2WJUA

Glutathione transferase a2-2 in complex with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE-S-TRANSFERASE A2-2
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wjuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wjuA01
2H19A 1XWGA 3GYKA 4MZBA 3EMXA 3WGDA 1M2BA 2V32A 1A2JA 1TI3A 1EEJA 1XCCA 3QDNA 4AGSA 5ECIB 4RUVA 2VCXA 2V2GA 1XOBA 5AISA 2GT6A 1M0UA 1WWJA 3KD0A 4IVFA 5CRHA 2C0FA 1MDKA 4F82A 2CV4A 3VWUA 4DVCA 1K0OA 4OMVA 1FB0A 1Z7PA 11GSA 3E0UA 4MJBA 2X8CA 2PERA 2HRKB 2DJKA 2MBSA 2OE3A 1U6TA 4I5QA 9GSSA 1O6JA 2HLSA 3DWVA 4LA1A 2CZ3A 2YJ7A 5IOXA 4NAXA 1SL1B 1B4QA 2FNOA 4JBBA 3GUSA 3M9JA 4MCUA 1AXDA 5DALA 1A23A 2M80A 5G30A 5ECHB 2XBQA 2VD0A 3G7YA 3HDCA 3BJ5A 3HHVA 1R7HA 3BD2A 3F6FA 3ZIJA 1SK2A 4K0NA 3UARA 4HEA2 22GSA 3TRQA 2PVQA 4GSTA 2HZEB 2PPTA 5JWOB 4O32A 4ZIJA 2H73A 3ISOA 5DJLA 2AYTA 3F8UA 3UJ1A 2YN1A 1FB6A 4IP1A 3VFIA 1OC3A 4QL7A 3ED3A 2H71A 4MJEA 2FWGA 1W4VA 5DCGA 4QL9A 4OCEA 2CVKA 1A0RP 5G5EA 1GNEA 2L6DA 2CQ9A 1PSQA 1GSUA 1VF3A 2I1UA 5D8IA 5A5KA 1M7TA 1KBNA 1B9XC 2VOCA 1TRUA 3M8NA 4LL4B 5BMUA 1WRYA 2KLXA 5HQPA 2LJAA 4XS4B 3GA4A 2GQMA 4IHUA 4L8EA 2M46A 4WR5A 1W89A 3H79A 2K6VA 3HVVA 1NM3A 3SBCA 2VLVA 5ECKB 1J0FA 5DALB 3RHBA 1U3AA 2LEGA 4KE3A 3Q6OA 5D9VA 1PGTA 4PNFA 2F8FA 1J08A 2QC7A 4ML6A 3CXGA 4CW9A 2PVOC 5IMDA 4TVEA 1SU9A 4NV5A 3HA9A 5AIVA 5H5RA 5A4VA 2YWIA 3FZ9A 2KUCA 2LS5A 1ZMAA 1S3DA 4PXOA 4KDYA 5COHA 4Z7XA 4EDYA 3MSZA 3HXSA 3KCMA 3VK9A 3I9V2 1A0FA 2AAWA 2H72A 4ML1A 1GUKA 2N5BA 2O85A 3HZ8A 4POMA 3VI5A 5AIXA 3OR5A 5DVBA 3KP9A 4MA9A 3KM6A 4HU9A 2HXKA 1X9SB 5G1LA 2EIQA 3D5JA 5F0GA 1R5AA 1OVNA 1XW6A 1TP9A 1FHEA 5CP1A 4BWSA 3HD5A 4ILFA 2PMTA 1Z9HA 2PBJA 4MJAA 1SL2B 3CRUA 4WBJA 4ZL8A 1BYEA 3DVXA 5D93A 3R2QA 3S9FA 1ZYEA 3D4MA 5B6NA 4KNDA 4L0WA 2MZCA 3HZ4A 1V98A 5ECNB 2CT6A 4EUYA 3KTLA 3L9SA 4LLRA 2ZCTA 4NXIA 2GSTA 2GQLA 4DSRA 3FW2A 5J3RA 3WGEA 3LORA 1ZYQB 4PNGA 2LKUA 2CAQA 4RI7A 2X8HA 4Q5NA 4EKZA 2CAIA 1TU8A 4YQUA 1PMTA 2PGTA 1HYUA 2DBCA 1B8XA 1T1VA 1AQWA 1T00A 1H4OA 5FT3A 4V2NA 4V1Ag 1K0AA 5ECQB 1OC8A 4KA0A 1OYJA 4EDZA 3FKFA 4YAPA 2LRTA 3HKRA 1MDIA 5CREA 1T8EB 4JZQA 1Z6MA 3FK8A 2JL4A 3GRXA 1YQ1A 1XXUA 4IW9A 1PRXA 1NW2A 3TB2A 2WRTA 4N11A 1ACVA 2LNTA 3N9JA 3HYPA 4G19A 1EV9A 3IA1A 2C0DA 2MMZA 3C8EA 1WIKA 3IAM2 3A3TA 4ZXGA 2WDUA 1QMVA 2GS3A 4F0BA 3Q74A 2IN3A 5J41A 4ZB8A 2H66A 3FY7A 1RW1A 2OA7A 3L78A 3IR4A 7GSSA 5LNKe 3UBKA 3LXZA 3QAVA 1GP1A 5D96A 3IBHA 5ABRA 5HR1A 2HRFA 3C71A 2IMFA 3TRPA 2VUPA 2IMDA 1URMA 1MD4A 4X1UA 4Q5FA 3CTGA 3L4NA 2FA8A 4L0UA 3GKKA 1VF2A 1DSBA 2VIMA 4XHMA 5IIZA 4RI6A 4CHSA 3CSHA 3TOUA 4FYUA 3GH6A 5ENUA 1R4WA 4NHZA 2LJKA 2H6ZA 2NTOA 6GSUA 3GMFA 2H8LA 4MF7A 2AUVA 3W6GA 1G7OA 4JE1A 4MH2A 5JCGA 2VAFA 1QQ2A 2EIRA 4L5LA 1K0CA 3DD3A 1FOVA 4V2MA 1GSYA 1ZCPA 1TRWA 5IQYA 5DAKA 4HQSA 3ERWA 2HSHA 1XWAA 1BEDA 1S3CA 3GSTA 1T4YA 5G2ZA 1ZZYA 1F6MC 1AQVA 1NHOA 4HZ4A 3CTFA 4V1Ap 16GSA 2HSNB 1WOUA 1WP0A 3IXRA 2WB9A 1BX9A 1AAZA 4KDXA 2DJJA 3A2WA 4GXZA 1R5PA 2K8SA 2VL2A 2XPDA 3VI7A 3KZQA 5G1KA 2IMKA 1Z3EA 4IKHA 1R26A 1I9DA 4D73A 3TOTA 1HD2A 3UVTA 2HRKA 1WJKA 2LNSA 2LUSA 1OKTA 1TK5B 1HQOA 2GTUA 3LQ7A 4G10A 3C73A 4PURA 4MF6A 2RM6A 1OAZA 2FWFA 3CSIA 4K2DA 1U87A 2YOIA 1K3YA 1PX7A 1X0RA 2GQKA 3LEFA 3HVSA 2LQOA 1V2AA 3Q18A 2WJUA 3MDKA 3TKSE 2I9HA 1GTIA 3APSA 5GAND 3M1GA 4EE0A 3RBTA 2FUG2 2WS2A 2LRNA 4F2IA 3F4RA 1XBSA 3RHCA 1A24A 5DAKB 2X8GA 1RQMA 5DQYA 3EINA 2R3XA 4WF4A 5ELGA 5DQSA 3ZVJA 4XRDA 1K3LA 5CAXA 2QKEA 4NWYA 1USBA 3IC4A 3UL3A 4EVMA 2JZSA 1GSEA 1Y6EA 1EP8A 3VWVA 5G31A 1F37A 5G5FA 4PQ1A 2RLIA 1I5GA 2FLSA 2FHEA 2TRXA 4GCIA 3KXOA 4LMWA 1GULA 4N0ZA 3F63A 3GFKA 2CA8A 2TRCP 1X5EA 4YH2A 5ID2B 1KNGA 1THOA 3ZZXA 4D73B 4IELA 4F0CA 3G9BA 4ZILA 3TKRA 2CVDA 1YZXA 4XS4A 2FWEA 5B7CA 2B5EA 3KH9A 3O6TA 3TKSA 3ZYWA 1XVQA 2JZTA 3M9KA 2D2ZA 1ERWA 1IYIA 3ZFLA 3BBYA 3KMOA 2GVPA 3E9JB 3KGKA 2YJHA 4ZBDA 3UVHA 2WULA 1O73A 4TW5A 1UC7A 1XW9A 1C72A 2E0QA 5EY6A 3HJPA 4OFTA 2YWNA 3US3A 1BAYA 4RQXA 4AF2A 4XIHA 2E2GA 3GIXA 1JFUA 1F2EA 4OFMA 4ZBBA 2K8VA 2BTOT 5JCUA 2HSMA 1QUWA 3VPTA 1XVWA 4K1FA 1O85A 1BQ7A 2DIYA 4POLA 3QOUA 5CNWA 4BVXB 2GT5A 5IM9A 2XBIA 1IYHA 2BMXA 4I8BA 1X5DA 1LU4A 3W8SA 1PL2A 1ST9A 2G2QA 3DRNA 1PD21 4WETA 4KF9A 5J4UA 4K7OA 2N5AA 2X64A 3G7JA 1UA5A 5F07A 1MEKA 2CZ2A 3LFLA 1YJ6A 4DSSA 4ID0A 2MMOA 4MZCA 4AJ6A 2OBKA 1K3OA 1Y25A 2RIIA 3VWWA 5FHIA 4XRAA 3FHKA 1MTCA 2ZNMA 4MPGA 5A4WA 4X43A 4IS0A 4HI7A 4I97A 1M2DA 1SKSB 1M99A 2C3NA 2H01A 3F0IA 3F4SA 5ECOB 1T7PB 1JZRA 5KN1A 4OFNA 2L4QA 3TKQA 4OD7A 1ILOA 4V2LA 1AUCA 5A4UA 1F3BA 1VGLA 6GSYA 2H74A 5HFKA 5EPFA 2HSMB 3QR6A 2GZYA 4HDEA 2FY6A 1BG5A 2TIRA 3VURA 4X0XA 2HFDA 2YWMA 4IGJA 3LXTA 4G0LA 1FVKA 1Q98A 2YWOA 1K0NA 3NOFA 3F6DA 2PU9C 1K0MA 1FVJA 3FZ5A 4BWQA 1TTZA 4TXOA 1GSDA 1TOFA 2J9HA 3F3RA 2YNXA 3ZIVA 4NMUA 2EIOA 3UBLA 2JSZA 3J7Yk 3DKSA 4HQZA 5H5SA 2ES7A 5IMAA 1ZGNA 4DSSB 4GSSA 1MDJA 5DBQA 2BJXA 3LYKA 3L9UA 4H86A 3EE2A 5DCHA 1GH2A 2QSIA 4WF5A 3GNJA 2GLRA 1Z5YE 4LMVA 3KJYA 1M9BA 1A2MA 3D21A 1LJRA 1A8YA 1O8XA 3ZREA 3HJOA 3GX8A 3KEBA 2RUEA 1EGOA 4O92A 4K7NA 5IPGA 1TK8B 4WR4A 2L5LA 5GSSA 4ZBAA 3H8QA 1GUMA 1XPVA 2J23A 2HYXA 3I6AA 2IFQA 2LRCA 2B5XA 1M2AA 2VL3A 5C04A 4G0KA 4PQIA 2LSTA 2DC5A 4MABA 4MLYA 1ERVA 3SWLA 3RDWA 4I6XA 4G0IA 1A2LA 5INYA 5KN0A 1SJIA 4TR4A 3TKPA 4TXOB 1TKDB 3GURA 3FEUA 1GRXA 1VF4A 4JR4A 2AV4A 3D0ZA 1ERTA 1O81A 3GHAA 1ABAA 2B7KA 2LV3A 4MH3A 2DMLA 2HQTA 2CX3A 3LSZA 2XPEA 4JEDA 2X99A 3H93A 1SK0A 2R6KA 2FWHA 2P0GA 1SD8A 4XCSA 2H0IA 4BL7A 4E8EA 3NZNA 6GSSA 2P5RA 2K9FA 5E4WA 2XHFA 1CQHA 3EU3A 18GSA 4HJ2A 1VRSD 4FYCA 3LYPA 2A4VA 4QQ7A 5CRGA 2GSRA 2VL2C 4MK3A 5KN3A 3D4TA 4PGTA 4N10A 5IOWA 1S3AA 5IMZA 3H4KA 3EMPA 1FAAA 1U88A 1JZWA 3TJJA 3ZLPA 1SJ6A 1SYRA 1PQNA 5EVOA 3I43A 2DJ3A 2B7JA 3NIVA 5AN1A 4EXJA 3DEXA 3TRXA 4K0GA 1CQGA 4KUNA 4EF0A 2IFQB 14GSA 1EZKA 2JACA 5IO0A 4FO5A 4KGIA 2O89A 2OADA 2IL3A 2F3MA 5B8BA 3EWLA 3QFBC 1SKRB 4GQFA 4HUAA 2VO4A 1G6WA 1E2YA 1JLWA 3UEMA 1KEBA 1XWBA 4GLTA 3V1WA 4FH8A 5FWGA 3QFAC 2I3YA 4ZL9A 3APQA 3C7MA 3D6IA 5AGYA 1K0DA 3WYWA 1T4ZA 4Q5QA 5IO2A 1HNCA 5KEJA 3IRAA 1TXXA 4BL7B 1AQXA 4ECIA 2L4CA 3U6VA 4L5OA 4CDOA 5DJMA 2C80A 4BA7A 3Q19A 2GSQA 4JR6A 2VLTA 1GTAA 2I4AA 2H1BA 1PKZA 3G7IA 3M3MA 1V9WA 2XC2A 3RPPA 1OKDA 4YAVA 3FZAA 4KCEA 3ME8A 3TJGA 5ID2A 1QK8A 2H1GA 4AJ8A 1PA3A 4ECBA 2L6CA 3ERFA 4P3YB 2YP6A 1SK1A 4YQMA 6GSWA 2LJRA 4F03A 4ULXA 3TKSC 4ISDA 5IPHA 5F06A 4HJMA 2H0HA 1AW9A 1PX6A 3DIEA 3F3QA 3BOAA 4KB3A 3ZMLA 2YZHA 2GZZA 4AJ7A 1OE7A 4HZ2A 1GNWA 2H70A 1KTEA 4GQCA 1QGVA 2DJ2A 2E2MA 4I2TA 1XIYA 2HNLA 5GSTA 5C00A 3ZTLA 4TR0A 1TW9A 3R3EA 3N5OA 1Z6NA 1QXHA 1G7EA 2VCTA 2H76A 4N30A 4GRFA 5CO3A 1UN2A 5JCWA 2C8UA 3CBUA 1DE1A 1HNBA 1V58A 4WKWA 3BCIA 1YKCA 3P90A 2G0FA 5D9WA 4BVXA 4OO4A 3CSJA 3GL3A 3KTBA 4I2UA 3TGZA 1M9AA 4JU5A 4OWYA 5IMFA 4ACSA 2JU5A 4KW6A 3KP8A 1G6YA 3GTUA 1SJZA 1TI1A 1PN9A 2C0GA 2GSSA 5JWQB 2B5YA 1PL1A 2ON5A 4USSA 3ZITA 3APOA 3F9UA 2DIZA 1EP7A 5D9XA 2HRAA 3O3TA 2V6OA 2C0EA 4EC0A 2OKAA 3KH7A 3IAS2 1X5CA 4ECJA 4N0VA 3E3EA 2KOKA 6GSXA 4MDCA 3ZVJD 2MMNA 1TRSA 4O5RA 5LD0A 2F8AA 4XTSA 4F9ZA 1QFNA 3QPMA 4PUFC 3GKNA 2NBSA 3ZRDA 1BJXA 2H6XA 2JSYA 1ZL9A 5LCZA 2DJ0A 5GAPD 2HE3A 2QGVA 5ECRB 3GKXA 3U5RE 4ZL7A 19GSA 3PR8A 2HI7A 3TDGA 4O7HA 3TJKA 3UAPA 2VM1A 3VPQA 4NPBA 5ECMB 1DE2A 5ECPB 4DSQA 1LBKA 1PKWA 4LL1B 5HR2A 4NHWA 2WGRA 2F51A 2VD1A 1YEXA 2AHEA 1N8JA 1ZOFA 1YDKA 1JZDA 1YY7A 3DMLA 2H30A 1JHBA 2OJLA 3GTUB 2L57A 5EL8A 2A2RA 2YV9A 2L59A 1YF1A 1TRVA 2MYGA 2YPMA 2LQQA 6GSVA 2WFCA 1GSSA 13GSA 2M72A 2REMA 3DYRA 2DSAA 3IDVA 1YKAA 3M0FA 3IPZA 2V41A 4XS1A 3P2AA 2PWJA 2EC4A 4FQUA 2IMEA 3BCKA 3DVWA 3KIJA 1V40A 2CX4A 2KP1A 2KP2A 5D73A 4PX1A 2H1DA 3J7Yb 1AIUA 2ALBA 2KHPA 3IK7A 1RK4A 3ZL5A 3MAKA 3UOMA 3WGXA 4IQAA 4KSOA 5KN2A 3P7XA 1EOHA 1U3IA 3P8WA 4IN0A 3TJFA 3TUEA 1SD9A 4HU7A 2C1YA 4Q5RA 5CRDA 5HR3A 2FD3A 1EWXA 4TN8A 10GSA 1EGRA 2F9SA 5GZZB 2IMIA 3QAWA 3GN3A 3MNGA 2GDRA 1J9BA 1A8LA 17GSA 4G2EA 4ZB9A 2I81A 2H0GA 1ERUA 3DXBA 1G0TA 3GSSA 2V1MA 1WMJA 2CVBA 4G9HA 1XFLA 1OE8A 1EV4A 3VWXA 3D22A 2VCWA 8GSSA 4E8HA 2GGTA 2P5QA 4KCAA 3L9VA 5F8BA 1GSFA 3GX0A 2HSYA 2O8VB 3CRTA 4J57E 1Q4JA 3PH9A 4TR1A 1SKWB 5CYYA 1GLPA 2YZUA 5JWRB 4XS6A 5DDLA 2C3QA 4BVYA 1OC9A 2JADA 2FCHA 5E59A 3EURA 5ELAA 1TU7A 2GZPA 4YQVA 1JLVA 1THXA 3PPUA 1JZOA 2L5OA 2NVLA 4EO3A 3H1NA 2VM2A 5F05A 5H5QA 3QAGA 5HFIA 4ZB6A 3JCML 4JRRA 3IE3A 5J5NA 1TJDA 2ON7A 3IHQA 4IBPA 2B6MA 1F9MA 3FR3A 1XWKA 2OE1A 2NPBA 3A2VA 12GSA 2JZRA 3IV4A 2NDOA 3EYTA 3FR9A 1Z7RA 3ZMKA 2R4VA 2K18A 5CRWA 2YANA 4NV2A 3A2XA 4KDUA 2C4JA 4MPFA 2HZFA 3KMNA 2N5FA 1GTBA 2OE0A 4K9ZA 2DMMA 4BPYA 4IP6A 2FGXA 4J56E 2FA4A 2OACA 4K8MA 4WBRD 1ML6A 2OBIA 4GTUA 4GSNA 1H75A 3VLNA 4K7IA 5HFGA 1WPIA 1WE0A 4TR1B 3I69A 1DUGA 5B6MA 4KH7A 5IMCA 4BVYB 1OC9B 2B1LA 2H75A 1ON4A 5B8AA 1O7UA 3HJMA 4WXTA 4WEYA 2VLUA 5HR0A 3UIWA 4PTSA 2DLXA 3FRCA 1YEPA 3HVXA 3TJBA 4IJIA 1GLQA 2VL9A 2IWTA 3RPNA 4IQ1A 4K6XA 1NSWA 3GH9A 2IIYA 3LGCA 4OCFA 2A2SA 4FIWA 2O7KA 2PN8A 3IOSA 4ECCA 1B9YC 2IJYA 3CYNA 2B1KA 4KX4A 1O8WA 4RQRA 4HS1A 3HY2A 1EEMA 6GSTA 4HOJA 1B48A 3WT1A 3O76A 1V57A 2MBTA 1DBYA 4IJ3A 3DGQA 3FYGA 1GUHA 4PQHA 3FZ4A 2VCVA 1XWCA 5L71A 3ERGA 3QMXA 3ME7A 4MF5A 2LTKA 1TK0B 1FW1A 2H6YA 2E7PA 3GL5A 1GL8A 3TCOA 3AY8A 2VCQA 2C3TA 4PUAA 3PINA 4TRXA 2HRNA 2AJQB 4TR3A 3C1SA 1VF1A 2HT9A 4POBA 1MD3A 3C1RA 4MZWA 3PGTA 4DEJA 1SL0B 1X9WB 1EOGA 2YV7A 1XW5A 3EU4A 4TXVA 3GV1A 1GSQA 3LG6A 1FG4A 1GWCA 2R37A 2RUFA 2AB6A 4GWRA 4MMMA 1K0BA 5IMVA 4J2FA 2P31A 2UZ8A 2R5GA 3HCZA 5ECLB 5D9TA 4OO5A 3EC3A 4POKA 2V6KA 3IC8A 3W8JA 2O87A 1YF0A 1E6BA 2MMAA 1AC1A 2WCIA 3LJRA 3FR6A 3IK9A 3RAZA 1T3BA 2YCDA 2DJ1A 1XZOA 1TDIA 3QD9A 2R2JA 2VCZA 4GF0A 3EVIA 20GSA 3CMIA 1SYXA 5J9CA 1GTUA 1NHYA 4TOPA 3WT2A 4MJCA 4FYBA 3MWHA 3QCPA 2H1AA 2ZUPA 1HNAA 3A5WA 3L0HA 4EL1A 2Z9SA 1XOAA 3UMAA 1X9MB 1N2AA 3LWAA 4MP4A 2RM5A 5ECSA 1FO5A 3WD6A 1F3AA 5J9BA 1SENA 1UVZA 4KAEA 2B3SA 3K8NA 3ZFBA 4KSMA 2PUKC 3F4TA 3GKMA 2WZ9A 1B4PA 2IPAA 2HZEA 4TKYA
