4EXJA

Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
221
Chain Sequence
VMAILYTGPTGNGRKPLVLGKLLNAPIKVHMFHPTKDIQEDWYLKLNPAGIVPTLVDDKGTPITESNNILLYIADTYDKEHKFFYSLKQDPKLYWEQNELLFYQATQFQSQTLTIANANYQNGHIDENIAQYVLSSFEKVFAFMETKLSGRDWFVGDKFTIVDIAFLVGEHRRRERLHNSPIWIDLKENFPNVEKWFQRAIAFENVEEILKEHAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
rcsb
source organism Lodderomyces elongisporus nrrl yb-4239
total genus 73
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4exjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4exjA01
4PUAA 3FZ9A 4AGSA 2PGTA 1FVKA 2OA7A 4PNGA 2C0DA 4HDEA 1UC7A 4XRDA 1GWCA 5IM9A 3H4KA 2NDOA 2O87A 4TRXA 2HRFA 4GLTA 5AIXA 2CVKA 3KTLA 2YPMA 4KCEA 1GTUA 4PURA 4CDOA 3GH9A 4MZCA 2CT6A 2VL9A 4OO5A 3ZYWA 4N0VA 5BMUA 4F0CA 3TRQA 1GH2A 2FWGA 3GKXA 1GSYA 4HS1A 3QCPA 3GYKA 2CQ9A 2YOIA 5ECNB 2PBJA 4EXJA 2LTKA 1BJXA 6GSSA 4MPGA 1KEBA 2V1MA 3IV4A 1Q4JA 1BX9A 2OJLA 2GDRA 6GSVA 4I6XA 3G9BA 4XHMA 2DJ2A 4GCIA 3ZTLA 2L4CA 3HZ4A 3DGQA 4BWQA 5ID2A 3TJGA 4HZ4A 3MDKA 3O76A 3F9UA 2JL4A 2PERA 3UJ1A 4CW9A 3J7Yk 1MEKA 2DJJA 4K6XA 5AGYA 4WBRD 2H75A 2MYGA 2VCWA 5JCWA 4KUNA 4V1Ag 2O89A 5A4WA 5G2ZA 5ECOB 12GSA 3IDVA 4MH3A 3LSZA 1RW1A 2IFQB 1EV9A 1TRWA 5D96A 4HU7A 3TRXA 1HNAA 2HSHA 1GLQA 1EOHA 3HVXA 5LNKe 2CA8A 2E0QA 1Z3EA 11GSA 4KX4A 1V58A 5ELGA 1VRSD 1OKTA 1ERVA 4HUAA 1H75A 1TI1A 3M9KA 2PPTA 5H5SA 4I2UA 2IMKA 4HQSA 4RQRA 1A2MA 3DVWA 4YQVA 2VL3A 3ME8A 3F6FA 3BD2A 1Z7PA 4TR0A 2B3SA 2VLUA 2JSZA 4POBA 4EL1A 3TOTA 2HSYA 2HLSA 1VGLA 2JZTA 2LQOA 3GTUA 4F2IA 3MNGA 4LL4B 3TJJA 1EEJA 5FT3A 2FWHA 5J5NA 3GNJA 4POLA 3ZMLA 5G1KA 1GSDA 1YF1A 1IYHA 3EYTA 3L0HA 1Z6MA 2MZCA 3EC3A 2WCIA 4OD7A 2H73A 4BVYB 4JE1A 17GSA 5DAKB 3P90A 3SBCA 2N5FA 5E59A 3TUEA 4XS4A 1TDIA 5ECQB 3IBHA 4NV2A 2R3XA 2JU5A 3QD9A 9GSSA 4GXZA 1G7OA 2XBIA 3BBYA 2WB9A 4F03A 2M80A 2LUSA 3HVSA 4MZWA 2GSSA 2HRNA 1PKWA 4G0LA 1PQNA 4ML1A 5AISA 3KD0A 1TRVA 3UBLA 4OCEA 4EVMA 5ENUA 1SJIA 1USBA 3TGZA 4K0NA 3A2XA 4KSOA 3TJKA 3GSSA 1W4VA 1TKDB 4MDCA 1PGTA 3GA4A 4J2FA 1HD2A 5DVBA 5J9BA 2K8SA 2DBCA 1V98A 1Z5YE 4AJ7A 4XS6A 4DSQA 3HJPA 1PSQA 2OBKA 4GTUA 2B1LA 1DE2A 1GSFA 1KNGA 1G6YA 1JZOA 2P5RA 3RPPA 3PGTA 4IQ1A 2N5BA 2LEGA 4JEDA 5HFKA 2BMXA 1H4OA 1AUCA 4MJBA 3F4SA 2HE3A 5IOXA 4O5RA 5GAND 2H72A 8GSSA 1WOUA 2PU9C 2HSMA 1QMVA 3EURA 3ZRDA 3LJRA 1CQGA 3O6TA 3CRUA 3VURA 1UVZA 3MAKA 2LKUA 4IJIA 2F3MA 4WR5A 1DE1A 6GSYA 1X5CA 2KHPA 4YH2A 2J9HA 1OYJA 1BEDA 2XBQA 3EU4A 2I4AA 5CYYA 1NHYA 3P8WA 3CSHA 1M2DA 5ECKB 2YZHA 1PX6A 1GNEA 4POKA 4Z7XA 4YAVA 5D73A 4MABA 2TRXA 2EIQA 4ZB6A 4L8EA 3A3TA 3WD6A 4TN8A 1EZKA 1I9DA 4KGIA 3KP9A 3HKRA 3G7YA 4TR1A 3VFIA 1K0BA 4MH2A 1TU7A 3HHVA 4ISDA 4PXOA 1SK1A 2QSIA 1SL0B 2LRTA 4XTSA 2VM1A 3IAS2 3ZZXA 1JZRA 2HZEB 4J57E 18GSA 1M7TA 3IPZA 4I2TA 1EWXA 3IR4A 2B1KA 4GQCA 4XS4B 3IAM2 3FYGA 4HI7A 1FAAA 3CYNA 4AJ8A 4K2DA 4LMVA 3FR6A 4FIWA 4GSSA 2NTOA 1T1VA 3ERWA 5DDLA 3H79A 1XVQA 3GL5A 5GSTA 2ES7A 2AV4A 4L5OA 1FG4A 3PINA 3BOAA 2WDUA 4HEA2 1TU8A 3TOUA 5IPGA 2NPBA 1WMJA 1R26A 4LMWA 3HD5A 3IK7A 1M2AA 3NOFA 3F6DA 1WP0A 4JZQA 1V57A 2CAIA 2GT5A 4EO3A 1Y25A 1GSQA 14GSA 4O92A 2WULA 3UOMA 5DBQA 4GRFA 2GZZA 1M9AA 1WRYA 5CRGA 2GSQA 1FB0A 2YJHA 5HQPA 3M1GA 3LQ7A 2R4VA 1XPVA 5CRDA 1JZDA 2H0GA 3L4NA 2FCHA 1GTAA 4N11A 3L78A 5HR3A 1A0RP 1EP8A 4ZIJA 3GV1A 3GMFA 3GH6A 1ML6A 2YNXA 2H1DA 1W89A 2REMA 1J9BA 4NHZA 3APQA 1THXA 2H6YA 2H74A 1TTZA 2IFQA 4POMA 2HNLA 3GX8A 3GL3A 3E0UA 5G5EA 2L59A 2IJYA 4F9ZA 1SKRB 1Q98A 4TOPA 2HYXA 1G6WA 3ISOA 2JACA 3Q19A 4ULXA 4MF7A 2PVOC 3ZIVA 3TKSE 3GX0A 2C3TA 2LNSA 3QFBC 3P2AA 4P3YB 4F0BA 4V1Ap 1UA5A 4IVFA 2EC4A 2N5AA 2DJKA 4L5LA 4OMVA 1XWCA 4USSA 4IGJA 3LFLA 2RIIA 5F07A 1K0AA 2H0HA 1FB6A 3MWHA 4MJEA 1F3AA 6GSWA 3M3MA 5G30A 3ZL5A 1WIKA 1B9YC 2WZ9A 1PKZA 2GS3A 4NMUA 3O3TA 3GHAA 2X64A 2IIYA 5EPFA 1NW2A 5JCUA 4BVYA 5DAKA 2AB6A 2L4QA 1IYIA 5J41A 1A23A 2FA8A 3GUSA 1T3BA 1WPIA 1BAYA 1YY7A 3DKSA 2C4JA 3FR9A 4XS1A 1U3AA 1ACVA 2HQTA 3TJBA 3R3EA 1A0FA 4FO5A 4J56E 2FA4A 2GVPA 5HFGA 1VF2A 5DCGA 1M2BA 1GRXA 2IMDA 2A4VA 2DJ0A 3KIJA 3F0IA 5CAXA 5F8BA 4MZBA 3VPQA 1U3IA 2OE0A 1PN9A 4ECBA 2HXKA 3NIVA 2BJXA 1TOFA 2YV7A 1SYXA 2L6DA 1K0MA 1XWGA 3FY7A 5H5QA 2C80A 22GSA 2VLTA 1EGRA 2VO4A 3RHCA 5ECHB 4IW9A 1BYEA 4MMMA 3H8QA 5D9TA 2R6KA 2VCZA 5DJMA 1A2LA 1K0DA 2F9SA 5DQYA 3N5OA 2V6OA 2H6XA 4PQHA 2CX4A 2MMAA 5JWQB 4G0KA 2YWIA 2C0GA 3QMXA 4DSSB 2FY6A 1QQ2A 2JSYA 5B8AA 3RDWA 4MA9A 3F8UA 4Q5RA 1B9XC 2JADA 4K7NA 3PPUA 13GSA 3IXRA 5CRWA 5G1LA 3W8JA 1GUKA 5LCZA 1R4WA 4BVXA 5COHA 5DJLA 3TB2A 4I97A 1TRSA 3HVVA 1JLWA 2AAWA 1OE7A 3PH9A 2FWFA 1E6BA 2H19A 3U5RE 2C3QA 4MF6A 3TDGA 2YP6A 2MMOA 2IMFA 1PA3A 1XIYA 1NHOA 1T7PB 2UZ8A 2NBSA 3H93A 5AN1A 2GLRA 1GSSA 2RLIA 2P0GA 4H86A 4IHUA 4K1FA 2VCTA 4E8EA 4E8HA 2CAQA 3IC4A 1GULA 1BG5A 3LXTA 2H1BA 3KP8A 1FW1A 3BJ5A 4ECJA 2DC5A 1FVJA 3IE3A 1SU9A 