4TOPA

Glycine max glutathione transferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
218
structure length
218
Chain Sequence
SDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYEFIMDLRKKLGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,4-D inducible glutathione S-transferase
publication title Crystal structure of Glycine max glutathione transferase in complex with glutathione: investigation of the mechanism operating by the Tau class glutathione transferases.
pubmed doi rcsb
source organism Glycine max
molecule tags Transferase
total genus 82
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4topA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4topA01
4I8BA 1R5AA 2C0EA 2HRNA 4JBBA 3NZNA 4MJEA 4TR1B 3KD0A 3HXSA 4PNFA 3TB2A 4NWYA 4X1UA 4XIHA 1AAZA 3CSIA 2HE3A 3C71A 2H1GA 2WGRA 5DBQA 3LFLA 1X5DA 1B4PA 4O92A 1JZRA 2GT6A 3DXBA 5G2ZA 1PL1A 2VL2C 2M80A 3H8QA 1SENA 2YV9A 5BMUA 4AF2A 5AISA 1MD3A 4LL4B 3HJOA 2H0IA 3IAS2 1U3AA 4K2DA 3GH9A 4HEA2 4K8MA 1ZGNA 3BCKA 2OKAA 1J08A 1O7UA 2A2SA 3DRNA 2ON7A 4NV2A 5J3RA 2HT9A 1AW9A 5FHIA 1MDKA 1MDJA 1GNEA 3D5JA 3IHQA 2K8SA 4GTUA 1MTCA 5FWGA 1EGRA 4GSTA 2VCQA 4N10A 1Z9HA 2DJ3A 2H75A 3CBUA 5D9WA 2MZCA 4XHMA 14GSA 1T1VA 11GSA 5E4WA 1A24A 4I97A 4MJCA 3VI5A 1K3LA 3UBLA 3A2XA 1B9XC 2WCIA 1G7OA 1X9WB 3QMXA 3FR6A 4BVYB 1ZOFA 4NMUA 5A4VA 1X9MB 1GWCA 3HVXA 5ECRB 12GSA 2LRCA 2V6KA 2AJQB 1RK4A 1GTIA 5LD0A 5KN3A 4KSOA 2GLRA 2E0QA 5ID2B 3D22A 4EO3A 2FD3A 2OE3A 5B6NA 1R26A 1K0NA 1ML6A 4BWQA 2H71A 1XWCA 1JHBA 1MDIA 2PVOC 1ST9A 3L9UA 1WP0A 1ZYQB 5B7CA 4IS0A 5JCWA 4WF5A 1KEBA 1YQ1A 1J9BA 1EEJA 1OC9A 4BVXA 1LBKA 2VO4A 3IXRA 1Z7PA 2O8VB 2WJUA 4MLYA 2DBCA 1VF2A 3I6AA 2K18A 2HQTA 1QUWA 2X99A 4Z7XA 1K0CA 1G6WA 2LV3A 4Q5FA 1E2YA 5C04A 4ACSA 4MP4A 1TRUA 1WWJA 5J41A 4LL1B 1M0UA 4ZB9A 4ULXA 5IMVA 3TJJA 2QKEA 1I5GA 4K6XA 3DVXA 3QD9A 2MMNA 3S9FA 3HVSA 3GTUA 4HZ4A 3ME8A 4ZILA 3TKSA 4ZBBA 4E8HA 2IMIA 1B48A 1EZKA 2K6VA 1SU9A 3TKSE 5IMDA 4JR4A 2C3QA 2DJ2A 4FYBA 3FZ9A 1K0BA 2AAWA 2H70A 3TKQA 4NAXA 1A0FA 4GF0A 2R2JA 3VPQA 2VLUA 2HSMB 5ELGA 2LRTA 1S3DA 3ZMKA 3FZ5A 2C80A 3AY8A 1BX9A 3VI7A 5HR3A 4KA0A 2VIMA 3WT2A 2YANA 2UZ8A 1J0FA 5L71A 3P2AA 4TR4A 2DSAA 1G6YA 1TU8A 2H8LA 3GYKA 1BYEA 3TKPA 4XS6A 5ABRA 3F8UA 4KCEA 1SD9A 3CXGA 2LS5A 1ZZYA 20GSA 3VWWA 4JRRA 3ZVJA 3KP9A 2CVKA 1VGLA 1GL8A 3RHCA 4PX1A 2H6XA 1U88A 1TDIA 1VRSD 1SL1B 3F63A 2H01A 6GSVA 2NTOA 4G0LA 2GGTA 1K0OA 4HU7A 1ACVA 3HA9A 2REMA 1XOAA 1GP1A 5INYA 5GAPD 2R6KA 2MYGA 2A4VA 5HFGA 2NDOA 3EMPA 5KEJA 2B6MA 5J9CA 2RUFA 1OVNA 2GZPA 3O6TA 2R5GA 3KEBA 3KXOA 2YWMA 3NOFA 2IFQA 1TI1A 2GTUA 1YY7A 1PX7A 3GKMA 2O89A 2WULA 1F2EA 3I9V2 3IBHA 4L5LA 6GSUA 3TDGA 1OE7A 2PWJA 3ZREA 5DDLA 1O8XA 3ZFLA 2P0GA 2PPTA 1K0DA 1FO5A 1THXA 2B7JA 3P7XA 4XRDA 2P5QA 3TRQA 4D73A 3F3QA 5DJMA 1PN9A 5G5EA 4EDYA 2VCTA 4WETA 3DEXA 2L57A 5ECPB 1OKTA 5IQYA 4ZL8A 1SJIA 4DEJA 1NHYA 3ZRDA 1WRYA 2C0FA 4O7HA 3LSZA 2VCVA 4L8EA 3EVIA 1W4VA 1M2DA 4FYUA 4CDOA 1VF1A 2YN1A 3R2QA 1M2AA 3VLNA 1Z5YE 2OBKA 5G30A 1GUKA 5CAXA 4OMVA 5KN1A 2ZCTA 3H4KA 3G7YA 2H0GA 4GXZA 1TK0B 1XWBA 1SYRA 3A2WA 2HFDA 2K9FA 4YAPA 3GMFA 5F0GA 4YQVA 4ZBDA 1SK0A 4BVXB 3IK9A 4DSRA 3LXTA 1Z6MA 1TRSA 2LJRA 4K7IA 2X8GA 2JSZA 3PINA 4ID0A 2WDUA 1R4WA 1TU7A 2PVQA 1EP8A 4PURA 5ECMB 5D9XA 3HVVA 4OD7A 2FCHA 2VL9A 2YPMA 3MWHA 1UVZA 2LQQA 1QFNA 3WD6A 4ECIA 3BOAA 4QQ7A 2KP1A 4N30A 3GNJA 2ZUPA 1Z6NA 3ED3A 2LJAA 2B5EA 1JZWA 2CVDA 2H6ZA 5JWQB 2HZEA 2VCXA 5CNWA 3IA1A 3WGXA 3J7Yb 4Q5QA 5H5QA 4V2MA 4XS1A 3G7JA 2WB9A 4XCSA 2PBJA 3GTUB 1GTAA 2DIZA 4ZXGA 5ID2A 2LNTA 3KP8A 1TKDB 4EKZA 3PGTA 4PNGA 3M9KA 2IWTA 4KSMA 5ECHB 3LORA 3DWVA 1N2AA 2AV4A 2KHPA 1O81A 4EF0A 1FAAA 2HYXA 3HCZA 5AIVA 3GV1A 1YJ6A 4F0CA 1GSDA 2YZUA 4K0NA 2HRAA 2HZFA 1SL0B 1DE1A 4G0IA 5CP1A 2CZ3A 3DD3A 5DCHA 5B6MA 3IC8A 3MNGA 3KMOA 5DALA 4XS4A 3ZIVA 3D21A 4JEDA 2IL3A 2O7KA 2XC2A 3TOUA 2IMEA 3I43A 10GSA 5G5FA 5DJLA 4Q5RA 2MBSA 3VURA 3RPNA 4WBRD 1AQXA 2DMLA 2E2MA 2M72A 2OACA 4WXTA 1PRXA 1ABAA 4TXVA 2ALBA 1JLVA 2DMMA 1T7PB 2F3MA 2R4VA 5G1LA 3H79A 4WR4A 2NVLA 5ENUA 4K9ZA 3IPZA 4TVEA 1GLPA 2B1LA 4JU5A 3M1GA 1OC3A 1R5PA 1JZOA 2RLIA 5IMAA 3EYTA 2I3YA 3P8WA 1ZMAA 3GKKA 1UA5A 4YH2A 3DIEA 4F82A 3C73A 1JFUA 4D73B 4HJ2A 5DVBA 4ML6A 2OADA 1XOBA 1BEDA 4KB3A 4ECCA 3LWAA 1EEMA 5FT3A 3IK7A 3GHAA 4EXJA 3VFIA 1PKZA 2HNLA 2VD1A 2J23A 1V57A 3RDWA 2YOIA 1H75A 2I81A 3KJYA 5CRWA 4QL7A 2KOKA 2KLXA 3TKRA 5AN1A 1HNBA 1A2JA 4ML1A 4WEYA 2L6DA 2DLXA 2B7KA 1V40A 2G0FA 4OCFA 1BG5A 1SD8A 3LXZA 2DJ1A 5IPHA 3VK9A 4PUFC 3F4SA 3W8SA 3L9SA 4ISDA 5F8BA 5C00A 2L59A 2FY6A 4K7NA 1IYIA 1W89A 1ON4A 3E9JB 2GQKA 2VAFA 1AQWA 1ERWA 2N5FA 3KM6A 2H0HA 3C8EA 2YCDA 1M99A 1QQ2A 3FRCA 3A5WA 4MJAA 2EIRA 3DMLA 1TI3A 4KDXA 2HZEB 1H4OA 5EY6A 2ES7A 2BMXA 2CX3A 6GSWA 1SKWB 1PL2A 1TW9A 1UC7A 5J4UA 4POLA 1NHOA 1JLWA 1WE0A 2BTOT 3PPUA 2VD0A 1PSQA 4EDZA 1HNAA 2EIQA 2F9SA 3ZYWA 3VWXA 2C1YA 4IP6A 2IMKA 1XWAA 1KBNA 2CVBA 4ECJA 3TKSC 4AJ8A 2FWHA 1C72A 4PUAA 4NPBA 5IOXA 2YV7A 3GRXA 5HR2A 4MK3A 1HYUA 1DE2A 1XVWA 2DIYA 3KH9A 1TK8B 2HSYA 2L5LA 1N8JA 3TCOA 3KIJA 1GUMA 1YEXA 1GSYA 5IO0A 4MZCA 2GZZA 2YWOA 5EVOA 4RUVA 3ZL5A 5DALB 2IMDA 4XS4B 4USSA 3W8JA 5CO3A 6GSSA 5CRGA 3UAPA 1OYJA 5GAND 1RW1A 2EC4A 2IMFA 4HOJA 2Z9SA 3WT1A 1GTBA 5AGYA 16GSA 5IPGA 5JWRB 4P3YB 2QGVA 5F07A 1FVKA 3FR3A 3WYWA 3C1SA 2HLSA 4RI7A 5G1KA 3FZ4A 4MDCA 4GSNA 3GX0A 4IQAA 5IMCA 1XWKA 2PERA 2FWFA 5ECOB 1SJ6A 1PMTA 1AXDA 1A8YA 5GSTA 4EC0A 1X5EA 17GSA 5CREA 4KX4A 4KAEA 3QR6A 1Q98A 1A2MA 2B5XA 5ECSA 3CMIA 3K8NA 3HDCA 4I6XA 5HFIA 2LJKA 1EWXA 1AC1A 2JACA 5J5NA 3ZTLA 2CZ2A 3O3TA 2L4CA 3D4MA 1YF0A 2LTKA 3PH9A 1QXHA 2YJ7A 2L5OA 1XZOA 4L0WA 1KNGA 3UL3A 1TTZA 1ZCPA 3RAZA 4K7OA 4V2LA 3P90A 5B8BA 3HHVA 3GA4A 1PX6A 4LMWA 6GSXA 4WBJA 2H1AA 2AUVA 2FHEA 1KTEA 3Q74A 4JZQA 4AJ6A 4TXOB 4TOPA 1NM3A 5DCGA 3RHBA 2VOCA 4DSSB 1PGTA 1S3AA 2ON5A 4XRAA 1TOFA 2L6CA 3HD5A 3SWLA 2FUG2 1ERTA 3WGEA 2I4AA 4DVCA 1BJXA 2VM2A 2GQMA 3U6VA 5DQSA 2IIYA 3BJ5A 1FOVA 2OBIA 5KN0A 2VLVA 1VF3A 2C8UA 2YJHA 2AHEA 4MCUA 3E0UA 1OKDA 4PGTA 3A3TA 1TXXA 1GSEA 3MAKA 4AJ7A 4J57E 2C0DA 3D0ZA 2KP2A 4YQUA 3A2VA 3IV4A 1IYHA 2XBQA 2BJXA 1YDKA 1F3BA 3QAGA 2LSTA 2O87A 3CRTA 1GUHA 2K8VA 3HYPA 3M0FA 2YZHA 4F0BA 4GCIA 2XPEA 4IP1A 2FWEA 2WZ9A 4KH7A 1F3AA 3ZZXA 4PQHA 2RM6A 1EV4A 1A8LA 1EOHA 2F51A 1K0AA 4G9HA 3GFKA 2JSYA 3HJPA 3DKSA 2MMZA 1SJZA 2PGTA 4IJIA 3L4NA 4GRFA 2V2GA 1UN2A 4K0GA 1WOUA 4IW9A 4OWYA 4WR5A 2CV4A 5D9TA 4HQSA 1X0RA 3F4TA 4V2NA 2FGXA 1ILOA 3LYPA 4HDEA 5DAKA 2GSRA 4BL7A 19GSA 2JL4A 3CSHA 4IVFA 3ZFBA 1F9MA 5GZZB 2LUSA 5H5RA 2HSNB 3LGCA 3L78A 2OE0A 3VWUA 3IAM2 1K3YA 5JCGA 4GSSA 2MMAA 1LU4A 1HD2A 2RM5A 1T4ZA 1SYXA 4XTSA 3FR9A 1B4QA 3GSSA 3KGKA 2MMOA 2QSIA 1FB6A 2F8FA 2DJKA 4BA7A 1WPIA 4ILFA 5A4WA 3EU4A 2CAQA 2HRKA 1O6JA 1OE8A 1XXUA 4HS1A 1QK8A 1X9SB 2HSHA 2VL3A 2H73A 2YWIA 3QAWA 1PQNA 4OO5A 1PA3A 4PXOA 3GX8A 2OJLA 1GULA 2IPAA 2LQOA 4L0UA 3EURA 4GQCA 2CAIA 4KDYA 4MF5A 3UARA 4NHZA 1B9YC 3EC3A 1EGOA 4LLRA 2H1BA 2FWGA 4FIWA 3C1RA 3UIWA 4FO5A 3QFBC 1XPVA 2YP6A 1MD4A 1BAYA 4KDUA 2JZRA 4IGJA 3FK8A 3VWVA 3R3EA 2JZSA 2PU9C 2AYTA 2TIRA 7GSSA 5EPFA 3ERWA 3Q19A 4NV5A 4MZBA 3QOUA 4GWRA 1YKAA 5IO2A 3F4RA 2CA8A 13GSA 4KNDA 1GSQA 3GKXA 3FY7A 4HUAA 1MEKA 1NW2A 3QFAC 2XPDA 3GURA 5LNKe 1WJKA 1F6MC 4MF6A 1X5CA 4J56E 4G0KA 4OFNA 1V98A 2HI7A 3I69A 1CQHA 3CSJA 3QAVA 3M3MA 1T8EB 3IOSA 3GSTA 2N5BA 2P5RA 4HU9A 3L0HA 3UEMA 3G7IA 3ISOA 1ZL9A 4K1FA 1GSFA 1A0RP 2H19A 3MSZA 5LCZA 5D9VA 1G0TA 1R7HA 2CT6A 4EUYA 1BQ7A 3GKNA 2GVPA 4NXIA 1OC8A 1WMJA 2PMTA 3APSA 4BWSA 1SK1A 5ECIB 4MPGA 1DSBA 2NPBA 1GLQA 3V1WA 4EVMA 4TXOA 2VCWA 4IKHA 3F0IA 5GSSA 3MDKA 4YQMA 3Q6OA 4DSSA 2FA8A 4V1Ap 4N0ZA 4IHUA 4O5RA 3O76A 3APOA 3EMXA 5IIZA 1XW9A 4X43A 2C3NA 3TOTA 5EL8A 4RQXA 2AB6A 3L9VA 1T4YA 5DAKB 4PQIA 4V1Ag 4BL7B 4ZL9A 5IM9A 2WS2A 4TN8A 3IE3A 2FLSA 3CYNA 4KF9A 4I2TA 3SBCA 5IOWA 1XBSA 1FHEA 3ZIJA 3C7MA 3TJGA 1S3CA 4ZBAA 2VL2A 2DJ0A 4HJMA 1Z3EA 4IJ3A 2GT5A 2E2GA 5HQPA 3ERGA 3UMAA 4E8EA 2R37A 1GSUA 2VCZA 4LA1A 2TRCP 2PUKC 3GH6A 5CRHA 3FYGA 1EV9A 3NIVA 4O32A 3APQA 3GL5A 1GTUA 1K3OA 1O85A 2HRKB 5ECKB 1SKRB 3F3RA 3KZQA 4MF7A 1ERVA 4N0VA 2P31A 3TRPA 3EE2A 2F8AA 4CW9A 3DYRA 1OAZA 4I2UA 2I1UA 5DQYA 3KMNA 5J9BA 1AQVA 1B8XA 1TRWA 3FHKA 4CHSA 1V9WA 6GSTA 5COHA 3CRUA 1G7EA 2H72A 1JZDA 1ZYEA 3UJ1A 1CQGA 2C4JA 1XVQA 2R3XA 1ERUA 1XW5A 1TJDA 3BCIA 3HJMA 4WKWA 4OFTA 4N11A 2NBSA 4Q5NA 4TRXA 3M8NA 1V58A 4PTSA 4IQ1A 1XFLA 3Q18A 3G9BA 5ECLB 4PQ1A 2H74A 2JZTA 2I9HA 2GSTA 2ZNMA 4DSQA 5A5KA 2IJYA 3LYKA 22GSA 4BPYA 2KUCA 4ECBA 3ZITA 4L5OA 1T00A 3CTGA 2CX4A 2QC7A 3TGZA 1GSSA 5CYYA 4OCEA 3ZVJD 1Z7RA 1URMA 1YEPA 3KTBA 3HZ8A 2V1MA 4JR6A 5D8IA 4IELA 5E59A 1XCCA 2LKUA 5AIXA 1RQMA 5H5SA 1U6TA 3DVWA 3EINA 1YZXA 2A2RA 3GL3A 2GSSA 2JADA 2X8CA 3LQ7A 3E3EA 4QL9A 3D6IA 1FW1A 4MPFA 2WRTA 3UOMA 1YF1A 2B1KA 1GRXA 1U87A 4X0XA 1GNWA 3IRAA 4ZL7A 4TW5A 5A4UA 4POMA 2FA4A 1M9AA 1K0MA 3CTFA 3D4TA 4WF4A 1SL2B 2YNXA 2B3SA 2LEGA 1AIUA 5ECNB 3UVTA 4RI6A 3N9JA 4GLTA 3FEUA 1GH2A 3QDNA 4TKYA 4ZIJA 3TRXA 5D93A 5KN2A 1XWGA 3TUEA 3H1NA 5HR0A 4LMVA 2HRFA 2LNSA 2L4QA 4F9ZA 2O85A 4OO4A 3UVHA 5D73A 5CRDA 4F03A 1SK2A 3M9JA 2WFCA 1A23A 2YWNA 2J9HA 5D96A 4FH8A 2V32A 1AUCA 3EU3A 4OFMA 2H30A 2X8HA 2XBIA 3J7Yk 2V41A 4TR3A 4TR1A 1TRVA 1I9DA 3WGDA 1SKSB 3ME7A 2IN3A 4HI7A 4J2FA 1TK5B 1O73A 2C0GA 3GIXA 3DGQA 1HNCA 2FNOA 4MJBA 1FVJA 1HQOA 1PKWA 5F06A 5HFKA 1T3BA 2N5AA 3BBYA 2H76A 1M2BA 1M7TA 1DBYA 5ELAA 1VF4A 4MA9A 5F05A 3GN3A 1Y25A 3LJRA 2EIOA 4KGIA 3UBKA 3IC4A 1FG4A 4IBPA 1Y6EA 2RUEA 1QGVA 2V6OA 4NHWA 1OC9B 4KCAA 2PN8A 1DUGA 2OA7A 4KW6A 4POBA 3TJBA 2VLTA 4MZWA 3N5OA 1TP9A 2JU5A 1WIKA 4RQRA 3U5RE 3OR5A 4HQZA 2VUPA 2OE1A 3KH7A 4FQUA 2DJJA 2LRNA 5IMZA 4G2EA 4BVYA 1EOGA 2RIIA 5G31A 9GSSA 2X64A 4G10A 3ZMLA 3LEFA 1EP7A 3BD2A 1USBA 3FKFA 2D2ZA 3ERFA 1O8WA 2GZYA 3IDVA 1XW6A 3HY2A 4KE3A 4KUNA 1XIYA 3F6DA 5HR1A 18GSA 4G19A 3FZAA 3W6GA 3QCPA 4FYCA 2MBTA 8GSSA 3IR4A 3FW2A 4YAVA 5JWOB 3GUSA 1U3IA 4TR0A 4HZ2A 3F9UA 1Q4JA 1YKCA 4EE0A 2VM1A 3HZ4A 4EL1A 4ZB8A 2XHFA 6GSYA 3TJKA 2DC5A 2B5YA 4MMMA 4I5QA 2CQ9A 1A2LA 1QMVA 3RPPA 3ZLPA 3JCML 1E6BA 1F37A 4ZB6A 2C3TA 4AGSA 2TRXA 2GS3A 4MABA 5B8AA 4POKA 4H86A 1NSWA 1FB0A 3US3A 2M46A 5ECQB 3KCMA 4MH3A 3QPMA 2GDRA 2HXKA 1THOA 1V2AA 2GQLA 3HKRA 3F6FA 2E7PA 4GQFA 3VPTA 4MH2A 3RBTA 1PD21 1M9BA 2G2QA 3H93A 5IMFA 2H66A 3KTLA 2HSMA 2IFQB 4JE1A 4F2IA 3PR8A 5JCUA 1LJRA 2H1DA 2H6YA 3LG6A 3EWLA 4IN0A 2GSQA 3TJFA