chains in the Genus database with same CATH superfamily
3MYDA 2H19A 1XWGA 4PI2C 3GYKA 4MZBA 3EMXA 3WGDA 1M2BA 2V32A 1A2JA 1TI3A 1EEJA 1XCCA 3QDNA 4AGSA 5ECIB 4RUVA 2VCXA 2V2GA 1XOBA 5AISA 2GT6A 1M0UA 1WWJA 3KD0A 4IVFA 5CRHA 2C0FA 1MDKA 4F82A 2CV4A 3VWUA 4DVCA 1K0OA 4OMVA 1FB0A 1Z7PA 11GSA 3E0UA 4MJBA 2X8CA 2PERA 2HRKB 2DJKA 2MBSA 2OE3A 1U6TA 4I5QA 9GSSA 1O6JA 2HLSA 3DWVA 4LA1A 2CZ3A 2YJ7A 5IOXA 4NAXA 1SL1B 1B4QA 2FNOA 4JBBA 3GUSA 3M9JA 4MCUA 1AXDA 5DALA 1A23A 2M80A 2A4HA 5G30A 5ECHB 2XBQA 2VD0A 3G7YA 3HDCA 3BJ5A 3HHVA 1R7HA 3BD2A 2O36A 3F6FA 3ZIJA 1SK2A 4K0NA 3UARA 4HEA2 22GSA 3TRQA 2PVQA 4GSTA 2HZEB 2PPTA 5JWOB 4O32A 4ZIJA 2H73A 3ISOA 5DJLA 2AYTA 3F8UA 3UJ1A 2YN1A 1FB6A 4IP1A 3VFIA 1OC3A 4QL7A 3ED3A 2H71A 4CY6A 4MJEA 2FWGA 1W4VA 5DCGA 4QL9A 4OCEA 2CVKA 1A0RP 5G5EA 1GNEA 4E68A 2L6DA 2CQ9A 1PSQA 1BF5A 1GSUA 1VF3A 2I1UA 5D8IA 5A5KA 1M7TA 1KBNA 1B9XC 2VOCA 1TRUA 3M8NA 4LL4B 5BMUA 1WRYA 2KLXA 5HQPA 2LJAA 4XS4B 3GA4A 2GQMA 4IHUA 4L8EA 2M46A 4WR5A 1W89A 3H79A 2K6VA 3HVVA 1NM3A 3SBCA 2VLVA 5ECKB 1J0FA 5DALB 3RHBA 1U3AA 2LEGA 4KE3A 3Q6OA 5D9VA 1PGTA 4PNFA 2F8FA 1J08A 2QC7A 4ML6A 3CXGA 4CW9A 2PVOC 5IMDA 4TVEA 1SU9A 1M3JA 4NV5A 3HA9A 5AIVA 5H5RA 5A4VA 2YWIA 3FZ9A 2KUCA 2LS5A 1ZMAA 1S3DA 4PXOA 4KDYA 5COHA 4Z7XA 4EDYA 3MSZA 3HXSA 4K2XA 3KCMA 3VK9A 3I9V2 1A0FA 2AAWA 2H72A 4ML1A 1GUKA 2N5BA 2O85A 3HZ8A 4POMA 3VI5A 5AIXA 3OR5A 5DVBA 3KP9A 4MA9A 3KM6A 4HU9A 2HXKA 1X9SB 5G1LA 2EIQA 1YEWC 3D5JA 5F0GA 1R5AA 1OVNA 1XW6A 1TP9A 1FHEA 5CP1A 4BWSA 3HD5A 4ILFA 2PMTA 1Z9HA 2PBJA 4MJAA 1SL2B 3CRUA 4WBJA 1SVLA 4ZL8A 1BYEA 3DVXA 5D93A 3R2QA 3S9FA 1ZYEA 3D4MA 5B6NA 4KNDA 4L0WA 4FXYP 2MZCA 3HZ4A 1V98A 5ECNB 2CT6A 1PFOA 4EUYA 3KTLA 3L9SA 4LLRA 2ZCTA 4NXIA 2GSTA 2GQLA 4DSRA 3FW2A 5J3RA 3WGEA 3LORA 1ZYQB 4PNGA 2LKUA 4Z2TA 2CAQA 4RI7A 2X8HA 2R0GA 4Q5NA 4EKZA 2CAIA 1TU8A 4YQUA 1PMTA 2PGTA 1HYUA 2DBCA 1B8XA 1T1VA 1AQWA 1T00A 1H4OA 5FT3A 4V2NA 4V1Ag 1K0AA 5ECQB 1OC8A 4KA0A 1OYJA 4EDZA 3FKFA 4YAPA 2LRTA 3HKRA 1MDIA 5CREA 1T8EB 4JZQA 1Z6MA 3FK8A 2JL4A 3GRXA 1YQ1A 1XXUA 4IW9A 1PRXA 1NW2A 3TB2A 2WRTA 4N11A 1ACVA 2QA2A 2LNTA 3N9JA 3HYPA 4G19A 1EV9A 1PN0A 3IA1A 2C0DA 2MMZA 4HSCX 2DKHA 3C8EA 1WIKA 3IAM2 3A3TA 4ZXGA 2WDUA 1QMVA 2GS3A 4F0BA 3Q74A 2IN3A 5J41A 4ZB8A 2H66A 3FY7A 1RW1A 2OA7A 3L78A 3IR4A 7GSSA 5LNKe 3UBKA 3LXZA 3QAVA 1GP1A 5D96A 3EPTA 3IBHA 4AKHA 5ABRA 5HR1A 2HRFA 3C71A 2IMFA 3TRPA 2VUPA 1N25A 1URMA 2IMDA 1MD4A 4X1UA 4Q5FA 3CTGA 3L4NA 2R0CA 2FA8A 4L0UA 3GKKA 1VF2A 1DSBA 2VIMA 4XHMA 5IIZA 4RI6A 4CHSA 3CSHA 1SVMA 3TOUA 4FYUA 3GH6A 5ENUA 1R4WA 4NHZA 2LJKA 2H6ZA 2NTOA 6GSUA 3GMFA 2H8LA 4MF7A 2AUVA 3W6GA 1G7OA 4JE1A 4MH2A 5JCGA 2VAFA 1QQ2A 2EIRA 4L5LA 1K0CA 3DD3A 2EFEA 1FOVA 2EFHA 5BRTA 4V2MA 1GSYA 1ZCPA 1TRWA 5IQYA 5DAKA 4HQSA 3ERWA 2HSHA 1XWAA 1BEDA 1S3CA 3GSTA 1T4YA 5G2ZA 1ZZYA 1F6MC 3MIXA 1AQVA 1NHOA 4HZ4A 3CTFA 4V1Ap 16GSA 2HSNB 1WOUA 1S4BP 1WP0A 3IXRA 5J4YA 2WB9A 1XG8A 1BX9A 1AAZA 4KDXA 2DJJA 3A2WA 4GXZA 1R5PA 2K8SA 2EFDA 2VL2A 2XPDA 3VI7A 3KZQA 5G1KA 2IMKA 1Z3EA 4IKHA 1R26A 4O5UA 1I9DA 4D73A 3TOTA 1HD2A 3UVTA 2HRKA 1WJKA 2LNSA 2LUSA 1OKTA 1TK5B 1HQOA 2GTUA 1ZYPA 3LQ7A 4G10A 3C73A 4PURA 4MF6A 2RM6A 1OAZA 2FWFA 3CSIA 4K2DA 1U87A 2YOIA 4AKGA 1K3YA 1PX7A 1X0RA 2GQKA 3LEFA 3HVSA 2LQOA 1V2AA 3Q18A 2WJUA 3MDKA 3TKSE 2I9HA 1GTIA 3APSA 5GAND 3M1GA 1S3RA 4EE0A 3RBTA 2FUG2 2WS2A 2LRNA 4F2IA 3F4RA 1XBSA 2WW0A 3RHCA 1A24A 5DAKB 2X8GA 1RQMA 5DQYA 3EINA 4Z2RA 2R3XA 4WF4A 5ELGA 5DQSA 3ZVJA 4XRDA 1K3LA 5CAXA 2QKEA 4NWYA 1USBA 3IC4A 3UL3A 4EVMA 2JZSA 1GSEA 1Y6EA 1EP8A 3VWVA 5G31A 1F37A 5G5FA 4PQ1A 2RLIA 1I5GA 2FLSA 2FHEA 2TRXA 4GCIA 3KXOA 4LMWA 1GULA 4N0ZA 3F63A 3GFKA 2CA8A 2TRCP 1X5EA 4YH2A 5ID2B 3RFRC 1KNGA 1THOA 3ZZXA 4D73B 4IELA 4F0CA 3G9BA 4ZILA 3TKRA 2CVDA 1YZXA 4CY8A 4XS4A 2FWEA 5J40A 5B7CA 2B5EA 3KH9A 3O6TA 3TKSA 3ZYWA 1XVQA 2O3EA 2JZTA 2D2ZA 3M9KA 1ERWA 1IYIA 3ZFLA 3BBYA 3KMOA 2GVPA 3E9JB 3KGKA 2YJHA 4ZBDA 3UVHA 2WULA 1O73A 4TW5A 1UC7A 1XW9A 1C72A 2E0QA 5EY6A 3HJPA 4OFTA 2YWNA 3US3A 1BAYA 4RQXA 4AF2A 4XIHA 2E2GA 4ICYA 3GIXA 1JFUA 1F2EA 4OFMA 4ZBBA 2K8VA 2BTOT 5JCUA 2HSMA 1QUWA 3VPTA 1XVWA 4K1FA 1O85A 1BQ7A 2DIYA 4POLA 3QOUA 5CNWA 4BVXB 2GT5A 5IM9A 2XBIA 1IYHA 2BMXA 4I8BA 1X5DA 1LU4A 3W8SA 1PL2A 1ST9A 2G2QA 3DRNA 1PD21 5A1NA 4WETA 4KF9A 5J4UA 4K7OA 4AI6A 2N5AA 2X64A 3G7JA 1UA5A 5F07A 1MEKA 2CZ2A 3LFLA 1YJ6A 4DSSA 4ID0A 2MMOA 4MZCA 4AJ6A 2OBKA 1K3OA 1Y25A 2RIIA 3VWWA 5FHIA 4XRAA 3FHKA 4ZB7A 1MTCA 2ZNMA 4MPGA 5A4WA 4X43A 4IS0A 4HI7A 4I97A 1M2DA 1SKSB 4YKFA 1M99A 2C3NA 2H01A 3F0IA 3F4SA 5ECOB 1T7PB 1JZRA 5KN1A 4OFNA 2L4QA 3TKQA 4OD7A 1ILOA 4V2LA 1AUCA 5A4UA 1F3BA 1VGLA 6GSYA 2H74A 5HFKA 5EPFA 2HSMB 3QR6A 2GZYA 4HDEA 2FY6A 1BG5A 4BIKA 4Z2UA 2TIRA 3VURA 4X0XA 2HFDA 2YWMA 4IGJA 3IHGA 3LXTA 4G0LA 1FVKA 1Q98A 2YWOA 1K0NA 3NOFA 3F6DA 2PU9C 4PHZC 1K0MA 1FVJA 3FZ5A 4BWQA 1TTZA 4TXOA 1GSDA 1TOFA 2J9HA 3F3RA 2YNXA 5A1NB 3ZIVA 4NMUA 2EIOA 2H1LA 3UBLA 2JSZA 3J7Yk 3DKSA 4HQZA 5H5SA 2ES7A 5IMAA 1ZGNA 4DSSB 4GSSA 1MDJA 5DBQA 2BJXA 3LYKA 3L9UA 4H86A 5KOWA 3EE2A 1M3IA 5DCHA 1GH2A 2QSIA 4WF5A 3GNJA 2GLRA 1Z5YE 4LMVA 3KJYA 1M9BA 1A2MA 3D21A 1LJRA 1A8YA 1O8XA 3ZREA 3TU3B 3HJOA 3GX8A 1Y1UA 3KEBA 2RUEA 1EGOA 4O92A 2WZSA 4K7NA 5IPGA 5A5HA 1TK8B 4WR4A 2L5LA 5GSSA 4ZBAA 3H8QA 4W66A 1GUMA 4N3ZA 1XPVA 2J23A 2HYXA 3I6AA 2IFQA 2O5VA 2LRCA 2B5XA 1M2AA 2VL3A 5C04A 4G0KA 4PQIA 2LSTA 2DC5A 4MABA 4MLYA 1ERVA 2X4AA 3SWLA 3RDWA 4I6XA 4G0IA 1A2LA 5INYA 5KN0A 1SJIA 4TR4A 3TKPA 4TXOB 1TKDB 3GURA 3FEUA 1TXUA 1GRXA 1VF4A 4JR4A 2QA1A 2AV4A 3D0ZA 5A34A 1ERTA 1O81A 3GHAA 1ABAA 2B7KA 4YKGA 2LV3A 4MH3A 2DMLA 2HQTA 2CX3A 3LSZA 2XPEA 4JEDA 2X99A 3H93A 1SK0A 2R6KA 2FWHA 2P0GA 1SD8A 4XCSA 2H0IA 4BL7A 4E8EA 3NZNA 6GSSA 2HSNA 2P5RA 2K9FA 5E4WA 2XHFA 1CQHA 3EU3A 18GSA 4HJ2A 1VRSD 4FYCA 3LYPA 2A4VA 4QQ7A 5CRGA 2GSRA 2VL2C 4MK3A 5KN3A 3D4TA 4PGTA 4N10A 5IOWA 1S3AA 5IMZA 3H4KA 3EMPA 1FAAA 1U88A 4A5PA 1JZWA 3TJJA 3ZLPA 2WW1A 5A5HB 1SJ6A 1SYRA 1PQNA 5EVOA 3I43A 2DJ3A 2B7JA 3NIVA 5AN1A 4EXJA 3DEXA 3LW9A 4K0GA 3TRXA 1CQGA 4KUNA 4EF0A 2IFQB 14GSA 1EZKA 2JACA 5IO0A 4FO5A 4KGIA 2O89A 2OADA 2IL3A 4GDFA 2F3MA 5B8BA 3EWLA 3QFBC 1SKRB 4GQFA 3A5IA 4HUAA 2VO4A 1G6WA 1E2YA 1JLWA 4G01A 3UEMA 1KEBA 1XWBA 4GLTA 5A34B 3V1WA 2DKIA 4FH8A 5FWGA 3QFAC 2I3YA 4ZL9A 3APQA 3C7MA 3D6IA 5AGYA 1K0DA 3WYWA 1T4ZA 4Q5QA 5IO2A 1HNCA 5KEJA 3IRAA 1TXXA 4BL7B 1AQXA 4ECIA 2L4CA 3U6VA 4L5OA 4CDOA 5DJMA 2C80A 4BA7A 1FOHA 3Q19A 2GSQA 4JR6A 2VLTA 1GTAA 2I4AA 2H1BA 1PKZA 3G7IA 3M3MA 1V9WA 2XC2A 3RPPA 1OKDA 4YAVA 3FZAA 4KCEA 3ME8A 3TJGA 5ID2A 1QK8A 2H1GA 4AJ8A 1PA3A 4ECBA 2L6CA 3ERFA 4P3YB 2YP6A 1SK1A 4YQMA 6GSWA 2LJRA 4F03A 2X49A 4ULXA 3TKSC 4ISDA 5IPHA 5F06A 4HJMA 2H0HA 1AW9A 1PX6A 3DIEA 3F3QA 2UV8G 3BOAA 4KB3A 3ZMLA 2YZHA 2GZZA 2VKZG 1OE7A 4HZ2A 4AJ7A 1GNWA 2H70A 1KTEA 4GQCA 1QGVA 2DJ2A 2E2MA 4I2TA 1XIYA 2HNLA 5GSTA 5C00A 3ZTLA 4TR0A 1TW9A 1YVLA 3R3EA 5KOXA 3N5OA 1Z6NA 1QXHA 1G7EA 2VCTA 2H76A 1ZYNA 4N30A 4GRFA 5CO3A 1UN2A 5JCWA 2C8UA 3CBUA 1DE1A 1HNBA 1V58A 4WKWA 3BCIA 1YKCA 3P90A 2G0FA 5D9WA 4BVXA 4OO4A 3CSJA 3GL3A 3KTBA 4I2UA 3TGZA 1M9AA 4JU5A 4OWYA 5IMFA 1BG1A 4ACSA 2JU5A 4KW6A 3KP8A 1G6YA 3GTUA 4AKXB 1SJZA 1TI1A 1PN9A 2C0GA 2GSSA 5JWQB 4EIQA 3FMWA 2B5YA 1PL1A 2ON5A 4USSA 3ZITA 3APOA 3F9UA 2DIZA 1EP7A 5D9XA 5J4VA 2HRAA 3O3TA 2V6OA 2C0EA 4EC0A 2OKAA 3IAS2 3KH7A 1X5CA 4ECJA 4N0VA 3E3EA 2KOKA 6GSXA 4MDCA 3ZVJD 2MMNA 1TRSA 4O5RA 5LD0A 2F8AA 4XTSA 4F9ZA 1QFNA 3QPMA 4PUFC 3GKNA 2WVYA 2NBSA 3ZRDA 1BJXA 2H6XA 2JSYA 1ZL9A 5LCZA 2DJ0A 4X4JA 5GAPD 3CHXC 2HE3A 2QGVA 5ECRB 3GKXA 3U5RE 4ZL7A 19GSA 3PR8A 2HI7A 3TDGA 4O7HA 3TJKA 3UAPA 2VM1A 3VPQA 4NPBA 5ECMB 2OT3A 1DE2A 5ECPB 4DSQA 1LBKA 1PKWA 4LL1B 5HR2A 4NHWA 3CQFA 2WW3A 2WGRA 2F51A 2VD1A 1YEXA 2AHEA 1N8JA 1ZOFA 1YDKA 1JZDA 1YY7A 4PI0C 3DMLA 2H30A 1JHBA 2OJLA 3GTUB 4QMKA 2L57A 5EL8A 2A2RA 2YV9A 2L59A 1YF1A 1TRVA 2MYGA 2YPMA 2LQQA 6GSVA 2WFCA 1GSSA 13GSA 2M72A 2REMA 3DYRA 2DSAA 3IDVA 1YKAA 3M0FA 3IPZA 2V41A 4XS1A 3P2AA 2PWJA 2EC4A 4FQUA 2IMEA 3BCKA 3DVWA 3KIJA 1V40A 4K5SA 2CX4A 2KP1A 2KP2A 5D73A 4PX1A 2H1DA 3J7Yb 1AIUA 2ALBA 2KHPA 3IK7A 1RK4A 3ZL5A 3MAKA 3UOMA 3WGXA 4IQAA 4KSOA 5KN2A 3P7XA 4EIPA 1EOHA 1U3IA 3P8WA 4IN0A 3TJFA 3TUEA 1SD9A 4HU7A 2C1YA 4Q5RA 5CRDA 5HR3A 2FD3A 1EWXA 4TN8A 10GSA 1EGRA 4MNNA 2F9SA 5GZZB 2EFCA 2IMIA 3QAWA 3GN3A 2WVZA 3MNGA 2GDRA 1J9BA 1A8LA 17GSA 4G2EA 4ZB9A 2I81A 2H0GA 1ERUA 3DXBA 1G0TA 3GSSA 2V1MA 1WMJA 2CVBA 4G9HA 1XFLA 1OE8A 1EV4A 3VWXA 3D22A 2VCWA 8GSSA 4E8HA 2GGTA 2P5QA 4KCAA 3L9VA 5F8BA 1GSFA 3GX0A 2HSYA 2O8VB 3CRTA 4J57E 1Q4JA 3PH9A 4TR1A 1SKWB 5CYYA 1GLPA 2YZUA 5JWRB 4XS6A 5DDLA 2C3QA 4BVYA 1OC9A 2JADA 2FCHA 5E59A 3EURA 5ELAA 1TU7A 2GZPA 4YQVA 1JLVA 1THXA 3PPUA 1JZOA 2L5OA 2NVLA 4EO3A 3H1NA 2VM2A 5F05A 5H5QA 3QAGA 5HFIA 4ZB6A 3JCML 4JRRA 3IE3A 5BMUB 5J5NA 1TJDA 2ON7A 3IHQA 4IBPA 2B6MA 1F9MA 3FR3A 1XWKA 2OE1A 2NPBA 3A2VA 12GSA 2JZRA 3IV4A 2NDOA 3EYTA 3FR9A 1Z7RA 3ZMKA 2R4VA 2WW2A 2K18A 5CRWA 2YANA 4NV2A 3A2XA 4KDUA 2C4JA 4MPFA 2HZFA 3KMNA 2N5FA 1GTBA 2OE0A 4K9ZA 2DMMA 4BPYA 4IP6A 2FGXA 4J56E 2FA4A 2OACA 4K8MA 4WBRD 1ML6A 2OBIA 4GTUA 4GSNA 1H75A 3VLNA 4K7IA 1I1IP 1WPIA 5HFGA 1WE0A 4TR1B 3I69A 1DUGA 5B6MA 4KH7A 5IMCA 3RGBC 4BVYB 1OC9B 2B1LA 2H75A 1ON4A 5B8AA 1O7UA 3HJMA 4WXTA 4WEYA 2VLUA 5HR0A 3UIWA 4PTSA 2DLXA 3FRCA 1YEPA 3HVXA 3TJBA 4IJIA 1GLQA 2VL9A 2IWTA 3HMJG 3RPNA 4IQ1A 4K6XA 1NSWA 3GH9A 2IIYA 3LGCA 4OCFA 2A2SA 4FIWA 2O7KA 2PN8A 3IOSA 4ECCA 1B9YC 2IJYA 3CYNA 2B1KA 3CWGA 4KX4A 1O8WA 4RQRA 2WVXA 4HS1A 3HY2A 1EEMA 6GSTA 1SVOA 4HOJA 1B48A 3WT1A 4K5RA 3O76A 1V57A 2MBTA 1DBYA 4IJ3A 3DGQA 3FYGA 1GUHA 4PQHA 3FZ4A 2VCVA 1XWCA 5L71A 3ERGA 3QMXA 3ME7A 4MF5A 2LTKA 1TK0B 1FW1A 2H6YA 3HVNA 2E7PA 3GL5A 4AKIA 3TCOA 1GL8A 3AY8A 2VCQA 2C3TA 4PUAA 3PINA 4TRXA 2HRNA 2AJQB 4TR3A 3C1SA 1VF1A 2HT9A 4POBA 1MD3A 3C1RA 4MZWA 3PGTA 4DEJA 1SL0B 1X9WB 1EOGA 2YV7A 1XW5A 3EU4A 4TXVA 3GV1A 1GSQA 3LG6A 1FG4A 1GWCA 2R37A 2RUFA 4O5QA 2AB6A 4GWRA 4MMMA 1K0BA 5IMVA 4J2FA 2P31A 2UZ8A 2R5GA 3HCZA 5ECLB 5J47A 5D9TA 4OO5A 3EC3A 4POKA 2V6KA 3IC8A 3W8JA 2O87A 1YF0A 1E6BA 2WVXB 2MMAA 1AC1A 2WCIA 3LJRA 3FR6A 3IK9A 3RAZA 1T3BA 2YCDA 2DJ1A 1XZOA 1TDIA 2R2JA 3QD9A 2VCZA 4GF0A 3EVIA 20GSA 3CMIA 1SYXA 5J9CA 1GTUA 1NHYA 4TOPA 3WT2A 4MJCA 4FYBA 3MWHA 3QCPA 2H1AA 2ZUPA 1HNAA 3A5WA 3L0HA 4EL1A 2Z9SA 1XOAA 3UMAA 1X9MB 1N2AA 3LWAA 4MP4A 2RM5A 5ECSA 1FO5A 2R0PA 3WD6A 1F3AA 5J9BA 2A2PA 1SENA 1UVZA 4KAEA 2B3SA 3K8NA 3ZFBA 4KSMA 2PUKC 3F4TA 3GKMA 2WZ9A 1B4PA 2IPAA 2HZEA 4TKYA