4V2LA 4KNDA 1YDKA 2B6MA 5C00A 2HZEA 5DQSA 2PWJA 2GGTA 4PUFC 5D93A 3W8SA 1XWBA 3ERGA 1R7HA 3QOUA 5A4VA 2YWOA 2VD1A 3GN3A 1O73A 4ZB9A 1SJZA 2XPEA 1BQ7A 1MD4A 1URMA 3FRCA 4MF5A 1AAZA 4KH7A 2P31A 5F06A 5J9CA 1R5AA 3QR6A 3AY8A 2MMNA 2KUCA 1X9WB 1XBSA 1WWJA 5ECPB 1U6TA 4FYCA 2CX3A 2DJ3A 3GRXA 4G9HA 5FWGA 1JZWA 3GKMA 1OVNA 2FHEA 2GT6A 2YN1A 2AUVA 3D21A 1YEXA 3DEXA 3WT2A 2XC2A 1B4PA 3R2QA 4ZL7A 5B6MA 1N2AA 3C1SA 2R5GA 1ABAA 3ZIJA 4GSTA 1CQHA 2ON7A 2FLSA 5ECMB 4PX1A 3CMIA 3HZ8A 4TR4A 4TR3A 5INYA 3WGEA 2WJUA 1K3YA 3KH7A 2X8GA 2GQKA 3FZAA 3NZNA 3G7JA 3JCML 4BWSA 1YKCA 3GIXA 3LORA 3TKRA 4KCAA 1U88A 1WE0A 1B4QA 4NWYA 2MMZA 3GSTA 3UBKA 2RUFA 3FK8A 4V2MA 2VAFA 1V2AA 3ZMKA 4ZB8A 3DWVA 1DBYA 3BCIA 2OE3A 1SD9A 4BVXB 1XW6A 1VF4A 2B5EA 3UMAA 2FWEA 3UAPA 1XVWA 4IN0A 3FKFA 2H66A 2XPDA 2L6CA 2VCXA 5CREA 3UL3A 4QL9A 2H70A 2R37A 2B5YA 1GNWA 3FR3A 3N9JA 3EMPA 3HYPA 4RUVA 2X8HA 3C7MA 1ZOFA 1EOGA 1HNBA 2WGRA 2X8CA 20GSA 2HFDA 5IO0A 4KDXA 3EE2A 4EDZA 1ZZYA 2PVQA 2LJRA 1M0UA 1G0TA 3HCZA 2DMLA 4N30A 2H1AA 1SL2B 1MDJA 1OC9B 7GSSA 2X99A 3ZITA 4AF2A 5GSSA 4D73B 2GQMA 5IMAA 1S3CA 5IOWA 5DALB 1U87A 4YAPA 3APSA 2I1UA 2A2SA 4LLRA 3UARA 4WR4A 2VIMA 5J4UA 4GWRA 16GSA 3Q6OA 3RAZA 4YQMA 1TJDA 3KM6A 1ERUA 4TKYA 5F0GA 3RPNA 2LNTA 2WRTA 2PUKC 2GZYA 2HRKB 3D4TA 3WGXA 2RM5A 1XWAA 3ZFLA 1YJ6A 2OE1A 1O8WA 4K0GA 3F3QA 3CSIA 1EGOA 5H5RA 3ZFBA 3KJYA 1JFUA 5ECLB 1GL8A 4WETA 5A4UA 2C0FA 3HY2A 1ZYEA 5F05A 1YKAA 3F4RA 1KTEA 4G10A 2C1YA 2JZRA 4TXOA 2H0IA 1ZGNA 1TI3A 1MTCA 4OFTA 3DIEA 2G0FA 3UVTA 4X43A 1X0RA 4PQ1A 4PQIA 5LD0A 5ECSA 4JRRA 4ZL9A 2HI7A 2H1GA 1O7UA 2G2QA 1GP1A 3UIWA 1X9SB 5B8BA 5GZZB 1RK4A 1TXXA 2AYTA 3VLNA 3VWUA 1GTBA 4LA1A 2V6KA 3LYPA 1SJ6A 5C04A 3TKSA 5JCGA 2I9HA 4NPBA 3DXBA 3E9JB 4Q5FA 4XCSA 4DSSA 1EV4A 4Q5QA 4QL7A 4K9ZA 1X9MB 2KP2A 4ZBAA 1ILOA 3ZREA 3DVXA 3GURA 5HR2A 3Q18A 2E2MA 2EIRA 1V40A 2JZSA 2OACA 1YF0A 3LGCA 1HNCA 3L9UA 2FGXA 4FYBA 3HJOA 3KGKA 1XOAA 2R2JA 4LL1B 2H71A 2K8VA 2PMTA 1AQVA 1O85A 1RQMA 4WXTA 3KH9A 2XHFA 2F8FA 3BCKA 3HXSA 3A2VA 1JLVA 1T00A 3EVIA 4ZXGA 4TXVA 5JWRB 5L71A 3UVHA 2DIYA 1GTIA 1SKSB 1DUGA 4OWYA 3D0ZA 3F4TA 5IMCA 5EY6A 1Z9HA 5B6NA 2M72A 3KMOA 3VI7A 4HJ2A 1OC8A 2L5OA 1LU4A 4IKHA 4MJAA 1B48A 2EIOA 4EE0A 2D2ZA 1QK8A 2LJKA 1OE8A 2LQQA 3VWXA 3D22A 4KF9A 5D8IA 2C0EA 2TIRA 3TRPA 2H6ZA 1C72A 2QGVA 3LYKA 2MBTA 3C1RA 2VL2C 3F63A 5IMFA 2RM6A 1FHEA 3QAWA 2DSAA 3IK9A 2H01A 2IN3A 1PD21 2O85A 2YCDA 3W6GA 1O6JA 3WGDA 4ZBDA 2LS5A 4TXOB 1K3OA 3M0FA 4TVEA 4KB3A 4WBJA 1XW9A 1T8EB 4CHSA 4GSNA 5D9VA 4PNFA 2H8LA 1THOA 3ED3A 4HOJA 1AC1A 1R5PA 5HR1A 2LRNA 3CRTA 1EEMA 2C8UA 1OKDA 4K7OA 2TRCP 3IA1A 3RHBA 4ID0A 2O7KA 4WEYA 3WT1A 5FHIA 4IP1A 4AJ6A 1TRUA 1LJRA 1NM3A 3F3RA 4KA0A 4JBBA 1A2JA 3PR8A 2OKAA 2WFCA 2WS2A 2IL3A 4EF0A 2B5XA 4BL7A 1EP7A 3U6VA 1MD3A 5CNWA 1PL2A 2VCVA 3IC8A 4V2NA 2MBSA 4MJCA 4HJMA 3LXZA 1V9WA 2I81A 2FNOA 1HQOA 1VF3A 2YZUA 3M8NA 3ERFA 3S9FA 4BPYA 2V41A 2YV9A 3KXOA 2J23A 3P7XA 5KEJA 2DMMA 2PN8A 5EVOA 1FO5A 4ACSA 3OR5A 1XFLA 10GSA 4WF5A 1PL1A 3LG6A 1GUHA 1AQWA 4X1UA 3C71A 1UN2A 4DSRA 3EINA 2ZUPA 3WYWA 1OC9A 1TK8B 2CVBA 3D6IA 1QFNA 4O7HA 2E2GA 1GSUA 4D73A 3TKSC 5IIZA 2HZFA 6GSUA 3APOA 1AQXA 5CO3A 5DALA 1MDIA 4HU9A 3LEFA 3TKPA 3ZVJD 1XXUA 3DD3A 3D5JA 2DLXA 5E4WA 5ELAA 1ERTA 2ALBA 3C8EA 3HDCA 5HFIA 4MP4A 1F6MC 3TKQA 2OADA 3KMNA 2H76A 1E2YA 1SKWB 1NSWA 4DEJA 1XW5A 2IMIA 3EU3A 2GTUA 4IBPA 2LSTA 2YJ7A 3QDNA 4L0WA 4HZ2A 3Q74A 2HRKA 1SYRA 2ZNMA 4G2EA 5HR0A 2YWNA 2I3YA 1TK0B 2NVLA 4O32A 3DMLA 4IS0A 5KN0A 5D9XA 5JWOB 1OAZA 1AIUA 4IP6A 2QKEA 2AHEA 3VK9A 3EMXA 4NXIA 1Z6NA 1KBNA 3E3EA 2IWTA 2KP1A 3A2WA 4IELA 1GLPA 3UEMA 2GQLA 1XCCA 2B7JA 4ZL8A 5IMDA 5IQYA 3VPTA 3DYRA 1SENA 4GF0A 1AW9A 5ID2B 2DJ1A 2K6VA 4KDUA 4EUYA 2K18A 3RBTA 1YQ1A 3I6AA 2YANA 5IO2A 3GFKA 3CTFA 4ILFA 3I43A 1QGVA 5EL8A 3A5WA 1ZL9A 4BL7B 5A5KA 1TP9A 2LV3A 4Q5NA 2YWMA 4JR4A 1Z7RA 4G19A 1J08A 3EWLA 2LRCA 4MK3A 3QAGA 3LWAA 1T4YA 4ZILA 1F9MA 4KE3A 4RI6A 1O81A 3KCMA 2CZ3A 1A8YA 1I5GA 4BA7A 4HQZA 4MLYA 1FOVA 3J7Yb 2VL2A 3C73A 2A2RA 5IMZA 1HYUA 3CXGA 2GSRA 3TJFA 2HT9A 4PGTA 1K0OA 4OO4A 3KTBA 4TW5A 3FHKA 4JR6A 5B7CA 2F8AA 3G7IA 3VI5A 3I9V2 1TK5B 19GSA 3D4MA 1K0CA 4KSMA 1F37A 2CV4A 1ZCPA 4ECIA 1K3LA 1N8JA 2VLVA 2C3NA 3GTUB 2M46A 3US3A 1AXDA 2VUPA 3HJMA 2VD0A 4L0UA 5G31A 1PMTA 3V1WA 5KN3A 1T4ZA 5G5FA 3DRNA 2HSNB 3FZ4A 3ZVJA 4KDYA 4OFMA 1ZMAA 3TCOA 6GSXA 3K8NA 1SK0A 4ZBBA 2L5LA 1VF1A 1F2EA 1MDKA 3QFAC 4X0XA 2E7PA 1ERWA 1X5DA 2KOKA 3VWWA 1XWKA 4IQAA 1S3DA 1M99A 3IHQA 2O8VB 1LBKA 2VCQA 1PRXA 2ZCTA 5J3RA 4N0ZA 5CRHA 4RQXA 1O8XA 5ABRA 2BTOT 5GAPD 2P5QA 1GSEA 1K0NA 1GUMA 2CVDA 4QQ7A 3ZLPA 2CZ2A 5ECRB 4XIHA 1SD8A 1XOBA 4F82A 4K8MA 5IPHA 1ON4A 1A8LA 4I8BA 4IJ3A 3ME7A 2VM2A 3QAVA 5IMVA 4WKWA 2AJQB 1SK2A 3KZQA 5D9WA 5ECIB 1Y6EA 3FW2A 1XZOA 1F3BA 2K9FA 3L9VA 3CSJA 4FYUA 3CBUA 3HA9A 4K7IA 4GQFA 3GKNA 4MCUA 2ON5A 5CP1A 2GZPA 1WJKA 1OC3A 4RI7A 2FUG2 4XRAA 1S3AA 4FH8A 2V32A 1PX7A 4NHWA 4DVCA 3CTGA 3FEUA 2V2GA 5AIVA 1YEPA 4WF4A 2B7KA 2OBIA 1JHBA 1ST9A 1J0FA 1QUWA 3L9SA 3MSZA 4EKZA 1ZYQB 2LJAA 6GSTA 2HSMB 2HRAA 4EC0A 5KN1A 1G7EA 5KN2A 3M9JA 4N10A 2H30A 3FZ5A 1TW9A 4MPFA 2Z9SA 4KW6A 1M9BA 1YZXA 4I5QA 1DSBA 2QC7A 4JU5A 3IRAA 4ECCA 3QPMA 1SL1B 3SWLA 2GSTA 4NV5A 3H1NA 2F51A 2IMEA 4EDYA 1QXHA 5DCHA 4PTSA 3I69A 1A24A 3KEBA 2VOCA 4FQUA 4YQUA 2L57A 3GKKA 4OCFA 4NAXA 4ML6A 4TR1B 4G0IA 2DIZA 1X5EA 2KLXA 3IOSA 2FD3A 4KAEA 2IPAA 1B8XA 3VWVA 2RUEA 4OFNA
