3W8SA

Crystal structure of monomeric na-gst-3, a glutathione s-transferase from the major human hookworm parasite necator americanus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
VHYKLTYFDGRGAAEIIRQIFVLAGQEYEDIRLSHDEWPKYKNEMPFGQLPVLEVDGKKLAQSFAIARFVAKKFGFAGKCPFEEALVDSITDQYKDFINEIRPFLRVAMGFAEGDLEKLSNEVFLPAREKFFGFMTNFLKESKSGYLVGDSLTFADLYLAECASEFAKKTPTIFDGFPEIKAHAEKVRSNPALKKWIETRPETKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase-3
publication title Structure of monomeric Na-GST-3, a glutathione S-transferase from the major human hookworm parasite Necator americanus.
pubmed doi rcsb
source organism Necator americanus
total genus 74
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3w8sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3w8sA01
1T4YA 1NM3A 3VI5A 3ERWA 1QQ2A 4ML1A 1KBNA 5F05A 2R6KA 3D5JA 4ZL7A 4NV2A 2V2GA 4IN0A 3PGTA 2O8VB 4PQIA 4YQUA 4KCAA 2GTUA 2MZCA 4JZQA 2GS3A 4EXJA 2IL3A 4KX4A 4IP6A 5D73A 1XW9A 2MYGA 4XS6A 3TJKA 3HCZA 5G1LA 5EY6A 1ZMAA 3EVIA 3KGKA 3H93A 3CXGA 4FYUA 6GSUA 3P8WA 3HJPA 3I69A 2J23A 4PUFC 3GTUB 4ZB9A 1PA3A 2L6DA 2H72A 2M46A 1AQWA 1BYEA 3W8JA 3WD6A 3DVXA 3GX0A 5INYA 1ZGNA 4BVYB 2JU5A 5D9VA 2VAFA 3RDWA 1THXA 2V1MA 2E2GA 2GQLA 2OE1A 4QL7A 1G6YA 1M0UA 5H5SA 2A4VA 1ERTA 5C04A 4MF6A 4NAXA 2LKUA 3GX8A 1Y6EA 6GSYA 4ECCA 5B6MA 3IC8A 3H79A 3FR3A 5CRDA 3LEFA 4AJ8A 4XTSA 4WF4A 4ULXA 3GKXA 3IBHA 4AJ6A 1TU7A 3GTUA 3KIJA 3W6GA 3VURA 1IYHA 1GTIA 3TKSE 1BJXA 3HY2A 5AGYA 1ERVA 1PX7A 1GL8A 2R37A 4NV5A 3WGXA 2H71A 3ME7A 4BVYA 2C0EA 1FOVA 3RPPA 2WB9A 3BCKA 3OR5A 4MK3A 1S3CA 2FCHA 5IMFA 1SU9A 3QMXA 2YANA 4ISDA 5F8BA 1MDKA 1HNBA 5HFIA 2KHPA 1TI1A 1Z5YE 4IVFA 5B7CA 5CO3A 3TRXA 4KDXA 5D9TA 4F9ZA 2VOCA 3CSHA 4L0WA 3ZMKA 4MJAA 4GSNA 3W8SA 3VK9A 2B5XA 2LTKA 3VWUA 1EEMA 2VCXA 1F6MC 1SL1B 4I8BA 1GNEA 3O76A 3RHBA 3MNGA 3KJYA 1QUWA 3KH9A 4PUAA 1PMTA 2QGVA 5BMUA 1PKZA 1C72A 3EMXA 3Q18A 5ECSA 3LWAA 2VD0A 1MEKA 2YPMA 5IPGA 4OCFA 1TXXA 4ZL8A 4EKZA 2TIRA 5J9BA 4IP1A 4EUYA 3LGCA 3BJ5A 3C71A 1XPVA 3QR6A 3ZZXA 2GSRA 4YAVA 1EOHA 3JCML 3ZITA 1GSYA 2PVOC 5CREA 3LYPA 4MJBA 2HYXA 1V2AA 2ALBA 2JL4A 2WULA 3FY7A 4KB3A 2PBJA 2DJ1A 1SK0A 1VRSD 3GNJA 2C0DA 2LRNA 4AF2A 2LS5A 3BOAA 4KE3A 3ZIVA 2AYTA 1K3YA 19GSA 1T4ZA 4JR4A 5CRHA 4DSRA 3NIVA 2P5RA 4USSA 4L8EA 4EDYA 3V1WA 4TKYA 1WWJA 2VIMA 1YKAA 3ERGA 2HRKB 1UA5A 1O8XA 1ST9A 5DCHA 2IMIA 4N0VA 3GN3A 4KGIA 2CZ2A 1PKWA 1J08A 4HU9A 3CYNA 3WGDA 2MBTA 5HR0A 2TRXA 5ECLB 3IA1A 9GSSA 1GSUA 1PL1A 4OWYA 3GA4A 1EGOA 1ZYEA 3TCOA 3ZREA 2DIYA 5IMZA 1GSFA 5B6NA 3RBTA 2IMKA 2PVQA 4BVXB 1EP7A 1NW2A 1XVQA 3F6DA 2CQ9A 4MZBA 3HJOA 2MMOA 2JZTA 2EC4A 2E0QA 3TKQA 4XRAA 1OC8A 1ERUA 5AISA 1ERWA 5ECHB 2A2SA 4OO5A 2R2JA 3GL5A 5F06A 2O85A 4GF0A 1R26A 3M0FA 2H1DA 2HRKA 2DMMA 3C1RA 2GSTA 1YF1A 4ZBDA 4JBBA 5COHA 2I3YA 2Z9SA 4ML6A 2DJJA 3A2VA 2PN8A 4G19A 2LJRA 4LL1B 4J56E 3GHAA 1SYXA 2OBKA 5ABRA 2C1YA 3EYTA 2B7JA 1K0CA 5KN3A 4BVXA 1XOAA 4D73B 3CBUA 1SK2A 5DALB 3FRCA 5ECQB 2OKAA 22GSA 2OA7A 2WFCA 1M2AA 3EU3A 4GQFA 3EWLA 4ZB8A 2R5GA 5DAKB 5DVBA 1PSQA 4K7IA 1SD9A 3ZTLA 3TRPA 1SYRA 4X1UA 3J7Yb 1XXUA 4P3YB 3TGZA 2H75A 2VLVA 3QD9A 4TN8A 1UC7A 1KEBA 5EPFA 2JACA 2B1LA 2FHEA 2H6YA 1TK8B 3QDNA 3UVHA 3F63A 2OADA 3J7Yk 2JZSA 1IYIA 1QGVA 2IPAA 3FR6A 3DMLA 3HD5A 4OO4A 1J0FA 4L0UA 1MD3A 1EV9A 4IKHA 3ZMLA 2HE3A 1PL2A 2B5EA 1Z9HA 3VI7A 3UBLA 3EINA 4MLYA 2OE3A 1OE8A 4KDYA 3IE3A 2V6KA 4KA0A 1GSQA 1FO5A 4Q5NA 4D73A 1JLVA 3UVTA 3M8NA 3LXZA 1HNCA 3E0UA 3GIXA 2FWHA 2M80A 2EIOA 2M72A 3VPTA 1AXDA 4GWRA 1GSEA 4DEJA 2L5LA 2NPBA 3D21A 4K1FA 3ZRDA 2MBSA 1TDIA 3C73A 3HKRA 4MP4A 3GYKA 5G5FA 4K0NA 3IV4A 5GZZB 3DYRA 4XS1A 2FWGA 4L5OA 5D9XA 1JZDA 1YKCA 1HD2A 2H30A 1V40A 5IMDA 4ZXGA 5ID2B 2RLIA 4KSOA 4HS1A 4K7NA 1S3DA 4ZIJA 3P90A 10GSA 4XS4A 4E8EA 1M9AA 3I6AA 1E6BA 4KH7A 1UVZA 1YEPA 1XWCA 5HFGA 2LNSA 4HUAA 4JRRA 2GLRA 1PD21 3IK7A 4E8HA 4IGJA 3PPUA 5ECRB 3D22A 1W4VA 4BL7A 2KP1A 1HYUA 5AIXA 2WRTA 3DGQA 2ON5A 1N8JA 2N5BA 3HDCA 4TVEA 2L4QA 3GKKA 2VL2C 2B5YA 3GH9A 2X8HA 4PNGA 5HFKA 2WCIA 1K0MA 4CDOA 1V57A 5FHIA 2I81A 2WJUA 1GP1A 3UBKA 5IM9A 4HJ2A 5IO0A 2YZUA 3BBYA 2YJHA 1SKSB 2H0HA 2YN1A 5ECIB 3FHKA 1A2MA 5ID2A 5IOXA 4G0KA 1OKTA 3I43A 3VLNA 1WOUA 3UL3A 2YZHA 4CHSA 1JZOA 4JU5A 1X9SB 1PQNA 2FD3A 1PGTA 1WMJA 5DJLA 4TW5A 3LG6A 3KXOA 5DBQA 5KN2A 2QKEA 3C8EA 1LJRA 3KP9A 1XW6A 1GULA 1BQ7A 1SK1A 3VWXA 2D2ZA 1THOA 5IO2A 1U6TA 3TDGA 3ZIJA 5G31A 1QFNA 5DQYA 1Z7RA 4HDEA 1BAYA 2LQOA 3Q6OA 4N0ZA 5FT3A 2PMTA 2NBSA 1SL2B 3QAWA 3KZQA 2WZ9A 3CTFA 1T00A 3DXBA 2JSZA 4TXOB 2VO4A 1ON4A 2I1UA 3AY8A 2WGRA 1K0DA 5CP1A 4I5QA 1PX6A 4BWSA 3ISOA 4AGSA 2I9HA 4ZILA 4LL4B 2H74A 3GV1A 1TOFA 4QL9A 2H19A 1GTAA 1GSDA 2DMLA 2QSIA 4YH2A 1JFUA 4ECIA 2HT9A 4TOPA 1USBA 3KM6A 2VL2A 4POLA 2ZCTA 3KEBA 3HZ4A 5JWQB 1URMA 2K8SA 4FIWA 4FYBA 5IMCA 4OD7A 4TR0A 3MWHA 5A5KA 4X43A 2TRCP 3KMOA 1U87A 3KTBA 3LFLA 2AHEA 2IMDA 4POMA 3UEMA 3TOTA 4WXTA 4FH8A 3EU4A 3C7MA 6GSVA 4K9ZA 4HU7A 2C8UA 4TXOA 5EL8A 1R5AA 4MH3A 3E3EA 4F2IA 3HJMA 2H0GA 2DJ0A 3FR9A 3D6IA 2JADA 4BPYA 2H73A 5ECNB 2BTOT 3RHCA 1Y25A 2GQKA 5IMAA 1B8XA 4TR1B 3APOA 1SJIA 1AW9A 1KTEA 1YEXA 3DIEA 1WPIA 3WGEA 3QAGA 2BJXA 4EL1A 1YDKA 2MMNA 4O32A 2C3QA 3VFIA 2C80A 4NWYA 1FVJA 3EC3A 4KF9A 2P0GA 4WKWA 1EZKA 4MF5A 5LD0A 3ZLPA 1K3OA 1A0RP 1F9MA 1JZRA 2PGTA 2VM1A 1K3LA 4ILFA 1Z7PA 1O8WA 1GNWA 1OAZA 2GZPA 1T7PB 5IQYA 4YQVA 4KW6A 2F51A 2LSTA 3IR4A 2F9SA 4TR1A 1OE7A 2H66A 4KNDA 16GSA 1WIKA 4EVMA 2BMXA 2EIQA 1TK5B 4HEA2 3S9FA 2DJKA 4ID0A 2O89A 1O81A 4O92A 1QMVA 1U88A 1GRXA 20GSA 5AIVA 1AC1A 1U3IA 4EE0A 3DKSA 4XRDA 4IELA 2HLSA 4NPBA 4Q5RA 2XBIA 5CRGA 4YAPA 1NSWA 1N2AA 1F37A 2JZRA 3IAM2 2G2QA 2K6VA 2J9HA 3M3MA 2DIZA 4NHWA 7GSSA 1AQXA 4FYCA 3TB2A 2MMAA 3HA9A 3GKMA 2V41A 2CAQA 4EDZA 2JSYA 4KUNA 3LXTA 4I2UA 3FKFA 18GSA 4LMWA 3LQ7A 1B48A 2ON7A 2GQMA 2RIIA 4V2MA 5D93A 4PGTA 1XFLA 2ZUPA 1TRSA 1TKDB 3UAPA 2R3XA 4X0XA 1DBYA 4OFMA 4WEYA 4Q5FA 2GVPA 1MDJA 4EO3A 2H8LA 5H5RA 4F82A 1SKRB 4L5LA 5KEJA 5J41A 1XVWA 3CRUA 5B8BA 1KNGA 4AJ7A 5DJMA 2FNOA 2GT5A 3L4NA 4IBPA 5H5QA 1YJ6A 4MA9A 1MDIA 2H70A 1G6WA 5E59A 3VPQA 2LEGA 3NZNA 2YV7A 5HR3A 4PQHA 1B9XC 4YQMA 2ES7A 5ENUA 3IC4A 4I2TA 5HQPA 3O3TA 4HOJA 2DSAA 2REMA 3P7XA 2PERA 1T3BA 3TKRA 2C0GA 2L5OA 2F8AA 3F6FA 3A2WA 3FW2A 3DVWA 1SJZA 5DDLA 1FAAA 2KOKA 3VWWA 3QAVA 5ELGA 4FQUA 1FB0A 4NXIA 2CVDA 1OC3A 1JLWA 1M9BA 4PTSA 3HXSA 2GSQA 3M9KA 2GZZA 2CV4A 1RW1A 4XS4B 1XIYA 4QQ7A 1I9DA 1BG5A 3QFBC 4GRFA 1A8LA 4MF7A 4ZB6A 5KN1A 5CAXA 4N11A 4HQSA 5FWGA 3FZAA 3M1GA 3GMFA 4MZWA 5F0GA 2QC7A 1F3BA 1ZCPA 4BL7B 3UMAA 4GSSA 2VUPA 1VGLA 4V1Ap 4KCEA 2H1BA 2K9FA 3TJJA 1V98A 1M7TA 2YWIA 2VCQA 3HZ8A 1XZOA 3CSIA 3LORA 4ZBBA 1FVKA 2IMFA 3KD0A 1B4QA 1A23A 1O6JA 3UJ1A 3ZYWA 5J9CA 4NHZA 5ECMB 3FZ9A 3KCMA 3GL3A 3IOSA 4BA7A 4NMUA 2P5QA 1T1VA 5JCGA 2YCDA 2GZYA 6GSSA 1O73A 5D96A 3TJFA 4I6XA 2LJKA 1EGRA 5JWRB 1SENA 4KSMA 5G30A 1GUHA 1K0OA 5EVOA 3TJBA 1G7EA 4K8MA 3G7YA 3ZVJD 3MDKA 2N5FA 5ECOB 1G7OA 1TRVA 3P2AA 2YOIA 1GWCA 4BWQA 4N30A 1GTUA 5F07A 2C3NA 2YWMA 3IK9A 3KMNA 1FB6A 2IFQB 2IJYA 3PR8A 4TR3A 2IMEA 2CAIA 2E2MA 3TUEA 2YNXA 1WP0A 4JR6A 3GSSA 2HSMB 4MPGA 3A2XA 3VWVA 3A3TA 6GSXA 2HSNB 4K7OA 2H1GA 2VCVA 3G7IA 5HR1A 2FUG2 2VL3A 1OVNA 3GSTA 4HZ4A 1SJ6A 4J2FA 4JEDA 1EWXA 1ZZYA 1JHBA 2DLXA 1F2EA 1RK4A 1VF4A 4PURA 1O7UA 3U5RE 2FY6A 4N10A 4K0GA 2YJ7A 2E7PA 2NVLA 4Q5QA 1BEDA 3N5OA 3QFAC 2P31A 3Q19A 2HNLA 2LRTA 4WBJA 3FZ4A 5B8AA 3K8NA 4IJ3A 2HQTA 2K8VA 2IFQA 2K18A 1ABAA 4IJIA 2MMZA 2AUVA 5LCZA 2AAWA 1EOGA 3EMPA 5L71A 1WE0A 1DE2A 2HSMA 3NOFA 2HZEB 1H75A 2X8GA 2H76A 3G7JA 3MAKA 2EIRA 3L9SA 1CQHA 2PWJA 1TJDA 4J57E 5A4VA 3FYGA 1W89A 11GSA 2XPEA 3GH6A 5J5NA 4MDCA 2YWNA 4HJMA 1VF2A 2O87A 1T8EB 2PPTA 2A2RA 5J4UA 1EV4A 4GCIA 4XCSA 2HRFA 1DE1A 1A0FA 4PXOA 3L9VA 3IAS2 2VL9A 1Q4JA 3TKSC 2XPDA 8GSSA 1TI3A 2XC2A 1FHEA 5D9WA 3GUSA 3FK8A 3IHQA 3GURA 4PX1A 2DJ3A 4IQAA 4O7HA 1FG4A 3H8QA 2IWTA 3KP8A 3RAZA 12GSA 2NDOA 4LA1A 5LNKe 2HZEA 1PN9A 4V2LA 4HI7A 5A4UA 4H86A 4XHMA 4PNFA 1DSBA 2VD1A 2VM2A 3D0ZA 2L59A 2XBQA 2I4AA 6GSTA 2CT6A 2OJLA 5ECKB 1XCCA 2L4CA 2FA8A 1I5GA 1GUKA 4ACSA 1YZXA 4EC0A 2KP2A 2CVKA 4G0LA 5ECPB 4MCUA 4TXVA 2DBCA 5G1KA 5CYYA 4IHUA 1X0RA 1GTBA 1X9MB 2H6XA 1A24A 2VCTA 1PRXA 1UN2A 2B1KA 5AN1A 2H1AA 1YY7A 1K0BA 3I9V2 4K2DA 4POKA 1BX9A 1A2JA 1NHOA 4RI7A 4OCEA 1TW9A 1HQOA 1Z6NA 2VCWA 3N9JA 4XIHA 1XWAA 4OFNA 1G0TA 1GLPA 3HVXA 3QOUA 4ECJA 1WRYA 3ZFBA 2H01A 4Z7XA 1NHYA 2HI7A 1QXHA 1OYJA 3ZVJA 4IS0A 2AV4A 1A2LA 1TU8A 1ACVA 5G5EA 1E2YA 5C00A 1HNAA 3F8UA 4HZ2A 3DD3A 14GSA 2FLSA 2C4JA 2RUEA 2LQQA 5GAPD 3F4RA 2LJAA 3F4SA 3IPZA 1X5CA 2NTOA 3L0HA 2B3SA 1SKWB 4ECBA 1A8YA 2H6ZA 4GLTA 5J3RA 3TKSA 1GLQA 4POBA 3FZ5A 4G0IA 3WT2A 2CVBA 3BCIA 3UIWA 5IOWA 2YWOA 2LUSA 2FA4A 1XBSA 2HZFA 4MPFA 1K0AA 4GQCA 3ERFA 2OBIA 1O85A 1ILOA 3HYPA 4RI6A 1V9WA 1VF3A 3KTLA 1TRWA 2RUFA 5HR2A 3EURA 2CA8A 3CSJA 3RPNA 3APSA 5GSTA 4G9HA 3F0IA 2GGTA 3R3EA 3H1NA 2HSHA 2KLXA 3DWVA 4MZCA 3HVSA 5A4WA 3CTGA 1TRUA 4TRXA 1AQVA 3LJRA 5IPHA 1Q98A 4F0BA 2RM6A 1AAZA 2PUKC 1ZYQB 1R4WA 1B4PA 1Z3EA 6GSWA 3SBCA 3WYWA 1H4OA 3CRTA 1ZL9A 2IIYA 3ED3A 1ZOFA 1QK8A 2DC5A 3G9BA 4RQXA 3L9UA 5JWOB 2X64A 3D4MA 1R5PA 2X8CA 3SWLA 3D4TA 3WT1A 3BD2A 1J9BA 4CW9A 1XWGA 5CNWA 4MH2A 2GT6A 2O7KA 1MD4A 4JE1A 2VLUA 4DSSB 1VF1A 3TJGA 13GSA 4MJEA 2XHFA 4KDUA 1SD8A 3M9JA 3QCPA 1XWKA 3DRNA 3R2QA 4FO5A 2PU9C 4GTUA 4RQRA 3GKNA 1OC9B 4MMMA 3ME8A 2OACA 1GSSA 2FWFA 3F3RA 4LLRA 2B7KA 4MABA 4F03A 2DJ2A 1M2DA 5G2ZA 3HVVA 4G10A 4DSQA 5DCGA 4GXZA 3A5WA 3LYKA 2ZNMA 4V2NA 2G0FA 5GSSA 4WETA 3APQA 5JCUA 3C1SA 1U3AA 2RM5A 2FGXA 3HHVA 1XW5A 2CX3A 2L57A 1XOBA 3U6VA 1X9WB 4DSSA 1M2BA 3PH9A 1LBKA 4G2EA 4O5RA 2F3MA 1K0NA 5GAND 1R7HA 2GSSA 1EEJA 2HRNA 1WJKA 4WR5A 1AUCA 2AB6A 2HRAA 2WDUA 2AJQB 4OFTA 4IW9A 4EF0A 3F9UA 3Q74A 4DVCA 5KN0A 2VLTA 2LRCA 2N5AA 3ZFLA 3LSZA 3H4KA 1OC9A 1LU4A 1OKDA 3IXRA 3QPMA 2B6MA 1S3AA 5ELAA 1CQGA 4LMVA 3TRQA 3TOUA 4K6XA 3TKPA 3UARA 3F4TA 1X5EA 2YP6A 3O6TA 4ZL9A 2F8FA 5D8IA 2LNTA 3GFKA 1JZWA 4ZBAA 2WS2A 3MSZA 2VCZA 1SL0B 1YQ1A 5DQSA 4OMVA 1RQMA 1TP9A 5DALA 5E4WA 4GSTA 2CZ3A 4KAEA 3F3QA 1DUGA 5DAKA 1V58A 2YV9A 1EP8A 2LV3A 3PINA 2IN3A 1F3AA 2GDRA 1M99A 3UOMA 3FEUA 2X99A 5JCWA 4IQ1A 3GRXA 4WR4A 1YF0A 1TK0B 4MJCA 3US3A 3KH7A 4PQ1A 2H0IA 1MTCA 1ML6A 3E9JB 5CRWA 4HQZA 3IRAA 1B9YC 2FWEA 2L6CA 2R4VA 1GUMA 4F0CA 4RUVA 4WF5A 3ZL5A 2C0FA 4V1Ag 5IIZA 4TR4A 1TTZA 2KUCA 5IMVA 3L78A 2HXKA 3IDVA 2HFDA 1FW1A 2CX4A 4WBRD 2UZ8A 3CMIA 1GH2A 3EE2A 2V6OA 1Z6MA 3DEXA 4I97A 17GSA 2HSYA 2C3TA 1XWBA 1AIUA 2OE0A 2V32A 1X5DA
