2WJUA

Glutathione transferase a2-2 in complex with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-S-TRANSFERASE A2-2
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wjuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wjuA01
2G2QA 3CBUA 1MD4A 6GSYA 4BA7A 3US3A 1BYEA 3TOUA 3HCZA 2VL9A 5E59A 1TJDA 4HS1A 2VOCA 3M3MA 5IMCA 4KCAA 5HQPA 1JLVA 22GSA 3FY7A 1TRUA 1NM3A 2PVQA 1JZDA 1WJKA 1ABAA 1G6YA 4K2DA 5ECHB 1GUHA 2V2GA 3LG6A 2FY6A 3DWVA 4K7NA 2L5OA 2KOKA 1I9DA 3GYKA 1PGTA 3N9JA 2GT5A 3M9JA 2L4CA 5D93A 1AXDA 3U5RE 1Z6NA 5IM9A 1SD9A 3A3TA 3BOAA 4PNGA 1AQXA 3ZFLA 3P8WA 2BTOT 1PX6A 4TR0A 2K8SA 2NPBA 2WB9A 4IW9A 1J08A 3E0UA 1WRYA 3FHKA 2E2GA 1T4ZA 5F8BA 4FH8A 2AAWA 1HNAA 1F3AA 4IN0A 4IJ3A 4ECIA 1QXHA 3F4TA 3FEUA 1A24A 5D9TA 1ZZYA 3CYNA 3CSIA 5IO2A 3D6IA 2FD3A 2H73A 1T4YA 1PKWA 2OADA 1KEBA 5ELGA 5FT3A 3UL3A 2F8AA 4ID0A 2FUG2 4ZL9A 1K0AA 2F51A 2H0IA 4X0XA 2KUCA 3KTBA 5IMDA 2HZEA 3GKKA 1TTZA 2HE3A 1W4VA 4K0GA 1OE8A 3QFAC 2GSTA 3LXZA 1EGOA 1EZKA 2HSNB 5J5NA 4V2LA 1J9BA 4KW6A 11GSA 2DJ0A 3DMLA 1C72A 3GKNA 1PSQA 4HZ4A 4Q5QA 5D9XA 3WT1A 4TRXA 3IC4A 1TRWA 3IR4A 1YF1A 4BWSA 1XW6A 3NOFA 5G5FA 2VL2A 3LEFA 4ISDA 2LQQA 4BPYA 2AJQB 1SJ6A 5IMZA 2LJAA 1FG4A 1PMTA 4WR4A 4JR4A 2VLVA 3S9FA 2IL3A 2FCHA 1R5AA 4XIHA 2GDRA 5E4WA 1YZXA 2K9FA 1GSQA 1A23A 3DXBA 1I5GA 2H1AA 2LKUA 3DYRA 1V2AA 2FWHA 3TB2A 2DBCA 1TP9A 3NZNA 3IV4A 4I8BA 2VL3A 3KEBA 2WZ9A 3UOMA 4O32A 4I97A 1A2LA 2YWIA 1YEXA 2AUVA 4MPGA 4DSQA 3R3EA 3GTUA 1B8XA 1ST9A 3D0ZA 3DD3A 1GLQA 1NHOA 2G0FA 1HYUA 3ME8A 4ULXA 1PL1A 2L6DA 2IPAA 3FR6A 2H6ZA 2H1DA 5EVOA 4MP4A 3WT2A 2PMTA 5ECKB 3HDCA 2YJHA 2H30A 4WBRD 17GSA 2KLXA 3HYPA 2YPMA 3NIVA 1X5EA 5CYYA 3VWWA 5AIVA 4ECCA 3MWHA 4KGIA 18GSA 3C7MA 3OR5A 2HSYA 2IN3A 2H1GA 2PVOC 4TXOA 4QL7A 1TW9A 2CT6A 3CSHA 3F63A 3VI7A 3D21A 5GAND 3TDGA 2TRCP 1A8LA 1PL2A 1NSWA 3EWLA 2XBQA 5B8BA 2KHPA 2DMMA 3H79A 4TVEA 3N5OA 3PH9A 4FQUA 4GCIA 6GSTA 1YDKA 3IC8A 4PQIA 4WBJA 1X9MB 5ID2B 4HJMA 4NHZA 1GLPA 1YY7A 2GZZA 2NBSA 2FLSA 1Y6EA 5DBQA 5G31A 5DALA 3FR9A 1USBA 3W6GA 1GSYA 1M0UA 5IQYA 1M9AA 4WF5A 4MPFA 2NTOA 3L0HA 1QQ2A 1WMJA 4IQAA 1XOBA 3IXRA 1U3AA 4XHMA 1TK0B 3UJ1A 4D73B 2JACA 1XW5A 2JZTA 1V57A 2V41A 2I9HA 3FR3A 1XVWA 3Q18A 3FZ9A 5B8AA 4IVFA 4X1UA 2H8LA 3BJ5A 2M46A 4MH2A 3TRQA 1EOHA 4HJ2A 2LRNA 2LQOA 2XBIA 3GSTA 1M2AA 3ZYWA 4GWRA 2E7PA 4NXIA 4PQHA 2X8GA 3APOA 1XWCA 3ZFBA 4NPBA 4BL7A 2LNSA 2JL4A 4OD7A 4HQSA 2DJ1A 3KTLA 10GSA 4EL1A 2X99A 4MK3A 1R4WA 1TU7A 1F3BA 1XW9A 4FYUA 1MDIA 5GAPD 5CO3A 4ZL8A 2VCWA 4WR5A 2A4VA 3GMFA 3ZZXA 5IOXA 3EU4A 1Y25A 3EYTA 3GURA 1UVZA 1VGLA 3ZIVA 1SKRB 3PPUA 1Q98A 1GTUA 1XPVA 4MCUA 1GSDA 4QL9A 1QUWA 2OBKA 2OJLA 3DKSA 3TKRA 1XXUA 4EKZA 4I6XA 2FA8A 1U88A 3IAM2 2CVDA 5EPFA 4IKHA 1PKZA 3HVVA 2TRXA 4I2TA 3LGCA 1HNCA 1V40A 3GL3A 3FKFA 2ES7A 16GSA 5EL8A 1K3YA 5A4UA 4F82A 1X5CA 3UEMA 4DSSB 4WKWA 4OMVA 3L78A 4MA9A 1OKTA 4HUAA 4PUFC 2DMLA 2UZ8A 4OFMA 3HJMA 3TJKA 1TI3A 3IRAA 2WULA 4JRRA 1FO5A 2AYTA 4GSTA 1GRXA 1SKSB 5KN1A 4XRAA 5KN2A 2JU5A 1R26A 1SL0B 4ZIJA 2B3SA 4TOPA 4CDOA 2QKEA 4IP6A 1Z7RA 3FZAA 4RQXA 3TRPA 3VK9A 5DCHA 3LQ7A 4YAVA 2IJYA 3PR8A 2CA8A 4LL4B 5FWGA 5CAXA 4HDEA 2X64A 5ECSA 1OC9B 3GFKA 4ECJA 2V6OA 1OC8A 1G0TA 1VF4A 1YKAA 4TN8A 3GH9A 2MMNA 3G7IA 3GV1A 4GXZA 5IIZA 3H4KA 3I43A 1F9MA 3LWAA 4GLTA 2A2RA 4IGJA 4PX1A 1QK8A 5C00A 4TR3A 4X43A 1FB0A 1AQWA 6GSVA 4MF7A 4BVXB 2H6YA 2HRAA 4XCSA 1XWAA 2CZ3A 4LMVA 4RI7A 3PINA 4TXVA 5G1KA 5DALB 1XOAA 5J4UA 2BMXA 2B7JA 1EEJA 3GRXA 2CAQA 4KDXA 2CAIA 5J9CA 4MF5A 2HI7A 2KP2A 3APSA 5ECMB 3TGZA 5JWRB 1ILOA 6GSXA 1MDKA 1K3OA 4JBBA 1F37A 5DJMA 3MSZA 3QAGA 2H0HA 14GSA 2B5EA 2EIQA 4AJ8A 1TRSA 2WFCA 1GNEA 2K6VA 5F0GA 5IMAA 2PWJA 4IELA 3HY2A 2PPTA 8GSSA 5ID2A 1WPIA 5AN1A 2C4JA 1G6WA 5ECQB 3RHBA 4N0VA 3G9BA 3SWLA 2H76A 3V1WA 1DE2A 4ECBA 2YV9A 2HXKA 1EP7A 1GTBA 3F9UA 1XVQA 1ERVA 4BL7B 4MABA 2C3QA 2O85A 5GZZB 4MJAA 4IS0A 3RPPA 3A5WA 1R7HA 2FWGA 1G7EA 1WE0A 3UARA 4MH3A 2ON7A 4O5RA 4ZB8A 2WS2A 1KNGA 4D73A 4GRFA 4HU9A 3HZ8A 4FYBA 3JCML 3TKSE 4Q5RA 2HQTA 2RM6A 1GSUA 4GSNA 1T8EB 5JCUA 1N2AA 1AQVA 3C1RA 1J0FA 1EOGA 4CHSA 2OE0A 3HZ4A 3TJJA 2DLXA 1YJ6A 4O7HA 3C73A 1O85A 4OO4A 3ZRDA 1SK1A 4TW5A 3W8SA 2DIYA 2GZYA 5D9VA 1ON4A 2YN1A 1RQMA 5A4WA 1FAAA 4MLYA 3L9SA 4ZXGA 4K6XA 2CX4A 2ALBA 1IYIA 5F06A 1A2JA 4BWQA 1TK5B 2FNOA 2I1UA 1UA5A 2EIOA 5D8IA 2WCIA 5ECOB 1TI1A 5B6NA 1M99A 1FHEA 1X0RA 5GSTA 1WP0A 5DJLA 2I4AA 2GTUA 2PU9C 3GIXA 1M2DA 3GSSA 2C0EA 2YWNA 2R5GA 1ERTA 3H8QA 2N5BA 5J9BA 4POBA 5ECPB 2L6CA 2XHFA 3Q74A 3GA4A 2H66A 2C1YA 2LUSA 1TXXA 4ACSA 2GT6A 1SL2B 3MAKA 4PURA 4USSA 3CMIA 4G0KA 2RIIA 4GQCA 3HVXA 2C0GA 2H6XA 2VCTA 3GX0A 3F6FA 1H4OA 4PTSA 2C8UA 2IMKA 2AV4A 4F03A 2PBJA 1M9BA 4DSSA 2YZHA 3F4SA 1OC3A 3EE2A 2LS5A 2E2MA 2PERA 1NHYA 1ACVA 3RHCA 2DJ2A 2H70A 3DIEA 1BX9A 4KX4A 4MDCA 4O92A 3TUEA 2IIYA 1T3BA 1GP1A 3VI5A 3TCOA 2WDUA 2DIZA 4YAPA 5B7CA 4ZILA 3UIWA 3A2XA 3DVWA 1U3IA 3GX8A 1GSSA 1Z9HA 3L9VA 1BG5A 4ZBDA 1BEDA 5IPGA 4MJEA 3TJBA 3IHQA 1K0MA 1LBKA 4AJ6A 3QAVA 3A2WA 3BD2A 2BJXA 4G9HA 3E9JB 1OC9A 3QD9A 4KUNA 1CQHA 1GWCA 1JZOA 2F9SA 2C0DA 3QOUA 4JE1A 5JCWA 4ZB9A 1VRSD 5J41A 3D4MA 1PX7A 4QQ7A 1ZCPA 4ZL7A 5H5RA 2LJRA 5KN3A 2YZUA 1AAZA 3GNJA 2VCZA 3E3EA 3ME7A 2K18A 1ZL9A 4BVXA 3DEXA 5HR2A 4F0CA 3HD5A 4LL1B 1RK4A 3QAWA 3FRCA 1H75A 4ZBBA 3UMAA 4K0NA 3APQA 3TOTA 2HFDA 4GF0A 5G30A 1Z5YE 2OACA 2C0FA 4NWYA 2L57A 2QC7A 1URMA 1PD21 4RI6A 3TJFA 3VWUA 4K7IA 5J3RA 4L5LA 3LYPA 1UN2A 1ZYEA 1IYHA 2WRTA 1THOA 1OYJA 2J9HA 5A5KA 1FW1A 2NDOA 6GSSA 4FYCA 1XFLA 4XTSA 4OFTA 4EF0A 3M0FA 3CXGA 3G7YA 4IP1A 4KAEA 2MZCA 1ERUA 3LJRA 3ISOA 4BVYB 3R2QA 1XWBA 3KIJA 4HOJA 2YANA 4G10A 1GULA 3M1GA 3C1SA 5CNWA 4J2FA 2YWMA 4PQ1A 2B5YA 4XS4B 5IMFA 3TKPA 4EC0A 2P5QA 4GTUA 1EEMA 2IFQA 4RUVA 4NHWA 1XWKA 3P90A 5IPHA 5ENUA 2VCXA 1ZGNA 3QFBC 4HQZA 3L9UA 3D4TA 3RAZA 1THXA 4NV5A 4NV2A 1A8YA 4I5QA 2OBIA 2F8FA 2I81A 3BBYA 3KGKA 3C8EA 3GHAA 2VUPA 3IA1A 2RUFA 5JCGA 1XWGA 3O6TA 2GGTA 3J7Yb 2DC5A 2HSMB 4K1FA 4YQMA 4YQVA 3DVXA 2JSYA 1WIKA 3WGDA 5DDLA 3G7JA 4K9ZA 3LYKA 1AUCA 2K8VA 1YF0A 1PRXA 2H0GA 3EMPA 3ZVJA 2VM1A 4V2NA 1MTCA 2VLTA 5G2ZA 3TKSC 3GL5A 1SU9A 3F3QA 4V1Ap 3W8JA 4Q5FA 1JHBA 4DEJA 1K0BA 4F0BA 4L0WA 5INYA 2HRFA 3HJPA 2FWFA 3FW2A 5COHA 2WJUA 1S3CA 3UAPA 1V98A 19GSA 3UVTA 2DJJA 1FOVA 1DUGA 3K8NA 1ML6A 4KF9A 2GQLA 2M80A 3UVHA 3TRXA 1YQ1A 2JADA 3LXTA 5LD0A 4YH2A 1XZOA 2P31A 5HR1A 1Z3EA 4V1Ag 5JWQB 5LNKe 4NAXA 2L5LA 4L8EA 1XCCA 2AB6A 3I6AA 4V2MA 2HRKB 1FVJA 2HRNA 4EDYA 6GSWA 3LFLA 4K8MA 3CRTA 3ED3A 4HU7A 3ZITA 5CRWA 1SYXA 2XPDA 5L71A 1G7OA 1FVKA 4EXJA 2RUEA 2XPEA 1BQ7A 2M72A 4NMUA 3KH9A 1SK2A 3KD0A 5HFIA 3KXOA 4ZBAA 2LNTA 2JZSA 4LA1A 4KDUA 5IO0A 2O87A 4KSOA 2HLSA 13GSA 2GSQA 20GSA 2OA7A 5ECLB 4LLRA 1GH2A 2B1KA 2GSRA 2TIRA 1O81A 3I9V2 3HA9A 1MEKA 1TOFA 1VF3A 1K0OA 3UBKA 2ZNMA 4KDYA 5CRGA 5DQSA 2C80A 3ZMLA 2REMA 4E8EA 2WGRA 3F0IA 2VAFA 3KZQA 1O8WA 2LJKA 5HR3A 2VIMA 2HYXA 4JU5A 2JSZA 1V9WA 1GTIA 5HFKA 2RM5A 1B48A 2B1LA 2X8CA 2MYGA 4E8HA 3GKXA 1UC7A 2HSHA 1LU4A 2FA4A 3BCIA 1QFNA 2LTKA 1JZWA 2IFQB 5KN0A 3F8UA 3VPTA 3HJOA 3D22A 2VCVA 2VO4A 4FIWA 3TKQA 3ZIJA 4G0IA 2FHEA 1SK0A 2NVLA 1A0RP 5C04A 4Q5NA 4OCEA 4MJBA 2CVBA 2YOIA 2IWTA 2X8HA 2VL2C 2CQ9A 1HQOA 4BVYA 1SD8A 3J7Yk 3U6VA 4GQFA 3TJGA 2VCQA 2DSAA 1Z7PA 3QCPA 1F2EA 2MBSA 3HKRA 2QSIA 4MJCA 3IPZA 3I69A 2KP1A 2QGVA 4TKYA 1PA3A 2HT9A 3EU3A 3RPNA 2P0GA 2CV4A 2MMZA 1WOUA 4XS4A 3WGXA 1T7PB 3DRNA 2YP6A 2E0QA 4IBPA 2F3MA 4MMMA 4CW9A 3IAS2 4KE3A 3D5JA 4POKA 2VD0A 4WF4A 1AIUA 4F2IA 4IHUA 3AY8A 7GSSA 4KSMA 2GQMA 4HEA2 1XBSA 3SBCA 3KP8A 1XIYA 2GSSA 4AJ7A 3H1NA 5CP1A 5HR0A 2HNLA 2IMDA 3GH6A 2CVKA 3QMXA 1X9WB 4MF6A 4PXOA 4TR1B 3VURA 2HSMA 4TR4A 2LRTA 4IJIA 2O89A 3F6DA 2B7KA 5BMUA 2OE1A 2O8VB 1RW1A 3LORA 2OE3A 2LV3A 2ZCTA 1S3AA 1TRVA 1KTEA 5ECRB 5JWOB 2ZUPA 1AC1A 3KH7A 4EE0A 3ZMKA 3IOSA 1BAYA 3HVSA 3WYWA 1GSFA 3ERFA 1TKDB 1ZMAA 1TU8A 3VPQA 4G0LA 3ZLPA 4XS6A 2OKAA 4YQUA 2RLIA 2O7KA 2VD1A 3RBTA 1A0FA 5CRDA 4MZBA 1DSBA 1X5DA 5ECIB 3ZREA 1OE7A 2PUKC 1VF2A 2C3NA 4WEYA 1OVNA 1JLWA 1W89A 3HHVA 3CTFA 1QMVA 4N30A 4Z7XA 5DCGA 2CZ2A 4OO5A 4I2UA 2YWOA 1JFUA 4HZ2A 4KA0A 3C71A 4WETA 5G5EA 2P5RA 5IOWA 3P7XA 3VFIA 3GN3A 2HRKA 2YV7A 2GS3A 3O76A 3MNGA 1GSEA 1OAZA 1WWJA 4G19A 4EUYA 3EINA 4LMWA 5DAKA 2J23A 2IMIA 2R2JA 1V58A 2L59A 4FO5A 4KCEA 1K0NA 2VM2A 2H19A 2H72A 3KP9A 1K0DA 1B9YC 1ZYQB 4P3YB 3IBHA 1K3LA 1U6TA 4GSSA 3H93A 3L4NA 2YJ7A 2FWEA 5F05A 3GKMA 1O73A 2FGXA 12GSA 2N5FA 1QGVA 3Q19A 2B5XA 1TDIA 2HZFA 3GUSA 4OFNA 4EDZA 1VF1A 1HNBA 1F6MC 1E2YA 5AISA 3M9KA 1X9SB 3CSJA 5DQYA 4KH7A 1K0CA 5D73A 1BJXA 2GZPA 6GSUA 1B4PA 2D2ZA 2L4QA 3VWVA 4RQRA 3FZ5A 3F4RA 3KM6A 3WGEA 1CQGA 1SYRA 1EV9A 5ELAA 2R37A 2GVPA 3KMOA 4WXTA 2Z9SA 5D9WA 4AGSA 2B6MA 2GLRA 3CRUA 2AHEA 1MD3A 4HI7A 5ECNB 3EC3A 3EVIA 5IMVA 4AF2A 4L0UA 2CX3A 4MZCA 2MMAA 5ABRA 2EC4A 1GL8A 1B4QA 1EV4A 4J57E 3EURA 3F3RA 3A2VA 1KBNA 3DGQA 2GQKA 2H75A 1TK8B 2HZEB 2IMFA 1N8JA 3HXSA 5B6MA 3KJYA 3VWXA 4ILFA 4KNDA 9GSSA 1ZOFA 1E6BA 2YCDA 1ERWA 2MBTA 4N0ZA 1DBYA 1SJIA 4IQ1A 4OCFA 1EP8A 1M7TA 5EY6A 4JEDA 5GSSA 4ML6A 2A2SA 3EMXA 1R5PA 4N11A 1OKDA 1T1VA 2V32A 5CRHA 4G2EA 4DSRA 4N10A 2N5AA 4EO3A 1SJZA 3P2AA 1T00A 1JZRA 3ZTLA 5DVBA 4PUAA 3WD6A 3FZ4A 1GUMA 5F07A 1M2BA 1SENA 1PN9A 2LRCA 1LJRA 1O7UA 2H01A 4J56E 3VLNA 3QPMA 1PQNA 2H74A 1DE1A 3ERWA 1U87A 4EVMA 1B9XC 1SL1B 1SKWB 3KMNA 1Z6MA 2ON5A 2PGTA 3O3TA 5D96A 5G1LA 3BCKA 2H71A 1Q4JA 3GTUB 4L5OA 2I3YA 3ZVJD 2V6KA 4JZQA 4F9ZA 4TR1A 5LCZA 2V1MA 2IMEA 5H5SA 3IK7A 1GNWA 1A2MA 2R4VA 3FK8A 3FYGA 2DJKA 3KCMA 1GUKA 1EWXA 2PN8A 2R6KA 3Q6OA 1NW2A 4PGTA 3ZL5A 2LEGA 4PNFA 3QR6A 2EIRA 2XC2A 1EGRA 3UBLA 3PGTA 5DAKB 5H5QA 4MZWA 4XRDA 5FHIA 4JR6A 3MDKA 2R3XA 2LSTA 4KB3A 5HFGA 3TKSA 1HD2A 3IK9A 4TXOB 3CTGA 1AW9A 3IE3A 1FB6A 3IDVA 3QDNA 5AIXA 4ML1A 5A4VA 1YKCA 3LSZA 4DVCA 3ERGA 5CREA 4H86A 2MMOA 1O8XA 1S3DA 2JZRA 4OWYA 4POLA 1YEPA 2VLUA 4POMA 1MDJA 3RDWA 2YNXA 2C3TA 3M8NA 4ZB6A 5AGYA 2H1BA 4XS1A 5KEJA 1O6JA 4K7OA 1GTAA 2DJ3A