chains in the Genus database with same CATH superfamily
4I8BA 1R5AA 2C0EA 2HRNA 4JBBA 3NZNA 4MJEA 4TR1B 3KD0A 3HXSA 4PNFA 3TB2A 4NWYA 4X1UA 4XIHA 1AAZA 3CSIA 2HE3A 3C71A 2H1GA 2WGRA 5DBQA 3LFLA 1X5DA 1B4PA 4O92A 1BG1A 1JZRA 2GT6A 3DXBA 5G2ZA 1PL1A 2VL2C 2M80A 3H8QA 1SENA 2YV9A 3HVNA 5BMUA 4AF2A 5AISA 1MD3A 4LL4B 3HJOA 2H0IA 2WVXB 3IAS2 1U3AA 4K2DA 3GH9A 4HEA2 4K8MA 1ZGNA 3BCKA 2OKAA 1J08A 1O7UA 2A2SA 3DRNA 2ON7A 4NV2A 5J3RA 4Z2RA 2HT9A 1AW9A 5FHIA 1MDKA 1MDJA 1GNEA 3D5JA 3IHQA 2K8SA 4GTUA 1MTCA 5FWGA 1EGRA 4GSTA 2VCQA 4N10A 1Z9HA 2DJ3A 2H75A 3CBUA 5D9WA 2MZCA 4XHMA 14GSA 4FXYP 2O36A 1T1VA 11GSA 5E4WA 1A24A 4I97A 4AKXB 4MJCA 3VI5A 1K3LA 3UBLA 3A2XA 1B9XC 2WCIA 1G7OA 1X9WB 3QMXA 3FR6A 4BVYB 1ZOFA 4NMUA 5A4VA 1X9MB 1GWCA 3HVXA 5ECRB 12GSA 2LRCA 2V6KA 2AJQB 1RK4A 1GTIA 5LD0A 5KN3A 4KSOA 2GLRA 2E0QA 5ID2B 3D22A 4EO3A 2FD3A 2OE3A 5B6NA 1R26A 1K0NA 1ML6A 4BWQA 2H71A 1XWCA 1JHBA 1MDIA 2PVOC 1ST9A 3L9UA 1WP0A 1ZYQB 5B7CA 4IS0A 5JCWA 4WF5A 1KEBA 1YQ1A 1J9BA 1EEJA 1OC9A 4BVXA 1LBKA 2VO4A 3IXRA 2WVYA 1Z7PA 1S3RA 2O8VB 2WJUA 4MLYA 2DBCA 1VF2A 3I6AA 2K18A 2HQTA 1QUWA 2X99A 4Z7XA 4E68A 1K0CA 1G6WA 2LV3A 3HMJG 4Q5FA 1E2YA 5C04A 4ACSA 4MP4A 1TRUA 1WWJA 5J41A 4LL1B 1M0UA 4ZB9A 4ULXA 5IMVA 3TJJA 4GDFA 2QKEA 1I5GA 4K6XA 3DVXA 3QD9A 1SVOA 2MMNA 3S9FA 3HVSA 3GTUA 4HZ4A 3ME8A 4ZILA 3TKSA 4ZBBA 4E8HA 1YVLA 4W66A 2IMIA 1B48A 1EZKA 2K6VA 1SU9A 3TKSE 5IMDA 4JR4A 2C3QA 2DJ2A 4FYBA 3FZ9A 1K0BA 2AAWA 2H70A 3MYDA 3TKQA 4NAXA 1A0FA 4GF0A 2R2JA 3VPQA 2VLUA 2HSMB 5J4VA 5ELGA 2LRTA 1S3DA 3ZMKA 3FZ5A 2C80A 3AY8A 1BX9A 3VI7A 5HR3A 4KA0A 2VIMA 3WT2A 2YANA 2UZ8A 1J0FA 5L71A 3P2AA 4TR4A 2DSAA 1G6YA 1TU8A 2H8LA 3GYKA 1BYEA 3TKPA 4XS6A 5ABRA 3F8UA 4KCEA 1SD9A 3CXGA 2LS5A 1ZZYA 2R0PA 20GSA 3VWWA 4JRRA 3ZVJA 3KP9A 2EFHA 2CVKA 1VGLA 1GL8A 3RHCA 4PX1A 2H6XA 3CHXC 1U88A 1TDIA 1VRSD 1SL1B 3F63A 2H01A 6GSVA 2NTOA 5BMUB 4G0LA 2GGTA 1K0OA 1ACVA 4HU7A 3HA9A 2REMA 1XOAA 1GP1A 5INYA 5GAPD 2R6KA 2MYGA 3RGBC 2A4VA 5HFGA 2NDOA 3EMPA 5KEJA 2B6MA 5J9CA 2RUFA 1OVNA 2GZPA 3O6TA 2R5GA 3KEBA 3KXOA 2YWMA 3NOFA 2IFQA 4A5PA 1TI1A 2GTUA 1YY7A 1PX7A 3GKMA 2O89A 2WULA 1F2EA 3I9V2 3IBHA 4L5LA 6GSUA 3TDGA 1OE7A 2PWJA 3ZREA 5DDLA 1O8XA 3ZFLA 2P0GA 2PPTA 1K0DA 1FO5A 1THXA 2B7JA 3P7XA 4XRDA 2P5QA 2QA1A 3TRQA 4D73A 3F3QA 5DJMA 1YEWC 1PN9A 5G5EA 2EFCA 4EDYA 2VCTA 4WETA 3DEXA 2L57A 5ECPB 1OKTA 5IQYA 4ZL8A 4K5RA 1SJIA 4DEJA 1NHYA 3ZRDA 1WRYA 2C0FA 4O7HA 3LSZA 2VCVA 4L8EA 3EVIA 1W4VA 1M2DA 4FYUA 4CDOA 1VF1A 2YN1A 3R2QA 1M2AA 3VLNA 1Z5YE 2OBKA 5G30A 1GUKA 5CAXA 4OMVA 5KN1A 2ZCTA 3H4KA 3G7YA 2H0GA 5J40A 4GXZA 1TK0B 1XWBA 1SYRA 3A2WA 2HFDA 2K9FA 4YAPA 2A4HA 3GMFA 5F0GA 4YQVA 4ZBDA 1SK0A 4BVXB 3IK9A 4DSRA 1I1IP 3LXTA 1Z6MA 1TRSA 2LJRA 4K7IA 2X8GA 2JSZA 3PINA 4ID0A 2WDUA 1R4WA 1TU7A 2PVQA 1EP8A 3HVVA 4PURA 5D9XA 5ECMB 4OD7A 2FCHA 2VL9A 2YPMA 3MWHA 1UVZA 2LQQA 1QFNA 3WD6A 4ECIA 3BOAA 4QQ7A 2KP1A 4N30A 2WVZA 3GNJA 2ZUPA 1Z6NA 3ED3A 2LJAA 2B5EA 1JZWA 2CVDA 2H6ZA 5JWQB 4N3ZA 2HZEA 2VCXA 5CNWA 3IA1A 3WGXA 3J7Yb 4Q5QA 5H5QA 4V2MA 4XS1A 3G7JA 2WB9A 4XCSA 2PBJA 3GTUB 1GTAA 2DIZA 4ZXGA 5ID2A 2LNTA 3KP8A 1TKDB 4EKZA 3PGTA 4PNGA 3M9KA 2IWTA 4KSMA 5ECHB 3LORA 3DWVA 1N2AA 2AV4A 2KHPA 1O81A 4EF0A 1FAAA 2HYXA 3HCZA 2EFDA 5AIVA 3GV1A 1YJ6A 4F0CA 1GSDA 2YZUA 4K0NA 2HRAA 2WZSA 2HZFA 1SL0B 3IHGA 1DE1A 4G0IA 5CP1A 2CZ3A 3DD3A 5DCHA 5B6MA 3IC8A 3MNGA 3KMOA 5DALA 4XS4A 3ZIVA 3D21A 4JEDA 5A5HA 2IL3A 2O7KA 2XC2A 3TOUA 2IMEA 3I43A 10GSA 5G5FA 5DJLA 4Q5RA 2MBSA 4YKGA 3VURA 3RPNA 4WBRD 4QMKA 1AQXA 2DMLA 2E2MA 2M72A 2OACA 5J4YA 4WXTA 1PRXA 1ABAA 4TXVA 2ALBA 1JLVA 2DMMA 1T7PB 2F3MA 2R4VA 5G1LA 3H79A 4WR4A 2NVLA 5ENUA 4K9ZA 3IPZA 4TVEA 1GLPA 2B1LA 4JU5A 3M1GA 1OC3A 1R5PA 1JZOA 2RLIA 5IMAA 3EYTA 2I3YA 3P8WA 1ZMAA 3GKKA 1UA5A 4YH2A 3DIEA 4F82A 4O5UA 3C73A 1JFUA 4D73B 4HJ2A 5DVBA 4ML6A 2OADA 1XOBA 1BEDA 4KB3A 4ECCA 3LWAA 1EEMA 5FT3A 3IK7A 3GHAA 4EXJA 1ZYNA 1PKZA 3VFIA 2HNLA 2VD1A 2J23A 1V57A 3RDWA 5A1NB 2YOIA 1H75A 2I81A 3TU3B 3KJYA 5CRWA 4QL7A 2KOKA 2KLXA 3TKRA 5AN1A 1HNBA 1A2JA 2O3EA 4ML1A 4WEYA 2L6DA 2DLXA 2B7KA 1V40A 2G0FA 4OCFA 1BG5A 1SD8A 3LXZA 2DJ1A 5IPHA 3VK9A 4PUFC 3F4SA 3W8SA 3L9SA 4ISDA 5F8BA 5C00A 2L59A 2FY6A 4K7NA 1IYIA 1W89A 4Z2UA 1ON4A 4O5QA 3E9JB 2GQKA 2VAFA 1AQWA 1ERWA 2N5FA 3KM6A 2H0HA 3C8EA 2YCDA 1M99A 1QQ2A 3FRCA 3A5WA 4MJAA 2EIRA 3DMLA 1TI3A 4KDXA 2HZEB 1H4OA 5EY6A 2ES7A 2BMXA 2CX3A 6GSWA 1SKWB 1PL2A 4ZB7A 1TW9A 1UC7A 5J4UA 4POLA 1NHOA 1JLWA 1WE0A 2BTOT 3PPUA 2VD0A 1PSQA 4EDZA 1HNAA 2EIQA 2F9SA 3ZYWA 3VWXA 3RFRC 2C1YA 1TXUA 4IP6A 2IMKA 1XWAA 1KBNA 2CVBA 4ECJA 3TKSC 4AJ8A 2FWHA 1C72A 4PUAA 4NPBA 5IOXA 2YV7A 3GRXA 5HR2A 4MK3A 1HYUA 4YKFA 1DE2A 1XVWA 2DIYA 3KH9A 1TK8B 2HSYA 2L5LA 1N8JA 3TCOA 3KIJA 1GUMA 1YEXA 1GSYA 5IO0A 4MZCA 2GZZA 2YWOA 5EVOA 4RUVA 2HSNA 3ZL5A 5DALB 2IMDA 4XS4B 4USSA 5A5HB 3W8JA 5A34A 5CO3A 6GSSA 5CRGA 4BIKA 3UAPA 1OYJA 5GAND 1RW1A 2EC4A 2IMFA 4HOJA 2Z9SA 3WT1A 1GTBA 5AGYA 16GSA 5IPGA 5JWRB 4P3YB 2QGVA 5F07A 1FVKA 3FR3A 3WYWA 3C1SA 2HLSA 4RI7A 5G1KA 3FZ4A 4MDCA 4GSNA 3GX0A 4IQAA 5IMCA 1XWKA 2PERA 2FWFA 5ECOB 1SJ6A 1PMTA 1AXDA 1A8YA 5GSTA 4EC0A 1X5EA 17GSA 5CREA 4KX4A 4KAEA 3QR6A 1Q98A 1A2MA 2B5XA 5ECSA 3CMIA 3K8NA 3HDCA 4I6XA 5HFIA 2LJKA 4G01A 1EWXA 1AC1A 4PHZC 2JACA 5J5NA 3ZTLA 2CZ2A 3O3TA 2L4CA 3D4MA 1YF0A 2LTKA 3PH9A 1QXHA 2YJ7A 2L5OA 1XZOA 2QA2A 4L0WA 1KNGA 3UL3A 1TTZA 1ZCPA 3RAZA 4K7OA 4V2LA 4EIQA 3P90A 5B8BA 3HHVA 3GA4A 1PX6A 4LMWA 6GSXA 4WBJA 2H1AA 2AUVA 2FHEA 1KTEA 3Q74A 4JZQA 4AJ6A 4TXOB 4TOPA 1NM3A 5DCGA 1BF5A 3RHBA 2VOCA 4DSSB 1PGTA 1S3AA 2ON5A 4XRAA 1TOFA 2L6CA 3HD5A 3SWLA 2DKIA 2FUG2 1ERTA 3WGEA 2I4AA 4DVCA 1BJXA 2VM2A 2GQMA 3U6VA 5DQSA 2IIYA 3BJ5A 1FOVA 2OBIA 5KN0A 2VLVA 1VF3A 2C8UA 3CQFA 2YJHA 2AHEA 4MCUA 3E0UA 1OKDA 4PGTA 3A3TA 1TXXA 1GSEA 3MAKA 4AJ7A 4J57E 2C0DA 3D0ZA 5A1NA 2KP2A 4YQUA 3A2VA 3IV4A 1IYHA 2XBQA 2BJXA 1YDKA 1F3BA 3QAGA 2LSTA 2O87A 3CRTA 1GUHA 2K8VA 3HYPA 3M0FA 2YZHA 4F0BA 4GCIA 2XPEA 4IP1A 2FWEA 2WZ9A 4KH7A 1F3AA 3ZZXA 4PQHA 2RM6A 1Y1UA 1EV4A 1A8LA 1EOHA 2F51A 1K0AA 4G9HA 5J47A 3GFKA 2JSYA 3HJPA 3DKSA 2MMZA 1SJZA 2PGTA 4IJIA 3L4NA 4GRFA 2V2GA 1UN2A 4K0GA 1WOUA 4IW9A 4OWYA 4WR5A 2CV4A 5D9TA 4HQSA 1X0RA 3F4TA 4V2NA 2FGXA 1ILOA 3LYPA 4HDEA 5DAKA 2GSRA 4BL7A 19GSA 2JL4A 3CSHA 4IVFA 3ZFBA 1F9MA 5GZZB 2LUSA 5H5RA 2HSNB 3LGCA 1XG8A 3L78A 2OE0A 3VWUA 3IAM2 1K3YA 5A34B 5JCGA 1S4BP 1SVMA 4GSSA 2MMAA 3CWGA 1LU4A 4AI6A 1HD2A 2RM5A 1T4ZA 1SYXA 4XTSA 3FR9A 1B4QA 3GSSA 3KGKA 2MMOA 2QSIA 1FB6A 2F8FA 2DJKA 4BA7A 2WW2A 1WPIA 4ILFA 5A4WA 3EU4A 2CAQA 2HRKA 1O6JA 1OE8A 1XXUA 4HS1A 1QK8A 1X9SB 2HSHA 2WW1A 2VL3A 2H73A 2YWIA 2H1LA 3QAWA 1PQNA 4OO5A 1PA3A 4PXOA 3GX8A 2OJLA 1GULA 2IPAA 2LQOA 4L0UA 3EURA 4GQCA 2CAIA 4KDYA 4MF5A 3UARA 4NHZA 1B9YC 3EC3A 1EGOA 4LLRA 2H1BA 2FWGA 4ICYA 4FIWA 3C1RA 3UIWA 4FO5A 3QFBC 1XPVA 2YP6A 1MD4A 1BAYA 4KDUA 2JZRA 4IGJA 3FK8A 3VWVA 3R3EA 2JZSA 2PU9C 2AYTA 2TIRA 7GSSA 2VKZG 5EPFA 3ERWA 2UV8G 3Q19A 4NV5A 4MZBA 3QOUA 4GWRA 1YKAA 5IO2A 3F4RA 2CA8A 13GSA 4KNDA 1GSQA 3GKXA 3FY7A 4HUAA 1MEKA 1NW2A 3QFAC 2XPDA 3GURA 5LNKe 1WJKA 2X4AA 1F6MC 4MF6A 1X5CA 4J56E 4G0KA 4OFNA 1V98A 2HI7A 4K5SA 3I69A 1CQHA 3CSJA 3QAVA 2OT3A 3M3MA 1T8EB 3IOSA 3GSTA 2N5BA 2P5RA 4HU9A 3L0HA 3UEMA 3G7IA 3ISOA 4EIPA 1ZL9A 4K1FA 1GSFA 1A0RP 2H19A 3MSZA 5LCZA 1PFOA 4PI2C 5D9VA 1G0TA 1R7HA 2CT6A 4EUYA 1BQ7A 3GKNA 4HSCX 1M3JA 2GVPA 4NXIA 5KOWA 1OC8A 1WMJA 2PMTA 3APSA 4BWSA 1SK1A 5ECIB 4MPGA 1DSBA 2NPBA 1GLQA 3V1WA 2EFEA 4EVMA 4TXOA 2VCWA 4IKHA 3F0IA 5GSSA 3MDKA 4YQMA 3Q6OA 4DSSA 2FA8A 4V1Ap 4N0ZA 4IHUA 4O5RA 3O76A 3APOA 3EMXA 5IIZA 1XW9A 4X43A 2C3NA 3TOTA 5EL8A 4RQXA 2AB6A 3L9VA 1T4YA 2O5VA 5DAKB 4PQIA 4V1Ag 4BL7B 4ZL9A 5IM9A 2WS2A 4TN8A 3IE3A 2FLSA 3CYNA 4KF9A 4I2TA 2A2PA 3SBCA 5IOWA 1XBSA 1FHEA 3ZIJA 3C7MA 3TJGA 1S3CA 4ZBAA 2VL2A 2DJ0A 4HJMA 4PI0C 1Z3EA 4IJ3A 2GT5A 2E2GA 5HQPA 3ERGA 3UMAA 4E8EA 2R37A 1GSUA 2VCZA 4LA1A 2TRCP 2PUKC 3GH6A 5CRHA 3FYGA 1EV9A 3NIVA 4O32A 3APQA 3GL5A 4AKGA 1GTUA 1K3OA 1O85A 2HRKB 5ECKB 1SKRB 3F3RA 3KZQA 4MF7A 1ERVA 1FOHA 4N0VA 2P31A 3TRPA 3EE2A 2F8AA 4CW9A 3DYRA 5KOXA 1OAZA 4I2UA 2I1UA 5DQYA 3KMNA 5J9BA 1AQVA 1B8XA 3EPTA 1TRWA 3FHKA 4CHSA 1V9WA 6GSTA 5COHA 3CRUA 1G7EA 2H72A 1JZDA 1ZYEA 3UJ1A 1CQGA 2C4JA 1XVQA 2R3XA 1ERUA 3FMWA 1XW5A 1TJDA 3BCIA 3HJMA 4WKWA 4OFTA 4N11A 2NBSA 4Q5NA 4TRXA 3M8NA 1V58A 4PTSA 4IQ1A 1XFLA 3Q18A 3G9BA 5ECLB 4PQ1A 2H74A 2JZTA 2I9HA 2GSTA 1M3IA 2ZNMA 4DSQA 5A5KA 2IJYA 3LYKA 22GSA 4BPYA 2KUCA 4ECBA 3ZITA 4L5OA 1T00A 3CTGA 2CX4A 2QC7A 3TGZA 1GSSA 5CYYA 4OCEA 3ZVJD 1Z7RA 1URMA 4AKIA 1YEPA 3KTBA 3HZ8A 2V1MA 4JR6A 3MIXA 5D8IA 4IELA 5E59A 1XCCA 2LKUA 5AIXA 1RQMA 5H5SA 1U6TA 3DVWA 3EINA 1YZXA 2A2RA 3GL3A 2GSSA 2JADA 2X8CA 3LQ7A 3E3EA 4QL9A 3D6IA 1FW1A 4MPFA 2WRTA 3UOMA 1YF1A 2B1KA 1GRXA 1U87A 4X0XA 4K2XA 1GNWA 3IRAA 4ZL7A 4TW5A 5A4UA 4POMA 4X4JA 2FA4A 