4TOPA

Glycine max glutathione transferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
SDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2,4-D inducible glutathione S-transferase
publication title Crystal structure of Glycine max glutathione transferase in complex with glutathione: investigation of the mechanism operating by the Tau class glutathione transferases.
pubmed doi rcsb
source organism Glycine max
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4topA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4topA01
2H0GA 2YP6A 4ML6A 1MEKA 2AHEA 3TRXA 3Q6OA 2HE3A 3H93A 2CZ2A 4KH7A 3HJPA 3A5WA 4G0IA 3GSSA 3GL5A 3RBTA 2DLXA 3ZVJA 5H5QA 3CMIA 5FT3A 3TKQA 1PX6A 1U3IA 3EC3A 5CRGA 5CRWA 2VM1A 4MH2A 4LL1B 1PL2A 4G9HA 4MPGA 4K2DA 4MPFA 5L71A 1SENA 3IC4A 2MMOA 1OVNA 4ML1A 4BVYA 4P3YB 2WCIA 4HJ2A 3L78A 5H5SA 4JZQA 2DJ3A 4TR1A 5IOWA 1HQOA 2VL9A 4L5LA 2PPTA 4IW9A 1XW9A 4KNDA 4I2TA 1BEDA 3DYRA 3US3A 5J9BA 3SWLA 2VIMA 5AIXA 1OE7A 4GF0A 4F0CA 2V2GA 2ZCTA 2LQOA 19GSA 3TJKA 1X5EA 3WT1A 3Q18A 2HZFA 5LCZA 3QAWA 1Z5YE 2FUG2 4I8BA 4PNGA 2RUFA 4Q5NA 1FB0A 17GSA 4D73A 4EKZA 2M46A 2DIYA 3KP9A 4OFTA 2H1AA 3DEXA 4X0XA 5D9VA 3GA4A 3HJOA 4K0GA 4K0NA 1F6MC 1SL0B 2GVPA 2N5AA 3M3MA 3ZREA 2DJKA 2YWMA 3GH6A 3A3TA 2K8VA 2KUCA 3GSTA 3M8NA 1NHOA 1BG5A 4AJ7A 2EC4A 3FR6A 5HR0A 5ELAA 4TOPA 1S3DA 3JCML 3IOSA 1OC8A 3LJRA 1YY7A 4GSTA 14GSA 1B4PA 1ZMAA 2IPAA 5IIZA 1TXXA 4POMA 2C3QA 4ZBAA 2YV7A 4NMUA 5IPGA 1GUMA 3ED3A 2H72A 3PPUA 4Z7XA 2R5GA 1PX7A 3VI7A 2HSNB 3DWVA 3O6TA 1K0OA 4IJIA 1Z7PA 2H19A 3WYWA 2X8GA 3F3RA 3KTBA 3EYTA 1XW6A 3ZFLA 4TR4A 3HZ4A 1XXUA 3CXGA 3E3EA 1I5GA 1F3AA 3KH7A 4PGTA 1ERVA 3O3TA 2F8FA 1V57A 1WMJA 1X9WB 3ZIJA 5G30A 1G7EA 3TJJA 1SD9A 4GXZA 1J0FA 2OJLA 1Z6NA 18GSA 3W8SA 4MH3A 3P7XA 3C71A 3D21A 5ID2B 3APSA 2YWOA 4YH2A 2CVKA 3R2QA 2PGTA 2YZUA 4FYCA 4ZB9A 2GQKA 3IDVA 4ISDA 5LNKe 2XBIA 3KCMA 2YZHA 5ECSA 3IRAA 3P90A 5JCUA 3IR4A 1ST9A 2G2QA 2VO4A 2C0GA 4G2EA 4GQFA 5B8BA 3VK9A 3WD6A 1O85A 2HSYA 4G0LA 1SKWB 2I1UA 4IBPA 5BMUA 2B1LA 4EO3A 4NHZA 4IKHA 3TKSC 2EIOA 3LYPA 5FHIA 2YPMA 5ENUA 4K7IA 4N11A 4I6XA 1T7PB 2M72A 2CVBA 3EU4A 5ECHB 1GTUA 1VRSD 2DSAA 1YJ6A 4WR5A 2CX3A 3L9SA 3KP8A 1NW2A 2DJ0A 2LV3A 2VD0A 1GWCA 1TI1A 4HDEA 2VAFA 3QDNA 2REMA 1SU9A 1M2AA 1JZRA 3SBCA 4EDZA 3F8UA 1SYXA 4GQCA 4GLTA 5DAKB 2X8CA 1KTEA 3FW2A 5ECRB 1O8WA 1FO5A 1O73A 4PQHA 4KA0A 3ME8A 4TN8A 2E2GA 1OE8A 2VCQA 1W89A 1ERTA 5G5EA 4XIHA 4IGJA 4V2NA 5EL8A 1X5CA 4OD7A 2LS5A 3IA1A 1XOBA 4YQMA 3GURA 1PMTA 2WB9A 1NSWA 4XRAA 1HNBA 2OADA 1R5AA 1ML6A 2XPEA 1UN2A 2L5LA 3FZ4A 4EF0A 2XHFA 5A4WA 1BX9A 3H8QA 4HZ4A 3FKFA 3LG6A 4MJCA 4MA9A 3ERFA 2L4CA 3LQ7A 4XHMA 3P8WA 1TK5B 3CRTA 2B5YA 1AQVA 4EXJA 3EE2A 1EZKA 1LU4A 4MZWA 4KB3A 3QR6A 2QKEA 3Q19A 3L0HA 1VF1A 1TP9A 2YV9A 2TRXA 1RW1A 1GL8A 12GSA 1U87A 2AB6A 5DAKA 2AYTA 5ELGA 2P5RA 4MP4A 10GSA 3U5RE 2GZZA 2FWFA 4L0WA 3F63A 4ZB8A 4YQUA 5J9CA 1B48A 2IFQB 1FAAA 1YDKA 5JCGA 3UJ1A 5D73A 2UZ8A 2H0HA 2WDUA 4POBA 4FH8A 3FZ9A 1ERUA 1B8XA 2C0EA 2VLTA 4POKA 4O5RA 4RUVA 3FY7A 2NPBA 2IL3A 4LA1A 2GT5A 5HFKA 1PN9A 2D2ZA 3F4RA 2FD3A 5DALA 1K3OA 4HZ2A 1XWKA 4XS4B 1RK4A 2OE0A 2DMMA 4N30A 4IS0A 2PUKC 3GHAA 5D96A 2XBQA 2N5BA 5IPHA 1TRVA 1AQXA 3MNGA 3I6AA 1R4WA 2FLSA 2HQTA 3GMFA 4JBBA 3GRXA 1O6JA 2LJKA 4ZXGA 3DRNA 3GKXA 4DEJA 3HY2A 1JFUA 2EIRA 5HR1A 5ECPB 4DVCA 2IIYA 2VUPA 3P2AA 1KBNA 3A2WA 3D4TA 4HJMA 2FHEA 4O7HA 2HSMB 2XPDA 1QQ2A 1M9AA 2C0FA 3APQA 3ERGA 5F0GA 3ZTLA 2OE1A 4RQXA 3KJYA 3GKMA 5IMVA 4J56E 4G10A 2OKAA 5A4UA 5GAPD 5F8BA 1XWBA 3ZIVA 4Q5FA 2R3XA 4WETA 4FIWA 3GFKA 2H70A 3GX8A 1CQHA 1TW9A 1TRWA 3GL3A 4RI7A 1JZOA 4BVYB 4ZL7A 2RLIA 3EVIA 4YAVA 2E2MA 2LRCA 4BA7A 2HRAA 2LJRA 1N8JA 5DQYA 3O76A 4J2FA 4AGSA 2ZNMA 1DE1A 1YKCA 4ZIJA 1GULA 3LSZA 2PWJA 4EUYA 1N2AA 1A0RP 5D9XA 3C1RA 2L6DA 2H73A 4IQ1A 5IM9A 1ON4A 4TR0A 3H4KA 5C04A 2H6ZA 4D73B 1S3AA 4ZBBA 2HSMA 2MBSA 2YWIA 2LNTA 4KDUA 2LJAA 2I4AA 3BCIA 1HD2A 1PD21 2VOCA 3CBUA 1QGVA 1XBSA 3GYKA 2K18A 3HA9A 4BVXA 2LQQA 2A2RA 2P31A 1NHYA 4WBJA 4KCEA 1SL2B 1VF4A 5A4VA 2VCTA 4TR3A 3DMLA 3FZAA 2O89A 2EIQA 2GSRA 2DIZA 1YF0A 5HFGA 1GSQA 3E9JB 2J23A 1XOAA 3HZ8A 4WF5A 3QCPA 3GIXA 3D6IA 3UARA 3ME7A 2IJYA 1EP8A 1GSSA 1TDIA 3HVVA 3DXBA 2CX4A 1F3BA 1O7UA 4PNFA 5CNWA 1QXHA 2VCZA 4GSSA 2CQ9A 20GSA 4LLRA 1DUGA 5DCHA 4JU5A 1H4OA 2KOKA 2YWNA 3ZL5A 2WJUA 1AW9A 5IMDA 1X9MB 1WRYA 4PQ1A 5CYYA 3FHKA 1G6WA 2MMNA 1WWJA 3HKRA 4HS1A 3AY8A 1ZOFA 3IAS2 1TTZA 4TRXA 4NPBA 4IP6A 1S3CA 4NWYA 1XPVA 4PXOA 2R6KA 2P0GA 2H30A 2CVDA 1XVWA 2HI7A 2XC2A 4K9ZA 2GZYA 1G7OA 4H86A 4ECBA 3S9FA 1XVQA 1BYEA 3QFBC 3KGKA 5A5KA 3VWWA 4ID0A 3UBLA 1ABAA 4OO4A 1XCCA 2PMTA 2HT9A 2X8HA 3UOMA 4I97A 2HRNA 2NDOA 2VL2A 1TU7A 3ZFBA 1XW5A 2H71A 6GSXA 1WPIA 2IN3A 1TKDB 1EV4A 3TJBA 5J3RA 2JZRA 5IO2A 1X0RA 3G7JA 3MSZA 4OCFA 1QK8A 2B5XA 3E0UA 5IQYA 5AGYA 2H0IA 3ZLPA 3VWVA 2JSYA 2H76A 4WF4A 1JHBA 4N10A 3ERWA 4TXOB 3L9VA 1V2AA 3CSJA 2YCDA 3H79A 1EEMA 4MJBA 4WR4A 1LBKA 1Z6MA 2ON5A 3TGZA 1JLVA 5ECOB 4L0UA 3ZMLA 22GSA 4HUAA 4XS6A 5EPFA 3TRPA 5J4UA 5GSTA 1MD4A 1AUCA 3LEFA 6GSWA 3W8JA 1K3YA 4MABA 1AIUA 1PKZA 2GT6A 4XCSA 1EOHA 2ALBA 5ECIB 4ZL9A 4OCEA 3F6FA 4X1UA 4EC0A 5B6NA 2LUSA 4EVMA 4HU7A 2LEGA 4E8EA 1BQ7A 4KAEA 1M2BA 4IVFA 3C73A 3EMXA 2C1YA 3HJMA 3GX0A 1MDJA 1O8XA 5IMFA 3UVHA 4MZCA 1AC1A 1C72A 2R4VA 5J41A 3I43A 5H5RA 5LD0A 4TXOA 4O92A 1QMVA 2VLVA 1A23A 1XIYA 3KD0A 1DE2A 4KW6A 2PU9C 5ECKB 2JSZA 3F4SA 2HFDA 2JZSA 3U6VA 1K0CA 1V98A 4NAXA 4I2UA 4OFNA 1XWGA 4N0VA 4Q5RA 3HD5A 4OWYA 4KF9A 1M7TA 5D9WA 5HR2A 2V41A 3LXTA 1MTCA 2C3NA 1FOVA 2PBJA 5KEJA 4TVEA 4V1Ag 2X64A 1PGTA 3TOUA 2NTOA 2VM2A 4HOJA 1CQGA 5CRHA 5DCGA 1U88A 2WGRA 1GSYA 3N9JA 4TKYA 2O8VB 2LNSA 4LMVA 5DALB 3HHVA 1DSBA 1GSDA 2B7KA 4ACSA 5CO3A 3EURA 3I69A 3VPTA 2RUEA 4POLA 3DKSA 2VL3A 2HNLA 2HXKA 3ZMKA 3CYNA 8GSSA 4K7NA 1SYRA 5AIVA 1A0FA 7GSSA 2KHPA 2C8UA 4BWSA 2OA7A 3QPMA 5B6MA 2IWTA 3VI5A 1A2MA 4LMWA 3LGCA 2C80A 4Q5QA 4IHUA 3DD3A 4MJAA 1YF1A 5DJLA 3BCKA 4TXVA 1OC3A 13GSA 4ULXA 2QC7A 3CSHA 4IP1A 4V2MA 6GSVA 5COHA 1A24A 2K6VA 1ZL9A 3KMOA 1V58A 2OE3A 3CRUA 2O85A 2V6OA 1IYIA 4KUNA 4X43A 4V2LA 2KP2A 4QL7A 4JR6A 4ZL8A 2HSHA 1EV9A 2CAQA 3KXOA 4N0ZA 1GTIA 2TRCP 3FR9A 2IMIA 2CA8A 2A4VA 3DIEA 2L5OA 2PVQA 1SJIA 1HNCA 1TI3A 1GNEA 2BTOT 2KP1A 3TB2A 4F03A 4K1FA 2AUVA 2WFCA 4ILFA 1JZWA 2G0FA 2ZUPA 2K9FA 3J7Yk 5DJMA 4KX4A 2RIIA 3ZITA 3HYPA 1F37A 2PVOC 3WGXA 1HNAA 3VPQA 1YQ1A 4ECCA 1OC9A 4QQ7A 1B9YC 3LWAA 4HI7A 1A2JA 4FYBA 4F82A 2MYGA 2FCHA 4HU9A 2B3SA 5EVOA 2O87A 3GV1A 3VLNA 5JCWA 1EWXA 1EOGA 4K7OA 3WT2A 1WJKA 2ES7A 3FEUA 5GSSA 2YN1A 1ZGNA 1T4YA 2F51A 2L6CA 3FR3A 1X9SB 3KH9A 4BVXB 1EGRA 1USBA 1ZCPA 3DVWA 2MMZA 3IK7A 1H75A 3ZYWA 1T00A 3OR5A 4BPYA 2HRKB 3TJGA 4MF6A 2CT6A 1YZXA 1FG4A 2GGTA 3UMAA 3GUSA 1FVJA 4EE0A 3GH9A 3UEMA 2LRNA 4WXTA 3G7IA 5JWOB 3C8EA 4WEYA 4IELA 3IE3A 3HXSA 4F9ZA 1A8LA 3D0ZA 1K0BA 1KNGA 1UC7A 1Z7RA 2IMEA 3BOAA 2CAIA 1GSEA 1AAZA 2QSIA 3G7YA 3CTFA 2L59A 3CSIA 5GZZB 3ZRDA 5JWRB 2GDRA 2DBCA 1PL1A 4BL7A 3F3QA 2DC5A 4NV5A 1VGLA 5G1LA 4OFMA 2HRFA 3ISOA 3NOFA 4KDYA 1Y6EA 3RAZA 2C4JA 3MDKA 1XZOA 5IMZA 2VCVA 3D22A 2YJ7A 2V32A 1GSFA 1FW1A 5KN3A 2LSTA 2IMDA 5D93A 4MCUA 3GKKA 1MDIA 3HDCA 1K0MA 3H1NA 1ILOA 4GWRA 2HRKA 2FWHA 2HZEA 4I5QA 6GSTA 3M9JA 3TKSE 3DGQA 1FB6A 2WRTA 2IMFA 5DQSA 1VF3A 3PINA 2RM6A 3IAM2 2H6YA 3L9UA 3WGEA 3KZQA 1SKSB 4GTUA 2OBIA 2DJ2A 4XRDA 4G19A 3BD2A 1FVKA 2LKUA 3UAPA 5CP1A 3UL3A 1YKAA 1F2EA 3D5JA 3UBKA 1GLPA 3L4NA 3LORA 2B7JA 1WOUA 4FO5A 4MZBA 5D8IA 1GNWA 4PUFC 1HYUA 2N5FA 3W6GA 5ECNB 1ZYEA 1TOFA 1M0UA 3FRCA 1M9BA 4L5OA 3EMPA 3F9UA 3G9BA 2L57A 2H01A 1OKTA 2JADA 1THXA 4GSNA 4GRFA 3M1GA 3HCZA 1JLWA 4L8EA 4PURA 3LXZA 3LFLA 1R7HA 1GRXA 4KCAA 1F9MA 4RI6A 1J9BA 5KN1A 3TRQA 5F07A 1OYJA 2FA4A 4MJEA 3KTLA 2VLUA 3TCOA 2H66A 5C00A 4DSSB 1YEPA 5DVBA 3RPPA 2MMAA 3IPZA 1B4QA 1NM3A 5ECQB 4PQIA 3GTUB 1T3BA 5G1KA 2JACA 3QAGA 4K6XA 2KLXA 3TKSA 5IMAA 1GTAA 3KEBA 1O81A 1GP1A 4WKWA 2VD1A 1RQMA 2NBSA 4GCIA 2F9SA 2AAWA 5CREA 4USSA 4LL4B 1Q4JA 3ZVJD 5HR3A 3VWUA 2DMLA 2P5QA 4MF7A 1Z9HA 2FGXA 2R37A 3ZZXA 1M99A 2YOIA 3FYGA 1PKWA 4KE3A 1W4VA 2QGVA 3R3EA 4K8MA 5DDLA 2GQLA 2GLRA 4PTSA 3HVSA 2E7PA 1SL1B 4MDCA 2H74A 2H6XA 1EGOA 2H1GA 5KN0A 4HQZA 1U3AA 3IK9A 2GSTA 3QFAC 4DSSA 2HLSA 4TW5A 1SJZA 3GTUA 4AJ6A 3C7MA 5G31A 1B9XC 3UIWA 2V1MA 3KMNA 1ERWA 4KSMA 1IYHA 2GSSA 4NHWA 2BMXA 2B1KA 3NIVA 5GAND 5FWGA 1BAYA 4J57E 3A2XA 2I9HA 2OBKA 2GS3A 4HEA2 1I9DA 3M9KA 1XWAA 2I81A 2F8AA 4JEDA 3A2VA 3QD9A 5AISA 4JRRA 1XWCA 1J08A 1MDKA 2L4QA 3EINA 4BWQA 3PH9A 2ON7A 2R2JA 2FNOA 1PQNA 9GSSA 5DBQA 4RQRA 1GSUA 3TJFA 2FWGA 1K0AA 4CW9A 3GKNA 4AF2A 5J5NA 1BJXA 4MF5A 1URMA 3EU3A 2VL2C 3TDGA 1WP0A 4ZB6A 1U6TA 1SK2A 1WIKA 1EEJA 1EP7A 1R26A 5G2ZA 4FQUA 6GSYA 3KIJA 1GTBA 2TIRA 3D4MA 4ECIA 4OMVA 2AJQB 1G6YA 5ID2A 3NZNA 2H75A 2AV4A 1SK0A 4CHSA 1VF2A 11GSA 2FY6A 5HQPA 4EDYA 4OO5A 4DSRA 3KM6A 4KDXA 1UVZA 1JZDA 1WE0A 1Z3EA 2JZTA 5HFIA 1TRSA 3WGDA 1TU8A 4E8HA 1XFLA 2Z9SA 1PSQA 2H1DA 3TOTA 3RPNA 5CAXA 2LRTA 1PA3A 2DJ1A 2A2SA 2WZ9A 4JE1A 2IMKA 3CTGA 2MZCA 16GSA 2FWEA 4V1Ap 2GQMA 4PUAA 1R5PA 4EL1A 3VURA 2BJXA 1K0NA 3I9V2 4O32A 5KN2A 1E2YA 1OC9B 3QOUA 1E6BA 2RM5A 6GSUA 2E0QA 5ABRA 1SKRB 1K0DA 3IBHA 1ZZYA 1THOA 1ZYQB 4YAPA 5IOXA 1A2LA 4IQAA 4AJ8A 1AXDA 5B7CA 4MLYA 2V6KA 1AQWA 2CZ3A 2JL4A 1T4ZA 5EY6A 2K8SA 4ZBDA 4IN0A 5F05A 2M80A 5JWQB 3APOA 5IO0A 2LTKA 3TKPA 3QMXA 3MAKA 1PRXA 1T8EB 1GUHA 5INYA 3VWXA 2GTUA 1SJ6A 4DSQA 5E59A 3IC8A 3MWHA 2YNXA 3N5OA 2YJHA 2CV4A 4NV2A 2FA8A 2B6MA 1TK0B 5CRDA 4IJ3A 2DJJA 2I3YA 2PERA 3PR8A 1V9WA 2O7KA 3HVXA 1TRUA 3RHBA 1Y25A 3TUEA 2GSQA 2YANA 2WS2A 2PN8A 1UA5A 5B8AA 2X99A 4PX1A 4NXIA 3GNJA 2J9HA 3F0IA 4FYUA 1A8YA 4BL7B 4XTSA 4F0BA 2VCWA 4KGIA 3UVTA 5IMCA 1DBYA 3Q74A 1SK1A 3IXRA 3VFIA 3F4TA 3EWLA 5D9TA 1K3LA 3F6DA 3LYKA 3J7Yb 5G5FA 1G0TA 2GZPA 1MD3A 2NVLA 3K8NA 3BJ5A 2F3MA 2H8LA 3C1SA 1KEBA 5E4WA 4CDOA 2IFQA 2HZEB 1OKDA 1TJDA 4ECJA 5ECLB 1X5DA 3PGTA 1QUWA 1YEXA 3DVXA 2HYXA 1TK8B 4G0KA 3TKRA 4ZILA 1GH2A 4JR4A 4YQVA 3IV4A 2C0DA 2WULA 3GN3A 4XS4A 1FHEA 2JU5A 2VCXA 3FZ5A 3M0FA 3RHCA 4XS1A 2H1BA 2MBTA 4MMMA 1V40A 2OACA 4TR1B 1GUKA 1Q98A 4F2IA 4QL9A 4MK3A 3IHQA 5AN1A 3RDWA 2B5EA 3BBYA 4HQSA 3FK8A 3V1WA 4KSOA 1LJRA 1QFNA 5ECMB 6GSSA 5F06A 1ACVA 4WBRD 1GLQA 1T1VA 2C3TA 3QAVA 1SD8A 1M2DA 1OAZA
