93A 4BA7A 2ON7A 4D73A 7GSSA 5HQPA 4MH3A 4TKYA 3M8NA 1O8XA 4KW6A 5J5NA 2H6YA 1QMVA 3QDNA 1OYJA 2LRNA 1KEBA 4F82A 5F05A 1Z6NA 4GRFA 2C1YA 2HRNA 3UJ1A 3CTGA 4X43A 6GSTA 4WR4A 4OMVA 2NDOA 1XW6A 2DMLA 1G7OA 1DE2A 3S9FA 3E9JB 2FWEA 1SL1B 1TP9A 5KEJA 1CQGA 2DKIA 1RK4A 1JZWA 4ML1A 2I1UA 4LA1A 2FA8A 3QAWA 5J3RA 3WYWA 4E8HA 5F06A 5ECPB 1G6WA 2C0FA 3TDGA 2VD0A 1GTBA 4EE0A 1XFLA 2L4QA 5E59A 4J2FA 1PMTA 4BWQA 5JCUA 5J47A 1SJ6A 1C72A 5DCGA 3APOA 3FKFA 5JWQB 4KUNA 1GSSA 3HJPA 3F9UA 2L57A 1WPIA 4K9ZA 1EEJA 1ZCPA 5J4YA 2RLIA 4Q5NA 4G2EA 4HJMA 4GQFA 4MABA 5DAKA 5D9XA 1M2AA 1ZGNA 1JZRA 1YF1A 4CY6A 4MJBA 2P5QA 2JZSA 4PXOA 4MF7A 6GSVA 3VWWA 3EPTA 3M1GA 2YJ7A 2UZ8A 2J9HA 4ISDA 1OC3A 4ECIA 1M7TA 2R0GA 4ZB8A 1B48A 2C0GA 4TN8A 3CYNA 1Y25A 1BF5A 1QXHA 1AQVA 2K9FA 5L71A 3IDVA 2FUG2 5IMVA 5KOWA 1ZMAA 1GLQA 2DJ3A 1PD21 5DJMA 3GYKA 4XIHA 1GNEA 2KOKA 3KH7A 3IAS2 2I81A 5INYA 3RHBA 5G1KA 1GTIA 2LJKA 3G9BA 1SL0B 3KEBA 3HDCA 2DJKA 1LBKA 2IMFA 5D9TA 1GULA 2HSHA 4PUFC 1ACVA 2L59A 1RW1A 4POKA 1XZOA 2P0GA 3GH9A 1TTZA 2LRCA 1DBYA 4PNFA 3DKSA 2R2JA 3WD6A 4PQIA 4ECBA 2N5BA 1SENA 4YKFA 19GSA 4CY8A 2F8FA 3R2QA 3ZLPA 4L5OA 2QSIA 1FB0A 2N5FA 2NVLA 2X8HA 5D96A 3H8QA 3KIJA 1PN0A 2GZPA 3ZIJA 3LGCA 3J7Yb 4N30A 5DDLA 3EC3A 1Z6MA 1UA5A 2CT6A 3TB2A 1PKWA 2C4JA 3UBLA 2IL3A 3PGTA 1GLPA 4ECCA 1R26A 1A0FA 3F3RA 2GZZA 3IHQA 3A2VA 3F0IA 4KSOA 1VGLA 2ALBA 3EINA 4ID0A 5CRGA 1JLVA 4K2DA 3US3A 2H1LA 5A4WA 4IGJA 2R5GA 2QKEA 3KP9A 2R37A 2LUSA 3NOFA 4I5QA 4TRXA 3HJOA 1S3AA 2X99A 5BMUB 1TDIA 4GSNA 2DJJA 1OKDA 1THOA 2KP1A 3PINA 1AUCA 4CW9A 1HQOA 1YEPA 2O89A 5B8BA 3UEMA 3FZ5A 4TXVA 4FQUA 3CTFA 1GSUA 3GSSA 3Q6OA 1MDKA 2VUPA 1ILOA 5BMUA 2E2MA 4JEDA 2ZCTA 4HU7A 2H19A 2VLTA 1GTUA 2EIRA 1FB6A 1TRVA 1VF1A 2NPBA 3UL3A 1DUGA 5ECSA 3CWGA 2JACA 5KN0A 4L5LA 5D73A 1PGTA 2DKHA 5A34B 5C00A 1EWXA 5CRWA 3W8JA 1SKWB 1PRXA 1SK2A 3D4TA 3G7YA 4XRAA 1WMJA 4LLRA 1H75A 1MTCA 3TGZA 1M9BA 3TJJA 2H75A 4WBJA 3LQ7A 4DEJA 4NWYA 5A34A 3BCIA 3FR3A 2VL9A 3IRAA 20GSA 3UBKA 1K3LA 3ZVJA 2C80A 4RUVA 4OO5A 2PMTA 4JZQA 3G7JA 2CAIA 5AGYA 3APSA 5GSSA 2B7KA 1NHYA 3TU3B 3FYGA 1N25A 4ZBBA 3D4MA 2X8CA 2TRXA 4ZXGA 4HOJA 4MDCA 4WF5A 1K0MA 3IK7A 1WIKA 4ZB9A 4HS1A 4AKIA 4XS6A 4K7NA 3KM6A 3LWAA 4WEYA 3MAKA 3VPQA 1TW9A 1TXUA 5KN3A 2CX4A 2LQQA 1YEXA 4ECJA 3ZTLA 4L0UA 4AKGA 3ZFBA 2YZUA 3RPPA 4F03A 5DQSA 2JZTA 2RIIA 5J9BA 1Y1UA 10GSA 5J9CA 2OJLA 4KDUA 3Q18A 4G0KA 5HR1A 2A2PA 1V98A 1YKAA 3DEXA 1XWKA 2P31A 2IFQA 3I69A 4GTUA 1JZOA 3C73A 3FZ4A 1BG1A 3GV1A 3L78A 2V2GA 4NHWA 1OAZA 4ILFA 4MP4A 3CSHA 4PNGA 1FVKA 1PSQA 4IQAA 3BD2A 4NXIA 5C04A 2H30A 5LNKe 4IVFA 2G0FA 2H1BA 1AW9A 4BWSA 1PX6A 3A2WA 3IE3A 3M0FA 1A0RP 2PVOC 3CSJA 5HFKA 1Y6EA 2HRFA 1UC7A 3GKMA 3HZ4A 2MBTA 5DQYA 1SJZA 3IHGA 1AC1A 3FMWA 11GSA 3FW2A 2AHEA 1WP0A 1J9BA 2YNXA 2PVQA 1V9WA 2A2SA 5ECOB 2CZ3A 1F6MC 1TOFA 3LJRA 4TR4A 5IPGA 2JU5A 1X5DA 3P8WA 3LXZA 1TJDA 1T3BA 3VWUA 3W6GA 2TIRA 4HZ4A 3HVSA 4OFNA 1NW2A 2OBKA 2HXKA 4V1Ap 3FZ9A 2X49A 1EV9A 3O6TA 1XWGA 1M99A 2YPMA 2EIOA 2O85A 1GSYA 2DSAA 2IIYA 1ZYEA 3F8UA 2IPAA 4Z2UA 4OO4A 3N5OA 3CXGA 1B4PA 3O3TA 3H79A 1QQ2A 2YZHA 2B5EA 4PQHA 1SK1A 5A5HB 5ECQB 3W8SA 1G6YA 3GIXA 1VF4A 2O87A 2UV8G 3GX8A 4KAEA 4I8BA 5HFIA 4TR1A 1R7HA 2VCVA 1YVLA 3DGQA 5D9WA 1HD2A 3ZFLA 5A5HA 3PPUA 3EU4A 4ZBDA 1Q4JA 3IPZA 4HQSA 3VURA 2WULA 1BAYA 2PGTA 2YV9A 4X0XA 2HSMB 4MJEA 5CP1A 5IO0A 1VF3A 4RQRA 5HFGA 2MMNA 2PPTA 4FIWA 4N0ZA 3UAPA 3JCML 2X4AA 1AXDA 1T4ZA 3LG6A 3F4TA 3GTUB 1KTEA 3Q74A 4J57E 2LEGA 1FO5A 3TJBA 1PX7A 2B1KA 2L5OA 3WT2A 2A2RA 2F8AA 3M3MA 5IOXA 4JRRA 3MIXA 2N5AA 3GTUA 2X64A 4IKHA 3HZ8A 4K5RA 5GSTA 2H6XA 1K0OA 1OE7A 2AYTA 2YP6A 2C3QA 3VI7A 3GFKA 4WF4A 1M2DA 4XTSA 1XXUA 4RQXA 2L5LA 5DALB 4KA0A 5G31A 2IWTA 3UARA 1AQWA 2YJHA 3RPNA 4KB3A 2OA7A 5DALA 2DBCA 4XHMA 2WRTA 3L9UA 4KCAA 4JR6A 3GX0A 1CQHA 2FWHA 4F9ZA 3VK9A 4G01A 5AISA 1ZOFA 3QAGA 4YQVA 3LEFA 4ZILA 2H76A 1XVWA 2O5VA 2AB6A 3U6VA 4MNNA 2AJQB 1JHBA 2GDRA 4BVYB 1SVOA 1EGRA 1MDJA 4BL7B 5E4WA 4WBRD 2C3TA 3UOMA 2XC2A 2B5XA 4GDFA 2XHFA 2K8VA 1RQMA 3BCKA 2DIYA 2MMZA 5H5QA 2L6DA 2LTKA 2V6KA 1BX9A 2GSTA 1ERTA 3IXRA 4BVYA 9GSSA 1FVJA 5CAXA 4MJAA 3A5IA 4TR0A 3FY7A 3TJGA 2DIZA 3I43A 3GH6A 1TI1A 1QGVA 5HR0A 1FW1A 1TU7A 2YV7A 1OE8A 3WGXA 2BTOT 4HUAA 3KMOA 3M9JA 2VLUA 4QL7A 3TKRA 1SJIA 3M9KA 5EVOA 3CMIA 2GQKA 3GUSA 4G19A 2X8GA 2HI7A 2MMOA 2GT5A 1FAAA 3QOUA 5JWRB 3A5WA 1Z5YE 1K0CA 2ZUPA 4K0GA 2ZNMA 4FYCA 5IM9A 3C8EA 1EV4A 4GF0A 2IMKA 2V41A 3PR8A 2HLSA 2HSNB 3HKRA 2O7KA 2C3NA 2LV3A 2O8VB 5IMCA 2VLVA 1PL2A 4EIPA 2LRTA 3F6FA 5IOWA 1F9MA 2R0PA 1U87A 2HSNA 1ABAA 1F37A 3VPTA 1XIYA 3BBYA 2JL4A 2CQ9A 2H0HA 2GGTA 1GP1A 5AN1A 2GQMA 2V6OA 1K0AA 4P3YB 2CAQA 1EOHA 3IBHA 5G1LA 1ERWA 4GQCA 1XWCA 4ZIJA 3ZMKA 4EL1A 2LNSA 4MK3A 2H71A 3FHKA 4DVCA 1QUWA 3G7IA 4EO3A 2V32A 4POLA 1HNBA 2KHPA 1S3CA 3FZAA 2FD3A 3GN3A 3WGEA 2FY6A 3HJMA 4USSA 2NBSA 4K5SA 3D21A 3FR6A 2R0CA 2LSTA 3I9V2 4OFTA 3EURA 3GKKA 8GSSA 3IV4A 2L6CA 1UVZA 3QCPA 22GSA 1OKTA 4MMMA 2HNLA 1K0DA 4CHSA 2VIMA 2GSSA 3OR5A 2FWFA 1GUKA 5IMDA 3IAM2 4MF6A 1V40A 4N3ZA 4K1FA 3TRQA 5D8IA 1HYUA 14GSA 1B9YC 4KDYA 4KF9A 3QFAC 4TOPA 4IN0A 2M72A 2VM1A 5GZZB 2XBQA 4O5QA 6GSYA 4N0VA 3TKQA 2DJ1A 3FK8A 5ECNB 3CRUA 2NTOA 3H1NA 3I6AA 3J7Yk 5A1NB 1A2LA 4I2TA 2RUFA 5B6MA 5ELAA 1GNWA 2LJAA 3DRNA 4L8EA 1SD9A 3VI5A 2JADA 2IMEA 5F8BA 4N10A 5ECMB 1EP7A 1AAZA 4I2UA 4IQ1A 4ZL9A 2BMXA 5A1NA 1PQNA 2LNTA 5LD0A 2CVBA 5F0GA 4ULXA 4IP1A 3TJKA 1NSWA 1N2AA 2IMIA 3GMFA 4KNDA 5GAND 3DMLA 3HXSA 3EU3A 4EDZA 4EIQA 4GSSA 5HR2A 2I9HA 1J0FA 3KZQA 2DC5A 1OC9B 5G5FA 3FR9A 4Q5QA 4FO5A 2FWGA 1I9DA 3IA1A 1T7PB 1TRWA 4POMA 1SVMA 2H1DA 2I3YA 2QC7A 4Z7XA 2WB9A 2FCHA 4ACSA 1X0RA 4AI6A 4OCFA 4FYUA 4OD7A 1V58A 2F51A 5B8AA 2OT3A 5DVBA 1XVQA 3D6IA 5COHA 3H4KA 3L9VA 4N11A 4G9HA 3HD5A 5CYYA 1QFNA 3SWLA 2HFDA 1ON4A 3C1RA 4OCEA 18GSA 5IQYA 3EMXA 3WT1A 2M80A 1O73A 2VCXA 3HMJG 5GAPD 1XBSA 2VL3A 3ZRDA 4K2XA 1S3DA 4ZB6A 1WRYA 2OE3A 1O6JA 2OADA 3EYTA 3P2AA 1LU4A 4NHZA 3QPMA 3UVHA 3GSTA 4MJCA 3VLNA 1PL1A 5JCGA 3KCMA 4AF2A 3CSIA 2MYGA 1ZYNA 4OFMA 5G30A 17GSA 2DMMA 1FOHA 2AUVA 2H0IA 3O76A 5IMAA 1O85A 1OVNA 4O32A 4NPBA 4KE3A 4J56E 4EC0A 5B7CA 2CZ2A 1W89A 4ZBAA 4FYBA 1SYRA 4TVEA 1XWBA 3MDKA 3LFLA 1X5CA 1GRXA 4KH7A 1GSFA 2PERA 5ECRB 2K8SA 4EDYA 1M0UA 1X9MB 1A23A 1EZKA 1ST9A 4PUAA 3VFIA 3TKPA 2CA8A 5JWOB 3ZMLA 13GSA 4K7OA 5CNWA 3H93A 4EF0A 1KBNA 2E7PA 2VCWA 4BVXB 5H5RA 3ED3A 4V2NA 5DJLA 1T1VA 5IMFA 3GL5A 1TU8A 1SKSB 3DYRA 3DVWA 1K0BA 2QA1A 2RUEA 4NV2A 2PN8A 4QMKA 4AKHA 3HA9A 2HT9A 1F2EA 5ABRA 5KN1A 2R6KA 3E0UA 5J4VA 1EEMA 5J40A 5ELGA 1G0TA 1AIUA 1A24A 4DSSB 4O92A 2D2ZA 1EOGA 3QD9A 4PQ1A 1SYXA 4KDXA 3GHAA 1WE0A 2HSMA 4ZL8A 2FNOA 3LXTA 1DE1A 1YDKA 4NAXA 4XS1A 1BG5A 4JBBA 4GCIA 