3W8SA

Crystal structure of monomeric na-gst-3, a glutathione s-transferase from the major human hookworm parasite necator americanus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
VHYKLTYFDGRGAAEIIRQIFVLAGQEYEDIRLSHDEWPKYKNEMPFGQLPVLEVDGKKLAQSFAIARFVAKKFGFAGKCPFEEALVDSITDQYKDFINEIRPFLRVAMGFAEGDLEKLSNEVFLPAREKFFGFMTNFLKESKSGYLVGDSLTFADLYLAECASEFAKKTPTIFDGFPEIKAHAEKVRSNPALKKWIETRPETKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase-3
publication title Structure of monomeric Na-GST-3, a glutathione S-transferase from the major human hookworm parasite Necator americanus.
pubmed doi rcsb
source organism Necator americanus
molecule tags Transferase
total genus 74
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3w8sA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3w8sA01
1QFNA 1ZCPA 4AJ8A 4IQ1A 1QMVA 2JU5A 1TK0B 2HZEA 4EL1A 1KNGA 2L6DA 3N9JA 4DSRA 4GLTA 1A24A 1ABAA 1M9AA 2QKEA 1AQVA 4MH2A 3GA4A 4MA9A 3FZAA 3TKQA 1SENA 1B4QA 1WE0A 1JFUA 4I6XA 2EC4A 1TDIA 3I69A 3QD9A 2CAIA 1Z6NA 3ZIJA 3HXSA 2NVLA 2RUEA 4ECBA 10GSA 3IRAA 1PX6A 3TKRA 5L71A 2HRAA 1GSYA 2IMIA 2YWNA 4XIHA 3MNGA 2TRXA 5IM9A 4KNDA 2M80A 3WD6A 1OKTA 2HQTA 4ZL9A 4G0IA 1S3DA 2O85A 2N5BA 1NHYA 4GQCA 2HRKB 3ERGA 4HU7A 1LBKA 4YAPA 2LV3A 3HVXA 2IMEA 1G7EA 1XWBA 2DJ3A 4KE3A 5G5FA 3FEUA 4PUAA 4MMMA 2PUKC 2MMZA 3G7JA 5J9CA 2G2QA 1LJRA 2L4QA 3D21A 2O87A 2FWEA 5HFKA 3C1SA 5B7CA 3FYGA 1PL2A 4IQAA 5G2ZA 3GX8A 3K8NA 1F6MC 2XC2A 2FY6A 5COHA 3CTFA 1A0FA 1ST9A 3AY8A 4KW6A 1SL1B 1DBYA 4TN8A 1PKWA 2L5OA 2H1DA 3US3A 4IN0A 3VLNA 3TB2A 3VI7A 4ISDA 1IYHA 5LCZA 4N11A 3IOSA 1DUGA 3GL3A 4LMWA 4PX1A 1WRYA 2KP2A 3VWVA 4TKYA 3F4RA 1XW6A 2WULA 5JCWA 5FHIA 2K9FA 4X1UA 3EMXA 1BYEA 2FWGA 5D8IA 2CZ3A 1O8WA 4KCAA 1BEDA 4XS6A 5D9XA 2XPDA 2MZCA 4WR5A 3LJRA 3H93A 4IELA 3HA9A 4OCEA 2E2MA 1OC9A 5E4WA 1A2LA 5JCUA 2H1GA 4JE1A 3HVSA 5CRDA 2DJ0A 3DWVA 2QSIA 3L9UA 4PQHA 1SKWB 3GTUA 1GH2A 4TR1A 2CQ9A 4E8EA 1SU9A 2XHFA 5GAPD 1H75A 4O7HA 3QFBC 1T3BA 1A2MA 4NPBA 3QFAC 3UEMA 1GLPA 1OVNA 1W4VA 2H6ZA 4JRRA 2BJXA 2R3XA 2OA7A 3TOTA 1PRXA 2H76A 4EKZA 3EC3A 5AGYA 1GTBA 1EP7A 4WF5A 3D4MA 1T00A 2A4VA 3HDCA 4TOPA 3UL3A 1S3AA 5FWGA 4FH8A 2LTKA 2GQLA 3M8NA 3IK7A 5IO2A 1K0OA 2CA8A 4ZILA 4G19A 1OC8A 3IPZA 2FA8A 5H5SA 1F3BA 3ZREA 1U3IA 7GSSA 1OC9B 1ERVA 2GSRA 4IP1A 4NMUA 3GTUB 4RQXA 3TJGA 3ZIVA 4TR1B 3GX0A 5INYA 3FW2A 2VO4A 2JZSA 2B1KA 4DSQA 4IGJA 2YWIA 3TUEA 3GN3A 13GSA 1WIKA 4PTSA 2ON7A 1QGVA 5G1KA 2HSYA 3UMAA 6GSYA 1ERWA 4BWSA 1R7HA 1YJ6A 3TJBA 4DSSA 1NM3A 3IE3A 4L8EA 2B3SA 5CRHA 5DCGA 2RM6A 2VCTA 2VL2C 2GZYA 4V1Ag 3WGDA 4F0BA 3TRXA 4WF4A 1GULA 4FYUA 1DE1A 2JADA 5CP1A 4TR4A 4HJMA 2YJ7A 2DJ1A 2EIRA 3IAM2 1ZZYA 2H66A 3C73A 4HU9A 1M2BA 4NXIA 2PU9C 2HLSA 2OJLA 1PQNA 3E0UA 4JBBA 2C8UA 2B7KA 2B7JA 5IPHA 3D0ZA 4P3YB 1MD4A 3CXGA 5CREA 1ZMAA 3GKXA 3R3EA 2PPTA 2L6CA 5AIVA 1AIUA 2YV9A 2OACA 1THXA 2YOIA 2H71A 1V9WA 2VM2A 4AGSA 3PINA 4DSSB 3F0IA 4KUNA 4ML1A 2GT5A 2ZUPA 1OC3A 3M9JA 5ABRA 3HYPA 2LRNA 20GSA 3R2QA 2VD0A 5ECPB 4OWYA 1FVJA 5IMDA 1ZYEA 2GQMA 1U87A 3HKRA 4ULXA 2H0IA 1GUMA 1PMTA 2GZPA 1ZL9A 4HI7A 1DE2A 4LMVA 3LWAA 2HYXA 2VL3A 2NDOA 4F82A 4GTUA 5A4WA 1V58A 1YF1A 4I97A 3PGTA 4AF2A 4AJ7A 3RBTA 4Q5NA 1UVZA 3WT2A 3EU3A 1OYJA 3L9SA 1RK4A 2E2GA 5G5EA 4MF5A 4PXOA 5DVBA 3BBYA 3UARA 3D6IA 4KX4A 2A2RA 1NSWA 3FZ9A 3WGEA 2H0HA 5KN2A 4TRXA 2VL2A 4L0UA 3ZFLA 2JL4A 2O8VB 3DEXA 2DJ2A 4HDEA 4FYCA 2GSQA 1B8XA 1XBSA 5B8BA 3DGQA 2RLIA 4DVCA 1U3AA 2CVDA 2R5GA 2VCXA 1F2EA 4MJAA 9GSSA 4BWQA 5HR3A 4MK3A 5ECMB 3NZNA 1GSSA 1SL0B 2R6KA 4PQIA 1J08A 4K9ZA 1ACVA 1OE8A 1K3YA 1GUKA 1X5DA 2LJRA 2X8GA 2RM5A 1GSQA 4MPFA 4WETA 2FD3A 3P90A 4MJCA 4GXZA 3F6FA 5ECIB 4O92A 3UIWA 1ERTA 4XS1A 2LQQA 1LU4A 3I6AA 4PQ1A 3ZLPA 1XVWA 1JHBA 3M3MA 2IMDA 1ZYQB 1M0UA 5IIZA 2DJJA 2YP6A 3DKSA 1V57A 1Z6MA 1WJKA 3SBCA 1SD8A 1EV9A 2VAFA 3WGXA 1QQ2A 3H79A 5IOWA 3APQA 3TRQA 4MP4A 2OBKA 3DIEA 3HZ8A 2V6KA 5DAKA 3KGKA 2GLRA 2LQOA 1T8EB 1GSEA 2VCVA 1TRVA 1X0RA 3KH7A 1M9BA 2PERA 2GTUA 2K8VA 3CSJA 5IOXA 3D5JA 1EEJA 4RI7A 3VWUA 4TR3A 1FO5A 2HRFA 2BTOT 1MD3A 1OKDA 1ILOA 3A2VA 2GSSA 2EIQA 3EURA 2FCHA 2DMLA 3HVVA 1M2AA 2HSNB 4ILFA 3FK8A 1FG4A 1X5EA 2LRCA 4MABA 1G7OA 3BD2A 5D96A 3DRNA 4MF6A 1EP8A 3N5OA 3H8QA 2AV4A 4TXVA 2CX4A 4NHZA 4OO4A 1K0AA 4XCSA 2KHPA 3IXRA 3UBKA 1N2AA 1PA3A 5CRWA 3EYTA 1MEKA 2NTOA 3IBHA 1SD9A 1XXUA 5DAKB 4K7NA 3UJ1A 1CQHA 2HZFA 1H4OA 5D9WA 3F63A 4ZXGA 4WBRD 3KMOA 4EDYA 4RUVA 2DLXA 3BJ5A 4ZBAA 3Q74A 4ZB8A 4K2DA 2E7PA 4F03A 2I1UA 3GL5A 5H5RA 2AHEA 3UVHA 4TVEA 1X9WB 2K8SA 1GSFA 2I3YA 2LSTA 2R2JA 3O3TA 1SYXA 2V41A 3GURA 3MAKA 2HFDA 5G1LA 2C80A 4RI6A 2VCWA 3U5RE 3LQ7A 1RW1A 5DBQA 5ECLB 2L4CA 4JR4A 6GSUA 2OBIA 2WCIA 5E59A 4H86A 1Y6EA 2H6YA 2DMMA 3E3EA 5J9BA 2YWMA 4POKA 4JZQA 2X8CA 4NWYA 5B8AA 1GSDA 3QAWA 4N0VA 4NV5A 1SK0A 3DYRA 3Q6OA 1FVKA 1EOGA 1WP0A 4IP6A 3H1NA 1UC7A 2NBSA 2LS5A 4WBJA 3FR9A 5IQYA 4N0ZA 4GRFA 2MYGA 1SJZA 6GSXA 1TK5B 4MPGA 2ALBA 5HFGA 2H19A 3KTBA 1XIYA 4RQRA 3RHBA 2OE1A 4YQVA 1K3LA 1XCCA 1RQMA 2IWTA 1W89A 3LEFA 4V2LA 3EINA 1GRXA 4ACSA 1THOA 3TKPA 1DSBA 1MDIA 5DQYA 1JZOA 5DJLA 2O7KA 1YKCA 3TDGA 4G2EA 1EGOA 4V2NA 1USBA 1R5AA 4POBA 4MCUA 1JLVA 3PH9A 5J5NA 4L5LA 2VLVA 3TRPA 4EVMA 4EXJA 3DVWA 2P31A 1TU8A 2MBTA 4ZB6A 3O6TA 4NV2A 3J7Yb 3P7XA 5JWQB 5G31A 3IHQA 4FO5A 4PNGA 4KA0A 4BPYA 2R4VA 2HE3A 1OAZA 2C3NA 5J3RA 1UA5A 19GSA 3SWLA 2H1BA 2PWJA 1YZXA 5F05A 4KH7A 1CQGA 1TK8B 1SJIA 4Z7XA 3LXTA 3VWWA 1NW2A 1XWGA 4X43A 5ECRB 3CRTA 4HZ2A 3IDVA 4LL1B 2I4AA 2XPEA 1TOFA 1T4YA 2C0GA 5JCGA 4OD7A 2MMAA 3RDWA 5IMAA 3A3TA 4EF0A 4D73A 3TJFA 1URMA 4E8HA 3KZQA 1O85A 1T7PB 3KP8A 1A23A 2H74A 4EDZA 5DJMA 3WYWA 5CO3A 4IKHA 1EOHA 3P2AA 2G0FA 1YF0A 2OADA 4I2UA 3NOFA 2E0QA 4HEA2 3TOUA 4F0CA 1G0TA 5AN1A 3ME8A 1EEMA 1J9BA 4EO3A 22GSA 4WR4A 2TRCP 3ZL5A 1GTUA 2KLXA 3GH6A 3OR5A 2K6VA 3DD3A 2YPMA 5KN0A 3C8EA 1PL1A 3M0FA 4GSTA 4JU5A 5A4UA 4KGIA 2X99A 3FRCA 3F8UA 2L5LA 4K0NA 4Q5RA 1A8YA 3A5WA 2D2ZA 3RPPA 2F51A 3LORA 2L57A 4D73B 3MDKA 1JLWA 2FHEA 2AJQB 3LFLA 1B4PA 2PGTA 2F9SA 1I9DA 5GSTA 3L78A 2CX3A 3KH9A 3KM6A 4YAVA 2FWFA 3TJJA 3LYKA 2B5XA 1AAZA 1BQ7A 2IL3A 6GSWA 5C00A 16GSA 4K7IA 5F06A 4MF7A 3MSZA 4CW9A 1SL2B 2KOKA 4IHUA 14GSA 3TJKA 2VCQA 2KUCA 3EVIA 4YQMA 4CHSA 1VF3A 2TIRA 4GSNA 2HNLA 3TGZA 2O89A 3GFKA 1TI3A 4I8BA 2KP1A 4F9ZA 4BA7A 3TCOA 1AC1A 5JWOB 1MDJA 1E6BA 1F3AA 6GSVA 3UBLA 3EE2A 4KSMA 1JZDA 3F3QA 5ECNB 3S9FA 2VIMA 1O8XA 5F07A 4KDYA 2C3QA 1X9SB 4G9HA 2C0EA 2YJHA 3CSHA 4OFMA 4L5OA 5G30A 3F4SA 1VRSD 2YV7A 2LNSA 3ZITA 1SK2A 2H30A 1V98A 3QPMA 1XW5A 2F3MA 1YEXA 3RHCA 2YANA 4G10A 5B6MA 4AJ6A 2WZ9A 4I2TA 1GP1A 3KD0A 1WOUA 1XOAA 4KB3A 3IC8A 2WB9A 3KP9A 5F8BA 5LNKe 1M2DA 5HFIA 1QK8A 5HR1A 3ME7A 2LRTA 1YKAA 2WJUA 1TRWA 2VL9A 1ON4A 2GS3A 1BG5A 5BMUA 2YZUA 2PVOC 4HS1A 1KBNA 3QMXA 3KMNA 3GIXA 2A2SA 4GWRA 2LUSA 3VI5A 1XOBA 3LXZA 2WGRA 2CVBA 3I9V2 1MDKA 4USSA 2IJYA 4XTSA 4ZB9A 5D93A 4FIWA 1ML6A 2HXKA 3HCZA 4N10A 2C0FA 4ECIA 1HYUA 4IJ3A 2M72A 1KEBA 4PURA 2YCDA 3HZ4A 3H4KA 3P8WA 1B9XC 3V1WA 6GSTA 5CYYA 2H73A 3CMIA 4K8MA 3IV4A 1PGTA 4KDUA 2CZ2A 2ZCTA 1HNAA 3VFIA 1R4WA 1GNEA 1YY7A 4MDCA 1XWAA 1VGLA 2GZZA 3L4NA 1GUHA 5J4UA 3FR6A 3Q18A 1TJDA 2V6OA 3L9VA 1EV4A 4YH2A 1V40A 4PUFC 1K0BA 4WKWA 5EL8A 5EY6A 4QL7A 4L0WA 1GTIA 3VURA 1AUCA 2HSMA 2FWHA 1OE7A 3F4TA 2YWOA 3C71A 1O6JA 1AQWA 1Q98A 3LG6A 5B6NA 4I5QA 2C3TA 1N8JA 8GSSA 2OKAA 2JSYA 1GNWA 2CV4A 3ED3A 4FQUA 2VM1A 1FB0A 3Q19A 4HOJA 5IMVA 1SKRB 4MJBA 3F9UA 2GT6A 1XWKA 2YZHA 3IK9A 4IS0A 5ENUA 1I5GA 2P5RA 4ID0A 4K6XA 5IPGA 3QCPA 5DQSA 4K0GA 3G9BA 2GVPA 1FB6A 3ZFBA 2HSHA 2GQKA 2R37A 1PSQA 4Q5FA 4O5RA 4QQ7A 3KEBA 3TKSE 2FNOA 3W8SA 3ZRDA 18GSA 5IMZA 11GSA 4KF9A 2JZTA 4ECJA 2DBCA 2HSMB 4J56E 2OE3A 3I43A 2LEGA 1A0RP 2YN1A 2C0DA 5CNWA 4WEYA 3JCML 3GKMA 2P5QA 3FHKA 3KCMA 2HZEB 4Q5QA 1B48A 4JR6A 4CDOA 1B9YC 4LA1A 2HRNA 1TTZA 1XW9A 2X64A 3C1RA 5F0GA 3HJMA 1GSUA 2WRTA 3APSA 1FOVA 2VLUA 3PR8A 4MZWA 2FA4A 2J23A 2I81A 1XVQA 1JZRA 2WS2A 1JZWA 5AISA 5DALA 2LKUA 4V1Ap 2H70A 1F37A 1TXXA 5HR0A 3A2XA 1HD2A 3FY7A 2H6XA 5J41A 1TRSA 4QL9A 2DSAA 2MMOA 1AQXA 3IR4A 1EZKA 3HHVA 3F6DA 2DJKA 2AUVA 5EPFA 3GKKA 4PNFA 3BCIA 2C1YA 1TW9A 3FZ5A 2WFCA 4NAXA 1PN9A 2GGTA 2GDRA 3ZMKA 2JACA 2VLTA 3LGCA 3E9JB 1Z9HA 3PPUA 4LL4B 1FW1A 1C72A 3GSSA 3HY2A 4HUAA 2PN8A 2J9HA 3ZYWA 5IMCA 4HQSA 1XFLA 5KN3A 2IFQA 3FKFA 2DIYA 4G0KA 2N5AA 5C04A 1XZOA 4BL7A 2RUFA 3ZTLA 3NIVA 3W6GA 3HJPA 2ES7A 5DALB 5DDLA 4EC0A 2P0GA 4ML6A 4J57E 2NPBA 2JSZA 3GNJA 1Y25A 3FR3A 5AIXA 1YEPA 2H75A 4GSSA 1VF4A 2IIYA 5CRGA 1QUWA 1A2JA 3D22A 2XBIA 3ZVJA 5GZZB 1R5PA 4IW9A 4POMA 3M1GA 4OFNA 3QAVA 2VD1A 1GTAA 5GSSA 5KN1A 3ISOA 2QC7A 2V2GA 3A2WA 1K0CA 4XRAA 3DMLA 2B1LA 3ZVJD 2YNXA 2IFQB 3F3RA 3KJYA 2PVQA 1NHOA 1E2YA 1V2AA 4LLRA 4BL7B 3UVTA 1EWXA 2CT6A 5ECSA 1GWCA 3CRUA 4FYBA 4O32A 1Z7PA 1SJ6A 2V32A 5D73A 1O73A 1VF2A 2I9HA 4GQFA 2RIIA 4G0LA 2XBQA 2H8LA 5D9TA 5HQPA 1ZOFA 12GSA 1T1VA 2H1AA 3LSZA 4XRDA 2B5EA 2K18A 5ECKB 2QGVA 1K0DA 3C7MA 1PD21 2F8AA 3M9KA 3QR6A 4V2MA 5HR2A 3RAZA 2H72A 4K7OA 5A4VA 3CYNA 3IAS2 5IO0A 3W8JA 3APOA 1HNBA 4NHWA 2IMKA 3J7Yk 2L59A 4OO5A 3LYPA 3FZ4A 3GYKA 2GSTA 1KTEA 2CVKA 2LJAA 2ZNMA 1AW9A 4TR0A 3CBUA 2FUG2 5ECHB 2VUPA 2H01A 3DVXA 5CAXA 2B5YA 3EWLA 2HI7A 2BMXA 1YQ1A 4WXTA 3ERWA 4HJ2A 5IMFA 1SYRA 4GF0A 3L0HA 4POLA 3UAPA 5KEJA 3EU4A 3IC4A 4MJEA 1HQOA 2PBJA 17GSA 4N30A 4BVYA 5ELGA 1PX7A 4TXOA 2V1MA 4YQUA 4BVXA 1BJXA 4X0XA 1Z3EA 1HNCA 1G6YA 2IPAA 2DIZA 3G7IA 3GUSA 2WDUA 4OCFA 3TKSC 2FGXA 3CTGA 4K1FA 4MZCA 3IA1A 5EVOA 1F9MA 1R26A 3QAGA 4ECCA 3QDNA 2DC5A 4IBPA 4ZBDA 4J2FA 2ON5A 4EUYA 1TKDB 1WWJA 4GCIA 3GMFA 2OE0A 1SKSB 2IN3A 5FT3A 3BOAA 1SK1A 2EIOA 3ERFA 5DCHA 1J0FA 2JZRA 3GSTA 3GKNA 2VCZA 4IJIA 1FAAA 4ZIJA 5GAND 2AB6A 3WT1A 4OFTA 4KSOA 4EE0A 2MMNA 1K0MA 3O76A 1Z7RA 2LJKA 2REMA 5ID2A 1BX9A 3QOUA 2UZ8A 4BVYB 6GSSA 4OMVA 4MZBA 4TXOB 3ZZXA 5ELAA 4BVXB 4XS4A 1VF1A 1XPVA 2AYTA 2H0GA 4KAEA 1S3CA 5H5QA 1BAYA 1G6WA 3VPQA 4F2IA 3KXOA 1T4ZA 1X9MB 4ZL8A 4HZ4A 2AAWA 1M99A 1IYIA 3HJOA 2Z9SA 4ZL7A 1Z5YE 3U6VA 2PMTA 1EGRA 4DEJA 1WMJA 3BCKA 3KIJA 2X8HA 4PGTA 1XWCA 5LD0A 2C4JA 1O81A 1U88A 2CAQA 4KDXA 1TRUA 3UOMA 1ZGNA 2HT9A 1A8LA 1FHEA 4JEDA 1TU7A 1TP9A 3KTLA 4MH3A 3EMPA 1QXHA 3CSIA 1U6TA 4ZBBA 5ECOB 2B6MA 5ECQB 3DXBA 3RPNA 2MBSA 5ID2B 2M46A 1Q4JA 2IMFA 4TW5A 3GHAA 2LNTA 4XS4B 3GV1A 3VWXA 4IVFA 3VPTA 1PKZA 3G7YA 3TKSA 5D9VA 2VOCA 5JWRB 3ZMLA 3GH9A 1O7UA 3GRXA 4KCEA 5A5KA 1M7TA 2F8FA 1AXDA 3VK9A 2N5FA 3MWHA 1GLQA 1WPIA 3D4TA 2FLSA 1X5CA 3HD5A 2HRKA 4XHMA 1GL8A 4HQZA 1TI1A 1K0NA 1MTCA 1K3OA 1YDKA 4MLYA 1ERUA 1UN2A