chains in the Genus database with same CATH superfamily
1T4YA 1NM3A 3VI5A 3ERWA 1QQ2A 4ML1A 1KBNA 2QA2A 5F05A 2R6KA 3D5JA 4ZL7A 4NV2A 2V2GA 4IN0A 3PGTA 2O8VB 4PQIA 4Z2TA 4YQUA 4KCAA 2GTUA 2MZCA 4JZQA 2GS3A 4EXJA 2IL3A 4KX4A 4IP6A 5D73A 1XW9A 2MYGA 4XS6A 3TJKA 3HCZA 5G1LA 5EY6A 1ZMAA 3EVIA 3KGKA 3H93A 3CXGA 4FYUA 6GSUA 3P8WA 3HJPA 3I69A 2J23A 4PUFC 3GTUB 4ZB9A 1PA3A 2L6DA 2H72A 2M46A 1AQWA 1BYEA 3W8JA 3WD6A 3DVXA 4EIPA 3GX0A 5INYA 1ZGNA 4BVYB 3HVNA 1YEWC 2JU5A 5D9VA 2VAFA 3RDWA 1THXA 2V1MA 2EFCA 2E2GA 2GQLA 2OE1A 4QL7A 1G6YA 1M0UA 5H5SA 2A4VA 1ERTA 5C04A 4MF6A 4NAXA 2LKUA 3GX8A 1Y6EA 6GSYA 4ECCA 5B6MA 4PI0C 3IC8A 3H79A 3FR3A 5CRDA 3LEFA 4AJ8A 4XTSA 4WF4A 4ULXA 3GKXA 4CY6A 3IBHA 4AJ6A 1TU7A 3GTUA 3KIJA 3W6GA 3VURA 1IYHA 1GTIA 4K5SA 3TKSE 1BJXA 3HY2A 5AGYA 1ERVA 1PX7A 1GL8A 2R37A 4NV5A 2R0CA 3WGXA 2H71A 3ME7A 4BVYA 2C0EA 1FOVA 3RPPA 2WB9A 3BCKA 3OR5A 5BMUB 4MK3A 4AKIA 1S3CA 2FCHA 5IMFA 1SU9A 3QMXA 2YANA 4ISDA 5F8BA 1MDKA 1HNBA 5HFIA 2KHPA 1TI1A 1Z5YE 5A34B 4IVFA 5B7CA 5CO3A 3TRXA 4KDXA 5D9TA 4F9ZA 2VOCA 3CSHA 4L0WA 3ZMKA 4MJAA 4GSNA 3W8SA 3VK9A 2B5XA 2LTKA 3VWUA 1EEMA 2VCXA 1F6MC 1SL1B 4I8BA 1GNEA 3O76A 3RHBA 3MNGA 3KJYA 1TXUA 2WW0A 1QUWA 3KH9A 4PUAA 1PMTA 2QGVA 5BMUA 1PKZA 1C72A 3EMXA 3Q18A 5ECSA 3LWAA 2VD0A 1MEKA 2YPMA 2X4AA 5IPGA 4OCFA 1TXXA 5A34A 4ZL8A 4EKZA 2TIRA 5J9BA 2WW2A 4IP1A 4EUYA 3LGCA 3BJ5A 3C71A 1SVMA 1XPVA 3QR6A 3ZZXA 2GSRA 1SVLA 4YAVA 1EOHA 3JCML 3ZITA 1GSYA 2PVOC 5CREA 3LYPA 4MJBA 2HYXA 1V2AA 2ALBA 2JL4A 2WULA 3FY7A 4KB3A 2PBJA 2DJ1A 1SK0A 5KOXA 1VRSD 3GNJA 2C0DA 2LRNA 4AF2A 2LS5A 3BOAA 4KE3A 3ZIVA 2AYTA 1K3YA 19GSA 1BG1A 1T4ZA 4JR4A 5CRHA 4DSRA 3NIVA 2P5RA 1ZYPA 4USSA 5J4VA 4L8EA 4EDYA 3V1WA 4TKYA 1WWJA 2VIMA 1YKAA 3HMJG 3ERGA 2HRKB 1UA5A 1O8XA 1ST9A 5DCHA 2IMIA 4N0VA 3GN3A 4KGIA 2CZ2A 1PKWA 1J08A 4HU9A 3CYNA 3WGDA 2MBTA 5HR0A 2TRXA 5ECLB 3IA1A 9GSSA 1GSUA 1PL1A 4OWYA 3GA4A 1EGOA 1ZYEA 3TCOA 3ZREA 2DIYA 5IMZA 1GSFA 5B6NA 3RBTA 2IMKA 2PVQA 4BVXB 1EP7A 1NW2A 1XVQA 3F6DA 1SVOA 3LW9A 2CQ9A 4MZBA 3HJOA 2MMOA 2JZTA 2EC4A 2EFDA 2E0QA 3TKQA 4XRAA 1OC8A 1ERUA 5AISA 1ERWA 5ECHB 2A2SA 4OO5A 2R2JA 3GL5A 5F06A 2O85A 4GF0A 1R26A 4Z2UA 3M0FA 2H1DA 2HRKA 2DMMA 2A4HA 3C1RA 2GSTA 1YF1A 4ZBDA 5A1NB 4JBBA 5COHA 2I3YA 2Z9SA 4ML6A 2DJJA 3A2VA 2PN8A 4G19A 2LJRA 4LL1B 4J56E 3GHAA 1SYXA 2OBKA 5ABRA 2C1YA 3EYTA 2B7JA 1K0CA 5KN3A 4BVXA 1XOAA 4D73B 3CBUA 1FOHA 1Y1UA 1SK2A 5DALB 3FRCA 5ECQB 2OKAA 22GSA 2OA7A 2WFCA 1M2AA 3EU3A 2X49A 3EWLA 4GQFA 4ZB8A 2R5GA 5DAKB 5DVBA 1PSQA 4K7IA 1SD9A 3ZTLA 3TRPA 1SYRA 4X1UA 3J7Yb 1XXUA 4P3YB 3TGZA 2H75A 2VLVA 3QD9A 4TN8A 1UC7A 1KEBA 5EPFA 2JACA 2B1LA 2FHEA 2H6YA 1TK8B 3QDNA 3UVHA 3F63A 2OADA 3J7Yk 2JZSA 1IYIA 1QGVA 5A1NA 2IPAA 3FR6A 3DMLA 3HD5A 3CQFA 2UV8G 4OO4A 1J0FA 4L0UA 1MD3A 1EV9A 4IKHA 3ZMLA 2HE3A 1PL2A 2B5EA 1Z9HA 3VI7A 3UBLA 3EINA 4MLYA 2OE3A 1OE8A 4KDYA 3IE3A 2V6KA 4KA0A 1GSQA 1FO5A 4Q5NA 4D73A 1JLVA 3UVTA 3M8NA 3LXZA 1HNCA 3E0UA 3GIXA 2FWHA 2M80A 2EIOA 2M72A 3VPTA 1AXDA 4GWRA 1GSEA 2O5VA 4MNNA 4DEJA 2L5LA 2NPBA 3D21A 4K1FA 3ZRDA 2MBSA 1TDIA 3C73A 3HKRA 4MP4A 3GYKA 5G5FA 4AKGA 4K0NA 2DKIA 3IV4A 5GZZB 3DYRA 4XS1A 2FWGA 4L5OA 5D9XA 1JZDA 1YKCA 1HD2A 2H30A 1BF5A 1V40A 5IMDA 4ZXGA 5ID2B 2RLIA 4KSOA 4HS1A 4K7NA 1S3DA 4ZIJA 3P90A 10GSA 3CHXC 4XS4A 4E8EA 1M9AA 4AKXB 3I6AA 1E6BA 4KH7A 1UVZA 1YEPA 1XWCA 5KOWA 5HFGA 2LNSA 4HUAA 4JRRA 2GLRA 1PD21 3IK7A 4K2XA 4E8HA 4IGJA 3PPUA 5ECRB 3D22A 1W4VA 4BL7A 2KP1A 1HYUA 5AIXA 2WRTA 3DGQA 2ON5A 1N8JA 2N5BA 3HDCA 4TVEA 2L4QA 3GKKA 2VL2C 2B5YA 3GH9A 2X8HA 4PNGA 5HFKA 2WCIA 1K0MA 4CDOA 1V57A 5FHIA 2I81A 2WJUA 5A5HB 3FMWA 1GP1A 3UBKA 5IM9A 4HJ2A 5IO0A 2YZUA 3BBYA 2YJHA 4N3ZA 1SKSB 2H0HA 2YN1A 5ECIB 3FHKA 1A2MA 5ID2A 5IOXA 4G0KA 1OKTA 3I43A 3VLNA 1WOUA 3UL3A 2YZHA 4CHSA 1JZOA 4JU5A 3A5IA 1X9SB 1PQNA 2FD3A 1PGTA 1WMJA 5DJLA 4TW5A 3LG6A 3KXOA 5DBQA 5KN2A 2QKEA 3C8EA 1LJRA 3KP9A 1XW6A 1GULA 2O36A 1BQ7A 1SK1A 3VWXA 2D2ZA 1THOA 5IO2A 1U6TA 3TDGA 3ZIJA 5G31A 1QFNA 3TU3B 5DQYA 1Z7RA 4HDEA 1BAYA 2LQOA 3EPTA 5A5HA 3Q6OA 4N0ZA 5FT3A 2PMTA 2NBSA 1SL2B 3QAWA 3KZQA 2WZ9A 3CTFA 1T00A 3DXBA 2JSZA 4TXOB 2VO4A 1ON4A 2I1UA 3AY8A 2WGRA 1K0DA 5CP1A 4I5QA 1PX6A 4BWSA 3ISOA 4AGSA 2I9HA 4ZILA 4LL4B 2H74A 3GV1A 1TOFA 4QL9A 2H19A 1GTAA 1GSDA 2DMLA 2QSIA 4YH2A 2WVYA 1JFUA 4ECIA 2WW3A 2HT9A 4TOPA 1USBA 3KM6A 2VL2A 4POLA 2ZCTA 3KEBA 3HZ4A 5JWQB 1URMA 2K8SA 4FIWA 4FYBA 5IMCA 4OD7A 4TR0A 3MWHA 5A5KA 4X43A 2TRCP 3KMOA 1U87A 3KTBA 3LFLA 2AHEA 2IMDA 4POMA 3UEMA 3TOTA 4WXTA 4FH8A 3EU4A 3C7MA 6GSVA 4K9ZA 4HU7A 2C8UA 4TXOA 5EL8A 1R5AA 4MH3A 3E3EA 4F2IA 3HJMA 3RFRC 2H0GA 2DJ0A 3FR9A 3D6IA 2JADA 4BPYA 2H73A 5ECNB 2BTOT 3RHCA 1Y25A 2GQKA 5IMAA 1B8XA 4TR1B 3APOA 1SJIA 1AW9A 1KTEA 1YEXA 3DIEA 1PFOA 1WPIA 3WGEA 3QAGA 2BJXA 4EL1A 1YDKA 2MMNA 4O32A 2C3QA 3VFIA 4ZB7A 2C80A 4NWYA 1FVJA 3EC3A 4KF9A 2P0GA 4WKWA 1EZKA 4MF5A 5LD0A 3ZLPA 1K3OA 1A0RP 1F9MA 1JZRA 2PGTA 2VM1A 1K3LA 4ILFA 1Z7PA 2DKHA 3MYDA 1O8WA 1GNWA 5J47A 1OAZA 3IHGA 2GZPA 1T7PB 5IQYA 4YQVA 4KW6A 2F51A 2LSTA 3IR4A 1ZYNA 2F9SA 4TR1A 1OE7A 2H66A 4KNDA 16GSA 1WIKA 4EVMA 4HSCX 2BMXA 2EIQA 1TK5B 4HEA2 3S9FA 2DJKA 4ID0A 2O89A 1O81A 4O92A 1QMVA 1U88A 1GRXA 20GSA 5AIVA 1AC1A 1U3IA 1XG8A 4EE0A 3DKSA 4XRDA 4IELA 2HLSA 4NPBA 4Q5RA 2VKZG 2XBIA 5CRGA 4YAPA 1NSWA 4BIKA 1N2AA 1F37A 2JZRA 3IAM2 2G2QA 2K6VA 2J9HA 3M3MA 2DIZA 1S4BP 4NHWA 7GSSA 1AQXA 4FYCA 3TB2A 2MMAA 3HA9A 3GKMA 2V41A 2CAQA 4EDZA 2JSYA 4KUNA 3LXTA 2O3EA 4I2UA 3FKFA 18GSA 4LMWA 3LQ7A 1B48A 2ON7A 2GQMA 2RIIA 4V2MA 5D93A 4PGTA 1XFLA 2ZUPA 1TRSA 1TKDB 3UAPA 2R3XA 4X0XA 1DBYA 4OFMA 4AI6A 4WEYA 4Q5FA 2GVPA 1MDJA 4EO3A 4O5QA 2H8LA 5H5RA 4F82A 1SKRB 4L5LA 5KEJA 5J41A 1XVWA 3CRUA 5B8BA 1KNGA 4AJ7A 5DJMA 2FNOA 2GT5A 3L4NA 4IBPA 5H5QA 2WVXB 1YJ6A 2WW1A 4MA9A 1MDIA 4PI2C 2H70A 1G6WA 5E59A 3VPQA 2LEGA 3NZNA 2YV7A 5HR3A 4PQHA 1B9XC 4YQMA 2ES7A 5ENUA 3IC4A 4I2TA 5HQPA 3O3TA 4HOJA 2DSAA 2REMA 3P7XA 2PERA 4G01A 1T3BA 3TKRA 2C0GA 2L5OA 2F8AA 3F6FA 3A2WA 3FW2A 3DVWA 1SJZA 5DDLA 1FAAA 2KOKA 3VWWA 3QAVA 5ELGA 4FQUA 2EFHA 1FB0A 4NXIA 2CVDA 1OC3A 1JLWA 1M9BA 4PTSA 3HXSA 2GSQA 1YVLA 3M9KA 2GZZA 2CV4A 1RW1A 4XS4B 2WVXA 1XIYA 4QQ7A 2WVZA 1I9DA 1BG5A 3QFBC 4GRFA 1A8LA 4MF7A 4ZB6A 5KN1A 5CAXA 4N11A 4HQSA 5FWGA 3FZAA 3M1GA 3GMFA 4MZWA 5J40A 5F0GA 2QC7A 1F3BA 4Z2RA 1ZCPA 4BL7B 3UMAA 4GSSA 2VUPA 1VGLA 4V1Ap 4KCEA 2H1BA 2K9FA 3TJJA 1V98A 1M7TA 2YWIA 2VCQA 3HZ8A 1XZOA 3CSIA 3LORA 4ZBBA 1FVKA 2IMFA 3KD0A 1M3IA 1B4QA 1A23A 1O6JA 3UJ1A 3ZYWA 5J9CA 4NHZA 5ECMB 3FZ9A 3KCMA 3GL3A 3IOSA 4BA7A 4NMUA 2P5QA 1T1VA 5JCGA 2YCDA 2GZYA 6GSSA 1O73A 5D96A 3TJFA 4I6XA 2LJKA 1EGRA 5JWRB 1SENA 4KSMA 5G30A 1GUHA 1K0OA 5EVOA 3TJBA 1G7EA 4K8MA 3G7YA 3ZVJD 3MDKA 2N5FA 5ECOB 1G7OA 1TRVA 3P2AA 2YOIA 1GWCA 4BWQA 4N30A 1GTUA 5F07A 2C3NA 2YWMA 3IK9A 3KMNA 1FB6A 2IFQB 2IJYA 3PR8A 4TR3A 2IMEA 2CAIA 2E2MA 2OT3A 3TUEA 2YNXA 1WP0A 4JR6A 3GSSA 2HSMB 4MPGA 3A2XA 3VWVA 3A3TA 6GSXA 2HSNB 4K7OA 2H1GA 2VCVA 3G7IA 5HR1A 2FUG2 4A5PA 4QMKA 2VL3A 1OVNA 3GSTA 4HZ4A 1SJ6A 4J2FA 4JEDA 1EWXA 1ZZYA 1JHBA 2DLXA 1M3JA 1F2EA 1RK4A 1VF4A 4PURA 1O7UA 3U5RE 2FY6A 4N10A 4K0GA 2YJ7A 2E7PA 2NVLA 4Q5QA 1BEDA 4X4JA 3N5OA 3QFAC 2P31A 3Q19A 2HNLA 2LRTA 4WBJA 3FZ4A 5B8AA 3K8NA 4IJ3A 2HQTA 2K8VA 2IFQA 2K18A 1ABAA 4IJIA 2MMZA 2AUVA 5LCZA 2AAWA 1EOGA 3EMPA 5L71A 1WE0A 1DE2A 2HSMA 4E68A 3NOFA 2HZEB 1H75A 2HSNA 2X8GA 2H76A 3G7JA 3MAKA 2EIRA 3MIXA 3L9SA 1CQHA 2PWJA 1TJDA 4J57E 5A4VA 3FYGA 1W89A 11GSA 2XPEA 3GH6A 5J5NA 4MDCA 2YWNA 4HJMA 1VF2A 2O87A 1T8EB 5J4YA 2PPTA 2A2RA 5J4UA 1EV4A 4GCIA 4XCSA 2HRFA 1DE1A 1A0FA 4PXOA 3L9VA 3IAS2 2VL9A 1Q4JA 3TKSC 2XPDA 8GSSA 1TI3A 2XC2A 1FHEA 5D9WA 3GUSA 3FK8A 3IHQA 3GURA 4PX1A 2DJ3A 2R0PA 4IQAA 4O7HA 3RGBC 1FG4A 3H8QA 2IWTA 3KP8A 3RAZA 12GSA 2NDOA 4LA1A 5LNKe 2HZEA 1PN9A 4V2LA 4HI7A 5A4UA 4H86A 4XHMA 4PNFA 1DSBA 2VD1A 2VM2A 3D0ZA 2L59A 2XBQA 2I4AA 6GSTA 2CT6A 2OJLA 5ECKB 1XCCA 2L4CA 2FA8A 1I5GA 1GUKA 4ACSA 1YZXA 4EC0A 2KP2A 2CVKA 4ICYA 4G0LA 5ECPB 4MCUA 4TXVA 2DBCA 5G1KA 5CYYA 4IHUA 1X0RA 1GTBA 1X9MB 2H6XA 1A24A 2VCTA 1PRXA 1UN2A 2B1KA 5AN1A 2H1AA 2WZSA 1YY7A 1K0BA 3I9V2 4K2DA 4POKA 1BX9A 1A2JA 1NHOA 4RI7A 4OCEA 1TW9A 1HQOA 1Z6NA 2VCWA 4K5RA 3N9JA 4XIHA 1XWAA 4OFNA 1G0TA 1GLPA 3HVXA 3QOUA 4ECJA 1WRYA 3ZFBA 2H01A 4Z7XA 1NHYA 2HI7A 1QXHA 1OYJA 3ZVJA 4IS0A 4PHZC 2AV4A 1A2LA 1TU8A 1ACVA 2QA1A 5G5EA 1E2YA 5C00A 1HNAA 3F8UA 4HZ2A 3DD3A 14GSA 2FLSA 2C4JA 2RUEA 2LQQA 5GAPD 3F4RA 2LJAA 3F4SA 3IPZA 1X5CA 4EIQA 2NTOA 3L0HA 2B3SA 1SKWB 4YKGA 4ECBA 1A8YA 2H6ZA 4GLTA 5J3RA 3TKSA 1GLQA 4POBA 4AKHA 3FZ5A 1N25A 4G0IA 3WT2A 2CVBA 3BCIA 3UIWA 5IOWA 2H1LA 2EFEA 2YWOA 2LUSA 2FA4A 1XBSA 2HZFA 4MPFA 1K0AA 4GQCA 3ERFA 2OBIA 1O85A 1ILOA 3HYPA 4RI6A 3CWGA 1V9WA 1VF3A 3KTLA 1TRWA 2RUFA 5HR2A 3EURA 2CA8A 3CSJA 3RPNA 4FXYP 