2IJYA 4TR3A 3ERGA 2EFCA 2B6MA 1O8WA 2ES7A 3CBUA 2H74A 1K3OA 1B9XC 5FWGA 1A2JA 1BQ7A 4MZBA 5FT3A 3A2XA 3GKXA 3TOUA 3ERFA 5ECLB 3SBCA 2VCTA 3GKNA 1FOVA 3QFBC 2WJUA 4TXOB 2IN3A 5JCWA 3F4SA 2CX3A 3KTBA 5F07A 4E8EA 2AAWA 1A2MA 2LKUA 3DWVA 1ERVA 3ZITA 4JR4A 1U6TA 3C71A 2C0EA 4MZCA 4TXOA 1GUHA 2FLSA 4PX1A 1OC8A 2WCIA 2LQOA 5AIVA 3TKSE 1XPVA 2FHEA 2FGXA 3TKSC 1GUMA 4GLTA 3N9JA 4NMUA 1JLWA 2XPDA 4A5PA 3KP8A 2R3XA 3P90A 2H73A 4K7IA 4YH2A 4EXJA 4POBA 6GSSA 2J23A 4V1Ag 5IO2A 1IYHA 2YWNA 3TUEA 4KSMA 6GSUA 2MMAA 1ZYQB 1U3AA 2JZRA 4NV5A 1SU9A 2HYXA 5J4UA 1GTAA 3APQA 4DSQA 4YKGA 3P7XA 4W66A 3GL3A 2G2QA 4BL7A 5G5EA 3ME7A 3ZZXA 1M2BA 1X9WB 5DAKB 5IMZA 1J08A 4GXZA 2WDUA 5B6NA 4F0CA 1T00A 1A8LA 5CREA 2EFDA 3KGKA 2F3MA 5IIZA 1N8JA 1NHOA 2H6ZA 4MA9A 3HVXA 1SD8A 3TJFA 2OBIA 5ID2B 4WR5A 3C7MA 2PBJA 2HRAA 2WFCA 1G7EA 3MNGA 1YY7A 1V2AA 2HSYA 4IJIA 4IBPA 3GRXA 5ID2A 2GSRA 5ENUA 5IPHA 4PGTA 2DLXA 2HZEB 1H4OA 2WGRA 2OE0A 5CRDA 4EVMA 3QMXA 4YAVA 2VM2A 1FG4A 3D5JA 4HQZA 2DJ2A 3BOAA 4ML6A 1ZL9A 2DJ0A 3LORA 2F9SA 2HZEA 4DSRA 3QAVA 2C0DA 2PWJA 1LJRA 1URMA 2H66A 3F4RA 2VCQA 1XWAA 3DIEA 4I97A 2GVPA 4AGSA 1GSEA 2YWOA 3D22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLX A;  2H01 A;  3UVT A;  3LYK A;  3TOT A;  5LCZ A;  3GA4 A;  3NIV A;  1U3I A;  4GWR A;  5HR3 A;  1EGO A;  1R5P A;  5ECH B;  3RAZ A;  1B8X A;  1USB A;  1UN2 A;  3TRX A;  3ZYW A;  1R5A A;  3IK9 A;  4HDE A;  2P5R A;  3LYP A;  2CVD A;  4YQU A;  3HHV A;  2OKA A;  1WWJ A;  1TK0 B;  4G10 A;  1XOB A;  2OE1 A;  2VL2 C;  5EL8 A;  3EVI A;  3V1W A;  5AIX A;  4MZW A;  3HVV A;  4QQ7 A;  2VO4 A;  1WOU A;  4PUR A;  2XBI A;  2LS5 A;  4AJ8 A;  2A4V A;  1HNA A;  2K18 A;  1GH2 A;  2HE3 A;  4KGI A;  1BED A;  2GSQ A;  2GQL A;  1TXX A;  4WXT A;  4HZ2 A;  2VCZ A;  2JSY A;  3VWX A;  5DBQ A;  4TW5 A;  4G0L A;  1Z9H A;  4IEL A;  2H72 A;  1YJ6 A;  1GL8 A;  3U5R E;  3PH9 A;  4JE1 A;  4MCU A;  1MEK A;  3HY2 A;  4G0I A;  3HYP A;  5DCH A;  2K6V A;  2YCD A;  2VD1 A;  4XRD A;  1V57 A;  1F3B A;  5G2Z A;  1U88 A;  3DVX A;  2MBS A;  1E2Y A;  2GLR A;  1A8Y A;  3R3E A;  3KD0 A;  4JU5 A;  1ZZY A;  3KH9 A;  4I6X A;  3TKS A;  2CVK A;  2GS3 A;  2H0G A;  3TCO A;  2WS2 A;  4YAP A;  3KXO A;  1Z7P A;  4RI7 A;  1VF2 A;  3UIW A;  3FEU A;  2QGV A;  4MH2 A;  16GS A;  1THX A;  1TKD B;  2MZC A;  3EWL A;  2IMD A;  2OAC A;  1QK8 A;  3ZL5 A;  1MDI A;  1GWC A;  3GUR A;  1YZX A;  1R4W A;  1VRS D;  4XCS A;  2H70 A;  4KX4 A;  2AV4 A;  5FHI A;  5KN2 A;  4HJ2 A;  1O7U A;  1W4V A;  2HZF A;  5J41 A;  3DD3 A;  2BJX A;  3ZRE A;  2REM A;  1BYE A;  4WET A;  3L4N A;  5A5K A;  1PKZ A;  1JFU A;  1X5E A;  3BJ5 A;  1PA3 A;  1ML6 A;  5A4V A;  1IYI A;  1OC9 A;  2LJR A;  2IFQ B;  1T8E B;  2I4A A;  3IC4 A;  3QR6 A;  2C8U A;  4LMV A;  3EE2 A;  2Z9S A;  4L0W A;  3DXB A;  2ON5 A;  4F2I A;  1TRS A;  4BPY A;  3AY8 A;  3F3Q A;  3WGD A;  4WKW A;  3IC8 A;  3MSZ A;  1K3Y A;  3RDW A;  2GTU A;  1GSQ A;  2B5Y A;  3D0Z A;  3A3T A;  4QL9 A;  5ECI B;  3ZVJ D;  2B7J A;  4IS0 A;  1MD4 A;  5EY6 A;  6GSW A;  5A4U A;  2GZY A;  4CDO A;  5H5S A;  1TK8 B;  4H86 A;  3ME8 A;  1PN9 A;  2XPE A;  4AJ7 A;  3L0H A;  3MWH A;  1JZD A;  1HNC A;  1BJX A;  4MPF A;  2H1G A;  1YQ1 A;  3KJY A;  4O7H A;  4IJ3 A;  2GT6 A;  1Z7R A;  4K0N A;  3KTL A;  3EMP A;  3IOS A;  5EPF A;  1E6B A;  1Q98 A;  4GST A;  3VWV A;  4IP6 A;  2YWM A;  3C1S A;  4XS4 B;  4HI7 A;  1XW5 A;  3LSZ A;  1F3A A;  2M46 A;  2KUC A;  5ECK B;  2B3S A;  4EKZ A;  1DSB A;  3Q19 A;  2RM5 A;  2VL2 A;  3UMA A;  3GNJ A;  2V1M A;  2CV4 A;  6GSX A;  4FH8 A;  2PU9 C;  5CO3 A;  4XS4 A;  1B4Q A;  1EP8 A;  3NZN A;  1XW9 A;  4MPG A;  1XOA A;  3ERW A;  1SK0 A;  2YAN A;  4HU9 A;  1O81 A;  2H8L A;  4TR1 B;  2E0Q A;  4IW9 A;  4BVX A;  2FA4 A;  3ZIV A;  2EC4 A;  4HEA 2;  4K6X A;  1YF0 A;  3CRT A;  4LL4 B;  4Q5F A;  3TRP A;  2KP2 A;  2YWI A;  1T4Y A;  4MF5 A;  4OWY A;  4AJ6 A;  4Q5R A;  2R4V A;  3HCZ A;  2L4C A;  2TRC P;  2VAF A;  1WJK A;  2YOI A;  4V2L A;  4MLY A;  1GSD A;  1I5G A;  1ERU A;  4YQM A;  2JSZ A;  2PUK C;  4IHU A;  3KMN A;  4ZL7 A;  3L9S A;  4EUY A;  2E2G A;  2B1L A;  3FRC A;  5D9V A;  1K0N A;  2EIQ A;  4KCE A;  1Z3E A;  4V2M A;  3F63 A;  4DSS A;  2WZ9 A;  1XCC A;  1NM3 A;  2HRK B;  12GS A;  4F0B A;  4LL1 B;  3K8N A;  2YN1 A;  4O5R A;  1KNG A;  3F6D A;  1TRU A;  4PTS A;  4K8M A;  1YKC A;  2H1A A;  2RM6 A;  3RHC A;  3ISO A;  4RI6 A;  1MD3 A;  1TK5 B;  1AQX A;  4D73 B;  5CRH A;  2HRK A;  2VOC A;  3RBT A;  1SKR B;  4LMW A;  1X9S B;  3IR4 A;  1M9A A;  2HQT A;  1SL2 B;  1TI3 A;  3E3E A;  1FHE A;  4X1U A;  5D93 A;  4BA7 A;  2ON7 A;  4D73 A;  7GSS A;  5HQP A;  4MH3 A;  4TKY A;  3M8N A;  1O8X A;  4KW6 A;  5J5N A;  2H6Y A;  1QMV A;  3QDN A;  1OYJ A;  2LRN A;  1KEB A;  4F82 A;  5F05 A;  1Z6N A;  4GRF A;  2C1Y A;  2HRN A;  3UJ1 A;  3CTG A;  4X43 A;  6GST A;  4WR4 A;  4OMV A;  2NDO A;  1XW6 A;  2DML A;  1G7O A;  1DE2 A;  3S9F A;  3E9J B;  2FWE A;  1SL1 B;  1TP9 A;  5KEJ A;  1CQG A;  1RK4 A;  1JZW A;  4ML1 A;  2I1U A;  4LA1 A;  2FA8 A;  3QAW A;  5J3R A;  3WYW A;  4E8H A;  5F06 A;  5ECP B;  1G6W A;  2C0F A;  3TDG A;  2VD0 A;  1GTB A;  4EE0 A;  1XFL A;  2L4Q A;  5E59 A;  4J2F A;  1PMT A;  4BWQ A;  5JCU A;  1SJ6 A;  1C72 A;  5DCG A;  3APO A;  3FKF A;  5JWQ B;  4KUN A;  1GSS A;  3HJP A;  3F9U A;  2L57 A;  1WPI A;  4K9Z A;  1EEJ A;  1ZCP A;  2RLI A;  4Q5N A;  4G2E A;  4HJM A;  4GQF A;  4MAB A;  5DAK A;  5D9X A;  1M2A A;  1ZGN A;  1JZR A;  1YF1 A;  4MJB A;  2P5Q A;  2JZS A;  4PXO A;  4MF7 A;  6GSV A;  3VWW A;  3M1G A;  2YJ7 A;  2UZ8 A;  2J9H A;  4ISD A;  1OC3 A;  4ECI A;  1M7T A;  4ZB8 A;  1B48 A;  2C0G A;  4TN8 A;  3CYN A;  1Y25 A;  1QXH A;  1AQV A;  2K9F A;  5L71 A;  3IDV A;  2FUG 2;  5IMV A;  1ZMA A;  1GLQ A;  2DJ3 A;  1PD2 1;  5DJM A;  3GYK A;  4XIH A;  1GNE A;  2KOK A;  3KH7 A;  3IAS 2;  2I81 A;  5INY A;  3RHB A;  5G1K A;  1GTI A;  2LJK A;  3G9B A;  1SL0 B;  3KEB A;  3HDC A;  2DJK A;  1LBK A;  2IMF A;  5D9T A;  1GUL A;  2HSH A;  4PUF C;  1ACV A;  2L59 A;  1RW1 A;  4POK A;  1XZO A;  2P0G A;  3GH9 A;  1TTZ A;  2LRC A;  1DBY A;  4PNF A;  3DKS A;  2R2J A;  3WD6 A;  4PQI A;  4ECB A;  2N5B A;  1SEN A;  19GS A;  2F8F A;  3R2Q A;  3ZLP A;  4L5O A;  2QSI A;  1FB0 A;  2N5F A;  2NVL A;  2X8H A;  5D96 A;  3H8Q A;  3KIJ A;  3ZIJ A;  2GZP A;  3LGC A;  3J7Y b;  4N30 A;  5DDL A;  3EC3 A;  1Z6M A;  1UA5 A;  2CT6 A;  3TB2 A;  1PKW A;  2C4J A;  3UBL A;  2IL3 A;  3PGT A;  1GLP A;  4ECC A;  1R26 A;  1A0F A;  3F3R A;  2GZZ A;  3IHQ A;  3A2V A;  3F0I A;  4KSO A;  1VGL A;  2ALB A;  3EIN A;  4ID0 A;  5CRG A;  1JLV A;  4K2D A;  3US3 A;  5A4W A;  4IGJ A;  2R5G A;  2QKE A;  3KP9 A;  2R37 A;  2LUS A;  