chains in the Genus database with same CATH superfamily
4PUAA 3FZ9A 4AGSA 2PGTA 1FVKA 2OA7A 4PNGA 2C0DA 4HDEA 1UC7A 4XRDA 1GWCA 5IM9A 3H4KA 2NDOA 2O87A 4X4JA 4TRXA 2HRFA 4GLTA 5AIXA 2CVKA 3KTLA 2YPMA 4KCEA 1GTUA 4PURA 4ICYA 4CDOA 3GH9A 4MZCA 2CT6A 2VL9A 4OO5A 3ZYWA 4N0VA 5BMUA 4F0CA 3TRQA 1GH2A 2FWGA 3GKXA 1GSYA 4HS1A 3QCPA 3GYKA 2CQ9A 2YOIA 5ECNB 2PBJA 4EXJA 2LTKA 1BJXA 6GSSA 4MPGA 1KEBA 2V1MA 3IV4A 1Q4JA 1BX9A 2OJLA 2GDRA 6GSVA 4I6XA 4GDFA 3G9BA 4XHMA 2DJ2A 4GCIA 3ZTLA 2L4CA 3HZ4A 3DGQA 4BWQA 5ID2A 3TJGA 4HZ4A 3MDKA 3O76A 3F9UA 2JL4A 2PERA 3UJ1A 4CW9A 3J7Yk 1MEKA 2DJJA 4K6XA 2DKIA 5AGYA 4WBRD 1FOHA 2H75A 2MYGA 2VCWA 5JCWA 4KUNA 4V1Ag 2O89A 2O5VA 5A4WA 5G2ZA 5ECOB 12GSA 3IDVA 4MH3A 3LSZA 1RW1A 2IFQB 1EV9A 1TRWA 5D96A 4HU7A 3TRXA 1HNAA 2HSHA 1GLQA 1EOHA 3HVXA 5LNKe 3RFRC 2CA8A 5A5HA 2E0QA 1Z3EA 11GSA 4KX4A 1V58A 5ELGA 1VRSD 1OKTA 1ERVA 4HUAA 1H75A 1TI1A 3M9KA 2PPTA 5H5SA 2IMKA 4I2UA 4HQSA 4RQRA 1A2MA 3DVWA 4YQVA 2VL3A 3ME8A 2EFHA 3F6FA 3BD2A 1Z7PA 4TR0A 5J4VA 2B3SA 2VLUA 2JSZA 3MYDA 4POBA 4EL1A 3TOTA 2HSYA 2HLSA 1VGLA 2JZTA 2LQOA 3GTUA 4F2IA 3MNGA 4LL4B 3TJJA 1EEJA 5FT3A 5BRTA 2FWHA 5J5NA 3GNJA 4POLA 3ZMLA 5G1KA 1GSDA 1YF1A 1IYHA 2HSNA 3EYTA 3L0HA 1Z6MA 2MZCA 3EC3A 2WCIA 4OD7A 2H73A 4BVYB 4JE1A 17GSA 5DAKB 3P90A 1M3IA 3SBCA 2N5FA 5E59A 3TUEA 4XS4A 1TDIA 5ECQB 2R0CA 3IBHA 4NV2A 2R3XA 2JU5A 3QD9A 9GSSA 4GXZA 1G7OA 2WVXA 2XBIA 3BBYA 2WB9A 4F03A 2M80A 2LUSA 3HVSA 4MZWA 2GSSA 2HRNA 1PKWA 4G0LA 5A1NA 1PQNA 2EFEA 4ML1A 5AISA 3KD0A 1TRVA 3UBLA 4OCEA 4EVMA 5ENUA 1SJIA 1USBA 3TGZA 4K0NA 3A2XA 4KSOA 3TJKA 3GSSA 1W4VA 1TKDB 4MDCA 1PGTA 3GA4A 4J2FA 2X49A 1HD2A 5DVBA 5J9BA 2K8SA 2DBCA 1N25A 1V98A 3MIXA 1Z5YE 4AJ7A 3EPTA 4XS6A 4DSQA 3HJPA 1PSQA 2OBKA 4GTUA 2B1LA 1DE2A 1GSFA 1KNGA 1G6YA 1JZOA 2P5RA 3RPPA 3PGTA 4IQ1A 2N5BA 2LEGA 4JEDA 5HFKA 2BMXA 1H4OA 1AUCA 4MJBA 3F4SA 2HE3A 5IOXA 4PI2C 4O5RA 3HMJG 2H72A 8GSSA 1WOUA 2PU9C 5GAND 2HSMA 1QMVA 3EURA 3ZRDA 3LJRA 1CQGA 3O6TA 3CRUA 3VURA 1UVZA 3MAKA 2LKUA 4IJIA 2F3MA 4WR5A 1DE1A 6GSYA 1X5CA 2KHPA 4YH2A 2J9HA 1OYJA 1BEDA 2XBQA 3EU4A 2I4AA 5CYYA 1NHYA 3P8WA 3CSHA 1M2DA 5ECKB 2YZHA 1PX6A 1GNEA 4POKA 4Z7XA 4YAVA 5D73A 4MABA 2TRXA 2EIQA 4ZB6A 4L8EA 3A3TA 3WD6A 4TN8A 1EZKA 1I9DA 4KGIA 3KP9A 3HKRA 3G7YA 2WW0A 4TR1A 4Z2UA 3VFIA 1K0BA 4MNNA 4MH2A 2R0PA 1TU7A 3HHVA 4ISDA 4PXOA 1SK1A 2QSIA 1SL0B 2LRTA 4XTSA 2VM1A 3IAS2 3ZZXA 1JZRA 2HZEB 4J57E 18GSA 1M7TA 3IPZA 4I2TA 1EWXA 3IR4A 2B1KA 4GQCA 4XS4B 3IAM2 3FYGA 4HI7A 1FAAA 3CYNA 4AJ8A 4K2DA 4LMVA 3FR6A 4FIWA 4GSSA 2NTOA 2WVXB 1T1VA 3ERWA 5DDLA 3H79A 1XVQA 3GL5A 5GSTA 2ES7A 2AV4A 4CY6A 4L5OA 1FG4A 3PINA 3BOAA 2WDUA 4HEA2 1TU8A 3TOUA 5IPGA 2NPBA 1PFOA 1WMJA 1R26A 4LMWA 3HD5A 3IK7A 1M2AA 3NOFA 3F6DA 2H1LA 1WP0A 4JZQA 1V57A 2CAIA 2GT5A 4EO3A 1Y25A 1GSQA 14GSA 4O92A 2WULA 3UOMA 5DBQA 4GRFA 2GZZA 1M9AA 1WRYA 5CRGA 2GSQA 1FB0A 1YVLA 2YJHA 5HQPA 3M1GA 3LQ7A 2R4VA 1XPVA 5CRDA 1JZDA 2H0GA 3L4NA 2FCHA 1GTAA 4N11A 3L78A 5HR3A 1A0RP 1EP8A 4ZIJA 3GV1A 3GMFA 3GH6A 1ML6A 2YNXA 2H1DA 1W89A 2REMA 1J9BA 4NHZA 1SVMA 3APQA 1THXA 2H6YA 2H74A 2WVYA 1TTZA 2IFQA 4POMA 2HNLA 3GX8A 3GL3A 3E0UA 5G5EA 2L59A 2IJYA 4F9ZA 1SKRB 1Q98A 4TOPA 2HYXA 1G6WA 3ISOA 2JACA 3Q19A 4BIKA 4ULXA 4MF7A 2PVOC 1M3JA 3ZIVA 3TKSE 3GX0A 2C3TA 4PI0C 2LNSA 3QFBC 3P2AA 4P3YB 4F0BA 4V1Ap 1UA5A 4IVFA 2EC4A 2N5AA 2DJKA 4L5LA 4OMVA 1XWCA 4USSA 4IGJA 3LFLA 2RIIA 5F07A 1K0AA 2H0HA 1FB6A 3MWHA 4MJEA 1F3AA 6GSWA 3M3MA 5G30A 3ZL5A 1WIKA 1B9YC 2WZ9A 1PKZA 2GS3A 4NMUA 3O3TA 3GHAA 2X64A 2IIYA 5EPFA 1NW2A 5JCUA 4BVYA 5DAKA 2AB6A 1S3RA 2L4QA 1IYIA 5J41A 1A23A 2FA8A 3GUSA 1T3BA 1WPIA 1BAYA 1YY7A 3DKSA 2C4JA 3FR9A 4XS1A 1U3AA 1ACVA 2HQTA 3TJBA 3R3EA 1A0FA 4FO5A 4J56E 2FA4A 2GVPA 5HFGA 1VF2A 5DCGA 1M2BA 1GRXA 2IMDA 4EIQA 2A4VA 2DJ0A 3KIJA 3F0IA 4Z2RA 5CAXA 5F8BA 4MZBA 3VPQA 1U3IA 2OE0A 1PN9A 4ECBA 2HXKA 3NIVA 2BJXA 1TOFA 2YV7A 4AKGA 1SYXA 2L6DA 1K0MA 1XWGA 3FY7A 5J40A 5H5QA 2WW3A 2C80A 22GSA 2VLTA 4ZB7A 1EGRA 2VO4A 3RHCA 5ECHB 4IW9A 1BYEA 4MMMA 3H8QA 5D9TA 2R6KA 2VCZA 5DJMA 1A2LA 1K0DA 2F9SA 5DQYA 3N5OA 2V6OA 2H6XA 4PQHA 2CX4A 2MMAA 5JWQB 4G0KA 2YWIA 2C0GA 3QMXA 4DSSB 2FY6A 1QQ2A 2JSYA 5B8AA 3RDWA 3FMWA 4MA9A 3F8UA 4Q5RA 1B9XC 2JADA 4K7NA 3PPUA 13GSA 3IXRA 5CRWA 5G1LA 3W8JA 