4L5OA

Crystal structure of 26 kda gst d26h mutant of clonorchis sinensis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
MAPVLGYWKIRGLAQPIRLLLEYVGHSYEEHSYGRCDGEKWQNDKHNLGLELPNLPYYKDGNFSLTQSLAILRYIADKHNMIGNTPVERAKISMIEGGLVDLRAGVSRIAYQETFEQLKVPYLQQLPSTLRMWSQFLGNNSYLHGSTPTHLDFMFYEALDVIRYLDPTSVEAFPNLMQFIHRIEALPNIKAFMESDRFIKWPLNGWSAYFGGGDAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glutathione transferase
publication title Crystal structures of 26kDa Clonorchis sinensis glutathione S-transferase reveal zinc binding and putative metal binding.
pubmed doi rcsb
source organism Clonorchis sinensis
total genus 71
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4l5oA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4l5oA01
2HSYA 1MEKA 4NAXA 3WGXA 4ZB6A 2EIOA 1H4OA 4CHSA 5E59A 3EWLA 5JWOB 2H71A 2H0HA 2CVKA 1XFLA 5JCGA 1SJZA 2X64A 2HNLA 1DUGA 2DJ2A 3I9V2 1A24A 5C00A 1Q4JA 1TK0B 2OA7A 4Q5NA 4POLA 3VWUA 1EEMA 4KNDA 1OKDA 4OO4A 4IP1A 5ID2B 3F4SA 1EOGA 3F3QA 4IHUA 2H1AA 4HEA2 4QQ7A 1QK8A 3FR3A 4PQ1A 1QMVA 4WKWA 5KN1A 5ECSA 2YNXA 5IMDA 5D73A 2VO4A 3ZYWA 1SENA 3ERWA 2DSAA 4MPGA 5DAKB 5G31A 2GSRA 4GCIA 4KX4A 3GHAA 3EMXA 3WT1A 1TDIA 3TJFA 4BPYA 4TKYA 3L0HA 2HRKA 3EVIA 5GSTA 2O85A 4OWYA 1GH2A 2GLRA 5CO3A 1SJIA 1MTCA 2DJ3A 3FR9A 5F05A 2GQLA 2YANA 4BVXB 5AN1A 2X8HA 3HJPA 4ILFA 2JU5A 1YF1A 1FB0A 5G2ZA 2XC2A 4P3YB 5GSSA 5H5SA 5KN2A 4O92A 3APQA 3LYKA 3BBYA 1Z9HA 1AC1A 1ST9A 2LS5A 3KD0A 3HJOA 3CTGA 1WP0A 4G0IA 2LSTA 3G7YA 5IIZA 2VAFA 3GNJA 4KAEA 1GSFA 2WJUA 3GKNA 2IJYA 3RPNA 2CQ9A 4DSSB 2F9SA 4PGTA 1LJRA 2V41A 1TK8B 3ZIVA 2IPAA 4WBRD 1WRYA 2K8VA 3MAKA 4HZ2A 3Q18A 3US3A 4BA7A 1ZL9A 5KN0A 1Z5YE 3A5WA 4LMWA 3IE3A 3H79A 2IWTA 3UOMA 4D73B 1T4YA 4IKHA 1HD2A 2HT9A 3HVSA 3QOUA 2K8SA 4EE0A 4PURA 1XWGA 2NPBA 2R37A 4XS6A 3R3EA 3TDGA 4Q5QA 5C04A 3CYNA 3D0ZA 5J9BA 4OO5A 5IPHA 1AQXA 5CYYA 1OC9A 3WT2A 3F9UA 5EL8A 2KLXA 5CRWA 3KP9A 3TKQA 1GP1A 1YEPA 1UN2A 3UARA 3TRPA 1AUCA 2CT6A 3VFIA 3VURA 1M2BA 4GLTA 2O89A 4OFMA 2XBQA 2DJ0A 2REMA 4MCUA 1U3IA 2VCWA 1XPVA 3R2QA 3KCMA 3ME7A 1THXA 3LXTA 10GSA 4K1FA 2OE3A 1NHOA 2AJQB 5HR1A 1DBYA 1AQWA 1ERVA 4LLRA 2F8AA 2IFQA 3VPTA 1SKWB 1TJDA 1GTAA 11GSA 1XOBA 3DYRA 4HQZA 2MMOA 2O87A 3HYPA 4OFTA 2YZUA 2QGVA 1ZYEA 2RUFA 3GKKA 2GTUA 3EC3A 3ZMKA 2BJXA 5ECPB 1A2JA 5AGYA 4RQXA 3IK9A 2TIRA 5ABRA 2HQTA 3GX8A 4L0WA 1KNGA 4K2DA 1IYHA 2D2ZA 1USBA 3IHQA 3G7JA 4ZL7A 1YKCA 1K0OA 3IR4A 3W8SA 3H4KA 4KGIA 4KA0A 2LQQA 3GKXA 2LJKA 2CA8A 3GH9A 3UMAA 3L4NA 2PN8A 3TKPA 4XS4A 3WGEA 1XVWA 3EMPA 4ZL9A 5DJLA 2M72A 3QDNA 3LXZA 3FY7A 3QPMA 1BQ7A 3GTUA 4NHWA 1ML6A 4TW5A 3TOTA 1N8JA 1GSDA 3FKFA 2DLXA 4X43A 2MBSA 3QCPA 6GSUA 4GSNA 3HKRA 5A5KA 6GSYA 2LJAA 2DMLA 1TOFA 1JLWA 3BCKA 2E0QA 2OADA 4EF0A 2C0DA 3FZAA 1Q98A 4KUNA 2IMFA 3F4RA 2JADA 9GSSA 1OVNA 3C8EA 2FGXA 3QR6A 2JSZA 2GQMA 2X8CA 5COHA 3ZTLA 1YJ6A 2G2QA 2VLUA 2HRKB 1XIYA 1X9WB 1YY7A 2KP2A 2YWIA 1UC7A 4HJMA 4MJBA 2B7KA 1B48A 3APSA 2P0GA 3D22A 2OBIA 2OE1A 2MZCA 3BOAA 1NHYA 5J3RA 12GSA 2F3MA 5G1LA 4KE3A 3C71A 4XIHA 3TKSA 4BWSA 2LRNA 2WS2A 3PGTA 1A8YA 1YEXA 2V6KA 5ECOB 4MH2A 3GYKA 4BWQA 4HUAA 1ERUA 4EDZA 2PU9C 4DSQA 4NWYA 2FD3A 2OKAA 5ECKB 4I2TA 1PKZA 4F0CA 1PQNA 2V2GA 4N11A 1W4VA 5KEJA 4WR4A 1BG5A 5FHIA 6GSXA 4XCSA 4ECBA 3NOFA 5G1KA 4JR6A 2NDOA 3HDCA 1NW2A 1OC3A 1PD21 4J56E 2H70A 1ZMAA 3DMLA 3L78A 4XRDA 4FQUA 2XPDA 4ISDA 2ZUPA 1A8LA 3APOA 2GZZA 3D4MA 3HHVA 3J7Yb 2FUG2 1WJKA 2I4AA 2IIYA 2TRCP 1OC9B 3GURA 1FO5A 1XZOA 3TKSC 1Z6MA 2L5OA 3MSZA 1PKWA 2YP6A 4G0LA 1TU8A 2CZ2A 2WFCA 4JE1A 1AIUA 3I43A 3DIEA 4LMVA 2K9FA 2B1LA 2ES7A 4X1UA 4L0UA 5HFIA 1M7TA 2C80A 5HR2A 1Z6NA 3RPPA 4HI7A 1K0MA 3H1NA 2AAWA 1FB6A 1XW6A 3L9VA 5IQYA 4NPBA 5DCHA 1K0BA 3FHKA 3AY8A 1S3CA 3P8WA 2IFQB 1TRVA 4PX1A 3MDKA 1PSQA 2HYXA 5CNWA 1BEDA 2PWJA 1E2YA 4IJ3A 2WZ9A 2AHEA 4HZ4A 2H0IA 3GRXA 4BL7A 1A0RP 2YV7A 3VLNA 4MF7A 4N30A 4YQMA 1WMJA 3CSIA 3UBKA 4I2UA 2HSNB 1RW1A 4ML1A 13GSA 1WOUA 3ERGA 3M9KA 2MMNA 2QKEA 4PUFC 3ZITA 1GSEA 1JLVA 4IELA 3VI7A 3GL3A 4POMA 5D9TA 3CRTA 16GSA 4IQ1A 1GSUA 4HQSA 1MDJA 4O5RA 1DE2A 3O6TA 2YV9A 1HQOA 2YWMA 3IPZA 3UVHA 3M8NA 2H1BA 5B6MA 1DE1A 2DC5A 1TU7A 3GX0A 2FLSA 1OC8A 1SL0B 3ZREA 4MZWA 3GTUB 8GSSA 5IM9A 3PINA 5DQYA 2LV3A 4ZB8A 2IMDA 4RI6A 2IL3A 5DCGA 5LNKe 1R5PA 3U5RE 3ZLPA 1C72A 2CV4A 5AISA 1XWKA 2L4QA 1U87A 4I8BA 1X9SB 2XPEA 1B4QA 3DD3A 2X99A 3IOSA 2GGTA 1N2AA 1U6TA 3EURA 4LL4B 4IN0A 3G7IA 4PNFA 5H5QA 2WULA 5JCUA 2H76A 2KP1A 5J41A 2PMTA 2YWNA 4J57E 3CXGA 1O6JA 1FG4A 2FY6A 3KGKA 3F4TA 2L57A 4TR1A 2GSQA 5F07A 3VPQA 5IOXA 2L6DA 4ZBAA 3PPUA 5GAPD 1FOVA 2F8FA 1ERTA 4RUVA 3I6AA 2GZYA 3GV1A 2RM6A 1NSWA 2B5EA 3H8QA 1PX6A 3O3TA 1ZYQB 3RHCA 2YN1A 3LORA 2VD0A 5BMUA 2RIIA 3LG6A 3WGDA 1DSBA 2JZRA 1T8EB 4MLYA 2OBKA 2RLIA 1PL2A 1HNCA 1KBNA 3GSSA 3U6VA 4OCEA 1EP8A 1BX9A 1U88A 5A4VA 4HU7A 4OD7A 2P5QA 5KN3A 2LQOA 5JWQB 2LEGA 2PUKC 2JL4A 1ON4A 3DVWA 4AGSA 3ZMLA 2DJJA 1AW9A 4G19A 1QQ2A 1XWBA 3EINA 1GLQA 2E2MA 4F0BA 5IMAA 4ML6A 2H19A 4JEDA 1SK1A 3HVVA 3EU3A 5H5RA 2H30A 4POKA 1V40A 1F9MA 3HD5A 5FWGA 4RI7A 4PTSA 1K0DA 4EVMA 3QAGA 3BD2A 4AJ7A 1OE8A 5CRHA 2UZ8A 5CP1A 2PGTA 4DSRA 2IMEA 1G6WA 2KOKA 3BJ5A 1THOA 1ZOFA 2VM1A 4NMUA 3UL3A 2CZ3A 2V6OA 1PMTA 4V2NA 1GSQA 1K0CA 4WXTA 3KZQA 1SK0A 4YAVA 1FVKA 4ZBDA 4PUAA 3IC4A 4PQIA 1JZOA 1SJ6A 1F3AA 2C3QA 1LBKA 3CBUA 4E8EA 4MF6A 1EGOA 4CDOA 2LRCA 4KDUA 1EWXA 2YZHA 4KCEA 1PX7A 1J08A 3LWAA 2HLSA 1G6YA 1TRWA 3GFKA 4ECCA 4G0KA 2IN3A 4WF4A 3GN3A 3MWHA 3FZ5A 4K6XA 1ACVA 4H86A 1TK5B 3KM6A 1A0FA 4O32A 2GVPA 2JACA 3CMIA 3DRNA 1Y25A 1V58A 4XHMA 1WWJA 3HY2A 1YQ1A 3VWWA 5HFGA 3TJBA 1AQVA 1TI1A 6GSTA 2WCIA 3VI5A 3IK7A 1TRSA 2C3NA 4IP6A 4KDYA 4FYUA 2HXKA 4MF5A 5G30A 1T3BA 1EOHA 5EY6A 3L9UA 1OYJA 2O7KA 2GT6A 2N5AA 2VL2A 3HCZA 2FWFA 1M9BA 5DJMA 3LJRA 3IV4A 1T7PB 4TN8A 1A2LA 1V2AA 5L71A 2H6ZA 1YF0A 2YJHA 1B8XA 3UVTA 3ISOA 3V1WA 3DGQA 4FH8A 4G2EA 2I1UA 2YJ7A 3EYTA 4TOPA 5DAKA 1RK4A 5B8AA 2FA8A 3HVXA 3DXBA 4K8MA 3ZFBA 3Q6OA 1JZWA 1YZXA 3UEMA 2VCZA 4EUYA 2QC7A 4RQRA 4TR1B 5AIVA 1XXUA 2NBSA 6GSSA 4XTSA 2YOIA 5IO0A 1QGVA 3H93A 1B4PA 1Z7RA 3TGZA 4DEJA 1QFNA 6GSVA 4GQCA 4K0NA 4NV2A 2NTOA 2GSTA 1PA3A 2VLTA 3IA1A 1I5GA 1ZZYA 2H01A 4AJ6A 3TCOA 3IAM2 1OE7A 2AV4A 4MABA 1MD3A 1IYIA 1Z3EA 5A4WA 2VL2C 3M9JA 3DWVA 1SD8A 3LQ7A 4PNGA 1PRXA 2LKUA 1HNAA 4GRFA 3P2AA 4MA9A 2TRXA 1O7UA 3Q19A 1XW9A 2O8VB 1BAYA 4F82A 3N9JA 3IC8A 2XBIA 1GLPA 1O8WA 1XWCA 3C1SA 2H72A 1K3OA 4V2MA 1XW5A 3PR8A 2I9HA 1H75A 2H6YA 2MMZA 3FYGA 1SYXA 1M99A 1TW9A 3E9JB 2BMXA 3F6DA 1G0TA 4N10A 2CVBA 1ZCPA 2GT5A 2WDUA 4GSSA 5DVBA 2B5XA 3A3TA 5EVOA 2J9HA 3TJJA 2ZCTA 2LTKA 3TKSE 4MMMA 1EZKA 3QMXA 3F6FA 4F2IA 3P90A 1EV4A 5J5NA 4USSA 5B7CA 2B7JA 1A23A 4HOJA 2HRNA 3TRQA 4ID0A 4EC0A 4K7OA 2C4JA 5LCZA 2YPMA 4XRAA 4N0VA 2CAIA 2VCVA 1X5EA 3VK9A 3F3RA 1SKRB 5B6NA 2YCDA 3G9BA 1F2EA 3Q74A 1V57A 3QFAC 4JBBA 3KP8A 2VL3A 1K0AA 1J9BA 3NIVA 1A2MA 3UJ1A 3F8UA 3A2WA 3A2VA 4ZB9A 1HYUA 1Z7PA 3ME8A 4X0XA 4IBPA 4ECIA 2HZFA 4TR4A 2G0FA 3E0UA 1SD9A 5J4UA 2VIMA 4FYCA 3KJYA 4TVEA 3VWVA 4LA1A 4MZCA 3M0FA 4K7IA 3ZIJA 2DIZA 1U3AA 1EGRA 1F6MC 2GS3A 2I81A 5ECHB 2P5RA 3C73A 3J7Yk 3PH9A 1SKSB 1HNBA 3KEBA 3ERFA 3GSTA 4Z7XA 2K6VA 1T4ZA 1JZDA 3KMOA 4GQFA 5F0GA 3HJMA 1TP9A 4XS4B 3GKMA 3GIXA 4IJIA 1LU4A 2HE3A 2OACA 2PPTA 1YDKA 3D5JA 2ON5A 1RQMA 3I69A 2DBCA 5HR3A 5IPGA 5B8BA 3VWXA 4AJ8A 2H1GA 4EKZA 1O85A 1PN9A 2KHPA 4MJAA 2CVDA 1YKAA 2R2JA 1WE0A 2KUCA 4GXZA 4YH2A 1K3LA 2ZNMA 2HSMA 3ZL5A 4OMVA 5J9CA 2JZTA 2OE0A 3SBCA 1S3DA 4G10A 2VLVA 2MBTA 2VD1A 4MJEA 4KH7A 2VCXA 1GUMA 4TRXA 7GSSA 2GQKA 1AXDA 5G5FA 1M0UA 2H75A 2LUSA 3LGCA 1TTZA 5IOWA 1F37A 4IVFA 3KH7A 4EL1A 3QAVA 3CSJA 2IMIA 2FWHA 5A4UA 4F03A 3D6IA 2DIYA 3DVXA 3RHBA 1PGTA 1FHEA 1GWCA 4KDXA 3TOUA 4POBA 3FK8A 2H66A 3WYWA 4BVYA 4L5LA 3KXOA 2JSYA 3CRUA 3N5OA 5INYA 2R3XA 1K0NA 3CTFA 4K0GA 1JHBA 3MNGA 3GL5A 5D9VA 1S3AA 3BCIA 4FIWA 2DJKA 2P31A 3C7MA 4JZQA 2A4VA 3FZ9A 3FZ4A 1FAAA 2FWEA 3IAS2 1GNWA 4V1Ap 2K18A 5ECIB 4AF2A 5E4WA 2H8LA 1GULA 2EIQA 4L8EA 3ZVJA 4O7HA 1URMA 1T1VA 3LSZA 1T00A 2NVLA 5D9XA 1WPIA 4L5OA 1XWAA 2B5YA 1X9MB 5DQSA 4ACSA 3ED3A 1O73A 1GSSA 20GSA 1E6BA 4J2FA 3ZFLA 1O8XA 1GUHA 3KTBA 4HDEA 2GSSA 2VUPA 4HJ2A 4TXVA 4ZL8A 2FWGA 1V9WA 1VRSD 2EIRA 1OAZA 4N0ZA 1FVJA 4WBJA 3FW2A 2PBJA 4I5QA 2LJRA 1VF3A 2YWOA 4YQUA 5CRGA 3HZ4A 2C0EA 1J0FA 2R6KA 4CW9A 4KF9A 5HQPA 2M80A 2F51A 2B6MA 3RDWA 3UBLA 1GUKA 1X5DA 4GF0A 2LNSA 4QL7A 2OJLA 2V32A 4IGJA 1R26A 2HRFA 1SYRA 4NXIA 2V1MA 2HSHA 4K7NA 4GSTA 5IMFA 2DJ1A 3E3EA 4LL1B 3IRAA 5CRDA 1FW1A 4JR4A 1EV9A 4ZXGA 4TR0A 1ERWA 2HZEA 2R5GA 4KCAA 3CSHA 1M2AA 5IO2A 1OKTA 4DVCA 22GSA 2WGRA 4BL7B 1KEBA 2QSIA 3KMNA 5AIXA 5D96A 5HFKA 5ELGA 2HFDA 2CX4A 2DMMA 1ILOA 4TR3A 4TXOA 2C1YA 1QUWA 1VF1A 4MK3A 2RM5A 5ECMB 2X8GA 1QXHA 3FEUA 5D93A 1I9DA 4JRRA 5IMZA 5DALA 1XOAA 3OR5A 3TB2A 4ZIJA 3SWLA 4HU9A 4V1Ag 4I6XA 2L59A 2A2SA 3FR6A 3O76A 1KTEA 2M46A 2FHEA 2C0GA 3TKRA 2ON7A 1XBSA 2HI7A 5DDLA 4FYBA 4PQHA 5D9WA 1CQGA 4NV5A 3EE2A 1WIKA 5F8BA 2N5FA 1AAZA 3M3MA 1VGLA 3TRXA 3QAWA 2B1KA 4ZILA 2PVQA 2L4CA 1B9YC 3HZ8A 5JWRB 2H74A 5ECLB 2LNTA 2RUEA 1G7EA 1XCCA 4NHZA 3NZNA 5LD0A 1G7OA 2ALBA 1SU9A 1B9XC 2H1DA 5IMCA 1SL2B 4ECJA 2HSMB 4I97A 5ID2A 2R4VA 2AB6A 4K9ZA 3K8NA 5D8IA 2EC4A 2E7PA 5DBQA 1MDKA 3IBHA 4YQVA 4IW9A 2C0FA 1BYEA 14GSA 4Q5RA 2PVOC 6GSWA 1EEJA 1UVZA 1BJXA 1UA5A 1Y6EA 1O81A 19GSA 1GTBA 2FA4A 2H0GA 4WEYA 4WETA 2JZSA 2C3TA 4BVXA 4HS1A 5G5EA 1JFUA 2LRTA 2E2GA 4WF5A 3LYPA 5GZZB 1VF4A 4BVYB 1NM3A 1X0RA 3P7XA 2WB9A 2XHFA 3QFBC 4KSMA 3KTLA 3ZRDA 2MMAA 18GSA 1W89A 2L6CA 4Q5FA 1GNEA 5ENUA 2FCHA 2A2RA 2L5LA 4KB3A 17GSA 3RBTA 1V98A 3TUEA 4OFNA 5ECQB 2WRTA 3DKSA 5CREA 3HA9A 3IDVA 1R4WA 4DSSA 2FNOA 1JZRA 3GA4A 1GL8A 1R5AA 4GTUA 5IMVA 4G9HA 3HXSA 3JCML 1K3YA 4PXOA 2AUVA 3A2XA 4ULXA 1PL1A 2PERA 3LEFA 3ZZXA 4D73A 3KIJA 3QD9A 2H6XA 1M9AA 2Z9SA 1CQHA 5ECNB 4MH3A 3D21A 1R7HA 4KW6A 2VL9A 3W8JA 3WD6A 4E8HA 3TJKA 3F0IA 4YAPA 2H73A 3ZVJD 3KH9A 4EXJA 1X5CA 1M2DA 2BTOT 2N5BA 5JCWA 2J23A 3UAPA 4OCFA 3C1RA 2VOCA 3EU4A 3GH6A 3F63A 4IS0A 4MJCA 5ECRB 5GAND 4MPFA 1VF2A 2B3SA 1GTUA 3FRCA 5CAXA 4EO3A 2VCTA 3IXRA 4JU5A 2I3YA 1EP7A 3M1GA 5FT3A 2CAQA 4GWRA 1TKDB 4FO5A 3GMFA 4WR5A 5EPFA 2HRAA 3RAZA 4F9ZA 2MYGA 1SL1B 2HZEB 1ZGNA 3W6GA 5HR0A 2AYTA 3LFLA 1MD4A 4ZBBA 1ABAA 1MDIA 2IMKA 1TRUA 1GRXA 4TXOB 4MP4A 3GUSA 4QL9A 1TI3A 2C8UA 1GSYA 4V2LA 4MDCA 4IQAA 1TXXA 3S9FA 1SK2A 4XS1A 2GZPA 5ELAA 5DALB 4EDYA 5F06A 3TJGA 1F3BA 1XVQA 3D4TA 4KSOA 4MZBA 3DEXA 3L9SA 1GTIA 2GDRA 2CX3A 2VCQA 2VM2A 3UIWA