chains in the Genus database with same CATH superfamily
1QFNA 1ZCPA 4MNNA 4AJ8A 4IQ1A 1QMVA 2JU5A 1TK0B 2WW1A 2HZEA 4EL1A 3A5IA 1KNGA 2L6DA 3N9JA 4DSRA 4GLTA 1A24A 1ABAA 1M9AA 2QKEA 1AQVA 2UV8G 4MH2A 3GA4A 4MA9A 3FZAA 3TKQA 1SENA 1B4QA 1WE0A 1JFUA 4I6XA 2EC4A 1TDIA 3I69A 2O3EA 3QD9A 2CAIA 1Z6NA 3ZIJA 3HXSA 2NVLA 2RUEA 4ECBA 10GSA 3IRAA 1PX6A 3TKRA 5L71A 2HRAA 1GSYA 2IMIA 2YWNA 4XIHA 3MNGA 2TRXA 5IM9A 4KNDA 2M80A 3WD6A 1OKTA 2HQTA 4ZL9A 4G0IA 1S3DA 2O85A 2N5BA 1NHYA 4GQCA 2HRKB 3ERGA 4HU7A 1LBKA 4YAPA 2LV3A 3HVXA 2IMEA 1G7EA 1XWBA 2DJ3A 4KE3A 5G5FA 4PHZC 3FEUA 4PUAA 4MMMA 2PUKC 2MMZA 3G7JA 5J9CA 2G2QA 1LJRA 2L4QA 3D21A 2O87A 2FWEA 5HFKA 3C1SA 5B7CA 3FYGA 1PL2A 4IQAA 5G2ZA 3GX8A 3K8NA 1F6MC 2XC2A 2FY6A 5COHA 3CTFA 1A0FA 4CY6A 1ST9A 3AY8A 4KW6A 1SL1B 1DBYA 4TN8A 1PKWA 2L5OA 4N3ZA 2H1DA 3US3A 4IN0A 3VLNA 3TB2A 3VI7A 4ISDA 1IYHA 2WVXA 5LCZA 4N11A 3IOSA 1DUGA 3GL3A 4LMWA 4PX1A 1WRYA 2KP2A 3VWVA 4TKYA 3F4RA 1XW6A 2WULA 5JCWA 5FHIA 2K9FA 4X1UA 1SVOA 3EMXA 1BYEA 2FWGA 5D8IA 2CZ3A 1O8WA 1FOHA 4KCAA 1BEDA 4XS6A 5D9XA 2XPDA 2MZCA 2O36A 4WR5A 3LJRA 3H93A 4IELA 3HA9A 4OCEA 2E2MA 4AI6A 1OC9A 5E4WA 3MIXA 1A2LA 5JCUA 2H1GA 4JE1A 3HVSA 5CRDA 2DJ0A 3DWVA 2QSIA 3L9UA 4PQHA 1SKWB 3GTUA 1GH2A 4TR1A 2CQ9A 4E8EA 1SU9A 2XHFA 5GAPD 2WVXB 1H75A 4O7HA 3QFBC 1T3BA 1A2MA 4NPBA 3QFAC 3UEMA 1GLPA 1OVNA 1W4VA 2H6ZA 4JRRA 2BJXA 2R3XA 2OA7A 3TOTA 1PRXA 2H76A 4EKZA 2R0CA 3EC3A 5AGYA 1GTBA 1EP7A 4WF5A 3D4MA 1T00A 2A4VA 3HDCA 4TOPA 3UL3A 1S3AA 5FWGA 4FH8A 2WW0A 2LTKA 2GQLA 3M8NA 3IK7A 2QA2A 5IO2A 1K0OA 2CA8A 4ZILA 4G19A 1OC8A 3IPZA 2FA8A 5H5SA 1F3BA 3ZREA 1U3IA 7GSSA 1OC9B 1ERVA 2GSRA 4IP1A 4NMUA 3GTUB 4RQXA 3TJGA 4AKHA 3ZIVA 4TR1B 3GX0A 5INYA 3FW2A 2VO4A 2JZSA 2B1KA 4DSQA 4IGJA 2YWIA 3TUEA 3GN3A 13GSA 1WIKA 4PTSA 1BG1A 2ON7A 1QGVA 5G1KA 2HSYA 3UMAA 6GSYA 1ERWA 4BWSA 1R7HA 1YJ6A 3TJBA 4DSSA 2DKHA 1NM3A 3IE3A 4L8EA 2B3SA 1PN0A 5CRHA 5DCGA 2RM6A 2VCTA 2VL2C 2GZYA 4V1Ag 3WGDA 4F0BA 3TRXA 4WF4A 1GULA 4FYUA 1DE1A 2JADA 5CP1A 4TR4A 4HJMA 2YJ7A 2H1LA 2DJ1A 2EIRA 3IAM2 1ZZYA 2H66A 3C73A 4HU9A 1M2BA 2O5VA 4NXIA 2PU9C 2HLSA 2OJLA 1PQNA 3E0UA 4JBBA 2C8UA 2B7KA 2B7JA 5IPHA 3D0ZA 4P3YB 1MD4A 3CXGA 5CREA 1ZMAA 3GKXA 3R3EA 2PPTA 2L6CA 5AIVA 1AIUA 2YV9A 2OACA 1THXA 2YOIA 2H71A 1V9WA 2VM2A 4AGSA 5A34A 3PINA 4DSSB 3F0IA 4KUNA 4ML1A 2GT5A 2ZUPA 1OC3A 3M9JA 5ABRA 3HYPA 2LRNA 20GSA 3R2QA 2VD0A 5ECPB 4OWYA 3RFRC 1FVJA 5J4VA 5IMDA 1ZYEA 2GQMA 1U87A 3HKRA 4ULXA 2H0IA 1GUMA 1PMTA 2GZPA 1ZL9A 4HI7A 1DE2A 4LMVA 3LWAA 2HYXA 2VL3A 2NDOA 4F82A 4GTUA 5A4WA 4HSCX 1V58A 1YF1A 4I97A 3PGTA 4AF2A 5KOWA 4AJ7A 3RBTA 4Q5NA 1UVZA 3WT2A 3EU3A 1OYJA 3L9SA 1RK4A 2E2GA 5G5EA 4MF5A 4PXOA 5DVBA 3BBYA 3UARA 1Y1UA 3D6IA 4KX4A 2A2RA 1NSWA 3FZ9A 3WGEA 5A34B 2H0HA 5KN2A 4TRXA 2VL2A 4L0UA 3ZFLA 2JL4A 2O8VB 3DEXA 2DJ2A 4HDEA 4FYCA 2GSQA 1B8XA 1XBSA 5B8BA 3DGQA 2RLIA 4DVCA 1U3AA 2CVDA 2R5GA 2VCXA 1F2EA 4MJAA 9GSSA 4BWQA 5HR3A 4MK3A 5ECMB 3NZNA 1GSSA 1SL0B 2R6KA 4PQIA 1J08A 4K9ZA 4GDFA 1ACVA 1OE8A 1K3YA 1GUKA 1X5DA 1YVLA 2LJRA 2RM5A 2X8GA 1GSQA 4MPFA 4WETA 2FD3A 3P90A 4MJCA 4GXZA 3F6FA 5ECIB 4O92A 3UIWA 1ERTA 4XS1A 2LQQA 1LU4A 3I6AA 4PQ1A 3ZLPA 2HSNA 1XVWA 1JHBA 3M3MA 2IMDA 1ZYQB 1M0UA 5IIZA 1ZYPA 2DJJA 2YP6A 3DKSA 1V57A 1Z6MA 1WJKA 3SBCA 1SD8A 1EV9A 2VAFA 3WGXA 1QQ2A 3H79A 5IOWA 3APQA 3TRQA 4MP4A 2OBKA 3DIEA 3HZ8A 2V6KA 5DAKA 3KGKA 2GLRA 2LQOA 1T8EB 1GSEA 2VCVA 1TRVA 1X0RA 3KH7A 1M9BA 2PERA 2GTUA 2K8VA 3CSJA 5IOXA 3D5JA 1EEJA 4K5SA 4RI7A 3FMWA 2A4HA 3VWUA 4TR3A 1FO5A 2HRFA 2BTOT 1MD3A 1OKDA 1ILOA 3A2VA 2GSSA 2EIQA 3EURA 2FCHA 2DMLA 3HVVA 1M2AA 2R0PA 2HSNB 4ILFA 3FK8A 1FG4A 1X5EA 2LRCA 4MABA 1G7OA 3BD2A 5D96A 3DRNA 4O5QA 4MF6A 1EP8A 3N5OA 3H8QA 2AV4A 4TXVA 2CX4A 4NHZA 4OO4A 1K0AA 4XCSA 2KHPA 3IXRA 2WW3A 4K5RA 3UBKA 4Z2UA 1N2AA 1PA3A 5CRWA 4O5UA 3EYTA 1MEKA 2NTOA 3IBHA 1SD9A 1XXUA 5DAKB 4K7NA 3UJ1A 1CQHA 4AKGA 2HZFA 1H4OA 5D9WA 1M3JA 3F63A 4ZXGA 4WBRD 3KMOA 4EDYA 4RUVA 2DLXA 3BJ5A 4ZBAA 3Q74A 4ZB8A 2E7PA 4K2DA 4F03A 2I1UA 3GL5A 5H5RA 2AHEA 3UVHA 4TVEA 1X9WB 2K8SA 1GSFA 2I3YA 2LSTA 2R2JA 3O3TA 1SYXA 2V41A 3GURA 3MAKA 2HFDA 5G1LA 4PI0C 2C80A 4RI6A 4PI2C 2VCWA 3U5RE 3LQ7A 1RW1A 1S3RA 5DBQA 2WVZA 5ECLB 2L4CA 4JR4A 6GSUA 2OBIA 2WCIA 5E59A 4H86A 1Y6EA 2H6YA 2DMMA 3E3EA 5J9BA 2YWMA 4POKA 4JZQA 2X8CA 4NWYA 5B8AA 1GSDA 3QAWA 4N0VA 4NV5A 1SK0A 3DYRA 3Q6OA 1FVKA 1EOGA 1WP0A 2X49A 4IP6A 3H1NA 1UC7A 2NBSA 2LS5A 4WBJA 3FR9A 5IQYA 4N0ZA 4GRFA 2MYGA 1SJZA 6GSXA 1TK5B 3CQFA 4MPGA 2ALBA 4CY8A 5HFGA 2H19A 3KTBA 1XIYA 4RQRA 3RHBA 2OE1A 4YQVA 1K3LA 1XCCA 1RQMA 2IWTA 1W89A 3LEFA 4V2LA 3EINA 1GRXA 4ACSA 1THOA 3TKPA 5A5HA 1DSBA 1MDIA 5DQYA 1JZOA 5DJLA 2O7KA 1YKCA 3TDGA 4G2EA 1EGOA 4V2NA 1USBA 1R5AA 4POBA 4MCUA 1JLVA 3PH9A 5J5NA 4L5LA 2VLVA 3TRPA 4EVMA 4EXJA 3DVWA 2P31A 1TU8A 2MBTA 4ZB6A 3O6TA 4NV2A 3J7Yb 3P7XA 5JWQB 5G31A 3IHQA 4FO5A 4PNGA 4KA0A 4BPYA 2R4VA 2HE3A 1OAZA 2C3NA 5J3RA 1UA5A 19GSA 3SWLA 2H1BA 2PWJA 1YZXA 5F05A 4KH7A 1CQGA 1TK8B 1SJIA 4Z7XA 3LXTA 3VWWA 1NW2A 1XWGA 5A5HB 4X43A 5ECRB 3CRTA 4HZ2A 3IDVA 4LL1B 2I4AA 2XPEA 1TOFA 1T4YA 3TU3B 2C0GA 5JCGA 4OD7A 2MMAA 3RDWA 5IMAA 3A3TA 4EF0A 4D73A 3TJFA 1URMA 4E8HA 3KZQA 1O85A 1T7PB 3KP8A 1A23A 2H74A 4EDZA 5DJMA 3WYWA 5CO3A 5KOXA 4IKHA 1EOHA 3P2AA 2G0FA 5BRTA 1YF0A 2OADA 4I2UA 3NOFA 2E0QA 4HEA2 3TOUA 4F0CA 1G0TA 5AN1A 3ME8A 4BIKA 1EEMA 1J9BA 4EO3A 22GSA 4WR4A 2TRCP 3ZL5A 1GTUA 2KLXA 3GH6A 3OR5A 2K6VA 3DD3A 2YPMA 5KN0A 3C8EA 1PL1A 3M0FA 5J40A 4GSTA 2EFCA 4JU5A 5A4UA 4KGIA 2X99A 3FRCA 3F8UA 2L5LA 2A2PA 4K0NA 4Q5RA 1A8YA 3A5WA 2D2ZA 3RPPA 2F51A 3LORA 2L57A 4D73B 3MDKA 1JLWA 2FHEA 2AJQB 3LFLA 1B4PA 2PGTA 1S4BP 2F9SA 1I9DA 5GSTA 3L78A 2CX3A 4YKGA 3KH9A 3KM6A 4YAVA 2FWFA 3TJJA 3LYKA 2B5XA 4AKIA 1AAZA 1BQ7A 2IL3A 6GSWA 5C00A 16GSA 4K7IA 5F06A 4MF7A 3MSZA 4CW9A 1SL2B 2KOKA 4IHUA 14GSA 3TJKA 2VCQA 2KUCA 3EVIA 4YQMA 4CHSA 1VF3A 1XG8A 2TIRA 4GSNA 2HNLA 3TGZA 2O89A 3GFKA 1TI3A 4I8BA 2KP1A 4F9ZA 4BA7A 3TCOA 1AC1A 5JWOB 1MDJA 1E6BA 1F3AA 6GSVA 3UBLA 3EE2A 4KSMA 1JZDA 3F3QA 5ECNB 3S9FA 2VIMA 1O8XA 5F07A 2VKZG 4KDYA 4X4JA 2C3QA 1X9SB 4G9HA 2C0EA 2YJHA 3CSHA 4OFMA 4L5OA 5G30A 3F4SA 1TXUA 1VRSD 2YV7A 2LNSA 3ZITA 1SK2A 2H30A 1V98A 3QPMA 1XW5A 2F3MA 1YEXA 3RHCA 2YANA 3CHXC 4G10A 5B6MA 4AJ6A 2WZ9A 4I2TA 4G01A 1GP1A 3KD0A 1WOUA 1XOAA 4KB3A 3IC8A 2WB9A 3KP9A 2WZSA 5F8BA 5LNKe 1M2DA 5HFIA 1QK8A 5HR1A 3ME7A 2LRTA 1YKAA 2WJUA 1TRWA 2VL9A 1ON4A 2GS3A 1BG5A 5BMUA 2YZUA 2PVOC 4HS1A 1KBNA 3QMXA 3KMNA 3GIXA 2A2SA 4K2XA 4GWRA 2LUSA 3VI5A 1XOBA 3LXZA 2WGRA 2CVBA 3I9V2 1MDKA 4USSA 2IJYA 4XTSA 4ZB9A 5D93A 4Z2RA 4FIWA 1ML6A 2HXKA 3HCZA 4N10A 2C0FA 4ECIA 1HYUA 2M72A 4IJ3A 1KEBA 4PURA 2YCDA 3HZ4A 3H4KA 3P8WA 1B9XC 3V1WA 6GSTA 5CYYA 2H73A 3CMIA 4K8MA 3IV4A 1PGTA 4KDUA 2CZ2A 2ZCTA 1HNAA 3VFIA 1R4WA 1GNEA 1YY7A 4MDCA 1XWAA 1VGLA 2GZZA 3L4NA 5BMUB 1GUHA 5J4UA 3FR6A 3Q18A 1TJDA 2V6OA 3L9VA 1EV4A 4YH2A 1V40A 4PUFC 1K0BA 4WKWA 5EL8A 5EY6A 4QL7A 4L0WA 1GTIA 3VURA 1AUCA 2HSMA 2FWHA 3LW9A 1OE7A 3F4TA 2YWOA 3C71A 1O6JA 1AQWA 1Q98A 3LG6A 5B6NA 4I5QA 2C3TA 1N8JA 8GSSA 2OKAA 1ZYNA 2JSYA 1GNWA 2CV4A 3ED3A 4FQUA 2VM1A 1FB0A 2WW2A 3Q19A 4HOJA 5IMVA 1SKRB 4MJBA 3F9UA 2GT6A 1XWKA 2YZHA 3IK9A 4IS0A 5ENUA 1I5GA 2P5RA 4ID0A 4FXYP 4K6XA 5IPGA 3QCPA 5DQSA 4K0GA 3G9BA 2GVPA 1FB6A 3ZFBA 2HSHA 2GQKA 2R37A 1PSQA 4Q5FA 4O5RA 4QQ7A 3KEBA 3TKSE 2FNOA 3W8SA 3ZRDA 1BF5A 18GSA 5IMZA 11GSA 4KF9A 2JZTA 4ECJA 2DBCA 2HSMB 4J56E 2OE3A 3I43A 2LEGA 1A0RP 2YN1A 2C0DA 5CNWA 4WEYA 3JCML 3GKMA 2P5QA 2EFHA 3FHKA 3KCMA 2HZEB 4Q5QA 1B48A 4JR6A 4CDOA 1B9YC 4LA1A 2HRNA 1TTZA 1XW9A 2X64A 3C1RA 5F0GA 3HJMA 1GSUA 2WRTA 3APSA 1FOVA 2VLUA 3PR8A 4MZWA 2FA4A 4AKXB 2J23A 2I81A 1XVQA 1JZRA 3HMJG 2WS2A 1JZWA 5AISA 5DALA 2LKUA 4V1Ap 2H70A 1I1IP 1F37A 1TXXA 5HR0A 3A2XA 1HD2A 3FY7A 2H6XA 5J41A 1TRSA 4QL9A 3IHGA 2DSAA 2MMOA 1AQXA 3IR4A 1EZKA 3HHVA 3F6DA 2DJKA 2AUVA 5EPFA 3GKKA 4PNFA 3BCIA 2C1YA 1TW9A 3FZ5A 2WFCA 4NAXA 1PN9A 2GGTA 2GDRA 3ZMKA 2JACA 2VLTA 3LGCA 3E9JB 1Z9HA 3PPUA 4LL4B 1FW1A 1C72A 3GSSA 3HY2A 4HUAA 2PN8A 2J9HA 3ZYWA 5IMCA 4HQSA 1XFLA 5KN3A 2IFQA 3FKFA 2DIYA 4G0KA 2N5AA 5C04A 1XZOA 4BL7A 2RUFA 3ZTLA 3NIVA 3W6GA 3HJPA 2ES7A 5DALB 5DDLA 4EC0A 2P0GA 4ML6A 4Z2TA 2X4AA 4J57E 2NPBA 2JSZA 3GNJA 1Y25A 3FR3A 5AIXA 1YEPA 2EFEA 2H75A 4GSSA 1VF4A 2IIYA 5CRGA 1QUWA 1A2JA 3D22A 2XBIA 3ZVJA 5GZZB 1R5PA 4IW9A 4POMA 3M1GA 4W66A 4OFNA 3QAVA 2VD1A 1GTAA 5GSSA 5KN1A 3ISOA 2QC7A 2V2GA 3CWGA 3A2WA 1K0CA 4XRAA 3DMLA 2B1LA 3ZVJD 4E68A 2YNXA 2IFQB 3F3RA 3KJYA 4ICYA 5A1NA 2PVQA 2OT3A 1NHOA 1E2YA 1V2AA 4LLRA 4BL7B 3UVTA 1EWXA 2CT6A 5ECSA 1GWCA 3CRUA 4FYBA 4A5PA 2R0GA 4O32A 1Z7PA 1SJ6A 2V32A 5D73A 1O73A 1VF2A 2I9HA 4GQFA 2RIIA 4G0LA 2XBQA 2H8LA 5D9TA 5HQPA 1ZOFA 12GSA 1T1VA 2H1AA 3LSZA 4XRDA 2B5EA 2K18A 