chains in the Genus database with same CATH superfamily
2G2QA 3CBUA 1MD4A 6GSYA 4BA7A 3US3A 1BYEA 3TOUA 3HCZA 2VL9A 5E59A 1TJDA 4HS1A 2VOCA 3M3MA 5IMCA 4KCAA 5HQPA 1JLVA 22GSA 3FY7A 1TRUA 1NM3A 2PVQA 1JZDA 1WJKA 1ABAA 1G6YA 4K2DA 5ECHB 1GUHA 2V2GA 3LG6A 2FY6A 3DWVA 4K7NA 2L5OA 2KOKA 1I9DA 3GYKA 1PGTA 3N9JA 2GT5A 3M9JA 2L4CA 5D93A 1AXDA 3U5RE 1Z6NA 5IM9A 1SD9A 3A3TA 3BOAA 4PNGA 1AQXA 3ZFLA 3P8WA 5A1NB 2BTOT 1PX6A 4TR0A 2K8SA 2NPBA 2WB9A 4IW9A 1J08A 3E0UA 1SVLA 1WRYA 3FHKA 2E2GA 1T4ZA 5F8BA 4CY8A 4FH8A 2AAWA 1HNAA 1F3AA 2WVXA 4IN0A 4IJ3A 4ECIA 1QXHA 3F4TA 3FEUA 1A24A 5D9TA 1ZZYA 3CYNA 3CSIA 5IO2A 3D6IA 2FD3A 2H73A 1T4YA 1PKWA 2OADA 1KEBA 5ELGA 5FT3A 3UL3A 2F8AA 4ID0A 2FUG2 4ZL9A 1K0AA 2WZSA 2F51A 2H0IA 4X0XA 2KUCA 3KTBA 5IMDA 2HZEA 3GKKA 1TTZA 2HE3A 1W4VA 4K0GA 1OE8A 3QFAC 2GSTA 3LXZA 2O3EA 1EGOA 1EZKA 2HSNB 5J5NA 4V2LA 5KOWA 1J9BA 4KW6A 11GSA 2DJ0A 3DMLA 1C72A 3GKNA 1PSQA 4HZ4A 4Q5QA 5D9XA 3WT1A 4TRXA 3IC4A 1TRWA 3IR4A 1YF1A 4BWSA 3IHGA 1XW6A 3NOFA 5G5FA 2VL2A 3LEFA 4ISDA 2LQQA 4BPYA 2AJQB 1SJ6A 5IMZA 5A5HB 2LJAA 1FG4A 5A34B 1PMTA 4WR4A 4JR4A 2VLVA 3S9FA 2IL3A 4AKXB 2FCHA 1R5AA 4XIHA 2GDRA 5E4WA 1YZXA 2K9FA 1GSQA 1A23A 3DXBA 1I5GA 2H1AA 2LKUA 2DKHA 3DYRA 1V2AA 2FWHA 3TB2A 2DBCA 1TP9A 3NZNA 3IV4A 4I8BA 2VL3A 3KEBA 2WZ9A 3UOMA 4O32A 4I97A 1A2LA 2YWIA 1YEXA 2AUVA 4MPGA 4DSQA 1S3RA 3R3EA 3GTUA 1B8XA 2R0PA 1ST9A 3D0ZA 3DD3A 1GLQA 1NHOA 2G0FA 1HYUA 3ME8A 4ULXA 1PL1A 2L6DA 2IPAA 3FR6A 2H6ZA 1Y1UA 2H1DA 5EVOA 4MP4A 3WT2A 2PMTA 5ECKB 3HDCA 3RGBC 2YJHA 2H30A 4WBRD 17GSA 2KLXA 3HYPA 2YPMA 3NIVA 1X5EA 5CYYA 3VWWA 5AIVA 4ECCA 3MWHA 4KGIA 18GSA 3C7MA 3OR5A 2HSYA 2IN3A 2H1GA 2PVOC 4TXOA 4QL7A 1TW9A 3A5IA 2CT6A 3CSHA 3F63A 3VI7A 3D21A 5GAND 3TDGA 2TRCP 1A8LA 1PL2A 1NSWA 3EWLA 2XBQA 5B8BA 2KHPA 2DMMA 3H79A 4TVEA 3N5OA 3PH9A 4FQUA 4GCIA 6GSTA 1YDKA 3IC8A 4PQIA 4WBJA 1X9MB 5ID2B 4HJMA 1TXUA 4NHZA 1GLPA 1YY7A 2GZZA 2NBSA 2FLSA 1Y6EA 5DBQA 5G31A 5DALA 3FR9A 1USBA 3W6GA 1GSYA 1M0UA 5IQYA 1M9AA 4WF5A 4MPFA 2NTOA 3L0HA 1QQ2A 1WMJA 4IQAA 1XOBA 3IXRA 1U3AA 4XHMA 1TK0B 3UJ1A 4D73B 2JACA 1XW5A 2JZTA 1V57A 2V41A 2I9HA 3FR3A 1XVWA 3Q18A 3FZ9A 5B8AA 4IVFA 4X1UA 2H8LA 4O5QA 3BJ5A 2M46A 4MH2A 3TRQA 1EOHA 4HJ2A 2LRNA 2LQOA 2XBIA 3GSTA 1M2AA 2QA2A 3ZYWA 4GWRA 2E7PA 4NXIA 5A1NA 4PQHA 2X8GA 3APOA 1XWCA 3ZFBA 4NPBA 4BL7A 2LNSA 2JL4A 4OD7A 4HQSA 2DJ1A 3KTLA 10GSA 4EL1A 2X99A 4MK3A 1R4WA 1TU7A 1F3BA 1XW9A 4FYUA 5BRTA 1MDIA 5GAPD 5CO3A 4ZL8A 2VCWA 4WR5A 2A4VA 3GMFA 3ZZXA 5IOXA 3EU4A 1Y25A 3EYTA 3GURA 1UVZA 1VGLA 3ZIVA 1SKRB 3PPUA 1Q98A 1GTUA 1XPVA 4MCUA 1GSDA 4ICYA 4QL9A 1QUWA 2OBKA 2OJLA 3DKSA 3TKRA 1XXUA 4EKZA 4I6XA 2FA8A 4BIKA 1U88A 3IAM2 2CVDA 5EPFA 4IKHA 1PKZA 3HVVA 2TRXA 4I2TA 3LGCA 1HNCA 1V40A 3GL3A 3FKFA 2ES7A 16GSA 5EL8A 1K3YA 5A4UA 4F82A 1X5CA 3UEMA 4DSSB 4WKWA 4OMVA 3L78A 4MA9A 1OKTA 4HUAA 4PUFC 2DMLA 2UZ8A 4OFMA 3HJMA 3TJKA 1TI3A 3IRAA 2WULA 4JRRA 1FO5A 2AYTA 4GSTA 1GRXA 1SKSB 5KN1A 4XRAA 5KN2A 5A34A 2JU5A 1R26A 1SL0B 4ZIJA 2B3SA 2O36A 4TOPA 4CDOA 2QKEA 4IP6A 1Z7RA 3FZAA 4RQXA 3TRPA 3VK9A 5DCHA 3LQ7A 4YAVA 2IJYA 3PR8A 2CA8A 4LL4B 5FWGA 5CAXA 4HDEA 2X64A 5ECSA 1OC9B 3GFKA 4ECJA 2V6OA 1OC8A 1G0TA 1VF4A 1YKAA 4TN8A 3GH9A 2MMNA 3G7IA 3GV1A 4GXZA 5IIZA 3H4KA 3I43A 1F9MA 3LWAA 4GLTA 2A2RA 4IGJA 4PX1A 1QK8A 5C00A 4TR3A 4X43A 1FB0A 1AQWA 6GSVA 4MF7A 4BVXB 2H6YA 2HRAA 4XCSA 1XWAA 2WW1A 2CZ3A 4LMVA 4RI7A 1M3IA 3PINA 4TXVA 5G1KA 5DALB 1XOAA 5J4UA 2BMXA 2B7JA 1EEJA 3GRXA 2CAQA 4KDXA 2CAIA 5J9CA 4MF5A 2HI7A 2KP2A 3APSA 5ECMB 3TGZA 5JWRB 1ILOA 6GSXA 1MDKA 1K3OA 4JBBA 3CWGA 1F37A 5DJMA 3MSZA 3QAGA 2H0HA 14GSA 2B5EA 2EIQA 4AJ8A 1TRSA 2WFCA 1GNEA 2K6VA 5F0GA 5IMAA 2PWJA 4IELA 3CHXC 3HY2A 2PPTA 8GSSA 5ID2A 1WPIA 5AN1A 2C4JA 1G6WA 5ECQB 3RHBA 4N0VA 3G9BA 3SWLA 2H76A 3V1WA 1DE2A 4ECBA 2YV9A 2HXKA 1EP7A 1GTBA 3F9UA 4AKGA 1XVQA 1ERVA 4BL7B 1YVLA 4MABA 2C3QA 1FOHA 5GZZB 2O85A 4MJAA 4IS0A 3RPPA 3A5WA 1R7HA 2FWGA 1G7EA 1WE0A 3UARA 4MH3A 2ON7A 4O5RA 4ZB8A 2WS2A 1KNGA 4D73A 4GRFA 4HU9A 3HZ8A 4FYBA 3JCML 3TKSE 4Q5RA 2HQTA 2RM6A 1GSUA 4GSNA 1T8EB 5JCUA 1N2AA 1AQVA 3C1RA 1J0FA 1EOGA 4CHSA 5J4YA 2OE0A 3HZ4A 3TJJA 2DLXA 1YJ6A 4O7HA 3C73A 1O85A 4OO4A 3ZRDA 1SK1A 4TW5A 3W8SA 2DIYA 2GZYA 5D9VA 1ON4A 2YN1A 1RQMA 5A4WA 1FAAA 4MLYA 3L9SA 4ZXGA 4K6XA 2CX4A 2ALBA 1IYIA 5F06A 1A2JA 4BWQA 1TK5B 2FNOA 2I1UA 1UA5A 2EIOA 1ZYPA 5D8IA 2WCIA 5ECOB 1TI1A 5B6NA 1M99A 1FHEA 1PN0A 1X0RA 5GSTA 1WP0A 5DJLA 2I4AA 2GTUA 2PU9C 3GIXA 1M2DA 3GSSA 2C0EA 2YWNA 2R5GA 1ERTA 3H8QA 2N5BA 2H1LA 1M3JA 5J9BA 4POBA 5ECPB 2L6CA 2XHFA 3Q74A 3GA4A 2H66A 2C1YA 2LUSA 1TXXA 4ACSA 2GT6A 1SL2B 3MAKA 4PURA 3HVNA 4USSA 3CMIA 2X4AA 4G0KA 2RIIA 4GQCA 3HVXA 2C0GA 2H6XA 2VCTA 3GX0A 3F6FA 1H4OA 4G01A 4PTSA 2C8UA 2IMKA 2AV4A 4F03A 2EFHA 2PBJA 1M9BA 4DSSA 2YZHA 3F4SA 1OC3A 3EE2A 2LS5A 2E2MA 2PERA 1NHYA 1ACVA 3RHCA 2DJ2A 2H70A 3DIEA 1BX9A 4KX4A 4MDCA 4O92A 3TUEA 2IIYA 2WVZA 4PI0C 1GP1A 1T3BA 3VI5A 3MYDA 3TCOA 2WDUA 2DIZA 4YAPA 5B7CA 4ZILA 3UIWA 3A2XA 2A2PA 3DVWA 1U3IA 3GX8A 1GSSA 1Z9HA 1YEWC 3L9VA 1BG5A 4ZBDA 1BEDA 5IPGA 4MJEA 3TJBA 3IHQA 1K0MA 1LBKA 4AJ6A 3QAVA 3A2WA 3BD2A 2BJXA 4G9HA 3E9JB 1OC9A 3QD9A 4KUNA 1CQHA 1GWCA 1JZOA 2F9SA 2C0DA 3QOUA 4JE1A 5JCWA 4ZB9A 1VRSD 5J41A 3D4MA 1PX7A 4QQ7A 1ZCPA 4ZL7A 5H5RA 2LJRA 5KN3A 2YZUA 1AAZA 3GNJA 4EIPA 2VCZA 3E3EA 3ME7A 2K18A 1ZL9A 2R0CA 4BVXA 3DEXA 5HR2A 4F0CA 3HD5A 4LL1B 1RK4A 3QAWA 3FRCA 1H75A 4ZBBA 4K5SA 3UMAA 4K0NA 3APQA 3TOTA 2HFDA 4GF0A 5G30A 1Z5YE 2OACA 2C0FA 4NWYA 2L57A 2QC7A 2EFEA 1URMA 1PD21 4RI6A 3TJFA 3VWUA 4K7IA 5J3RA 4L5LA 3LYPA 1UN2A 1ZYEA 1IYHA 2WRTA 1THOA 1OYJA 2J9HA 5A5KA 1FW1A 2NDOA 6GSSA 4FYCA 1XFLA 4XTSA 4OFTA 4EF0A 4E68A 3M0FA 5J4VA 3CXGA 3G7YA 4IP1A 4QMKA 4KAEA 2MZCA 1ERUA 3LJRA 2VKZG 3ISOA 4BVYB 3R2QA 1XWBA 3KIJA 4HOJA 2YANA 4G10A 1GULA 3M1GA 3C1SA 5CNWA 4J2FA 2YWMA 4PQ1A 2B5YA 4XS4B 5IMFA 3TKPA 4EC0A 2P5QA 4GTUA 1EEMA 2IFQA 4RUVA 4NHWA 1XWKA 3P90A 5IPHA 5ENUA 2VCXA 1ZGNA 3QFBC 5J47A 4HQZA 3L9UA 3D4TA 3RAZA 1THXA 5KOXA 4NV5A 4NV2A 1A8YA 4I5QA 4O5UA 2OBIA 2F8FA 2I81A 3BBYA 3KGKA 3C8EA 2WW0A 3GHAA 2VUPA 3IA1A 2RUFA 5JCGA 1XWGA 3O6TA 2GGTA 3J7Yb 2DC5A 2HSMB 4K1FA 4YQMA 4YQVA 3DVXA 2JSYA 1WIKA 3WGDA 5DDLA 5BMUB 3G7JA 3HMJG 2OT3A 4K9ZA 3LYKA 1AUCA 2K8VA 1YF0A 1PRXA 2H0GA 3EMPA 3ZVJA 2VM1A 4V2NA 1MTCA 2VLTA 5G2ZA 3TKSC 3GL5A 4A5PA 1SU9A 3F3QA 4V1Ap 3W8JA 4Q5FA 1JHBA 4DEJA 1K0BA 4F0BA 4L0WA 5INYA 4PI2C 2HRFA 3HJPA 2FWFA 3FW2A 5COHA 2WJUA 1S3CA 3UAPA 1V98A 19GSA 3UVTA 2DJJA 5J40A 1FOVA 1DUGA 3K8NA 1ML6A 4KF9A 2GQLA 2M80A 3UVHA 3TRXA 1YQ1A 2JADA 3LXTA 2WVYA 4YH2A 5LD0A 1XZOA 2P31A 5HR1A 1Z3EA 4V1Ag 5JWQB 5LNKe 4NAXA 2L5LA 4L8EA 1XCCA 3MIXA 2AB6A 4FXYP 3I6AA 4V2MA 2HRKB 1FVJA 2HRNA 4EDYA 6GSWA 3LFLA 4K8MA 3CRTA 3ED3A 4HU7A 3ZITA 5CRWA 1SYXA 3TU3B 2XPDA 5L71A 1G7OA 1FVKA 4EXJA 2RUEA 2XPEA 1BQ7A 2M72A 4NMUA 3KH9A 1N25A 1SK2A 3KD0A 5HFIA 3KXOA 4ZBAA 1PFOA 3CQFA 2LNTA 2JZSA 4LA1A 4KDUA 5IO0A 4YKGA 2O87A 4KSOA 4AKHA 13GSA 2HLSA 2GSQA 4N3ZA 20GSA 1S4BP 2OA7A 5ECLB 4LLRA 1GH2A 2B1KA 2GSRA 2TIRA 1O81A 3I9V2 3HA9A 4W66A 4PHZC 1MEKA 1TOFA 1VF3A 1K0OA 4Z2TA 3UBKA 2ZNMA 4KDYA 5CRGA 5DQSA 2C80A 3ZMLA 2REMA 4E8EA 2WGRA 3F0IA 2VAFA 3KZQA 1O8WA 1BG1A 2LJKA 5HR3A 1ZYNA 2VIMA 2HYXA 4JU5A 2JSZA 1V9WA 1GTIA 5HFKA 2RM5A 1B48A 2B1LA 2X8CA 2MYGA 4E8HA 3GKXA 1UC7A 2HSHA 1LU4A 2FA4A 3BCIA 1QFNA 4CY6A 2LTKA 1JZWA 2IFQB 5KN0A 3F8UA 3VPTA 3HJOA 3D22A 2VCVA 2VO4A 4FIWA 3TKQA 3ZIJA 4G0IA 2FHEA 1SK0A 2NVLA 1A0RP 5C04A 4Q5NA 4OCEA 4MJBA 2CVBA 2YOIA 2IWTA 2X8HA 2VL2C 2CQ9A 1HQOA 4BVYA 1SD8A 3J7Yk 2O5VA 3U6VA 4GQFA 3TJGA 2VCQA 2DSAA 1Z7PA 3QCPA 1F2EA 2MBSA 3HKRA 2QSIA 4MJCA 3IPZA 3I69A 2KP1A 2QGVA 4TKYA 1PA3A 2HT9A 3EU3A 3RPNA 2P0GA 2CV4A 2MMZA 1WOUA 4XS4A 3WGXA 1T7PB 3DRNA 2YP6A 2E0QA 4IBPA 2F3MA 4MMMA 4CW9A 3IAS2 4KE3A 2X49A 3D5JA 4POKA 2VD0A 4WF4A 1AIUA 4F2IA 4IHUA 3AY8A 2DKIA 7GSSA 4KSMA 2GQMA 4HEA2 1XBSA 3SBCA 3KP8A 1XIYA 2GSSA 4AJ7A 3H1NA 5CP1A 5HR0A 2HNLA 2IMDA 3GH6A 2CVKA 3QMXA 1X9WB 4ZB7A 4MF6A 4PXOA 4TR1B 3VURA 2HSMA 4TR4A 2LRTA 4IJIA 2O89A 1SVMA 2EFDA 3F6DA 2B7KA 5BMUA 2OE1A 2O8VB 4K5RA 1RW1A 3LORA 2OE3A 2LV3A 2ZCTA 1S3AA 1TRVA 1KTEA 5ECRB 4EIQA 5JWOB 2ZUPA 1AC1A 3KH7A 4K2XA 4EE0A 2A4HA 3ZMKA 3IOSA 1BAYA 3HVSA 3WYWA 1GSFA 3ERFA 1TKDB 1ZMAA 1TU8A 3VPQA 4G0LA 3ZLPA 4XS6A 2OKAA 4YQUA 2RLIA 2O7KA 2VD1A 3RBTA 1A0FA 4AKIA 5CRDA 4MZBA 4Z2UA 1DSBA 1X5DA 5ECIB 3ZREA 1OE7A 2PUKC 1VF2A 2C3NA 4WEYA 1OVNA 1JLWA 1W89A 3HHVA 3CTFA 1QMVA 2QA1A 4N30A 4Z7XA 5DCGA 2CZ2A 2R0GA 4OO5A 4I2UA 2YWOA 1JFUA 4HZ2A 4KA0A 1I1IP 3C71A 4WETA 5G5EA 2P5RA 5IOWA 3P7XA 3VFIA 1XG8A 3GN3A 2HRKA 2YV7A 2GS3A 3O76A 3MNGA 1GSEA 1OAZA 1WWJA 4G19A 4EUYA 3EINA 4LMWA 5DAKA 2J23A 2IMIA 2R2JA 1V58A 2L59A 4FO5A 4KCEA 1K0NA 2VM2A 2H19A 2H72A 3KP9A 1K0DA 4MNNA 1B9YC 1ZYQB 4P3YB 3IBHA 1K3LA 1U6TA 4GSSA 3H93A 2WW2A 3L4NA 2YJ7A 2FWEA 5F05A 3GKMA 1O73A 2FGXA 12GSA 2N5FA 1QGVA 3Q19A 2B5XA 1TDIA 2HZFA 3GUSA 4OFNA 4EDZA 1VF1A 3RFRC 1HNBA 1F6MC 1E2YA 5AISA 3M9KA 1X9SB 3CSJA 5DQYA 4KH7A 1K0CA 5D73A 1BJXA 2GZPA 6GSUA 1BF5A 1B4PA 2D2ZA 2L4QA 3VWVA 4RQRA 3FZ5A 3F4RA 3KM6A 3WGEA 1CQGA 1SYRA 1EV9A 5ELAA 2R37A 2GVPA 3KMOA 4WXTA 2Z9SA 5D9WA 4AGSA 2B6MA 2GLRA 3CRUA 2AHEA 1MD3A 4HI7A 2WVXB 5ECNB 3EC3A 2EFCA 3EVIA 5IMVA 4AF2A 4L0UA 2CX3A 4MZCA 2MMAA 5ABRA 2EC4A 1GL8A 1B4QA 1EV4A 4J57E 3EURA 3F3RA 3A2VA 1KBNA 3DGQA 2GQKA 2H75A 1TK8B 2HZEB 2IMFA 1N8JA 3HXSA 5B6MA 3KJYA 3VWXA 3LW9A 4ILFA 4KNDA 9GSSA 1ZOFA 1E6BA 2YCDA 1ERWA 2MBTA 2UV8G 4N0ZA 1DBYA 1SJIA 4IQ1A 4OCFA 1EP8A 1M7TA 5EY6A 4JEDA 5GSSA 4ML6A 2A2SA 3EMXA 4Z2RA 1R5PA 4N11A 1OKDA 1T1VA 2V32A 5CRHA 4G2EA 4DSRA 4N10A 2N5AA 4EO3A 1SJZA 3P2AA 1T00A 1JZRA 3ZTLA 5DVBA 4PUAA 3WD6A 3FZ4A 1GUMA 5F07A 1M2BA 1SENA 1PN9A 2LRCA 1LJRA 1O7UA 2H01A 4J56E 3VLNA 3QPMA 1PQNA 4GDFA 2H74A 1DE1A 3ERWA 1U87A 4EVMA 1B9XC 1SL1B 1SKWB 4AI6A 3KMNA 1Z6MA 2ON5A 2PGTA 2HSNA 3O3TA 5D96A 5G1LA 3BCKA 2H71A 1Q4JA 3GTUB 4HSCX 4X4JA 4L5OA 2I3YA 3ZVJD 2V6KA 4JZQA 4F9ZA 4TR1A 5LCZA 2V1MA 2IMEA 5H5SA 3IK7A 1GNWA 1A2MA 2R4VA 3FK8A 3FYGA 2DJKA 5A5HA 3KCMA 1GUKA 1EWXA 2PN8A 2R6KA 3Q6OA 1NW2A 4PGTA 3ZL5A 2LEGA 4PNFA 3FMWA 3QR6A 2EIRA 2XC2A 1EGRA 3UBLA 3PGTA 5DAKB 5H5QA 4MZWA 4XRDA 5FHIA 4YKFA 4JR6A 3MDKA 2R3XA 2LSTA 1SVOA 4KB3A 5HFGA 3TKSA 1HD2A 3IK9A 4TXOB 2WW3A 3CTGA 1AW9A 3IE3A 1FB6A 3IDVA 3QDNA 5AIXA 4ML1A 5A4VA 1YKCA 3LSZA 4DVCA 3ERGA 5CREA 4H86A 3EPTA 2MMOA 1O8XA 1S3DA 2JZRA 4OWYA 4POLA 1YEPA 2VLUA 4POMA 1MDJA 3RDWA 2YNXA 2C3TA 3M8NA 4ZB6A 5AGYA 2H1BA 4XS1A 5KEJA 1O6JA 4K7OA 1GTAA 2DJ3A