3APSA 5GSTA 4G9HA 3F0IA 2GGTA 3R3EA 3H1NA 2HSHA 2KLXA 3DWVA 4MZCA 3HVSA 5A4WA 3CTGA 1TRUA 4TRXA 1AQVA 3LJRA 5IPHA 1Q98A 4F0BA 2RM6A 1AAZA 2PUKC 1ZYQB 4O5UA 1R4WA 1B4PA 1Z3EA 6GSWA 3SBCA 3WYWA 1H4OA 3CRTA 1ZL9A 2IIYA 3ED3A 1ZOFA 1QK8A 2DC5A 3G9BA 4RQXA 3L9UA 5JWOB 2X64A 3D4MA 1R5PA 2X8CA 3SWLA 3D4TA 3WT1A 3BD2A 1J9BA 4CW9A 1XWGA 5CNWA 4MH2A 2GT6A 2O7KA 1MD4A 4JE1A 2VLUA 4DSSB 1VF1A 3TJGA 13GSA 4MJEA 2XHFA 4KDUA 1SD8A 1PN0A 3M9JA 3QCPA 1XWKA 3DRNA 3R2QA 4FO5A 2PU9C 1S3RA 4GTUA 4RQRA 3GKNA 1OC9B 4MMMA 3ME8A 2OACA 1GSSA 2FWFA 3F3RA 4LLRA 2B7KA 4MABA 4F03A 2DJ2A 1M2DA 5G2ZA 3HVVA 4G10A 4DSQA 5DCGA 4GXZA 3A5WA 3LYKA 2ZNMA 4V2NA 2G0FA 5GSSA 4WETA 3APQA 5JCUA 3C1SA 1U3AA 2RM5A 4YKFA 2FGXA 3HHVA 1XW5A 2CX3A 2R0GA 2L57A 1XOBA 3U6VA 1X9WB 4DSSA 1M2BA 3PH9A 1LBKA 4G2EA 4O5RA 2F3MA 1K0NA 5GAND 1R7HA 2GSSA 1EEJA 2HRNA 1WJKA 4WR5A 1AUCA 2AB6A 2HRAA 2WDUA 2AJQB 4OFTA 4IW9A 2A2PA 4EF0A 3F9UA 3Q74A 4DVCA 5KN0A 2VLTA 2LRCA 2N5AA 3ZFLA 3LSZA 3H4KA 1OC9A 1LU4A 1OKDA 3IXRA 3QPMA 2B6MA 1S3AA 5ELAA 1CQGA 4LMVA 3TRQA 3TOUA 4K6XA 3TKPA 3UARA 3F4TA 1X5EA 2YP6A 3O6TA 4ZL9A 2F8FA 5D8IA 2LNTA 3GFKA 1JZWA 4ZBAA 2WS2A 3MSZA 2VCZA 1SL0B 1YQ1A 5DQSA 4OMVA 1RQMA 1TP9A 5DALA 5E4WA 4GSTA 2CZ3A 4KAEA 3F3QA 1DUGA 5DAKA 5BRTA 4W66A 1V58A 2YV9A 1EP8A 2LV3A 3PINA 1I1IP 2IN3A 1F3AA 2GDRA 1M99A 3UOMA 3FEUA 2X99A 5JCWA 4IQ1A 3GRXA 4WR4A 1YF0A 1TK0B 4MJCA 3US3A 3KH7A 4PQ1A 2H0IA 4CY8A 1MTCA 1ML6A 3E9JB 5CRWA 4HQZA 3IRAA 1B9YC 2FWEA 2L6CA 2R4VA 1GUMA 4F0CA 4GDFA 4RUVA 4WF5A 3ZL5A 2C0FA 4V1Ag 5IIZA 4TR4A 1TTZA 2KUCA 5IMVA 3L78A 2HXKA 3IDVA 2HFDA 1FW1A 2CX4A 4WBRD 2UZ8A 3CMIA 1GH2A 3EE2A 2V6OA 1Z6MA 3DEXA 4I97A 17GSA 2HSYA 2C3TA 1XWBA 1AIUA 2OE0A 2V32A 1X5DA
chains in the Genus database with same CATH topology
1T4YA 1NM3A 3VI5A 3ERWA 1QQ2A 4ML1A 1KBNA 2QA2A 5F05A 2R6KA 3D5JA 4ZL7A 4NV2A 2V2GA 4IN0A 3PGTA 2O8VB 4PQIA 4Z2TA 4YQUA 4KCAA 2GTUA 2MZCA 4JZQA 2GS3A 4EXJA 2IL3A 4KX4A 4IP6A 5D73A 1XW9A 2MYGA 4XS6A 3TJKA 3HCZA 5G1LA 5EY6A 1ZMAA 3EVIA 3KGKA 3H93A 3CXGA 4FYUA 6GSUA 3P8WA 3HJPA 3I69A 2J23A 4PUFC 3GTUB 4ZB9A 1PA3A 2L6DA 2H72A 2M46A 1AQWA 1BYEA 3W8JA 3WD6A 3DVXA 4EIPA 3GX0A 5INYA 1ZGNA 4BVYB 2JU5A 5D9VA 2VAFA 3RDWA 1THXA 2V1MA 2EFCA 2E2GA 2GQLA 2OE1A 4QL7A 1G6YA 1M0UA 5H5SA 2A4VA 1ERTA 5C04A 4MF6A 4NAXA 2LKUA 3GX8A 1Y6EA 6GSYA 4ECCA 5B6MA 3IC8A 3H79A 3FR3A 5CRDA 3LEFA 4AJ8A 4XTSA 4WF4A 4ULXA 3GKXA 4CY6A 3IBHA 4AJ6A 1TU7A 3GTUA 3KIJA 3W6GA 3VURA 1IYHA 1GTIA 4K5SA 3TKSE 1BJXA 3HY2A 5AGYA 1ERVA 1PX7A 1GL8A 2R37A 4NV5A 2R0CA 3WGXA 2H71A 3ME7A 4BVYA 2C0EA 1FOVA 3RPPA 2WB9A 3BCKA 3OR5A 5BMUB 4MK3A 4AKIA 1S3CA 2FCHA 5IMFA 1SU9A 3QMXA 2YANA 4ISDA 5F8BA 1MDKA 1HNBA 5HFIA 2KHPA 1TI1A 1Z5YE 5A34B 4IVFA 5B7CA 5CO3A 3TRXA 4KDXA 5D9TA 4F9ZA 2VOCA 3CSHA 4L0WA 3ZMKA 4MJAA 4GSNA 3W8SA 3VK9A 2B5XA 2LTKA 3VWUA 1EEMA 2VCXA 1F6MC 1SL1B 4I8BA 1GNEA 3O76A 3RHBA 3MNGA 3KJYA 1TXUA 1QUWA 3KH9A 4PUAA 1PMTA 2QGVA 5BMUA 1PKZA 1C72A 3EMXA 3Q18A 5ECSA 3LWAA 2VD0A 1MEKA 2YPMA 2X4AA 5IPGA 4OCFA 1TXXA 5A34A 4ZL8A 4EKZA 2TIRA 5J9BA 4IP1A 4EUYA 3LGCA 3BJ5A 3C71A 1SVMA 1XPVA 3QR6A 3ZZXA 2GSRA 1SVLA 4YAVA 1EOHA 3JCML 3ZITA 1GSYA 2PVOC 5CREA 3LYPA 4MJBA 2HYXA 1V2AA 2ALBA 2JL4A 2WULA 3FY7A 4KB3A 2PBJA 2DJ1A 1SK0A 5KOXA 1VRSD 3GNJA 2C0DA 2LRNA 4AF2A 2LS5A 3BOAA 4KE3A 3ZIVA 2AYTA 1K3YA 19GSA 1BG1A 1T4ZA 4JR4A 5CRHA 4DSRA 3NIVA 2P5RA 1ZYPA 4USSA 5J4VA 4L8EA 4EDYA 3V1WA 4TKYA 1WWJA 2VIMA 1YKAA 3HMJG 3ERGA 2HRKB 1UA5A 1O8XA 1ST9A 5DCHA 2IMIA 4N0VA 3GN3A 4KGIA 2CZ2A 1PKWA 1J08A 4HU9A 3CYNA 3WGDA 2MBTA 5HR0A 2TRXA 5ECLB 3IA1A 9GSSA 1GSUA 1PL1A 4OWYA 3GA4A 1EGOA 1ZYEA 3TCOA 3ZREA 2DIYA 5IMZA 1GSFA 5B6NA 3RBTA 2IMKA 2PVQA 4BVXB 1EP7A 1NW2A 1XVQA 3F6DA 1SVOA 3LW9A 2CQ9A 4MZBA 3HJOA 2MMOA 2JZTA 2EC4A 2EFDA 2E0QA 3TKQA 4XRAA 1OC8A 1ERUA 5AISA 1ERWA 5ECHB 2A2SA 4OO5A 2R2JA 3GL5A 5F06A 2O85A 4GF0A 1R26A 4Z2UA 3M0FA 2H1DA 2HRKA 2DMMA 2A4HA 3C1RA 2GSTA 1YF1A 4ZBDA 5A1NB 4JBBA 5COHA 2I3YA 2Z9SA 4ML6A 2DJJA 3A2VA 2PN8A 4G19A 2LJRA 4LL1B 4J56E 3GHAA 1SYXA 2OBKA 5ABRA 2C1YA 3EYTA 2B7JA 1K0CA 5KN3A 4BVXA 1XOAA 4D73B 3CBUA 1FOHA 1Y1UA 1SK2A 5DALB 3FRCA 5ECQB 2OKAA 22GSA 2OA7A 2WFCA 1M2AA 3EU3A 2X49A 3EWLA 4GQFA 4ZB8A 2R5GA 5DAKB 5DVBA 1PSQA 4K7IA 1SD9A 3ZTLA 3TRPA 1SYRA 4X1UA 3J7Yb 1XXUA 4P3YB 3TGZA 2H75A 2VLVA 3QD9A 4TN8A 1UC7A 1KEBA 5EPFA 2JACA 2B1LA 2FHEA 2H6YA 1TK8B 3QDNA 3UVHA 3F63A 2OADA 3J7Yk 2JZSA 1IYIA 1QGVA 5A1NA 2IPAA 3FR6A 3DMLA 3HD5A 2UV8G 4OO4A 1J0FA 4L0UA 1MD3A 1EV9A 4IKHA 3ZMLA 2HE3A 1PL2A 2B5EA 1Z9HA 3VI7A 3UBLA 3EINA 4MLYA 2OE3A 1OE8A 4KDYA 3IE3A 2V6KA 4KA0A 1GSQA 1FO5A 4Q5NA 4D73A 1JLVA 3UVTA 3M8NA 3LXZA 1HNCA 3E0UA 3GIXA 2FWHA 2M80A 2EIOA 2M72A 3VPTA 1AXDA 4GWRA 1GSEA 2O5VA 4MNNA 4DEJA 2L5LA 2NPBA 3D21A 4K1FA 3ZRDA 2MBSA 1TDIA 3C73A 3HKRA 4MP4A 3GYKA 5G5FA 4AKGA 4K0NA 2DKIA 3IV4A 5GZZB 3DYRA 4XS1A 2FWGA 4L5OA 5D9XA 1JZDA 1YKCA 1HD2A 2H30A 1BF5A 1V40A 5IMDA 4ZXGA 5ID2B 2RLIA 4KSOA 4HS1A 4K7NA 1S3DA 4ZIJA 3P90A 10GSA 4XS4A 4E8EA 1M9AA 4AKXB 3I6AA 1E6BA 4KH7A 1UVZA 1YEPA 1XWCA 5KOWA 5HFGA 2LNSA 4HUAA 4JRRA 2GLRA 1PD21 3IK7A 4K2XA 4E8HA 4IGJA 3PPUA 5ECRB 3D22A 1W4VA 4BL7A 2KP1A 1HYUA 5AIXA 2WRTA 3DGQA 2ON5A 1N8JA 2N5BA 3HDCA 4TVEA 2L4QA 3GKKA 2VL2C 2B5YA 3GH9A 2X8HA 4PNGA 5HFKA 2WCIA 1K0MA 4CDOA 1V57A 5FHIA 2I81A 2WJUA 5A5HB 3FMWA 1GP1A 3UBKA 5IM9A 4HJ2A 5IO0A 2YZUA 3BBYA 2YJHA 4N3ZA 1SKSB 2H0HA 2YN1A 5ECIB 3FHKA 1A2MA 5ID2A 5IOXA 4G0KA 1OKTA 3I43A 3VLNA 1WOUA 3UL3A 2YZHA 4CHSA 1JZOA 4JU5A 3A5IA 1X9SB 1PQNA 2FD3A 1PGTA 1WMJA 5DJLA 4TW5A 3LG6A 3KXOA 5DBQA 5KN2A 2QKEA 3C8EA 1LJRA 3KP9A 1XW6A 1GULA 1BQ7A 1SK1A 3VWXA 2D2ZA 1THOA 5IO2A 1U6TA 3TDGA 3ZIJA 5G31A 1QFNA 3TU3B 5DQYA 1Z7RA 4HDEA 1BAYA 2LQOA 3EPTA 5A5HA 3Q6OA 4N0ZA 5FT3A 2PMTA 2NBSA 1SL2B 3QAWA 3KZQA 2WZ9A 3CTFA 1T00A 3DXBA 2JSZA 4TXOB 2VO4A 1ON4A 2I1UA 3AY8A 2WGRA 1K0DA 5CP1A 4I5QA 1PX6A 4BWSA 3ISOA 4AGSA 2I9HA 4ZILA 4LL4B 2H74A 3GV1A 1TOFA 4QL9A 2H19A 1GTAA 1GSDA 2DMLA 2QSIA 4YH2A 1JFUA 4ECIA 2HT9A 4TOPA 1USBA 3KM6A 2VL2A 4POLA 2ZCTA 3KEBA 3HZ4A 5JWQB 1URMA 2K8SA 4FIWA 4FYBA 5IMCA 4OD7A 4TR0A 3MWHA 5A5KA 4X43A 2TRCP 3KMOA 1U87A 3KTBA 3LFLA 2AHEA 2IMDA 4POMA 3UEMA 3TOTA 4WXTA 4FH8A 3EU4A 3C7MA 6GSVA 4K9ZA 4HU7A 2C8UA 4TXOA 5EL8A 1R5AA 4MH3A 3E3EA 4F2IA 3HJMA 2H0GA 2DJ0A 3FR9A 3D6IA 2JADA 4BPYA 2H73A 5ECNB 2BTOT 3RHCA 1Y25A 2GQKA 5IMAA 1B8XA 4TR1B 3APOA 1SJIA 1AW9A 1KTEA 1YEXA 3DIEA 1WPIA 3WGEA 3QAGA 2BJXA 4EL1A 1YDKA 2MMNA 4O32A 2C3QA 3VFIA 4ZB7A 2C80A 4NWYA 1FVJA 3EC3A 4KF9A 2P0GA 4WKWA 1EZKA 4MF5A 5LD0A 3ZLPA 1K3OA 1A0RP 1F9MA 1JZRA 2PGTA 2VM1A 1K3LA 4ILFA 1Z7PA 2DKHA 3MYDA 1O8WA 1GNWA 5J47A 1OAZA 3IHGA 2GZPA 1T7PB 5IQYA 4YQVA 4KW6A 2F51A 2LSTA 3IR4A 1ZYNA 2F9SA 4TR1A 1OE7A 2H66A 4KNDA 16GSA 1WIKA 4EVMA 2BMXA 2EIQA 1TK5B 4HEA2 3S9FA 2DJKA 4ID0A 2O89A 1O81A 4O92A 1QMVA 1U88A 1GRXA 20GSA 5AIVA 1AC1A 1U3IA 4EE0A 3DKSA 4XRDA 4IELA 2HLSA 4NPBA 4Q5RA 2VKZG 2XBIA 5CRGA 4YAPA 1NSWA 1N2AA 1F37A 2JZRA 3IAM2 2G2QA 2K6VA 2J9HA 3M3MA 2DIZA 4NHWA 7GSSA 1AQXA 4FYCA 3TB2A 2MMAA 3HA9A 3GKMA 2V41A 2CAQA 4EDZA 2JSYA 4KUNA 3LXTA 4I2UA 3FKFA 18GSA 4LMWA 3LQ7A 1B48A 2ON7A 2GQMA 2RIIA 4V2MA 5D93A 4PGTA 1XFLA 2ZUPA 1TRSA 1TKDB 3UAPA 2R3XA 4X0XA 1DBYA 4OFMA 4AI6A 4WEYA 4Q5FA 2GVPA 1MDJA 4EO3A 4O5QA 2H8LA 5H5RA 4F82A 1SKRB 4L5LA 5KEJA 5J41A 1XVWA 3CRUA 5B8BA 1KNGA 4AJ7A 5DJMA 2FNOA 2GT5A 3L4NA 4IBPA 5H5QA 1YJ6A 4MA9A 1MDIA 2H70A 1G6WA 5E59A 3VPQA 2LEGA 3NZNA 2YV7A 5HR3A 4PQHA 1B9XC 4YQMA 2ES7A 5ENUA 3IC4A 4I2TA 5HQPA 3O3TA 4HOJA 2DSAA 2REMA 3P7XA 2PERA 4G01A 1T3BA 3TKRA 2C0GA 2L5OA 2F8AA 3F6FA 3A2WA 3FW2A 3DVWA 1SJZA 5DDLA 1FAAA 2KOKA 3VWWA 3QAVA 5ELGA 4FQUA 2EFHA 1FB0A 4NXIA 2CVDA 1OC3A 1JLWA 1M9BA 4PTSA 3HXSA 2GSQA 1YVLA 3M9KA 2GZZA 2CV4A 1RW1A 4XS4B 1XIYA 4QQ7A 1I9DA 1BG5A 3QFBC 4GRFA 1A8LA 4MF7A 4ZB6A 5KN1A 5CAXA 4N11A 4HQSA 5FWGA 3FZAA 3M1GA 3GMFA 4MZWA 5J40A 5F0GA 2QC7A 1F3BA 4Z2RA 1ZCPA 4BL7B 3UMAA 4GSSA 2VUPA 1VGLA 4V1Ap 4KCEA 2H1BA 2K9FA 3TJJA 1V98A 1M7TA 2YWIA 2VCQA 3HZ8A 1XZOA 3CSIA 3LORA 4ZBBA 1FVKA 2IMFA 3KD0A 1B4QA 1A23A 1O6JA 3UJ1A 3ZYWA 5J9CA 4NHZA 5ECMB 3FZ9A 3KCMA 3GL3A 3IOSA 4BA7A 4NMUA 2P5QA 1T1VA 5JCGA 2YCDA 2GZYA 6GSSA 1O73A 5D96A 3TJFA 4I6XA 2LJKA 1EGRA 5JWRB 1SENA 4KSMA 5G30A 1GUHA 1K0OA 5EVOA 3TJBA 1G7EA 4K8MA 3G7YA 3ZVJD 3MDKA 2N5FA 5ECOB 1G7OA 1TRVA 3P2AA 2YOIA 1GWCA 4BWQA 4N30A 1GTUA 5F07A 2C3NA 2YWMA 3IK9A 3KMNA 1FB6A 2IFQB 2IJYA 3PR8A 4TR3A 2IMEA 2CAIA 2E2MA 2OT3A 3TUEA 2YNXA 1WP0A 4JR6A 3GSSA 2HSMB 4MPGA 3A2XA 3VWVA 3A3TA 6GSXA 2HSNB 4K7OA 2H1GA 2VCVA 3G7IA 5HR1A 2FUG2 4A5PA 4QMKA 2VL3A 1OVNA 3GSTA 4HZ4A 1SJ6A 4J2FA 4JEDA 1EWXA 1ZZYA 1JHBA 2DLXA 1F2EA 1RK4A 1VF4A 4PURA 1O7UA 3U5RE 2FY6A 4N10A 4K0GA 2YJ7A 2E7PA 2NVLA 4Q5QA 1BEDA 4X4JA 3N5OA 3QFAC 2P31A 3Q19A 2HNLA 2LRTA 4WBJA 3FZ4A 5B8AA 3K8NA 4IJ3A 2HQTA 2K8VA 2IFQA 2K18A 1ABAA 4IJIA 2MMZA 2AUVA 5LCZA 2AAWA 1EOGA 3EMPA 5L71A 1WE0A 1DE2A 2HSMA 4E68A 3NOFA 2HZEB 1H75A 2HSNA 2X8GA 2H76A 3G7JA 3MAKA 2EIRA 3MIXA 3L9SA 1CQHA 2PWJA 1TJDA 4J57E 5A4VA 3FYGA 1W89A 11GSA 2XPEA 3GH6A 5J5NA 4MDCA 2YWNA 4HJMA 1VF2A 2O87A 1T8EB 5J4YA 2PPTA 2A2RA 5J4UA 1EV4A 4GCIA 4XCSA 2HRFA 1DE1A 1A0FA 4PXOA 3L9VA 3IAS2 2VL9A 1Q4JA 3TKSC 2XPDA 8GSSA 1TI3A 2XC2A 1FHEA 5D9WA 3GUSA 3FK8A 3IHQA 3GURA 4PX1A 2DJ3A 2R0PA 4IQAA 4O7HA 1FG4A 3H8QA 2IWTA 3KP8A 3RAZA 12GSA 2NDOA 4LA1A 5LNKe 2HZEA 1PN9A 4V2LA 4HI7A 5A4UA 4H86A 4XHMA 4PNFA 1DSBA 2VD1A 2VM2A 3D0ZA 2L59A 2XBQA 2I4AA 6GSTA 2CT6A 2OJLA 5ECKB 1XCCA 2L4CA 2FA8A 1I5GA 1GUKA 4ACSA 1YZXA 4EC0A 2KP2A 2CVKA 4ICYA 4G0LA 5ECPB 4MCUA 4TXVA 2DBCA 5G1KA 5CYYA 4IHUA 1X0RA 1GTBA 1X9MB 2H6XA 1A24A 2VCTA 1PRXA 1UN2A 2B1KA 5AN1A 