1M9AA 1K0MA 3CTFA 3D4TA 4WF4A 1SL2B 2YNXA 2B3SA 4Z2TA 2LEGA 1AIUA 5ECNB 3UVTA 4RI6A 3N9JA 5BRTA 4GLTA 3FEUA 1GH2A 3QDNA 4TKYA 4ZIJA 2R0GA 3TRXA 5D93A 5KN2A 1XWGA 3TUEA 3H1NA 5HR0A 4LMVA 2HRFA 2LNSA 2L4QA 4F9ZA 2O85A 4OO4A 3UVHA 5D73A 5CRDA 4F03A 4AKHA 1SK2A 3M9JA 2WFCA 1A23A 2YWNA 2J9HA 5D96A 4FH8A 2V32A 1AUCA 3EU3A 4OFMA 2X49A 2H30A 2X8HA 2XBIA 2WW0A 3J7Yk 2V41A 4TR3A 4TR1A 1TRVA 1I9DA 1N25A 3WGDA 2R0CA 1SKSB 3ME7A 2IN3A 4HI7A 4J2FA 1TK5B 1O73A 2C0GA 3GIXA 3DGQA 1HNCA 2FNOA 4MJBA 1FVJA 1HQOA 1PKWA 5F06A 5HFKA 1T3BA 2N5AA 3BBYA 2H76A 1M2BA 1M7TA 2WVXA 1DBYA 5ELAA 1VF4A 1PN0A 4MA9A 5F05A 3GN3A 1Y25A 3LJRA 2EIOA 4KGIA 3UBKA 3IC4A 1FG4A 4IBPA 1Y6EA 2RUEA 1QGVA 2V6OA 4NHWA 1OC9B 4KCAA 2PN8A 1SVLA 1DUGA 4MNNA 2OA7A 4KW6A 4POBA 3TJBA 2VLTA 4MZWA 3N5OA 1TP9A 2JU5A 1WIKA 4RQRA 3U5RE 3OR5A 4HQZA 2VUPA 2OE1A 3KH7A 4FQUA 2DJJA 2LRNA 5IMZA 4G2EA 4BVYA 1EOGA 2RIIA 5G31A 9GSSA 2X64A 4CY8A 4G10A 3ZMLA 3LEFA 1EP7A 3BD2A 1USBA 3FKFA 2D2ZA 3ERFA 1O8WA 2GZYA 3IDVA 1XW6A 3HY2A 4KE3A 4KUNA 1XIYA 3F6DA 5HR1A 18GSA 4G19A 3FZAA 3W6GA 3QCPA 4FYCA 2MBTA 8GSSA 3IR4A 3FW2A 4YAVA 5JWOB 3GUSA 1U3IA 4TR0A 4HZ2A 3F9UA 1Q4JA 1YKCA 4EE0A 2VM1A 3HZ4A 4EL1A 4ZB8A 2XHFA 6GSYA 3TJKA 2DC5A 2B5YA 4MMMA 3A5IA 4I5QA 2CQ9A 1A2LA 1QMVA 3RPPA 3ZLPA 3JCML 1E6BA 1F37A 4ZB6A 2C3TA 4AGSA 4CY6A 2TRXA 2GS3A 4MABA 5B8AA 4POKA 4H86A 1NSWA 1FB0A 3US3A 2M46A 5ECQB 3KCMA 4MH3A 3QPMA 2GDRA 2HXKA 1THOA 1V2AA 2GQLA 3HKRA 3F6FA 2E7PA 4GQFA 3VPTA 1ZYPA 2WW3A 4MH2A 3RBTA 1PD21 1M9BA 2G2QA 3H93A 5IMFA 2H66A 3KTLA 2HSMA 2IFQB 4JE1A 4F2IA 3PR8A 3LW9A 5JCUA 1LJRA 2H1DA 2H6YA 3LG6A 2DKHA 3EWLA 4IN0A 2GSQA 3TJFA
chains in the Genus database with same CATH topology
4I8BA 1R5AA 2C0EA 2HRNA 4JBBA 3NZNA 4MJEA 4TR1B 3KD0A 3HXSA 4PNFA 3TB2A 4NWYA 4X1UA 4XIHA 1AAZA 3CSIA 2HE3A 3C71A 2H1GA 2WGRA 5DBQA 3LFLA 1X5DA 1B4PA 4O92A 1BG1A 1JZRA 2GT6A 3DXBA 5G2ZA 1PL1A 2VL2C 2M80A 3H8QA 1SENA 2YV9A 5BMUA 4AF2A 5AISA 1MD3A 4LL4B 3HJOA 2H0IA 3IAS2 1U3AA 4K2DA 3GH9A 4HEA2 4K8MA 1ZGNA 3BCKA 2OKAA 1J08A 1O7UA 2A2SA 3DRNA 2ON7A 4NV2A 5J3RA 4Z2RA 2HT9A 1AW9A 5FHIA 1MDKA 1MDJA 1GNEA 3D5JA 3IHQA 2K8SA 4GTUA 1MTCA 5FWGA 1EGRA 4GSTA 2VCQA 4N10A 1Z9HA 2DJ3A 2H75A 3CBUA 5D9WA 2MZCA 4XHMA 14GSA 1T1VA 11GSA 5E4WA 1A24A 4I97A 4AKXB 4MJCA 3VI5A 1K3LA 3UBLA 3A2XA 1B9XC 2WCIA 1G7OA 1X9WB 3QMXA 3FR6A 4BVYB 1ZOFA 4NMUA 5A4VA 1X9MB 1GWCA 3HVXA 5ECRB 12GSA 2LRCA 2V6KA 2AJQB 1RK4A 1GTIA 5LD0A 5KN3A 4KSOA 2GLRA 2E0QA 5ID2B 3D22A 4EO3A 2FD3A 2OE3A 5B6NA 1R26A 1K0NA 1ML6A 4BWQA 2H71A 1XWCA 1JHBA 1MDIA 2PVOC 1ST9A 3L9UA 1WP0A 1ZYQB 5B7CA 4IS0A 5JCWA 4WF5A 1KEBA 1YQ1A 1J9BA 1EEJA 1OC9A 4BVXA 1LBKA 2VO4A 3IXRA 1Z7PA 2O8VB 2WJUA 4MLYA 2DBCA 1VF2A 3I6AA 2K18A 2HQTA 1QUWA 2X99A 4Z7XA 4E68A 1K0CA 1G6WA 2LV3A 3HMJG 4Q5FA 1E2YA 5C04A 4ACSA 4MP4A 1TRUA 1WWJA 5J41A 4LL1B 1M0UA 4ZB9A 4ULXA 5IMVA 3TJJA 4GDFA 2QKEA 1I5GA 4K6XA 3DVXA 3QD9A 1SVOA 2MMNA 3S9FA 3HVSA 3GTUA 4HZ4A 3ME8A 4ZILA 3TKSA 4ZBBA 4E8HA 1YVLA 4W66A 2IMIA 1B48A 1EZKA 2K6VA 1SU9A 3TKSE 5IMDA 4JR4A 2C3QA 2DJ2A 4FYBA 3FZ9A 1K0BA 2AAWA 2H70A 3MYDA 3TKQA 4NAXA 1A0FA 4GF0A 2R2JA 3VPQA 2VLUA 2HSMB 5J4VA 5ELGA 2LRTA 1S3DA 3ZMKA 3FZ5A 2C80A 3AY8A 1BX9A 3VI7A 5HR3A 4KA0A 2VIMA 3WT2A 2YANA 2UZ8A 1J0FA 5L71A 3P2AA 4TR4A 2DSAA 1G6YA 1TU8A 2H8LA 3GYKA 1BYEA 3TKPA 4XS6A 5ABRA 3F8UA 4KCEA 1SD9A 3CXGA 2LS5A 1ZZYA 2R0PA 20GSA 3VWWA 4JRRA 3ZVJA 3KP9A 2EFHA 2CVKA 1VGLA 1GL8A 3RHCA 4PX1A 2H6XA 1U88A 1TDIA 1VRSD 1SL1B 3F63A 2H01A 6GSVA 2NTOA 5BMUB 4G0LA 2GGTA 1K0OA 1ACVA 4HU7A 3HA9A 2REMA 1XOAA 1GP1A 5INYA 5GAPD 2R6KA 2MYGA 2A4VA 5HFGA 2NDOA 3EMPA 5KEJA 2B6MA 5J9CA 2RUFA 1OVNA 2GZPA 3O6TA 2R5GA 3KEBA 3KXOA 2YWMA 3NOFA 2IFQA 4A5PA 1TI1A 2GTUA 1YY7A 1PX7A 3GKMA 2O89A 2WULA 1F2EA 3I9V2 3IBHA 4L5LA 6GSUA 3TDGA 1OE7A 2PWJA 3ZREA 5DDLA 1O8XA 3ZFLA 2P0GA 2PPTA 1K0DA 1FO5A 1THXA 2B7JA 3P7XA 4XRDA 2P5QA 2QA1A 3TRQA 4D73A 3F3QA 5DJMA 1PN9A 5G5EA 2EFCA 4EDYA 2VCTA 4WETA 3DEXA 2L57A 5ECPB 1OKTA 5IQYA 4ZL8A 4K5RA 1SJIA 4DEJA 1NHYA 3ZRDA 1WRYA 2C0FA 4O7HA 3LSZA 2VCVA 4L8EA 3EVIA 1W4VA 1M2DA 4FYUA 4CDOA 1VF1A 2YN1A 3R2QA 1M2AA 3VLNA 1Z5YE 2OBKA 5G30A 1GUKA 5CAXA 4OMVA 5KN1A 2ZCTA 3H4KA 3G7YA 2H0GA 5J40A 4GXZA 1TK0B 1XWBA 1SYRA 3A2WA 2HFDA 2K9FA 4YAPA 2A4HA 3GMFA 5F0GA 4YQVA 4ZBDA 1SK0A 4BVXB 3IK9A 4DSRA 3LXTA 1Z6MA 1TRSA 2LJRA 4K7IA 2X8GA 2JSZA 3PINA 4ID0A 2WDUA 1R4WA 1TU7A 2PVQA 1EP8A 4PURA 5ECMB 5D9XA 3HVVA 4OD7A 2FCHA 2VL9A 2YPMA 3MWHA 1UVZA 2LQQA 1QFNA 3WD6A 4ECIA 3BOAA 4QQ7A 2KP1A 4N30A 3GNJA 2ZUPA 1Z6NA 3ED3A 2LJAA 2B5EA 1JZWA 2CVDA 2H6ZA 5JWQB 4N3ZA 2HZEA 2VCXA 5CNWA 3IA1A 3WGXA 3J7Yb 4Q5QA 5H5QA 4V2MA 4XS1A 3G7JA 2WB9A 4XCSA 2PBJA 3GTUB 1GTAA 2DIZA 4ZXGA 5ID2A 2LNTA 3KP8A 1TKDB 4EKZA 3PGTA 4PNGA 3M9KA 2IWTA 4KSMA 5ECHB 3LORA 3DWVA 1N2AA 2AV4A 2KHPA 1O81A 4EF0A 1FAAA 2HYXA 3HCZA 2EFDA 5AIVA 3GV1A 1YJ6A 4F0CA 1GSDA 2YZUA 4K0NA 2HRAA 2HZFA 1SL0B 3IHGA 1DE1A 4G0IA 5CP1A 2CZ3A 3DD3A 5DCHA 5B6MA 3IC8A 3MNGA 3KMOA 5DALA 4XS4A 3ZIVA 3D21A 4JEDA 5A5HA 2IL3A 2O7KA 2XC2A 3TOUA 2IMEA 3I43A 10GSA 5G5FA 5DJLA 4Q5RA 2MBSA 4YKGA 3VURA 3RPNA 4WBRD 4QMKA 1AQXA 2DMLA 2E2MA 2M72A 2OACA 5J4YA 4WXTA 1PRXA 1ABAA 4TXVA 2ALBA 1JLVA 2DMMA 1T7PB 2F3MA 2R4VA 5G1LA 3H79A 4WR4A 2NVLA 5ENUA 4K9ZA 3IPZA 4TVEA 1GLPA 2B1LA 4JU5A 3M1GA 1OC3A 1R5PA 1JZOA 2RLIA 5IMAA 3EYTA 2I3YA 3P8WA 1ZMAA 3GKKA 1UA5A 4YH2A 3DIEA 4F82A 4O5UA 3C73A 1JFUA 4D73B 4HJ2A 5DVBA 4ML6A 2OADA 1XOBA 1BEDA 4KB3A 4ECCA 3LWAA 1EEMA 5FT3A 3IK7A 3GHAA 4EXJA 1ZYNA 1PKZA 3VFIA 2HNLA 2VD1A 2J23A 1V57A 3RDWA 5A1NB 2YOIA 1H75A 2I81A 3TU3B 3KJYA 5CRWA 4QL7A 2KOKA 2KLXA 3TKRA 5AN1A 1HNBA 1A2JA 4ML1A 4WEYA 2L6DA 2DLXA 2B7KA 1V40A 2G0FA 4OCFA 1BG5A 1SD8A 3LXZA 2DJ1A 5IPHA 3VK9A 4PUFC 3F4SA 3W8SA 3L9SA 4ISDA 5F8BA 5C00A 2L59A 2FY6A 4K7NA 1IYIA 1W89A 4Z2UA 1ON4A 4O5QA 3E9JB 2GQKA 2VAFA 1AQWA 1ERWA 2N5FA 3KM6A 2H0HA 3C8EA 2YCDA 1M99A 1QQ2A 3FRCA 3A5WA 4MJAA 2EIRA 3DMLA 1TI3A 4KDXA 2HZEB 1H4OA 5EY6A 2ES7A 2BMXA 2CX3A 6GSWA 1SKWB 1PL2A 4ZB7A 1TW9A 1UC7A 5J4UA 4POLA 1NHOA 1JLWA 1WE0A 2BTOT 3PPUA 2VD0A 1PSQA 4EDZA 1HNAA 2EIQA 2F9SA 3ZYWA 3VWXA 2C1YA 1TXUA 4IP6A 2IMKA 1XWAA 1KBNA 2CVBA 4ECJA 3TKSC 4AJ8A 2FWHA 1C72A 4PUAA 4NPBA 5IOXA 2YV7A 3GRXA 5HR2A 4MK3A 1HYUA 4YKFA 1DE2A 1XVWA 2DIYA 3KH9A 1TK8B 2HSYA 2L5LA 1N8JA 3TCOA 3KIJA 1GUMA 1YEXA 1GSYA 5IO0A 4MZCA 2GZZA 2YWOA 5EVOA 4RUVA 2HSNA 3ZL5A 5DALB 2IMDA 4XS4B 4USSA 5A5HB 3W8JA 5A34A 5CO3A 6GSSA 5CRGA 3UAPA 1OYJA 5GAND 1RW1A 2EC4A 2IMFA 4HOJA 2Z9SA 3WT1A 1GTBA 5AGYA 16GSA 5IPGA 5JWRB 4P3YB 2QGVA 5F07A 1FVKA 3FR3A 3WYWA 3C1SA 2HLSA 4RI7A 5G1KA 3FZ4A 4MDCA 4GSNA 3GX0A 4IQAA 5IMCA 1XWKA 2PERA 2FWFA 5ECOB 1SJ6A 1PMTA 1AXDA 1A8YA 5GSTA 4EC0A 1X5EA 17GSA 5CREA 4KX4A 4KAEA 3QR6A 1Q98A 1A2MA 2B5XA 5ECSA 3CMIA 3K8NA 3HDCA 4I6XA 5HFIA 2LJKA 4G01A 1EWXA 1AC1A 2JACA 5J5NA 3ZTLA 2CZ2A 3O3TA 2L4CA 3D4MA 1YF0A 2LTKA 3PH9A 1QXHA 2YJ7A 2L5OA 1XZOA 2QA2A 4L0WA 1KNGA 3UL3A 1TTZA 1ZCPA 3RAZA 4K7OA 4V2LA 4EIQA 3P90A 5B8BA 3HHVA 3GA4A 1PX6A 4LMWA 6GSXA 4WBJA 2H1AA 2AUVA 2FHEA 1KTEA 3Q74A 4JZQA 4AJ6A 4TXOB 4TOPA 1NM3A 5DCGA 1BF5A 3RHBA 2VOCA 4DSSB 1PGTA 1S3AA 2ON5A 4XRAA 1TOFA 2L6CA 3HD5A 3SWLA 2DKIA 2FUG2 1ERTA 3WGEA 2I4AA 4DVCA 1BJXA 2VM2A 2GQMA 3U6VA 5DQSA 2IIYA 3BJ5A 1FOVA 2OBIA 5KN0A 2VLVA 1VF3A 2C8UA 2YJHA 2AHEA 4MCUA 3E0UA 1OKDA 4PGTA 3A3TA 1TXXA 1GSEA 3MAKA 4AJ7A 4J57E 2C0DA 3D0ZA 5A1NA 2KP2A 4YQUA 3A2VA 3IV4A 1IYHA 2XBQA 2BJXA 1YDKA 1F3BA 3QAGA 2LSTA 2O87A 3CRTA 1GUHA 2K8VA 3HYPA 3M0FA 2YZHA 4F0BA 4GCIA 2XPEA 4IP1A 2FWEA 2WZ9A 4KH7A 1F3AA 3ZZXA 4PQHA 2RM6A 1Y1UA 1EV4A 1A8LA 1EOHA 2F51A 1K0AA 4G9HA 5J47A 3GFKA 2JSYA 3HJPA 3DKSA 2MMZA 1SJZA 2PGTA 4IJIA 3L4NA 4GRFA 2V2GA 1UN2A 4K0GA 1WOUA 4IW9A 4OWYA 4WR5A 2CV4A 5D9TA 4HQSA 1X0RA 3F4TA 4V2NA 2FGXA 1ILOA 3LYPA 4HDEA 5DAKA 2GSRA 4BL7A 19GSA 2JL4A 3CSHA 4IVFA 3ZFBA 1F9MA 5GZZB 2LUSA 5H5RA 2HSNB 3LGCA 3L78A 2OE0A 3VWUA 3IAM2 1K3YA 5A34B 5JCGA 1SVMA 4GSSA 2MMAA 3CWGA 1LU4A 4AI6A 1HD2A 2RM5A 1T4ZA 1SYXA 4XTSA 3FR9A 1B4QA 3GSSA 3KGKA 2MMOA 2QSIA 1FB6A 2F8FA 2DJKA 4BA7A 1WPIA 4ILFA 5A4WA 3EU4A 2CAQA 2HRKA 1O6JA 1OE8A 1XXUA 4HS1A 1QK8A 1X9SB 2HSHA 2VL3A 2H73A 2YWIA 2H1LA 3QAWA 1PQNA 4OO5A 1PA3A 4PXOA 3GX8A 2OJLA 1GULA 2IPAA 2LQOA 4L0UA 3EURA 4GQCA 2CAIA 4KDYA 4MF5A 3UARA 4NHZA 1B9YC 3EC3A 1EGOA 4LLRA 2H1BA 2FWGA 4ICYA 4FIWA 3C1RA 3UIWA 4FO5A 3QFBC 1XPVA 2YP6A 1MD4A 1BAYA 4KDUA 2JZRA 4IGJA 3FK8A 3VWVA 3R3EA 2JZSA 2PU9C 2AYTA 2TIRA 7GSSA 2VKZG 5EPFA 3ERWA 2UV8G 3Q19A 4NV5A 4MZBA 3QOUA 4GWRA 1YKAA 5IO2A 3F4RA 2CA8A 13GSA 4KNDA 1GSQA 3GKXA 3FY7A 4HUAA 1MEKA 1NW2A 3QFAC 2XPDA 3GURA 5LNKe 1WJKA 2X4AA 1F6MC 4MF6A 1X5CA 4J56E 4G0KA 4OFNA 1V98A 2HI7A 4K5SA 3I69A 1CQHA 3CSJA 3QAVA 2OT3A 3M3MA 1T8EB 3IOSA 3GSTA 2N5BA 2P5RA 4HU9A 3L0HA 3UEMA 3G7IA 3ISOA 4EIPA 1ZL9A 4K1FA 1GSFA 1A0RP 2H19A 3MSZA 5LCZA 5D9VA 1G0TA 1R7HA 2CT6A 4EUYA 1BQ7A 3GKNA 2GVPA 4NXIA 5KOWA 1OC8A 1WMJA 2PMTA 3APSA 4BWSA 1SK1A 5ECIB 4MPGA 1DSBA 2NPBA 1GLQA 3V1WA 2EFEA 4EVMA 4TXOA 2VCWA 4IKHA 3F0IA 5GSSA 3MDKA 4YQMA 3Q6OA 4DSSA 2FA8A 4V1Ap 4N0ZA 4IHUA 4O5RA 3O76A 3APOA 3EMXA 5IIZA 1XW9A 4X43A 2C3NA 3TOTA 5EL8A 4RQXA 2AB6A 3L9VA 1T4YA 2O5VA 5DAKB 4PQIA 4V1Ag 4BL7B 4ZL9A 5IM9A 2WS2A 4TN8A 3IE3A 2FLSA 3CYNA 4KF9A 4I2TA 2A2PA 3SBCA 5IOWA 1XBSA 1FHEA 3ZIJA 3C7MA 3TJGA 1S3CA 4ZBAA 2VL2A 2DJ0A 4HJMA 1Z3EA 4IJ3A 2GT5A 2E2GA 5HQPA 3ERGA 3UMAA 4E8EA 2R37A 1GSUA 2VCZA 4LA1A 2TRCP 2PUKC 3GH6A 5CRHA 3FYGA 1EV9A 3NIVA 4O32A 3APQA 3GL5A 4AKGA 1GTUA 1K3OA 1O85A 2HRKB 5ECKB 1SKRB 3F3RA 3KZQA 4MF7A 1ERVA 1FOHA 4N0VA 2P31A 3TRPA 3EE2A 2F8AA 4CW9A 3DYRA 5KOXA 1OAZA 4I2UA 2I1UA 5DQYA 3KMNA 5J9BA 1AQVA 