chains in the Genus database with same CATH superfamily
2HSYA 1MEKA 4NAXA 1SVOA 4ZB6A 3WGXA 2EIOA 1H4OA 4CHSA 5E59A 3EWLA 5A5HA 5JWOB 2H71A 2A4HA 2H0HA 2CVKA 1XFLA 5JCGA 1SJZA 2X64A 2HNLA 1DUGA 1XG8A 2DJ2A 3I9V2 1A24A 5C00A 1Q4JA 1TK0B 2OA7A 1ZYPA 4Q5NA 4POLA 3VWUA 1EEMA 4KNDA 1OKDA 4OO4A 4IP1A 5ID2B 3F4SA 1EOGA 3F3QA 4IHUA 2H1AA 4HEA2 4QQ7A 1QK8A 3FR3A 4PQ1A 1QMVA 4WKWA 3MIXA 5KN1A 5ECSA 2YNXA 5IMDA 5D73A 2VO4A 3ZYWA 1SENA 3ERWA 2DSAA 4MPGA 5DAKB 5G31A 2GSRA 4GCIA 4KX4A 3GHAA 3EMXA 3WT1A 1TDIA 2WVZA 4YKGA 3TJFA 4BPYA 4TKYA 3L0HA 2HRKA 3EVIA 5GSTA 2O85A 4OWYA 1GH2A 2GLRA 5CO3A 1SJIA 1MTCA 2DJ3A 3FR9A 5F05A 2GQLA 2YANA 4BVXB 5AN1A 2X8HA 3HJPA 4CY6A 4ILFA 2JU5A 1YF1A 1FB0A 5G2ZA 2XC2A 4K5RA 4P3YB 5GSSA 5H5SA 5KN2A 4O92A 1M3JA 3APQA 3LYKA 3BBYA 1Z9HA 1AC1A 1ST9A 2LS5A 3KD0A 3HJOA 3CTGA 1WP0A 4G0IA 2LSTA 3G7YA 5IIZA 2VAFA 3GNJA 4KAEA 3TU3B 1GSFA 2WJUA 3GKNA 2IJYA 3RPNA 2CQ9A 4DSSB 2F9SA 4PGTA 1LJRA 2V41A 1TK8B 4FXYP 3ZIVA 2IPAA 4PI2C 4WBRD 1WRYA 2K8VA 3MAKA 4HZ2A 3Q18A 3US3A 4BA7A 1ZL9A 5KN0A 1Z5YE 3A5WA 4LMWA 3IE3A 3H79A 2X4AA 2IWTA 3UOMA 4D73B 1T4YA 4IKHA 1HD2A 2R0CA 2HT9A 3HVSA 4ZB7A 3QOUA 2K8SA 4EE0A 4PURA 1XWGA 2NPBA 2R37A 4XS6A 3R3EA 3TDGA 4Q5QA 5C04A 3CYNA 3D0ZA 5J9BA 4OO5A 5IPHA 1AQXA 5CYYA 1OC9A 3WT2A 3F9UA 5EL8A 2KLXA 5CRWA 3KP9A 3TKQA 1GP1A 1YEPA 1UN2A 3UARA 3TRPA 1AUCA 2CT6A 3VFIA 3VURA 1M2BA 4GLTA 2O89A 4OFMA 2XBQA 2DJ0A 2REMA 4MCUA 1U3IA 2VCWA 1XPVA 3R2QA 3KCMA 3ME7A 1THXA 3LXTA 4ICYA 10GSA 4K1FA 1PN0A 2OE3A 1NHOA 2AJQB 5HR1A 1DBYA 1AQWA 1ERVA 4LLRA 2F8AA 2IFQA 3VPTA 1SKWB 1TJDA 1GTAA 11GSA 1XOBA 3DYRA 2WVXB 4HQZA 2MMOA 2O87A 3HYPA 4OFTA 2YZUA 2QGVA 1ZYEA 2RUFA 3GKKA 2GTUA 3EC3A 3ZMKA 2BJXA 5ECPB 1A2JA 5AGYA 4RQXA 3IK9A 2TIRA 5ABRA 2HQTA 2HSNA 3GX8A 4L0WA 1KNGA 4K2DA 1IYHA 2D2ZA 1USBA 3IHQA 3G7JA 4ZL7A 1YKCA 1K0OA 3IR4A 3W8SA 3H4KA 4KGIA 4KA0A 2LQQA 3GKXA 2LJKA 2CA8A 1S3RA 3GH9A 3UMAA 3L4NA 2PN8A 3TKPA 5A5HB 4XS4A 3WGEA 1XVWA 3EMPA 4ZL9A 5DJLA 2M72A 3QDNA 3LXZA 3FY7A 5A34A 1BQ7A 3QPMA 3GTUA 4NHWA 1ML6A 4TW5A 3TOTA 1N8JA 1GSDA 3FKFA 2DLXA 4X43A 2MBSA 3QCPA 6GSUA 4GSNA 3HKRA 5A5KA 6GSYA 2LJAA 2DMLA 1TOFA 1JLWA 3BCKA 2E0QA 2OADA 4EF0A 1PFOA 2C0DA 4CY8A 3FZAA 1Q98A 4KUNA 2IMFA 3F4RA 2JADA 4Z2TA 9GSSA 1OVNA 3C8EA 1Y1UA 2FGXA 3QR6A 2JSZA 2GQMA 2X8CA 5COHA 3FMWA 3ZTLA 4AKXB 1YJ6A 2G2QA 2VLUA 2HRKB 1XIYA 1X9WB 1YY7A 2KP2A 2YWIA 1FOHA 1UC7A 4HJMA 4MJBA 2B7KA 1B48A 3APSA 2P0GA 3D22A 2QA1A 2OBIA 2OE1A 2MZCA 3BOAA 1NHYA 5J3RA 12GSA 2F3MA 5G1LA 4KE3A 3C71A 4XIHA 3TKSA 4BWSA 2LRNA 2WS2A 3PGTA 1A8YA 1YEXA 2V6KA 5ECOB 4MH2A 3GYKA 4BWQA 4HUAA 1ERUA 4EDZA 2PU9C 4DSQA 4NWYA 2FD3A 2OKAA 5ECKB 4I2TA 1PKZA 4F0CA 1PQNA 2V2GA 4N11A 2EFCA 4GDFA 1W4VA 5KEJA 4WR4A 1BG5A 5FHIA 6GSXA 4XCSA 4ECBA 3NOFA 5G1KA 4JR6A 2NDOA 3HDCA 1NW2A 1OC3A 1PD21 4J56E 2H70A 1ZMAA 3DMLA 4AI6A 3L78A 4XRDA 4FQUA 2XPDA 4ISDA 2ZUPA 1A8LA 3APOA 2GZZA 3D4MA 3HHVA 4YKFA 3J7Yb 2FUG2 1WJKA 2I4AA 2IIYA 2TRCP 1OC9B 3GURA 1FO5A 1XZOA 3TKSC 1Z6MA 2L5OA 3MSZA 1PKWA 2YP6A 4G0LA 1TU8A 2CZ2A 2WFCA 4JE1A 1AIUA 3I43A 3DIEA 4LMVA 2K9FA 2B1LA 2ES7A 4X1UA 4L0UA 5HFIA 1M7TA 2C80A 5HR2A 1Z6NA 3RPPA 5J40A 4HI7A 1K0MA 3H1NA 2AAWA 1FB6A 1XW6A 3L9VA 5IQYA 4AKGA 4NPBA 5DCHA 1I1IP 1K0BA 3FHKA 2EFDA 3AY8A 1S3CA 3P8WA 2IFQB 1TRVA 4PX1A 3MDKA 1PSQA 2HYXA 5CNWA 1BEDA 2PWJA 1E2YA 4IJ3A 2WZ9A 2AHEA 4HZ4A 2H0IA 3GRXA 4BL7A 1A0RP 2YV7A 3VLNA 1SVMA 4MF7A 4N30A 4YQMA 1WMJA 3CSIA 4E68A 3UBKA 4I2UA 2HSNB 1RW1A 4ML1A 13GSA 1WOUA 3ERGA 3M9KA 2MMNA 2QKEA 1ZYNA 4PUFC 3ZITA 1GSEA 1JLVA 4IELA 3VI7A 3GL3A 4POMA 5D9TA 3CRTA 16GSA 4IQ1A 1GSUA 4HQSA 1MDJA 4O5RA 1DE2A 3O6TA 2YV9A 1HQOA 2YWMA 3IPZA 3UVHA 3M8NA 2H1BA 3IHGA 5B6MA 1DE1A 2DC5A 3GX0A 1TU7A 2FLSA 1OC8A 1SL0B 3ZREA 4MZWA 3GTUB 8GSSA 5IM9A 3PINA 5DQYA 2LV3A 4ZB8A 2IMDA 4RI6A 2IL3A 5DCGA 5LNKe 1R5PA 3U5RE 3ZLPA 3A5IA 1C72A 2CV4A 5AISA 1XWKA 2L4QA 1U87A 4I8BA 1X9SB 2XPEA 1B4QA 3DD3A 2X99A 3IOSA 2QA2A 2GGTA 1N2AA 1U6TA 3EURA 4LL4B 4IN0A 3G7IA 4PNFA 4O5UA 5H5QA 2WULA 5JCUA 2H76A 4AKHA 2KP1A 4AKIA 5J41A 2WZSA 2PMTA 2YWNA 4J57E 3CXGA 1O6JA 1FG4A 2FY6A 3KGKA 3F4TA 2L57A 4TR1A 2GSQA 5F07A 3VPQA 5IOXA 2L6DA 4ZBAA 3PPUA 5GAPD 1FOVA 2F8FA 1ERTA 4RUVA 3I6AA 2GZYA 3GV1A 2RM6A 1NSWA 2B5EA 3H8QA 1PX6A 3O3TA 1ZYQB 3RHCA 2YN1A 3LORA 2VD0A 5BMUA 2RIIA 3LG6A 3WGDA 1DSBA 2JZRA 1T8EB 4MLYA 2OBKA 2RLIA 1PL2A 1HNCA 1KBNA 3GSSA 3U6VA 4OCEA 1EP8A 1BX9A 1U88A 5A4VA 4HU7A 4OD7A 2P5QA 5KN3A 2LQOA 5JWQB 2LEGA 2PUKC 2JL4A 1ON4A 3DVWA 4AGSA 3ZMLA 2WVYA 2DJJA 1AW9A 4G19A 1QQ2A 1XWBA 3EINA 1GLQA 2E2MA 4F0BA 5IMAA 4ML6A 2H19A 4JEDA 1SK1A 3HVVA 3EU3A 5H5RA 2H30A 4POKA 1V40A 1F9MA 3HD5A 5FWGA 4RI7A 4PTSA 1S4BP 1K0DA 4EVMA 3QAGA 4K2XA 3CWGA 3BD2A 4AJ7A 1OE8A 5CRHA 2UZ8A 5CP1A 2PGTA 4DSRA 2IMEA 1G6WA 2KOKA 3BJ5A 1THOA 1ZOFA 2VM1A 1M3IA 4NMUA 3UL3A 2CZ3A 2V6OA 1PMTA 4V2NA 1GSQA 1K0CA 4WXTA 3KZQA 1SK0A 4YAVA 2O36A 1FVKA 4ZBDA 4PUAA 2WW2A 3IC4A 4PQIA 1JZOA 1SJ6A 1F3AA 2C3QA 1LBKA 1TXUA 3CBUA 4E8EA 4MF6A 1EGOA 4CDOA 2LRCA 4KDUA 1EWXA 2YZHA 4KCEA 1PX7A 1J08A 3LWAA 2EFHA 2HLSA 1G6YA 1TRWA 3GFKA 4ECCA 4G0KA 2IN3A 4WF4A 3GN3A 3MWHA 3FZ5A 4K6XA 1ACVA 4H86A 4Z2UA 1TK5B 3KM6A 1A0FA 5KOXA 5KOWA 4O32A 2GVPA 2JACA 3CMIA 3DRNA 1Y25A 1V58A 4XHMA 1WWJA 3HY2A 1YQ1A 3VWWA 5HFGA 3TJBA 1SVLA 1AQVA 1TI1A 6GSTA 2WCIA 3VI5A 3IK7A 1TRSA 2C3NA 4IP6A 4KDYA 4FYUA 2DKHA 2HXKA 4MF5A 5G30A 1T3BA 1EOHA 5EY6A 3L9UA 1OYJA 2O7KA 2GT6A 2N5AA 2VL2A 3HCZA 2FWFA 1M9BA 5DJMA 3LJRA 3IV4A 1T7PB 4TN8A 1A2LA 1V2AA 5L71A 2H6ZA 1YF0A 2YJHA 1B8XA 3UVTA 3ISOA 3V1WA 3DGQA 4FH8A 4G2EA 3RFRC 2I1UA 2YJ7A 3EYTA 4TOPA 5DAKA 1RK4A 5J4VA 5B8AA 2FA8A 3HVXA 2VKZG 3DXBA 4K8MA 3ZFBA 3Q6OA 1JZWA 1YZXA 3UEMA 2VCZA 4EUYA 2QC7A 4RQRA 4TR1B 5AIVA 1XXUA 2NBSA 6GSSA 2O3EA 2YOIA 4XTSA 5IO0A 1QGVA 3H93A 1B4PA 1Z7RA 3TGZA 4PI0C 4DEJA 1QFNA 6GSVA 4GQCA 5BRTA 4K0NA 4NV2A 2NTOA 2GSTA 1PA3A 2VLTA 3IA1A 1I5GA 1ZZYA 2H01A 4EIPA 4AJ6A 3TCOA 3IAM2 1OE7A 2AV4A 4MABA 5BMUB 3EPTA 1MD3A 1IYIA 1Z3EA 5A4WA 2VL2C 3M9JA 3DWVA 1SD8A 3LQ7A 4PNGA 1PRXA 2LKUA 1HNAA 4GRFA 3P2AA 4MA9A 2TRXA 1O7UA 3Q19A 1XW9A 2O8VB 3LW9A 1BAYA 4F82A 3N9JA 3IC8A 2XBIA 1GLPA 1O8WA 1XWCA 3C1SA 2H72A 1K3OA 4V2MA 1XW5A 3PR8A 2I9HA 1H75A 2H6YA 2MMZA 3FYGA 1SYXA 1M99A 1TW9A 3E9JB 2BMXA 3F6DA 1G0TA 4N3ZA 4N10A 2CVBA 1ZCPA 2GT5A 2WDUA 4GSSA 5DVBA 2B5XA 3A3TA 4A5PA 5EVOA 2R0PA 2J9HA 3TJJA 2ZCTA 2LTKA 3TKSE 4MMMA 1EZKA 3QMXA 3F6FA 4F2IA 3P90A 1EV4A 5J5NA 4USSA 5B7CA 2B7JA 1A23A 4HOJA 2HRNA 3TRQA 4ID0A 4EC0A 4K7OA 3HVNA 2C4JA 5LCZA 2YPMA 4XRAA 4N0VA 2CAIA 2VCVA 4HSCX 1X5EA 3VK9A 3F3RA 1SKRB 5B6NA 2YCDA 3G9BA 1F2EA 3Q74A 1V57A 3QFAC 4JBBA 3KP8A 2VL3A 1K0AA 1J9BA 4EIQA 3NIVA 1A2MA 3UJ1A 3F8UA 3A2WA 1BF5A 3A2VA 4ZB9A 1HYUA 1Z7PA 3ME8A 4X0XA 4IBPA 2UV8G 4ECIA 2HZFA 4TR4A 2G0FA 3E0UA 1SD9A 5J4UA 2VIMA 4FYCA 3KJYA 4TVEA 3VWVA 4LA1A 4MZCA 3M0FA 4K7IA 3ZIJA 2DIZA 1U3AA 1EGRA 1F6MC 2GS3A 1N25A 5ECHB 2I81A 2P5RA 3C73A 3J7Yk 3PH9A 1SKSB 1HNBA 3KEBA 3ERFA 3GSTA 4Z7XA 2K6VA 1T4ZA 1JZDA 3KMOA 5A1NA 5F0GA 4GQFA 3HJMA 1TP9A 4XS4B 3GKMA 3GIXA 4IJIA 1LU4A 2HE3A 2OACA 2PPTA 5A34B 1YDKA 2WW1A 3D5JA 2ON5A 1RQMA 3I69A 2DBCA 5HR3A 5IPGA 5B8BA 3VWXA 4AJ8A 2H1GA 4EKZA 1O85A 1PN9A 2KHPA 4MJAA 2CVDA 1YKAA 2R2JA 4X4JA 1WE0A 2KUCA 4GXZA 4YH2A 1K3LA 2EFEA 2ZNMA 2HSMA 3ZL5A 4OMVA 5J9CA 2JZTA 2OE0A 3SBCA 1S3DA 4G10A 2VLVA 2MBTA 2VD1A 4MJEA 4KH7A 2VCXA 1GUMA 4TRXA 7GSSA 2GQKA 1AXDA 5G5FA 1M0UA 2H75A 2LUSA 4PHZC 3LGCA 1TTZA 5IOWA 1F37A 4IVFA 3KH7A 4MNNA 4EL1A 3QAVA 3CSJA 2IMIA 2FWHA 5A4UA 4F03A 3D6IA 2DIYA 3DVXA 3RHBA 1PGTA 1FHEA 1GWCA 4KDXA 3TOUA 4POBA 3FK8A 2H66A 3WYWA 4BVYA 4L5LA 3KXOA 2JSYA 3CRUA 3N5OA 5INYA 2R3XA 1BG1A 1K0NA 4QMKA 3CTFA 4K0GA 1JHBA 3MNGA 3GL5A 5D9VA 1S3AA 3BCIA 4FIWA 2DJKA 2P31A 3C7MA 4JZQA 2A4VA 3FZ9A 3FZ4A 1FAAA 2FWEA 3IAS2 1GNWA 4V1Ap 2K18A 5ECIB 4AF2A 5E4WA 2OT3A 2H8LA 1GULA 2EIQA 4L8EA 5J4YA 3ZVJA 4O7HA 1URMA 1T1VA 3LSZA 1T00A 2NVLA 5D9XA 1WPIA 4L5OA 1XWAA 2B5YA 1X9MB 5DQSA 4ACSA 3ED3A 1O73A 1GSSA 20GSA 1E6BA 4J2FA 3ZFLA 1O8XA 2X49A 1GUHA 3KTBA 4HDEA 2GSSA 2VUPA 4HJ2A 4TXVA 4ZL8A 2FWGA 1V9WA 1VRSD 2EIRA 1OAZA 4N0ZA 1FVJA 4WBJA 3FW2A 2PBJA 4I5QA 2LJRA 1VF3A 2YWOA 4YQUA 3CHXC 5CRGA 3HZ4A 2C0EA 1J0FA 2R6KA 3RGBC 4CW9A 4KF9A 5HQPA 2M80A 2WW3A 2F51A 2B6MA 3RDWA 3UBLA 1GUKA 1X5DA 4GF0A 2LNSA 4QL7A 2OJLA 2V32A 4IGJA 1R26A 2HRFA 1SYRA 4NXIA 4O5QA 2V1MA 2HSHA 4K7NA 4GSTA 5IMFA 2DJ1A 3E3EA 4LL1B 3IRAA 5CRDA 1FW1A 4JR4A 1EV9A 4ZXGA 4TR0A 1ERWA 2HZEA 2R5GA 4KCAA 3CSHA 1M2AA 5IO2A 1OKTA 4DVCA 22GSA 2WGRA 4BL7B 1KEBA 2QSIA 3KMNA 5AIXA 5D96A 5HFKA 5ELGA 2HFDA 2CX4A 2O5VA 2DMMA 2H1LA 1ILOA 4TR3A 4TXOA 2C1YA 1QUWA 1VF1A 4MK3A 5J47A 2RM5A 5ECMB 2X8GA 1QXHA 3FEUA 3MYDA 5D93A 1YEWC 1I9DA 2WW0A 4JRRA 5IMZA 5DALA 1XOAA 3OR5A 3TB2A 4ZIJA 3SWLA 4HU9A 4V1Ag 4I6XA 2L59A 2A2SA 3FR6A 3O76A 