chains in the Genus database with same CATH topology
2G2QA 3CBUA 1MD4A 6GSYA 4BA7A 3US3A 1BYEA 3TOUA 3HCZA 2VL9A 5E59A 1TJDA 4HS1A 2VOCA 3M3MA 5IMCA 4KCAA 5HQPA 1JLVA 22GSA 3FY7A 1TRUA 1NM3A 2PVQA 1JZDA 1WJKA 1ABAA 1G6YA 4K2DA 5ECHB 1GUHA 2V2GA 3LG6A 2FY6A 3DWVA 4K7NA 2L5OA 2KOKA 1I9DA 3GYKA 1PGTA 3N9JA 2GT5A 3M9JA 2L4CA 5D93A 1AXDA 3U5RE 1Z6NA 5IM9A 1SD9A 3A3TA 3BOAA 4PNGA 1AQXA 3ZFLA 3P8WA 5A1NB 2BTOT 1PX6A 4TR0A 2K8SA 2NPBA 2WB9A 4IW9A 1J08A 3E0UA 1SVLA 1WRYA 3FHKA 2E2GA 1T4ZA 5F8BA 4CY8A 4FH8A 2AAWA 1HNAA 1F3AA 4IN0A 4IJ3A 4ECIA 1QXHA 3F4TA 3FEUA 1A24A 5D9TA 1ZZYA 3CYNA 3CSIA 5IO2A 3D6IA 2FD3A 2H73A 1T4YA 1PKWA 2OADA 1KEBA 5ELGA 5FT3A 3UL3A 2F8AA 4ID0A 2FUG2 4ZL9A 1K0AA 2F51A 2H0IA 4X0XA 2KUCA 3KTBA 5IMDA 2HZEA 3GKKA 1TTZA 2HE3A 1W4VA 4K0GA 1OE8A 3QFAC 2GSTA 3LXZA 1EGOA 1EZKA 2HSNB 5J5NA 4V2LA 5KOWA 1J9BA 4KW6A 11GSA 2DJ0A 3DMLA 1C72A 3GKNA 1PSQA 4HZ4A 4Q5QA 5D9XA 3WT1A 4TRXA 3IC4A 1TRWA 3IR4A 1YF1A 4BWSA 3IHGA 1XW6A 3NOFA 5G5FA 2VL2A 3LEFA 4ISDA 2LQQA 4BPYA 2AJQB 1SJ6A 5IMZA 5A5HB 2LJAA 1FG4A 5A34B 1PMTA 4WR4A 4JR4A 2VLVA 3S9FA 2IL3A 4AKXB 2FCHA 1R5AA 4XIHA 2GDRA 5E4WA 1YZXA 2K9FA 1GSQA 1A23A 3DXBA 1I5GA 2H1AA 2LKUA 2DKHA 3DYRA 1V2AA 2FWHA 3TB2A 2DBCA 1TP9A 3NZNA 3IV4A 4I8BA 2VL3A 3KEBA 2WZ9A 3UOMA 4O32A 4I97A 1A2LA 2YWIA 1YEXA 2AUVA 4MPGA 4DSQA 3R3EA 3GTUA 1B8XA 2R0PA 1ST9A 3D0ZA 3DD3A 1GLQA 1NHOA 2G0FA 1HYUA 3ME8A 4ULXA 1PL1A 2L6DA 2IPAA 3FR6A 2H6ZA 1Y1UA 2H1DA 5EVOA 4MP4A 3WT2A 2PMTA 5ECKB 3HDCA 2YJHA 2H30A 4WBRD 17GSA 2KLXA 3HYPA 2YPMA 3NIVA 1X5EA 5CYYA 3VWWA 5AIVA 4ECCA 3MWHA 4KGIA 18GSA 3C7MA 3OR5A 2HSYA 2IN3A 2H1GA 2PVOC 4TXOA 4QL7A 1TW9A 3A5IA 2CT6A 3CSHA 3F63A 3VI7A 3D21A 5GAND 3TDGA 2TRCP 1A8LA 1PL2A 1NSWA 3EWLA 2XBQA 5B8BA 2KHPA 2DMMA 3H79A 4TVEA 3N5OA 3PH9A 4FQUA 4GCIA 6GSTA 1YDKA 3IC8A 4PQIA 4WBJA 1X9MB 5ID2B 4HJMA 1TXUA 4NHZA 1GLPA 1YY7A 2GZZA 2NBSA 2FLSA 1Y6EA 5DBQA 5G31A 5DALA 3FR9A 1USBA 3W6GA 1GSYA 1M0UA 5IQYA 1M9AA 4WF5A 4MPFA 2NTOA 3L0HA 1QQ2A 1WMJA 4IQAA 1XOBA 3IXRA 1U3AA 4XHMA 1TK0B 3UJ1A 4D73B 2JACA 1XW5A 2JZTA 1V57A 2V41A 2I9HA 3FR3A 1XVWA 3Q18A 3FZ9A 5B8AA 4IVFA 4X1UA 2H8LA 4O5QA 3BJ5A 2M46A 4MH2A 3TRQA 1EOHA 4HJ2A 2LRNA 2LQOA 2XBIA 3GSTA 1M2AA 2QA2A 3ZYWA 4GWRA 2E7PA 4NXIA 5A1NA 4PQHA 2X8GA 3APOA 1XWCA 3ZFBA 4NPBA 4BL7A 2LNSA 2JL4A 4OD7A 4HQSA 2DJ1A 3KTLA 10GSA 4EL1A 2X99A 4MK3A 1R4WA 1TU7A 1F3BA 1XW9A 4FYUA 5BRTA 1MDIA 5GAPD 5CO3A 4ZL8A 2VCWA 4WR5A 2A4VA 3GMFA 3ZZXA 5IOXA 3EU4A 1Y25A 3EYTA 3GURA 1UVZA 1VGLA 3ZIVA 1SKRB 3PPUA 1Q98A 1GTUA 1XPVA 4MCUA 1GSDA 4ICYA 4QL9A 1QUWA 2OBKA 2OJLA 3DKSA 3TKRA 1XXUA 4EKZA 4I6XA 2FA8A 1U88A 3IAM2 2CVDA 5EPFA 4IKHA 1PKZA 3HVVA 2TRXA 4I2TA 3LGCA 1HNCA 1V40A 3GL3A 3FKFA 2ES7A 16GSA 5EL8A 1K3YA 5A4UA 4F82A 1X5CA 3UEMA 4DSSB 4WKWA 4OMVA 3L78A 4MA9A 1OKTA 4HUAA 4PUFC 2DMLA 2UZ8A 4OFMA 3HJMA 3TJKA 1TI3A 3IRAA 2WULA 4JRRA 1FO5A 2AYTA 4GSTA 1GRXA 1SKSB 5KN1A 4XRAA 5KN2A 5A34A 2JU5A 1R26A 1SL0B 4ZIJA 2B3SA 4TOPA 4CDOA 2QKEA 4IP6A 1Z7RA 3FZAA 4RQXA 3TRPA 3VK9A 5DCHA 3LQ7A 4YAVA 2IJYA 3PR8A 2CA8A 4LL4B 5FWGA 5CAXA 4HDEA 2X64A 5ECSA 1OC9B 3GFKA 4ECJA 2V6OA 1OC8A 1G0TA 1VF4A 1YKAA 4TN8A 3GH9A 2MMNA 3G7IA 3GV1A 4GXZA 5IIZA 3H4KA 3I43A 1F9MA 3LWAA 4GLTA 2A2RA 4IGJA 4PX1A 1QK8A 5C00A 4TR3A 4X43A 1FB0A 1AQWA 6GSVA 4MF7A 4BVXB 2H6YA 2HRAA 4XCSA 1XWAA 2CZ3A 4LMVA 4RI7A 3PINA 4TXVA 5G1KA 5DALB 1XOAA 5J4UA 2BMXA 2B7JA 1EEJA 3GRXA 2CAQA 4KDXA 2CAIA 5J9CA 4MF5A 2HI7A 2KP2A 3APSA 5ECMB 3TGZA 5JWRB 1ILOA 6GSXA 1MDKA 1K3OA 4JBBA 3CWGA 1F37A 5DJMA 3MSZA 3QAGA 2H0HA 14GSA 2B5EA 2EIQA 4AJ8A 1TRSA 2WFCA 1GNEA 2K6VA 5F0GA 5IMAA 2PWJA 4IELA 3HY2A 2PPTA 8GSSA 5ID2A 1WPIA 5AN1A 2C4JA 1G6WA 5ECQB 3RHBA 4N0VA 3G9BA 3SWLA 2H76A 3V1WA 1DE2A 4ECBA 2YV9A 2HXKA 1EP7A 1GTBA 3F9UA 4AKGA 1XVQA 1ERVA 4BL7B 1YVLA 4MABA 2C3QA 1FOHA 5GZZB 2O85A 4MJAA 4IS0A 3RPPA 3A5WA 1R7HA 2FWGA 1G7EA 1WE0A 3UARA 4MH3A 2ON7A 4O5RA 4ZB8A 2WS2A 1KNGA 4D73A 4GRFA 4HU9A 3HZ8A 4FYBA 3JCML 3TKSE 4Q5RA 2HQTA 2RM6A 1GSUA 4GSNA 1T8EB 5JCUA 1N2AA 1AQVA 3C1RA 1J0FA 1EOGA 4CHSA 5J4YA 2OE0A 3HZ4A 3TJJA 2DLXA 1YJ6A 4O7HA 3C73A 1O85A 4OO4A 3ZRDA 1SK1A 4TW5A 3W8SA 2DIYA 2GZYA 5D9VA 1ON4A 2YN1A 1RQMA 5A4WA 1FAAA 4MLYA 3L9SA 4ZXGA 4K6XA 2CX4A 2ALBA 1IYIA 5F06A 1A2JA 4BWQA 1TK5B 2FNOA 2I1UA 1UA5A 2EIOA 1ZYPA 5D8IA 2WCIA 5ECOB 1TI1A 5B6NA 1M99A 1FHEA 1PN0A 1X0RA 5GSTA 1WP0A 5DJLA 2I4AA 2GTUA 2PU9C 3GIXA 1M2DA 3GSSA 2C0EA 2YWNA 2R5GA 1ERTA 3H8QA 2N5BA 2H1LA 5J9BA 4POBA 5ECPB 2L6CA 2XHFA 3Q74A 3GA4A 2H66A 2C1YA 2LUSA 1TXXA 4ACSA 2GT6A 1SL2B 3MAKA 4PURA 4USSA 3CMIA 2X4AA 4G0KA 2RIIA 4GQCA 3HVXA 2C0GA 2H6XA 2VCTA 3GX0A 3F6FA 1H4OA 4G01A 4PTSA 2C8UA 2IMKA 2AV4A 4F03A 2EFHA 2PBJA 1M9BA 4DSSA 2YZHA 3F4SA 1OC3A 3EE2A 2LS5A 2E2MA 2PERA 1NHYA 1ACVA 3RHCA 2DJ2A 2H70A 3DIEA 1BX9A 4KX4A 4MDCA 4O92A 3TUEA 2IIYA 1T3BA 1GP1A 3VI5A 3MYDA 3TCOA 2WDUA 2DIZA 4YAPA 5B7CA 4ZILA 3UIWA 3A2XA 2A2PA 3DVWA 1U3IA 3GX8A 1GSSA 1Z9HA 3L9VA 1BG5A 4ZBDA 1BEDA 5IPGA 4MJEA 3TJBA 3IHQA 1K0MA 1LBKA 4AJ6A 3QAVA 3A2WA 3BD2A 2BJXA 4G9HA 3E9JB 1OC9A 3QD9A 4KUNA 1CQHA 1GWCA 1JZOA 2F9SA 2C0DA 3QOUA 4JE1A 5JCWA 4ZB9A 1VRSD 5J41A 3D4MA 1PX7A 4QQ7A 1ZCPA 4ZL7A 5H5RA 2LJRA 5KN3A 2YZUA 1AAZA 3GNJA 4EIPA 2VCZA 3E3EA 3ME7A 2K18A 1ZL9A 2R0CA 4BVXA 3DEXA 5HR2A 4F0CA 3HD5A 4LL1B 1RK4A 3QAWA 3FRCA 1H75A 4ZBBA 4K5SA 3UMAA 4K0NA 3APQA 3TOTA 2HFDA 4GF0A 5G30A 1Z5YE 2OACA 2C0FA 4NWYA 2L57A 2QC7A 2EFEA 1URMA 1PD21 4RI6A 3TJFA 3VWUA 4K7IA 5J3RA 4L5LA 3LYPA 1UN2A 1ZYEA 1IYHA 2WRTA 1THOA 1OYJA 2J9HA 5A5KA 1FW1A 2NDOA 6GSSA 4FYCA 1XFLA 4XTSA 4OFTA 4EF0A 4E68A 3M0FA 5J4VA 3CXGA 3G7YA 4IP1A 4QMKA 4KAEA 2MZCA 1ERUA 3LJRA 2VKZG 3ISOA 4BVYB 3R2QA 1XWBA 3KIJA 4HOJA 2YANA 4G10A 1GULA 3M1GA 3C1SA 5CNWA 4J2FA 2YWMA 4PQ1A 2B5YA 4XS4B 5IMFA 3TKPA 4EC0A 2P5QA 4GTUA 1EEMA 2IFQA 4RUVA 4NHWA 1XWKA 3P90A 5IPHA 5ENUA 2VCXA 1ZGNA 3QFBC 5J47A 4HQZA 3L9UA 3D4TA 3RAZA 1THXA 5KOXA 4NV5A 4NV2A 1A8YA 4I5QA 4O5UA 2OBIA 2F8FA 2I81A 3BBYA 3KGKA 3C8EA 3GHAA 2VUPA 3IA1A 2RUFA 5JCGA 1XWGA 3O6TA 2GGTA 3J7Yb 2DC5A 2HSMB 4K1FA 4YQMA 4YQVA 3DVXA 2JSYA 1WIKA 3WGDA 5DDLA 5BMUB 3G7JA 3HMJG 2OT3A 4K9ZA 3LYKA 1AUCA 2K8VA 1YF0A 1PRXA 2H0GA 3EMPA 3ZVJA 2VM1A 4V2NA 1MTCA 2VLTA 5G2ZA 3TKSC 3GL5A 4A5PA 1SU9A 3F3QA 4V1Ap 3W8JA 4Q5FA 1JHBA 4DEJA 1K0BA 4F0BA 4L0WA 5INYA 2HRFA 3HJPA 2FWFA 3FW2A 5COHA 2WJUA 1S3CA 3UAPA 1V98A 19GSA 3UVTA 2DJJA 5J40A 1FOVA 1DUGA 3K8NA 1ML6A 4KF9A 2GQLA 2M80A 3UVHA 3TRXA 1YQ1A 2JADA 3LXTA 5LD0A 4YH2A 1XZOA 2P31A 5HR1A 1Z3EA 4V1Ag 5JWQB 5LNKe 4NAXA 2L5LA 4L8EA 1XCCA 3MIXA 2AB6A 3I6AA 4V2MA 2HRKB 1FVJA 2HRNA 4EDYA 6GSWA 3LFLA 4K8MA 3CRTA 3ED3A 4HU7A 3ZITA 5CRWA 1SYXA 3TU3B 2XPDA 5L71A 1G7OA 1FVKA 4EXJA 2RUEA 2XPEA 1BQ7A 2M72A 4NMUA 3KH9A 1N25A 1SK2A 3KD0A 5HFIA 3KXOA 4ZBAA 2LNTA 2JZSA 4LA1A 4KDUA 5IO0A 4YKGA 2O87A 4KSOA 4AKHA 13GSA 2HLSA 2GSQA 4N3ZA 20GSA 2OA7A 5ECLB 4LLRA 1GH2A 2B1KA 2GSRA 2TIRA 1O81A 3I9V2 3HA9A 4W66A 1MEKA 1TOFA 1VF3A 1K0OA 4Z2TA 3UBKA 2ZNMA 4KDYA 5CRGA 5DQSA 2C80A 3ZMLA 2REMA 4E8EA 2WGRA 3F0IA 2VAFA 3KZQA 1O8WA 1BG1A 2LJKA 5HR3A 1ZYNA 2VIMA 2HYXA 4JU5A 2JSZA 1V9WA 1GTIA 5HFKA 2RM5A 1B48A 2B1LA 2X8CA 2MYGA 4E8HA 3GKXA 1UC7A 2HSHA 1LU4A 2FA4A 3BCIA 1QFNA 4CY6A 2LTKA 1JZWA 2IFQB 5KN0A 3F8UA 3VPTA 3HJOA 3D22A 2VCVA 2VO4A 4FIWA 3TKQA 3ZIJA 4G0IA 2FHEA 1SK0A 2NVLA 1A0RP 5C04A 4Q5NA 4OCEA 4MJBA 2CVBA 2YOIA 2IWTA 2X8HA 2VL2C 2CQ9A 1HQOA 4BVYA 1SD8A 3J7Yk 2O5VA 3U6VA 4GQFA 3TJGA 2VCQA 2DSAA 1Z7PA 3QCPA 1F2EA 2MBSA 3HKRA 2QSIA 4MJCA 3IPZA 3I69A 2KP1A 2QGVA 4TKYA 1PA3A 2HT9A 3EU3A 3RPNA 2P0GA 2CV4A 2MMZA 1WOUA 4XS4A 3WGXA 1T7PB 3DRNA 2YP6A 2E0QA 4IBPA 2F3MA 4MMMA 4CW9A 3IAS2 4KE3A 2X49A 3D5JA 4POKA 2VD0A 4WF4A 1AIUA 4F2IA 4IHUA 3AY8A 2DKIA 7GSSA 4KSMA 2GQMA 4HEA2 1XBSA 3SBCA 3KP8A 1XIYA 2GSSA 4AJ7A 3H1NA 5CP1A 5HR0A 2HNLA 2IMDA 3GH6A 2CVKA 3QMXA 1X9WB 4ZB7A 4MF6A 4PXOA 4TR1B 3VURA 2HSMA 4TR4A 2LRTA 4IJIA 2O89A 1SVMA 2EFDA 3F6DA 2B7KA 5BMUA 2OE1A 2O8VB 4K5RA 1RW1A 3LORA 2OE3A 2LV3A 2ZCTA 1S3AA 1TRVA 1KTEA 5ECRB 4EIQA 5JWOB 2ZUPA 1AC1A 3KH7A 4K2XA 4EE0A 2A4HA 3ZMKA 3IOSA 1BAYA 3HVSA 3WYWA 1GSFA 3ERFA 1TKDB 1ZMAA 1TU8A 3VPQA 4G0LA 3ZLPA 4XS6A 2OKAA 4YQUA 2RLIA 2O7KA 2VD1A 3RBTA 1A0FA 4AKIA 5CRDA 4MZBA 4Z2UA 1DSBA 1X5DA 5ECIB 3ZREA 1OE7A 2PUKC 1VF2A 2C3NA 4WEYA 1OVNA 