1B8XA 3EPTA 1TRWA 3FHKA 4CHSA 1V9WA 6GSTA 5COHA 3CRUA 1G7EA 2H72A 1JZDA 1ZYEA 3UJ1A 1CQGA 2C4JA 1XVQA 2R3XA 1ERUA 3FMWA 1XW5A 1TJDA 3BCIA 3HJMA 4WKWA 4OFTA 4N11A 2NBSA 4Q5NA 4TRXA 3M8NA 1V58A 4PTSA 4IQ1A 1XFLA 3Q18A 3G9BA 5ECLB 4PQ1A 2H74A 2JZTA 2I9HA 2GSTA 2ZNMA 4DSQA 5A5KA 2IJYA 3LYKA 22GSA 4BPYA 2KUCA 4ECBA 3ZITA 4L5OA 1T00A 3CTGA 2CX4A 2QC7A 3TGZA 1GSSA 5CYYA 4OCEA 3ZVJD 1Z7RA 1URMA 4AKIA 1YEPA 3KTBA 3HZ8A 2V1MA 4JR6A 3MIXA 5D8IA 4IELA 5E59A 1XCCA 2LKUA 5AIXA 1RQMA 5H5SA 1U6TA 3DVWA 3EINA 1YZXA 2A2RA 3GL3A 2GSSA 2JADA 2X8CA 3LQ7A 3E3EA 4QL9A 3D6IA 1FW1A 4MPFA 2WRTA 3UOMA 1YF1A 2B1KA 1GRXA 1U87A 4X0XA 4K2XA 1GNWA 3IRAA 4ZL7A 4TW5A 5A4UA 4POMA 4X4JA 2FA4A 1M9AA 1K0MA 3CTFA 3D4TA 4WF4A 1SL2B 2YNXA 2B3SA 4Z2TA 2LEGA 1AIUA 5ECNB 3UVTA 4RI6A 3N9JA 5BRTA 4GLTA 3FEUA 1GH2A 3QDNA 4TKYA 4ZIJA 2R0GA 3TRXA 5D93A 5KN2A 1XWGA 3TUEA 3H1NA 5HR0A 4LMVA 2HRFA 2LNSA 2L4QA 4F9ZA 2O85A 4OO4A 3UVHA 5D73A 5CRDA 4F03A 4AKHA 1SK2A 3M9JA 2WFCA 1A23A 2YWNA 2J9HA 5D96A 4FH8A 2V32A 1AUCA 3EU3A 4OFMA 2X49A 2H30A 2X8HA 2XBIA 3J7Yk 2V41A 4TR3A 4TR1A 1TRVA 1I9DA 1N25A 3WGDA 2R0CA 1SKSB 3ME7A 2IN3A 4HI7A 4J2FA 1TK5B 1O73A 2C0GA 3GIXA 3DGQA 1HNCA 2FNOA 4MJBA 1FVJA 1HQOA 1PKWA 5F06A 5HFKA 1T3BA 2N5AA 3BBYA 2H76A 1M2BA 1M7TA 1DBYA 5ELAA 1VF4A 1PN0A 4MA9A 5F05A 3GN3A 1Y25A 3LJRA 2EIOA 4KGIA 3UBKA 3IC4A 1FG4A 4IBPA 1Y6EA 2RUEA 1QGVA 2V6OA 4NHWA 1OC9B 4KCAA 2PN8A 1SVLA 1DUGA 4MNNA 2OA7A 4KW6A 4POBA 3TJBA 2VLTA 4MZWA 3N5OA 1TP9A 2JU5A 1WIKA 4RQRA 3U5RE 3OR5A 4HQZA 2VUPA 2OE1A 3KH7A 4FQUA 2DJJA 2LRNA 5IMZA 4G2EA 4BVYA 1EOGA 2RIIA 5G31A 9GSSA 2X64A 4CY8A 4G10A 3ZMLA 3LEFA 1EP7A 3BD2A 1USBA 3FKFA 2D2ZA 3ERFA 1O8WA 2GZYA 3IDVA 1XW6A 3HY2A 4KE3A 4KUNA 1XIYA 3F6DA 5HR1A 18GSA 4G19A 3FZAA 3W6GA 3QCPA 4FYCA 2MBTA 8GSSA 3IR4A 3FW2A 4YAVA 5JWOB 3GUSA 1U3IA 4TR0A 4HZ2A 3F9UA 1Q4JA 1YKCA 4EE0A 2VM1A 3HZ4A 4EL1A 4ZB8A 2XHFA 6GSYA 3TJKA 2DC5A 2B5YA 4MMMA 3A5IA 4I5QA 2CQ9A 1A2LA 1QMVA 3RPPA 3ZLPA 3JCML 1E6BA 1F37A 4ZB6A 2C3TA 4AGSA 4CY6A 2TRXA 2GS3A 4MABA 5B8AA 4POKA 4H86A 1NSWA 1FB0A 3US3A 2M46A 5ECQB 3KCMA 4MH3A 3QPMA 2GDRA 2HXKA 1THOA 1V2AA 2GQLA 3HKRA 3F6FA 2E7PA 4GQFA 3VPTA 1ZYPA 4MH2A 3RBTA 1PD21 1M9BA 2G2QA 3H93A 5IMFA 2H66A 3KTLA 2HSMA 2IFQB 4JE1A 4F2IA 3PR8A 3LW9A 5JCUA 1LJRA 2H1DA 2H6YA 3LG6A 2DKHA 3EWLA 4IN0A 2GSQA 3TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8B A;  1R5A A;  2C0E A;  2HRN A;  4JBB A;  3NZN A;  4MJE A;  4TR1 B;  3KD0 A;  3HXS A;  4PNF A;  3TB2 A;  4NWY A;  4X1U A;  4XIH A;  1AAZ A;  3CSI A;  2HE3 A;  3C71 A;  2H1G A;  2WGR A;  5DBQ A;  3LFL A;  1X5D A;  1B4P A;  4O92 A;  1JZR A;  2GT6 A;  3DXB A;  5G2Z A;  1PL1 A;  2VL2 C;  2M80 A;  3H8Q A;  1SEN A;  2YV9 A;  5BMU A;  4AF2 A;  5AIS A;  1MD3 A;  4LL4 B;  3HJO A;  2H0I A;  3IAS 2;  1U3A A;  4K2D A;  3GH9 A;  4HEA 2;  4K8M A;  1ZGN A;  3BCK A;  2OKA A;  1J08 A;  1O7U A;  2A2S A;  3DRN A;  2ON7 A;  4NV2 A;  5J3R A;  2HT9 A;  1AW9 A;  5FHI A;  1MDK A;  1MDJ A;  1GNE A;  3D5J A;  3IHQ A;  2K8S A;  4GTU A;  1MTC A;  5FWG A;  1EGR A;  4GST A;  2VCQ A;  4N10 A;  1Z9H A;  2DJ3 A;  2H75 A;  3CBU A;  5D9W A;  2MZC A;  4XHM A;  14GS A;  1T1V A;  11GS A;  5E4W A;  1A24 A;  4I97 A;  4MJC A;  3VI5 A;  1K3L A;  3UBL A;  3A2X A;  1B9X C;  2WCI A;  1G7O A;  1X9W B;  3QMX A;  3FR6 A;  4BVY B;  1ZOF A;  4NMU A;  5A4V A;  1X9M B;  1GWC A;  3HVX A;  5ECR B;  12GS A;  2LRC A;  2V6K A;  2AJQ B;  1RK4 A;  1GTI A;  5LD0 A;  5KN3 A;  4KSO A;  2GLR A;  2E0Q A;  5ID2 B;  3D22 A;  4EO3 A;  2FD3 A;  2OE3 A;  5B6N A;  1R26 A;  1K0N A;  1ML6 A;  4BWQ A;  2H71 A;  1XWC A;  1JHB A;  1MDI A;  2PVO C;  1ST9 A;  3L9U A;  1WP0 A;  1ZYQ B;  5B7C A;  4IS0 A;  5JCW A;  4WF5 A;  1KEB A;  1YQ1 A;  1J9B A;  1EEJ A;  1OC9 A;  4BVX A;  1LBK A;  2VO4 A;  3IXR A;  1Z7P A;  2O8V B;  2WJU A;  4MLY A;  2DBC A;  1VF2 A;  3I6A A;  2K18 A;  2HQT A;  1QUW A;  2X99 A;  4Z7X A;  1K0C A;  1G6W A;  2LV3 A;  4Q5F A;  1E2Y A;  5C04 A;  4ACS A;  4MP4 A;  1TRU A;  1WWJ A;  5J41 A;  4LL1 B;  1M0U A;  4ZB9 A;  4ULX A;  5IMV A;  3TJJ A;  2QKE A;  1I5G A;  4K6X A;  3DVX A;  3QD9 A;  2MMN A;  3S9F A;  3HVS A;  3GTU A;  4HZ4 A;  3ME8 A;  4ZIL A;  3TKS A;  4ZBB A;  4E8H A;  2IMI A;  1B48 A;  1EZK A;  2K6V A;  1SU9 A;  3TKS E;  5IMD A;  4JR4 A;  2C3Q A;  2DJ2 A;  4FYB A;  3FZ9 A;  1K0B A;  2AAW A;  2H70 A;  3TKQ A;  4NAX A;  1A0F A;  4GF0 A;  2R2J A;  3VPQ A;  2VLU A;  2HSM B;  5ELG A;  2LRT A;  1S3D A;  3ZMK A;  3FZ5 A;  2C80 A;  3AY8 A;  1BX9 A;  3VI7 A;  5HR3 A;  4KA0 A;  2VIM A;  3WT2 A;  2YAN A;  2UZ8 A;  1J0F A;  5L71 A;  3P2A A;  4TR4 A;  2DSA A;  1G6Y A;  1TU8 A;  2H8L A;  3GYK A;  1BYE A;  3TKP A;  4XS6 A;  5ABR A;  3F8U A;  4KCE A;  1SD9 A;  3CXG A;  2LS5 A;  1ZZY A;  20GS A;  3VWW A;  4JRR A;  3ZVJ A;  3KP9 A;  2CVK A;  1VGL A;  1GL8 A;  3RHC A;  4PX1 A;  2H6X A;  1U88 A;  1TDI A;  1VRS D;  1SL1 B;  3F63 A;  2H01 A;  6GSV A;  2NTO A;  4G0L A;  2GGT A;  1K0O A;  4HU7 A;  1ACV A;  3HA9 A;  2REM A;  1XOA A;  1GP1 A;  5INY A;  5GAP D;  2R6K A;  2MYG A;  2A4V A;  5HFG A;  2NDO A;  3EMP A;  5KEJ A;  2B6M A;  5J9C A;  2RUF A;  1OVN A;  2GZP A;  3O6T A;  2R5G A;  3KEB A;  3KXO A;  2YWM A;  3NOF A;  2IFQ A;  1TI1 A;  2GTU A;  1YY7 A;  1PX7 A;  3GKM A;  2O89 A;  2WUL A;  1F2E A;  3I9V 2;  3IBH A;  4L5L A;  6GSU A;  3TDG A;  1OE7 A;  2PWJ A;  3ZRE A;  5DDL A;  1O8X A;  3ZFL A;  2P0G A;  2PPT A;  1K0D A;  1FO5 A;  1THX A;  2B7J A;  3P7X A;  4XRD A;  2P5Q A;  3TRQ A;  4D73 A;  3F3Q A;  5DJM A;  1PN9 A;  5G5E A;  4EDY A;  2VCT A;  4WET A;  3DEX A;  2L57 A;  5ECP B;  1OKT A;  5IQY A;  4ZL8 A;  1SJI A;  4DEJ A;  1NHY A;  3ZRD A;  1WRY A;  2C0F A;  4O7H A;  3LSZ A;  2VCV A;  4L8E A;  3EVI A;  1W4V A;  1M2D A;  4FYU A;  4CDO A;  1VF1 A;  2YN1 A;  3R2Q A;  1M2A A;  3VLN A;  1Z5Y E;  2OBK A;  5G30 A;  1GUK A;  5CAX A;  4OMV A;  5KN1 A;  2ZCT A;  3H4K A;  3G7Y A;  2H0G A;  4GXZ A;  1TK0 B;  1XWB A;  1SYR A;  3A2W A;  2HFD A;  2K9F A;  4YAP A;  3GMF A;  5F0G A;  4YQV A;  4ZBD A;  1SK0 A;  4BVX B;  3IK9 A;  4DSR A;  3LXT A;  1Z6M A;  1TRS A;  2LJR A;  4K7I A;  2X8G A;  2JSZ A;  3PIN A;  4ID0 A;  2WDU A;  1R4W A;  1TU7 A;  2PVQ A;  1EP8 A;  4PUR A;  5ECM B;  5D9X A;  3HVV A;  4OD7 A;  2FCH A;  2VL9 A;  2YPM A;  3MWH A;  1UVZ A;  2LQQ A;  1QFN A;  3WD6 A;  4ECI A;  3BOA A;  4QQ7 A;  2KP1 A;  4N30 A;  3GNJ A;  2ZUP A;  1Z6N A;  3ED3 A;  2LJA A;  2B5E A;  1JZW A;  2CVD A;  2H6Z A;  5JWQ B;  2HZE A;  2VCX A;  5CNW A;  3IA1 A;  3WGX A;  3J7Y b;  4Q5Q A;  5H5Q A;  4V2M A;  4XS1 A;  3G7J A;  2WB9 A;  4XCS A;  2PBJ A;  3GTU B;  1GTA A;  2DIZ A;  4ZXG A;  5ID2 A;  2LNT A;  3KP8 A;  1TKD B;  4EKZ A;  3PGT A;  4PNG A;  3M9K A;  2IWT A;  4KSM A;  5ECH B;  3LOR A;  3DWV A;  1N2A A;  2AV4 A;  2KHP A;  1O81 A;  4EF0 A;  1FAA A;  2HYX A;  3HCZ A;  5AIV A;  3GV1 A;  1YJ6 A;  4F0C A;  1GSD A;  2YZU A;  4K0N A;  2HRA A;  2HZF A;  1SL0 B;  1DE1 A;  4G0I A;  5CP1 A;  2CZ3 A;  3DD3 A;  5DCH A;  5B6M A;  3IC8 A;  3MNG A;  3KMO A;  5DAL A;  4XS4 A;  3ZIV A;  3D21 A;  4JED A;  2IL3 A;  2O7K A;  2XC2 A;  3TOU A;  2IME A;  3I43 A;  10GS A;  5G5F A;  5DJL A;  4Q5R A;  2MBS A;  3VUR A;  3RPN A;  4WBR D;  1AQX A;  2DML A;  2E2M A;  2M72 A;  2OAC A;  4WXT A;  1PRX A;  1ABA A;  4TXV A;  2ALB A;  1JLV A;  2DMM A;  1T7P B;  2F3M A;  2R4V A;  5G1L A;  3H79 A;  4WR4 A;  2NVL A;  5ENU A;  4K9Z A;  3IPZ A;  4TVE A;  1GLP A;  2B1L A;  4JU5 A;  3M1G A;  1OC3 A;  1R5P A;  1JZO A;  2RLI A;  5IMA A;  3EYT A;  2I3Y A;  3P8W A;  1ZMA A;  3GKK A;  1UA5 A;  4YH2 A;  3DIE A;  4F82 A;  3C73 A;  1JFU A;  4D73 B;  4HJ2 A;  5DVB A;  4ML6 A;  2OAD A;  1XOB A;  1BED A;  4KB3 A;  4ECC A;  3LWA A;  1EEM A;  5FT3 A;  3IK7 A;  3GHA A;  4EXJ A;  3VFI A;  1PKZ A;  2HNL A;  2VD1 A;  2J23 A;  1V57 A;  3RDW A;  2YOI A;  1H75 A;  2I81 A;  3KJY A;  5CRW A;  4QL7 A;  2KOK A;  2KLX A;  3TKR A;  5AN1 A;  1HNB A;  1A2J A;  4ML1 A;  4WEY A;  2L6D A;  2DLX A;  2B7K A;  1V40 A;  2G0F A;  4OCF A;  1BG5 A;  1SD8 A;  3LXZ A;  2DJ1 A;  5IPH A;  3VK9 A;  4PUF C;  3F4S A;  3W8S A;  3L9S A;  4ISD A;  5F8B A;  5C00 A;  2L59 A;  2FY6 A;  4K7N A;  1IYI A;  1W89 A;  1ON4 A;  3E9J B;  2GQK A;  2VAF A;  1AQW A;  1ERW A;  2N5F A;  3KM6 A;  2H0H A;  3C8E A;  2YCD A;  1M99 A;  1QQ2 A;  3FRC A;  3A5W A;  4MJA A;  2EIR A;  3DML A;  1TI3 A;  4KDX A;  2HZE B;  1H4O A;  5EY6 A;  2ES7 A;  2BMX A;  2CX3 A;  6GSW A;  1SKW B;  1PL2 A;  1TW9 A;  1UC7 A;  5J4U A;  4POL A;  1NHO A;  1JLW A;  1WE0 A;  2BTO T;  3PPU A;  2VD0 A;  1PSQ A;  4EDZ A;  1HNA A;  2EIQ A;  2F9S A;  3ZYW A;  3VWX A;  2C1Y A;  4IP6 A;  2IMK A;  1XWA A;  1KBN A;  2CVB A;  4ECJ A;  3TKS C;  4AJ8 A;  2FWH A;  1C72 A;  4PUA A;  4NPB A;  5IOX A;  2YV7 A;  3GRX A;  5HR2 A;  4MK3 A;  1HYU A;  1DE2 A;  1XVW A;  2DIY A;  3KH9 A;  1TK8 B;  2HSY A;  2L5L A;  1N8J A;  3TCO A;  3KIJ A;  1GUM A;  1YEX A;  1GSY A;  5IO0 A;  4MZC A;  2GZZ A;  2YWO A;  5EVO A;  4RUV A;  3ZL5 A;  5DAL B;  2IMD A;  4XS4 B;  4USS A;  3W8J A;  5CO3 A;  6GSS A;  5CRG A;  3UAP A;  1OYJ A;  5GAN D;  1RW1 A;  2EC4 A;  2IMF A;  4HOJ A;  2Z9S A;  3WT1 A;  1GTB A;  5AGY A;  16GS A;  5IPG A;  5JWR B;  4P3Y B;  2QGV A;  5F07 A;  1FVK A;  3FR3 A;  3WYW A;  3C1S A;  2HLS A;  4RI7 A;  5G1K A;  3FZ4 A;  4MDC A;  4GSN A;  3GX0 A;  4IQA A;  5IMC A;  1XWK A;  2PER A;  2FWF A;  5ECO B;  1SJ6 A;  1PMT A;  1AXD A;  1A8Y A;  5GST A;  4EC0 A;  1X5E A;  17GS A;  5CRE A;  4KX4 A;  4KAE A;  3QR6 A;  1Q98 A;  1A2M A;  2B5X A;  5ECS A;  3CMI A;  3K8N A;  3HDC A;  4I6X A;  5HFI A;  2LJK