3NOF A;  4I5Q A;  4TRX A;  3HJO A;  1S3A A;  2X99 A;  1TDI A;  4GSN A;  2DJJ A;  1OKD A;  1THO A;  2KP1 A;  3PIN A;  1AUC A;  4CW9 A;  1HQO A;  1YEP A;  2O89 A;  5B8B A;  3UEM A;  3FZ5 A;  4TXV A;  4FQU A;  3CTF A;  1GSU A;  3GSS A;  3Q6O A;  1MDK A;  2VUP A;  1ILO A;  5BMU A;  2E2M A;  4JED A;  2ZCT A;  4HU7 A;  2H19 A;  2VLT A;  1GTU A;  2EIR A;  1FB6 A;  1TRV A;  1VF1 A;  2NPB A;  3UL3 A;  1DUG A;  5ECS A;  2JAC A;  5KN0 A;  4L5L A;  5D73 A;  1PGT A;  5C00 A;  1EWX A;  5CRW A;  3W8J A;  1SKW B;  1PRX A;  1SK2 A;  3D4T A;  3G7Y A;  4XRA A;  1WMJ A;  4LLR A;  1H75 A;  1MTC A;  3TGZ A;  1M9B A;  3TJJ A;  2H75 A;  4WBJ A;  3LQ7 A;  4DEJ A;  4NWY A;  3FR3 A;  2VL9 A;  3BCI A;  3IRA A;  20GS A;  3UBK A;  1K3L A;  3ZVJ A;  2C80 A;  4RUV A;  4OO5 A;  2PMT A;  4JZQ A;  3G7J A;  2CAI A;  5AGY A;  3APS A;  5GSS A;  2B7K A;  1NHY A;  3FYG A;  4ZBB A;  3D4M A;  2X8C A;  2TRX A;  4ZXG A;  4HOJ A;  4MDC A;  4WF5 A;  1K0M A;  3IK7 A;  1WIK A;  4ZB9 A;  4HS1 A;  4XS6 A;  4K7N A;  3KM6 A;  3LWA A;  4WEY A;  3MAK A;  3VPQ A;  1TW9 A;  5KN3 A;  2CX4 A;  2LQQ A;  1YEX A;  4ECJ A;  3ZTL A;  4L0U A;  3ZFB A;  2YZU A;  3RPP A;  4F03 A;  5DQS A;  2JZT A;  2RII A;  5J9B A;  10GS A;  5J9C A;  2OJL A;  4KDU A;  3Q18 A;  4G0K A;  5HR1 A;  1V98 A;  1YKA A;  3DEX A;  1XWK A;  2P31 A;  2IFQ A;  3I69 A;  4GTU A;  1JZO A;  3C73 A;  3FZ4 A;  3GV1 A;  3L78 A;  2V2G A;  4NHW A;  1OAZ A;  4ILF A;  4MP4 A;  3CSH A;  4PNG A;  1FVK A;  1PSQ A;  4IQA A;  3BD2 A;  4NXI A;  5C04 A;  2H30 A;  5LNK e;  4IVF A;  2G0F A;  2H1B A;  1AW9 A;  4BWS A;  1PX6 A;  3A2W A;  3IE3 A;  3M0F A;  1A0R P;  2PVO C;  3CSJ A;  5HFK A;  1Y6E A;  2HRF A;  1UC7 A;  3GKM A;  3HZ4 A;  2MBT A;  5DQY A;  1SJZ A;  1AC1 A;  11GS A;  3FW2 A;  2AHE A;  1WP0 A;  1J9B A;  2YNX A;  2PVQ A;  1V9W A;  2A2S A;  5ECO B;  2CZ3 A;  1F6M C;  1TOF A;  3LJR A;  4TR4 A;  5IPG A;  2JU5 A;  1X5D A;  3P8W A;  3LXZ A;  1TJD A;  1T3B A;  3VWU A;  3W6G A;  2TIR A;  4HZ4 A;  3HVS A;  4OFN A;  1NW2 A;  2OBK A;  2HXK A;  4V1A p;  3FZ9 A;  1EV9 A;  3O6T A;  1XWG A;  1M99 A;  2YPM A;  2EIO A;  2O85 A;  1GSY A;  2DSA A;  2IIY A;  1ZYE A;  3F8U A;  2IPA A;  4OO4 A;  3N5O A;  3CXG A;  1B4P A;  3O3T A;  3H79 A;  1QQ2 A;  2YZH A;  2B5E A;  4PQH A;  1SK1 A;  5ECQ B;  3W8S A;  1G6Y A;  3GIX A;  1VF4 A;  2O87 A;  3GX8 A;  4KAE A;  4I8B A;  5HFI A;  4TR1 A;  1R7H A;  2VCV A;  3DGQ A;  5D9W A;  1HD2 A;  3ZFL A;  3PPU A;  3EU4 A;  4ZBD A;  1Q4J A;  3IPZ A;  4HQS A;  3VUR A;  2WUL A;  1BAY A;  2PGT A;  2YV9 A;  4X0X A;  2HSM B;  4MJE A;  5CP1 A;  5IO0 A;  1VF3 A;  4RQR A;  5HFG A;  2MMN A;  2PPT A;  4FIW A;  4N0Z A;  3UAP A;  3JCM L;  1AXD A;  1T4Z A;  3LG6 A;  3F4T A;  3GTU B;  1KTE A;  3Q74 A;  4J57 E;  2LEG A;  1FO5 A;  3TJB A;  1PX7 A;  2B1K A;  2L5O A;  3WT2 A;  2A2R A;  2F8A A;  3M3M A;  5IOX A;  4JRR A;  2N5A A;  3GTU A;  2X64 A;  4IKH A;  3HZ8 A;  5GST A;  2H6X A;  1K0O A;  1OE7 A;  2AYT A;  2YP6 A;  2C3Q A;  3VI7 A;  3GFK A;  4WF4 A;  1M2D A;  4XTS A;  1XXU A;  4RQX A;  2L5L A;  5DAL B;  4KA0 A;  5G31 A;  2IWT A;  3UAR A;  1AQW A;  2YJH A;  3RPN A;  4KB3 A;  2OA7 A;  5DAL A;  2DBC A;  4XHM A;  2WRT A;  3L9U A;  4KCA A;  4JR6 A;  3GX0 A;  1CQH A;  2FWH A;  4F9Z A;  3VK9 A;  5AIS A;  1ZOF A;  3QAG A;  4YQV A;  3LEF A;  4ZIL A;  2H76 A;  1XVW A;  2AB6 A;  3U6V A;  2AJQ B;  1JHB A;  2GDR A;  4BVY B;  1EGR A;  1MDJ A;  4BL7 B;  5E4W A;  4WBR D;  2C3T A;  3UOM A;  2XC2 A;  2B5X A;  2XHF A;  2K8V A;  1RQM A;  3BCK A;  2DIY A;  2MMZ A;  5H5Q A;  2L6D A;  2LTK A;  2V6K A;  1BX9 A;  2GST A;  1ERT A;  3IXR A;  4BVY A;  9GSS A;  1FVJ A;  5CAX A;  4MJA A;  4TR0 A;  3FY7 A;  3TJG A;  2DIZ A;  3I43 A;  3GH6 A;  1TI1 A;  1QGV A;  5HR0 A;  1FW1 A;  1TU7 A;  2YV7 A;  1OE8 A;  3WGX A;  2BTO T;  4HUA A;  3KMO A;  3M9J A;  2VLU A;  4QL7 A;  3TKR A;  1SJI A;  3M9K A;  5EVO A;  3CMI A;  2GQK A;  3GUS A;  4G19 A;  2X8G A;  2HI7 A;  2MMO A;  2GT5 A;  1FAA A;  3QOU A;  5JWR B;  3A5W A;  1Z5Y E;  1K0C A;  2ZUP A;  4K0G A;  2ZNM A;  4FYC A;  5IM9 A;  3C8E A;  1EV4 A;  4GF0 A;  2IMK A;  2V41 A;  3PR8 A;  2HLS A;  2HSN B;  3HKR A;  2O7K A;  2C3N A;  2LV3 A;  2O8V B;  5IMC A;  2VLV A;  1PL2 A;  2LRT A;  3F6F A;  5IOW A;  1F9M A;  1U87 A;  1ABA A;  1F37 A;  3VPT A;  1XIY A;  3BBY A;  2JL4 A;  2CQ9 A;  2H0H A;  2GGT A;  1GP1 A;  5AN1 A;  2GQM A;  2V6O A;  1K0A A;  4P3Y B;  2CAQ A;  1EOH A;  3IBH A;  5G1L A;  1ERW A;  4GQC A;  1XWC A;  4ZIJ A;  3ZMK A;  4EL1 A;  2LNS A;  4MK3 A;  2H71 A;  3FHK A;  4DVC A;  1QUW A;  3G7I A;  4EO3 A;  2V32 A;  4POL A;  1HNB A;  2KHP A;  1S3C A;  3FZA A;  2FD3 A;  3GN3 A;  3WGE A;  2FY6 A;  3HJM A;  4USS A;  2NBS A;  3D21 A;  3FR6 A;  2LST A;  3I9V 2;  4OFT A;  3EUR A;  3GKK A;  8GSS A;  3IV4 A;  2L6C A;  1UVZ A;  3QCP A;  22GS A;  1OKT A;  4MMM A;  2HNL A;  1K0D A;  4CHS A;  2VIM A;  2GSS A;  3OR5 A;  2FWF A;  1GUK A;  5IMD A;  3IAM 2;  4MF6 A;  1V40 A;  4K1F A;  3TRQ A;  5D8I A;  1HYU A;  14GS A;  1B9Y C;  4KDY A;  4KF9 A;  3QFA C;  4TOP A;  4IN0 A;  2M72 A;  2VM1 A;  5GZZ B;  2XBQ A;  6GSY A;  4N0V A;  3TKQ A;  2DJ1 A;  3FK8 A;  5ECN B;  3CRU A;  2NTO A;  3H1N A;  3I6A A;  3J7Y k;  1A2L A;  4I2T A;  2RUF A;  5B6M A;  5ELA A;  1GNW A;  2LJA A;  3DRN A;  4L8E A;  1SD9 A;  3VI5 A;  2JAD A;  2IME A;  5F8B A;  4N10 A;  5ECM B;  1EP7 A;  1AAZ A;  4I2U A;  4IQ1 A;  4ZL9 A;  2BMX A;  1PQN A;  2LNT A;  5LD0 A;  2CVB A;  5F0G A;  4ULX A;  4IP1 A;  3TJK A;  1NSW A;  1N2A A;  2IMI A;  3GMF A;  4KND A;  5GAN D;  3DML A;  3HXS A;  3EU3 A;  4EDZ A;  4GSS A;  5HR2 A;  2I9H A;  1J0F A;  3KZQ A;  2DC5 A;  1OC9 B;  5G5F A;  3FR9 A;  4Q5Q A;  4FO5 A;  2FWG A;  1I9D A;  3IA1 A;  1T7P B;  1TRW A;  4POM A;  2H1D A;  2I3Y A;  2QC7 A;  4Z7X A;  2WB9 A;  2FCH A;  4ACS A;  1X0R A;  4OCF A;  4FYU A;  4OD7 A;  1V58 A;  2F51 A;  5B8A A;  5DVB A;  1XVQ A;  3D6I A;  5COH A;  3H4K A;  3L9V A;  4N11 A;  4G9H A;  3HD5 A;  5CYY A;  1QFN A;  3SWL A;  2HFD A;  1ON4 A;  3C1R A;  4OCE A;  18GS A;  5IQY A;  3EMX A;  3WT1 A;  2M80 A;  1O73 A;  2VCX A;  5GAP D;  1XBS A;  2VL3 A;  3ZRD A;  1S3D A;  4ZB6 A;  1WRY A;  2OE3 A;  1O6J A;  2OAD A;  3EYT A;  3P2A A;  1LU4 A;  4NHZ A;  3QPM A;  3UVH A;  3GST A;  4MJC A;  3VLN A;  1PL1 A;  5JCG A;  3KCM A;  4AF2 A;  3CSI A;  2MYG A;  4OFM A;  5G30 A;  17GS A;  2DMM A;  2AUV A;  2H0I A;  3O76 A;  5IMA A;  1O85 A;  1OVN A;  4O32 A;  4NPB A;  4KE3 A;  4J56 E;  4EC0 A;  5B7C A;  2CZ2 A;  1W89 A;  4ZBA A;  4FYB A;  1SYR A;  4TVE A;  1XWB A;  3MDK A;  3LFL A;  1X5C A;  1GRX A;  4KH7 A;  1GSF A;  2PER A;  5ECR B;  2K8S A;  4EDY A;  1M0U A;  