1GUKA 5LCZA 1R4WA 4BVXA 5COHA 5DJLA 3TB2A 4I97A 1TRSA 3HVVA 1JLWA 2AAWA 1OE7A 3LW9A 3PH9A 2FWFA 1E6BA 2H19A 3U5RE 2C3QA 4MF6A 3TDGA 2YP6A 2MMOA 2IMFA 1PA3A 1XIYA 1NHOA 1T7PB 2UZ8A 2NBSA 3H93A 5AN1A 2GLRA 1GSSA 2RLIA 2P0GA 4H86A 4IHUA 4K1FA 2VCTA 4E8EA 4E8HA 2CAQA 3IC4A 1GULA 1BG5A 3LXTA 2H1BA 3KP8A 1FW1A 3BJ5A 4ECJA 4AKIA 2DC5A 1FVJA 3IE3A 1SU9A 4V2LA 4KNDA 1YDKA 2B6MA 5C00A 2HZEA 5DQSA 2PWJA 2GGTA 4PUFC 5D93A 3W8SA 1XWBA 3ERGA 1R7HA 3QOUA 5A4VA 2YWOA 2VD1A 3GN3A 1O73A 4ZB9A 1SJZA 2XPEA 2WW2A 1XG8A 1BQ7A 1MD4A 1URMA 3FRCA 4MF5A 1AAZA 4KH7A 2P31A 5F06A 4YKGA 5J9CA 1R5AA 3QR6A 3AY8A 2MMNA 2KUCA 1X9WB 1XBSA 1WWJA 5ECPB 1U6TA 4FYCA 2CX3A 2DJ3A 3GRXA 4G9HA 5FWGA 1JZWA 3GKMA 1OVNA 2FHEA 2GT6A 2YN1A 2AUVA 3D21A 1YEXA 3DEXA 3WT2A 2XC2A 2UV8G 1B4PA 3R2QA 4ZL7A 2DKHA 5B6MA 1N2AA 3C1SA 2R5GA 1ABAA 3ZIJA 4GSTA 1CQHA 2ON7A 2FLSA 5ECMB 3CWGA 4AI6A 4PX1A 3CMIA 3HZ8A 4TR4A 4TR3A 5INYA 3WGEA 2WJUA 1K3YA 3KH7A 2X8GA 2GQKA 3FZAA 4EIPA 3NZNA 3G7JA 3JCML 4BWSA 1YKCA 3GIXA 3LORA 3TKRA 4KCAA 1U88A 1WE0A 1B4QA 4NWYA 2MMZA 3GSTA 3UBKA 2RUFA 3FK8A 4V2MA 2VAFA 1V2AA 3ZMKA 4ZB8A 3DWVA 1DBYA 3BCIA 2OE3A 1SD9A 4BVXB 1XW6A 1VF4A 2B5EA 3UMAA 2FWEA 3UAPA 1XVWA 4IN0A 3FKFA 2H66A 2XPDA 2L6CA 2VCXA 5CREA 1Y1UA 3UL3A 4QL9A 2H70A 2R37A 4N3ZA 2A2PA 2B5YA 1GNWA 3FR3A 3N9JA 3EMPA 3HYPA 4RUVA 2X8HA 3C7MA 1ZOFA 1EOGA 1HNBA 2WGRA 2X8CA 20GSA 2HFDA 5IO0A 4KDXA 3EE2A 4EDZA 1ZZYA 2PVQA 2LJRA 4FXYP 1M0UA 1G0TA 3HCZA 2DMLA 4N30A 2H1AA 1SL2B 1MDJA 1OC9B 7GSSA 2X99A 3ZITA 4HSCX 5GSSA 4AF2A 4D73B 2GQMA 5IMAA 1S3CA 5IOWA 5KOXA 5DALB 4K5SA 1U87A 4YAPA 3APSA 3A5IA 2I1UA 2A2SA 4LLRA 3UARA 4WR4A 2VIMA 5J4UA 4GWRA 16GSA 3Q6OA 3RAZA 4YQMA 1TJDA 3KM6A 1ERUA 4TKYA 5F0GA 5J47A 3RPNA 2LNTA 2WRTA 2PUKC 2GZYA 5A34B 2HRKB 3D4TA 3WGXA 2RM5A 1XWAA 3ZFLA 1YJ6A 2OE1A 1O8WA 4K0GA 3F3QA 3CSIA 1EGOA 5H5RA 1TXUA 3ZFBA 3KJYA 1JFUA 5ECLB 1GL8A 4WETA 5A4UA 2C0FA 3HY2A 3F4RA 5F05A 1YKAA 1ZYEA 3TU3B 1KTEA 4G10A 2C1YA 2JZRA 4TXOA 2H0IA 1ZGNA 1TI3A 1MTCA 4OFTA 3DIEA 2A4HA 2G0FA 3UVTA 4X43A 1X0RA 4PQ1A 4PQIA 5LD0A 5ECSA 4JRRA 4ZL9A 2HI7A 2H1GA 1O7UA 2G2QA 1GP1A 3UIWA 1X9SB 5B8BA 5GZZB 1RK4A 1TXXA 2AYTA 4Z2TA 3VLNA 3VWUA 1GTBA 1I1IP 2V6KA 4LA1A 3LYPA 1SJ6A 5C04A 3TKSA 5JCGA 4YKFA 2I9HA 4NPBA 3DXBA 3E9JB 4Q5FA 4XCSA 4DSSA 1EV4A 4Q5QA 4QL7A 4K9ZA 1X9MB 2KP2A 2EFCA 4ZBAA 1ILOA 3ZREA 1YEWC 3DVXA 3GURA 2O3EA 5HR2A 3Q18A 2E2MA 2EIRA 1V40A 2JZSA 2OACA 1YF0A 3LGCA 1HNCA 3L9UA 2FGXA 4FYBA 3HJOA 3KGKA 1XOAA 2R2JA 4LL1B 2H71A 2WZSA 2K8VA 2PMTA 1AQVA 1O85A 1RQMA 4WXTA 3KH9A 2XHFA 2F8FA 3BCKA 3HXSA 3A2VA 1JLVA 1T00A 3EVIA 4ZXGA 4TXVA 5JWRB 5L71A 3UVHA 2DIYA 1GTIA 1SKSB 1DUGA 4OWYA 3D0ZA 3F4TA 5IMCA 5EY6A 1Z9HA 5B6NA 2M72A 3KMOA 3VI7A 4HJ2A 1OC8A 2L5OA 1LU4A 4IKHA 1SVOA 4MJAA 1B48A 2EIOA 4EE0A 2D2ZA 1QK8A 2LJKA 4AKXB 1OE8A 2LQQA 3VWXA 3D22A 4KF9A 5D8IA 2C0EA 2TIRA 3TRPA 2H6ZA 1C72A 2QGVA 3LYKA 2MBTA 3C1RA 2VL2C 3F63A 5IMFA 2RM6A 1FHEA 3QAWA 2DSAA 3IK9A 2H01A 2IN3A 1PD21 2O85A 2YCDA 3W6GA 1O6JA 3WGDA 4ZBDA 2LS5A 4TXOB 1K3OA 3M0FA 4TVEA 4KB3A 4WBJA 1XW9A 1T8EB 4CHSA 4GSNA 5D9VA 4PNFA 2H8LA 2VKZG 2R0GA 1S4BP 1THOA 3ED3A 4HOJA 1AC1A 1R5PA 5HR1A 2LRNA 3CRTA 1EEMA 2C8UA 1OKDA 4K7OA 2TRCP 3IA1A 3RHBA 4ID0A 2O7KA 4WEYA 3WT1A 5FHIA 4IP1A 4AJ6A 1TRUA 2WW1A 1LJRA 1NM3A 3F3RA 4KA0A 4JBBA 1A2JA 3PR8A 2OKAA 2WFCA 2WS2A 4O5QA 2IL3A 4EF0A 2B5XA 4BL7A 1EP7A 3U6VA 1MD3A 5CNWA 1PL2A 2VCVA 3IC8A 4V2NA 2MBSA 4MJCA 4HJMA 3LXZA 1V9WA 2I81A 2FNOA 1HQOA 1VF3A 2YZUA 3M8NA 3ERFA 3S9FA 4BPYA 2QA1A 2V41A 2YV9A 3KXOA 2X4AA 2J23A 3P7XA 4A5PA 5KEJA 2DMMA 2PN8A 5EVOA 1FO5A 4ACSA 3OR5A 1XFLA 10GSA 4WF5A 1PL1A 3LG6A 1GUHA 1AQWA 4X1UA 3C71A 1UN2A 4DSRA 3EINA 2ZUPA 3WYWA 1OC9A 1TK8B 2CVBA 3D6IA 1QFNA 4O7HA 2E2GA 1GSUA 4D73A 3TKSC 5IIZA 2HZFA 6GSUA 3APOA 1AQXA 5CO3A 5DALA 1MDIA 1BF5A 4HU9A 3LEFA 3TKPA 3ZVJD 1XXUA 3DD3A 3D5JA 2DLXA 5E4WA 5ELAA 1ERTA 2ALBA 3C8EA 3HDCA 5HFIA 4MP4A 4AKHA 1F6MC 3TKQA 2OADA 3KMNA 2H76A 1E2YA 1SKWB 1NSWA 4DEJA 1XW5A 2IMIA 3EU3A 2GTUA 5A34A 4IBPA 2LSTA 2YJ7A 3QDNA 4L0WA 4HZ2A 3Q74A 2HRKA 1SYRA 2ZNMA 4G2EA 5BMUB 5HR0A 2YWNA 2I3YA 1TK0B 2NVLA 4O32A 3DMLA 4IS0A 5KN0A 4K5RA 5D9XA 5JWOB 4CY8A 1OAZA 1AIUA 2QKEA 2AHEA 3VK9A 3EMXA 4IP6A 4NXIA 1Z6NA 1KBNA 3E3EA 4G01A 2KP1A 2IWTA 3A2WA 4IELA 1GLPA 4W66A 3UEMA 2GQLA 2OT3A 1XCCA 2B7JA 4ZL8A 5IMDA 5IQYA 3VPTA 3DYRA 1SENA 4GF0A 1AW9A 5ID2B 2DJ1A 5J4YA 2K6VA 4KDUA 4EUYA 2K18A 3RBTA 1YQ1A 3I6AA 2YANA 5IO2A 3GFKA 4O5UA 3CTFA 4ILFA 3I43A 1QGVA 5EL8A 4E68A 3A5WA 1ZL9A 4BL7B 5A5KA 1TP9A 2QA2A 2LV3A 4Q5NA 2YWMA 4JR4A 1Z7RA 4G19A 1J08A 3EWLA 2LRCA 4MK3A 3QAGA 3LWAA 1T4YA 4ZILA 1F9MA 4KE3A 4RI6A 1O81A 3KCMA 2EFDA 2CZ3A 5A5HB 1A8YA 1I5GA 4BA7A 4HQZA 4MLYA 1FOVA 3J7Yb 2VL2A 3C73A 2A2RA 5IMZA 1HYUA 3CXGA 2GSRA 3TJFA 2HT9A 4PGTA 1K0OA 4OO4A 3KTBA 4TW5A 3FHKA 4JR6A 5B7CA 2F8AA 3G7IA 3VI5A 