1SVLA 5ECKB 2QGVA 1K0DA 3C7MA 1PD21 2F8AA 3M9KA 3QR6A 4V2MA 5HR2A 3RAZA 2H72A 4K7OA 3RGBC 5A4VA 3CYNA 3EPTA 3IAS2 5IO0A 3W8JA 3APOA 1HNBA 4NHWA 2EFDA 2IMKA 3J7Yk 2L59A 4OO5A 3LYPA 5A1NB 3FZ4A 3GYKA 1SVMA 2GSTA 1KTEA 2CVKA 2LJAA 2ZNMA 1AW9A 4TR0A 3CBUA 2FUG2 5ECHB 2VUPA 2H01A 3DVXA 5CAXA 2B5YA 3EWLA 2HI7A 2BMXA 1YQ1A 4WXTA 3ERWA 4HJ2A 5IMFA 1SYRA 4GF0A 3L0HA 4POLA 3UAPA 5KEJA 3EU4A 3IC4A 4MJEA 4EIPA 1HQOA 2PBJA 17GSA 4N30A 4BVYA 5ELGA 1PX7A 4TXOA 2V1MA 4YQUA 4BVXA 4EIQA 3MYDA 1BJXA 4X0XA 1Z3EA 1HNCA 1G6YA 2IPAA 2DIZA 3G7IA 3GUSA 2WDUA 4OCFA 3TKSC 2FGXA 3CTGA 4K1FA 4MZCA 3IA1A 5EVOA 1F9MA 1R26A 3QAGA 4ECCA 3QDNA 1N25A 2DC5A 4IBPA 4ZBDA 1PFOA 4J2FA 2ON5A 4EUYA 1TKDB 1WWJA 4QMKA 4GCIA 3GMFA 2OE0A 1SKSB 2IN3A 5FT3A 3BOAA 1SK1A 2EIOA 3ERFA 5DCHA 1J0FA 2JZRA 3GSTA 3GKNA 2VCZA 4IJIA 1FAAA 2DKIA 4ZIJA 5GAND 2AB6A 3WT1A 4OFTA 4KSOA 4EE0A 2MMNA 1K0MA 3O76A 1Z7RA 2LJKA 2REMA 5ID2A 3HVNA 1BX9A 3QOUA 2UZ8A 4BVYB 6GSSA 4OMVA 4MZBA 4TXOB 3ZZXA 5J47A 5ELAA 4BVXB 2QA1A 4XS4A 1VF1A 1XPVA 2AYTA 2H0GA 4KAEA 1S3CA 5H5QA 1BAYA 1G6WA 3VPQA 4F2IA 3KXOA 1T4ZA 1X9MB 4ZL8A 4HZ4A 2AAWA 1M99A 4YKFA 1IYIA 3HJOA 2Z9SA 4ZL7A 1Z5YE 3U6VA 2PMTA 1EGRA 4DEJA 1WMJA 3BCKA 3KIJA 2X8HA 4PGTA 1XWCA 1M3IA 5LD0A 2C4JA 1O81A 1U88A 2CAQA 4KDXA 1TRUA 3UOMA 1ZGNA 2HT9A 1A8LA 1FHEA 4JEDA 1TU7A 1TP9A 3KTLA 4MH3A 3EMPA 1QXHA 3CSIA 1U6TA 4ZBBA 5ECOB 2B6MA 5ECQB 3DXBA 3RPNA 2MBSA 5ID2B 2M46A 1Q4JA 2IMFA 4TW5A 3GHAA 2LNTA 4XS4B 3GV1A 3VWXA 4IVFA 3VPTA 1PKZA 3G7YA 3TKSA 5D9VA 2VOCA 5JWRB 3ZMLA 3GH9A 1O7UA 3GRXA 1YEWC 4KCEA 5A5KA 1M7TA 2F8FA 4ZB7A 1AXDA 3VK9A 2N5FA 3MWHA 1GLQA 1WPIA 3D4TA 2FLSA 5J4YA 1X5CA 3HD5A 2HRKA 4XHMA 1GL8A 4HQZA 1TI1A 1K0NA 1MTCA 2WVYA 1K3OA 1YDKA 4MLYA 1ERUA 1UN2A
chains in the Genus database with same CATH topology
1QFNA 1ZCPA 4MNNA 4AJ8A 4IQ1A 1QMVA 2JU5A 1TK0B 2HZEA 4EL1A 3A5IA 1KNGA 2L6DA 3N9JA 4DSRA 4GLTA 1A24A 1ABAA 1M9AA 2QKEA 1AQVA 2UV8G 4MH2A 3GA4A 4MA9A 3FZAA 3TKQA 1SENA 1B4QA 1WE0A 1JFUA 4I6XA 2EC4A 1TDIA 3I69A 3QD9A 2CAIA 1Z6NA 3ZIJA 3HXSA 2NVLA 2RUEA 4ECBA 10GSA 3IRAA 1PX6A 3TKRA 5L71A 2HRAA 1GSYA 2IMIA 2YWNA 4XIHA 3MNGA 2TRXA 5IM9A 4KNDA 2M80A 3WD6A 1OKTA 2HQTA 4ZL9A 4G0IA 1S3DA 2O85A 2N5BA 1NHYA 4GQCA 2HRKB 3ERGA 4HU7A 1LBKA 4YAPA 2LV3A 3HVXA 2IMEA 1G7EA 1XWBA 2DJ3A 4KE3A 5G5FA 3FEUA 4PUAA 4MMMA 2PUKC 2MMZA 3G7JA 5J9CA 2G2QA 1LJRA 2L4QA 3D21A 2O87A 2FWEA 5HFKA 3C1SA 5B7CA 3FYGA 1PL2A 4IQAA 5G2ZA 3GX8A 3K8NA 1F6MC 2XC2A 2FY6A 5COHA 3CTFA 1A0FA 4CY6A 1ST9A 3AY8A 4KW6A 1SL1B 1DBYA 4TN8A 1PKWA 2L5OA 4N3ZA 2H1DA 3US3A 4IN0A 3VLNA 3TB2A 3VI7A 4ISDA 1IYHA 5LCZA 4N11A 3IOSA 1DUGA 3GL3A 4LMWA 4PX1A 1WRYA 2KP2A 3VWVA 4TKYA 3F4RA 1XW6A 2WULA 5JCWA 5FHIA 2K9FA 4X1UA 1SVOA 3EMXA 1BYEA 2FWGA 5D8IA 2CZ3A 1O8WA 1FOHA 4KCAA 1BEDA 4XS6A 5D9XA 2XPDA 2MZCA 4WR5A 3LJRA 3H93A 4IELA 3HA9A 4OCEA 2E2MA 4AI6A 1OC9A 5E4WA 3MIXA 1A2LA 5JCUA 2H1GA 4JE1A 3HVSA 5CRDA 2DJ0A 3DWVA 2QSIA 3L9UA 4PQHA 1SKWB 3GTUA 1GH2A 4TR1A 2CQ9A 4E8EA 1SU9A 2XHFA 5GAPD 1H75A 4O7HA 3QFBC 1T3BA 1A2MA 4NPBA 3QFAC 3UEMA 1GLPA 1OVNA 1W4VA 2H6ZA 4JRRA 2BJXA 2R3XA 2OA7A 3TOTA 1PRXA 2H76A 4EKZA 2R0CA 3EC3A 5AGYA 1GTBA 1EP7A 4WF5A 3D4MA 1T00A 2A4VA 3HDCA 4TOPA 3UL3A 1S3AA 5FWGA 4FH8A 2LTKA 2GQLA 3M8NA 3IK7A 2QA2A 5IO2A 1K0OA 2CA8A 4ZILA 4G19A 1OC8A 3IPZA 2FA8A 5H5SA 1F3BA 3ZREA 1U3IA 7GSSA 1OC9B 1ERVA 2GSRA 4IP1A 4NMUA 3GTUB 4RQXA 3TJGA 4AKHA 3ZIVA 4TR1B 3GX0A 5INYA 3FW2A 2VO4A 2JZSA 2B1KA 4DSQA 4IGJA 2YWIA 3TUEA 3GN3A 13GSA 1WIKA 4PTSA 1BG1A 2ON7A 1QGVA 5G1KA 2HSYA 3UMAA 6GSYA 1ERWA 4BWSA 1R7HA 1YJ6A 3TJBA 4DSSA 2DKHA 1NM3A 3IE3A 4L8EA 2B3SA 1PN0A 5CRHA 5DCGA 2RM6A 2VCTA 2VL2C 2GZYA 4V1Ag 3WGDA 4F0BA 3TRXA 4WF4A 1GULA 4FYUA 1DE1A 2JADA 5CP1A 4TR4A 4HJMA 2YJ7A 2H1LA 2DJ1A 2EIRA 3IAM2 1ZZYA 2H66A 3C73A 4HU9A 1M2BA 2O5VA 4NXIA 2PU9C 2HLSA 2OJLA 1PQNA 3E0UA 4JBBA 2C8UA 2B7KA 2B7JA 5IPHA 3D0ZA 4P3YB 1MD4A 3CXGA 5CREA 1ZMAA 3GKXA 3R3EA 2PPTA 2L6CA 5AIVA 1AIUA 2YV9A 2OACA 1THXA 2YOIA 2H71A 1V9WA 2VM2A 4AGSA 5A34A 3PINA 4DSSB 3F0IA 4KUNA 4ML1A 2GT5A 2ZUPA 1OC3A 3M9JA 5ABRA 3HYPA 2LRNA 20GSA 3R2QA 2VD0A 5ECPB 4OWYA 1FVJA 5J4VA 5IMDA 1ZYEA 2GQMA 1U87A 3HKRA 4ULXA 2H0IA 1GUMA 1PMTA 2GZPA 1ZL9A 4HI7A 1DE2A 4LMVA 3LWAA 2HYXA 2VL3A 2NDOA 4F82A 4GTUA 5A4WA 1V58A 1YF1A 4I97A 3PGTA 4AF2A 5KOWA 4AJ7A 3RBTA 4Q5NA 1UVZA 3WT2A 3EU3A 1OYJA 3L9SA 1RK4A 2E2GA 5G5EA 4MF5A 4PXOA 5DVBA 3BBYA 3UARA 1Y1UA 3D6IA 4KX4A 2A2RA 1NSWA 3FZ9A 3WGEA 5A34B 2H0HA 5KN2A 4TRXA 2VL2A 4L0UA 3ZFLA 2JL4A 2O8VB 3DEXA 2DJ2A 4HDEA 4FYCA 2GSQA 1B8XA 1XBSA 5B8BA 3DGQA 2RLIA 4DVCA 1U3AA 2CVDA 2R5GA 2VCXA 1F2EA 4MJAA 9GSSA 4BWQA 5HR3A 4MK3A 5ECMB 3NZNA 1GSSA 1SL0B 2R6KA 4PQIA 1J08A 4K9ZA 4GDFA 1ACVA 1OE8A 1K3YA 1GUKA 1X5DA 1YVLA 2LJRA 2RM5A 2X8GA 1GSQA 4MPFA 4WETA 2FD3A 3P90A 4MJCA 4GXZA 3F6FA 5ECIB 4O92A 3UIWA 1ERTA 4XS1A 2LQQA 1LU4A 3I6AA 4PQ1A 3ZLPA 2HSNA 1XVWA 1JHBA 3M3MA 2IMDA 1ZYQB 1M0UA 5IIZA 1ZYPA 2DJJA 2YP6A 3DKSA 1V57A 1Z6MA 1WJKA 3SBCA 1SD8A 1EV9A 2VAFA 3WGXA 1QQ2A 3H79A 5IOWA 3APQA 3TRQA 4MP4A 2OBKA 3DIEA 3HZ8A 2V6KA 5DAKA 3KGKA 2GLRA 2LQOA 1T8EB 1GSEA 2VCVA 1TRVA 1X0RA 3KH7A 1M9BA 2PERA 2GTUA 2K8VA 3CSJA 5IOXA 3D5JA 1EEJA 4K5SA 4RI7A 3FMWA 2A4HA 3VWUA 4TR3A 1FO5A 2HRFA 2BTOT 1MD3A 1OKDA 1ILOA 3A2VA 2GSSA 2EIQA 3EURA 2FCHA 2DMLA 3HVVA 1M2AA 2R0PA 2HSNB 4ILFA 3FK8A 1FG4A 1X5EA 2LRCA 4MABA 1G7OA 3BD2A 5D96A 3DRNA 4O5QA 4MF6A 1EP8A 3N5OA 3H8QA 2AV4A 4TXVA 2CX4A 4NHZA 4OO4A 1K0AA 4XCSA 2KHPA 3IXRA 4K5RA 3UBKA 4Z2UA 1N2AA 1PA3A 5CRWA 4O5UA 3EYTA 1MEKA 2NTOA 3IBHA 1SD9A 1XXUA 5DAKB 4K7NA 3UJ1A 1CQHA 4AKGA 2HZFA 1H4OA 5D9WA 3F63A 4ZXGA 4WBRD 3KMOA 4EDYA 4RUVA 2DLXA 3BJ5A 4ZBAA 3Q74A 4ZB8A 2E7PA 4K2DA 4F03A 2I1UA 3GL5A 5H5RA 2AHEA 3UVHA 4TVEA 1X9WB 2K8SA 1GSFA 2I3YA 2LSTA 2R2JA 3O3TA 1SYXA 2V41A 3GURA 3MAKA 2HFDA 5G1LA 2C80A 4RI6A 2VCWA 3U5RE 3LQ7A 1RW1A 5DBQA 5ECLB 2L4CA 4JR4A 6GSUA 2OBIA 2WCIA 5E59A 4H86A 1Y6EA 2H6YA 2DMMA 3E3EA 5J9BA 2YWMA 4POKA 4JZQA 2X8CA 4NWYA 5B8AA 1GSDA 3QAWA 4N0VA 4NV5A 1SK0A 3DYRA 3Q6OA 1FVKA 1EOGA 1WP0A 2X49A 4IP6A 3H1NA 1UC7A 2NBSA 2LS5A 4WBJA 3FR9A 5IQYA 4N0ZA 4GRFA 2MYGA 1SJZA 6GSXA 1TK5B 4MPGA 2ALBA 4CY8A 5HFGA 2H19A 3KTBA 1XIYA 4RQRA 3RHBA 2OE1A 4YQVA 1K3LA 1XCCA 1RQMA 2IWTA 1W89A 3LEFA 4V2LA 3EINA 1GRXA 4ACSA 1THOA 3TKPA 5A5HA 1DSBA 1MDIA 5DQYA 1JZOA 5DJLA 2O7KA 1YKCA 3TDGA 4G2EA 1EGOA 4V2NA 1USBA 1R5AA 4POBA 4MCUA 1JLVA 3PH9A 5J5NA 4L5LA 2VLVA 3TRPA 4EVMA 4EXJA 3DVWA 2P31A 1TU8A 2MBTA 4ZB6A 3O6TA 4NV2A 3J7Yb 3P7XA 5JWQB 5G31A 3IHQA 4FO5A 4PNGA 4KA0A 4BPYA 2R4VA 2HE3A 1OAZA 2C3NA 5J3RA 1UA5A 19GSA 3SWLA 2H1BA 2PWJA 1YZXA 5F05A 4KH7A 1CQGA 1TK8B 1SJIA 4Z7XA 3LXTA 3VWWA 1NW2A 1XWGA 5A5HB 4X43A 5ECRB 3CRTA 4HZ2A 3IDVA 4LL1B 2I4AA 2XPEA 1TOFA 1T4YA 3TU3B 2C0GA 5JCGA 4OD7A 2MMAA 3RDWA 5IMAA 3A3TA 4EF0A 4D73A 3TJFA 1URMA 4E8HA 3KZQA 1O85A 1T7PB 3KP8A 1A23A 2H74A 4EDZA 5DJMA 3WYWA 5CO3A 5KOXA 4IKHA 1EOHA 3P2AA 2G0FA 5BRTA 1YF0A 2OADA 4I2UA 3NOFA 2E0QA 4HEA2 3TOUA 4F0CA 1G0TA 5AN1A 3ME8A 1EEMA 1J9BA 4EO3A 22GSA 4WR4A 2TRCP 3ZL5A 1GTUA 2KLXA 3GH6A 3OR5A 2K6VA 3DD3A 2YPMA 5KN0A 3C8EA 1PL1A 3M0FA 5J40A 4GSTA 2EFCA 4JU5A 5A4UA 4KGIA 2X99A 3FRCA 3F8UA 2L5LA 2A2PA 4K0NA 4Q5RA 1A8YA 3A5WA 2D2ZA 3RPPA 2F51A 3LORA 2L57A 4D73B 3MDKA 1JLWA 2FHEA 2AJQB 3LFLA 1B4PA 2PGTA 2F9SA 1I9DA 5GSTA 3L78A 2CX3A 4YKGA 3KH9A 3KM6A 4YAVA 2FWFA 3TJJA 3LYKA 2B5XA 4AKIA 1AAZA 1BQ7A 2IL3A 6GSWA 5C00A 16GSA 4K7IA 5F06A 4MF7A 3MSZA 4CW9A 1SL2B 2KOKA 4IHUA 14GSA 3TJKA 2VCQA 2KUCA 3EVIA 4YQMA 4CHSA 1VF3A 2TIRA 4GSNA 2HNLA 3TGZA 2O89A 3GFKA 1TI3A 4I8BA 2KP1A 4F9ZA 4BA7A 3TCOA 1AC1A 5JWOB 1MDJA 1E6BA 1F3AA 6GSVA 3UBLA 3EE2A 4KSMA 1JZDA 3F3QA 5ECNB 3S9FA 2VIMA 1O8XA 5F07A 2VKZG 4KDYA 4X4JA 2C3QA 1X9SB 4G9HA 2C0EA 2YJHA 3CSHA 4OFMA 4L5OA 5G30A 3F4SA 1TXUA 1VRSD 2YV7A 2LNSA 3ZITA 1SK2A 2H30A 1V98A 3QPMA 1XW5A 2F3MA 1YEXA 3RHCA 2YANA 4G10A 5B6MA 4AJ6A 2WZ9A 4I2TA 4G01A 1GP1A 3KD0A 1WOUA 1XOAA 4KB3A 3IC8A 2WB9A 3KP9A 5F8BA 5LNKe 1M2DA 5HFIA 1QK8A 5HR1A 3ME7A 2LRTA 1YKAA 2WJUA 1TRWA 2VL9A 1ON4A 2GS3A 1BG5A 5BMUA 2YZUA 2PVOC 4HS1A 1KBNA 3QMXA 3KMNA 3GIXA 2A2SA 4K2XA 4GWRA 2LUSA 3VI5A 1XOBA 3LXZA 2WGRA 2CVBA 3I9V2 1MDKA 4USSA 2IJYA 4XTSA 4ZB9A 5D93A 4Z2RA 4FIWA 1ML6A 2HXKA 3HCZA 4N10A 2C0FA 4ECIA 1HYUA 2M72A 4IJ3A 1KEBA 4PURA 2YCDA 3HZ4A 3H4KA 3P8WA 1B9XC 3V1WA 6GSTA 5CYYA 2H73A 3CMIA 4K8MA 3IV4A 1PGTA 4KDUA 2CZ2A 2ZCTA 1HNAA 3VFIA 1R4WA 1GNEA 1YY7A 4MDCA 1XWAA 1VGLA 2GZZA 3L4NA 5BMUB 1GUHA 5J4UA 3FR6A 3Q18A 1TJDA 2V6OA 3L9VA 1EV4A 4YH2A 1V40A 4PUFC 1K0BA 4WKWA 5EL8A 5EY6A 4QL7A 4L0WA 1GTIA 3VURA 1AUCA 2HSMA 2FWHA 3LW9A 1OE7A 3F4TA 2YWOA 3C71A 1O6JA 1AQWA 1Q98A 3LG6A 5B6NA 4I5QA 2C3TA 1N8JA 8GSSA 2OKAA 1ZYNA 2JSYA 1GNWA 2CV4A 3ED3A 4FQUA 2VM1A 1FB0A 3Q19A 4HOJA 5IMVA 1SKRB 4MJBA 3F9UA 2GT6A 1XWKA 2YZHA 3IK9A 4IS0A 5ENUA 1I5GA 2P5RA 4ID0A 4K6XA 5IPGA 3QCPA 5DQSA 4K0GA 3G9BA 2GVPA 1FB6A 3ZFBA 2HSHA 2GQKA 2R37A 1PSQA 4Q5FA 4O5RA 4QQ7A 3KEBA 3TKSE 2FNOA 3W8SA 3ZRDA 1BF5A 18GSA 5IMZA 11GSA 4KF9A 2JZTA 4ECJA 2DBCA 2HSMB 4J56E 2OE3A 3I43A 2LEGA 1A0RP 2YN1A 2C0DA 5CNWA 4WEYA 3JCML 3GKMA 2P5QA 2EFHA 3FHKA 3KCMA 2HZEB 4Q5QA 1B48A 4JR6A 4CDOA 1B9YC 4LA1A 2HRNA 1TTZA 1XW9A 2X64A 3C1RA 5F0GA 3HJMA 1GSUA 2WRTA 3APSA 1FOVA 2VLUA 3PR8A 4MZWA 2FA4A 4AKXB 2J23A 2I81A 1XVQA 1JZRA 3HMJG 2WS2A 1JZWA 5AISA 5DALA 2LKUA 4V1Ap 2H70A 1F37A 1TXXA 5HR0A 3A2XA 1HD2A 3FY7A 2H6XA 5J41A 1TRSA 4QL9A 3IHGA 2DSAA 2MMOA 1AQXA 3IR4A 1EZKA 3HHVA 3F6DA 2DJKA 2AUVA 5EPFA 3GKKA 4PNFA 3BCIA 2C1YA 1TW9A 3FZ5A 2WFCA 4NAXA 1PN9A 2GGTA 2GDRA 3ZMKA 2JACA 2VLTA 3LGCA 3E9JB 1Z9HA 3PPUA 4LL4B 1FW1A 1C72A 3GSSA 3HY2A 4HUAA 2PN8A 2J9HA 3ZYWA 5IMCA 4HQSA 