1X9M B;  1A23 A;  1EZK A;  1ST9 A;  4PUA A;  3VFI A;  3TKP A;  2CA8 A;  5JWO B;  3ZML A;  13GS A;  4K7O A;  5CNW A;  3H93 A;  4EF0 A;  1KBN A;  2E7P A;  2VCW A;  4BVX B;  5H5R A;  3ED3 A;  4V2N A;  5DJL A;  1T1V A;  5IMF A;  3GL5 A;  1TU8 A;  1SKS B;  3DYR A;  3DVW A;  1K0B A;  2RUE A;  4NV2 A;  2PN8 A;  3HA9 A;  2HT9 A;  1F2E A;  5ABR A;  5KN1 A;  2R6K A;  3E0U A;  1EEM A;  5ELG A;  1G0T A;  1AIU A;  1A24 A;  4DSS B;  4O92 A;  2D2Z A;  1EOG A;  3QD9 A;  4PQ1 A;  1SYX A;  4KDX A;  3GHA A;  1WE0 A;  2HSM A;  4ZL8 A;  2FNO A;  3LXT A;  1DE1 A;  1YDK A;  4NAX A;  4XS1 A;  1BG5 A;  4JBB A;  4GCI A;  2IJY A;  4TR3 A;  3ERG A;  2B6M A;  1O8W A;  2ES7 A;  3CBU A;  2H74 A;  1K3O A;  1B9X C;  5FWG A;  1A2J A;  1BQ7 A;  4MZB A;  5FT3 A;  3A2X A;  3GKX A;  3TOU A;  3ERF A;  5ECL B;  3SBC A;  2VCT A;  3GKN A;  1FOV A;  3QFB C;  2WJU A;  4TXO B;  2IN3 A;  5JCW A;  3F4S A;  2CX3 A;  3KTB A;  5F07 A;  4E8E A;  2AAW A;  1A2M A;  2LKU A;  3DWV A;  1ERV A;  3ZIT A;  4JR4 A;  1U6T A;  3C71 A;  2C0E A;  4MZC A;  4TXO A;  1GUH A;  2FLS A;  4PX1 A;  1OC8 A;  2WCI A;  2LQO A;  5AIV A;  3TKS E;  1XPV A;  2FHE A;  2FGX A;  3TKS C;  1GUM A;  4GLT A;  3N9J A;  4NMU A;  1JLW A;  2XPD A;  3KP8 A;  2R3X A;  3P90 A;  2H73 A;  4K7I A;  4YH2 A;  4EXJ A;  4POB A;  6GSS A;  2J23 A;  4V1A g;  5IO2 A;  1IYH A;  2YWN A;  3TUE A;  4KSM A;  6GSU A;  2MMA A;  1ZYQ B;  1U3A A;  2JZR A;  4NV5 A;  1SU9 A;  2HYX A;  5J4U A;  1GTA A;  3APQ A;  4DSQ A;  3P7X A;  3GL3 A;  2G2Q A;  4BL7 A;  5G5E A;  3ME7 A;  3ZZX A;  1M2B A;  1X9W B;  5DAK B;  5IMZ A;  1J08 A;  4GXZ A;  2WDU A;  5B6N A;  4F0C A;  1T00 A;  1A8L A;  5CRE A;  3KGK A;  2F3M A;  5IIZ A;  1N8J A;  1NHO A;  2H6Z A;  4MA9 A;  3HVX A;  1SD8 A;  3TJF A;  2OBI A;  5ID2 B;  4WR5 A;  3C7M A;  2PBJ A;  2HRA A;  2WFC A;  1G7E A;  3MNG A;  1YY7 A;  1V2A A;  2HSY A;  4IJI A;  4IBP A;  3GRX A;  5ID2 A;  2GSR A;  5ENU A;  5IPH A;  4PGT A;  2DLX A;  2HZE B;  1H4O A;  2WGR A;  2OE0 A;  5CRD A;  4EVM A;  3QMX A;  4YAV A;  2VM2 A;  1FG4 A;  3D5J A;  4HQZ A;  2DJ2 A;  3BOA A;  4ML6 A;  1ZL9 A;  2DJ0 A;  3LOR A;  2F9S A;  2HZE A;  4DSR A;  3QAV A;  2C0D A;  2PWJ A;  1LJR A;  1URM A;  2H66 A;  3F4R A;  2VCQ A;  1XWA A;  3DIE A;  4I97 A;  2GVP A;  4AGS A;  1GSE A;  2YWO A;  3D22 A; 
#chains in the Genus database with same CATH topology
 2KLX A;  2H01 A;  3UVT A;  3LYK A;  3TOT A;  5LCZ A;  3GA4 A;  3NIV A;  1U3I A;  4GWR A;  5HR3 A;  1EGO A;  1R5P A;  5ECH B;  3RAZ A;  1B8X A;  1USB A;  1UN2 A;  3TRX A;  3ZYW A;  1R5A A;  3IK9 A;  4HDE A;  2P5R A;  3LYP A;  2CVD A;  4YQU A;  3HHV A;  2OKA A;  1WWJ A;  1TK0 B;  4G10 A;  1XOB A;  2OE1 A;  2VL2 C;  5EL8 A;  3EVI A;  3V1W A;  5AIX A;  3RFR C;  4MZW A;  3HVV A;  4QQ7 A;  5KOX A;  2VO4 A;  1WOU A;  4PUR A;  2XBI A;  2LS5 A;  4AJ8 A;  2A4V A;  1HNA A;  2K18 A;  1GH2 A;  2HE3 A;  4KGI A;  1BED A;  2GSQ A;  2GQL A;  1ZYP A;  1TXX A;  4WXT A;  4HZ2 A;  2VCZ A;  2JSY A;  3VWX A;  5DBQ A;  4TW5 A;  4G0L A;  1Z9H A;  4IEL A;  2H72 A;  1M3I A;  1YJ6 A;  1GL8 A;  3U5R E;  3PH9 A;  4Z2R A;  4JE1 A;  4MCU A;  1MEK A;  3HY2 A;  4G0I A;  3HYP A;  5DCH A;  2K6V A;  2YCD A;  2VD1 A;  4XRD A;  1V57 A;  1F3B A;  5G2Z A;  1U88 A;  3DVX A;  2MBS A;  1E2Y A;  2GLR A;  1A8Y A;  3R3E A;  3KD0 A;  4JU5 A;  1ZZY A;  3KH9 A;  4ZB7 A;  4I6X A;  3TKS A;  2CVK A;  2GS3 A;  1SVL A;  2H0G A;  3TCO A;  2WS2 A;  4YAP A;  3KXO A;  1Z7P A;  4RI7 A;  1VF2 A;  3UIW A;  3FEU A;  2QGV A;  4MH2 A;  16GS A;  1THX A;  1TKD B;  2MZC A;  3EWL A;  2IMD A;  2OAC A;  1QK8 A;  3ZL5 A;  1MDI A;  1GWC A;  3GUR A;  1YZX A;  4Z2T A;  1R4W A;  2EFH A;  4BIK A;  1VRS D;  4XCS A;  2H70 A;  4KX4 A;  2AV4 A;  5FHI A;  5KN2 A;  4HJ2 A;  1O7U A;  1W4V A;  2HZF A;  5J41 A;  3DD3 A;  2BJX A;  3ZRE A;  2REM A;  1BYE A;  4WET A;  3L4N A;  5A5K A;  1PKZ A;  1JFU A;  1X5E A;  3BJ5 A;  1PA3 A;  1ML6 A;  5A4V A;  1IYI A;  3MYD A;  1OC9 A;  2LJR A;  2IFQ B;  1T8E B;  2I4A A;  3IC4 A;  3QR6 A;  2C8U A;  4LMV A;  3EE2 A;  2Z9S A;  2QA2 A;  4L0W A;  3DXB A;  2ON5 A;  4F2I A;  1TRS A;  4BPY A;  3AY8 A;  3F3Q A;  3WGD A;  4WKW A;  3IC8 A;  3MSZ A;  1K3Y A;  3RDW A;  2GTU A;  1GSQ A;  2B5Y A;  3D0Z A;  3A3T A;  4FXY P;  4QL9 A;  5ECI B;  3ZVJ D;  2B7J A;  2O3E A;  4IS0 A;  1MD4 A;  5EY6 A;  6GSW A;  5A4U A;  2GZY A;  4CDO A;  5H5S A;  1TK8 B;  4H86 A;  3ME8 A;  1PN9 A;  2XPE A;  4AJ7 A;  3L0H A;  3MWH A;  1JZD A;  1HNC A;  1BJX A;  4MPF A;  2H1G A;  1YQ1 A;  3KJY A;  4O7H A;  2A4H A;  4IJ3 A;  2GT6 A;  1Z7R A;  2VKZ G;  4K0N A;  4HSC X;  3KTL A;  3EMP A;  3IOS A;  5EPF A;  4E68 A;  1E6B A;  1Q98 A;  4GST A;  3VWV A;  4IP6 A;  2YWM A;  3C1S A;  4XS4 B;  4HI7 A;  2WW2 A;  1XW5 A;  3LSZ A;  1F3A A;  2M46 A;  2KUC A;  5ECK B;  2B3S A;  4EKZ A;  1DSB A;  3Q19 A;  2RM5 A;  2VL2 A;  3UMA A;  3GNJ A;  2V1M A;  2CV4 A;  1PFO A;  6GSX A;  4FH8 A;  2PU9 C;  5CO3 A;  4XS4 A;  2WVX B;  1B4Q A;  1EP8 A;  3NZN A;  1XW9 A;  4MPG A;  1XOA A;  3ERW A;  5BRT A;  4AKX B;  1SK0 A;  2YAN A;  4HU9 A;  1O81 A;  2H8L A;  4TR1 B;  2E0Q A;  4IW9 A;  4BVX A;  2FA4 A;  3ZIV A;  2EC4 A;  4HEA 2;  3LW9 A;  4K6X A;  1YF0 A;  3CRT A;  4LL4 B;  4Q5F A;  3TRP A;  2KP2 A;  2YWI A;  1T4Y A;  4MF5 A;  4OWY A;  4AJ6 A;  2EFE A;  4Q5R A;  2R4V A;  3HCZ A;  2L4C A;  2TRC P;  2VAF A;  1WJK A;  2YOI A;  4V2L A;  4MLY A;  1GSD A;  1I5G A;  1ERU A;  4YQM A;  2JSZ A;  2PUK C;  4IHU A;  4X4J A;  3KMN A;  4ZL7 A;  3L9S A;  4EUY A;  2E2G A;  2B1L A;  3FRC A;  4O5U A;  5D9V A;  1K0N A;  2EIQ A;  4ICY A;  1Z3E A;  4KCE A;  4V2M A;  3F63 A;  4DSS A;  2WZ9 A;  1XCC A;  1NM3 A;  2HRK B;  12GS A;  4F0B A;  4LL1 B;  3K8N A;  2YN1 A;  4O5R A;  1KNG A;  3F6D A;  1TRU A;  4PTS A;  4K8M A;  1YKC A;  2H1A A;  2RM6 A;  3RHC A;  3ISO A;  4RI6 A;  1MD3 A;  1TK5 B;  1AQX A;  4D73 B;  5CRH A;  2HRK A;  2VOC A;  3RBT A;  1SKR B;  4LMW A;  1X9S B;  3IR4 A;  1M9A A;  2HQT A;  1SL2 B;  1TI3 A;  3E3E A;  1FHE A;  4X1U A;  5D93 A;  4BA7 A;  2ON7 A;  4D73 A;  7GSS A;  5HQP A;  4MH3 A;  4TKY A;  3M8N A;  1O8X A;  4KW6 A;  5J5N A;  2H6Y A;  1QMV A;  3QDN A;  1OYJ A;  2LRN A;  1KEB A;  4F82 A;  5F05 A;  1Z6N A;  4GRF A;  2C1Y A;  2HRN A;  3UJ1 A;  3CTG A;  4X43 A;  6GST A;  4WR4 A;  4OMV A;  2NDO A;  1XW6 A;  2DML A;  1G7O A;  1DE2 A;  3S9F A;  3E9J B;  2FWE A;  1SL1 B;  1TP9 A;  5KEJ A;  1CQG A;  2DKI A;  1RK4 A;  1JZW A;  4ML1 A;  2I1U A;  4LA1 A;  2FA8 A;  3HVN A;  3QAW A;  5J3R A;  3WYW A;  4E8H A;  5F06 A;  5ECP B;  1G6W A;  2C0F A;  3TDG A;  2VD0 A;  1GTB A;  4EE0 A;  1XFL A;  2L4Q A;  5E59 A;  4J2F A;  1PMT A;  4BWQ A;  5JCU A;  5J47 A;  