2WJUA

Glutathione transferase a2-2 in complex with glutathione
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
221
Chain Sequence
AEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE-S-TRANSFERASE A2-2
publication title Structural Basis for Featuring of Steroid Isomerase Activity in Alpha Class Glutathione Transferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 221
sequence length 221
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2wjuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wjuA01
3FZAA 2YCDA 2KUCA 4MABA 2F8FA 2JSZA 2LJAA 1M0UA 3EC3A 2CZ2A 4HJMA 2DIYA 2DSAA 3LXTA 3EU3A 5KN2A 2OACA 2OE3A 2B7KA 3K8NA 2YP6A 1KNGA 3P7XA 2R4VA 2HYXA 2LSTA 3VWVA 4G0KA 4OFMA 1V9WA 3M1GA 5B7CA 1TU8A 4N10A 3PPUA 3CBUA 4WF4A 2H6ZA 2RUFA 2PVQA 1XCCA 1XZOA 1ZOFA 5F07A 2RM6A 2YV9A 1SKSB 1YEXA 1VGLA 5AGYA 4NWYA 4I8BA 1NHOA 2PGTA 3EMPA 2E2MA 5G30A 2H76A 3KGKA 4X43A 2DBCA 1ILOA 3I9V2 2JZTA 1TJDA 1PA3A 3WT2A 3IC8A 2R5GA 3HA9A 4G0IA 1GSQA 2WZ9A 2PMTA 2A2SA 3ME7A 3TRXA 1G6WA 2L4QA 2TRXA 5HR3A 4KUNA 1BG5A 3IAS2 1T00A 3E9JB 3GTUA 1SJIA 5ECKB 7GSSA 2LV3A 2PWJA 2ON5A 3IR4A 2NBSA 2GT6A 1LBKA 1PKZA 3HVSA 1DSBA 4TR1A 5G5EA 1EV9A 4AGSA 2LUSA 5ABRA 3FHKA 1FVKA 4EDYA 2L59A 3GHAA 3DVWA 2KP2A 4V2MA 1GSUA 2CV4A 4GLTA 3DWVA 4HS1A 1GUHA 1SD9A 2VIMA 4HQZA 1SJ6A 4ML1A 4OFTA 2O85A 1SL2B 4TXOA 4XS6A 2E2GA 1SJZA 1UC7A 2HRKB 5F06A 6GSWA 1THOA 4WXTA 2H71A 4V1Ag 1DBYA 3QFAC 1GLPA 3ZMLA 4MLYA 3C1RA 4PNFA 3ED3A 1WMJA 2K8VA 1NSWA 3RPPA 3ZVJD 3N9JA 1G7EA 3D22A 5J41A 4USSA 4HQSA 5IMFA 1C72A 1MDJA 4JU5A 2ALBA 1T8EB 4DVCA 3BJ5A 4GQCA 4PURA 2HT9A 3HJPA 1XPVA 4ML6A 4AJ7A 5HR1A 4PGTA 2LNSA 3UEMA 3HVXA 4JZQA 3GKMA 4P3YB 2HQTA 1FVJA 2B5YA 4BVXA 4KNDA 3VWXA 5IMDA 5J4UA 1SL0B 1USBA 2HSYA 3O76A 4XHMA 5EPFA 4K7OA 3IOSA 1YF0A 1TTZA 3RAZA 2LJRA 2GQLA 1V40A 3QAVA 3WGXA 1ABAA 2CX4A 5JWQB 5ECOB 4ILFA 4IELA 2H72A 1AIUA 2MMZA 5JCWA 2IIYA 1XFLA 2C3TA 1SD8A 4EDZA 4TXVA 1GTUA 1M2AA 4YH2A 1DE2A 3F63A 2XBIA 4ACSA 1YKCA 3R2QA 1TRSA 2WS2A 1Q4JA 1TRVA 4PNGA 1F3BA 5GAND 1ERUA 18GSA 2HNLA 3Q18A 2I81A 3KCMA 2N5AA 5CP1A 1W4VA 5J5NA 1VF3A 4ZB6A 2VCTA 1XWCA 5DCHA 5DQYA 1FAAA 3VK9A 2WB9A 1A2MA 1OC8A 4GCIA 2CAIA 5D9WA 3LYPA 5D93A 3HDCA 4NHZA 3IC4A 3HHVA 2B7JA 5IIZA 3UBLA 1SKWB 3GSSA 17GSA 4FIWA 2AJQB 2I3YA 2JZSA 2OE1A 1FHEA 1XVWA 3R3EA 6GSTA 3ZFBA 3LEFA 1MDIA 4BL7B 1A8YA 2V41A 2YZUA 2IMFA 1TK5B 2FNOA 1MEKA 3EURA 1GL8A 3QCPA 2VL9A 2PERA 1ST9A 2C3NA 3UOMA 3KMOA 3DKSA 2O8VB 1JHBA 1NHYA 2LRNA 4HDEA 5CAXA 2GQMA 1TDIA 1G0TA 3QR6A 3FR9A 2E0QA 2XC2A 4G19A 4I97A 4NMUA 3ZZXA 3KIJA 3ZL5A 1M99A 3TGZA 1ZYEA 1GP1A 1PD21 3Q74A 1SK2A 4MF5A 1SYXA 4YQMA 2YWIA 5JWRB 2VCZA 4O5RA 1FB6A 3RHCA 4FYBA 3OR5A 12GSA 3QMXA 5ID2B 4D73B 1EOHA 4I2TA 1R5AA 3MWHA 1F2EA 2AYTA 1TI3A 3HZ4A 3HYPA 1FO5A 4MJCA 2HRKA 4V2LA 4G0LA 5AN1A 2GGTA 1M9AA 2PBJA 5ECQB 3F6DA 5C00A 4MPGA 1QQ2A 1TRUA 3MSZA 1U3AA 1BX9A 3ZIJA 1ZYQB 4PUAA 4BA7A 3HZ8A 4NPBA 2GSRA 3IXRA 2LS5A 2IMEA 1SENA 4ECCA 2AB6A 1V98A 4V1Ap 1B48A 6GSXA 5D9TA 3O3TA 5CYYA 4WEYA 2MBSA 3EU4A 3FZ5A 1GUMA 4HU7A 2BTOT 1YJ6A 5DBQA 2H73A 2LQQA 3TDGA 5CRWA 2IMIA 5KEJA 1Z7PA 2K18A 2VAFA 3TJJA 1JZOA 1VF1A 3D0ZA 1THXA 1YEPA 2C0GA 2L4CA 3F3RA 3ERGA 2YWNA 1GH2A 1PKWA 4F0CA 4QL7A 1WIKA 3M8NA 1M9BA 1H4OA 1F3AA 4JEDA 3WGEA 2BJXA 2VL3A 4DSSB 2FHEA 3C1SA 5E4WA 1A24A 1BEDA 1HNCA 2LRCA 3J7Yb 1R26A 2M72A 2KHPA 4G2EA 5GZZB 1WPIA 1GWCA 4OMVA 3FKFA 2C8UA 3C71A 3LORA 2CVKA 3APQA 5L71A 3LFLA 1XVQA 1J9BA 4MJAA 2JU5A 1GSEA 3FY7A 2YANA 3V1WA 22GSA 3TJFA 3L9UA 2H01A 5ECRB 3D21A 2IMDA 3UBKA 4IJIA 1EWXA 3GKNA 4BVYB 2GQKA 4F82A 1K0CA 4POMA 5GSSA 1X5DA 2WRTA 4OWYA 1EGRA 3F4RA 6GSYA 5F05A 1SL1B 2YNXA 1J0FA 2H66A 4HJ2A 3IRAA 4TKYA 4TR0A 2RUEA 2LRTA 4GF0A 1YQ1A 4ZBBA 2IFQB 1SYRA 4TR3A 1V2AA 3KM6A 4L0WA 3UAPA 5D8IA 4BL7A 1AC1A 4TR4A 3QAWA 4WR5A 4JRRA 3HJMA 1K3YA 1E2YA 3EMXA 6GSUA 3WYWA 3TJBA 4EE0A 4NHWA 3C73A 3PINA 2H19A 4IN0A 4RI7A 4WF5A 3ERFA 5B8AA 5F8BA 4IS0A 3F3QA 4KW6A 4Q5RA 2PUKC 1XOBA 2C0DA 4ID0A 3UARA 1WJKA 1CQHA 3TOTA 1OKDA 3DD3A 2H8LA 1PX7A 2KLXA 4EF0A 5CNWA 4XCSA 3TKPA 1ZGNA 2QGVA 3F6FA 2XBQA 4YAPA 1HNBA 5ID2A 2LNTA 3A2WA 4D73A 2QSIA 3KJYA 3UVHA 4QL9A 5IOXA 3FZ4A 2FY6A 2JACA 4LMVA 3TB2A 1O85A 2DLXA 1HD2A 3ZYWA 1QUWA 2K8SA 2H1DA 4TN8A 3KMNA 2WFCA 4XS4B 1K0DA 5DVBA 3KZQA 1EEMA 2VLUA 2K9FA 5HFKA 3M0FA 4MA9A 4K7NA 5HQPA 2ZNMA 2PPTA 3A2XA 2C3QA 3ZITA 4PQ1A 4IP6A 3CXGA 3L0HA 3PR8A 2B3SA 4F0BA 2VCVA 3EVIA 5LNKe 4TW5A 4TVEA 3UVTA 5JCUA 3H8QA 3KTBA 4ZXGA 1T3BA 3JCML 2H1GA 4V2NA 3RDWA 2HZEB 4ZL7A 4MH2A 1WRYA 4GQFA 4K6XA 4O32A 4OCEA 4FYCA 3CRTA 2EIRA 3KP8A 1WP0A 1Z6MA 5ECSA 5GSTA 2IWTA 4PQIA 1ERWA 2N5BA 4G9HA 2HLSA 4IQ1A 3W8SA 1EP8A 2VCQA 3E3EA 2G0FA 1SU9A 2QC7A 2HSMB 3D4MA 4DSSA 2YWOA 1TI1A 2Z9SA 1ZMAA 5COHA 2GZYA 1SKRB 1S3DA 1O73A 1FW1A 3TKQA 4K8MA 4BWQA 3D6IA 1AUCA 2RM5A 3LWAA 4MMMA 1XWKA 2X8CA 4KCAA 1HQOA 4GRFA 4N0ZA 4YQUA 2XPEA 3HJOA 2J9HA 4PQHA 1AXDA 2RIIA 1UN2A 2TIRA 4IHUA 1PMTA 3F4SA 3BCKA 4XRAA 1GSFA 3H1NA 3GYKA 3BOAA 2X8GA 1OE7A 2IJYA 1Q98A 4TRXA 3GKXA 1Z7RA 4BVYA 3G9BA 2WJUA 4PTSA 4GTUA 2C0EA 4PX1A 4IGJA 1GNEA 4ZB8A 2WULA 2F9SA 6GSVA 4GSTA 2DMLA 1TXXA 2LKUA 3MAKA 1T4ZA 4EO3A 3QAGA 4RI6A 1YF1A 1T4YA 2KP1A 5CRHA 2AAWA 3GSTA 1I9DA 3LSZA 1SK1A 2O89A 2IFQA 3QFBC 4GSSA 2QKEA 3VWUA 5CREA 1T1VA 1PL1A 3N5OA 1TOFA 3P8WA 2OBKA 2VCXA 4KB3A 1EP7A 2L57A 2HSHA 2YJHA 1GNWA 1YZXA 1B8XA 4OO5A 1DE1A 3BBYA 1HYUA 6GSSA 1O81A 2NTOA 1PX6A 3LQ7A 2K6VA 16GSA 2VUPA 5IM9A 2CA8A 1RK4A 4F03A 4I5QA 2F3MA 2HFDA 3H79A 1TKDB 1O6JA 3DGQA 4KDUA 3DXBA 3IK7A 1WE0A 2H1AA 3GKKA 2VD0A 4MJBA 4X1UA 4QQ7A 3GN3A 2BMXA 19GSA 3U5RE 4KDYA 1IYHA 5IO0A 1JZRA 5G5FA 2EIOA 2VO4A 1QFNA 2OKAA 1VF4A 2V1MA 1EEJA 3GNJA 1EZKA 4XS4A 4MF6A 2IN3A 5CRDA 1BQ7A 3FW2A 4LL1B 1UA5A 3FRCA 5FWGA 2WGRA 2XHFA 5B8BA 3RPNA 3UJ1A 4IKHA 4OFNA 2NVLA 1QXHA 5H5QA 5DAKB 4YAVA 1VF2A 2PN8A 3IAM2 1F9MA 5A5KA 5B6MA 3GX0A 2B6MA 1N8JA 4ULXA 5J9BA 5IMCA 2DJ1A 2LEGA 2M46A 1YDKA 3VFIA 1U6TA 1XWGA 3I6AA 1O7UA 1U3IA 2HZEA 1Y6EA 4IP1A 4ZBAA 5FT3A 1MD3A 2J23A 2YWMA 3IHQA 3CYNA 2R3XA 3GH9A 3VI7A 1JZDA 2MBTA 2MYGA 4NAXA 2ZCTA 3KH9A 4MPFA 2C4JA 4RQXA 5EVOA 5HR0A 1R5PA 2MMAA 1QK8A 4HUAA 2WCIA 3LGCA 2AV4A 1U88A 2CQ9A 4AJ6A 2HSMA 3IBHA 4XRDA 3TKRA 3WGDA 1PQNA 2FCHA 4I2UA 5D96A 4E8EA 4JE1A 3GL3A 4MP4A 2FWEA 14GSA 5LCZA 3GA4A 5EY6A 3DRNA 3IA1A 4KSMA 5ECMB 2VOCA 1X9SB 2B5EA 1XW6A 3MDKA 1YY7A 4MCUA 2H30A 5HR2A 3ZRDA 3I69A 3Q19A 2HZFA 4K2DA 1QGVA 4RUVA 1HNAA 2DJ2A 3NIVA 4ZL9A 4MDCA 1WWJA 4JR6A 5DJMA 4POBA 4K0GA 4MH3A 1GTBA 1IYIA 1M2BA 5DALB 3GFKA 4J56E 1X5CA 3HCZA 2C80A 3F9UA 2VD1A 1O8WA 2GZZA 4Z7XA 5D9VA 1XXUA 1B9YC 3CSIA 4K1FA 1TK0B 1V57A 3GIXA 4Q5QA 4E8HA 5GAPD 11GSA 3ZMKA 3CSHA 4DSQA 5ENUA 1K3LA 4DEJA 2DIZA 5EL8A 1ML6A 3M9JA 2OA7A 4ZBDA 1NW2A 3SBCA 4WR4A 4K9ZA 3F8UA 1LU4A 3QPMA 3P90A 2DJJA 3L78A 2B1LA 1XW5A 5HFGA 4HOJA 2YOIA 5H5SA 2XPDA 2EC4A 2MMNA 4WKWA 4IW9A 3O6TA 1Z3EA 4J2FA 1NM3A 4KAEA 2VL2C 1ZZYA 3LXZA 1Z9HA 5IQYA 4FYUA 1ACVA 5IO2A 1OE8A 2ON7A 3CTGA 2WDUA 1X5EA 1B9XC 4EUYA 5KN3A 4KE3A 4L8EA 2H1BA 2VM2A 1G6YA 2NDOA 4GWRA 1ERVA 5DDLA 3HXSA 1FG4A 1URMA 4HZ4A 1MD4A 1F6MC 4MJEA 3D4TA 4N11A 1GSYA 1B4PA 1PL2A 2IMKA 4KCEA 2FD3A 2GSSA 2PU9C 4N30A 3TCOA 3HY2A 1OYJA 4K0NA 2EIQA 3NZNA 3AY8A 5CRGA 4CDOA 2VM1A 3VI5A 2B1KA 4GSNA 1S3AA 2MMOA 4I6XA 3ZVJA 4EL1A 4KGIA 1A23A 4HEA2 2HSNB 5DAKA 1K0NA 2H6XA 2HI7A 3TOUA 3D5JA 3MNGA 1A2LA 2TRCP 1F37A 2YN1A 2DC5A 1XWBA 3RBTA 4EVMA 5E59A 2V32A 2H70A 2VLVA 3IV4A 4MZWA 4L0UA 4DSRA 4JBBA 2C1YA 1XOAA 4POKA 4L5LA 1SK0A 3WD6A 2LTKA 3VPQA 4KA0A 4MF7A 5ELAA 5J9CA 4ZB9A 3ZIVA 3KH7A 4PXOA 3A2VA 5F0GA 5G1LA 2X99A 1KTEA 3L9VA 2P0GA 3QDNA 3APOA 3BCIA 3TKSE 4XS1A 3GUSA 5J3RA 4BWSA 2HRFA 20GSA 4YQVA 3ZLPA 3VURA 3J7Yk 3IK9A 3F0IA 1K0OA 1ON4A 4ZILA 1ZL9A 1BAYA 9GSSA 3WT1A 3EINA 1TU7A 2GVPA 1OKTA 3G7JA 2OJLA 4K7IA 3PGTA 1ERTA 4ECIA 2H0GA 2FWGA 3A3TA 3GX8A 3APSA 3QOUA 5JCGA 5IMAA 1E6BA 1R4WA 1XIYA 3L4NA 5IOWA 1VRSD 5LD0A 2HXKA 5DALA 4POLA 4ECBA 2AHEA 1TRWA 1V58A 1TK8B 1A0RP 1JLWA 1OC9B 4ZIJA 2KOKA 2CAQA 4LMWA 3FZ9A 3KEBA 1KEBA 1JZWA 1B4QA 2GSTA 3US3A 4CHSA 2GS3A 4KDXA 4MZCA 2O87A 2DJKA 2A4VA 1H75A 1XBSA 2V2GA 1RQMA 1EOGA 3GH6A 3IPZA 4EKZA 3SWLA 2CVBA 1EGOA 2P5QA 3EYTA 5DQSA 8GSSA 4IJ3A 1GULA 2MZCA 5G2ZA 2P31A 2GTUA 2JL4A 4JR4A 2JADA 3CMIA 2ES7A 5INYA 1KBNA 1UVZA 2HRNA 1M2DA 5FHIA 2E7PA 3TRPA 2C0FA 4L5OA 2YZHA 5KN0A 4NXIA 2HRAA 1K0BA 4EC0A 4XIHA 4IBPA 5BMUA 3UL3A 1X9WB 3ERWA 2AUVA 2I9HA 2FWHA 2CVDA 5G31A 1JLVA 1AQXA 3TUEA 3GL5A 2M80A 3U6VA 3CTFA 4O92A 4H86A 1DUGA 3ISOA 2JZRA 4ZL8A 4OD7A 4FO5A 2G2QA 5AISA 5DCGA 3FR3A 1A0FA 3FR6A 3TKSA 4LL4B 2FUG2 2YJ7A 5IPHA 3HD5A 3G7IA 4HU9A 2FGXA 4WETA 1S3CA 2B5XA 2YPMA 1XWAA 3FK8A 3IE3A 4LLRA 4EXJA 1M7TA 3ME8A 2CT6A 3DYRA 1K3OA 1FOVA 1GUKA 3NOFA 5DJLA 3GRXA 3DMLA 3P2AA 2O7KA 5IMVA 3TJKA 2LJKA 3M9KA 2LQOA 5JWOB 2DJ3A 1AQWA 4ECJA 2DJ0A 3TJGA 3VLNA 1K0AA 3H4KA 1MDKA 4AF2A 4GXZA 2IPAA 1T7PB 1BJXA 4WBJA 4OCFA 1FB0A 4TOPA 2NPBA 1PGTA 3EE2A 3ZFLA 3M3MA 4LA1A 3PH9A 2L6DA 1Y25A 4NV2A 1GSSA 3ZREA 4O7HA 1K0MA 5A4VA 3I43A 3VPTA 1X9MB 1EV4A 3TKSC 2I1UA 3E0UA 1U87A 5AIVA 5ECLB 3FYGA 3H93A 2P5RA 4MK3A 4OO4A 1AW9A 1OC3A 2R2JA 3KD0A 2N5FA 2FWFA 4WBRD 2R37A 3IDVA 1GTIA 3L9SA 1BYEA 2R6KA 5B6NA 3S9FA 4KX4A 1GLQA 4RQRA 3ZTLA 2GLRA 2CZ3A 5A4UA 3KXOA 3VWWA 1OVNA 3LYKA 3LJRA 1X0RA 2JSYA 2H0IA 4Q5NA 2L5OA 2OBIA 1OC9A 5ECNB 4N0VA 2H6YA 4F9ZA 3CSJA 1PN9A 1TW9A 3UIWA 2X64A 13GSA 4G10A 3CRUA 3BD2A 4AJ8A 2CX3A 1QMVA 5G1KA 5KN1A 1WOUA 5ECIB 1N2AA 1O8XA 1A8LA 4IVFA 4MZBA 1AAZA 3UMAA 2VCWA 3HKRA 2FLSA 3DIEA 1I5GA 1G7OA 3G7YA 4F2IA 3GMFA 2VL2A 2UZ8A 5ECHB 3GTUB 1OAZA 5A4WA 1AQVA 5ELGA 2DMMA 1W89A 1ZCPA 3HVVA 2REMA 1TP9A 1CQGA 2RLIA 4TR1B 3RHBA 3KP9A 4PUFC 3FEUA 5CO3A 2F51A 2X8HA 3C8EA 2YV7A 3EWLA 5IMZA 3QD9A 1GTAA 2H75A 2H74A 2VLTA 1JFUA 2FA4A 1YKAA 4TXOB 4KH7A 4J57E 2GSQA 3W8JA 2ZUPA 3DEXA 4XTSA 1RW1A 2IL3A 1GSDA 1J08A 4KSOA 2GT5A 3Q6OA 1GRXA 4FQUA 4ISDA 2OADA 5H5RA 3GV1A 1PSQA 3GURA 4BPYA 1A2JA 4NV5A 1R7HA 2F8AA 4Q5FA 4HI7A 2GZPA 5C04A 4CW9A 5IPGA 1Z5YE 1XW9A 5HFIA 3KTLA 2PVOC 4IQAA 2V6KA 3TRQA 4FH8A 4BVXB 3W6GA 2A2RA 1Z6NA 5AIXA 10GSA 1MTCA 2L6CA 2HE3A 5D73A 2I4AA 2OE0A 1PRXA 4X0XA 2GDRA 4KF9A 5D9XA 2V6OA 2D2ZA 3DVXA 5ECPB 3LG6A 1LJRA 2FA8A 2L5LA 3C7MA 3F4TA 3A5WA 4HZ2A 2H0HA