A;  1EWX A;  1AC1 A;  2JAC A;  5J5N A;  3ZTL A;  2CZ2 A;  3O3T A;  2L4C A;  3D4M A;  1YF0 A;  2LTK A;  3PH9 A;  1QXH A;  2YJ7 A;  2L5O A;  1XZO A;  4L0W A;  1KNG A;  3UL3 A;  1TTZ A;  1ZCP A;  3RAZ A;  4K7O A;  4V2L A;  3P90 A;  5B8B A;  3HHV A;  3GA4 A;  1PX6 A;  4LMW A;  6GSX A;  4WBJ A;  2H1A A;  2AUV A;  2FHE A;  1KTE A;  3Q74 A;  4JZQ A;  4AJ6 A;  4TXO B;  4TOP A;  1NM3 A;  5DCG A;  3RHB A;  2VOC A;  4DSS B;  1PGT A;  1S3A A;  2ON5 A;  4XRA A;  1TOF A;  2L6C A;  3HD5 A;  3SWL A;  2FUG 2;  1ERT A;  3WGE A;  2I4A A;  4DVC A;  1BJX A;  2VM2 A;  2GQM A;  3U6V A;  5DQS A;  2IIY A;  3BJ5 A;  1FOV A;  2OBI A;  5KN0 A;  2VLV A;  1VF3 A;  2C8U A;  2YJH A;  2AHE A;  4MCU A;  3E0U A;  1OKD A;  4PGT A;  3A3T A;  1TXX A;  1GSE A;  3MAK A;  4AJ7 A;  4J57 E;  2C0D A;  3D0Z A;  2KP2 A;  4YQU A;  3A2V A;  3IV4 A;  1IYH A;  2XBQ A;  2BJX A;  1YDK A;  1F3B A;  3QAG A;  2LST A;  2O87 A;  3CRT A;  1GUH A;  2K8V A;  3HYP A;  3M0F A;  2YZH A;  4F0B A;  4GCI A;  2XPE A;  4IP1 A;  2FWE A;  2WZ9 A;  4KH7 A;  1F3A A;  3ZZX A;  4PQH A;  2RM6 A;  1EV4 A;  1A8L A;  1EOH A;  2F51 A;  1K0A A;  4G9H A;  3GFK A;  2JSY A;  3HJP A;  3DKS A;  2MMZ A;  1SJZ A;  2PGT A;  4IJI A;  3L4N A;  4GRF A;  2V2G A;  1UN2 A;  4K0G A;  1WOU A;  4IW9 A;  4OWY A;  4WR5 A;  2CV4 A;  5D9T A;  4HQS A;  1X0R A;  3F4T A;  4V2N A;  2FGX A;  1ILO A;  3LYP A;  4HDE A;  5DAK A;  2GSR A;  4BL7 A;  19GS A;  2JL4 A;  3CSH A;  4IVF A;  3ZFB A;  1F9M A;  5GZZ B;  2LUS A;  5H5R A;  2HSN B;  3LGC A;  3L78 A;  2OE0 A;  3VWU A;  3IAM 2;  1K3Y A;  5JCG A;  4GSS A;  2MMA A;  1LU4 A;  1HD2 A;  2RM5 A;  1T4Z A;  1SYX A;  4XTS A;  3FR9 A;  1B4Q A;  3GSS A;  3KGK A;  2MMO A;  2QSI A;  1FB6 A;  2F8F A;  2DJK A;  4BA7 A;  1WPI A;  4ILF A;  5A4W A;  3EU4 A;  2CAQ A;  2HRK A;  1O6J A;  1OE8 A;  1XXU A;  4HS1 A;  1QK8 A;  1X9S B;  2HSH A;  2VL3 A;  2H73 A;  2YWI A;  3QAW A;  1PQN A;  4OO5 A;  1PA3 A;  4PXO A;  3GX8 A;  2OJL A;  1GUL A;  2IPA A;  2LQO A;  4L0U A;  3EUR A;  4GQC A;  2CAI A;  4KDY A;  4MF5 A;  3UAR A;  4NHZ A;  1B9Y C;  3EC3 A;  1EGO A;  4LLR A;  2H1B A;  2FWG A;  4FIW A;  3C1R A;  3UIW A;  4FO5 A;  3QFB C;  1XPV A;  2YP6 A;  1MD4 A;  1BAY A;  4KDU A;  2JZR A;  4IGJ A;  3FK8 A;  3VWV A;  3R3E A;  2JZS A;  2PU9 C;  2AYT A;  2TIR A;  7GSS A;  5EPF A;  3ERW A;  3Q19 A;  4NV5 A;  4MZB A;  3QOU A;  4GWR A;  1YKA A;  5IO2 A;  3F4R A;  2CA8 A;  13GS A;  4KND A;  1GSQ A;  3GKX A;  3FY7 A;  4HUA A;  1MEK A;  1NW2 A;  3QFA C;  2XPD A;  3GUR A;  5LNK e;  1WJK A;  1F6M C;  4MF6 A;  1X5C A;  4J56 E;  4G0K A;  4OFN A;  1V98 A;  2HI7 A;  3I69 A;  1CQH A;  3CSJ A;  3QAV A;  3M3M A;  1T8E B;  3IOS A;  3GST A;  2N5B A;  2P5R A;  4HU9 A;  3L0H A;  3UEM A;  3G7I A;  3ISO A;  1ZL9 A;  4K1F A;  1GSF A;  1A0R P;  2H19 A;  3MSZ A;  5LCZ A;  5D9V A;  1G0T A;  1R7H A;  2CT6 A;  4EUY A;  1BQ7 A;  3GKN A;  2GVP A;  4NXI A;  1OC8 A;  1WMJ A;  2PMT A;  3APS A;  4BWS A;  1SK1 A;  5ECI B;  4MPG A;  1DSB A;  2NPB A;  1GLQ A;  3V1W A;  4EVM A;  4TXO A;  2VCW A;  4IKH A;  3F0I A;  5GSS A;  3MDK A;  4YQM A;  3Q6O A;  4DSS A;  2FA8 A;  4V1A p;  4N0Z A;  4IHU A;  4O5R A;  3O76 A;  3APO A;  3EMX A;  5IIZ A;  1XW9 A;  4X43 A;  2C3N A;  3TOT A;  5EL8 A;  4RQX A;  2AB6 A;  3L9V A;  1T4Y A;  5DAK B;  4PQI A;  4V1A g;  4BL7 B;  4ZL9 A;  5IM9 A;  2WS2 A;  4TN8 A;  3IE3 A;  2FLS A;  3CYN A;  4KF9 A;  4I2T A;  3SBC A;  5IOW A;  1XBS A;  1FHE A;  3ZIJ A;  3C7M A;  3TJG A;  1S3C A;  4ZBA A;  2VL2 A;  2DJ0 A;  4HJM A;  1Z3E A;  4IJ3 A;  2GT5 A;  2E2G A;  5HQP A;  3ERG A;  3UMA A;  4E8E A;  2R37 A;  1GSU A;  2VCZ A;  4LA1 A;  2TRC P;  2PUK C;  3GH6 A;  5CRH A;  3FYG A;  1EV9 A;  3NIV A;  4O32 A;  3APQ A;  3GL5 A;  1GTU A;  1K3O A;  1O85 A;  2HRK B;  5ECK B;  1SKR B;  3F3R A;  3KZQ A;  4MF7 A;  1ERV A;  4N0V A;  2P31 A;  3TRP A;  3EE2 A;  2F8A A;  4CW9 A;  3DYR A;  1OAZ A;  4I2U A;  2I1U A;  5DQY A;  3KMN A;  5J9B A;  1AQV A;  1B8X A;  1TRW A;  3FHK A;  4CHS A;  1V9W A;  6GST A;  5COH A;  3CRU A;  1G7E A;  2H72 A;  1JZD A;  1ZYE A;  3UJ1 A;  1CQG A;  2C4J A;  1XVQ A;  2R3X A;  1ERU A;  1XW5 A;  1TJD A;  3BCI A;  3HJM A;  4WKW A;  4OFT A;  4N11 A;  2NBS A;  4Q5N A;  4TRX A;  3M8N A;  1V58 A;  4PTS A;  4IQ1 A;  1XFL A;  3Q18 A;  3G9B A;  5ECL B;  4PQ1 A;  2H74 A;  2JZT A;  2I9H A;  2GST A;  2ZNM A;  4DSQ A;  5A5K A;  2IJY A;  3LYK A;  22GS A;  4BPY A;  2KUC A;  4ECB A;  3ZIT A;  4L5O A;  1T00 A;  3CTG A;  2CX4 A;  2QC7 A;  3TGZ A;  1GSS A;  5CYY A;  4OCE A;  3ZVJ D;  1Z7R A;  1URM A;  1YEP A;  3KTB A;  3HZ8 A;  2V1M A;  4JR6 A;  5D8I A;  4IEL A;  5E59 A;  1XCC A;  2LKU A;  5AIX A;  1RQM A;  5H5S A;  1U6T A;  3DVW A;  3EIN A;  1YZX A;  2A2R A;  3GL3 A;  2GSS A;  2JAD A;  2X8C A;  3LQ7 A;  3E3E A;  4QL9 A;  3D6I A;  1FW1 A;  4MPF A;  2WRT A;  3UOM A;  1YF1 A;  2B1K A;  1GRX A;  1U87 A;  4X0X A;  1GNW A;  3IRA A;  4ZL7 A;  4TW5 A;  5A4U A;  4POM A;  2FA4 A;  1M9A A;  1K0M A;  3CTF A;  3D4T A;  4WF4 A;  1SL2 B;  2YNX A;  2B3S A;  2LEG A;  1AIU A;  5ECN B;  3UVT A;  4RI6 A;  3N9J A;  4GLT A;  3FEU A;  1GH2 A;  3QDN A;  4TKY A;  4ZIJ A;  3TRX A;  5D93 A;  5KN2 A;  1XWG A;  3TUE A;  3H1N A;  5HR0 A;  4LMV A;  2HRF A;  2LNS A;  2L4Q A;  4F9Z A;  2O85 A;  4OO4 A;  3UVH A;  5D73 A;  5CRD A;  4F03 A;  1SK2 A;  3M9J A;  2WFC A;  1A23 A;  2YWN A;  2J9H A;  5D96 A;  4FH8 A;  2V32 A;  1AUC A;  3EU3 A;  4OFM A;  2H30 A;  2X8H A;  2XBI A;  3J7Y k;  2V41 A;  4TR3 A;  4TR1 A;  1TRV A;  1I9D A;  3WGD A;  1SKS B;  3ME7 A;  2IN3 A;  4HI7 A;  4J2F A;  1TK5 B;  1O73 A;  2C0G A;  3GIX A;  3DGQ A;  1HNC A;  2FNO A;  4MJB A;  1FVJ A;  1HQO A;  1PKW A;  5F06 A;  5HFK A;  1T3B A;  2N5A A;  3BBY A;  2H76 A;  1M2B A;  1M7T A;  1DBY A;  5ELA A;  1VF4 A;  4MA9 A;  5F05 A;  3GN3 A;  1Y25 A;  3LJR A;  2EIO A;  4KGI A;  3UBK A;  3IC4 A;  1FG4 A;  4IBP A;  1Y6E A;  2RUE A;  1QGV A;  2V6O A;  4NHW A;  1OC9 B;  4KCA A;  2PN8 A;  1DUG A;  2OA7 A;  4KW6 A;  4POB A;  3TJB A;  2VLT A;  4MZW A;  3N5O A;  1TP9 A;  2JU5 A;  1WIK A;  4RQR A;  3U5R E;  3OR5 A;  4HQZ A;  2VUP A;  2OE1 A;  3KH7 A;  4FQU A;  2DJJ A;  2LRN A;  5IMZ A;  4G2E A;  4BVY A;  1EOG A;  2RII A;  5G31 A;  9GSS A;  2X64 A;  4G10 A;  3ZML A;  3LEF A;  1EP7 A;  3BD2 A;  1USB A;  3FKF A;  2D2Z A;  3ERF A;  1O8W A;  2GZY A;  3IDV A;  1XW6 A;  3HY2 A;  4KE3 A;  4KUN A;  1XIY A;  3F6D A;  5HR1 A;  18GS A;  4G19 A;  3FZA A;  3W6G A;  3QCP A;  4FYC A;  2MBT A;  8GSS A;  3IR4 A;  3FW2 A;  4YAV A;  5JWO B;  3GUS A;  1U3I A;  4TR0 A;  4HZ2 A;  3F9U A;  1Q4J A;  1YKC A;  4EE0 A;  2VM1 A;  3HZ4 A;  4EL1 A;  4ZB8 A;  2XHF A;  6GSY A;  3TJK A;  2DC5 A;  2B5Y A;  4MMM A;  4I5Q A;  2CQ9 A;  1A2L A;  1QMV A;  3RPP A;  3ZLP A;  3JCM L;  1E6B A;  1F37 A;  4ZB6 A;  2C3T A;  4AGS A;  2TRX A;  2GS3 A;  4MAB A;  5B8A A;  4POK A;  4H86 A;  1NSW A;  1FB0 A;  3US3 A;  2M46 A;  5ECQ B;  3KCM A;  4MH3 A;  3QPM A;  2GDR A;  2HXK A;  1THO A;  1V2A A;  2GQL A;  3HKR A;  3F6F A;  2E7P A;  4GQF A;  3VPT A;  4MH2 A;  3RBT A;  1PD2 1;  1M9B A;  2G2Q A;  3H93 A;  5IMF A;  2H66 A;  3KTL A;  2HSM A;  2IFQ B;  4JE1 A;  4F2I A;  3PR8 A;  5JCU A;  1LJR A;  2H1D A;  2H6Y A;  3LG6 A;  3EWL A;  4IN0 A;  2GSQ A;  3TJF A; 
#chains in the Genus database with same CATH topology
 4I8B A;  1R5A A;  2C0E A;  2HRN A;  4JBB A;  3NZN A;  4MJE A;  4TR1 B;  3KD0 A;  3HXS A;  4PNF A;  3TB2 A;  4NWY A;  4X1U A;  4XIH A;  1AAZ A;  3CSI A;  2HE3 A;  3C71 A;  2H1G A;  2WGR A;  5DBQ A;  3LFL A;  1X5D A;  1B4P A;  4O92 A;  1BG1 A;  1JZR A;  2GT6 A;  3DXB A;  5G2Z A;  1PL1 A;  2VL2 C;  2M80 A;  3H8Q A;  1SEN A;  2YV9 A;  3HVN A;  5BMU A;  4AF2 A;  5AIS A;  1MD3 A;  4LL4 B;  3HJO A;  2H0I A;  2WVX B;  3IAS 2;  1U3A A;  4K2D A;  3GH9 A;  4HEA 2;  4K8M A;  1ZGN A;  3BCK A;  2OKA A;  1J08 A;  1O7U A;  2A2S A;  3DRN A;  2ON7 A;  4NV2 A;  5J3R A;  4Z2R A;  2HT9 A;  1AW9 A;  5FHI A;  1MDK A;  1MDJ A;  1GNE A;  3D5J A;  3IHQ A;  2K8S A;  4GTU A;  1MTC A;  5FWG A;  1EGR A;  4GST A;  2VCQ A;  4N10 A;  1Z9H A;  2DJ3 A;  2H75 A;  3CBU A;  5D9W A;  2MZC A;  4XHM A;  14GS A;  4FXY P;  2O36 A;  1T1V A;  11GS A;  5E4W A;  1A24 A;  4I97 A;  4AKX B;  4MJC A;  3VI5 A;  1K3L A;  3UBL A;  3A2X A;  1B9X C;  2WCI A;  1G7O A;  1X9W B;  3QMX A;  3FR6 A;  4BVY B;  1ZOF A;  4NMU A;  5A4V A;  1X9M B;  1GWC A;  3HVX A;  5ECR B;  12GS A;  2LRC A;  2V6K A;  2AJQ B;  1RK4 A;  1GTI A;  5LD0 A;  5KN3 A;  4KSO A;  2GLR A;  2E0Q A;  5ID2 B;  3D22 A;  4EO3 A;  2FD3 A;  2OE3 A;  5B6N A;  1R26 A;  1K0N A;  1ML6 A;  4BWQ A;  2H71 A;  1XWC A;  1JHB A;  1MDI A;  2PVO C;  1ST9 A;  3L9U A;  1WP0 A;  1ZYQ B;  5B7C A;  4IS0 A;  5JCW A;  4WF5 A;  1KEB A;  1YQ1 A;  1J9B A;  1EEJ A;  1OC9 A;  4BVX A;  1LBK A;  2VO4 A;  3IXR A;  2WVY A;  1Z7P A;  1S3R A;  2O8V B;  2WJU A;  4MLY A;  2DBC A;  1VF2 A;  3I6A A;  2K18 A;  2HQT A;  1QUW A;  2X99 A;  4Z7X A;  4E68 A;  1K0C A;  1G6W A;  2LV3 A;  3HMJ G;  4Q5F A;  1E2Y A;  5C04 A;  4ACS A;  4MP4 A;  1TRU A;  1WWJ A;  5J41 A;  4LL1 B;  1M0U A;  4ZB9 A;  4ULX A;  5IMV A;  3TJJ A;  4GDF A;  2QKE A;  1I5G A;  4K6X A;  3DVX A;  3QD9 A;  1SVO A;  2MMN A;  3S9F A;  3HVS A;  3GTU A;  4HZ4 A;  3ME8 A;  4ZIL A;  3TKS A;  4ZBB A;  4E8H A;  1YVL A;  4W66 A;  2IMI A;  1B48 A;  1EZK A;  2K6V A;  1SU9 A;  3TKS E;  5IMD A;  4JR4 A;  2C3Q A;  2DJ2 A;  4FYB A;  3FZ9 A;  1K0B A;  2AAW A;  2H70 A;  3MYD A;  3TKQ A;  4NAX A;  1A0F A;  4GF0 A;  2R2J A;  3VPQ A;  2VLU A;  2HSM B;  5J4V A;  5ELG A;  2LRT A;  1S3D A;  3ZMK A;  3FZ5 