1KTEA 2M46A 2FHEA 5A1NB 2C0GA 3TKRA 2ON7A 2R0GA 1XBSA 2HI7A 5DDLA 4FYBA 4PQHA 5D9WA 1CQGA 4NV5A 3EE2A 1WIKA 5F8BA 2N5FA 1AAZA 3M3MA 1VGLA 3TRXA 3QAWA 2B1KA 4ZILA 2PVQA 2L4CA 1B9YC 3HZ8A 4W66A 5JWRB 2H74A 5ECLB 2LNTA 2RUEA 1G7EA 1XCCA 4NHZA 3NZNA 5LD0A 1G7OA 3CQFA 2ALBA 1SU9A 1B9XC 2H1DA 5IMCA 1SL2B 4ECJA 2HSMB 4I97A 5ID2A 2R4VA 2AB6A 2A2PA 3K8NA 4K9ZA 5D8IA 2EC4A 2E7PA 5DBQA 1MDKA 3IBHA 4YQVA 4IW9A 2C0FA 1BYEA 14GSA 4Q5RA 2PVOC 6GSWA 1EEJA 1UVZA 4BIKA 1BJXA 1UA5A 1Y6EA 1O81A 19GSA 1GTBA 2FA4A 2H0GA 4WEYA 4WETA 2JZSA 2C3TA 4BVXA 4HS1A 5G5EA 1JFUA 2LRTA 2E2GA 4WF5A 3LYPA 5GZZB 1VF4A 4BVYB 1NM3A 1X0RA 3P7XA 2WB9A 2XHFA 3QFBC 4KSMA 3KTLA 3ZRDA 2MMAA 18GSA 1W89A 2L6CA 4Q5FA 1GNEA 5ENUA 2FCHA 2A2RA 2L5LA 4KB3A 17GSA 3RBTA 1V98A 3TUEA 4OFNA 5ECQB 2WRTA 3DKSA 5CREA 3HA9A 3IDVA 1R4WA 4DSSA 2FNOA 1JZRA 3GA4A 1GL8A 1R5AA 4GTUA 5IMVA 4G9HA 3HXSA 3JCML 1K3YA 4PXOA 2AUVA 3HMJG 3A2XA 4ULXA 1PL1A 2PERA 3LEFA 3ZZXA 4D73A 3KIJA 3QD9A 2H6XA 1M9AA 2Z9SA 1CQHA 5ECNB 4MH3A 3D21A 1R7HA 4KW6A 2VL9A 3W8JA 3WD6A 4E8HA 3TJKA 3F0IA 4K5SA 4YAPA 2H73A 3ZVJD 3KH9A 4EXJA 1X5CA 1M2DA 2BTOT 2N5BA 5JCWA 2J23A 3UAPA 4OCFA 3C1RA 2VOCA 3EU4A 3GH6A 3F63A 4IS0A 4MJCA 5ECRB 5GAND 4MPFA 1VF2A 2DKIA 4Z2RA 2B3SA 1GTUA 3FRCA 5CAXA 4EO3A 2VCTA 3IXRA 4JU5A 2I3YA 1EP7A 3M1GA 5FT3A 2CAQA 4GWRA 1TKDB 4FO5A 3GMFA 4WR5A 5EPFA 2HRAA 3RAZA 4F9ZA 2MYGA 1SL1B 2HZEB 1ZGNA 3W6GA 5HR0A 2AYTA 3LFLA 1MD4A 4ZBBA 1ABAA 4G01A 1MDIA 2IMKA 1TRUA 1GRXA 4TXOB 2WVXA 3GUSA 4MP4A 4QL9A 1TI3A 2C8UA 1GSYA 4V2LA 4MDCA 4IQAA 1TXXA 3S9FA 1SK2A 4XS1A 2GZPA 5ELAA 5DALB 4EDYA 5F06A 3TJGA 1F3BA 1XVQA 3D4TA 4KSOA 4MZBA 3DEXA 3L9SA 1GTIA 1YVLA 2GDRA 2CX3A 2VCQA 2VM2A 3UIWA
chains in the Genus database with same CATH topology
2HSYA 1MEKA 4NAXA 1SVOA 4ZB6A 3WGXA 2EIOA 1H4OA 4CHSA 5E59A 3EWLA 5A5HA 5JWOB 2H71A 2A4HA 2H0HA 2CVKA 1XFLA 5JCGA 1SJZA 2X64A 2HNLA 1DUGA 2DJ2A 3I9V2 1A24A 5C00A 1Q4JA 1TK0B 2OA7A 1ZYPA 4Q5NA 4POLA 3VWUA 1EEMA 4KNDA 1OKDA 4OO4A 4IP1A 5ID2B 3F4SA 1EOGA 3F3QA 4IHUA 2H1AA 4HEA2 4QQ7A 1QK8A 3FR3A 4PQ1A 1QMVA 4WKWA 3MIXA 5KN1A 5ECSA 2YNXA 5IMDA 5D73A 2VO4A 3ZYWA 1SENA 3ERWA 2DSAA 4MPGA 5DAKB 5G31A 2GSRA 4GCIA 4KX4A 3GHAA 3EMXA 3WT1A 1TDIA 4YKGA 3TJFA 4BPYA 4TKYA 3L0HA 2HRKA 3EVIA 5GSTA 2O85A 4OWYA 1GH2A 2GLRA 5CO3A 1SJIA 1MTCA 2DJ3A 3FR9A 5F05A 2GQLA 2YANA 4BVXB 5AN1A 2X8HA 3HJPA 4CY6A 4ILFA 2JU5A 1YF1A 1FB0A 5G2ZA 2XC2A 4K5RA 4P3YB 5GSSA 5H5SA 5KN2A 4O92A 3APQA 3LYKA 3BBYA 1Z9HA 1AC1A 1ST9A 2LS5A 3KD0A 3HJOA 3CTGA 1WP0A 4G0IA 2LSTA 3G7YA 5IIZA 2VAFA 3GNJA 4KAEA 3TU3B 1GSFA 2WJUA 3GKNA 2IJYA 3RPNA 2CQ9A 4DSSB 2F9SA 4PGTA 1LJRA 2V41A 1TK8B 3ZIVA 2IPAA 4WBRD 1WRYA 2K8VA 3MAKA 4HZ2A 3Q18A 3US3A 4BA7A 1ZL9A 5KN0A 1Z5YE 3A5WA 4LMWA 3IE3A 3H79A 2X4AA 2IWTA 3UOMA 4D73B 1T4YA 4IKHA 1HD2A 2R0CA 2HT9A 3HVSA 4ZB7A 3QOUA 2K8SA 4EE0A 4PURA 1XWGA 2NPBA 2R37A 4XS6A 3R3EA 3TDGA 4Q5QA 5C04A 3CYNA 3D0ZA 5J9BA 4OO5A 5IPHA 1AQXA 5CYYA 1OC9A 3WT2A 3F9UA 5EL8A 2KLXA 5CRWA 3KP9A 3TKQA 1GP1A 1YEPA 1UN2A 3UARA 3TRPA 1AUCA 2CT6A 3VFIA 3VURA 1M2BA 4GLTA 2O89A 4OFMA 2XBQA 2DJ0A 2REMA 4MCUA 1U3IA 2VCWA 1XPVA 3R2QA 3KCMA 3ME7A 1THXA 3LXTA 4ICYA 10GSA 4K1FA 1PN0A 2OE3A 1NHOA 2AJQB 5HR1A 1DBYA 1AQWA 1ERVA 4LLRA 2F8AA 2IFQA 3VPTA 1SKWB 1TJDA 1GTAA 11GSA 1XOBA 3DYRA 4HQZA 2MMOA 2O87A 3HYPA 4OFTA 2YZUA 2QGVA 1ZYEA 2RUFA 3GKKA 2GTUA 3EC3A 3ZMKA 2BJXA 5ECPB 1A2JA 5AGYA 4RQXA 3IK9A 2TIRA 5ABRA 2HQTA 2HSNA 3GX8A 4L0WA 1KNGA 4K2DA 1IYHA 2D2ZA 1USBA 3IHQA 3G7JA 4ZL7A 1YKCA 1K0OA 3IR4A 3W8SA 3H4KA 4KGIA 4KA0A 2LQQA 3GKXA 2LJKA 2CA8A 3GH9A 3UMAA 3L4NA 2PN8A 3TKPA 5A5HB 4XS4A 3WGEA 1XVWA 3EMPA 4ZL9A 5DJLA 2M72A 3QDNA 3LXZA 3FY7A 5A34A 1BQ7A 3QPMA 3GTUA 4NHWA 1ML6A 4TW5A 3TOTA 1N8JA 1GSDA 3FKFA 2DLXA 4X43A 2MBSA 3QCPA 6GSUA 4GSNA 3HKRA 5A5KA 6GSYA 2LJAA 2DMLA 1TOFA 1JLWA 3BCKA 2E0QA 2OADA 4EF0A 2C0DA 4CY8A 3FZAA 1Q98A 4KUNA 2IMFA 3F4RA 2JADA 4Z2TA 9GSSA 1OVNA 3C8EA 1Y1UA 2FGXA 3QR6A 2JSZA 2GQMA 2X8CA 5COHA 3FMWA 3ZTLA 4AKXB 1YJ6A 2G2QA 2VLUA 2HRKB 1XIYA 1X9WB 1YY7A 2KP2A 2YWIA 1FOHA 1UC7A 4HJMA 4MJBA 2B7KA 1B48A 3APSA 2P0GA 3D22A 2QA1A 2OBIA 2OE1A 2MZCA 3BOAA 1NHYA 5J3RA 12GSA 2F3MA 5G1LA 4KE3A 3C71A 4XIHA 3TKSA 4BWSA 2LRNA 2WS2A 3PGTA 1A8YA 1YEXA 2V6KA 5ECOB 4MH2A 3GYKA 4BWQA 4HUAA 1ERUA 4EDZA 2PU9C 4DSQA 4NWYA 2FD3A 2OKAA 5ECKB 4I2TA 1PKZA 4F0CA 1PQNA 2V2GA 4N11A 2EFCA 4GDFA 1W4VA 5KEJA 4WR4A 1BG5A 5FHIA 6GSXA 4XCSA 4ECBA 3NOFA 5G1KA 4JR6A 2NDOA 3HDCA 1NW2A 1OC3A 1PD21 4J56E 2H70A 1ZMAA 3DMLA 4AI6A 3L78A 4XRDA 4FQUA 2XPDA 4ISDA 2ZUPA 1A8LA 3APOA 2GZZA 3D4MA 3HHVA 4YKFA 3J7Yb 2FUG2 1WJKA 2I4AA 2IIYA 2TRCP 1OC9B 3GURA 1FO5A 1XZOA 3TKSC 1Z6MA 2L5OA 3MSZA 1PKWA 2YP6A 4G0LA 1TU8A 2CZ2A 2WFCA 4JE1A 1AIUA 3I43A 3DIEA 4LMVA 2K9FA 2B1LA 2ES7A 4X1UA 4L0UA 5HFIA 1M7TA 2C80A 5HR2A 1Z6NA 3RPPA 5J40A 4HI7A 1K0MA 3H1NA 2AAWA 1FB6A 1XW6A 3L9VA 5IQYA 4AKGA 4NPBA 5DCHA 1K0BA 3FHKA 2EFDA 3AY8A 1S3CA 3P8WA 2IFQB 1TRVA 4PX1A 3MDKA 1PSQA 2HYXA 5CNWA 1BEDA 2PWJA 1E2YA 4IJ3A 2WZ9A 2AHEA 4HZ4A 2H0IA 3GRXA 4BL7A 1A0RP 2YV7A 3VLNA 1SVMA 4MF7A 4N30A 4YQMA 1WMJA 3CSIA 4E68A 3UBKA 4I2UA 2HSNB 1RW1A 4ML1A 13GSA 1WOUA 3ERGA 3M9KA 2MMNA 2QKEA 1ZYNA 4PUFC 3ZITA 1GSEA 1JLVA 4IELA 3VI7A 3GL3A 4POMA 5D9TA 3CRTA 16GSA 4IQ1A 1GSUA 4HQSA 1MDJA 4O5RA 1DE2A 3O6TA 2YV9A 1HQOA 2YWMA 3IPZA 3UVHA 3M8NA 2H1BA 3IHGA 5B6MA 1DE1A 2DC5A 1TU7A 3GX0A 2FLSA 1OC8A 1SL0B 3ZREA 4MZWA 3GTUB 8GSSA 5IM9A 3PINA 5DQYA 2LV3A 4ZB8A 2IMDA 4RI6A 2IL3A 5DCGA 5LNKe 1R5PA 3U5RE 3ZLPA 3A5IA 1C72A 2CV4A 5AISA 1XWKA 2L4QA 1U87A 4I8BA 1X9SB 2XPEA 1B4QA 3DD3A 2X99A 3IOSA 2QA2A 2GGTA 1N2AA 1U6TA 3EURA 4LL4B 4IN0A 3G7IA 4PNFA 4O5UA 5H5QA 2WULA 5JCUA 2H76A 4AKHA 2KP1A 4AKIA 5J41A 2PMTA 2YWNA 4J57E 3CXGA 1O6JA 1FG4A 2FY6A 3KGKA 3F4TA 2L57A 4TR1A 2GSQA 5F07A 3VPQA 5IOXA 2L6DA 4ZBAA 3PPUA 5GAPD 1FOVA 2F8FA 1ERTA 4RUVA 3I6AA 2GZYA 3GV1A 2RM6A 1NSWA 2B5EA 3H8QA 1PX6A 3O3TA 1ZYQB 3RHCA 2YN1A 3LORA 2VD0A 5BMUA 2RIIA 3LG6A 3WGDA 1DSBA 2JZRA 1T8EB 4MLYA 2OBKA 2RLIA 1PL2A 1HNCA 1KBNA 3GSSA 3U6VA 4OCEA 1EP8A 1BX9A 1U88A 5A4VA 4HU7A 4OD7A 2P5QA 5KN3A 2LQOA 5JWQB 2LEGA 2PUKC 2JL4A 1ON4A 3DVWA 4AGSA 3ZMLA 2DJJA 1AW9A 4G19A 1QQ2A 1XWBA 3EINA 1GLQA 2E2MA 4F0BA 5IMAA 4ML6A 2H19A 4JEDA 1SK1A 3HVVA 3EU3A 5H5RA 2H30A 4POKA 1V40A 1F9MA 3HD5A 5FWGA 4RI7A 4PTSA 1K0DA 4EVMA 3QAGA 4K2XA 3CWGA 3BD2A 4AJ7A 1OE8A 5CRHA 2UZ8A 5CP1A 2PGTA 4DSRA 2IMEA 1G6WA 2KOKA 3BJ5A 1THOA 1ZOFA 2VM1A 4NMUA 3UL3A 2CZ3A 2V6OA 1PMTA 4V2NA 1GSQA 1K0CA 4WXTA 3KZQA 1SK0A 4YAVA 1FVKA 4ZBDA 4PUAA 3IC4A 4PQIA 1JZOA 1SJ6A 1F3AA 2C3QA 1LBKA 1TXUA 3CBUA 4E8EA 4MF6A 1EGOA 4CDOA 2LRCA 4KDUA 1EWXA 2YZHA 4KCEA 1PX7A 1J08A 3LWAA 2EFHA 2HLSA 1G6YA 1TRWA 3GFKA 4ECCA 4G0KA 2IN3A 4WF4A 3GN3A 3MWHA 3FZ5A 4K6XA 1ACVA 4H86A 4Z2UA 1TK5B 3KM6A 1A0FA 5KOXA 5KOWA 4O32A 2GVPA 2JACA 3CMIA 3DRNA 1Y25A 1V58A 4XHMA 1WWJA 3HY2A 1YQ1A 3VWWA 5HFGA 3TJBA 1SVLA 1AQVA 1TI1A 6GSTA 2WCIA 3VI5A 3IK7A 1TRSA 2C3NA 4IP6A 4KDYA 4FYUA 2DKHA 2HXKA 4MF5A 5G30A 1T3BA 1EOHA 5EY6A 3L9UA 1OYJA 2O7KA 2GT6A 2N5AA 2VL2A 3HCZA 2FWFA 1M9BA 5DJMA 3LJRA 3IV4A 1T7PB 4TN8A 1A2LA 1V2AA 5L71A 2H6ZA 1YF0A 2YJHA 1B8XA 3UVTA 3ISOA 3V1WA 3DGQA 4FH8A 4G2EA 2I1UA 2YJ7A 3EYTA 4TOPA 5DAKA 1RK4A 5J4VA 5B8AA 2FA8A 3HVXA 2VKZG 3DXBA 4K8MA 3ZFBA 3Q6OA 1JZWA 1YZXA 3UEMA 2VCZA 4EUYA 2QC7A 4RQRA 4TR1B 5AIVA 1XXUA 2NBSA 6GSSA 4XTSA 2YOIA 5IO0A 1QGVA 3H93A 1B4PA 1Z7RA 3TGZA 4DEJA 1QFNA 6GSVA 4GQCA 5BRTA 4K0NA 4NV2A 2NTOA 2GSTA 1PA3A 2VLTA 3IA1A 1I5GA 1ZZYA 2H01A 4EIPA 4AJ6A 3TCOA 3IAM2 1OE7A 2AV4A 4MABA 5BMUB 3EPTA 1MD3A 1IYIA 1Z3EA 5A4WA 2VL2C 3M9JA 3DWVA 1SD8A 3LQ7A 4PNGA 1PRXA 2LKUA 1HNAA 4GRFA 3P2AA 4MA9A 2TRXA 1O7UA 3Q19A 1XW9A 2O8VB 3LW9A 1BAYA 4F82A 3N9JA 3IC8A 2XBIA 1GLPA 1O8WA 1XWCA 3C1SA 2H72A 1K3OA 4V2MA 1XW5A 3PR8A 2I9HA 1H75A 2H6YA 2MMZA 3FYGA 1SYXA 1M99A 1TW9A 3E9JB 2BMXA 3F6DA 1G0TA 4N3ZA 4N10A 2CVBA 1ZCPA 2GT5A 2WDUA 4GSSA 5DVBA 2B5XA 3A3TA 4A5PA 5EVOA 2R0PA 2J9HA 3TJJA 2ZCTA 2LTKA 3TKSE 4MMMA 1EZKA 3QMXA 3F6FA 4F2IA 3P90A 1EV4A 5J5NA 4USSA 5B7CA 2B7JA 1A23A 4HOJA 2HRNA 3TRQA 4ID0A 4EC0A 4K7OA 2C4JA 5LCZA 2YPMA 4XRAA 4N0VA 2CAIA 2VCVA 1X5EA 3VK9A 3F3RA 1SKRB 5B6NA 2YCDA 3G9BA 1F2EA 3Q74A 1V57A 3QFAC 4JBBA 3KP8A 2VL3A 1K0AA 1J9BA 4EIQA 3NIVA 1A2MA 3UJ1A 3F8UA 3A2WA 1BF5A 3A2VA 4ZB9A 1HYUA 1Z7PA 3ME8A 4X0XA 4IBPA 2UV8G 4ECIA 2HZFA 4TR4A 2G0FA 3E0UA 1SD9A 5J4UA 2VIMA 4FYCA 3KJYA 4TVEA 3VWVA 4LA1A 4MZCA 3M0FA 4K7IA 3ZIJA 2DIZA 1U3AA 1EGRA 1F6MC 2GS3A 1N25A 5ECHB 2I81A 2P5RA 3C73A 3J7Yk 3PH9A 1SKSB 1HNBA 3KEBA 3ERFA 3GSTA 4Z7XA 2K6VA 1T4ZA 1JZDA 3KMOA 5A1NA 5F0GA 4GQFA 3HJMA 1TP9A 4XS4B 3GKMA 3GIXA 4IJIA 1LU4A 2HE3A 2OACA 2PPTA 5A34B 1YDKA 3D5JA 2ON5A 1RQMA 3I69A 2DBCA 5HR3A 5IPGA 5B8BA 3VWXA 4AJ8A 2H1GA 4EKZA 1O85A 1PN9A 2KHPA 4MJAA 2CVDA 1YKAA 2R2JA 4X4JA 1WE0A 2KUCA 4GXZA 4YH2A 1K3LA 2EFEA 2ZNMA 2HSMA 3ZL5A 4OMVA 5J9CA 2JZTA 2OE0A 3SBCA 1S3DA 4G10A 2VLVA 2MBTA 2VD1A 4MJEA 4KH7A 2VCXA 1GUMA 4TRXA 7GSSA 2GQKA 1AXDA 5G5FA 1M0UA 2H75A 2LUSA 3LGCA 1TTZA 5IOWA 1F37A 4IVFA 3KH7A 4MNNA 4EL1A 3QAVA 3CSJA 2IMIA 2FWHA 5A4UA 4F03A 3D6IA 2DIYA 3DVXA 3RHBA 1PGTA 1FHEA 1GWCA 4KDXA 3TOUA 4POBA 3FK8A 2H66A 3WYWA 4BVYA 4L5LA 3KXOA 2JSYA 3CRUA 3N5OA 5INYA 2R3XA 1BG1A 1K0NA 4QMKA 3CTFA 4K0GA 1JHBA 3MNGA 3GL5A 5D9VA 1S3AA 3BCIA 4FIWA 2DJKA 2P31A 3C7MA 4JZQA 2A4VA 3FZ9A 3FZ4A 1FAAA 2FWEA 3IAS2 1GNWA 4V1Ap 2K18A 5ECIB 4AF2A 5E4WA 2OT3A 2H8LA 1GULA 2EIQA 4L8EA 5J4YA 3ZVJA 4O7HA 1URMA 1T1VA 3LSZA 1T00A 2NVLA 5D9XA 1WPIA 4L5OA 1XWAA 2B5YA 1X9MB 5DQSA 4ACSA 3ED3A 1O73A 1GSSA 20GSA 1E6BA 4J2FA 3ZFLA 1O8XA 2X49A 1GUHA 3KTBA 4HDEA 2GSSA 2VUPA 4HJ2A 4TXVA 4ZL8A 2FWGA 1V9WA 