chains in the Genus database with same CATH topology
3MYDA 2H19A 1XWGA 3GYKA 4MZBA 3EMXA 3WGDA 1M2BA 2V32A 1A2JA 1TI3A 1EEJA 1XCCA 3QDNA 4AGSA 5ECIB 4RUVA 2VCXA 2V2GA 1XOBA 5AISA 2GT6A 1M0UA 1WWJA 3KD0A 4IVFA 5CRHA 2C0FA 1MDKA 4F82A 2CV4A 3VWUA 4DVCA 1K0OA 4OMVA 1FB0A 1Z7PA 11GSA 3E0UA 4MJBA 2X8CA 2PERA 2HRKB 2DJKA 2MBSA 2OE3A 1U6TA 4I5QA 9GSSA 1O6JA 2HLSA 3DWVA 4LA1A 2CZ3A 2YJ7A 5IOXA 4NAXA 1SL1B 1B4QA 2FNOA 4JBBA 3GUSA 3M9JA 4MCUA 1AXDA 5DALA 1A23A 2M80A 2A4HA 5G30A 5ECHB 2XBQA 2VD0A 3G7YA 3HDCA 3BJ5A 3HHVA 1R7HA 3BD2A 3F6FA 3ZIJA 1SK2A 4K0NA 3UARA 4HEA2 22GSA 3TRQA 2PVQA 4GSTA 2HZEB 2PPTA 5JWOB 4O32A 4ZIJA 2H73A 3ISOA 5DJLA 2AYTA 3F8UA 3UJ1A 2YN1A 1FB6A 4IP1A 3VFIA 1OC3A 4QL7A 3ED3A 2H71A 4CY6A 4MJEA 2FWGA 1W4VA 5DCGA 4QL9A 4OCEA 2CVKA 1A0RP 5G5EA 1GNEA 4E68A 2L6DA 2CQ9A 1PSQA 1BF5A 1GSUA 1VF3A 2I1UA 5D8IA 5A5KA 1M7TA 1KBNA 1B9XC 2VOCA 1TRUA 3M8NA 4LL4B 5BMUA 1WRYA 2KLXA 5HQPA 2LJAA 4XS4B 3GA4A 2GQMA 4IHUA 4L8EA 2M46A 4WR5A 1W89A 3H79A 2K6VA 3HVVA 1NM3A 3SBCA 2VLVA 5ECKB 1J0FA 5DALB 3RHBA 1U3AA 2LEGA 4KE3A 3Q6OA 5D9VA 1PGTA 4PNFA 2F8FA 1J08A 2QC7A 4ML6A 3CXGA 4CW9A 2PVOC 5IMDA 4TVEA 1SU9A 4NV5A 3HA9A 5AIVA 5H5RA 5A4VA 2YWIA 3FZ9A 2KUCA 2LS5A 1ZMAA 1S3DA 4PXOA 4KDYA 5COHA 4Z7XA 4EDYA 3MSZA 3HXSA 4K2XA 3KCMA 3VK9A 3I9V2 1A0FA 2AAWA 2H72A 4ML1A 1GUKA 2N5BA 2O85A 3HZ8A 4POMA 3VI5A 5AIXA 3OR5A 5DVBA 3KP9A 4MA9A 3KM6A 4HU9A 2HXKA 1X9SB 5G1LA 2EIQA 3D5JA 5F0GA 1R5AA 1OVNA 1XW6A 1TP9A 1FHEA 5CP1A 4BWSA 3HD5A 4ILFA 2PMTA 1Z9HA 2PBJA 4MJAA 1SL2B 3CRUA 4WBJA 1SVLA 4ZL8A 1BYEA 3DVXA 5D93A 3R2QA 3S9FA 1ZYEA 3D4MA 5B6NA 4KNDA 4L0WA 2MZCA 3HZ4A 1V98A 5ECNB 2CT6A 4EUYA 3KTLA 3L9SA 4LLRA 2ZCTA 4NXIA 2GSTA 2GQLA 4DSRA 3FW2A 5J3RA 3WGEA 3LORA 1ZYQB 4PNGA 2LKUA 4Z2TA 2CAQA 4RI7A 2X8HA 2R0GA 4Q5NA 4EKZA 2CAIA 1TU8A 4YQUA 1PMTA 2PGTA 1HYUA 2DBCA 1B8XA 1T1VA 1AQWA 1T00A 1H4OA 5FT3A 4V2NA 4V1Ag 1K0AA 5ECQB 1OC8A 4KA0A 1OYJA 4EDZA 3FKFA 4YAPA 2LRTA 3HKRA 1MDIA 5CREA 1T8EB 4JZQA 1Z6MA 3FK8A 2JL4A 3GRXA 1YQ1A 1XXUA 4IW9A 1PRXA 1NW2A 3TB2A 2WRTA 4N11A 1ACVA 2QA2A 2LNTA 3N9JA 3HYPA 4G19A 1EV9A 1PN0A 3IA1A 2C0DA 2MMZA 2DKHA 3C8EA 1WIKA 3IAM2 3A3TA 4ZXGA 2WDUA 1QMVA 2GS3A 4F0BA 3Q74A 2IN3A 5J41A 4ZB8A 2H66A 3FY7A 1RW1A 2OA7A 3L78A 3IR4A 7GSSA 5LNKe 3UBKA 3LXZA 3QAVA 1GP1A 5D96A 3EPTA 3IBHA 4AKHA 5ABRA 5HR1A 2HRFA 3C71A 2IMFA 3TRPA 2VUPA 1N25A 1URMA 2IMDA 1MD4A 4X1UA 4Q5FA 3CTGA 3L4NA 2R0CA 2FA8A 4L0UA 3GKKA 1VF2A 1DSBA 2VIMA 4XHMA 5IIZA 4RI6A 4CHSA 3CSHA 1SVMA 3TOUA 4FYUA 3GH6A 5ENUA 1R4WA 4NHZA 2LJKA 2H6ZA 2NTOA 6GSUA 3GMFA 2H8LA 4MF7A 2AUVA 3W6GA 1G7OA 4JE1A 4MH2A 5JCGA 2VAFA 1QQ2A 2EIRA 4L5LA 1K0CA 3DD3A 2EFEA 1FOVA 2EFHA 5BRTA 4V2MA 1GSYA 1ZCPA 1TRWA 5IQYA 5DAKA 4HQSA 3ERWA 2HSHA 1XWAA 1BEDA 1S3CA 3GSTA 1T4YA 5G2ZA 1ZZYA 1F6MC 3MIXA 1AQVA 1NHOA 4HZ4A 3CTFA 4V1Ap 16GSA 2HSNB 1WOUA 1WP0A 3IXRA 5J4YA 2WB9A 1BX9A 1AAZA 4KDXA 2DJJA 3A2WA 4GXZA 1R5PA 2K8SA 2EFDA 2VL2A 2XPDA 3VI7A 3KZQA 5G1KA 2IMKA 1Z3EA 4IKHA 1R26A 4O5UA 1I9DA 4D73A 3TOTA 1HD2A 3UVTA 2HRKA 1WJKA 2LNSA 2LUSA 1OKTA 1TK5B 1HQOA 2GTUA 1ZYPA 3LQ7A 4G10A 3C73A 4PURA 4MF6A 2RM6A 1OAZA 2FWFA 3CSIA 4K2DA 1U87A 2YOIA 4AKGA 1K3YA 1PX7A 1X0RA 2GQKA 3LEFA 3HVSA 2LQOA 1V2AA 3Q18A 2WJUA 3MDKA 3TKSE 2I9HA 1GTIA 3APSA 5GAND 3M1GA 4EE0A 3RBTA 2FUG2 2WS2A 2LRNA 4F2IA 3F4RA 1XBSA 3RHCA 1A24A 5DAKB 2X8GA 1RQMA 5DQYA 3EINA 4Z2RA 2R3XA 4WF4A 5ELGA 5DQSA 3ZVJA 4XRDA 1K3LA 5CAXA 2QKEA 4NWYA 1USBA 3IC4A 3UL3A 4EVMA 2JZSA 1GSEA 1Y6EA 1EP8A 3VWVA 5G31A 1F37A 5G5FA 4PQ1A 2RLIA 1I5GA 2FLSA 2FHEA 2TRXA 4GCIA 3KXOA 4LMWA 1GULA 4N0ZA 3F63A 3GFKA 2CA8A 2TRCP 1X5EA 4YH2A 5ID2B 1KNGA 1THOA 3ZZXA 4D73B 4IELA 4F0CA 3G9BA 4ZILA 3TKRA 2CVDA 1YZXA 4CY8A 4XS4A 2FWEA 5J40A 5B7CA 2B5EA 3KH9A 3O6TA 3TKSA 3ZYWA 1XVQA 2JZTA 3M9KA 2D2ZA 1ERWA 1IYIA 3ZFLA 3BBYA 3KMOA 2GVPA 3E9JB 3KGKA 2YJHA 4ZBDA 3UVHA 2WULA 1O73A 4TW5A 1UC7A 1XW9A 1C72A 2E0QA 5EY6A 3HJPA 4OFTA 2YWNA 3US3A 1BAYA 4RQXA 4AF2A 4XIHA 2E2GA 4ICYA 3GIXA 1JFUA 1F2EA 4OFMA 4ZBBA 2K8VA 2BTOT 5JCUA 2HSMA 1QUWA 3VPTA 1XVWA 4K1FA 1O85A 1BQ7A 2DIYA 4POLA 3QOUA 5CNWA 4BVXB 2GT5A 5IM9A 2XBIA 1IYHA 2BMXA 4I8BA 1X5DA 1LU4A 3W8SA 1PL2A 1ST9A 2G2QA 3DRNA 1PD21 5A1NA 4WETA 4KF9A 5J4UA 4K7OA 4AI6A 2N5AA 2X64A 3G7JA 1UA5A 5F07A 1MEKA 2CZ2A 3LFLA 1YJ6A 4DSSA 4ID0A 2MMOA 4MZCA 4AJ6A 2OBKA 1K3OA 1Y25A 2RIIA 3VWWA 5FHIA 4XRAA 3FHKA 4ZB7A 1MTCA 2ZNMA 4MPGA 5A4WA 4X43A 4IS0A 4HI7A 4I97A 1M2DA 1SKSB 4YKFA 1M99A 2C3NA 2H01A 3F0IA 3F4SA 5ECOB 1T7PB 1JZRA 5KN1A 4OFNA 2L4QA 3TKQA 4OD7A 1ILOA 4V2LA 1AUCA 5A4UA 1F3BA 1VGLA 6GSYA 2H74A 5HFKA 5EPFA 2HSMB 3QR6A 2GZYA 4HDEA 2FY6A 1BG5A 4Z2UA 2TIRA 3VURA 4X0XA 2HFDA 2YWMA 4IGJA 3IHGA 3LXTA 4G0LA 1FVKA 1Q98A 2YWOA 1K0NA 3NOFA 3F6DA 2PU9C 1K0MA 1FVJA 3FZ5A 4BWQA 1TTZA 4TXOA 1GSDA 1TOFA 2J9HA 3F3RA 2YNXA 5A1NB 3ZIVA 4NMUA 2EIOA 2H1LA 3UBLA 2JSZA 3J7Yk 3DKSA 4HQZA 5H5SA 2ES7A 5IMAA 1ZGNA 4DSSB 4GSSA 1MDJA 5DBQA 2BJXA 3LYKA 3L9UA 4H86A 5KOWA 3EE2A 5DCHA 1GH2A 2QSIA 4WF5A 3GNJA 2GLRA 1Z5YE 4LMVA 3KJYA 1M9BA 1A2MA 3D21A 1LJRA 1A8YA 1O8XA 3ZREA 3TU3B 3HJOA 3GX8A 1Y1UA 3KEBA 2RUEA 1EGOA 4O92A 4K7NA 5IPGA 5A5HA 1TK8B 4WR4A 2L5LA 5GSSA 4ZBAA 3H8QA 4W66A 1GUMA 4N3ZA 1XPVA 2J23A 2HYXA 3I6AA 2IFQA 2O5VA 2LRCA 2B5XA 1M2AA 2VL3A 5C04A 4G0KA 4PQIA 2LSTA 2DC5A 4MABA 4MLYA 1ERVA 2X4AA 3SWLA 3RDWA 4I6XA 4G0IA 1A2LA 5INYA 5KN0A 1SJIA 4TR4A 3TKPA 4TXOB 1TKDB 3GURA 3FEUA 1TXUA 1GRXA 1VF4A 4JR4A 2QA1A 2AV4A 3D0ZA 5A34A 1ERTA 1O81A 3GHAA 1ABAA 2B7KA 4YKGA 2LV3A 4MH3A 2DMLA 2HQTA 2CX3A 3LSZA 2XPEA 4JEDA 2X99A 3H93A 1SK0A 2R6KA 2FWHA 2P0GA 1SD8A 4XCSA 2H0IA 4BL7A 4E8EA 3NZNA 6GSSA 2HSNA 2P5RA 2K9FA 5E4WA 2XHFA 1CQHA 3EU3A 18GSA 4HJ2A 1VRSD 4FYCA 3LYPA 2A4VA 4QQ7A 5CRGA 2GSRA 2VL2C 4MK3A 5KN3A 3D4TA 4PGTA 4N10A 5IOWA 1S3AA 5IMZA 3H4KA 3EMPA 1FAAA 1U88A 4A5PA 1JZWA 3TJJA 3ZLPA 5A5HB 1SJ6A 1SYRA 1PQNA 5EVOA 3I43A 2DJ3A 2B7JA 3NIVA 5AN1A 4EXJA 3DEXA 3LW9A 4K0GA 3TRXA 1CQGA 4KUNA 4EF0A 2IFQB 14GSA 1EZKA 2JACA 5IO0A 4FO5A 4KGIA 2O89A 2OADA 2IL3A 4GDFA 2F3MA 5B8BA 3EWLA 3QFBC 1SKRB 4GQFA 3A5IA 4HUAA 2VO4A 1G6WA 1E2YA 1JLWA 4G01A 3UEMA 1KEBA 1XWBA 4GLTA 5A34B 3V1WA 2DKIA 4FH8A 5FWGA 3QFAC 2I3YA 4ZL9A 3APQA 3C7MA 3D6IA 5AGYA 1K0DA 3WYWA 1T4ZA 4Q5QA 5IO2A 1HNCA 5KEJA 3IRAA 1TXXA 4BL7B 1AQXA 4ECIA 2L4CA 3U6VA 4L5OA 4CDOA 5DJMA 2C80A 4BA7A 1FOHA 3Q19A 2GSQA 4JR6A 2VLTA 1GTAA 2I4AA 2H1BA 1PKZA 3G7IA 3M3MA 1V9WA 2XC2A 3RPPA 1OKDA 4YAVA 3FZAA 4KCEA 3ME8A 3TJGA 5ID2A 1QK8A 2H1GA 4AJ8A 1PA3A 4ECBA 2L6CA 3ERFA 4P3YB 2YP6A 1SK1A 4YQMA 6GSWA 2LJRA 4F03A 2X49A 4ULXA 3TKSC 4ISDA 5IPHA 5F06A 4HJMA 2H0HA 1AW9A 1PX6A 3DIEA 3F3QA 2UV8G 3BOAA 4KB3A 3ZMLA 2YZHA 2GZZA 2VKZG 1OE7A 4HZ2A 4AJ7A 1GNWA 2H70A 1KTEA 4GQCA 1QGVA 2DJ2A 2E2MA 4I2TA 1XIYA 2HNLA 5GSTA 5C00A 3ZTLA 4TR0A 1TW9A 1YVLA 3R3EA 5KOXA 3N5OA 1Z6NA 1QXHA 1G7EA 2VCTA 2H76A 1ZYNA 4N30A 4GRFA 5CO3A 1UN2A 5JCWA 2C8UA 3CBUA 1DE1A 1HNBA 1V58A 4WKWA 3BCIA 1YKCA 3P90A 2G0FA 5D9WA 4BVXA 4OO4A 3CSJA 3GL3A 3KTBA 4I2UA 3TGZA 1M9AA 4JU5A 4OWYA 5IMFA 1BG1A 4ACSA 2JU5A 4KW6A 3KP8A 1G6YA 3GTUA 4AKXB 1SJZA 1TI1A 1PN9A 2C0GA 2GSSA 5JWQB 4EIQA 3FMWA 2B5YA 1PL1A 2ON5A 4USSA 3ZITA 3APOA 3F9UA 2DIZA 1EP7A 5D9XA 5J4VA 2HRAA 3O3TA 2V6OA 2C0EA 4EC0A 2OKAA 3KH7A 3IAS2 1X5CA 4ECJA 4N0VA 3E3EA 2KOKA 6GSXA 4MDCA 3ZVJD 2MMNA 1TRSA 4O5RA 5LD0A 2F8AA 4XTSA 4F9ZA 1QFNA 3QPMA 4PUFC 3GKNA 2NBSA 3ZRDA 1BJXA 2H6XA 2JSYA 1ZL9A 5LCZA 2DJ0A 4X4JA 5GAPD 2HE3A 2QGVA 5ECRB 3GKXA 3U5RE 4ZL7A 19GSA 3PR8A 2HI7A 3TDGA 4O7HA 3TJKA 3UAPA 2VM1A 3VPQA 4NPBA 5ECMB 2OT3A 1DE2A 5ECPB 4DSQA 1LBKA 1PKWA 4LL1B 5HR2A 4NHWA 2WGRA 2F51A 2VD1A 1YEXA 2AHEA 1N8JA 1ZOFA 1YDKA 1JZDA 1YY7A 3DMLA 2H30A 1JHBA 2OJLA 3GTUB 4QMKA 2L57A 5EL8A 2A2RA 2YV9A 2L59A 1YF1A 1TRVA 2MYGA 2YPMA 2LQQA 6GSVA 2WFCA 1GSSA 13GSA 2M72A 2REMA 3DYRA 2DSAA 3IDVA 1YKAA 3M0FA 3IPZA 2V41A 4XS1A 3P2AA 2PWJA 2EC4A 4FQUA 2IMEA 3BCKA 3DVWA 3KIJA 1V40A 4K5SA 2CX4A 2KP1A 2KP2A 5D73A 4PX1A 2H1DA 3J7Yb 1AIUA 2ALBA 2KHPA 3IK7A 1RK4A 3ZL5A 3MAKA 3UOMA 3WGXA 4IQAA 4KSOA 5KN2A 3P7XA 4EIPA 1EOHA 1U3IA 3P8WA 4IN0A 3TJFA 3TUEA 1SD9A 4HU7A 2C1YA 4Q5RA 5CRDA 5HR3A 2FD3A 1EWXA 4TN8A 10GSA 1EGRA 4MNNA 2F9SA 5GZZB 2EFCA 2IMIA 3QAWA 3GN3A 3MNGA 2GDRA 1J9BA 1A8LA 17GSA 4G2EA 4ZB9A 2I81A 2H0GA 1ERUA 3DXBA 1G0TA 3GSSA 