1XFLA 5KN3A 2IFQA 3FKFA 2DIYA 4G0KA 2N5AA 5C04A 1XZOA 4BL7A 2RUFA 3ZTLA 3NIVA 3W6GA 3HJPA 2ES7A 5DALB 5DDLA 4EC0A 2P0GA 4ML6A 4Z2TA 2X4AA 4J57E 2NPBA 2JSZA 3GNJA 1Y25A 3FR3A 5AIXA 1YEPA 2EFEA 2H75A 4GSSA 1VF4A 2IIYA 5CRGA 1QUWA 1A2JA 3D22A 2XBIA 3ZVJA 5GZZB 1R5PA 4IW9A 4POMA 3M1GA 4W66A 4OFNA 3QAVA 2VD1A 1GTAA 5GSSA 5KN1A 3ISOA 2QC7A 2V2GA 3CWGA 3A2WA 1K0CA 4XRAA 3DMLA 2B1LA 3ZVJD 4E68A 2YNXA 2IFQB 3F3RA 3KJYA 4ICYA 5A1NA 2PVQA 2OT3A 1NHOA 1E2YA 1V2AA 4LLRA 4BL7B 3UVTA 1EWXA 2CT6A 5ECSA 1GWCA 3CRUA 4FYBA 4A5PA 2R0GA 4O32A 1Z7PA 1SJ6A 2V32A 5D73A 1O73A 1VF2A 2I9HA 4GQFA 2RIIA 4G0LA 2XBQA 2H8LA 5D9TA 5HQPA 1ZOFA 12GSA 1T1VA 2H1AA 3LSZA 4XRDA 2B5EA 2K18A 1SVLA 5ECKB 2QGVA 1K0DA 3C7MA 1PD21 2F8AA 3M9KA 3QR6A 4V2MA 5HR2A 3RAZA 2H72A 4K7OA 5A4VA 3CYNA 3EPTA 3IAS2 5IO0A 3W8JA 3APOA 1HNBA 4NHWA 2EFDA 2IMKA 3J7Yk 2L59A 4OO5A 3LYPA 5A1NB 3FZ4A 3GYKA 1SVMA 2GSTA 1KTEA 2CVKA 2LJAA 2ZNMA 1AW9A 4TR0A 3CBUA 2FUG2 5ECHB 2VUPA 2H01A 3DVXA 5CAXA 2B5YA 3EWLA 2HI7A 2BMXA 1YQ1A 4WXTA 3ERWA 4HJ2A 5IMFA 1SYRA 4GF0A 3L0HA 4POLA 3UAPA 5KEJA 3EU4A 3IC4A 4MJEA 4EIPA 1HQOA 2PBJA 17GSA 4N30A 4BVYA 5ELGA 1PX7A 4TXOA 2V1MA 4YQUA 4BVXA 4EIQA 3MYDA 1BJXA 4X0XA 1Z3EA 1HNCA 1G6YA 2IPAA 2DIZA 3G7IA 3GUSA 2WDUA 4OCFA 3TKSC 2FGXA 3CTGA 4K1FA 4MZCA 3IA1A 5EVOA 1F9MA 1R26A 3QAGA 4ECCA 3QDNA 1N25A 2DC5A 4IBPA 4ZBDA 4J2FA 2ON5A 4EUYA 1TKDB 1WWJA 4QMKA 4GCIA 3GMFA 2OE0A 1SKSB 2IN3A 5FT3A 3BOAA 1SK1A 2EIOA 3ERFA 5DCHA 1J0FA 2JZRA 3GSTA 3GKNA 2VCZA 4IJIA 1FAAA 2DKIA 4ZIJA 5GAND 2AB6A 3WT1A 4OFTA 4KSOA 4EE0A 2MMNA 1K0MA 3O76A 1Z7RA 2LJKA 2REMA 5ID2A 1BX9A 3QOUA 2UZ8A 4BVYB 6GSSA 4OMVA 4MZBA 4TXOB 3ZZXA 5J47A 5ELAA 4BVXB 2QA1A 4XS4A 1VF1A 1XPVA 2AYTA 2H0GA 4KAEA 1S3CA 5H5QA 1BAYA 1G6WA 3VPQA 4F2IA 3KXOA 1T4ZA 1X9MB 4ZL8A 4HZ4A 2AAWA 1M99A 4YKFA 1IYIA 3HJOA 2Z9SA 4ZL7A 1Z5YE 3U6VA 2PMTA 1EGRA 4DEJA 1WMJA 3BCKA 3KIJA 2X8HA 4PGTA 1XWCA 5LD0A 2C4JA 1O81A 1U88A 2CAQA 4KDXA 1TRUA 3UOMA 1ZGNA 2HT9A 1A8LA 1FHEA 4JEDA 1TU7A 1TP9A 3KTLA 4MH3A 3EMPA 1QXHA 3CSIA 1U6TA 4ZBBA 5ECOB 2B6MA 5ECQB 3DXBA 3RPNA 2MBSA 5ID2B 2M46A 1Q4JA 2IMFA 4TW5A 3GHAA 2LNTA 4XS4B 3GV1A 3VWXA 4IVFA 3VPTA 1PKZA 3G7YA 3TKSA 5D9VA 2VOCA 5JWRB 3ZMLA 3GH9A 1O7UA 3GRXA 4KCEA 5A5KA 1M7TA 2F8FA 4ZB7A 1AXDA 3VK9A 2N5FA 3MWHA 1GLQA 1WPIA 3D4TA 2FLSA 5J4YA 1X5CA 3HD5A 2HRKA 4XHMA 1GL8A 4HQZA 1TI1A 1K0NA 1MTCA 1K3OA 1YDKA 4MLYA 1ERUA 1UN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFN A;  1ZCP A;  4AJ8 A;  4IQ1 A;  1QMV A;  2JU5 A;  1TK0 B;  2HZE A;  4EL1 A;  1KNG A;  2L6D A;  3N9J A;  4DSR A;  4GLT A;  1A24 A;  1ABA A;  1M9A A;  2QKE A;  1AQV A;  4MH2 A;  3GA4 A;  4MA9 A;  3FZA A;  3TKQ A;  1SEN A;  1B4Q A;  1WE0 A;  1JFU A;  4I6X A;  2EC4 A;  1TDI A;  3I69 A;  3QD9 A;  2CAI A;  1Z6N A;  3ZIJ A;  3HXS A;  2NVL A;  2RUE A;  4ECB A;  10GS A;  3IRA A;  1PX6 A;  3TKR A;  5L71 A;  2HRA A;  1GSY A;  2IMI A;  2YWN A;  4XIH A;  3MNG A;  2TRX A;  5IM9 A;  4KND A;  2M80 A;  3WD6 A;  1OKT A;  2HQT A;  4ZL9 A;  4G0I A;  1S3D A;  2O85 A;  2N5B A;  1NHY A;  4GQC A;  2HRK B;  3ERG A;  4HU7 A;  1LBK A;  4YAP A;  2LV3 A;  3HVX A;  2IME A;  1G7E A;  1XWB A;  2DJ3 A;  4KE3 A;  5G5F A;  3FEU A;  4PUA A;  4MMM A;  2PUK C;  2MMZ A;  3G7J A;  5J9C A;  2G2Q A;  1LJR A;  2L4Q A;  3D21 A;  2O87 A;  2FWE A;  5HFK A;  3C1S A;  5B7C A;  3FYG A;  1PL2 A;  4IQA A;  5G2Z A;  3GX8 A;  3K8N A;  1F6M C;  2XC2 A;  2FY6 A;  5COH A;  3CTF A;  1A0F A;  1ST9 A;  3AY8 A;  4KW6 A;  1SL1 B;  1DBY A;  4TN8 A;  1PKW A;  2L5O A;  2H1D A;  3US3 A;  4IN0 A;  3VLN A;  3TB2 A;  3VI7 A;  4ISD A;  1IYH A;  5LCZ A;  4N11 A;  3IOS A;  1DUG A;  3GL3 A;  4LMW A;  4PX1 A;  1WRY A;  2KP2 A;  3VWV A;  4TKY A;  3F4R A;  1XW6 A;  2WUL A;  5JCW A;  5FHI A;  2K9F A;  4X1U A;  3EMX A;  1BYE A;  2FWG A;  5D8I A;  2CZ3 A;  1O8W A;  4KCA A;  1BED A;  4XS6 A;  5D9X A;  2XPD A;  2MZC A;  4WR5 A;  3LJR A;  3H93 A;  4IEL A;  3HA9 A;  4OCE A;  2E2M A;  1OC9 A;  5E4W A;  1A2L A;  5JCU A;  2H1G A;  4JE1 A;  3HVS A;  5CRD A;  2DJ0 A;  3DWV A;  2QSI A;  3L9U A;  4PQH A;  1SKW B;  3GTU A;  1GH2 A;  4TR1 A;  2CQ9 A;  4E8E A;  1SU9 A;  2XHF A;  5GAP D;  1H75 A;  4O7H A;  3QFB C;  1T3B A;  1A2M A;  4NPB A;  3QFA C;  3UEM A;  1GLP A;  1OVN A;  1W4V A;  2H6Z A;  4JRR A;  2BJX A;  2R3X A;  2OA7 A;  3TOT A;  1PRX A;  2H76 A;  4EKZ A;  3EC3 A;  5AGY A;  1GTB A;  1EP7 A;  4WF5 A;  3D4M A;  1T00 A;  2A4V A;  3HDC A;  4TOP A;  3UL3 A;  1S3A A;  5FWG A;  4FH8 A;  2LTK A;  2GQL A;  3M8N A;  3IK7 A;  5IO2 A;  1K0O A;  2CA8 A;  4ZIL A;  4G19 A;  1OC8 A;  3IPZ A;  2FA8 A;  5H5S A;  1F3B A;  3ZRE A;  1U3I A;  7GSS A;  1OC9 B;  1ERV A;  2GSR A;  4IP1 A;  4NMU A;  3GTU B;  4RQX A;  3TJG A;  3ZIV A;  4TR1 B;  3GX0 A;  5INY A;  3FW2 A;  2VO4 A;  2JZS A;  2B1K A;  4DSQ A;  4IGJ A;  2YWI A;  3TUE A;  3GN3 A;  13GS A;  1WIK A;  4PTS A;  2ON7 A;  1QGV A;  5G1K A;  2HSY A;  3UMA A;  6GSY A;  1ERW A;  4BWS A;  1R7H A;  1YJ6 A;  3TJB A;  4DSS A;  1NM3 A;  3IE3 A;  4L8E A;  2B3S A;  5CRH A;  5DCG A;  2RM6 A;  2VCT A;  2VL2 C;  2GZY A;  4V1A g;  3WGD A;  4F0B A;  3TRX A;  4WF4 A;  1GUL A;  4FYU A;  1DE1 A;  2JAD A;  5CP1 A;  4TR4 A;  4HJM A;  2YJ7 A;  2DJ1 A;  2EIR A;  3IAM 2;  1ZZY A;  2H66 A;  3C73 A;  4HU9 A;  1M2B A;  4NXI A;  2PU9 C;  2HLS A;  2OJL A;  1PQN A;  3E0U A;  4JBB A;  2C8U A;  2B7K A;  2B7J A;  5IPH A;  3D0Z A;  4P3Y B;  1MD4 A;  3CXG A;  5CRE A;  1ZMA A;  3GKX A;  3R3E A;  2PPT A;  2L6C A;  5AIV A;  1AIU A;  2YV9 A;  2OAC A;  1THX A;  2YOI A;  2H71 A;  1V9W A;  2VM2 A;  4AGS A;  3PIN A;  4DSS B;  3F0I A;  4KUN A;  4ML1 A;  2GT5 A;  2ZUP A;  1OC3 A;  3M9J A;  5ABR A;  3HYP A;  2LRN A;  20GS A;  3R2Q A;  2VD0 A;  5ECP B;  4OWY A;  1FVJ A;  5IMD A;  1ZYE A;  2GQM A;  1U87 A;  3HKR A;  4ULX A;  2H0I A;  1GUM A;  1PMT A;  2GZP A;  1ZL9 A;  4HI7 A;  1DE2 A;  4LMV A;  3LWA A;  2HYX A;  2VL3 A;  2NDO A;  4F82 A;  4GTU A;  5A4W A;  1V58 A;  1YF1 A;  4I97 A;  3PGT A;  4AF2 A;  4AJ7 A;  3RBT A;  4Q5N A;  1UVZ A;  3WT2 A;  3EU3 A;  1OYJ A;  3L9S A;  1RK4 A;  2E2G A;  5G5E A;  4MF5 A;  4PXO A;  5DVB A;  3BBY A;  3UAR A;  3D6I A;  4KX4 A;  2A2R A;  1NSW A;  3FZ9 A;  3WGE A;  2H0H A;  5KN2 A;  4TRX A;  2VL2 A;  4L0U A;  3ZFL A;  2JL4 A;  2O8V B;  3DEX A;  2DJ2 A;  4HDE A;  4FYC A;  2GSQ A;  1B8X A;  1XBS A;  5B8B A;  3DGQ A;  2RLI A;  4DVC A;  1U3A A;  2CVD A;  2R5G A;  2VCX A;  1F2E A;  4MJA A;  9GSS A;  4BWQ A;  5HR3 A;  4MK3 A;  5ECM B;  3NZN A;  1GSS A;  1SL0 B;  2R6K A;  4PQI A;  1J08 A;  4K9Z A;  1ACV A;  1OE8 A;  1K3Y A;  1GUK A;  1X5D A;  2LJR A;  2X8G A;  2RM5 A;  1GSQ A;  4MPF A;  4WET A;  2FD3 A;  3P90 A;  4MJC A;  4GXZ A;  3F6F A;  5ECI B;  4O92 A;  3UIW A;  1ERT A;  4XS1 A;  2LQQ A;  1LU4 A;  3I6A A;  4PQ1 A;  3ZLP A;  1XVW A;  1JHB A;  3M3M A;  2IMD A;  1ZYQ B;  1M0U A;  5IIZ A;  2DJJ A;  2YP6 A;  3DKS A;  1V57 A;  1Z6M A;  1WJK A;  3SBC A;  1SD8 A;  1EV9 A;  2VAF A;  3WGX A;  1QQ2 A;  3H79 A;  5IOW A;  3APQ A;  3TRQ A;  4MP4 A;  2OBK A;  3DIE A;  3HZ8 A;  2V6K A;  5DAK A;  3KGK A;  2GLR A;  2LQO A;  1T8E B;  1GSE A;  2VCV A;  1TRV A;  1X0R A;  3KH7 A;  1M9B A;  2PER A;  2GTU A;  2K8V A;  3CSJ A;  5IOX A;  3D5J A;  1EEJ A;  4RI7 A;  3VWU A;  4TR3 A;  1FO5 A;  2HRF A;  2BTO T;  1MD3 A;  1OKD A;  1ILO A;  3A2V A;  2GSS A;  2EIQ A;  3EUR A;  2FCH A;  2DML A;  3HVV A;  1M2A A;  2HSN B;  4ILF A;  3FK8 A;  1FG4 A;  1X5E A;  2LRC A;  4MAB A;  1G7O A;  3BD2 A;  5D96 A;  3DRN A;  4MF6 A;  1EP8 A;  3N5O A;  3H8Q A;  2AV4 A;  4TXV A;  2CX4 A;  4NHZ A;  4OO4 A;  1K0A A;  4XCS A;  2KHP A;  3IXR A;  3UBK A;  1N2A A;  1PA3 A;  5CRW A;  3EYT A;  1MEK A;  2NTO A;  3IBH A;  1SD9 A;  1XXU A;  5DAK B;  4K7N A;  3UJ1 A;  1CQH A;  2HZF A;  1H4O A;  5D9W A;  3F63 A;  4ZXG A;  4WBR D;  3KMO A;  4EDY A;  4RUV A;  2DLX A;  3BJ5 A;  4ZBA A;  3Q74 A;  4ZB8 A;  4K2D A;  2E7P A;  4F03 A;  2I1U A;  3GL5 A;  5H5R A;  2AHE A;  3UVH A;  4TVE A;  1X9W B;  2K8S A;  1GSF A;  2I3Y A;  2LST A;  2R2J A;  3O3T A;  1SYX A;  2V41 A;  3GUR A;  3MAK A;  2HFD A;  5G1L A;  2C80 A;  4RI6 A;  2VCW A;  3U5R E;  3LQ7 A;  1RW1 A;  5DBQ A;  5ECL B;  2L4C A;  4JR4 A;  6GSU A;  2OBI A;  2WCI A;  5E59 A;  4H86 A;  1Y6E A;  2H6Y A;  2DMM A;  3E3E A;  5J9B A;  2YWM A;  4POK A;  4JZQ A;  2X8C A;  4NWY A;  5B8A A;  1GSD A;  3QAW A;  4N0V A;  4NV5 A;  1SK0 A;  3DYR A;  3Q6O A;  1FVK A;  1EOG A;  1WP0 A;  4IP6 A;  3H1N A;  1UC7 A;  2NBS A;  2LS5 A;  4WBJ A;  3FR9 A;  5IQY A;  4N0Z A;  4GRF A;  2MYG A;  1SJZ A;  6GSX A;  1TK5 B;  4MPG A;  2ALB A;  5HFG A;  2H19 A;  3KTB A;  1XIY A;  4RQR A;  3RHB A;  2OE1 A;  4YQV A;  1K3L A;  1XCC A;  1RQM A;  2IWT A;  1W89 A;  3LEF A;  4V2L A;  3EIN A;  1GRX A;  4ACS A;  1THO A;  3TKP A;  1DSB A;  1MDI A;  5DQY A;  1JZO A;  5DJL A;  2O7K A;  1YKC A;  3TDG A;  4G2E A;  1EGO A;  4V2N A;  1USB A;  1R5A A;  4POB A;  4MCU A;  1JLV A;  3PH9 A;  5J5N A;  4L5L A;  2VLV A;  3TRP A;  4EVM A;  4EXJ A;  3DVW A;  2P31 A;  1TU8 A;  2MBT A;  4ZB6 A;  3O6T A;  4NV2 A;  3J7Y b;  3P7X A;  5JWQ B;  5G31 A;  3IHQ A;  4FO5 A;  4PNG A;  4KA0 A;  4BPY A;  2R4V A;  2HE3 A;  1OAZ A;  2C3N A;  5J3R A;  1UA5 A;  19GS A;  3SWL A;  2H1B A;  2PWJ A;  1YZX A;  5F05 A;  4KH7 A;  1CQG A;  1TK8 B;  1SJI A;  4Z7X A;  3LXT A;  3VWW A;  1NW2 A;  1XWG A;  4X43 A;  5ECR B;  3CRT A;  4HZ2 A;  3IDV A;  4LL1 B;  2I4A A;  2XPE A;  1TOF A;  1T4Y A;  2C0G A;  5JCG A;  4OD7 A;  2MMA A;  3RDW A;  5IMA A;  3A3T A;  4EF0 A;  4D73 A;  3TJF A;  1URM A;  4E8H A;  3KZQ A;  1O85 A;  1T7P B;  3KP8 A;  1A23 A;  