1VRSD 2EIRA 1OAZA 4N0ZA 1FVJA 4WBJA 3FW2A 2PBJA 4I5QA 2LJRA 1VF3A 2YWOA 4YQUA 5CRGA 3HZ4A 2C0EA 1J0FA 2R6KA 4CW9A 4KF9A 5HQPA 2M80A 2F51A 2B6MA 3RDWA 3UBLA 1GUKA 1X5DA 4GF0A 2LNSA 4QL7A 2OJLA 2V32A 4IGJA 1R26A 2HRFA 1SYRA 4NXIA 4O5QA 2V1MA 2HSHA 4K7NA 4GSTA 5IMFA 2DJ1A 3E3EA 4LL1B 3IRAA 5CRDA 1FW1A 4JR4A 1EV9A 4ZXGA 4TR0A 1ERWA 2HZEA 2R5GA 4KCAA 3CSHA 1M2AA 5IO2A 1OKTA 4DVCA 22GSA 2WGRA 4BL7B 1KEBA 2QSIA 3KMNA 5AIXA 5D96A 5HFKA 5ELGA 2HFDA 2CX4A 2O5VA 2DMMA 2H1LA 1ILOA 4TR3A 4TXOA 2C1YA 1QUWA 1VF1A 4MK3A 5J47A 2RM5A 5ECMB 2X8GA 1QXHA 3FEUA 3MYDA 5D93A 1I9DA 4JRRA 5IMZA 5DALA 1XOAA 3OR5A 3TB2A 4ZIJA 3SWLA 4HU9A 4V1Ag 4I6XA 2L59A 2A2SA 3FR6A 3O76A 1KTEA 2M46A 2FHEA 5A1NB 2C0GA 3TKRA 2ON7A 2R0GA 1XBSA 2HI7A 5DDLA 4FYBA 4PQHA 5D9WA 1CQGA 4NV5A 3EE2A 1WIKA 5F8BA 2N5FA 1AAZA 3M3MA 1VGLA 3TRXA 3QAWA 2B1KA 4ZILA 2PVQA 2L4CA 1B9YC 3HZ8A 4W66A 5JWRB 2H74A 5ECLB 2LNTA 2RUEA 1G7EA 1XCCA 4NHZA 3NZNA 5LD0A 1G7OA 2ALBA 1SU9A 1B9XC 2H1DA 5IMCA 1SL2B 4ECJA 2HSMB 4I97A 5ID2A 2R4VA 2AB6A 2A2PA 3K8NA 4K9ZA 5D8IA 2EC4A 2E7PA 5DBQA 1MDKA 3IBHA 4YQVA 4IW9A 2C0FA 1BYEA 14GSA 4Q5RA 2PVOC 6GSWA 1EEJA 1UVZA 1BJXA 1UA5A 1Y6EA 1O81A 19GSA 1GTBA 2FA4A 2H0GA 4WEYA 4WETA 2JZSA 2C3TA 4BVXA 4HS1A 5G5EA 1JFUA 2LRTA 2E2GA 4WF5A 3LYPA 5GZZB 1VF4A 4BVYB 1NM3A 1X0RA 3P7XA 2WB9A 2XHFA 3QFBC 4KSMA 3KTLA 3ZRDA 2MMAA 18GSA 1W89A 2L6CA 4Q5FA 1GNEA 5ENUA 2FCHA 2A2RA 2L5LA 4KB3A 17GSA 3RBTA 1V98A 3TUEA 4OFNA 5ECQB 2WRTA 3DKSA 5CREA 3HA9A 3IDVA 1R4WA 4DSSA 2FNOA 1JZRA 3GA4A 1GL8A 1R5AA 4GTUA 5IMVA 4G9HA 3HXSA 3JCML 1K3YA 4PXOA 2AUVA 3HMJG 3A2XA 4ULXA 1PL1A 2PERA 3LEFA 3ZZXA 4D73A 3KIJA 3QD9A 2H6XA 1M9AA 2Z9SA 1CQHA 5ECNB 4MH3A 3D21A 1R7HA 4KW6A 2VL9A 3W8JA 3WD6A 4E8HA 3TJKA 3F0IA 4K5SA 4YAPA 2H73A 3ZVJD 3KH9A 4EXJA 1X5CA 1M2DA 2BTOT 2N5BA 5JCWA 2J23A 3UAPA 4OCFA 3C1RA 2VOCA 3EU4A 3GH6A 3F63A 4IS0A 4MJCA 5ECRB 5GAND 4MPFA 1VF2A 2DKIA 4Z2RA 2B3SA 1GTUA 3FRCA 5CAXA 4EO3A 2VCTA 3IXRA 4JU5A 2I3YA 1EP7A 3M1GA 5FT3A 2CAQA 4GWRA 1TKDB 4FO5A 3GMFA 4WR5A 5EPFA 2HRAA 3RAZA 4F9ZA 2MYGA 1SL1B 2HZEB 1ZGNA 3W6GA 5HR0A 2AYTA 3LFLA 1MD4A 4ZBBA 1ABAA 4G01A 1MDIA 2IMKA 1TRUA 1GRXA 4TXOB 4MP4A 3GUSA 4QL9A 1TI3A 2C8UA 1GSYA 4V2LA 4MDCA 4IQAA 1TXXA 3S9FA 1SK2A 4XS1A 2GZPA 5ELAA 5DALB 4EDYA 5F06A 3TJGA 1F3BA 1XVQA 3D4TA 4KSOA 4MZBA 3DEXA 3L9SA 1GTIA 1YVLA 2GDRA 2CX3A 2VCQA 2VM2A 3UIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSY A;  1MEK A;  4NAX A;  3WGX A;  4ZB6 A;  2EIO A;  1H4O A;  4CHS A;  5E59 A;  3EWL A;  5JWO B;  2H71 A;  2H0H A;  2CVK A;  1XFL A;  5JCG A;  1SJZ A;  2X64 A;  2HNL A;  1DUG A;  2DJ2 A;  3I9V 2;  1A24 A;  5C00 A;  1Q4J A;  1TK0 B;  2OA7 A;  4Q5N A;  4POL A;  3VWU A;  1EEM A;  4KND A;  1OKD A;  4OO4 A;  4IP1 A;  5ID2 B;  3F4S A;  1EOG A;  3F3Q A;  4IHU A;  2H1A A;  4HEA 2;  4QQ7 A;  1QK8 A;  3FR3 A;  4PQ1 A;  1QMV A;  4WKW A;  5KN1 A;  5ECS A;  2YNX A;  5IMD A;  5D73 A;  2VO4 A;  3ZYW A;  1SEN A;  3ERW A;  2DSA A;  4MPG A;  5DAK B;  5G31 A;  2GSR A;  4GCI A;  4KX4 A;  3GHA A;  3EMX A;  3WT1 A;  1TDI A;  3TJF A;  4BPY A;  4TKY A;  3L0H A;  2HRK A;  3EVI A;  5GST A;  2O85 A;  4OWY A;  1GH2 A;  2GLR A;  5CO3 A;  1SJI A;  1MTC A;  2DJ3 A;  3FR9 A;  5F05 A;  2GQL A;  2YAN A;  4BVX B;  5AN1 A;  2X8H A;  3HJP A;  4ILF A;  2JU5 A;  1YF1 A;  1FB0 A;  5G2Z A;  2XC2 A;  4P3Y B;  5GSS A;  5H5S A;  5KN2 A;  4O92 A;  3APQ A;  3LYK A;  3BBY A;  1Z9H A;  1AC1 A;  1ST9 A;  2LS5 A;  3KD0 A;  3HJO A;  3CTG A;  1WP0 A;  4G0I A;  2LST A;  3G7Y A;  5IIZ A;  2VAF A;  3GNJ A;  4KAE A;  1GSF A;  2WJU A;  3GKN A;  2IJY A;  3RPN A;  2CQ9 A;  4DSS B;  2F9S A;  4PGT A;  1LJR A;  2V41 A;  1TK8 B;  3ZIV A;  2IPA A;  4WBR D;  1WRY A;  2K8V A;  3MAK A;  4HZ2 A;  3Q18 A;  3US3 A;  4BA7 A;  1ZL9 A;  5KN0 A;  1Z5Y E;  3A5W A;  4LMW A;  3IE3 A;  3H79 A;  2IWT A;  3UOM A;  4D73 B;  1T4Y A;  4IKH A;  1HD2 A;  2HT9 A;  3HVS A;  3QOU A;  2K8S A;  4EE0 A;  4PUR A;  1XWG A;  2NPB A;  2R37 A;  4XS6 A;  3R3E A;  3TDG A;  4Q5Q A;  5C04 A;  3CYN A;  3D0Z A;  5J9B A;  4OO5 A;  5IPH A;  1AQX A;  5CYY A;  1OC9 A;  3WT2 A;  3F9U A;  5EL8 A;  2KLX A;  5CRW A;  3KP9 A;  3TKQ A;  1GP1 A;  1YEP A;  1UN2 A;  3UAR A;  3TRP A;  1AUC A;  2CT6 A;  3VFI A;  3VUR A;  1M2B A;  4GLT A;  2O89 A;  4OFM A;  2XBQ A;  2DJ0 A;  2REM A;  4MCU A;  1U3I A;  2VCW A;  1XPV A;  3R2Q A;  3KCM A;  3ME7 A;  1THX A;  3LXT A;  10GS A;  4K1F A;  2OE3 A;  1NHO A;  2AJQ B;  5HR1 A;  1DBY A;  1AQW A;  1ERV A;  4LLR A;  2F8A A;  2IFQ A;  3VPT A;  1SKW B;  1TJD A;  1GTA A;  11GS A;  1XOB A;  3DYR A;  4HQZ A;  2MMO A;  2O87 A;  3HYP A;  4OFT A;  2YZU A;  2QGV A;  1ZYE A;  2RUF A;  3GKK A;  2GTU A;  3EC3 A;  3ZMK A;  2BJX A;  5ECP B;  1A2J A;  5AGY A;  4RQX A;  3IK9 A;  2TIR A;  5ABR A;  2HQT A;  3GX8 A;  4L0W A;  1KNG A;  4K2D A;  1IYH A;  2D2Z A;  1USB A;  3IHQ A;  3G7J A;  4ZL7 A;  1YKC A;  1K0O A;  3IR4 A;  3W8S A;  3H4K A;  4KGI A;  4KA0 A;  2LQQ A;  3GKX A;  2LJK A;  2CA8 A;  3GH9 A;  3UMA A;  3L4N A;  2PN8 A;  3TKP A;  4XS4 A;  3WGE A;  1XVW A;  3EMP A;  4ZL9 A;  5DJL A;  2M72 A;  3QDN A;  3LXZ A;  3FY7 A;  3QPM A;  1BQ7 A;  3GTU A;  4NHW A;  1ML6 A;  4TW5 A;  3TOT A;  1N8J A;  1GSD A;  3FKF A;  2DLX A;  4X43 A;  2MBS A;  3QCP A;  6GSU A;  4GSN A;  3HKR A;  5A5K A;  6GSY A;  2LJA A;  2DML A;  1TOF A;  1JLW A;  3BCK A;  2E0Q A;  2OAD A;  4EF0 A;  2C0D A;  3FZA A;  1Q98 A;  4KUN A;  2IMF A;  3F4R A;  2JAD A;  9GSS A;  1OVN A;  3C8E A;  2FGX A;  3QR6 A;  2JSZ A;  2GQM A;  2X8C A;  5COH A;  3ZTL A;  1YJ6 A;  2G2Q A;  2VLU A;  2HRK B;  1XIY A;  1X9W B;  1YY7 A;  2KP2 A;  2YWI A;  1UC7 A;  4HJM A;  4MJB A;  2B7K A;  1B48 A;  3APS A;  2P0G A;  3D22 A;  2OBI A;  2OE1 A;  2MZC A;  3BOA A;  1NHY A;  5J3R A;  12GS A;  2F3M A;  5G1L A;  4KE3 A;  3C71 A;  4XIH A;  3TKS A;  4BWS A;  2LRN A;  2WS2 A;  3PGT A;  1A8Y A;  1YEX A;  2V6K A;  5ECO B;  4MH2 A;  3GYK A;  4BWQ A;  4HUA A;  1ERU A;  4EDZ A;  2PU9 C;  4DSQ A;  4NWY A;  2FD3 A;  2OKA A;  5ECK B;  4I2T A;  1PKZ A;  4F0C A;  1PQN A;  2V2G A;  4N11 A;  1W4V A;  5KEJ A;  4WR4 A;  1BG5 A;  5FHI A;  6GSX A;  4XCS A;  4ECB A;  3NOF A;  5G1K A;  4JR6 A;  2NDO A;  3HDC A;  1NW2 A;  1OC3 A;  1PD2 1;  4J56 E;  2H70 A;  1ZMA A;  3DML A;  3L78 A;  4XRD A;  4FQU A;  2XPD A;  4ISD A;  2ZUP A;  1A8L A;  3APO A;  2GZZ A;  3D4M A;  3HHV A;  3J7Y b;  2FUG 2;  1WJK A;  2I4A A;  2IIY A;  2TRC P;  1OC9 B;  3GUR A;  1FO5 A;  1XZO A;  3TKS C;  1Z6M A;  2L5O A;  3MSZ A;  1PKW A;  2YP6 A;  4G0L A;  1TU8 A;  2CZ2 A;  2WFC A;  4JE1 A;  1AIU A;  3I43 A;  3DIE A;  4LMV A;  2K9F A;  2B1L A;  2ES7 A;  4X1U A;  4L0U A;  5HFI A;  1M7T A;  2C80 A;  5HR2 A;  1Z6N A;  3RPP A;  4HI7 A;  1K0M A;  3H1N A;  2AAW A;  1FB6 A;  1XW6 A;  3L9V A;  5IQY A;  4NPB A;  5DCH A;  1K0B A;  3FHK A;  3AY8 A;  1S3C A;  3P8W A;  2IFQ B;  1TRV A;  4PX1 A;  3MDK A;  1PSQ A;  2HYX A;  5CNW A;  1BED A;  2PWJ A;  1E2Y A;  4IJ3 A;  2WZ9 A;  2AHE A;  4HZ4 A;  2H0I A;  3GRX A;  4BL7 A;  1A0R P;  2YV7 A;  3VLN A;  4MF7 A;  4N30 A;  4YQM A;  1WMJ A;  3CSI A;  3UBK A;  4I2U A;  2HSN B;  1RW1 A;  4ML1 A;  13GS A;  1WOU A;  3ERG A;  3M9K A;  2MMN A;  2QKE A;  4PUF C;  3ZIT A;  1GSE A;  1JLV A;  4IEL A;  3VI7 A;  3GL3 A;  4POM A;  5D9T A;  3CRT A;  16GS A;  4IQ1 A;  1GSU A;  4HQS A;  1MDJ A;  4O5R A;  1DE2 A;  3O6T A;  2YV9 A;  1HQO A;  2YWM A;  3IPZ A;  3UVH A;  3M8N A;  2H1B A;  5B6M A;  1DE1 A;  2DC5 A;  1TU7 A;  3GX0 A;  2FLS A;  1OC8 A;  1SL0 B;  3ZRE A;  4MZW A;  3GTU B;  8GSS A;  5IM9 A;  3PIN A;  5DQY A;  2LV3 A;  4ZB8 A;  2IMD A;  4RI6 A;  2IL3 A;  5DCG A;  5LNK e;  1R5P A;  3U5R E;  3ZLP A;  1C72 A;  2CV4 A;  5AIS A;  1XWK A;  2L4Q A;  1U87 A;  4I8B A;  1X9S B;  2XPE A;  1B4Q A;  3DD3 A;  2X99 A;  3IOS A;  2GGT A;  1N2A A;  1U6T A;  3EUR A;  4LL4 B;  4IN0 A;  3G7I A;  4PNF A;  5H5Q A;  2WUL A;  5JCU A;  2H76 A;  2KP1 A;  5J41 A;  2PMT A;  2YWN A;  4J57 E;  3CXG A;  1O6J A;  1FG4 A;  2FY6 A;  3KGK A;  3F4T A;  2L57 A;  4TR1 A;  2GSQ A;  5F07 A;  3VPQ A;  5IOX A;  2L6D A;  4ZBA A;  3PPU A;  5GAP D;  1FOV A;  2F8F A;  1ERT A;  4RUV A;  3I6A A;  2GZY A;  3GV1 A;  2RM6 A;  1NSW A;  2B5E A;  3H8Q A;  1PX6 A;  3O3T A;  1ZYQ B;  3RHC A;  2YN1 A;  3LOR A;  2VD0 A;  5BMU A;  2RII A;  3LG6 A;  3WGD A;  1DSB A;  2JZR A;  1T8E B;  4MLY A;  2OBK A;  2RLI A;  1PL2 A;  1HNC A;  1KBN A;  3GSS A;  3U6V A;  4OCE A;  1EP8 A;  1BX9 A;  1U88 A;  5A4V A;  4HU7 A;  4OD7 A;  2P5Q A;  5KN3 A;  2LQO A;  5JWQ B;  2LEG A;  2PUK C;  2JL4 A;  1ON4 A;  3DVW A;  4AGS A;  3ZML A;  2DJJ A;  1AW9 A;  4G19 A;  1QQ2 A;  1XWB A;  3EIN A;  1GLQ A;  2E2M A;  4F0B A;  5IMA A;  4ML6 A;  2H19 A;  4JED A;  1SK1 A;  3HVV A;  3EU3 A;  5H5R A;  2H30 A;  4POK A;  1V40 A;  1F9M A;  3HD5 A;  5FWG A;  4RI7 A;  4PTS A;  1K0D A;  4EVM A;  3QAG A;  3BD2 A;  4AJ7 A;  1OE8 A;  5CRH A;  2UZ8 A;  5CP1 A;  2PGT A;  4DSR A;  2IME A;  1G6W A;  2KOK A;  3BJ5 A;  1THO A;  1ZOF A;  2VM1 A;  4NMU A;  3UL3 A;  2CZ3 A;  2V6O A;  1PMT A;  4V2N A;  1GSQ A;  1K0C A;  4WXT A;  3KZQ A;  1SK0 A;  4YAV A;  1FVK A;  4ZBD A;  4PUA A;  3IC4 A;  4PQI A;  1JZO A;  1SJ6 A;  1F3A A;  2C3Q A;  1LBK A;  3CBU A;  4E8E A;  4MF6 A;  1EGO A;  4CDO A;  2LRC A;  4KDU A;  1EWX A;  2YZH A;  4KCE A;  1PX7 A;  1J08 A;  3LWA A;  2HLS A;  1G6Y A;  1TRW A;  3GFK A;  4ECC A;  4G0K A;  2IN3 A;  4WF4 A;  3GN3 A;  3MWH A;  3FZ5 A;  4K6X A;  1ACV A;  4H86 A;  1TK5 B;  3KM6 A;  1A0F A;  4O32 A;  2GVP A;  2JAC A;  3CMI A;  3DRN A;  1Y25 A;  1V58 A;  4XHM A;  1WWJ A;  3HY2 A;  1YQ1 A;  3VWW A;  