3I9V2 1TK5B 19GSA 3D4MA 1K0CA 4KSMA 1F37A 2CV4A 1ZCPA 4ECIA 1K3LA 1N8JA 2VLVA 2C3NA 3GTUB 2M46A 3US3A 1AXDA 2VUPA 3HJMA 2VD0A 4L0UA 5G31A 1PMTA 3V1WA 5KN3A 1T4ZA 5G5FA 3DRNA 2HSNB 3FZ4A 3ZVJA 4KDYA 4OFMA 1ZMAA 3TCOA 6GSXA 3K8NA 1SK0A 4ZBBA 2L5LA 1VF1A 1F2EA 1MDKA 3QFAC 4X0XA 2E7PA 1ERWA 1X5DA 2KOKA 3VWWA 1XWKA 4IQAA 1S3DA 1M99A 3IHQA 2O8VB 1LBKA 1BG1A 2VCQA 1PRXA 2ZCTA 3CQFA 5J3RA 4N0ZA 5CRHA 4RQXA 1O8XA 5ABRA 2BTOT 5GAPD 2P5QA 1GSEA 1K0NA 1GUMA 2CVDA 1SVLA 4QQ7A 3ZLPA 2CZ2A 5A1NB 5ECRB 4XIHA 1SD8A 2WVZA 1XOBA 4F82A 4K8MA 5IPHA 1ON4A 4K2XA 1A8LA 4I8BA 4IJ3A 3ME7A 2VM2A 3QAVA 5IMVA 4WKWA 4QMKA 2AJQB 1SK2A 3KZQA 5D9WA 5KOWA 5ECIB 1Y6EA 3FW2A 1XZOA 1ZYNA 1F3BA 2K9FA 3L9VA 3CSJA 4FYUA 3CBUA 3HA9A 4K7IA 4GQFA 3GKNA 4MCUA 2ON5A 5CP1A 2GZPA 1WJKA 1OC3A 4RI7A 2FUG2 4XRAA 1S3AA 4FH8A 2V32A 1PN0A 1PX7A 4NHWA 4DVCA 3CTGA 3FEUA 2V2GA 5AIVA 1YEPA 4WF4A 2B7KA 2OBIA 1JHBA 1ST9A 1J0FA 1QUWA 3L9SA 3MSZA 4EKZA 1ZYQB 2LJAA 6GSTA 2HSMB 2HRAA 4EC0A 5KN1A 1G7EA 5KN2A 3M9JA 4N10A 2H30A 3FZ5A 3IHGA 1TW9A 3HVNA 4MPFA 2Z9SA 4KW6A 1M9BA 4PHZC 1YZXA 4I5QA 1DSBA 1ZYPA 2QC7A 4JU5A 3IRAA 4ECCA 3RGBC 3QPMA 1SL1B 3SWLA 2GSTA 4NV5A 3H1NA 2F51A 2IMEA 4EDYA 1QXHA 5DCHA 4PTSA 3I69A 1A24A 3KEBA 2VOCA 4FQUA 4YQUA 2L57A 2O36A 3GKKA 4OCFA 4NAXA 4ML6A 4TR1B 4G0IA 2DIZA 1X5EA 2KLXA 3IOSA 2FD3A 4KAEA 2IPAA 1B8XA 3CHXC 3VWVA 2RUEA 4OFNA
chains in the Genus database with same CATH topology
4PUAA 3FZ9A 4AGSA 2PGTA 1FVKA 2OA7A 4PNGA 2C0DA 4HDEA 1UC7A 4XRDA 1GWCA 5IM9A 3H4KA 2NDOA 2O87A 4X4JA 4TRXA 2HRFA 4GLTA 5AIXA 2CVKA 3KTLA 2YPMA 4KCEA 1GTUA 4PURA 4ICYA 4CDOA 3GH9A 4MZCA 2CT6A 2VL9A 4OO5A 3ZYWA 4N0VA 5BMUA 4F0CA 3TRQA 1GH2A 2FWGA 3GKXA 1GSYA 4HS1A 3QCPA 3GYKA 2CQ9A 2YOIA 5ECNB 2PBJA 4EXJA 2LTKA 1BJXA 6GSSA 4MPGA 1KEBA 2V1MA 3IV4A 1Q4JA 1BX9A 2OJLA 2GDRA 6GSVA 4I6XA 4GDFA 3G9BA 4XHMA 2DJ2A 4GCIA 3ZTLA 2L4CA 3HZ4A 3DGQA 4BWQA 5ID2A 3TJGA 4HZ4A 3MDKA 3O76A 3F9UA 2JL4A 2PERA 3UJ1A 4CW9A 3J7Yk 1MEKA 2DJJA 4K6XA 2DKIA 5AGYA 4WBRD 1FOHA 2H75A 2MYGA 2VCWA 5JCWA 4KUNA 4V1Ag 2O89A 2O5VA 5A4WA 5G2ZA 5ECOB 12GSA 3IDVA 4MH3A 3LSZA 1RW1A 2IFQB 1EV9A 1TRWA 5D96A 4HU7A 3TRXA 1HNAA 2HSHA 1GLQA 1EOHA 3HVXA 5LNKe 2CA8A 5A5HA 2E0QA 1Z3EA 11GSA 4KX4A 1V58A 5ELGA 1VRSD 1OKTA 1ERVA 4HUAA 1H75A 1TI1A 3M9KA 2PPTA 5H5SA 2IMKA 4I2UA 4HQSA 4RQRA 1A2MA 3DVWA 4YQVA 2VL3A 3ME8A 2EFHA 3F6FA 3BD2A 1Z7PA 4TR0A 5J4VA 2B3SA 2VLUA 2JSZA 3MYDA 4POBA 4EL1A 3TOTA 2HSYA 2HLSA 1VGLA 2JZTA 2LQOA 3GTUA 4F2IA 3MNGA 4LL4B 3TJJA 1EEJA 5FT3A 5BRTA 2FWHA 5J5NA 3GNJA 4POLA 3ZMLA 5G1KA 1GSDA 1YF1A 1IYHA 2HSNA 3EYTA 3L0HA 1Z6MA 2MZCA 3EC3A 2WCIA 4OD7A 2H73A 4BVYB 4JE1A 17GSA 5DAKB 3P90A 3SBCA 2N5FA 5E59A 3TUEA 4XS4A 1TDIA 5ECQB 2R0CA 3IBHA 4NV2A 2R3XA 2JU5A 3QD9A 9GSSA 4GXZA 1G7OA 2XBIA 3BBYA 2WB9A 4F03A 2M80A 2LUSA 3HVSA 4MZWA 2GSSA 2HRNA 1PKWA 4G0LA 5A1NA 1PQNA 2EFEA 4ML1A 5AISA 3KD0A 1TRVA 3UBLA 4OCEA 4EVMA 5ENUA 1SJIA 1USBA 3TGZA 4K0NA 3A2XA 4KSOA 3TJKA 3GSSA 1W4VA 1TKDB 4MDCA 1PGTA 3GA4A 4J2FA 2X49A 1HD2A 5DVBA 5J9BA 2K8SA 2DBCA 1N25A 1V98A 3MIXA 1Z5YE 4AJ7A 3EPTA 4XS6A 4DSQA 3HJPA 1PSQA 2OBKA 4GTUA 2B1LA 1DE2A 1GSFA 1KNGA 1G6YA 1JZOA 2P5RA 3RPPA 3PGTA 4IQ1A 2N5BA 2LEGA 4JEDA 5HFKA 2BMXA 1H4OA 1AUCA 4MJBA 3F4SA 2HE3A 5IOXA 4O5RA 3HMJG 2H72A 8GSSA 1WOUA 2PU9C 5GAND 2HSMA 1QMVA 3EURA 3ZRDA 3LJRA 1CQGA 3O6TA 3CRUA 3VURA 1UVZA 3MAKA 2LKUA 4IJIA 2F3MA 4WR5A 1DE1A 6GSYA 1X5CA 2KHPA 4YH2A 2J9HA 1OYJA 1BEDA 2XBQA 3EU4A 2I4AA 5CYYA 1NHYA 3P8WA 3CSHA 1M2DA 5ECKB 2YZHA 1PX6A 1GNEA 4POKA 4Z7XA 4YAVA 5D73A 4MABA 2TRXA 2EIQA 4ZB6A 4L8EA 3A3TA 3WD6A 4TN8A 1EZKA 1I9DA 4KGIA 3KP9A 3HKRA 3G7YA 4TR1A 4Z2UA 3VFIA 1K0BA 4MNNA 4MH2A 2R0PA 1TU7A 3HHVA 4ISDA 4PXOA 1SK1A 2QSIA 1SL0B 2LRTA 4XTSA 2VM1A 3IAS2 3ZZXA 1JZRA 2HZEB 4J57E 18GSA 1M7TA 3IPZA 4I2TA 1EWXA 3IR4A 2B1KA 4GQCA 4XS4B 3IAM2 3FYGA 4HI7A 1FAAA 3CYNA 4AJ8A 4K2DA 4LMVA 3FR6A 4FIWA 4GSSA 2NTOA 1T1VA 3ERWA 5DDLA 3H79A 1XVQA 3GL5A 5GSTA 2ES7A 2AV4A 4CY6A 4L5OA 1FG4A 3PINA 3BOAA 2WDUA 4HEA2 1TU8A 3TOUA 5IPGA 2NPBA 1WMJA 1R26A 4LMWA 3HD5A 3IK7A 1M2AA 3NOFA 3F6DA 2H1LA 1WP0A 4JZQA 1V57A 2CAIA 2GT5A 4EO3A 1Y25A 1GSQA 14GSA 4O92A 2WULA 3UOMA 5DBQA 4GRFA 2GZZA 1M9AA 1WRYA 5CRGA 2GSQA 1FB0A 1YVLA 2YJHA 5HQPA 3M1GA 3LQ7A 2R4VA 1XPVA 5CRDA 1JZDA 2H0GA 3L4NA 2FCHA 1GTAA 4N11A 3L78A 5HR3A 1A0RP 1EP8A 4ZIJA 3GV1A 3GMFA 3GH6A 1ML6A 2YNXA 2H1DA 1W89A 2REMA 1J9BA 4NHZA 1SVMA 3APQA 1THXA 2H6YA 2H74A 1TTZA 2IFQA 4POMA 2HNLA 3GX8A 3GL3A 3E0UA 5G5EA 2L59A 2IJYA 4F9ZA 1SKRB 1Q98A 4TOPA 2HYXA 1G6WA 3ISOA 2JACA 3Q19A 4ULXA 4MF7A 2PVOC 3ZIVA 3TKSE 3GX0A 2C3TA 2LNSA 3QFBC 3P2AA 4P3YB 4F0BA 4V1Ap 1UA5A 4IVFA 2EC4A 2N5AA 2DJKA 4L5LA 4OMVA 1XWCA 4USSA 4IGJA 3LFLA 2RIIA 5F07A 1K0AA 2H0HA 1FB6A 3MWHA 4MJEA 1F3AA 6GSWA 3M3MA 5G30A 3ZL5A 1WIKA 1B9YC 2WZ9A 1PKZA 2GS3A 4NMUA 3O3TA 3GHAA 2X64A 