1JLWA 1W89A 3HHVA 3CTFA 1QMVA 2QA1A 4N30A 4Z7XA 5DCGA 2CZ2A 2R0GA 4OO5A 4I2UA 2YWOA 1JFUA 4HZ2A 4KA0A 3C71A 4WETA 5G5EA 2P5RA 5IOWA 3P7XA 3VFIA 3GN3A 2HRKA 2YV7A 2GS3A 3O76A 3MNGA 1GSEA 1OAZA 1WWJA 4G19A 4EUYA 3EINA 4LMWA 5DAKA 2J23A 2IMIA 2R2JA 1V58A 2L59A 4FO5A 4KCEA 1K0NA 2VM2A 2H19A 2H72A 3KP9A 1K0DA 4MNNA 1B9YC 1ZYQB 4P3YB 3IBHA 1K3LA 1U6TA 4GSSA 3H93A 3L4NA 2YJ7A 2FWEA 5F05A 3GKMA 1O73A 2FGXA 12GSA 2N5FA 1QGVA 3Q19A 2B5XA 1TDIA 2HZFA 3GUSA 4OFNA 4EDZA 1VF1A 1HNBA 1F6MC 1E2YA 5AISA 3M9KA 1X9SB 3CSJA 5DQYA 4KH7A 1K0CA 5D73A 1BJXA 2GZPA 6GSUA 1BF5A 1B4PA 2D2ZA 2L4QA 3VWVA 4RQRA 3FZ5A 3F4RA 3KM6A 3WGEA 1CQGA 1SYRA 1EV9A 5ELAA 2R37A 2GVPA 3KMOA 4WXTA 2Z9SA 5D9WA 4AGSA 2B6MA 2GLRA 3CRUA 2AHEA 1MD3A 4HI7A 5ECNB 3EC3A 2EFCA 3EVIA 5IMVA 4AF2A 4L0UA 2CX3A 4MZCA 2MMAA 5ABRA 2EC4A 1GL8A 1B4QA 1EV4A 4J57E 3EURA 3F3RA 3A2VA 1KBNA 3DGQA 2GQKA 2H75A 1TK8B 2HZEB 2IMFA 1N8JA 3HXSA 5B6MA 3KJYA 3VWXA 3LW9A 4ILFA 4KNDA 9GSSA 1ZOFA 1E6BA 2YCDA 1ERWA 2MBTA 2UV8G 4N0ZA 1DBYA 1SJIA 4IQ1A 4OCFA 1EP8A 1M7TA 5EY6A 4JEDA 5GSSA 4ML6A 2A2SA 3EMXA 4Z2RA 1R5PA 4N11A 1OKDA 1T1VA 2V32A 5CRHA 4G2EA 4DSRA 4N10A 2N5AA 4EO3A 1SJZA 3P2AA 1T00A 1JZRA 3ZTLA 5DVBA 4PUAA 3WD6A 3FZ4A 1GUMA 5F07A 1M2BA 1SENA 1PN9A 2LRCA 1LJRA 1O7UA 2H01A 4J56E 3VLNA 3QPMA 1PQNA 4GDFA 2H74A 1DE1A 3ERWA 1U87A 4EVMA 1B9XC 1SL1B 1SKWB 4AI6A 3KMNA 1Z6MA 2ON5A 2PGTA 2HSNA 3O3TA 5D96A 5G1LA 3BCKA 2H71A 1Q4JA 3GTUB 4X4JA 4L5OA 2I3YA 3ZVJD 2V6KA 4JZQA 4F9ZA 4TR1A 5LCZA 2V1MA 2IMEA 5H5SA 3IK7A 1GNWA 1A2MA 2R4VA 3FK8A 3FYGA 2DJKA 5A5HA 3KCMA 1GUKA 1EWXA 2PN8A 2R6KA 3Q6OA 1NW2A 4PGTA 3ZL5A 2LEGA 4PNFA 3FMWA 3QR6A 2EIRA 2XC2A 1EGRA 3UBLA 3PGTA 5DAKB 5H5QA 4MZWA 4XRDA 5FHIA 4YKFA 4JR6A 3MDKA 2R3XA 2LSTA 1SVOA 4KB3A 5HFGA 3TKSA 1HD2A 3IK9A 4TXOB 3CTGA 1AW9A 3IE3A 1FB6A 3IDVA 3QDNA 5AIXA 4ML1A 5A4VA 1YKCA 3LSZA 4DVCA 3ERGA 5CREA 4H86A 3EPTA 2MMOA 1O8XA 1S3DA 2JZRA 4OWYA 4POLA 1YEPA 2VLUA 4POMA 1MDJA 3RDWA 2YNXA 2C3TA 3M8NA 4ZB6A 5AGYA 2H1BA 4XS1A 5KEJA 1O6JA 4K7OA 1GTAA 2DJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2Q A;  3CBU A;  1MD4 A;  6GSY A;  4BA7 A;  3US3 A;  1BYE A;  3TOU A;  3HCZ A;  2VL9 A;  5E59 A;  1TJD A;  4HS1 A;  2VOC A;  3M3M A;  5IMC A;  4KCA A;  5HQP A;  1JLV A;  22GS A;  3FY7 A;  1TRU A;  1NM3 A;  2PVQ A;  1JZD A;  1WJK A;  1ABA A;  1G6Y A;  4K2D A;  5ECH B;  1GUH A;  2V2G A;  3LG6 A;  2FY6 A;  3DWV A;  4K7N A;  2L5O A;  2KOK A;  1I9D A;  3GYK A;  1PGT A;  3N9J A;  2GT5 A;  3M9J A;  2L4C A;  5D93 A;  1AXD A;  3U5R E;  1Z6N A;  5IM9 A;  1SD9 A;  3A3T A;  3BOA A;  4PNG A;  1AQX A;  3ZFL A;  3P8W A;  2BTO T;  1PX6 A;  4TR0 A;  2K8S A;  2NPB A;  2WB9 A;  4IW9 A;  1J08 A;  3E0U A;  1WRY A;  3FHK A;  2E2G A;  1T4Z A;  5F8B A;  4FH8 A;  2AAW A;  1HNA A;  1F3A A;  4IN0 A;  4IJ3 A;  4ECI A;  1QXH A;  3F4T A;  3FEU A;  1A24 A;  5D9T A;  1ZZY A;  3CYN A;  3CSI A;  5IO2 A;  3D6I A;  2FD3 A;  2H73 A;  1T4Y A;  1PKW A;  2OAD A;  1KEB A;  5ELG A;  5FT3 A;  3UL3 A;  2F8A A;  4ID0 A;  2FUG 2;  4ZL9 A;  1K0A A;  2F51 A;  2H0I A;  4X0X A;  2KUC A;  3KTB A;  5IMD A;  2HZE A;  3GKK A;  1TTZ A;  2HE3 A;  1W4V A;  4K0G A;  1OE8 A;  3QFA C;  2GST A;  3LXZ A;  1EGO A;  1EZK A;  2HSN B;  5J5N A;  4V2L A;  1J9B A;  4KW6 A;  11GS A;  2DJ0 A;  3DML A;  1C72 A;  3GKN A;  1PSQ A;  4HZ4 A;  4Q5Q A;  5D9X A;  3WT1 A;  4TRX A;  3IC4 A;  1TRW A;  3IR4 A;  1YF1 A;  4BWS A;  1XW6 A;  3NOF A;  5G5F A;  2VL2 A;  3LEF A;  4ISD A;  2LQQ A;  4BPY A;  2AJQ B;  1SJ6 A;  5IMZ A;  2LJA A;  1FG4 A;  1PMT A;  4WR4 A;  4JR4 A;  2VLV A;  3S9F A;  2IL3 A;  2FCH A;  1R5A A;  4XIH A;  2GDR A;  5E4W A;  1YZX A;  2K9F A;  1GSQ A;  1A23 A;  3DXB A;  1I5G A;  2H1A A;  2LKU A;  3DYR A;  1V2A A;  2FWH A;  3TB2 A;  2DBC A;  1TP9 A;  3NZN A;  3IV4 A;  4I8B A;  2VL3 A;  3KEB A;  2WZ9 A;  3UOM A;  4O32 A;  4I97 A;  1A2L A;  2YWI A;  1YEX A;  2AUV A;  4MPG A;  4DSQ A;  3R3E A;  3GTU A;  1B8X A;  1ST9 A;  3D0Z A;  3DD3 A;  1GLQ A;  1NHO A;  2G0F A;  1HYU A;  3ME8 A;  4ULX A;  1PL1 A;  2L6D A;  2IPA A;  3FR6 A;  2H6Z A;  2H1D A;  5EVO A;  4MP4 A;  3WT2 A;  2PMT A;  5ECK B;  3HDC A;  2YJH A;  2H30 A;  4WBR D;  17GS A;  2KLX A;  3HYP A;  2YPM A;  3NIV A;  1X5E A;  5CYY A;  3VWW A;  5AIV A;  4ECC A;  3MWH A;  4KGI A;  18GS A;  3C7M A;  3OR5 A;  2HSY A;  2IN3 A;  2H1G A;  2PVO C;  4TXO A;  4QL7 A;  1TW9 A;  2CT6 A;  3CSH A;  3F63 A;  3VI7 A;  3D21 A;  5GAN D;  3TDG A;  2TRC P;  1A8L A;  1PL2 A;  1NSW A;  3EWL A;  2XBQ A;  5B8B A;  2KHP A;  2DMM A;  3H79 A;  4TVE A;  3N5O A;  3PH9 A;  4FQU A;  4GCI A;  6GST A;  1YDK A;  3IC8 A;  4PQI A;  4WBJ A;  1X9M B;  5ID2 B;  4HJM A;  4NHZ A;  1GLP A;  1YY7 A;  2GZZ A;  2NBS A;  2FLS A;  1Y6E A;  5DBQ A;  5G31 A;  5DAL A;  3FR9 A;  1USB A;  3W6G A;  1GSY A;  1M0U A;  5IQY A;  1M9A A;  4WF5 A;  4MPF A;  2NTO A;  3L0H A;  1QQ2 A;  1WMJ A;  4IQA A;  1XOB A;  3IXR A;  1U3A A;  4XHM A;  1TK0 B;  3UJ1 A;  4D73 B;  2JAC A;  1XW5 A;  2JZT A;  1V57 A;  2V41 A;  2I9H A;  3FR3 A;  1XVW A;  3Q18 A;  3FZ9 A;  5B8A A;  4IVF A;  4X1U A;  2H8L A;  3BJ5 A;  2M46 A;  4MH2 A;  3TRQ A;  1EOH A;  4HJ2 A;  2LRN A;  2LQO A;  2XBI A;  3GST A;  1M2A A;  3ZYW A;  4GWR A;  2E7P A;  4NXI A;  4PQH A;  2X8G A;  3APO A;  1XWC A;  3ZFB A;  4NPB A;  4BL7 A;  2LNS A;  2JL4 A;  4OD7 A;  4HQS A;  2DJ1 A;  3KTL A;  10GS A;  4EL1 A;  2X99 A;  4MK3 A;  1R4W A;  1TU7 A;  1F3B A;  1XW9 A;  4FYU A;  1MDI A;  5GAP D;  5CO3 A;  4ZL8 A;  2VCW A;  4WR5 A;  2A4V A;  3GMF A;  3ZZX A;  5IOX A;  3EU4 A;  1Y25 A;  3EYT A;  3GUR A;  1UVZ A;  1VGL A;  3ZIV A;  1SKR B;  3PPU A;  1Q98 A;  1GTU A;  1XPV A;  4MCU A;  1GSD A;  4QL9 A;  1QUW A;  2OBK A;  2OJL A;  3DKS A;  3TKR A;  1XXU A;  4EKZ A;  4I6X A;  2FA8 A;  1U88 A;  3IAM 2;  2CVD A;  5EPF A;  4IKH A;  1PKZ A;  3HVV A;  2TRX A;  4I2T A;  3LGC A;  1HNC A;  1V40 A;  3GL3 A;  3FKF A;  2ES7 A;  16GS A;  5EL8 A;  1K3Y A;  5A4U A;  4F82 A;  1X5C A;  3UEM A;  4DSS B;  4WKW A;  4OMV A;  3L78 A;  4MA9 A;  1OKT A;  4HUA A;  4PUF C;  2DML A;  2UZ8 A;  4OFM A;  3HJM A;  3TJK A;  1TI3 A;  3IRA A;  2WUL A;  4JRR A;  1FO5 A;  2AYT A;  4GST A;  1GRX A;  1SKS B;  5KN1 A;  4XRA A;  5KN2 A;  2JU5 A;  1R26 A;  1SL0 B;  4ZIJ A;  2B3S A;  4TOP A;  4CDO A;  2QKE A;  4IP6 A;  1Z7R A;  3FZA A;  4RQX A;  3TRP A;  3VK9 A;  5DCH A;  3LQ7 A;  4YAV A;  2IJY A;  3PR8 A;  2CA8 A;  4LL4 B;  5FWG A;  5CAX A;  4HDE A;  2X64 A;  5ECS A;  1OC9 B;  3GFK A;  4ECJ A;  2V6O A;  1OC8 A;  1G0T A;  1VF4 A;  1YKA A;  4TN8 A;  3GH9 A;  2MMN A;  3G7I A;  3GV1 A;  4GXZ A;  5IIZ A;  3H4K A;  3I43 A;  1F9M A;  3LWA A;  4GLT A;  2A2R A;  4IGJ A;  4PX1 A;  1QK8 A;  5C00 A;  4TR3 A;  4X43 A;  1FB0 A;  1AQW A;  6GSV A;  4MF7 A;  4BVX B;  2H6Y A;  2HRA A;  4XCS A;  1XWA A;  2CZ3 A;  4LMV A;  4RI7 A;  3PIN A;  4TXV A;  5G1K A;  5DAL B;  1XOA A;  5J4U A;  2BMX A;  2B7J A;  1EEJ A;  3GRX A;  2CAQ A;  4KDX A;  2CAI A;  5J9C A;  4MF5 A;  2HI7 A;  2KP2 A;  3APS A;  5ECM B;  3TGZ A;  5JWR B;  1ILO A;  6GSX A;  1MDK A;  1K3O A;  4JBB A;  1F37 A;  5DJM A;  3MSZ A;  3QAG A;  2H0H A;  14GS A;  2B5E A;  2EIQ A;  4AJ8 A;  1TRS A;  2WFC A;  1GNE A;  2K6V A;  5F0G A;  5IMA A;  2PWJ A;  4IEL A;  3HY2 A;  2PPT A;  8GSS A;  5ID2 A;  1WPI A;  5AN1 A;  2C4J A;  1G6W A;  5ECQ B;  3RHB A;  4N0V A;  3G9B A;  3SWL A;  2H76 A;  3V1W A;  1DE2 A;  4ECB A;  2YV9 A;  2HXK A;  1EP7 A;  1GTB A;  3F9U A;  1XVQ A;  1ERV A;  4BL7 B;  4MAB A;  2C3Q A;  2O85 A;  5GZZ B;  4MJA A;  4IS0 A;  3RPP A;  3A5W A;  1R7H A;  2FWG A;  1G7E A;  1WE0 A;  3UAR A;  4MH3 A;  2ON7 A;  4O5R A;  4ZB8 A;  2WS2 A;  1KNG A;  4D73 A;  4GRF A;  4HU9 A;  3HZ8 A;  4FYB A;  3JCM L;  3TKS E;  4Q5R A;  2HQT A;  2RM6 A;  1GSU A;  4GSN A;  1T8E B;  5JCU A;  1N2A A;  1AQV A;  3C1R A;  1J0F A;  1EOG A;  4CHS A;  2OE0 A;  3HZ4 A;  3TJJ A;  2DLX A;  1YJ6 A;  4O7H A;  3C73 A;  1O85 A;  4OO4 A;  3ZRD A;  1SK1 A;  4TW5 A;  3W8S A;  2DIY A;  2GZY A;  5D9V A;  1ON4 A;  2YN1 A;  1RQM A;  5A4W A;  1FAA A;  4MLY A;  3L9S A;  4ZXG A;  4K6X A;  2CX4 A;  2ALB A;  1IYI A;  5F06 A;  1A2J A;  4BWQ A;  1TK5 B;  2FNO A;  2I1U A;  1UA5 A;  2EIO A;  5D8I A;  2WCI A;  5ECO B;  1TI1 A;  5B6N A;  1M99 A;  1FHE A;  1X0R A;  5GST A;  1WP0 A;  5DJL A;  2I4A A;  2GTU A;  2PU9 C;  3GIX A;  1M2D A;  3GSS A;  2C0E A;  2YWN A;  2R5G A;  1ERT A;  3H8Q A;  2N5B A;  5J9B A;  4POB A;  5ECP B;  2L6C A;  2XHF A;  3Q74 A;  3GA4 A;  2H66 A;  2C1Y A;  2LUS A;  1TXX A;  4ACS A;  2GT6 A;  1SL2 B;  3MAK A;  4PUR A;  4USS A;  3CMI A;  4G0K A;  2RII A;  4GQC A;  3HVX A;  2C0G A;  2H6X A;  2VCT A;  3GX0 A;  3F6F A;  1H4O A;  4PTS A;  2C8U A;  2IMK A;  2AV4 A;  4F03 A;  2PBJ A;  1M9B A;  4DSS A;  2YZH A;  3F4S A;  1OC3 A;  3EE2 A;  2LS5 A;  2E2M A;  2PER A;  1NHY A;  1ACV A;  3RHC A;  2DJ2 A;  2H70 A;  3DIE A;  1BX9 A;  4KX4 A;  4MDC A;  4O92 A;  3TUE A;  2IIY A;  1T3B A;  1GP1 A;  3VI5 A;  3TCO A;  2WDU A;  2DIZ A;  4YAP A;  5B7C A;  4ZIL A;  3UIW A;  3A2X A;  3DVW A;  1U3I A;  3GX8 A;  1GSS A;  1Z9H A;  3L9V A;  1BG5 A;  4ZBD A;  1BED A;  5IPG A;  4MJE A;  3TJB A;  3IHQ A;  1K0M A;  1LBK A;  4AJ6 A;  3QAV A;  3A2W A;  3BD2 A;  2BJX A;  4G9H A;  3E9J B;  1OC9 A;  3QD9 A;  4KUN A;  1CQH A;  1GWC A;  1JZO A;  2F9S A;  2C0D A;  3QOU A;  4JE1 A;  5JCW A;  4ZB9 A;  1VRS D;  5J41 A;  3D4M A;  1PX7 A;  4QQ7 A;  1ZCP A;  4ZL7 A;  5H5R A;  2LJR A;  5KN3 A;  2YZU A;  1AAZ A;  3GNJ A;  2VCZ A;  3E3E A;  3ME7 A;  2K18 A;  1ZL9 A;  4BVX A;  