5HFG A;  3TJB A;  1AQV A;  1TI1 A;  6GST A;  2WCI A;  3VI5 A;  3IK7 A;  1TRS A;  2C3N A;  4IP6 A;  4KDY A;  4FYU A;  2HXK A;  4MF5 A;  5G30 A;  1T3B A;  1EOH A;  5EY6 A;  3L9U A;  1OYJ A;  2O7K A;  2GT6 A;  2N5A A;  2VL2 A;  3HCZ A;  2FWF A;  1M9B A;  5DJM A;  3LJR A;  3IV4 A;  1T7P B;  4TN8 A;  1A2L A;  1V2A A;  5L71 A;  2H6Z A;  1YF0 A;  2YJH A;  1B8X A;  3UVT A;  3ISO A;  3V1W A;  3DGQ A;  4FH8 A;  4G2E A;  2I1U A;  2YJ7 A;  3EYT A;  4TOP A;  5DAK A;  1RK4 A;  5B8A A;  2FA8 A;  3HVX A;  3DXB A;  4K8M A;  3ZFB A;  3Q6O A;  1JZW A;  1YZX A;  3UEM A;  2VCZ A;  4EUY A;  2QC7 A;  4RQR A;  4TR1 B;  5AIV A;  1XXU A;  2NBS A;  6GSS A;  4XTS A;  2YOI A;  5IO0 A;  1QGV A;  3H93 A;  1B4P A;  1Z7R A;  3TGZ A;  4DEJ A;  1QFN A;  6GSV A;  4GQC A;  4K0N A;  4NV2 A;  2NTO A;  2GST A;  1PA3 A;  2VLT A;  3IA1 A;  1I5G A;  1ZZY A;  2H01 A;  4AJ6 A;  3TCO A;  3IAM 2;  1OE7 A;  2AV4 A;  4MAB A;  1MD3 A;  1IYI A;  1Z3E A;  5A4W A;  2VL2 C;  3M9J A;  3DWV A;  1SD8 A;  3LQ7 A;  4PNG A;  1PRX A;  2LKU A;  1HNA A;  4GRF A;  3P2A A;  4MA9 A;  2TRX A;  1O7U A;  3Q19 A;  1XW9 A;  2O8V B;  1BAY A;  4F82 A;  3N9J A;  3IC8 A;  2XBI A;  1GLP A;  1O8W A;  1XWC A;  3C1S A;  2H72 A;  1K3O A;  4V2M A;  1XW5 A;  3PR8 A;  2I9H A;  1H75 A;  2H6Y A;  2MMZ A;  3FYG A;  1SYX A;  1M99 A;  1TW9 A;  3E9J B;  2BMX A;  3F6D A;  1G0T A;  4N10 A;  2CVB A;  1ZCP A;  2GT5 A;  2WDU A;  4GSS A;  5DVB A;  2B5X A;  3A3T A;  5EVO A;  2J9H A;  3TJJ A;  2ZCT A;  2LTK A;  3TKS E;  4MMM A;  1EZK A;  3QMX A;  3F6F A;  4F2I A;  3P90 A;  1EV4 A;  5J5N A;  4USS A;  5B7C A;  2B7J A;  1A23 A;  4HOJ A;  2HRN A;  3TRQ A;  4ID0 A;  4EC0 A;  4K7O A;  2C4J A;  5LCZ A;  2YPM A;  4XRA A;  4N0V A;  2CAI A;  2VCV A;  1X5E A;  3VK9 A;  3F3R A;  1SKR B;  5B6N A;  2YCD A;  3G9B A;  1F2E A;  3Q74 A;  1V57 A;  3QFA C;  4JBB A;  3KP8 A;  2VL3 A;  1K0A A;  1J9B A;  3NIV A;  1A2M A;  3UJ1 A;  3F8U A;  3A2W A;  3A2V A;  4ZB9 A;  1HYU A;  1Z7P A;  3ME8 A;  4X0X A;  4IBP A;  4ECI A;  2HZF A;  4TR4 A;  2G0F A;  3E0U A;  1SD9 A;  5J4U A;  2VIM A;  4FYC A;  3KJY A;  4TVE A;  3VWV A;  4LA1 A;  4MZC A;  3M0F A;  4K7I A;  3ZIJ A;  2DIZ A;  1U3A A;  1EGR A;  1F6M C;  2GS3 A;  2I81 A;  5ECH B;  2P5R A;  3C73 A;  3J7Y k;  3PH9 A;  1SKS B;  1HNB A;  3KEB A;  3ERF A;  3GST A;  4Z7X A;  2K6V A;  1T4Z A;  1JZD A;  3KMO A;  4GQF A;  5F0G A;  3HJM A;  1TP9 A;  4XS4 B;  3GKM A;  3GIX A;  4IJI A;  1LU4 A;  2HE3 A;  2OAC A;  2PPT A;  1YDK A;  3D5J A;  2ON5 A;  1RQM A;  3I69 A;  2DBC A;  5HR3 A;  5IPG A;  5B8B A;  3VWX A;  4AJ8 A;  2H1G A;  4EKZ A;  1O85 A;  1PN9 A;  2KHP A;  4MJA A;  2CVD A;  1YKA A;  2R2J A;  1WE0 A;  2KUC A;  4GXZ A;  4YH2 A;  1K3L A;  2ZNM A;  2HSM A;  3ZL5 A;  4OMV A;  5J9C A;  2JZT A;  2OE0 A;  3SBC A;  1S3D A;  4G10 A;  2VLV A;  2MBT A;  2VD1 A;  4MJE A;  4KH7 A;  2VCX A;  1GUM A;  4TRX A;  7GSS A;  2GQK A;  1AXD A;  5G5F A;  1M0U A;  2H75 A;  2LUS A;  3LGC A;  1TTZ A;  5IOW A;  1F37 A;  4IVF A;  3KH7 A;  4EL1 A;  3QAV A;  3CSJ A;  2IMI A;  2FWH A;  5A4U A;  4F03 A;  3D6I A;  2DIY A;  3DVX A;  3RHB A;  1PGT A;  1FHE A;  1GWC A;  4KDX A;  3TOU A;  4POB A;  3FK8 A;  2H66 A;  3WYW A;  4BVY A;  4L5L A;  3KXO A;  2JSY A;  3CRU A;  3N5O A;  5INY A;  2R3X A;  1K0N A;  3CTF A;  4K0G A;  1JHB A;  3MNG A;  3GL5 A;  5D9V A;  1S3A A;  3BCI A;  4FIW A;  2DJK A;  2P31 A;  3C7M A;  4JZQ A;  2A4V A;  3FZ9 A;  3FZ4 A;  1FAA A;  2FWE A;  3IAS 2;  1GNW A;  4V1A p;  2K18 A;  5ECI B;  4AF2 A;  5E4W A;  2H8L A;  1GUL A;  2EIQ A;  4L8E A;  3ZVJ A;  4O7H A;  1URM A;  1T1V A;  3LSZ A;  1T00 A;  2NVL A;  5D9X A;  1WPI A;  4L5O A;  1XWA A;  2B5Y A;  1X9M B;  5DQS A;  4ACS A;  3ED3 A;  1O73 A;  1GSS A;  20GS A;  1E6B A;  4J2F A;  3ZFL A;  1O8X A;  1GUH A;  3KTB A;  4HDE A;  2GSS A;  2VUP A;  4HJ2 A;  4TXV A;  4ZL8 A;  2FWG A;  1V9W A;  1VRS D;  2EIR A;  1OAZ A;  4N0Z A;  1FVJ A;  4WBJ A;  3FW2 A;  2PBJ A;  4I5Q A;  2LJR A;  1VF3 A;  2YWO A;  4YQU A;  5CRG A;  3HZ4 A;  2C0E A;  1J0F A;  2R6K A;  4CW9 A;  4KF9 A;  5HQP A;  2M80 A;  2F51 A;  2B6M A;  3RDW A;  3UBL A;  1GUK A;  1X5D A;  4GF0 A;  2LNS A;  4QL7 A;  2OJL A;  2V32 A;  4IGJ A;  1R26 A;  2HRF A;  1SYR A;  4NXI A;  2V1M A;  2HSH A;  4K7N A;  4GST A;  5IMF A;  2DJ1 A;  3E3E A;  4LL1 B;  3IRA A;  5CRD A;  1FW1 A;  4JR4 A;  1EV9 A;  4ZXG A;  4TR0 A;  1ERW A;  2HZE A;  2R5G A;  4KCA A;  3CSH A;  1M2A A;  5IO2 A;  1OKT A;  4DVC A;  22GS A;  2WGR A;  4BL7 B;  1KEB A;  2QSI A;  3KMN A;  5AIX A;  5D96 A;  5HFK A;  5ELG A;  2HFD A;  2CX4 A;  2DMM A;  1ILO A;  4TR3 A;  4TXO A;  2C1Y A;  1QUW A;  1VF1 A;  4MK3 A;  2RM5 A;  5ECM B;  2X8G A;  1QXH A;  3FEU A;  5D93 A;  1I9D A;  4JRR A;  5IMZ A;  5DAL A;  1XOA A;  3OR5 A;  3TB2 A;  4ZIJ A;  3SWL A;  4HU9 A;  4V1A g;  4I6X A;  2L59 A;  2A2S A;  3FR6 A;  3O76 A;  1KTE A;  2M46 A;  2FHE A;  2C0G A;  3TKR A;  2ON7 A;  1XBS A;  2HI7 A;  5DDL A;  4FYB A;  4PQH A;  5D9W A;  1CQG A;  4NV5 A;  3EE2 A;  1WIK A;  5F8B A;  2N5F A;  1AAZ A;  3M3M A;  1VGL A;  3TRX A;  3QAW A;  2B1K A;  4ZIL A;  2PVQ A;  2L4C A;  1B9Y C;  3HZ8 A;  5JWR B;  2H74 A;  5ECL B;  2LNT A;  2RUE A;  1G7E A;  1XCC A;  4NHZ A;  3NZN A;  5LD0 A;  1G7O A;  2ALB A;  1SU9 A;  1B9X C;  2H1D A;  5IMC A;  1SL2 B;  4ECJ A;  2HSM B;  4I97 A;  5ID2 A;  2R4V A;  2AB6 A;  4K9Z A;  3K8N A;  5D8I A;  2EC4 A;  2E7P A;  5DBQ A;  1MDK A;  3IBH A;  4YQV A;  4IW9 A;  2C0F A;  1BYE A;  14GS A;  4Q5R A;  2PVO C;  6GSW A;  1EEJ A;  1UVZ A;  1BJX A;  1UA5 A;  1Y6E A;  1O81 A;  19GS A;  1GTB A;  2FA4 A;  2H0G A;  4WEY A;  4WET A;  2JZS A;  2C3T A;  4BVX A;  4HS1 A;  5G5E A;  1JFU A;  2LRT A;  2E2G A;  4WF5 A;  3LYP A;  5GZZ B;  1VF4 A;  4BVY B;  1NM3 A;  1X0R A;  3P7X A;  2WB9 A;  2XHF A;  3QFB C;  4KSM A;  3KTL A;  3ZRD A;  2MMA A;  18GS A;  1W89 A;  2L6C A;  4Q5F A;  1GNE A;  5ENU A;  2FCH A;  2A2R A;  2L5L A;  4KB3 A;  17GS A;  3RBT A;  1V98 A;  3TUE A;  4OFN A;  5ECQ B;  2WRT A;  3DKS A;  5CRE A;  3HA9 A;  3IDV A;  1R4W A;  4DSS A;  2FNO A;  1JZR A;  3GA4 A;  1GL8 A;  1R5A A;  4GTU A;  5IMV A;  4G9H A;  3HXS A;  3JCM L;  1K3Y A;  4PXO A;  2AUV A;  3A2X A;  4ULX A;  1PL1 A;  2PER A;  3LEF A;  3ZZX A;  4D73 A;  3KIJ A;  3QD9 A;  2H6X A;  1M9A A;  2Z9S A;  1CQH A;  5ECN B;  4MH3 A;  3D21 A;  1R7H A;  4KW6 A;  2VL9 A;  3W8J A;  3WD6 A;  4E8H A;  3TJK A;  3F0I A;  4YAP A;  2H73 A;  3ZVJ D;  3KH9 A;  4EXJ A;  1X5C A;  1M2D A;  2BTO T;  2N5B A;  5JCW A;  2J23 A;  3UAP A;  4OCF A;  3C1R A;  2VOC A;  3EU4 A;  3GH6 A;  3F63 A;  4IS0 A;  4MJC A;  5ECR B;  5GAN D;  4MPF A;  1VF2 A;  2B3S A;  1GTU A;  3FRC A;  5CAX A;  4EO3 A;  2VCT A;  3IXR A;  4JU5 A;  2I3Y A;  1EP7 A;  3M1G A;  5FT3 A;  2CAQ A;  4GWR A;  1TKD B;  4FO5 A;  3GMF A;  4WR5 A;  5EPF A;  2HRA A;  3RAZ A;  4F9Z A;  2MYG A;  1SL1 B;  2HZE B;  1ZGN A;  3W6G A;  5HR0 A;  2AYT A;  3LFL A;  1MD4 A;  4ZBB A;  1ABA A;  1MDI A;  2IMK A;  1TRU A;  1GRX A;  4TXO B;  4MP4 A;  3GUS A;  4QL9 A;  1TI3 A;  2C8U A;  1GSY A;  4V2L A;  4MDC A;  4IQA A;  1TXX A;  3S9F A;  1SK2 A;  4XS1 A;  2GZP A;  5ELA A;  5DAL B;  4EDY A;  5F06 A;  3TJG A;  1F3B A;  1XVQ A;  3D4T A;  4KSO A;  4MZB A;  3DEX A;  3L9S A;  1GTI A;  2GDR A;  2CX3 A;  2VCQ A;  2VM2 A;  3UIW A; 
#chains in the Genus database with same CATH topology
 2HSY A;  1MEK A;  4NAX A;  1SVO A;  4ZB6 A;  3WGX A;  2EIO A;  1H4O A;  4CHS A;  5E59 A;  3EWL A;  5A5H A;  5JWO B;  2H71 A;  2A4H A;  2H0H A;  2CVK A;  1XFL A;  5JCG A;  1SJZ A;  2X64 A;  2HNL A;  1DUG A;  1XG8 A;  2DJ2 A;  3I9V 2;  1A24 A;  5C00 A;  1Q4J A;  1TK0 B;  2OA7 A;  1ZYP A;  4Q5N A;  4POL A;  3VWU A;  1EEM A;  4KND A;  1OKD A;  4OO4 A;  4IP1 A;  5ID2 B;  3F4S A;  1EOG A;  3F3Q A;  4IHU A;  2H1A A;  4HEA 2;  4QQ7 A;  1QK8 A;  3FR3 A;  4PQ1 A;  1QMV A;  4WKW A;  3MIX A;  5KN1 A;  5ECS A;  2YNX A;  5IMD A;  5D73 A;  2VO4 A;  3ZYW A;  1SEN A;  3ERW A;  2DSA A;  4MPG A;  5DAK B;  5G31 A;  2GSR A;  4GCI A;  4KX4 A;  3GHA A;  3EMX A;  3WT1 A;  1TDI A;  2WVZ A;  4YKG A;  3TJF A;  4BPY A;  4TKY A;  3L0H A;  2HRK A;  3EVI A;  5GST A;  2O85 A;  4OWY A;  1GH2 A;  2GLR A;  5CO3 A;  1SJI A;  1MTC A;  2DJ3 A;  3FR9 A;  5F05 A;  2GQL A;  2YAN A;  4BVX B;  5AN1 A;  2X8H A;  3HJP A;  4CY6 A;  4ILF A;  2JU5 A;  1YF1 A;  1FB0 A;  5G2Z A;  2XC2 A;  4K5R A;  4P3Y B;  5GSS A;  5H5S A;  5KN2 A;  4O92 A;  1M3J A;  3APQ A;  3LYK A;  3BBY A;  1Z9H A;  1AC1 A;  1ST9 A;  2LS5 A;  3KD0 A;  3HJO A;  3CTG A;  1WP0 A;  4G0I A;  2LST A;  3G7Y A;  5IIZ A;  2VAF A;  3GNJ A;  4KAE A;  3TU3 B;  1GSF A;  2WJU A;  3GKN A;  2IJY A;  3RPN A;  2CQ9 A;  4DSS B;  2F9S A;  4PGT A;  1LJR A;  2V41 A;  1TK8 B;  4FXY P;  3ZIV A;  2IPA A;  4PI2 C;  4WBR D;  1WRY A;  2K8V A;  3MAK A;  4HZ2 A;  3Q18 A;  3US3 A;  4BA7 A;  1ZL9 A;  5KN0 A;  1Z5Y E;  3A5W A;  4LMW A;  3IE3 A;  3H79 A;  2X4A A;  2IWT A;  3UOM A;  4D73 B;  1T4Y A;  4IKH A;  1HD2 A;  2R0C A;  2HT9 A;  3HVS A;  4ZB7 A;  3QOU A;  2K8S A;  4EE0 A;  4PUR A;  1XWG A;  2NPB A;  2R37 A;  4XS6 A;  3R3E A;  3TDG A;  4Q5Q A;  5C04 A;  3CYN A;  3D0Z A;  5J9B A;  4OO5 A;  5IPH A;  1AQX A;  5CYY A;  1OC9 A;  3WT2 A;  3F9U A;  5EL8 A;  2KLX A;  5CRW A;  3KP9 A;  3TKQ A;  1GP1 A;  1YEP A;  1UN2 A;  3UAR A;  3TRP A;  1AUC A;  2CT6 A;  3VFI A;  3VUR A;  1M2B A;  4GLT A;  2O89 A;  4OFM A;  2XBQ A;  2DJ0 A;  2REM A;  4MCU A;  1U3I A;  2VCW A;  1XPV A;  3R2Q A;  3KCM A;  3ME7 A;  1THX A;  3LXT A;  4ICY A;  10GS A;  4K1F A;  1PN0 A;  2OE3 A;  1NHO A;  2AJQ B;  5HR1 A;  1DBY A;  1AQW A;  