2H1AA 1YY7A 1K0BA 3I9V2 4K2DA 4POKA 1BX9A 1A2JA 1NHOA 4RI7A 4OCEA 1TW9A 1HQOA 1Z6NA 2VCWA 4K5RA 3N9JA 4XIHA 1XWAA 4OFNA 1G0TA 1GLPA 3HVXA 3QOUA 4ECJA 1WRYA 3ZFBA 2H01A 4Z7XA 1NHYA 2HI7A 1QXHA 1OYJA 3ZVJA 4IS0A 2AV4A 1A2LA 1TU8A 1ACVA 2QA1A 5G5EA 1E2YA 5C00A 1HNAA 3F8UA 4HZ2A 3DD3A 14GSA 2FLSA 2C4JA 2RUEA 2LQQA 5GAPD 3F4RA 2LJAA 3F4SA 3IPZA 1X5CA 4EIQA 2NTOA 3L0HA 2B3SA 1SKWB 4YKGA 4ECBA 1A8YA 2H6ZA 4GLTA 5J3RA 3TKSA 1GLQA 4POBA 4AKHA 3FZ5A 1N25A 4G0IA 3WT2A 2CVBA 3BCIA 3UIWA 5IOWA 2H1LA 2EFEA 2YWOA 2LUSA 2FA4A 1XBSA 2HZFA 4MPFA 1K0AA 4GQCA 3ERFA 2OBIA 1O85A 1ILOA 3HYPA 4RI6A 3CWGA 1V9WA 1VF3A 3KTLA 1TRWA 2RUFA 5HR2A 3EURA 2CA8A 3CSJA 3RPNA 3APSA 5GSTA 4G9HA 3F0IA 2GGTA 3R3EA 3H1NA 2HSHA 2KLXA 3DWVA 4MZCA 3HVSA 5A4WA 3CTGA 1TRUA 4TRXA 1AQVA 3LJRA 5IPHA 1Q98A 4F0BA 2RM6A 1AAZA 2PUKC 1ZYQB 4O5UA 1R4WA 1B4PA 1Z3EA 6GSWA 3SBCA 3WYWA 1H4OA 3CRTA 1ZL9A 2IIYA 3ED3A 1ZOFA 1QK8A 2DC5A 3G9BA 4RQXA 3L9UA 5JWOB 2X64A 3D4MA 1R5PA 2X8CA 3SWLA 3D4TA 3WT1A 3BD2A 1J9BA 4CW9A 1XWGA 5CNWA 4MH2A 2GT6A 2O7KA 1MD4A 4JE1A 2VLUA 4DSSB 1VF1A 3TJGA 13GSA 4MJEA 2XHFA 4KDUA 1SD8A 1PN0A 3M9JA 3QCPA 1XWKA 3DRNA 3R2QA 4FO5A 2PU9C 4GTUA 4RQRA 3GKNA 1OC9B 4MMMA 3ME8A 2OACA 1GSSA 2FWFA 3F3RA 4LLRA 2B7KA 4MABA 4F03A 2DJ2A 1M2DA 5G2ZA 3HVVA 4G10A 4DSQA 5DCGA 4GXZA 3A5WA 3LYKA 2ZNMA 4V2NA 2G0FA 5GSSA 4WETA 3APQA 5JCUA 3C1SA 1U3AA 2RM5A 4YKFA 2FGXA 3HHVA 1XW5A 2CX3A 2R0GA 2L57A 1XOBA 3U6VA 1X9WB 4DSSA 1M2BA 3PH9A 1LBKA 4G2EA 4O5RA 2F3MA 1K0NA 5GAND 1R7HA 2GSSA 1EEJA 2HRNA 1WJKA 4WR5A 1AUCA 2AB6A 2HRAA 2WDUA 2AJQB 4OFTA 4IW9A 2A2PA 4EF0A 3F9UA 3Q74A 4DVCA 5KN0A 2VLTA 2LRCA 2N5AA 3ZFLA 3LSZA 3H4KA 1OC9A 1LU4A 1OKDA 3IXRA 3QPMA 2B6MA 1S3AA 5ELAA 1CQGA 4LMVA 3TRQA 3TOUA 4K6XA 3TKPA 3UARA 3F4TA 1X5EA 2YP6A 3O6TA 4ZL9A 2F8FA 5D8IA 2LNTA 3GFKA 1JZWA 4ZBAA 2WS2A 3MSZA 2VCZA 1SL0B 1YQ1A 5DQSA 4OMVA 1RQMA 1TP9A 5DALA 5E4WA 4GSTA 2CZ3A 4KAEA 3F3QA 1DUGA 5DAKA 5BRTA 4W66A 1V58A 2YV9A 1EP8A 2LV3A 3PINA 2IN3A 1F3AA 2GDRA 1M99A 3UOMA 3FEUA 2X99A 5JCWA 4IQ1A 3GRXA 4WR4A 1YF0A 1TK0B 4MJCA 3US3A 3KH7A 4PQ1A 2H0IA 4CY8A 1MTCA 1ML6A 3E9JB 5CRWA 4HQZA 3IRAA 1B9YC 2FWEA 2L6CA 2R4VA 1GUMA 4F0CA 4GDFA 4RUVA 4WF5A 3ZL5A 2C0FA 4V1Ag 5IIZA 4TR4A 1TTZA 2KUCA 5IMVA 3L78A 2HXKA 3IDVA 2HFDA 1FW1A 2CX4A 4WBRD 2UZ8A 3CMIA 1GH2A 3EE2A 2V6OA 1Z6MA 3DEXA 4I97A 17GSA 2HSYA 2C3TA 1XWBA 1AIUA 2OE0A 2V32A 1X5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Y A;  1NM3 A;  3VI5 A;  3ERW A;  1QQ2 A;  4ML1 A;  1KBN A;  5F05 A;  2R6K A;  3D5J A;  4ZL7 A;  4NV2 A;  2V2G A;  4IN0 A;  3PGT A;  2O8V B;  4PQI A;  4YQU A;  4KCA A;  2GTU A;  2MZC A;  4JZQ A;  2GS3 A;  4EXJ A;  2IL3 A;  4KX4 A;  4IP6 A;  5D73 A;  1XW9 A;  2MYG A;  4XS6 A;  3TJK A;  3HCZ A;  5G1L A;  5EY6 A;  1ZMA A;  3EVI A;  3KGK A;  3H93 A;  3CXG A;  4FYU A;  6GSU A;  3P8W A;  3HJP A;  3I69 A;  2J23 A;  4PUF C;  3GTU B;  4ZB9 A;  1PA3 A;  2L6D A;  2H72 A;  2M46 A;  1AQW A;  1BYE A;  3W8J A;  3WD6 A;  3DVX A;  3GX0 A;  5INY A;  1ZGN A;  4BVY B;  2JU5 A;  5D9V A;  2VAF A;  3RDW A;  1THX A;  2V1M A;  2E2G A;  2GQL A;  2OE1 A;  4QL7 A;  1G6Y A;  1M0U A;  5H5S A;  2A4V A;  1ERT A;  5C04 A;  4MF6 A;  4NAX A;  2LKU A;  3GX8 A;  1Y6E A;  6GSY A;  4ECC A;  5B6M A;  3IC8 A;  3H79 A;  3FR3 A;  5CRD A;  3LEF A;  4AJ8 A;  4XTS A;  4WF4 A;  4ULX A;  3GKX A;  3IBH A;  4AJ6 A;  1TU7 A;  3GTU A;  3KIJ A;  3W6G A;  3VUR A;  1IYH A;  1GTI A;  3TKS E;  1BJX A;  3HY2 A;  5AGY A;  1ERV A;  1PX7 A;  1GL8 A;  2R37 A;  4NV5 A;  3WGX A;  2H71 A;  3ME7 A;  4BVY A;  2C0E A;  1FOV A;  3RPP A;  2WB9 A;  3BCK A;  3OR5 A;  4MK3 A;  1S3C A;  2FCH A;  5IMF A;  1SU9 A;  3QMX A;  2YAN A;  4ISD A;  5F8B A;  1MDK A;  1HNB A;  5HFI A;  2KHP A;  1TI1 A;  1Z5Y E;  4IVF A;  5B7C A;  5CO3 A;  3TRX A;  4KDX A;  5D9T A;  4F9Z A;  2VOC A;  3CSH A;  4L0W A;  3ZMK A;  4MJA A;  4GSN A;  3W8S A;  3VK9 A;  2B5X A;  2LTK A;  3VWU A;  1EEM A;  2VCX A;  1F6M C;  1SL1 B;  4I8B A;  1GNE A;  3O76 A;  3RHB A;  3MNG A;  3KJY A;  1QUW A;  3KH9 A;  4PUA A;  1PMT A;  2QGV A;  5BMU A;  1PKZ A;  1C72 A;  3EMX A;  3Q18 A;  5ECS A;  3LWA A;  2VD0 A;  1MEK A;  2YPM A;  5IPG A;  4OCF A;  1TXX A;  4ZL8 A;  4EKZ A;  2TIR A;  5J9B A;  4IP1 A;  4EUY A;  3LGC A;  3BJ5 A;  3C71 A;  1XPV A;  3QR6 A;  3ZZX A;  2GSR A;  4YAV A;  1EOH A;  3JCM L;  3ZIT A;  1GSY A;  2PVO C;  5CRE A;  3LYP A;  4MJB A;  2HYX A;  1V2A A;  2ALB A;  2JL4 A;  2WUL A;  3FY7 A;  4KB3 A;  2PBJ A;  2DJ1 A;  1SK0 A;  1VRS D;  3GNJ A;  2C0D A;  2LRN A;  4AF2 A;  2LS5 A;  3BOA A;  4KE3 A;  3ZIV A;  2AYT A;  1K3Y A;  19GS A;  1T4Z A;  4JR4 A;  5CRH A;  4DSR A;  3NIV A;  2P5R A;  4USS A;  4L8E A;  4EDY A;  3V1W A;  4TKY A;  1WWJ A;  2VIM A;  1YKA A;  3ERG A;  2HRK B;  1UA5 A;  1O8X A;  1ST9 A;  5DCH A;  2IMI A;  4N0V A;  3GN3 A;  4KGI A;  2CZ2 A;  1PKW A;  1J08 A;  4HU9 A;  3CYN A;  3WGD A;  2MBT A;  5HR0 A;  2TRX A;  5ECL B;  3IA1 A;  9GSS A;  1GSU A;  1PL1 A;  4OWY A;  3GA4 A;  1EGO A;  1ZYE A;  3TCO A;  3ZRE A;  2DIY A;  5IMZ A;  1GSF A;  5B6N A;  3RBT A;  2IMK A;  2PVQ A;  4BVX B;  1EP7 A;  1NW2 A;  1XVQ A;  3F6D A;  2CQ9 A;  4MZB A;  3HJO A;  2MMO A;  2JZT A;  2EC4 A;  2E0Q A;  3TKQ A;  4XRA A;  1OC8 A;  1ERU A;  5AIS A;  1ERW A;  5ECH B;  2A2S A;  4OO5 A;  2R2J A;  3GL5 A;  5F06 A;  2O85 A;  4GF0 A;  1R26 A;  3M0F A;  2H1D A;  2HRK A;  2DMM A;  3C1R A;  2GST A;  1YF1 A;  4ZBD A;  4JBB A;  5COH A;  2I3Y A;  2Z9S A;  4ML6 A;  2DJJ A;  3A2V A;  2PN8 A;  4G19 A;  2LJR A;  4LL1 B;  4J56 E;  3GHA A;  1SYX A;  2OBK A;  5ABR A;  2C1Y A;  3EYT A;  2B7J A;  1K0C A;  5KN3 A;  4BVX A;  1XOA A;  4D73 B;  3CBU A;  1SK2 A;  5DAL B;  3FRC A;  5ECQ B;  2OKA A;  22GS A;  2OA7 A;  2WFC A;  1M2A A;  3EU3 A;  4GQF A;  3EWL A;  4ZB8 A;  2R5G A;  5DAK B;  5DVB A;  1PSQ A;  4K7I A;  1SD9 A;  3ZTL A;  3TRP A;  1SYR A;  4X1U A;  3J7Y b;  1XXU A;  4P3Y B;  3TGZ A;  2H75 A;  2VLV A;  3QD9 A;  4TN8 A;  1UC7 A;  1KEB A;  5EPF A;  2JAC A;  2B1L A;  2FHE A;  2H6Y A;  1TK8 B;  3QDN A;  3UVH A;  3F63 A;  2OAD A;  3J7Y k;  2JZS A;  1IYI A;  1QGV A;  2IPA A;  3FR6 A;  3DML A;  3HD5 A;  4OO4 A;  1J0F A;  4L0U A;  1MD3 A;  1EV9 A;  4IKH A;  3ZML A;  2HE3 A;  1PL2 A;  2B5E A;  1Z9H A;  3VI7 A;  3UBL A;  3EIN A;  4MLY A;  2OE3 A;  1OE8 A;  4KDY A;  3IE3 A;  2V6K A;  4KA0 A;  1GSQ A;  1FO5 A;  4Q5N A;  4D73 A;  1JLV A;  3UVT A;  3M8N A;  3LXZ A;  1HNC A;  3E0U A;  3GIX A;  2FWH A;  2M80 A;  2EIO A;  2M72 A;  3VPT A;  1AXD A;  4GWR A;  1GSE A;  4DEJ A;  2L5L A;  2NPB A;  3D21 A;  4K1F A;  3ZRD A;  2MBS A;  1TDI A;  3C73 A;  3HKR A;  4MP4 A;  3GYK A;  5G5F A;  4K0N A;  3IV4 A;  5GZZ B;  3DYR A;  4XS1 A;  2FWG A;  4L5O A;  5D9X A;  1JZD A;  1YKC A;  1HD2 A;  2H30 A;  1V40 A;  5IMD A;  4ZXG A;  5ID2 B;  2RLI A;  4KSO A;  4HS1 A;  4K7N A;  1S3D A;  4ZIJ A;  3P90 A;  10GS A;  4XS4 A;  4E8E A;  1M9A A;  3I6A A;  1E6B A;  4KH7 A;  1UVZ A;  1YEP A;  1XWC A;  5HFG A;  2LNS A;  4HUA A;  4JRR A;  2GLR A;  1PD2 1;  3IK7 A;  4E8H A;  4IGJ A;  3PPU A;  5ECR B;  3D22 A;  1W4V A;  4BL7 A;  2KP1 A;  1HYU A;  5AIX A;  2WRT A;  3DGQ A;  2ON5 A;  1N8J A;  2N5B A;  3HDC A;  4TVE A;  2L4Q A;  3GKK A;  2VL2 C;  2B5Y A;  3GH9 A;  2X8H A;  4PNG A;  5HFK A;  2WCI A;  1K0M A;  4CDO A;  1V57 A;  5FHI A;  2I81 A;  2WJU A;  1GP1 A;  3UBK A;  5IM9 A;  4HJ2 A;  5IO0 A;  2YZU A;  3BBY A;  2YJH A;  1SKS B;  2H0H A;  2YN1 A;  5ECI B;  3FHK A;  1A2M A;  5ID2 A;  5IOX A;  4G0K A;  1OKT A;  3I43 A;  3VLN A;  1WOU A;  3UL3 A;  2YZH A;  4CHS A;  1JZO A;  4JU5 A;  1X9S B;  1PQN A;  2FD3 A;  1PGT A;  1WMJ A;  5DJL A;  4TW5 A;  3LG6 A;  3KXO A;  5DBQ A;  5KN2 A;  2QKE A;  3C8E A;  1LJR A;  3KP9 A;  1XW6 A;  1GUL A;  1BQ7 A;  1SK1 A;  3VWX A;  2D2Z A;  1THO A;  5IO2 A;  1U6T A;  3TDG A;  3ZIJ A;  5G31 A;  1QFN A;  5DQY A;  1Z7R A;  4HDE A;  1BAY A;  2LQO A;  3Q6O A;  4N0Z A;  5FT3 A;  2PMT A;  2NBS A;  1SL2 B;  3QAW A;  3KZQ A;  2WZ9 A;  3CTF A;  1T00 A;  3DXB A;  2JSZ A;  4TXO B;  2VO4 A;  1ON4 A;  2I1U A;  3AY8 A;  2WGR A;  1K0D A;  5CP1 A;  4I5Q A;  1PX6 A;  4BWS A;  3ISO A;  4AGS A;  2I9H A;  4ZIL A;  4LL4 B;  2H74 A;  3GV1 A;  1TOF A;  4QL9 A;  2H19 A;  1GTA A;  1GSD A;  2DML A;  2QSI A;  4YH2 A;  1JFU A;  4ECI A;  2HT9 A;  4TOP A;  1USB A;  3KM6 A;  2VL2 A;  4POL A;  2ZCT A;  3KEB A;  3HZ4 A;  5JWQ B;  1URM A;  2K8S A;  4FIW A;  4FYB A;  5IMC A;  4OD7 A;  4TR0 A;  3MWH A;  5A5K A;  4X43 A;  2TRC P;  3KMO A;  1U87 A;  3KTB A;  3LFL A;  2AHE A;  2IMD A;  4POM A;  3UEM A;  3TOT A;  4WXT A;  4FH8 A;  3EU4 A;  3C7M A;  6GSV A;  4K9Z A;  4HU7 A;  2C8U A;  4TXO A;  5EL8 A;  1R5A A;  4MH3 A;  3E3E A;  4F2I A;  3HJM A;  2H0G A;  2DJ0 A;  3FR9 A;  3D6I A;  2JAD A;  4BPY A;  2H73 A;  5ECN B;  2BTO T;  3RHC A;  1Y25 A;  2GQK A;  5IMA A;  1B8X A;  4TR1 B;  3APO A;  1SJI A;  1AW9 A;  1KTE A;  1YEX A;  3DIE A;  1WPI A;  3WGE A;  3QAG A;  2BJX A;  4EL1 A;  1YDK A;  2MMN A;  4O32 A;  2C3Q A;  3VFI A;  2C80 A;  4NWY A;  1FVJ A;  3EC3 A;  4KF9 A;  2P0G A;  4WKW A;  1EZK A;  4MF5 A;  5LD0 A;  3ZLP A;  1K3O A;  1A0R P;  1F9M A;  1JZR A;  2PGT A;  2VM1 A;  1K3L A;  4ILF A;  1Z7P A;  1O8W A;  1GNW A;  1OAZ A;  2GZP A;  1T7P B;  5IQY A;  4YQV A;  4KW6 A;  2F51 A;  2LST A;  3IR4 A;  2F9S A;  4TR1 A;  1OE7 A;  2H66 A;  4KND A;  16GS A;  1WIK A;  4EVM A;  2BMX A;  2EIQ A;  1TK5 B;  4HEA 2;  3S9F A;  2DJK A;  4ID0 A;  2O89 A;  1O81 A;  4O92 A;  1QMV A;  1U88 A;  1GRX A;  20GS A;  5AIV A;  1AC1 A;  1U3I A;  4EE0 A;  3DKS A;  4XRD A;  4IEL A;  2HLS A;  4NPB A;  4Q5R A;  2XBI A;  5CRG