2IIYA 5EPFA 1NW2A 5JCUA 4BVYA 5DAKA 2AB6A 2L4QA 1IYIA 5J41A 1A23A 2FA8A 3GUSA 1T3BA 1WPIA 1BAYA 1YY7A 3DKSA 2C4JA 3FR9A 4XS1A 1U3AA 1ACVA 2HQTA 3TJBA 3R3EA 1A0FA 4FO5A 4J56E 2FA4A 2GVPA 5HFGA 1VF2A 5DCGA 1M2BA 1GRXA 2IMDA 4EIQA 2A4VA 2DJ0A 3KIJA 3F0IA 4Z2RA 5CAXA 5F8BA 4MZBA 3VPQA 1U3IA 2OE0A 1PN9A 4ECBA 2HXKA 3NIVA 2BJXA 1TOFA 2YV7A 4AKGA 1SYXA 2L6DA 1K0MA 1XWGA 3FY7A 5J40A 5H5QA 2C80A 22GSA 2VLTA 4ZB7A 1EGRA 2VO4A 3RHCA 5ECHB 4IW9A 1BYEA 4MMMA 3H8QA 5D9TA 2R6KA 2VCZA 5DJMA 1A2LA 1K0DA 2F9SA 5DQYA 3N5OA 2V6OA 2H6XA 4PQHA 2CX4A 2MMAA 5JWQB 4G0KA 2YWIA 2C0GA 3QMXA 4DSSB 2FY6A 1QQ2A 2JSYA 5B8AA 3RDWA 3FMWA 4MA9A 3F8UA 4Q5RA 1B9XC 2JADA 4K7NA 3PPUA 13GSA 3IXRA 5CRWA 5G1LA 3W8JA 1GUKA 5LCZA 1R4WA 4BVXA 5COHA 5DJLA 3TB2A 4I97A 1TRSA 3HVVA 1JLWA 2AAWA 1OE7A 3LW9A 3PH9A 2FWFA 1E6BA 2H19A 3U5RE 2C3QA 4MF6A 3TDGA 2YP6A 2MMOA 2IMFA 1PA3A 1XIYA 1NHOA 1T7PB 2UZ8A 2NBSA 3H93A 5AN1A 2GLRA 1GSSA 2RLIA 2P0GA 4H86A 4IHUA 4K1FA 2VCTA 4E8EA 4E8HA 2CAQA 3IC4A 1GULA 1BG5A 3LXTA 2H1BA 3KP8A 1FW1A 3BJ5A 4ECJA 4AKIA 2DC5A 1FVJA 3IE3A 1SU9A 4V2LA 4KNDA 1YDKA 2B6MA 5C00A 2HZEA 5DQSA 2PWJA 2GGTA 4PUFC 5D93A 3W8SA 1XWBA 3ERGA 1R7HA 3QOUA 5A4VA 2YWOA 2VD1A 3GN3A 1O73A 4ZB9A 1SJZA 2XPEA 1BQ7A 1MD4A 1URMA 3FRCA 4MF5A 1AAZA 4KH7A 2P31A 5F06A 4YKGA 5J9CA 1R5AA 3QR6A 3AY8A 2MMNA 2KUCA 1X9WB 1XBSA 1WWJA 5ECPB 1U6TA 4FYCA 2CX3A 2DJ3A 3GRXA 4G9HA 5FWGA 1JZWA 3GKMA 1OVNA 2FHEA 2GT6A 2YN1A 2AUVA 3D21A 1YEXA 3DEXA 3WT2A 2XC2A 2UV8G 1B4PA 3R2QA 4ZL7A 2DKHA 5B6MA 1N2AA 3C1SA 2R5GA 1ABAA 3ZIJA 4GSTA 1CQHA 2ON7A 2FLSA 5ECMB 3CWGA 4AI6A 4PX1A 3CMIA 3HZ8A 4TR4A 4TR3A 5INYA 3WGEA 2WJUA 1K3YA 3KH7A 2X8GA 2GQKA 3FZAA 4EIPA 3NZNA 3G7JA 3JCML 4BWSA 1YKCA 3GIXA 3LORA 3TKRA 4KCAA 1U88A 1WE0A 1B4QA 4NWYA 2MMZA 3GSTA 3UBKA 2RUFA 3FK8A 4V2MA 2VAFA 1V2AA 3ZMKA 4ZB8A 3DWVA 1DBYA 3BCIA 2OE3A 1SD9A 4BVXB 1XW6A 1VF4A 2B5EA 3UMAA 2FWEA 3UAPA 1XVWA 4IN0A 3FKFA 2H66A 2XPDA 2L6CA 2VCXA 5CREA 1Y1UA 3UL3A 4QL9A 2H70A 2R37A 4N3ZA 2A2PA 2B5YA 1GNWA 3FR3A 3N9JA 3EMPA 3HYPA 4RUVA 2X8HA 3C7MA 1ZOFA 1EOGA 1HNBA 2WGRA 2X8CA 20GSA 2HFDA 5IO0A 4KDXA 3EE2A 4EDZA 1ZZYA 2PVQA 2LJRA 1M0UA 1G0TA 3HCZA 2DMLA 4N30A 2H1AA 1SL2B 1MDJA 1OC9B 7GSSA 2X99A 3ZITA 4AF2A 5GSSA 4D73B 2GQMA 5IMAA 1S3CA 5IOWA 5KOXA 5DALB 4K5SA 1U87A 4YAPA 3APSA 3A5IA 2I1UA 2A2SA 4LLRA 3UARA 4WR4A 2VIMA 5J4UA 4GWRA 16GSA 3Q6OA 3RAZA 4YQMA 1TJDA 3KM6A 1ERUA 4TKYA 5F0GA 5J47A 3RPNA 2LNTA 2WRTA 2PUKC 2GZYA 5A34B 2HRKB 3D4TA 3WGXA 2RM5A 1XWAA 3ZFLA 1YJ6A 2OE1A 1O8WA 4K0GA 3F3QA 3CSIA 1EGOA 5H5RA 1TXUA 3ZFBA 3KJYA 1JFUA 5ECLB 1GL8A 4WETA 5A4UA 2C0FA 3HY2A 3F4RA 5F05A 1YKAA 1ZYEA 3TU3B 1KTEA 4G10A 2C1YA 2JZRA 4TXOA 2H0IA 1ZGNA 1TI3A 1MTCA 4OFTA 3DIEA 2A4HA 2G0FA 3UVTA 4X43A 1X0RA 4PQ1A 4PQIA 5LD0A 5ECSA 4JRRA 4ZL9A 2HI7A 2H1GA 1O7UA 2G2QA 1GP1A 3UIWA 1X9SB 5B8BA 5GZZB 1RK4A 1TXXA 2AYTA 4Z2TA 3VLNA 3VWUA 1GTBA 4LA1A 2V6KA 3LYPA 1SJ6A 5C04A 3TKSA 5JCGA 4YKFA 2I9HA 4NPBA 3DXBA 3E9JB 4Q5FA 4XCSA 4DSSA 1EV4A 4Q5QA 4QL7A 4K9ZA 1X9MB 2KP2A 2EFCA 4ZBAA 1ILOA 3ZREA 3DVXA 3GURA 5HR2A 3Q18A 2E2MA 2EIRA 1V40A 2JZSA 2OACA 1YF0A 3LGCA 1HNCA 3L9UA 2FGXA 4FYBA 3HJOA 3KGKA 1XOAA 2R2JA 4LL1B 2H71A 2K8VA 2PMTA 1AQVA 1O85A 1RQMA 4WXTA 3KH9A 2XHFA 2F8FA 3BCKA 3HXSA 3A2VA 1JLVA 1T00A 3EVIA 4ZXGA 4TXVA 5JWRB 5L71A 3UVHA 2DIYA 1GTIA 1SKSB 1DUGA 4OWYA 3D0ZA 3F4TA 5IMCA 5EY6A 1Z9HA 5B6NA 2M72A 3KMOA 3VI7A 4HJ2A 1OC8A 2L5OA 1LU4A 4IKHA 1SVOA 4MJAA 1B48A 2EIOA 4EE0A 2D2ZA 1QK8A 2LJKA 4AKXB 1OE8A 2LQQA 3VWXA 3D22A 4KF9A 5D8IA 2C0EA 2TIRA 3TRPA 2H6ZA 1C72A 2QGVA 3LYKA 2MBTA 3C1RA 2VL2C 3F63A 5IMFA 2RM6A 1FHEA 3QAWA 2DSAA 3IK9A 2H01A 2IN3A 1PD21 2O85A 2YCDA 3W6GA 1O6JA 3WGDA 4ZBDA 2LS5A 4TXOB 1K3OA 3M0FA 4TVEA 4KB3A 4WBJA 1XW9A 1T8EB 4CHSA 4GSNA 5D9VA 4PNFA 2H8LA 2VKZG 2R0GA 1THOA 3ED3A 4HOJA 1AC1A 1R5PA 5HR1A 2LRNA 3CRTA 1EEMA 2C8UA 1OKDA 4K7OA 2TRCP 3IA1A 3RHBA 4ID0A 2O7KA 4WEYA 3WT1A 5FHIA 4IP1A 4AJ6A 1TRUA 1LJRA 1NM3A 3F3RA 4KA0A 4JBBA 1A2JA 3PR8A 2OKAA 2WFCA 2WS2A 4O5QA 2IL3A 4EF0A 2B5XA 4BL7A 1EP7A 3U6VA 1MD3A 5CNWA 1PL2A 2VCVA 3IC8A 4V2NA 2MBSA 4MJCA 4HJMA 3LXZA 1V9WA 2I81A 2FNOA 1HQOA 1VF3A 2YZUA 3M8NA 3ERFA 3S9FA 4BPYA 2QA1A 2V41A 2YV9A 3KXOA 2X4AA 2J23A 3P7XA 4A5PA 5KEJA 2DMMA 2PN8A 5EVOA 1FO5A 4ACSA 3OR5A 1XFLA 10GSA 4WF5A 1PL1A 3LG6A 1GUHA 1AQWA 4X1UA 3C71A 1UN2A 4DSRA 3EINA 2ZUPA 3WYWA 1OC9A 1TK8B 2CVBA 3D6IA 1QFNA 4O7HA 2E2GA 1GSUA 4D73A 3TKSC 5IIZA 2HZFA 6GSUA 3APOA 1AQXA 5CO3A 5DALA 1MDIA 1BF5A 4HU9A 3LEFA 3TKPA 3ZVJD 1XXUA 3DD3A 3D5JA 2DLXA 5E4WA 5ELAA 1ERTA 2ALBA 3C8EA 3HDCA 5HFIA 4MP4A 4AKHA 1F6MC 3TKQA 2OADA 3KMNA 2H76A 1E2YA 1SKWB 1NSWA 4DEJA 1XW5A 2IMIA 3EU3A 2GTUA 5A34A 4IBPA 2LSTA 2YJ7A 3QDNA 4L0WA 4HZ2A 3Q74A 2HRKA 1SYRA 2ZNMA 4G2EA 5BMUB 5HR0A 2YWNA 2I3YA 1TK0B 2NVLA 4O32A 3DMLA 4IS0A 5KN0A 4K5RA 5D9XA 5JWOB 4CY8A 1OAZA 