3DEX A;  5HR2 A;  4F0C A;  3HD5 A;  4LL1 B;  1RK4 A;  3QAW A;  3FRC A;  1H75 A;  4ZBB A;  3UMA A;  4K0N A;  3APQ A;  3TOT A;  2HFD A;  4GF0 A;  5G30 A;  1Z5Y E;  2OAC A;  2C0F A;  4NWY A;  2L57 A;  2QC7 A;  1URM A;  1PD2 1;  4RI6 A;  3TJF A;  3VWU A;  4K7I A;  5J3R A;  4L5L A;  3LYP A;  1UN2 A;  1ZYE A;  1IYH A;  2WRT A;  1THO A;  1OYJ A;  2J9H A;  5A5K A;  1FW1 A;  2NDO A;  6GSS A;  4FYC A;  1XFL A;  4XTS A;  4OFT A;  4EF0 A;  3M0F A;  3CXG A;  3G7Y A;  4IP1 A;  4KAE A;  2MZC A;  1ERU A;  3LJR A;  3ISO A;  4BVY B;  3R2Q A;  1XWB A;  3KIJ A;  4HOJ A;  2YAN A;  4G10 A;  1GUL A;  3M1G A;  3C1S A;  5CNW A;  4J2F A;  2YWM A;  4PQ1 A;  2B5Y A;  4XS4 B;  5IMF A;  3TKP A;  4EC0 A;  2P5Q A;  4GTU A;  1EEM A;  2IFQ A;  4RUV A;  4NHW A;  1XWK A;  3P90 A;  5IPH A;  5ENU A;  2VCX A;  1ZGN A;  3QFB C;  4HQZ A;  3L9U A;  3D4T A;  3RAZ A;  1THX A;  4NV5 A;  4NV2 A;  1A8Y A;  4I5Q A;  2OBI A;  2F8F A;  2I81 A;  3BBY A;  3KGK A;  3C8E A;  3GHA A;  2VUP A;  3IA1 A;  2RUF A;  5JCG A;  1XWG A;  3O6T A;  2GGT A;  3J7Y b;  2DC5 A;  2HSM B;  4K1F A;  4YQM A;  4YQV A;  3DVX A;  2JSY A;  1WIK A;  3WGD A;  5DDL A;  3G7J A;  4K9Z A;  3LYK A;  1AUC A;  2K8V A;  1YF0 A;  1PRX A;  2H0G A;  3EMP A;  3ZVJ A;  2VM1 A;  4V2N A;  1MTC A;  2VLT A;  5G2Z A;  3TKS C;  3GL5 A;  1SU9 A;  3F3Q A;  4V1A p;  3W8J A;  4Q5F A;  1JHB A;  4DEJ A;  1K0B A;  4F0B A;  4L0W A;  5INY A;  2HRF A;  3HJP A;  2FWF A;  3FW2 A;  5COH A;  2WJU A;  1S3C A;  3UAP A;  1V98 A;  19GS A;  3UVT A;  2DJJ A;  1FOV A;  1DUG A;  3K8N A;  1ML6 A;  4KF9 A;  2GQL A;  2M80 A;  3UVH A;  3TRX A;  1YQ1 A;  2JAD A;  3LXT A;  5LD0 A;  4YH2 A;  1XZO A;  2P31 A;  5HR1 A;  1Z3E A;  4V1A g;  5JWQ B;  5LNK e;  4NAX A;  2L5L A;  4L8E A;  1XCC A;  2AB6 A;  3I6A A;  4V2M A;  2HRK B;  1FVJ A;  2HRN A;  4EDY A;  6GSW A;  3LFL A;  4K8M A;  3CRT A;  3ED3 A;  4HU7 A;  3ZIT A;  5CRW A;  1SYX A;  2XPD A;  5L71 A;  1G7O A;  1FVK A;  4EXJ A;  2RUE A;  2XPE A;  1BQ7 A;  2M72 A;  4NMU A;  3KH9 A;  1SK2 A;  3KD0 A;  5HFI A;  3KXO A;  4ZBA A;  2LNT A;  2JZS A;  4LA1 A;  4KDU A;  5IO0 A;  2O87 A;  4KSO A;  2HLS A;  13GS A;  2GSQ A;  20GS A;  2OA7 A;  5ECL B;  4LLR A;  1GH2 A;  2B1K A;  2GSR A;  2TIR A;  1O81 A;  3I9V 2;  3HA9 A;  1MEK A;  1TOF A;  1VF3 A;  1K0O A;  3UBK A;  2ZNM A;  4KDY A;  5CRG A;  5DQS A;  2C80 A;  3ZML A;  2REM A;  4E8E A;  2WGR A;  3F0I A;  2VAF A;  3KZQ A;  1O8W A;  2LJK A;  5HR3 A;  2VIM A;  2HYX A;  4JU5 A;  2JSZ A;  1V9W A;  1GTI A;  5HFK A;  2RM5 A;  1B48 A;  2B1L A;  2X8C A;  2MYG A;  4E8H A;  3GKX A;  1UC7 A;  2HSH A;  1LU4 A;  2FA4 A;  3BCI A;  1QFN A;  2LTK A;  1JZW A;  2IFQ B;  5KN0 A;  3F8U A;  3VPT A;  3HJO A;  3D22 A;  2VCV A;  2VO4 A;  4FIW A;  3TKQ A;  3ZIJ A;  4G0I A;  2FHE A;  1SK0 A;  2NVL A;  1A0R P;  5C04 A;  4Q5N A;  4OCE A;  4MJB A;  2CVB A;  2YOI A;  2IWT A;  2X8H A;  2VL2 C;  2CQ9 A;  1HQO A;  4BVY A;  1SD8 A;  3J7Y k;  3U6V A;  4GQF A;  3TJG A;  2VCQ A;  2DSA A;  1Z7P A;  3QCP A;  1F2E A;  2MBS A;  3HKR A;  2QSI A;  4MJC A;  3IPZ A;  3I69 A;  2KP1 A;  2QGV A;  4TKY A;  1PA3 A;  2HT9 A;  3EU3 A;  3RPN A;  2P0G A;  2CV4 A;  2MMZ A;  1WOU A;  4XS4 A;  3WGX A;  1T7P B;  3DRN A;  2YP6 A;  2E0Q A;  4IBP A;  2F3M A;  4MMM A;  4CW9 A;  3IAS 2;  4KE3 A;  3D5J A;  4POK A;  2VD0 A;  4WF4 A;  1AIU A;  4F2I A;  4IHU A;  3AY8 A;  7GSS A;  4KSM A;  2GQM A;  4HEA 2;  1XBS A;  3SBC A;  3KP8 A;  1XIY A;  2GSS A;  4AJ7 A;  3H1N A;  5CP1 A;  5HR0 A;  2HNL A;  2IMD A;  3GH6 A;  2CVK A;  3QMX A;  1X9W B;  4MF6 A;  4PXO A;  4TR1 B;  3VUR A;  2HSM A;  4TR4 A;  2LRT A;  4IJI A;  2O89 A;  3F6D A;  2B7K A;  5BMU A;  2OE1 A;  2O8V B;  1RW1 A;  3LOR A;  2OE3 A;  2LV3 A;  2ZCT A;  1S3A A;  1TRV A;  1KTE A;  5ECR B;  5JWO B;  2ZUP A;  1AC1 A;  3KH7 A;  4EE0 A;  3ZMK A;  3IOS A;  1BAY A;  3HVS A;  3WYW A;  1GSF A;  3ERF A;  1TKD B;  1ZMA A;  1TU8 A;  3VPQ A;  4G0L A;  3ZLP A;  4XS6 A;  2OKA A;  4YQU A;  2RLI A;  2O7K A;  2VD1 A;  3RBT A;  1A0F A;  5CRD A;  4MZB A;  1DSB A;  1X5D A;  5ECI B;  3ZRE A;  1OE7 A;  2PUK C;  1VF2 A;  2C3N A;  4WEY A;  1OVN A;  1JLW A;  1W89 A;  3HHV A;  3CTF A;  1QMV A;  4N30 A;  4Z7X A;  5DCG A;  2CZ2 A;  4OO5 A;  4I2U A;  2YWO A;  1JFU A;  4HZ2 A;  4KA0 A;  3C71 A;  4WET A;  5G5E A;  2P5R A;  5IOW A;  3P7X A;  3VFI A;  3GN3 A;  2HRK A;  2YV7 A;  2GS3 A;  3O76 A;  3MNG A;  1GSE A;  1OAZ A;  1WWJ A;  4G19 A;  4EUY A;  3EIN A;  4LMW A;  5DAK A;  2J23 A;  2IMI A;  2R2J A;  1V58 A;  2L59 A;  4FO5 A;  4KCE A;  1K0N A;  2VM2 A;  2H19 A;  2H72 A;  3KP9 A;  1K0D A;  1B9Y C;  1ZYQ B;  4P3Y B;  3IBH A;  1K3L A;  1U6T A;  4GSS A;  3H93 A;  3L4N A;  2YJ7 A;  2FWE A;  5F05 A;  3GKM A;  1O73 A;  2FGX A;  12GS A;  2N5F A;  1QGV A;  3Q19 A;  2B5X A;  1TDI A;  2HZF A;  3GUS A;  4OFN A;  4EDZ A;  1VF1 A;  1HNB A;  1F6M C;  1E2Y A;  5AIS A;  3M9K A;  1X9S B;  3CSJ A;  5DQY A;  4KH7 A;  1K0C A;  5D73 A;  1BJX A;  2GZP A;  6GSU A;  1B4P A;  2D2Z A;  2L4Q A;  3VWV A;  4RQR A;  3FZ5 A;  3F4R A;  3KM6 A;  3WGE A;  1CQG A;  1SYR A;  1EV9 A;  5ELA A;  2R37 A;  2GVP A;  3KMO A;  4WXT A;  2Z9S A;  5D9W A;  4AGS A;  2B6M A;  2GLR A;  3CRU A;  2AHE A;  1MD3 A;  4HI7 A;  5ECN B;  3EC3 A;  3EVI A;  5IMV A;  4AF2 A;  4L0U A;  2CX3 A;  4MZC A;  2MMA A;  5ABR A;  2EC4 A;  1GL8 A;  1B4Q A;  1EV4 A;  4J57 E;  3EUR A;  3F3R A;  3A2V A;  1KBN A;  3DGQ A;  2GQK A;  2H75 A;  1TK8 B;  2HZE B;  2IMF A;  1N8J A;  3HXS A;  5B6M A;  3KJY A;  3VWX A;  4ILF A;  4KND A;  9GSS A;  1ZOF A;  1E6B A;  2YCD A;  1ERW A;  2MBT A;  4N0Z A;  1DBY A;  1SJI A;  4IQ1 A;  4OCF A;  1EP8 A;  1M7T A;  5EY6 A;  4JED A;  5GSS A;  4ML6 A;  2A2S A;  3EMX A;  1R5P A;  4N11 A;  1OKD A;  1T1V A;  2V32 A;  5CRH A;  4G2E A;  4DSR A;  4N10 A;  2N5A A;  4EO3 A;  1SJZ A;  3P2A A;  1T00 A;  1JZR A;  3ZTL A;  5DVB A;  4PUA A;  3WD6 A;  3FZ4 A;  1GUM A;  5F07 A;  1M2B A;  1SEN A;  1PN9 A;  2LRC A;  1LJR A;  1O7U A;  2H01 A;  4J56 E;  3VLN A;  3QPM A;  1PQN A;  2H74 A;  1DE1 A;  3ERW A;  1U87 A;  4EVM A;  1B9X C;  1SL1 B;  1SKW B;  3KMN A;  1Z6M A;  2ON5 A;  2PGT A;  3O3T A;  5D96 A;  5G1L A;  3BCK A;  2H71 A;  1Q4J A;  3GTU B;  4L5O A;  2I3Y A;  3ZVJ D;  2V6K A;  4JZQ A;  4F9Z A;  4TR1 A;  5LCZ A;  2V1M A;  2IME A;  5H5S A;  3IK7 A;  1GNW A;  1A2M A;  2R4V A;  3FK8 A;  3FYG A;  2DJK A;  3KCM A;  1GUK A;  1EWX A;  2PN8 A;  2R6K A;  3Q6O A;  1NW2 A;  4PGT A;  3ZL5 A;  2LEG A;  4PNF A;  3QR6 A;  2EIR A;  2XC2 A;  1EGR A;  3UBL A;  3PGT A;  5DAK B;  5H5Q A;  4MZW A;  4XRD A;  5FHI A;  4JR6 A;  3MDK A;  2R3X A;  2LST A;  4KB3 A;  5HFG A;  3TKS A;  1HD2 A;  3IK9 A;  4TXO B;  3CTG A;  1AW9 A;  3IE3 A;  1FB6 A;  3IDV A;  3QDN A;  5AIX A;  4ML1 A;  5A4V A;  1YKC A;  3LSZ A;  4DVC A;  3ERG A;  5CRE A;  4H86 A;  2MMO A;  1O8X A;  1S3D A;  2JZR A;  4OWY A;  4POL A;  1YEP A;  2VLU A;  4POM A;  1MDJ A;  3RDW A;  2YNX A;  2C3T A;  3M8N A;  4ZB6 A;  5AGY A;  2H1B A;  4XS1 A;  5KEJ A;  1O6J A;  4K7O A;  1GTA A;  2DJ3 A; 
#chains in the Genus database with same CATH topology
 2G2Q A;  3CBU A;  1MD4 A;  6GSY A;  4BA7 A;  3US3 A;  1BYE A;  3TOU A;  3HCZ A;  2VL9 A;  5E59 A;  1TJD A;  4HS1 A;  2VOC A;  3M3M A;  5IMC A;  4KCA A;  5HQP A;  1JLV A;  22GS A;  3FY7 A;  1TRU A;  1NM3 A;  2PVQ A;  1JZD A;  1WJK A;  1ABA A;  1G6Y A;  4K2D A;  5ECH B;  1GUH A;  2V2G A;  3LG6 A;  2FY6 A;  3DWV A;  4K7N A;  2L5O A;  2KOK A;  1I9D A;  3GYK A;  1PGT A;  3N9J A;  2GT5 A;  3M9J A;  2L4C A;  5D93 A;  1AXD A;  3U5R E;  1Z6N A;  5IM9 A;  1SD9 A;  3A3T A;  3BOA A;  4PNG A;  1AQX A;  3ZFL A;  3P8W A;  5A1N B;  2BTO T;  1PX6 A;  4TR0 A;  2K8S A;  2NPB A;  2WB9 A;  4IW9 A;  1J08 A;  3E0U A;  1SVL A;  1WRY A;  3FHK A;  2E2G A;  1T4Z A;  5F8B A;  4CY8 A;  4FH8 A;  2AAW A;  1HNA A;  1F3A A;  2WVX A;  4IN0 A;  4IJ3 A;  4ECI A;  1QXH A;  3F4T A;  3FEU A;  1A24 A;  5D9T A;  1ZZY A;  3CYN A;  3CSI A;  5IO2 A;  3D6I A;  2FD3 A;  2H73 A;  1T4Y A;  1PKW A;  2OAD A;  1KEB A;  5ELG A;  5FT3 A;  3UL3 A;  2F8A A;  4ID0 A;  2FUG 2;  4ZL9 A;  1K0A A;  2WZS A;  2F51 A;  2H0I A;  4X0X A;  2KUC A;  3KTB A;  5IMD A;  2HZE A;  3GKK A;  1TTZ A;  2HE3 A;  1W4V A;  4K0G A;  1OE8 A;  3QFA C;  2GST A;  3LXZ A;  2O3E A;  1EGO A;  1EZK A;  2HSN B;  5J5N A;  4V2L A;  5KOW A;  1J9B A;  4KW6 A;  11GS A;  2DJ0 A;  3DML A;  1C72 A;  3GKN A;  1PSQ A;  4HZ4 A;  4Q5Q A;  5D9X A;  3WT1 A;  4TRX A;  3IC4 A;  1TRW A;  3IR4 A;  1YF1 A;  4BWS A;  3IHG A;  1XW6 A;  3NOF A;  5G5F A;  2VL2 A;  3LEF A;  4ISD A;  2LQQ A;  4BPY A;  2AJQ B;  1SJ6 A;  5IMZ A;  5A5H B;  2LJA A;  1FG4 A;  5A34 B;  1PMT A;  4WR4 A;  4JR4 A;  2VLV A;  3S9F A;  2IL3 A;  4AKX B;  2FCH A;  1R5A A;  4XIH A;  2GDR A;  5E4W A;  1YZX A;  2K9F A;  1GSQ A;  1A23 A;  3DXB A;  1I5G A;  2H1A A;  2LKU A;  2DKH A;  3DYR A;  1V2A A;  2FWH A;  3TB2 A;  2DBC A;  1TP9 A;  3NZN A;  3IV4 A;  4I8B A;  2VL3 A;  3KEB A;  2WZ9 A;  3UOM A;  4O32 A;  4I97 A;  1A2L A;  2YWI A;  1YEX A;  2AUV A;  4MPG A;  4DSQ A;  1S3R A;  3R3E A;  3GTU A;  1B8X A;  2R0P A;  1ST9 A;  3D0Z A;  3DD3 A;  1GLQ A;  1NHO A;  2G0F A;  1HYU A;  3ME8 A;  4ULX A;  1PL1 A;  2L6D A;  2IPA A;  3FR6 A;  2H6Z A;  1Y1U A;  2H1D A;  5EVO A;  4MP4 A;  3WT2 A;  2PMT A;  5ECK B;  3HDC A;  3RGB C;  2YJH A;  2H30 A;  4WBR D;  17GS A;  2KLX A;  3HYP A;  2YPM A;  3NIV A;  1X5E A;  5CYY A;  3VWW A;  5AIV A;  4ECC A;  3MWH A;  4KGI A;  18GS A;  3C7M A;  3OR5 A;  2HSY A;  2IN3 A;  2H1G A;  2PVO C;  4TXO A;  