A;  4YAP A;  1NSW A;  1N2A A;  1F37 A;  2JZR A;  3IAM 2;  2G2Q A;  2K6V A;  2J9H A;  3M3M A;  2DIZ A;  4NHW A;  7GSS A;  1AQX A;  4FYC A;  3TB2 A;  2MMA A;  3HA9 A;  3GKM A;  2V41 A;  2CAQ A;  4EDZ A;  2JSY A;  4KUN A;  3LXT A;  4I2U A;  3FKF A;  18GS A;  4LMW A;  3LQ7 A;  1B48 A;  2ON7 A;  2GQM A;  2RII A;  4V2M A;  5D93 A;  4PGT A;  1XFL A;  2ZUP A;  1TRS A;  1TKD B;  3UAP A;  2R3X A;  4X0X A;  1DBY A;  4OFM A;  4WEY A;  4Q5F A;  2GVP A;  1MDJ A;  4EO3 A;  2H8L A;  5H5R A;  4F82 A;  1SKR B;  4L5L A;  5KEJ A;  5J41 A;  1XVW A;  3CRU A;  5B8B A;  1KNG A;  4AJ7 A;  5DJM A;  2FNO A;  2GT5 A;  3L4N A;  4IBP A;  5H5Q A;  1YJ6 A;  4MA9 A;  1MDI A;  2H70 A;  1G6W A;  5E59 A;  3VPQ A;  2LEG A;  3NZN A;  2YV7 A;  5HR3 A;  4PQH A;  1B9X C;  4YQM A;  2ES7 A;  5ENU A;  3IC4 A;  4I2T A;  5HQP A;  3O3T A;  4HOJ A;  2DSA A;  2REM A;  3P7X A;  2PER A;  1T3B A;  3TKR A;  2C0G A;  2L5O A;  2F8A A;  3F6F A;  3A2W A;  3FW2 A;  3DVW A;  1SJZ A;  5DDL A;  1FAA A;  2KOK A;  3VWW A;  3QAV A;  5ELG A;  4FQU A;  1FB0 A;  4NXI A;  2CVD A;  1OC3 A;  1JLW A;  1M9B A;  4PTS A;  3HXS A;  2GSQ A;  3M9K A;  2GZZ A;  2CV4 A;  1RW1 A;  4XS4 B;  1XIY A;  4QQ7 A;  1I9D A;  1BG5 A;  3QFB C;  4GRF A;  1A8L A;  4MF7 A;  4ZB6 A;  5KN1 A;  5CAX A;  4N11 A;  4HQS A;  5FWG A;  3FZA A;  3M1G A;  3GMF A;  4MZW A;  5F0G A;  2QC7 A;  1F3B A;  1ZCP A;  4BL7 B;  3UMA A;  4GSS A;  2VUP A;  1VGL A;  4V1A p;  4KCE A;  2H1B A;  2K9F A;  3TJJ A;  1V98 A;  1M7T A;  2YWI A;  2VCQ A;  3HZ8 A;  1XZO A;  3CSI A;  3LOR A;  4ZBB A;  1FVK A;  2IMF A;  3KD0 A;  1B4Q A;  1A23 A;  1O6J A;  3UJ1 A;  3ZYW A;  5J9C A;  4NHZ A;  5ECM B;  3FZ9 A;  3KCM A;  3GL3 A;  3IOS A;  4BA7 A;  4NMU A;  2P5Q A;  1T1V A;  5JCG A;  2YCD A;  2GZY A;  6GSS A;  1O73 A;  5D96 A;  3TJF A;  4I6X A;  2LJK A;  1EGR A;  5JWR B;  1SEN A;  4KSM A;  5G30 A;  1GUH A;  1K0O A;  5EVO A;  3TJB A;  1G7E A;  4K8M A;  3G7Y A;  3ZVJ D;  3MDK A;  2N5F A;  5ECO B;  1G7O A;  1TRV A;  3P2A A;  2YOI A;  1GWC A;  4BWQ A;  4N30 A;  1GTU A;  5F07 A;  2C3N A;  2YWM A;  3IK9 A;  3KMN A;  1FB6 A;  2IFQ B;  2IJY A;  3PR8 A;  4TR3 A;  2IME A;  2CAI A;  2E2M A;  3TUE A;  2YNX A;  1WP0 A;  4JR6 A;  3GSS A;  2HSM B;  4MPG A;  3A2X A;  3VWV A;  3A3T A;  6GSX A;  2HSN B;  4K7O A;  2H1G A;  2VCV A;  3G7I A;  5HR1 A;  2FUG 2;  2VL3 A;  1OVN A;  3GST A;  4HZ4 A;  1SJ6 A;  4J2F A;  4JED A;  1EWX A;  1ZZY A;  1JHB A;  2DLX A;  1F2E A;  1RK4 A;  1VF4 A;  4PUR A;  1O7U A;  3U5R E;  2FY6 A;  4N10 A;  4K0G A;  2YJ7 A;  2E7P A;  2NVL A;  4Q5Q A;  1BED A;  3N5O A;  3QFA C;  2P31 A;  3Q19 A;  2HNL A;  2LRT A;  4WBJ A;  3FZ4 A;  5B8A A;  3K8N A;  4IJ3 A;  2HQT A;  2K8V A;  2IFQ A;  2K18 A;  1ABA A;  4IJI A;  2MMZ A;  2AUV A;  5LCZ A;  2AAW A;  1EOG A;  3EMP A;  5L71 A;  1WE0 A;  1DE2 A;  2HSM A;  3NOF A;  2HZE B;  1H75 A;  2X8G A;  2H76 A;  3G7J A;  3MAK A;  2EIR A;  3L9S A;  1CQH A;  2PWJ A;  1TJD A;  4J57 E;  5A4V A;  3FYG A;  1W89 A;  11GS A;  2XPE A;  3GH6 A;  5J5N A;  4MDC A;  2YWN A;  4HJM A;  1VF2 A;  2O87 A;  1T8E B;  2PPT A;  2A2R A;  5J4U A;  1EV4 A;  4GCI A;  4XCS A;  2HRF A;  1DE1 A;  1A0F A;  4PXO A;  3L9V A;  3IAS 2;  2VL9 A;  1Q4J A;  3TKS C;  2XPD A;  8GSS A;  1TI3 A;  2XC2 A;  1FHE A;  5D9W A;  3GUS A;  3FK8 A;  3IHQ A;  3GUR A;  4PX1 A;  2DJ3 A;  4IQA A;  4O7H A;  1FG4 A;  3H8Q A;  2IWT A;  3KP8 A;  3RAZ A;  12GS A;  2NDO A;  4LA1 A;  5LNK e;  2HZE A;  1PN9 A;  4V2L A;  4HI7 A;  5A4U A;  4H86 A;  4XHM A;  4PNF A;  1DSB A;  2VD1 A;  2VM2 A;  3D0Z A;  2L59 A;  2XBQ A;  2I4A A;  6GST A;  2CT6 A;  2OJL A;  5ECK B;  1XCC A;  2L4C A;  2FA8 A;  1I5G A;  1GUK A;  4ACS A;  1YZX A;  4EC0 A;  2KP2 A;  2CVK A;  4G0L A;  5ECP B;  4MCU A;  4TXV A;  2DBC A;  5G1K A;  5CYY A;  4IHU A;  1X0R A;  1GTB A;  1X9M B;  2H6X A;  1A24 A;  2VCT A;  1PRX A;  1UN2 A;  2B1K A;  5AN1 A;  2H1A A;  1YY7 A;  1K0B A;  3I9V 2;  4K2D A;  4POK A;  1BX9 A;  1A2J A;  1NHO A;  4RI7 A;  4OCE A;  1TW9 A;  1HQO A;  1Z6N A;  2VCW A;  3N9J A;  4XIH A;  1XWA A;  4OFN A;  1G0T A;  1GLP A;  3HVX A;  3QOU A;  4ECJ A;  1WRY A;  3ZFB A;  2H01 A;  4Z7X A;  1NHY A;  2HI7 A;  1QXH A;  1OYJ A;  3ZVJ A;  4IS0 A;  2AV4 A;  1A2L A;  1TU8 A;  1ACV A;  5G5E A;  1E2Y A;  5C00 A;  1HNA A;  3F8U A;  4HZ2 A;  3DD3 A;  14GS A;  2FLS A;  2C4J A;  2RUE A;  2LQQ A;  5GAP D;  3F4R A;  2LJA A;  3F4S A;  3IPZ A;  1X5C A;  2NTO A;  3L0H A;  2B3S A;  1SKW B;  4ECB A;  1A8Y A;  2H6Z A;  4GLT A;  5J3R A;  3TKS A;  1GLQ A;  4POB A;  3FZ5 A;  4G0I A;  3WT2 A;  2CVB A;  3BCI A;  3UIW A;  5IOW A;  2YWO A;  2LUS A;  2FA4 A;  1XBS A;  2HZF A;  4MPF A;  1K0A A;  4GQC A;  3ERF A;  2OBI A;  1O85 A;  1ILO A;  3HYP A;  4RI6 A;  1V9W A;  1VF3 A;  3KTL A;  1TRW A;  2RUF A;  5HR2 A;  3EUR A;  2CA8 A;  3CSJ A;  3RPN A;  3APS A;  5GST A;  4G9H A;  3F0I A;  2GGT A;  3R3E A;  3H1N A;  2HSH A;  2KLX A;  3DWV A;  4MZC A;  3HVS A;  5A4W A;  3CTG A;  1TRU A;  4TRX A;  1AQV A;  3LJR A;  5IPH A;  1Q98 A;  4F0B A;  2RM6 A;  1AAZ A;  2PUK C;  1ZYQ B;  1R4W A;  1B4P A;  1Z3E A;  6GSW A;  3SBC A;  3WYW A;  1H4O A;  3CRT A;  1ZL9 A;  2IIY A;  3ED3 A;  1ZOF A;  1QK8 A;  2DC5 A;  3G9B A;  4RQX A;  3L9U A;  5JWO B;  2X64 A;  3D4M A;  1R5P A;  2X8C A;  3SWL A;  3D4T A;  3WT1 A;  3BD2 A;  1J9B A;  4CW9 A;  1XWG A;  5CNW A;  4MH2 A;  2GT6 A;  2O7K A;  1MD4 A;  4JE1 A;  2VLU A;  4DSS B;  1VF1 A;  3TJG A;  13GS A;  4MJE A;  2XHF A;  4KDU A;  1SD8 A;  3M9J A;  3QCP A;  1XWK A;  3DRN A;  3R2Q A;  4FO5 A;  2PU9 C;  4GTU A;  4RQR A;  3GKN A;  1OC9 B;  4MMM A;  3ME8 A;  2OAC A;  1GSS A;  2FWF A;  3F3R A;  4LLR A;  2B7K A;  4MAB A;  4F03 A;  2DJ2 A;  1M2D A;  5G2Z A;  3HVV A;  4G10 A;  4DSQ A;  5DCG A;  4GXZ A;  3A5W A;  3LYK A;  2ZNM A;  4V2N A;  2G0F A;  5GSS A;  4WET A;  3APQ A;  5JCU A;  3C1S A;  1U3A A;  2RM5 A;  2FGX A;  3HHV A;  1XW5 A;  2CX3 A;  2L57 A;  1XOB A;  3U6V A;  1X9W B;  4DSS A;  1M2B A;  3PH9 A;  1LBK A;  4G2E A;  4O5R A;  2F3M A;  1K0N A;  5GAN D;  1R7H A;  2GSS A;  1EEJ A;  2HRN A;  1WJK A;  4WR5 A;  1AUC A;  2AB6 A;  2HRA A;  2WDU A;  2AJQ B;  4OFT A;  4IW9 A;  4EF0 A;  3F9U A;  3Q74 A;  4DVC A;  5KN0 A;  2VLT A;  2LRC A;  2N5A A;  3ZFL A;  3LSZ A;  3H4K A;  1OC9 A;  1LU4 A;  1OKD A;  3IXR A;  3QPM A;  2B6M A;  1S3A A;  5ELA A;  1CQG A;  4LMV A;  3TRQ A;  3TOU A;  4K6X A;  3TKP A;  3UAR A;  3F4T A;  1X5E A;  2YP6 A;  3O6T A;  4ZL9 A;  2F8F A;  5D8I A;  2LNT A;  3GFK A;  1JZW A;  4ZBA A;  2WS2 A;  3MSZ A;  2VCZ A;  1SL0 B;  1YQ1 A;  5DQS A;  4OMV A;  1RQM A;  1TP9 A;  5DAL A;  5E4W A;  4GST A;  2CZ3 A;  4KAE A;  3F3Q A;  1DUG A;  5DAK A;  1V58 A;  2YV9 A;  1EP8 A;  2LV3 A;  3PIN A;  2IN3 A;  1F3A A;  2GDR A;  1M99 A;  3UOM A;  3FEU A;  2X99 A;  5JCW A;  4IQ1 A;  3GRX A;  4WR4 A;  1YF0 A;  1TK0 B;  4MJC A;  3US3 A;  3KH7 A;  4PQ1 A;  2H0I A;  1MTC A;  1ML6 A;  3E9J B;  5CRW A;  4HQZ A;  3IRA A;  1B9Y C;  2FWE A;  2L6C A;  2R4V A;  1GUM A;  4F0C A;  4RUV A;  4WF5 A;  3ZL5 A;  2C0F A;  4V1A g;  5IIZ A;  4TR4 A;  1TTZ A;  2KUC A;  5IMV A;  3L78 A;  2HXK A;  3IDV A;  2HFD A;  1FW1 A;  2CX4 A;  4WBR D;  2UZ8 A;  3CMI A;  1GH2 A;  3EE2 A;  2V6O A;  1Z6M A;  3DEX A;  4I97 A;  17GS A;  2HSY A;  2C3T A;  1XWB A;  1AIU A;  2OE0 A;  2V32 A;  1X5D A; 
#chains in the Genus database with same CATH topology
 1T4Y A;  1NM3 A;  3VI5 A;  3ERW A;  1QQ2 A;  4ML1 A;  1KBN A;  2QA2 A;  5F05 A;  2R6K A;  3D5J A;  4ZL7 A;  4NV2 A;  2V2G A;  4IN0 A;  3PGT A;  2O8V B;  4PQI A;  4Z2T A;  4YQU A;  4KCA A;  2GTU A;  2MZC A;  4JZQ A;  2GS3 A;  4EXJ A;  2IL3 A;  4KX4 A;  4IP6 A;  5D73 A;  1XW9 A;  2MYG A;  4XS6 A;  3TJK A;  3HCZ A;  5G1L A;  5EY6 A;  1ZMA A;  3EVI A;  3KGK A;  3H93 A;  3CXG A;  4FYU A;  6GSU A;  3P8W A;  3HJP A;  3I69 A;  2J23 A;  4PUF C;  3GTU B;  4ZB9 A;  1PA3 A;  2L6D A;  2H72 A;  2M46 A;  1AQW A;  1BYE A;  3W8J A;  3WD6 A;  3DVX A;  4EIP A;  3GX0 A;  5INY A;  1ZGN A;  4BVY B;  3HVN A;  1YEW C;  2JU5 A;  5D9V A;  2VAF A;  3RDW A;  1THX A;  2V1M A;  2EFC A;  2E2G A;  2GQL A;  2OE1 A;  4QL7 A;  1G6Y A;  1M0U A;  5H5S A;  2A4V A;  1ERT A;  5C04 A;  4MF6 A;  4NAX A;  2LKU A;  3GX8 A;  1Y6E A;  6GSY A;  4ECC A;  5B6M A;  4PI0 C;  3IC8 A;  3H79 A;  3FR3 A;  5CRD A;  3LEF A;  4AJ8 A;  4XTS A;  4WF4 A;  4ULX A;  3GKX A;  4CY6 A;  3IBH A;  4AJ6 A;  1TU7 A;  3GTU A;  3KIJ A;  3W6G A;  3VUR A;  1IYH A;  1GTI A;  4K5S A;  3TKS E;  1BJX A;  3HY2 A;  5AGY A;  1ERV A;  1PX7 A;  1GL8 A;  2R37 A;  4NV5 A;  2R0C A;  3WGX A;  2H71 A;  3ME7 A;  4BVY A;  2C0E A;  1FOV A;  3RPP A;  2WB9 A;  3BCK A;  3OR5 A;  5BMU B;  4MK3 A;  4AKI A;  1S3C A;  2FCH A;  5IMF A;  1SU9 A;  3QMX A;  2YAN A;  4ISD A;  5F8B A;  1MDK A;  1HNB A;  5HFI A;  2KHP A;  1TI1 A;  1Z5Y E;  5A34 B;  4IVF A;  5B7C A;  5CO3 A;  3TRX A;  4KDX A;  5D9T A;  4F9Z A;  2VOC A;  3CSH A;  4L0W A;  3ZMK A;  4MJA A;  4GSN A;  3W8S A;  3VK9 A;  2B5X A;  2LTK A;  3VWU A;  1EEM A;  2VCX A;  1F6M C;  1SL1 B;  4I8B A;  1GNE A;  3O76 A;  3RHB A;  3MNG A;  3KJY A;  1TXU A;  2WW0 A;  1QUW A;  3KH9 A;  4PUA A;  1PMT A;  2QGV A;  5BMU A;  1PKZ A;  1C72 A;  3EMX A;  3Q18 A;  5ECS A;  3LWA A;  2VD0 A;  1MEK A;  2YPM A;  2X4A A;  5IPG A;  4OCF A;  1TXX A;  5A34 A;  4ZL8 A;  4EKZ A;  2TIR A;  5J9B A;  2WW2 A;  4IP1 A;  4EUY A;  3LGC A;  3BJ5 A;  3C71 A;  1SVM A;  1XPV A;  3QR6 A;  3ZZX A;  2GSR A;  1SVL A;  4YAV A;  1EOH A;  3JCM L;  3ZIT A;  1GSY A;  2PVO C;  5CRE A;  3LYP A;  4MJB A;  2HYX A;  1V2A A;  2ALB A;  2JL4 A;  2WUL A;  3FY7 A;  4KB3 A;  2PBJ A;  