1SJ6 A;  1C72 A;  5DCG A;  3APO A;  3FKF A;  5JWQ B;  4KUN A;  1GSS A;  3HJP A;  3F9U A;  2L57 A;  1WPI A;  4K9Z A;  1EEJ A;  1ZCP A;  5J4Y A;  2RLI A;  4Q5N A;  4G2E A;  4HJM A;  4GQF A;  4MAB A;  5DAK A;  5D9X A;  1M2A A;  1ZGN A;  1JZR A;  1YF1 A;  4CY6 A;  4MJB A;  2P5Q A;  2JZS A;  4PXO A;  4MF7 A;  6GSV A;  3VWW A;  3EPT A;  3M1G A;  2YJ7 A;  2UZ8 A;  2J9H A;  4ISD A;  1OC3 A;  4ECI A;  1M7T A;  2R0G A;  4ZB8 A;  1B48 A;  2C0G A;  4TN8 A;  3CYN A;  1Y25 A;  1BF5 A;  1QXH A;  1AQV A;  2K9F A;  5L71 A;  3IDV A;  2FUG 2;  5IMV A;  5KOW A;  1ZMA A;  1GLQ A;  2DJ3 A;  1PD2 1;  5DJM A;  3GYK A;  4XIH A;  1GNE A;  2KOK A;  3KH7 A;  3IAS 2;  2I81 A;  5INY A;  3RHB A;  5G1K A;  1GTI A;  2LJK A;  3G9B A;  1SL0 B;  3KEB A;  3HDC A;  2DJK A;  1LBK A;  2IMF A;  5D9T A;  1GUL A;  2HSH A;  4PUF C;  1ACV A;  2L59 A;  1RW1 A;  4POK A;  1XZO A;  2P0G A;  3GH9 A;  1TTZ A;  2LRC A;  1DBY A;  4PNF A;  3DKS A;  2R2J A;  3WD6 A;  4PQI A;  4ECB A;  2N5B A;  1SEN A;  4YKF A;  19GS A;  4CY8 A;  2F8F A;  3R2Q A;  3ZLP A;  4L5O A;  2QSI A;  1FB0 A;  2N5F A;  2NVL A;  2X8H A;  5D96 A;  3H8Q A;  3KIJ A;  1PN0 A;  2GZP A;  3ZIJ A;  3LGC A;  3J7Y b;  4N30 A;  5DDL A;  3EC3 A;  1Z6M A;  1UA5 A;  2CT6 A;  3TB2 A;  1PKW A;  2C4J A;  3UBL A;  2IL3 A;  3PGT A;  1GLP A;  4ECC A;  1R26 A;  1A0F A;  3F3R A;  2GZZ A;  3IHQ A;  3A2V A;  3F0I A;  4KSO A;  1VGL A;  2ALB A;  3EIN A;  4ID0 A;  5CRG A;  1JLV A;  4K2D A;  3US3 A;  2H1L A;  5A4W A;  4IGJ A;  2R5G A;  2QKE A;  3KP9 A;  2R37 A;  2LUS A;  3NOF A;  4I5Q A;  4TRX A;  3HJO A;  1S3A A;  2X99 A;  5BMU B;  1TDI A;  4GSN A;  2DJJ A;  1OKD A;  1THO A;  2KP1 A;  3PIN A;  1AUC A;  4CW9 A;  1HQO A;  1YEP A;  2O89 A;  5B8B A;  3UEM A;  2WVY A;  3FZ5 A;  4TXV A;  4FQU A;  3CTF A;  1GSU A;  3GSS A;  3Q6O A;  1MDK A;  2VUP A;  1ILO A;  5BMU A;  2E2M A;  4JED A;  2ZCT A;  4HU7 A;  2H19 A;  2VLT A;  1GTU A;  2EIR A;  1FB6 A;  1TRV A;  1VF1 A;  2NPB A;  3UL3 A;  1DUG A;  5ECS A;  3CWG A;  2JAC A;  5KN0 A;  4L5L A;  5D73 A;  1PGT A;  2DKH A;  5A34 B;  5C00 A;  1S3R A;  1EWX A;  5CRW A;  3W8J A;  1SKW B;  1PRX A;  1SK2 A;  3D4T A;  3G7Y A;  4XRA A;  1WMJ A;  4LLR A;  1H75 A;  1MTC A;  3TGZ A;  1M9B A;  3TJJ A;  2H75 A;  4WBJ A;  3LQ7 A;  4DEJ A;  4NWY A;  5A34 A;  3BCI A;  3FR3 A;  2VL9 A;  3IRA A;  20GS A;  3UBK A;  1K3L A;  3ZVJ A;  2C80 A;  4RUV A;  4OO5 A;  2PMT A;  4JZQ A;  3G7J A;  2CAI A;  5AGY A;  3APS A;  5GSS A;  2B7K A;  1NHY A;  3TU3 B;  3FYG A;  1N25 A;  4ZBB A;  3D4M A;  2X8C A;  2TRX A;  4ZXG A;  4HOJ A;  4MDC A;  4WF5 A;  1K0M A;  3IK7 A;  1WIK A;  4ZB9 A;  4HS1 A;  4AKI A;  4XS6 A;  4K7N A;  3KM6 A;  3LWA A;  4WEY A;  3MAK A;  3VPQ A;  1TW9 A;  1TXU A;  5KN3 A;  2CX4 A;  2LQQ A;  1YEX A;  4ECJ A;  3ZTL A;  4L0U A;  4AKG A;  3ZFB A;  2YZU A;  3RPP A;  4F03 A;  5DQS A;  4PHZ C;  2JZT A;  2RII A;  5J9B A;  1Y1U A;  10GS A;  5J9C A;  2OJL A;  4KDU A;  3Q18 A;  4G0K A;  5HR1 A;  2A2P A;  1V98 A;  1YKA A;  3DEX A;  1XWK A;  2P31 A;  2IFQ A;  3I69 A;  4GTU A;  1JZO A;  3C73 A;  3FZ4 A;  1BG1 A;  3GV1 A;  3L78 A;  2V2G A;  4NHW A;  1OAZ A;  4ILF A;  4MP4 A;  3CSH A;  4PNG A;  1FVK A;  1PSQ A;  4IQA A;  3BD2 A;  4NXI A;  5C04 A;  2H30 A;  5LNK e;  4IVF A;  2G0F A;  2H1B A;  1AW9 A;  4BWS A;  1PX6 A;  3A2W A;  3IE3 A;  3M0F A;  1A0R P;  2PVO C;  3CSJ A;  5HFK A;  1Y6E A;  2HRF A;  1UC7 A;  3GKM A;  3HZ4 A;  2MBT A;  5DQY A;  1SJZ A;  3IHG A;  2WVZ A;  1AC1 A;  3FMW A;  11GS A;  3FW2 A;  2AHE A;  1WP0 A;  1J9B A;  2YNX A;  2PVQ A;  1V9W A;  2A2S A;  5ECO B;  2CZ3 A;  1F6M C;  1TOF A;  3LJR A;  4TR4 A;  5IPG A;  2JU5 A;  1X5D A;  3P8W A;  3LXZ A;  1TJD A;  1T3B A;  3VWU A;  3W6G A;  2TIR A;  4HZ4 A;  3HVS A;  4OFN A;  1NW2 A;  2OBK A;  2HXK A;  4V1A p;  3FZ9 A;  2X49 A;  1EV9 A;  3O6T A;  1XWG A;  1M99 A;  2YPM A;  2EIO A;  2O85 A;  1GSY A;  2DSA A;  2IIY A;  1ZYE A;  3F8U A;  2IPA A;  4Z2U A;  4OO4 A;  3N5O A;  3CXG A;  1B4P A;  2WVX A;  3O3T A;  3H79 A;  1QQ2 A;  2YZH A;  2B5E A;  4PQH A;  1SK1 A;  5A5H B;  5ECQ B;  3W8S A;  1G6Y A;  3GIX A;  1VF4 A;  2O87 A;  2UV8 G;  3GX8 A;  4KAE A;  4I8B A;  5HFI A;  4TR1 A;  1R7H A;  2VCV A;  1YVL A;  3DGQ A;  5D9W A;  1HD2 A;  3ZFL A;  5A5H A;  3PPU A;  3EU4 A;  4ZBD A;  1Q4J A;  3IPZ A;  4HQS A;  3VUR A;  2WUL A;  1BAY A;  2PGT A;  2YV9 A;  4X0X A;  2HSM B;  4MJE A;  5CP1 A;  5IO0 A;  1VF3 A;  4RQR A;  5HFG A;  2MMN A;  2WW1 A;  2PPT A;  4FIW A;  4N0Z A;  3UAP A;  3JCM L;  2X4A A;  1AXD A;  1T4Z A;  3LG6 A;  3F4T A;  3GTU B;  1KTE A;  3Q74 A;  4J57 E;  2LEG A;  1FO5 A;  3TJB A;  1PX7 A;  2B1K A;  2L5O A;  3WT2 A;  2A2R A;  2F8A A;  3M3M A;  5IOX A;  4JRR A;  3MIX A;  2N5A A;  3GTU A;  2X64 A;  4IKH A;  3HZ8 A;  4K5R A;  5GST A;  2H6X A;  1K0O A;  1OE7 A;  2AYT A;  2YP6 A;  2C3Q A;  3VI7 A;  3GFK A;  4WF4 A;  1M2D A;  4XTS A;  1XXU A;  4RQX A;  2L5L A;  5DAL B;  4KA0 A;  5G31 A;  2IWT A;  3UAR A;  1AQW A;  2YJH A;  3RPN A;  4KB3 A;  2OA7 A;  5DAL A;  2DBC A;  4XHM A;  2WRT A;  3L9U A;  4KCA A;  4JR6 A;  3GX0 A;  1I1I P;  1CQH A;  2FWH A;  4F9Z A;  3VK9 A;  4G01 A;  5AIS A;  1ZOF A;  3QAG A;  4YQV A;  3LEF A;  4ZIL A;  2H76 A;  1XVW A;  2O5V A;  2AB6 A;  3U6V A;  4MNN A;  2AJQ B;  1JHB A;  2GDR A;  4BVY B;  1SVO A;  1EGR A;  1MDJ A;  4BL7 B;  5E4W A;  4WBR D;  2C3T A;  3UOM A;  2XC2 A;  2B5X A;  4GDF A;  2XHF A;  2K8V A;  1RQM A;  3BCK A;  2DIY A;  2MMZ A;  5H5Q A;  2L6D A;  2LTK A;  2V6K A;  1BX9 A;  2GST A;  1ERT A;  3IXR A;  4BVY A;  9GSS A;  1FVJ A;  5CAX A;  4MJA A;  3A5I A;  4TR0 A;  3FY7 A;  3TJG A;  2DIZ A;  3I43 A;  3GH6 A;  1TI1 A;  1QGV A;  5HR0 A;  1FW1 A;  1TU7 A;  2YV7 A;  1OE8 A;  3CQF A;  3WGX A;  2BTO T;  4HUA A;  3KMO A;  3M9J A;  2VLU A;  4QL7 A;  3TKR A;  1SJI A;  3M9K A;  5EVO A;  3CMI A;  2GQK A;  3GUS A;  4G19 A;  2X8G A;  2HI7 A;  2MMO A;  2GT5 A;  1FAA A;  3QOU A;  5JWR B;  3A5W A;  1Z5Y E;  1K0C A;  2ZUP A;  4K0G A;  2ZNM A;  2WW3 A;  4FYC A;  5IM9 A;  3C8E A;  1EV4 A;  4GF0 A;  2IMK A;  2V41 A;  3PR8 A;  2HLS A;  2HSN B;  3HKR A;  2O7K A;  2C3N A;  2LV3 A;  2O8V B;  5IMC A;  2VLV A;  1PL2 A;  4EIP A;  2LRT A;  3F6F A;  3RGB C;  5IOW A;  1F9M A;  2R0P A;  1U87 A;  2HSN A;  1ABA A;  1F37 A;  3VPT A;  1XIY A;  3BBY A;  2JL4 A;  2CQ9 A;  2H0H A;  2GGT A;  1GP1 A;  5AN1 A;  4PI2 C;  2GQM A;  2V6O A;  1K0A A;  4P3Y B;  2CAQ A;  1EOH A;  3IBH A;  5G1L A;  1ERW A;  4GQC A;  1XWC A;  4ZIJ A;  3ZMK A;  4EL1 A;  2LNS A;  4PI0 C;  4MK3 A;  2H71 A;  3FHK A;  4DVC A;  1QUW A;  3G7I A;  4EO3 A;  2V32 A;  4POL A;  1HNB A;  2KHP A;  1S3C A;  3FZA A;  2FD3 A;  3GN3 A;  3WGE A;  