4QL7 A;  1TW9 A;  3A5I A;  2CT6 A;  3CSH A;  3F63 A;  3VI7 A;  3D21 A;  5GAN D;  3TDG A;  2TRC P;  1A8L A;  1PL2 A;  1NSW A;  3EWL A;  2XBQ A;  5B8B A;  2KHP A;  2DMM A;  3H79 A;  4TVE A;  3N5O A;  3PH9 A;  4FQU A;  4GCI A;  6GST A;  1YDK A;  3IC8 A;  4PQI A;  4WBJ A;  1X9M B;  5ID2 B;  4HJM A;  1TXU A;  4NHZ A;  1GLP A;  1YY7 A;  2GZZ A;  2NBS A;  2FLS A;  1Y6E A;  5DBQ A;  5G31 A;  5DAL A;  3FR9 A;  1USB A;  3W6G A;  1GSY A;  1M0U A;  5IQY A;  1M9A A;  4WF5 A;  4MPF A;  2NTO A;  3L0H A;  1QQ2 A;  1WMJ A;  4IQA A;  1XOB A;  3IXR A;  1U3A A;  4XHM A;  1TK0 B;  3UJ1 A;  4D73 B;  2JAC A;  1XW5 A;  2JZT A;  1V57 A;  2V41 A;  2I9H A;  3FR3 A;  1XVW A;  3Q18 A;  3FZ9 A;  5B8A A;  4IVF A;  4X1U A;  2H8L A;  4O5Q A;  3BJ5 A;  2M46 A;  4MH2 A;  3TRQ A;  1EOH A;  4HJ2 A;  2LRN A;  2LQO A;  2XBI A;  3GST A;  1M2A A;  2QA2 A;  3ZYW A;  4GWR A;  2E7P A;  4NXI A;  5A1N A;  4PQH A;  2X8G A;  3APO A;  1XWC A;  3ZFB A;  4NPB A;  4BL7 A;  2LNS A;  2JL4 A;  4OD7 A;  4HQS A;  2DJ1 A;  3KTL A;  10GS A;  4EL1 A;  2X99 A;  4MK3 A;  1R4W A;  1TU7 A;  1F3B A;  1XW9 A;  4FYU A;  5BRT A;  1MDI A;  5GAP D;  5CO3 A;  4ZL8 A;  2VCW A;  4WR5 A;  2A4V A;  3GMF A;  3ZZX A;  5IOX A;  3EU4 A;  1Y25 A;  3EYT A;  3GUR A;  1UVZ A;  1VGL A;  3ZIV A;  1SKR B;  3PPU A;  1Q98 A;  1GTU A;  1XPV A;  4MCU A;  1GSD A;  4ICY A;  4QL9 A;  1QUW A;  2OBK A;  2OJL A;  3DKS A;  3TKR A;  1XXU A;  4EKZ A;  4I6X A;  2FA8 A;  4BIK A;  1U88 A;  3IAM 2;  2CVD A;  5EPF A;  4IKH A;  1PKZ A;  3HVV A;  2TRX A;  4I2T A;  3LGC A;  1HNC A;  1V40 A;  3GL3 A;  3FKF A;  2ES7 A;  16GS A;  5EL8 A;  1K3Y A;  5A4U A;  4F82 A;  1X5C A;  3UEM A;  4DSS B;  4WKW A;  4OMV A;  3L78 A;  4MA9 A;  1OKT A;  4HUA A;  4PUF C;  2DML A;  2UZ8 A;  4OFM A;  3HJM A;  3TJK A;  1TI3 A;  3IRA A;  2WUL A;  4JRR A;  1FO5 A;  2AYT A;  4GST A;  1GRX A;  1SKS B;  5KN1 A;  4XRA A;  5KN2 A;  5A34 A;  2JU5 A;  1R26 A;  1SL0 B;  4ZIJ A;  2B3S A;  2O36 A;  4TOP A;  4CDO A;  2QKE A;  4IP6 A;  1Z7R A;  3FZA A;  4RQX A;  3TRP A;  3VK9 A;  5DCH A;  3LQ7 A;  4YAV A;  2IJY A;  3PR8 A;  2CA8 A;  4LL4 B;  5FWG A;  5CAX A;  4HDE A;  2X64 A;  5ECS A;  1OC9 B;  3GFK A;  4ECJ A;  2V6O A;  1OC8 A;  1G0T A;  1VF4 A;  1YKA A;  4TN8 A;  3GH9 A;  2MMN A;  3G7I A;  3GV1 A;  4GXZ A;  5IIZ A;  3H4K A;  3I43 A;  1F9M A;  3LWA A;  4GLT A;  2A2R A;  4IGJ A;  4PX1 A;  1QK8 A;  5C00 A;  4TR3 A;  4X43 A;  1FB0 A;  1AQW A;  6GSV A;  4MF7 A;  4BVX B;  2H6Y A;  2HRA A;  4XCS A;  1XWA A;  2WW1 A;  2CZ3 A;  4LMV A;  4RI7 A;  1M3I A;  3PIN A;  4TXV A;  5G1K A;  5DAL B;  1XOA A;  5J4U A;  2BMX A;  2B7J A;  1EEJ A;  3GRX A;  2CAQ A;  4KDX A;  2CAI A;  5J9C A;  4MF5 A;  2HI7 A;  2KP2 A;  3APS A;  5ECM B;  3TGZ A;  5JWR B;  1ILO A;  6GSX A;  1MDK A;  1K3O A;  4JBB A;  3CWG A;  1F37 A;  5DJM A;  3MSZ A;  3QAG A;  2H0H A;  14GS A;  2B5E A;  2EIQ A;  4AJ8 A;  1TRS A;  2WFC A;  1GNE A;  2K6V A;  5F0G A;  5IMA A;  2PWJ A;  4IEL A;  3CHX C;  3HY2 A;  2PPT A;  8GSS A;  5ID2 A;  1WPI A;  5AN1 A;  2C4J A;  1G6W A;  5ECQ B;  3RHB A;  4N0V A;  3G9B A;  3SWL A;  2H76 A;  3V1W A;  1DE2 A;  4ECB A;  2YV9 A;  2HXK A;  1EP7 A;  1GTB A;  3F9U A;  4AKG A;  1XVQ A;  1ERV A;  4BL7 B;  1YVL A;  4MAB A;  2C3Q A;  1FOH A;  5GZZ B;  2O85 A;  4MJA A;  4IS0 A;  3RPP A;  3A5W A;  1R7H A;  2FWG A;  1G7E A;  1WE0 A;  3UAR A;  4MH3 A;  2ON7 A;  4O5R A;  4ZB8 A;  2WS2 A;  1KNG A;  4D73 A;  4GRF A;  4HU9 A;  3HZ8 A;  4FYB A;  3JCM L;  3TKS E;  4Q5R A;  2HQT A;  2RM6 A;  1GSU A;  4GSN A;  1T8E B;  5JCU A;  1N2A A;  1AQV A;  3C1R A;  1J0F A;  1EOG A;  4CHS A;  5J4Y A;  2OE0 A;  3HZ4 A;  3TJJ A;  2DLX A;  1YJ6 A;  4O7H A;  3C73 A;  1O85 A;  4OO4 A;  3ZRD A;  1SK1 A;  4TW5 A;  3W8S A;  2DIY A;  2GZY A;  5D9V A;  1ON4 A;  2YN1 A;  1RQM A;  5A4W A;  1FAA A;  4MLY A;  3L9S A;  4ZXG A;  4K6X A;  2CX4 A;  2ALB A;  1IYI A;  5F06 A;  1A2J A;  4BWQ A;  1TK5 B;  2FNO A;  2I1U A;  1UA5 A;  2EIO A;  1ZYP A;  5D8I A;  2WCI A;  5ECO B;  1TI1 A;  5B6N A;  1M99 A;  1FHE A;  1PN0 A;  1X0R A;  5GST A;  1WP0 A;  5DJL A;  2I4A A;  2GTU A;  2PU9 C;  3GIX A;  1M2D A;  3GSS A;  2C0E A;  2YWN A;  2R5G A;  1ERT A;  3H8Q A;  2N5B A;  2H1L A;  1M3J A;  5J9B A;  4POB A;  5ECP B;  2L6C A;  2XHF A;  3Q74 A;  3GA4 A;  2H66 A;  2C1Y A;  2LUS A;  1TXX A;  4ACS A;  2GT6 A;  1SL2 B;  3MAK A;  4PUR A;  3HVN A;  4USS A;  3CMI A;  2X4A A;  4G0K A;  2RII A;  4GQC A;  3HVX A;  2C0G A;  2H6X A;  2VCT A;  3GX0 A;  3F6F A;  1H4O A;  4G01 A;  4PTS A;  2C8U A;  2IMK A;  2AV4 A;  4F03 A;  2EFH A;  2PBJ A;  1M9B A;  4DSS A;  2YZH A;  3F4S A;  1OC3 A;  3EE2 A;  2LS5 A;  2E2M A;  2PER A;  1NHY A;  1ACV A;  3RHC A;  2DJ2 A;  2H70 A;  3DIE A;  1BX9 A;  4KX4 A;  4MDC A;  4O92 A;  3TUE A;  2IIY A;  2WVZ A;  4PI0 C;  1GP1 A;  1T3B A;  3VI5 A;  3MYD A;  3TCO A;  2WDU A;  2DIZ A;  4YAP A;  5B7C A;  4ZIL A;  3UIW A;  3A2X A;  2A2P A;  3DVW A;  1U3I A;  3GX8 A;  1GSS A;  1Z9H A;  1YEW C;  3L9V A;  1BG5 A;  4ZBD A;  1BED A;  5IPG A;  4MJE A;  3TJB A;  3IHQ A;  1K0M A;  1LBK A;  4AJ6 A;  3QAV A;  3A2W A;  3BD2 A;  2BJX A;  4G9H A;  3E9J B;  1OC9 A;  3QD9 A;  4KUN A;  1CQH A;  1GWC A;  1JZO A;  2F9S A;  2C0D A;  3QOU A;  4JE1 A;  5JCW A;  4ZB9 A;  1VRS D;  5J41 A;  3D4M A;  1PX7 A;  4QQ7 A;  1ZCP A;  4ZL7 A;  5H5R A;  2LJR A;  5KN3 A;  2YZU A;  1AAZ A;  3GNJ A;  4EIP A;  2VCZ A;  3E3E A;  3ME7 A;  2K18 A;  1ZL9 A;  2R0C A;  4BVX A;  3DEX A;  5HR2 A;  4F0C A;  3HD5 A;  4LL1 B;  1RK4 A;  3QAW A;  3FRC A;  1H75 A;  4ZBB A;  4K5S A;  3UMA A;  4K0N A;  3APQ A;  3TOT A;  2HFD A;  4GF0 A;  5G30 A;  1Z5Y E;  2OAC A;  2C0F A;  4NWY A;  2L57 A;  2QC7 A;  2EFE A;  1URM A;  1PD2 1;  4RI6 A;  3TJF A;  3VWU A;  4K7I A;  5J3R A;  4L5L A;  3LYP A;  1UN2 A;  1ZYE A;  1IYH A;  2WRT A;  1THO A;  1OYJ A;  2J9H A;  5A5K A;  1FW1 A;  2NDO A;  6GSS A;  4FYC A;  1XFL A;  4XTS A;  4OFT A;  4EF0 A;  4E68 A;  3M0F A;  5J4V A;  3CXG A;  3G7Y A;  4IP1 A;  4QMK A;  4KAE A;  2MZC A;  1ERU A;  3LJR A;  2VKZ G;  3ISO A;  4BVY B;  3R2Q A;  1XWB A;  3KIJ A;  4HOJ A;  2YAN A;  4G10 A;  1GUL A;  3M1G A;  3C1S A;  5CNW A;  4J2F A;  2YWM A;  4PQ1 A;  2B5Y A;  4XS4 B;  5IMF A;  3TKP A;  4EC0 A;  2P5Q A;  4GTU A;  1EEM A;  2IFQ A;  4RUV A;  4NHW A;  1XWK A;  3P90 A;  5IPH A;  5ENU A;  2VCX A;  1ZGN A;  3QFB C;  5J47 A;  4HQZ A;  3L9U A;  3D4T A;  3RAZ A;  1THX A;  5KOX A;  4NV5 A;  4NV2 A;  1A8Y A;  4I5Q A;  4O5U A;  2OBI A;  2F8F A;  2I81 A;  3BBY A;  3KGK A;  3C8E A;  2WW0 A;  3GHA A;  2VUP A;  3IA1 A;  2RUF A;  5JCG A;  1XWG A;  3O6T A;  2GGT A;  3J7Y b;  2DC5 A;  2HSM B;  4K1F A;  4YQM A;  4YQV A;  3DVX A;  2JSY A;  1WIK A;  3WGD A;  5DDL A;  5BMU B;  3G7J A;  3HMJ G;  2OT3 A;  4K9Z A;  3LYK A;  1AUC A;  2K8V A;  1YF0 A;  1PRX A;  2H0G A;  3EMP A;  3ZVJ A;  2VM1 A;  4V2N A;  1MTC A;  2VLT A;  5G2Z A;  3TKS C;  3GL5 A;  4A5P A;  1SU9 A;  3F3Q A;  4V1A p;  3W8J A;  4Q5F A;  1JHB A;  4DEJ A;  1K0B A;  4F0B A;  4L0W A;  5INY A;  4PI2 C;  2HRF A;  3HJP A;  2FWF A;  3FW2 A;  5COH A;  2WJU A;  1S3C A;  3UAP A;  1V98 A;  19GS A;  3UVT A;  2DJJ A;  5J40 A;  1FOV A;  1DUG A;  3K8N A;  1ML6 A;  4KF9 A;  2GQL A;  2M80 A;  3UVH A;  3TRX A;  1YQ1 A;  2JAD A;  3LXT A;  2WVY A;  4YH2 A;  5LD0 A;  1XZO A;  2P31 A;  5HR1 A;  1Z3E A;  4V1A g;  5JWQ B;  5LNK e;  4NAX A;  2L5L A;  4L8E A;  1XCC A;  3MIX A;  2AB6 A;  4FXY P;  3I6A A;  4V2M A;  2HRK B;  1FVJ A;  2HRN A;  4EDY A;  6GSW A;  3LFL A;  4K8M A;  3CRT A;  3ED3 A;  4HU7 A;  3ZIT A;  5CRW A;  1SYX A;  3TU3 B;  2XPD A;  5L71 A;  1G7O A;  1FVK A;  4EXJ A;  2RUE A;  2XPE A;  1BQ7 A;  2M72 A;  4NMU A;  3KH9 A;  1N25 A;  1SK2 A;  3KD0 A;  5HFI A;  3KXO A;  4ZBA A;  1PFO A;  3CQF A;  2LNT A;  2JZS A;  4LA1 A;  4KDU A;  5IO0 A;  4YKG A;  2O87 A;  4KSO A;  4AKH A;  13GS A;  2HLS A;  2GSQ A;  4N3Z A;  20GS A;  1S4B P;  2OA7 A;  5ECL B;  4LLR A;  1GH2 A;  2B1K A;  2GSR A;  2TIR A;  1O81 A;  3I9V 2;  3HA9 A;  4W66 A;  4PHZ C;  1MEK A;  1TOF A;  1VF3 A;  1K0O A;  4Z2T A;  3UBK A;  2ZNM A;  4KDY A;  5CRG A;  5DQS A;  2C80 A;  3ZML A;  2REM A;  4E8E A;  2WGR A;  3F0I A;  2VAF A;  3KZQ A;  1O8W A;  1BG1 A;  2LJK A;  5HR3 A;  1ZYN A;  2VIM A;  2HYX A;  4JU5 A;  2JSZ A;  1V9W A;  1GTI A;  5HFK A;  2RM5 A;  1B48 A;  2B1L A;  2X8C A;  2MYG A;  4E8H A;  3GKX A;  1UC7 A;  2HSH A;  1LU4 A;  2FA4 A;  3BCI A;  1QFN A;  4CY6 A;  2LTK A;  1JZW A;  2IFQ B;  5KN0 A;  3F8U A;  3VPT A;  3HJO A;  3D22 A;  2VCV A;  2VO4 A;  4FIW A;  3TKQ A;  3ZIJ A;  4G0I A;  2FHE A;  1SK0 A;  2NVL A;  1A0R P;  5C04 A;  4Q5N A;  4OCE A;  4MJB A;  2CVB A;  2YOI A;  2IWT A;  2X8H A;  2VL2 C;  2CQ9 A;  1HQO A;  4BVY A;  1SD8 A;  3J7Y k;  2O5V A;  3U6V A;  4GQF A;  3TJG A;  2VCQ A;  2DSA A;  1Z7P A;  3QCP A;  1F2E A;  2MBS A;  3HKR A;  2QSI A;  4MJC A;  3IPZ A;  3I69 A;  2KP1 A;  2QGV A;  4TKY A;  1PA3 A;  2HT9 A;  3EU3 A;  3RPN A;  2P0G A;  2CV4 A;  2MMZ A;  1WOU A;  4XS4 A;  3WGX A;  1T7P B;  3DRN A;  2YP6 A;  2E0Q A;  4IBP A;  2F3M A;  4MMM A;  4CW9 A;  3IAS 2;  4KE3 A;  2X49 A;  3D5J A;  4POK A;  2VD0 A;  4WF4 A;  1AIU A;  4F2I A;  4IHU A;  3AY8 A;  2DKI A;  7GSS A;  4KSM A;  2GQM A;  4HEA 2;  1XBS A;  3SBC A;  3KP8 A;  1XIY A;  2GSS A;  4AJ7 A;  3H1N A;  5CP1 A;  5HR0 A;  2HNL A;  2IMD A;  3GH6 A;  2CVK A;  3QMX A;  1X9W B;  4ZB7 A;  4MF6 A;  4PXO A;  4TR1 B;  3VUR A;  2HSM A;  4TR4 A;  2LRT A;  4IJI A;  2O89 A;  1SVM A;  2EFD A;  3F6D A;  2B7K A;  5BMU A;  2OE1 A;  