1ERV A;  4LLR A;  2F8A A;  2IFQ A;  3VPT A;  1SKW B;  1TJD A;  1GTA A;  11GS A;  1XOB A;  3DYR A;  2WVX B;  4HQZ A;  2MMO A;  2O87 A;  3HYP A;  4OFT A;  2YZU A;  2QGV A;  1ZYE A;  2RUF A;  3GKK A;  2GTU A;  3EC3 A;  3ZMK A;  2BJX A;  5ECP B;  1A2J A;  5AGY A;  4RQX A;  3IK9 A;  2TIR A;  5ABR A;  2HQT A;  2HSN A;  3GX8 A;  4L0W A;  1KNG A;  4K2D A;  1IYH A;  2D2Z A;  1USB A;  3IHQ A;  3G7J A;  4ZL7 A;  1YKC A;  1K0O A;  3IR4 A;  3W8S A;  3H4K A;  4KGI A;  4KA0 A;  2LQQ A;  3GKX A;  2LJK A;  2CA8 A;  1S3R A;  3GH9 A;  3UMA A;  3L4N A;  2PN8 A;  3TKP A;  5A5H B;  4XS4 A;  3WGE A;  1XVW A;  3EMP A;  4ZL9 A;  5DJL A;  2M72 A;  3QDN A;  3LXZ A;  3FY7 A;  5A34 A;  1BQ7 A;  3QPM A;  3GTU A;  4NHW A;  1ML6 A;  4TW5 A;  3TOT A;  1N8J A;  1GSD A;  3FKF A;  2DLX A;  4X43 A;  2MBS A;  3QCP A;  6GSU A;  4GSN A;  3HKR A;  5A5K A;  6GSY A;  2LJA A;  2DML A;  1TOF A;  1JLW A;  3BCK A;  2E0Q A;  2OAD A;  4EF0 A;  1PFO A;  2C0D A;  4CY8 A;  3FZA A;  1Q98 A;  4KUN A;  2IMF A;  3F4R A;  2JAD A;  4Z2T A;  9GSS A;  1OVN A;  3C8E A;  1Y1U A;  2FGX A;  3QR6 A;  2JSZ A;  2GQM A;  2X8C A;  5COH A;  3FMW A;  3ZTL A;  4AKX B;  1YJ6 A;  2G2Q A;  2VLU A;  2HRK B;  1XIY A;  1X9W B;  1YY7 A;  2KP2 A;  2YWI A;  1FOH A;  1UC7 A;  4HJM A;  4MJB A;  2B7K A;  1B48 A;  3APS A;  2P0G A;  3D22 A;  2QA1 A;  2OBI A;  2OE1 A;  2MZC A;  3BOA A;  1NHY A;  5J3R A;  12GS A;  2F3M A;  5G1L A;  4KE3 A;  3C71 A;  4XIH A;  3TKS A;  4BWS A;  2LRN A;  2WS2 A;  3PGT A;  1A8Y A;  1YEX A;  2V6K A;  5ECO B;  4MH2 A;  3GYK A;  4BWQ A;  4HUA A;  1ERU A;  4EDZ A;  2PU9 C;  4DSQ A;  4NWY A;  2FD3 A;  2OKA A;  5ECK B;  4I2T A;  1PKZ A;  4F0C A;  1PQN A;  2V2G A;  4N11 A;  2EFC A;  4GDF A;  1W4V A;  5KEJ A;  4WR4 A;  1BG5 A;  5FHI A;  6GSX A;  4XCS A;  4ECB A;  3NOF A;  5G1K A;  4JR6 A;  2NDO A;  3HDC A;  1NW2 A;  1OC3 A;  1PD2 1;  4J56 E;  2H70 A;  1ZMA A;  3DML A;  4AI6 A;  3L78 A;  4XRD A;  4FQU A;  2XPD A;  4ISD A;  2ZUP A;  1A8L A;  3APO A;  2GZZ A;  3D4M A;  3HHV A;  4YKF A;  3J7Y b;  2FUG 2;  1WJK A;  2I4A A;  2IIY A;  2TRC P;  1OC9 B;  3GUR A;  1FO5 A;  1XZO A;  3TKS C;  1Z6M A;  2L5O A;  3MSZ A;  1PKW A;  2YP6 A;  4G0L A;  1TU8 A;  2CZ2 A;  2WFC A;  4JE1 A;  1AIU A;  3I43 A;  3DIE A;  4LMV A;  2K9F A;  2B1L A;  2ES7 A;  4X1U A;  4L0U A;  5HFI A;  1M7T A;  2C80 A;  5HR2 A;  1Z6N A;  3RPP A;  5J40 A;  4HI7 A;  1K0M A;  3H1N A;  2AAW A;  1FB6 A;  1XW6 A;  3L9V A;  5IQY A;  4AKG A;  4NPB A;  5DCH A;  1I1I P;  1K0B A;  3FHK A;  2EFD A;  3AY8 A;  1S3C A;  3P8W A;  2IFQ B;  1TRV A;  4PX1 A;  3MDK A;  1PSQ A;  2HYX A;  5CNW A;  1BED A;  2PWJ A;  1E2Y A;  4IJ3 A;  2WZ9 A;  2AHE A;  4HZ4 A;  2H0I A;  3GRX A;  4BL7 A;  1A0R P;  2YV7 A;  3VLN A;  1SVM A;  4MF7 A;  4N30 A;  4YQM A;  1WMJ A;  3CSI A;  4E68 A;  3UBK A;  4I2U A;  2HSN B;  1RW1 A;  4ML1 A;  13GS A;  1WOU A;  3ERG A;  3M9K A;  2MMN A;  2QKE A;  1ZYN A;  4PUF C;  3ZIT A;  1GSE A;  1JLV A;  4IEL A;  3VI7 A;  3GL3 A;  4POM A;  5D9T A;  3CRT A;  16GS A;  4IQ1 A;  1GSU A;  4HQS A;  1MDJ A;  4O5R A;  1DE2 A;  3O6T A;  2YV9 A;  1HQO A;  2YWM A;  3IPZ A;  3UVH A;  3M8N A;  2H1B A;  3IHG A;  5B6M A;  1DE1 A;  2DC5 A;  3GX0 A;  1TU7 A;  2FLS A;  1OC8 A;  1SL0 B;  3ZRE A;  4MZW A;  3GTU B;  8GSS A;  5IM9 A;  3PIN A;  5DQY A;  2LV3 A;  4ZB8 A;  2IMD A;  4RI6 A;  2IL3 A;  5DCG A;  5LNK e;  1R5P A;  3U5R E;  3ZLP A;  3A5I A;  1C72 A;  2CV4 A;  5AIS A;  1XWK A;  2L4Q A;  1U87 A;  4I8B A;  1X9S B;  2XPE A;  1B4Q A;  3DD3 A;  2X99 A;  3IOS A;  2QA2 A;  2GGT A;  1N2A A;  1U6T A;  3EUR A;  4LL4 B;  4IN0 A;  3G7I A;  4PNF A;  4O5U A;  5H5Q A;  2WUL A;  5JCU A;  2H76 A;  4AKH A;  2KP1 A;  4AKI A;  5J41 A;  2WZS A;  2PMT A;  2YWN A;  4J57 E;  3CXG A;  1O6J A;  1FG4 A;  2FY6 A;  3KGK A;  3F4T A;  2L57 A;  4TR1 A;  2GSQ A;  5F07 A;  3VPQ A;  5IOX A;  2L6D A;  4ZBA A;  3PPU A;  5GAP D;  1FOV A;  2F8F A;  1ERT A;  4RUV A;  3I6A A;  2GZY A;  3GV1 A;  2RM6 A;  1NSW A;  2B5E A;  3H8Q A;  1PX6 A;  3O3T A;  1ZYQ B;  3RHC A;  2YN1 A;  3LOR A;  2VD0 A;  5BMU A;  2RII A;  3LG6 A;  3WGD A;  1DSB A;  2JZR A;  1T8E B;  4MLY A;  2OBK A;  2RLI A;  1PL2 A;  1HNC A;  1KBN A;  3GSS A;  3U6V A;  4OCE A;  1EP8 A;  1BX9 A;  1U88 A;  5A4V A;  4HU7 A;  4OD7 A;  2P5Q A;  5KN3 A;  2LQO A;  5JWQ B;  2LEG A;  2PUK C;  2JL4 A;  1ON4 A;  3DVW A;  4AGS A;  3ZML A;  2WVY A;  2DJJ A;  1AW9 A;  4G19 A;  1QQ2 A;  1XWB A;  3EIN A;  1GLQ A;  2E2M A;  4F0B A;  5IMA A;  4ML6 A;  2H19 A;  4JED A;  1SK1 A;  3HVV A;  3EU3 A;  5H5R A;  2H30 A;  4POK A;  1V40 A;  1F9M A;  3HD5 A;  5FWG A;  4RI7 A;  4PTS A;  1S4B P;  1K0D A;  4EVM A;  3QAG A;  4K2X A;  3CWG A;  3BD2 A;  4AJ7 A;  1OE8 A;  5CRH A;  2UZ8 A;  5CP1 A;  2PGT A;  4DSR A;  2IME A;  1G6W A;  2KOK A;  3BJ5 A;  1THO A;  1ZOF A;  2VM1 A;  1M3I A;  4NMU A;  3UL3 A;  2CZ3 A;  2V6O A;  1PMT A;  4V2N A;  1GSQ A;  1K0C A;  4WXT A;  3KZQ A;  1SK0 A;  4YAV A;  2O36 A;  1FVK A;  4ZBD A;  4PUA A;  2WW2 A;  3IC4 A;  4PQI A;  1JZO A;  1SJ6 A;  1F3A A;  2C3Q A;  1LBK A;  1TXU A;  3CBU A;  4E8E A;  4MF6 A;  1EGO A;  4CDO A;  2LRC A;  4KDU A;  1EWX A;  2YZH A;  4KCE A;  1PX7 A;  1J08 A;  3LWA A;  2EFH A;  2HLS A;  1G6Y A;  1TRW A;  3GFK A;  4ECC A;  4G0K A;  2IN3 A;  4WF4 A;  3GN3 A;  3MWH A;  3FZ5 A;  4K6X A;  1ACV A;  4H86 A;  4Z2U A;  1TK5 B;  3KM6 A;  1A0F A;  5KOX A;  5KOW A;  4O32 A;  2GVP A;  2JAC A;  3CMI A;  3DRN A;  1Y25 A;  1V58 A;  4XHM A;  1WWJ A;  3HY2 A;  1YQ1 A;  3VWW A;  5HFG A;  3TJB A;  1SVL A;  1AQV A;  1TI1 A;  6GST A;  2WCI A;  3VI5 A;  3IK7 A;  1TRS A;  2C3N A;  4IP6 A;  4KDY A;  4FYU A;  2DKH A;  2HXK A;  4MF5 A;  5G30 A;  1T3B A;  1EOH A;  5EY6 A;  3L9U A;  1OYJ A;  2O7K A;  2GT6 A;  2N5A A;  2VL2 A;  3HCZ A;  2FWF A;  1M9B A;  5DJM A;  3LJR A;  3IV4 A;  1T7P B;  4TN8 A;  1A2L A;  1V2A A;  5L71 A;  2H6Z A;  1YF0 A;  2YJH A;  1B8X A;  3UVT A;  3ISO A;  3V1W A;  3DGQ A;  4FH8 A;  4G2E A;  3RFR C;  2I1U A;  2YJ7 A;  3EYT A;  4TOP A;  5DAK A;  1RK4 A;  5J4V A;  5B8A A;  2FA8 A;  3HVX A;  2VKZ G;  3DXB A;  4K8M A;  3ZFB A;  3Q6O A;  1JZW A;  1YZX A;  3UEM A;  2VCZ A;  4EUY A;  2QC7 A;  4RQR A;  4TR1 B;  5AIV A;  1XXU A;  2NBS A;  6GSS A;  2O3E A;  2YOI A;  4XTS A;  5IO0 A;  1QGV A;  3H93 A;  1B4P A;  1Z7R A;  3TGZ A;  4PI0 C;  4DEJ A;  1QFN A;  6GSV A;  4GQC A;  5BRT A;  4K0N A;  4NV2 A;  2NTO A;  2GST A;  1PA3 A;  2VLT A;  3IA1 A;  1I5G A;  1ZZY A;  2H01 A;  4EIP A;  4AJ6 A;  3TCO A;  3IAM 2;  1OE7 A;  2AV4 A;  4MAB A;  5BMU B;  3EPT A;  1MD3 A;  1IYI A;  1Z3E A;  5A4W A;  2VL2 C;  3M9J A;  3DWV A;  1SD8 A;  3LQ7 A;  4PNG A;  1PRX A;  2LKU A;  1HNA A;  4GRF A;  3P2A A;  4MA9 A;  2TRX A;  1O7U A;  3Q19 A;  1XW9 A;  2O8V B;  3LW9 A;  1BAY A;  4F82 A;  3N9J A;  3IC8 A;  2XBI A;  1GLP A;  1O8W A;  1XWC A;  3C1S A;  2H72 A;  1K3O A;  4V2M A;  1XW5 A;  3PR8 A;  2I9H A;  1H75 A;  2H6Y A;  2MMZ A;  3FYG A;  1SYX A;  1M99 A;  1TW9 A;  3E9J B;  2BMX A;  3F6D A;  1G0T A;  4N3Z A;  4N10 A;  2CVB A;  1ZCP A;  2GT5 A;  2WDU A;  4GSS A;  5DVB A;  2B5X A;  3A3T A;  4A5P A;  5EVO A;  2R0P A;  2J9H A;  3TJJ A;  2ZCT A;  2LTK A;  3TKS E;  4MMM A;  1EZK A;  3QMX A;  3F6F A;  4F2I A;  3P90 A;  1EV4 A;  5J5N A;  4USS A;  5B7C A;  2B7J A;  1A23 A;  4HOJ A;  2HRN A;  3TRQ A;  4ID0 A;  4EC0 A;  4K7O A;  3HVN A;  2C4J A;  5LCZ A;  2YPM A;  4XRA A;  4N0V A;  2CAI A;  2VCV A;  4HSC X;  1X5E A;  3VK9 A;  3F3R A;  1SKR B;  5B6N A;  2YCD A;  3G9B A;  1F2E A;  3Q74 A;  1V57 A;  3QFA C;  4JBB A;  3KP8 A;  2VL3 A;  1K0A A;  1J9B A;  4EIQ A;  3NIV A;  1A2M A;  3UJ1 A;  3F8U A;  3A2W A;  1BF5 A;  3A2V A;  4ZB9 A;  1HYU A;  1Z7P A;  3ME8 A;  4X0X A;  4IBP A;  2UV8 G;  4ECI A;  2HZF A;  4TR4 A;  2G0F A;  3E0U A;  1SD9 A;  5J4U A;  2VIM A;  4FYC A;  3KJY A;  4TVE A;  3VWV A;  4LA1 A;  4MZC A;  3M0F A;  4K7I A;  3ZIJ A;  2DIZ A;  1U3A A;  1EGR A;  1F6M C;  2GS3 A;  1N25 A;  5ECH B;  2I81 A;  2P5R A;  3C73 A;  3J7Y k;  3PH9 A;  1SKS B;  1HNB A;  3KEB A;  3ERF A;  3GST A;  4Z7X A;  2K6V A;  1T4Z A;  1JZD A;  3KMO A;  5A1N A;  5F0G A;  4GQF A;  3HJM A;  1TP9 A;  4XS4 B;  3GKM A;  3GIX A;  4IJI A;  1LU4 A;  2HE3 A;  2OAC A;  2PPT A;  5A34 B;  1YDK A;  2WW1 A;  3D5J A;  2ON5 A;  1RQM A;  3I69 A;  2DBC A;  5HR3 A;  5IPG A;  5B8B A;  3VWX A;  4AJ8 A;  2H1G A;  4EKZ A;  1O85 A;  1PN9 A;  2KHP A;  4MJA A;  2CVD A;  1YKA A;  2R2J A;  4X4J A;  1WE0 A;  2KUC A;  4GXZ A;  4YH2 A;  1K3L A;  2EFE A;  2ZNM A;  2HSM A;  3ZL5 A;  4OMV A;  5J9C A;  2JZT A;  2OE0 A;  3SBC A;  1S3D A;  4G10 A;  2VLV A;  2MBT A;  2VD1 A;  4MJE A;  4KH7 A;  2VCX A;  1GUM A;  4TRX A;  7GSS A;  2GQK A;  1AXD A;  5G5F A;  1M0U A;  2H75 A;  2LUS A;  4PHZ C;  3LGC A;  1TTZ A;  5IOW A;  1F37 A;  4IVF A;  3KH7 A;  4MNN A;  4EL1 A;  3QAV A;  3CSJ A;  2IMI A;  2FWH A;  5A4U A;  4F03 A;  3D6I A;  2DIY A;  3DVX A;  3RHB A;  1PGT A;  1FHE A;  1GWC A;  4KDX A;  3TOU A;  4POB A;  3FK8 A;  2H66 A;  3WYW A;  4BVY A;  4L5L A;  3KXO A;  2JSY A;  3CRU A;  3N5O A;  5INY A;  2R3X A;  1BG1 A;  1K0N A;  4QMK A;  3CTF A;  4K0G A;  1JHB A;  3MNG A;  3GL5 A;  5D9V A;  1S3A A;  3BCI A;  4FIW A;  2DJK A;  2P31 A;  3C7M A;  4JZQ A;  2A4V A;  3FZ9 A;  3FZ4 A;  1FAA A;  2FWE A;  3IAS 2;  1GNW A;  4V1A p;  2K18 A;  5ECI B;  4AF2 A;  5E4W A;  2OT3 A;  2H8L A;  1GUL A;  2EIQ A;  4L8E A;  5J4Y A;  3ZVJ A;  4O7H A;  1URM A;  1T1V A;  3LSZ A;  1T00 A;  2NVL A;  5D9X A;  1WPI A;  4L5O A;  1XWA A;  2B5Y A;  1X9M B;  5DQS A;  4ACS A;  3ED3 A;  1O73 A;  1GSS A;  20GS A;  1E6B A;  