2DJ1 A;  1SK0 A;  5KOX A;  1VRS D;  3GNJ A;  2C0D A;  2LRN A;  4AF2 A;  2LS5 A;  3BOA A;  4KE3 A;  3ZIV A;  2AYT A;  1K3Y A;  19GS A;  1BG1 A;  1T4Z A;  4JR4 A;  5CRH A;  4DSR A;  3NIV A;  2P5R A;  1ZYP A;  4USS A;  5J4V A;  4L8E A;  4EDY A;  3V1W A;  4TKY A;  1WWJ A;  2VIM A;  1YKA A;  3HMJ G;  3ERG A;  2HRK B;  1UA5 A;  1O8X A;  1ST9 A;  5DCH A;  2IMI A;  4N0V A;  3GN3 A;  4KGI A;  2CZ2 A;  1PKW A;  1J08 A;  4HU9 A;  3CYN A;  3WGD A;  2MBT A;  5HR0 A;  2TRX A;  5ECL B;  3IA1 A;  9GSS A;  1GSU A;  1PL1 A;  4OWY A;  3GA4 A;  1EGO A;  1ZYE A;  3TCO A;  3ZRE A;  2DIY A;  5IMZ A;  1GSF A;  5B6N A;  3RBT A;  2IMK A;  2PVQ A;  4BVX B;  1EP7 A;  1NW2 A;  1XVQ A;  3F6D A;  1SVO A;  3LW9 A;  2CQ9 A;  4MZB A;  3HJO A;  2MMO A;  2JZT A;  2EC4 A;  2EFD A;  2E0Q A;  3TKQ A;  4XRA A;  1OC8 A;  1ERU A;  5AIS A;  1ERW A;  5ECH B;  2A2S A;  4OO5 A;  2R2J A;  3GL5 A;  5F06 A;  2O85 A;  4GF0 A;  1R26 A;  4Z2U A;  3M0F A;  2H1D A;  2HRK A;  2DMM A;  2A4H A;  3C1R A;  2GST A;  1YF1 A;  4ZBD A;  5A1N B;  4JBB A;  5COH A;  2I3Y A;  2Z9S A;  4ML6 A;  2DJJ A;  3A2V A;  2PN8 A;  4G19 A;  2LJR A;  4LL1 B;  4J56 E;  3GHA A;  1SYX A;  2OBK A;  5ABR A;  2C1Y A;  3EYT A;  2B7J A;  1K0C A;  5KN3 A;  4BVX A;  1XOA A;  4D73 B;  3CBU A;  1FOH A;  1Y1U A;  1SK2 A;  5DAL B;  3FRC A;  5ECQ B;  2OKA A;  22GS A;  2OA7 A;  2WFC A;  1M2A A;  3EU3 A;  2X49 A;  3EWL A;  4GQF A;  4ZB8 A;  2R5G A;  5DAK B;  5DVB A;  1PSQ A;  4K7I A;  1SD9 A;  3ZTL A;  3TRP A;  1SYR A;  4X1U A;  3J7Y b;  1XXU A;  4P3Y B;  3TGZ A;  2H75 A;  2VLV A;  3QD9 A;  4TN8 A;  1UC7 A;  1KEB A;  5EPF A;  2JAC A;  2B1L A;  2FHE A;  2H6Y A;  1TK8 B;  3QDN A;  3UVH A;  3F63 A;  2OAD A;  3J7Y k;  2JZS A;  1IYI A;  1QGV A;  5A1N A;  2IPA A;  3FR6 A;  3DML A;  3HD5 A;  3CQF A;  2UV8 G;  4OO4 A;  1J0F A;  4L0U A;  1MD3 A;  1EV9 A;  4IKH A;  3ZML A;  2HE3 A;  1PL2 A;  2B5E A;  1Z9H A;  3VI7 A;  3UBL A;  3EIN A;  4MLY A;  2OE3 A;  1OE8 A;  4KDY A;  3IE3 A;  2V6K A;  4KA0 A;  1GSQ A;  1FO5 A;  4Q5N A;  4D73 A;  1JLV A;  3UVT A;  3M8N A;  3LXZ A;  1HNC A;  3E0U A;  3GIX A;  2FWH A;  2M80 A;  2EIO A;  2M72 A;  3VPT A;  1AXD A;  4GWR A;  1GSE A;  2O5V A;  4MNN A;  4DEJ A;  2L5L A;  2NPB A;  3D21 A;  4K1F A;  3ZRD A;  2MBS A;  1TDI A;  3C73 A;  3HKR A;  4MP4 A;  3GYK A;  5G5F A;  4AKG A;  4K0N A;  2DKI A;  3IV4 A;  5GZZ B;  3DYR A;  4XS1 A;  2FWG A;  4L5O A;  5D9X A;  1JZD A;  1YKC A;  1HD2 A;  2H30 A;  1BF5 A;  1V40 A;  5IMD A;  4ZXG A;  5ID2 B;  2RLI A;  4KSO A;  4HS1 A;  4K7N A;  1S3D A;  4ZIJ A;  3P90 A;  10GS A;  3CHX C;  4XS4 A;  4E8E A;  1M9A A;  4AKX B;  3I6A A;  1E6B A;  4KH7 A;  1UVZ A;  1YEP A;  1XWC A;  5KOW A;  5HFG A;  2LNS A;  4HUA A;  4JRR A;  2GLR A;  1PD2 1;  3IK7 A;  4K2X A;  4E8H A;  4IGJ A;  3PPU A;  5ECR B;  3D22 A;  1W4V A;  4BL7 A;  2KP1 A;  1HYU A;  5AIX A;  2WRT A;  3DGQ A;  2ON5 A;  1N8J A;  2N5B A;  3HDC A;  4TVE A;  2L4Q A;  3GKK A;  2VL2 C;  2B5Y A;  3GH9 A;  2X8H A;  4PNG A;  5HFK A;  2WCI A;  1K0M A;  4CDO A;  1V57 A;  5FHI A;  2I81 A;  2WJU A;  5A5H B;  3FMW A;  1GP1 A;  3UBK A;  5IM9 A;  4HJ2 A;  5IO0 A;  2YZU A;  3BBY A;  2YJH A;  4N3Z A;  1SKS B;  2H0H A;  2YN1 A;  5ECI B;  3FHK A;  1A2M A;  5ID2 A;  5IOX A;  4G0K A;  1OKT A;  3I43 A;  3VLN A;  1WOU A;  3UL3 A;  2YZH A;  4CHS A;  1JZO A;  4JU5 A;  3A5I A;  1X9S B;  1PQN A;  2FD3 A;  1PGT A;  1WMJ A;  5DJL A;  4TW5 A;  3LG6 A;  3KXO A;  5DBQ A;  5KN2 A;  2QKE A;  3C8E A;  1LJR A;  3KP9 A;  1XW6 A;  1GUL A;  2O36 A;  1BQ7 A;  1SK1 A;  3VWX A;  2D2Z A;  1THO A;  5IO2 A;  1U6T A;  3TDG A;  3ZIJ A;  5G31 A;  1QFN A;  3TU3 B;  5DQY A;  1Z7R A;  4HDE A;  1BAY A;  2LQO A;  3EPT A;  5A5H A;  3Q6O A;  4N0Z A;  5FT3 A;  2PMT A;  2NBS A;  1SL2 B;  3QAW A;  3KZQ A;  2WZ9 A;  3CTF A;  1T00 A;  3DXB A;  2JSZ A;  4TXO B;  2VO4 A;  1ON4 A;  2I1U A;  3AY8 A;  2WGR A;  1K0D A;  5CP1 A;  4I5Q A;  1PX6 A;  4BWS A;  3ISO A;  4AGS A;  2I9H A;  4ZIL A;  4LL4 B;  2H74 A;  3GV1 A;  1TOF A;  4QL9 A;  2H19 A;  1GTA A;  1GSD A;  2DML A;  2QSI A;  4YH2 A;  2WVY A;  1JFU A;  4ECI A;  2WW3 A;  2HT9 A;  4TOP A;  1USB A;  3KM6 A;  2VL2 A;  4POL A;  2ZCT A;  3KEB A;  3HZ4 A;  5JWQ B;  1URM A;  2K8S A;  4FIW A;  4FYB A;  5IMC A;  4OD7 A;  4TR0 A;  3MWH A;  5A5K A;  4X43 A;  2TRC P;  3KMO A;  1U87 A;  3KTB A;  3LFL A;  2AHE A;  2IMD A;  4POM A;  3UEM A;  3TOT A;  4WXT A;  4FH8 A;  3EU4 A;  3C7M A;  6GSV A;  4K9Z A;  4HU7 A;  2C8U A;  4TXO A;  5EL8 A;  1R5A A;  4MH3 A;  3E3E A;  4F2I A;  3HJM A;  3RFR C;  2H0G A;  2DJ0 A;  3FR9 A;  3D6I A;  2JAD A;  4BPY A;  2H73 A;  5ECN B;  2BTO T;  3RHC A;  1Y25 A;  2GQK A;  5IMA A;  1B8X A;  4TR1 B;  3APO A;  1SJI A;  1AW9 A;  1KTE A;  1YEX A;  3DIE A;  1PFO A;  1WPI A;  3WGE A;  3QAG A;  2BJX A;  4EL1 A;  1YDK A;  2MMN A;  4O32 A;  2C3Q A;  3VFI A;  4ZB7 A;  2C80 A;  4NWY A;  1FVJ A;  3EC3 A;  4KF9 A;  2P0G A;  4WKW A;  1EZK A;  4MF5 A;  5LD0 A;  3ZLP A;  1K3O A;  1A0R P;  1F9M A;  1JZR A;  2PGT A;  2VM1 A;  1K3L A;  4ILF A;  1Z7P A;  2DKH A;  3MYD A;  1O8W A;  1GNW A;  5J47 A;  1OAZ A;  3IHG A;  2GZP A;  1T7P B;  5IQY A;  4YQV A;  4KW6 A;  2F51 A;  2LST A;  3IR4 A;  1ZYN A;  2F9S A;  4TR1 A;  1OE7 A;  2H66 A;  4KND A;  16GS A;  1WIK A;  4EVM A;  4HSC X;  2BMX A;  2EIQ A;  1TK5 B;  4HEA 2;  3S9F A;  2DJK A;  4ID0 A;  2O89 A;  1O81 A;  4O92 A;  1QMV A;  1U88 A;  1GRX A;  20GS A;  5AIV A;  1AC1 A;  1U3I A;  1XG8 A;  4EE0 A;  3DKS A;  4XRD A;  4IEL A;  2HLS A;  4NPB A;  4Q5R A;  2VKZ G;  2XBI A;  5CRG A;  4YAP A;  1NSW A;  4BIK A;  1N2A A;  1F37 A;  2JZR A;  3IAM 2;  2G2Q A;  2K6V A;  2J9H A;  3M3M A;  2DIZ A;  1S4B P;  4NHW A;  7GSS A;  1AQX A;  4FYC A;  3TB2 A;  2MMA A;  3HA9 A;  3GKM A;  2V41 A;  2CAQ A;  4EDZ A;  2JSY A;  4KUN A;  3LXT A;  2O3E A;  4I2U A;  3FKF A;  18GS A;  4LMW A;  3LQ7 A;  1B48 A;  2ON7 A;  2GQM A;  2RII A;  4V2M A;  5D93 A;  4PGT A;  1XFL A;  2ZUP A;  1TRS A;  1TKD B;  3UAP A;  2R3X A;  4X0X A;  1DBY A;  4OFM A;  4AI6 A;  4WEY A;  4Q5F A;  2GVP A;  1MDJ A;  4EO3 A;  4O5Q A;  2H8L A;  5H5R A;  4F82 A;  1SKR B;  4L5L A;  5KEJ A;  5J41 A;  1XVW A;  3CRU A;  5B8B A;  1KNG A;  4AJ7 A;  5DJM A;  2FNO A;  2GT5 A;  3L4N A;  4IBP A;  5H5Q A;  2WVX B;  1YJ6 A;  2WW1 A;  4MA9 A;  1MDI A;  4PI2 C;  2H70 A;  1G6W A;  5E59 A;  3VPQ A;  2LEG A;  3NZN A;  2YV7 A;  5HR3 A;  4PQH A;  1B9X C;  4YQM A;  2ES7 A;  5ENU A;  3IC4 A;  4I2T A;  5HQP A;  3O3T A;  4HOJ A;  2DSA A;  2REM A;  3P7X A;  2PER A;  4G01 A;  1T3B A;  3TKR A;  2C0G A;  2L5O A;  2F8A A;  3F6F A;  3A2W A;  3FW2 A;  3DVW A;  1SJZ A;  5DDL A;  1FAA A;  2KOK A;  3VWW A;  3QAV A;  5ELG A;  4FQU A;  2EFH A;  1FB0 A;  4NXI A;  2CVD A;  1OC3 A;  1JLW A;  1M9B A;  4PTS A;  3HXS A;  2GSQ A;  1YVL A;  3M9K A;  2GZZ A;  2CV4 A;  1RW1 A;  4XS4 B;  2WVX A;  1XIY A;  4QQ7 A;  2WVZ A;  1I9D A;  1BG5 A;  3QFB C;  4GRF A;  1A8L A;  4MF7 A;  4ZB6 A;  5KN1 A;  5CAX A;  4N11 A;  4HQS A;  5FWG A;  3FZA A;  3M1G A;  3GMF A;  4MZW A;  5J40 A;  5F0G A;  2QC7 A;  1F3B A;  4Z2R A;  1ZCP A;  4BL7 B;  3UMA A;  4GSS A;  2VUP A;  1VGL A;  4V1A p;  4KCE A;  2H1B A;  2K9F A;  3TJJ A;  1V98 A;  1M7T A;  2YWI A;  2VCQ A;  3HZ8 A;  1XZO A;  3CSI A;  3LOR A;  4ZBB A;  1FVK A;  2IMF A;  3KD0 A;  1M3I A;  1B4Q A;  1A23 A;  1O6J A;  3UJ1 A;  3ZYW A;  5J9C A;  4NHZ A;  5ECM B;  3FZ9 A;  3KCM A;  3GL3 A;  3IOS A;  4BA7 A;  4NMU A;  2P5Q A;  1T1V A;  5JCG A;  2YCD A;  2GZY A;  6GSS A;  1O73 A;  5D96 A;  3TJF A;  4I6X A;  2LJK A;  1EGR A;  5JWR B;  1SEN A;  4KSM A;  5G30 A;  1GUH A;  1K0O A;  5EVO A;  3TJB A;  1G7E A;  4K8M A;  3G7Y A;  3ZVJ D;  3MDK A;  2N5F A;  5ECO B;  1G7O A;  1TRV A;  3P2A A;  2YOI A;  1GWC A;  4BWQ A;  4N30 A;  1GTU A;  5F07 A;  2C3N A;  2YWM A;  3IK9 A;  3KMN A;  1FB6 A;  2IFQ B;  2IJY A;  3PR8 A;  4TR3 A;  2IME A;  2CAI A;  2E2M A;  2OT3 A;  3TUE A;  2YNX A;  1WP0 A;  4JR6 A;  3GSS A;  2HSM B;  4MPG A;  3A2X A;  3VWV A;  3A3T A;  6GSX A;  2HSN B;  4K7O A;  2H1G A;  2VCV A;  3G7I A;  5HR1 A;  2FUG 2;  4A5P A;  4QMK A;  2VL3 A;  1OVN A;  3GST A;  4HZ4 A;  1SJ6 A;  4J2F A;  4JED A;  1EWX A;  1ZZY A;  1JHB A;  2DLX A;  1M3J A;  1F2E A;  1RK4 A;  1VF4 A;  4PUR A;  1O7U A;  3U5R E;  2FY6 A;  4N10 A;  4K0G A;  2YJ7 A;  2E7P A;  2NVL A;  4Q5Q A;  1BED A;  4X4J A;  3N5O A;  3QFA C;  2P31 A;  3Q19 A;  2HNL A;  2LRT A;  4WBJ A;  3FZ4 A;  5B8A A;  3K8N A;  4IJ3 A;  2HQT A;  2K8V A;  2IFQ A;  2K18 A;  1ABA A;  4IJI A;  2MMZ A;  2AUV A;  5LCZ A;  2AAW A;  1EOG A;  3EMP A;  5L71 A;  1WE0 A;  1DE2 A;  2HSM A;  4E68 A;  3NOF A;  2HZE B;  1H75 A;  2HSN A;  2X8G A;  2H76 A;  3G7J A;  3MAK A;  2EIR A;  3MIX A;  3L9S A;  1CQH A;  2PWJ A;  1TJD A;  4J57 E;  5A4V A;  3FYG A;  1W89 A;  11GS A;  2XPE A;  3GH6 A;  5J5N A;  4MDC A;  2YWN A;  4HJM A;  1VF2 A;  2O87 A;  1T8E B;  5J4Y A;  2PPT A;  2A2R A;  5J4U A;  1EV4 A;  4GCI A;  4XCS A;  2HRF A;  1DE1 A;  1A0F A;  4PXO A;  3L9V A;  3IAS 2;  2VL9 A;  1Q4J A;  3TKS C;  2XPD A;  8GSS A;  1TI3 A;  2XC2 A;  1FHE A;  5D9W A;  3GUS A;  3FK8 A;  3IHQ A;  3GUR A;  4PX1 A;  2DJ3 A;  2R0P A;  4IQA A;  4O7H A;  3RGB C;  1FG4 A;  3H8Q A;  2IWT A;  3KP8 A;  3RAZ A;  12GS A;  2NDO A;  4LA1 A;  5LNK e;  2HZE A;  1PN9 A;  4V2L A;  4HI7 A;  5A4U A;  4H86 A;  4XHM A;  4PNF A;  1DSB A;  2VD1 A;  2VM2 A;  3D0Z A;  2L59 A;  2XBQ A;  2I4A A;  6GST A;  2CT6 A;  2OJL A;  5ECK B;  1XCC A;  2L4C A;  2FA8 A;  1I5G A;  1GUK A;  4ACS A;  1YZX A;  4EC0 A;  2KP2 A;  2CVK A;  4ICY A;  4G0L A;  5ECP B;  4MCU A;  