2V1MA 1WMJA 2CVBA 4G9HA 1XFLA 1OE8A 1EV4A 3VWXA 3D22A 2VCWA 8GSSA 4E8HA 2GGTA 2P5QA 4KCAA 3L9VA 5F8BA 1GSFA 3GX0A 2HSYA 2O8VB 3CRTA 4J57E 1Q4JA 3PH9A 4TR1A 1SKWB 5CYYA 1GLPA 2YZUA 5JWRB 4XS6A 5DDLA 2C3QA 4BVYA 1OC9A 2JADA 2FCHA 5E59A 3EURA 5ELAA 1TU7A 2GZPA 4YQVA 1JLVA 1THXA 3PPUA 1JZOA 2L5OA 2NVLA 4EO3A 3H1NA 2VM2A 5F05A 5H5QA 3QAGA 5HFIA 4ZB6A 3JCML 4JRRA 3IE3A 5BMUB 5J5NA 1TJDA 2ON7A 3IHQA 4IBPA 2B6MA 1F9MA 3FR3A 1XWKA 2OE1A 2NPBA 3A2VA 12GSA 2JZRA 3IV4A 2NDOA 3EYTA 3FR9A 1Z7RA 3ZMKA 2R4VA 2K18A 5CRWA 2YANA 4NV2A 3A2XA 4KDUA 2C4JA 4MPFA 2HZFA 3KMNA 2N5FA 1GTBA 2OE0A 4K9ZA 2DMMA 4BPYA 4IP6A 2FGXA 4J56E 2FA4A 2OACA 4K8MA 4WBRD 1ML6A 2OBIA 4GTUA 4GSNA 1H75A 3VLNA 4K7IA 5HFGA 1WPIA 1WE0A 4TR1B 3I69A 1DUGA 5B6MA 4KH7A 5IMCA 4BVYB 1OC9B 2B1LA 2H75A 1ON4A 5B8AA 1O7UA 3HJMA 4WXTA 4WEYA 2VLUA 5HR0A 3UIWA 4PTSA 2DLXA 3FRCA 1YEPA 3HVXA 3TJBA 4IJIA 1GLQA 2VL9A 2IWTA 3HMJG 3RPNA 4IQ1A 4K6XA 1NSWA 3GH9A 2IIYA 3LGCA 4OCFA 2A2SA 4FIWA 2O7KA 2PN8A 3IOSA 4ECCA 1B9YC 2IJYA 3CYNA 2B1KA 3CWGA 4KX4A 1O8WA 4RQRA 4HS1A 3HY2A 1EEMA 6GSTA 1SVOA 4HOJA 1B48A 3WT1A 4K5RA 3O76A 1V57A 2MBTA 1DBYA 4IJ3A 3DGQA 3FYGA 1GUHA 4PQHA 3FZ4A 2VCVA 1XWCA 5L71A 3ERGA 3QMXA 3ME7A 4MF5A 2LTKA 1TK0B 1FW1A 2H6YA 2E7PA 3GL5A 4AKIA 3TCOA 1GL8A 3AY8A 2VCQA 2C3TA 4PUAA 3PINA 4TRXA 2HRNA 2AJQB 4TR3A 3C1SA 1VF1A 2HT9A 4POBA 1MD3A 3C1RA 4MZWA 3PGTA 4DEJA 1SL0B 1X9WB 1EOGA 2YV7A 1XW5A 3EU4A 4TXVA 3GV1A 1GSQA 3LG6A 1FG4A 1GWCA 2R37A 2RUFA 4O5QA 2AB6A 4GWRA 4MMMA 1K0BA 5IMVA 4J2FA 2P31A 2UZ8A 2R5GA 3HCZA 5ECLB 5J47A 5D9TA 4OO5A 3EC3A 4POKA 2V6KA 3IC8A 3W8JA 2O87A 1YF0A 1E6BA 2MMAA 1AC1A 2WCIA 3LJRA 3FR6A 3IK9A 3RAZA 1T3BA 2YCDA 2DJ1A 1XZOA 1TDIA 2R2JA 3QD9A 2VCZA 4GF0A 3EVIA 20GSA 3CMIA 1SYXA 5J9CA 1GTUA 1NHYA 4TOPA 3WT2A 4MJCA 4FYBA 3MWHA 3QCPA 2H1AA 2ZUPA 1HNAA 3A5WA 3L0HA 4EL1A 2Z9SA 1XOAA 3UMAA 1X9MB 1N2AA 3LWAA 4MP4A 2RM5A 5ECSA 1FO5A 2R0PA 3WD6A 1F3AA 5J9BA 2A2PA 1SENA 1UVZA 4KAEA 2B3SA 3K8NA 3ZFBA 4KSMA 2PUKC 3F4TA 3GKMA 2WZ9A 1B4PA 2IPAA 2HZEA 4TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H19 A;  1XWG A;  3GYK A;  4MZB A;  3EMX A;  3WGD A;  1M2B A;  2V32 A;  1A2J A;  1TI3 A;  1EEJ A;  1XCC A;  3QDN A;  4AGS A;  5ECI B;  4RUV A;  2VCX A;  2V2G A;  1XOB A;  5AIS A;  2GT6 A;  1M0U A;  1WWJ A;  3KD0 A;  4IVF A;  5CRH A;  2C0F A;  1MDK A;  4F82 A;  2CV4 A;  3VWU A;  4DVC A;  1K0O A;  4OMV A;  1FB0 A;  1Z7P A;  11GS A;  3E0U A;  4MJB A;  2X8C A;  2PER A;  2HRK B;  2DJK A;  2MBS A;  2OE3 A;  1U6T A;  4I5Q A;  9GSS A;  1O6J A;  2HLS A;  3DWV A;  4LA1 A;  2CZ3 A;  2YJ7 A;  5IOX A;  4NAX A;  1SL1 B;  1B4Q A;  2FNO A;  4JBB A;  3GUS A;  3M9J A;  4MCU A;  1AXD A;  5DAL A;  1A23 A;  2M80 A;  5G30 A;  5ECH B;  2XBQ A;  2VD0 A;  3G7Y A;  3HDC A;  3BJ5 A;  3HHV A;  1R7H A;  3BD2 A;  3F6F A;  3ZIJ A;  1SK2 A;  4K0N A;  3UAR A;  4HEA 2;  22GS A;  3TRQ A;  2PVQ A;  4GST A;  2HZE B;  2PPT A;  5JWO B;  4O32 A;  4ZIJ A;  2H73 A;  3ISO A;  5DJL A;  2AYT A;  3F8U A;  3UJ1 A;  2YN1 A;  1FB6 A;  4IP1 A;  3VFI A;  1OC3 A;  4QL7 A;  3ED3 A;  2H71 A;  4MJE A;  2FWG A;  1W4V A;  5DCG A;  4QL9 A;  4OCE A;  2CVK A;  1A0R P;  5G5E A;  1GNE A;  2L6D A;  2CQ9 A;  1PSQ A;  1GSU A;  1VF3 A;  2I1U A;  5D8I A;  5A5K A;  1M7T A;  1KBN A;  1B9X C;  2VOC A;  1TRU A;  3M8N A;  4LL4 B;  5BMU A;  1WRY A;  2KLX A;  5HQP A;  2LJA A;  4XS4 B;  3GA4 A;  2GQM A;  4IHU A;  4L8E A;  2M46 A;  4WR5 A;  1W89 A;  3H79 A;  2K6V A;  3HVV A;  1NM3 A;  3SBC A;  2VLV A;  5ECK B;  1J0F A;  5DAL B;  3RHB A;  1U3A A;  2LEG A;  4KE3 A;  3Q6O A;  5D9V A;  1PGT A;  4PNF A;  2F8F A;  1J08 A;  2QC7 A;  4ML6 A;  3CXG A;  4CW9 A;  2PVO C;  5IMD A;  4TVE A;  1SU9 A;  4NV5 A;  3HA9 A;  5AIV A;  5H5R A;  5A4V A;  2YWI A;  3FZ9 A;  2KUC A;  2LS5 A;  1ZMA A;  1S3D A;  4PXO A;  4KDY A;  5COH A;  4Z7X A;  4EDY A;  3MSZ A;  3HXS A;  3KCM A;  3VK9 A;  3I9V 2;  1A0F A;  2AAW A;  2H72 A;  4ML1 A;  1GUK A;  2N5B A;  2O85 A;  3HZ8 A;  4POM A;  3VI5 A;  5AIX A;  3OR5 A;  5DVB A;  3KP9 A;  4MA9 A;  3KM6 A;  4HU9 A;  2HXK A;  1X9S B;  5G1L A;  2EIQ A;  3D5J A;  5F0G A;  1R5A A;  1OVN A;  1XW6 A;  1TP9 A;  1FHE A;  5CP1 A;  4BWS A;  3HD5 A;  4ILF A;  2PMT A;  1Z9H A;  2PBJ A;  4MJA A;  1SL2 B;  3CRU A;  4WBJ A;  4ZL8 A;  1BYE A;  3DVX A;  5D93 A;  3R2Q A;  3S9F A;  1ZYE A;  3D4M A;  5B6N A;  4KND A;  4L0W A;  2MZC A;  3HZ4 A;  1V98 A;  5ECN B;  2CT6 A;  4EUY A;  3KTL A;  3L9S A;  4LLR A;  2ZCT A;  4NXI A;  2GST A;  2GQL A;  4DSR A;  3FW2 A;  5J3R A;  3WGE A;  3LOR A;  1ZYQ B;  4PNG A;  2LKU A;  2CAQ A;  4RI7 A;  2X8H A;  4Q5N A;  4EKZ A;  2CAI A;  1TU8 A;  4YQU A;  1PMT A;  2PGT A;  1HYU A;  2DBC A;  1B8X A;  1T1V A;  1AQW A;  1T00 A;  1H4O A;  5FT3 A;  4V2N A;  4V1A g;  1K0A A;  5ECQ B;  1OC8 A;  4KA0 A;  1OYJ A;  4EDZ A;  3FKF A;  4YAP A;  2LRT A;  3HKR A;  1MDI A;  5CRE A;  1T8E B;  4JZQ A;  1Z6M A;  3FK8 A;  2JL4 A;  3GRX A;  1YQ1 A;  1XXU A;  4IW9 A;  1PRX A;  1NW2 A;  3TB2 A;  2WRT A;  4N11 A;  1ACV A;  2LNT A;  3N9J A;  3HYP A;  4G19 A;  1EV9 A;  3IA1 A;  2C0D A;  2MMZ A;  3C8E A;  1WIK A;  3IAM 2;  3A3T A;  4ZXG A;  2WDU A;  1QMV A;  2GS3 A;  4F0B A;  3Q74 A;  2IN3 A;  5J41 A;  4ZB8 A;  2H66 A;  3FY7 A;  1RW1 A;  2OA7 A;  3L78 A;  3IR4 A;  7GSS A;  5LNK e;  3UBK A;  3LXZ A;  3QAV A;  1GP1 A;  5D96 A;  3IBH A;  5ABR A;  5HR1 A;  2HRF A;  3C71 A;  2IMF A;  3TRP A;  2VUP A;  2IMD A;  1URM A;  1MD4 A;  4X1U A;  4Q5F A;  3CTG A;  3L4N A;  2FA8 A;  4L0U A;  3GKK A;  1VF2 A;  1DSB A;  2VIM A;  4XHM A;  5IIZ A;  4RI6 A;  4CHS A;  3CSH A;  3TOU A;  4FYU A;  3GH6 A;  5ENU A;  1R4W A;  4NHZ A;  2LJK A;  2H6Z A;  2NTO A;  6GSU A;  3GMF A;  2H8L A;  4MF7 A;  2AUV A;  3W6G A;  1G7O A;  4JE1 A;  4MH2 A;  5JCG A;  2VAF A;  1QQ2 A;  2EIR A;  4L5L A;  1K0C A;  3DD3 A;  1FOV A;  4V2M A;  1GSY A;  1ZCP A;  1TRW A;  5IQY A;  5DAK A;  4HQS A;  3ERW A;  2HSH A;  1XWA A;  1BED A;  1S3C A;  3GST A;  1T4Y A;  5G2Z A;  1ZZY A;  1F6M C;  1AQV A;  1NHO A;  4HZ4 A;  3CTF A;  4V1A p;  16GS A;  2HSN B;  1WOU A;  1WP0 A;  3IXR A;  2WB9 A;  1BX9 A;  1AAZ A;  4KDX A;  2DJJ A;  3A2W A;  4GXZ A;  1R5P A;  2K8S A;  2VL2 A;  2XPD A;  3VI7 A;  3KZQ A;  5G1K A;  2IMK A;  1Z3E A;  4IKH A;  1R26 A;  1I9D A;  4D73 A;  3TOT A;  1HD2 A;  3UVT A;  2HRK A;  1WJK A;  2LNS A;  2LUS A;  1OKT A;  1TK5 B;  1HQO A;  2GTU A;  3LQ7 A;  4G10 A;  3C73 A;  4PUR A;  4MF6 A;  2RM6 A;  1OAZ A;  2FWF A;  3CSI A;  4K2D A;  1U87 A;  2YOI A;  1K3Y A;  1PX7 A;  1X0R A;  2GQK A;  3LEF A;  3HVS A;  2LQO A;  1V2A A;  3Q18 A;  2WJU A;  3MDK A;  3TKS E;  2I9H A;  1GTI A;  3APS A;  5GAN D;  3M1G A;  4EE0 A;  3RBT A;  2FUG 2;  2WS2 A;  2LRN A;  4F2I A;  3F4R A;  1XBS A;  3RHC A;  1A24 A;  5DAK B;  2X8G A;  1RQM A;  5DQY A;  3EIN A;  2R3X A;  4WF4 A;  5ELG A;  5DQS A;  3ZVJ A;  4XRD A;  1K3L A;  5CAX A;  2QKE A;  4NWY A;  1USB A;  3IC4 A;  3UL3 A;  4EVM A;  2JZS A;  1GSE A;  1Y6E A;  1EP8 A;  3VWV A;  5G31 A;  1F37 A;  5G5F A;  4PQ1 A;  2RLI A;  1I5G A;  2FLS A;  2FHE A;  2TRX A;  4GCI A;  3KXO A;  4LMW A;  1GUL A;  4N0Z A;  3F63 A;  3GFK A;  2CA8 A;  2TRC P;  1X5E A;  4YH2 A;  5ID2 B;  1KNG A;  1THO A;  3ZZX A;  4D73 B;  4IEL A;  4F0C A;  3G9B A;  4ZIL A;  3TKR A;  2CVD A;  1YZX A;  4XS4 A;  2FWE A;  5B7C A;  2B5E A;  3KH9 A;  3O6T A;  3TKS A;  3ZYW A;  1XVQ A;  2JZT A;  3M9K A;  2D2Z A;  1ERW A;  1IYI A;  3ZFL A;  3BBY A;  3KMO A;  2GVP A;  3E9J B;  3KGK A;  2YJH A;  4ZBD A;  3UVH A;  2WUL A;  1O73 A;  4TW5 A;  1UC7 A;  1XW9 A;  1C72 A;  2E0Q A;  5EY6 A;  3HJP A;  4OFT A;  2YWN A;  3US3 A;  1BAY A;  4RQX A;  4AF2 A;  4XIH A;  2E2G A;  3GIX A;  1JFU A;  1F2E A;  4OFM A;  4ZBB A;  2K8V A;  2BTO T;  5JCU A;  2HSM A;  1QUW A;  3VPT A;  1XVW A;  4K1F A;  1O85 A;  1BQ7 A;  2DIY A;  4POL A;  3QOU A;  5CNW A;  4BVX B;  2GT5 A;  5IM9 A;  2XBI A;  1IYH A;  2BMX A;  4I8B A;  1X5D A;  1LU4 A;  3W8S A;  1PL2 A;  1ST9 A;  2G2Q A;  3DRN A;  1PD2 1;  4WET A;  4KF9 A;  5J4U A;  4K7O A;  2N5A A;  2X64 A;  3G7J A;  1UA5 A;  5F07 A;  1MEK A;  2CZ2 A;  3LFL A;  1YJ6 A;  4DSS A;  4ID0 A;  2MMO A;  4MZC A;  4AJ6 A;  2OBK A;  1K3O A;  1Y25 A;  2RII A;  3VWW A;  5FHI A;  4XRA A;  3FHK A;  1MTC A;  2ZNM A;  4MPG A;  5A4W A;  4X43 A;  4IS0 A;  4HI7 A;  4I97 A;  1M2D A;  1SKS B;  1M99 A;  2C3N A;  2H01 A;  3F0I A;  3F4S A;  5ECO B;  1T7P B;  1JZR A;  5KN1 A;  4OFN A;  2L4Q A;  3TKQ A;  4OD7 A;  1ILO A;  4V2L A;  1AUC A;  5A4U A;  1F3B A;  1VGL A;  6GSY A;  2H74 A;  5HFK A;  5EPF A;  2HSM B;  3QR6 A;  2GZY A;  4HDE A;  2FY6 A;  1BG5 A;  2TIR A;  3VUR A;  4X0X A;  2HFD A;  2YWM A;  4IGJ A;  3LXT A;  4G0L A;  1FVK A;  1Q98 A;  2YWO A;  1K0N A;  3NOF A;  3F6D A;  2PU9 C;  1K0M A;  1FVJ A;  3FZ5 A;  4BWQ A;  1TTZ A;  4TXO A;  1GSD A;  1TOF A;  2J9H A;  3F3R A;  2YNX A;  3ZIV A;  4NMU A;  2EIO A;  3UBL A;  2JSZ A;  3J7Y k;  3DKS A;  4HQZ A;  5H5S A;  2ES7 A;  5IMA A;  1ZGN A;  4DSS B;  4GSS A;  1MDJ A;  5DBQ A;  2BJX A;  3LYK A;  3L9U A;  4H86 A;  3EE2 A;  5DCH A;  1GH2 A;  2QSI A;  4WF5 A;  3GNJ A;  2GLR A;  1Z5Y E;  4LMV A;  3KJY A;  1M9B A;  1A2M A;  3D21 A;  1LJR A;  1A8Y A;  1O8X A;  3ZRE A;  3HJO A;  3GX8 A;  3KEB A;  2RUE A;  1EGO A;  4O92 A;  4K7N A;  5IPG A;  1TK8 B;  4WR4 A;  2L5L A;  5GSS A;  4ZBA A;  3H8Q A;  1GUM A;  1XPV A;  2J23 A;  2HYX A;  3I6A A;  2IFQ A;  2LRC A;  2B5X A;  1M2A A;  2VL3 A;  5C04 A;  4G0K A;  4PQI A;  2LST A;  2DC5 A;  4MAB A;  4MLY A;  1ERV A;  3SWL A;  3RDW A;  4I6X A;  