chains in the Genus database with same CATH superfamily
2H0GA 2YP6A 4ML6A 1MEKA 2AHEA 3TRXA 3Q6OA 2HE3A 3H93A 2CZ2A 4KH7A 3HJPA 3A5WA 4G0IA 1SVMA 3GSSA 3GL5A 3RBTA 2DLXA 3ZVJA 5H5QA 3CMIA 5FT3A 3TKQA 5A1NB 1PX6A 1U3IA 3EC3A 5CRGA 5CRWA 2VM1A 4MH2A 4LL1B 1PL2A 4G9HA 4MPGA 4K2DA 4MPFA 5L71A 1SENA 3IC4A 2MMOA 1OVNA 4ML1A 4BVYA 4P3YB 2WCIA 4HJ2A 3L78A 5H5SA 4JZQA 2DJ3A 4TR1A 5IOWA 4GDFA 1HQOA 2VL9A 4L5LA 2PPTA 4IW9A 2A2PA 1XW9A 4KNDA 4I2TA 1BEDA 3DYRA 3US3A 5J9BA 3SWLA 2VIMA 5AIXA 1OE7A 4GF0A 4F0CA 2V2GA 2ZCTA 2LQOA 19GSA 3TJKA 1X5EA 3WT1A 3Q18A 2HZFA 5LCZA 3QAWA 1Z5YE 2FUG2 4I8BA 4PNGA 2RUFA 4Q5NA 4O5QA 1FB0A 17GSA 1YVLA 4D73A 4EKZA 2M46A 2DIYA 3KP9A 4OFTA 2H1AA 3DEXA 4X0XA 5D9VA 3GA4A 3HJOA 4K0GA 4K0NA 4YKGA 1F6MC 1SL0B 2GVPA 2N5AA 3M3MA 3ZREA 2DJKA 2YWMA 3GH6A 3A3TA 2K8VA 2KUCA 3GSTA 3M8NA 1NHOA 1BG5A 4AJ7A 2EC4A 2DKHA 1BF5A 3FR6A 5HR0A 5ELAA 4K5RA 4TOPA 1S3DA 3JCML 3IOSA 1OC8A 3LJRA 1YY7A 4GSTA 14GSA 1B4PA 1ZMAA 2IPAA 5IIZA 1TXXA 4POMA 2C3QA 4ZBAA 2YV7A 4NMUA 5IPGA 1GUMA 3ED3A 2H72A 3PPUA 4Z7XA 1BG1A 2R5GA 1PX7A 3VI7A 2HSNB 3DWVA 3O6TA 1K0OA 4IJIA 1Z7PA 2H19A 3WYWA 2X8GA 3F3RA 3KTBA 3EYTA 1XW6A 3ZFLA 4TR4A 3HZ4A 1XXUA 3CXGA 3E3EA 1I5GA 4Z2UA 1F3AA 3KH7A 4PGTA 1ERVA 3O3TA 2F8FA 1V57A 1WMJA 1X9WB 3ZIJA 5G30A 1G7EA 3TJJA 1SD9A 4GXZA 1J0FA 2OJLA 1Z6NA 18GSA 3W8SA 4MH3A 3P7XA 3C71A 3D21A 5ID2B 3APSA 2YWOA 4YH2A 2CVKA 3R2QA 2PGTA 2YZUA 4BIKA 4FYCA 4ZB9A 2GQKA 3IDVA 4ISDA 5LNKe 2XBIA 3KCMA 2YZHA 5ECSA 3IRAA 3P90A 5JCUA 3IR4A 1ST9A 2WW1A 2G2QA 2VO4A 2C0GA 4G2EA 4GQFA 5B8BA 2UV8G 3VK9A 3WD6A 1O85A 2HSYA 2A4HA 4G0LA 1SKWB 2I1UA 4IBPA 5BMUA 2B1LA 4EO3A 4NHZA 4IKHA 3TKSC 2EIOA 3LYPA 5FHIA 2QA1A 2YPMA 3FMWA 4K7IA 5ENUA 4N11A 4I6XA 1T7PB 2M72A 2CVBA 3EU4A 5ECHB 1GTUA 1VRSD 2DSAA 1YJ6A 4WR5A 2CX3A 3L9SA 3KP8A 1NW2A 2DJ0A 2LV3A 2VD0A 1GWCA 1TI1A 4HDEA 2VAFA 3QDNA 2REMA 1SU9A 1M2AA 1JZRA 3SBCA 4EDZA 3F8UA 1SYXA 4GQCA 4GLTA 5DAKB 3EPTA 2X8CA 1KTEA 3FW2A 5ECRB 1O8WA 1FO5A 1O73A 4PQHA 4KA0A 3ME8A 4TN8A 3CHXC 2E2GA 1OE8A 2VCQA 1W89A 1ERTA 5G5EA 4XIHA 4IGJA 4V2NA 5EL8A 4AKGA 3MIXA 1X5CA 2DKIA 4OD7A 2LS5A 3IA1A 1XOBA 4YQMA 3GURA 1PMTA 2WB9A 5J4YA 1NSWA 4XRAA 1HNBA 2OADA 1R5AA 1ML6A 2XPEA 1UN2A 2L5LA 3FZ4A 4EF0A 2XHFA 5A4WA 1BX9A 3H8QA 4HZ4A 3FKFA 3LG6A 4MJCA 4MA9A 3ERFA 2L4CA 3LQ7A 4XHMA 3P8WA 1TK5B 3CRTA 2B5YA 1AQVA 4EXJA 3EE2A 4E68A 1EZKA 1LU4A 4MZWA 4KB3A 3QR6A 2QKEA 3Q19A 3L0HA 1VF1A 1TP9A 2YV9A 2TRXA 1RW1A 1GL8A 12GSA 1U87A 2AB6A 5DAKA 2AYTA 5ELGA 2P5RA 4MP4A 10GSA 3U5RE 2GZZA 2FWFA 4L0WA 3F63A 4ZB8A 4YQUA 5J9CA 1B48A 2IFQB 1FAAA 1YDKA 5JCGA 3UJ1A 5D73A 2UZ8A 2H0HA 2WDUA 4POBA 4FH8A 3FZ9A 1ZYNA 1ERUA 1B8XA 2C0EA 2VLTA 4POKA 4O5RA 2WW2A 4RUVA 3FY7A 2NPBA 2IL3A 4LA1A 2GT5A 5HFKA 1PN9A 2D2ZA 3F4RA 2FD3A 5DALA 1K3OA 4HZ2A 1XWKA 4XS4B 1RK4A 2OE0A 2DMMA 4N30A 4IS0A 2PUKC 3GHAA 5D96A 2XBQA 2N5BA 5IPHA 1TRVA 1AQXA 3MNGA 3I6AA 1R4WA 2FLSA 2HQTA 3GMFA 4JBBA 3GRXA 1O6JA 2LJKA 4ZXGA 3DRNA 3GKXA 4DEJA 3HY2A 1JFUA 2EIRA 5HR1A 5ECPB 4DVCA 2IIYA 2VUPA 3P2AA 1KBNA 3A2WA 3D4TA 4HJMA 2FHEA 4O7HA 2HSMB 2XPDA 1QQ2A 3APQA 1M9AA 2C0FA 3ERGA 5F0GA 3ZTLA 2OE1A 4RQXA 3KJYA 3GKMA 5IMVA 4J56E 4G10A 2OKAA 5A4UA 5GAPD 4QMKA 5F8BA 1XWBA 3ZIVA 4Q5FA 2R3XA 4WETA 4FIWA 3GFKA 2H70A 3GX8A 1CQHA 2R0GA 1TW9A 1TRWA 3GL3A 4RI7A 4N3ZA 4BVYB 1JZOA 4ZL7A 2RLIA 3EVIA 4YAVA 2E2MA 2LRCA 4BA7A 2HRAA 1S3RA 2LJRA 1N8JA 5DQYA 2H1LA 3O76A 4J2FA 4AGSA 2ZNMA 1DE1A 1YKCA 4ZIJA 1GULA 3LSZA 2PWJA 4O5UA 4EUYA 1N2AA 1A0RP 5D9XA 3C1RA 2L6DA 2H73A 4IQ1A 5IM9A 1ON4A 4TR0A 3H4KA 5C04A 2H6ZA 4D73B 1S3AA 4ZBBA 2HSMA 2MBSA 2YWIA 2LNTA 4KDUA 2LJAA 2I4AA 3BCIA 1HD2A 1PD21 2VOCA 3CBUA 1QGVA 1XBSA 3GYKA 2K18A 3HA9A 4BVXA 2LQQA 2A2RA 2P31A 1NHYA 4WBJA 4KCEA 1SL2B 1VF4A 5A4VA 2VCTA 5J47A 4TR3A 3DMLA 3FZAA 4ICYA 2O89A 2EIQA 2GSRA 2WVYA 2DIZA 1YF0A 5HFGA 1GSQA 3E9JB 2J23A 1XOAA 3HZ8A 4WF5A 3QCPA 3GIXA 3D6IA 3UARA 3ME7A 2IJYA 1EP8A 1GSSA 1TDIA 3HVVA 3DXBA 2CX4A 1F3BA 1O7UA 4PNFA 5CNWA 1QXHA 2VCZA 2WW0A 4GSSA 2CQ9A 2R0CA 20GSA 4LLRA 1DUGA 5DCHA 4JU5A 1H4OA 2KOKA 2YWNA 3ZL5A 2WJUA 1AW9A 5IMDA 1X9MB 1WRYA 4PQ1A 5CYYA 3FHKA 1G6WA 2MMNA 1WWJA 3HKRA 1ZYPA 4HS1A 4AI6A 3AY8A 1ZOFA 3IAS2 1TTZA 4TRXA 4NPBA 4IP6A 1S3CA 4NWYA 1XPVA 4PXOA 2R6KA 2VKZG 2P0GA 2H30A 2CVDA 1XVWA 2HI7A 2XC2A 4K9ZA 2GZYA 1G7OA 4H86A 4ECBA 3S9FA 1XVQA 1BYEA 3QFBC 3KGKA 5A5KA 3VWWA 4W66A 4ID0A 3UBLA 1ABAA 4OO4A 1XCCA 2PMTA 2HT9A 2X8HA 3UOMA 4I97A 2HRNA 2NDOA 2VL2A 1TU7A 3ZFBA 1XW5A 1SVOA 2H71A 6GSXA 1WPIA 5BMUB 2IN3A 1TKDB 1EV4A 3TJBA 5J3RA 2JZRA 5IO2A 1X0RA 3G7JA 3MSZA 5BRTA 4OCFA 1QK8A 2B5XA 3E0UA 5IQYA 5AGYA 2H0IA 3ZLPA 3VWVA 2JSYA 2H76A 4WF4A 1JHBA 4N10A 3ERWA 4TXOB 3L9VA 1V2AA 3CSJA 2QA2A 2YCDA 3H79A 1EEMA 4MJBA 4WR4A 1LBKA 1Z6MA 4EIPA 2ON5A 3TGZA 3HMJG 1PFOA 1JLVA 5ECOB 4L0UA 3ZMLA 22GSA 4HUAA 4XS6A 5EPFA 3TRPA 5J4UA 5GSTA 1MD4A 1AUCA 3LEFA 6GSWA 4AKHA 3W8JA 1K3YA 4MABA 1AIUA 1PKZA 2GT6A 4XCSA 1EOHA 2ALBA 5ECIB 1SVLA 4ZL9A 4OCEA 3F6FA 4X1UA 4EC0A 5B6NA 2LUSA 4EVMA 4HU7A 2LEGA 4E8EA 1BQ7A 4KAEA 1M2BA 4AKXB 4IVFA 3C73A 3EMXA 2C1YA 3HJMA 3GX0A 1MDJA 2O5VA 1O8XA 4K2XA 5IMFA 3UVHA 4MZCA 1AC1A 1C72A 2R4VA 5J41A 3I43A 5H5RA 5LD0A 4TXOA 4O92A 1QMVA 2WZSA 2VLVA 1A23A 1XIYA 3KD0A 1DE2A 4KW6A 2PU9C 5ECKB 2JSZA 3F4SA 2HFDA 2JZSA 3U6VA 1K0CA 1V98A 4NAXA 4I2UA 4OFNA 1XWGA 4N0VA 4Q5RA 2WVXB 3HD5A 4OWYA 4KF9A 1M7TA 5D9WA 3MYDA 5HR2A 2V41A 3LXTA 1MTCA 2C3NA 4AKIA 4Z2RA 1FOVA 2PBJA 5KEJA 4TVEA 4V1Ag 2X64A 1PGTA 3TOUA 2NTOA 2VM2A 2OT3A 4HOJA 1CQGA 5CRHA 5DCGA 1U88A 2WGRA 1GSYA 2O36A 3N9JA 4TKYA 2O8VB 2LNSA 4LMVA 5DALB 2O3EA 3HHVA 1DSBA 1GSDA 2B7KA 4ACSA 5CO3A 3EURA 1YEWC 3RGBC 4A5PA 3I69A 3VPTA 2RUEA 4POLA 3DKSA 3HVNA 2VL3A 2HNLA 2HXKA 3ZMKA 3CYNA 8GSSA 4K7NA 1SYRA 5AIVA 4HSCX 1A0FA 7GSSA 2KHPA 2C8UA 4BWSA 2OA7A 3QPMA 5B6MA 2IWTA 3VI5A 1A2MA 4LMWA 3LGCA 2C80A 2WVXA 4Q5QA 4IHUA 3DD3A 4MJAA 1YF1A 5DJLA 3BCKA 4TXVA 1OC3A 13GSA 4ULXA 2QC7A 3CSHA 4IP1A 4V2MA 6GSVA 5COHA 1A24A 2K6VA 1ZL9A 3KMOA 1V58A 2OE3A 3CRUA 2O85A 2V6OA 1IYIA 4KUNA 4X43A 4V2LA 2KP2A 4QL7A 4JR6A 4ZL8A 2HSHA 1EV9A 2CAQA 3KXOA 4N0ZA 1GTIA 2TRCP 3FR9A 2IMIA 2CA8A 2A4VA 3DIEA 2L5OA 2PVQA 1SJIA 1HNCA 1TI3A 1GNEA 2BTOT 2KP1A 3TB2A 4F03A 4K1FA 2AUVA 2WFCA 4YKFA 4ILFA 1JZWA 2G0FA 2ZUPA 2K9FA 3J7Yk 5DJMA 4KX4A 2RIIA 3ZITA 3HYPA 1F37A 2PVOC 3RFRC 1PN0A 3WGXA 1HNAA 3VPQA 1YQ1A 4ECCA 1OC9A 4QQ7A 1XG8A 1B9YC 3LWAA 4HI7A 1A2JA 4FYBA 4F82A 2MYGA 2FCHA 4HU9A 4CY8A 2B3SA 5EVOA 5KOWA 2O87A 3GV1A 3VLNA 5JCWA 1EWXA 1EOGA 4K7OA 3WT2A 1WJKA 2ES7A 3FEUA 5GSSA 2YN1A 1ZGNA 1T4YA 2F51A 2L6CA 3FR3A 1X9SB 3KH9A 4BVXB 1EGRA 1USBA 1ZCPA 3DVWA 2MMZA 3IK7A 1H75A 3ZYWA 1T00A 3OR5A 4BPYA 2HRKB 4CY6A 3TJGA 4MF6A 2CT6A 1YZXA 1FG4A 2GGTA 3UMAA 3GUSA 1FVJA 4EE0A 2EFDA 3GH9A 3UEMA 2LRNA 4WXTA 3G7IA 5JWOB 3C8EA 4G01A 4IELA 4WEYA 3IE3A 3HXSA 4F9ZA 1A8LA 3D0ZA 1K0BA 1KNGA 1UC7A 1Z7RA 2IMEA 3BOAA 2CAIA 1GSEA 1AAZA 2QSIA 3G7YA 3CTFA 2L59A 3CSIA 5GZZB 3ZRDA 5JWRB 2GDRA 2DBCA 1PL1A 3CQFA 4BL7A 3F3QA 2DC5A 4K5SA 4NV5A 1VGLA 5G1LA 4OFMA 2HRFA 3ISOA 3NOFA 4KDYA 1Y6EA 3RAZA 2C4JA 3MDKA 4EIQA 1XZOA 5IMZA 2VCVA 3D22A 2YJ7A 2V32A 1GSFA 1FW1A 5KN3A 2LSTA 2IMDA 5D93A 4MCUA 3GKKA 1MDIA 2X49A 3HDCA 1K0MA 3H1NA 1ILOA 4GWRA 2HRKA 2FWHA 2HZEA 4I5QA 6GSTA 3M9JA 3TKSE 3DGQA 1FB6A 2WRTA 2IMFA 5DQSA 1VF3A 1M3JA 3PINA 2RM6A 3IAM2 2H6YA 3L9UA 3WGEA 3KZQA 1SKSB 4GTUA 2OBIA 2DJ2A 4XRDA 4G19A 3BD2A 1N25A 1FVKA 2LKUA 3UAPA 5CP1A 3UL3A 1YKAA 1F2EA 3D5JA 3UBKA 1GLPA 3L4NA 3LORA 2B7JA 1WOUA 4FO5A 4MZBA 5D8IA 1GNWA 1M3IA 4PUFC 1HYUA 2N5FA 3W6GA 5ECNB 1ZYEA 1TOFA 1M0UA 3FRCA 4Z2TA 1M9BA 4L5OA 3EMPA 3F9UA 3G9BA 2L57A 2H01A 1OKTA 2JADA 1THXA 4GSNA 4GRFA 3M1GA 3HCZA 1JLWA 4L8EA 4PURA 3LXZA 3LFLA 1R7HA 1GRXA 4KCAA 1F9MA 4RI6A 1J9BA 5KN1A 5A1NA 3TRQA 5F07A 1OYJA 2FA4A 4MJEA 3KTLA 2VLUA 3TCOA 2H66A 5C00A 4DSSB 1YEPA 5DVBA 3RPPA 2MMAA 3IPZA 1B4QA 1NM3A 5ECQB 4PQIA 3GTUB 1T3BA 5G1KA 2JACA 3QAGA 4K6XA 2KLXA 3TKSA 5IMAA 1GTAA 3KEBA 1S4BP 1O81A 1GP1A 4WKWA 2VD1A 1RQMA 2NBSA 4GCIA 2F9SA 2AAWA 5CREA 4USSA 4LL4B 1Q4JA 3ZVJD 5HR3A 3VWUA 2DMLA 2P5QA 4MF7A 1Z9HA 2FGXA 2R37A 3ZZXA 1M99A 5J40A 2YOIA 3FYGA 1PKWA 4KE3A 1W4VA 2QGVA 3R3EA 4K8MA 5DDLA 2GQLA 2GLRA 4PTSA 3HVSA 2E7PA 4PI0C 1SL1B 4MDCA 2H74A 2H6XA 1EGOA 2H1GA 5KN0A 4HQZA 1U3AA 3IK9A 2GSTA 3QFAC 4DSSA 2HLSA 4TW5A 1SJZA 3GTUA 1TXUA 4AJ6A 3C7MA 5G31A 1B9XC 3UIWA 5KOXA 2V1MA 3KMNA 1ERWA 1I1IP 4KSMA 1IYHA 2GSSA 4NHWA 2BMXA 2B1KA 3NIVA 5GAND 5FWGA 1BAYA 4J57E 3A2XA 2I9HA 2OBKA 2GS3A 4HEA2 1I9DA 3M9KA 1XWAA 4ZB7A 2I81A 2F8AA 4JEDA 3A2VA 3QD9A 5AISA 4JRRA 1XWCA 1J08A 1MDKA 2L4QA 3EINA 1FOHA 4BWQA 3PH9A 3LW9A 2ON7A 2HSNA 2WW3A 2R2JA 2FNOA 1PQNA 9GSSA 5DBQA 4RQRA 1GSUA 3TJFA 2FWGA 1K0AA 4CW9A 3GKNA 4AF2A 5J5NA 1BJXA 4MF5A 1URMA 3EU3A 2VL2C 3TDGA 1WP0A 4ZB6A 1U6TA 1SK2A 1WIKA 1EEJA 1EP7A 1R26A 5G2ZA 4FQUA 6GSYA 3KIJA 1GTBA 2TIRA 3D4MA 4ECIA 4OMVA 2AJQB 1G6YA 5ID2A 3NZNA 2H75A 2AV4A 1SK0A 4CHSA 5A34B 1VF2A 11GSA 2FY6A 5HQPA 2EFHA 4EDYA 4OO5A 