4TXV A;  2DBC A;  5G1K A;  5CYY A;  4IHU A;  1X0R A;  1GTB A;  1X9M B;  2H6X A;  1A24 A;  2VCT A;  1PRX A;  1UN2 A;  2B1K A;  5AN1 A;  2H1A A;  2WZS A;  1YY7 A;  1K0B A;  3I9V 2;  4K2D A;  4POK A;  1BX9 A;  1A2J A;  1NHO A;  4RI7 A;  4OCE A;  1TW9 A;  1HQO A;  1Z6N A;  2VCW A;  4K5R A;  3N9J A;  4XIH A;  1XWA A;  4OFN A;  1G0T A;  1GLP A;  3HVX A;  3QOU A;  4ECJ A;  1WRY A;  3ZFB A;  2H01 A;  4Z7X A;  1NHY A;  2HI7 A;  1QXH A;  1OYJ A;  3ZVJ A;  4IS0 A;  4PHZ C;  2AV4 A;  1A2L A;  1TU8 A;  1ACV A;  2QA1 A;  5G5E A;  1E2Y A;  5C00 A;  1HNA A;  3F8U A;  4HZ2 A;  3DD3 A;  14GS A;  2FLS A;  2C4J A;  2RUE A;  2LQQ A;  5GAP D;  3F4R A;  2LJA A;  3F4S A;  3IPZ A;  1X5C A;  4EIQ A;  2NTO A;  3L0H A;  2B3S A;  1SKW B;  4YKG A;  4ECB A;  1A8Y A;  2H6Z A;  4GLT A;  5J3R A;  3TKS A;  1GLQ A;  4POB A;  4AKH A;  3FZ5 A;  1N25 A;  4G0I A;  3WT2 A;  2CVB A;  3BCI A;  3UIW A;  5IOW A;  2H1L A;  2EFE A;  2YWO A;  2LUS A;  2FA4 A;  1XBS A;  2HZF A;  4MPF A;  1K0A A;  4GQC A;  3ERF A;  2OBI A;  1O85 A;  1ILO A;  3HYP A;  4RI6 A;  3CWG A;  1V9W A;  1VF3 A;  3KTL A;  1TRW A;  2RUF A;  5HR2 A;  3EUR A;  2CA8 A;  3CSJ A;  3RPN A;  4FXY P;  3APS A;  5GST A;  4G9H A;  3F0I A;  2GGT A;  3R3E A;  3H1N A;  2HSH A;  2KLX A;  3DWV A;  4MZC A;  3HVS A;  5A4W A;  3CTG A;  1TRU A;  4TRX A;  1AQV A;  3LJR A;  5IPH A;  1Q98 A;  4F0B A;  2RM6 A;  1AAZ A;  2PUK C;  1ZYQ B;  4O5U A;  1R4W A;  1B4P A;  1Z3E A;  6GSW A;  3SBC A;  3WYW A;  1H4O A;  3CRT A;  1ZL9 A;  2IIY A;  3ED3 A;  1ZOF A;  1QK8 A;  2DC5 A;  3G9B A;  4RQX A;  3L9U A;  5JWO B;  2X64 A;  3D4M A;  1R5P A;  2X8C A;  3SWL A;  3D4T A;  3WT1 A;  3BD2 A;  1J9B A;  4CW9 A;  1XWG A;  5CNW A;  4MH2 A;  2GT6 A;  2O7K A;  1MD4 A;  4JE1 A;  2VLU A;  4DSS B;  1VF1 A;  3TJG A;  13GS A;  4MJE A;  2XHF A;  4KDU A;  1SD8 A;  1PN0 A;  3M9J A;  3QCP A;  1XWK A;  3DRN A;  3R2Q A;  4FO5 A;  2PU9 C;  1S3R A;  4GTU A;  4RQR A;  3GKN A;  1OC9 B;  4MMM A;  3ME8 A;  2OAC A;  1GSS A;  2FWF A;  3F3R A;  4LLR A;  2B7K A;  4MAB A;  4F03 A;  2DJ2 A;  1M2D A;  5G2Z A;  3HVV A;  4G10 A;  4DSQ A;  5DCG A;  4GXZ A;  3A5W A;  3LYK A;  2ZNM A;  4V2N A;  2G0F A;  5GSS A;  4WET A;  3APQ A;  5JCU A;  3C1S A;  1U3A A;  2RM5 A;  4YKF A;  2FGX A;  3HHV A;  1XW5 A;  2CX3 A;  2R0G A;  2L57 A;  1XOB A;  3U6V A;  1X9W B;  4DSS A;  1M2B A;  3PH9 A;  1LBK A;  4G2E A;  4O5R A;  2F3M A;  1K0N A;  5GAN D;  1R7H A;  2GSS A;  1EEJ A;  2HRN A;  1WJK A;  4WR5 A;  1AUC A;  2AB6 A;  2HRA A;  2WDU A;  2AJQ B;  4OFT A;  4IW9 A;  2A2P A;  4EF0 A;  3F9U A;  3Q74 A;  4DVC A;  5KN0 A;  2VLT A;  2LRC A;  2N5A A;  3ZFL A;  3LSZ A;  3H4K A;  1OC9 A;  1LU4 A;  1OKD A;  3IXR A;  3QPM A;  2B6M A;  1S3A A;  5ELA A;  1CQG A;  4LMV A;  3TRQ A;  3TOU A;  4K6X A;  3TKP A;  3UAR A;  3F4T A;  1X5E A;  2YP6 A;  3O6T A;  4ZL9 A;  2F8F A;  5D8I A;  2LNT A;  3GFK A;  1JZW A;  4ZBA A;  2WS2 A;  3MSZ A;  2VCZ A;  1SL0 B;  1YQ1 A;  5DQS A;  4OMV A;  1RQM A;  1TP9 A;  5DAL A;  5E4W A;  4GST A;  2CZ3 A;  4KAE A;  3F3Q A;  1DUG A;  5DAK A;  5BRT A;  4W66 A;  1V58 A;  2YV9 A;  1EP8 A;  2LV3 A;  3PIN A;  1I1I P;  2IN3 A;  1F3A A;  2GDR A;  1M99 A;  3UOM A;  3FEU A;  2X99 A;  5JCW A;  4IQ1 A;  3GRX A;  4WR4 A;  1YF0 A;  1TK0 B;  4MJC A;  3US3 A;  3KH7 A;  4PQ1 A;  2H0I A;  4CY8 A;  1MTC A;  1ML6 A;  3E9J B;  5CRW A;  4HQZ A;  3IRA A;  1B9Y C;  2FWE A;  2L6C A;  2R4V A;  1GUM A;  4F0C A;  4GDF A;  4RUV A;  4WF5 A;  3ZL5 A;  2C0F A;  4V1A g;  5IIZ A;  4TR4 A;  1TTZ A;  2KUC A;  5IMV A;  3L78 A;  2HXK A;  3IDV A;  2HFD A;  1FW1 A;  2CX4 A;  4WBR D;  2UZ8 A;  3CMI A;  1GH2 A;  3EE2 A;  2V6O A;  1Z6M A;  3DEX A;  4I97 A;  17GS A;  2HSY A;  2C3T A;  1XWB A;  1AIU A;  2OE0 A;  2V32 A;  1X5D A; 
#chains in the Genus database with same CATH homology
 1T4Y A;  1NM3 A;  3VI5 A;  3ERW A;  1QQ2 A;  4ML1 A;  1KBN A;  2QA2 A;  5F05 A;  2R6K A;  3D5J A;  4ZL7 A;  4NV2 A;  2V2G A;  4IN0 A;  3PGT A;  2O8V B;  4PQI A;  4Z2T A;  4YQU A;  4KCA A;  2GTU A;  2MZC A;  4JZQ A;  2GS3 A;  4EXJ A;  2IL3 A;  4KX4 A;  4IP6 A;  5D73 A;  1XW9 A;  2MYG A;  4XS6 A;  3TJK A;  3HCZ A;  5G1L A;  5EY6 A;  1ZMA A;  3EVI A;  3KGK A;  3H93 A;  3CXG A;  4FYU A;  6GSU A;  3P8W A;  3HJP A;  3I69 A;  2J23 A;  4PUF C;  3GTU B;  4ZB9 A;  1PA3 A;  2L6D A;  2H72 A;  2M46 A;  1AQW A;  1BYE A;  3W8J A;  3WD6 A;  3DVX A;  4EIP A;  3GX0 A;  5INY A;  1ZGN A;  4BVY B;  2JU5 A;  5D9V A;  2VAF A;  3RDW A;  1THX A;  2V1M A;  2EFC A;  2E2G A;  2GQL A;  2OE1 A;  4QL7 A;  1G6Y A;  1M0U A;  5H5S A;  2A4V A;  1ERT A;  5C04 A;  4MF6 A;  4NAX A;  2LKU A;  3GX8 A;  1Y6E A;  6GSY A;  4ECC A;  5B6M A;  3IC8 A;  3H79 A;  3FR3 A;  5CRD A;  3LEF A;  4AJ8 A;  4XTS A;  4WF4 A;  4ULX A;  3GKX A;  4CY6 A;  3IBH A;  4AJ6 A;  1TU7 A;  3GTU A;  3KIJ A;  3W6G A;  3VUR A;  1IYH A;  1GTI A;  4K5S A;  3TKS E;  1BJX A;  3HY2 A;  5AGY A;  1ERV A;  1PX7 A;  1GL8 A;  2R37 A;  4NV5 A;  2R0C A;  3WGX A;  2H71 A;  3ME7 A;  4BVY A;  2C0E A;  1FOV A;  3RPP A;  2WB9 A;  3BCK A;  3OR5 A;  5BMU B;  4MK3 A;  4AKI A;  1S3C A;  2FCH A;  5IMF A;  1SU9 A;  3QMX A;  2YAN A;  4ISD A;  5F8B A;  1MDK A;  1HNB A;  5HFI A;  2KHP A;  1TI1 A;  1Z5Y E;  5A34 B;  4IVF A;  5B7C A;  5CO3 A;  3TRX A;  4KDX A;  5D9T A;  4F9Z A;  2VOC A;  3CSH A;  4L0W A;  3ZMK A;  4MJA A;  4GSN A;  3W8S A;  3VK9 A;  2B5X A;  2LTK A;  3VWU A;  1EEM A;  2VCX A;  1F6M C;  1SL1 B;  4I8B A;  1GNE A;  3O76 A;  3RHB A;  3MNG A;  3KJY A;  1TXU A;  1QUW A;  3KH9 A;  4PUA A;  1PMT A;  2QGV A;  5BMU A;  1PKZ A;  1C72 A;  3EMX A;  3Q18 A;  5ECS A;  3LWA A;  2VD0 A;  1MEK A;  2YPM A;  2X4A A;  5IPG A;  4OCF A;  1TXX A;  5A34 A;  4ZL8 A;  4EKZ A;  2TIR A;  5J9B A;  4IP1 A;  4EUY A;  3LGC A;  3BJ5 A;  3C71 A;  1SVM A;  1XPV A;  3QR6 A;  3ZZX A;  2GSR A;  1SVL A;  4YAV A;  1EOH A;  3JCM L;  3ZIT A;  1GSY A;  2PVO C;  5CRE A;  3LYP A;  4MJB A;  2HYX A;  1V2A A;  2ALB A;  2JL4 A;  2WUL A;  3FY7 A;  4KB3 A;  2PBJ A;  2DJ1 A;  1SK0 A;  5KOX A;  1VRS D;  3GNJ A;  2C0D A;  2LRN A;  4AF2 A;  2LS5 A;  3BOA A;  4KE3 A;  3ZIV A;  2AYT A;  1K3Y A;  19GS A;  1BG1 A;  1T4Z A;  4JR4 A;  5CRH A;  4DSR A;  3NIV A;  2P5R A;  1ZYP A;  4USS A;  5J4V A;  4L8E A;  4EDY A;  3V1W A;  4TKY A;  1WWJ A;  2VIM A;  1YKA A;  3HMJ G;  3ERG A;  2HRK B;  1UA5 A;  1O8X A;  1ST9 A;  5DCH A;  2IMI A;  4N0V A;  3GN3 A;  4KGI A;  2CZ2 A;  1PKW A;  1J08 A;  4HU9 A;  3CYN A;  3WGD A;  2MBT A;  5HR0 A;  2TRX A;  5ECL B;  3IA1 A;  9GSS A;  1GSU A;  1PL1 A;  4OWY A;  3GA4 A;  1EGO A;  1ZYE A;  3TCO A;  3ZRE A;  2DIY A;  5IMZ A;  1GSF A;  5B6N A;  3RBT A;  2IMK A;  2PVQ A;  4BVX B;  1EP7 A;  1NW2 A;  1XVQ A;  3F6D A;  1SVO A;  3LW9 A;  2CQ9 A;  4MZB A;  3HJO A;  2MMO A;  2JZT A;  2EC4 A;  2EFD A;  2E0Q A;  3TKQ A;  4XRA A;  1OC8 A;  1ERU A;  5AIS A;  1ERW A;  5ECH B;  2A2S A;  4OO5 A;  2R2J A;  3GL5 A;  5F06 A;  2O85 A;  4GF0 A;  1R26 A;  4Z2U A;  3M0F A;  2H1D A;  2HRK A;  2DMM A;  2A4H A;  3C1R A;  2GST A;  1YF1 A;  4ZBD A;  5A1N B;  4JBB A;  5COH A;  2I3Y A;  2Z9S A;  4ML6 A;  2DJJ A;  3A2V A;  2PN8 A;  4G19 A;  2LJR A;  4LL1 B;  4J56 E;  3GHA A;  1SYX A;  2OBK A;  5ABR A;  2C1Y A;  3EYT A;  2B7J A;  1K0C A;  5KN3 A;  4BVX A;  1XOA A;  4D73 B;  3CBU A;  1FOH A;  1Y1U A;  1SK2 A;  5DAL B;  3FRC A;  5ECQ B;  2OKA A;  22GS A;  2OA7 A;  2WFC A;  1M2A A;  3EU3 A;  2X49 A;  3EWL A;  4GQF A;  4ZB8 A;  2R5G A;  5DAK B;  5DVB A;  1PSQ A;  4K7I A;  1SD9 A;  3ZTL A;  3TRP A;  1SYR A;  4X1U A;  3J7Y b;  1XXU A;  4P3Y B;  3TGZ A;  2H75 A;  2VLV A;  3QD9 A;  4TN8 A;  1UC7 A;  1KEB A;  5EPF A;  2JAC A;  2B1L A;  2FHE A;  2H6Y A;  1TK8 B;  3QDN A;  3UVH A;  3F63 A;  2OAD A;  3J7Y k;  2JZS A;  1IYI A;  1QGV A;  5A1N A;  2IPA A;  3FR6 A;  3DML A;  3HD5 A;  2UV8 G;  4OO4 A;  1J0F A;  4L0U A;  1MD3 A;  1EV9 A;  4IKH A;  3ZML A;  2HE3 A;  1PL2 A;  2B5E A;  1Z9H A;  3VI7 A;  3UBL A;  3EIN A;  4MLY A;  2OE3 A;  1OE8 A;  4KDY A;  3IE3 A;  2V6K A;  4KA0 A;  1GSQ A;  1FO5 A;  4Q5N A;  4D73 A;  1JLV A;  3UVT A;  3M8N A;  3LXZ A;  1HNC A;  3E0U A;  3GIX A;  2FWH A;  2M80 A;  2EIO A;  2M72 A;  3VPT A;  1AXD A;  4GWR A;  1GSE A;  2O5V A;  4MNN A;  4DEJ A;  2L5L A;  2NPB A;  3D21 A;  4K1F A;  3ZRD A;  2MBS A;  1TDI A;  3C73 A;  3HKR A;  4MP4 A;  3GYK A;  5G5F A;  4AKG A;  4K0N A;  2DKI A;  3IV4 A;  5GZZ B;  3DYR A;  4XS1 A;  2FWG A;  4L5O A;  5D9X A;  1JZD A;  1YKC A;  1HD2 A;  2H30 A;  1BF5 A;  1V40 A;  5IMD A;  4ZXG A;  5ID2 B;  2RLI A;  4KSO A;  4HS1 A;  4K7N A;  1S3D A;  4ZIJ A;  3P90 A;  10GS A;  4XS4 A;  4E8E A;  1M9A A;  4AKX B;  3I6A A;  1E6B A;  4KH7 A;  1UVZ A;  1YEP A;  1XWC A;  5KOW A;  5HFG A;  2LNS A;  4HUA A;  4JRR A;  2GLR A;  1PD2 1;  3IK7 A;  4K2X A;  4E8H A;  4IGJ A;  3PPU A;  5ECR B;  3D22 A;  1W4V A;  4BL7 A;  2KP1 A;  1HYU A;  5AIX A;  2WRT A;  3DGQ A;  2ON5 A;  1N8J A;  2N5B A;  3HDC A;  4TVE A;  2L4Q A;  3GKK A;  2VL2 C;  2B5Y A;  3GH9 A;  2X8H A;  4PNG A;  5HFK A;  2WCI A;  1K0M A;  4CDO A;  1V57 A;  5FHI A;  2I81 A;  2WJU A;  5A5H B;  3FMW A;  1GP1 A;  3UBK A;  5IM9 A;  4HJ2 A;  5IO0 A;  2YZU A;  3BBY A;  2YJH A;  4N3Z A;  1SKS B;  2H0H A;  2YN1 A;  5ECI B;  3FHK A;  1A2M A;  5ID2 A;  5IOX A;  4G0K A;  1OKT A;  3I43 A;  3VLN A;  1WOU A;  3UL3 A;  2YZH A;  4CHS A;  1JZO A;  4JU5 A;  3A5I A;  1X9S B;  1PQN A;  2FD3 A;  1PGT A;  1WMJ A;  5DJL A;  4TW5 A;  3LG6 A;  3KXO A;  5DBQ A;  5KN2 A;  2QKE A;  3C8E A;  1LJR A;  3KP9 A;  1XW6 A;  1GUL A;  1BQ7 A;  1SK1 A;  3VWX A;  2D2Z A;  1THO A;  5IO2 A;  1U6T A;  