A;  2C80 A;  3AY8 A;  1BX9 A;  3VI7 A;  5HR3 A;  4KA0 A;  2VIM A;  3WT2 A;  2YAN A;  2UZ8 A;  1J0F A;  5L71 A;  3P2A A;  4TR4 A;  2DSA A;  1G6Y A;  1TU8 A;  2H8L A;  3GYK A;  1BYE A;  3TKP A;  4XS6 A;  5ABR A;  3F8U A;  4KCE A;  1SD9 A;  3CXG A;  2LS5 A;  1ZZY A;  2R0P A;  20GS A;  3VWW A;  4JRR A;  3ZVJ A;  3KP9 A;  2EFH A;  2CVK A;  1VGL A;  1GL8 A;  3RHC A;  4PX1 A;  2H6X A;  3CHX C;  1U88 A;  1TDI A;  1VRS D;  1SL1 B;  3F63 A;  2H01 A;  6GSV A;  2NTO A;  5BMU B;  4G0L A;  2GGT A;  1K0O A;  1ACV A;  4HU7 A;  3HA9 A;  2REM A;  1XOA A;  1GP1 A;  5INY A;  5GAP D;  2R6K A;  2MYG A;  3RGB C;  2A4V A;  5HFG A;  2NDO A;  3EMP A;  5KEJ A;  2B6M A;  5J9C A;  2RUF A;  1OVN A;  2GZP A;  3O6T A;  2R5G A;  3KEB A;  3KXO A;  2YWM A;  3NOF A;  2IFQ A;  4A5P A;  1TI1 A;  2GTU A;  1YY7 A;  1PX7 A;  3GKM A;  2O89 A;  2WUL A;  1F2E A;  3I9V 2;  3IBH A;  4L5L A;  6GSU A;  3TDG A;  1OE7 A;  2PWJ A;  3ZRE A;  5DDL A;  1O8X A;  3ZFL A;  2P0G A;  2PPT A;  1K0D A;  1FO5 A;  1THX A;  2B7J A;  3P7X A;  4XRD A;  2P5Q A;  2QA1 A;  3TRQ A;  4D73 A;  3F3Q A;  5DJM A;  1YEW C;  1PN9 A;  5G5E A;  2EFC A;  4EDY A;  2VCT A;  4WET A;  3DEX A;  2L57 A;  5ECP B;  1OKT A;  5IQY A;  4ZL8 A;  4K5R A;  1SJI A;  4DEJ A;  1NHY A;  3ZRD A;  1WRY A;  2C0F A;  4O7H A;  3LSZ A;  2VCV A;  4L8E A;  3EVI A;  1W4V A;  1M2D A;  4FYU A;  4CDO A;  1VF1 A;  2YN1 A;  3R2Q A;  1M2A A;  3VLN A;  1Z5Y E;  2OBK A;  5G30 A;  1GUK A;  5CAX A;  4OMV A;  5KN1 A;  2ZCT A;  3H4K A;  3G7Y A;  2H0G A;  5J40 A;  4GXZ A;  1TK0 B;  1XWB A;  1SYR A;  3A2W A;  2HFD A;  2K9F A;  4YAP A;  2A4H A;  3GMF A;  5F0G A;  4YQV A;  4ZBD A;  1SK0 A;  4BVX B;  3IK9 A;  4DSR A;  1I1I P;  3LXT A;  1Z6M A;  1TRS A;  2LJR A;  4K7I A;  2X8G A;  2JSZ A;  3PIN A;  4ID0 A;  2WDU A;  1R4W A;  1TU7 A;  2PVQ A;  1EP8 A;  3HVV A;  4PUR A;  5D9X A;  5ECM B;  4OD7 A;  2FCH A;  2VL9 A;  2YPM A;  3MWH A;  1UVZ A;  2LQQ A;  1QFN A;  3WD6 A;  4ECI A;  3BOA A;  4QQ7 A;  2KP1 A;  4N30 A;  2WVZ A;  3GNJ A;  2ZUP A;  1Z6N A;  3ED3 A;  2LJA A;  2B5E A;  1JZW A;  2CVD A;  2H6Z A;  5JWQ B;  4N3Z A;  2HZE A;  2VCX A;  5CNW A;  3IA1 A;  3WGX A;  3J7Y b;  4Q5Q A;  5H5Q A;  4V2M A;  4XS1 A;  3G7J A;  2WB9 A;  4XCS A;  2PBJ A;  3GTU B;  1GTA A;  2DIZ A;  4ZXG A;  5ID2 A;  2LNT A;  3KP8 A;  1TKD B;  4EKZ A;  3PGT A;  4PNG A;  3M9K A;  2IWT A;  4KSM A;  5ECH B;  3LOR A;  3DWV A;  1N2A A;  2AV4 A;  2KHP A;  1O81 A;  4EF0 A;  1FAA A;  2HYX A;  3HCZ A;  2EFD A;  5AIV A;  3GV1 A;  1YJ6 A;  4F0C A;  1GSD A;  2YZU A;  4K0N A;  2HRA A;  2WZS A;  2HZF A;  1SL0 B;  3IHG A;  1DE1 A;  4G0I A;  5CP1 A;  2CZ3 A;  3DD3 A;  5DCH A;  5B6M A;  3IC8 A;  3MNG A;  3KMO A;  5DAL A;  4XS4 A;  3ZIV A;  3D21 A;  4JED A;  5A5H A;  2IL3 A;  2O7K A;  2XC2 A;  3TOU A;  2IME A;  3I43 A;  10GS A;  5G5F A;  5DJL A;  4Q5R A;  2MBS A;  4YKG A;  3VUR A;  3RPN A;  4WBR D;  4QMK A;  1AQX A;  2DML A;  2E2M A;  2M72 A;  2OAC A;  5J4Y A;  4WXT A;  1PRX A;  1ABA A;  4TXV A;  2ALB A;  1JLV A;  2DMM A;  1T7P B;  2F3M A;  2R4V A;  5G1L A;  3H79 A;  4WR4 A;  2NVL A;  5ENU A;  4K9Z A;  3IPZ A;  4TVE A;  1GLP A;  2B1L A;  4JU5 A;  3M1G A;  1OC3 A;  1R5P A;  1JZO A;  2RLI A;  5IMA A;  3EYT A;  2I3Y A;  3P8W A;  1ZMA A;  3GKK A;  1UA5 A;  4YH2 A;  3DIE A;  4F82 A;  4O5U A;  3C73 A;  1JFU A;  4D73 B;  4HJ2 A;  5DVB A;  4ML6 A;  2OAD A;  1XOB A;  1BED A;  4KB3 A;  4ECC A;  3LWA A;  1EEM A;  5FT3 A;  3IK7 A;  3GHA A;  4EXJ A;  1ZYN A;  1PKZ A;  3VFI A;  2HNL A;  2VD1 A;  2J23 A;  1V57 A;  3RDW A;  5A1N B;  2YOI A;  1H75 A;  2I81 A;  3TU3 B;  3KJY A;  5CRW A;  4QL7 A;  2KOK A;  2KLX A;  3TKR A;  5AN1 A;  1HNB A;  1A2J A;  2O3E A;  4ML1 A;  4WEY A;  2L6D A;  2DLX A;  2B7K A;  1V40 A;  2G0F A;  4OCF A;  1BG5 A;  1SD8 A;  3LXZ A;  2DJ1 A;  5IPH A;  3VK9 A;  4PUF C;  3F4S A;  3W8S A;  3L9S A;  4ISD A;  5F8B A;  5C00 A;  2L59 A;  2FY6 A;  4K7N A;  1IYI A;  1W89 A;  4Z2U A;  1ON4 A;  4O5Q A;  3E9J B;  2GQK A;  2VAF A;  1AQW A;  1ERW A;  2N5F A;  3KM6 A;  2H0H A;  3C8E A;  2YCD A;  1M99 A;  1QQ2 A;  3FRC A;  3A5W A;  4MJA A;  2EIR A;  3DML A;  1TI3 A;  4KDX A;  2HZE B;  1H4O A;  5EY6 A;  2ES7 A;  2BMX A;  2CX3 A;  6GSW A;  1SKW B;  1PL2 A;  4ZB7 A;  1TW9 A;  1UC7 A;  5J4U A;  4POL A;  1NHO A;  1JLW A;  1WE0 A;  2BTO T;  3PPU A;  2VD0 A;  1PSQ A;  4EDZ A;  1HNA A;  2EIQ A;  2F9S A;  3ZYW A;  3VWX A;  3RFR C;  2C1Y A;  1TXU A;  4IP6 A;  2IMK A;  1XWA A;  1KBN A;  2CVB A;  4ECJ A;  3TKS C;  4AJ8 A;  2FWH A;  1C72 A;  4PUA A;  4NPB A;  5IOX A;  2YV7 A;  3GRX A;  5HR2 A;  4MK3 A;  1HYU A;  4YKF A;  1DE2 A;  1XVW A;  2DIY A;  3KH9 A;  1TK8 B;  2HSY A;  2L5L A;  1N8J A;  3TCO A;  3KIJ A;  1GUM A;  1YEX A;  1GSY A;  5IO0 A;  4MZC A;  2GZZ A;  2YWO A;  5EVO A;  4RUV A;  2HSN A;  3ZL5 A;  5DAL B;  2IMD A;  4XS4 B;  4USS A;  5A5H B;  3W8J A;  5A34 A;  5CO3 A;  6GSS A;  5CRG A;  4BIK A;  3UAP A;  1OYJ A;  5GAN D;  1RW1 A;  2EC4 A;  2IMF A;  4HOJ A;  2Z9S A;  3WT1 A;  1GTB A;  5AGY A;  16GS A;  5IPG A;  5JWR B;  4P3Y B;  2QGV A;  5F07 A;  1FVK A;  3FR3 A;  3WYW A;  3C1S A;  2HLS A;  4RI7 A;  5G1K A;  3FZ4 A;  4MDC A;  4GSN A;  3GX0 A;  4IQA A;  5IMC A;  1XWK A;  2PER A;  2FWF A;  5ECO B;  1SJ6 A;  1PMT A;  1AXD A;  1A8Y A;  5GST A;  4EC0 A;  1X5E A;  17GS A;  5CRE A;  4KX4 A;  4KAE A;  3QR6 A;  1Q98 A;  1A2M A;  2B5X A;  5ECS A;  3CMI A;  3K8N A;  3HDC A;  4I6X A;  5HFI A;  2LJK A;  4G01 A;  1EWX A;  1AC1 A;  4PHZ C;  2JAC A;  5J5N A;  3ZTL A;  2CZ2 A;  3O3T A;  2L4C A;  3D4M A;  1YF0 A;  2LTK A;  3PH9 A;  1QXH A;  2YJ7 A;  2L5O A;  1XZO A;  2QA2 A;  4L0W A;  1KNG A;  3UL3 A;  1TTZ A;  1ZCP A;  3RAZ A;  4K7O A;  4V2L A;  4EIQ A;  3P90 A;  5B8B A;  3HHV A;  3GA4 A;  1PX6 A;  4LMW A;  6GSX A;  4WBJ A;  2H1A A;  2AUV A;  2FHE A;  1KTE A;  3Q74 A;  4JZQ A;  4AJ6 A;  4TXO B;  4TOP A;  1NM3 A;  5DCG A;  1BF5 A;  3RHB A;  2VOC A;  4DSS B;  1PGT A;  1S3A A;  2ON5 A;  4XRA A;  1TOF A;  2L6C A;  3HD5 A;  3SWL A;  2DKI A;  2FUG 2;  1ERT A;  3WGE A;  2I4A A;  4DVC A;  1BJX A;  2VM2 A;  2GQM A;  3U6V A;  5DQS A;  2IIY A;  3BJ5 A;  1FOV A;  2OBI A;  5KN0 A;  2VLV A;  1VF3 A;  2C8U A;  3CQF A;  2YJH A;  2AHE A;  4MCU A;  3E0U A;  1OKD A;  4PGT A;  3A3T A;  1TXX A;  1GSE A;  3MAK A;  4AJ7 A;  4J57 E;  2C0D A;  3D0Z A;  5A1N A;  2KP2 A;  4YQU A;  3A2V A;  3IV4 A;  1IYH A;  2XBQ A;  2BJX A;  1YDK A;  1F3B A;  3QAG A;  2LST A;  2O87 A;  3CRT A;  1GUH A;  2K8V A;  3HYP A;  3M0F A;  2YZH A;  4F0B A;  4GCI A;  2XPE A;  4IP1 A;  2FWE A;  2WZ9 A;  4KH7 A;  1F3A A;  3ZZX A;  4PQH A;  2RM6 A;  1Y1U A;  1EV4 A;  1A8L A;  1EOH A;  2F51 A;  1K0A A;  4G9H A;  5J47 A;  3GFK A;  2JSY A;  3HJP A;  3DKS A;  2MMZ A;  1SJZ A;  2PGT A;  4IJI A;  3L4N A;  4GRF A;  2V2G A;  1UN2 A;  4K0G A;  1WOU A;  4IW9 A;  4OWY A;  4WR5 A;  2CV4 A;  5D9T A;  4HQS A;  1X0R A;  3F4T A;  4V2N A;  2FGX A;  1ILO A;  3LYP A;  4HDE A;  5DAK A;  2GSR A;  4BL7 A;  19GS A;  2JL4 A;  3CSH A;  4IVF A;  3ZFB A;  1F9M A;  5GZZ B;  2LUS A;  5H5R A;  2HSN B;  3LGC A;  1XG8 A;  3L78 A;  2OE0 A;  3VWU A;  3IAM 2;  1K3Y A;  5A34 B;  5JCG A;  1S4B P;  1SVM A;  4GSS A;  2MMA A;  3CWG A;  1LU4 A;  4AI6 A;  1HD2 A;  2RM5 A;  1T4Z A;  1SYX A;  4XTS A;  3FR9 A;  1B4Q A;  3GSS A;  3KGK A;  2MMO A;  2QSI A;  1FB6 A;  2F8F A;  2DJK A;  4BA7 A;  2WW2 A;  1WPI A;  4ILF A;  5A4W A;  3EU4 A;  2CAQ A;  2HRK A;  1O6J A;  1OE8 A;  1XXU A;  4HS1 A;  1QK8 A;  1X9S B;  2HSH A;  2WW1 A;  2VL3 A;  2H73 A;  2YWI A;  2H1L A;  3QAW A;  1PQN A;  4OO5 A;  1PA3 A;  4PXO A;  3GX8 A;  2OJL A;  1GUL A;  2IPA A;  2LQO A;  4L0U A;  3EUR A;  4GQC A;  2CAI A;  4KDY A;  4MF5 A;  3UAR A;  4NHZ A;  1B9Y C;  3EC3 A;  1EGO A;  4LLR A;  2H1B A;  2FWG A;  4ICY A;  4FIW A;  3C1R A;  3UIW A;  4FO5 A;  3QFB C;  1XPV A;  2YP6 A;  1MD4 A;  1BAY A;  4KDU A;  2JZR A;  4IGJ A;  3FK8 A;  3VWV A;  3R3E A;  2JZS A;  2PU9 C;  2AYT A;  2TIR A;  7GSS A;  2VKZ G;  5EPF A;  3ERW A;  2UV8 G;  3Q19 A;  4NV5 A;  4MZB A;  3QOU A;  4GWR A;  1YKA A;  5IO2 A;  3F4R A;  2CA8 A;  13GS A;  4KND A;  1GSQ A;  3GKX A;  3FY7 A;  4HUA A;  1MEK A;  1NW2 A;  3QFA C;  2XPD A;  3GUR A;  5LNK e;  1WJK A;  2X4A A;  1F6M C;  4MF6 A;  1X5C A;  4J56 E;  4G0K A;  4OFN A;  1V98 A;  2HI7 A;  4K5S A;  3I69 A;  1CQH A;  3CSJ A;  3QAV A;  2OT3 A;  3M3M A;  1T8E B;  3IOS A;  3GST A;  2N5B A;  2P5R A;  4HU9 A;  3L0H A;  3UEM A;  3G7I A;  3ISO A;  4EIP A;  1ZL9 A;  4K1F A;  1GSF A;  1A0R P;  2H19 A;  3MSZ A;  5LCZ A;  1PFO A;  4PI2 C;  5D9V A;  1G0T A;  1R7H A;  2CT6 A;  4EUY A;  1BQ7 A;  3GKN A;  4HSC X;  1M3J A;  2GVP A;  4NXI A;  5KOW A;  1OC8 A;  1WMJ A;  2PMT A;  3APS A;  4BWS A;  1SK1 A;  5ECI B;  4MPG A;  1DSB A;  2NPB A;  1GLQ A;  3V1W A;  2EFE A;  4EVM A;  4TXO A;  2VCW A;  4IKH A;  3F0I A;  5GSS A;  3MDK A;  4YQM A;  3Q6O A;  4DSS A;  2FA8 A;  4V1A p;  4N0Z A;  4IHU A;  4O5R A;  3O76 A;  3APO A;  3EMX A;  5IIZ A;  1XW9 A;  4X43 A;  2C3N A;  3TOT A;  5EL8 A;  4RQX A;  2AB6 A;  3L9V A;  1T4Y A;  2O5V A;  5DAK B;  4PQI A;  4V1A g;  4BL7 B;  4ZL9 A;  5IM9 A;  2WS2 A;  4TN8 A;  3IE3 A;  2FLS A;  3CYN A;  4KF9 A;  4I2T A;  2A2P A;  3SBC A;  5IOW A;  1XBS A;  1FHE A;  3ZIJ A;  3C7M A;  3TJG A;  1S3C A;  4ZBA A;  2VL2 A;  2DJ0 A;  4HJM A;  4PI0 C;  1Z3E A;  4IJ3 A;  2GT5 A;  2E2G A;  5HQP A;  3ERG A;  3UMA A;  4E8E A;  2R37 A;  1GSU A;  2VCZ A;  4LA1 A;  2TRC P;  2PUK C;  3GH6 A;  5CRH A;  3FYG A;  1EV9 A;  3NIV A;  4O32 A;  3APQ A;  3GL5 A;  4AKG A;  1GTU A;  1K3O A;  1O85 A;  2HRK