4DSRA 3KM6A 2EFCA 4KDXA 1UVZA 1JZDA 1WE0A 1Z3EA 2JZTA 5HFIA 1TRSA 3WGDA 1TU8A 4E8HA 1XFLA 2Z9SA 1PSQA 2H1DA 5A5HB 3TOTA 3RPNA 5CAXA 2LRTA 1PA3A 2DJ1A 2A2SA 2WZ9A 4JE1A 5J4VA 2IMKA 3CTGA 2MZCA 16GSA 2FWEA 4V1Ap 2GQMA 4PUAA 1Y1UA 1R5PA 4EL1A 3VURA 2BJXA 1K0NA 3I9V2 4O32A 5KN2A 1E2YA 1OC9B 3QOUA 1E6BA 2RM5A 6GSUA 2E0QA 5ABRA 1SKRB 1K0DA 3IBHA 1ZZYA 1THOA 3IHGA 1ZYQB 4YAPA 5IOXA 1A2LA 4IQAA 4AJ8A 1AXDA 5B7CA 4MLYA 2V6KA 1AQWA 2CZ3A 2JL4A 1T4ZA 5EY6A 4MNNA 2K8SA 4ZBDA 4IN0A 5A34A 5F05A 2M80A 4PHZC 5JWQB 3APOA 5IO0A 2WVZA 2LTKA 3TKPA 3QMXA 3MAKA 1PRXA 1T8EB 1GUHA 5INYA 3VWXA 2GTUA 1SJ6A 3TU3B 4DSQA 5E59A 3IC8A 2YNXA 3MWHA 3N5OA 2YJHA 2CV4A 4NV2A 2FA8A 2B6MA 1TK0B 5A5HA 2X4AA 5CRDA 4IJ3A 2DJJA 2I3YA 2PERA 3PR8A 1V9WA 2O7KA 3HVXA 1TRUA 3RHBA 1Y25A 3TUEA 2GSQA 2YANA 2WS2A 2PN8A 3CWGA 1UA5A 5B8AA 2X99A 4PX1A 4NXIA 3GNJA 2J9HA 3F0IA 4FYUA 1A8YA 4BL7B 4XTSA 4F0BA 2VCWA 4KGIA 3UVTA 5IMCA 1DBYA 3Q74A 1SK1A 3IXRA 3VFIA 3F4TA 3EWLA 5D9TA 1K3LA 3F6DA 3LYKA 3J7Yb 5G5FA 1G0TA 2GZPA 1MD3A 2NVLA 3K8NA 3A5IA 3BJ5A 2F3MA 2H8LA 3C1SA 1KEBA 5E4WA 4CDOA 2IFQA 2HZEB 1OKDA 1TJDA 4ECJA 5ECLB 1X5DA 3PGTA 1QUWA 1YEXA 3DVXA 2HYXA 2R0PA 1TK8B 4G0KA 3TKRA 4ZILA 1GH2A 4JR4A 4YQVA 3IV4A 2C0DA 2WULA 3GN3A 4XS4A 1FHEA 2JU5A 2VCXA 3FZ5A 3M0FA 4PI2C 3RHCA 4XS1A 2H1BA 2MBTA 4X4JA 4MMMA 1V40A 2OACA 4TR1B 1GUKA 1Q98A 4F2IA 4QL9A 4MK3A 3IHQA 5AN1A 3RDWA 2EFEA 2B5EA 3BBYA 4HQSA 4FXYP 3FK8A 3V1WA 4KSOA 1LJRA 1QFNA 5ECMB 6GSSA 5F06A 1ACVA 4WBRD 1GLQA 1T1VA 2C3TA 3QAVA 1SD8A 1M2DA 1OAZA
chains in the Genus database with same CATH topology
2H0GA 2YP6A 4ML6A 1MEKA 2AHEA 3TRXA 3Q6OA 2HE3A 3H93A 2CZ2A 4KH7A 3HJPA 3A5WA 4G0IA 1SVMA 3GSSA 3GL5A 3RBTA 2DLXA 3ZVJA 5H5QA 3CMIA 5FT3A 3TKQA 5A1NB 1PX6A 1U3IA 3EC3A 5CRGA 5CRWA 2VM1A 4MH2A 4LL1B 1PL2A 4G9HA 4MPGA 4K2DA 4MPFA 5L71A 1SENA 3IC4A 2MMOA 1OVNA 4ML1A 4BVYA 4P3YB 2WCIA 4HJ2A 3L78A 5H5SA 4JZQA 2DJ3A 4TR1A 5IOWA 4GDFA 1HQOA 2VL9A 4L5LA 2PPTA 4IW9A 2A2PA 1XW9A 4KNDA 4I2TA 1BEDA 3DYRA 3US3A 5J9BA 3SWLA 2VIMA 5AIXA 1OE7A 4GF0A 4F0CA 2V2GA 2ZCTA 2LQOA 19GSA 3TJKA 1X5EA 3WT1A 3Q18A 2HZFA 5LCZA 3QAWA 1Z5YE 2FUG2 4I8BA 4PNGA 2RUFA 4Q5NA 4O5QA 1FB0A 17GSA 1YVLA 4D73A 4EKZA 2M46A 2DIYA 3KP9A 4OFTA 2H1AA 3DEXA 4X0XA 5D9VA 3GA4A 3HJOA 4K0GA 4K0NA 4YKGA 1F6MC 1SL0B 2GVPA 2N5AA 3M3MA 3ZREA 2DJKA 2YWMA 3GH6A 3A3TA 2K8VA 2KUCA 3GSTA 3M8NA 1NHOA 1BG5A 4AJ7A 2EC4A 2DKHA 1BF5A 3FR6A 5HR0A 5ELAA 4K5RA 4TOPA 1S3DA 3JCML 3IOSA 1OC8A 3LJRA 1YY7A 4GSTA 14GSA 1B4PA 1ZMAA 2IPAA 5IIZA 1TXXA 4POMA 2C3QA 4ZBAA 2YV7A 4NMUA 5IPGA 1GUMA 3ED3A 2H72A 3PPUA 4Z7XA 1BG1A 2R5GA 1PX7A 3VI7A 2HSNB 3DWVA 3O6TA 1K0OA 4IJIA 1Z7PA 2H19A 3WYWA 2X8GA 3F3RA 3KTBA 3EYTA 1XW6A 3ZFLA 4TR4A 3HZ4A 1XXUA 3CXGA 3E3EA 1I5GA 4Z2UA 1F3AA 3KH7A 4PGTA 1ERVA 3O3TA 2F8FA 1V57A 1WMJA 1X9WB 3ZIJA 5G30A 1G7EA 3TJJA 1SD9A 4GXZA 1J0FA 2OJLA 1Z6NA 18GSA 3W8SA 4MH3A 3P7XA 3C71A 3D21A 5ID2B 3APSA 2YWOA 4YH2A 2CVKA 3R2QA 2PGTA 2YZUA 4FYCA 4ZB9A 2GQKA 3IDVA 4ISDA 5LNKe 2XBIA 3KCMA 2YZHA 5ECSA 3IRAA 3P90A 5JCUA 3IR4A 1ST9A 2G2QA 2VO4A 2C0GA 4G2EA 4GQFA 5B8BA 2UV8G 3VK9A 3WD6A 1O85A 2HSYA 2A4HA 4G0LA 1SKWB 2I1UA 4IBPA 5BMUA 2B1LA 4EO3A 4NHZA 4IKHA 3TKSC 2EIOA 3LYPA 5FHIA 2QA1A 2YPMA 3FMWA 4K7IA 5ENUA 4N11A 4I6XA 1T7PB 2M72A 2CVBA 3EU4A 5ECHB 1GTUA 1VRSD 2DSAA 1YJ6A 4WR5A 2CX3A 3L9SA 3KP8A 1NW2A 2DJ0A 2LV3A 2VD0A 1GWCA 1TI1A 4HDEA 2VAFA 3QDNA 2REMA 1SU9A 1M2AA 1JZRA 3SBCA 4EDZA 3F8UA 1SYXA 4GQCA 4GLTA 5DAKB 3EPTA 2X8CA 1KTEA 3FW2A 5ECRB 1O8WA 1FO5A 1O73A 4PQHA 4KA0A 3ME8A 4TN8A 2E2GA 1OE8A 2VCQA 1W89A 1ERTA 5G5EA 4XIHA 4IGJA 4V2NA 5EL8A 4AKGA 3MIXA 1X5CA 2DKIA 4OD7A 2LS5A 3IA1A 1XOBA 4YQMA 3GURA 1PMTA 2WB9A 5J4YA 1NSWA 4XRAA 1HNBA 2OADA 1R5AA 1ML6A 2XPEA 1UN2A 2L5LA 3FZ4A 4EF0A 2XHFA 5A4WA 1BX9A 3H8QA 4HZ4A 3FKFA 3LG6A 4MJCA 4MA9A 3ERFA 2L4CA 3LQ7A 4XHMA 3P8WA 1TK5B 3CRTA 2B5YA 1AQVA 4EXJA 3EE2A 4E68A 1EZKA 1LU4A 4MZWA 4KB3A 3QR6A 2QKEA 3Q19A 3L0HA 1VF1A 1TP9A 2YV9A 2TRXA 1RW1A 1GL8A 12GSA 1U87A 2AB6A 5DAKA 2AYTA 5ELGA 2P5RA 4MP4A 10GSA 3U5RE 2GZZA 2FWFA 4L0WA 3F63A 4ZB8A 4YQUA 5J9CA 1B48A 2IFQB 1FAAA 1YDKA 5JCGA 3UJ1A 5D73A 2UZ8A 2H0HA 2WDUA 4POBA 4FH8A 3FZ9A 1ZYNA 1ERUA 1B8XA 2C0EA 2VLTA 4POKA 4O5RA 4RUVA 3FY7A 2NPBA 2IL3A 4LA1A 2GT5A 5HFKA 1PN9A 2D2ZA 3F4RA 2FD3A 5DALA 1K3OA 4HZ2A 1XWKA 4XS4B 1RK4A 2OE0A 2DMMA 4N30A 4IS0A 2PUKC 3GHAA 5D96A 2XBQA 2N5BA 5IPHA 1TRVA 1AQXA 3MNGA 3I6AA 1R4WA 2FLSA 2HQTA 3GMFA 4JBBA 3GRXA 1O6JA 2LJKA 4ZXGA 3DRNA 3GKXA 4DEJA 3HY2A 1JFUA 2EIRA 5HR1A 5ECPB 4DVCA 2IIYA 2VUPA 3P2AA 1KBNA 3A2WA 3D4TA 4HJMA 2FHEA 4O7HA 2HSMB 2XPDA 1QQ2A 3APQA 1M9AA 2C0FA 3ERGA 5F0GA 3ZTLA 2OE1A 4RQXA 3KJYA 3GKMA 5IMVA 4J56E 4G10A 2OKAA 5A4UA 5GAPD 4QMKA 5F8BA 1XWBA 3ZIVA 4Q5FA 2R3XA 4WETA 4FIWA 3GFKA 2H70A 3GX8A 1CQHA 2R0GA 1TW9A 1TRWA 3GL3A 4RI7A 4N3ZA 4BVYB 1JZOA 4ZL7A 2RLIA 3EVIA 4YAVA 2E2MA 2LRCA 4BA7A 2HRAA 2LJRA 1N8JA 5DQYA 2H1LA 3O76A 4J2FA 4AGSA 2ZNMA 1DE1A 1YKCA 4ZIJA 1GULA 3LSZA 2PWJA 4O5UA 4EUYA 1N2AA 1A0RP 5D9XA 3C1RA 2L6DA 2H73A 4IQ1A 5IM9A 1ON4A 4TR0A 3H4KA 5C04A 2H6ZA 4D73B 1S3AA 4ZBBA 2HSMA 2MBSA 2YWIA 2LNTA 4KDUA 2LJAA 2I4AA 3BCIA 1HD2A 1PD21 2VOCA 3CBUA 1QGVA 1XBSA 3GYKA 2K18A 3HA9A 4BVXA 2LQQA 2A2RA 2P31A 1NHYA 4WBJA 4KCEA 1SL2B 1VF4A 5A4VA 2VCTA 5J47A 4TR3A 3DMLA 3FZAA 4ICYA 2O89A 2EIQA 2GSRA 2DIZA 1YF0A 5HFGA 1GSQA 3E9JB 2J23A 1XOAA 3HZ8A 4WF5A 3QCPA 3GIXA 3D6IA 3UARA 3ME7A 2IJYA 1EP8A 1GSSA 1TDIA 3HVVA 3DXBA 2CX4A 1F3BA 1O7UA 4PNFA 5CNWA 1QXHA 2VCZA 4GSSA 2CQ9A 2R0CA 20GSA 4LLRA 1DUGA 5DCHA 4JU5A 1H4OA 2KOKA 2YWNA 3ZL5A 2WJUA 1AW9A 5IMDA 1X9MB 1WRYA 4PQ1A 5CYYA 3FHKA 1G6WA 2MMNA 1WWJA 3HKRA 1ZYPA 4HS1A 4AI6A 3AY8A 1ZOFA 3IAS2 1TTZA 4TRXA 4NPBA 4IP6A 1S3CA 4NWYA 1XPVA 4PXOA 2R6KA 2VKZG 2P0GA 2H30A 2CVDA 1XVWA 2HI7A 2XC2A 4K9ZA 2GZYA 1G7OA 4H86A 4ECBA 3S9FA 1XVQA 1BYEA 3QFBC 3KGKA 5A5KA 3VWWA 4W66A 4ID0A 3UBLA 1ABAA 4OO4A 1XCCA 2PMTA 2HT9A 2X8HA 3UOMA 4I97A 2HRNA 2NDOA 2VL2A 1TU7A 3ZFBA 1XW5A 1SVOA 2H71A 6GSXA 1WPIA 5BMUB 2IN3A 1TKDB 1EV4A 3TJBA 5J3RA 2JZRA 5IO2A 1X0RA 3G7JA 3MSZA 5BRTA 4OCFA 1QK8A 2B5XA 3E0UA 5IQYA 5AGYA 2H0IA 3ZLPA 3VWVA 2JSYA 2H76A 4WF4A 1JHBA 4N10A 3ERWA 4TXOB 3L9VA 1V2AA 3CSJA 2QA2A 2YCDA 3H79A 1EEMA 4MJBA 4WR4A 1LBKA 1Z6MA 4EIPA 2ON5A 3TGZA 3HMJG 1JLVA 5ECOB 4L0UA 3ZMLA 22GSA 4HUAA 4XS6A 5EPFA 3TRPA 5J4UA 5GSTA 1MD4A 1AUCA 3LEFA 6GSWA 4AKHA 3W8JA 1K3YA 4MABA 1AIUA 1PKZA 2GT6A 4XCSA 1EOHA 2ALBA 5ECIB 1SVLA 4ZL9A 4OCEA 3F6FA 4X1UA 4EC0A 5B6NA 2LUSA 4EVMA 4HU7A 2LEGA 4E8EA 1BQ7A 4KAEA 1M2BA 4AKXB 4IVFA 3C73A 3EMXA 2C1YA 3HJMA 3GX0A 1MDJA 2O5VA 1O8XA 4K2XA 5IMFA 3UVHA 4MZCA 1AC1A 1C72A 2R4VA 5J41A 3I43A 5H5RA 5LD0A 4TXOA 4O92A 1QMVA 2VLVA 1A23A 1XIYA 3KD0A 1DE2A 4KW6A 2PU9C 5ECKB 2JSZA 3F4SA 2HFDA 2JZSA 3U6VA 1K0CA 1V98A 4NAXA 4I2UA 4OFNA 1XWGA 4N0VA 4Q5RA 3HD5A 4OWYA 4KF9A 1M7TA 5D9WA 3MYDA 5HR2A 2V41A 3LXTA 1MTCA 2C3NA 4AKIA 4Z2RA 1FOVA 2PBJA 5KEJA 4TVEA 4V1Ag 2X64A 1PGTA 3TOUA 2NTOA 2VM2A 2OT3A 4HOJA 1CQGA 5CRHA 5DCGA 1U88A 2WGRA 1GSYA 3N9JA 4TKYA 2O8VB 2LNSA 4LMVA 5DALB 3HHVA 1DSBA 1GSDA 2B7KA 4ACSA 5CO3A 3EURA 4A5PA 3I69A 3VPTA 2RUEA 4POLA 3DKSA 2VL3A 2HNLA 2HXKA 3ZMKA 3CYNA 8GSSA 4K7NA 1SYRA 5AIVA 1A0FA 7GSSA 2KHPA 2C8UA 4BWSA 2OA7A 3QPMA 5B6MA 2IWTA 3VI5A 1A2MA 4LMWA 3LGCA 2C80A 4Q5QA 4IHUA 3DD3A 4MJAA 1YF1A 5DJLA 3BCKA 4TXVA 1OC3A 13GSA 4ULXA 2QC7A 3CSHA 4IP1A 4V2MA 6GSVA 5COHA 1A24A 2K6VA 1ZL9A 3KMOA 1V58A 2OE3A 3CRUA 2O85A 2V6OA 1IYIA 4KUNA 4X43A 4V2LA 2KP2A 4QL7A 4JR6A 4ZL8A 2HSHA 1EV9A 2CAQA 3KXOA 4N0ZA 1GTIA 2TRCP 3FR9A 2IMIA 2CA8A 2A4VA 3DIEA 2L5OA 2PVQA 1SJIA 1HNCA 1TI3A 1GNEA 2BTOT 2KP1A 3TB2A 4F03A 4K1FA 2AUVA 2WFCA 4YKFA 4ILFA 1JZWA 2G0FA 2ZUPA 2K9FA 3J7Yk 5DJMA 4KX4A 2RIIA 3ZITA 3HYPA 1F37A 2PVOC 1PN0A 3WGXA 1HNAA 3VPQA 1YQ1A 4ECCA 1OC9A 4QQ7A 1B9YC 3LWAA 4HI7A 1A2JA 4FYBA 4F82A 2MYGA 2FCHA 4HU9A 4CY8A 2B3SA 5EVOA 5KOWA 2O87A 3GV1A 3VLNA 5JCWA 1EWXA 1EOGA 4K7OA 3WT2A 1WJKA 2ES7A 3FEUA 5GSSA 2YN1A 1ZGNA 1T4YA 2F51A 2L6CA 3FR3A 1X9SB 3KH9A 4BVXB 1EGRA 1USBA 1ZCPA 3DVWA 2MMZA 3IK7A 1H75A 3ZYWA 1T00A 3OR5A 4BPYA 2HRKB 4CY6A 3TJGA 4MF6A 2CT6A 1YZXA 1FG4A 2GGTA 3UMAA 3GUSA 1FVJA 4EE0A 2EFDA 3GH9A 3UEMA 2LRNA 4WXTA 3G7IA 5JWOB 3C8EA 4G01A 4IELA 4WEYA 3IE3A 3HXSA 4F9ZA 1A8LA 3D0ZA 1K0BA 1KNGA 1UC7A 1Z7RA 2IMEA 3BOAA 2CAIA 1GSEA 1AAZA 2QSIA 3G7YA 3CTFA 2L59A 3CSIA 5GZZB 3ZRDA 5JWRB 2GDRA 2DBCA 1PL1A 4BL7A 3F3QA 2DC5A 4K5SA 4NV5A 1VGLA 5G1LA 4OFMA 2HRFA 3ISOA 3NOFA 4KDYA 1Y6EA 3RAZA 2C4JA 3MDKA 4EIQA 1XZOA 5IMZA 2VCVA 3D22A 2YJ7A 2V32A 1GSFA 1FW1A 5KN3A 2LSTA 2IMDA 5D93A 4MCUA 3GKKA 1MDIA 2X49A 3HDCA 1K0MA 3H1NA 1ILOA 4GWRA 2HRKA 2FWHA 2HZEA 4I5QA 6GSTA 3M9JA 3TKSE 3DGQA 1FB6A 2WRTA 2IMFA 5DQSA 1VF3A 3PINA 2RM6A 3IAM2 2H6YA 3L9UA 3WGEA 3KZQA 1SKSB 4GTUA 2OBIA 2DJ2A 4XRDA 4G19A 3BD2A 1N25A 1FVKA 2LKUA 3UAPA 5CP1A 3UL3A 1YKAA 1F2EA 3D5JA 3UBKA 1GLPA 3L4NA 3LORA 2B7JA 1WOUA 4FO5A 4MZBA 5D8IA 1GNWA 4PUFC 1HYUA 2N5FA 3W6GA 5ECNB 1ZYEA 1TOFA 1M0UA 3FRCA 4Z2TA 1M9BA 4L5OA 3EMPA 3F9UA 3G9BA 2L57A 2H01A 1OKTA 2JADA 1THXA 4GSNA 4GRFA 3M1GA 3HCZA 1JLWA 4L8EA 4PURA 3LXZA 3LFLA 1R7HA 1GRXA 4KCAA 1F9MA 4RI6A 1J9BA 5KN1A 5A1NA 3TRQA 5F07A 1OYJA 2FA4A 4MJEA 3KTLA 2VLUA 3TCOA 2H66A 5C00A 4DSSB 1YEPA 5DVBA 3RPPA 2MMAA 3IPZA 1B4QA 1NM3A 5ECQB 4PQIA 3GTUB 1T3BA 5G1KA 2JACA 3QAGA 4K6XA 2KLXA 3TKSA 5IMAA 1GTAA 3KEBA 1O81A 1GP1A 4WKWA 2VD1A 1RQMA 2NBSA 4GCIA 2F9SA 2AAWA 5CREA 4USSA 4LL4B 1Q4JA 3ZVJD 5HR3A 3VWUA 2DMLA 2P5QA 4MF7A 1Z9HA 2FGXA 2R37A 3ZZXA 1M99A 5J40A 2YOIA 3FYGA 1PKWA 4KE3A 1W4VA 2QGVA 3R3EA 4K8MA 5DDLA 2GQLA 2GLRA 4PTSA 3HVSA 2E7PA 1SL1B 4MDCA 2H74A 2H6XA 