chains in the Genus database with same CATH superfamily
3FZAA 2YCDA 2KUCA 4MABA 2F8FA 2JSZA 2LJAA 1M0UA 3EC3A 2CZ2A 4HJMA 4AKIA 1PFOA 2DIYA 2DSAA 3LXTA 3EU3A 5KN2A 2OACA 2OE3A 2B7KA 3K8NA 2YP6A 1KNGA 3P7XA 2R4VA 2HYXA 2LSTA 3VWVA 4G0KA 4OFMA 1V9WA 3M1GA 5B7CA 1TU8A 4N10A 3PPUA 3CBUA 4WF4A 2H6ZA 2RUFA 2PVQA 1XCCA 1XZOA 1ZOFA 5F07A 2RM6A 2YV9A 1SKSB 1YEXA 1VGLA 5AGYA 4NWYA 4I8BA 1NHOA 2PGTA 2WW1A 1YEWC 5A34A 3EMPA 2E2MA 5G30A 2H76A 3KGKA 4X43A 2DBCA 1ILOA 3I9V2 2JZTA 1TJDA 1PA3A 4CY8A 3WT2A 3IC8A 2R5GA 3HA9A 4G0IA 1GSQA 2WZ9A 2PMTA 2A2SA 3ME7A 3TRXA 1G6WA 2L4QA 2TRXA 5HR3A 4KUNA 1BG5A 3IAS2 1T00A 3E9JB 4Z2TA 3GTUA 1SJIA 5ECKB 7GSSA 2LV3A 2PWJA 2ON5A 3IR4A 2NBSA 2GT6A 1LBKA 1PKZA 3HVSA 4K5RA 1DSBA 4TR1A 5G5EA 1EV9A 3MYDA 4AGSA 2LUSA 5ABRA 3FHKA 1FVKA 4EDYA 2L59A 3GHAA 3DVWA 2KP2A 4V2MA 1GSUA 2CV4A 4GLTA 3DWVA 4HS1A 1GUHA 1SD9A 2VIMA 4HQZA 1SJ6A 4ML1A 4OFTA 2O85A 1SL2B 4TXOA 4XS6A 2E2GA 1SJZA 1UC7A 2HRKB 5F06A 6GSWA 1THOA 2A2PA 4WXTA 2H71A 4V1Ag 1DBYA 3QFAC 1GLPA 3ZMLA 4MLYA 3C1RA 4PNFA 3ED3A 1WMJA 2K8VA 1NSWA 3RPPA 3ZVJD 3N9JA 1G7EA 3D22A 5J41A 4USSA 4HQSA 5IMFA 1C72A 1MDJA 4JU5A 2ALBA 1T8EB 4DVCA 3BJ5A 4GQCA 4PURA 2HT9A 3HJPA 1XPVA 4ML6A 4AJ7A 5HR1A 4PGTA 2LNSA 3UEMA 3HVXA 4JZQA 3GKMA 2O36A 4P3YB 2HQTA 1FVJA 2B5YA 1Y1UA 4BVXA 4KNDA 3VWXA 5IMDA 2WVXA 5J4UA 1SL0B 1USBA 2HSYA 3O76A 4XHMA 5EPFA 4K7OA 3IOSA 4ICYA 4Z2RA 1YF0A 1TTZA 3RAZA 2LJRA 2GQLA 1V40A 3QAVA 3WGXA 1ABAA 2CX4A 5JWQB 5ECOB 4ILFA 4IELA 2H72A 1AIUA 2MMZA 5JCWA 2IIYA 1XFLA 2C3TA 1SD8A 4EDZA 4TXVA 1GTUA 1M2AA 4YH2A 3MIXA 1DE2A 3F63A 2XBIA 4ACSA 1YKCA 3R2QA 1TRSA 2WS2A 1Q4JA 1TRVA 4PNGA 1F3BA 5GAND 1ERUA 2WVYA 1ZYPA 18GSA 2HNLA 3Q18A 2I81A 3KCMA 2N5AA 5CP1A 1W4VA 5J40A 5J5NA 1VF3A 4ZB6A 2VCTA 1XWCA 5DCHA 5DQYA 1FAAA 3VK9A 2WB9A 1A2MA 1OC8A 4GCIA 2CAIA 5D9WA 3LYPA 5D93A 3HDCA 4NHZA 3IC4A 3HHVA 2B7JA 5IIZA 3UBLA 1SKWB 3GSSA 17GSA 4FIWA 2AJQB 2I3YA 2JZSA 2OE1A 1FHEA 1XVWA 3R3EA 6GSTA 3ZFBA 3LEFA 1MDIA 4BL7B 1A8YA 2V41A 2YZUA 2IMFA 2OT3A 1TK5B 2FNOA 1MEKA 3EURA 1GL8A 3QCPA 2VL9A 4K2XA 2PERA 1ST9A 2C3NA 3UOMA 3KMOA 3DKSA 2O8VB 1JHBA 1NHYA 2LRNA 4HDEA 5CAXA 2GQMA 1TDIA 1G0TA 3QR6A 3FR9A 5J4YA 2E0QA 3LW9A 2XC2A 4G19A 4I97A 4NMUA 3ZZXA 3KIJA 3ZL5A 1M99A 4O5QA 3TGZA 1ZYEA 1GP1A 1PD21 3Q74A 1SK2A 4MF5A 1SYXA 4YQMA 2YWIA 5JWRB 2VCZA 4O5RA 1FB6A 3RHCA 4FYBA 3OR5A 12GSA 3QMXA 5ID2B 4D73B 1EOHA 1TXUA 4I2TA 1R5AA 4AI6A 3MWHA 1F2EA 2AYTA 1TI3A 3HZ4A 3HYPA 1FO5A 4MJCA 2HRKA 4V2LA 4G0LA 5AN1A 2GGTA 1M9AA 2PBJA 5ECQB 3F6DA 5C00A 4MPGA 1QQ2A 1TRUA 3MSZA 1U3AA 1BX9A 3ZIJA 1ZYQB 4PUAA 4BA7A 3HZ8A 4NPBA 2H1LA 2GSRA 3IXRA 2LS5A 2IMEA 1SENA 4ECCA 2AB6A 1V98A 3HVNA 4V1Ap 1B48A 6GSXA 5D9TA 3O3TA 5CYYA 4WEYA 2MBSA 3EU4A 3FZ5A 1GUMA 4HU7A 2BTOT 1YJ6A 5DBQA 2H73A 2LQQA 3TDGA 5CRWA 2IMIA 5KEJA 1Z7PA 2EFDA 2K18A 2VAFA 3TJJA 1JZOA 1M3JA 1VF1A 3D0ZA 1THXA 1YEPA 2C0GA 2L4CA 3F3RA 3ERGA 2YWNA 1GH2A 1PKWA 4F0CA 4QL7A 1WIKA 3M8NA 1M9BA 1H4OA 1F3AA 1SVOA 4JEDA 3WGEA 2BJXA 2VL3A 4DSSB 2FHEA 3C1SA 5E4WA 1A24A 1BEDA 1HNCA 2LRCA 3J7Yb 1R26A 2M72A 2KHPA 4G2EA 5GZZB 2DKHA 1WPIA 1GWCA 4OMVA 3FKFA 2C8UA 3C71A 3LORA 2CVKA 3APQA 5L71A 3LFLA 1XVQA 1J9BA 4MJAA 2JU5A 1GSEA 5A1NB 3FY7A 2YANA 3V1WA 22GSA 3TJFA 3L9UA 2H01A 4PI0C 5ECRB 3D21A 2IMDA 3UBKA 4IJIA 1EWXA 3GKNA 4BVYB 2GQKA 4F82A 1K0CA 4POMA 1FOHA 5GSSA 1X5DA 2WRTA 2WZSA 5KOXA 4OWYA 1EGRA 3F4RA 6GSYA 5F05A 1SL1B 3EPTA 2YNXA 1J0FA 2H66A 4HJ2A 3IRAA 4TKYA 4TR0A 2RUEA 2LRTA 4GF0A 2WW2A 1YQ1A 4ZBBA 2IFQB 1SYRA 4TR3A 1V2AA 3KM6A 4L0WA 3UAPA 4K5SA 4N3ZA 5D8IA 4BL7A 1AC1A 4TR4A 3QAWA 4WR5A 5J4VA 4JRRA 3HJMA 1K3YA 1E2YA 3EMXA 6GSUA 3WYWA 3TJBA 4EE0A 4NHWA 3C73A 3PINA 2H19A 4IN0A 4RI7A 4WF5A 3ERFA 5B8AA 5F8BA 4IS0A 3F3QA 4KW6A 4Q5RA 2PUKC 1XOBA 2C0DA 4ID0A 3UARA 1WJKA 1CQHA 3TOTA 1OKDA 3DD3A 2H8LA 2QA1A 1PX7A 2KLXA 4EF0A 1I1IP 5CNWA 4XCSA 3TKPA 1ZGNA 2QGVA 3F6FA 1M3IA 4YAPA 2XBQA 1HNBA 2EFCA 5ID2A 2LNTA 3A2WA 4D73A 2QSIA 3KJYA 3UVHA 4QL9A 5IOXA 3FZ4A 2FY6A 2JACA 4LMVA 3TB2A 1O85A 2DLXA 1HD2A 3ZYWA 1QUWA 2K8SA 4YKGA 2H1DA 4TN8A 3KMNA 2WFCA 4XS4B 1K0DA 5DVBA 3KZQA 1EEMA 2VLUA 3FMWA 2K9FA 5HFKA 3M0FA 4MA9A 4K7NA 5HQPA 2ZNMA 2PPTA 3A2XA 2C3QA 3ZITA 4PQ1A 4IP6A 3CXGA 3L0HA 3PR8A 2B3SA 4F0BA 2VCVA 3EVIA 5LNKe 4TW5A 4TVEA 3UVTA 5JCUA 3H8QA 3KTBA 4ZXGA 1T3BA 2EFEA 3JCML 2H1GA 4V2NA 3RDWA 2HZEB 4ZL7A 4MH2A 1WRYA 4GQFA 4K6XA 4O32A 4OCEA 4FYCA 3CRTA 2EIRA 3KP8A 1WP0A 1Z6MA 5ECSA 5GSTA 2IWTA 4PQIA 1ERWA 2N5BA 4G9HA 4EIPA 2HLSA 4IQ1A 3W8SA 1EP8A 2VCQA 3E3EA 2G0FA 1SU9A 2QC7A 2HSMB 3D4MA 4DSSA 2YWOA 1TI1A 2Z9SA 1ZMAA 5COHA 2GZYA 1SKRB 1S3DA 1O73A 1FW1A 3TKQA 3HMJG 4K8MA 4BWQA 3D6IA 1AUCA 2RM5A 3LWAA 4MMMA 1XWKA 2X8CA 4KCAA 1HQOA 4GRFA 4N0ZA 4YQUA 2XPEA 4PHZC 3HJOA 2EFHA 2J9HA 4PQHA 5A1NA 1AXDA 2RIIA 1UN2A 2TIRA 4IHUA 1PMTA 3F4SA 3BCKA 4XRAA 1GSFA 3H1NA 3GYKA 3BOAA 2X8GA 1OE7A 2IJYA 1Q98A 4TRXA 3GKXA 1Z7RA 4BVYA 3G9BA 2WJUA 4PTSA 4G01A 4GTUA 2C0EA 4PX1A 4IGJA 1GNEA 4ZB8A 2WULA 2F9SA 6GSVA 4GSTA 2DMLA 1TXXA 2LKUA 3MAKA 1T4ZA 4EO3A 3QAGA 4RI6A 1YF1A 1T4YA 2KP1A 5CRHA 2AAWA 3GSTA 1I9DA 3LSZA 1SK1A 2O89A 2R0GA 2IFQA 3QFBC 4GSSA 2QKEA 3VWUA 5CREA 1T1VA 2WW0A 1PL1A 3N5OA 1TOFA 2R0CA 3P8WA 2OBKA 2VCXA 4KB3A 1EP7A 2L57A 2HSHA 2YJHA 1GNWA 1YZXA 1B8XA 4OO5A 1DE1A 3BBYA 1HYUA 6GSSA 1O81A 2NTOA 4YKFA 1PX6A 3CHXC 3LQ7A 2K6VA 16GSA 2VUPA 3RFRC 5IM9A 2CA8A 1RK4A 4F03A 4I5QA 2F3MA 2HFDA 3H79A 1TKDB 1O6JA 3DGQA 4KDUA 3DXBA 3IK7A 1WE0A 2H1AA 3GKKA 2VD0A 4MJBA 4X1UA 4QQ7A 3GN3A 2BMXA 19GSA 3U5RE 4KDYA 1IYHA 5IO0A 4O5UA 1JZRA 5G5FA 2EIOA 2VO4A 1QFNA 2OKAA 1VF4A 2V1MA 1EEJA 3GNJA 1EZKA 4XS4A 4MF6A 2IN3A 5CRDA 1BQ7A 3FW2A 4ZB7A 4LL1B 1UA5A 3FRCA 5FWGA 2WGRA 4W66A 2XHFA 5B8BA 3RPNA 3UJ1A 4IKHA 4OFNA 2NVLA 1QXHA 5H5QA 5DAKB 4YAVA 1VF2A 2PN8A 3IAM2 1F9MA 5A5KA 5B6MA 3GX0A 2B6MA 1N8JA 4ULXA 5J9BA 5IMCA 2R0PA 1S4BP 4E68A 2DJ1A 2WW3A 2X49A 2LEGA 2M46A 1YDKA 3VFIA 1U6TA 1XWGA 3I6AA 1O7UA 1U3IA 2HZEA 1Y6EA 4IP1A 4ZBAA 5FT3A 1MD3A 2J23A 2YWMA 3IHQA 3CYNA 2R3XA 3GH9A 3VI7A 1JZDA 2MBTA 2MYGA 4NAXA 2ZCTA 3KH9A 4MPFA 2C4JA 4RQXA 5EVOA 5HR0A 1R5PA 2A4HA 2MMAA 1QK8A 4HUAA 2WCIA 3LGCA 2AV4A 1U88A 2CQ9A 4AJ6A 2HSMA 3IBHA 4XRDA 3TKRA 3WGDA 1PQNA 2FCHA 4I2UA 5D96A 4E8EA 4JE1A 3GL3A 4MP4A 2FWEA 1YVLA 14GSA 5LCZA 3GA4A 4AKGA 5EY6A 3DRNA 1PN0A 3IA1A 4KSMA 5ECMB 4BIKA 2VOCA 1X9SB 2B5EA 1XW6A 3MDKA 1YY7A 2WVZA 4MCUA 2H30A 2X4AA 5HR2A 3ZRDA 3I69A 3Q19A 2HZFA 4K2DA 3TU3B 1QGVA 4GDFA 4RUVA 1HNAA 1BF5A 2DJ2A 3NIVA 4ZL9A 4MDCA 1WWJA 4JR6A 5DJMA 4POBA 4K0GA 4MH3A 1GTBA 1IYIA 1M2BA 5DALB 3GFKA 4J56E 1X5CA 3HCZA 2C80A 3F9UA 2VD1A 1O8WA 2GZZA 4Z7XA 4AKXB 5D9VA 1XXUA 1B9YC 3CSIA 4K1FA 1TK0B 1V57A 3GIXA 4Q5QA 4E8HA 5GAPD 11GSA 3ZMKA 3CSHA 4DSQA 5ENUA 1K3LA 4DEJA 2DIZA 5EL8A 1ML6A 3M9JA 2OA7A 4ZBDA 1NW2A 3SBCA 4WR4A 4K9ZA 3F8UA 1LU4A 4AKHA 3QPMA 3P90A 2DJJA 3L78A 2B1LA 1XW5A 5HFGA 4HOJA 2YOIA 5H5SA 2XPDA 2EC4A 2MMNA 4WKWA 4IW9A 3O6TA 1Z3EA 4J2FA 1NM3A 4KAEA 2VL2C 1ZZYA 3LXZA 1Z9HA 5IQYA 4FYUA 1ACVA 5IO2A 1OE8A 2ON7A 3CTGA 2WDUA 1X5EA 1B9XC 4EUYA 5KN3A 4KE3A 4L8EA 2H1BA 2VM2A 1G6YA 2NDOA 4GWRA 1ERVA 5DDLA 3HXSA 4MNNA 1FG4A 1URMA 4HZ4A 1MD4A 1F6MC 5BRTA 4MJEA 3D4TA 4N11A 1GSYA 1B4PA 1PL2A 5BMUB 2IMKA 4KCEA 2FD3A 2GSSA 2PU9C 4N30A 3TCOA 3HY2A 1OYJA 4K0NA 2EIQA 3NZNA 3AY8A 5CRGA 4CDOA 2VM1A 5A5HB 3VI5A 2B1KA 4GSNA 1S3AA 2MMOA 4I6XA 3ZVJA 4EL1A 4KGIA 1A23A 4HEA2 2HSNB 5DAKA 1K0NA 2H6XA 2HI7A 3TOUA 3D5JA 3MNGA 1A2LA 2TRCP 1F37A 2YN1A 2DC5A 1XWBA 3RBTA 4EVMA 5J47A 5E59A 2V32A 2H70A 2VLVA 3IV4A 4MZWA 4L0UA 4DSRA 4JBBA 2C1YA 1XOAA 4POKA 4L5LA 4HSCX 1SK0A 3WD6A 2LTKA 3VPQA 4KA0A 4MF7A 5ELAA 5J9CA 4ZB9A 4CY6A 3ZIVA 3KH7A 4PXOA 3A2VA 5F0GA 5G1LA 2X99A 1KTEA 3L9VA 2P0GA 3QDNA 3APOA 3BCIA 3TKSE 4XS1A 3GUSA 5J3RA 4BWSA 2HRFA 20GSA 4YQVA 3ZLPA 3VURA 3J7Yk 3IK9A 3F0IA 1K0OA 1ON4A 4ZILA 1ZL9A 1BAYA 1ZYNA 9GSSA 3WT1A 3EINA 1TU7A 2GVPA 1OKTA 3G7JA 2OJLA 4K7IA 3PGTA 1ERTA 4ECIA 2H0GA 2FWGA 3A3TA 3GX8A 3APSA 3QOUA 5JCGA 5IMAA 1E6BA 1R4WA 1XIYA 3L4NA 5IOWA 1VRSD 5LD0A 2HXKA 5DALA 4POLA 4ECBA 2AHEA 1TRWA 1V58A 1TK8B 1A0RP 1JLWA 2O3EA 1OC9B 4ZIJA 2KOKA 2CAQA 4LMWA 3FZ9A 3KEBA 1KEBA 1JZWA 1B4QA 2GSTA 3US3A 4CHSA 2GS3A 4KDXA 4MZCA 2O87A 2DJKA 2A4VA 1H75A 1XBSA 2V2GA 1RQMA 1EOGA 3GH6A 3IPZA 4EKZA 3SWLA 2CVBA 1EGOA 2P5QA 4FXYP 3EYTA 5DQSA 8GSSA 4IJ3A 1GULA 2MZCA 5G2ZA 2P31A 2GTUA 2JL4A 4JR4A 2JADA 3CMIA 2ES7A 5INYA 1KBNA 1UVZA 2HRNA 1M2DA 5FHIA 2E7PA 3TRPA 2C0FA 4L5OA 2YZHA 5KN0A 4NXIA 2HRAA 1K0BA 4EC0A 4XIHA 4IBPA 1XG8A 5BMUA 3UL3A 1X9WB 2QA2A 3ERWA 5A5HA 2AUVA 2I9HA 2FWHA 2CVDA 5G31A 1JLVA 1AQXA 2DKIA 3TUEA 3GL5A 2M80A 3U6VA 3CTFA 4O92A 4H86A 2HSNA 1DUGA 3ISOA 2JZRA 4ZL8A 4OD7A 2UV8G 4FO5A 2G2QA 5AISA 5DCGA 3FR3A 1A0FA 3FR6A 3TKSA 4LL4B 2FUG2 2YJ7A 5IPHA 3HD5A 3G7IA 4HU9A 2FGXA 4WETA 1S3CA 2B5XA 2YPMA 1XWAA 3FK8A 3IE3A 4LLRA 4EXJA 1M7TA 3ME8A 2CT6A 3DYRA 1K3OA 1FOVA 1GUKA 3NOFA 5DJLA 3GRXA 3DMLA 3P2AA 2O7KA 5IMVA 3TJKA 2LJKA 3M9KA 2LQOA 5JWOB 2DJ3A 1AQWA 4ECJA 2DJ0A 3TJGA 3VLNA 