4J2F A;  3ZFL A;  1O8X A;  2X49 A;  1GUH A;  3KTB A;  4HDE A;  2GSS A;  2VUP A;  4HJ2 A;  4TXV A;  4ZL8 A;  2FWG A;  1V9W A;  1VRS D;  2EIR A;  1OAZ A;  4N0Z A;  1FVJ A;  4WBJ A;  3FW2 A;  2PBJ A;  4I5Q A;  2LJR A;  1VF3 A;  2YWO A;  4YQU A;  3CHX C;  5CRG A;  3HZ4 A;  2C0E A;  1J0F A;  2R6K A;  3RGB C;  4CW9 A;  4KF9 A;  5HQP A;  2M80 A;  2WW3 A;  2F51 A;  2B6M A;  3RDW A;  3UBL A;  1GUK A;  1X5D A;  4GF0 A;  2LNS A;  4QL7 A;  2OJL A;  2V32 A;  4IGJ A;  1R26 A;  2HRF A;  1SYR A;  4NXI A;  4O5Q A;  2V1M A;  2HSH A;  4K7N A;  4GST A;  5IMF A;  2DJ1 A;  3E3E A;  4LL1 B;  3IRA A;  5CRD A;  1FW1 A;  4JR4 A;  1EV9 A;  4ZXG A;  4TR0 A;  1ERW A;  2HZE A;  2R5G A;  4KCA A;  3CSH A;  1M2A A;  5IO2 A;  1OKT A;  4DVC A;  22GS A;  2WGR A;  4BL7 B;  1KEB A;  2QSI A;  3KMN A;  5AIX A;  5D96 A;  5HFK A;  5ELG A;  2HFD A;  2CX4 A;  2O5V A;  2DMM A;  2H1L A;  1ILO A;  4TR3 A;  4TXO A;  2C1Y A;  1QUW A;  1VF1 A;  4MK3 A;  5J47 A;  2RM5 A;  5ECM B;  2X8G A;  1QXH A;  3FEU A;  3MYD A;  5D93 A;  1YEW C;  1I9D A;  2WW0 A;  4JRR A;  5IMZ A;  5DAL A;  1XOA A;  3OR5 A;  3TB2 A;  4ZIJ A;  3SWL A;  4HU9 A;  4V1A g;  4I6X A;  2L59 A;  2A2S A;  3FR6 A;  3O76 A;  1KTE A;  2M46 A;  2FHE A;  5A1N B;  2C0G A;  3TKR A;  2ON7 A;  2R0G A;  1XBS A;  2HI7 A;  5DDL A;  4FYB A;  4PQH A;  5D9W A;  1CQG A;  4NV5 A;  3EE2 A;  1WIK A;  5F8B A;  2N5F A;  1AAZ A;  3M3M A;  1VGL A;  3TRX A;  3QAW A;  2B1K A;  4ZIL A;  2PVQ A;  2L4C A;  1B9Y C;  3HZ8 A;  4W66 A;  5JWR B;  2H74 A;  5ECL B;  2LNT A;  2RUE A;  1G7E A;  1XCC A;  4NHZ A;  3NZN A;  5LD0 A;  1G7O A;  3CQF A;  2ALB A;  1SU9 A;  1B9X C;  2H1D A;  5IMC A;  1SL2 B;  4ECJ A;  2HSM B;  4I97 A;  5ID2 A;  2R4V A;  2AB6 A;  2A2P A;  3K8N A;  4K9Z A;  5D8I A;  2EC4 A;  2E7P A;  5DBQ A;  1MDK A;  3IBH A;  4YQV A;  4IW9 A;  2C0F A;  1BYE A;  14GS A;  4Q5R A;  2PVO C;  6GSW A;  1EEJ A;  1UVZ A;  4BIK A;  1BJX A;  1UA5 A;  1Y6E A;  1O81 A;  19GS A;  1GTB A;  2FA4 A;  2H0G A;  4WEY A;  4WET A;  2JZS A;  2C3T A;  4BVX A;  4HS1 A;  5G5E A;  1JFU A;  2LRT A;  2E2G A;  4WF5 A;  3LYP A;  5GZZ B;  1VF4 A;  4BVY B;  1NM3 A;  1X0R A;  3P7X A;  2WB9 A;  2XHF A;  3QFB C;  4KSM A;  3KTL A;  3ZRD A;  2MMA A;  18GS A;  1W89 A;  2L6C A;  4Q5F A;  1GNE A;  5ENU A;  2FCH A;  2A2R A;  2L5L A;  4KB3 A;  17GS A;  3RBT A;  1V98 A;  3TUE A;  4OFN A;  5ECQ B;  2WRT A;  3DKS A;  5CRE A;  3HA9 A;  3IDV A;  1R4W A;  4DSS A;  2FNO A;  1JZR A;  3GA4 A;  1GL8 A;  1R5A A;  4GTU A;  5IMV A;  4G9H A;  3HXS A;  3JCM L;  1K3Y A;  4PXO A;  2AUV A;  3HMJ G;  3A2X A;  4ULX A;  1PL1 A;  2PER A;  3LEF A;  3ZZX A;  4D73 A;  3KIJ A;  3QD9 A;  2H6X A;  1M9A A;  2Z9S A;  1CQH A;  5ECN B;  4MH3 A;  3D21 A;  1R7H A;  4KW6 A;  2VL9 A;  3W8J A;  3WD6 A;  4E8H A;  3TJK A;  3F0I A;  4K5S A;  4YAP A;  2H73 A;  3ZVJ D;  3KH9 A;  4EXJ A;  1X5C A;  1M2D A;  2BTO T;  2N5B A;  5JCW A;  2J23 A;  3UAP A;  4OCF A;  3C1R A;  2VOC A;  3EU4 A;  3GH6 A;  3F63 A;  4IS0 A;  4MJC A;  5ECR B;  5GAN D;  4MPF A;  1VF2 A;  2DKI A;  4Z2R A;  2B3S A;  1GTU A;  3FRC A;  5CAX A;  4EO3 A;  2VCT A;  3IXR A;  4JU5 A;  2I3Y A;  1EP7 A;  3M1G A;  5FT3 A;  2CAQ A;  4GWR A;  1TKD B;  4FO5 A;  3GMF A;  4WR5 A;  5EPF A;  2HRA A;  3RAZ A;  4F9Z A;  2MYG A;  1SL1 B;  2HZE B;  1ZGN A;  3W6G A;  5HR0 A;  2AYT A;  3LFL A;  1MD4 A;  4ZBB A;  1ABA A;  4G01 A;  1MDI A;  2IMK A;  1TRU A;  1GRX A;  4TXO B;  2WVX A;  3GUS A;  4MP4 A;  4QL9 A;  1TI3 A;  2C8U A;  1GSY A;  4V2L A;  4MDC A;  4IQA A;  1TXX A;  3S9F A;  1SK2 A;  4XS1 A;  2GZP A;  5ELA A;  5DAL B;  4EDY A;  5F06 A;  3TJG A;  1F3B A;  1XVQ A;  3D4T A;  4KSO A;  4MZB A;  3DEX A;  3L9S A;  1GTI A;  1YVL A;  2GDR A;  2CX3 A;  2VCQ A;  2VM2 A;  3UIW A; 
#chains in the Genus database with same CATH homology
 2HSY A;  1MEK A;  4NAX A;  1SVO A;  4ZB6 A;  3WGX A;  2EIO A;  1H4O A;  4CHS A;  5E59 A;  3EWL A;  5A5H A;  5JWO B;  2H71 A;  2A4H A;  2H0H A;  2CVK A;  1XFL A;  5JCG A;  1SJZ A;  2X64 A;  2HNL A;  1DUG A;  2DJ2 A;  3I9V 2;  1A24 A;  5C00 A;  1Q4J A;  1TK0 B;  2OA7 A;  1ZYP A;  4Q5N A;  4POL A;  3VWU A;  1EEM A;  4KND A;  1OKD A;  4OO4 A;  4IP1 A;  5ID2 B;  3F4S A;  1EOG A;  3F3Q A;  4IHU A;  2H1A A;  4HEA 2;  4QQ7 A;  1QK8 A;  3FR3 A;  4PQ1 A;  1QMV A;  4WKW A;  3MIX A;  5KN1 A;  5ECS A;  2YNX A;  5IMD A;  5D73 A;  2VO4 A;  3ZYW A;  1SEN A;  3ERW A;  2DSA A;  4MPG A;  5DAK B;  5G31 A;  2GSR A;  4GCI A;  4KX4 A;  3GHA A;  3EMX A;  3WT1 A;  1TDI A;  4YKG A;  3TJF A;  4BPY A;  4TKY A;  3L0H A;  2HRK A;  3EVI A;  5GST A;  2O85 A;  4OWY A;  1GH2 A;  2GLR A;  5CO3 A;  1SJI A;  1MTC A;  2DJ3 A;  3FR9 A;  5F05 A;  2GQL A;  2YAN A;  4BVX B;  5AN1 A;  2X8H A;  3HJP A;  4CY6 A;  4ILF A;  2JU5 A;  1YF1 A;  1FB0 A;  5G2Z A;  2XC2 A;  4K5R A;  4P3Y B;  5GSS A;  5H5S A;  5KN2 A;  4O92 A;  3APQ A;  3LYK A;  3BBY A;  1Z9H A;  1AC1 A;  1ST9 A;  2LS5 A;  3KD0 A;  3HJO A;  3CTG A;  1WP0 A;  4G0I A;  2LST A;  3G7Y A;  5IIZ A;  2VAF A;  3GNJ A;  4KAE A;  3TU3 B;  1GSF A;  2WJU A;  3GKN A;  2IJY A;  3RPN A;  2CQ9 A;  4DSS B;  2F9S A;  4PGT A;  1LJR A;  2V41 A;  1TK8 B;  3ZIV A;  2IPA A;  4WBR D;  1WRY A;  2K8V A;  3MAK A;  4HZ2 A;  3Q18 A;  3US3 A;  4BA7 A;  1ZL9 A;  5KN0 A;  1Z5Y E;  3A5W A;  4LMW A;  3IE3 A;  3H79 A;  2X4A A;  2IWT A;  3UOM A;  4D73 B;  1T4Y A;  4IKH A;  1HD2 A;  2R0C A;  2HT9 A;  3HVS A;  4ZB7 A;  3QOU A;  2K8S A;  4EE0 A;  4PUR A;  1XWG A;  2NPB A;  2R37 A;  4XS6 A;  3R3E A;  3TDG A;  4Q5Q A;  5C04 A;  3CYN A;  3D0Z A;  5J9B A;  4OO5 A;  5IPH A;  1AQX A;  5CYY A;  1OC9 A;  3WT2 A;  3F9U A;  5EL8 A;  2KLX A;  5CRW A;  3KP9 A;  3TKQ A;  1GP1 A;  1YEP A;  1UN2 A;  3UAR A;  3TRP A;  1AUC A;  2CT6 A;  3VFI A;  3VUR A;  1M2B A;  4GLT A;  2O89 A;  4OFM A;  2XBQ A;  2DJ0 A;  2REM A;  4MCU A;  1U3I A;  2VCW A;  1XPV A;  3R2Q A;  3KCM A;  3ME7 A;  1THX A;  3LXT A;  4ICY A;  10GS A;  4K1F A;  1PN0 A;  2OE3 A;  1NHO A;  2AJQ B;  5HR1 A;  1DBY A;  1AQW A;  1ERV A;  4LLR A;  2F8A A;  2IFQ A;  3VPT A;  1SKW B;  1TJD A;  1GTA A;  11GS A;  1XOB A;  3DYR A;  4HQZ A;  2MMO A;  2O87 A;  3HYP A;  4OFT A;  2YZU A;  2QGV A;  1ZYE A;  2RUF A;  3GKK A;  2GTU A;  3EC3 A;  3ZMK A;  2BJX A;  5ECP B;  1A2J A;  5AGY A;  4RQX A;  3IK9 A;  2TIR A;  5ABR A;  2HQT A;  2HSN A;  3GX8 A;  4L0W A;  1KNG A;  4K2D A;  1IYH A;  2D2Z A;  1USB A;  3IHQ A;  3G7J A;  4ZL7 A;  1YKC A;  1K0O A;  3IR4 A;  3W8S A;  3H4K A;  4KGI A;  4KA0 A;  2LQQ A;  3GKX A;  2LJK A;  2CA8 A;  3GH9 A;  3UMA A;  3L4N A;  2PN8 A;  3TKP A;  5A5H B;  4XS4 A;  3WGE A;  1XVW A;  3EMP A;  4ZL9 A;  5DJL A;  2M72 A;  3QDN A;  3LXZ A;  3FY7 A;  5A34 A;  1BQ7 A;  3QPM A;  3GTU A;  4NHW A;  1ML6 A;  4TW5 A;  3TOT A;  1N8J A;  1GSD A;  3FKF A;  2DLX A;  4X43 A;  2MBS A;  3QCP A;  6GSU A;  4GSN A;  3HKR A;  5A5K A;  6GSY A;  2LJA A;  2DML A;  1TOF A;  1JLW A;  3BCK A;  2E0Q A;  2OAD A;  4EF0 A;  2C0D A;  4CY8 A;  3FZA A;  1Q98 A;  4KUN A;  2IMF A;  3F4R A;  2JAD A;  4Z2T A;  9GSS A;  1OVN A;  3C8E A;  1Y1U A;  2FGX A;  3QR6 A;  2JSZ A;  2GQM A;  2X8C A;  5COH A;  3FMW A;  3ZTL A;  4AKX B;  1YJ6 A;  2G2Q A;  2VLU A;  2HRK B;  1XIY A;  1X9W B;  1YY7 A;  2KP2 A;  2YWI A;  1FOH A;  1UC7 A;  4HJM A;  4MJB A;  2B7K A;  1B48 A;  3APS A;  2P0G A;  3D22 A;  2QA1 A;  2OBI A;  2OE1 A;  2MZC A;  3BOA A;  1NHY A;  5J3R A;  12GS A;  2F3M A;  5G1L A;  4KE3 A;  3C71 A;  4XIH A;  3TKS A;  4BWS A;  2LRN A;  2WS2 A;  3PGT A;  1A8Y A;  1YEX A;  2V6K A;  5ECO B;  4MH2 A;  3GYK A;  4BWQ A;  4HUA A;  1ERU A;  4EDZ A;  2PU9 C;  4DSQ A;  4NWY A;  2FD3 A;  2OKA A;  5ECK B;  4I2T A;  1PKZ A;  4F0C A;  1PQN A;  2V2G A;  4N11 A;  2EFC A;  4GDF A;  1W4V A;  5KEJ A;  4WR4 A;  1BG5 A;  5FHI A;  6GSX A;  4XCS A;  4ECB A;  3NOF A;  5G1K A;  4JR6 A;  2NDO A;  3HDC A;  1NW2 A;  1OC3 A;  1PD2 1;  4J56 E;  2H70 A;  1ZMA A;  3DML A;  4AI6 A;  3L78 A;  4XRD A;  4FQU A;  2XPD A;  4ISD A;  2ZUP A;  1A8L A;  3APO A;  2GZZ A;  3D4M A;  3HHV A;  4YKF A;  3J7Y b;  2FUG 2;  1WJK A;  2I4A A;  2IIY A;  2TRC P;  1OC9 B;  3GUR A;  1FO5 A;  1XZO A;  3TKS C;  1Z6M A;  2L5O A;  3MSZ A;  1PKW A;  2YP6 A;  4G0L A;  1TU8 A;  2CZ2 A;  2WFC A;  4JE1 A;  1AIU A;  3I43 A;  3DIE A;  4LMV A;  2K9F A;  2B1L A;  2ES7 A;  4X1U A;  4L0U A;  5HFI A;  1M7T A;  2C80 A;  5HR2 A;  1Z6N A;  3RPP A;  5J40 A;  4HI7 A;  1K0M A;  3H1N A;  2AAW A;  1FB6 A;  1XW6 A;  3L9V A;  5IQY A;  4AKG A;  4NPB A;  5DCH A;  1K0B A;  3FHK A;  2EFD A;  3AY8 A;  1S3C A;  3P8W A;  2IFQ B;  1TRV A;  4PX1 A;  3MDK A;  1PSQ A;  2HYX A;  5CNW A;  1BED A;  2PWJ A;  1E2Y A;  4IJ3 A;  2WZ9 A;  2AHE A;  4HZ4 A;  2H0I A;  3GRX A;  4BL7 A;  1A0R P;  2YV7 A;  3VLN A;  1SVM A;  4MF7 A;  4N30 A;  4YQM A;  1WMJ A;  3CSI A;  4E68 A;  3UBK A;  4I2U A;  2HSN B;  1RW1 A;  4ML1 A;  13GS A;  1WOU A;  3ERG A;  3M9K A;  2MMN A;  2QKE A;  1ZYN A;  4PUF C;  3ZIT A;  1GSE A;  1JLV A;  4IEL A;  3VI7 A;  3GL3 A;  4POM A;  5D9T A;  3CRT A;  16GS A;  4IQ1 A;  1GSU A;  4HQS A;  1MDJ A;  4O5R A;  1DE2 A;  3O6T A;  2YV9 A;  1HQO A;  2YWM A;  3IPZ A;  3UVH A;  3M8N A;  2H1B A;  3IHG A;  5B6M A;  1DE1 A;  2DC5 A;  1TU7 A;  3GX0 A;  2FLS A;  1OC8 A;  1SL0 B;  3ZRE A;  4MZW A;  3GTU B;  8GSS A;  5IM9 A;  3PIN A;  5DQY A;  2LV3 A;  4ZB8 A;  2IMD A;  4RI6 A;  2IL3 A;  5DCG A;  5LNK e;  1R5P A;  3U5R E;  3ZLP A;  3A5I A;  1C72 A;  2CV4 A;  5AIS A;  1XWK A;  2L4Q A;  1U87 A;  4I8B A;  1X9S B;  2XPE A;  1B4Q A;  3DD3 A;  2X99 A;  3IOS A;  2QA2 A;  2GGT A;  1N2A A;  1U6T A;  3EUR A;  4LL4 B;  4IN0 