1EGOA 2H1GA 5KN0A 4HQZA 1U3AA 3IK9A 2GSTA 3QFAC 4DSSA 2HLSA 4TW5A 1SJZA 3GTUA 1TXUA 4AJ6A 3C7MA 5G31A 1B9XC 3UIWA 5KOXA 2V1MA 3KMNA 1ERWA 4KSMA 1IYHA 2GSSA 4NHWA 2BMXA 2B1KA 3NIVA 5GAND 5FWGA 1BAYA 4J57E 3A2XA 2I9HA 2OBKA 2GS3A 4HEA2 1I9DA 3M9KA 1XWAA 4ZB7A 2I81A 2F8AA 4JEDA 3A2VA 3QD9A 5AISA 4JRRA 1XWCA 1J08A 1MDKA 2L4QA 3EINA 1FOHA 4BWQA 3PH9A 3LW9A 2ON7A 2HSNA 2R2JA 2FNOA 1PQNA 9GSSA 5DBQA 4RQRA 1GSUA 3TJFA 2FWGA 1K0AA 4CW9A 3GKNA 4AF2A 5J5NA 1BJXA 4MF5A 1URMA 3EU3A 2VL2C 3TDGA 1WP0A 4ZB6A 1U6TA 1SK2A 1WIKA 1EEJA 1EP7A 1R26A 5G2ZA 4FQUA 6GSYA 3KIJA 1GTBA 2TIRA 3D4MA 4ECIA 4OMVA 2AJQB 1G6YA 5ID2A 3NZNA 2H75A 2AV4A 1SK0A 4CHSA 5A34B 1VF2A 11GSA 2FY6A 5HQPA 2EFHA 4EDYA 4OO5A 4DSRA 3KM6A 2EFCA 4KDXA 1UVZA 1JZDA 1WE0A 1Z3EA 2JZTA 5HFIA 1TRSA 3WGDA 1TU8A 4E8HA 1XFLA 2Z9SA 1PSQA 2H1DA 5A5HB 3TOTA 3RPNA 5CAXA 2LRTA 1PA3A 2DJ1A 2A2SA 2WZ9A 4JE1A 5J4VA 2IMKA 3CTGA 2MZCA 16GSA 2FWEA 4V1Ap 2GQMA 4PUAA 1Y1UA 1R5PA 4EL1A 3VURA 2BJXA 1K0NA 3I9V2 4O32A 5KN2A 1E2YA 1OC9B 3QOUA 1E6BA 2RM5A 6GSUA 2E0QA 5ABRA 1SKRB 1K0DA 3IBHA 1ZZYA 1THOA 3IHGA 1ZYQB 4YAPA 5IOXA 1A2LA 4IQAA 4AJ8A 1AXDA 5B7CA 4MLYA 2V6KA 1AQWA 2CZ3A 2JL4A 1T4ZA 5EY6A 4MNNA 2K8SA 4ZBDA 4IN0A 5A34A 5F05A 2M80A 5JWQB 3APOA 5IO0A 2LTKA 3TKPA 3QMXA 3MAKA 1PRXA 1T8EB 1GUHA 5INYA 3VWXA 2GTUA 1SJ6A 3TU3B 4DSQA 5E59A 3IC8A 3MWHA 2YNXA 3N5OA 2YJHA 2CV4A 4NV2A 2FA8A 2B6MA 1TK0B 5A5HA 2X4AA 5CRDA 4IJ3A 2DJJA 2I3YA 2PERA 3PR8A 1V9WA 2O7KA 3HVXA 1TRUA 3RHBA 1Y25A 3TUEA 2GSQA 2YANA 2WS2A 2PN8A 3CWGA 1UA5A 5B8AA 2X99A 4PX1A 4NXIA 3GNJA 2J9HA 3F0IA 4FYUA 1A8YA 4BL7B 4XTSA 4F0BA 2VCWA 4KGIA 3UVTA 5IMCA 1DBYA 3Q74A 1SK1A 3IXRA 3VFIA 3F4TA 3EWLA 5D9TA 1K3LA 3F6DA 3LYKA 3J7Yb 5G5FA 1G0TA 2GZPA 1MD3A 2NVLA 3K8NA 3A5IA 3BJ5A 2F3MA 2H8LA 3C1SA 1KEBA 5E4WA 4CDOA 2IFQA 2HZEB 1OKDA 1TJDA 4ECJA 5ECLB 1X5DA 3PGTA 1QUWA 1YEXA 3DVXA 2HYXA 2R0PA 1TK8B 4G0KA 3TKRA 4ZILA 1GH2A 4JR4A 4YQVA 3IV4A 2C0DA 2WULA 3GN3A 4XS4A 1FHEA 2JU5A 2VCXA 3FZ5A 3M0FA 3RHCA 4XS1A 2H1BA 2MBTA 4X4JA 4MMMA 1V40A 2OACA 4TR1B 1GUKA 1Q98A 4F2IA 4QL9A 4MK3A 3IHQA 5AN1A 3RDWA 2EFEA 2B5EA 3BBYA 4HQSA 3FK8A 3V1WA 4KSOA 1LJRA 1QFNA 5ECMB 6GSSA 5F06A 1ACVA 4WBRD 1GLQA 1T1VA 2C3TA 3QAVA 1SD8A 1M2DA 1OAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0G A;  2YP6 A;  4ML6 A;  1MEK A;  2AHE A;  3TRX A;  3Q6O A;  2HE3 A;  3H93 A;  2CZ2 A;  4KH7 A;  3HJP A;  3A5W A;  4G0I A;  3GSS A;  3GL5 A;  3RBT A;  2DLX A;  3ZVJ A;  5H5Q A;  3CMI A;  5FT3 A;  3TKQ A;  1PX6 A;  1U3I A;  3EC3 A;  5CRG A;  5CRW A;  2VM1 A;  4MH2 A;  4LL1 B;  1PL2 A;  4G9H A;  4MPG A;  4K2D A;  4MPF A;  5L71 A;  1SEN A;  3IC4 A;  2MMO A;  1OVN A;  4ML1 A;  4BVY A;  4P3Y B;  2WCI A;  4HJ2 A;  3L78 A;  5H5S A;  4JZQ A;  2DJ3 A;  4TR1 A;  5IOW A;  1HQO A;  2VL9 A;  4L5L A;  2PPT A;  4IW9 A;  1XW9 A;  4KND A;  4I2T A;  1BED A;  3DYR A;  3US3 A;  5J9B A;  3SWL A;  2VIM A;  5AIX A;  1OE7 A;  4GF0 A;  4F0C A;  2V2G A;  2ZCT A;  2LQO A;  19GS A;  3TJK A;  1X5E A;  3WT1 A;  3Q18 A;  2HZF A;  5LCZ A;  3QAW A;  1Z5Y E;  2FUG 2;  4I8B A;  4PNG A;  2RUF A;  4Q5N A;  1FB0 A;  17GS A;  4D73 A;  4EKZ A;  2M46 A;  2DIY A;  3KP9 A;  4OFT A;  2H1A A;  3DEX A;  4X0X A;  5D9V A;  3GA4 A;  3HJO A;  4K0G A;  4K0N A;  1F6M C;  1SL0 B;  2GVP A;  2N5A A;  3M3M A;  3ZRE A;  2DJK A;  2YWM A;  3GH6 A;  3A3T A;  2K8V A;  2KUC A;  3GST A;  3M8N A;  1NHO A;  1BG5 A;  4AJ7 A;  2EC4 A;  3FR6 A;  5HR0 A;  5ELA A;  4TOP A;  1S3D A;  3JCM L;  3IOS A;  1OC8 A;  3LJR A;  1YY7 A;  4GST A;  14GS A;  1B4P A;  1ZMA A;  2IPA A;  5IIZ A;  1TXX A;  4POM A;  2C3Q A;  4ZBA A;  2YV7 A;  4NMU A;  5IPG A;  1GUM A;  3ED3 A;  2H72 A;  3PPU A;  4Z7X A;  2R5G A;  1PX7 A;  3VI7 A;  2HSN B;  3DWV A;  3O6T A;  1K0O A;  4IJI A;  1Z7P A;  2H19 A;  3WYW A;  2X8G A;  3F3R A;  3KTB A;  3EYT A;  1XW6 A;  3ZFL A;  4TR4 A;  3HZ4 A;  1XXU A;  3CXG A;  3E3E A;  1I5G A;  1F3A A;  3KH7 A;  4PGT A;  1ERV A;  3O3T A;  2F8F A;  1V57 A;  1WMJ A;  1X9W B;  3ZIJ A;  5G30 A;  1G7E A;  3TJJ A;  1SD9 A;  4GXZ A;  1J0F A;  2OJL A;  1Z6N A;  18GS A;  3W8S A;  4MH3 A;  3P7X A;  3C71 A;  3D21 A;  5ID2 B;  3APS A;  2YWO A;  4YH2 A;  2CVK A;  3R2Q A;  2PGT A;  2YZU A;  4FYC A;  4ZB9 A;  2GQK A;  3IDV A;  4ISD A;  5LNK e;  2XBI A;  3KCM A;  2YZH A;  5ECS A;  3IRA A;  3P90 A;  5JCU A;  3IR4 A;  1ST9 A;  2G2Q A;  2VO4 A;  2C0G A;  4G2E A;  4GQF A;  5B8B A;  3VK9 A;  3WD6 A;  1O85 A;  2HSY A;  4G0L A;  1SKW B;  2I1U A;  4IBP A;  5BMU A;  2B1L A;  4EO3 A;  4NHZ A;  4IKH A;  3TKS C;  2EIO A;  3LYP A;  5FHI A;  2YPM A;  5ENU A;  4K7I A;  4N11 A;  4I6X A;  1T7P B;  2M72 A;  2CVB A;  3EU4 A;  5ECH B;  1GTU A;  1VRS D;  2DSA A;  1YJ6 A;  4WR5 A;  2CX3 A;  3L9S A;  3KP8 A;  1NW2 A;  2DJ0 A;  2LV3 A;  2VD0 A;  1GWC A;  1TI1 A;  4HDE A;  2VAF A;  3QDN A;  2REM A;  1SU9 A;  1M2A A;  1JZR A;  3SBC A;  4EDZ A;  3F8U A;  1SYX A;  4GQC A;  4GLT A;  5DAK B;  2X8C A;  1KTE A;  3FW2 A;  5ECR B;  1O8W A;  1FO5 A;  1O73 A;  4PQH A;  4KA0 A;  3ME8 A;  4TN8 A;  2E2G A;  1OE8 A;  2VCQ A;  1W89 A;  1ERT A;  5G5E A;  4XIH A;  4IGJ A;  4V2N A;  5EL8 A;  1X5C A;  4OD7 A;  2LS5 A;  3IA1 A;  1XOB A;  4YQM A;  3GUR A;  1PMT A;  2WB9 A;  1NSW A;  4XRA A;  1HNB A;  2OAD A;  1R5A A;  1ML6 A;  2XPE A;  1UN2 A;  2L5L A;  3FZ4 A;  4EF0 A;  2XHF A;  5A4W A;  1BX9 A;  3H8Q A;  4HZ4 A;  3FKF A;  3LG6 A;  4MJC A;  4MA9 A;  3ERF A;  2L4C A;  3LQ7 A;  4XHM A;  3P8W A;  1TK5 B;  3CRT A;  2B5Y A;  1AQV A;  4EXJ A;  3EE2 A;  1EZK A;  1LU4 A;  4MZW A;  4KB3 A;  3QR6 A;  2QKE A;  3Q19 A;  3L0H A;  1VF1 A;  1TP9 A;  2YV9 A;  2TRX A;  1RW1 A;  1GL8 A;  12GS A;  1U87 A;  2AB6 A;  5DAK A;  2AYT A;  5ELG A;  2P5R A;  4MP4 A;  10GS A;  3U5R E;  2GZZ A;  2FWF A;  4L0W A;  3F63 A;  4ZB8 A;  4YQU A;  5J9C A;  1B48 A;  2IFQ B;  1FAA A;  1YDK A;  5JCG A;  3UJ1 A;  5D73 A;  2UZ8 A;  2H0H A;  2WDU A;  4POB A;  4FH8 A;  3FZ9 A;  1ERU A;  1B8X A;  2C0E A;  2VLT A;  4POK A;  4O5R A;  4RUV A;  3FY7 A;  2NPB A;  2IL3 A;  4LA1 A;  2GT5 A;  5HFK A;  1PN9 A;  2D2Z A;  3F4R A;  2FD3 A;  5DAL A;  1K3O A;  4HZ2 A;  1XWK A;  4XS4 B;  1RK4 A;  2OE0 A;  2DMM A;  4N30 A;  4IS0 A;  2PUK C;  3GHA A;  5D96 A;  2XBQ A;  2N5B A;  5IPH A;  1TRV A;  1AQX A;  3MNG A;  3I6A A;  1R4W A;  2FLS A;  2HQT A;  3GMF A;  4JBB A;  3GRX A;  1O6J A;  2LJK A;  4ZXG A;  3DRN A;  3GKX A;  4DEJ A;  3HY2 A;  1JFU A;  2EIR A;  5HR1 A;  5ECP B;  4DVC A;  2IIY A;  2VUP A;  3P2A A;  1KBN A;  3A2W A;  3D4T A;  4HJM A;  2FHE A;  4O7H A;  2HSM B;  2XPD A;  1QQ2 A;  1M9A A;  2C0F A;  3APQ A;  3ERG A;  5F0G A;  3ZTL A;  2OE1 A;  4RQX A;  3KJY A;  3GKM A;  5IMV A;  4J56 E;  4G10 A;  2OKA A;  5A4U A;  5GAP D;  5F8B A;  1XWB A;  3ZIV A;  4Q5F A;  2R3X A;  4WET A;  4FIW A;  3GFK A;  2H70 A;  3GX8 A;  1CQH A;  1TW9 A;  1TRW A;  3GL3 A;  4RI7 A;  1JZO A;  4BVY B;  4ZL7 A;  2RLI A;  3EVI A;  4YAV A;  2E2M A;  2LRC A;  4BA7 A;  2HRA A;  2LJR A;  1N8J A;  5DQY A;  3O76 A;  4J2F A;  4AGS A;  2ZNM A;  1DE1 A;  1YKC A;  4ZIJ A;  1GUL A;  3LSZ A;  2PWJ A;  4EUY A;  1N2A A;  1A0R P;  5D9X A;  3C1R A;  2L6D A;  2H73 A;  4IQ1 A;  5IM9 A;  1ON4 A;  4TR0 A;  3H4K A;  5C04 A;  2H6Z A;  4D73 B;  1S3A A;  4ZBB A;  2HSM A;  2MBS A;  2YWI A;  2LNT A;  4KDU A;  2LJA A;  2I4A A;  3BCI A;  1HD2 A;  1PD2 1;  2VOC A;  3CBU A;  1QGV A;  1XBS A;  3GYK A;  2K18 A;  3HA9 A;  4BVX A;  2LQQ A;  2A2R A;  2P31 A;  1NHY A;  4WBJ A;  4KCE A;  1SL2 B;  1VF4 A;  5A4V A;  2VCT A;  4TR3 A;  3DML A;  3FZA A;  2O89 A;  2EIQ A;  2GSR A;  2DIZ A;  1YF0 A;  5HFG A;  1GSQ A;  3E9J B;  2J23 A;  1XOA A;  3HZ8 A;  4WF5 A;  3QCP A;  3GIX A;  3D6I A;  3UAR A;  3ME7 A;  2IJY A;  1EP8 A;  1GSS A;  1TDI A;  3HVV A;  3DXB A;  2CX4 A;  1F3B A;  1O7U A;  4PNF A;  5CNW A;  1QXH A;  2VCZ A;  4GSS A;  2CQ9 A;  20GS A;  4LLR A;  1DUG A;  5DCH A;  4JU5 A;  1H4O A;  2KOK A;  2YWN A;  3ZL5 A;  2WJU A;  1AW9 A;  5IMD A;  1X9M B;  1WRY A;  4PQ1 A;  5CYY A;  3FHK A;  1G6W A;  2MMN A;  1WWJ A;  3HKR A;  4HS1 A;  3AY8 A;  1ZOF A;  3IAS 2;  1TTZ A;  4TRX A;  4NPB A;  4IP6 A;  1S3C A;  4NWY A;  1XPV A;  4PXO A;  2R6K A;  2P0G A;  2H30 A;  2CVD A;  1XVW A;  2HI7 A;  2XC2 A;  4K9Z A;  2GZY A;  1G7O A;  4H86 A;  4ECB A;  3S9F A;  1XVQ A;  1BYE A;  3QFB C;  3KGK A;  5A5K A;  3VWW A;  4ID0 A;  3UBL A;  1ABA A;  4OO4 A;  1XCC A;  2PMT A;  2HT9 A;  2X8H A;  3UOM A;  4I97 A;  2HRN A;  2NDO A;  2VL2 A;  1TU7 A;  3ZFB A;  1XW5 A;  2H71 A;  6GSX A;  1WPI A;  2IN3 A;  1TKD B;  1EV4 A;  3TJB A;  5J3R A;  2JZR A;  5IO2 A;  1X0R A;  3G7J A;  3MSZ A;  4OCF A;  1QK8 A;  2B5X A;  3E0U A;  5IQY A;  5AGY A;  2H0I A;  3ZLP A;  3VWV A;  2JSY A;  2H76 A;  4WF4 A;  1JHB A;  4N10 A;  3ERW A;  4TXO B;  3L9V A;  1V2A A;  3CSJ A;  2YCD A;  3H79 A;  1EEM A;  4MJB A;  4WR4 A;  1LBK A;  1Z6M A;  2ON5 A;  3TGZ A;  1JLV A;  5ECO B;  4L0U A;  3ZML A;  22GS A;  4HUA A;  4XS6 A;  5EPF A;  3TRP A;  5J4U A;  5GST A;  1MD4 A;  1AUC A;  3LEF A;  6GSW A;  3W8J A;  1K3Y A;  4MAB A;  1AIU A;  1PKZ A;  2GT6 A;  4XCS A;  1EOH A;  2ALB A;  5ECI B;  4ZL9 A;  4OCE A;  3F6F A;  4X1U A;  4EC0 A;  5B6N A;  2LUS A;  4EVM A;  4HU7 A;  2LEG A;  4E8E A;  1BQ7 A;  4KAE A;  1M2B A;  4IVF A;  3C73 A;  3EMX A;  2C1Y A;  3HJM A;  3GX0 A;  1MDJ A;  1O8X A;  5IMF A;  3UVH A;  4MZC A;  1AC1 A;  1C72 A;  2R4V A;  5J41 A;  3I43 A;  5H5R A;  5LD0 A;  4TXO A;  4O92 A;  1QMV A;  2VLV A;  1A23 A;  1XIY A;  3KD0 A;  1DE2 A;  4KW6 A;  2PU9 C;  5ECK B;  2JSZ A;  3F4S A;  2HFD A;  2JZS A;  3U6V A;  1K0C A;  1V98 