2FY6 A;  3HJM A;  4USS A;  2NBS A;  4K5S A;  3D21 A;  3FR6 A;  2R0C A;  2LST A;  3I9V 2;  4OFT A;  3EUR A;  3GKK A;  8GSS A;  3IV4 A;  2L6C A;  1UVZ A;  3QCP A;  22GS A;  1S4B P;  1OKT A;  4MMM A;  2HNL A;  1K0D A;  4CHS A;  2VIM A;  2GSS A;  3OR5 A;  2FWF A;  1GUK A;  5IMD A;  3IAM 2;  4MF6 A;  1V40 A;  4N3Z A;  4K1F A;  3TRQ A;  5D8I A;  1HYU A;  14GS A;  1B9Y C;  4KDY A;  4KF9 A;  3QFA C;  4TOP A;  4IN0 A;  2M72 A;  2VM1 A;  5GZZ B;  2XBQ A;  4O5Q A;  6GSY A;  4N0V A;  3TKQ A;  2DJ1 A;  3FK8 A;  5ECN B;  3CRU A;  2NTO A;  3H1N A;  3I6A A;  3J7Y k;  5A1N B;  1A2L A;  4I2T A;  2RUF A;  5B6M A;  5ELA A;  1GNW A;  2LJA A;  3DRN A;  4L8E A;  1SD9 A;  3VI5 A;  2JAD A;  2IME A;  5F8B A;  4N10 A;  5ECM B;  1EP7 A;  1AAZ A;  4I2U A;  4IQ1 A;  4ZL9 A;  2BMX A;  5A1N A;  1PQN A;  2LNT A;  5LD0 A;  2CVB A;  5F0G A;  4ULX A;  4IP1 A;  3TJK A;  1NSW A;  1N2A A;  2IMI A;  3GMF A;  4KND A;  5GAN D;  3DML A;  3HXS A;  3EU3 A;  4EDZ A;  4EIQ A;  4GSS A;  5HR2 A;  2I9H A;  1J0F A;  3KZQ A;  2DC5 A;  1OC9 B;  5G5F A;  3FR9 A;  4Q5Q A;  4FO5 A;  2FWG A;  1I9D A;  3IA1 A;  1T7P B;  1TRW A;  4POM A;  3CHX C;  1SVM A;  2H1D A;  2I3Y A;  2QC7 A;  4Z7X A;  2WB9 A;  2FCH A;  4ACS A;  1X0R A;  4AI6 A;  4OCF A;  4FYU A;  4OD7 A;  1V58 A;  2F51 A;  5B8A A;  2OT3 A;  5DVB A;  1XVQ A;  3D6I A;  5COH A;  3H4K A;  3L9V A;  4N11 A;  4G9H A;  3HD5 A;  5CYY A;  1QFN A;  3SWL A;  2HFD A;  1ON4 A;  3C1R A;  4OCE A;  18GS A;  5IQY A;  3EMX A;  3WT1 A;  2M80 A;  1O73 A;  2VCX A;  3HMJ G;  5GAP D;  1XBS A;  2VL3 A;  3ZRD A;  4K2X A;  1S3D A;  4ZB6 A;  1WRY A;  2OE3 A;  1O6J A;  2OAD A;  3EYT A;  3P2A A;  1LU4 A;  4NHZ A;  3QPM A;  3UVH A;  3GST A;  4MJC A;  3VLN A;  1PL1 A;  5JCG A;  3KCM A;  4AF2 A;  3CSI A;  2MYG A;  1ZYN A;  4OFM A;  5G30 A;  17GS A;  2DMM A;  1FOH A;  2AUV A;  2H0I A;  3O76 A;  5IMA A;  1O85 A;  1OVN A;  4O32 A;  4NPB A;  4KE3 A;  4J56 E;  4EC0 A;  5B7C A;  2CZ2 A;  1W89 A;  4ZBA A;  4FYB A;  1SYR A;  1M3J A;  4TVE A;  1XWB A;  3MDK A;  3LFL A;  1X5C A;  1GRX A;  4KH7 A;  1GSF A;  2PER A;  5ECR B;  2K8S A;  4EDY A;  1M0U A;  1X9M B;  1A23 A;  1EZK A;  1ST9 A;  4PUA A;  3VFI A;  3TKP A;  2CA8 A;  5JWO B;  3ZML A;  13GS A;  4K7O A;  5CNW A;  3H93 A;  4EF0 A;  1KBN A;  2E7P A;  2VCW A;  4BVX B;  5H5R A;  3ED3 A;  4V2N A;  5DJL A;  1T1V A;  5IMF A;  3GL5 A;  1TU8 A;  1SKS B;  3DYR A;  3DVW A;  1K0B A;  2QA1 A;  2RUE A;  4NV2 A;  2PN8 A;  4QMK A;  4AKH A;  3HA9 A;  2HT9 A;  1F2E A;  5ABR A;  5KN1 A;  2R6K A;  3E0U A;  5J4V A;  1EEM A;  5J40 A;  5ELG A;  1G0T A;  1AIU A;  1A24 A;  4DSS B;  4O92 A;  2D2Z A;  1EOG A;  3QD9 A;  4PQ1 A;  1SYX A;  4KDX A;  3GHA A;  1WE0 A;  2HSM A;  4ZL8 A;  2FNO A;  3LXT A;  1DE1 A;  1YDK A;  4NAX A;  4XS1 A;  1BG5 A;  4JBB A;  4GCI A;  2IJY A;  1XG8 A;  4TR3 A;  3ERG A;  2EFC A;  2B6M A;  1O8W A;  2ES7 A;  3CBU A;  2H74 A;  1K3O A;  1B9X C;  5FWG A;  1A2J A;  1BQ7 A;  4MZB A;  5FT3 A;  2WW0 A;  3A2X A;  3GKX A;  3TOU A;  3ERF A;  5ECL B;  3SBC A;  2VCT A;  3GKN A;  1FOV A;  3QFB C;  2WJU A;  4TXO B;  2IN3 A;  5JCW A;  3F4S A;  2CX3 A;  3KTB A;  5F07 A;  4E8E A;  2AAW A;  1A2M A;  2LKU A;  3DWV A;  1ERV A;  3ZIT A;  4JR4 A;  1U6T A;  3C71 A;  2C0E A;  4MZC A;  4TXO A;  1GUH A;  2FLS A;  4PX1 A;  1OC8 A;  2WCI A;  2LQO A;  5AIV A;  3TKS E;  1XPV A;  2FHE A;  2FGX A;  3TKS C;  1GUM A;  4GLT A;  3N9J A;  4NMU A;  1JLW A;  2XPD A;  4A5P A;  3KP8 A;  2R3X A;  3P90 A;  2H73 A;  4K7I A;  4YH2 A;  4EXJ A;  4POB A;  6GSS A;  2J23 A;  4V1A g;  5IO2 A;  1IYH A;  2YWN A;  3TUE A;  4KSM A;  6GSU A;  2MMA A;  1ZYQ B;  2O36 A;  1U3A A;  2JZR A;  4NV5 A;  1SU9 A;  2HYX A;  5J4U A;  1GTA A;  3APQ A;  4DSQ A;  4YKG A;  3P7X A;  4W66 A;  3GL3 A;  2G2Q A;  4BL7 A;  5G5E A;  3ME7 A;  3ZZX A;  1M2B A;  1X9W B;  5DAK B;  5IMZ A;  1J08 A;  4GXZ A;  2WDU A;  5B6N A;  4F0C A;  1T00 A;  1A8L A;  5CRE A;  2EFD A;  3KGK A;  2F3M A;  5IIZ A;  1N8J A;  1NHO A;  2H6Z A;  4MA9 A;  1YEW C;  3HVX A;  1SD8 A;  3TJF A;  2OBI A;  5ID2 B;  4WR5 A;  2WZS A;  3C7M A;  2PBJ A;  2HRA A;  2WFC A;  1G7E A;  3MNG A;  1YY7 A;  1V2A A;  2HSY A;  4IJI A;  4IBP A;  3GRX A;  5ID2 A;  2GSR A;  5ENU A;  5IPH A;  4PGT A;  2DLX A;  2HZE B;  1H4O A;  2WGR A;  2OE0 A;  5CRD A;  4EVM A;  3QMX A;  4YAV A;  2VM2 A;  1FG4 A;  3D5J A;  4HQZ A;  2DJ2 A;  3BOA A;  4ML6 A;  1ZL9 A;  2DJ0 A;  3LOR A;  2F9S A;  2HZE A;  4DSR A;  3QAV A;  2C0D A;  2PWJ A;  1LJR A;  1URM A;  2H66 A;  3F4R A;  2VCQ A;  1XWA A;  3DIE A;  4I97 A;  2GVP A;  4AGS A;  1GSE A;  2YWO A;  3D22 A; 
#chains in the Genus database with same CATH homology
 2KLX A;  2H01 A;  3UVT A;  3LYK A;  3TOT A;  5LCZ A;  3GA4 A;  3NIV A;  1U3I A;  4GWR A;  5HR3 A;  1EGO A;  1R5P A;  5ECH B;  3RAZ A;  1B8X A;  1USB A;  1UN2 A;  3TRX A;  3ZYW A;  1R5A A;  3IK9 A;  4HDE A;  2P5R A;  3LYP A;  2CVD A;  4YQU A;  3HHV A;  2OKA A;  1WWJ A;  1TK0 B;  4G10 A;  1XOB A;  2OE1 A;  2VL2 C;  5EL8 A;  3EVI A;  3V1W A;  5AIX A;  4MZW A;  3HVV A;  4QQ7 A;  5KOX A;  2VO4 A;  1WOU A;  4PUR A;  2XBI A;  2LS5 A;  4AJ8 A;  2A4V A;  1HNA A;  2K18 A;  1GH2 A;  2HE3 A;  4KGI A;  1BED A;  2GSQ A;  2GQL A;  1ZYP A;  1TXX A;  4WXT A;  4HZ2 A;  2VCZ A;  2JSY A;  3VWX A;  5DBQ A;  4TW5 A;  4G0L A;  1Z9H A;  4IEL A;  2H72 A;  1YJ6 A;  1GL8 A;  3U5R E;  3PH9 A;  4Z2R A;  4JE1 A;  4MCU A;  1MEK A;  3HY2 A;  4G0I A;  3HYP A;  5DCH A;  2K6V A;  2YCD A;  2VD1 A;  4XRD A;  1V57 A;  1F3B A;  5G2Z A;  1U88 A;  3DVX A;  2MBS A;  1E2Y A;  2GLR A;  1A8Y A;  3R3E A;  3KD0 A;  4JU5 A;  1ZZY A;  3KH9 A;  4ZB7 A;  4I6X A;  3TKS A;  2CVK A;  2GS3 A;  1SVL A;  2H0G A;  3TCO A;  2WS2 A;  4YAP A;  3KXO A;  1Z7P A;  4RI7 A;  1VF2 A;  3UIW A;  3FEU A;  2QGV A;  4MH2 A;  16GS A;  1THX A;  1TKD B;  2MZC A;  3EWL A;  2IMD A;  2OAC A;  1QK8 A;  3ZL5 A;  1MDI A;  1GWC A;  3GUR A;  1YZX A;  4Z2T A;  1R4W A;  2EFH A;  1VRS D;  4XCS A;  2H70 A;  4KX4 A;  2AV4 A;  5FHI A;  5KN2 A;  4HJ2 A;  1O7U A;  1W4V A;  2HZF A;  5J41 A;  3DD3 A;  2BJX A;  3ZRE A;  2REM A;  1BYE A;  4WET A;  3L4N A;  5A5K A;  1PKZ A;  1JFU A;  1X5E A;  3BJ5 A;  1PA3 A;  1ML6 A;  5A4V A;  1IYI A;  3MYD A;  1OC9 A;  2LJR A;  2IFQ B;  1T8E B;  2I4A A;  3IC4 A;  3QR6 A;  2C8U A;  4LMV A;  3EE2 A;  2Z9S A;  2QA2 A;  4L0W A;  3DXB A;  2ON5 A;  4F2I A;  1TRS A;  4BPY A;  3AY8 A;  3F3Q A;  3WGD A;  4WKW A;  3IC8 A;  3MSZ A;  1K3Y A;  3RDW A;  2GTU A;  1GSQ A;  2B5Y A;  3D0Z A;  3A3T A;  4QL9 A;  5ECI B;  3ZVJ D;  2B7J A;  4IS0 A;  1MD4 A;  5EY6 A;  6GSW A;  5A4U A;  2GZY A;  4CDO A;  5H5S A;  1TK8 B;  4H86 A;  3ME8 A;  1PN9 A;  2XPE