2H74 A;  4EDZ A;  5DJM A;  3WYW A;  5CO3 A;  4IKH A;  1EOH A;  3P2A A;  2G0F A;  1YF0 A;  2OAD A;  4I2U A;  3NOF A;  2E0Q A;  4HEA 2;  3TOU A;  4F0C A;  1G0T A;  5AN1 A;  3ME8 A;  1EEM A;  1J9B A;  4EO3 A;  22GS A;  4WR4 A;  2TRC P;  3ZL5 A;  1GTU A;  2KLX A;  3GH6 A;  3OR5 A;  2K6V A;  3DD3 A;  2YPM A;  5KN0 A;  3C8E A;  1PL1 A;  3M0F A;  4GST A;  4JU5 A;  5A4U A;  4KGI A;  2X99 A;  3FRC A;  3F8U A;  2L5L A;  4K0N A;  4Q5R A;  1A8Y A;  3A5W A;  2D2Z A;  3RPP A;  2F51 A;  3LOR A;  2L57 A;  4D73 B;  3MDK A;  1JLW A;  2FHE A;  2AJQ B;  3LFL A;  1B4P A;  2PGT A;  2F9S A;  1I9D A;  5GST A;  3L78 A;  2CX3 A;  3KH9 A;  3KM6 A;  4YAV A;  2FWF A;  3TJJ A;  3LYK A;  2B5X A;  1AAZ A;  1BQ7 A;  2IL3 A;  6GSW A;  5C00 A;  16GS A;  4K7I A;  5F06 A;  4MF7 A;  3MSZ A;  4CW9 A;  1SL2 B;  2KOK A;  4IHU A;  14GS A;  3TJK A;  2VCQ A;  2KUC A;  3EVI A;  4YQM A;  4CHS A;  1VF3 A;  2TIR A;  4GSN A;  2HNL A;  3TGZ A;  2O89 A;  3GFK A;  1TI3 A;  4I8B A;  2KP1 A;  4F9Z A;  4BA7 A;  3TCO A;  1AC1 A;  5JWO B;  1MDJ A;  1E6B A;  1F3A A;  6GSV A;  3UBL A;  3EE2 A;  4KSM A;  1JZD A;  3F3Q A;  5ECN B;  3S9F A;  2VIM A;  1O8X A;  5F07 A;  4KDY A;  2C3Q A;  1X9S B;  4G9H A;  2C0E A;  2YJH A;  3CSH A;  4OFM A;  4L5O A;  5G30 A;  3F4S A;  1VRS D;  2YV7 A;  2LNS A;  3ZIT A;  1SK2 A;  2H30 A;  1V98 A;  3QPM A;  1XW5 A;  2F3M A;  1YEX A;  3RHC A;  2YAN A;  4G10 A;  5B6M A;  4AJ6 A;  2WZ9 A;  4I2T A;  1GP1 A;  3KD0 A;  1WOU A;  1XOA A;  4KB3 A;  3IC8 A;  2WB9 A;  3KP9 A;  5F8B A;  5LNK e;  1M2D A;  5HFI A;  1QK8 A;  5HR1 A;  3ME7 A;  2LRT A;  1YKA A;  2WJU A;  1TRW A;  2VL9 A;  1ON4 A;  2GS3 A;  1BG5 A;  5BMU A;  2YZU A;  2PVO C;  4HS1 A;  1KBN A;  3QMX A;  3KMN A;  3GIX A;  2A2S A;  4GWR A;  2LUS A;  3VI5 A;  1XOB A;  3LXZ A;  2WGR A;  2CVB A;  3I9V 2;  1MDK A;  4USS A;  2IJY A;  4XTS A;  4ZB9 A;  5D93 A;  4FIW A;  1ML6 A;  2HXK A;  3HCZ A;  4N10 A;  2C0F A;  4ECI A;  1HYU A;  4IJ3 A;  2M72 A;  1KEB A;  4PUR A;  2YCD A;  3HZ4 A;  3H4K A;  3P8W A;  1B9X C;  3V1W A;  6GST A;  5CYY A;  2H73 A;  3CMI A;  4K8M A;  3IV4 A;  1PGT A;  4KDU A;  2CZ2 A;  2ZCT A;  1HNA A;  3VFI A;  1R4W A;  1GNE A;  1YY7 A;  4MDC A;  1XWA A;  1VGL A;  2GZZ A;  3L4N A;  1GUH A;  5J4U A;  3FR6 A;  3Q18 A;  1TJD A;  2V6O A;  3L9V A;  1EV4 A;  4YH2 A;  1V40 A;  4PUF C;  1K0B A;  4WKW A;  5EL8 A;  5EY6 A;  4QL7 A;  4L0W A;  1GTI A;  3VUR A;  1AUC A;  2HSM A;  2FWH A;  1OE7 A;  3F4T A;  2YWO A;  3C71 A;  1O6J A;  1AQW A;  1Q98 A;  3LG6 A;  5B6N A;  4I5Q A;  2C3T A;  1N8J A;  8GSS A;  2OKA A;  2JSY A;  1GNW A;  2CV4 A;  3ED3 A;  4FQU A;  2VM1 A;  1FB0 A;  3Q19 A;  4HOJ A;  5IMV A;  1SKR B;  4MJB A;  3F9U A;  2GT6 A;  1XWK A;  2YZH A;  3IK9 A;  4IS0 A;  5ENU A;  1I5G A;  2P5R A;  4ID0 A;  4K6X A;  5IPG A;  3QCP A;  5DQS A;  4K0G A;  3G9B A;  2GVP A;  1FB6 A;  3ZFB A;  2HSH A;  2GQK A;  2R37 A;  1PSQ A;  4Q5F A;  4O5R A;  4QQ7 A;  3KEB A;  3TKS E;  2FNO A;  3W8S A;  3ZRD A;  18GS A;  5IMZ A;  11GS A;  4KF9 A;  2JZT A;  4ECJ A;  2DBC A;  2HSM B;  4J56 E;  2OE3 A;  3I43 A;  2LEG A;  1A0R P;  2YN1 A;  2C0D A;  5CNW A;  4WEY A;  3JCM L;  3GKM A;  2P5Q A;  3FHK A;  3KCM A;  2HZE B;  4Q5Q A;  1B48 A;  4JR6 A;  4CDO A;  1B9Y C;  4LA1 A;  2HRN A;  1TTZ A;  1XW9 A;  2X64 A;  3C1R A;  5F0G A;  3HJM A;  1GSU A;  2WRT A;  3APS A;  1FOV A;  2VLU A;  3PR8 A;  4MZW A;  2FA4 A;  2J23 A;  2I81 A;  1XVQ A;  1JZR A;  2WS2 A;  1JZW A;  5AIS A;  5DAL A;  2LKU A;  4V1A p;  2H70 A;  1F37 A;  1TXX A;  5HR0 A;  3A2X A;  1HD2 A;  3FY7 A;  2H6X A;  5J41 A;  1TRS A;  4QL9 A;  2DSA A;  2MMO A;  1AQX A;  3IR4 A;  1EZK A;  3HHV A;  3F6D A;  2DJK A;  2AUV A;  5EPF A;  3GKK A;  4PNF A;  3BCI A;  2C1Y A;  1TW9 A;  3FZ5 A;  2WFC A;  4NAX A;  1PN9 A;  2GGT A;  2GDR A;  3ZMK A;  2JAC A;  2VLT A;  3LGC A;  3E9J B;  1Z9H A;  3PPU A;  4LL4 B;  1FW1 A;  1C72 A;  3GSS A;  3HY2 A;  4HUA A;  2PN8 A;  2J9H A;  3ZYW A;  5IMC A;  4HQS A;  1XFL A;  5KN3 A;  2IFQ A;  3FKF A;  2DIY A;  4G0K A;  2N5A A;  5C04 A;  1XZO A;  4BL7 A;  2RUF A;  3ZTL A;  3NIV A;  3W6G A;  3HJP A;  2ES7 A;  5DAL B;  5DDL A;  4EC0 A;  2P0G A;  4ML6 A;  4J57 E;  2NPB A;  2JSZ A;  3GNJ A;  1Y25 A;  3FR3 A;  5AIX A;  1YEP A;  2H75 A;  4GSS A;  1VF4 A;  2IIY A;  5CRG A;  1QUW A;  1A2J A;  3D22 A;  2XBI A;  3ZVJ A;  5GZZ B;  1R5P A;  4IW9 A;  4POM A;  3M1G A;  4OFN A;  3QAV A;  2VD1 A;  1GTA A;  5GSS A;  5KN1 A;  3ISO A;  2QC7 A;  2V2G A;  3A2W A;  1K0C A;  4XRA A;  3DML A;  2B1L A;  3ZVJ D;  2YNX A;  2IFQ B;  3F3R A;  3KJY A;  2PVQ A;  1NHO A;  1E2Y A;  1V2A A;  4LLR A;  4BL7 B;  3UVT A;  1EWX A;  2CT6 A;  5ECS A;  1GWC A;  3CRU A;  4FYB A;  4O32 A;  1Z7P A;  1SJ6 A;  2V32 A;  5D73 A;  1O73 A;  1VF2 A;  2I9H A;  4GQF A;  2RII A;  4G0L A;  2XBQ A;  2H8L A;  5D9T A;  5HQP A;  1ZOF A;  12GS A;  1T1V A;  2H1A A;  3LSZ A;  4XRD A;  2B5E A;  2K18 A;  5ECK B;  2QGV A;  1K0D A;  3C7M A;  1PD2 1;  2F8A A;  3M9K A;  3QR6 A;  4V2M A;  5HR2 A;  3RAZ A;  2H72 A;  4K7O A;  5A4V A;  3CYN A;  3IAS 2;  5IO0 A;  3W8J A;  3APO A;  1HNB A;  4NHW A;  2IMK A;  3J7Y k;  2L59 A;  4OO5 A;  3LYP A;  3FZ4 A;  3GYK A;  2GST A;  1KTE A;  2CVK A;  2LJA A;  2ZNM A;  1AW9 A;  4TR0 A;  3CBU A;  2FUG 2;  5ECH B;  2VUP A;  2H01 A;  3DVX A;  5CAX A;  2B5Y A;  3EWL A;  2HI7 A;  2BMX A;  1YQ1 A;  4WXT A;  3ERW A;  4HJ2 A;  5IMF A;  1SYR A;  4GF0 A;  3L0H A;  4POL A;  3UAP A;  5KEJ A;  3EU4 A;  3IC4 A;  4MJE A;  1HQO A;  2PBJ A;  17GS A;  4N30 A;  4BVY A;  5ELG A;  1PX7 A;  4TXO A;  2V1M A;  4YQU A;  4BVX A;  1BJX A;  4X0X A;  1Z3E A;  1HNC A;  1G6Y A;  2IPA A;  2DIZ A;  3G7I A;  3GUS A;  2WDU A;  4OCF A;  3TKS C;  2FGX A;  3CTG A;  4K1F A;  4MZC A;  3IA1 A;  5EVO A;  1F9M A;  1R26 A;  3QAG A;  4ECC A;  3QDN A;  2DC5 A;  4IBP A;  4ZBD A;  4J2F A;  2ON5 A;  4EUY A;  1TKD B;  1WWJ A;  4GCI A;  3GMF A;  2OE0 A;  1SKS B;  2IN3 A;  5FT3 A;  3BOA A;  1SK1 A;  2EIO A;  3ERF A;  5DCH A;  1J0F A;  2JZR A;  3GST A;  3GKN A;  2VCZ A;  4IJI A;  1FAA A;  4ZIJ A;  5GAN D;  2AB6 A;  3WT1 A;  4OFT A;  4KSO A;  4EE0 A;  2MMN A;  1K0M A;  3O76 A;  1Z7R A;  2LJK A;  2REM A;  5ID2 A;  1BX9 A;  3QOU A;  2UZ8 A;  4BVY B;  6GSS A;  4OMV A;  4MZB A;  4TXO B;  3ZZX A;  5ELA A;  4BVX B;  4XS4 A;  1VF1 A;  1XPV A;  2AYT A;  2H0G A;  4KAE A;  1S3C A;  5H5Q A;  1BAY A;  1G6W A;  3VPQ A;  4F2I A;  3KXO A;  1T4Z A;  1X9M B;  4ZL8 A;  4HZ4 A;  2AAW A;  1M99 A;  1IYI A;  3HJO A;  2Z9S A;  4ZL7 A;  1Z5Y E;  3U6V A;  2PMT A;  1EGR A;  4DEJ A;  1WMJ A;  3BCK A;  3KIJ A;  2X8H A;  4PGT A;  1XWC A;  5LD0 A;  2C4J A;  1O81 A;  1U88 A;  2CAQ A;  4KDX A;  1TRU A;  3UOM A;  1ZGN A;  2HT9 A;  1A8L A;  1FHE A;  4JED A;  1TU7 A;  1TP9 A;  3KTL A;  4MH3 A;  3EMP A;  1QXH A;  3CSI A;  1U6T A;  4ZBB A;  5ECO B;  2B6M A;  5ECQ B;  3DXB A;  3RPN A;  2MBS A;  5ID2 B;  2M46 A;  1Q4J A;  2IMF A;  4TW5 A;  3GHA A;  2LNT A;  4XS4 B;  3GV1 A;  3VWX A;  4IVF A;  3VPT A;  1PKZ A;  3G7Y A;  3TKS A;  5D9V A;  2VOC A;  5JWR B;  3ZML A;  3GH9 A;  1O7U A;  3GRX A;  4KCE A;  5A5K A;  1M7T A;  2F8F A;  1AXD A;  3VK9 A;  2N5F A;  3MWH A;  1GLQ A;  1WPI A;  3D4T A;  2FLS A;  1X5C A;  3HD5 A;  2HRK A;  4XHM A;  1GL8 A;  4HQZ A;  1TI1 A;  1K0N A;  1MTC A;  1K3O A;  1YDK A;  4MLY A;  1ERU A;  1UN2 A; 
#chains in the Genus database with same CATH topology
 1QFN A;  1ZCP A;  4MNN A;  4AJ8 A;  4IQ1 A;  1QMV A;  2JU5 A;  1TK0 B;  2WW1 A;  2HZE A;  4EL1 A;  3A5I A;  1KNG A;  2L6D A;  3N9J A;  4DSR A;  4GLT A;  1A24 A;  1ABA A;  1M9A A;  2QKE A;  1AQV A;  2UV8 G;  4MH2 A;  3GA4 A;  4MA9 A;  3FZA A;  3TKQ A;  1SEN A;  1B4Q A;  1WE0 A;  1JFU A;  4I6X A;  2EC4 A;  1TDI A;  3I69 A;  2O3E A;  3QD9 A;  2CAI A;  1Z6N A;  3ZIJ A;  3HXS A;  2NVL A;  2RUE A;  4ECB A;  10GS A;  3IRA A;  1PX6 A;  3TKR A;  5L71 A;  2HRA A;  1GSY A;  2IMI A;  2YWN A;  4XIH A;  3MNG A;  2TRX A;  5IM9 A;  4KND A;  2M80 A;  3WD6 A;  1OKT A;  2HQT A;  4ZL9 A;  4G0I A;  1S3D A;  2O85 A;  2N5B A;  1NHY A;  4GQC A;  2HRK B;  3ERG A;  4HU7 A;  1LBK A;  4YAP A;  2LV3 A;  3HVX A;  2IME A;  1G7E A;  1XWB A;  2DJ3 A;  4KE3 A;  5G5F A;  4PHZ C;  3FEU A;  4PUA A;  4MMM A;  2PUK C;  2MMZ A;  3G7J A;  5J9C A;  2G2Q A;  1LJR A;  2L4Q A;  3D21 A;  2O87 A;  2FWE A;  5HFK A;  3C1S A;  5B7C A;  3FYG A;  1PL2 A;  4IQA A;  5G2Z A;  3GX8 A;  3K8N A;  1F6M C;  2XC2 A;  2FY6 A;  5COH A;  3CTF A;  1A0F A;  4CY6 A;  1ST9 A;  3AY8 A;  4KW6 A;  1SL1 B;  1DBY A;  4TN8 A;  1PKW A;  2L5O A;  4N3Z A;  2H1D A;  3US3 A;  4IN0 A;  3VLN A;  3TB2 A;  3VI7 A;  4ISD A;  1IYH A;  2WVX A;  5LCZ A;  4N11 A;  3IOS A;  1DUG A;  3GL3 A;  4LMW A;  4PX1 A;  1WRY A;  2KP2 A;  3VWV A;  4TKY A;  3F4R A;  1XW6 A;  2WUL A;  5JCW A;  5FHI A;  2K9F A;  4X1U A;  1SVO A;  3EMX A;  1BYE A;  2FWG A;  5D8I A;  2CZ3 A;  1O8W A;  1FOH A;  4KCA A;  1BED A;  4XS6 A;  5D9X A;  2XPD A;  2MZC A;  2O36 A;  4WR5 A;  3LJR A;  3H93 A;  4IEL A;  3HA9 A;  4OCE A;  2E2M A;  4AI6 A;  1OC9 A;  5E4W A;  3MIX A;  1A2L A;  5JCU A;  2H1G A;  4JE1 A;  3HVS A;  5CRD A;  2DJ0 A;  3DWV A;  2QSI A;  3L9U A;  4PQH A;  1SKW B;  3GTU A;  1GH2 A;  4TR1 A;  2CQ9 A;  4E8E A;  1SU9 A;  2XHF A;  5GAP D;  2WVX B;  1H75 A;  4O7H A;  3QFB C;  1T3B A;  1A2M A;  4NPB A;  3QFA C;  3UEM A;  1GLP A;  1OVN A;  1W4V A;  2H6Z A;  4JRR A;  2BJX A;  2R3X A;  2OA7 A;  3TOT A;  1PRX A;  2H76 A;  4EKZ A;  2R0C A;  3EC3 A;  5AGY A;  1GTB A;  1EP7 A;  4WF5 A;  3D4M A;  1T00 A;  2A4V A;  3HDC A;  4TOP A;  3UL3 A;  1S3A A;  5FWG A;  4FH8 A;  2WW0 A;  2LTK A;  2GQL