A;  4NAX A;  4I2U A;  4OFN A;  1XWG A;  4N0V A;  4Q5R A;  3HD5 A;  4OWY A;  4KF9 A;  1M7T A;  5D9W A;  5HR2 A;  2V41 A;  3LXT A;  1MTC A;  2C3N A;  1FOV A;  2PBJ A;  5KEJ A;  4TVE A;  4V1A g;  2X64 A;  1PGT A;  3TOU A;  2NTO A;  2VM2 A;  4HOJ A;  1CQG A;  5CRH A;  5DCG A;  1U88 A;  2WGR A;  1GSY A;  3N9J A;  4TKY A;  2O8V B;  2LNS A;  4LMV A;  5DAL B;  3HHV A;  1DSB A;  1GSD A;  2B7K A;  4ACS A;  5CO3 A;  3EUR A;  3I69 A;  3VPT A;  2RUE A;  4POL A;  3DKS A;  2VL3 A;  2HNL A;  2HXK A;  3ZMK A;  3CYN A;  8GSS A;  4K7N A;  1SYR A;  5AIV A;  1A0F A;  7GSS A;  2KHP A;  2C8U A;  4BWS A;  2OA7 A;  3QPM A;  5B6M A;  2IWT A;  3VI5 A;  1A2M A;  4LMW A;  3LGC A;  2C80 A;  4Q5Q A;  4IHU A;  3DD3 A;  4MJA A;  1YF1 A;  5DJL A;  3BCK A;  4TXV A;  1OC3 A;  13GS A;  4ULX A;  2QC7 A;  3CSH A;  4IP1 A;  4V2M A;  6GSV A;  5COH A;  1A24 A;  2K6V A;  1ZL9 A;  3KMO A;  1V58 A;  2OE3 A;  3CRU A;  2O85 A;  2V6O A;  1IYI A;  4KUN A;  4X43 A;  4V2L A;  2KP2 A;  4QL7 A;  4JR6 A;  4ZL8 A;  2HSH A;  1EV9 A;  2CAQ A;  3KXO A;  4N0Z A;  1GTI A;  2TRC P;  3FR9 A;  2IMI A;  2CA8 A;  2A4V A;  3DIE A;  2L5O A;  2PVQ A;  1SJI A;  1HNC A;  1TI3 A;  1GNE A;  2BTO T;  2KP1 A;  3TB2 A;  4F03 A;  4K1F A;  2AUV A;  2WFC A;  4ILF A;  1JZW A;  2G0F A;  2ZUP A;  2K9F A;  3J7Y k;  5DJM A;  4KX4 A;  2RII A;  3ZIT A;  3HYP A;  1F37 A;  2PVO C;  3WGX A;  1HNA A;  3VPQ A;  1YQ1 A;  4ECC A;  1OC9 A;  4QQ7 A;  1B9Y C;  3LWA A;  4HI7 A;  1A2J A;  4FYB A;  4F82 A;  2MYG A;  2FCH A;  4HU9 A;  2B3S A;  5EVO A;  2O87 A;  3GV1 A;  3VLN A;  5JCW A;  1EWX A;  1EOG A;  4K7O A;  3WT2 A;  1WJK A;  2ES7 A;  3FEU A;  5GSS A;  2YN1 A;  1ZGN A;  1T4Y A;  2F51 A;  2L6C A;  3FR3 A;  1X9S B;  3KH9 A;  4BVX B;  1EGR A;  1USB A;  1ZCP A;  3DVW A;  2MMZ A;  3IK7 A;  1H75 A;  3ZYW A;  1T00 A;  3OR5 A;  4BPY A;  2HRK B;  3TJG A;  4MF6 A;  2CT6 A;  1YZX A;  1FG4 A;  2GGT A;  3UMA A;  3GUS A;  1FVJ A;  4EE0 A;  3GH9 A;  3UEM A;  2LRN A;  4WXT A;  3G7I A;  5JWO B;  3C8E A;  4WEY A;  4IEL A;  3IE3 A;  3HXS A;  4F9Z A;  1A8L A;  3D0Z A;  1K0B A;  1KNG A;  1UC7 A;  1Z7R A;  2IME A;  3BOA A;  2CAI A;  1GSE A;  1AAZ A;  2QSI A;  3G7Y A;  3CTF A;  2L59 A;  3CSI A;  5GZZ B;  3ZRD A;  5JWR B;  2GDR A;  2DBC A;  1PL1 A;  4BL7 A;  3F3Q A;  2DC5 A;  4NV5 A;  1VGL A;  5G1L A;  4OFM A;  2HRF A;  3ISO A;  3NOF A;  4KDY A;  1Y6E A;  3RAZ A;  2C4J A;  3MDK A;  1XZO A;  5IMZ A;  2VCV A;  3D22 A;  2YJ7 A;  2V32 A;  1GSF A;  1FW1 A;  5KN3 A;  2LST A;  2IMD A;  5D93 A;  4MCU A;  3GKK A;  1MDI A;  3HDC A;  1K0M A;  3H1N A;  1ILO A;  4GWR A;  2HRK A;  2FWH A;  2HZE A;  4I5Q A;  6GST A;  3M9J A;  3TKS E;  3DGQ A;  1FB6 A;  2WRT A;  2IMF A;  5DQS A;  1VF3 A;  3PIN A;  2RM6 A;  3IAM 2;  2H6Y A;  3L9U A;  3WGE A;  3KZQ A;  1SKS B;  4GTU A;  2OBI A;  2DJ2 A;  4XRD A;  4G19 A;  3BD2 A;  1FVK A;  2LKU A;  3UAP A;  5CP1 A;  3UL3 A;  1YKA A;  1F2E A;  3D5J A;  3UBK A;  1GLP A;  3L4N A;  3LOR A;  2B7J A;  1WOU A;  4FO5 A;  4MZB A;  5D8I A;  1GNW A;  4PUF C;  1HYU A;  2N5F A;  3W6G A;  5ECN B;  1ZYE A;  1TOF A;  1M0U A;  3FRC A;  1M9B A;  4L5O A;  3EMP A;  3F9U A;  3G9B A;  2L57 A;  2H01 A;  1OKT A;  2JAD A;  1THX A;  4GSN A;  4GRF A;  3M1G A;  3HCZ A;  1JLW A;  4L8E A;  4PUR A;  3LXZ A;  3LFL A;  1R7H A;  1GRX A;  4KCA A;  1F9M A;  4RI6 A;  1J9B A;  5KN1 A;  3TRQ A;  5F07 A;  1OYJ A;  2FA4 A;  4MJE A;  3KTL A;  2VLU A;  3TCO A;  2H66 A;  5C00 A;  4DSS B;  1YEP A;  5DVB A;  3RPP A;  2MMA A;  3IPZ A;  1B4Q A;  1NM3 A;  5ECQ B;  4PQI A;  3GTU B;  1T3B A;  5G1K A;  2JAC A;  3QAG A;  4K6X A;  2KLX A;  3TKS A;  5IMA A;  1GTA A;  3KEB A;  1O81 A;  1GP1 A;  4WKW A;  2VD1 A;  1RQM A;  2NBS A;  4GCI A;  2F9S A;  2AAW A;  5CRE A;  4USS A;  4LL4 B;  1Q4J A;  3ZVJ D;  5HR3 A;  3VWU A;  2DML A;  2P5Q A;  4MF7 A;  1Z9H A;  2FGX A;  2R37 A;  3ZZX A;  1M99 A;  2YOI A;  3FYG A;  1PKW A;  4KE3 A;  1W4V A;  2QGV A;  3R3E A;  4K8M A;  5DDL A;  2GQL A;  2GLR A;  4PTS A;  3HVS A;  2E7P A;  1SL1 B;  4MDC A;  2H74 A;  2H6X A;  1EGO A;  2H1G A;  5KN0 A;  4HQZ A;  1U3A A;  3IK9 A;  2GST A;  3QFA C;  4DSS A;  2HLS A;  4TW5 A;  1SJZ A;  3GTU A;  4AJ6 A;  3C7M A;  5G31 A;  1B9X C;  3UIW A;  2V1M A;  3KMN A;  1ERW A;  4KSM A;  1IYH A;  2GSS A;  4NHW A;  2BMX A;  2B1K A;  3NIV A;  5GAN D;  5FWG A;  1BAY A;  4J57 E;  3A2X A;  2I9H A;  2OBK A;  2GS3 A;  4HEA 2;  1I9D A;  3M9K A;  1XWA A;  2I81 A;  2F8A A;  4JED A;  3A2V A;  3QD9 A;  5AIS A;  4JRR A;  1XWC A;  1J08 A;  1MDK A;  2L4Q A;  3EIN A;  4BWQ A;  3PH9 A;  2ON7 A;  2R2J A;  2FNO A;  1PQN A;  9GSS A;  5DBQ A;  4RQR A;  1GSU A;  3TJF A;  2FWG A;  1K0A A;  4CW9 A;  3GKN A;  4AF2 A;  5J5N A;  1BJX A;  4MF5 A;  1URM A;  3EU3 A;  2VL2 C;  3TDG A;  1WP0 A;  4ZB6 A;  1U6T A;  1SK2 A;  1WIK A;  1EEJ A;  1EP7 A;  1R26 A;  5G2Z A;  4FQU A;  6GSY A;  3KIJ A;  1GTB A;  2TIR A;  3D4M A;  4ECI A;  4OMV A;  2AJQ B;  1G6Y A;  5ID2 A;  3NZN A;  2H75 A;  2AV4 A;  1SK0 A;  4CHS A;  1VF2 A;  11GS A;  2FY6 A;  5HQP A;  4EDY A;  4OO5 A;  4DSR A;  3KM6 A;  4KDX A;  1UVZ A;  1JZD A;  1WE0 A;  1Z3E A;  2JZT A;  5HFI A;  1TRS A;  3WGD A;  1TU8 A;  4E8H A;  1XFL A;  2Z9S A;  1PSQ A;  2H1D A;  3TOT A;  3RPN A;  5CAX A;  2LRT A;  1PA3 A;  2DJ1 A;  2A2S A;  2WZ9 A;  4JE1 A;  2IMK A;  3CTG A;  2MZC A;  16GS A;  2FWE A;  4V1A p;  2GQM A;  4PUA A;  1R5P A;  4EL1 A;  3VUR A;  2BJX A;  1K0N A;  3I9V 2;  4O32 A;  5KN2 A;  1E2Y A;  1OC9 B;  3QOU A;  1E6B A;  2RM5 A;  6GSU A;  2E0Q A;  5ABR A;  1SKR B;  1K0D A;  3IBH A;  1ZZY A;  1THO A;  1ZYQ B;  4YAP A;  5IOX A;  1A2L A;  4IQA A;  4AJ8 A;  1AXD A;  5B7C A;  4MLY A;  2V6K A;  1AQW A;  2CZ3 A;  2JL4 A;  1T4Z A;  5EY6 A;  2K8S A;  4ZBD A;  4IN0 A;  5F05 A;  2M80 A;  5JWQ B;  3APO A;  5IO0 A;  2LTK A;  3TKP A;  3QMX A;  3MAK A;  1PRX A;  1T8E B;  1GUH A;  5INY A;  3VWX A;  2GTU A;  1SJ6 A;  4DSQ A;  5E59 A;  3IC8 A;  3MWH A;  2YNX A;  3N5O A;  2YJH A;  2CV4 A;  4NV2 A;  2FA8 A;  2B6M A;  1TK0 B;  5CRD A;  4IJ3 A;  2DJJ A;  2I3Y A;  2PER A;  3PR8 A;  1V9W A;  2O7K A;  3HVX A;  1TRU A;  3RHB A;  1Y25 A;  3TUE A;  2GSQ A;  2YAN A;  2WS2 A;  2PN8 A;  1UA5 A;  5B8A A;  2X99 A;  4PX1 A;  4NXI A;  3GNJ A;  2J9H A;  3F0I A;  4FYU A;  1A8Y A;  4BL7 B;  4XTS A;  4F0B A;  2VCW A;  4KGI A;  3UVT A;  5IMC A;  1DBY A;  3Q74 A;  1SK1 A;  3IXR A;  3VFI A;  3F4T A;  3EWL A;  5D9T A;  1K3L A;  3F6D A;  3LYK A;  3J7Y b;  5G5F A;  1G0T A;  2GZP A;  1MD3 A;  2NVL A;  3K8N A;  3BJ5 A;  2F3M A;  2H8L A;  3C1S A;  1KEB A;  5E4W A;  4CDO A;  2IFQ A;  2HZE B;  1OKD A;  1TJD A;  4ECJ A;  5ECL B;  1X5D A;  3PGT A;  1QUW A;  1YEX A;  3DVX A;  2HYX A;  1TK8 B;  4G0K A;  3TKR A;  4ZIL A;  1GH2 A;  4JR4 A;  4YQV A;  3IV4 A;  2C0D A;  2WUL A;  3GN3 A;  4XS4 A;  1FHE A;  2JU5 A;  2VCX A;  3FZ5 A;  3M0F A;  3RHC A;  4XS1 A;  2H1B A;  2MBT A;  4MMM A;  1V40 A;  2OAC A;  4TR1 B;  1GUK A;  1Q98 A;  4F2I A;  4QL9 A;  4MK3 A;  3IHQ A;  5AN1 A;  3RDW A;  2B5E A;  3BBY A;  4HQS A;  3FK8 A;  3V1W A;  4KSO A;  1LJR A;  1QFN A;  5ECM B;  6GSS A;  5F06 A;  1ACV A;  4WBR D;  1GLQ A;  1T1V A;  2C3T A;  3QAV A;  1SD8 A;  1M2D A;  1OAZ A; 
#chains in the Genus database with same CATH topology
 2H0G A;  2YP6 A;  4ML6 A;  1MEK A;  2AHE A;  3TRX A;  3Q6O A;  2HE3 A;  3H93 A;  2CZ2 A;  4KH7 A;  3HJP A;  3A5W A;  4G0I A;  1SVM A;  3GSS A;  3GL5 A;  3RBT A;  2DLX A;  3ZVJ A;  5H5Q A;  3CMI A;  5FT3 A;  3TKQ A;  5A1N B;  1PX6 A;  1U3I A;  3EC3 A;  5CRG A;  5CRW A;  2VM1 A;  4MH2 A;  4LL1 B;  1PL2 A;  4G9H A;  4MPG A;  4K2D A;  4MPF A;  5L71 A;  1SEN A;  3IC4 A;  2MMO A;  1OVN A;  4ML1 A;  4BVY A;  4P3Y B;  2WCI A;  4HJ2 A;  3L78 A;  5H5S A;  4JZQ A;  2DJ3 A;  4TR1 A;  5IOW A;  4GDF A;  1HQO A;  2VL9 A;  4L5L A;  2PPT A;  4IW9 A;  2A2P A;  1XW9 A;  4KND A;  4I2T A;  1BED A;  3DYR A;  3US3 A;  5J9B A;  3SWL A;  2VIM A;  5AIX A;  1OE7 A;  4GF0 A;  4F0C A;  2V2G A;  2ZCT A;  2LQO A;  19GS A;  3TJK A;  1X5E A;  3WT1 A;  3Q18 A;  2HZF A;  5LCZ A;  3QAW A;  1Z5Y E;  2FUG 2;  4I8B A;  4PNG A;  2RUF A;  4Q5N A;  4O5Q A;  1FB0 A;  17GS A;  1YVL A;  4D73 A;  4EKZ A;  2M46 A;  2DIY A;  3KP9 A;  4OFT A;  2H1A A;  3DEX A;  4X0X A;  5D9V A;  3GA4 A;  3HJO A;  4K0G A;  4K0N A;  4YKG A;  1F6M C;  1SL0 B;  2GVP A;  2N5A A;  3M3M A;  3ZRE A;  2DJK A;  2YWM A;  3GH6 A;  3A3T A;  2K8V A;  2KUC A;  3GST A;  3M8N A;  1NHO A;  1BG5 A;  4AJ7 A;  2EC4 A;  2DKH A;  1BF5 A;  3FR6 A;  5HR0 A;  5ELA A;  4K5R A;  4TOP A;  1S3D A;  3JCM L;  3IOS A;  1OC8 A;  3LJR A;  1YY7 A;  4GST A;  14GS A;  1B4P A;  1ZMA A;  2IPA A;  5IIZ A;  1TXX A;  4POM A;  2C3Q A;  4ZBA A;  2YV7 A;  4NMU A;  5IPG A;  1GUM A;  3ED3 A;  2H72 A;  3PPU A;  4Z7X A;  1BG1 A;  2R5G A;  1PX7 A;  3VI7 A;  2HSN B;  3DWV A;  3O6T A;  1K0O A;  4IJI A;  1Z7P A;  2H19 A;  3WYW A;  2X8G A;  3F3R A;  3KTB A;  3EYT A;  1XW6 A;  3ZFL A;  4TR4 A;  3HZ4 A;  1XXU A;  3CXG A;  3E3E A;  1I5G A;  4Z2U A;  1F3A A;  3KH7 A;  4PGT A;  1ERV A;  3O3T A;  2F8F A;  1V57 A;  1WMJ A;  1X9W B;  3ZIJ A;  5G30 A;  1G7E A;  3TJJ A;  1SD9 A;  4GXZ A;  1J0F A;  2OJL A;  1Z6N A;  18GS A;  3W8S A;  4MH3 A;  3P7X A;  3C71 A;  3D21 A;  5ID2 B;  3APS A;  2YWO A;  4YH2 A;  2CVK A;  3R2Q A;  2PGT A;  2YZU A;  4BIK A;  4FYC A;  4ZB9 A;  2GQK A;  3IDV A;  4ISD A;  5LNK e;  2XBI A;  3KCM A;  2YZH A;  5ECS A;  3IRA A;  3P90 A;  5JCU A;  3IR4 A;  1ST9 A;  2WW1 A;  2G2Q A;  2VO4 A;  2C0G A;  4G2E A;  4GQF A;  5B8B A;  2UV8 G;  3VK9 A;  3WD6 A;  1O85 A;  2HSY A;  2A4H