1K0AA 3H4KA 1MDKA 4AF2A 4GXZA 2IPAA 3CWGA 1T7PB 1BJXA 4WBJA 1SVMA 4OCFA 1FB0A 4TOPA 2NPBA 1PGTA 4A5PA 3EE2A 3ZFLA 3M3MA 4LA1A 3PH9A 2L6DA 1Y25A 2O5VA 1S3RA 4NV2A 1GSSA 3ZREA 4O7HA 1K0MA 5A4VA 3I43A 3VPTA 1X9MB 1EV4A 3TKSC 2I1UA 3E0UA 1U87A 5AIVA 5ECLB 3FYGA 3H93A 2P5RA 4MK3A 4OO4A 1AW9A 1OC3A 2R2JA 3KD0A 2N5FA 2FWFA 4WBRD 2R37A 3IDVA 1GTIA 3L9SA 1BYEA 2R6KA 5B6NA 3S9FA 4KX4A 1GLQA 1BG1A 4RQRA 3ZTLA 2GLRA 2CZ3A 5A4UA 3KXOA 3VWWA 1OVNA 3LYKA 3LJRA 1X0RA 4PI2C 2JSYA 2H0IA 4Q5NA 2L5OA 2OBIA 1OC9A 5ECNB 4N0VA 2H6YA 4QMKA 4F9ZA 3CSJA 1PN9A 1TW9A 3UIWA 2X64A 1SVLA 13GSA 4G10A 3CRUA 3BD2A 4AJ8A 5A34B 2CX3A 1QMVA 5G1KA 4EIQA 5KN1A 1WOUA 5KOWA 5ECIB 1N2AA 1O8XA 1A8LA 4IVFA 4MZBA 1AAZA 3UMAA 3HKRA 2VCWA 2FLSA 3DIEA 1I5GA 1G7OA 3G7YA 4F2IA 3GMFA 3CQFA 2VL2A 2UZ8A 5ECHB 3GTUB 1OAZA 5A4WA 1AQVA 5ELGA 2DMMA 3A5IA 1W89A 1ZCPA 3HVVA 2REMA 1TP9A 1CQGA 2RLIA 4TR1B 3RHBA 3KP9A 4PUFC 3FEUA 5CO3A 2F51A 2X8HA 3C8EA 2YV7A 3EWLA 4Z2UA 5IMZA 3QD9A 1GTAA 2VKZG 2H75A 2H74A 2VLTA 1JFUA 2FA4A 1YKAA 4TXOB 4KH7A 4J57E 2GSQA 3W8JA 2ZUPA 3DEXA 4XTSA 1RW1A 2IL3A 1GSDA 1J08A 4KSOA 2GT5A 3Q6OA 1GRXA 4FQUA 4ISDA 2OADA 5H5RA 3GV1A 1PSQA 3GURA 4BPYA 1A2JA 4NV5A 1R7HA 2F8AA 4Q5FA 4HI7A 2GZPA 3IHGA 5C04A 4CW9A 5IPGA 1Z5YE 1XW9A 5HFIA 3KTLA 2PVOC 4X4JA 4IQAA 2V6KA 3TRQA 4FH8A 4BVXB 3W6GA 2A2RA 2WVXB 1Z6NA 5AIXA 10GSA 1MTCA 2L6CA 2HE3A 5D73A 2I4AA 2OE0A 1PRXA 3RGBC 4X0XA 2GDRA 4KF9A 5D9XA 2V6OA 2D2ZA 3DVXA 5ECPB 3LG6A 1LJRA 2FA8A 2L5LA 3C7MA 3F4TA 1N25A 3A5WA 4HZ2A 2H0HA
chains in the Genus database with same CATH topology
3FZAA 2YCDA 2KUCA 4MABA 2F8FA 2JSZA 2LJAA 1M0UA 3EC3A 2CZ2A 4HJMA 4AKIA 2DIYA 2DSAA 3LXTA 3EU3A 5KN2A 2OACA 2OE3A 2B7KA 3K8NA 2YP6A 1KNGA 3P7XA 2R4VA 2HYXA 2LSTA 3VWVA 4G0KA 4OFMA 1V9WA 3M1GA 5B7CA 1TU8A 4N10A 3PPUA 3CBUA 4WF4A 2H6ZA 2RUFA 2PVQA 1XCCA 1XZOA 1ZOFA 5F07A 2RM6A 2YV9A 1SKSB 1YEXA 1VGLA 5AGYA 4NWYA 4I8BA 1NHOA 2PGTA 5A34A 3EMPA 2E2MA 5G30A 2H76A 3KGKA 4X43A 2DBCA 1ILOA 3I9V2 2JZTA 1TJDA 1PA3A 4CY8A 3WT2A 3IC8A 2R5GA 3HA9A 4G0IA 1GSQA 2WZ9A 2PMTA 2A2SA 3ME7A 3TRXA 1G6WA 2L4QA 2TRXA 5HR3A 4KUNA 1BG5A 3IAS2 1T00A 3E9JB 4Z2TA 3GTUA 1SJIA 5ECKB 7GSSA 2LV3A 2PWJA 2ON5A 3IR4A 2NBSA 2GT6A 1LBKA 1PKZA 3HVSA 4K5RA 1DSBA 4TR1A 5G5EA 1EV9A 3MYDA 4AGSA 2LUSA 5ABRA 3FHKA 1FVKA 4EDYA 2L59A 3GHAA 3DVWA 2KP2A 4V2MA 1GSUA 2CV4A 4GLTA 3DWVA 4HS1A 1GUHA 1SD9A 2VIMA 4HQZA 1SJ6A 4ML1A 4OFTA 2O85A 1SL2B 4TXOA 4XS6A 2E2GA 1SJZA 1UC7A 2HRKB 5F06A 6GSWA 1THOA 2A2PA 4WXTA 2H71A 4V1Ag 1DBYA 3QFAC 1GLPA 3ZMLA 4MLYA 3C1RA 4PNFA 3ED3A 1WMJA 2K8VA 1NSWA 3RPPA 3ZVJD 3N9JA 1G7EA 3D22A 5J41A 4USSA 4HQSA 5IMFA 1C72A 1MDJA 4JU5A 2ALBA 1T8EB 4DVCA 3BJ5A 4GQCA 4PURA 2HT9A 3HJPA 1XPVA 4ML6A 4AJ7A 5HR1A 4PGTA 2LNSA 3UEMA 3HVXA 4JZQA 3GKMA 4P3YB 2HQTA 1FVJA 2B5YA 1Y1UA 4BVXA 4KNDA 3VWXA 5IMDA 5J4UA 1SL0B 1USBA 2HSYA 3O76A 4XHMA 5EPFA 4K7OA 3IOSA 4ICYA 4Z2RA 1YF0A 1TTZA 3RAZA 2LJRA 2GQLA 1V40A 3QAVA 3WGXA 1ABAA 2CX4A 5JWQB 5ECOB 4ILFA 4IELA 2H72A 1AIUA 2MMZA 5JCWA 2IIYA 1XFLA 2C3TA 1SD8A 4EDZA 4TXVA 1GTUA 1M2AA 4YH2A 3MIXA 1DE2A 3F63A 2XBIA 4ACSA 1YKCA 3R2QA 1TRSA 2WS2A 1Q4JA 1TRVA 4PNGA 1F3BA 5GAND 1ERUA 1ZYPA 18GSA 2HNLA 3Q18A 2I81A 3KCMA 2N5AA 5CP1A 1W4VA 5J40A 5J5NA 1VF3A 4ZB6A 2VCTA 1XWCA 5DCHA 5DQYA 1FAAA 3VK9A 2WB9A 1A2MA 1OC8A 4GCIA 2CAIA 5D9WA 3LYPA 5D93A 3HDCA 4NHZA 3IC4A 3HHVA 2B7JA 5IIZA 3UBLA 1SKWB 3GSSA 17GSA 4FIWA 2AJQB 2I3YA 2JZSA 2OE1A 1FHEA 1XVWA 3R3EA 6GSTA 3ZFBA 3LEFA 1MDIA 4BL7B 1A8YA 2V41A 2YZUA 2IMFA 2OT3A 1TK5B 2FNOA 1MEKA 3EURA 1GL8A 3QCPA 2VL9A 4K2XA 2PERA 1ST9A 2C3NA 3UOMA 3KMOA 3DKSA 2O8VB 1JHBA 1NHYA 2LRNA 4HDEA 5CAXA 2GQMA 1TDIA 1G0TA 3QR6A 3FR9A 5J4YA 2E0QA 3LW9A 2XC2A 4G19A 4I97A 4NMUA 3ZZXA 3KIJA 3ZL5A 1M99A 4O5QA 3TGZA 1ZYEA 1GP1A 1PD21 3Q74A 1SK2A 4MF5A 1SYXA 4YQMA 2YWIA 5JWRB 2VCZA 4O5RA 1FB6A 3RHCA 4FYBA 3OR5A 12GSA 3QMXA 5ID2B 4D73B 1EOHA 1TXUA 4I2TA 1R5AA 4AI6A 3MWHA 1F2EA 2AYTA 1TI3A 3HZ4A 3HYPA 1FO5A 4MJCA 2HRKA 4V2LA 4G0LA 5AN1A 2GGTA 1M9AA 2PBJA 5ECQB 3F6DA 5C00A 4MPGA 1QQ2A 1TRUA 3MSZA 1U3AA 1BX9A 3ZIJA 1ZYQB 4PUAA 4BA7A 3HZ8A 4NPBA 2H1LA 2GSRA 3IXRA 2LS5A 2IMEA 1SENA 4ECCA 2AB6A 1V98A 4V1Ap 1B48A 6GSXA 5D9TA 3O3TA 5CYYA 4WEYA 2MBSA 3EU4A 3FZ5A 1GUMA 4HU7A 2BTOT 1YJ6A 5DBQA 2H73A 2LQQA 3TDGA 5CRWA 2IMIA 5KEJA 1Z7PA 2EFDA 2K18A 2VAFA 3TJJA 1JZOA 1VF1A 3D0ZA 1THXA 1YEPA 2C0GA 2L4CA 3F3RA 3ERGA 2YWNA 1GH2A 1PKWA 4F0CA 4QL7A 1WIKA 3M8NA 1M9BA 1H4OA 1F3AA 1SVOA 4JEDA 3WGEA 2BJXA 2VL3A 4DSSB 2FHEA 3C1SA 5E4WA 1A24A 1BEDA 1HNCA 2LRCA 3J7Yb 1R26A 2M72A 2KHPA 4G2EA 5GZZB 2DKHA 1WPIA 1GWCA 4OMVA 3FKFA 2C8UA 3C71A 3LORA 2CVKA 3APQA 5L71A 3LFLA 1XVQA 1J9BA 4MJAA 2JU5A 1GSEA 5A1NB 3FY7A 2YANA 3V1WA 22GSA 3TJFA 3L9UA 2H01A 5ECRB 3D21A 2IMDA 3UBKA 4IJIA 1EWXA 3GKNA 4BVYB 2GQKA 4F82A 1K0CA 4POMA 1FOHA 5GSSA 1X5DA 2WRTA 5KOXA 4OWYA 1EGRA 3F4RA 6GSYA 5F05A 1SL1B 3EPTA 2YNXA 1J0FA 2H66A 4HJ2A 3IRAA 4TKYA 4TR0A 2RUEA 2LRTA 4GF0A 1YQ1A 4ZBBA 2IFQB 1SYRA 4TR3A 1V2AA 3KM6A 4L0WA 3UAPA 4K5SA 4N3ZA 5D8IA 4BL7A 1AC1A 4TR4A 3QAWA 4WR5A 5J4VA 4JRRA 3HJMA 1K3YA 1E2YA 3EMXA 6GSUA 3WYWA 3TJBA 4EE0A 4NHWA 3C73A 3PINA 2H19A 4IN0A 4RI7A 4WF5A 3ERFA 5B8AA 5F8BA 4IS0A 3F3QA 4KW6A 4Q5RA 2PUKC 1XOBA 2C0DA 4ID0A 3UARA 1WJKA 1CQHA 3TOTA 1OKDA 3DD3A 2H8LA 2QA1A 1PX7A 2KLXA 4EF0A 5CNWA 4XCSA 3TKPA 1ZGNA 2QGVA 3F6FA 2XBQA 4YAPA 1HNBA 2EFCA 5ID2A 2LNTA 3A2WA 4D73A 2QSIA 3KJYA 3UVHA 4QL9A 5IOXA 3FZ4A 2FY6A 2JACA 4LMVA 3TB2A 1O85A 2DLXA 1HD2A 3ZYWA 1QUWA 2K8SA 4YKGA 2H1DA 4TN8A 3KMNA 2WFCA 4XS4B 1K0DA 5DVBA 3KZQA 1EEMA 2VLUA 3FMWA 2K9FA 5HFKA 3M0FA 4MA9A 4K7NA 5HQPA 2ZNMA 2PPTA 3A2XA 2C3QA 3ZITA 4PQ1A 4IP6A 3CXGA 3L0HA 3PR8A 2B3SA 4F0BA 2VCVA 3EVIA 5LNKe 4TW5A 4TVEA 3UVTA 5JCUA 3H8QA 3KTBA 4ZXGA 1T3BA 2EFEA 3JCML 2H1GA 4V2NA 3RDWA 2HZEB 4ZL7A 4MH2A 1WRYA 4GQFA 4K6XA 4O32A 4OCEA 4FYCA 3CRTA 2EIRA 3KP8A 1WP0A 1Z6MA 5ECSA 5GSTA 2IWTA 4PQIA 1ERWA 2N5BA 4G9HA 4EIPA 2HLSA 4IQ1A 3W8SA 1EP8A 2VCQA 3E3EA 2G0FA 1SU9A 2QC7A 2HSMB 3D4MA 4DSSA 2YWOA 1TI1A 2Z9SA 1ZMAA 5COHA 2GZYA 1SKRB 1S3DA 1O73A 1FW1A 3TKQA 3HMJG 4K8MA 4BWQA 3D6IA 1AUCA 2RM5A 3LWAA 4MMMA 1XWKA 2X8CA 4KCAA 1HQOA 4GRFA 4N0ZA 4YQUA 2XPEA 3HJOA 2EFHA 2J9HA 4PQHA 5A1NA 1AXDA 2RIIA 1UN2A 2TIRA 4IHUA 1PMTA 3F4SA 3BCKA 4XRAA 1GSFA 3H1NA 3GYKA 3BOAA 2X8GA 1OE7A 2IJYA 1Q98A 4TRXA 3GKXA 1Z7RA 4BVYA 3G9BA 2WJUA 4PTSA 4G01A 4GTUA 2C0EA 4PX1A 4IGJA 1GNEA 4ZB8A 2WULA 2F9SA 6GSVA 4GSTA 2DMLA 1TXXA 2LKUA 3MAKA 1T4ZA 4EO3A 3QAGA 4RI6A 1YF1A 1T4YA 2KP1A 5CRHA 2AAWA 3GSTA 1I9DA 3LSZA 1SK1A 2O89A 2R0GA 2IFQA 3QFBC 4GSSA 2QKEA 3VWUA 5CREA 1T1VA 1PL1A 3N5OA 1TOFA 2R0CA 3P8WA 2OBKA 2VCXA 4KB3A 1EP7A 2L57A 2HSHA 2YJHA 1GNWA 1YZXA 1B8XA 4OO5A 1DE1A 3BBYA 1HYUA 6GSSA 1O81A 2NTOA 4YKFA 1PX6A 3LQ7A 2K6VA 16GSA 2VUPA 5IM9A 2CA8A 1RK4A 4F03A 4I5QA 2F3MA 2HFDA 3H79A 1TKDB 1O6JA 3DGQA 4KDUA 3DXBA 3IK7A 1WE0A 2H1AA 3GKKA 2VD0A 4MJBA 4X1UA 4QQ7A 3GN3A 2BMXA 19GSA 3U5RE 4KDYA 1IYHA 5IO0A 4O5UA 1JZRA 5G5FA 2EIOA 2VO4A 1QFNA 2OKAA 1VF4A 2V1MA 1EEJA 3GNJA 1EZKA 4XS4A 4MF6A 2IN3A 5CRDA 1BQ7A 3FW2A 4ZB7A 4LL1B 1UA5A 3FRCA 5FWGA 2WGRA 4W66A 2XHFA 5B8BA 3RPNA 3UJ1A 4IKHA 4OFNA 2NVLA 1QXHA 5H5QA 5DAKB 4YAVA 1VF2A 2PN8A 3IAM2 1F9MA 5A5KA 5B6MA 3GX0A 2B6MA 1N8JA 4ULXA 5J9BA 5IMCA 2R0PA 4E68A 2DJ1A 2X49A 2LEGA 2M46A 1YDKA 3VFIA 1U6TA 1XWGA 3I6AA 1O7UA 1U3IA 2HZEA 1Y6EA 4IP1A 4ZBAA 5FT3A 1MD3A 2J23A 2YWMA 3IHQA 3CYNA 2R3XA 3GH9A 3VI7A 1JZDA 2MBTA 2MYGA 4NAXA 2ZCTA 3KH9A 4MPFA 2C4JA 4RQXA 5EVOA 5HR0A 1R5PA 2A4HA 2MMAA 1QK8A 4HUAA 2WCIA 3LGCA 2AV4A 1U88A 2CQ9A 4AJ6A 2HSMA 3IBHA 4XRDA 3TKRA 3WGDA 1PQNA 2FCHA 4I2UA 5D96A 4E8EA 4JE1A 3GL3A 4MP4A 2FWEA 1YVLA 14GSA 5LCZA 3GA4A 4AKGA 5EY6A 3DRNA 1PN0A 3IA1A 4KSMA 5ECMB 2VOCA 1X9SB 2B5EA 1XW6A 3MDKA 1YY7A 4MCUA 2H30A 2X4AA 5HR2A 3ZRDA 3I69A 3Q19A 2HZFA 4K2DA 3TU3B 1QGVA 4GDFA 4RUVA 1HNAA 1BF5A 2DJ2A 3NIVA 4ZL9A 4MDCA 1WWJA 4JR6A 5DJMA 4POBA 4K0GA 4MH3A 1GTBA 1IYIA 1M2BA 5DALB 3GFKA 4J56E 1X5CA 3HCZA 2C80A 3F9UA 2VD1A 1O8WA 2GZZA 4Z7XA 4AKXB 5D9VA 1XXUA 1B9YC 3CSIA 4K1FA 1TK0B 1V57A 3GIXA 4Q5QA 4E8HA 5GAPD 11GSA 3ZMKA 3CSHA 4DSQA 5ENUA 1K3LA 4DEJA 2DIZA 5EL8A 1ML6A 3M9JA 2OA7A 4ZBDA 1NW2A 3SBCA 4WR4A 4K9ZA 3F8UA 1LU4A 4AKHA 3QPMA 3P90A 2DJJA 3L78A 2B1LA 1XW5A 5HFGA 4HOJA 2YOIA 5H5SA 2XPDA 2EC4A 2MMNA 4WKWA 4IW9A 3O6TA 1Z3EA 4J2FA 1NM3A 4KAEA 2VL2C 1ZZYA 3LXZA 1Z9HA 5IQYA 4FYUA 1ACVA 5IO2A 1OE8A 2ON7A 3CTGA 2WDUA 1X5EA 1B9XC 4EUYA 5KN3A 4KE3A 4L8EA 2H1BA 2VM2A 1G6YA 2NDOA 4GWRA 1ERVA 5DDLA 3HXSA 4MNNA 1FG4A 1URMA 4HZ4A 1MD4A 1F6MC 5BRTA 4MJEA 3D4TA 4N11A 1GSYA 1B4PA 1PL2A 5BMUB 2IMKA 4KCEA 2FD3A 2GSSA 2PU9C 4N30A 3TCOA 3HY2A 1OYJA 4K0NA 2EIQA 3NZNA 3AY8A 5CRGA 4CDOA 2VM1A 5A5HB 3VI5A 2B1KA 4GSNA 1S3AA 2MMOA 4I6XA 3ZVJA 4EL1A 4KGIA 1A23A 4HEA2 2HSNB 5DAKA 1K0NA 2H6XA 2HI7A 3TOUA 3D5JA 3MNGA 1A2LA 2TRCP 1F37A 2YN1A 2DC5A 1XWBA 3RBTA 4EVMA 5J47A 5E59A 2V32A 2H70A 2VLVA 3IV4A 4MZWA 4L0UA 4DSRA 4JBBA 2C1YA 1XOAA 4POKA 4L5LA 1SK0A 3WD6A 2LTKA 3VPQA 4KA0A 4MF7A 5ELAA 5J9CA 4ZB9A 4CY6A 3ZIVA 3KH7A 4PXOA 3A2VA 5F0GA 5G1LA 2X99A 1KTEA 3L9VA 2P0GA 3QDNA 3APOA 3BCIA 3TKSE 4XS1A 3GUSA 5J3RA 4BWSA 2HRFA 20GSA 4YQVA 3ZLPA 3VURA 3J7Yk 3IK9A 3F0IA 1K0OA 1ON4A 4ZILA 1ZL9A 1BAYA 1ZYNA 9GSSA 3WT1A 3EINA 1TU7A 2GVPA 1OKTA 3G7JA 2OJLA 4K7IA 3PGTA 1ERTA 4ECIA 2H0GA 2FWGA 3A3TA 3GX8A 3APSA 3QOUA 5JCGA 5IMAA 1E6BA 1R4WA 1XIYA 3L4NA 5IOWA 1VRSD 5LD0A 2HXKA 5DALA 4POLA 4ECBA 2AHEA 1TRWA 1V58A 1TK8B 1A0RP 1JLWA 1OC9B 4ZIJA 2KOKA 2CAQA 4LMWA 3FZ9A 3KEBA 1KEBA 1JZWA 1B4QA 2GSTA 3US3A 4CHSA 2GS3A 4KDXA 4MZCA 2O87A 2DJKA 2A4VA 1H75A 1XBSA 2V2GA 1RQMA 1EOGA 3GH6A 