A;  3M8N A;  3IK7 A;  2QA2 A;  5IO2 A;  1K0O A;  2CA8 A;  4ZIL A;  4G19 A;  1OC8 A;  3IPZ A;  2FA8 A;  5H5S A;  1F3B A;  3ZRE A;  1U3I A;  7GSS A;  1OC9 B;  1ERV A;  2GSR A;  4IP1 A;  4NMU A;  3GTU B;  4RQX A;  3TJG A;  4AKH A;  3ZIV A;  4TR1 B;  3GX0 A;  5INY A;  3FW2 A;  2VO4 A;  2JZS A;  2B1K A;  4DSQ A;  4IGJ A;  2YWI A;  3TUE A;  3GN3 A;  13GS A;  1WIK A;  4PTS A;  1BG1 A;  2ON7 A;  1QGV A;  5G1K A;  2HSY A;  3UMA A;  6GSY A;  1ERW A;  4BWS A;  1R7H A;  1YJ6 A;  3TJB A;  4DSS A;  2DKH A;  1NM3 A;  3IE3 A;  4L8E A;  2B3S A;  1PN0 A;  5CRH A;  5DCG A;  2RM6 A;  2VCT A;  2VL2 C;  2GZY A;  4V1A g;  3WGD A;  4F0B A;  3TRX A;  4WF4 A;  1GUL A;  4FYU A;  1DE1 A;  2JAD A;  5CP1 A;  4TR4 A;  4HJM A;  2YJ7 A;  2H1L A;  2DJ1 A;  2EIR A;  3IAM 2;  1ZZY A;  2H66 A;  3C73 A;  4HU9 A;  1M2B A;  2O5V A;  4NXI A;  2PU9 C;  2HLS A;  2OJL A;  1PQN A;  3E0U A;  4JBB A;  2C8U A;  2B7K A;  2B7J A;  5IPH A;  3D0Z A;  4P3Y B;  1MD4 A;  3CXG A;  5CRE A;  1ZMA A;  3GKX A;  3R3E A;  2PPT A;  2L6C A;  5AIV A;  1AIU A;  2YV9 A;  2OAC A;  1THX A;  2YOI A;  2H71 A;  1V9W A;  2VM2 A;  4AGS A;  5A34 A;  3PIN A;  4DSS B;  3F0I A;  4KUN A;  4ML1 A;  2GT5 A;  2ZUP A;  1OC3 A;  3M9J A;  5ABR A;  3HYP A;  2LRN A;  20GS A;  3R2Q A;  2VD0 A;  5ECP B;  4OWY A;  3RFR C;  1FVJ A;  5J4V A;  5IMD A;  1ZYE A;  2GQM A;  1U87 A;  3HKR A;  4ULX A;  2H0I A;  1GUM A;  1PMT A;  2GZP A;  1ZL9 A;  4HI7 A;  1DE2 A;  4LMV A;  3LWA A;  2HYX A;  2VL3 A;  2NDO A;  4F82 A;  4GTU A;  5A4W A;  4HSC X;  1V58 A;  1YF1 A;  4I97 A;  3PGT A;  4AF2 A;  5KOW A;  4AJ7 A;  3RBT A;  4Q5N A;  1UVZ A;  3WT2 A;  3EU3 A;  1OYJ A;  3L9S A;  1RK4 A;  2E2G A;  5G5E A;  4MF5 A;  4PXO A;  5DVB A;  3BBY A;  3UAR A;  1Y1U A;  3D6I A;  4KX4 A;  2A2R A;  1NSW A;  3FZ9 A;  3WGE A;  5A34 B;  2H0H A;  5KN2 A;  4TRX A;  2VL2 A;  4L0U A;  3ZFL A;  2JL4 A;  2O8V B;  3DEX A;  2DJ2 A;  4HDE A;  4FYC A;  2GSQ A;  1B8X A;  1XBS A;  5B8B A;  3DGQ A;  2RLI A;  4DVC A;  1U3A A;  2CVD A;  2R5G A;  2VCX A;  1F2E A;  4MJA A;  9GSS A;  4BWQ A;  5HR3 A;  4MK3 A;  5ECM B;  3NZN A;  1GSS A;  1SL0 B;  2R6K A;  4PQI A;  1J08 A;  4K9Z A;  4GDF A;  1ACV A;  1OE8 A;  1K3Y A;  1GUK A;  1X5D A;  1YVL A;  2LJR A;  2RM5 A;  2X8G A;  1GSQ A;  4MPF A;  4WET A;  2FD3 A;  3P90 A;  4MJC A;  4GXZ A;  3F6F A;  5ECI B;  4O92 A;  3UIW A;  1ERT A;  4XS1 A;  2LQQ A;  1LU4 A;  3I6A A;  4PQ1 A;  3ZLP A;  2HSN A;  1XVW A;  1JHB A;  3M3M A;  2IMD A;  1ZYQ B;  1M0U A;  5IIZ A;  1ZYP A;  2DJJ A;  2YP6 A;  3DKS A;  1V57 A;  1Z6M A;  1WJK A;  3SBC A;  1SD8 A;  1EV9 A;  2VAF A;  3WGX A;  1QQ2 A;  3H79 A;  5IOW A;  3APQ A;  3TRQ A;  4MP4 A;  2OBK A;  3DIE A;  3HZ8 A;  2V6K A;  5DAK A;  3KGK A;  2GLR A;  2LQO A;  1T8E B;  1GSE A;  2VCV A;  1TRV A;  1X0R A;  3KH7 A;  1M9B A;  2PER A;  2GTU A;  2K8V A;  3CSJ A;  5IOX A;  3D5J A;  1EEJ A;  4K5S A;  4RI7 A;  3FMW A;  2A4H A;  3VWU A;  4TR3 A;  1FO5 A;  2HRF A;  2BTO T;  1MD3 A;  1OKD A;  1ILO A;  3A2V A;  2GSS A;  2EIQ A;  3EUR A;  2FCH A;  2DML A;  3HVV A;  1M2A A;  2R0P A;  2HSN B;  4ILF A;  3FK8 A;  1FG4 A;  1X5E A;  2LRC A;  4MAB A;  1G7O A;  3BD2 A;  5D96 A;  3DRN A;  4O5Q A;  4MF6 A;  1EP8 A;  3N5O A;  3H8Q A;  2AV4 A;  4TXV A;  2CX4 A;  4NHZ A;  4OO4 A;  1K0A A;  4XCS A;  2KHP A;  3IXR A;  2WW3 A;  4K5R A;  3UBK A;  4Z2U A;  1N2A A;  1PA3 A;  5CRW A;  4O5U A;  3EYT A;  1MEK A;  2NTO A;  3IBH A;  1SD9 A;  1XXU A;  5DAK B;  4K7N A;  3UJ1 A;  1CQH A;  4AKG A;  2HZF A;  1H4O A;  5D9W A;  1M3J A;  3F63 A;  4ZXG A;  4WBR D;  3KMO A;  4EDY A;  4RUV A;  2DLX A;  3BJ5 A;  4ZBA A;  3Q74 A;  4ZB8 A;  2E7P A;  4K2D A;  4F03 A;  2I1U A;  3GL5 A;  5H5R A;  2AHE A;  3UVH A;  4TVE A;  1X9W B;  2K8S A;  1GSF A;  2I3Y A;  2LST A;  2R2J A;  3O3T A;  1SYX A;  2V41 A;  3GUR A;  3MAK A;  2HFD A;  5G1L A;  4PI0 C;  2C80 A;  4RI6 A;  4PI2 C;  2VCW A;  3U5R E;  3LQ7 A;  1RW1 A;  1S3R A;  5DBQ A;  2WVZ A;  5ECL B;  2L4C A;  4JR4 A;  6GSU A;  2OBI A;  2WCI A;  5E59 A;  4H86 A;  1Y6E A;  2H6Y A;  2DMM A;  3E3E A;  5J9B A;  2YWM A;  4POK A;  4JZQ A;  2X8C A;  4NWY A;  5B8A A;  1GSD A;  3QAW A;  4N0V A;  4NV5 A;  1SK0 A;  3DYR A;  3Q6O A;  1FVK A;  1EOG A;  1WP0 A;  2X49 A;  4IP6 A;  3H1N A;  1UC7 A;  2NBS A;  2LS5 A;  4WBJ A;  3FR9 A;  5IQY A;  4N0Z A;  4GRF A;  2MYG A;  1SJZ A;  6GSX A;  1TK5 B;  3CQF A;  4MPG A;  2ALB A;  4CY8 A;  5HFG A;  2H19 A;  3KTB A;  1XIY A;  4RQR A;  3RHB A;  2OE1 A;  4YQV A;  1K3L A;  1XCC A;  1RQM A;  2IWT A;  1W89 A;  3LEF A;  4V2L A;  3EIN A;  1GRX A;  4ACS A;  1THO A;  3TKP A;  5A5H A;  1DSB A;  1MDI A;  5DQY A;  1JZO A;  5DJL A;  2O7K A;  1YKC A;  3TDG A;  4G2E A;  1EGO A;  4V2N A;  1USB A;  1R5A A;  4POB A;  4MCU A;  1JLV A;  3PH9 A;  5J5N A;  4L5L A;  2VLV A;  3TRP A;  4EVM A;  4EXJ A;  3DVW A;  2P31 A;  1TU8 A;  2MBT A;  4ZB6 A;  3O6T A;  4NV2 A;  3J7Y b;  3P7X A;  5JWQ B;  5G31 A;  3IHQ A;  4FO5 A;  4PNG A;  4KA0 A;  4BPY A;  2R4V A;  2HE3 A;  1OAZ A;  2C3N A;  5J3R A;  1UA5 A;  19GS A;  3SWL A;  2H1B A;  2PWJ A;  1YZX A;  5F05 A;  4KH7 A;  1CQG A;  1TK8 B;  1SJI A;  4Z7X A;  3LXT A;  3VWW A;  1NW2 A;  1XWG A;  5A5H B;  4X43 A;  5ECR B;  3CRT A;  4HZ2 A;  3IDV A;  4LL1 B;  2I4A A;  2XPE A;  1TOF A;  1T4Y A;  3TU3 B;  2C0G A;  5JCG A;  4OD7 A;  2MMA A;  3RDW A;  5IMA A;  3A3T A;  4EF0 A;  4D73 A;  3TJF A;  1URM A;  4E8H A;  3KZQ A;  1O85 A;  1T7P B;  3KP8 A;  1A23 A;  2H74 A;  4EDZ A;  5DJM A;  3WYW A;  5CO3 A;  5KOX A;  4IKH A;  1EOH A;  3P2A A;  2G0F A;  5BRT A;  1YF0 A;  2OAD A;  4I2U A;  3NOF A;  2E0Q A;  4HEA 2;  3TOU A;  4F0C A;  1G0T A;  5AN1 A;  3ME8 A;  4BIK A;  1EEM A;  1J9B A;  4EO3 A;  22GS A;  4WR4 A;  2TRC P;  3ZL5 A;  1GTU A;  2KLX A;  3GH6 A;  3OR5 A;  2K6V A;  3DD3 A;  2YPM A;  5KN0 A;  3C8E A;  1PL1 A;  3M0F A;  5J40 A;  4GST A;  2EFC A;  4JU5 A;  5A4U A;  4KGI A;  2X99 A;  3FRC A;  3F8U A;  2L5L A;  2A2P A;  4K0N A;  4Q5R A;  1A8Y A;  3A5W A;  2D2Z A;  3RPP A;  2F51 A;  3LOR A;  2L57 A;  4D73 B;  3MDK A;  1JLW A;  2FHE A;  2AJQ B;  3LFL A;  1B4P A;  2PGT A;  1S4B P;  2F9S A;  1I9D A;  5GST A;  3L78 A;  2CX3 A;  4YKG A;  3KH9 A;  3KM6 A;  4YAV A;  2FWF A;  3TJJ A;  3LYK A;  2B5X A;  4AKI A;  1AAZ A;  1BQ7 A;  2IL3 A;  6GSW A;  5C00 A;  16GS A;  4K7I A;  5F06 A;  4MF7 A;  3MSZ A;  4CW9 A;  1SL2 B;  2KOK A;  4IHU A;  14GS A;  3TJK A;  2VCQ A;  2KUC A;  3EVI A;  4YQM A;  4CHS A;  1VF3 A;  1XG8 A;  2TIR A;  4GSN A;  2HNL A;  3TGZ A;  2O89 A;  3GFK A;  1TI3 A;  4I8B A;  2KP1 A;  4F9Z A;  4BA7 A;  3TCO A;  1AC1 A;  5JWO B;  1MDJ A;  1E6B A;  1F3A A;  6GSV A;  3UBL A;  3EE2 A;  4KSM A;  1JZD A;  3F3Q A;  5ECN B;  3S9F A;  2VIM A;  1O8X A;  5F07 A;  2VKZ G;  4KDY A;  4X4J A;  2C3Q A;  1X9S B;  4G9H A;  2C0E A;  2YJH A;  3CSH A;  4OFM A;  4L5O A;  5G30 A;  3F4S A;  1TXU A;  1VRS D;  2YV7 A;  2LNS A;  3ZIT A;  1SK2 A;  2H30 A;  1V98 A;  3QPM A;  1XW5 A;  2F3M A;  1YEX A;  3RHC A;  2YAN A;  3CHX C;  4G10 A;  5B6M A;  4AJ6 A;  2WZ9 A;  4I2T A;  4G01 A;  1GP1 A;  3KD0 A;  1WOU A;  1XOA A;  4KB3 A;  3IC8 A;  2WB9 A;  3KP9 A;  2WZS A;  5F8B A;  5LNK e;  1M2D A;  5HFI A;  1QK8 A;  5HR1 A;  3ME7 A;  2LRT A;  1YKA A;  2WJU A;  1TRW A;  2VL9 A;  1ON4 A;  2GS3 A;  1BG5 A;  5BMU A;  2YZU A;  2PVO C;  4HS1 A;  1KBN A;  3QMX A;  3KMN A;  3GIX A;  2A2S A;  4K2X A;  4GWR A;  2LUS A;  3VI5 A;  1XOB A;  3LXZ A;  2WGR A;  2CVB A;  3I9V 2;  1MDK A;  4USS A;  2IJY A;  4XTS A;  4ZB9 A;  5D93 A;  4Z2R A;  4FIW A;  1ML6 A;  2HXK A;  3HCZ A;  4N10 A;  2C0F A;  4ECI A;  1HYU A;  2M72 A;  4IJ3 A;  1KEB A;  4PUR A;  2YCD A;  3HZ4 A;  3H4K A;  3P8W A;  1B9X C;  3V1W A;  6GST A;  5CYY A;  2H73 A;  3CMI A;  4K8M A;  3IV4 A;  1PGT A;  4KDU A;  2CZ2 A;  2ZCT A;  1HNA A;  3VFI A;  1R4W A;  1GNE A;  1YY7 A;  4MDC A;  1XWA A;  1VGL A;  2GZZ A;  3L4N A;  5BMU B;  1GUH A;  5J4U A;  3FR6 A;  3Q18 A;  1TJD A;  2V6O A;  3L9V A;  1EV4 A;  4YH2 A;  1V40 A;  4PUF C;  1K0B A;  4WKW A;  5EL8 A;  5EY6 A;  4QL7 A;  4L0W A;  1GTI A;  3VUR A;  1AUC A;  2HSM A;  2FWH A;  3LW9 A;  1OE7 A;  3F4T A;  2YWO A;  3C71 A;  1O6J A;  1AQW A;  1Q98 A;  3LG6 A;  5B6N A;  4I5Q A;  2C3T A;  1N8J A;  8GSS A;  2OKA A;  1ZYN A;  2JSY A;  1GNW A;  2CV4 A;  3ED3 A;  4FQU A;  2VM1 A;  1FB0 A;  2WW2 A;  3Q19 A;  4HOJ A;  5IMV A;  1SKR B;  4MJB A;  3F9U A;  2GT6 A;  1XWK A;  2YZH A;  3IK9 A;  4IS0 A;  5ENU A;  1I5G A;  2P5R A;  4ID0 A;  4FXY P;  4K6X A;  5IPG A;  3QCP A;  5DQS A;  4K0G A;  3G9B A;  2GVP A;  1FB6 A;  3ZFB A;  2HSH A;  2GQK A;  2R37 A;  1PSQ A;  4Q5F A;  4O5R A;  4QQ7 A;  3KEB A;  3TKS E;  2FNO A;  3W8S A;  3ZRD A;  1BF5 A;  18GS A;  5IMZ A;  11GS A;  4KF9 A;  2JZT A;  4ECJ A;  2DBC A;  2HSM B;  4J56 E;  2OE3 A;  3I43 A;  2LEG A;  1A0R P;  2YN1 A;  2C0D A;  5CNW A;  4WEY A;  3JCM L;  3GKM A;  2P5Q A;  2EFH A;  3FHK A;  3KCM A;  2HZE B;  4Q5Q A;  1B48 A;  4JR6 A;  4CDO A;  1B9Y C;  4LA1 A;  2HRN A;  1TTZ A;  1XW9 A;  2X64 A;  3C1R A;  5F0G A;  3HJM A;  1GSU A;  2WRT A;  3APS A;  1FOV A;  2VLU A;  3PR8 A;  4MZW A;  2FA4 A;  4AKX B;  2J23 A;  2I81 A;  1XVQ A;  1JZR A;  3HMJ G;  2WS2 A;  1JZW A;  5AIS A;  5DAL A;  2LKU A;  4V1A p;  2H70 A;  1I1I P;  1F37 A;  1TXX A;  5HR0 A;  3A2X A;  1HD2 A;  3FY7 A;  2H6X A;  5J41 A;  1TRS A;  4QL9 A;  3IHG A;  2DSA A;  2MMO A;  1AQX A;  3IR4 A;  1EZK A;  3HHV A;  3F6D A;  2DJK A;  2AUV A;  5EPF A;  3GKK A;  4PNF A;  3BCI A;  2C1Y A;  1TW9 A;  3FZ5 A;  2WFC A;  4NAX A;  1PN9 A;  2GGT A;  2GDR A;  3ZMK A;  2JAC A;  2VLT A;  3LGC A;  3E9J B;  1Z9H