1AIUA 2QKEA 2AHEA 3VK9A 3EMXA 4IP6A 4NXIA 1Z6NA 1KBNA 3E3EA 4G01A 2KP1A 2IWTA 3A2WA 4IELA 1GLPA 4W66A 3UEMA 2GQLA 2OT3A 1XCCA 2B7JA 4ZL8A 5IMDA 5IQYA 3VPTA 3DYRA 1SENA 4GF0A 1AW9A 5ID2B 2DJ1A 5J4YA 2K6VA 4KDUA 4EUYA 2K18A 3RBTA 1YQ1A 3I6AA 2YANA 5IO2A 3GFKA 4O5UA 3CTFA 4ILFA 3I43A 1QGVA 5EL8A 4E68A 3A5WA 1ZL9A 4BL7B 5A5KA 1TP9A 2QA2A 2LV3A 4Q5NA 2YWMA 4JR4A 1Z7RA 4G19A 1J08A 3EWLA 2LRCA 4MK3A 3QAGA 3LWAA 1T4YA 4ZILA 1F9MA 4KE3A 4RI6A 1O81A 3KCMA 2EFDA 2CZ3A 5A5HB 1A8YA 1I5GA 4BA7A 4HQZA 4MLYA 1FOVA 3J7Yb 2VL2A 3C73A 2A2RA 5IMZA 1HYUA 3CXGA 2GSRA 3TJFA 2HT9A 4PGTA 1K0OA 4OO4A 3KTBA 4TW5A 3FHKA 4JR6A 5B7CA 2F8AA 3G7IA 3VI5A 3I9V2 1TK5B 19GSA 3D4MA 1K0CA 4KSMA 1F37A 2CV4A 1ZCPA 4ECIA 1K3LA 1N8JA 2VLVA 2C3NA 3GTUB 2M46A 3US3A 1AXDA 2VUPA 3HJMA 2VD0A 4L0UA 5G31A 1PMTA 3V1WA 5KN3A 1T4ZA 5G5FA 3DRNA 2HSNB 3FZ4A 3ZVJA 4KDYA 4OFMA 1ZMAA 3TCOA 6GSXA 3K8NA 1SK0A 4ZBBA 2L5LA 1VF1A 1F2EA 1MDKA 3QFAC 4X0XA 2E7PA 1ERWA 1X5DA 2KOKA 3VWWA 1XWKA 4IQAA 1S3DA 1M99A 3IHQA 2O8VB 1LBKA 1BG1A 2VCQA 1PRXA 2ZCTA 5J3RA 4N0ZA 5CRHA 4RQXA 1O8XA 5ABRA 2BTOT 5GAPD 2P5QA 1GSEA 1K0NA 1GUMA 2CVDA 1SVLA 4QQ7A 3ZLPA 2CZ2A 5A1NB 5ECRB 4XIHA 1SD8A 1XOBA 4F82A 4K8MA 5IPHA 1ON4A 4K2XA 1A8LA 4I8BA 4IJ3A 3ME7A 2VM2A 3QAVA 5IMVA 4WKWA 4QMKA 2AJQB 1SK2A 3KZQA 5D9WA 5KOWA 5ECIB 1Y6EA 3FW2A 1XZOA 1ZYNA 1F3BA 2K9FA 3L9VA 3CSJA 4FYUA 3CBUA 3HA9A 4K7IA 4GQFA 3GKNA 4MCUA 2ON5A 5CP1A 2GZPA 1WJKA 1OC3A 4RI7A 2FUG2 4XRAA 1S3AA 4FH8A 2V32A 1PN0A 1PX7A 4NHWA 4DVCA 3CTGA 3FEUA 2V2GA 5AIVA 1YEPA 4WF4A 2B7KA 2OBIA 1JHBA 1ST9A 1J0FA 1QUWA 3L9SA 3MSZA 4EKZA 1ZYQB 2LJAA 6GSTA 2HSMB 2HRAA 4EC0A 5KN1A 1G7EA 5KN2A 3M9JA 4N10A 2H30A 3FZ5A 3IHGA 1TW9A 4MPFA 2Z9SA 4KW6A 1M9BA 1YZXA 4I5QA 1DSBA 1ZYPA 2QC7A 4JU5A 3IRAA 4ECCA 3QPMA 1SL1B 3SWLA 2GSTA 4NV5A 3H1NA 2F51A 2IMEA 4EDYA 1QXHA 5DCHA 4PTSA 3I69A 1A24A 3KEBA 2VOCA 4FQUA 4YQUA 2L57A 3GKKA 4OCFA 4NAXA 4ML6A 4TR1B 4G0IA 2DIZA 1X5EA 2KLXA 3IOSA 2FD3A 4KAEA 2IPAA 1B8XA 3VWVA 2RUEA 4OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUA A;  3FZ9 A;  4AGS A;  2PGT A;  1FVK A;  2OA7 A;  4PNG A;  2C0D A;  4HDE A;  1UC7 A;  4XRD A;  1GWC A;  5IM9 A;  3H4K A;  2NDO A;  2O87 A;  4TRX A;  2HRF A;  4GLT A;  5AIX A;  2CVK A;  3KTL A;  2YPM A;  4KCE A;  1GTU A;  4PUR A;  4CDO A;  3GH9 A;  4MZC A;  2CT6 A;  2VL9 A;  4OO5 A;  3ZYW A;  4N0V A;  5BMU A;  4F0C A;  3TRQ A;  1GH2 A;  2FWG A;  3GKX A;  1GSY A;  4HS1 A;  3QCP A;  3GYK A;  2CQ9 A;  2YOI A;  5ECN B;  2PBJ A;  4EXJ A;  2LTK A;  1BJX A;  6GSS A;  4MPG A;  1KEB A;  2V1M A;  3IV4 A;  1Q4J A;  1BX9 A;  2OJL A;  2GDR A;  6GSV A;  4I6X A;  3G9B A;  4XHM A;  2DJ2 A;  4GCI A;  3ZTL A;  2L4C A;  3HZ4 A;  3DGQ A;  4BWQ A;  5ID2 A;  3TJG A;  4HZ4 A;  3MDK A;  3O76 A;  3F9U A;  2JL4 A;  2PER A;  3UJ1 A;  4CW9 A;  3J7Y k;  1MEK A;  2DJJ A;  4K6X A;  5AGY A;  4WBR D;  2H75 A;  2MYG A;  2VCW A;  5JCW A;  4KUN A;  4V1A g;  2O89 A;  5A4W A;  5G2Z A;  5ECO B;  12GS A;  3IDV A;  4MH3 A;  3LSZ A;  1RW1 A;  2IFQ B;  1EV9 A;  1TRW A;  5D96 A;  4HU7 A;  3TRX A;  1HNA A;  2HSH A;  1GLQ A;  1EOH A;  3HVX A;  5LNK e;  2CA8 A;  2E0Q A;  1Z3E A;  11GS A;  4KX4 A;  1V58 A;  5ELG A;  1VRS D;  1OKT A;  1ERV A;  4HUA A;  1H75 A;  1TI1 A;  3M9K A;  2PPT A;  5H5S A;  4I2U A;  2IMK A;  4HQS A;  4RQR A;  1A2M A;  3DVW A;  4YQV A;  2VL3 A;  3ME8 A;  3F6F A;  3BD2 A;  1Z7P A;  4TR0 A;  2B3S A;  2VLU A;  2JSZ A;  4POB A;  4EL1 A;  3TOT A;  2HSY A;  2HLS A;  1VGL A;  2JZT A;  2LQO A;  3GTU A;  4F2I A;  3MNG A;  4LL4 B;  3TJJ A;  1EEJ A;  5FT3 A;  2FWH A;  5J5N A;  3GNJ A;  4POL A;  3ZML A;  5G1K A;  1GSD A;  1YF1 A;  1IYH A;  3EYT A;  3L0H A;  1Z6M A;  2MZC A;  3EC3 A;  2WCI A;  4OD7 A;  2H73 A;  4BVY B;  4JE1 A;  17GS A;  5DAK B;  3P90 A;  3SBC A;  2N5F A;  5E59 A;  3TUE A;  4XS4 A;  1TDI A;  5ECQ B;  3IBH A;  4NV2 A;  2R3X A;  2JU5 A;  3QD9 A;  9GSS A;  4GXZ A;  1G7O A;  2XBI A;  3BBY A;  2WB9 A;  4F03 A;  2M80 A;  2LUS A;  3HVS A;  4MZW A;  2GSS A;  2HRN A;  1PKW A;  4G0L A;  1PQN A;  4ML1 A;  5AIS A;  3KD0 A;  1TRV A;  3UBL A;  4OCE A;  4EVM A;  5ENU A;  1SJI A;  1USB A;  3TGZ A;  4K0N A;  3A2X A;  4KSO A;  3TJK A;  3GSS A;  1W4V A;  1TKD B;  4MDC A;  1PGT A;  3GA4 A;  4J2F A;  1HD2 A;  5DVB A;  5J9B A;  2K8S A;  2DBC A;  1V98 A;  1Z5Y E;  4AJ7 A;  4XS6 A;  4DSQ A;  3HJP A;  1PSQ A;  2OBK A;  4GTU A;  2B1L A;  1DE2 A;  1GSF A;  1KNG A;  1G6Y A;  1JZO A;  2P5R A;  3RPP A;  3PGT A;  4IQ1 A;  2N5B A;  2LEG A;  4JED A;  5HFK A;  2BMX A;  1H4O A;  1AUC A;  4MJB A;  3F4S A;  2HE3 A;  5IOX A;  4O5R A;  5GAN D;  2H72 A;  8GSS A;  1WOU A;  2PU9 C;  2HSM A;  1QMV A;  3EUR A;  3ZRD A;  3LJR A;  1CQG A;  3O6T A;  3CRU A;  3VUR A;  1UVZ A;  3MAK A;  2LKU A;  4IJI A;  2F3M A;  4WR5 A;  1DE1 A;  6GSY A;  1X5C A;  2KHP A;  4YH2 