3IPZA 4EKZA 3SWLA 2CVBA 1EGOA 2P5QA 3EYTA 5DQSA 8GSSA 4IJ3A 1GULA 2MZCA 5G2ZA 2P31A 2GTUA 2JL4A 4JR4A 2JADA 3CMIA 2ES7A 5INYA 1KBNA 1UVZA 2HRNA 1M2DA 5FHIA 2E7PA 3TRPA 2C0FA 4L5OA 2YZHA 5KN0A 4NXIA 2HRAA 1K0BA 4EC0A 4XIHA 4IBPA 5BMUA 3UL3A 1X9WB 2QA2A 3ERWA 5A5HA 2AUVA 2I9HA 2FWHA 2CVDA 5G31A 1JLVA 1AQXA 2DKIA 3TUEA 3GL5A 2M80A 3U6VA 3CTFA 4O92A 4H86A 2HSNA 1DUGA 3ISOA 2JZRA 4ZL8A 4OD7A 2UV8G 4FO5A 2G2QA 5AISA 5DCGA 3FR3A 1A0FA 3FR6A 3TKSA 4LL4B 2FUG2 2YJ7A 5IPHA 3HD5A 3G7IA 4HU9A 2FGXA 4WETA 1S3CA 2B5XA 2YPMA 1XWAA 3FK8A 3IE3A 4LLRA 4EXJA 1M7TA 3ME8A 2CT6A 3DYRA 1K3OA 1FOVA 1GUKA 3NOFA 5DJLA 3GRXA 3DMLA 3P2AA 2O7KA 5IMVA 3TJKA 2LJKA 3M9KA 2LQOA 5JWOB 2DJ3A 1AQWA 4ECJA 2DJ0A 3TJGA 3VLNA 1K0AA 3H4KA 1MDKA 4AF2A 4GXZA 2IPAA 3CWGA 1T7PB 1BJXA 4WBJA 1SVMA 4OCFA 1FB0A 4TOPA 2NPBA 1PGTA 4A5PA 3EE2A 3ZFLA 3M3MA 4LA1A 3PH9A 2L6DA 1Y25A 2O5VA 4NV2A 1GSSA 3ZREA 4O7HA 1K0MA 5A4VA 3I43A 3VPTA 1X9MB 1EV4A 3TKSC 2I1UA 3E0UA 1U87A 5AIVA 5ECLB 3FYGA 3H93A 2P5RA 4MK3A 4OO4A 1AW9A 1OC3A 2R2JA 3KD0A 2N5FA 2FWFA 4WBRD 2R37A 3IDVA 1GTIA 3L9SA 1BYEA 2R6KA 5B6NA 3S9FA 4KX4A 1GLQA 1BG1A 4RQRA 3ZTLA 2GLRA 2CZ3A 5A4UA 3KXOA 3VWWA 1OVNA 3LYKA 3LJRA 1X0RA 2JSYA 2H0IA 4Q5NA 2L5OA 2OBIA 1OC9A 5ECNB 4N0VA 2H6YA 4QMKA 4F9ZA 3CSJA 1PN9A 1TW9A 3UIWA 2X64A 1SVLA 13GSA 4G10A 3CRUA 3BD2A 4AJ8A 5A34B 2CX3A 1QMVA 5G1KA 4EIQA 5KN1A 1WOUA 5KOWA 5ECIB 1N2AA 1O8XA 1A8LA 4IVFA 4MZBA 1AAZA 3UMAA 3HKRA 2VCWA 2FLSA 3DIEA 1I5GA 1G7OA 3G7YA 4F2IA 3GMFA 2VL2A 2UZ8A 5ECHB 3GTUB 1OAZA 5A4WA 1AQVA 5ELGA 2DMMA 3A5IA 1W89A 1ZCPA 3HVVA 2REMA 1TP9A 1CQGA 2RLIA 4TR1B 3RHBA 3KP9A 4PUFC 3FEUA 5CO3A 2F51A 2X8HA 3C8EA 2YV7A 3EWLA 4Z2UA 5IMZA 3QD9A 1GTAA 2VKZG 2H75A 2H74A 2VLTA 1JFUA 2FA4A 1YKAA 4TXOB 4KH7A 4J57E 2GSQA 3W8JA 2ZUPA 3DEXA 4XTSA 1RW1A 2IL3A 1GSDA 1J08A 4KSOA 2GT5A 3Q6OA 1GRXA 4FQUA 4ISDA 2OADA 5H5RA 3GV1A 1PSQA 3GURA 4BPYA 1A2JA 4NV5A 1R7HA 2F8AA 4Q5FA 4HI7A 2GZPA 3IHGA 5C04A 4CW9A 5IPGA 1Z5YE 1XW9A 5HFIA 3KTLA 2PVOC 4X4JA 4IQAA 2V6KA 3TRQA 4FH8A 4BVXB 3W6GA 2A2RA 1Z6NA 5AIXA 10GSA 1MTCA 2L6CA 2HE3A 5D73A 2I4AA 2OE0A 1PRXA 4X0XA 2GDRA 4KF9A 5D9XA 2V6OA 2D2ZA 3DVXA 5ECPB 3LG6A 1LJRA 2FA8A 2L5LA 3C7MA 3F4TA 1N25A 3A5WA 4HZ2A 2H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZA A;  2YCD A;  2KUC A;  4MAB A;  2F8F A;  2JSZ A;  2LJA A;  1M0U A;  3EC3 A;  2CZ2 A;  4HJM A;  2DIY A;  2DSA A;  3LXT A;  3EU3 A;  5KN2 A;  2OAC A;  2OE3 A;  2B7K A;  3K8N A;  2YP6 A;  1KNG A;  3P7X A;  2R4V A;  2HYX A;  2LST A;  3VWV A;  4G0K A;  4OFM A;  1V9W A;  3M1G A;  5B7C A;  1TU8 A;  4N10 A;  3PPU A;  3CBU A;  4WF4 A;  2H6Z A;  2RUF A;  2PVQ A;  1XCC A;  1XZO A;  1ZOF A;  5F07 A;  2RM6 A;  2YV9 A;  1SKS B;  1YEX A;  1VGL A;  5AGY A;  4NWY A;  4I8B A;  1NHO A;  2PGT A;  3EMP A;  2E2M A;  5G30 A;  2H76 A;  3KGK A;  4X43 A;  2DBC A;  1ILO A;  3I9V 2;  2JZT A;  1TJD A;  1PA3 A;  3WT2 A;  3IC8 A;  2R5G A;  3HA9 A;  4G0I A;  1GSQ A;  2WZ9 A;  2PMT A;  2A2S A;  3ME7 A;  3TRX A;  1G6W A;  2L4Q A;  2TRX A;  5HR3 A;  4KUN A;  1BG5 A;  3IAS 2;  1T00 A;  3E9J B;  3GTU A;  1SJI A;  5ECK B;  7GSS A;  2LV3 A;  2PWJ A;  2ON5 A;  3IR4 A;  2NBS A;  2GT6 A;  1LBK A;  1PKZ A;  3HVS A;  1DSB A;  4TR1 A;  5G5E A;  1EV9 A;  4AGS A;  2LUS A;  5ABR A;  3FHK A;  1FVK A;  4EDY A;  2L59 A;  3GHA A;  3DVW A;  2KP2 A;  4V2M A;  1GSU A;  2CV4 A;  4GLT A;  3DWV A;  4HS1 A;  1GUH A;  1SD9 A;  2VIM A;  4HQZ A;  1SJ6 A;  4ML1 A;  4OFT A;  2O85 A;  1SL2 B;  4TXO A;  4XS6 A;  2E2G A;  1SJZ A;  1UC7 A;  2HRK B;  5F06 A;  6GSW A;  1THO A;  4WXT A;  2H71 A;  4V1A g;  1DBY A;  3QFA C;  1GLP A;  3ZML A;  4MLY A;  3C1R A;  4PNF A;  3ED3 A;  1WMJ A;  2K8V A;  1NSW A;  3RPP A;  3ZVJ D;  3N9J A;  1G7E A;  3D22 A;  5J41 A;  4USS A;  4HQS A;  5IMF A;  1C72 A;  1MDJ A;  4JU5 A;  2ALB A;  1T8E B;  4DVC A;  3BJ5 A;  4GQC A;  4PUR A;  2HT9 A;  3HJP A;  1XPV A;  4ML6 A;  4AJ7 A;  5HR1 A;  4PGT A;  2LNS A;  3UEM A;  3HVX A;  4JZQ A;  3GKM A;  4P3Y B;  2HQT A;  1FVJ A;  2B5Y A;  4BVX A;  4KND A;  3VWX A;  5IMD A;  5J4U A;  1SL0 B;  1USB A;  2HSY A;  3O76 A;  4XHM A;  5EPF A;  4K7O A;  3IOS A;  1YF0 A;  1TTZ A;  3RAZ A;  2LJR A;  2GQL A;  1V40 A;  3QAV A;  3WGX A;  1ABA A;  2CX4 A;  5JWQ B;  5ECO B;  4ILF A;  4IEL A;  2H72 A;  1AIU A;  2MMZ A;  5JCW A;  2IIY A;  1XFL A;  2C3T A;  1SD8 A;  4EDZ A;  4TXV A;  1GTU A;  1M2A A;  4YH2 A;  1DE2 A;  3F63 A;  2XBI A;  4ACS A;  1YKC A;  3R2Q A;  1TRS A;  2WS2 A;  1Q4J A;  1TRV A;  4PNG A;  1F3B A;  5GAN D;  1ERU A;  18GS A;  2HNL A;  3Q18 A;  2I81 A;  3KCM A;  2N5A A;  5CP1 A;  1W4V A;  5J5N A;  1VF3 A;  4ZB6 A;  2VCT A;  1XWC A;  5DCH A;  5DQY A;  1FAA A;  3VK9 A;  2WB9 A;  1A2M A;  1OC8 A;  4GCI A;  2CAI A;  5D9W A;  3LYP A;  5D93 A;  3HDC A;  4NHZ A;  3IC4 A;  3HHV A;  2B7J A;  5IIZ A;  3UBL A;  1SKW B;  3GSS A;  17GS A;  4FIW A;  2AJQ B;  2I3Y A;  2JZS A;  2OE1 A;  1FHE A;  1XVW A;  3R3E A;  6GST A;  3ZFB A;  3LEF A;  1MDI A;  4BL7 B;  1A8Y A;  2V41 A;  2YZU A;  2IMF A;  1TK5 B;  2FNO A;  1MEK A;  3EUR A;  1GL8 A;  3QCP A;  2VL9 A;  2PER A;  1ST9 A;  2C3N A;  3UOM A;  3KMO A;  3DKS A;  2O8V B;  1JHB A;  1NHY A;  2LRN A;  4HDE A;  5CAX A;  2GQM A;  1TDI A;  1G0T A;  3QR6 A;  3FR9 A;  2E0Q A;  2XC2 A;  4G19 A;  4I97 A;  4NMU A;  3ZZX A;  3KIJ A;  3ZL5 A;  1M99 A;  3TGZ A;  1ZYE A;  1GP1 A;  1PD2 1;  3Q74 A;  1SK2 A;  4MF5 A;  1SYX A;  4YQM A;  2YWI A;  5JWR B;  2VCZ A;  4O5R A;  1FB6 A;  3RHC A;  4FYB A;  3OR5 A;  12GS A;  3QMX A;  5ID2 B;  4D73 B;  1EOH A;  4I2T A;  1R5A A;  3MWH A;  1F2E A;  2AYT A;  1TI3 A;  3HZ4 A;  3HYP A;  1FO5 A;  4MJC A;  2HRK A;  4V2L A;  4G0L A;  5AN1 A;  2GGT A;  1M9A A;  2PBJ A;  5ECQ B;  3F6D A;  5C00 A;  4MPG A;  1QQ2 A;  1TRU A;  3MSZ A;  1U3A A;  1BX9 A;  3ZIJ A;  1ZYQ B;  4PUA A;  4BA7 A;  3HZ8 A;  4NPB A;  2GSR A;  3IXR A;  2LS5 A;  2IME A;  1SEN A;  4ECC A;  2AB6 A;  1V98 A;  4V1A p;  1B48 A;  6GSX A;  5D9T A;  3O3T A;  5CYY A;  4WEY A;  2MBS A;  3EU4 A;  3FZ5 A;  1GUM A;  4HU7 A;  2BTO T;  1YJ6 A;  5DBQ A;  2H73 A;  2LQQ A;  3TDG A;  5CRW A;  2IMI A;  5KEJ A;  1Z7P A;  2K18 A;  2VAF A;  3TJJ A;  1JZO A;  1VF1 A;  3D0Z A;  1THX A;  1YEP A;  2C0G A;  2L4C A;  3F3R A;  3ERG A;  2YWN A;  1GH2 A;  1PKW A;  4F0C A;  4QL7 A;  1WIK A;  3M8N A;  1M9B A;  1H4O A;  1F3A A;  4JED A;  3WGE A;  2BJX A;  2VL3 A;  4DSS B;  2FHE A;  3C1S A;  5E4W A;  1A24 A;  1BED A;  1HNC A;  2LRC A;  3J7Y b;  1R26 A;  2M72 A;  2KHP A;  4G2E A;  5GZZ B;  1WPI A;  1GWC A;  4OMV A;  3FKF A;  2C8U A;  3C71 A;  3LOR A;  2CVK A;  3APQ A;  5L71 A;  3LFL A;  1XVQ A;  1J9B A;  4MJA A;  2JU5 A;  1GSE A;  3FY7 A;  2YAN A;  3V1W A;  22GS A;  3TJF A;  3L9U A;  2H01 A;  5ECR B;  3D21 A;  2IMD A;  3UBK A;  4IJI A;  1EWX A;  3GKN A;  4BVY B;  2GQK A;  4F82 A;  1K0C A;  4POM A;  5GSS A;  1X5D A;  2WRT A;  4OWY A;  1EGR A;  3F4R A;  6GSY A;  5F05 A;  1SL1 B;  2YNX A;  1J0F A;  2H66 A;  4HJ2 A;  3IRA A;  4TKY A;  4TR0 A;  2RUE A;  2LRT A;  4GF0 A;  1YQ1 A;  4ZBB A;  2IFQ B;  1SYR A;  4TR3 A;  1V2A A;  3KM6 A;  4L0W A;  3UAP A;  5D8I A;  4BL7 A;  1AC1 A;  4TR4 A;  3QAW A;  4WR5 A;  4JRR A;  3HJM A;  1K3Y A;  1E2Y A;  3EMX A;  6GSU A;  3WYW A;  3TJB A;  4EE0 A;  4NHW A;  3C73 A;  3PIN A;  2H19 A;  4IN0 A;  4RI7 A;  4WF5 A;  3ERF A;  5B8A A;  5F8B A;  4IS0 A;  3F3Q A;  4KW6 A;  4Q5R A;  2PUK C;  1XOB A;  2C0D A;  4ID0 A;  3UAR A;  1WJK A;  1CQH A;  3TOT A;  1OKD A;  3DD3 A;  2H8L A;  1PX7 A;  2KLX A;  4EF0 A;  5CNW A;  4XCS A;  3TKP A;  1ZGN A;  2QGV A;  3F6F A;  2XBQ A;  4YAP A;  1HNB A;  5ID2 A;  2LNT A;  3A2W A;  4D73 A;  2QSI A;  3KJY A;  3UVH A;  4QL9 A;  5IOX A;  3FZ4 A;  2FY6 A;  2JAC A;  4LMV A;  3TB2 A;  1O85 A;  2DLX A;  1HD2 A;  3ZYW A;  1QUW A;  2K8S A;  2H1D A;  4TN8 A;  3KMN A;  2WFC A;  4XS4 B;  1K0D A;  5DVB A;  3KZQ A;  1EEM A;  2VLU A;  2K9F A;  5HFK A;  3M0F A;  4MA9 A;  4K7N A;  5HQP A;  2ZNM A;  2PPT A;  3A2X A;  2C3Q A;  3ZIT A;  4PQ1 A;  4IP6 A;  3CXG A;  3L0H A;  3PR8 A;  2B3S A;  4F0B A;  2VCV A;  3EVI A;  5LNK e;  4TW5 A;  4TVE A;  3UVT A;  5JCU A;  3H8Q A;  3KTB A;  4ZXG A;  1T3B A;  3JCM L;  2H1G A;  4V2N A;  3RDW A;  2HZE B;  4ZL7 A;  4MH2 A;  1WRY A;  4GQF A;  4K6X A;  4O32 A;  4OCE A;  4FYC A;  3CRT A;  2EIR A;  3KP8 A;  1WP0 A;  1Z6M A;  5ECS A;  5GST A;  2IWT A;  4PQI A;  1ERW A;  2N5B A;  4G9H A;  2HLS A;  4IQ1 A;  3W8S A;  1EP8 A;  2VCQ A;  3E3E A;  2G0F A;  1SU9 A;  2QC7 A;  2HSM B;  3D4M A;  4DSS A;  2YWO A;  1TI1 A;  2Z9S A;  1ZMA A;  5COH A;  2GZY A;  1SKR B;  1S3D A;  1O73 A;  1FW1 A;  3TKQ A;  4K8M A;  4BWQ A;  3D6I A;  1AUC A;  2RM5 A;  3LWA A;  4MMM A;  1XWK A;  2X8C A;  4KCA A;  1HQO A;  4GRF A;  4N0Z A;  4YQU A;  2XPE A;  3HJO A;  2J9H A;  4PQH A;  1AXD A;  2RII A;  1UN2 A;  2TIR A;  4IHU A;  1PMT A;  3F4S A;  3BCK A;  4XRA A;  1GSF A;  3H1N A;  3GYK A;  3BOA A;  2X8G A;  1OE7 A;  2IJY A;  1Q98 A;  4TRX A;  3GKX A;  1Z7R A;  4BVY A;  3G9B A;  2WJU A;  4PTS A;  4GTU A;  2C0E A;  4PX1 A;  4IGJ A;  1GNE A;  4ZB8 A;  2WUL A;  2F9S A;  6GSV A;  4GST A;  2DML A;  1TXX A;  2LKU A;  3MAK A;  1T4Z A;  4EO3 A;  3QAG A;  4RI6 A;  1YF1 A;  1T4Y A;  2KP1 A;  5CRH A;  2AAW A;  3GST A;  1I9D A;  3LSZ A;  1SK1 A;  2O89 A;  2IFQ A;  3QFB C;  4GSS A;  2QKE A;  3VWU A;  5CRE A;  1T1V A;  1PL1 A;  3N5O A;  1TOF A;  3P8W A;  2OBK A;  2VCX A;  4KB3 A;  1EP7 A;  2L57 A;  2HSH A;  2YJH A;  1GNW A;  1YZX A;  1B8X A;  4OO5 A;  1DE1 A;  3BBY A;  1HYU A;  6GSS A;  1O81 A;  2NTO A;  1PX6 A;  3LQ7 A;  2K6V