A;  3G7I A;  4PNF A;  4O5U A;  5H5Q A;  2WUL A;  5JCU A;  2H76 A;  4AKH A;  2KP1 A;  4AKI A;  5J41 A;  2PMT A;  2YWN A;  4J57 E;  3CXG A;  1O6J A;  1FG4 A;  2FY6 A;  3KGK A;  3F4T A;  2L57 A;  4TR1 A;  2GSQ A;  5F07 A;  3VPQ A;  5IOX A;  2L6D A;  4ZBA A;  3PPU A;  5GAP D;  1FOV A;  2F8F A;  1ERT A;  4RUV A;  3I6A A;  2GZY A;  3GV1 A;  2RM6 A;  1NSW A;  2B5E A;  3H8Q A;  1PX6 A;  3O3T A;  1ZYQ B;  3RHC A;  2YN1 A;  3LOR A;  2VD0 A;  5BMU A;  2RII A;  3LG6 A;  3WGD A;  1DSB A;  2JZR A;  1T8E B;  4MLY A;  2OBK A;  2RLI A;  1PL2 A;  1HNC A;  1KBN A;  3GSS A;  3U6V A;  4OCE A;  1EP8 A;  1BX9 A;  1U88 A;  5A4V A;  4HU7 A;  4OD7 A;  2P5Q A;  5KN3 A;  2LQO A;  5JWQ B;  2LEG A;  2PUK C;  2JL4 A;  1ON4 A;  3DVW A;  4AGS A;  3ZML A;  2DJJ A;  1AW9 A;  4G19 A;  1QQ2 A;  1XWB A;  3EIN A;  1GLQ A;  2E2M A;  4F0B A;  5IMA A;  4ML6 A;  2H19 A;  4JED A;  1SK1 A;  3HVV A;  3EU3 A;  5H5R A;  2H30 A;  4POK A;  1V40 A;  1F9M A;  3HD5 A;  5FWG A;  4RI7 A;  4PTS A;  1K0D A;  4EVM A;  3QAG A;  4K2X A;  3CWG A;  3BD2 A;  4AJ7 A;  1OE8 A;  5CRH A;  2UZ8 A;  5CP1 A;  2PGT A;  4DSR A;  2IME A;  1G6W A;  2KOK A;  3BJ5 A;  1THO A;  1ZOF A;  2VM1 A;  4NMU A;  3UL3 A;  2CZ3 A;  2V6O A;  1PMT A;  4V2N A;  1GSQ A;  1K0C A;  4WXT A;  3KZQ A;  1SK0 A;  4YAV A;  1FVK A;  4ZBD A;  4PUA A;  3IC4 A;  4PQI A;  1JZO A;  1SJ6 A;  1F3A A;  2C3Q A;  1LBK A;  1TXU A;  3CBU A;  4E8E A;  4MF6 A;  1EGO A;  4CDO A;  2LRC A;  4KDU A;  1EWX A;  2YZH A;  4KCE A;  1PX7 A;  1J08 A;  3LWA A;  2EFH A;  2HLS A;  1G6Y A;  1TRW A;  3GFK A;  4ECC A;  4G0K A;  2IN3 A;  4WF4 A;  3GN3 A;  3MWH A;  3FZ5 A;  4K6X A;  1ACV A;  4H86 A;  4Z2U A;  1TK5 B;  3KM6 A;  1A0F A;  5KOX A;  5KOW A;  4O32 A;  2GVP A;  2JAC A;  3CMI A;  3DRN A;  1Y25 A;  1V58 A;  4XHM A;  1WWJ A;  3HY2 A;  1YQ1 A;  3VWW A;  5HFG A;  3TJB A;  1SVL A;  1AQV A;  1TI1 A;  6GST A;  2WCI A;  3VI5 A;  3IK7 A;  1TRS A;  2C3N A;  4IP6 A;  4KDY A;  4FYU A;  2DKH A;  2HXK A;  4MF5 A;  5G30 A;  1T3B A;  1EOH A;  5EY6 A;  3L9U A;  1OYJ A;  2O7K A;  2GT6 A;  2N5A A;  2VL2 A;  3HCZ A;  2FWF A;  1M9B A;  5DJM A;  3LJR A;  3IV4 A;  1T7P B;  4TN8 A;  1A2L A;  1V2A A;  5L71 A;  2H6Z A;  1YF0 A;  2YJH A;  1B8X A;  3UVT A;  3ISO A;  3V1W A;  3DGQ A;  4FH8 A;  4G2E A;  2I1U A;  2YJ7 A;  3EYT A;  4TOP A;  5DAK A;  1RK4 A;  5J4V A;  5B8A A;  2FA8 A;  3HVX A;  2VKZ G;  3DXB A;  4K8M A;  3ZFB A;  3Q6O A;  1JZW A;  1YZX A;  3UEM A;  2VCZ A;  4EUY A;  2QC7 A;  4RQR A;  4TR1 B;  5AIV A;  1XXU A;  2NBS A;  6GSS A;  4XTS A;  2YOI A;  5IO0 A;  1QGV A;  3H93 A;  1B4P A;  1Z7R A;  3TGZ A;  4DEJ A;  1QFN A;  6GSV A;  4GQC A;  5BRT A;  4K0N A;  4NV2 A;  2NTO A;  2GST A;  1PA3 A;  2VLT A;  3IA1 A;  1I5G A;  1ZZY A;  2H01 A;  4EIP A;  4AJ6 A;  3TCO A;  3IAM 2;  1OE7 A;  2AV4 A;  4MAB A;  5BMU B;  3EPT A;  1MD3 A;  1IYI A;  1Z3E A;  5A4W A;  2VL2 C;  3M9J A;  3DWV A;  1SD8 A;  3LQ7 A;  4PNG A;  1PRX A;  2LKU A;  1HNA A;  4GRF A;  3P2A A;  4MA9 A;  2TRX A;  1O7U A;  3Q19 A;  1XW9 A;  2O8V B;  3LW9 A;  1BAY A;  4F82 A;  3N9J A;  3IC8 A;  2XBI A;  1GLP A;  1O8W A;  1XWC A;  3C1S A;  2H72 A;  1K3O A;  4V2M A;  1XW5 A;  3PR8 A;  2I9H A;  1H75 A;  2H6Y A;  2MMZ A;  3FYG A;  1SYX A;  1M99 A;  1TW9 A;  3E9J B;  2BMX A;  3F6D A;  1G0T A;  4N3Z A;  4N10 A;  2CVB A;  1ZCP A;  2GT5 A;  2WDU A;  4GSS A;  5DVB A;  2B5X A;  3A3T A;  4A5P A;  5EVO A;  2R0P A;  2J9H A;  3TJJ A;  2ZCT A;  2LTK A;  3TKS E;  4MMM A;  1EZK A;  3QMX A;  3F6F A;  4F2I A;  3P90 A;  1EV4 A;  5J5N A;  4USS A;  5B7C A;  2B7J A;  1A23 A;  4HOJ A;  2HRN A;  3TRQ A;  4ID0 A;  4EC0 A;  4K7O A;  2C4J A;  5LCZ A;  2YPM A;  4XRA A;  4N0V A;  2CAI A;  2VCV A;  1X5E A;  3VK9 A;  3F3R A;  1SKR B;  5B6N A;  2YCD A;  3G9B A;  1F2E A;  3Q74 A;  1V57 A;  3QFA C;  4JBB A;  3KP8 A;  2VL3 A;  1K0A A;  1J9B A;  4EIQ A;  3NIV A;  1A2M A;  3UJ1 A;  3F8U A;  3A2W A;  1BF5 A;  3A2V A;  4ZB9 A;  1HYU A;  1Z7P A;  3ME8 A;  4X0X A;  4IBP A;  2UV8 G;  4ECI A;  2HZF A;  4TR4 A;  2G0F A;  3E0U A;  1SD9 A;  5J4U A;  2VIM A;  4FYC A;  3KJY A;  4TVE A;  3VWV A;  4LA1 A;  4MZC A;  3M0F A;  4K7I A;  3ZIJ A;  2DIZ A;  1U3A A;  1EGR A;  1F6M C;  2GS3 A;  1N25 A;  5ECH B;  2I81 A;  2P5R A;  3C73 A;  3J7Y k;  3PH9 A;  1SKS B;  1HNB A;  3KEB A;  3ERF A;  3GST A;  4Z7X A;  2K6V A;  1T4Z A;  1JZD A;  3KMO A;  5A1N A;  5F0G A;  4GQF A;  3HJM A;  1TP9 A;  4XS4 B;  3GKM A;  3GIX A;  4IJI A;  1LU4 A;  2HE3 A;  2OAC A;  2PPT A;  5A34 B;  1YDK A;  3D5J A;  2ON5 A;  1RQM A;  3I69 A;  2DBC A;  5HR3 A;  5IPG A;  5B8B A;  3VWX A;  4AJ8 A;  2H1G A;  4EKZ A;  1O85 A;  1PN9 A;  2KHP A;  4MJA A;  2CVD A;  1YKA A;  2R2J A;  4X4J A;  1WE0 A;  2KUC A;  4GXZ A;  4YH2 A;  1K3L A;  2EFE A;  2ZNM A;  2HSM A;  3ZL5 A;  4OMV A;  5J9C A;  2JZT A;  2OE0 A;  3SBC A;  1S3D A;  4G10 A;  2VLV A;  2MBT A;  2VD1 A;  4MJE A;  4KH7 A;  2VCX A;  1GUM A;  4TRX A;  7GSS A;  2GQK A;  1AXD A;  5G5F A;  1M0U A;  2H75 A;  2LUS A;  3LGC A;  1TTZ A;  5IOW A;  1F37 A;  4IVF A;  3KH7 A;  4MNN A;  4EL1 A;  3QAV A;  3CSJ A;  2IMI A;  2FWH A;  5A4U A;  4F03 A;  3D6I A;  2DIY A;  3DVX A;  3RHB A;  1PGT A;  1FHE A;  1GWC A;  4KDX A;  3TOU A;  4POB A;  3FK8 A;  2H66 A;  3WYW A;  4BVY A;  4L5L A;  3KXO A;  2JSY A;  3CRU A;  3N5O A;  5INY A;  2R3X A;  1BG1 A;  1K0N A;  4QMK A;  3CTF A;  4K0G A;  1JHB A;  3MNG A;  3GL5 A;  5D9V A;  1S3A A;  3BCI A;  4FIW A;  2DJK A;  2P31 A;  3C7M A;  4JZQ A;  2A4V A;  3FZ9 A;  3FZ4 A;  1FAA A;  2FWE A;  3IAS 2;  1GNW A;  4V1A p;  2K18 A;  5ECI B;  4AF2 A;  5E4W A;  2OT3 A;  2H8L A;  1GUL A;  2EIQ A;  4L8E A;  5J4Y A;  3ZVJ A;  4O7H A;  1URM A;  1T1V A;  3LSZ A;  1T00 A;  2NVL A;  5D9X A;  1WPI A;  4L5O A;  1XWA A;  2B5Y A;  1X9M B;  5DQS A;  4ACS A;  3ED3 A;  1O73 A;  1GSS A;  20GS A;  1E6B A;  4J2F A;  3ZFL A;  1O8X A;  2X49 A;  1GUH A;  3KTB A;  4HDE A;  2GSS A;  2VUP A;  4HJ2 A;  4TXV A;  4ZL8 A;  2FWG A;  1V9W A;  1VRS D;  2EIR A;  1OAZ A;  4N0Z A;  1FVJ A;  4WBJ A;  3FW2 A;  2PBJ A;  4I5Q A;  2LJR A;  1VF3 A;  2YWO A;  4YQU A;  5CRG A;  3HZ4 A;  2C0E A;  1J0F A;  2R6K A;  4CW9 A;  4KF9 A;  5HQP A;  2M80 A;  2F51 A;  2B6M A;  3RDW A;  3UBL A;  1GUK A;  1X5D A;  4GF0 A;  2LNS A;  4QL7 A;  2OJL A;  2V32 A;  4IGJ A;  1R26 A;  2HRF A;  1SYR A;  4NXI A;  4O5Q A;  2V1M A;  2HSH A;  4K7N A;  4GST A;  5IMF A;  2DJ1 A;  3E3E A;  4LL1 B;  3IRA A;  5CRD A;  1FW1 A;  4JR4 A;  1EV9 A;  4ZXG A;  4TR0 A;  1ERW A;  2HZE A;  2R5G A;  4KCA A;  3CSH A;  1M2A A;  5IO2 A;  1OKT A;  4DVC A;  22GS A;  2WGR A;  4BL7 B;  1KEB A;  2QSI A;  3KMN A;  5AIX A;  5D96 A;  5HFK A;  5ELG A;  2HFD A;  2CX4 A;  2O5V A;  2DMM A;  2H1L A;  1ILO A;  4TR3 A;  4TXO A;  2C1Y A;  1QUW A;  1VF1 A;  4MK3 A;  5J47 A;  2RM5 A;  5ECM B;  2X8G A;  1QXH A;  3FEU A;  3MYD A;  5D93 A;  1I9D A;  4JRR A;  5IMZ A;  5DAL A;  1XOA A;  3OR5 A;  3TB2 A;  4ZIJ A;  3SWL A;  4HU9 A;  4V1A g;  4I6X A;  2L59 A;  2A2S A;  3FR6 A;  3O76 A;  1KTE A;  2M46 A;  2FHE A;  5A1N B;  2C0G A;  3TKR A;  2ON7 A;  2R0G A;  1XBS A;  2HI7 A;  5DDL A;  4FYB A;  4PQH A;  5D9W A;  1CQG A;  4NV5 A;  3EE2 A;  1WIK A;  5F8B A;  2N5F A;  1AAZ A;  3M3M A;  1VGL A;  3TRX A;  3QAW A;  2B1K A;  4ZIL A;  2PVQ A;  2L4C A;  1B9Y C;  3HZ8 A;  4W66 A;  5JWR B;  2H74 A;  5ECL B;  2LNT A;  2RUE A;  1G7E A;  1XCC A;  4NHZ A;  3NZN A;  5LD0 A;  1G7O A;  2ALB A;  1SU9 A;  1B9X C;  2H1D A;  5IMC A;  1SL2 B;  4ECJ A;  2HSM B;  4I97 A;  5ID2 A;  2R4V A;  2AB6 A;  2A2P A;  3K8N A;  4K9Z A;  5D8I A;  2EC4 A;  2E7P A;  5DBQ A;  1MDK A;  3IBH A;  4YQV A;  4IW9 A;  2C0F A;  1BYE A;  14GS A;  4Q5R A;  2PVO C;  6GSW A;  1EEJ A;  1UVZ A;  1BJX A;  1UA5 A;  1Y6E A;  1O81 A;  19GS A;  1GTB A;  2FA4 A;  2H0G A;  4WEY A;  4WET A;  2JZS A;  2C3T A;  4BVX A;  4HS1 A;  5G5E A;  1JFU A;  2LRT A;  2E2G A;  4WF5 A;  3LYP A;  5GZZ B;  1VF4 A;  4BVY B;  1NM3 A;  1X0R A;  3P7X A;  2WB9 A;  2XHF A;  3QFB C;  4KSM A;  3KTL A;  3ZRD A;  2MMA A;  18GS A;  1W89 A;  2L6C A;  4Q5F A;  1GNE A;  5ENU A;  2FCH A;  2A2R A;  2L5L A;  4KB3 A;  17GS A;  3RBT A;  1V98 A;  3TUE A;  4OFN A;  5ECQ B;  2WRT A;  3DKS A;  5CRE A;  3HA9 A;  3IDV A;  1R4W A;  4DSS A;  2FNO A;  1JZR A;  3GA4 A;  1GL8 A;  1R5A A;  4GTU A;  5IMV A;  4G9H A;  3HXS A;  3JCM L;  1K3Y A;  4PXO A;  2AUV A;  3HMJ G;  3A2X A;  4ULX A;  1PL1 A;  2PER A;  3LEF A;  3ZZX A;  4D73 A;  3KIJ A;  3QD9 A;  2H6X A;  1M9A A;  2Z9S A;  1CQH A;  5ECN B;  4MH3 A;  3D21 A;  1R7H A;  4KW6 A;  2VL9 A;  3W8J A;  3WD6 A;  4E8H A;  3TJK A;  3F0I A;  4K5S A;  4YAP A;  2H73 A;  3ZVJ D;  3KH9 A;  4EXJ A;  1X5C A;  1M2D A;  2BTO T;  2N5B A;  5JCW A;  2J23 A;  3UAP A;  4OCF A;  3C1R A;  2VOC A;  3EU4 A;  3GH6 A;  3F63 A;  4IS0 A;  4MJC A;  5ECR B;  5GAN D;  4MPF A;  1VF2 A;  2DKI A;  4Z2R A;  2B3S A;  1GTU A;  3FRC A;  5CAX A;  4EO3 A;  2VCT A;  3IXR A;  4JU5 A;  2I3Y A;  1EP7 A;  3M1G A;  5FT3 A;  2CAQ A;  4GWR A;  1TKD B;  4FO5 A;  3GMF A;  4WR5 A;  5EPF A;  2HRA A;  3RAZ A;  4F9Z A;  2MYG A;  1SL1 B;  2HZE B;  1ZGN A;  3W6G A;  5HR0 A;  2AYT A;  3LFL A;  1MD4 A;  4ZBB A;  1ABA A;  4G01 A;  1MDI A;  2IMK A;  1TRU A;  1GRX A;  4TXO B;  4MP4 A;  3GUS A;  4QL9 A;  1TI3 A;  2C8U A;  1GSY A;  4V2L A;  4MDC A;  4IQA A;  1TXX A;  3S9F A;  1SK2 A;  4XS1 A;  2GZP A;  5ELA A;  5DAL B;  4EDY A;  5F06 A;  3TJG A;  1F3B A;  1XVQ A;  3D4T A;  4KSO A;  4MZB A;  3DEX A;  3L9S A;  1GTI A;  1YVL A;  2GDR A;  2CX3 A;  2VCQ A;  2VM2 A;  3UIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...