A;  3PPU A;  4LL4 B;  1FW1 A;  1C72 A;  3GSS A;  3HY2 A;  4HUA A;  2PN8 A;  2J9H A;  3ZYW A;  5IMC A;  4HQS A;  1XFL A;  5KN3 A;  2IFQ A;  3FKF A;  2DIY A;  4G0K A;  2N5A A;  5C04 A;  1XZO A;  4BL7 A;  2RUF A;  3ZTL A;  3NIV A;  3W6G A;  3HJP A;  2ES7 A;  5DAL B;  5DDL A;  4EC0 A;  2P0G A;  4ML6 A;  4Z2T A;  2X4A A;  4J57 E;  2NPB A;  2JSZ A;  3GNJ A;  1Y25 A;  3FR3 A;  5AIX A;  1YEP A;  2EFE A;  2H75 A;  4GSS A;  1VF4 A;  2IIY A;  5CRG A;  1QUW A;  1A2J A;  3D22 A;  2XBI A;  3ZVJ A;  5GZZ B;  1R5P A;  4IW9 A;  4POM A;  3M1G A;  4W66 A;  4OFN A;  3QAV A;  2VD1 A;  1GTA A;  5GSS A;  5KN1 A;  3ISO A;  2QC7 A;  2V2G A;  3CWG A;  3A2W A;  1K0C A;  4XRA A;  3DML A;  2B1L A;  3ZVJ D;  4E68 A;  2YNX A;  2IFQ B;  3F3R A;  3KJY A;  4ICY A;  5A1N A;  2PVQ A;  2OT3 A;  1NHO A;  1E2Y A;  1V2A A;  4LLR A;  4BL7 B;  3UVT A;  1EWX A;  2CT6 A;  5ECS A;  1GWC A;  3CRU A;  4FYB A;  4A5P A;  2R0G A;  4O32 A;  1Z7P A;  1SJ6 A;  2V32 A;  5D73 A;  1O73 A;  1VF2 A;  2I9H A;  4GQF A;  2RII A;  4G0L A;  2XBQ A;  2H8L A;  5D9T A;  5HQP A;  1ZOF A;  12GS A;  1T1V A;  2H1A A;  3LSZ A;  4XRD A;  2B5E A;  2K18 A;  1SVL A;  5ECK B;  2QGV A;  1K0D A;  3C7M A;  1PD2 1;  2F8A A;  3M9K A;  3QR6 A;  4V2M A;  5HR2 A;  3RAZ A;  2H72 A;  4K7O A;  3RGB C;  5A4V A;  3CYN A;  3EPT A;  3IAS 2;  5IO0 A;  3W8J A;  3APO A;  1HNB A;  4NHW A;  2EFD A;  2IMK A;  3J7Y k;  2L59 A;  4OO5 A;  3LYP A;  5A1N B;  3FZ4 A;  3GYK A;  1SVM A;  2GST A;  1KTE A;  2CVK A;  2LJA A;  2ZNM A;  1AW9 A;  4TR0 A;  3CBU A;  2FUG 2;  5ECH B;  2VUP A;  2H01 A;  3DVX A;  5CAX A;  2B5Y A;  3EWL A;  2HI7 A;  2BMX A;  1YQ1 A;  4WXT A;  3ERW A;  4HJ2 A;  5IMF A;  1SYR A;  4GF0 A;  3L0H A;  4POL A;  3UAP A;  5KEJ A;  3EU4 A;  3IC4 A;  4MJE A;  4EIP A;  1HQO A;  2PBJ A;  17GS A;  4N30 A;  4BVY A;  5ELG A;  1PX7 A;  4TXO A;  2V1M A;  4YQU A;  4BVX A;  4EIQ A;  3MYD A;  1BJX A;  4X0X A;  1Z3E A;  1HNC A;  1G6Y A;  2IPA A;  2DIZ A;  3G7I A;  3GUS A;  2WDU A;  4OCF A;  3TKS C;  2FGX A;  3CTG A;  4K1F A;  4MZC A;  3IA1 A;  5EVO A;  1F9M A;  1R26 A;  3QAG A;  4ECC A;  3QDN A;  1N25 A;  2DC5 A;  4IBP A;  4ZBD A;  1PFO A;  4J2F A;  2ON5 A;  4EUY A;  1TKD B;  1WWJ A;  4QMK A;  4GCI A;  3GMF A;  2OE0 A;  1SKS B;  2IN3 A;  5FT3 A;  3BOA A;  1SK1 A;  2EIO A;  3ERF A;  5DCH A;  1J0F A;  2JZR A;  3GST A;  3GKN A;  2VCZ A;  4IJI A;  1FAA A;  2DKI A;  4ZIJ A;  5GAN D;  2AB6 A;  3WT1 A;  4OFT A;  4KSO A;  4EE0 A;  2MMN A;  1K0M A;  3O76 A;  1Z7R A;  2LJK A;  2REM A;  5ID2 A;  3HVN A;  1BX9 A;  3QOU A;  2UZ8 A;  4BVY B;  6GSS A;  4OMV A;  4MZB A;  4TXO B;  3ZZX A;  5J47 A;  5ELA A;  4BVX B;  2QA1 A;  4XS4 A;  1VF1 A;  1XPV A;  2AYT A;  2H0G A;  4KAE A;  1S3C A;  5H5Q A;  1BAY A;  1G6W A;  3VPQ A;  4F2I A;  3KXO A;  1T4Z A;  1X9M B;  4ZL8 A;  4HZ4 A;  2AAW A;  1M99 A;  4YKF A;  1IYI A;  3HJO A;  2Z9S A;  4ZL7 A;  1Z5Y E;  3U6V A;  2PMT A;  1EGR A;  4DEJ A;  1WMJ A;  3BCK A;  3KIJ A;  2X8H A;  4PGT A;  1XWC A;  1M3I A;  5LD0 A;  2C4J A;  1O81 A;  1U88 A;  2CAQ A;  4KDX A;  1TRU A;  3UOM A;  1ZGN A;  2HT9 A;  1A8L A;  1FHE A;  4JED A;  1TU7 A;  1TP9 A;  3KTL A;  4MH3 A;  3EMP A;  1QXH A;  3CSI A;  1U6T A;  4ZBB A;  5ECO B;  2B6M A;  5ECQ B;  3DXB A;  3RPN A;  2MBS A;  5ID2 B;  2M46 A;  1Q4J A;  2IMF A;  4TW5 A;  3GHA A;  2LNT A;  4XS4 B;  3GV1 A;  3VWX A;  4IVF A;  3VPT A;  1PKZ A;  3G7Y A;  3TKS A;  5D9V A;  2VOC A;  5JWR B;  3ZML A;  3GH9 A;  1O7U A;  3GRX A;  1YEW C;  4KCE A;  5A5K A;  1M7T A;  2F8F A;  4ZB7 A;  1AXD A;  3VK9 A;  2N5F A;  3MWH A;  1GLQ A;  1WPI A;  3D4T A;  2FLS A;  5J4Y A;  1X5C A;  3HD5 A;  2HRK A;  4XHM A;  1GL8 A;  4HQZ A;  1TI1 A;  1K0N A;  1MTC A;  2WVY A;  1K3O A;  1YDK A;  4MLY A;  1ERU A;  1UN2 A; 
#chains in the Genus database with same CATH homology
 1QFN A;  1ZCP A;  4MNN A;  4AJ8 A;  4IQ1 A;  1QMV A;  2JU5 A;  1TK0 B;  2HZE A;  4EL1 A;  3A5I A;  1KNG A;  2L6D A;  3N9J A;  4DSR A;  4GLT A;  1A24 A;  1ABA A;  1M9A A;  2QKE A;  1AQV A;  2UV8 G;  4MH2 A;  3GA4 A;  4MA9 A;  3FZA A;  3TKQ A;  1SEN A;  1B4Q A;  1WE0 A;  1JFU A;  4I6X A;  2EC4 A;  1TDI A;  3I69 A;  3QD9 A;  2CAI A;  1Z6N A;  3ZIJ A;  3HXS A;  2NVL A;  2RUE A;  4ECB A;  10GS A;  3IRA A;  1PX6 A;  3TKR A;  5L71 A;  2HRA A;  1GSY A;  2IMI A;  2YWN A;  4XIH A;  3MNG A;  2TRX A;  5IM9 A;  4KND A;  2M80 A;  3WD6 A;  1OKT A;  2HQT A;  4ZL9 A;  4G0I A;  1S3D A;  2O85 A;  2N5B A;  1NHY A;  4GQC A;  2HRK B;  3ERG A;  4HU7 A;  1LBK A;  4YAP A;  2LV3 A;  3HVX A;  2IME A;  1G7E A;  1XWB A;  2DJ3 A;  4KE3 A;  5G5F A;  3FEU A;  4PUA A;  4MMM A;  2PUK C;  2MMZ A;  3G7J A;  5J9C A;  2G2Q A;  1LJR A;  2L4Q A;  3D21 A;  2O87 A;  2FWE A;  5HFK A;  3C1S A;  5B7C A;  3FYG A;  1PL2 A;  4IQA A;  5G2Z A;  3GX8 A;  3K8N A;  1F6M C;  2XC2 A;  2FY6 A;  5COH A;  3CTF A;  1A0F A;  4CY6 A;  1ST9 A;  3AY8 A;  4KW6 A;  1SL1 B;  1DBY A;  4TN8 A;  1PKW A;  2L5O A;  4N3Z A;  2H1D A;  3US3 A;  4IN0 A;  3VLN A;  3TB2 A;  3VI7 A;  4ISD A;  1IYH A;  5LCZ A;  4N11 A;  3IOS A;  1DUG A;  3GL3 A;  4LMW A;  4PX1 A;  1WRY A;  2KP2 A;  3VWV A;  4TKY A;  3F4R A;  1XW6 A;  2WUL A;  5JCW A;  5FHI A;  2K9F A;  4X1U A;  1SVO A;  3EMX A;  1BYE A;  2FWG A;  5D8I A;  2CZ3 A;  1O8W A;  1FOH A;  4KCA A;  1BED A;  4XS6 A;  5D9X A;  2XPD A;  2MZC A;  4WR5 A;  3LJR A;  3H93 A;  4IEL A;  3HA9 A;  4OCE A;  2E2M A;  4AI6 A;  1OC9 A;  5E4W A;  3MIX A;  1A2L A;  5JCU A;  2H1G A;  4JE1 A;  3HVS A;  5CRD A;  2DJ0 A;  3DWV A;  2QSI A;  3L9U A;  4PQH A;  1SKW B;  3GTU A;  1GH2 A;  4TR1 A;  2CQ9 A;  4E8E A;  1SU9 A;  2XHF A;  5GAP D;  1H75 A;  4O7H A;  3QFB C;  1T3B A;  1A2M A;  4NPB A;  3QFA C;  3UEM A;  1GLP A;  1OVN A;  1W4V A;  2H6Z A;  4JRR A;  2BJX A;  2R3X A;  2OA7 A;  3TOT A;  1PRX A;  2H76 A;  4EKZ A;  2R0C A;  3EC3 A;  5AGY A;  1GTB A;  1EP7 A;  4WF5 A;  3D4M A;  1T00 A;  2A4V A;  3HDC A;  4TOP A;  3UL3 A;  1S3A A;  5FWG A;  4FH8 A;  2LTK A;  2GQL A;  3M8N A;  3IK7 A;  2QA2 A;  5IO2 A;  1K0O A;  2CA8 A;  4ZIL A;  4G19 A;  1OC8 A;  3IPZ A;  2FA8 A;  5H5S A;  1F3B A;  3ZRE A;  1U3I A;  7GSS A;  1OC9 B;  1ERV A;  2GSR A;  4IP1 A;  4NMU A;  3GTU B;  4RQX A;  3TJG A;  4AKH A;  3ZIV A;  4TR1 B;  3GX0 A;  5INY A;  3FW2 A;  2VO4 A;  2JZS A;  2B1K A;  4DSQ A;  4IGJ A;  2YWI A;  3TUE A;  3GN3 A;  13GS A;  1WIK A;  4PTS A;  1BG1 A;  2ON7 A;  1QGV A;  5G1K A;  2HSY A;  3UMA A;  6GSY A;  1ERW A;  4BWS A;  1R7H A;  1YJ6 A;  3TJB A;  4DSS A;  2DKH A;  1NM3 A;  3IE3 A;  4L8E A;  2B3S A;  1PN0 A;  5CRH A;  5DCG A;  2RM6 A;  2VCT A;  2VL2 C;  2GZY A;  4V1A g;  3WGD A;  4F0B A;  3TRX A;  4WF4 A;  1GUL A;  4FYU A;  1DE1 A;  2JAD A;  5CP1 A;  4TR4 A;  4HJM A;  2YJ7 A;  2H1L A;  2DJ1 A;  2EIR A;  3IAM 2;  1ZZY A;  2H66 A;  3C73 A;  4HU9 A;  1M2B A;  2O5V A;  4NXI A;  2PU9 C;  2HLS A;  2OJL A;  1PQN A;  3E0U A;  4JBB A;  2C8U A;  2B7K A;  2B7J A;  5IPH A;  3D0Z A;  4P3Y B;  1MD4 A;  3CXG A;  5CRE A;  1ZMA A;  3GKX A;  3R3E A;  2PPT A;  2L6C A;  5AIV A;  1AIU A;  2YV9 A;  2OAC A;  1THX A;  2YOI A;  2H71 A;  1V9W A;  2VM2 A;  4AGS A;  5A34 A;  3PIN A;  4DSS B;  3F0I A;  4KUN A;  4ML1 A;  2GT5 A;  2ZUP A;  1OC3 A;  3M9J A;  5ABR A;  3HYP A;  2LRN A;  20GS A;  3R2Q A;  2VD0 A;  5ECP B;  4OWY A;  1FVJ A;  5J4V A;  5IMD A;  1ZYE A;  2GQM A;  1U87 A;  3HKR A;  4ULX A;  2H0I A;  1GUM A;  1PMT A;  2GZP A;  1ZL9 A;  4HI7 A;  1DE2 A;  4LMV A;  3LWA A;  2HYX A;  2VL3 A;  2NDO A;  4F82 A;  4GTU A;  5A4W A;  1V58 A;  1YF1 A;  4I97 A;  3PGT A;  4AF2 A;  5KOW A;  4AJ7 A;  3RBT A;  4Q5N A;  1UVZ A;  3WT2 A;  3EU3 A;  1OYJ A;  3L9S A;  1RK4 A;  2E2G A;  5G5E A;  4MF5 A;  4PXO A;  5DVB A;  3BBY A;  3UAR A;  1Y1U A;  3D6I A;  4KX4 A;  2A2R A;  1NSW A;  3FZ9 A;  3WGE A;  5A34 B;  2H0H A;  5KN2 A;  4TRX A;  2VL2 A;  4L0U A;  3ZFL A;  2JL4 A;  2O8V B;  3DEX A;  2DJ2 A;  4HDE A;  4FYC A;  2GSQ A;  1B8X A;  1XBS A;  5B8B A;  3DGQ A;  2RLI A;  4DVC A;  1U3A A;  2CVD A;  2R5G A;  2VCX A;  1F2E A;  4MJA A;  9GSS A;  4BWQ A;  5HR3 A;  4MK3 A;  5ECM B;  3NZN A;  1GSS A;  1SL0 B;  2R6K A;  4PQI A;  1J08 A;  4K9Z A;  4GDF A;  1ACV A;  1OE8 A;  1K3Y A;  1GUK A;  1X5D A;  1YVL A;  2LJR A;  2RM5 A;  2X8G A;  1GSQ A;  4MPF A;  4WET A;  2FD3 A;  3P90 A;  4MJC A;  4GXZ A;  3F6F A;  5ECI B;  4O92 A;  3UIW A;  1ERT A;  4XS1 A;  2LQQ A;  1LU4 A;  3I6A A;  4PQ1 A;  3ZLP A;  2HSN A;  1XVW A;  1JHB A;  3M3M A;  2IMD A;  1ZYQ B;  1M0U A;  5IIZ A;  1ZYP A;  2DJJ A;  2YP6 A;  3DKS A;  1V57 A;  1Z6M A;  1WJK A;  3SBC A;  1SD8 A;  1EV9 A;  2VAF A;  3WGX A;  1QQ2 A;  3H79 A;  5IOW A;  3APQ A;  3TRQ A;  4MP4 A;  2OBK A;  3DIE A;  3HZ8 A;  2V6K A;  5DAK A;  3KGK A;  2GLR A;  2LQO A;  1T8E B;  1GSE A;  2VCV A;  1TRV A;  1X0R A;  3KH7 A;  1M9B A;  2PER A;  2GTU A;  2K8V A;  3CSJ A;  5IOX A;  3D5J A;  1EEJ A;  4K5S A;  4RI7 A;  3FMW A;  2A4H A;  3VWU A;  4TR3 A;  1FO5 A;  2HRF A;  2BTO T;  1MD3 A;  1OKD A;  1ILO A;  3A2V A;  2GSS A;  2EIQ A;  3EUR A;  2FCH A;  2DML A;  3HVV A;  1M2A A;  2R0P A;  2HSN B;  4ILF A;  3FK8 A;  1FG4 A;  1X5E A;  2LRC A;  4MAB A;  1G7O A;  3BD2 A;  5D96 A;  3DRN A;  4O5Q A;  4MF6 A;  1EP8 A;  3N5O A;  3H8Q A;  2AV4 A;  4TXV A;  2CX4 A;  4NHZ A;  4OO4 A;  1K0A A;  4XCS A;  2KHP A;  3IXR A;  4K5R A;  3UBK A;  4Z2U A;  1N2A A;  1PA3 A;  5CRW A;  4O5U A;  3EYT A;  1MEK A;  2NTO A;  3IBH A;  1SD9 A;  1XXU A;  5DAK B;  4K7N A;  3UJ1 A;  1CQH A;  4AKG A;  2HZF A;  1H4O A;  5D9W A;  3F63 A;  4ZXG A;  4WBR D;  3KMO A;  4EDY A;  4RUV A;  2DLX A;  3BJ5 A;  4ZBA A;  3Q74 A;  4ZB8 A;  