4G0I A;  1A2L A;  5INY A;  5KN0 A;  1SJI A;  4TR4 A;  3TKP A;  4TXO B;  1TKD B;  3GUR A;  3FEU A;  1GRX A;  1VF4 A;  4JR4 A;  2AV4 A;  3D0Z A;  1ERT A;  1O81 A;  3GHA A;  1ABA A;  2B7K A;  2LV3 A;  4MH3 A;  2DML A;  2HQT A;  2CX3 A;  3LSZ A;  2XPE A;  4JED A;  2X99 A;  3H93 A;  1SK0 A;  2R6K A;  2FWH A;  2P0G A;  1SD8 A;  4XCS A;  2H0I A;  4BL7 A;  4E8E A;  3NZN A;  6GSS A;  2P5R A;  2K9F A;  5E4W A;  2XHF A;  1CQH A;  3EU3 A;  18GS A;  4HJ2 A;  1VRS D;  4FYC A;  3LYP A;  2A4V A;  4QQ7 A;  5CRG A;  2GSR A;  2VL2 C;  4MK3 A;  5KN3 A;  3D4T A;  4PGT A;  4N10 A;  5IOW A;  1S3A A;  5IMZ A;  3H4K A;  3EMP A;  1FAA A;  1U88 A;  1JZW A;  3TJJ A;  3ZLP A;  1SJ6 A;  1SYR A;  1PQN A;  5EVO A;  3I43 A;  2DJ3 A;  2B7J A;  3NIV A;  5AN1 A;  4EXJ A;  3DEX A;  3TRX A;  4K0G A;  1CQG A;  4KUN A;  4EF0 A;  2IFQ B;  14GS A;  1EZK A;  2JAC A;  5IO0 A;  4FO5 A;  4KGI A;  2O89 A;  2OAD A;  2IL3 A;  2F3M A;  5B8B A;  3EWL A;  3QFB C;  1SKR B;  4GQF A;  4HUA A;  2VO4 A;  1G6W A;  1E2Y A;  1JLW A;  3UEM A;  1KEB A;  1XWB A;  4GLT A;  3V1W A;  4FH8 A;  5FWG A;  3QFA C;  2I3Y A;  4ZL9 A;  3APQ A;  3C7M A;  3D6I A;  5AGY A;  1K0D A;  3WYW A;  1T4Z A;  4Q5Q A;  5IO2 A;  1HNC A;  5KEJ A;  3IRA A;  1TXX A;  4BL7 B;  1AQX A;  4ECI A;  2L4C A;  3U6V A;  4L5O A;  4CDO A;  5DJM A;  2C80 A;  4BA7 A;  3Q19 A;  2GSQ A;  4JR6 A;  2VLT A;  1GTA A;  2I4A A;  2H1B A;  1PKZ A;  3G7I A;  3M3M A;  1V9W A;  2XC2 A;  3RPP A;  1OKD A;  4YAV A;  3FZA A;  4KCE A;  3ME8 A;  3TJG A;  5ID2 A;  1QK8 A;  2H1G A;  4AJ8 A;  1PA3 A;  4ECB A;  2L6C A;  3ERF A;  4P3Y B;  2YP6 A;  1SK1 A;  4YQM A;  6GSW A;  2LJR A;  4F03 A;  4ULX A;  3TKS C;  4ISD A;  5IPH A;  5F06 A;  4HJM A;  2H0H A;  1AW9 A;  1PX6 A;  3DIE A;  3F3Q A;  3BOA A;  4KB3 A;  3ZML A;  2YZH A;  2GZZ A;  4AJ7 A;  1OE7 A;  4HZ2 A;  1GNW A;  2H70 A;  1KTE A;  4GQC A;  1QGV A;  2DJ2 A;  2E2M A;  4I2T A;  1XIY A;  2HNL A;  5GST A;  5C00 A;  3ZTL A;  4TR0 A;  1TW9 A;  3R3E A;  3N5O A;  1Z6N A;  1QXH A;  1G7E A;  2VCT A;  2H76 A;  4N30 A;  4GRF A;  5CO3 A;  1UN2 A;  5JCW A;  2C8U A;  3CBU A;  1DE1 A;  1HNB A;  1V58 A;  4WKW A;  3BCI A;  1YKC A;  3P90 A;  2G0F A;  5D9W A;  4BVX A;  4OO4 A;  3CSJ A;  3GL3 A;  3KTB A;  4I2U A;  3TGZ A;  1M9A A;  4JU5 A;  4OWY A;  5IMF A;  4ACS A;  2JU5 A;  4KW6 A;  3KP8 A;  1G6Y A;  3GTU A;  1SJZ A;  1TI1 A;  1PN9 A;  2C0G A;  2GSS A;  5JWQ B;  2B5Y A;  1PL1 A;  2ON5 A;  4USS A;  3ZIT A;  3APO A;  3F9U A;  2DIZ A;  1EP7 A;  5D9X A;  2HRA A;  3O3T A;  2V6O A;  2C0E A;  4EC0 A;  2OKA A;  3KH7 A;  3IAS 2;  1X5C A;  4ECJ A;  4N0V A;  3E3E A;  2KOK A;  6GSX A;  4MDC A;  3ZVJ D;  2MMN A;  1TRS A;  4O5R A;  5LD0 A;  2F8A A;  4XTS A;  4F9Z A;  1QFN A;  3QPM A;  4PUF C;  3GKN A;  2NBS A;  3ZRD A;  1BJX A;  2H6X A;  2JSY A;  1ZL9 A;  5LCZ A;  2DJ0 A;  5GAP D;  2HE3 A;  2QGV A;  5ECR B;  3GKX A;  3U5R E;  4ZL7 A;  19GS A;  3PR8 A;  2HI7 A;  3TDG A;  4O7H A;  3TJK A;  3UAP A;  2VM1 A;  3VPQ A;  4NPB A;  5ECM B;  1DE2 A;  5ECP B;  4DSQ A;  1LBK A;  1PKW A;  4LL1 B;  5HR2 A;  4NHW A;  2WGR A;  2F51 A;  2VD1 A;  1YEX A;  2AHE A;  1N8J A;  1ZOF A;  1YDK A;  1JZD A;  1YY7 A;  3DML A;  2H30 A;  1JHB A;  2OJL A;  3GTU B;  2L57 A;  5EL8 A;  2A2R A;  2YV9 A;  2L59 A;  1YF1 A;  1TRV A;  2MYG A;  2YPM A;  2LQQ A;  6GSV A;  2WFC A;  1GSS A;  13GS A;  2M72 A;  2REM A;  3DYR A;  2DSA A;  3IDV A;  1YKA A;  3M0F A;  3IPZ A;  2V41 A;  4XS1 A;  3P2A A;  2PWJ A;  2EC4 A;  4FQU A;  2IME A;  3BCK A;  3DVW A;  3KIJ A;  1V40 A;  2CX4 A;  2KP1 A;  2KP2 A;  5D73 A;  4PX1 A;  2H1D A;  3J7Y b;  1AIU A;  2ALB A;  2KHP A;  3IK7 A;  1RK4 A;  3ZL5 A;  3MAK A;  3UOM A;  3WGX A;  4IQA A;  4KSO A;  5KN2 A;  3P7X A;  1EOH A;  1U3I A;  3P8W A;  4IN0 A;  3TJF A;  3TUE A;  1SD9 A;  4HU7 A;  2C1Y A;  4Q5R A;  5CRD A;  5HR3 A;  2FD3 A;  1EWX A;  4TN8 A;  10GS A;  1EGR A;  2F9S A;  5GZZ B;  2IMI A;  3QAW A;  3GN3 A;  3MNG A;  2GDR A;  1J9B A;  1A8L A;  17GS A;  4G2E A;  4ZB9 A;  2I81 A;  2H0G A;  1ERU A;  3DXB A;  1G0T A;  3GSS A;  2V1M A;  1WMJ A;  2CVB A;  4G9H A;  1XFL A;  1OE8 A;  1EV4 A;  3VWX A;  3D22 A;  2VCW A;  8GSS A;  4E8H A;  2GGT A;  2P5Q A;  4KCA A;  3L9V A;  5F8B A;  1GSF A;  3GX0 A;  2HSY A;  2O8V B;  3CRT A;  4J57 E;  1Q4J A;  3PH9 A;  4TR1 A;  1SKW B;  5CYY A;  1GLP A;  2YZU A;  5JWR B;  4XS6 A;  5DDL A;  2C3Q A;  4BVY A;  1OC9 A;  2JAD A;  2FCH A;  5E59 A;  3EUR A;  5ELA A;  1TU7 A;  2GZP A;  4YQV A;  1JLV A;  1THX A;  3PPU A;  1JZO A;  2L5O A;  2NVL A;  4EO3 A;  3H1N A;  2VM2 A;  5F05 A;  5H5Q A;  3QAG A;  5HFI A;  4ZB6 A;  3JCM L;  4JRR A;  3IE3 A;  5J5N A;  1TJD A;  2ON7 A;  3IHQ A;  4IBP A;  2B6M A;  1F9M A;  3FR3 A;  1XWK A;  2OE1 A;  2NPB A;  3A2V A;  12GS A;  2JZR A;  3IV4 A;  2NDO A;  3EYT A;  3FR9 A;  1Z7R A;  3ZMK A;  2R4V A;  2K18 A;  5CRW A;  2YAN A;  4NV2 A;  3A2X A;  4KDU A;  2C4J A;  4MPF A;  2HZF A;  3KMN A;  2N5F A;  1GTB A;  2OE0 A;  4K9Z A;  2DMM A;  4BPY A;  4IP6 A;  2FGX A;  4J56 E;  2FA4 A;  2OAC A;  4K8M A;  4WBR D;  1ML6 A;  2OBI A;  4GTU A;  4GSN A;  1H75 A;  3VLN A;  4K7I A;  5HFG A;  1WPI A;  1WE0 A;  4TR1 B;  3I69 A;  1DUG A;  5B6M A;  4KH7 A;  5IMC A;  4BVY B;  1OC9 B;  2B1L A;  2H75 A;  1ON4 A;  5B8A A;  1O7U A;  3HJM A;  4WXT A;  4WEY A;  2VLU A;  5HR0 A;  3UIW A;  4PTS A;  2DLX A;  3FRC A;  1YEP A;  3HVX A;  3TJB A;  4IJI A;  1GLQ A;  2VL9 A;  2IWT A;  3RPN A;  4IQ1 A;  4K6X A;  1NSW A;  3GH9 A;  2IIY A;  3LGC A;  4OCF A;  2A2S A;  4FIW A;  2O7K A;  2PN8 A;  3IOS A;  4ECC A;  1B9Y C;  2IJY A;  3CYN A;  2B1K A;  4KX4 A;  1O8W A;  4RQR A;  4HS1 A;  3HY2 A;  1EEM A;  6GST A;  4HOJ A;  1B48 A;  3WT1 A;  3O76 A;  1V57 A;  2MBT A;  1DBY A;  4IJ3 A;  3DGQ A;  3FYG A;  1GUH A;  4PQH A;  3FZ4 A;  2VCV A;  1XWC A;  5L71 A;  3ERG A;  3QMX A;  3ME7 A;  4MF5 A;  2LTK A;  1TK0 B;  1FW1 A;  2H6Y A;  2E7P A;  3GL5 A;  1GL8 A;  3TCO A;  3AY8 A;  2VCQ A;  2C3T A;  4PUA A;  3PIN A;  4TRX A;  2HRN A;  2AJQ B;  4TR3 A;  3C1S A;  1VF1 A;  2HT9 A;  4POB A;  1MD3 A;  3C1R A;  4MZW A;  3PGT A;  4DEJ A;  1SL0 B;  1X9W B;  1EOG A;  2YV7 A;  1XW5 A;  3EU4 A;  4TXV A;  3GV1 A;  1GSQ A;  3LG6 A;  1FG4 A;  1GWC A;  2R37 A;  2RUF A;  2AB6 A;  4GWR A;  4MMM A;  1K0B A;  5IMV A;  4J2F A;  2P31 A;  2UZ8 A;  2R5G A;  3HCZ A;  5ECL B;  5D9T A;  4OO5 A;  3EC3 A;  4POK A;  2V6K A;  3IC8 A;  3W8J A;  2O87 A;  1YF0 A;  1E6B A;  2MMA A;  1AC1 A;  2WCI A;  3LJR A;  3FR6 A;  3IK9 A;  3RAZ A;  1T3B A;  2YCD A;  2DJ1 A;  1XZO A;  1TDI A;  3QD9 A;  2R2J A;  2VCZ A;  4GF0 A;  3EVI A;  20GS A;  3CMI A;  1SYX A;  5J9C A;  1GTU A;  1NHY A;  4TOP A;  3WT2 A;  4MJC A;  4FYB A;  3MWH A;  3QCP A;  2H1A A;  2ZUP A;  1HNA A;  3A5W A;  3L0H A;  4EL1 A;  2Z9S A;  1XOA A;  3UMA A;  1X9M B;  1N2A A;  3LWA A;  4MP4 A;  2RM5 A;  5ECS A;  1FO5 A;  3WD6 A;  1F3A A;  5J9B A;  1SEN A;  1UVZ A;  4KAE A;  2B3S A;  3K8N A;  3ZFB A;  4KSM A;  2PUK C;  3F4T A;  3GKM A;  2WZ9 A;  1B4P A;  2IPA A;  2HZE A;  4TKY A; 
#chains in the Genus database with same CATH topology
 3MYD A;  2H19 A;  1XWG A;  4PI2 C;  3GYK A;  4MZB A;  3EMX A;  3WGD A;  1M2B A;  2V32 A;  1A2J A;  1TI3 A;  1EEJ A;  1XCC A;  3QDN A;  4AGS A;  5ECI B;  4RUV A;  2VCX A;  2V2G A;  1XOB A;  5AIS A;  2GT6 A;  1M0U A;  1WWJ A;  3KD0 A;  4IVF A;  5CRH A;  2C0F A;  1MDK A;  4F82 A;  2CV4 A;  3VWU A;  4DVC A;  1K0O A;  4OMV A;  1FB0 A;  1Z7P A;  11GS A;  3E0U A;  4MJB A;  2X8C A;  2PER A;  2HRK B;  2DJK A;  2MBS A;  2OE3 A;  1U6T A;  4I5Q A;  9GSS A;  1O6J A;  2HLS A;  3DWV A;  4LA1 A;  2CZ3 A;  2YJ7 A;  5IOX A;  4NAX A;  1SL1 B;  1B4Q A;  2FNO A;  4JBB A;  3GUS A;  3M9J A;  4MCU A;  1AXD A;  5DAL A;  1A23 A;  2M80 A;  2A4H A;  5G30 A;  5ECH B;  2XBQ A;  2VD0 A;  3G7Y A;  3HDC A;  3BJ5 A;  3HHV A;  1R7H A;  3BD2 A;  2O36 A;  3F6F A;  3ZIJ A;  1SK2 A;  4K0N A;  3UAR A;  4HEA 2;  22GS A;  3TRQ A;  2PVQ A;  4GST A;  2HZE B;  2PPT A;  5JWO B;  4O32 A;  4ZIJ A;  2H73 A;  3ISO A;  5DJL A;  2AYT A;  3F8U A;  3UJ1 A;  2YN1 A;  1FB6 A;  4IP1 A;  3VFI A;  1OC3 A;  4QL7 A;  3ED3 A;  2H71 A;  4CY6 A;  4MJE A;  2FWG A;  1W4V A;  5DCG A;  4QL9 A;  4OCE A;  2CVK A;  1A0R P;  5G5E A;  1GNE A;  4E68 A;  2L6D A;  2CQ9 A;  1PSQ A;  1BF5 A;  1GSU A;  1VF3 A;  2I1U A;  5D8I A;  5A5K A;  1M7T A;  1KBN A;  1B9X C;  2VOC A;  1TRU A;  3M8N A;  4LL4 B;  5BMU A;  1WRY A;  2KLX A;  5HQP A;  2LJA A;  4XS4 B;  3GA4 A;  2GQM A;  4IHU A;  4L8E A;  2M46 A;  4WR5 A;  1W89 A;  3H79 A;  2K6V A;  3HVV A;  1NM3 A;  3SBC A;  2VLV A;  5ECK B;  1J0F A;  5DAL B;  3RHB A;  1U3A A;  2LEG A;  4KE3 A;  3Q6O A;  5D9V A;  1PGT A;  4PNF A;  2F8F A;  1J08 A;  2QC7 A;  4ML6 A;  3CXG A;  4CW9 A;  2PVO C;  5IMD A;  4TVE A;  1SU9 A;  1M3J A;  4NV5 A;  3HA9 A;  5AIV A;  5H5R A;  5A4V A;  2YWI A;  3FZ9 A;  2KUC A;  2LS5 A;  1ZMA A;  1S3D A;  4PXO A;  4KDY A;  5COH A;  4Z7X A;  4EDY A;  3MSZ A;  3HXS A;  4K2X A;  3KCM A;  3VK9 A;  3I9V 2;  1A0F A;  2AAW A;  2H72 A;  4ML1 A;  1GUK A;  2N5B A;  2O85 A;  3HZ8 A;  4POM A;  3VI5 A;  5AIX A;  3OR5 A;  5DVB A;  3KP9 A;  4MA9 A;  3KM6 A;  4HU9 A;  2HXK A;  1X9S B;  5G1L A;  2EIQ A;  1YEW C;  3D5J A;  5F0G A;  1R5A A;  1OVN A;  1XW6 A;  1TP9 A;  1FHE A;  5CP1 A;  4BWS A;  3HD5 A;  4ILF A;  2PMT A;  1Z9H A;  2PBJ A;  4MJA A;  1SL2 B;  3CRU A;  4WBJ A;  1SVL A;  4ZL8 A;  1BYE A;  3DVX A;  5D93 A;  3R2Q A;  3S9F A;  1ZYE A;  3D4M A;  5B6N A;  4KND A;  4L0W A;  4FXY P;  2MZC A;  3HZ4 A;  1V98 A;  