2O8V B;  4K5R A;  1RW1 A;  3LOR A;  2OE3 A;  2LV3 A;  2ZCT A;  1S3A A;  1TRV A;  1KTE A;  5ECR B;  4EIQ A;  5JWO B;  2ZUP A;  1AC1 A;  3KH7 A;  4K2X A;  4EE0 A;  2A4H A;  3ZMK A;  3IOS A;  1BAY A;  3HVS A;  3WYW A;  1GSF A;  3ERF A;  1TKD B;  1ZMA A;  1TU8 A;  3VPQ A;  4G0L A;  3ZLP A;  4XS6 A;  2OKA A;  4YQU A;  2RLI A;  2O7K A;  2VD1 A;  3RBT A;  1A0F A;  4AKI A;  5CRD A;  4MZB A;  4Z2U A;  1DSB A;  1X5D A;  5ECI B;  3ZRE A;  1OE7 A;  2PUK C;  1VF2 A;  2C3N A;  4WEY A;  1OVN A;  1JLW A;  1W89 A;  3HHV A;  3CTF A;  1QMV A;  2QA1 A;  4N30 A;  4Z7X A;  5DCG A;  2CZ2 A;  2R0G A;  4OO5 A;  4I2U A;  2YWO A;  1JFU A;  4HZ2 A;  4KA0 A;  1I1I P;  3C71 A;  4WET A;  5G5E A;  2P5R A;  5IOW A;  3P7X A;  3VFI A;  1XG8 A;  3GN3 A;  2HRK A;  2YV7 A;  2GS3 A;  3O76 A;  3MNG A;  1GSE A;  1OAZ A;  1WWJ A;  4G19 A;  4EUY A;  3EIN A;  4LMW A;  5DAK A;  2J23 A;  2IMI A;  2R2J A;  1V58 A;  2L59 A;  4FO5 A;  4KCE A;  1K0N A;  2VM2 A;  2H19 A;  2H72 A;  3KP9 A;  1K0D A;  4MNN A;  1B9Y C;  1ZYQ B;  4P3Y B;  3IBH A;  1K3L A;  1U6T A;  4GSS A;  3H93 A;  2WW2 A;  3L4N A;  2YJ7 A;  2FWE A;  5F05 A;  3GKM A;  1O73 A;  2FGX A;  12GS A;  2N5F A;  1QGV A;  3Q19 A;  2B5X A;  1TDI A;  2HZF A;  3GUS A;  4OFN A;  4EDZ A;  1VF1 A;  3RFR C;  1HNB A;  1F6M C;  1E2Y A;  5AIS A;  3M9K A;  1X9S B;  3CSJ A;  5DQY A;  4KH7 A;  1K0C A;  5D73 A;  1BJX A;  2GZP A;  6GSU A;  1BF5 A;  1B4P A;  2D2Z A;  2L4Q A;  3VWV A;  4RQR A;  3FZ5 A;  3F4R A;  3KM6 A;  3WGE A;  1CQG A;  1SYR A;  1EV9 A;  5ELA A;  2R37 A;  2GVP A;  3KMO A;  4WXT A;  2Z9S A;  5D9W A;  4AGS A;  2B6M A;  2GLR A;  3CRU A;  2AHE A;  1MD3 A;  4HI7 A;  2WVX B;  5ECN B;  3EC3 A;  2EFC A;  3EVI A;  5IMV A;  4AF2 A;  4L0U A;  2CX3 A;  4MZC A;  2MMA A;  5ABR A;  2EC4 A;  1GL8 A;  1B4Q A;  1EV4 A;  4J57 E;  3EUR A;  3F3R A;  3A2V A;  1KBN A;  3DGQ A;  2GQK A;  2H75 A;  1TK8 B;  2HZE B;  2IMF A;  1N8J A;  3HXS A;  5B6M A;  3KJY A;  3VWX A;  3LW9 A;  4ILF A;  4KND A;  9GSS A;  1ZOF A;  1E6B A;  2YCD A;  1ERW A;  2MBT A;  2UV8 G;  4N0Z A;  1DBY A;  1SJI A;  4IQ1 A;  4OCF A;  1EP8 A;  1M7T A;  5EY6 A;  4JED A;  5GSS A;  4ML6 A;  2A2S A;  3EMX A;  4Z2R A;  1R5P A;  4N11 A;  1OKD A;  1T1V A;  2V32 A;  5CRH A;  4G2E A;  4DSR A;  4N10 A;  2N5A A;  4EO3 A;  1SJZ A;  3P2A A;  1T00 A;  1JZR A;  3ZTL A;  5DVB A;  4PUA A;  3WD6 A;  3FZ4 A;  1GUM A;  5F07 A;  1M2B A;  1SEN A;  1PN9 A;  2LRC A;  1LJR A;  1O7U A;  2H01 A;  4J56 E;  3VLN A;  3QPM A;  1PQN A;  4GDF A;  2H74 A;  1DE1 A;  3ERW A;  1U87 A;  4EVM A;  1B9X C;  1SL1 B;  1SKW B;  4AI6 A;  3KMN A;  1Z6M A;  2ON5 A;  2PGT A;  2HSN A;  3O3T A;  5D96 A;  5G1L A;  3BCK A;  2H71 A;  1Q4J A;  3GTU B;  4HSC X;  4X4J A;  4L5O A;  2I3Y A;  3ZVJ D;  2V6K A;  4JZQ A;  4F9Z A;  4TR1 A;  5LCZ A;  2V1M A;  2IME A;  5H5S A;  3IK7 A;  1GNW A;  1A2M A;  2R4V A;  3FK8 A;  3FYG A;  2DJK A;  5A5H A;  3KCM A;  1GUK A;  1EWX A;  2PN8 A;  2R6K A;  3Q6O A;  1NW2 A;  4PGT A;  3ZL5 A;  2LEG A;  4PNF A;  3FMW A;  3QR6 A;  2EIR A;  2XC2 A;  1EGR A;  3UBL A;  3PGT A;  5DAK B;  5H5Q A;  4MZW A;  4XRD A;  5FHI A;  4YKF A;  4JR6 A;  3MDK A;  2R3X A;  2LST A;  1SVO A;  4KB3 A;  5HFG A;  3TKS A;  1HD2 A;  3IK9 A;  4TXO B;  2WW3 A;  3CTG A;  1AW9 A;  3IE3 A;  1FB6 A;  3IDV A;  3QDN A;  5AIX A;  4ML1 A;  5A4V A;  1YKC A;  3LSZ A;  4DVC A;  3ERG A;  5CRE A;  4H86 A;  3EPT A;  2MMO A;  1O8X A;  1S3D A;  2JZR A;  4OWY A;  4POL A;  1YEP A;  2VLU A;  4POM A;  1MDJ A;  3RDW A;  2YNX A;  2C3T A;  3M8N A;  4ZB6 A;  5AGY A;  2H1B A;  4XS1 A;  5KEJ A;  1O6J A;  4K7O A;  1GTA A;  2DJ3 A; 
#chains in the Genus database with same CATH homology
 2G2Q A;  3CBU A;  1MD4 A;  6GSY A;  4BA7 A;  3US3 A;  1BYE A;  3TOU A;  3HCZ A;  2VL9 A;  5E59 A;  1TJD A;  4HS1 A;  2VOC A;  3M3M A;  5IMC A;  4KCA A;  5HQP A;  1JLV A;  22GS A;  3FY7 A;  1TRU A;  1NM3 A;  2PVQ A;  1JZD A;  1WJK A;  1ABA A;  1G6Y A;  4K2D A;  5ECH B;  1GUH A;  2V2G A;  3LG6 A;  2FY6 A;  3DWV A;  4K7N A;  2L5O A;  2KOK A;  1I9D A;  3GYK A;  1PGT A;  3N9J A;  2GT5 A;  3M9J A;  2L4C A;  5D93 A;  1AXD A;  3U5R E;  1Z6N A;  5IM9 A;  1SD9 A;  3A3T A;  3BOA A;  4PNG A;  1AQX A;  3ZFL A;  3P8W A;  5A1N B;  2BTO T;  1PX6 A;  4TR0 A;  2K8S A;  2NPB A;  2WB9 A;  4IW9 A;  1J08 A;  3E0U A;  1SVL A;  1WRY A;  3FHK A;  2E2G A;  1T4Z A;  5F8B A;  4CY8 A;  4FH8 A;  2AAW A;  1HNA A;  1F3A A;  4IN0 A;  4IJ3 A;  4ECI A;  1QXH A;  3F4T A;  3FEU A;  1A24 A;  5D9T A;  1ZZY A;  3CYN A;  3CSI A;  5IO2 A;  3D6I A;  2FD3 A;  2H73 A;  1T4Y A;  1PKW A;  2OAD A;  1KEB A;  5ELG A;  5FT3 A;  3UL3 A;  2F8A A;  4ID0 A;  2FUG 2;  4ZL9 A;  1K0A A;  2F51 A;  2H0I A;  4X0X A;  2KUC A;  3KTB A;  5IMD A;  2HZE A;  3GKK A;  1TTZ A;  2HE3 A;  1W4V A;  4K0G A;  1OE8 A;  3QFA C;  2GST A;  3LXZ A;  1EGO A;  1EZK A;  2HSN B;  5J5N A;  4V2L A;  5KOW A;  1J9B A;  4KW6 A;  11GS A;  2DJ0 A;  3DML A;  1C72 A;  3GKN A;  1PSQ A;  4HZ4 A;  4Q5Q A;  5D9X A;  3WT1 A;  4TRX A;  3IC4 A;  1TRW A;  3IR4 A;  1YF1 A;  4BWS A;  3IHG A;  1XW6 A;  3NOF A;  5G5F A;  2VL2 A;  3LEF A;  4ISD A;  2LQQ A;  4BPY A;  2AJQ B;  1SJ6 A;  5IMZ A;  5A5H B;  2LJA A;  1FG4 A;  5A34 B;  1PMT A;  4WR4 A;  4JR4 A;  2VLV A;  3S9F A;  2IL3 A;  4AKX B;  2FCH A;  1R5A A;  4XIH A;  2GDR A;  5E4W A;  1YZX A;  2K9F A;  1GSQ A;  1A23 A;  3DXB A;  1I5G A;  2H1A A;  2LKU A;  2DKH A;  3DYR A;  1V2A A;  2FWH A;  3TB2 A;  2DBC A;  1TP9 A;  3NZN A;  3IV4 A;  4I8B A;  2VL3 A;  3KEB A;  2WZ9 A;  3UOM A;  4O32 A;  4I97 A;  1A2L A;  2YWI A;  1YEX A;  2AUV A;  4MPG A;  4DSQ A;  3R3E A;  3GTU A;  1B8X A;  2R0P A;  1ST9 A;  3D0Z A;  3DD3 A;  1GLQ A;  1NHO A;  2G0F A;  1HYU A;  3ME8 A;  4ULX A;  1PL1 A;  2L6D A;  2IPA A;  3FR6 A;  2H6Z A;  1Y1U A;  2H1D A;  5EVO A;  4MP4 A;  3WT2 A;  2PMT A;  5ECK B;  3HDC A;  2YJH A;  2H30 A;  4WBR D;  17GS A;  2KLX A;  3HYP A;  2YPM A;  3NIV A;  1X5E A;  5CYY A;  3VWW A;  5AIV A;  4ECC A;  3MWH A;  4KGI A;  18GS A;  3C7M A;  3OR5 A;  2HSY A;  2IN3 A;  2H1G A;  2PVO C;  4TXO A;  4QL7 A;  1TW9 A;  3A5I A;  2CT6 A;  3CSH A;  3F63 A;  3VI7 A;  3D21 A;  5GAN D;  3TDG A;  2TRC P;  1A8L A;  1PL2 A;  1NSW A;  3EWL A;  2XBQ A;  5B8B A;  2KHP A;  2DMM A;  3H79 A;  4TVE A;  3N5O A;  3PH9 A;  4FQU A;  4GCI A;  6GST A;  1YDK A;  3IC8 A;  4PQI A;  4WBJ A;  1X9M B;  5ID2 B;  4HJM A;  1TXU A;  4NHZ A;  1GLP A;  1YY7 A;  2GZZ A;  2NBS A;  2FLS A;  1Y6E A;  5DBQ A;  5G31 A;  5DAL A;  3FR9 A;  1USB A;  3W6G A;  1GSY A;  1M0U A;  5IQY A;  1M9A A;  4WF5 A;  4MPF A;  2NTO A;  3L0H A;  1QQ2 A;  1WMJ A;  4IQA A;  1XOB A;  3IXR A;  1U3A A;  4XHM A;  1TK0 B;  3UJ1 A;  4D73 B;  2JAC A;  1XW5 A;  2JZT A;  1V57 A;  2V41 A;  2I9H A;  3FR3 A;  1XVW A;  3Q18 A;  3FZ9 A;  5B8A A;  4IVF A;  4X1U A;  2H8L A;  4O5Q A;  3BJ5 A;  2M46 A;  4MH2 A;  3TRQ A;  1EOH A;  4HJ2 A;  2LRN A;  2LQO A;  2XBI A;  3GST A;  1M2A A;  2QA2 A;  3ZYW A;  4GWR A;  2E7P A;  4NXI A;  5A1N A;  4PQH A;  2X8G A;  3APO A;  1XWC A;  3ZFB A;  4NPB A;  4BL7 A;  2LNS A;  2JL4 A;  4OD7 A;  4HQS A;  2DJ1 A;  3KTL A;  10GS A;  4EL1 A;  2X99 A;  4MK3 A;  1R4W A;  1TU7 A;  1F3B A;  1XW9 A;  4FYU A;  5BRT A;  1MDI A;  5GAP D;  5CO3 A;  4ZL8 A;  2VCW A;  4WR5 A;  2A4V A;  3GMF A;  3ZZX A;  5IOX A;  3EU4 A;  1Y25 A;  3EYT A;  3GUR A;  1UVZ A;  1VGL A;  3ZIV A;  1SKR B;  3PPU A;  1Q98 A;  1GTU A;  1XPV A;  4MCU A;  1GSD A;  4ICY A;  4QL9 A;  1QUW A;  2OBK A;  2OJL A;  3DKS A;  3TKR A;  1XXU A;  4EKZ A;  4I6X A;  2FA8 A;  1U88 A;  3IAM 2;  2CVD A;  5EPF A;  4IKH A;  1PKZ A;  3HVV A;  2TRX A;  4I2T A;  3LGC A;  1HNC A;  1V40 A;  3GL3 A;  3FKF A;  2ES7 A;  16GS A;  5EL8 A;  1K3Y A;  5A4U A;  4F82 A;  1X5C A;  3UEM A;  4DSS B;  4WKW A;  4OMV A;  3L78 A;  4MA9 A;  1OKT A;  4HUA A;  4PUF C;  2DML A;  2UZ8 A;  4OFM A;  3HJM A;  3TJK A;  1TI3 A;  3IRA A;  2WUL A;  4JRR A;  1FO5 A;  2AYT A;  4GST A;  1GRX A;  1SKS B;  5KN1 A;  4XRA A;  5KN2 A;  5A34 A;  2JU5 A;  1R26 A;  1SL0 B;  4ZIJ A;  2B3S A;  4TOP A;  4CDO A;  2QKE A;  4IP6 A;  1Z7R A;  3FZA A;  4RQX A;  3TRP A;  3VK9 A;  5DCH A;  3LQ7 A;  4YAV A;  2IJY A;  3PR8 A;  2CA8 A;  4LL4 B;  5FWG A;  5CAX A;  4HDE A;  2X64 A;  5ECS A;  1OC9 B;  3GFK A;  4ECJ A;  2V6O A;  1OC8 A;  1G0T A;  1VF4 A;  1YKA A;  4TN8 A;  3GH9 A;  2MMN A;  3G7I A;  3GV1 A;  4GXZ A;  5IIZ A;  3H4K A;  3I43 A;  1F9M A;  3LWA A;  4GLT A;  2A2R A;  4IGJ A;  4PX1 A;  1QK8 A;  5C00 A;  4TR3 A;  4X43 A;  1FB0 A;  1AQW A;  6GSV A;  4MF7 A;  4BVX B;  2H6Y A;  2HRA A;  4XCS A;  1XWA A;  2CZ3 A;  4LMV A;  4RI7 A;  3PIN A;  4TXV A;  5G1K A;  5DAL B;  1XOA A;  5J4U A;  2BMX A;  2B7J A;  1EEJ A;  3GRX A;  2CAQ A;  4KDX A;  2CAI A;  5J9C A;  4MF5 A;  2HI7 A;  2KP2 A;  3APS A;  5ECM B;  3TGZ A;  5JWR B;  1ILO A;  6GSX A;  1MDK A;  1K3O A;  4JBB A;  3CWG A;  1F37 A;  5DJM A;  3MSZ A;  3QAG A;  2H0H A;  14GS A;  2B5E A;  2EIQ A;  4AJ8 A;  1TRS A;  2WFC A;  1GNE A;  2K6V A;  5F0G A;  5IMA A;  2PWJ A;  4IEL A;  3HY2 A;  2PPT A;  8GSS A;  5ID2 A;  1WPI A;  5AN1 A;  2C4J A;  1G6W A;  5ECQ B;  3RHB A;  4N0V A;  3G9B A;  3SWL A;  2H76 A;  3V1W A;  1DE2 A;  4ECB A;  2YV9 A;  2HXK A;  1EP7 A;  1GTB A;  3F9U A;  4AKG A;  1XVQ A;  1ERV A;  4BL7 B;  1YVL A;  4MAB A;  2C3Q A;  1FOH A;  5GZZ B;  2O85 A;  4MJA A;  4IS0 A;  3RPP A;  3A5W A;  1R7H A;  2FWG A;  1G7E A;  1WE0 A;  3UAR A;  4MH3 A;  2ON7 A;  4O5R A;  4ZB8 A;  2WS2 A;  1KNG A;  4D73 A;  4GRF A;  4HU9 A;  3HZ8 A;  4FYB A;  3JCM