A;  4AJ7 A;  3L0H A;  3MWH A;  1JZD A;  1HNC A;  1BJX A;  4MPF A;  2H1G A;  1YQ1 A;  3KJY A;  4O7H A;  2A4H A;  4IJ3 A;  2GT6 A;  1Z7R A;  2VKZ G;  4K0N A;  3KTL A;  3EMP A;  3IOS A;  5EPF A;  4E68 A;  1E6B A;  1Q98 A;  4GST A;  3VWV A;  4IP6 A;  2YWM A;  3C1S A;  4XS4 B;  4HI7 A;  1XW5 A;  3LSZ A;  1F3A A;  2M46 A;  2KUC A;  5ECK B;  2B3S A;  4EKZ A;  1DSB A;  3Q19 A;  2RM5 A;  2VL2 A;  3UMA A;  3GNJ A;  2V1M A;  2CV4 A;  6GSX A;  4FH8 A;  2PU9 C;  5CO3 A;  4XS4 A;  1B4Q A;  1EP8 A;  3NZN A;  1XW9 A;  4MPG A;  1XOA A;  3ERW A;  5BRT A;  4AKX B;  1SK0 A;  2YAN A;  4HU9 A;  1O81 A;  2H8L A;  4TR1 B;  2E0Q A;  4IW9 A;  4BVX A;  2FA4 A;  3ZIV A;  2EC4 A;  4HEA 2;  3LW9 A;  4K6X A;  1YF0 A;  3CRT A;  4LL4 B;  4Q5F A;  3TRP A;  2KP2 A;  2YWI A;  1T4Y A;  4MF5 A;  4OWY A;  4AJ6 A;  2EFE A;  4Q5R A;  2R4V A;  3HCZ A;  2L4C A;  2TRC P;  2VAF A;  1WJK A;  2YOI A;  4V2L A;  4MLY A;  1GSD A;  1I5G A;  1ERU A;  4YQM A;  2JSZ A;  2PUK C;  4IHU A;  4X4J A;  3KMN A;  4ZL7 A;  3L9S A;  4EUY A;  2E2G A;  2B1L A;  3FRC A;  4O5U A;  5D9V A;  1K0N A;  2EIQ A;  4ICY A;  1Z3E A;  4KCE A;  4V2M A;  3F63 A;  4DSS A;  2WZ9 A;  1XCC A;  1NM3 A;  2HRK B;  12GS A;  4F0B A;  4LL1 B;  3K8N A;  2YN1 A;  4O5R A;  1KNG A;  3F6D A;  1TRU A;  4PTS A;  4K8M A;  1YKC A;  2H1A A;  2RM6 A;  3RHC A;  3ISO A;  4RI6 A;  1MD3 A;  1TK5 B;  1AQX A;  4D73 B;  5CRH A;  2HRK A;  2VOC A;  3RBT A;  1SKR B;  4LMW A;  1X9S B;  3IR4 A;  1M9A A;  2HQT A;  1SL2 B;  1TI3 A;  3E3E A;  1FHE A;  4X1U A;  5D93 A;  4BA7 A;  2ON7 A;  4D73 A;  7GSS A;  5HQP A;  4MH3 A;  4TKY A;  3M8N A;  1O8X A;  4KW6 A;  5J5N A;  2H6Y A;  1QMV A;  3QDN A;  1OYJ A;  2LRN A;  1KEB A;  4F82 A;  5F05 A;  1Z6N A;  4GRF A;  2C1Y A;  2HRN A;  3UJ1 A;  3CTG A;  4X43 A;  6GST A;  4WR4 A;  4OMV A;  2NDO A;  1XW6 A;  2DML A;  1G7O A;  1DE2 A;  3S9F A;  3E9J B;  2FWE A;  1SL1 B;  1TP9 A;  5KEJ A;  1CQG A;  2DKI A;  1RK4 A;  1JZW A;  4ML1 A;  2I1U A;  4LA1 A;  2FA8 A;  3QAW A;  5J3R A;  3WYW A;  4E8H A;  5F06 A;  5ECP B;  1G6W A;  2C0F A;  3TDG A;  2VD0 A;  1GTB A;  4EE0 A;  1XFL A;  2L4Q A;  5E59 A;  4J2F A;  1PMT A;  4BWQ A;  5JCU A;  5J47 A;  1SJ6 A;  1C72 A;  5DCG A;  3APO A;  3FKF A;  5JWQ B;  4KUN A;  1GSS A;  3HJP A;  3F9U A;  2L57 A;  1WPI A;  4K9Z A;  1EEJ A;  1ZCP A;  5J4Y A;  2RLI A;  4Q5N A;  4G2E A;  4HJM A;  4GQF A;  4MAB A;  5DAK A;  5D9X A;  1M2A A;  1ZGN A;  1JZR A;  1YF1 A;  4CY6 A;  4MJB A;  2P5Q A;  2JZS A;  4PXO A;  4MF7 A;  6GSV A;  3VWW A;  3EPT A;  3M1G A;  2YJ7 A;  2UZ8 A;  2J9H A;  4ISD A;  1OC3 A;  4ECI A;  1M7T A;  2R0G A;  4ZB8 A;  1B48 A;  2C0G A;  4TN8 A;  3CYN A;  1Y25 A;  1BF5 A;  1QXH A;  1AQV A;  2K9F A;  5L71 A;  3IDV A;  2FUG 2;  5IMV A;  5KOW A;  1ZMA A;  1GLQ A;  2DJ3 A;  1PD2 1;  5DJM A;  3GYK A;  4XIH A;  1GNE A;  2KOK A;  3KH7 A;  3IAS 2;  2I81 A;  5INY A;  3RHB A;  5G1K A;  1GTI A;  2LJK A;  3G9B A;  1SL0 B;  3KEB A;  3HDC A;  2DJK A;  1LBK A;  2IMF A;  5D9T A;  1GUL A;  2HSH A;  4PUF C;  1ACV A;  2L59 A;  1RW1 A;  4POK A;  1XZO A;  2P0G A;  3GH9 A;  1TTZ A;  2LRC A;  1DBY A;  4PNF A;  3DKS A;  2R2J A;  3WD6 A;  4PQI A;  4ECB A;  2N5B A;  1SEN A;  4YKF A;  19GS A;  4CY8 A;  2F8F A;  3R2Q A;  3ZLP A;  4L5O A;  2QSI A;  1FB0 A;  2N5F A;  2NVL A;  2X8H A;  5D96 A;  3H8Q A;  3KIJ A;  1PN0 A;  2GZP A;  3ZIJ A;  3LGC A;  3J7Y b;  4N30 A;  5DDL A;  3EC3 A;  1Z6M A;  1UA5 A;  2CT6 A;  3TB2 A;  1PKW A;  2C4J A;  3UBL A;  2IL3 A;  3PGT A;  1GLP A;  4ECC A;  1R26 A;  1A0F A;  3F3R A;  2GZZ A;  3IHQ A;  3A2V A;  3F0I A;  4KSO A;  1VGL A;  2ALB A;  3EIN A;  4ID0 A;  5CRG A;  1JLV A;  4K2D A;  3US3 A;  2H1L A;  5A4W A;  4IGJ A;  2R5G A;  2QKE A;  3KP9 A;  2R37 A;  2LUS A;  3NOF A;  4I5Q A;  4TRX A;  3HJO A;  1S3A A;  2X99 A;  5BMU B;  1TDI A;  4GSN A;  2DJJ A;  1OKD A;  1THO A;  2KP1 A;  3PIN A;  1AUC A;  4CW9 A;  1HQO A;  1YEP A;  2O89 A;  5B8B A;  3UEM A;  3FZ5 A;  4TXV A;  4FQU A;  3CTF A;  1GSU A;  3GSS A;  3Q6O A;  1MDK A;  2VUP A;  1ILO A;  5BMU A;  2E2M A;  4JED A;  2ZCT A;  4HU7 A;  2H19 A;  2VLT A;  1GTU A;  2EIR A;  1FB6 A;  1TRV A;  1VF1 A;  2NPB A;  3UL3 A;  1DUG A;  5ECS A;  3CWG A;  2JAC A;  5KN0 A;  4L5L A;  5D73 A;  1PGT A;  2DKH A;  5A34 B;  5C00 A;  1EWX A;  5CRW A;  3W8J A;  1SKW B;  1PRX A;  1SK2 A;  3D4T A;  3G7Y A;  4XRA A;  1WMJ A;  4LLR A;  1H75 A;  1MTC A;  3TGZ A;  1M9B A;  3TJJ A;  2H75 A;  4WBJ A;  3LQ7 A;  4DEJ A;  4NWY A;  5A34 A;  3BCI A;  3FR3 A;  2VL9 A;  3IRA A;  20GS A;  3UBK A;  1K3L A;  3ZVJ A;  2C80 A;  4RUV A;  4OO5 A;  2PMT A;  4JZQ A;  3G7J A;  2CAI A;  5AGY A;  3APS A;  5GSS A;  2B7K A;  1NHY A;  3TU3 B;  3FYG A;  1N25 A;  4ZBB A;  3D4M A;  2X8C A;  2TRX A;  4ZXG A;  4HOJ A;  4MDC A;  4WF5 A;  1K0M A;  3IK7 A;  1WIK A;  4ZB9 A;  4HS1 A;  4AKI A;  4XS6 A;  4K7N A;  3KM6 A;  3LWA A;  4WEY A;  3MAK A;  3VPQ A;  1TW9 A;  1TXU A;  5KN3 A;  2CX4 A;  2LQQ A;  1YEX A;  4ECJ A;  3ZTL A;  4L0U A;  4AKG A;  3ZFB A;  2YZU A;  3RPP A;  4F03 A;  5DQS A;  2JZT A;  2RII A;  5J9B A;  1Y1U A;  10GS A;  5J9C A;  2OJL A;  4KDU A;  3Q18 A;  4G0K A;  5HR1 A;  2A2P A;  1V98 A;  1YKA A;  3DEX A;  1XWK A;  2P31 A;  2IFQ A;  3I69 A;  4GTU A;  1JZO A;  3C73 A;  3FZ4 A;  1BG1 A;  3GV1 A;  3L78 A;  2V2G A;  4NHW A;  1OAZ A;  4ILF A;  4MP4 A;  3CSH A;  4PNG A;  1FVK A;  1PSQ A;  4IQA A;  3BD2 A;  4NXI A;  5C04 A;  2H30 A;  5LNK e;  4IVF A;  2G0F A;  2H1B A;  1AW9 A;  4BWS A;  1PX6 A;  3A2W A;  3IE3 A;  3M0F A;  1A0R P;  2PVO C;  3CSJ A;  5HFK A;  1Y6E A;  2HRF A;  1UC7 A;  3GKM A;  3HZ4 A;  2MBT A;  5DQY A;  1SJZ A;  3IHG A;  1AC1 A;  3FMW A;  11GS A;  3FW2 A;  2AHE A;  1WP0 A;  1J9B A;  2YNX A;  2PVQ A;  1V9W A;  2A2S A;  5ECO B;  2CZ3 A;  1F6M C;  1TOF A;  3LJR A;  4TR4 A;  5IPG A;  2JU5 A;  1X5D A;  3P8W A;  3LXZ A;  1TJD A;  1T3B A;  3VWU A;  3W6G A;  2TIR A;  4HZ4 A;  3HVS A;  4OFN A;  1NW2 A;  2OBK A;  2HXK A;  4V1A p;  3FZ9 A;  2X49 A;  1EV9 A;  3O6T A;  1XWG A;  1M99 A;  2YPM A;  2EIO A;  2O85 A;  1GSY A;  2DSA A;  2IIY A;  1ZYE A;  3F8U A;  2IPA A;  4Z2U A;  4OO4 A;  3N5O A;  3CXG A;  1B4P A;  3O3T A;  3H79 A;  1QQ2 A;  2YZH A;  2B5E A;  4PQH A;  1SK1 A;  5A5H B;  5ECQ B;  3W8S A;  1G6Y A;  3GIX A;  1VF4 A;  2O87 A;  2UV8 G;  3GX8 A;  4KAE A;  4I8B A;  5HFI A;  4TR1 A;  1R7H A;  2VCV A;  1YVL A;  3DGQ A;  5D9W A;  1HD2 A;  3ZFL A;  5A5H A;  3PPU A;  3EU4 A;  4ZBD A;  1Q4J A;  3IPZ A;  4HQS A;  3VUR A;  2WUL A;  1BAY A;  2PGT A;  2YV9 A;  4X0X A;  2HSM B;  4MJE A;  5CP1 A;  5IO0 A;  1VF3 A;  4RQR A;  5HFG A;  2MMN A;  2PPT A;  4FIW A;  4N0Z A;  3UAP A;  3JCM L;  2X4A A;  1AXD