A;  4G0L A;  1SKW B;  2I1U A;  4IBP A;  5BMU A;  2B1L A;  4EO3 A;  4NHZ A;  4IKH A;  3TKS C;  2EIO A;  3LYP A;  5FHI A;  2QA1 A;  2YPM A;  3FMW A;  4K7I A;  5ENU A;  4N11 A;  4I6X A;  1T7P B;  2M72 A;  2CVB A;  3EU4 A;  5ECH B;  1GTU A;  1VRS D;  2DSA A;  1YJ6 A;  4WR5 A;  2CX3 A;  3L9S A;  3KP8 A;  1NW2 A;  2DJ0 A;  2LV3 A;  2VD0 A;  1GWC A;  1TI1 A;  4HDE A;  2VAF A;  3QDN A;  2REM A;  1SU9 A;  1M2A A;  1JZR A;  3SBC A;  4EDZ A;  3F8U A;  1SYX A;  4GQC A;  4GLT A;  5DAK B;  3EPT A;  2X8C A;  1KTE A;  3FW2 A;  5ECR B;  1O8W A;  1FO5 A;  1O73 A;  4PQH A;  4KA0 A;  3ME8 A;  4TN8 A;  3CHX C;  2E2G A;  1OE8 A;  2VCQ A;  1W89 A;  1ERT A;  5G5E A;  4XIH A;  4IGJ A;  4V2N A;  5EL8 A;  4AKG A;  3MIX A;  1X5C A;  2DKI A;  4OD7 A;  2LS5 A;  3IA1 A;  1XOB A;  4YQM A;  3GUR A;  1PMT A;  2WB9 A;  5J4Y A;  1NSW A;  4XRA A;  1HNB A;  2OAD A;  1R5A A;  1ML6 A;  2XPE A;  1UN2 A;  2L5L A;  3FZ4 A;  4EF0 A;  2XHF A;  5A4W A;  1BX9 A;  3H8Q A;  4HZ4 A;  3FKF A;  3LG6 A;  4MJC A;  4MA9 A;  3ERF A;  2L4C A;  3LQ7 A;  4XHM A;  3P8W A;  1TK5 B;  3CRT A;  2B5Y A;  1AQV A;  4EXJ A;  3EE2 A;  4E68 A;  1EZK A;  1LU4 A;  4MZW A;  4KB3 A;  3QR6 A;  2QKE A;  3Q19 A;  3L0H A;  1VF1 A;  1TP9 A;  2YV9 A;  2TRX A;  1RW1 A;  1GL8 A;  12GS A;  1U87 A;  2AB6 A;  5DAK A;  2AYT A;  5ELG A;  2P5R A;  4MP4 A;  10GS A;  3U5R E;  2GZZ A;  2FWF A;  4L0W A;  3F63 A;  4ZB8 A;  4YQU A;  5J9C A;  1B48 A;  2IFQ B;  1FAA A;  1YDK A;  5JCG A;  3UJ1 A;  5D73 A;  2UZ8 A;  2H0H A;  2WDU A;  4POB A;  4FH8 A;  3FZ9 A;  1ZYN A;  1ERU A;  1B8X A;  2C0E A;  2VLT A;  4POK A;  4O5R A;  2WW2 A;  4RUV A;  3FY7 A;  2NPB A;  2IL3 A;  4LA1 A;  2GT5 A;  5HFK A;  1PN9 A;  2D2Z A;  3F4R A;  2FD3 A;  5DAL A;  1K3O A;  4HZ2 A;  1XWK A;  4XS4 B;  1RK4 A;  2OE0 A;  2DMM A;  4N30 A;  4IS0 A;  2PUK C;  3GHA A;  5D96 A;  2XBQ A;  2N5B A;  5IPH A;  1TRV A;  1AQX A;  3MNG A;  3I6A A;  1R4W A;  2FLS A;  2HQT A;  3GMF A;  4JBB A;  3GRX A;  1O6J A;  2LJK A;  4ZXG A;  3DRN A;  3GKX A;  4DEJ A;  3HY2 A;  1JFU A;  2EIR A;  5HR1 A;  5ECP B;  4DVC A;  2IIY A;  2VUP A;  3P2A A;  1KBN A;  3A2W A;  3D4T A;  4HJM A;  2FHE A;  4O7H A;  2HSM B;  2XPD A;  1QQ2 A;  3APQ A;  1M9A A;  2C0F A;  3ERG A;  5F0G A;  3ZTL A;  2OE1 A;  4RQX A;  3KJY A;  3GKM A;  5IMV A;  4J56 E;  4G10 A;  2OKA A;  5A4U A;  5GAP D;  4QMK A;  5F8B A;  1XWB A;  3ZIV A;  4Q5F A;  2R3X A;  4WET A;  4FIW A;  3GFK A;  2H70 A;  3GX8 A;  1CQH A;  2R0G A;  1TW9 A;  1TRW A;  3GL3 A;  4RI7 A;  4N3Z A;  4BVY B;  1JZO A;  4ZL7 A;  2RLI A;  3EVI A;  4YAV A;  2E2M A;  2LRC A;  4BA7 A;  2HRA A;  1S3R A;  2LJR A;  1N8J A;  5DQY A;  2H1L A;  3O76 A;  4J2F A;  4AGS A;  2ZNM A;  1DE1 A;  1YKC A;  4ZIJ A;  1GUL A;  3LSZ A;  2PWJ A;  4O5U A;  4EUY A;  1N2A A;  1A0R P;  5D9X A;  3C1R A;  2L6D A;  2H73 A;  4IQ1 A;  5IM9 A;  1ON4 A;  4TR0 A;  3H4K A;  5C04 A;  2H6Z A;  4D73 B;  1S3A A;  4ZBB A;  2HSM A;  2MBS A;  2YWI A;  2LNT A;  4KDU A;  2LJA A;  2I4A A;  3BCI A;  1HD2 A;  1PD2 1;  2VOC A;  3CBU A;  1QGV A;  1XBS A;  3GYK A;  2K18 A;  3HA9 A;  4BVX A;  2LQQ A;  2A2R A;  2P31 A;  1NHY A;  4WBJ A;  4KCE A;  1SL2 B;  1VF4 A;  5A4V A;  2VCT A;  5J47 A;  4TR3 A;  3DML A;  3FZA A;  4ICY A;  2O89 A;  2EIQ A;  2GSR A;  2WVY A;  2DIZ A;  1YF0 A;  5HFG A;  1GSQ A;  3E9J B;  2J23 A;  1XOA A;  3HZ8 A;  4WF5 A;  3QCP A;  3GIX A;  3D6I A;  3UAR A;  3ME7 A;  2IJY A;  1EP8 A;  1GSS A;  1TDI A;  3HVV A;  3DXB A;  2CX4 A;  1F3B A;  1O7U A;  4PNF A;  5CNW A;  1QXH A;  2VCZ A;  2WW0 A;  4GSS A;  2CQ9 A;  2R0C A;  20GS A;  4LLR A;  1DUG A;  5DCH A;  4JU5 A;  1H4O A;  2KOK A;  2YWN A;  3ZL5 A;  2WJU A;  1AW9 A;  5IMD A;  1X9M B;  1WRY A;  4PQ1 A;  5CYY A;  3FHK A;  1G6W A;  2MMN A;  1WWJ A;  3HKR A;  1ZYP A;  4HS1 A;  4AI6 A;  3AY8 A;  1ZOF A;  3IAS 2;  1TTZ A;  4TRX A;  4NPB A;  4IP6 A;  1S3C A;  4NWY A;  1XPV A;  4PXO A;  2R6K A;  2VKZ G;  2P0G A;  2H30 A;  2CVD A;  1XVW A;  2HI7 A;  2XC2 A;  4K9Z A;  2GZY A;  1G7O A;  4H86 A;  4ECB A;  3S9F A;  1XVQ A;  1BYE A;  3QFB C;  3KGK A;  5A5K A;  3VWW A;  4W66 A;  4ID0 A;  3UBL A;  1ABA A;  4OO4 A;  1XCC A;  2PMT A;  2HT9 A;  2X8H A;  3UOM A;  4I97 A;  2HRN A;  2NDO A;  2VL2 A;  1TU7 A;  3ZFB A;  1XW5 A;  1SVO A;  2H71 A;  6GSX A;  1WPI A;  5BMU B;  2IN3 A;  1TKD B;  1EV4 A;  3TJB A;  5J3R A;  2JZR A;  5IO2 A;  1X0R A;  3G7J A;  3MSZ A;  5BRT A;  4OCF A;  1QK8 A;  2B5X A;  3E0U A;  5IQY A;  5AGY A;  2H0I A;  3ZLP A;  3VWV A;  2JSY A;  2H76 A;  4WF4 A;  1JHB A;  4N10 A;  3ERW A;  4TXO B;  3L9V A;  1V2A A;  3CSJ A;  2QA2 A;  2YCD A;  3H79 A;  1EEM A;  4MJB A;  4WR4 A;  1LBK A;  1Z6M A;  4EIP A;  2ON5 A;  3TGZ A;  3HMJ G;  1PFO A;  1JLV A;  5ECO B;  4L0U A;  3ZML A;  22GS A;  4HUA A;  4XS6 A;  5EPF A;  3TRP A;  5J4U A;  5GST A;  1MD4 A;  1AUC A;  3LEF A;  6GSW A;  4AKH A;  3W8J A;  1K3Y A;  4MAB A;  1AIU A;  1PKZ A;  2GT6 A;  4XCS A;  1EOH A;  2ALB A;  5ECI B;  1SVL A;  4ZL9 A;  4OCE A;  3F6F A;  4X1U A;  4EC0 A;  5B6N A;  2LUS A;  4EVM A;  4HU7 A;  2LEG A;  4E8E A;  1BQ7 A;  4KAE A;  1M2B A;  4AKX B;  4IVF A;  3C73 A;  3EMX A;  2C1Y A;  3HJM A;  3GX0 A;  1MDJ A;  2O5V A;  1O8X A;  4K2X A;  5IMF A;  3UVH A;  4MZC A;  1AC1 A;  1C72 A;  2R4V A;  5J41 A;  3I43 A;  5H5R A;  5LD0 A;  4TXO A;  4O92 A;  1QMV A;  2WZS A;  2VLV A;  1A23 A;  1XIY A;  3KD0 A;  1DE2 A;  4KW6 A;  2PU9 C;  5ECK B;  2JSZ A;  3F4S A;  2HFD A;  2JZS A;  3U6V A;  1K0C A;  1V98 A;  4NAX A;  4I2U A;  4OFN A;  1XWG A;  4N0V A;  4Q5R A;  2WVX B;  3HD5 A;  4OWY A;  4KF9 A;  1M7T A;  5D9W A;  3MYD A;  5HR2 A;  2V41 A;  3LXT A;  1MTC A;  2C3N A;  4AKI A;  4Z2R A;  1FOV A;  2PBJ A;  5KEJ A;  4TVE A;  4V1A g;  2X64 A;  1PGT A;  3TOU A;  2NTO A;  2VM2 A;  2OT3 A;  4HOJ A;  1CQG A;  5CRH A;  5DCG A;  1U88 A;  2WGR A;  1GSY A;  2O36 A;  3N9J A;  4TKY A;  2O8V B;  2LNS A;  4LMV A;  5DAL B;  2O3E A;  3HHV A;  1DSB A;  1GSD A;  2B7K A;  4ACS A;  5CO3 A;  3EUR A;  1YEW C;  3RGB C;  4A5P A;  3I69 A;  3VPT A;  2RUE A;  4POL A;  3DKS A;  3HVN A;  2VL3 A;  2HNL A;  2HXK A;  3ZMK A;  3CYN A;  8GSS A;  4K7N A;  1SYR A;  5AIV A;  4HSC X;  1A0F A;  7GSS A;  2KHP A;  2C8U A;  4BWS A;  2OA7 A;  3QPM A;  5B6M A;  2IWT A;  3VI5 A;  1A2M A;  4LMW A;  3LGC A;  2C80 A;  2WVX A;  4Q5Q A;  4IHU A;  3DD3 A;  4MJA A;  1YF1 A;  5DJL A;  3BCK A;  4TXV A;  1OC3 A;  13GS A;  4ULX A;  2QC7 A;  3CSH A;  4IP1 A;  4V2M A;  6GSV A;  5COH A;  1A24 A;  2K6V A;  1ZL9 A;  3KMO A;  1V58 A;  2OE3 A;  3CRU A;  2O85 A;  2V6O A;  1IYI A;  4KUN A;  4X43 A;  4V2L A;  2KP2 A;  4QL7 A;  4JR6 A;  4ZL8 A;  2HSH A;  1EV9 A;  2CAQ A;  3KXO A;  4N0Z A;  1GTI A;  2TRC P;  3FR9 A;  2IMI A;  2CA8 A;  2A4V A;  3DIE A;  2L5O A;  2PVQ A;  1SJI A;  1HNC A;  1TI3 A;  1GNE A;  2BTO T;  2KP1 A;  3TB2 A;  4F03 A;  4K1F A;  2AUV A;  2WFC A;  4YKF A;  4ILF A;  1JZW A;  2G0F A;  2ZUP A;  2K9F A;  3J7Y k;  5DJM A;  4KX4 A;  2RII A;  3ZIT A;  3HYP A;  1F37 A;  2PVO C;  3RFR C;  1PN0 A;  3WGX A;  1HNA A;  3VPQ A;  1YQ1 A;  4ECC A;  1OC9 A;  4QQ7 A;  1XG8 A;  1B9Y C;  3LWA A;  4HI7 A;  1A2J A;  4FYB A;  4F82 A;  2MYG A;  2FCH A;  4HU9 A;  4CY8 A;  2B3S A;  5EVO A;  5KOW A;  2O87 A;  3GV1 A;  3VLN A;  5JCW A;  1EWX A;  1EOG A;  4K7O A;  3WT2 A;  1WJK A;  2ES7 A;  3FEU A;  5GSS A;  2YN1 A;  1ZGN A;  1T4Y A;  2F51 A;  2L6C A;  3FR3 A;  1X9S B;  3KH9 A;  4BVX B;  1EGR A;  1USB A;  1ZCP A;  3DVW A;  2MMZ A;  3IK7 A;  1H75 A;  3ZYW A;  1T00 A;  3OR5 A;  4BPY A;  2HRK B;  4CY6 A;  3TJG A;  4MF6 A;  2CT6 A;  1YZX A;  1FG4 A;  2GGT A;  3UMA A;  3GUS A;  1FVJ A;  4EE0 A;  2EFD A;  3GH9 A;  3UEM A;  2LRN A;  4WXT A;  3G7I A;  5JWO B;  3C8E A;  4G01 A;  4IEL A;  4WEY A;  3IE3 A;  3HXS A;  4F9Z A;  1A8L A;  3D0Z A;  1K0B A;  1KNG A;  1UC7 A;  1Z7R A;  2IME A;  3BOA A;  2CAI A;  1GSE A;  1AAZ A;  2QSI A;  3G7Y A;  3CTF A;  2L59 A;  3CSI A;  5GZZ B;  3ZRD A;  5JWR B;  2GDR A;  2DBC A;  1PL1 A;  3CQF A;  4BL7 A;  3F3Q A;  2DC5 A;  4K5S A;  4NV5 A;  1VGL A;  5G1L A;  4OFM A;  2HRF A;  3ISO A;  3NOF A;  4KDY A;  1Y6E A;  3RAZ A;  2C4J A;  3MDK A;  4EIQ A;  1XZO A;  5IMZ A;  2VCV A;  3D22 A;  2YJ7 A;  2V32 A;  1GSF A;  1FW1 A;  5KN3 A;  2LST A;  2IMD A;  5D93 A;  4MCU A;  3GKK A;  1MDI A;  2X49 A;  3HDC A;  1K0M A;  3H1N A;  1ILO A;  4GWR A;  2HRK A;  2FWH A;  2HZE A;  4I5Q A;  6GST A;  3M9J A;  3TKS E;  3DGQ A;  1FB6 A;  2WRT A;  2IMF A;  5DQS A;  1VF3 A;  1M3J A;  3PIN A;  2RM6 A;  3IAM 2;  2H6Y A;  3L9U A;  3WGE A;  3KZQ A;  1SKS B;  4GTU A;  2OBI A;  2DJ2 A;  4XRD A;  4G19 A;  3BD2 A;  1N25 A;  1FVK A;  2LKU A;  3UAP A;  5CP1 A;  3UL3 A;  1YKA A;  1F2E A;  3D5J A;  3UBK A;  1GLP A;  3L4N A;  3LOR A;  2B7J A;  1WOU A;  4FO5 A;  4MZB A;  5D8I A;  1GNW A;  1M3I A;  4PUF C;  1HYU A;  2N5F A;  3W6G A;  5ECN B;  1ZYE A;  1TOF A;  1M0U A;  3FRC A;  4Z2T A;  1M9B A;  4L5O A;  3EMP A;  3F9U A;  3G9B A;  2L57 A;  2H01 A;  1OKT A;  2JAD A;  1THX A;  4GSN A;  4GRF A;  3M1G A;  3HCZ A;  1JLW A;  4L8E A;  4PUR A;  3LXZ A;  3LFL A;  1R7H A;  1GRX A;  4KCA A;  1F9M A;  4RI6 A;  1J9B A;  5KN1 A;  5A1N A;  3TRQ A;  5F07 A;  1OYJ A;  2FA4 A;  4MJE A;  3KTL A;  2VLU A;  3TCO A;  2H66 A;  5C00 A;  4DSS B;  1YEP A;  5DVB A;  3RPP A;  2MMA A;  3IPZ A;  1B4Q A;  1NM3 A;  5ECQ B;  4PQI A;  3GTU B;  1T3B A;  5G1K A;  2JAC A;  3QAG A;  4K6X A;  2KLX A;  3TKS A;  5IMA A;  1GTA A;  3KEB A;  1S4B P;  1O81 A;  1GP1 A;  4WKW A;  2VD1 A;  1RQM A;  2NBS A;  4GCI A;  2F9S A;  2AAW A;  5CRE A;  4USS A;  4LL4 