L;  3TKS E;  4Q5R A;  2HQT A;  2RM6 A;  1GSU A;  4GSN A;  1T8E B;  5JCU A;  1N2A A;  1AQV A;  3C1R A;  1J0F A;  1EOG A;  4CHS A;  5J4Y A;  2OE0 A;  3HZ4 A;  3TJJ A;  2DLX A;  1YJ6 A;  4O7H A;  3C73 A;  1O85 A;  4OO4 A;  3ZRD A;  1SK1 A;  4TW5 A;  3W8S A;  2DIY A;  2GZY A;  5D9V A;  1ON4 A;  2YN1 A;  1RQM A;  5A4W A;  1FAA A;  4MLY A;  3L9S A;  4ZXG A;  4K6X A;  2CX4 A;  2ALB A;  1IYI A;  5F06 A;  1A2J A;  4BWQ A;  1TK5 B;  2FNO A;  2I1U A;  1UA5 A;  2EIO A;  1ZYP A;  5D8I A;  2WCI A;  5ECO B;  1TI1 A;  5B6N A;  1M99 A;  1FHE A;  1PN0 A;  1X0R A;  5GST A;  1WP0 A;  5DJL A;  2I4A A;  2GTU A;  2PU9 C;  3GIX A;  1M2D A;  3GSS A;  2C0E A;  2YWN A;  2R5G A;  1ERT A;  3H8Q A;  2N5B A;  2H1L A;  5J9B A;  4POB A;  5ECP B;  2L6C A;  2XHF A;  3Q74 A;  3GA4 A;  2H66 A;  2C1Y A;  2LUS A;  1TXX A;  4ACS A;  2GT6 A;  1SL2 B;  3MAK A;  4PUR A;  4USS A;  3CMI A;  2X4A A;  4G0K A;  2RII A;  4GQC A;  3HVX A;  2C0G A;  2H6X A;  2VCT A;  3GX0 A;  3F6F A;  1H4O A;  4G01 A;  4PTS A;  2C8U A;  2IMK A;  2AV4 A;  4F03 A;  2EFH A;  2PBJ A;  1M9B A;  4DSS A;  2YZH A;  3F4S A;  1OC3 A;  3EE2 A;  2LS5 A;  2E2M A;  2PER A;  1NHY A;  1ACV A;  3RHC A;  2DJ2 A;  2H70 A;  3DIE A;  1BX9 A;  4KX4 A;  4MDC A;  4O92 A;  3TUE A;  2IIY A;  1T3B A;  1GP1 A;  3VI5 A;  3MYD A;  3TCO A;  2WDU A;  2DIZ A;  4YAP A;  5B7C A;  4ZIL A;  3UIW A;  3A2X A;  2A2P A;  3DVW A;  1U3I A;  3GX8 A;  1GSS A;  1Z9H A;  3L9V A;  1BG5 A;  4ZBD A;  1BED A;  5IPG A;  4MJE A;  3TJB A;  3IHQ A;  1K0M A;  1LBK A;  4AJ6 A;  3QAV A;  3A2W A;  3BD2 A;  2BJX A;  4G9H A;  3E9J B;  1OC9 A;  3QD9 A;  4KUN A;  1CQH A;  1GWC A;  1JZO A;  2F9S A;  2C0D A;  3QOU A;  4JE1 A;  5JCW A;  4ZB9 A;  1VRS D;  5J41 A;  3D4M A;  1PX7 A;  4QQ7 A;  1ZCP A;  4ZL7 A;  5H5R A;  2LJR A;  5KN3 A;  2YZU A;  1AAZ A;  3GNJ A;  4EIP A;  2VCZ A;  3E3E A;  3ME7 A;  2K18 A;  1ZL9 A;  2R0C A;  4BVX A;  3DEX A;  5HR2 A;  4F0C A;  3HD5 A;  4LL1 B;  1RK4 A;  3QAW A;  3FRC A;  1H75 A;  4ZBB A;  4K5S A;  3UMA A;  4K0N A;  3APQ A;  3TOT A;  2HFD A;  4GF0 A;  5G30 A;  1Z5Y E;  2OAC A;  2C0F A;  4NWY A;  2L57 A;  2QC7 A;  2EFE A;  1URM A;  1PD2 1;  4RI6 A;  3TJF A;  3VWU A;  4K7I A;  5J3R A;  4L5L A;  3LYP A;  1UN2 A;  1ZYE A;  1IYH A;  2WRT A;  1THO A;  1OYJ A;  2J9H A;  5A5K A;  1FW1 A;  2NDO A;  6GSS A;  4FYC A;  1XFL A;  4XTS A;  4OFT A;  4EF0 A;  4E68 A;  3M0F A;  5J4V A;  3CXG A;  3G7Y A;  4IP1 A;  4QMK A;  4KAE A;  2MZC A;  1ERU A;  3LJR A;  2VKZ G;  3ISO A;  4BVY B;  3R2Q A;  1XWB A;  3KIJ A;  4HOJ A;  2YAN A;  4G10 A;  1GUL A;  3M1G A;  3C1S A;  5CNW A;  4J2F A;  2YWM A;  4PQ1 A;  2B5Y A;  4XS4 B;  5IMF A;  3TKP A;  4EC0 A;  2P5Q A;  4GTU A;  1EEM A;  2IFQ A;  4RUV A;  4NHW A;  1XWK A;  3P90 A;  5IPH A;  5ENU A;  2VCX A;  1ZGN A;  3QFB C;  5J47 A;  4HQZ A;  3L9U A;  3D4T A;  3RAZ A;  1THX A;  5KOX A;  4NV5 A;  4NV2 A;  1A8Y A;  4I5Q A;  4O5U A;  2OBI A;  2F8F A;  2I81 A;  3BBY A;  3KGK A;  3C8E A;  3GHA A;  2VUP A;  3IA1 A;  2RUF A;  5JCG A;  1XWG A;  3O6T A;  2GGT A;  3J7Y b;  2DC5 A;  2HSM B;  4K1F A;  4YQM A;  4YQV A;  3DVX A;  2JSY A;  1WIK A;  3WGD A;  5DDL A;  5BMU B;  3G7J A;  3HMJ G;  2OT3 A;  4K9Z A;  3LYK A;  1AUC A;  2K8V A;  1YF0 A;  1PRX A;  2H0G A;  3EMP A;  3ZVJ A;  2VM1 A;  4V2N A;  1MTC A;  2VLT A;  5G2Z A;  3TKS C;  3GL5 A;  4A5P A;  1SU9 A;  3F3Q A;  4V1A p;  3W8J A;  4Q5F A;  1JHB A;  4DEJ A;  1K0B A;  4F0B A;  4L0W A;  5INY A;  2HRF A;  3HJP A;  2FWF A;  3FW2 A;  5COH A;  2WJU A;  1S3C A;  3UAP A;  1V98 A;  19GS A;  3UVT A;  2DJJ A;  5J40 A;  1FOV A;  1DUG A;  3K8N A;  1ML6 A;  4KF9 A;  2GQL A;  2M80 A;  3UVH A;  3TRX A;  1YQ1 A;  2JAD A;  3LXT A;  5LD0 A;  4YH2 A;  1XZO A;  2P31 A;  5HR1 A;  1Z3E A;  4V1A g;  5JWQ B;  5LNK e;  4NAX A;  2L5L A;  4L8E A;  1XCC A;  3MIX A;  2AB6 A;  3I6A A;  4V2M A;  2HRK B;  1FVJ A;  2HRN A;  4EDY A;  6GSW A;  3LFL A;  4K8M A;  3CRT A;  3ED3 A;  4HU7 A;  3ZIT A;  5CRW A;  1SYX A;  3TU3 B;  2XPD A;  5L71 A;  1G7O A;  1FVK A;  4EXJ A;  2RUE A;  2XPE A;  1BQ7 A;  2M72 A;  4NMU A;  3KH9 A;  1N25 A;  1SK2 A;  3KD0 A;  5HFI A;  3KXO A;  4ZBA A;  2LNT A;  2JZS A;  4LA1 A;  4KDU A;  5IO0 A;  4YKG A;  2O87 A;  4KSO A;  4AKH A;  13GS A;  2HLS A;  2GSQ A;  4N3Z A;  20GS A;  2OA7 A;  5ECL B;  4LLR A;  1GH2 A;  2B1K A;  2GSR A;  2TIR A;  1O81 A;  3I9V 2;  3HA9 A;  4W66 A;  1MEK A;  1TOF A;  1VF3 A;  1K0O A;  4Z2T A;  3UBK A;  2ZNM A;  4KDY A;  5CRG A;  5DQS A;  2C80 A;  3ZML A;  2REM A;  4E8E A;  2WGR A;  3F0I A;  2VAF A;  3KZQ A;  1O8W A;  1BG1 A;  2LJK A;  5HR3 A;  1ZYN A;  2VIM A;  2HYX A;  4JU5 A;  2JSZ A;  1V9W A;  1GTI A;  5HFK A;  2RM5 A;  1B48 A;  2B1L A;  2X8C A;  2MYG A;  4E8H A;  3GKX A;  1UC7 A;  2HSH A;  1LU4 A;  2FA4 A;  3BCI A;  1QFN A;  4CY6 A;  2LTK A;  1JZW A;  2IFQ B;  5KN0 A;  3F8U A;  3VPT A;  3HJO A;  3D22 A;  2VCV A;  2VO4 A;  4FIW A;  3TKQ A;  3ZIJ A;  4G0I A;  2FHE A;  1SK0 A;  2NVL A;  1A0R P;  5C04 A;  4Q5N A;  4OCE A;  4MJB A;  2CVB A;  2YOI A;  2IWT A;  2X8H A;  2VL2 C;  2CQ9 A;  1HQO A;  4BVY A;  1SD8 A;  3J7Y k;  2O5V A;  3U6V A;  4GQF A;  3TJG A;  2VCQ A;  2DSA A;  1Z7P A;  3QCP A;  1F2E A;  2MBS A;  3HKR A;  2QSI A;  4MJC A;  3IPZ A;  3I69 A;  2KP1 A;  2QGV A;  4TKY A;  1PA3 A;  2HT9 A;  3EU3 A;  3RPN A;  2P0G A;  2CV4 A;  2MMZ A;  1WOU A;  4XS4 A;  3WGX A;  1T7P B;  3DRN A;  2YP6 A;  2E0Q A;  4IBP A;  2F3M A;  4MMM A;  4CW9 A;  3IAS 2;  4KE3 A;  2X49 A;  3D5J A;  4POK A;  2VD0 A;  4WF4 A;  1AIU A;  4F2I A;  4IHU A;  3AY8 A;  2DKI A;  7GSS A;  4KSM A;  2GQM A;  4HEA 2;  1XBS A;  3SBC A;  3KP8 A;  1XIY A;  2GSS A;  4AJ7 A;  3H1N A;  5CP1 A;  5HR0 A;  2HNL A;  2IMD A;  3GH6 A;  2CVK A;  3QMX A;  1X9W B;  4ZB7 A;  4MF6 A;  4PXO A;  4TR1 B;  3VUR A;  2HSM A;  4TR4 A;  2LRT A;  4IJI A;  2O89 A;  1SVM A;  2EFD A;  3F6D A;  2B7K A;  5BMU A;  2OE1 A;  2O8V B;  4K5R A;  1RW1 A;  3LOR A;  2OE3 A;  2LV3 A;  2ZCT A;  1S3A A;  1TRV A;  1KTE A;  5ECR B;  4EIQ A;  5JWO B;  2ZUP A;  1AC1 A;  3KH7 A;  4K2X A;  4EE0 A;  2A4H A;  3ZMK A;  3IOS A;  1BAY A;  3HVS A;  3WYW A;  1GSF A;  3ERF A;  1TKD B;  1ZMA A;  1TU8 A;  3VPQ A;  4G0L A;  3ZLP A;  4XS6 A;  2OKA A;  4YQU A;  2RLI A;  2O7K A;  2VD1 A;  3RBT A;  1A0F A;  4AKI A;  5CRD A;  4MZB A;  4Z2U A;  1DSB A;  1X5D A;  5ECI B;  3ZRE A;  1OE7 A;  2PUK C;  1VF2 A;  2C3N A;  4WEY A;  1OVN A;  1JLW A;  1W89 A;  3HHV A;  3CTF A;  1QMV A;  2QA1 A;  4N30 A;  4Z7X A;  5DCG A;  2CZ2 A;  2R0G A;  4OO5 A;  4I2U A;  2YWO A;  1JFU A;  4HZ2 A;  4KA0 A;  3C71 A;  4WET A;  5G5E A;  2P5R A;  5IOW A;  3P7X A;  3VFI A;  3GN3 A;  2HRK A;  2YV7 A;  2GS3 A;  3O76 A;  3MNG A;  1GSE A;  1OAZ A;  1WWJ A;  4G19 A;  4EUY A;  3EIN A;  4LMW A;  5DAK A;  2J23 A;  2IMI A;  2R2J A;  1V58 A;  2L59 A;  4FO5 A;  4KCE A;  1K0N A;  2VM2 A;  2H19 A;  2H72 A;  3KP9 A;  1K0D A;  4MNN A;  1B9Y C;  1ZYQ B;  4P3Y B;  3IBH A;  1K3L A;  1U6T A;  4GSS A;  3H93 A;  3L4N A;  2YJ7 A;  2FWE A;  5F05 A;  3GKM A;  1O73 A;  2FGX A;  12GS A;  2N5F A;  1QGV A;  3Q19 A;  2B5X A;  1TDI A;  2HZF A;  3GUS A;  4OFN A;  4EDZ A;  1VF1 A;  1HNB A;  1F6M C;  1E2Y A;  5AIS A;  3M9K A;  1X9S B;  3CSJ A;  5DQY A;  4KH7 A;  1K0C A;  5D73 A;  1BJX A;  2GZP A;  6GSU A;  1BF5 A;  1B4P A;  2D2Z A;  2L4Q A;  3VWV A;  4RQR A;  3FZ5 A;  3F4R A;  3KM6 A;  3WGE A;  1CQG A;  1SYR A;  1EV9 A;  5ELA A;  2R37 A;  2GVP A;  3KMO A;  4WXT A;  2Z9S A;  5D9W A;  4AGS A;  2B6M A;  2GLR A;  3CRU A;  2AHE A;  1MD3 A;  4HI7 A;  5ECN B;  3EC3 A;  2EFC A;  3EVI A;  5IMV A;  4AF2 A;  4L0U A;  2CX3 A;  4MZC A;  2MMA A;  5ABR A;  2EC4 A;  1GL8 A;  1B4Q A;  1EV4 A;  4J57 E;  3EUR A;  3F3R A;  3A2V A;  1KBN A;  3DGQ A;  2GQK A;  2H75 A;  1TK8 B;  2HZE B;  2IMF A;  1N8J A;  3HXS A;  5B6M A;  3KJY A;  3VWX A;  3LW9 A;  4ILF A;  4KND A;  9GSS A;  1ZOF A;  1E6B A;  2YCD A;  1ERW A;  2MBT A;  2UV8 G;  4N0Z A;  1DBY A;  1SJI A;  4IQ1 A;  4OCF A;  1EP8 A;  1M7T A;  5EY6 A;  4JED A;  5GSS A;  4ML6 A;  2A2S A;  3EMX A;  4Z2R A;  1R5P A;  4N11 A;  1OKD A;  1T1V A;  2V32 A;  5CRH A;  4G2E A;  4DSR A;  4N10 A;  2N5A A;  4EO3 A;  1SJZ A;  3P2A A;  1T00 A;  1JZR A;  3ZTL A;  5DVB A;  4PUA A;  3WD6 A;  3FZ4 A;  1GUM A;  5F07 A;  1M2B A;  1SEN A;  1PN9 A;  2LRC A;  1LJR A;  1O7U A;  2H01 A;  4J56 E;  3VLN A;  3QPM A;  1PQN A;  4GDF A;  2H74 A;  1DE1 A;  3ERW A;  1U87 A;  4EVM A;  1B9X C;  1SL1 B;  1SKW B;  4AI6 A;  3KMN A;  1Z6M A;  2ON5 A;  2PGT A;  2HSN A;  3O3T A;  5D96 A;  5G1L A;  3BCK A;  2H71 A;  1Q4J A;  3GTU B;  4X4J A;  4L5O A;  2I3Y A;  3ZVJ D;  2V6K A;  4JZQ A;  4F9Z A;  4TR1 A;  5LCZ A;  2V1M A;  2IME A;  5H5S A;  3IK7 A;  1GNW A;  1A2M A;  2R4V A;  3FK8 A;  3FYG A;  2DJK A;  5A5H A;  3KCM A;  1GUK A;  1EWX A;  2PN8 A;  2R6K A;  3Q6O A;  1NW2 A;  4PGT A;  3ZL5 A;  2LEG A;  4PNF A;  3FMW A;  3QR6 A;  2EIR A;  2XC2 A;  1EGR A;  3UBL A;  3PGT A;  5DAK B;  5H5Q A;  4MZW A;  4XRD A;  5FHI A;  4YKF A;  4JR6 A;  3MDK A;  2R3X A;  2LST A;  1SVO A;  4KB3 A;  5HFG A;  3TKS A;  1HD2 A;  3IK9 A;  4TXO B;  3CTG A;  1AW9 A;  3IE3 A;  1FB6 A;  3IDV A;  3QDN A;  5AIX A;  4ML1 A;  5A4V A;  1YKC A;  3LSZ A;  4DVC A;  3ERG A;  5CRE A;  4H86 A;  3EPT A;  2MMO A;  1O8X A;  1S3D A;  2JZR A;  4OWY A;  4POL A;  1YEP A;  2VLU A;  4POM A;  1MDJ A;  3RDW A;  2YNX A;  2C3T A;  3M8N A;  4ZB6 A;  5AGY A;  2H1B A;  4XS1 A;  5KEJ A;  1O6J A;  4K7O A;  1GTA A;  2DJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...