3TDG A;  3ZIJ A;  5G31 A;  1QFN A;  3TU3 B;  5DQY A;  1Z7R A;  4HDE A;  1BAY A;  2LQO A;  3EPT A;  5A5H A;  3Q6O A;  4N0Z A;  5FT3 A;  2PMT A;  2NBS A;  1SL2 B;  3QAW A;  3KZQ A;  2WZ9 A;  3CTF A;  1T00 A;  3DXB A;  2JSZ A;  4TXO B;  2VO4 A;  1ON4 A;  2I1U A;  3AY8 A;  2WGR A;  1K0D A;  5CP1 A;  4I5Q A;  1PX6 A;  4BWS A;  3ISO A;  4AGS A;  2I9H A;  4ZIL A;  4LL4 B;  2H74 A;  3GV1 A;  1TOF A;  4QL9 A;  2H19 A;  1GTA A;  1GSD A;  2DML A;  2QSI A;  4YH2 A;  1JFU A;  4ECI A;  2HT9 A;  4TOP A;  1USB A;  3KM6 A;  2VL2 A;  4POL A;  2ZCT A;  3KEB A;  3HZ4 A;  5JWQ B;  1URM A;  2K8S A;  4FIW A;  4FYB A;  5IMC A;  4OD7 A;  4TR0 A;  3MWH A;  5A5K A;  4X43 A;  2TRC P;  3KMO A;  1U87 A;  3KTB A;  3LFL A;  2AHE A;  2IMD A;  4POM A;  3UEM A;  3TOT A;  4WXT A;  4FH8 A;  3EU4 A;  3C7M A;  6GSV A;  4K9Z A;  4HU7 A;  2C8U A;  4TXO A;  5EL8 A;  1R5A A;  4MH3 A;  3E3E A;  4F2I A;  3HJM A;  2H0G A;  2DJ0 A;  3FR9 A;  3D6I A;  2JAD A;  4BPY A;  2H73 A;  5ECN B;  2BTO T;  3RHC A;  1Y25 A;  2GQK A;  5IMA A;  1B8X A;  4TR1 B;  3APO A;  1SJI A;  1AW9 A;  1KTE A;  1YEX A;  3DIE A;  1WPI A;  3WGE A;  3QAG A;  2BJX A;  4EL1 A;  1YDK A;  2MMN A;  4O32 A;  2C3Q A;  3VFI A;  4ZB7 A;  2C80 A;  4NWY A;  1FVJ A;  3EC3 A;  4KF9 A;  2P0G A;  4WKW A;  1EZK A;  4MF5 A;  5LD0 A;  3ZLP A;  1K3O A;  1A0R P;  1F9M A;  1JZR A;  2PGT A;  2VM1 A;  1K3L A;  4ILF A;  1Z7P A;  2DKH A;  3MYD A;  1O8W A;  1GNW A;  5J47 A;  1OAZ A;  3IHG A;  2GZP A;  1T7P B;  5IQY A;  4YQV A;  4KW6 A;  2F51 A;  2LST A;  3IR4 A;  1ZYN A;  2F9S A;  4TR1 A;  1OE7 A;  2H66 A;  4KND A;  16GS A;  1WIK A;  4EVM A;  2BMX A;  2EIQ A;  1TK5 B;  4HEA 2;  3S9F A;  2DJK A;  4ID0 A;  2O89 A;  1O81 A;  4O92 A;  1QMV A;  1U88 A;  1GRX A;  20GS A;  5AIV A;  1AC1 A;  1U3I A;  4EE0 A;  3DKS A;  4XRD A;  4IEL A;  2HLS A;  4NPB A;  4Q5R A;  2VKZ G;  2XBI A;  5CRG A;  4YAP A;  1NSW A;  1N2A A;  1F37 A;  2JZR A;  3IAM 2;  2G2Q A;  2K6V A;  2J9H A;  3M3M A;  2DIZ A;  4NHW A;  7GSS A;  1AQX A;  4FYC A;  3TB2 A;  2MMA A;  3HA9 A;  3GKM A;  2V41 A;  2CAQ A;  4EDZ A;  2JSY A;  4KUN A;  3LXT A;  4I2U A;  3FKF A;  18GS A;  4LMW A;  3LQ7 A;  1B48 A;  2ON7 A;  2GQM A;  2RII A;  4V2M A;  5D93 A;  4PGT A;  1XFL A;  2ZUP A;  1TRS A;  1TKD B;  3UAP A;  2R3X A;  4X0X A;  1DBY A;  4OFM A;  4AI6 A;  4WEY A;  4Q5F A;  2GVP A;  1MDJ A;  4EO3 A;  4O5Q A;  2H8L A;  5H5R A;  4F82 A;  1SKR B;  4L5L A;  5KEJ A;  5J41 A;  1XVW A;  3CRU A;  5B8B A;  1KNG A;  4AJ7 A;  5DJM A;  2FNO A;  2GT5 A;  3L4N A;  4IBP A;  5H5Q A;  1YJ6 A;  4MA9 A;  1MDI A;  2H70 A;  1G6W A;  5E59 A;  3VPQ A;  2LEG A;  3NZN A;  2YV7 A;  5HR3 A;  4PQH A;  1B9X C;  4YQM A;  2ES7 A;  5ENU A;  3IC4 A;  4I2T A;  5HQP A;  3O3T A;  4HOJ A;  2DSA A;  2REM A;  3P7X A;  2PER A;  4G01 A;  1T3B A;  3TKR A;  2C0G A;  2L5O A;  2F8A A;  3F6F A;  3A2W A;  3FW2 A;  3DVW A;  1SJZ A;  5DDL A;  1FAA A;  2KOK A;  3VWW A;  3QAV A;  5ELG A;  4FQU A;  2EFH A;  1FB0 A;  4NXI A;  2CVD A;  1OC3 A;  1JLW A;  1M9B A;  4PTS A;  3HXS A;  2GSQ A;  1YVL A;  3M9K A;  2GZZ A;  2CV4 A;  1RW1 A;  4XS4 B;  1XIY A;  4QQ7 A;  1I9D A;  1BG5 A;  3QFB C;  4GRF A;  1A8L A;  4MF7 A;  4ZB6 A;  5KN1 A;  5CAX A;  4N11 A;  4HQS A;  5FWG A;  3FZA A;  3M1G A;  3GMF A;  4MZW A;  5J40 A;  5F0G A;  2QC7 A;  1F3B A;  4Z2R A;  1ZCP A;  4BL7 B;  3UMA A;  4GSS A;  2VUP A;  1VGL A;  4V1A p;  4KCE A;  2H1B A;  2K9F A;  3TJJ A;  1V98 A;  1M7T A;  2YWI A;  2VCQ A;  3HZ8 A;  1XZO A;  3CSI A;  3LOR A;  4ZBB A;  1FVK A;  2IMF A;  3KD0 A;  1B4Q A;  1A23 A;  1O6J A;  3UJ1 A;  3ZYW A;  5J9C A;  4NHZ A;  5ECM B;  3FZ9 A;  3KCM A;  3GL3 A;  3IOS A;  4BA7 A;  4NMU A;  2P5Q A;  1T1V A;  5JCG A;  2YCD A;  2GZY A;  6GSS A;  1O73 A;  5D96 A;  3TJF A;  4I6X A;  2LJK A;  1EGR A;  5JWR B;  1SEN A;  4KSM A;  5G30 A;  1GUH A;  1K0O A;  5EVO A;  3TJB A;  1G7E A;  4K8M A;  3G7Y A;  3ZVJ D;  3MDK A;  2N5F A;  5ECO B;  1G7O A;  1TRV A;  3P2A A;  2YOI A;  1GWC A;  4BWQ A;  4N30 A;  1GTU A;  5F07 A;  2C3N A;  2YWM A;  3IK9 A;  3KMN A;  1FB6 A;  2IFQ B;  2IJY A;  3PR8 A;  4TR3 A;  2IME A;  2CAI A;  2E2M A;  2OT3 A;  3TUE A;  2YNX A;  1WP0 A;  4JR6 A;  3GSS A;  2HSM B;  4MPG A;  3A2X A;  3VWV A;  3A3T A;  6GSX A;  2HSN B;  4K7O A;  2H1G A;  2VCV A;  3G7I A;  5HR1 A;  2FUG 2;  4A5P A;  4QMK A;  2VL3 A;  1OVN A;  3GST A;  4HZ4 A;  1SJ6 A;  4J2F A;  4JED A;  1EWX A;  1ZZY A;  1JHB A;  2DLX A;  1F2E A;  1RK4 A;  1VF4 A;  4PUR A;  1O7U A;  3U5R E;  2FY6 A;  4N10 A;  4K0G A;  2YJ7 A;  2E7P A;  2NVL A;  4Q5Q A;  1BED A;  4X4J A;  3N5O A;  3QFA C;  2P31 A;  3Q19 A;  2HNL A;  2LRT A;  4WBJ A;  3FZ4 A;  5B8A A;  3K8N A;  4IJ3 A;  2HQT A;  2K8V A;  2IFQ A;  2K18 A;  1ABA A;  4IJI A;  2MMZ A;  2AUV A;  5LCZ A;  2AAW A;  1EOG A;  3EMP A;  5L71 A;  1WE0 A;  1DE2 A;  2HSM A;  4E68 A;  3NOF A;  2HZE B;  1H75 A;  2HSN A;  2X8G A;  2H76 A;  3G7J A;  3MAK A;  2EIR A;  3MIX A;  3L9S A;  1CQH A;  2PWJ A;  1TJD A;  4J57 E;  5A4V A;  3FYG A;  1W89 A;  11GS A;  2XPE A;  3GH6 A;  5J5N A;  4MDC A;  2YWN A;  4HJM A;  1VF2 A;  2O87 A;  1T8E B;  5J4Y A;  2PPT A;  2A2R A;  5J4U A;  1EV4 A;  4GCI A;  4XCS A;  2HRF A;  1DE1 A;  1A0F A;  4PXO A;  3L9V A;  3IAS 2;  2VL9 A;  1Q4J A;  3TKS C;  2XPD A;  8GSS A;  1TI3 A;  2XC2 A;  1FHE A;  5D9W A;  3GUS A;  3FK8 A;  3IHQ A;  3GUR A;  4PX1 A;  2DJ3 A;  2R0P A;  4IQA A;  4O7H A;  1FG4 A;  3H8Q A;  2IWT A;  3KP8 A;  3RAZ A;  12GS A;  2NDO A;  4LA1 A;  5LNK e;  2HZE A;  1PN9 A;  4V2L A;  4HI7 A;  5A4U A;  4H86 A;  4XHM A;  4PNF A;  1DSB A;  2VD1 A;  2VM2 A;  3D0Z A;  2L59 A;  2XBQ A;  2I4A A;  6GST A;  2CT6 A;  2OJL A;  5ECK B;  1XCC A;  2L4C A;  2FA8 A;  1I5G A;  1GUK A;  4ACS A;  1YZX A;  4EC0 A;  2KP2 A;  2CVK A;  4ICY A;  4G0L A;  5ECP B;  4MCU A;  4TXV A;  2DBC A;  5G1K A;  5CYY A;  4IHU A;  1X0R A;  1GTB A;  1X9M B;  2H6X A;  1A24 A;  2VCT A;  1PRX A;  1UN2 A;  2B1K A;  5AN1 A;  2H1A A;  1YY7 A;  1K0B A;  3I9V 2;  4K2D A;  4POK A;  1BX9 A;  1A2J A;  1NHO A;  4RI7 A;  4OCE A;  1TW9 A;  1HQO A;  1Z6N A;  2VCW A;  4K5R A;  3N9J A;  4XIH A;  1XWA A;  4OFN A;  1G0T A;  1GLP A;  3HVX A;  3QOU A;  4ECJ A;  1WRY A;  3ZFB A;  2H01 A;  4Z7X A;  1NHY A;  2HI7 A;  1QXH A;  1OYJ A;  3ZVJ A;  4IS0 A;  2AV4 A;  1A2L A;  1TU8 A;  1ACV A;  2QA1 A;  5G5E A;  1E2Y A;  5C00 A;  1HNA A;  3F8U A;  4HZ2 A;  3DD3 A;  14GS A;  2FLS A;  2C4J A;  2RUE A;  2LQQ A;  5GAP D;  3F4R A;  2LJA A;  3F4S A;  3IPZ A;  1X5C A;  4EIQ A;  2NTO A;  3L0H A;  2B3S A;  1SKW B;  4YKG A;  4ECB A;  1A8Y A;  2H6Z A;  4GLT A;  5J3R A;  3TKS A;  1GLQ A;  4POB A;  4AKH A;  3FZ5 A;  1N25 A;  4G0I A;  3WT2 A;  2CVB A;  3BCI A;  3UIW A;  5IOW A;  2H1L A;  2EFE A;  2YWO A;  2LUS A;  2FA4 A;  1XBS A;  2HZF A;  4MPF A;  1K0A A;  4GQC A;  3ERF A;  2OBI A;  1O85 A;  1ILO A;  3HYP A;  4RI6 A;  3CWG A;  1V9W A;  1VF3 A;  3KTL A;  1TRW A;  2RUF A;  5HR2 A;  3EUR A;  2CA8 A;  3CSJ A;  3RPN A;  3APS A;  5GST A;  4G9H A;  3F0I A;  2GGT A;  3R3E A;  3H1N A;  2HSH A;  2KLX A;  3DWV A;  4MZC A;  3HVS A;  5A4W A;  3CTG A;  1TRU A;  4TRX A;  1AQV A;  3LJR A;  5IPH A;  1Q98 A;  4F0B A;  2RM6 A;  1AAZ A;  2PUK C;  1ZYQ B;  4O5U A;  1R4W A;  1B4P A;  1Z3E A;  6GSW A;  3SBC A;  3WYW A;  1H4O A;  3CRT A;  1ZL9 A;  2IIY A;  3ED3 A;  1ZOF A;  1QK8 A;  2DC5 A;  3G9B A;  4RQX A;  3L9U A;  5JWO B;  2X64 A;  3D4M A;  1R5P A;  2X8C A;  3SWL A;  3D4T A;  3WT1 A;  3BD2 A;  1J9B A;  4CW9 A;  1XWG A;  5CNW A;  4MH2 A;  2GT6 A;  2O7K A;  1MD4 A;  4JE1 A;  2VLU A;  4DSS B;  1VF1 A;  3TJG A;  13GS A;  4MJE A;  2XHF A;  4KDU A;  1SD8 A;  1PN0 A;  3M9J A;  3QCP A;  1XWK A;  3DRN A;  3R2Q A;  4FO5 A;  2PU9 C;  4GTU A;  4RQR A;  3GKN A;  1OC9 B;  4MMM A;  3ME8 A;  2OAC A;  1GSS A;  2FWF A;  3F3R A;  4LLR A;  2B7K A;  4MAB A;  4F03 A;  2DJ2 A;  1M2D A;  5G2Z A;  3HVV A;  4G10 A;  4DSQ A;  5DCG A;  4GXZ A;  3A5W A;  3LYK A;  2ZNM A;  4V2N A;  2G0F A;  5GSS A;  4WET A;  3APQ A;  5JCU A;  3C1S A;  1U3A A;  2RM5 A;  4YKF A;  2FGX A;  3HHV A;  1XW5 A;  2CX3 A;  2R0G A;  2L57 A;  1XOB A;  3U6V A;  1X9W B;  4DSS A;  1M2B A;  3PH9 A;  1LBK A;  4G2E A;  4O5R A;  2F3M A;  1K0N A;  5GAN D;  1R7H A;  2GSS A;  1EEJ A;  2HRN A;  1WJK A;  4WR5 A;  1AUC A;  2AB6 A;  2HRA A;  2WDU A;  2AJQ B;  4OFT A;  4IW9 A;  2A2P A;  4EF0 A;  3F9U A;  3Q74 A;  4DVC A;  5KN0 A;  2VLT A;  2LRC A;  2N5A A;  3ZFL A;  3LSZ A;  3H4K A;  1OC9 A;  1LU4 A;  1OKD A;  3IXR A;  3QPM A;  2B6M A;  1S3A A;  5ELA A;  1CQG A;  4LMV A;  3TRQ A;  3TOU A;  4K6X A;  3TKP A;  3UAR A;  3F4T A;  1X5E A;  2YP6 A;  3O6T A;  4ZL9 A;  2F8F A;  5D8I A;  2LNT A;  3GFK A;  1JZW A;  4ZBA A;  2WS2 A;  3MSZ A;  2VCZ A;  1SL0 B;  1YQ1 A;  5DQS A;  4OMV A;  1RQM A;  1TP9 A;  5DAL A;  5E4W A;  4GST A;  2CZ3 A;  4KAE A;  3F3Q A;  1DUG A;  5DAK A;  5BRT A;  4W66 A;  1V58 A;  2YV9 A;  1EP8 A;  2LV3 A;  3PIN A;  2IN3 A;  1F3A A;  2GDR A;  1M99 A;  3UOM A;  3FEU A;  2X99 A;  5JCW A;  4IQ1 A;  3GRX A;  4WR4 A;  1YF0 A;  1TK0 B;  4MJC A;  3US3 A;  3KH7 A;  4PQ1 A;  2H0I A;  4CY8 A;  1MTC A;  1ML6 A;  3E9J B;  5CRW A;  4HQZ A;  3IRA A;  1B9Y C;  2FWE A;  2L6C A;  2R4V A;  1GUM A;  4F0C A;  4GDF A;  4RUV A;  4WF5 A;  3ZL5 A;  2C0F A;  4V1A g;  5IIZ A;  4TR4 A;  1TTZ A;  2KUC A;  5IMV A;  3L78 A;  2HXK A;  3IDV A;  2HFD A;  1FW1 A;  2CX4 A;  4WBR D;  2UZ8 A;  3CMI A;  1GH2 A;  3EE2 A;  2V6O A;  1Z6M A;  3DEX A;  4I97 A;  17GS A;  2HSY A;  2C3T A;  1XWB A;  1AIU A;  2OE0 A;  2V32 A;  1X5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...