B;  5ECK B;  1SKR B;  3F3R A;  3KZQ A;  4MF7 A;  1ERV A;  1FOH A;  4N0V A;  2P31 A;  3TRP A;  3EE2 A;  2F8A A;  4CW9 A;  3DYR A;  5KOX A;  1OAZ A;  4I2U A;  2I1U A;  5DQY A;  3KMN A;  5J9B A;  1AQV A;  1B8X A;  3EPT A;  1TRW A;  3FHK A;  4CHS A;  1V9W A;  6GST A;  5COH A;  3CRU A;  1G7E A;  2H72 A;  1JZD A;  1ZYE A;  3UJ1 A;  1CQG A;  2C4J A;  1XVQ A;  2R3X A;  1ERU A;  3FMW A;  1XW5 A;  1TJD A;  3BCI A;  3HJM A;  4WKW A;  4OFT A;  4N11 A;  2NBS A;  4Q5N A;  4TRX A;  3M8N A;  1V58 A;  4PTS A;  4IQ1 A;  1XFL A;  3Q18 A;  3G9B A;  5ECL B;  4PQ1 A;  2H74 A;  2JZT A;  2I9H A;  2GST A;  1M3I A;  2ZNM A;  4DSQ A;  5A5K A;  2IJY A;  3LYK A;  22GS A;  4BPY A;  2KUC A;  4ECB A;  3ZIT A;  4L5O A;  1T00 A;  3CTG A;  2CX4 A;  2QC7 A;  3TGZ A;  1GSS A;  5CYY A;  4OCE A;  3ZVJ D;  1Z7R A;  1URM A;  4AKI A;  1YEP A;  3KTB A;  3HZ8 A;  2V1M A;  4JR6 A;  3MIX A;  5D8I A;  4IEL A;  5E59 A;  1XCC A;  2LKU A;  5AIX A;  1RQM A;  5H5S A;  1U6T A;  3DVW A;  3EIN A;  1YZX A;  2A2R A;  3GL3 A;  2GSS A;  2JAD A;  2X8C A;  3LQ7 A;  3E3E A;  4QL9 A;  3D6I A;  1FW1 A;  4MPF A;  2WRT A;  3UOM A;  1YF1 A;  2B1K A;  1GRX A;  1U87 A;  4X0X A;  4K2X A;  1GNW A;  3IRA A;  4ZL7 A;  4TW5 A;  5A4U A;  4POM A;  4X4J A;  2FA4 A;  1M9A A;  1K0M A;  3CTF A;  3D4T A;  4WF4 A;  1SL2 B;  2YNX A;  2B3S A;  4Z2T A;  2LEG A;  1AIU A;  5ECN B;  3UVT A;  4RI6 A;  3N9J A;  5BRT A;  4GLT A;  3FEU A;  1GH2 A;  3QDN A;  4TKY A;  4ZIJ A;  2R0G A;  3TRX A;  5D93 A;  5KN2 A;  1XWG A;  3TUE A;  3H1N A;  5HR0 A;  4LMV A;  2HRF A;  2LNS A;  2L4Q A;  4F9Z A;  2O85 A;  4OO4 A;  3UVH A;  5D73 A;  5CRD A;  4F03 A;  4AKH A;  1SK2 A;  3M9J A;  2WFC A;  1A23 A;  2YWN A;  2J9H A;  5D96 A;  4FH8 A;  2V32 A;  1AUC A;  3EU3 A;  4OFM A;  2X49 A;  2H30 A;  2X8H A;  2XBI A;  2WW0 A;  3J7Y k;  2V41 A;  4TR3 A;  4TR1 A;  1TRV A;  1I9D A;  1N25 A;  3WGD A;  2R0C A;  1SKS B;  3ME7 A;  2IN3 A;  4HI7 A;  4J2F A;  1TK5 B;  1O73 A;  2C0G A;  3GIX A;  3DGQ A;  1HNC A;  2FNO A;  4MJB A;  1FVJ A;  1HQO A;  1PKW A;  5F06 A;  5HFK A;  1T3B A;  2N5A A;  3BBY A;  2H76 A;  1M2B A;  1M7T A;  2WVX A;  1DBY A;  5ELA A;  1VF4 A;  1PN0 A;  4MA9 A;  5F05 A;  3GN3 A;  1Y25 A;  3LJR A;  2EIO A;  4KGI A;  3UBK A;  3IC4 A;  1FG4 A;  4IBP A;  1Y6E A;  2RUE A;  1QGV A;  2V6O A;  4NHW A;  1OC9 B;  4KCA A;  2PN8 A;  1SVL A;  1DUG A;  4MNN A;  2OA7 A;  4KW6 A;  4POB A;  3TJB A;  2VLT A;  4MZW A;  3N5O A;  1TP9 A;  2JU5 A;  1WIK A;  4RQR A;  3U5R E;  3OR5 A;  4HQZ A;  2VUP A;  2OE1 A;  3KH7 A;  4FQU A;  2DJJ A;  2LRN A;  5IMZ A;  4G2E A;  4BVY A;  1EOG A;  2RII A;  5G31 A;  9GSS A;  2X64 A;  4CY8 A;  4G10 A;  3ZML A;  3LEF A;  1EP7 A;  3BD2 A;  1USB A;  3FKF A;  2D2Z A;  3ERF A;  1O8W A;  2GZY A;  3IDV A;  1XW6 A;  3HY2 A;  4KE3 A;  4KUN A;  1XIY A;  3F6D A;  5HR1 A;  18GS A;  4G19 A;  3FZA A;  3W6G A;  3QCP A;  4FYC A;  2MBT A;  8GSS A;  3IR4 A;  3FW2 A;  4YAV A;  5JWO B;  3GUS A;  1U3I A;  4TR0 A;  4HZ2 A;  3F9U A;  1Q4J A;  1YKC A;  4EE0 A;  2VM1 A;  3HZ4 A;  4EL1 A;  4ZB8 A;  2XHF A;  6GSY A;  3TJK A;  2DC5 A;  2B5Y A;  4MMM A;  3A5I A;  4I5Q A;  2CQ9 A;  1A2L A;  1QMV A;  3RPP A;  3ZLP A;  3JCM L;  1E6B A;  1F37 A;  4ZB6 A;  2C3T A;  4AGS A;  4CY6 A;  2TRX A;  2GS3 A;  4MAB A;  5B8A A;  4POK A;  4H86 A;  1NSW A;  1FB0 A;  3US3 A;  2M46 A;  5ECQ B;  3KCM A;  4MH3 A;  3QPM A;  2GDR A;  2HXK A;  1THO A;  1V2A A;  2GQL A;  3HKR A;  3F6F A;  2E7P A;  4GQF A;  3VPT A;  1ZYP A;  2WW3 A;  4MH2 A;  3RBT A;  1PD2 1;  1M9B A;  2G2Q A;  3H93 A;  5IMF A;  2H66 A;  3KTL A;  2HSM A;  2IFQ B;  4JE1 A;  4F2I A;  3PR8 A;  3LW9 A;  5JCU A;  1LJR A;  2H1D A;  2H6Y A;  3LG6 A;  2DKH A;  3EWL A;  4IN0 A;  2GSQ A;  3TJF A; 
#chains in the Genus database with same CATH homology
 4I8B A;  1R5A A;  2C0E A;  2HRN A;  4JBB A;  3NZN A;  4MJE A;  4TR1 B;  3KD0 A;  3HXS A;  4PNF A;  3TB2 A;  4NWY A;  4X1U A;  4XIH A;  1AAZ A;  3CSI A;  2HE3 A;  3C71 A;  2H1G A;  2WGR A;  5DBQ A;  3LFL A;  1X5D A;  1B4P A;  4O92 A;  1BG1 A;  1JZR A;  2GT6 A;  3DXB A;  5G2Z A;  1PL1 A;  2VL2 C;  2M80 A;  3H8Q A;  1SEN A;  2YV9 A;  5BMU A;  4AF2 A;  5AIS A;  1MD3 A;  4LL4 B;  3HJO A;  2H0I A;  3IAS 2;  1U3A A;  4K2D A;  3GH9 A;  4HEA 2;  4K8M A;  1ZGN A;  3BCK A;  2OKA A;  1J08 A;  1O7U A;  2A2S A;  3DRN A;  2ON7 A;  4NV2 A;  5J3R A;  4Z2R A;  2HT9 A;  1AW9 A;  5FHI A;  1MDK A;  1MDJ A;  1GNE A;  3D5J A;  3IHQ A;  2K8S A;  4GTU A;  1MTC A;  5FWG A;  1EGR A;  4GST A;  2VCQ A;  4N10 A;  1Z9H A;  2DJ3 A;  2H75 A;  3CBU A;  5D9W A;  2MZC A;  4XHM A;  14GS A;  1T1V A;  11GS A;  5E4W A;  1A24 A;  4I97 A;  4AKX B;  4MJC A;  3VI5 A;  1K3L A;  3UBL A;  3A2X A;  1B9X C;  2WCI A;  1G7O A;  1X9W B;  3QMX A;  3FR6 A;  4BVY B;  1ZOF A;  4NMU A;  5A4V A;  1X9M B;  1GWC A;  3HVX A;  5ECR B;  12GS A;  2LRC A;  2V6K A;  2AJQ B;  1RK4 A;  1GTI A;  5LD0 A;  5KN3 A;  4KSO A;  2GLR A;  2E0Q A;  5ID2 B;  3D22 A;  4EO3 A;  2FD3 A;  2OE3 A;  5B6N A;  1R26 A;  1K0N A;  1ML6 A;  4BWQ A;  2H71 A;  1XWC A;  1JHB A;  1MDI A;  2PVO C;  1ST9 A;  3L9U A;  1WP0 A;  1ZYQ B;  5B7C A;  4IS0 A;  5JCW A;  4WF5 A;  1KEB A;  1YQ1 A;  1J9B A;  1EEJ A;  1OC9 A;  4BVX A;  1LBK A;  2VO4 A;  3IXR A;  1Z7P A;  2O8V B;  2WJU A;  4MLY A;  2DBC A;  1VF2 A;  3I6A A;  2K18 A;  2HQT A;  1QUW A;  2X99 A;  4Z7X A;  4E68 A;  1K0C A;  1G6W A;  2LV3 A;  3HMJ G;  4Q5F A;  1E2Y A;  5C04 A;  4ACS A;  4MP4 A;  1TRU A;  1WWJ A;  5J41 A;  4LL1 B;  1M0U A;  4ZB9 A;  4ULX A;  5IMV A;  3TJJ A;  4GDF A;  2QKE A;  1I5G A;  4K6X A;  3DVX A;  3QD9 A;  1SVO A;  2MMN A;  3S9F A;  3HVS A;  3GTU A;  4HZ4 A;  3ME8 A;  4ZIL A;  3TKS A;  4ZBB A;  4E8H A;  1YVL A;  4W66 A;  2IMI A;  1B48 A;  1EZK A;  2K6V A;  1SU9 A;  3TKS E;  5IMD A;  4JR4 A;  2C3Q A;  2DJ2 A;  4FYB A;  3FZ9 A;  1K0B A;  2AAW A;  2H70 A;  3MYD A;  3TKQ A;  4NAX A;  1A0F A;  4GF0 A;  2R2J A;  3VPQ A;  2VLU A;  2HSM B;  5J4V A;  5ELG A;  2LRT A;  1S3D A;  3ZMK A;  3FZ5 A;  2C80 A;  3AY8 A;  1BX9 A;  3VI7 A;  5HR3 A;  4KA0 A;  2VIM A;  3WT2 A;  2YAN A;  2UZ8 A;  1J0F A;  5L71 A;  3P2A A;  4TR4 A;  2DSA A;  1G6Y A;  1TU8 A;  2H8L A;  3GYK A;  1BYE A;  3TKP A;  4XS6 A;  5ABR A;  3F8U A;  4KCE A;  1SD9 A;  3CXG A;  2LS5 A;  1ZZY A;  2R0P A;  20GS A;  3VWW A;  4JRR A;  3ZVJ A;  3KP9 A;  2EFH A;  2CVK A;  1VGL A;  1GL8 A;  3RHC A;  4PX1 A;  2H6X A;  1U88 A;  1TDI A;  1VRS D;  1SL1 B;  3F63 A;  2H01 A;  6GSV A;  2NTO A;  5BMU B;  4G0L A;  2GGT A;  1K0O A;  1ACV A;  4HU7 A;  3HA9 A;  2REM A;  1XOA A;  1GP1 A;  5INY A;  5GAP D;  2R6K A;  2MYG A;  2A4V A;  5HFG A;  2NDO A;  3EMP A;  5KEJ A;  2B6M A;  5J9C A;  2RUF A;  1OVN A;  2GZP A;  3O6T A;  2R5G A;  3KEB A;  3KXO A;  2YWM A;  3NOF A;  2IFQ A;  4A5P A;  1TI1 A;  2GTU A;  1YY7 A;  1PX7 A;  3GKM A;  2O89 A;  2WUL A;  1F2E A;  3I9V 2;  3IBH A;  4L5L A;  6GSU A;  3TDG A;  1OE7 A;  2PWJ A;  3ZRE A;  5DDL A;  1O8X A;  3ZFL A;  2P0G A;  2PPT A;  1K0D A;  1FO5 A;  1THX A;  2B7J A;  3P7X A;  4XRD A;  2P5Q A;  2QA1 A;  3TRQ A;  4D73 A;  3F3Q A;  5DJM A;  1PN9 A;  5G5E A;  2EFC A;  4EDY A;  2VCT A;  4WET A;  3DEX A;  2L57 A;  5ECP B;  1OKT A;  5IQY A;  4ZL8 A;  4K5R A;  1SJI A;  4DEJ A;  1NHY A;  3ZRD A;  1WRY A;  2C0F A;  4O7H A;  3LSZ A;  2VCV A;  4L8E A;  3EVI A;  1W4V A;  1M2D A;  4FYU A;  4CDO A;  1VF1 A;  2YN1 A;  3R2Q A;  1M2A A;  3VLN A;  1Z5Y E;  2OBK A;  5G30 A;  1GUK A;  5CAX A;  4OMV A;  5KN1 A;  2ZCT A;  3H4K A;  3G7Y A;  2H0G A;  5J40 A;  4GXZ A;  1TK0 B;  1XWB A;  1SYR A;  3A2W A;  2HFD A;  2K9F A;  4YAP A;  2A4H A;  3GMF A;  5F0G A;  4YQV A;  4ZBD A;  1SK0 A;  4BVX B;  3IK9 A;  4DSR A;  3LXT A;  1Z6M A;  1TRS A;  2LJR A;  4K7I A;  2X8G A;  2JSZ A;  3PIN A;  4ID0 A;  2WDU A;  1R4W A;  1TU7 A;  2PVQ A;  1EP8 A;  4PUR A;  5ECM B;  5D9X A;  3HVV A;  4OD7 A;  2FCH A;  2VL9 A;  2YPM A;  3MWH A;  1UVZ A;  2LQQ A;  1QFN A;  3WD6 A;  4ECI A;  3BOA A;  4QQ7 A;  2KP1 A;  4N30 A;  3GNJ A;  2ZUP A;  1Z6N A;  3ED3 A;  2LJA A;  2B5E A;  1JZW A;  2CVD A;  2H6Z A;  5JWQ B;  4N3Z A;  2HZE A;  2VCX A;  5CNW A;  3IA1 A;  3WGX A;  3J7Y b;  4Q5Q A;  5H5Q A;  4V2M A;  4XS1 A;  3G7J A;  2WB9 A;  4XCS A;  2PBJ A;  3GTU B;  1GTA A;  2DIZ A;  4ZXG A;  5ID2 A;  2LNT A;  3KP8 A;  1TKD B;  4EKZ A;  3PGT A;  4PNG A;  3M9K A;  2IWT A;  4KSM A;  5ECH B;  3LOR A;  3DWV A;  1N2A A;  2AV4 A;  2KHP A;  1O81 A;  4EF0 A;  1FAA A;  2HYX A;  3HCZ A;  2EFD A;  5AIV A;  3GV1 A;  1YJ6 A;  4F0C A;  1GSD A;  2YZU A;  4K0N A;  2HRA A;  2HZF A;  1SL0 B;  3IHG A;  1DE1 A;  4G0I A;  5CP1 A;  2CZ3 A;  3DD3 A;  5DCH A;  5B6M A;  3IC8 A;  3MNG A;  3KMO A;  5DAL A;  4XS4 A;  3ZIV A;  3D21 A;  4JED A;  5A5H A;  2IL3 A;  2O7K A;  2XC2 A;  3TOU A;  2IME A;  3I43 A;  10GS A;  5G5F A;  5DJL A;  4Q5R A;  2MBS A;  4YKG A;  3VUR A;  3RPN A;  4WBR D;  4QMK A;  1AQX A;  2DML A;  2E2M A;  2M72 A;  2OAC A;  5J4Y A;  4WXT A;  1PRX A;  1ABA A;  4TXV A;  2ALB A;  1JLV A;  2DMM A;  1T7P B;  2F3M A;  2R4V A;  5G1L A;  3H79 A;  4WR4 A;  2NVL A;  5ENU A;  4K9Z A;  3IPZ A;  4TVE A;  1GLP A;  2B1L A;  4JU5 A;  3M1G A;  1OC3 A;  1R5P A;  1JZO A;  2RLI A;  5IMA A;  3EYT A;  2I3Y A;  3P8W A;  1ZMA A;  3GKK A;  1UA5 A;  4YH2 A;  3DIE A;  4F82 A;  4O5U A;  3C73 A;  1JFU A;  4D73 B;  4HJ2 A;  5DVB A;  4ML6 A;  2OAD A;  1XOB A;  1BED A;  4KB3 A;  4ECC A;  3LWA A;  1EEM A;  5FT3 A;  3IK7 A;  3GHA A;  4EXJ A;  1ZYN A;  1PKZ A;  3VFI A;  2HNL A;  2VD1 A;  2J23 A;  1V57 A;  3RDW A;  5A1N B;  2YOI A;  1H75 A;  2I81 A;  3TU3 B;  3KJY A;  5CRW