A;  16GS A;  2VUP A;  5IM9 A;  2CA8 A;  1RK4 A;  4F03 A;  4I5Q A;  2F3M A;  2HFD A;  3H79 A;  1TKD B;  1O6J A;  3DGQ A;  4KDU A;  3DXB A;  3IK7 A;  1WE0 A;  2H1A A;  3GKK A;  2VD0 A;  4MJB A;  4X1U A;  4QQ7 A;  3GN3 A;  2BMX A;  19GS A;  3U5R E;  4KDY A;  1IYH A;  5IO0 A;  1JZR A;  5G5F A;  2EIO A;  2VO4 A;  1QFN A;  2OKA A;  1VF4 A;  2V1M A;  1EEJ A;  3GNJ A;  1EZK A;  4XS4 A;  4MF6 A;  2IN3 A;  5CRD A;  1BQ7 A;  3FW2 A;  4LL1 B;  1UA5 A;  3FRC A;  5FWG A;  2WGR A;  2XHF A;  5B8B A;  3RPN A;  3UJ1 A;  4IKH A;  4OFN A;  2NVL A;  1QXH A;  5H5Q A;  5DAK B;  4YAV A;  1VF2 A;  2PN8 A;  3IAM 2;  1F9M A;  5A5K A;  5B6M A;  3GX0 A;  2B6M A;  1N8J A;  4ULX A;  5J9B A;  5IMC A;  2DJ1 A;  2LEG A;  2M46 A;  1YDK A;  3VFI A;  1U6T A;  1XWG A;  3I6A A;  1O7U A;  1U3I A;  2HZE A;  1Y6E A;  4IP1 A;  4ZBA A;  5FT3 A;  1MD3 A;  2J23 A;  2YWM A;  3IHQ A;  3CYN A;  2R3X A;  3GH9 A;  3VI7 A;  1JZD A;  2MBT A;  2MYG A;  4NAX A;  2ZCT A;  3KH9 A;  4MPF A;  2C4J A;  4RQX A;  5EVO A;  5HR0 A;  1R5P A;  2MMA A;  1QK8 A;  4HUA A;  2WCI A;  3LGC A;  2AV4 A;  1U88 A;  2CQ9 A;  4AJ6 A;  2HSM A;  3IBH A;  4XRD A;  3TKR A;  3WGD A;  1PQN A;  2FCH A;  4I2U A;  5D96 A;  4E8E A;  4JE1 A;  3GL3 A;  4MP4 A;  2FWE A;  14GS A;  5LCZ A;  3GA4 A;  5EY6 A;  3DRN A;  3IA1 A;  4KSM A;  5ECM B;  2VOC A;  1X9S B;  2B5E A;  1XW6 A;  3MDK A;  1YY7 A;  4MCU A;  2H30 A;  5HR2 A;  3ZRD A;  3I69 A;  3Q19 A;  2HZF A;  4K2D A;  1QGV A;  4RUV A;  1HNA A;  2DJ2 A;  3NIV A;  4ZL9 A;  4MDC A;  1WWJ A;  4JR6 A;  5DJM A;  4POB A;  4K0G A;  4MH3 A;  1GTB A;  1IYI A;  1M2B A;  5DAL B;  3GFK A;  4J56 E;  1X5C A;  3HCZ A;  2C80 A;  3F9U A;  2VD1 A;  1O8W A;  2GZZ A;  4Z7X A;  5D9V A;  1XXU A;  1B9Y C;  3CSI A;  4K1F A;  1TK0 B;  1V57 A;  3GIX A;  4Q5Q A;  4E8H A;  5GAP D;  11GS A;  3ZMK A;  3CSH A;  4DSQ A;  5ENU A;  1K3L A;  4DEJ A;  2DIZ A;  5EL8 A;  1ML6 A;  3M9J A;  2OA7 A;  4ZBD A;  1NW2 A;  3SBC A;  4WR4 A;  4K9Z A;  3F8U A;  1LU4 A;  3QPM A;  3P90 A;  2DJJ A;  3L78 A;  2B1L A;  1XW5 A;  5HFG A;  4HOJ A;  2YOI A;  5H5S A;  2XPD A;  2EC4 A;  2MMN A;  4WKW A;  4IW9 A;  3O6T A;  1Z3E A;  4J2F A;  1NM3 A;  4KAE A;  2VL2 C;  1ZZY A;  3LXZ A;  1Z9H A;  5IQY A;  4FYU A;  1ACV A;  5IO2 A;  1OE8 A;  2ON7 A;  3CTG A;  2WDU A;  1X5E A;  1B9X C;  4EUY A;  5KN3 A;  4KE3 A;  4L8E A;  2H1B A;  2VM2 A;  1G6Y A;  2NDO A;  4GWR A;  1ERV A;  5DDL A;  3HXS A;  1FG4 A;  1URM A;  4HZ4 A;  1MD4 A;  1F6M C;  4MJE A;  3D4T A;  4N11 A;  1GSY A;  1B4P A;  1PL2 A;  2IMK A;  4KCE A;  2FD3 A;  2GSS A;  2PU9 C;  4N30 A;  3TCO A;  3HY2 A;  1OYJ A;  4K0N A;  2EIQ A;  3NZN A;  3AY8 A;  5CRG A;  4CDO A;  2VM1 A;  3VI5 A;  2B1K A;  4GSN A;  1S3A A;  2MMO A;  4I6X A;  3ZVJ A;  4EL1 A;  4KGI A;  1A23 A;  4HEA 2;  2HSN B;  5DAK A;  1K0N A;  2H6X A;  2HI7 A;  3TOU A;  3D5J A;  3MNG A;  1A2L A;  2TRC P;  1F37 A;  2YN1 A;  2DC5 A;  1XWB A;  3RBT A;  4EVM A;  5E59 A;  2V32 A;  2H70 A;  2VLV A;  3IV4 A;  4MZW A;  4L0U A;  4DSR A;  4JBB A;  2C1Y A;  1XOA A;  4POK A;  4L5L A;  1SK0 A;  3WD6 A;  2LTK A;  3VPQ A;  4KA0 A;  4MF7 A;  5ELA A;  5J9C A;  4ZB9 A;  3ZIV A;  3KH7 A;  4PXO A;  3A2V A;  5F0G A;  5G1L A;  2X99 A;  1KTE A;  3L9V A;  2P0G A;  3QDN A;  3APO A;  3BCI A;  3TKS E;  4XS1 A;  3GUS A;  5J3R A;  4BWS A;  2HRF A;  20GS A;  4YQV A;  3ZLP A;  3VUR A;  3J7Y k;  3IK9 A;  3F0I A;  1K0O A;  1ON4 A;  4ZIL A;  1ZL9 A;  1BAY A;  9GSS A;  3WT1 A;  3EIN A;  1TU7 A;  2GVP A;  1OKT A;  3G7J A;  2OJL A;  4K7I A;  3PGT A;  1ERT A;  4ECI A;  2H0G A;  2FWG A;  3A3T A;  3GX8 A;  3APS A;  3QOU A;  5JCG A;  5IMA A;  1E6B A;  1R4W A;  1XIY A;  3L4N A;  5IOW A;  1VRS D;  5LD0 A;  2HXK A;  5DAL A;  4POL A;  4ECB A;  2AHE A;  1TRW A;  1V58 A;  1TK8 B;  1A0R P;  1JLW A;  1OC9 B;  4ZIJ A;  2KOK A;  2CAQ A;  4LMW A;  3FZ9 A;  3KEB A;  1KEB A;  1JZW A;  1B4Q A;  2GST A;  3US3 A;  4CHS A;  2GS3 A;  4KDX A;  4MZC A;  2O87 A;  2DJK A;  2A4V A;  1H75 A;  1XBS A;  2V2G A;  1RQM A;  1EOG A;  3GH6 A;  3IPZ A;  4EKZ A;  3SWL A;  2CVB A;  1EGO A;  2P5Q A;  3EYT A;  5DQS A;  8GSS A;  4IJ3 A;  1GUL A;  2MZC A;  5G2Z A;  2P31 A;  2GTU A;  2JL4 A;  4JR4 A;  2JAD A;  3CMI A;  2ES7 A;  5INY A;  1KBN A;  1UVZ A;  2HRN A;  1M2D A;  5FHI A;  2E7P A;  3TRP A;  2C0F A;  4L5O A;  2YZH A;  5KN0 A;  4NXI A;  2HRA A;  1K0B A;  4EC0 A;  4XIH A;  4IBP A;  5BMU A;  3UL3 A;  1X9W B;  3ERW A;  2AUV A;  2I9H A;  2FWH A;  2CVD A;  5G31 A;  1JLV A;  1AQX A;  3TUE A;  3GL5 A;  2M80 A;  3U6V A;  3CTF A;  4O92 A;  4H86 A;  1DUG A;  3ISO A;  2JZR A;  4ZL8 A;  4OD7 A;  4FO5 A;  2G2Q A;  5AIS A;  5DCG A;  3FR3 A;  1A0F A;  3FR6 A;  3TKS A;  4LL4 B;  2FUG 2;  2YJ7 A;  5IPH A;  3HD5 A;  3G7I A;  4HU9 A;  2FGX A;  4WET A;  1S3C A;  2B5X A;  2YPM A;  1XWA A;  3FK8 A;  3IE3 A;  4LLR A;  4EXJ A;  1M7T A;  3ME8 A;  2CT6 A;  3DYR A;  1K3O A;  1FOV A;  1GUK A;  3NOF A;  5DJL A;  3GRX A;  3DML A;  3P2A A;  2O7K A;  5IMV A;  3TJK A;  2LJK A;  3M9K A;  2LQO A;  5JWO B;  2DJ3 A;  1AQW A;  4ECJ A;  2DJ0 A;  3TJG A;  3VLN A;  1K0A A;  3H4K A;  1MDK A;  4AF2 A;  4GXZ A;  2IPA A;  1T7P B;  1BJX A;  4WBJ A;  4OCF A;  1FB0 A;  4TOP A;  2NPB A;  1PGT A;  3EE2 A;  3ZFL A;  3M3M A;  4LA1 A;  3PH9 A;  2L6D A;  1Y25 A;  4NV2 A;  1GSS A;  3ZRE A;  4O7H A;  1K0M A;  5A4V A;  3I43 A;  3VPT A;  1X9M B;  1EV4 A;  3TKS C;  2I1U A;  3E0U A;  1U87 A;  5AIV A;  5ECL B;  3FYG A;  3H93 A;  2P5R A;  4MK3 A;  4OO4 A;  1AW9 A;  1OC3 A;  2R2J A;  3KD0 A;  2N5F A;  2FWF A;  4WBR D;  2R37 A;  3IDV A;  1GTI A;  3L9S A;  1BYE A;  2R6K A;  5B6N A;  3S9F A;  4KX4 A;  1GLQ A;  4RQR A;  3ZTL A;  2GLR A;  2CZ3 A;  5A4U A;  3KXO A;  3VWW A;  1OVN A;  3LYK A;  3LJR A;  1X0R A;  2JSY A;  2H0I A;  4Q5N A;  2L5O A;  2OBI A;  1OC9 A;  5ECN B;  4N0V A;  2H6Y A;  4F9Z A;  3CSJ A;  1PN9 A;  1TW9 A;  3UIW A;  2X64 A;  13GS A;  4G10 A;  3CRU A;  3BD2 A;  4AJ8 A;  2CX3 A;  1QMV A;  5G1K A;  5KN1 A;  1WOU A;  5ECI B;  1N2A A;  1O8X A;  1A8L A;  4IVF A;  4MZB A;  1AAZ A;  3UMA A;  2VCW A;  3HKR A;  2FLS A;  3DIE A;  1I5G A;  1G7O A;  3G7Y A;  4F2I A;  3GMF A;  2VL2 A;  2UZ8 A;  5ECH B;  3GTU B;  1OAZ A;  5A4W A;  1AQV A;  5ELG A;  2DMM A;  1W89 A;  1ZCP A;  3HVV A;  2REM A;  1TP9 A;  1CQG A;  2RLI A;  4TR1 B;  3RHB A;  3KP9 A;  4PUF C;  3FEU A;  5CO3 A;  2F51 A;  2X8H A;  3C8E A;  2YV7 A;  3EWL A;  5IMZ A;  3QD9 A;  1GTA A;  2H75 A;  2H74 A;  2VLT A;  1JFU A;  2FA4 A;  1YKA A;  4TXO B;  4KH7 A;  4J57 E;  2GSQ A;  3W8J A;  2ZUP A;  3DEX A;  4XTS A;  1RW1 A;  2IL3 A;  1GSD A;  1J08 A;  4KSO A;  2GT5 A;  3Q6O A;  1GRX A;  4FQU A;  4ISD A;  2OAD A;  5H5R A;  3GV1 A;  1PSQ A;  3GUR A;  4BPY A;  1A2J A;  4NV5 A;  1R7H A;  2F8A A;  4Q5F A;  4HI7 A;  2GZP A;  5C04 A;  4CW9 A;  5IPG A;  1Z5Y E;  1XW9 A;  5HFI A;  3KTL A;  2PVO C;  4IQA A;  2V6K A;  3TRQ A;  4FH8 A;  4BVX B;  3W6G A;  2A2R A;  1Z6N A;  5AIX A;  10GS A;  1MTC A;  2L6C A;  2HE3 A;  5D73 A;  2I4A A;  2OE0 A;  1PRX A;  4X0X A;  2GDR A;  4KF9 A;  5D9X A;  2V6O A;  2D2Z A;  3DVX A;  5ECP B;  3LG6 A;  1LJR A;  2FA8 A;  2L5L A;  3C7M A;  3F4T A;  3A5W A;  4HZ2 A;  2H0H A; 
#chains in the Genus database with same CATH topology
 3FZA A;  2YCD A;  2KUC A;  4MAB A;  2F8F A;  2JSZ A;  2LJA A;  1M0U A;  3EC3 A;  2CZ2 A;  4HJM A;  4AKI A;  1PFO A;  2DIY A;  2DSA A;  3LXT A;  3EU3 A;  5KN2 A;  2OAC A;  2OE3 A;  2B7K A;  3K8N A;  2YP6 A;  1KNG A;  3P7X A;  2R4V A;  2HYX A;  2LST A;  3VWV A;  4G0K A;  4OFM A;  1V9W A;  3M1G A;  5B7C A;  1TU8 A;  4N10 A;  3PPU A;  3CBU A;  4WF4 A;  2H6Z A;  2RUF A;  2PVQ A;  1XCC A;  1XZO A;  1ZOF A;  5F07 A;  2RM6 A;  2YV9 A;  1SKS B;  1YEX A;  1VGL A;  5AGY A;  4NWY A;  4I8B A;  1NHO A;  2PGT A;  2WW1 A;  1YEW C;  5A34 A;  3EMP A;  2E2M A;  5G30 A;  2H76 A;  3KGK A;  4X43 A;  2DBC A;  1ILO A;  3I9V 2;  2JZT A;  1TJD A;  1PA3 A;  4CY8 A;  3WT2 A;  3IC8 A;  2R5G A;  3HA9 A;  4G0I A;  1GSQ A;  2WZ9 A;  2PMT A;  2A2S A;  3ME7 A;  3TRX A;  1G6W A;  2L4Q A;  2TRX A;  5HR3 A;  4KUN A;  1BG5 A;  3IAS 2;  1T00 A;  3E9J B;  4Z2T A;  3GTU A;  1SJI A;  5ECK B;  7GSS A;  2LV3 A;  2PWJ A;  2ON5 A;  3IR4 A;  2NBS A;  2GT6 A;  1LBK A;  1PKZ A;  3HVS A;  4K5R A;  1DSB A;  4TR1 A;  5G5E A;  1EV9 A;  3MYD A;  4AGS A;  2LUS A;  5ABR A;  3FHK A;  1FVK A;  4EDY A;  2L59 A;  3GHA A;  3DVW A;  2KP2 A;  4V2M A;  1GSU A;  2CV4 A;  4GLT A;  3DWV A;  4HS1 A;  1GUH A;  1SD9 A;  2VIM A;  4HQZ A;  1SJ6 A;  4ML1 A;  4OFT A;  2O85 A;  1SL2 B;  4TXO A;  4XS6 A;  2E2G A;  1SJZ A;  1UC7 A;  2HRK B;  5F06 A;  6GSW A;  1THO A;  2A2P A;  4WXT A;  2H71 A;  4V1A g;  1DBY A;  3QFA C;  1GLP A;  3ZML A;  4MLY A;  3C1R A;  4PNF A;  3ED3 A;  1WMJ A;  2K8V A;  1NSW A;  3RPP A;  3ZVJ D;  3N9J A;  1G7E A;  3D22 A;  5J41 A;  4USS A;  4HQS A;  5IMF A;  1C72 A;  1MDJ A;  4JU5 A;  2ALB A;  1T8E B;  4DVC A;  3BJ5 A;  4GQC A;  4PUR A;  2HT9 A;  3HJP A;  1XPV A;  4ML6 A;  4AJ7 A;  5HR1 A;  4PGT A;  2LNS A;  3UEM A;  3HVX A;  4JZQ A;  3GKM A;  2O36 A;  4P3Y B;  2HQT A;  1FVJ A;  2B5Y A;  1Y1U A;  4BVX A;  4KND A;  3VWX A;  5IMD A;  2WVX A;  5J4U A;  1SL0 B;  1USB A;  2HSY A;  3O76 A;  4XHM A;  5EPF A;  4K7O A;  3IOS A;  4ICY A;  4Z2R A;  1YF0 A;  1TTZ A;  3RAZ A;  2LJR A;  2GQL A;  1V40 A;  3QAV A;  3WGX A;  1ABA A;  2CX4 A;  5JWQ B;  5ECO B;  4ILF A;  4IEL A;  2H72 A;  1AIU A;  2MMZ A;  5JCW A;  2IIY A;  1XFL A;  2C3T A;  1SD8 A;  4EDZ A;  4TXV A;  1GTU A;  1M2A A;  4YH2 A;  3MIX A;  1DE2 A;  3F63 A;  2XBI A;  4ACS A;  