5ECN B;  2CT6 A;  1PFO A;  4EUY A;  3KTL A;  3L9S A;  4LLR A;  2ZCT A;  4NXI A;  2GST A;  2GQL A;  4DSR A;  3FW2 A;  5J3R A;  3WGE A;  3LOR A;  1ZYQ B;  4PNG A;  2LKU A;  4Z2T A;  2CAQ A;  4RI7 A;  2X8H A;  2R0G A;  4Q5N A;  4EKZ A;  2CAI A;  1TU8 A;  4YQU A;  1PMT A;  2PGT A;  1HYU A;  2DBC A;  1B8X A;  1T1V A;  1AQW A;  1T00 A;  1H4O A;  5FT3 A;  4V2N A;  4V1A g;  1K0A A;  5ECQ B;  1OC8 A;  4KA0 A;  1OYJ A;  4EDZ A;  3FKF A;  4YAP A;  2LRT A;  3HKR A;  1MDI A;  5CRE A;  1T8E B;  4JZQ A;  1Z6M A;  3FK8 A;  2JL4 A;  3GRX A;  1YQ1 A;  1XXU A;  4IW9 A;  1PRX A;  1NW2 A;  3TB2 A;  2WRT A;  4N11 A;  1ACV A;  2QA2 A;  2LNT A;  3N9J A;  3HYP A;  4G19 A;  1EV9 A;  1PN0 A;  3IA1 A;  2C0D A;  2MMZ A;  4HSC X;  2DKH A;  3C8E A;  1WIK A;  3IAM 2;  3A3T A;  4ZXG A;  2WDU A;  1QMV A;  2GS3 A;  4F0B A;  3Q74 A;  2IN3 A;  5J41 A;  4ZB8 A;  2H66 A;  3FY7 A;  1RW1 A;  2OA7 A;  3L78 A;  3IR4 A;  7GSS A;  5LNK e;  3UBK A;  3LXZ A;  3QAV A;  1GP1 A;  5D96 A;  3EPT A;  3IBH A;  4AKH A;  5ABR A;  5HR1 A;  2HRF A;  3C71 A;  2IMF A;  3TRP A;  2VUP A;  1N25 A;  1URM A;  2IMD A;  1MD4 A;  4X1U A;  4Q5F A;  3CTG A;  3L4N A;  2R0C A;  2FA8 A;  4L0U A;  3GKK A;  1VF2 A;  1DSB A;  2VIM A;  4XHM A;  5IIZ A;  4RI6 A;  4CHS A;  3CSH A;  1SVM A;  3TOU A;  4FYU A;  3GH6 A;  5ENU A;  1R4W A;  4NHZ A;  2LJK A;  2H6Z A;  2NTO A;  6GSU A;  3GMF A;  2H8L A;  4MF7 A;  2AUV A;  3W6G A;  1G7O A;  4JE1 A;  4MH2 A;  5JCG A;  2VAF A;  1QQ2 A;  2EIR A;  4L5L A;  1K0C A;  3DD3 A;  2EFE A;  1FOV A;  2EFH A;  5BRT A;  4V2M A;  1GSY A;  1ZCP A;  1TRW A;  5IQY A;  5DAK A;  4HQS A;  3ERW A;  2HSH A;  1XWA A;  1BED A;  1S3C A;  3GST A;  1T4Y A;  5G2Z A;  1ZZY A;  1F6M C;  3MIX A;  1AQV A;  1NHO A;  4HZ4 A;  3CTF A;  4V1A p;  16GS A;  2HSN B;  1WOU A;  1S4B P;  1WP0 A;  3IXR A;  5J4Y A;  2WB9 A;  1XG8 A;  1BX9 A;  1AAZ A;  4KDX A;  2DJJ A;  3A2W A;  4GXZ A;  1R5P A;  2K8S A;  2EFD A;  2VL2 A;  2XPD A;  3VI7 A;  3KZQ A;  5G1K A;  2IMK A;  1Z3E A;  4IKH A;  1R26 A;  4O5U A;  1I9D A;  4D73 A;  3TOT A;  1HD2 A;  3UVT A;  2HRK A;  1WJK A;  2LNS A;  2LUS A;  1OKT A;  1TK5 B;  1HQO A;  2GTU A;  1ZYP A;  3LQ7 A;  4G10 A;  3C73 A;  4PUR A;  4MF6 A;  2RM6 A;  1OAZ A;  2FWF A;  3CSI A;  4K2D A;  1U87 A;  2YOI A;  4AKG A;  1K3Y A;  1PX7 A;  1X0R A;  2GQK A;  3LEF A;  3HVS A;  2LQO A;  1V2A A;  3Q18 A;  2WJU A;  3MDK A;  3TKS E;  2I9H A;  1GTI A;  3APS A;  5GAN D;  3M1G A;  1S3R A;  4EE0 A;  3RBT A;  2FUG 2;  2WS2 A;  2LRN A;  4F2I A;  3F4R A;  1XBS A;  2WW0 A;  3RHC A;  1A24 A;  5DAK B;  2X8G A;  1RQM A;  5DQY A;  3EIN A;  4Z2R A;  2R3X A;  4WF4 A;  5ELG A;  5DQS A;  3ZVJ A;  4XRD A;  1K3L A;  5CAX A;  2QKE A;  4NWY A;  1USB A;  3IC4 A;  3UL3 A;  4EVM A;  2JZS A;  1GSE A;  1Y6E A;  1EP8 A;  3VWV A;  5G31 A;  1F37 A;  5G5F A;  4PQ1 A;  2RLI A;  1I5G A;  2FLS A;  2FHE A;  2TRX A;  4GCI A;  3KXO A;  4LMW A;  1GUL A;  4N0Z A;  3F63 A;  3GFK A;  2CA8 A;  2TRC P;  1X5E A;  4YH2 A;  5ID2 B;  3RFR C;  1KNG A;  1THO A;  3ZZX A;  4D73 B;  4IEL A;  4F0C A;  3G9B A;  4ZIL A;  3TKR A;  2CVD A;  1YZX A;  4CY8 A;  4XS4 A;  2FWE A;  5J40 A;  5B7C A;  2B5E A;  3KH9 A;  3O6T A;  3TKS A;  3ZYW A;  1XVQ A;  2O3E A;  2JZT A;  2D2Z A;  3M9K A;  1ERW A;  1IYI A;  3ZFL A;  3BBY A;  3KMO A;  2GVP A;  3E9J B;  3KGK A;  2YJH A;  4ZBD A;  3UVH A;  2WUL A;  1O73 A;  4TW5 A;  1UC7 A;  1XW9 A;  1C72 A;  2E0Q A;  5EY6 A;  3HJP A;  4OFT A;  2YWN A;  3US3 A;  1BAY A;  4RQX A;  4AF2 A;  4XIH A;  2E2G A;  4ICY A;  3GIX A;  1JFU A;  1F2E A;  4OFM A;  4ZBB A;  2K8V A;  2BTO T;  5JCU A;  2HSM A;  1QUW A;  3VPT A;  1XVW A;  4K1F A;  1O85 A;  1BQ7 A;  2DIY A;  4POL A;  3QOU A;  5CNW A;  4BVX B;  2GT5 A;  5IM9 A;  2XBI A;  1IYH A;  2BMX A;  4I8B A;  1X5D A;  1LU4 A;  3W8S A;  1PL2 A;  1ST9 A;  2G2Q A;  3DRN A;  1PD2 1;  5A1N A;  4WET A;  4KF9 A;  5J4U A;  4K7O A;  4AI6 A;  2N5A A;  2X64 A;  3G7J A;  1UA5 A;  5F07 A;  1MEK A;  2CZ2 A;  3LFL A;  1YJ6 A;  4DSS A;  4ID0 A;  2MMO A;  4MZC A;  4AJ6 A;  2OBK A;  1K3O A;  1Y25 A;  2RII A;  3VWW A;  5FHI A;  4XRA A;  3FHK A;  4ZB7 A;  1MTC A;  2ZNM A;  4MPG A;  5A4W A;  4X43 A;  4IS0 A;  4HI7 A;  4I97 A;  1M2D A;  1SKS B;  4YKF A;  1M99 A;  2C3N A;  2H01 A;  3F0I A;  3F4S A;  5ECO B;  1T7P B;  1JZR A;  5KN1 A;  4OFN A;  2L4Q A;  3TKQ A;  4OD7 A;  1ILO A;  4V2L A;  1AUC A;  5A4U A;  1F3B A;  1VGL A;  6GSY A;  2H74 A;  5HFK A;  5EPF A;  2HSM B;  3QR6 A;  2GZY A;  4HDE A;  2FY6 A;  1BG5 A;  4BIK A;  4Z2U A;  2TIR A;  3VUR A;  4X0X A;  2HFD A;  2YWM A;  4IGJ A;  3IHG A;  3LXT A;  4G0L A;  1FVK A;  1Q98 A;  2YWO A;  1K0N A;  3NOF A;  3F6D A;  2PU9 C;  4PHZ C;  1K0M A;  1FVJ A;  3FZ5 A;  4BWQ A;  1TTZ A;  4TXO A;  1GSD A;  1TOF A;  2J9H A;  3F3R A;  2YNX A;  5A1N B;  3ZIV A;  4NMU A;  2EIO A;  2H1L A;  3UBL A;  2JSZ A;  3J7Y k;  3DKS A;  4HQZ A;  5H5S A;  2ES7 A;  5IMA A;  1ZGN A;  4DSS B;  4GSS A;  1MDJ A;  5DBQ A;  2BJX A;  3LYK A;  3L9U A;  4H86 A;  5KOW A;  3EE2 A;  1M3I A;  5DCH A;  1GH2 A;  2QSI A;  4WF5 A;  3GNJ A;  2GLR A;  1Z5Y E;  4LMV A;  3KJY A;  1M9B A;  1A2M A;  3D21 A;  1LJR A;  1A8Y A;  1O8X A;  3ZRE A;  3TU3 B;  3HJO A;  3GX8 A;  1Y1U A;  3KEB A;  2RUE A;  1EGO A;  4O92 A;  2WZS A;  4K7N A;  5IPG A;  5A5H A;  1TK8 B;  4WR4 A;  2L5L A;  5GSS A;  4ZBA A;  3H8Q A;  4W66 A;  1GUM A;  4N3Z A;  1XPV A;  2J23 A;  2HYX A;  3I6A A;  2IFQ A;  2O5V A;  2LRC A;  2B5X A;  1M2A A;  2VL3 A;  5C04 A;  4G0K A;  4PQI A;  2LST A;  2DC5 A;  4MAB A;  4MLY A;  1ERV A;  2X4A A;  3SWL A;  3RDW A;  4I6X A;  4G0I A;  1A2L A;  5INY A;  5KN0 A;  1SJI A;  4TR4 A;  3TKP A;  4TXO B;  1TKD B;  3GUR A;  3FEU A;  1TXU A;  1GRX A;  1VF4 A;  4JR4 A;  2QA1 A;  2AV4 A;  3D0Z A;  5A34 A;  1ERT A;  1O81 A;  3GHA A;  1ABA A;  2B7K A;  4YKG A;  2LV3 A;  4MH3 A;  2DML A;  2HQT A;  2CX3 A;  3LSZ A;  2XPE A;  4JED A;  2X99 A;  3H93 A;  1SK0 A;  2R6K A;  2FWH A;  2P0G A;  1SD8 A;  4XCS A;  2H0I A;  4BL7 A;  4E8E A;  3NZN A;  6GSS A;  2HSN A;  2P5R A;  2K9F A;  5E4W A;  2XHF A;  1CQH A;  3EU3 A;  18GS A;  4HJ2 A;  1VRS D;  4FYC A;  3LYP A;  2A4V A;  4QQ7 A;  5CRG A;  2GSR A;  2VL2 C;  4MK3 A;  5KN3 A;  3D4T A;  4PGT A;  4N10 A;  5IOW A;  1S3A A;  5IMZ A;  3H4K A;  3EMP A;  1FAA A;  1U88 A;  4A5P A;  1JZW A;  3TJJ A;  3ZLP A;  2WW1 A;  5A5H B;  1SJ6 A;  1SYR A;  1PQN A;  5EVO A;  3I43 A;  2DJ3 A;  2B7J A;  3NIV A;  5AN1 A;  4EXJ A;  3DEX A;  3LW9 A;  4K0G A;  3TRX A;  1CQG A;  4KUN A;  4EF0 A;  2IFQ B;  14GS A;  1EZK A;  2JAC A;  5IO0 A;  4FO5 A;  4KGI A;  2O89 A;  2OAD A;  2IL3 A;  4GDF A;  2F3M A;  5B8B A;  3EWL A;  3QFB C;  1SKR B;  4GQF A;  3A5I A;  4HUA A;  2VO4 A;  1G6W A;  1E2Y A;  1JLW A;  4G01 A;  3UEM A;  1KEB A;  1XWB A;  4GLT A;  5A34 B;  3V1W A;  2DKI A;  4FH8 A;  5FWG A;  3QFA C;  2I3Y A;  4ZL9 A;  3APQ A;  3C7M A;  3D6I A;  5AGY A;  1K0D A;  3WYW A;  1T4Z A;  4Q5Q A;  5IO2 A;  1HNC A;  5KEJ A;  3IRA A;  1TXX A;  4BL7 B;  1AQX A;  4ECI A;  2L4C A;  3U6V A;  4L5O A;  4CDO A;  5DJM A;  2C80 A;  4BA7 A;  1FOH A;  3Q19 A;  2GSQ A;  4JR6 A;  2VLT A;  1GTA A;  2I4A A;  2H1B A;  1PKZ A;  3G7I A;  3M3M A;  1V9W A;  2XC2 A;  3RPP A;  1OKD A;  4YAV A;  3FZA A;  4KCE A;  3ME8 A;  3TJG A;  5ID2 A;  1QK8 A;  2H1G A;  4AJ8 A;  1PA3 A;  4ECB A;  2L6C A;  3ERF A;  4P3Y B;  2YP6 A;  1SK1 A;  4YQM A;  6GSW A;  2LJR A;  4F03 A;  2X49 A;  4ULX A;  3TKS C;  4ISD A;  5IPH A;  5F06 A;  4HJM A;  2H0H A;  1AW9 A;  1PX6 A;  3DIE A;  3F3Q A;  2UV8 G;  3BOA A;  4KB3 A;  3ZML A;  2YZH A;  2GZZ A;  2VKZ G;  1OE7 A;  4HZ2 A;  4AJ7 A;  1GNW A;  2H70 A;  1KTE A;  4GQC A;  1QGV A;  2DJ2 A;  2E2M A;  4I2T A;  1XIY A;  2HNL A;  5GST A;  5C00 A;  3ZTL A;  4TR0 A;  1TW9 A;  1YVL A;  3R3E A;  5KOX A;  3N5O A;  1Z6N A;  1QXH A;  1G7E A;  2VCT A;  2H76 A;  1ZYN A;  4N30 A;  4GRF A;  5CO3 A;  1UN2 A;  5JCW A;  2C8U A;  3CBU A;  1DE1 A;  1HNB A;  1V58 A;  4WKW A;  3BCI A;  1YKC A;  3P90 A;  2G0F A;  5D9W A;  4BVX A;  4OO4 A;  3CSJ A;  3GL3 A;  3KTB A;  4I2U A;  3TGZ A;  1M9A A;  4JU5 A;  4OWY A;  5IMF A;  1BG1 A;  4ACS A;  2JU5 A;  4KW6 A;  3KP8 A;  1G6Y A;  3GTU A;  4AKX B;  1SJZ A;  1TI1 A;  1PN9 A;  2C0G A;  2GSS A;  5JWQ B;  4EIQ A;  3FMW A;  2B5Y A;  1PL1 A;  2ON5 A;  4USS A;  3ZIT A;  3APO A;  3F9U A;  2DIZ A;  1EP7 A;  5D9X A;  5J4V A;  2HRA A;  3O3T A;  2V6O A;  2C0E A;  4EC0 A;  2OKA A;  3IAS 2;  3KH7 A;  1X5C A;  4ECJ A;  4N0V A;  3E3E A;  2KOK A;  6GSX A;  4MDC A;  3ZVJ D;  2MMN A;  1TRS A;  4O5R A;  5LD0 A;  2F8A A;  4XTS A;  4F9Z A;  1QFN A;  3QPM A;  4PUF C;  3GKN A;  2WVY A;  2NBS A;  3ZRD A;  1BJX A;  2H6X A;  2JSY A;  1ZL9 A;  5LCZ A;  2DJ0 A;  4X4J A;  5GAP D;  3CHX C;  2HE3 A;  2QGV A;  5ECR B;  3GKX A;  3U5R E;  4ZL7 A;  19GS A;  3PR8 A;  2HI7 A;  3TDG A;  4O7H A;  3TJK A;  3UAP A;  2VM1 A;  3VPQ A;  4NPB A;  5ECM B;  2OT3 A;  1DE2 A;  5ECP B;  4DSQ A;  1LBK A;  1PKW A;  4LL1 B;  5HR2 A;  4NHW A;  3CQF A;  2WW3 A;  2WGR A;  2F51 A;  2VD1 A;  1YEX A;  2AHE A;  1N8J A;  1ZOF A;  1YDK A;  1JZD A;  1YY7 A;  4PI0 C;  3DML A;  2H30 A;  1JHB A;  2OJL A;  3GTU B;  4QMK A;  2L57 A;  5EL8 A;  2A2R A;  2YV9 A;  2L59 A;  1YF1 A;  1TRV A;  2MYG A;  2YPM A;  2LQQ A;  6GSV A;  2WFC A;  1GSS A;  13GS A;  2M72 A;  2REM A;  3DYR A;  2DSA A;  3IDV A;  1YKA A;  3M0F A;  3IPZ A;  2V41 A;  4XS1 A;  3P2A A;  2PWJ A;  2EC4 A;  4FQU A;  2IME A;  3BCK A;  3DVW A;  3KIJ A;  1V40 A;  4K5S A;  2CX4 A;  2KP1 A;  2KP2 A;  5D73 