2E7P A;  4K2D A;  4F03 A;  2I1U A;  3GL5 A;  5H5R A;  2AHE A;  3UVH A;  4TVE A;  1X9W B;  2K8S A;  1GSF A;  2I3Y A;  2LST A;  2R2J A;  3O3T A;  1SYX A;  2V41 A;  3GUR A;  3MAK A;  2HFD A;  5G1L A;  2C80 A;  4RI6 A;  2VCW A;  3U5R E;  3LQ7 A;  1RW1 A;  5DBQ A;  5ECL B;  2L4C A;  4JR4 A;  6GSU A;  2OBI A;  2WCI A;  5E59 A;  4H86 A;  1Y6E A;  2H6Y A;  2DMM A;  3E3E A;  5J9B A;  2YWM A;  4POK A;  4JZQ A;  2X8C A;  4NWY A;  5B8A A;  1GSD A;  3QAW A;  4N0V A;  4NV5 A;  1SK0 A;  3DYR A;  3Q6O A;  1FVK A;  1EOG A;  1WP0 A;  2X49 A;  4IP6 A;  3H1N A;  1UC7 A;  2NBS A;  2LS5 A;  4WBJ A;  3FR9 A;  5IQY A;  4N0Z A;  4GRF A;  2MYG A;  1SJZ A;  6GSX A;  1TK5 B;  4MPG A;  2ALB A;  4CY8 A;  5HFG A;  2H19 A;  3KTB A;  1XIY A;  4RQR A;  3RHB A;  2OE1 A;  4YQV A;  1K3L A;  1XCC A;  1RQM A;  2IWT A;  1W89 A;  3LEF A;  4V2L A;  3EIN A;  1GRX A;  4ACS A;  1THO A;  3TKP A;  5A5H A;  1DSB A;  1MDI A;  5DQY A;  1JZO A;  5DJL A;  2O7K A;  1YKC A;  3TDG A;  4G2E A;  1EGO A;  4V2N A;  1USB A;  1R5A A;  4POB A;  4MCU A;  1JLV A;  3PH9 A;  5J5N A;  4L5L A;  2VLV A;  3TRP A;  4EVM A;  4EXJ A;  3DVW A;  2P31 A;  1TU8 A;  2MBT A;  4ZB6 A;  3O6T A;  4NV2 A;  3J7Y b;  3P7X A;  5JWQ B;  5G31 A;  3IHQ A;  4FO5 A;  4PNG A;  4KA0 A;  4BPY A;  2R4V A;  2HE3 A;  1OAZ A;  2C3N A;  5J3R A;  1UA5 A;  19GS A;  3SWL A;  2H1B A;  2PWJ A;  1YZX A;  5F05 A;  4KH7 A;  1CQG A;  1TK8 B;  1SJI A;  4Z7X A;  3LXT A;  3VWW A;  1NW2 A;  1XWG A;  5A5H B;  4X43 A;  5ECR B;  3CRT A;  4HZ2 A;  3IDV A;  4LL1 B;  2I4A A;  2XPE A;  1TOF A;  1T4Y A;  3TU3 B;  2C0G A;  5JCG A;  4OD7 A;  2MMA A;  3RDW A;  5IMA A;  3A3T A;  4EF0 A;  4D73 A;  3TJF A;  1URM A;  4E8H A;  3KZQ A;  1O85 A;  1T7P B;  3KP8 A;  1A23 A;  2H74 A;  4EDZ A;  5DJM A;  3WYW A;  5CO3 A;  5KOX A;  4IKH A;  1EOH A;  3P2A A;  2G0F A;  5BRT A;  1YF0 A;  2OAD A;  4I2U A;  3NOF A;  2E0Q A;  4HEA 2;  3TOU A;  4F0C A;  1G0T A;  5AN1 A;  3ME8 A;  1EEM A;  1J9B A;  4EO3 A;  22GS A;  4WR4 A;  2TRC P;  3ZL5 A;  1GTU A;  2KLX A;  3GH6 A;  3OR5 A;  2K6V A;  3DD3 A;  2YPM A;  5KN0 A;  3C8E A;  1PL1 A;  3M0F A;  5J40 A;  4GST A;  2EFC A;  4JU5 A;  5A4U A;  4KGI A;  2X99 A;  3FRC A;  3F8U A;  2L5L A;  2A2P A;  4K0N A;  4Q5R A;  1A8Y A;  3A5W A;  2D2Z A;  3RPP A;  2F51 A;  3LOR A;  2L57 A;  4D73 B;  3MDK A;  1JLW A;  2FHE A;  2AJQ B;  3LFL A;  1B4P A;  2PGT A;  2F9S A;  1I9D A;  5GST A;  3L78 A;  2CX3 A;  4YKG A;  3KH9 A;  3KM6 A;  4YAV A;  2FWF A;  3TJJ A;  3LYK A;  2B5X A;  4AKI A;  1AAZ A;  1BQ7 A;  2IL3 A;  6GSW A;  5C00 A;  16GS A;  4K7I A;  5F06 A;  4MF7 A;  3MSZ A;  4CW9 A;  1SL2 B;  2KOK A;  4IHU A;  14GS A;  3TJK A;  2VCQ A;  2KUC A;  3EVI A;  4YQM A;  4CHS A;  1VF3 A;  2TIR A;  4GSN A;  2HNL A;  3TGZ A;  2O89 A;  3GFK A;  1TI3 A;  4I8B A;  2KP1 A;  4F9Z A;  4BA7 A;  3TCO A;  1AC1 A;  5JWO B;  1MDJ A;  1E6B A;  1F3A A;  6GSV A;  3UBL A;  3EE2 A;  4KSM A;  1JZD A;  3F3Q A;  5ECN B;  3S9F A;  2VIM A;  1O8X A;  5F07 A;  2VKZ G;  4KDY A;  4X4J A;  2C3Q A;  1X9S B;  4G9H A;  2C0E A;  2YJH A;  3CSH A;  4OFM A;  4L5O A;  5G30 A;  3F4S A;  1TXU A;  1VRS D;  2YV7 A;  2LNS A;  3ZIT A;  1SK2 A;  2H30 A;  1V98 A;  3QPM A;  1XW5 A;  2F3M A;  1YEX A;  3RHC A;  2YAN A;  4G10 A;  5B6M A;  4AJ6 A;  2WZ9 A;  4I2T A;  4G01 A;  1GP1 A;  3KD0 A;  1WOU A;  1XOA A;  4KB3 A;  3IC8 A;  2WB9 A;  3KP9 A;  5F8B A;  5LNK e;  1M2D A;  5HFI A;  1QK8 A;  5HR1 A;  3ME7 A;  2LRT A;  1YKA A;  2WJU A;  1TRW A;  2VL9 A;  1ON4 A;  2GS3 A;  1BG5 A;  5BMU A;  2YZU A;  2PVO C;  4HS1 A;  1KBN A;  3QMX A;  3KMN A;  3GIX A;  2A2S A;  4K2X A;  4GWR A;  2LUS A;  3VI5 A;  1XOB A;  3LXZ A;  2WGR A;  2CVB A;  3I9V 2;  1MDK A;  4USS A;  2IJY A;  4XTS A;  4ZB9 A;  5D93 A;  4Z2R A;  4FIW A;  1ML6 A;  2HXK A;  3HCZ A;  4N10 A;  2C0F A;  4ECI A;  1HYU A;  2M72 A;  4IJ3 A;  1KEB A;  4PUR A;  2YCD A;  3HZ4 A;  3H4K A;  3P8W A;  1B9X C;  3V1W A;  6GST A;  5CYY A;  2H73 A;  3CMI A;  4K8M A;  3IV4 A;  1PGT A;  4KDU A;  2CZ2 A;  2ZCT A;  1HNA A;  3VFI A;  1R4W A;  1GNE A;  1YY7 A;  4MDC A;  1XWA A;  1VGL A;  2GZZ A;  3L4N A;  5BMU B;  1GUH A;  5J4U A;  3FR6 A;  3Q18 A;  1TJD A;  2V6O A;  3L9V A;  1EV4 A;  4YH2 A;  1V40 A;  4PUF C;  1K0B A;  4WKW A;  5EL8 A;  5EY6 A;  4QL7 A;  4L0W A;  1GTI A;  3VUR A;  1AUC A;  2HSM A;  2FWH A;  3LW9 A;  1OE7 A;  3F4T A;  2YWO A;  3C71 A;  1O6J A;  1AQW A;  1Q98 A;  3LG6 A;  5B6N A;  4I5Q A;  2C3T A;  1N8J A;  8GSS A;  2OKA A;  1ZYN A;  2JSY A;  1GNW A;  2CV4 A;  3ED3 A;  4FQU A;  2VM1 A;  1FB0 A;  3Q19 A;  4HOJ A;  5IMV A;  1SKR B;  4MJB A;  3F9U A;  2GT6 A;  1XWK A;  2YZH A;  3IK9 A;  4IS0 A;  5ENU A;  1I5G A;  2P5R A;  4ID0 A;  4K6X A;  5IPG A;  3QCP A;  5DQS A;  4K0G A;  3G9B A;  2GVP A;  1FB6 A;  3ZFB A;  2HSH A;  2GQK A;  2R37 A;  1PSQ A;  4Q5F A;  4O5R A;  4QQ7 A;  3KEB A;  3TKS E;  2FNO A;  3W8S A;  3ZRD A;  1BF5 A;  18GS A;  5IMZ A;  11GS A;  4KF9 A;  2JZT A;  4ECJ A;  2DBC A;  2HSM B;  4J56 E;  2OE3 A;  3I43 A;  2LEG A;  1A0R P;  2YN1 A;  2C0D A;  5CNW A;  4WEY A;  3JCM L;  3GKM A;  2P5Q A;  2EFH A;  3FHK A;  3KCM A;  2HZE B;  4Q5Q A;  1B48 A;  4JR6 A;  4CDO A;  1B9Y C;  4LA1 A;  2HRN A;  1TTZ A;  1XW9 A;  2X64 A;  3C1R A;  5F0G A;  3HJM A;  1GSU A;  2WRT A;  3APS A;  1FOV A;  2VLU A;  3PR8 A;  4MZW A;  2FA4 A;  4AKX B;  2J23 A;  2I81 A;  1XVQ A;  1JZR A;  3HMJ G;  2WS2 A;  1JZW A;  5AIS A;  5DAL A;  2LKU A;  4V1A p;  2H70 A;  1F37 A;  1TXX A;  5HR0 A;  3A2X A;  1HD2 A;  3FY7 A;  2H6X A;  5J41 A;  1TRS A;  4QL9 A;  3IHG A;  2DSA A;  2MMO A;  1AQX A;  3IR4 A;  1EZK A;  3HHV A;  3F6D A;  2DJK A;  2AUV A;  5EPF A;  3GKK A;  4PNF A;  3BCI A;  2C1Y A;  1TW9 A;  3FZ5 A;  2WFC A;  4NAX A;  1PN9 A;  2GGT A;  2GDR A;  3ZMK A;  2JAC A;  2VLT A;  3LGC A;  3E9J B;  1Z9H A;  3PPU A;  4LL4 B;  1FW1 A;  1C72 A;  3GSS A;  3HY2 A;  4HUA A;  2PN8 A;  2J9H A;  3ZYW A;  5IMC A;  4HQS A;  1XFL A;  5KN3 A;  2IFQ A;  3FKF A;  2DIY A;  4G0K A;  2N5A A;  5C04 A;  1XZO A;  4BL7 A;  2RUF A;  3ZTL A;  3NIV A;  3W6G A;  3HJP A;  2ES7 A;  5DAL B;  5DDL A;  4EC0 A;  2P0G A;  4ML6 A;  4Z2T A;  2X4A A;  4J57 E;  2NPB A;  2JSZ A;  3GNJ A;  1Y25 A;  3FR3 A;  5AIX A;  1YEP A;  2EFE A;  2H75 A;  4GSS A;  1VF4 A;  2IIY A;  5CRG A;  1QUW A;  1A2J A;  3D22 A;  2XBI A;  3ZVJ A;  5GZZ B;  1R5P A;  4IW9 A;  4POM A;  3M1G A;  4W66 A;  4OFN A;  3QAV A;  2VD1 A;  1GTA A;  5GSS A;  5KN1 A;  3ISO A;  2QC7 A;  2V2G A;  3CWG A;  3A2W A;  1K0C A;  4XRA A;  3DML A;  2B1L A;  3ZVJ D;  4E68 A;  2YNX A;  2IFQ B;  3F3R A;  3KJY A;  4ICY A;  5A1N A;  2PVQ A;  2OT3 A;  1NHO A;  1E2Y A;  1V2A A;  4LLR A;  4BL7 B;  3UVT A;  1EWX A;  2CT6 A;  5ECS A;  1GWC A;  3CRU A;  4FYB A;  4A5P A;  2R0G A;  4O32 A;  1Z7P A;  1SJ6 A;  2V32 A;  5D73 A;  1O73 A;  1VF2 A;  2I9H A;  4GQF A;  2RII A;  4G0L A;  2XBQ A;  2H8L A;  5D9T A;  5HQP A;  1ZOF A;  12GS A;  1T1V A;  2H1A A;  3LSZ A;  4XRD A;  2B5E A;  2K18 A;  1SVL A;  5ECK B;  2QGV A;  1K0D A;  3C7M A;  1PD2 1;  2F8A A;  3M9K A;  3QR6 A;  4V2M A;  5HR2 A;  3RAZ A;  2H72 A;  4K7O A;  5A4V A;  3CYN A;  3EPT A;  3IAS 2;  5IO0 A;  3W8J A;  3APO A;  1HNB A;  4NHW A;  2EFD A;  2IMK A;  3J7Y k;  2L59 A;  4OO5 A;  3LYP A;  5A1N B;  3FZ4 A;  3GYK A;  1SVM A;  2GST A;  1KTE A;  2CVK A;  2LJA A;  2ZNM A;  1AW9 A;  4TR0 A;  3CBU A;  2FUG 2;  5ECH B;  2VUP A;  2H01 A;  3DVX A;  5CAX A;  2B5Y A;  3EWL A;  2HI7 A;  2BMX A;  1YQ1 A;  4WXT A;  3ERW A;  4HJ2 A;  5IMF A;  1SYR A;  4GF0 A;  3L0H A;  4POL A;  3UAP A;  5KEJ A;  3EU4 A;  3IC4 A;  4MJE A;  4EIP A;  1HQO A;  2PBJ A;  17GS A;  4N30 A;  4BVY A;  5ELG A;  1PX7 A;  4TXO A;  2V1M A;  4YQU A;  4BVX A;  4EIQ A;  3MYD A;  1BJX A;  4X0X A;  1Z3E A;  1HNC A;  1G6Y A;  2IPA A;  2DIZ A;  3G7I A;  3GUS A;  2WDU A;  4OCF A;  3TKS C;  2FGX A;  3CTG A;  4K1F A;  4MZC A;  3IA1 A;  5EVO A;  1F9M A;  1R26 A;  3QAG A;  4ECC A;  3QDN A;  1N25 A;  2DC5 A;  4IBP A;  4ZBD A;  4J2F A;  2ON5 A;  4EUY A;  1TKD B;  1WWJ A;  4QMK A;  4GCI A;  3GMF A;  2OE0 A;  1SKS B;  2IN3 A;  5FT3 A;  3BOA A;  1SK1 A;  2EIO A;  3ERF A;  5DCH A;  1J0F A;  2JZR A;  3GST A;  3GKN A;  2VCZ A;  4IJI A;  1FAA A;  2DKI A;  4ZIJ A;  5GAN D;  2AB6 A;  3WT1 A;  4OFT A;  4KSO A;  4EE0 A;  2MMN A;  1K0M A;  3O76 A;  1Z7R A;  2LJK A;  2REM A;  5ID2 A;  1BX9 A;  3QOU A;  2UZ8 A;  4BVY B;  6GSS A;  4OMV A;  4MZB A;  4TXO B;  3ZZX A;  5J47 A;  5ELA A;  4BVX B;  2QA1 A;  4XS4 A;  1VF1 A;  1XPV A;  2AYT A;  2H0G A;  4KAE A;  1S3C A;  5H5Q A;  1BAY A;  1G6W A;  3VPQ A;  4F2I A;  3KXO A;  1T4Z A;  1X9M B;  4ZL8 A;  4HZ4 A;  2AAW A;  1M99 A;  4YKF A;  1IYI A;  3HJO A;  2Z9S A;  4ZL7 A;  1Z5Y E;  3U6V A;  2PMT A;  1EGR A;  4DEJ A;  1WMJ A;  3BCK A;  3KIJ A;  2X8H A;  4PGT A;  1XWC A;  5LD0 A;  2C4J A;  1O81 A;  1U88 A;  2CAQ A;  4KDX A;  1TRU A;  3UOM A;  1ZGN A;  2HT9 A;  1A8L A;  1FHE A;  4JED A;  1TU7 A;  1TP9 A;  3KTL A;  4MH3 A;  3EMP A;  1QXH A;  3CSI A;  1U6T A;  4ZBB A;  5ECO B;  2B6M A;  5ECQ B;  3DXB A;  3RPN A;  2MBS A;  5ID2 B;  2M46 A;  1Q4J A;  2IMF A;  4TW5 A;  3GHA A;  2LNT A;  4XS4 B;  3GV1 A;  3VWX A;  4IVF A;  3VPT A;  1PKZ A;  3G7Y A;  3TKS A;  5D9V A;  2VOC A;  5JWR B;  3ZML A;  3GH9 A;  1O7U A;  3GRX A;  4KCE A;  5A5K A;  1M7T A;  2F8F A;  4ZB7 A;  1AXD A;  3VK9 A;  2N5F A;  3MWH A;  1GLQ A;  1WPI A;  3D4T A;  2FLS A;  5J4Y A;  1X5C A;  3HD5 A;  2HRK A;  4XHM A;  1GL8 A;  4HQZ A;  1TI1 A;  1K0N A;  1MTC A;  1K3O A;  1YDK A;  4MLY A;  1ERU A;  1UN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...