A;  4QL7 A;  2KOK A;  2KLX A;  3TKR A;  5AN1 A;  1HNB A;  1A2J A;  4ML1 A;  4WEY A;  2L6D A;  2DLX A;  2B7K A;  1V40 A;  2G0F A;  4OCF A;  1BG5 A;  1SD8 A;  3LXZ A;  2DJ1 A;  5IPH A;  3VK9 A;  4PUF C;  3F4S A;  3W8S A;  3L9S A;  4ISD A;  5F8B A;  5C00 A;  2L59 A;  2FY6 A;  4K7N A;  1IYI A;  1W89 A;  4Z2U A;  1ON4 A;  4O5Q A;  3E9J B;  2GQK A;  2VAF A;  1AQW A;  1ERW A;  2N5F A;  3KM6 A;  2H0H A;  3C8E A;  2YCD A;  1M99 A;  1QQ2 A;  3FRC A;  3A5W A;  4MJA A;  2EIR A;  3DML A;  1TI3 A;  4KDX A;  2HZE B;  1H4O A;  5EY6 A;  2ES7 A;  2BMX A;  2CX3 A;  6GSW A;  1SKW B;  1PL2 A;  4ZB7 A;  1TW9 A;  1UC7 A;  5J4U A;  4POL A;  1NHO A;  1JLW A;  1WE0 A;  2BTO T;  3PPU A;  2VD0 A;  1PSQ A;  4EDZ A;  1HNA A;  2EIQ A;  2F9S A;  3ZYW A;  3VWX A;  2C1Y A;  1TXU A;  4IP6 A;  2IMK A;  1XWA A;  1KBN A;  2CVB A;  4ECJ A;  3TKS C;  4AJ8 A;  2FWH A;  1C72 A;  4PUA A;  4NPB A;  5IOX A;  2YV7 A;  3GRX A;  5HR2 A;  4MK3 A;  1HYU A;  4YKF A;  1DE2 A;  1XVW A;  2DIY A;  3KH9 A;  1TK8 B;  2HSY A;  2L5L A;  1N8J A;  3TCO A;  3KIJ A;  1GUM A;  1YEX A;  1GSY A;  5IO0 A;  4MZC A;  2GZZ A;  2YWO A;  5EVO A;  4RUV A;  2HSN A;  3ZL5 A;  5DAL B;  2IMD A;  4XS4 B;  4USS A;  5A5H B;  3W8J A;  5A34 A;  5CO3 A;  6GSS A;  5CRG A;  3UAP A;  1OYJ A;  5GAN D;  1RW1 A;  2EC4 A;  2IMF A;  4HOJ A;  2Z9S A;  3WT1 A;  1GTB A;  5AGY A;  16GS A;  5IPG A;  5JWR B;  4P3Y B;  2QGV A;  5F07 A;  1FVK A;  3FR3 A;  3WYW A;  3C1S A;  2HLS A;  4RI7 A;  5G1K A;  3FZ4 A;  4MDC A;  4GSN A;  3GX0 A;  4IQA A;  5IMC A;  1XWK A;  2PER A;  2FWF A;  5ECO B;  1SJ6 A;  1PMT A;  1AXD A;  1A8Y A;  5GST A;  4EC0 A;  1X5E A;  17GS A;  5CRE A;  4KX4 A;  4KAE A;  3QR6 A;  1Q98 A;  1A2M A;  2B5X A;  5ECS A;  3CMI A;  3K8N A;  3HDC A;  4I6X A;  5HFI A;  2LJK A;  4G01 A;  1EWX A;  1AC1 A;  2JAC A;  5J5N A;  3ZTL A;  2CZ2 A;  3O3T A;  2L4C A;  3D4M A;  1YF0 A;  2LTK A;  3PH9 A;  1QXH A;  2YJ7 A;  2L5O A;  1XZO A;  2QA2 A;  4L0W A;  1KNG A;  3UL3 A;  1TTZ A;  1ZCP A;  3RAZ A;  4K7O A;  4V2L A;  4EIQ A;  3P90 A;  5B8B A;  3HHV A;  3GA4 A;  1PX6 A;  4LMW A;  6GSX A;  4WBJ A;  2H1A A;  2AUV A;  2FHE A;  1KTE A;  3Q74 A;  4JZQ A;  4AJ6 A;  4TXO B;  4TOP A;  1NM3 A;  5DCG A;  1BF5 A;  3RHB A;  2VOC A;  4DSS B;  1PGT A;  1S3A A;  2ON5 A;  4XRA A;  1TOF A;  2L6C A;  3HD5 A;  3SWL A;  2DKI A;  2FUG 2;  1ERT A;  3WGE A;  2I4A A;  4DVC A;  1BJX A;  2VM2 A;  2GQM A;  3U6V A;  5DQS A;  2IIY A;  3BJ5 A;  1FOV A;  2OBI A;  5KN0 A;  2VLV A;  1VF3 A;  2C8U A;  2YJH A;  2AHE A;  4MCU A;  3E0U A;  1OKD A;  4PGT A;  3A3T A;  1TXX A;  1GSE A;  3MAK A;  4AJ7 A;  4J57 E;  2C0D A;  3D0Z A;  5A1N A;  2KP2 A;  4YQU A;  3A2V A;  3IV4 A;  1IYH A;  2XBQ A;  2BJX A;  1YDK A;  1F3B A;  3QAG A;  2LST A;  2O87 A;  3CRT A;  1GUH A;  2K8V A;  3HYP A;  3M0F A;  2YZH A;  4F0B A;  4GCI A;  2XPE A;  4IP1 A;  2FWE A;  2WZ9 A;  4KH7 A;  1F3A A;  3ZZX A;  4PQH A;  2RM6 A;  1Y1U A;  1EV4 A;  1A8L A;  1EOH A;  2F51 A;  1K0A A;  4G9H A;  5J47 A;  3GFK A;  2JSY A;  3HJP A;  3DKS A;  2MMZ A;  1SJZ A;  2PGT A;  4IJI A;  3L4N A;  4GRF A;  2V2G A;  1UN2 A;  4K0G A;  1WOU A;  4IW9 A;  4OWY A;  4WR5 A;  2CV4 A;  5D9T A;  4HQS A;  1X0R A;  3F4T A;  4V2N A;  2FGX A;  1ILO A;  3LYP A;  4HDE A;  5DAK A;  2GSR A;  4BL7 A;  19GS A;  2JL4 A;  3CSH A;  4IVF A;  3ZFB A;  1F9M A;  5GZZ B;  2LUS A;  5H5R A;  2HSN B;  3LGC A;  3L78 A;  2OE0 A;  3VWU A;  3IAM 2;  1K3Y A;  5A34 B;  5JCG A;  1SVM A;  4GSS A;  2MMA A;  3CWG A;  1LU4 A;  4AI6 A;  1HD2 A;  2RM5 A;  1T4Z A;  1SYX A;  4XTS A;  3FR9 A;  1B4Q A;  3GSS A;  3KGK A;  2MMO A;  2QSI A;  1FB6 A;  2F8F A;  2DJK A;  4BA7 A;  1WPI A;  4ILF A;  5A4W A;  3EU4 A;  2CAQ A;  2HRK A;  1O6J A;  1OE8 A;  1XXU A;  4HS1 A;  1QK8 A;  1X9S B;  2HSH A;  2VL3 A;  2H73 A;  2YWI A;  2H1L A;  3QAW A;  1PQN A;  4OO5 A;  1PA3 A;  4PXO A;  3GX8 A;  2OJL A;  1GUL A;  2IPA A;  2LQO A;  4L0U A;  3EUR A;  4GQC A;  2CAI A;  4KDY A;  4MF5 A;  3UAR A;  4NHZ A;  1B9Y C;  3EC3 A;  1EGO A;  4LLR A;  2H1B A;  2FWG A;  4ICY A;  4FIW A;  3C1R A;  3UIW A;  4FO5 A;  3QFB C;  1XPV A;  2YP6 A;  1MD4 A;  1BAY A;  4KDU A;  2JZR A;  4IGJ A;  3FK8 A;  3VWV A;  3R3E A;  2JZS A;  2PU9 C;  2AYT A;  2TIR A;  7GSS A;  2VKZ G;  5EPF A;  3ERW A;  2UV8 G;  3Q19 A;  4NV5 A;  4MZB A;  3QOU A;  4GWR A;  1YKA A;  5IO2 A;  3F4R A;  2CA8 A;  13GS A;  4KND A;  1GSQ A;  3GKX A;  3FY7 A;  4HUA A;  1MEK A;  1NW2 A;  3QFA C;  2XPD A;  3GUR A;  5LNK e;  1WJK A;  2X4A A;  1F6M C;  4MF6 A;  1X5C A;  4J56 E;  4G0K A;  4OFN A;  1V98 A;  2HI7 A;  4K5S A;  3I69 A;  1CQH A;  3CSJ A;  3QAV A;  2OT3 A;  3M3M A;  1T8E B;  3IOS A;  3GST A;  2N5B A;  2P5R A;  4HU9 A;  3L0H A;  3UEM A;  3G7I A;  3ISO A;  4EIP A;  1ZL9 A;  4K1F A;  1GSF A;  1A0R P;  2H19 A;  3MSZ A;  5LCZ A;  5D9V A;  1G0T A;  1R7H A;  2CT6 A;  4EUY A;  1BQ7 A;  3GKN A;  2GVP A;  4NXI A;  5KOW A;  1OC8 A;  1WMJ A;  2PMT A;  3APS A;  4BWS A;  1SK1 A;  5ECI B;  4MPG A;  1DSB A;  2NPB A;  1GLQ A;  3V1W A;  2EFE A;  4EVM A;  4TXO A;  2VCW A;  4IKH A;  3F0I A;  5GSS A;  3MDK A;  4YQM A;  3Q6O A;  4DSS A;  2FA8 A;  4V1A p;  4N0Z A;  4IHU A;  4O5R A;  3O76 A;  3APO A;  3EMX A;  5IIZ A;  1XW9 A;  4X43 A;  2C3N A;  3TOT A;  5EL8 A;  4RQX A;  2AB6 A;  3L9V A;  1T4Y A;  2O5V A;  5DAK B;  4PQI A;  4V1A g;  4BL7 B;  4ZL9 A;  5IM9 A;  2WS2 A;  4TN8 A;  3IE3 A;  2FLS A;  3CYN A;  4KF9 A;  4I2T A;  2A2P A;  3SBC A;  5IOW A;  1XBS A;  1FHE A;  3ZIJ A;  3C7M A;  3TJG A;  1S3C A;  4ZBA A;  2VL2 A;  2DJ0 A;  4HJM A;  1Z3E A;  4IJ3 A;  2GT5 A;  2E2G A;  5HQP A;  3ERG A;  3UMA A;  4E8E A;  2R37 A;  1GSU A;  2VCZ A;  4LA1 A;  2TRC P;  2PUK C;  3GH6 A;  5CRH A;  3FYG A;  1EV9 A;  3NIV A;  4O32 A;  3APQ A;  3GL5 A;  4AKG A;  1GTU A;  1K3O A;  1O85 A;  2HRK B;  5ECK B;  1SKR B;  3F3R A;  3KZQ A;  4MF7 A;  1ERV A;  1FOH A;  4N0V A;  2P31 A;  3TRP A;  3EE2 A;  2F8A A;  4CW9 A;  3DYR A;  5KOX A;  1OAZ A;  4I2U A;  2I1U A;  5DQY A;  3KMN A;  5J9B A;  1AQV A;  1B8X A;  3EPT A;  1TRW A;  3FHK A;  4CHS A;  1V9W A;  6GST A;  5COH A;  3CRU A;  1G7E A;  2H72 A;  1JZD A;  1ZYE A;  3UJ1 A;  1CQG A;  2C4J A;  1XVQ A;  2R3X A;  1ERU A;  3FMW A;  1XW5 A;  1TJD A;  3BCI A;  3HJM A;  4WKW A;  4OFT A;  4N11 A;  2NBS A;  4Q5N A;  4TRX A;  3M8N A;  1V58 A;  4PTS A;  4IQ1 A;  1XFL A;  3Q18 A;  3G9B A;  5ECL B;  4PQ1 A;  2H74 A;  2JZT A;  2I9H A;  2GST A;  2ZNM A;  4DSQ A;  5A5K A;  2IJY A;  3LYK A;  22GS A;  4BPY A;  2KUC A;  4ECB A;  3ZIT A;  4L5O A;  1T00 A;  3CTG A;  2CX4 A;  2QC7 A;  3TGZ A;  1GSS A;  5CYY A;  4OCE A;  3ZVJ D;  1Z7R A;  1URM A;  4AKI A;  1YEP A;  3KTB A;  3HZ8 A;  2V1M A;  4JR6 A;  3MIX A;  5D8I A;  4IEL A;  5E59 A;  1XCC A;  2LKU A;  5AIX A;  1RQM A;  5H5S A;  1U6T A;  3DVW A;  3EIN A;  1YZX A;  2A2R A;  3GL3 A;  2GSS A;  2JAD A;  2X8C A;  3LQ7 A;  3E3E A;  4QL9 A;  3D6I A;  1FW1 A;  4MPF A;  2WRT A;  3UOM A;  1YF1 A;  2B1K A;  1GRX A;  1U87 A;  4X0X A;  4K2X A;  1GNW A;  3IRA A;  4ZL7 A;  4TW5 A;  5A4U A;  4POM A;  4X4J A;  2FA4 A;  1M9A A;  1K0M A;  3CTF A;  3D4T A;  4WF4 A;  1SL2 B;  2YNX A;  2B3S A;  4Z2T A;  2LEG A;  1AIU A;  5ECN B;  3UVT A;  4RI6 A;  3N9J A;  5BRT A;  4GLT A;  3FEU A;  1GH2 A;  3QDN A;  4TKY A;  4ZIJ A;  2R0G A;  3TRX A;  5D93 A;  5KN2 A;  1XWG A;  3TUE A;  3H1N A;  5HR0 A;  4LMV A;  2HRF A;  2LNS A;  2L4Q A;  4F9Z A;  2O85 A;  4OO4 A;  3UVH A;  5D73 A;  5CRD A;  4F03 A;  4AKH A;  1SK2 A;  3M9J A;  2WFC A;  1A23 A;  2YWN A;  2J9H A;  5D96 A;  4FH8 A;  2V32 A;  1AUC A;  3EU3 A;  4OFM A;  2X49 A;  2H30 A;  2X8H A;  2XBI A;  3J7Y k;  2V41 A;  4TR3 A;  4TR1 A;  1TRV A;  1I9D A;  1N25 A;  3WGD A;  2R0C A;  1SKS B;  3ME7 A;  2IN3 A;  4HI7 A;  4J2F A;  1TK5 B;  1O73 A;  2C0G A;  3GIX A;  3DGQ A;  1HNC A;  2FNO A;  4MJB A;  1FVJ A;  1HQO A;  1PKW A;  5F06 A;  5HFK A;  1T3B A;  2N5A A;  3BBY A;  2H76 A;  1M2B A;  1M7T A;  1DBY A;  5ELA A;  1VF4 A;  1PN0 A;  4MA9 A;  5F05 A;  3GN3 A;  1Y25 A;  3LJR A;  2EIO A;  4KGI A;  3UBK A;  3IC4 A;  1FG4 A;  4IBP A;  1Y6E A;  2RUE A;  1QGV A;  2V6O A;  4NHW A;  1OC9 B;  4KCA A;  2PN8 A;  1SVL A;  1DUG A;  4MNN A;  2OA7 A;  4KW6 A;  4POB A;  3TJB A;  2VLT A;  4MZW A;  3N5O A;  1TP9 A;  2JU5 A;  1WIK A;  4RQR A;  3U5R E;  3OR5 A;  4HQZ A;  2VUP A;  2OE1 A;  3KH7 A;  4FQU A;  2DJJ A;  2LRN A;  5IMZ A;  4G2E A;  4BVY A;  1EOG A;  2RII A;  5G31 A;  9GSS A;  2X64 A;  4CY8 A;  4G10 A;  3ZML A;  3LEF A;  1EP7 A;  3BD2 A;  1USB A;  3FKF A;  2D2Z A;  3ERF A;  1O8W A;  2GZY A;  3IDV A;  1XW6 A;  3HY2 A;  4KE3 A;  4KUN A;  1XIY A;  3F6D A;  5HR1 A;  18GS A;  4G19 A;  3FZA A;  3W6G A;  3QCP A;  4FYC A;  2MBT A;  8GSS A;  3IR4 A;  3FW2 A;  4YAV A;  5JWO B;  3GUS A;  1U3I A;  4TR0 A;  4HZ2 A;  3F9U A;  1Q4J A;  1YKC A;  4EE0 A;  2VM1 A;  3HZ4 A;  4EL1 A;  4ZB8 A;  2XHF A;  6GSY A;  3TJK A;  2DC5 A;  2B5Y A;  4MMM A;  3A5I A;  4I5Q A;  2CQ9 A;  1A2L A;  1QMV A;  3RPP A;  3ZLP A;  3JCM L;  1E6B A;  1F37 A;  4ZB6 A;  2C3T A;  4AGS A;  4CY6 A;  2TRX A;  2GS3 A;  4MAB A;  5B8A A;  4POK A;  4H86 A;  1NSW A;  1FB0 A;  3US3 A;  2M46 A;  5ECQ B;  3KCM A;  4MH3 A;  3QPM A;  2GDR A;  2HXK A;  1THO A;  1V2A A;  2GQL A;  3HKR A;  3F6F A;  2E7P A;  4GQF A;  3VPT A;  1ZYP A;  4MH2 A;  3RBT A;  1PD2 1;  1M9B A;  2G2Q A;  3H93 A;  5IMF A;  2H66 A;  3KTL A;  2HSM A;  2IFQ B;  4JE1 A;  4F2I A;  3PR8 A;  3LW9 A;  5JCU A;  1LJR A;  2H1D A;  2H6Y A;  3LG6 A;  2DKH A;  3EWL A;  4IN0 A;  2GSQ A;  3TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...