A;  1T4Z A;  3LG6 A;  3F4T A;  3GTU B;  1KTE A;  3Q74 A;  4J57 E;  2LEG A;  1FO5 A;  3TJB A;  1PX7 A;  2B1K A;  2L5O A;  3WT2 A;  2A2R A;  2F8A A;  3M3M A;  5IOX A;  4JRR A;  3MIX A;  2N5A A;  3GTU A;  2X64 A;  4IKH A;  3HZ8 A;  4K5R A;  5GST A;  2H6X A;  1K0O A;  1OE7 A;  2AYT A;  2YP6 A;  2C3Q A;  3VI7 A;  3GFK A;  4WF4 A;  1M2D A;  4XTS A;  1XXU A;  4RQX A;  2L5L A;  5DAL B;  4KA0 A;  5G31 A;  2IWT A;  3UAR A;  1AQW A;  2YJH A;  3RPN A;  4KB3 A;  2OA7 A;  5DAL A;  2DBC A;  4XHM A;  2WRT A;  3L9U A;  4KCA A;  4JR6 A;  3GX0 A;  1CQH A;  2FWH A;  4F9Z A;  3VK9 A;  4G01 A;  5AIS A;  1ZOF A;  3QAG A;  4YQV A;  3LEF A;  4ZIL A;  2H76 A;  1XVW A;  2O5V A;  2AB6 A;  3U6V A;  4MNN A;  2AJQ B;  1JHB A;  2GDR A;  4BVY B;  1SVO A;  1EGR A;  1MDJ A;  4BL7 B;  5E4W A;  4WBR D;  2C3T A;  3UOM A;  2XC2 A;  2B5X A;  4GDF A;  2XHF A;  2K8V A;  1RQM A;  3BCK A;  2DIY A;  2MMZ A;  5H5Q A;  2L6D A;  2LTK A;  2V6K A;  1BX9 A;  2GST A;  1ERT A;  3IXR A;  4BVY A;  9GSS A;  1FVJ A;  5CAX A;  4MJA A;  3A5I A;  4TR0 A;  3FY7 A;  3TJG A;  2DIZ A;  3I43 A;  3GH6 A;  1TI1 A;  1QGV A;  5HR0 A;  1FW1 A;  1TU7 A;  2YV7 A;  1OE8 A;  3WGX A;  2BTO T;  4HUA A;  3KMO A;  3M9J A;  2VLU A;  4QL7 A;  3TKR A;  1SJI A;  3M9K A;  5EVO A;  3CMI A;  2GQK A;  3GUS A;  4G19 A;  2X8G A;  2HI7 A;  2MMO A;  2GT5 A;  1FAA A;  3QOU A;  5JWR B;  3A5W A;  1Z5Y E;  1K0C A;  2ZUP A;  4K0G A;  2ZNM A;  4FYC A;  5IM9 A;  3C8E A;  1EV4 A;  4GF0 A;  2IMK A;  2V41 A;  3PR8 A;  2HLS A;  2HSN B;  3HKR A;  2O7K A;  2C3N A;  2LV3 A;  2O8V B;  5IMC A;  2VLV A;  1PL2 A;  4EIP A;  2LRT A;  3F6F A;  5IOW A;  1F9M A;  2R0P A;  1U87 A;  2HSN A;  1ABA A;  1F37 A;  3VPT A;  1XIY A;  3BBY A;  2JL4 A;  2CQ9 A;  2H0H A;  2GGT A;  1GP1 A;  5AN1 A;  2GQM A;  2V6O A;  1K0A A;  4P3Y B;  2CAQ A;  1EOH A;  3IBH A;  5G1L A;  1ERW A;  4GQC A;  1XWC A;  4ZIJ A;  3ZMK A;  4EL1 A;  2LNS A;  4MK3 A;  2H71 A;  3FHK A;  4DVC A;  1QUW A;  3G7I A;  4EO3 A;  2V32 A;  4POL A;  1HNB A;  2KHP A;  1S3C A;  3FZA A;  2FD3 A;  3GN3 A;  3WGE A;  2FY6 A;  3HJM A;  4USS A;  2NBS A;  4K5S A;  3D21 A;  3FR6 A;  2R0C A;  2LST A;  3I9V 2;  4OFT A;  3EUR A;  3GKK A;  8GSS A;  3IV4 A;  2L6C A;  1UVZ A;  3QCP A;  22GS A;  1OKT A;  4MMM A;  2HNL A;  1K0D A;  4CHS A;  2VIM A;  2GSS A;  3OR5 A;  2FWF A;  1GUK A;  5IMD A;  3IAM 2;  4MF6 A;  1V40 A;  4N3Z A;  4K1F A;  3TRQ A;  5D8I A;  1HYU A;  14GS A;  1B9Y C;  4KDY A;  4KF9 A;  3QFA C;  4TOP A;  4IN0 A;  2M72 A;  2VM1 A;  5GZZ B;  2XBQ A;  4O5Q A;  6GSY A;  4N0V A;  3TKQ A;  2DJ1 A;  3FK8 A;  5ECN B;  3CRU A;  2NTO A;  3H1N A;  3I6A A;  3J7Y k;  5A1N B;  1A2L A;  4I2T A;  2RUF A;  5B6M A;  5ELA A;  1GNW A;  2LJA A;  3DRN A;  4L8E A;  1SD9 A;  3VI5 A;  2JAD A;  2IME A;  5F8B A;  4N10 A;  5ECM B;  1EP7 A;  1AAZ A;  4I2U A;  4IQ1 A;  4ZL9 A;  2BMX A;  5A1N A;  1PQN A;  2LNT A;  5LD0 A;  2CVB A;  5F0G A;  4ULX A;  4IP1 A;  3TJK A;  1NSW A;  1N2A A;  2IMI A;  3GMF A;  4KND A;  5GAN D;  3DML A;  3HXS A;  3EU3 A;  4EDZ A;  4EIQ A;  4GSS A;  5HR2 A;  2I9H A;  1J0F A;  3KZQ A;  2DC5 A;  1OC9 B;  5G5F A;  3FR9 A;  4Q5Q A;  4FO5 A;  2FWG A;  1I9D A;  3IA1 A;  1T7P B;  1TRW A;  4POM A;  1SVM A;  2H1D A;  2I3Y A;  2QC7 A;  4Z7X A;  2WB9 A;  2FCH A;  4ACS A;  1X0R A;  4AI6 A;  4OCF A;  4FYU A;  4OD7 A;  1V58 A;  2F51 A;  5B8A A;  2OT3 A;  5DVB A;  1XVQ A;  3D6I A;  5COH A;  3H4K A;  3L9V A;  4N11 A;  4G9H A;  3HD5 A;  5CYY A;  1QFN A;  3SWL A;  2HFD A;  1ON4 A;  3C1R A;  4OCE A;  18GS A;  5IQY A;  3EMX A;  3WT1 A;  2M80 A;  1O73 A;  2VCX A;  3HMJ G;  5GAP D;  1XBS A;  2VL3 A;  3ZRD A;  4K2X A;  1S3D A;  4ZB6 A;  1WRY A;  2OE3 A;  1O6J A;  2OAD A;  3EYT A;  3P2A A;  1LU4 A;  4NHZ A;  3QPM A;  3UVH A;  3GST A;  4MJC A;  3VLN A;  1PL1 A;  5JCG A;  3KCM A;  4AF2 A;  3CSI A;  2MYG A;  1ZYN A;  4OFM A;  5G30 A;  17GS A;  2DMM A;  1FOH A;  2AUV A;  2H0I A;  3O76 A;  5IMA A;  1O85 A;  1OVN A;  4O32 A;  4NPB A;  4KE3 A;  4J56 E;  4EC0 A;  5B7C A;  2CZ2 A;  1W89 A;  4ZBA A;  4FYB A;  1SYR A;  4TVE A;  1XWB A;  3MDK A;  3LFL A;  1X5C A;  1GRX A;  4KH7 A;  1GSF A;  2PER A;  5ECR B;  2K8S A;  4EDY A;  1M0U A;  1X9M B;  1A23 A;  1EZK A;  1ST9 A;  4PUA A;  3VFI A;  3TKP A;  2CA8 A;  5JWO B;  3ZML A;  13GS A;  4K7O A;  5CNW A;  3H93 A;  4EF0 A;  1KBN A;  2E7P A;  2VCW A;  4BVX B;  5H5R A;  3ED3 A;  4V2N A;  5DJL A;  1T1V A;  5IMF A;  3GL5 A;  1TU8 A;  1SKS B;  3DYR A;  3DVW A;  1K0B A;  2QA1 A;  2RUE A;  4NV2 A;  2PN8 A;  4QMK A;  4AKH A;  3HA9 A;  2HT9 A;  1F2E A;  5ABR A;  5KN1 A;  2R6K A;  3E0U A;  5J4V A;  1EEM A;  5J40 A;  5ELG A;  1G0T A;  1AIU A;  1A24 A;  4DSS B;  4O92 A;  2D2Z A;  1EOG A;  3QD9 A;  4PQ1 A;  1SYX A;  4KDX A;  3GHA A;  1WE0 A;  2HSM A;  4ZL8 A;  2FNO A;  3LXT A;  1DE1 A;  1YDK A;  4NAX A;  4XS1 A;  1BG5 A;  4JBB A;  4GCI A;  2IJY A;  4TR3 A;  3ERG A;  2EFC A;  2B6M A;  1O8W A;  2ES7 A;  3CBU A;  2H74 A;  1K3O A;  1B9X C;  5FWG A;  1A2J A;  1BQ7 A;  4MZB A;  5FT3 A;  3A2X A;  3GKX A;  3TOU A;  3ERF A;  5ECL B;  3SBC A;  2VCT A;  3GKN A;  1FOV A;  3QFB C;  2WJU A;  4TXO B;  2IN3 A;  5JCW A;  3F4S A;  2CX3 A;  3KTB A;  5F07 A;  4E8E A;  2AAW A;  1A2M A;  2LKU A;  3DWV A;  1ERV A;  3ZIT A;  4JR4 A;  1U6T A;  3C71 A;  2C0E A;  4MZC A;  4TXO A;  1GUH A;  2FLS A;  4PX1 A;  1OC8 A;  2WCI A;  2LQO A;  5AIV A;  3TKS E;  1XPV A;  2FHE A;  2FGX A;  3TKS C;  1GUM A;  4GLT A;  3N9J A;  4NMU A;  1JLW A;  2XPD A;  4A5P A;  3KP8 A;  2R3X A;  3P90 A;  2H73 A;  4K7I A;  4YH2 A;  4EXJ A;  4POB A;  6GSS A;  2J23 A;  4V1A g;  5IO2 A;  1IYH A;  2YWN A;  3TUE A;  4KSM A;  6GSU A;  2MMA A;  1ZYQ B;  1U3A A;  2JZR A;  4NV5 A;  1SU9 A;  2HYX A;  5J4U A;  1GTA A;  3APQ A;  4DSQ A;  4YKG A;  3P7X A;  4W66 A;  3GL3 A;  2G2Q A;  4BL7 A;  5G5E A;  3ME7 A;  3ZZX A;  1M2B A;  1X9W B;  5DAK B;  5IMZ A;  1J08 A;  4GXZ A;  2WDU A;  5B6N A;  4F0C A;  1T00 A;  1A8L A;  5CRE A;  2EFD A;  3KGK A;  2F3M A;  5IIZ A;  1N8J A;  1NHO A;  2H6Z A;  4MA9 A;  3HVX A;  1SD8 A;  3TJF A;  2OBI A;  5ID2 B;  4WR5 A;  3C7M A;  2PBJ A;  2HRA A;  2WFC A;  1G7E A;  3MNG A;  1YY7 A;  1V2A A;  2HSY A;  4IJI A;  4IBP A;  3GRX A;  5ID2 A;  2GSR A;  5ENU A;  5IPH A;  4PGT A;  2DLX A;  2HZE B;  1H4O A;  2WGR A;  2OE0 A;  5CRD A;  4EVM A;  3QMX A;  4YAV A;  2VM2 A;  1FG4 A;  3D5J A;  4HQZ A;  2DJ2 A;  3BOA A;  4ML6 A;  1ZL9 A;  2DJ0 A;  3LOR A;  2F9S A;  2HZE A;  4DSR A;  3QAV A;  2C0D A;  2PWJ A;  1LJR A;  1URM A;  2H66 A;  3F4R A;  2VCQ A;  1XWA A;  3DIE A;  4I97 A;  2GVP A;  4AGS A;  1GSE A;  2YWO A;  3D22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...