B;  1Q4J A;  3ZVJ D;  5HR3 A;  3VWU A;  2DML A;  2P5Q A;  4MF7 A;  1Z9H A;  2FGX A;  2R37 A;  3ZZX A;  1M99 A;  5J40 A;  2YOI A;  3FYG A;  1PKW A;  4KE3 A;  1W4V A;  2QGV A;  3R3E A;  4K8M A;  5DDL A;  2GQL A;  2GLR A;  4PTS A;  3HVS A;  2E7P A;  4PI0 C;  1SL1 B;  4MDC A;  2H74 A;  2H6X A;  1EGO A;  2H1G A;  5KN0 A;  4HQZ A;  1U3A A;  3IK9 A;  2GST A;  3QFA C;  4DSS A;  2HLS A;  4TW5 A;  1SJZ A;  3GTU A;  1TXU A;  4AJ6 A;  3C7M A;  5G31 A;  1B9X C;  3UIW A;  5KOX A;  2V1M A;  3KMN A;  1ERW A;  1I1I P;  4KSM A;  1IYH A;  2GSS A;  4NHW A;  2BMX A;  2B1K A;  3NIV A;  5GAN D;  5FWG A;  1BAY A;  4J57 E;  3A2X A;  2I9H A;  2OBK A;  2GS3 A;  4HEA 2;  1I9D A;  3M9K A;  1XWA A;  4ZB7 A;  2I81 A;  2F8A A;  4JED A;  3A2V A;  3QD9 A;  5AIS A;  4JRR A;  1XWC A;  1J08 A;  1MDK A;  2L4Q A;  3EIN A;  1FOH A;  4BWQ A;  3PH9 A;  3LW9 A;  2ON7 A;  2HSN A;  2WW3 A;  2R2J A;  2FNO A;  1PQN A;  9GSS A;  5DBQ A;  4RQR A;  1GSU A;  3TJF A;  2FWG A;  1K0A A;  4CW9 A;  3GKN A;  4AF2 A;  5J5N A;  1BJX A;  4MF5 A;  1URM A;  3EU3 A;  2VL2 C;  3TDG A;  1WP0 A;  4ZB6 A;  1U6T A;  1SK2 A;  1WIK A;  1EEJ A;  1EP7 A;  1R26 A;  5G2Z A;  4FQU A;  6GSY A;  3KIJ A;  1GTB A;  2TIR A;  3D4M A;  4ECI A;  4OMV A;  2AJQ B;  1G6Y A;  5ID2 A;  3NZN A;  2H75 A;  2AV4 A;  1SK0 A;  4CHS A;  5A34 B;  1VF2 A;  11GS A;  2FY6 A;  5HQP A;  2EFH A;  4EDY A;  4OO5 A;  4DSR A;  3KM6 A;  2EFC A;  4KDX A;  1UVZ A;  1JZD A;  1WE0 A;  1Z3E A;  2JZT A;  5HFI A;  1TRS A;  3WGD A;  1TU8 A;  4E8H A;  1XFL A;  2Z9S A;  1PSQ A;  2H1D A;  5A5H B;  3TOT A;  3RPN A;  5CAX A;  2LRT A;  1PA3 A;  2DJ1 A;  2A2S A;  2WZ9 A;  4JE1 A;  5J4V A;  2IMK A;  3CTG A;  2MZC A;  16GS A;  2FWE A;  4V1A p;  2GQM A;  4PUA A;  1Y1U A;  1R5P A;  4EL1 A;  3VUR A;  2BJX A;  1K0N A;  3I9V 2;  4O32 A;  5KN2 A;  1E2Y A;  1OC9 B;  3QOU A;  1E6B A;  2RM5 A;  6GSU A;  2E0Q A;  5ABR A;  1SKR B;  1K0D A;  3IBH A;  1ZZY A;  1THO A;  3IHG A;  1ZYQ B;  4YAP A;  5IOX A;  1A2L A;  4IQA A;  4AJ8 A;  1AXD A;  5B7C A;  4MLY A;  2V6K A;  1AQW A;  2CZ3 A;  2JL4 A;  1T4Z A;  5EY6 A;  4MNN A;  2K8S A;  4ZBD A;  4IN0 A;  5A34 A;  5F05 A;  2M80 A;  4PHZ C;  5JWQ B;  3APO A;  5IO0 A;  2WVZ A;  2LTK A;  3TKP A;  3QMX A;  3MAK A;  1PRX A;  1T8E B;  1GUH A;  5INY A;  3VWX A;  2GTU A;  1SJ6 A;  3TU3 B;  4DSQ A;  5E59 A;  3IC8 A;  2YNX A;  3MWH A;  3N5O A;  2YJH A;  2CV4 A;  4NV2 A;  2FA8 A;  2B6M A;  1TK0 B;  5A5H A;  2X4A A;  5CRD A;  4IJ3 A;  2DJJ A;  2I3Y A;  2PER A;  3PR8 A;  1V9W A;  2O7K A;  3HVX A;  1TRU A;  3RHB A;  1Y25 A;  3TUE A;  2GSQ A;  2YAN A;  2WS2 A;  2PN8 A;  3CWG A;  1UA5 A;  5B8A A;  2X99 A;  4PX1 A;  4NXI A;  3GNJ A;  2J9H A;  3F0I A;  4FYU A;  1A8Y A;  4BL7 B;  4XTS A;  4F0B A;  2VCW A;  4KGI A;  3UVT A;  5IMC A;  1DBY A;  3Q74 A;  1SK1 A;  3IXR A;  3VFI A;  3F4T A;  3EWL A;  5D9T A;  1K3L A;  3F6D A;  3LYK A;  3J7Y b;  5G5F A;  1G0T A;  2GZP A;  1MD3 A;  2NVL A;  3K8N A;  3A5I A;  3BJ5 A;  2F3M A;  2H8L A;  3C1S A;  1KEB A;  5E4W A;  4CDO A;  2IFQ A;  2HZE B;  1OKD A;  1TJD A;  4ECJ A;  5ECL B;  1X5D A;  3PGT A;  1QUW A;  1YEX A;  3DVX A;  2HYX A;  2R0P A;  1TK8 B;  4G0K A;  3TKR A;  4ZIL A;  1GH2 A;  4JR4 A;  4YQV A;  3IV4 A;  2C0D A;  2WUL A;  3GN3 A;  4XS4 A;  1FHE A;  2JU5 A;  2VCX A;  3FZ5 A;  3M0F A;  4PI2 C;  3RHC A;  4XS1 A;  2H1B A;  2MBT A;  4X4J A;  4MMM A;  1V40 A;  2OAC A;  4TR1 B;  1GUK A;  1Q98 A;  4F2I A;  4QL9 A;  4MK3 A;  3IHQ A;  5AN1 A;  3RDW A;  2EFE A;  2B5E A;  3BBY A;  4HQS A;  4FXY P;  3FK8 A;  3V1W A;  4KSO A;  1LJR A;  1QFN A;  5ECM B;  6GSS A;  5F06 A;  1ACV A;  4WBR D;  1GLQ A;  1T1V A;  2C3T A;  3QAV A;  1SD8 A;  1M2D A;  1OAZ A; 
#chains in the Genus database with same CATH homology
 2H0G A;  2YP6 A;  4ML6 A;  1MEK A;  2AHE A;  3TRX A;  3Q6O A;  2HE3 A;  3H93 A;  2CZ2 A;  4KH7 A;  3HJP A;  3A5W A;  4G0I A;  1SVM A;  3GSS A;  3GL5 A;  3RBT A;  2DLX A;  3ZVJ A;  5H5Q A;  3CMI A;  5FT3 A;  3TKQ A;  5A1N B;  1PX6 A;  1U3I A;  3EC3 A;  5CRG A;  5CRW A;  2VM1 A;  4MH2 A;  4LL1 B;  1PL2 A;  4G9H A;  4MPG A;  4K2D A;  4MPF A;  5L71 A;  1SEN A;  3IC4 A;  2MMO A;  1OVN A;  4ML1 A;  4BVY A;  4P3Y B;  2WCI A;  4HJ2 A;  3L78 A;  5H5S A;  4JZQ A;  2DJ3 A;  4TR1 A;  5IOW A;  4GDF A;  1HQO A;  2VL9 A;  4L5L A;  2PPT A;  4IW9 A;  2A2P A;  1XW9 A;  4KND A;  4I2T A;  1BED A;  3DYR A;  3US3 A;  5J9B A;  3SWL A;  2VIM A;  5AIX A;  1OE7 A;  4GF0 A;  4F0C A;  2V2G A;  2ZCT A;  2LQO A;  19GS A;  3TJK A;  1X5E A;  3WT1 A;  3Q18 A;  2HZF A;  5LCZ A;  3QAW A;  1Z5Y E;  2FUG 2;  4I8B A;  4PNG A;  2RUF A;  4Q5N A;  4O5Q A;  1FB0 A;  17GS A;  1YVL A;  4D73 A;  4EKZ A;  2M46 A;  2DIY A;  3KP9 A;  4OFT A;  2H1A A;  3DEX A;  4X0X A;  5D9V A;  3GA4 A;  3HJO A;  4K0G A;  4K0N A;  4YKG A;  1F6M C;  1SL0 B;  2GVP A;  2N5A A;  3M3M A;  3ZRE A;  2DJK A;  2YWM A;  3GH6 A;  3A3T A;  2K8V A;  2KUC A;  3GST A;  3M8N A;  1NHO A;  1BG5 A;  4AJ7 A;  2EC4 A;  2DKH A;  1BF5 A;  3FR6 A;  5HR0 A;  5ELA A;  4K5R A;  4TOP A;  1S3D A;  3JCM L;  3IOS A;  1OC8 A;  3LJR A;  1YY7 A;  4GST A;  14GS A;  1B4P A;  1ZMA A;  2IPA A;  5IIZ A;  1TXX A;  4POM A;  2C3Q A;  4ZBA A;  2YV7 A;  4NMU A;  5IPG A;  1GUM A;  3ED3 A;  2H72 A;  3PPU A;  4Z7X A;  1BG1 A;  2R5G A;  1PX7 A;  3VI7 A;  2HSN B;  3DWV A;  3O6T A;  1K0O A;  4IJI A;  1Z7P A;  2H19 A;  3WYW A;  2X8G A;  3F3R A;  3KTB A;  3EYT A;  1XW6 A;  3ZFL A;  4TR4 A;  3HZ4 A;  1XXU A;  3CXG A;  3E3E A;  1I5G A;  4Z2U A;  1F3A A;  3KH7 A;  4PGT A;  1ERV A;  3O3T A;  2F8F A;  1V57 A;  1WMJ A;  1X9W B;  3ZIJ A;  5G30 A;  1G7E A;  3TJJ A;  1SD9 A;  4GXZ A;  1J0F A;  2OJL A;  1Z6N A;  18GS A;  3W8S A;  4MH3 A;  3P7X A;  3C71 A;  3D21 A;  5ID2 B;  3APS A;  2YWO A;  4YH2 A;  2CVK A;  3R2Q A;  2PGT A;  2YZU A;  4FYC A;  4ZB9 A;  2GQK A;  3IDV A;  4ISD A;  5LNK e;  2XBI A;  3KCM A;  2YZH A;  5ECS A;  3IRA A;  3P90 A;  5JCU A;  3IR4 A;  1ST9 A;  2G2Q A;  2VO4 A;  2C0G A;  4G2E A;  4GQF A;  5B8B A;  2UV8 G;  3VK9 A;  3WD6 A;  1O85 A;  2HSY A;  2A4H A;  4G0L A;  1SKW B;  2I1U A;  4IBP A;  5BMU A;  2B1L A;  4EO3 A;  4NHZ A;  4IKH A;  3TKS C;  2EIO A;  3LYP A;  5FHI A;  2QA1 A;  2YPM A;  3FMW A;  4K7I A;  5ENU A;  4N11 A;  4I6X A;  1T7P B;  2M72 A;  2CVB A;  3EU4 A;  5ECH B;  1GTU A;  1VRS D;  2DSA A;  1YJ6 A;  4WR5 A;  2CX3 A;  3L9S A;  3KP8 A;  1NW2 A;  2DJ0 A;  2LV3 A;  2VD0 A;  1GWC A;  1TI1 A;  4HDE A;  2VAF A;  3QDN A;  2REM A;  1SU9 A;  1M2A A;  1JZR A;  3SBC A;  4EDZ A;  3F8U A;  1SYX A;  4GQC A;  4GLT A;  5DAK B;  3EPT A;  2X8C A;  1KTE A;  3FW2 A;  5ECR B;  1O8W A;  1FO5 A;  1O73 A;  4PQH A;  4KA0 A;  3ME8 A;  4TN8 A;  2E2G A;  1OE8 A;  2VCQ A;  1W89 A;  1ERT A;  5G5E A;  4XIH A;  4IGJ A;  4V2N A;  5EL8 A;  4AKG A;  3MIX A;  1X5C A;  2DKI A;  4OD7 A;  2LS5 A;  3IA1 A;  1XOB A;  4YQM A;  3GUR A;  1PMT A;  2WB9 A;  5J4Y A;  1NSW A;  4XRA A;  1HNB A;  2OAD A;  1R5A A;  1ML6 A;  2XPE A;  1UN2 A;  2L5L A;  3FZ4 A;  4EF0 A;  2XHF A;  5A4W A;  1BX9 A;  3H8Q A;  4HZ4 A;  3FKF A;  3LG6 A;  4MJC A;  4MA9 A;  3ERF A;  2L4C A;  3LQ7 A;  4XHM A;  3P8W A;  1TK5 B;  3CRT A;  2B5Y A;  1AQV A;  4EXJ A;  3EE2 A;  4E68 A;  1EZK A;  1LU4 A;  4MZW A;  4KB3 A;  3QR6 A;  2QKE A;  3Q19 A;  3L0H A;  1VF1 A;  1TP9 A;  2YV9 A;  2TRX A;  1RW1 A;  1GL8 A;  12GS A;  1U87 A;  2AB6 A;  5DAK A;  2AYT A;  5ELG A;  2P5R A;  4MP4 A;  10GS A;  3U5R E;  2GZZ A;  2FWF A;  4L0W A;  3F63 A;  4ZB8 A;  4YQU A;  5J9C A;  1B48 A;  2IFQ B;  1FAA A;  1YDK A;  5JCG A;  3UJ1 A;  5D73 A;  2UZ8 A;  2H0H A;  2WDU A;  4POB A;  4FH8 A;  3FZ9 A;  1ZYN A;  1ERU A;  1B8X A;  2C0E A;  2VLT A;  4POK A;  4O5R A;  4RUV A;  3FY7 A;  2NPB A;  2IL3 A;  4LA1 A;  2GT5 A;  5HFK A;  1PN9 A;  2D2Z A;  3F4R A;  2FD3 A;  5DAL A;  1K3O A;  4HZ2 A;  1XWK A;  4XS4 B;  1RK4 A;  2OE0 A;  2DMM A;  4N30 A;  4IS0 A;  2PUK C;  3GHA A;  5D96 A;  2XBQ A;  2N5B A;  5IPH A;  1TRV A;  1AQX A;  3MNG A;  3I6A A;  1R4W A;  2FLS A;  2HQT A;  3GMF A;  4JBB A;  3GRX A;  1O6J A;  2LJK A;  4ZXG A;  3DRN A;  3GKX A;  4DEJ A;  3HY2 A;  1JFU A;  2EIR A;  5HR1 A;  5ECP B;  4DVC A;  2IIY A;  2VUP A;  3P2A A;  1KBN A;  3A2W A;  3D4T A;  4HJM A;  2FHE A;  4O7H A;  2HSM B;  2XPD A;  1QQ2 A;  3APQ A;  1M9A A;  2C0F A;  3ERG A;  5F0G A;  3ZTL A;  2OE1 A;  4RQX A;  3KJY A;  3GKM A;  5IMV A;  4J56 E;  4G10 A;  2OKA A;  5A4U A;  5GAP D;  4QMK A;  5F8B A;  1XWB A;  3ZIV A;  4Q5F A;  2R3X A;  4WET A;  4FIW A;  3GFK A;  2H70 A;  3GX8 A;  1CQH A;  2R0G A;  1TW9 A;  1TRW A;  3GL3 A;  4RI7 A;  4N3Z A;  4BVY B;  1JZO A;  4ZL7 A;  2RLI A;  3EVI A;  4YAV A;  2E2M A;  2LRC A;  4BA7 A;  2HRA A;  2LJR A;  1N8J A;  5DQY A;  2H1L A;  3O76 A;  4J2F A;  4AGS A;  2ZNM A;  1DE1 A;  1YKC A;  4ZIJ A;  1GUL A;  3LSZ A;  2PWJ A;  4O5U A;  4EUY A;  1N2A A;  1A0R P;  5D9X A;  3C1R A;  2L6D A;  2H73 A;  4IQ1 A;  5IM9 A;  1ON4 A;  4TR0 A;  3H4K A;  5C04 A;  2H6Z A;  4D73 B;  1S3A A;  4ZBB A;  2HSM A;  2MBS A;  2YWI A;  2LNT A;  4KDU A;  2LJA A;  2I4A A;  3BCI A;  1HD2 A;  1PD2 1;  2VOC A;  3CBU A;  1QGV A;  1XBS A;  3GYK A;  2K18 A;  3HA9 A;  4BVX A;  2LQQ A;  2A2R A;  2P31 A;  1NHY A;  4WBJ A;  4KCE A;  1SL2 B;  1VF4 A;  5A4V A;  2VCT A;  5J47 A;  4TR3 A;  3DML A;  3FZA A;  4ICY A;  2O89 A;  2EIQ A;  2GSR A;  2DIZ A;  1YF0 A;  5HFG A;  1GSQ A;  3E9J B;  2J23 A;  1XOA A;  3HZ8 A;  4WF5 A;  3QCP A;  3GIX A;  3D6I A;  3UAR A;  3ME7 A;  2IJY A;  1EP8 A;  1GSS A;  1TDI A;  3HVV A;  3DXB A;  2CX4 A;  1F3B A;  1O7U A;  4PNF A;  5CNW A;  1QXH