1YKC A;  3R2Q A;  1TRS A;  2WS2 A;  1Q4J A;  1TRV A;  4PNG A;  1F3B A;  5GAN D;  1ERU A;  2WVY A;  1ZYP A;  18GS A;  2HNL A;  3Q18 A;  2I81 A;  3KCM A;  2N5A A;  5CP1 A;  1W4V A;  5J40 A;  5J5N A;  1VF3 A;  4ZB6 A;  2VCT A;  1XWC A;  5DCH A;  5DQY A;  1FAA A;  3VK9 A;  2WB9 A;  1A2M A;  1OC8 A;  4GCI A;  2CAI A;  5D9W A;  3LYP A;  5D93 A;  3HDC A;  4NHZ A;  3IC4 A;  3HHV A;  2B7J A;  5IIZ A;  3UBL A;  1SKW B;  3GSS A;  17GS A;  4FIW A;  2AJQ B;  2I3Y A;  2JZS A;  2OE1 A;  1FHE A;  1XVW A;  3R3E A;  6GST A;  3ZFB A;  3LEF A;  1MDI A;  4BL7 B;  1A8Y A;  2V41 A;  2YZU A;  2IMF A;  2OT3 A;  1TK5 B;  2FNO A;  1MEK A;  3EUR A;  1GL8 A;  3QCP A;  2VL9 A;  4K2X A;  2PER A;  1ST9 A;  2C3N A;  3UOM A;  3KMO A;  3DKS A;  2O8V B;  1JHB A;  1NHY A;  2LRN A;  4HDE A;  5CAX A;  2GQM A;  1TDI A;  1G0T A;  3QR6 A;  3FR9 A;  5J4Y A;  2E0Q A;  3LW9 A;  2XC2 A;  4G19 A;  4I97 A;  4NMU A;  3ZZX A;  3KIJ A;  3ZL5 A;  1M99 A;  4O5Q A;  3TGZ A;  1ZYE A;  1GP1 A;  1PD2 1;  3Q74 A;  1SK2 A;  4MF5 A;  1SYX A;  4YQM A;  2YWI A;  5JWR B;  2VCZ A;  4O5R A;  1FB6 A;  3RHC A;  4FYB A;  3OR5 A;  12GS A;  3QMX A;  5ID2 B;  4D73 B;  1EOH A;  1TXU A;  4I2T A;  1R5A A;  4AI6 A;  3MWH A;  1F2E A;  2AYT A;  1TI3 A;  3HZ4 A;  3HYP A;  1FO5 A;  4MJC A;  2HRK A;  4V2L A;  4G0L A;  5AN1 A;  2GGT A;  1M9A A;  2PBJ A;  5ECQ B;  3F6D A;  5C00 A;  4MPG A;  1QQ2 A;  1TRU A;  3MSZ A;  1U3A A;  1BX9 A;  3ZIJ A;  1ZYQ B;  4PUA A;  4BA7 A;  3HZ8 A;  4NPB A;  2H1L A;  2GSR A;  3IXR A;  2LS5 A;  2IME A;  1SEN A;  4ECC A;  2AB6 A;  1V98 A;  3HVN A;  4V1A p;  1B48 A;  6GSX A;  5D9T A;  3O3T A;  5CYY A;  4WEY A;  2MBS A;  3EU4 A;  3FZ5 A;  1GUM A;  4HU7 A;  2BTO T;  1YJ6 A;  5DBQ A;  2H73 A;  2LQQ A;  3TDG A;  5CRW A;  2IMI A;  5KEJ A;  1Z7P A;  2EFD A;  2K18 A;  2VAF A;  3TJJ A;  1JZO A;  1M3J A;  1VF1 A;  3D0Z A;  1THX A;  1YEP A;  2C0G A;  2L4C A;  3F3R A;  3ERG A;  2YWN A;  1GH2 A;  1PKW A;  4F0C A;  4QL7 A;  1WIK A;  3M8N A;  1M9B A;  1H4O A;  1F3A A;  1SVO A;  4JED A;  3WGE A;  2BJX A;  2VL3 A;  4DSS B;  2FHE A;  3C1S A;  5E4W A;  1A24 A;  1BED A;  1HNC A;  2LRC A;  3J7Y b;  1R26 A;  2M72 A;  2KHP A;  4G2E A;  5GZZ B;  2DKH A;  1WPI A;  1GWC A;  4OMV A;  3FKF A;  2C8U A;  3C71 A;  3LOR A;  2CVK A;  3APQ A;  5L71 A;  3LFL A;  1XVQ A;  1J9B A;  4MJA A;  2JU5 A;  1GSE A;  5A1N B;  3FY7 A;  2YAN A;  3V1W A;  22GS A;  3TJF A;  3L9U A;  2H01 A;  4PI0 C;  5ECR B;  3D21 A;  2IMD A;  3UBK A;  4IJI A;  1EWX A;  3GKN A;  4BVY B;  2GQK A;  4F82 A;  1K0C A;  4POM A;  1FOH A;  5GSS A;  1X5D A;  2WRT A;  2WZS A;  5KOX A;  4OWY A;  1EGR A;  3F4R A;  6GSY A;  5F05 A;  1SL1 B;  3EPT A;  2YNX A;  1J0F A;  2H66 A;  4HJ2 A;  3IRA A;  4TKY A;  4TR0 A;  2RUE A;  2LRT A;  4GF0 A;  2WW2 A;  1YQ1 A;  4ZBB A;  2IFQ B;  1SYR A;  4TR3 A;  1V2A A;  3KM6 A;  4L0W A;  3UAP A;  4K5S A;  4N3Z A;  5D8I A;  4BL7 A;  1AC1 A;  4TR4 A;  3QAW A;  4WR5 A;  5J4V A;  4JRR A;  3HJM A;  1K3Y A;  1E2Y A;  3EMX A;  6GSU A;  3WYW A;  3TJB A;  4EE0 A;  4NHW A;  3C73 A;  3PIN A;  2H19 A;  4IN0 A;  4RI7 A;  4WF5 A;  3ERF A;  5B8A A;  5F8B A;  4IS0 A;  3F3Q A;  4KW6 A;  4Q5R A;  2PUK C;  1XOB A;  2C0D A;  4ID0 A;  3UAR A;  1WJK A;  1CQH A;  3TOT A;  1OKD A;  3DD3 A;  2H8L A;  2QA1 A;  1PX7 A;  2KLX A;  4EF0 A;  1I1I P;  5CNW A;  4XCS A;  3TKP A;  1ZGN A;  2QGV A;  3F6F A;  1M3I A;  4YAP A;  2XBQ A;  1HNB A;  2EFC A;  5ID2 A;  2LNT A;  3A2W A;  4D73 A;  2QSI A;  3KJY A;  3UVH A;  4QL9 A;  5IOX A;  3FZ4 A;  2FY6 A;  2JAC A;  4LMV A;  3TB2 A;  1O85 A;  2DLX A;  1HD2 A;  3ZYW A;  1QUW A;  2K8S A;  4YKG A;  2H1D A;  4TN8 A;  3KMN A;  2WFC A;  4XS4 B;  1K0D A;  5DVB A;  3KZQ A;  1EEM A;  2VLU A;  3FMW A;  2K9F A;  5HFK A;  3M0F A;  4MA9 A;  4K7N A;  5HQP A;  2ZNM A;  2PPT A;  3A2X A;  2C3Q A;  3ZIT A;  4PQ1 A;  4IP6 A;  3CXG A;  3L0H A;  3PR8 A;  2B3S A;  4F0B A;  2VCV A;  3EVI A;  5LNK e;  4TW5 A;  4TVE A;  3UVT A;  5JCU A;  3H8Q A;  3KTB A;  4ZXG A;  1T3B A;  2EFE A;  3JCM L;  2H1G A;  4V2N A;  3RDW A;  2HZE B;  4ZL7 A;  4MH2 A;  1WRY A;  4GQF A;  4K6X A;  4O32 A;  4OCE A;  4FYC A;  3CRT A;  2EIR A;  3KP8 A;  1WP0 A;  1Z6M A;  5ECS A;  5GST A;  2IWT A;  4PQI A;  1ERW A;  2N5B A;  4G9H A;  4EIP A;  2HLS A;  4IQ1 A;  3W8S A;  1EP8 A;  2VCQ A;  3E3E A;  2G0F A;  1SU9 A;  2QC7 A;  2HSM B;  3D4M A;  4DSS A;  2YWO A;  1TI1 A;  2Z9S A;  1ZMA A;  5COH A;  2GZY A;  1SKR B;  1S3D A;  1O73 A;  1FW1 A;  3TKQ A;  3HMJ G;  4K8M A;  4BWQ A;  3D6I A;  1AUC A;  2RM5 A;  3LWA A;  4MMM A;  1XWK A;  2X8C A;  4KCA A;  1HQO A;  4GRF A;  4N0Z A;  4YQU A;  2XPE A;  4PHZ C;  3HJO A;  2EFH A;  2J9H A;  4PQH A;  5A1N A;  1AXD A;  2RII A;  1UN2 A;  2TIR A;  4IHU A;  1PMT A;  3F4S A;  3BCK A;  4XRA A;  1GSF A;  3H1N A;  3GYK A;  3BOA A;  2X8G A;  1OE7 A;  2IJY A;  1Q98 A;  4TRX A;  3GKX A;  1Z7R A;  4BVY A;  3G9B A;  2WJU A;  4PTS A;  4G01 A;  4GTU A;  2C0E A;  4PX1 A;  4IGJ A;  1GNE A;  4ZB8 A;  2WUL A;  2F9S A;  6GSV A;  4GST A;  2DML A;  1TXX A;  2LKU A;  3MAK A;  1T4Z A;  4EO3 A;  3QAG A;  4RI6 A;  1YF1 A;  1T4Y A;  2KP1 A;  5CRH A;  2AAW A;  3GST A;  1I9D A;  3LSZ A;  1SK1 A;  2O89 A;  2R0G A;  2IFQ A;  3QFB C;  4GSS A;  2QKE A;  3VWU A;  5CRE A;  1T1V A;  2WW0 A;  1PL1 A;  3N5O A;  1TOF A;  2R0C A;  3P8W A;  2OBK A;  2VCX A;  4KB3 A;  1EP7 A;  2L57 A;  2HSH A;  2YJH A;  1GNW A;  1YZX A;  1B8X A;  4OO5 A;  1DE1 A;  3BBY A;  1HYU A;  6GSS A;  1O81 A;  2NTO A;  4YKF A;  1PX6 A;  3CHX C;  3LQ7 A;  2K6V A;  16GS A;  2VUP A;  3RFR C;  5IM9 A;  2CA8 A;  1RK4 A;  4F03 A;  4I5Q A;  2F3M A;  2HFD A;  3H79 A;  1TKD B;  1O6J A;  3DGQ A;  4KDU A;  3DXB A;  3IK7 A;  1WE0 A;  2H1A A;  3GKK A;  2VD0 A;  4MJB A;  4X1U A;  4QQ7 A;  3GN3 A;  2BMX A;  19GS A;  3U5R E;  4KDY A;  1IYH A;  5IO0 A;  4O5U A;  1JZR A;  5G5F A;  2EIO A;  2VO4 A;  1QFN A;  2OKA A;  1VF4 A;  2V1M A;  1EEJ A;  3GNJ A;  1EZK A;  4XS4 A;  4MF6 A;  2IN3 A;  5CRD A;  1BQ7 A;  3FW2 A;  4ZB7 A;  4LL1 B;  1UA5 A;  3FRC A;  5FWG A;  2WGR A;  4W66 A;  2XHF A;  5B8B A;  3RPN A;  3UJ1 A;  4IKH A;  4OFN A;  2NVL A;  1QXH A;  5H5Q A;  5DAK B;  4YAV A;  1VF2 A;  2PN8 A;  3IAM 2;  1F9M A;  5A5K A;  5B6M A;  3GX0 A;  2B6M A;  1N8J A;  4ULX A;  5J9B A;  5IMC A;  2R0P A;  1S4B P;  4E68 A;  2DJ1 A;  2WW3 A;  2X49 A;  2LEG A;  2M46 A;  1YDK A;  3VFI A;  1U6T A;  1XWG A;  3I6A A;  1O7U A;  1U3I A;  2HZE A;  1Y6E A;  4IP1 A;  4ZBA A;  5FT3 A;  1MD3 A;  2J23 A;  2YWM A;  3IHQ A;  3CYN A;  2R3X A;  3GH9 A;  3VI7 A;  1JZD A;  2MBT A;  2MYG A;  4NAX A;  2ZCT A;  3KH9 A;  4MPF A;  2C4J A;  4RQX A;  5EVO A;  5HR0 A;  1R5P A;  2A4H A;  2MMA A;  1QK8 A;  4HUA A;  2WCI A;  3LGC A;  2AV4 A;  1U88 A;  2CQ9 A;  4AJ6 A;  2HSM A;  3IBH A;  4XRD A;  3TKR A;  3WGD A;  1PQN A;  2FCH A;  4I2U A;  5D96 A;  4E8E A;  4JE1 A;  3GL3 A;  4MP4 A;  2FWE A;  1YVL A;  14GS A;  5LCZ A;  3GA4 A;  4AKG A;  5EY6 A;  3DRN A;  1PN0 A;  3IA1 A;  4KSM A;  5ECM B;  4BIK A;  2VOC A;  1X9S B;  2B5E A;  1XW6 A;  3MDK A;  1YY7 A;  2WVZ A;  4MCU A;  2H30 A;  2X4A A;  5HR2 A;  3ZRD A;  3I69 A;  3Q19 A;  2HZF A;  4K2D A;  3TU3 B;  1QGV A;  4GDF A;  4RUV A;  1HNA A;  1BF5 A;  2DJ2 A;  3NIV A;  4ZL9 A;  4MDC A;  1WWJ A;  4JR6 A;  5DJM A;  4POB A;  4K0G A;  4MH3 A;  1GTB A;  1IYI A;  1M2B A;  5DAL B;  3GFK A;  4J56 E;  1X5C A;  3HCZ A;  2C80 A;  3F9U A;  2VD1 A;  1O8W A;  2GZZ A;  4Z7X A;  4AKX B;  5D9V A;  1XXU A;  1B9Y C;  3CSI A;  4K1F A;  1TK0 B;  1V57 A;  3GIX A;  4Q5Q A;  4E8H A;  5GAP D;  11GS A;  3ZMK A;  3CSH A;  4DSQ A;  5ENU A;  1K3L A;  4DEJ A;  2DIZ A;  5EL8 A;  1ML6 A;  3M9J A;  2OA7 A;  4ZBD A;  1NW2 A;  3SBC A;  4WR4 A;  4K9Z A;  3F8U A;  1LU4 A;  4AKH A;  3QPM A;  3P90 A;  2DJJ A;  3L78 A;  2B1L A;  1XW5 A;  5HFG A;  4HOJ A;  2YOI A;  5H5S A;  2XPD A;  2EC4 A;  2MMN A;  4WKW A;  4IW9 A;  3O6T A;  1Z3E A;  4J2F A;  1NM3 A;  4KAE A;  2VL2 C;  1ZZY A;  3LXZ A;  1Z9H A;  5IQY A;  4FYU A;  1ACV A;  5IO2 A;  1OE8 A;  2ON7 A;  3CTG A;  2WDU A;  1X5E A;  1B9X C;  4EUY A;  5KN3 A;  4KE3 A;  4L8E A;  2H1B A;  2VM2 A;  1G6Y A;  2NDO A;  4GWR A;  1ERV A;  5DDL A;  3HXS A;  4MNN A;  1FG4 A;  1URM A;  4HZ4 A;  1MD4 A;  1F6M C;  5BRT A;  4MJE A;  3D4T A;  4N11 A;  1GSY A;  1B4P A;  1PL2 A;  5BMU B;  2IMK A;  4KCE A;  2FD3 A;  2GSS A;  2PU9 C;  4N30 A;  3TCO A;  3HY2 A;  1OYJ A;  4K0N A;  2EIQ A;  3NZN A;  3AY8 A;  5CRG A;  4CDO A;  2VM1 A;  5A5H B;  3VI5 A;  2B1K A;  4GSN A;  1S3A A;  2MMO A;  4I6X A;  3ZVJ A;  4EL1 A;  4KGI A;  1A23 A;  4HEA 2;  2HSN B;  5DAK A;  1K0N A;  2H6X A;  2HI7 A;  3TOU A;  3D5J A;  3MNG A;  1A2L A;  2TRC P;  1F37 A;  2YN1 A;  2DC5 A;  1XWB A;  3RBT A;  4EVM A;  5J47 A;  5E59 A;  2V32 A;  2H70 A;  2VLV A;  3IV4 A;  4MZW A;  4L0U A;  4DSR A;  4JBB A;  2C1Y A;  1XOA A;  4POK A;  4L5L A;  4HSC X;  1SK0 A;  3WD6 A;  2LTK A;  3VPQ A;  4KA0 A;  4MF7 A;  5ELA A;  5J9C A;  4ZB9 A;  4CY6 A;  3ZIV A;  3KH7 A;  4PXO A;  3A2V A;  5F0G A;  5G1L A;  2X99 A;  1KTE A;  3L9V A;  2P0G A;  3QDN A;  3APO A;  3BCI A;  3TKS E;  4XS1 A;  3GUS A;  5J3R A;  4BWS A;  2HRF A;  20GS A;  4YQV A;  3ZLP A;  3VUR A;  3J7Y k;  3IK9 A;  3F0I A;  1K0O A;  1ON4 A;  4ZIL A;  1ZL9 A;  1BAY A;  1ZYN A;  9GSS A;  3WT1 A;  3EIN A;  1TU7 A;  2GVP A;  1OKT A;  3G7J A;  2OJL A;  4K7I A;  3PGT A;  1ERT A;  4ECI A;  2H0G A;  2FWG A;  3A3T A;  3GX8 A;  3APS A;  3QOU A;  5JCG A;  5IMA A;  1E6B A;  1R4W A;  1XIY A;  3L4N A;  5IOW A;  1VRS D;  5LD0 A;  2HXK A;  5DAL A;  4POL A;  4ECB A;  