A;  4PX1 A;  2H1D A;  3J7Y b;  1AIU A;  2ALB A;  2KHP A;  3IK7 A;  1RK4 A;  3ZL5 A;  3MAK A;  3UOM A;  3WGX A;  4IQA A;  4KSO A;  5KN2 A;  3P7X A;  4EIP A;  1EOH A;  1U3I A;  3P8W A;  4IN0 A;  3TJF A;  3TUE A;  1SD9 A;  4HU7 A;  2C1Y A;  4Q5R A;  5CRD A;  5HR3 A;  2FD3 A;  1EWX A;  4TN8 A;  10GS A;  1EGR A;  4MNN A;  2F9S A;  5GZZ B;  2EFC A;  2IMI A;  3QAW A;  3GN3 A;  2WVZ A;  3MNG A;  2GDR A;  1J9B A;  1A8L A;  17GS A;  4G2E A;  4ZB9 A;  2I81 A;  2H0G A;  1ERU A;  3DXB A;  1G0T A;  3GSS A;  2V1M A;  1WMJ A;  2CVB A;  4G9H A;  1XFL A;  1OE8 A;  1EV4 A;  3VWX A;  3D22 A;  2VCW A;  8GSS A;  4E8H A;  2GGT A;  2P5Q A;  4KCA A;  3L9V A;  5F8B A;  1GSF A;  3GX0 A;  2HSY A;  2O8V B;  3CRT A;  4J57 E;  1Q4J A;  3PH9 A;  4TR1 A;  1SKW B;  5CYY A;  1GLP A;  2YZU A;  5JWR B;  4XS6 A;  5DDL A;  2C3Q A;  4BVY A;  1OC9 A;  2JAD A;  2FCH A;  5E59 A;  3EUR A;  5ELA A;  1TU7 A;  2GZP A;  4YQV A;  1JLV A;  1THX A;  3PPU A;  1JZO A;  2L5O A;  2NVL A;  4EO3 A;  3H1N A;  2VM2 A;  5F05 A;  5H5Q A;  3QAG A;  5HFI A;  4ZB6 A;  3JCM L;  4JRR A;  3IE3 A;  5BMU B;  5J5N A;  1TJD A;  2ON7 A;  3IHQ A;  4IBP A;  2B6M A;  1F9M A;  3FR3 A;  1XWK A;  2OE1 A;  2NPB A;  3A2V A;  12GS A;  2JZR A;  3IV4 A;  2NDO A;  3EYT A;  3FR9 A;  1Z7R A;  3ZMK A;  2R4V A;  2WW2 A;  2K18 A;  5CRW A;  2YAN A;  4NV2 A;  3A2X A;  4KDU A;  2C4J A;  4MPF A;  2HZF A;  3KMN A;  2N5F A;  1GTB A;  2OE0 A;  4K9Z A;  2DMM A;  4BPY A;  4IP6 A;  2FGX A;  4J56 E;  2FA4 A;  2OAC A;  4K8M A;  4WBR D;  1ML6 A;  2OBI A;  4GTU A;  4GSN A;  1H75 A;  3VLN A;  4K7I A;  1I1I P;  1WPI A;  5HFG A;  1WE0 A;  4TR1 B;  3I69 A;  1DUG A;  5B6M A;  4KH7 A;  5IMC A;  3RGB C;  4BVY B;  1OC9 B;  2B1L A;  2H75 A;  1ON4 A;  5B8A A;  1O7U A;  3HJM A;  4WXT A;  4WEY A;  2VLU A;  5HR0 A;  3UIW A;  4PTS A;  2DLX A;  3FRC A;  1YEP A;  3HVX A;  3TJB A;  4IJI A;  1GLQ A;  2VL9 A;  2IWT A;  3HMJ G;  3RPN A;  4IQ1 A;  4K6X A;  1NSW A;  3GH9 A;  2IIY A;  3LGC A;  4OCF A;  2A2S A;  4FIW A;  2O7K A;  2PN8 A;  3IOS A;  4ECC A;  1B9Y C;  2IJY A;  3CYN A;  2B1K A;  3CWG A;  4KX4 A;  1O8W A;  4RQR A;  2WVX A;  4HS1 A;  3HY2 A;  1EEM A;  6GST A;  1SVO A;  4HOJ A;  1B48 A;  3WT1 A;  4K5R A;  3O76 A;  1V57 A;  2MBT A;  1DBY A;  4IJ3 A;  3DGQ A;  3FYG A;  1GUH A;  4PQH A;  3FZ4 A;  2VCV A;  1XWC A;  5L71 A;  3ERG A;  3QMX A;  3ME7 A;  4MF5 A;  2LTK A;  1TK0 B;  1FW1 A;  2H6Y A;  3HVN A;  2E7P A;  3GL5 A;  4AKI A;  3TCO A;  1GL8 A;  3AY8 A;  2VCQ A;  2C3T A;  4PUA A;  3PIN A;  4TRX A;  2HRN A;  2AJQ B;  4TR3 A;  3C1S A;  1VF1 A;  2HT9 A;  4POB A;  1MD3 A;  3C1R A;  4MZW A;  3PGT A;  4DEJ A;  1SL0 B;  1X9W B;  1EOG A;  2YV7 A;  1XW5 A;  3EU4 A;  4TXV A;  3GV1 A;  1GSQ A;  3LG6 A;  1FG4 A;  1GWC A;  2R37 A;  2RUF A;  4O5Q A;  2AB6 A;  4GWR A;  4MMM A;  1K0B A;  5IMV A;  4J2F A;  2P31 A;  2UZ8 A;  2R5G A;  3HCZ A;  5ECL B;  5J47 A;  5D9T A;  4OO5 A;  3EC3 A;  4POK A;  2V6K A;  3IC8 A;  3W8J A;  2O87 A;  1YF0 A;  1E6B A;  2WVX B;  2MMA A;  1AC1 A;  2WCI A;  3LJR A;  3FR6 A;  3IK9 A;  3RAZ A;  1T3B A;  2YCD A;  2DJ1 A;  1XZO A;  1TDI A;  2R2J A;  3QD9 A;  2VCZ A;  4GF0 A;  3EVI A;  20GS A;  3CMI A;  1SYX A;  5J9C A;  1GTU A;  1NHY A;  4TOP A;  3WT2 A;  4MJC A;  4FYB A;  3MWH A;  3QCP A;  2H1A A;  2ZUP A;  1HNA A;  3A5W A;  3L0H A;  4EL1 A;  2Z9S A;  1XOA A;  3UMA A;  1X9M B;  1N2A A;  3LWA A;  4MP4 A;  2RM5 A;  5ECS A;  1FO5 A;  2R0P A;  3WD6 A;  1F3A A;  5J9B A;  2A2P A;  1SEN A;  1UVZ A;  4KAE A;  2B3S A;  3K8N A;  3ZFB A;  4KSM A;  2PUK C;  3F4T A;  3GKM A;  2WZ9 A;  1B4P A;  2IPA A;  2HZE A;  4TKY A; 
#chains in the Genus database with same CATH homology
 3MYD A;  2H19 A;  1XWG A;  3GYK A;  4MZB A;  3EMX A;  3WGD A;  1M2B A;  2V32 A;  1A2J A;  1TI3 A;  1EEJ A;  1XCC A;  3QDN A;  4AGS A;  5ECI B;  4RUV A;  2VCX A;  2V2G A;  1XOB A;  5AIS A;  2GT6 A;  1M0U A;  1WWJ A;  3KD0 A;  4IVF A;  5CRH A;  2C0F A;  1MDK A;  4F82 A;  2CV4 A;  3VWU A;  4DVC A;  1K0O A;  4OMV A;  1FB0 A;  1Z7P A;  11GS A;  3E0U A;  4MJB A;  2X8C A;  2PER A;  2HRK B;  2DJK A;  2MBS A;  2OE3 A;  1U6T A;  4I5Q A;  9GSS A;  1O6J A;  2HLS A;  3DWV A;  4LA1 A;  2CZ3 A;  2YJ7 A;  5IOX A;  4NAX A;  1SL1 B;  1B4Q A;  2FNO A;  4JBB A;  3GUS A;  3M9J A;  4MCU A;  1AXD A;  5DAL A;  1A23 A;  2M80 A;  2A4H A;  5G30 A;  5ECH B;  2XBQ A;  2VD0 A;  3G7Y A;  3HDC A;  3BJ5 A;  3HHV A;  1R7H A;  3BD2 A;  3F6F A;  3ZIJ A;  1SK2 A;  4K0N A;  3UAR A;  4HEA 2;  22GS A;  3TRQ A;  2PVQ A;  4GST A;  2HZE B;  2PPT A;  5JWO B;  4O32 A;  4ZIJ A;  2H73 A;  3ISO A;  5DJL A;  2AYT A;  3F8U A;  3UJ1 A;  2YN1 A;  1FB6 A;  4IP1 A;  3VFI A;  1OC3 A;  4QL7 A;  3ED3 A;  2H71 A;  4CY6 A;  4MJE A;  2FWG A;  1W4V A;  5DCG A;  4QL9 A;  4OCE A;  2CVK A;  1A0R P;  5G5E A;  1GNE A;  4E68 A;  2L6D A;  2CQ9 A;  1PSQ A;  1BF5 A;  1GSU A;  1VF3 A;  2I1U A;  5D8I A;  5A5K A;  1M7T A;  1KBN A;  1B9X C;  2VOC A;  1TRU A;  3M8N A;  4LL4 B;  5BMU A;  1WRY A;  2KLX A;  5HQP A;  2LJA A;  4XS4 B;  3GA4 A;  2GQM A;  4IHU A;  4L8E A;  2M46 A;  4WR5 A;  1W89 A;  3H79 A;  2K6V A;  3HVV A;  1NM3 A;  3SBC A;  2VLV A;  5ECK B;  1J0F A;  5DAL B;  3RHB A;  1U3A A;  2LEG A;  4KE3 A;  3Q6O A;  5D9V A;  1PGT A;  4PNF A;  2F8F A;  1J08 A;  2QC7 A;  4ML6 A;  3CXG A;  4CW9 A;  2PVO C;  5IMD A;  4TVE A;  1SU9 A;  4NV5 A;  3HA9 A;  5AIV A;  5H5R A;  5A4V A;  2YWI A;  3FZ9 A;  2KUC A;  2LS5 A;  1ZMA A;  1S3D A;  4PXO A;  4KDY A;  5COH A;  4Z7X A;  4EDY A;  3MSZ A;  3HXS A;  4K2X A;  3KCM A;  3VK9 A;  3I9V 2;  1A0F A;  2AAW A;  2H72 A;  4ML1 A;  1GUK A;  2N5B A;  2O85 A;  3HZ8 A;  4POM A;  3VI5 A;  5AIX A;  3OR5 A;  5DVB A;  3KP9 A;  4MA9 A;  3KM6 A;  4HU9 A;  2HXK A;  1X9S B;  5G1L A;  2EIQ A;  3D5J A;  5F0G A;  1R5A A;  1OVN A;  1XW6 A;  1TP9 A;  1FHE A;  5CP1 A;  4BWS A;  3HD5 A;  4ILF A;  2PMT A;  1Z9H A;  2PBJ A;  4MJA A;  1SL2 B;  3CRU A;  4WBJ A;  1SVL A;  4ZL8 A;  1BYE A;  3DVX A;  5D93 A;  3R2Q A;  3S9F A;  1ZYE A;  3D4M A;  5B6N A;  4KND A;  4L0W A;  2MZC A;  3HZ4 A;  1V98 A;  5ECN B;  2CT6 A;  4EUY A;  3KTL A;  3L9S A;  4LLR A;  2ZCT A;  4NXI A;  2GST A;  2GQL A;  4DSR A;  3FW2 A;  5J3R A;  3WGE A;  3LOR A;  1ZYQ B;  4PNG A;  2LKU A;  4Z2T A;  2CAQ A;  4RI7 A;  2X8H A;  2R0G A;  4Q5N A;  4EKZ A;  2CAI A;  1TU8 A;  4YQU A;  1PMT A;  2PGT A;  1HYU A;  2DBC A;  1B8X A;  1T1V A;  1AQW A;  1T00 A;  1H4O A;  5FT3 A;  4V2N A;  4V1A g;  1K0A A;  5ECQ B;  1OC8 A;  4KA0 A;  1OYJ A;  4EDZ A;  3FKF A;  4YAP A;  2LRT A;  3HKR A;  1MDI A;  5CRE A;  1T8E B;  4JZQ A;  1Z6M A;  3FK8 A;  2JL4 A;  3GRX A;  1YQ1 A;  1XXU A;  4IW9 A;  1PRX A;  1NW2 A;  3TB2 A;  2WRT A;  4N11 A;  1ACV A;  2QA2 A;  2LNT A;  3N9J A;  3HYP A;  4G19 A;  1EV9 A;  1PN0 A;  3IA1 A;  2C0D A;  2MMZ A;  2DKH A;  3C8E A;  1WIK A;  3IAM 2;  3A3T A;  4ZXG A;  2WDU A;  1QMV A;  2GS3 A;  4F0B A;  3Q74 A;  2IN3 A;  5J41 A;  4ZB8 A;  2H66 A;  3FY7 A;  1RW1 A;  2OA7 A;  3L78 A;  3IR4 A;  7GSS A;  5LNK e;  3UBK A;  3LXZ A;  3QAV A;  1GP1 A;  5D96 A;  3EPT A;  3IBH A;  4AKH A;  5ABR A;  5HR1 A;  2HRF A;  3C71 A;  2IMF A;  3TRP A;  2VUP A;  1N25 A;  1URM A;  2IMD A;  1MD4 A;  4X1U A;  4Q5F A;  3CTG A;  3L4N A;  2R0C A;  2FA8 A;  4L0U A;  3GKK A;  1VF2 A;  1DSB A;  2VIM A;  4XHM A;  5IIZ A;  4RI6 A;  4CHS A;  3CSH A;  1SVM A;  3TOU A;  4FYU A;  3GH6 A;  5ENU A;  1R4W A;  4NHZ A;  2LJK A;  2H6Z A;  2NTO A;  6GSU A;  3GMF A;  2H8L A;  4MF7 A;  2AUV A;  3W6G A;  1G7O A;  4JE1 A;  4MH2 A;  5JCG A;  2VAF A;  1QQ2 A;  2EIR A;  4L5L A;  1K0C A;  3DD3 A;  2EFE A;  1FOV A;  2EFH A;  5BRT A;  4V2M A;  1GSY A;  1ZCP A;  1TRW A;  5IQY A;  5DAK A;  4HQS A;  3ERW A;  2HSH A;  1XWA A;  1BED A;  1S3C A;  3GST A;  1T4Y A;  5G2Z A;  1ZZY A;  1F6M C;  3MIX A;  1AQV A;  1NHO A;  4HZ4 A;  3CTF A;  4V1A p;  16GS A;  2HSN B;  1WOU A;  1WP0 A;  3IXR A;  5J4Y A;  2WB9 A;  1BX9 A;  1AAZ A;  4KDX A;  2DJJ A;  3A2W A;  4GXZ A;  1R5P A;  2K8S A;  2EFD A;  2VL2 A;  2XPD A;  3VI7 A;  3KZQ A;  5G1K A;  2IMK A;  1Z3E A;  4IKH A;  1R26 A;  4O5U A;  1I9D A;  4D73 A;  3TOT A;  1HD2 A;  3UVT A;  2HRK A;  1WJK A;  2LNS A;  2LUS A;  1OKT A;  1TK5 B;  1HQO A;  2GTU A;  1ZYP A;  3LQ7 A;  4G10 A;  3C73 A;  4PUR A;  4MF6 A;  2RM6 A;  1OAZ A;  2FWF A;  3CSI A;  4K2D A;  1U87 A;  2YOI A;  4AKG A;  1K3Y A;  1PX7 A;  1X0R A;  2GQK A;  3LEF A;  3HVS A;  2LQO A;  1V2A A;  3Q18 A;  2WJU A;  3MDK A;  3TKS E;  2I9H A;  1GTI A;  3APS A;  5GAN D;  3M1G A;  4EE0 A;  3RBT A;  2FUG 2;  2WS2 A;  2LRN A;  4F2I A;  3F4R A;  1XBS A;  3RHC A;  1A24 A;  5DAK B;  2X8G A;  1RQM A;  5DQY A;  3EIN A;  4Z2R A;  2R3X A;  4WF4 A;  5ELG A;  5DQS A;  3ZVJ A;  4XRD A;  1K3L A;  5CAX A;  2QKE A;  4NWY A;  1USB A;  3IC4 A;  3UL3 A;  4EVM A;  2JZS A;  1GSE A;  1Y6E A;  1EP8 A;  3VWV A;  5G31 A;  1F37 A;  5G5F A;  4PQ1 A;  2RLI A;  1I5G A;  2FLS A;  2FHE A;  2TRX A;  4GCI A;  3KXO A;  4LMW A;  1GUL A;  4N0Z A;  3F63 A;  3GFK A;  2CA8 A;  2TRC P;  1X5E A;  4YH2 A;  5ID2 B;  1KNG A;  1THO A;  3ZZX A;  4D73 B;  4IEL A;  4F0C A;  3G9B A;  4ZIL A;  3TKR A;  2CVD A;  1YZX A;  4CY8 A;  4XS4 A;  2FWE A;  5J40 A;  5B7C A;  2B5E A;  3KH9 A;  3O6T A;  3TKS A;  3ZYW A;  1XVQ A;  2JZT A;  3M9K A;  2D2Z A;  1ERW A;  1IYI A;  3ZFL A;  3BBY A;  3KMO A;  2GVP A;  3E9J B;  3KGK A;  2YJH A;  4ZBD A;  3UVH A;  2WUL A;  1O73 A;  4TW5 A;  1UC7 A;  1XW9 A;  1C72 A;  2E0Q A;  5EY6 A;  3HJP A;  4OFT A;  2YWN A;  3US3 A;  1BAY A;  4RQX A;  4AF2 A;  4XIH