A;  2VCZ A;  4GSS A;  2CQ9 A;  2R0C A;  20GS A;  4LLR A;  1DUG A;  5DCH A;  4JU5 A;  1H4O A;  2KOK A;  2YWN A;  3ZL5 A;  2WJU A;  1AW9 A;  5IMD A;  1X9M B;  1WRY A;  4PQ1 A;  5CYY A;  3FHK A;  1G6W A;  2MMN A;  1WWJ A;  3HKR A;  1ZYP A;  4HS1 A;  4AI6 A;  3AY8 A;  1ZOF A;  3IAS 2;  1TTZ A;  4TRX A;  4NPB A;  4IP6 A;  1S3C A;  4NWY A;  1XPV A;  4PXO A;  2R6K A;  2VKZ G;  2P0G A;  2H30 A;  2CVD A;  1XVW A;  2HI7 A;  2XC2 A;  4K9Z A;  2GZY A;  1G7O A;  4H86 A;  4ECB A;  3S9F A;  1XVQ A;  1BYE A;  3QFB C;  3KGK A;  5A5K A;  3VWW A;  4W66 A;  4ID0 A;  3UBL A;  1ABA A;  4OO4 A;  1XCC A;  2PMT A;  2HT9 A;  2X8H A;  3UOM A;  4I97 A;  2HRN A;  2NDO A;  2VL2 A;  1TU7 A;  3ZFB A;  1XW5 A;  1SVO A;  2H71 A;  6GSX A;  1WPI A;  5BMU B;  2IN3 A;  1TKD B;  1EV4 A;  3TJB A;  5J3R A;  2JZR A;  5IO2 A;  1X0R A;  3G7J A;  3MSZ A;  5BRT A;  4OCF A;  1QK8 A;  2B5X A;  3E0U A;  5IQY A;  5AGY A;  2H0I A;  3ZLP A;  3VWV A;  2JSY A;  2H76 A;  4WF4 A;  1JHB A;  4N10 A;  3ERW A;  4TXO B;  3L9V A;  1V2A A;  3CSJ A;  2QA2 A;  2YCD A;  3H79 A;  1EEM A;  4MJB A;  4WR4 A;  1LBK A;  1Z6M A;  4EIP A;  2ON5 A;  3TGZ A;  3HMJ G;  1JLV A;  5ECO B;  4L0U A;  3ZML A;  22GS A;  4HUA A;  4XS6 A;  5EPF A;  3TRP A;  5J4U A;  5GST A;  1MD4 A;  1AUC A;  3LEF A;  6GSW A;  4AKH A;  3W8J A;  1K3Y A;  4MAB A;  1AIU A;  1PKZ A;  2GT6 A;  4XCS A;  1EOH A;  2ALB A;  5ECI B;  1SVL A;  4ZL9 A;  4OCE A;  3F6F A;  4X1U A;  4EC0 A;  5B6N A;  2LUS A;  4EVM A;  4HU7 A;  2LEG A;  4E8E A;  1BQ7 A;  4KAE A;  1M2B A;  4AKX B;  4IVF A;  3C73 A;  3EMX A;  2C1Y A;  3HJM A;  3GX0 A;  1MDJ A;  2O5V A;  1O8X A;  4K2X A;  5IMF A;  3UVH A;  4MZC A;  1AC1 A;  1C72 A;  2R4V A;  5J41 A;  3I43 A;  5H5R A;  5LD0 A;  4TXO A;  4O92 A;  1QMV A;  2VLV A;  1A23 A;  1XIY A;  3KD0 A;  1DE2 A;  4KW6 A;  2PU9 C;  5ECK B;  2JSZ A;  3F4S A;  2HFD A;  2JZS A;  3U6V A;  1K0C A;  1V98 A;  4NAX A;  4I2U A;  4OFN A;  1XWG A;  4N0V A;  4Q5R A;  3HD5 A;  4OWY A;  4KF9 A;  1M7T A;  5D9W A;  3MYD A;  5HR2 A;  2V41 A;  3LXT A;  1MTC A;  2C3N A;  4AKI A;  4Z2R A;  1FOV A;  2PBJ A;  5KEJ A;  4TVE A;  4V1A g;  2X64 A;  1PGT A;  3TOU A;  2NTO A;  2VM2 A;  2OT3 A;  4HOJ A;  1CQG A;  5CRH A;  5DCG A;  1U88 A;  2WGR A;  1GSY A;  3N9J A;  4TKY A;  2O8V B;  2LNS A;  4LMV A;  5DAL B;  3HHV A;  1DSB A;  1GSD A;  2B7K A;  4ACS A;  5CO3 A;  3EUR A;  4A5P A;  3I69 A;  3VPT A;  2RUE A;  4POL A;  3DKS A;  2VL3 A;  2HNL A;  2HXK A;  3ZMK A;  3CYN A;  8GSS A;  4K7N A;  1SYR A;  5AIV A;  1A0F A;  7GSS A;  2KHP A;  2C8U A;  4BWS A;  2OA7 A;  3QPM A;  5B6M A;  2IWT A;  3VI5 A;  1A2M A;  4LMW A;  3LGC A;  2C80 A;  4Q5Q A;  4IHU A;  3DD3 A;  4MJA A;  1YF1 A;  5DJL A;  3BCK A;  4TXV A;  1OC3 A;  13GS A;  4ULX A;  2QC7 A;  3CSH A;  4IP1 A;  4V2M A;  6GSV A;  5COH A;  1A24 A;  2K6V A;  1ZL9 A;  3KMO A;  1V58 A;  2OE3 A;  3CRU A;  2O85 A;  2V6O A;  1IYI A;  4KUN A;  4X43 A;  4V2L A;  2KP2 A;  4QL7 A;  4JR6 A;  4ZL8 A;  2HSH A;  1EV9 A;  2CAQ A;  3KXO A;  4N0Z A;  1GTI A;  2TRC P;  3FR9 A;  2IMI A;  2CA8 A;  2A4V A;  3DIE A;  2L5O A;  2PVQ A;  1SJI A;  1HNC A;  1TI3 A;  1GNE A;  2BTO T;  2KP1 A;  3TB2 A;  4F03 A;  4K1F A;  2AUV A;  2WFC A;  4YKF A;  4ILF A;  1JZW A;  2G0F A;  2ZUP A;  2K9F A;  3J7Y k;  5DJM A;  4KX4 A;  2RII A;  3ZIT A;  3HYP A;  1F37 A;  2PVO C;  1PN0 A;  3WGX A;  1HNA A;  3VPQ A;  1YQ1 A;  4ECC A;  1OC9 A;  4QQ7 A;  1B9Y C;  3LWA A;  4HI7 A;  1A2J A;  4FYB A;  4F82 A;  2MYG A;  2FCH A;  4HU9 A;  4CY8 A;  2B3S A;  5EVO A;  5KOW A;  2O87 A;  3GV1 A;  3VLN A;  5JCW A;  1EWX A;  1EOG A;  4K7O A;  3WT2 A;  1WJK A;  2ES7 A;  3FEU A;  5GSS A;  2YN1 A;  1ZGN A;  1T4Y A;  2F51 A;  2L6C A;  3FR3 A;  1X9S B;  3KH9 A;  4BVX B;  1EGR A;  1USB A;  1ZCP A;  3DVW A;  2MMZ A;  3IK7 A;  1H75 A;  3ZYW A;  1T00 A;  3OR5 A;  4BPY A;  2HRK B;  4CY6 A;  3TJG A;  4MF6 A;  2CT6 A;  1YZX A;  1FG4 A;  2GGT A;  3UMA A;  3GUS A;  1FVJ A;  4EE0 A;  2EFD A;  3GH9 A;  3UEM A;  2LRN A;  4WXT A;  3G7I A;  5JWO B;  3C8E A;  4G01 A;  4IEL A;  4WEY A;  3IE3 A;  3HXS A;  4F9Z A;  1A8L A;  3D0Z A;  1K0B A;  1KNG A;  1UC7 A;  1Z7R A;  2IME A;  3BOA A;  2CAI A;  1GSE A;  1AAZ A;  2QSI A;  3G7Y A;  3CTF A;  2L59 A;  3CSI A;  5GZZ B;  3ZRD A;  5JWR B;  2GDR A;  2DBC A;  1PL1 A;  4BL7 A;  3F3Q A;  2DC5 A;  4K5S A;  4NV5 A;  1VGL A;  5G1L A;  4OFM A;  2HRF A;  3ISO A;  3NOF A;  4KDY A;  1Y6E A;  3RAZ A;  2C4J A;  3MDK A;  4EIQ A;  1XZO A;  5IMZ A;  2VCV A;  3D22 A;  2YJ7 A;  2V32 A;  1GSF A;  1FW1 A;  5KN3 A;  2LST A;  2IMD A;  5D93 A;  4MCU A;  3GKK A;  1MDI A;  2X49 A;  3HDC A;  1K0M A;  3H1N A;  1ILO A;  4GWR A;  2HRK A;  2FWH A;  2HZE A;  4I5Q A;  6GST A;  3M9J A;  3TKS E;  3DGQ A;  1FB6 A;  2WRT A;  2IMF A;  5DQS A;  1VF3 A;  3PIN A;  2RM6 A;  3IAM 2;  2H6Y A;  3L9U A;  3WGE A;  3KZQ A;  1SKS B;  4GTU A;  2OBI A;  2DJ2 A;  4XRD A;  4G19 A;  3BD2 A;  1N25 A;  1FVK A;  2LKU A;  3UAP A;  5CP1 A;  3UL3 A;  1YKA A;  1F2E A;  3D5J A;  3UBK A;  1GLP A;  3L4N A;  3LOR A;  2B7J A;  1WOU A;  4FO5 A;  4MZB A;  5D8I A;  1GNW A;  4PUF C;  1HYU A;  2N5F A;  3W6G A;  5ECN B;  1ZYE A;  1TOF A;  1M0U A;  3FRC A;  4Z2T A;  1M9B A;  4L5O A;  3EMP A;  3F9U A;  3G9B A;  2L57 A;  2H01 A;  1OKT A;  2JAD A;  1THX A;  4GSN A;  4GRF A;  3M1G A;  3HCZ A;  1JLW A;  4L8E A;  4PUR A;  3LXZ A;  3LFL A;  1R7H A;  1GRX A;  4KCA A;  1F9M A;  4RI6 A;  1J9B A;  5KN1 A;  5A1N A;  3TRQ A;  5F07 A;  1OYJ A;  2FA4 A;  4MJE A;  3KTL A;  2VLU A;  3TCO A;  2H66 A;  5C00 A;  4DSS B;  1YEP A;  5DVB A;  3RPP A;  2MMA A;  3IPZ A;  1B4Q A;  1NM3 A;  5ECQ B;  4PQI A;  3GTU B;  1T3B A;  5G1K A;  2JAC A;  3QAG A;  4K6X A;  2KLX A;  3TKS A;  5IMA A;  1GTA A;  3KEB A;  1O81 A;  1GP1 A;  4WKW A;  2VD1 A;  1RQM A;  2NBS A;  4GCI A;  2F9S A;  2AAW A;  5CRE A;  4USS A;  4LL4 B;  1Q4J A;  3ZVJ D;  5HR3 A;  3VWU A;  2DML A;  2P5Q A;  4MF7 A;  1Z9H A;  2FGX A;  2R37 A;  3ZZX A;  1M99 A;  5J40 A;  2YOI A;  3FYG A;  1PKW A;  4KE3 A;  1W4V A;  2QGV A;  3R3E A;  4K8M A;  5DDL A;  2GQL A;  2GLR A;  4PTS A;  3HVS A;  2E7P A;  1SL1 B;  4MDC A;  2H74 A;  2H6X A;  1EGO A;  2H1G A;  5KN0 A;  4HQZ A;  1U3A A;  3IK9 A;  2GST A;  3QFA C;  4DSS A;  2HLS A;  4TW5 A;  1SJZ A;  3GTU A;  1TXU A;  4AJ6 A;  3C7M A;  5G31 A;  1B9X C;  3UIW A;  5KOX A;  2V1M A;  3KMN A;  1ERW A;  4KSM A;  1IYH A;  2GSS A;  4NHW A;  2BMX A;  2B1K A;  3NIV A;  5GAN D;  5FWG A;  1BAY A;  4J57 E;  3A2X A;  2I9H A;  2OBK A;  2GS3 A;  4HEA 2;  1I9D A;  3M9K A;  1XWA A;  4ZB7 A;  2I81 A;  2F8A A;  4JED A;  3A2V A;  3QD9 A;  5AIS A;  4JRR A;  1XWC A;  1J08 A;  1MDK A;  2L4Q A;  3EIN A;  1FOH A;  4BWQ A;  3PH9 A;  3LW9 A;  2ON7 A;  2HSN A;  2R2J A;  2FNO A;  1PQN A;  9GSS A;  5DBQ A;  4RQR A;  1GSU A;  3TJF A;  2FWG A;  1K0A A;  4CW9 A;  3GKN A;  4AF2 A;  5J5N A;  1BJX A;  4MF5 A;  1URM A;  3EU3 A;  2VL2 C;  3TDG A;  1WP0 A;  4ZB6 A;  1U6T A;  1SK2 A;  1WIK A;  1EEJ A;  1EP7 A;  1R26 A;  5G2Z A;  4FQU A;  6GSY A;  3KIJ A;  1GTB A;  2TIR A;  3D4M A;  4ECI A;  4OMV A;  2AJQ B;  1G6Y A;  5ID2 A;  3NZN A;  2H75 A;  2AV4 A;  1SK0 A;  4CHS A;  5A34 B;  1VF2 A;  11GS A;  2FY6 A;  5HQP A;  2EFH A;  4EDY A;  4OO5 A;  4DSR A;  3KM6 A;  2EFC A;  4KDX A;  1UVZ A;  1JZD A;  1WE0 A;  1Z3E A;  2JZT A;  5HFI A;  1TRS A;  3WGD A;  1TU8 A;  4E8H A;  1XFL A;  2Z9S A;  1PSQ A;  2H1D A;  5A5H B;  3TOT A;  3RPN A;  5CAX A;  2LRT A;  1PA3 A;  2DJ1 A;  2A2S A;  2WZ9 A;  4JE1 A;  5J4V A;  2IMK A;  3CTG A;  2MZC A;  16GS A;  2FWE A;  4V1A p;  2GQM A;  4PUA A;  1Y1U A;  1R5P A;  4EL1 A;  3VUR A;  2BJX A;  1K0N A;  3I9V 2;  4O32 A;  5KN2 A;  1E2Y A;  1OC9 B;  3QOU A;  1E6B A;  2RM5 A;  6GSU A;  2E0Q A;  5ABR A;  1SKR B;  1K0D A;  3IBH A;  1ZZY A;  1THO A;  3IHG A;  1ZYQ B;  4YAP A;  5IOX A;  1A2L A;  4IQA A;  4AJ8 A;  1AXD A;  5B7C A;  4MLY A;  2V6K A;  1AQW A;  2CZ3 A;  2JL4 A;  1T4Z A;  5EY6 A;  4MNN A;  2K8S A;  4ZBD A;  4IN0 A;  5A34 A;  5F05 A;  2M80 A;  5JWQ B;  3APO A;  5IO0 A;  2LTK A;  3TKP A;  3QMX A;  3MAK A;  1PRX A;  1T8E B;  1GUH A;  5INY A;  3VWX A;  2GTU A;  1SJ6 A;  3TU3 B;  4DSQ A;  5E59 A;  3IC8 A;  3MWH A;  2YNX A;  3N5O A;  2YJH A;  2CV4 A;  4NV2 A;  2FA8 A;  2B6M A;  1TK0 B;  5A5H A;  2X4A A;  5CRD A;  4IJ3 A;  2DJJ A;  2I3Y A;  2PER A;  3PR8 A;  1V9W A;  2O7K A;  3HVX A;  1TRU A;  3RHB A;  1Y25 A;  3TUE A;  2GSQ A;  2YAN A;  2WS2 A;  2PN8 A;  3CWG A;  1UA5 A;  5B8A A;  2X99 A;  4PX1 A;  4NXI A;  3GNJ A;  2J9H A;  3F0I A;  4FYU A;  1A8Y A;  4BL7 B;  4XTS A;  4F0B A;  2VCW A;  4KGI A;  3UVT A;  5IMC A;  1DBY A;  3Q74 A;  1SK1 A;  3IXR A;  3VFI A;  3F4T A;  3EWL A;  5D9T A;  1K3L A;  3F6D A;  3LYK A;  3J7Y b;  5G5F A;  1G0T A;  2GZP A;  1MD3 A;  2NVL A;  3K8N A;  3A5I A;  3BJ5 A;  2F3M A;  2H8L A;  3C1S A;  1KEB A;  5E4W A;  4CDO A;  2IFQ A;  2HZE B;  1OKD A;  1TJD A;  4ECJ A;  5ECL B;  1X5D A;  3PGT A;  1QUW A;  1YEX A;  3DVX A;  2HYX A;  2R0P A;  1TK8 B;  4G0K A;  3TKR A;  4ZIL A;  1GH2 A;  4JR4 A;  4YQV A;  3IV4 A;  2C0D A;  2WUL A;  3GN3 A;  4XS4 A;  1FHE A;  2JU5 A;  2VCX A;  3FZ5 A;  3M0F A;  3RHC A;  4XS1 A;  2H1B A;  2MBT A;  4X4J A;  4MMM A;  1V40 A;  2OAC A;  4TR1 B;  1GUK A;  1Q98 A;  4F2I A;  4QL9 A;  4MK3 A;  3IHQ A;  5AN1 A;  3RDW A;  2EFE A;  2B5E A;  3BBY A;  4HQS A;  3FK8 A;  3V1W A;  4KSO A;  1LJR A;  1QFN A;  5ECM B;  6GSS A;  5F06 A;  1ACV A;  4WBR D;  1GLQ A;  1T1V A;  2C3T A;  3QAV A;  1SD8 A;  1M2D A;  1OAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...