2AHE A;  1TRW A;  1V58 A;  1TK8 B;  1A0R P;  1JLW A;  2O3E A;  1OC9 B;  4ZIJ A;  2KOK A;  2CAQ A;  4LMW A;  3FZ9 A;  3KEB A;  1KEB A;  1JZW A;  1B4Q A;  2GST A;  3US3 A;  4CHS A;  2GS3 A;  4KDX A;  4MZC A;  2O87 A;  2DJK A;  2A4V A;  1H75 A;  1XBS A;  2V2G A;  1RQM A;  1EOG A;  3GH6 A;  3IPZ A;  4EKZ A;  3SWL A;  2CVB A;  1EGO A;  2P5Q A;  4FXY P;  3EYT A;  5DQS A;  8GSS A;  4IJ3 A;  1GUL A;  2MZC A;  5G2Z A;  2P31 A;  2GTU A;  2JL4 A;  4JR4 A;  2JAD A;  3CMI A;  2ES7 A;  5INY A;  1KBN A;  1UVZ A;  2HRN A;  1M2D A;  5FHI A;  2E7P A;  3TRP A;  2C0F A;  4L5O A;  2YZH A;  5KN0 A;  4NXI A;  2HRA A;  1K0B A;  4EC0 A;  4XIH A;  4IBP A;  1XG8 A;  5BMU A;  3UL3 A;  1X9W B;  2QA2 A;  3ERW A;  5A5H A;  2AUV A;  2I9H A;  2FWH A;  2CVD A;  5G31 A;  1JLV A;  1AQX A;  2DKI A;  3TUE A;  3GL5 A;  2M80 A;  3U6V A;  3CTF A;  4O92 A;  4H86 A;  2HSN A;  1DUG A;  3ISO A;  2JZR A;  4ZL8 A;  4OD7 A;  2UV8 G;  4FO5 A;  2G2Q A;  5AIS A;  5DCG A;  3FR3 A;  1A0F A;  3FR6 A;  3TKS A;  4LL4 B;  2FUG 2;  2YJ7 A;  5IPH A;  3HD5 A;  3G7I A;  4HU9 A;  2FGX A;  4WET A;  1S3C A;  2B5X A;  2YPM A;  1XWA A;  3FK8 A;  3IE3 A;  4LLR A;  4EXJ A;  1M7T A;  3ME8 A;  2CT6 A;  3DYR A;  1K3O A;  1FOV A;  1GUK A;  3NOF A;  5DJL A;  3GRX A;  3DML A;  3P2A A;  2O7K A;  5IMV A;  3TJK A;  2LJK A;  3M9K A;  2LQO A;  5JWO B;  2DJ3 A;  1AQW A;  4ECJ A;  2DJ0 A;  3TJG A;  3VLN A;  1K0A A;  3H4K A;  1MDK A;  4AF2 A;  4GXZ A;  2IPA A;  3CWG A;  1T7P B;  1BJX A;  4WBJ A;  1SVM A;  4OCF A;  1FB0 A;  4TOP A;  2NPB A;  1PGT A;  4A5P A;  3EE2 A;  3ZFL A;  3M3M A;  4LA1 A;  3PH9 A;  2L6D A;  1Y25 A;  2O5V A;  1S3R A;  4NV2 A;  1GSS A;  3ZRE A;  4O7H A;  1K0M A;  5A4V A;  3I43 A;  3VPT A;  1X9M B;  1EV4 A;  3TKS C;  2I1U A;  3E0U A;  1U87 A;  5AIV A;  5ECL B;  3FYG A;  3H93 A;  2P5R A;  4MK3 A;  4OO4 A;  1AW9 A;  1OC3 A;  2R2J A;  3KD0 A;  2N5F A;  2FWF A;  4WBR D;  2R37 A;  3IDV A;  1GTI A;  3L9S A;  1BYE A;  2R6K A;  5B6N A;  3S9F A;  4KX4 A;  1GLQ A;  1BG1 A;  4RQR A;  3ZTL A;  2GLR A;  2CZ3 A;  5A4U A;  3KXO A;  3VWW A;  1OVN A;  3LYK A;  3LJR A;  1X0R A;  4PI2 C;  2JSY A;  2H0I A;  4Q5N A;  2L5O A;  2OBI A;  1OC9 A;  5ECN B;  4N0V A;  2H6Y A;  4QMK A;  4F9Z A;  3CSJ A;  1PN9 A;  1TW9 A;  3UIW A;  2X64 A;  1SVL A;  13GS A;  4G10 A;  3CRU A;  3BD2 A;  4AJ8 A;  5A34 B;  2CX3 A;  1QMV A;  5G1K A;  4EIQ A;  5KN1 A;  1WOU A;  5KOW A;  5ECI B;  1N2A A;  1O8X A;  1A8L A;  4IVF A;  4MZB A;  1AAZ A;  3UMA A;  3HKR A;  2VCW A;  2FLS A;  3DIE A;  1I5G A;  1G7O A;  3G7Y A;  4F2I A;  3GMF A;  3CQF A;  2VL2 A;  2UZ8 A;  5ECH B;  3GTU B;  1OAZ A;  5A4W A;  1AQV A;  5ELG A;  2DMM A;  3A5I A;  1W89 A;  1ZCP A;  3HVV A;  2REM A;  1TP9 A;  1CQG A;  2RLI A;  4TR1 B;  3RHB A;  3KP9 A;  4PUF C;  3FEU A;  5CO3 A;  2F51 A;  2X8H A;  3C8E A;  2YV7 A;  3EWL A;  4Z2U A;  5IMZ A;  3QD9 A;  1GTA A;  2VKZ G;  2H75 A;  2H74 A;  2VLT A;  1JFU A;  2FA4 A;  1YKA A;  4TXO B;  4KH7 A;  4J57 E;  2GSQ A;  3W8J A;  2ZUP A;  3DEX A;  4XTS A;  1RW1 A;  2IL3 A;  1GSD A;  1J08 A;  4KSO A;  2GT5 A;  3Q6O A;  1GRX A;  4FQU A;  4ISD A;  2OAD A;  5H5R A;  3GV1 A;  1PSQ A;  3GUR A;  4BPY A;  1A2J A;  4NV5 A;  1R7H A;  2F8A A;  4Q5F A;  4HI7 A;  2GZP A;  3IHG A;  5C04 A;  4CW9 A;  5IPG A;  1Z5Y E;  1XW9 A;  5HFI A;  3KTL A;  2PVO C;  4X4J A;  4IQA A;  2V6K A;  3TRQ A;  4FH8 A;  4BVX B;  3W6G A;  2A2R A;  2WVX B;  1Z6N A;  5AIX A;  10GS A;  1MTC A;  2L6C A;  2HE3 A;  5D73 A;  2I4A A;  2OE0 A;  1PRX A;  3RGB C;  4X0X A;  2GDR A;  4KF9 A;  5D9X A;  2V6O A;  2D2Z A;  3DVX A;  5ECP B;  3LG6 A;  1LJR A;  2FA8 A;  2L5L A;  3C7M A;  3F4T A;  1N25 A;  3A5W A;  4HZ2 A;  2H0H A; 
#chains in the Genus database with same CATH homology
 3FZA A;  2YCD A;  2KUC A;  4MAB A;  2F8F A;  2JSZ A;  2LJA A;  1M0U A;  3EC3 A;  2CZ2 A;  4HJM A;  4AKI A;  2DIY A;  2DSA A;  3LXT A;  3EU3 A;  5KN2 A;  2OAC A;  2OE3 A;  2B7K A;  3K8N A;  2YP6 A;  1KNG A;  3P7X A;  2R4V A;  2HYX A;  2LST A;  3VWV A;  4G0K A;  4OFM A;  1V9W A;  3M1G A;  5B7C A;  1TU8 A;  4N10 A;  3PPU A;  3CBU A;  4WF4 A;  2H6Z A;  2RUF A;  2PVQ A;  1XCC A;  1XZO A;  1ZOF A;  5F07 A;  2RM6 A;  2YV9 A;  1SKS B;  1YEX A;  1VGL A;  5AGY A;  4NWY A;  4I8B A;  1NHO A;  2PGT A;  5A34 A;  3EMP A;  2E2M A;  5G30 A;  2H76 A;  3KGK A;  4X43 A;  2DBC A;  1ILO A;  3I9V 2;  2JZT A;  1TJD A;  1PA3 A;  4CY8 A;  3WT2 A;  3IC8 A;  2R5G A;  3HA9 A;  4G0I A;  1GSQ A;  2WZ9 A;  2PMT A;  2A2S A;  3ME7 A;  3TRX A;  1G6W A;  2L4Q A;  2TRX A;  5HR3 A;  4KUN A;  1BG5 A;  3IAS 2;  1T00 A;  3E9J B;  4Z2T A;  3GTU A;  1SJI A;  5ECK B;  7GSS A;  2LV3 A;  2PWJ A;  2ON5 A;  3IR4 A;  2NBS A;  2GT6 A;  1LBK A;  1PKZ A;  3HVS A;  4K5R A;  1DSB A;  4TR1 A;  5G5E A;  1EV9 A;  3MYD A;  4AGS A;  2LUS A;  5ABR A;  3FHK A;  1FVK A;  4EDY A;  2L59 A;  3GHA A;  3DVW A;  2KP2 A;  4V2M A;  1GSU A;  2CV4 A;  4GLT A;  3DWV A;  4HS1 A;  1GUH A;  1SD9 A;  2VIM A;  4HQZ A;  1SJ6 A;  4ML1 A;  4OFT A;  2O85 A;  1SL2 B;  4TXO A;  4XS6 A;  2E2G A;  1SJZ A;  1UC7 A;  2HRK B;  5F06 A;  6GSW A;  1THO A;  2A2P A;  4WXT A;  2H71 A;  4V1A g;  1DBY A;  3QFA C;  1GLP A;  3ZML A;  4MLY A;  3C1R A;  4PNF A;  3ED3 A;  1WMJ A;  2K8V A;  1NSW A;  3RPP A;  3ZVJ D;  3N9J A;  1G7E A;  3D22 A;  5J41 A;  4USS A;  4HQS A;  5IMF A;  1C72 A;  1MDJ A;  4JU5 A;  2ALB A;  1T8E B;  4DVC A;  3BJ5 A;  4GQC A;  4PUR A;  2HT9 A;  3HJP A;  1XPV A;  4ML6 A;  4AJ7 A;  5HR1 A;  4PGT A;  2LNS A;  3UEM A;  3HVX A;  4JZQ A;  3GKM A;  4P3Y B;  2HQT A;  1FVJ A;  2B5Y A;  1Y1U A;  4BVX A;  4KND A;  3VWX A;  5IMD A;  5J4U A;  1SL0 B;  1USB A;  2HSY A;  3O76 A;  4XHM A;  5EPF A;  4K7O A;  3IOS A;  4ICY A;  4Z2R A;  1YF0 A;  1TTZ A;  3RAZ A;  2LJR A;  2GQL A;  1V40 A;  3QAV A;  3WGX A;  1ABA A;  2CX4 A;  5JWQ B;  5ECO B;  4ILF A;  4IEL A;  2H72 A;  1AIU A;  2MMZ A;  5JCW A;  2IIY A;  1XFL A;  2C3T A;  1SD8 A;  4EDZ A;  4TXV A;  1GTU A;  1M2A A;  4YH2 A;  3MIX A;  1DE2 A;  3F63 A;  2XBI A;  4ACS A;  1YKC A;  3R2Q A;  1TRS A;  2WS2 A;  1Q4J A;  1TRV A;  4PNG A;  1F3B A;  5GAN D;  1ERU A;  1ZYP A;  18GS A;  2HNL A;  3Q18 A;  2I81 A;  3KCM A;  2N5A A;  5CP1 A;  1W4V A;  5J40 A;  5J5N A;  1VF3 A;  4ZB6 A;  2VCT A;  1XWC A;  5DCH A;  5DQY A;  1FAA A;  3VK9 A;  2WB9 A;  1A2M A;  1OC8 A;  4GCI A;  2CAI A;  5D9W A;  3LYP A;  5D93 A;  3HDC A;  4NHZ A;  3IC4 A;  3HHV A;  2B7J A;  5IIZ A;  3UBL A;  1SKW B;  3GSS A;  17GS A;  4FIW A;  2AJQ B;  2I3Y A;  2JZS A;  2OE1 A;  1FHE A;  1XVW A;  3R3E A;  6GST A;  3ZFB A;  3LEF A;  1MDI A;  4BL7 B;  1A8Y A;  2V41 A;  2YZU A;  2IMF A;  2OT3 A;  1TK5 B;  2FNO A;  1MEK A;  3EUR A;  1GL8 A;  3QCP A;  2VL9 A;  4K2X A;  2PER A;  1ST9 A;  2C3N A;  3UOM A;  3KMO A;  3DKS A;  2O8V B;  1JHB A;  1NHY A;  2LRN A;  4HDE A;  5CAX A;  2GQM A;  1TDI A;  1G0T A;  3QR6 A;  3FR9 A;  5J4Y A;  2E0Q A;  3LW9 A;  2XC2 A;  4G19 A;  4I97 A;  4NMU A;  3ZZX A;  3KIJ A;  3ZL5 A;  1M99 A;  4O5Q A;  3TGZ A;  1ZYE A;  1GP1 A;  1PD2 1;  3Q74 A;  1SK2 A;  4MF5 A;  1SYX A;  4YQM A;  2YWI A;  5JWR B;  2VCZ A;  4O5R A;  1FB6 A;  3RHC A;  4FYB A;  3OR5 A;  12GS A;  3QMX A;  5ID2 B;  4D73 B;  1EOH A;  1TXU A;  4I2T A;  1R5A A;  4AI6 A;  3MWH A;  1F2E A;  2AYT A;  1TI3 A;  3HZ4 A;  3HYP A;  1FO5 A;  4MJC A;  2HRK A;  4V2L A;  4G0L A;  5AN1 A;  2GGT A;  1M9A A;  2PBJ A;  5ECQ B;  3F6D A;  5C00 A;  4MPG A;  1QQ2 A;  1TRU A;  3MSZ A;  1U3A A;  1BX9 A;  3ZIJ A;  1ZYQ B;  4PUA A;  4BA7 A;  3HZ8 A;  4NPB A;  2H1L A;  2GSR A;  3IXR A;  2LS5 A;  2IME A;  1SEN A;  4ECC A;  2AB6 A;  1V98 A;  4V1A p;  1B48 A;  6GSX A;  5D9T A;  3O3T A;  5CYY A;  4WEY A;  2MBS A;  3EU4 A;  3FZ5 A;  1GUM A;  4HU7 A;  2BTO T;  1YJ6 A;  5DBQ A;  2H73 A;  2LQQ A;  3TDG A;  5CRW A;  2IMI A;  5KEJ A;  1Z7P A;  2EFD A;  2K18 A;  2VAF A;  3TJJ A;  1JZO A;  1VF1 A;  3D0Z A;  1THX A;  1YEP A;  2C0G A;  2L4C A;  3F3R A;  3ERG A;  2YWN A;  1GH2 A;  1PKW A;  4F0C A;  4QL7 A;  1WIK A;  3M8N A;  1M9B A;  1H4O A;  1F3A A;  1SVO A;  4JED A;  3WGE A;  2BJX A;  2VL3 A;  4DSS B;  2FHE A;  3C1S A;  5E4W A;  1A24 A;  1BED A;  1HNC A;  2LRC A;  3J7Y b;  1R26 A;  2M72 A;  2KHP A;  4G2E A;  5GZZ B;  2DKH A;  1WPI A;  1GWC A;  4OMV A;  3FKF A;  2C8U A;  3C71 A;  3LOR A;  2CVK A;  3APQ A;  5L71 A;  3LFL A;  1XVQ A;  1J9B A;  4MJA A;  2JU5 A;  1GSE A;  5A1N B;  3FY7 A;  2YAN A;  3V1W A;  22GS A;  3TJF A;  3L9U A;  2H01 A;  5ECR B;  3D21 A;  2IMD A;  3UBK A;  4IJI A;  1EWX A;  3GKN A;  4BVY B;  2GQK A;  4F82 A;  1K0C A;  4POM A;  1FOH A;  5GSS A;  1X5D A;  2WRT A;  5KOX A;  4OWY A;  1EGR A;  3F4R A;  6GSY A;  5F05 A;  1SL1 B;  3EPT A;  2YNX A;  1J0F A;  2H66 A;  4HJ2 A;  3IRA A;  4TKY A;  4TR0 A;  2RUE A;  2LRT A;  4GF0 A;  1YQ1 A;  4ZBB A;  2IFQ B;  1SYR A;  4TR3 A;  1V2A A;  3KM6 A;  4L0W A;  3UAP A;  4K5S A;  4N3Z A;  5D8I A;  4BL7 A;  1AC1 A;  4TR4 A;  3QAW A;  4WR5 A;  5J4V A;  4JRR A;  3HJM A;  1K3Y A;  1E2Y A;  3EMX A;  6GSU A;  3WYW A;  3TJB A;  4EE0 A;  4NHW A;  3C73 A;  3PIN A;  2H19 A;  4IN0 A;  4RI7 A;  4WF5 A;  3ERF A;  5B8A A;  5F8B A;  4IS0 A;  3F3Q A;  4KW6 A;  4Q5R A;  2PUK C;  1XOB A;  2C0D A;  4ID0 A;  3UAR A;  1WJK A;  1CQH A;  3TOT A;  1OKD A;  3DD3 A;  2H8L A;  2QA1 A;  1PX7 A;  2KLX A;  4EF0 A;  5CNW A;  4XCS A;  3TKP A;  1ZGN A;  2QGV A;  3F6F A;  2XBQ A;  4YAP A;  1HNB A;  2EFC A;  5ID2 A;  2LNT A;  3A2W A;  4D73 A;  2QSI A;  3KJY A;  3UVH A;  4QL9 A;  5IOX A;  3FZ4 A;  2FY6 A;  2JAC A;  4LMV A;  3TB2 A;  1O85 A;  2DLX A;  1HD2 