A;  2E2G A;  4ICY A;  3GIX A;  1JFU A;  1F2E A;  4OFM A;  4ZBB A;  2K8V A;  2BTO T;  5JCU A;  2HSM A;  1QUW A;  3VPT A;  1XVW A;  4K1F A;  1O85 A;  1BQ7 A;  2DIY A;  4POL A;  3QOU A;  5CNW A;  4BVX B;  2GT5 A;  5IM9 A;  2XBI A;  1IYH A;  2BMX A;  4I8B A;  1X5D A;  1LU4 A;  3W8S A;  1PL2 A;  1ST9 A;  2G2Q A;  3DRN A;  1PD2 1;  5A1N A;  4WET A;  4KF9 A;  5J4U A;  4K7O A;  4AI6 A;  2N5A A;  2X64 A;  3G7J A;  1UA5 A;  5F07 A;  1MEK A;  2CZ2 A;  3LFL A;  1YJ6 A;  4DSS A;  4ID0 A;  2MMO A;  4MZC A;  4AJ6 A;  2OBK A;  1K3O A;  1Y25 A;  2RII A;  3VWW A;  5FHI A;  4XRA A;  3FHK A;  4ZB7 A;  1MTC A;  2ZNM A;  4MPG A;  5A4W A;  4X43 A;  4IS0 A;  4HI7 A;  4I97 A;  1M2D A;  1SKS B;  4YKF A;  1M99 A;  2C3N A;  2H01 A;  3F0I A;  3F4S A;  5ECO B;  1T7P B;  1JZR A;  5KN1 A;  4OFN A;  2L4Q A;  3TKQ A;  4OD7 A;  1ILO A;  4V2L A;  1AUC A;  5A4U A;  1F3B A;  1VGL A;  6GSY A;  2H74 A;  5HFK A;  5EPF A;  2HSM B;  3QR6 A;  2GZY A;  4HDE A;  2FY6 A;  1BG5 A;  4Z2U A;  2TIR A;  3VUR A;  4X0X A;  2HFD A;  2YWM A;  4IGJ A;  3IHG A;  3LXT A;  4G0L A;  1FVK A;  1Q98 A;  2YWO A;  1K0N A;  3NOF A;  3F6D A;  2PU9 C;  1K0M A;  1FVJ A;  3FZ5 A;  4BWQ A;  1TTZ A;  4TXO A;  1GSD A;  1TOF A;  2J9H A;  3F3R A;  2YNX A;  5A1N B;  3ZIV A;  4NMU A;  2EIO A;  2H1L A;  3UBL A;  2JSZ A;  3J7Y k;  3DKS A;  4HQZ A;  5H5S A;  2ES7 A;  5IMA A;  1ZGN A;  4DSS B;  4GSS A;  1MDJ A;  5DBQ A;  2BJX A;  3LYK A;  3L9U A;  4H86 A;  5KOW A;  3EE2 A;  5DCH A;  1GH2 A;  2QSI A;  4WF5 A;  3GNJ A;  2GLR A;  1Z5Y E;  4LMV A;  3KJY A;  1M9B A;  1A2M A;  3D21 A;  1LJR A;  1A8Y A;  1O8X A;  3ZRE A;  3TU3 B;  3HJO A;  3GX8 A;  1Y1U A;  3KEB A;  2RUE A;  1EGO A;  4O92 A;  4K7N A;  5IPG A;  5A5H A;  1TK8 B;  4WR4 A;  2L5L A;  5GSS A;  4ZBA A;  3H8Q A;  4W66 A;  1GUM A;  4N3Z A;  1XPV A;  2J23 A;  2HYX A;  3I6A A;  2IFQ A;  2O5V A;  2LRC A;  2B5X A;  1M2A A;  2VL3 A;  5C04 A;  4G0K A;  4PQI A;  2LST A;  2DC5 A;  4MAB A;  4MLY A;  1ERV A;  2X4A A;  3SWL A;  3RDW A;  4I6X A;  4G0I A;  1A2L A;  5INY A;  5KN0 A;  1SJI A;  4TR4 A;  3TKP A;  4TXO B;  1TKD B;  3GUR A;  3FEU A;  1TXU A;  1GRX A;  1VF4 A;  4JR4 A;  2QA1 A;  2AV4 A;  3D0Z A;  5A34 A;  1ERT A;  1O81 A;  3GHA A;  1ABA A;  2B7K A;  4YKG A;  2LV3 A;  4MH3 A;  2DML A;  2HQT A;  2CX3 A;  3LSZ A;  2XPE A;  4JED A;  2X99 A;  3H93 A;  1SK0 A;  2R6K A;  2FWH A;  2P0G A;  1SD8 A;  4XCS A;  2H0I A;  4BL7 A;  4E8E A;  3NZN A;  6GSS A;  2HSN A;  2P5R A;  2K9F A;  5E4W A;  2XHF A;  1CQH A;  3EU3 A;  18GS A;  4HJ2 A;  1VRS D;  4FYC A;  3LYP A;  2A4V A;  4QQ7 A;  5CRG A;  2GSR A;  2VL2 C;  4MK3 A;  5KN3 A;  3D4T A;  4PGT A;  4N10 A;  5IOW A;  1S3A A;  5IMZ A;  3H4K A;  3EMP A;  1FAA A;  1U88 A;  4A5P A;  1JZW A;  3TJJ A;  3ZLP A;  5A5H B;  1SJ6 A;  1SYR A;  1PQN A;  5EVO A;  3I43 A;  2DJ3 A;  2B7J A;  3NIV A;  5AN1 A;  4EXJ A;  3DEX A;  3LW9 A;  4K0G A;  3TRX A;  1CQG A;  4KUN A;  4EF0 A;  2IFQ B;  14GS A;  1EZK A;  2JAC A;  5IO0 A;  4FO5 A;  4KGI A;  2O89 A;  2OAD A;  2IL3 A;  4GDF A;  2F3M A;  5B8B A;  3EWL A;  3QFB C;  1SKR B;  4GQF A;  3A5I A;  4HUA A;  2VO4 A;  1G6W A;  1E2Y A;  1JLW A;  4G01 A;  3UEM A;  1KEB A;  1XWB A;  4GLT A;  5A34 B;  3V1W A;  2DKI A;  4FH8 A;  5FWG A;  3QFA C;  2I3Y A;  4ZL9 A;  3APQ A;  3C7M A;  3D6I A;  5AGY A;  1K0D A;  3WYW A;  1T4Z A;  4Q5Q A;  5IO2 A;  1HNC A;  5KEJ A;  3IRA A;  1TXX A;  4BL7 B;  1AQX A;  4ECI A;  2L4C A;  3U6V A;  4L5O A;  4CDO A;  5DJM A;  2C80 A;  4BA7 A;  1FOH A;  3Q19 A;  2GSQ A;  4JR6 A;  2VLT A;  1GTA A;  2I4A A;  2H1B A;  1PKZ A;  3G7I A;  3M3M A;  1V9W A;  2XC2 A;  3RPP A;  1OKD A;  4YAV A;  3FZA A;  4KCE A;  3ME8 A;  3TJG A;  5ID2 A;  1QK8 A;  2H1G A;  4AJ8 A;  1PA3 A;  4ECB A;  2L6C A;  3ERF A;  4P3Y B;  2YP6 A;  1SK1 A;  4YQM A;  6GSW A;  2LJR A;  4F03 A;  2X49 A;  4ULX A;  3TKS C;  4ISD A;  5IPH A;  5F06 A;  4HJM A;  2H0H A;  1AW9 A;  1PX6 A;  3DIE A;  3F3Q A;  2UV8 G;  3BOA A;  4KB3 A;  3ZML A;  2YZH A;  2GZZ A;  2VKZ G;  1OE7 A;  4HZ2 A;  4AJ7 A;  1GNW A;  2H70 A;  1KTE A;  4GQC A;  1QGV A;  2DJ2 A;  2E2M A;  4I2T A;  1XIY A;  2HNL A;  5GST A;  5C00 A;  3ZTL A;  4TR0 A;  1TW9 A;  1YVL A;  3R3E A;  5KOX A;  3N5O A;  1Z6N A;  1QXH A;  1G7E A;  2VCT A;  2H76 A;  1ZYN A;  4N30 A;  4GRF A;  5CO3 A;  1UN2 A;  5JCW A;  2C8U A;  3CBU A;  1DE1 A;  1HNB A;  1V58 A;  4WKW A;  3BCI A;  1YKC A;  3P90 A;  2G0F A;  5D9W A;  4BVX A;  4OO4 A;  3CSJ A;  3GL3 A;  3KTB A;  4I2U A;  3TGZ A;  1M9A A;  4JU5 A;  4OWY A;  5IMF A;  1BG1 A;  4ACS A;  2JU5 A;  4KW6 A;  3KP8 A;  1G6Y A;  3GTU A;  4AKX B;  1SJZ A;  1TI1 A;  1PN9 A;  2C0G A;  2GSS A;  5JWQ B;  4EIQ A;  3FMW A;  2B5Y A;  1PL1 A;  2ON5 A;  4USS A;  3ZIT A;  3APO A;  3F9U A;  2DIZ A;  1EP7 A;  5D9X A;  5J4V A;  2HRA A;  3O3T A;  2V6O A;  2C0E A;  4EC0 A;  2OKA A;  3KH7 A;  3IAS 2;  1X5C A;  4ECJ A;  4N0V A;  3E3E A;  2KOK A;  6GSX A;  4MDC A;  3ZVJ D;  2MMN A;  1TRS A;  4O5R A;  5LD0 A;  2F8A A;  4XTS A;  4F9Z A;  1QFN A;  3QPM A;  4PUF C;  3GKN A;  2NBS A;  3ZRD A;  1BJX A;  2H6X A;  2JSY A;  1ZL9 A;  5LCZ A;  2DJ0 A;  4X4J A;  5GAP D;  2HE3 A;  2QGV A;  5ECR B;  3GKX A;  3U5R E;  4ZL7 A;  19GS A;  3PR8 A;  2HI7 A;  3TDG A;  4O7H A;  3TJK A;  3UAP A;  2VM1 A;  3VPQ A;  4NPB A;  5ECM B;  2OT3 A;  1DE2 A;  5ECP B;  4DSQ A;  1LBK A;  1PKW A;  4LL1 B;  5HR2 A;  4NHW A;  2WGR A;  2F51 A;  2VD1 A;  1YEX A;  2AHE A;  1N8J A;  1ZOF A;  1YDK A;  1JZD A;  1YY7 A;  3DML A;  2H30 A;  1JHB A;  2OJL A;  3GTU B;  4QMK A;  2L57 A;  5EL8 A;  2A2R A;  2YV9 A;  2L59 A;  1YF1 A;  1TRV A;  2MYG A;  2YPM A;  2LQQ A;  6GSV A;  2WFC A;  1GSS A;  13GS A;  2M72 A;  2REM A;  3DYR A;  2DSA A;  3IDV A;  1YKA A;  3M0F A;  3IPZ A;  2V41 A;  4XS1 A;  3P2A A;  2PWJ A;  2EC4 A;  4FQU A;  2IME A;  3BCK A;  3DVW A;  3KIJ A;  1V40 A;  4K5S A;  2CX4 A;  2KP1 A;  2KP2 A;  5D73 A;  4PX1 A;  2H1D A;  3J7Y b;  1AIU A;  2ALB A;  2KHP A;  3IK7 A;  1RK4 A;  3ZL5 A;  3MAK A;  3UOM A;  3WGX A;  4IQA A;  4KSO A;  5KN2 A;  3P7X A;  4EIP A;  1EOH A;  1U3I A;  3P8W A;  4IN0 A;  3TJF A;  3TUE A;  1SD9 A;  4HU7 A;  2C1Y A;  4Q5R A;  5CRD A;  5HR3 A;  2FD3 A;  1EWX A;  4TN8 A;  10GS A;  1EGR A;  4MNN A;  2F9S A;  5GZZ B;  2EFC A;  2IMI A;  3QAW A;  3GN3 A;  3MNG A;  2GDR A;  1J9B A;  1A8L A;  17GS A;  4G2E A;  4ZB9 A;  2I81 A;  2H0G A;  1ERU A;  3DXB A;  1G0T A;  3GSS A;  2V1M A;  1WMJ A;  2CVB A;  4G9H A;  1XFL A;  1OE8 A;  1EV4 A;  3VWX A;  3D22 A;  2VCW A;  8GSS A;  4E8H A;  2GGT A;  2P5Q A;  4KCA A;  3L9V A;  5F8B A;  1GSF A;  3GX0 A;  2HSY A;  2O8V B;  3CRT A;  4J57 E;  1Q4J A;  3PH9 A;  4TR1 A;  1SKW B;  5CYY A;  1GLP A;  2YZU A;  5JWR B;  4XS6 A;  5DDL A;  2C3Q A;  4BVY A;  1OC9 A;  2JAD A;  2FCH A;  5E59 A;  3EUR A;  5ELA A;  1TU7 A;  2GZP A;  4YQV A;  1JLV A;  1THX A;  3PPU A;  1JZO A;  2L5O A;  2NVL A;  4EO3 A;  3H1N A;  2VM2 A;  5F05 A;  5H5Q A;  3QAG A;  5HFI A;  4ZB6 A;  3JCM L;  4JRR A;  3IE3 A;  5BMU B;  5J5N A;  1TJD A;  2ON7 A;  3IHQ A;  4IBP A;  2B6M A;  1F9M A;  3FR3 A;  1XWK A;  2OE1 A;  2NPB A;  3A2V A;  12GS A;  2JZR A;  3IV4 A;  2NDO A;  3EYT A;  3FR9 A;  1Z7R A;  3ZMK A;  2R4V A;  2K18 A;  5CRW A;  2YAN A;  4NV2 A;  3A2X A;  4KDU A;  2C4J A;  4MPF A;  2HZF A;  3KMN A;  2N5F A;  1GTB A;  2OE0 A;  4K9Z A;  2DMM A;  4BPY A;  4IP6 A;  2FGX A;  4J56 E;  2FA4 A;  2OAC A;  4K8M A;  4WBR D;  1ML6 A;  2OBI A;  4GTU A;  4GSN A;  1H75 A;  3VLN A;  4K7I A;  5HFG A;  1WPI A;  1WE0 A;  4TR1 B;  3I69 A;  1DUG A;  5B6M A;  4KH7 A;  5IMC A;  4BVY B;  1OC9 B;  2B1L A;  2H75 A;  1ON4 A;  5B8A A;  1O7U A;  3HJM A;  4WXT A;  4WEY A;  2VLU A;  5HR0 A;  3UIW A;  4PTS A;  2DLX A;  3FRC A;  1YEP A;  3HVX A;  3TJB A;  4IJI A;  1GLQ A;  2VL9 A;  2IWT A;  3HMJ G;  3RPN A;  4IQ1 A;  4K6X A;  1NSW A;  3GH9 A;  2IIY A;  3LGC A;  4OCF A;  2A2S A;  4FIW A;  2O7K A;  2PN8 A;  3IOS A;  4ECC A;  1B9Y C;  2IJY A;  3CYN A;  2B1K A;  3CWG A;  4KX4 A;  1O8W A;  4RQR A;  4HS1 A;  3HY2 A;  1EEM A;  6GST A;  1SVO A;  4HOJ A;  1B48 A;  3WT1 A;  4K5R A;  3O76 A;  1V57 A;  2MBT A;  1DBY A;  4IJ3 A;  3DGQ A;  3FYG A;  1GUH A;  4PQH A;  3FZ4 A;  2VCV A;  1XWC A;  5L71 A;  3ERG A;  3QMX A;  3ME7 A;  4MF5 A;  2LTK A;  1TK0 B;  1FW1 A;  2H6Y A;  2E7P A;  3GL5 A;  4AKI A;  3TCO A;  1GL8 A;  3AY8 A;  2VCQ A;  2C3T A;  4PUA A;  3PIN A;  4TRX A;  2HRN A;  2AJQ B;  4TR3 A;  3C1S A;  1VF1 A;  2HT9 A;  4POB A;  1MD3 A;  3C1R A;  4MZW A;  3PGT A;  4DEJ A;  1SL0 B;  1X9W B;  1EOG A;  2YV7 A;  1XW5 A;  3EU4 A;  4TXV A;  3GV1 A;  1GSQ A;  3LG6 A;  1FG4 A;  1GWC A;  2R37 A;  2RUF A;  4O5Q A;  2AB6 A;  4GWR A;  4MMM A;  1K0B A;  5IMV A;  4J2F A;  2P31 A;  2UZ8 A;  2R5G A;  3HCZ A;  5ECL B;  5J47 A;  5D9T A;  4OO5 A;  3EC3 A;  4POK A;  2V6K A;  3IC8 A;  3W8J A;  2O87 A;  1YF0 A;  1E6B A;  2MMA A;  1AC1 A;  2WCI A;  3LJR A;  3FR6 A;  3IK9 A;  3RAZ A;  1T3B A;  2YCD A;  2DJ1 A;  1XZO A;  1TDI A;  2R2J A;  3QD9 A;  2VCZ A;  4GF0 A;  3EVI A;  20GS A;  3CMI A;  1SYX A;  5J9C A;  1GTU A;  1NHY A;  4TOP A;  3WT2 A;  4MJC A;  4FYB A;  3MWH A;  3QCP A;  2H1A A;  2ZUP A;  1HNA A;  3A5W A;  3L0H A;  4EL1 A;  2Z9S A;  1XOA A;  3UMA A;  1X9M B;  1N2A A;  3LWA A;  4MP4 A;  2RM5 A;  5ECS A;  1FO5 A;  2R0P A;  3WD6 A;  1F3A A;  5J9B A;  2A2P A;  1SEN A;  1UVZ A;  4KAE A;  2B3S A;  3K8N A;  3ZFB A;  4KSM A;  2PUK C;  3F4T A;  3GKM A;  2WZ9 A;  1B4P A;  2IPA A;  2HZE A;  4TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...