A;  3ZYW A;  1QUW A;  2K8S A;  4YKG A;  2H1D A;  4TN8 A;  3KMN A;  2WFC A;  4XS4 B;  1K0D A;  5DVB A;  3KZQ A;  1EEM A;  2VLU A;  3FMW A;  2K9F A;  5HFK A;  3M0F A;  4MA9 A;  4K7N A;  5HQP A;  2ZNM A;  2PPT A;  3A2X A;  2C3Q A;  3ZIT A;  4PQ1 A;  4IP6 A;  3CXG A;  3L0H A;  3PR8 A;  2B3S A;  4F0B A;  2VCV A;  3EVI A;  5LNK e;  4TW5 A;  4TVE A;  3UVT A;  5JCU A;  3H8Q A;  3KTB A;  4ZXG A;  1T3B A;  2EFE A;  3JCM L;  2H1G A;  4V2N A;  3RDW A;  2HZE B;  4ZL7 A;  4MH2 A;  1WRY A;  4GQF A;  4K6X A;  4O32 A;  4OCE A;  4FYC A;  3CRT A;  2EIR A;  3KP8 A;  1WP0 A;  1Z6M A;  5ECS A;  5GST A;  2IWT A;  4PQI A;  1ERW A;  2N5B A;  4G9H A;  4EIP A;  2HLS A;  4IQ1 A;  3W8S A;  1EP8 A;  2VCQ A;  3E3E A;  2G0F A;  1SU9 A;  2QC7 A;  2HSM B;  3D4M A;  4DSS A;  2YWO A;  1TI1 A;  2Z9S A;  1ZMA A;  5COH A;  2GZY A;  1SKR B;  1S3D A;  1O73 A;  1FW1 A;  3TKQ A;  3HMJ G;  4K8M A;  4BWQ A;  3D6I A;  1AUC A;  2RM5 A;  3LWA A;  4MMM A;  1XWK A;  2X8C A;  4KCA A;  1HQO A;  4GRF A;  4N0Z A;  4YQU A;  2XPE A;  3HJO A;  2EFH A;  2J9H A;  4PQH A;  5A1N A;  1AXD A;  2RII A;  1UN2 A;  2TIR A;  4IHU A;  1PMT A;  3F4S A;  3BCK A;  4XRA A;  1GSF A;  3H1N A;  3GYK A;  3BOA A;  2X8G A;  1OE7 A;  2IJY A;  1Q98 A;  4TRX A;  3GKX A;  1Z7R A;  4BVY A;  3G9B A;  2WJU A;  4PTS A;  4G01 A;  4GTU A;  2C0E A;  4PX1 A;  4IGJ A;  1GNE A;  4ZB8 A;  2WUL A;  2F9S A;  6GSV A;  4GST A;  2DML A;  1TXX A;  2LKU A;  3MAK A;  1T4Z A;  4EO3 A;  3QAG A;  4RI6 A;  1YF1 A;  1T4Y A;  2KP1 A;  5CRH A;  2AAW A;  3GST A;  1I9D A;  3LSZ A;  1SK1 A;  2O89 A;  2R0G A;  2IFQ A;  3QFB C;  4GSS A;  2QKE A;  3VWU A;  5CRE A;  1T1V A;  1PL1 A;  3N5O A;  1TOF A;  2R0C A;  3P8W A;  2OBK A;  2VCX A;  4KB3 A;  1EP7 A;  2L57 A;  2HSH A;  2YJH A;  1GNW A;  1YZX A;  1B8X A;  4OO5 A;  1DE1 A;  3BBY A;  1HYU A;  6GSS A;  1O81 A;  2NTO A;  4YKF A;  1PX6 A;  3LQ7 A;  2K6V A;  16GS A;  2VUP A;  5IM9 A;  2CA8 A;  1RK4 A;  4F03 A;  4I5Q A;  2F3M A;  2HFD A;  3H79 A;  1TKD B;  1O6J A;  3DGQ A;  4KDU A;  3DXB A;  3IK7 A;  1WE0 A;  2H1A A;  3GKK A;  2VD0 A;  4MJB A;  4X1U A;  4QQ7 A;  3GN3 A;  2BMX A;  19GS A;  3U5R E;  4KDY A;  1IYH A;  5IO0 A;  4O5U A;  1JZR A;  5G5F A;  2EIO A;  2VO4 A;  1QFN A;  2OKA A;  1VF4 A;  2V1M A;  1EEJ A;  3GNJ A;  1EZK A;  4XS4 A;  4MF6 A;  2IN3 A;  5CRD A;  1BQ7 A;  3FW2 A;  4ZB7 A;  4LL1 B;  1UA5 A;  3FRC A;  5FWG A;  2WGR A;  4W66 A;  2XHF A;  5B8B A;  3RPN A;  3UJ1 A;  4IKH A;  4OFN A;  2NVL A;  1QXH A;  5H5Q A;  5DAK B;  4YAV A;  1VF2 A;  2PN8 A;  3IAM 2;  1F9M A;  5A5K A;  5B6M A;  3GX0 A;  2B6M A;  1N8J A;  4ULX A;  5J9B A;  5IMC A;  2R0P A;  4E68 A;  2DJ1 A;  2X49 A;  2LEG A;  2M46 A;  1YDK A;  3VFI A;  1U6T A;  1XWG A;  3I6A A;  1O7U A;  1U3I A;  2HZE A;  1Y6E A;  4IP1 A;  4ZBA A;  5FT3 A;  1MD3 A;  2J23 A;  2YWM A;  3IHQ A;  3CYN A;  2R3X A;  3GH9 A;  3VI7 A;  1JZD A;  2MBT A;  2MYG A;  4NAX A;  2ZCT A;  3KH9 A;  4MPF A;  2C4J A;  4RQX A;  5EVO A;  5HR0 A;  1R5P A;  2A4H A;  2MMA A;  1QK8 A;  4HUA A;  2WCI A;  3LGC A;  2AV4 A;  1U88 A;  2CQ9 A;  4AJ6 A;  2HSM A;  3IBH A;  4XRD A;  3TKR A;  3WGD A;  1PQN A;  2FCH A;  4I2U A;  5D96 A;  4E8E A;  4JE1 A;  3GL3 A;  4MP4 A;  2FWE A;  1YVL A;  14GS A;  5LCZ A;  3GA4 A;  4AKG A;  5EY6 A;  3DRN A;  1PN0 A;  3IA1 A;  4KSM A;  5ECM B;  2VOC A;  1X9S B;  2B5E A;  1XW6 A;  3MDK A;  1YY7 A;  4MCU A;  2H30 A;  2X4A A;  5HR2 A;  3ZRD A;  3I69 A;  3Q19 A;  2HZF A;  4K2D A;  3TU3 B;  1QGV A;  4GDF A;  4RUV A;  1HNA A;  1BF5 A;  2DJ2 A;  3NIV A;  4ZL9 A;  4MDC A;  1WWJ A;  4JR6 A;  5DJM A;  4POB A;  4K0G A;  4MH3 A;  1GTB A;  1IYI A;  1M2B A;  5DAL B;  3GFK A;  4J56 E;  1X5C A;  3HCZ A;  2C80 A;  3F9U A;  2VD1 A;  1O8W A;  2GZZ A;  4Z7X A;  4AKX B;  5D9V A;  1XXU A;  1B9Y C;  3CSI A;  4K1F A;  1TK0 B;  1V57 A;  3GIX A;  4Q5Q A;  4E8H A;  5GAP D;  11GS A;  3ZMK A;  3CSH A;  4DSQ A;  5ENU A;  1K3L A;  4DEJ A;  2DIZ A;  5EL8 A;  1ML6 A;  3M9J A;  2OA7 A;  4ZBD A;  1NW2 A;  3SBC A;  4WR4 A;  4K9Z A;  3F8U A;  1LU4 A;  4AKH A;  3QPM A;  3P90 A;  2DJJ A;  3L78 A;  2B1L A;  1XW5 A;  5HFG A;  4HOJ A;  2YOI A;  5H5S A;  2XPD A;  2EC4 A;  2MMN A;  4WKW A;  4IW9 A;  3O6T A;  1Z3E A;  4J2F A;  1NM3 A;  4KAE A;  2VL2 C;  1ZZY A;  3LXZ A;  1Z9H A;  5IQY A;  4FYU A;  1ACV A;  5IO2 A;  1OE8 A;  2ON7 A;  3CTG A;  2WDU A;  1X5E A;  1B9X C;  4EUY A;  5KN3 A;  4KE3 A;  4L8E A;  2H1B A;  2VM2 A;  1G6Y A;  2NDO A;  4GWR A;  1ERV A;  5DDL A;  3HXS A;  4MNN A;  1FG4 A;  1URM A;  4HZ4 A;  1MD4 A;  1F6M C;  5BRT A;  4MJE A;  3D4T A;  4N11 A;  1GSY A;  1B4P A;  1PL2 A;  5BMU B;  2IMK A;  4KCE A;  2FD3 A;  2GSS A;  2PU9 C;  4N30 A;  3TCO A;  3HY2 A;  1OYJ A;  4K0N A;  2EIQ A;  3NZN A;  3AY8 A;  5CRG A;  4CDO A;  2VM1 A;  5A5H B;  3VI5 A;  2B1K A;  4GSN A;  1S3A A;  2MMO A;  4I6X A;  3ZVJ A;  4EL1 A;  4KGI A;  1A23 A;  4HEA 2;  2HSN B;  5DAK A;  1K0N A;  2H6X A;  2HI7 A;  3TOU A;  3D5J A;  3MNG A;  1A2L A;  2TRC P;  1F37 A;  2YN1 A;  2DC5 A;  1XWB A;  3RBT A;  4EVM A;  5J47 A;  5E59 A;  2V32 A;  2H70 A;  2VLV A;  3IV4 A;  4MZW A;  4L0U A;  4DSR A;  4JBB A;  2C1Y A;  1XOA A;  4POK A;  4L5L A;  1SK0 A;  3WD6 A;  2LTK A;  3VPQ A;  4KA0 A;  4MF7 A;  5ELA A;  5J9C A;  4ZB9 A;  4CY6 A;  3ZIV A;  3KH7 A;  4PXO A;  3A2V A;  5F0G A;  5G1L A;  2X99 A;  1KTE A;  3L9V A;  2P0G A;  3QDN A;  3APO A;  3BCI A;  3TKS E;  4XS1 A;  3GUS A;  5J3R A;  4BWS A;  2HRF A;  20GS A;  4YQV A;  3ZLP A;  3VUR A;  3J7Y k;  3IK9 A;  3F0I A;  1K0O A;  1ON4 A;  4ZIL A;  1ZL9 A;  1BAY A;  1ZYN A;  9GSS A;  3WT1 A;  3EIN A;  1TU7 A;  2GVP A;  1OKT A;  3G7J A;  2OJL A;  4K7I A;  3PGT A;  1ERT A;  4ECI A;  2H0G A;  2FWG A;  3A3T A;  3GX8 A;  3APS A;  3QOU A;  5JCG A;  5IMA A;  1E6B A;  1R4W A;  1XIY A;  3L4N A;  5IOW A;  1VRS D;  5LD0 A;  2HXK A;  5DAL A;  4POL A;  4ECB A;  2AHE A;  1TRW A;  1V58 A;  1TK8 B;  1A0R P;  1JLW A;  1OC9 B;  4ZIJ A;  2KOK A;  2CAQ A;  4LMW A;  3FZ9 A;  3KEB A;  1KEB A;  1JZW A;  1B4Q A;  2GST A;  3US3 A;  4CHS A;  2GS3 A;  4KDX A;  4MZC A;  2O87 A;  2DJK A;  2A4V A;  1H75 A;  1XBS A;  2V2G A;  1RQM A;  1EOG A;  3GH6 A;  3IPZ A;  4EKZ A;  3SWL A;  2CVB A;  1EGO A;  2P5Q A;  3EYT A;  5DQS A;  8GSS A;  4IJ3 A;  1GUL A;  2MZC A;  5G2Z A;  2P31 A;  2GTU A;  2JL4 A;  4JR4 A;  2JAD A;  3CMI A;  2ES7 A;  5INY A;  1KBN A;  1UVZ A;  2HRN A;  1M2D A;  5FHI A;  2E7P A;  3TRP A;  2C0F A;  4L5O A;  2YZH A;  5KN0 A;  4NXI A;  2HRA A;  1K0B A;  4EC0 A;  4XIH A;  4IBP A;  5BMU A;  3UL3 A;  1X9W B;  2QA2 A;  3ERW A;  5A5H A;  2AUV A;  2I9H A;  2FWH A;  2CVD A;  5G31 A;  1JLV A;  1AQX A;  2DKI A;  3TUE A;  3GL5 A;  2M80 A;  3U6V A;  3CTF A;  4O92 A;  4H86 A;  2HSN A;  1DUG A;  3ISO A;  2JZR A;  4ZL8 A;  4OD7 A;  2UV8 G;  4FO5 A;  2G2Q A;  5AIS A;  5DCG A;  3FR3 A;  1A0F A;  3FR6 A;  3TKS A;  4LL4 B;  2FUG 2;  2YJ7 A;  5IPH A;  3HD5 A;  3G7I A;  4HU9 A;  2FGX A;  4WET A;  1S3C A;  2B5X A;  2YPM A;  1XWA A;  3FK8 A;  3IE3 A;  4LLR A;  4EXJ A;  1M7T A;  3ME8 A;  2CT6 A;  3DYR A;  1K3O A;  1FOV A;  1GUK A;  3NOF A;  5DJL A;  3GRX A;  3DML A;  3P2A A;  2O7K A;  5IMV A;  3TJK A;  2LJK A;  3M9K A;  2LQO A;  5JWO B;  2DJ3 A;  1AQW A;  4ECJ A;  2DJ0 A;  3TJG A;  3VLN A;  1K0A A;  3H4K A;  1MDK A;  4AF2 A;  4GXZ A;  2IPA A;  3CWG A;  1T7P B;  1BJX A;  4WBJ A;  1SVM A;  4OCF A;  1FB0 A;  4TOP A;  2NPB A;  1PGT A;  4A5P A;  3EE2 A;  3ZFL A;  3M3M A;  4LA1 A;  3PH9 A;  2L6D A;  1Y25 A;  2O5V A;  4NV2 A;  1GSS A;  3ZRE A;  4O7H A;  1K0M A;  5A4V A;  3I43 A;  3VPT A;  1X9M B;  1EV4 A;  3TKS C;  2I1U A;  3E0U A;  1U87 A;  5AIV A;  5ECL B;  3FYG A;  3H93 A;  2P5R A;  4MK3 A;  4OO4 A;  1AW9 A;  1OC3 A;  2R2J A;  3KD0 A;  2N5F A;  2FWF A;  4WBR D;  2R37 A;  3IDV A;  1GTI A;  3L9S A;  1BYE A;  2R6K A;  5B6N A;  3S9F A;  4KX4 A;  1GLQ A;  1BG1 A;  4RQR A;  3ZTL A;  2GLR A;  2CZ3 A;  5A4U A;  3KXO A;  3VWW A;  1OVN A;  3LYK A;  3LJR A;  1X0R A;  2JSY A;  2H0I A;  4Q5N A;  2L5O A;  2OBI A;  1OC9 A;  5ECN B;  4N0V A;  2H6Y A;  4QMK A;  4F9Z A;  3CSJ A;  1PN9 A;  1TW9 A;  3UIW A;  2X64 A;  1SVL A;  13GS A;  4G10 A;  3CRU A;  3BD2 A;  4AJ8 A;  5A34 B;  2CX3 A;  1QMV A;  5G1K A;  4EIQ A;  5KN1 A;  1WOU A;  5KOW A;  5ECI B;  1N2A A;  1O8X A;  1A8L A;  4IVF A;  4MZB A;  1AAZ A;  3UMA A;  3HKR A;  2VCW A;  2FLS A;  3DIE A;  1I5G A;  1G7O A;  3G7Y A;  4F2I A;  3GMF A;  2VL2 A;  2UZ8 A;  5ECH B;  3GTU B;  1OAZ A;  5A4W A;  1AQV A;  5ELG A;  2DMM A;  3A5I A;  1W89 A;  1ZCP A;  3HVV A;  2REM A;  1TP9 A;  1CQG A;  2RLI A;  4TR1 B;  3RHB A;  3KP9 A;  4PUF C;  3FEU A;  5CO3 A;  2F51 A;  2X8H A;  3C8E A;  2YV7 A;  3EWL A;  4Z2U A;  5IMZ A;  3QD9 A;  1GTA A;  2VKZ G;  2H75 A;  2H74 A;  2VLT A;  1JFU A;  2FA4 A;  1YKA A;  4TXO B;  4KH7 A;  4J57 E;  2GSQ A;  3W8J A;  2ZUP A;  3DEX A;  4XTS A;  1RW1 A;  2IL3 A;  1GSD A;  1J08 A;  4KSO A;  2GT5 A;  3Q6O A;  1GRX A;  4FQU A;  4ISD A;  2OAD A;  5H5R A;  3GV1 A;  1PSQ A;  3GUR A;  4BPY A;  1A2J A;  4NV5 A;  1R7H A;  2F8A A;  4Q5F A;  4HI7 A;  2GZP A;  3IHG A;  5C04 A;  4CW9 A;  5IPG A;  1Z5Y E;  1XW9 A;  5HFI A;  3KTL A;  2PVO C;  4X4J A;  4IQA A;  2V6K A;  3TRQ A;  4FH8 A;  4BVX B;  3W6G A;  2A2R A;  1Z6N A;  5AIX A;  10GS A;  1MTC A;  2L6C A;  2HE3 A;  5D73 A;  2I4A A;  2OE0 A;  1PRX A;  4X0X A;  2GDR A;  4KF9 A;  5D9X A;  2V6O A;  2D2Z A;  3DVX A;  5ECP B;  3LG6 A;  1LJR A;  2FA8 A;  2L5L A;  3C7M A;  3F4T A;  1N25 A;  3A5W A;  4HZ2 A;  2H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...