A;  2J9H A;  1OYJ A;  1BED A;  2XBQ A;  3EU4 A;  2I4A A;  5CYY A;  1NHY A;  3P8W A;  3CSH A;  1M2D A;  5ECK B;  2YZH A;  1PX6 A;  1GNE A;  4POK A;  4Z7X A;  4YAV A;  5D73 A;  4MAB A;  2TRX A;  2EIQ A;  4ZB6 A;  4L8E A;  3A3T A;  3WD6 A;  4TN8 A;  1EZK A;  1I9D A;  4KGI A;  3KP9 A;  3HKR A;  3G7Y A;  4TR1 A;  3VFI A;  1K0B A;  4MH2 A;  1TU7 A;  3HHV A;  4ISD A;  4PXO A;  1SK1 A;  2QSI A;  1SL0 B;  2LRT A;  4XTS A;  2VM1 A;  3IAS 2;  3ZZX A;  1JZR A;  2HZE B;  4J57 E;  18GS A;  1M7T A;  3IPZ A;  4I2T A;  1EWX A;  3IR4 A;  2B1K A;  4GQC A;  4XS4 B;  3IAM 2;  3FYG A;  4HI7 A;  1FAA A;  3CYN A;  4AJ8 A;  4K2D A;  4LMV A;  3FR6 A;  4FIW A;  4GSS A;  2NTO A;  1T1V A;  3ERW A;  5DDL A;  3H79 A;  1XVQ A;  3GL5 A;  5GST A;  2ES7 A;  2AV4 A;  4L5O A;  1FG4 A;  3PIN A;  3BOA A;  2WDU A;  4HEA 2;  1TU8 A;  3TOU A;  5IPG A;  2NPB A;  1WMJ A;  1R26 A;  4LMW A;  3HD5 A;  3IK7 A;  1M2A A;  3NOF A;  3F6D A;  1WP0 A;  4JZQ A;  1V57 A;  2CAI A;  2GT5 A;  4EO3 A;  1Y25 A;  1GSQ A;  14GS A;  4O92 A;  2WUL A;  3UOM A;  5DBQ A;  4GRF A;  2GZZ A;  1M9A A;  1WRY A;  5CRG A;  2GSQ A;  1FB0 A;  2YJH A;  5HQP A;  3M1G A;  3LQ7 A;  2R4V A;  1XPV A;  5CRD A;  1JZD A;  2H0G A;  3L4N A;  2FCH A;  1GTA A;  4N11 A;  3L78 A;  5HR3 A;  1A0R P;  1EP8 A;  4ZIJ A;  3GV1 A;  3GMF A;  3GH6 A;  1ML6 A;  2YNX A;  2H1D A;  1W89 A;  2REM A;  1J9B A;  4NHZ A;  3APQ A;  1THX A;  2H6Y A;  2H74 A;  1TTZ A;  2IFQ A;  4POM A;  2HNL A;  3GX8 A;  3GL3 A;  3E0U A;  5G5E A;  2L59 A;  2IJY A;  4F9Z A;  1SKR B;  1Q98 A;  4TOP A;  2HYX A;  1G6W A;  3ISO A;  2JAC A;  3Q19 A;  4ULX A;  4MF7 A;  2PVO C;  3ZIV A;  3TKS E;  3GX0 A;  2C3T A;  2LNS A;  3QFB C;  3P2A A;  4P3Y B;  4F0B A;  4V1A p;  1UA5 A;  4IVF A;  2EC4 A;  2N5A A;  2DJK A;  4L5L A;  4OMV A;  1XWC A;  4USS A;  4IGJ A;  3LFL A;  2RII A;  5F07 A;  1K0A A;  2H0H A;  1FB6 A;  3MWH A;  4MJE A;  1F3A A;  6GSW A;  3M3M A;  5G30 A;  3ZL5 A;  1WIK A;  1B9Y C;  2WZ9 A;  1PKZ A;  2GS3 A;  4NMU A;  3O3T A;  3GHA A;  2X64 A;  2IIY A;  5EPF A;  1NW2 A;  5JCU A;  4BVY A;  5DAK A;  2AB6 A;  2L4Q A;  1IYI A;  5J41 A;  1A23 A;  2FA8 A;  3GUS A;  1T3B A;  1WPI A;  1BAY A;  1YY7 A;  3DKS A;  2C4J A;  3FR9 A;  4XS1 A;  1U3A A;  1ACV A;  2HQT A;  3TJB A;  3R3E A;  1A0F A;  4FO5 A;  4J56 E;  2FA4 A;  2GVP A;  5HFG A;  1VF2 A;  5DCG A;  1M2B A;  1GRX A;  2IMD A;  2A4V A;  2DJ0 A;  3KIJ A;  3F0I A;  5CAX A;  5F8B A;  4MZB A;  3VPQ A;  1U3I A;  2OE0 A;  1PN9 A;  4ECB A;  2HXK A;  3NIV A;  2BJX A;  1TOF A;  2YV7 A;  1SYX A;  2L6D A;  1K0M A;  1XWG A;  3FY7 A;  5H5Q A;  2C80 A;  22GS A;  2VLT A;  1EGR A;  2VO4 A;  3RHC A;  5ECH B;  4IW9 A;  1BYE A;  4MMM A;  3H8Q A;  5D9T A;  2R6K A;  2VCZ A;  5DJM A;  1A2L A;  1K0D A;  2F9S A;  5DQY A;  3N5O A;  2V6O A;  2H6X A;  4PQH A;  2CX4 A;  2MMA A;  5JWQ B;  4G0K A;  2YWI A;  2C0G A;  3QMX A;  4DSS B;  2FY6 A;  1QQ2 A;  2JSY A;  5B8A A;  3RDW A;  4MA9 A;  3F8U A;  4Q5R A;  1B9X C;  2JAD A;  4K7N A;  3PPU A;  13GS A;  3IXR A;  5CRW A;  5G1L A;  3W8J A;  1GUK A;  5LCZ A;  1R4W A;  4BVX A;  5COH A;  5DJL A;  3TB2 A;  4I97 A;  1TRS A;  3HVV A;  1JLW A;  2AAW A;  1OE7 A;  3PH9 A;  2FWF A;  1E6B A;  2H19 A;  3U5R E;  2C3Q A;  4MF6 A;  3TDG A;  2YP6 A;  2MMO A;  2IMF A;  1PA3 A;  1XIY A;  1NHO A;  1T7P B;  2UZ8 A;  2NBS A;  3H93 A;  5AN1 A;  2GLR A;  1GSS A;  2RLI A;  2P0G A;  4H86 A;  4IHU A;  4K1F A;  2VCT A;  4E8E A;  4E8H A;  2CAQ A;  3IC4 A;  1GUL A;  1BG5 A;  3LXT A;  2H1B A;  3KP8 A;  1FW1 A;  3BJ5 A;  4ECJ A;  2DC5 A;  1FVJ A;  3IE3 A;  1SU9 A;  4V2L A;  4KND A;  1YDK A;  2B6M A;  5C00 A;  2HZE A;  5DQS A;  2PWJ A;  2GGT A;  4PUF C;  5D93 A;  3W8S A;  1XWB A;  3ERG A;  1R7H A;  3QOU A;  5A4V A;  2YWO A;  2VD1 A;  3GN3 A;  1O73 A;  4ZB9 A;  1SJZ A;  2XPE A;  1BQ7 A;  1MD4 A;  1URM A;  3FRC A;  4MF5 A;  1AAZ A;  4KH7 A;  2P31 A;  5F06 A;  5J9C A;  1R5A A;  3QR6 A;  3AY8 A;  2MMN A;  2KUC A;  1X9W B;  1XBS A;  1WWJ A;  5ECP B;  1U6T A;  4FYC A;  2CX3 A;  2DJ3 A;  3GRX A;  4G9H A;  5FWG A;  1JZW A;  3GKM A;  1OVN A;  2FHE A;  2GT6 A;  2YN1 A;  2AUV A;  3D21 A;  1YEX A;  3DEX A;  3WT2 A;  2XC2 A;  1B4P A;  3R2Q A;  4ZL7 A;  5B6M A;  1N2A A;  3C1S A;  2R5G A;  1ABA A;  3ZIJ A;  4GST A;  1CQH A;  2ON7 A;  2FLS A;  5ECM B;  4PX1 A;  3CMI A;  3HZ8 A;  4TR4 A;  4TR3 A;  5INY A;  3WGE A;  2WJU A;  1K3Y A;  3KH7 A;  2X8G A;  2GQK A;  3FZA A;  3NZN A;  3G7J A;  3JCM L;  4BWS A;  1YKC A;  3GIX A;  3LOR A;  3TKR A;  4KCA A;  1U88 A;  1WE0 A;  1B4Q A;  4NWY A;  2MMZ A;  3GST A;  3UBK A;  2RUF A;  3FK8 A;  4V2M A;  2VAF A;  1V2A A;  3ZMK A;  4ZB8 A;  3DWV A;  1DBY A;  3BCI A;  2OE3 A;  1SD9 A;  4BVX B;  1XW6 A;  1VF4 A;  2B5E A;  3UMA A;  2FWE A;  3UAP A;  1XVW A;  4IN0 A;  3FKF A;  2H66 A;  2XPD A;  2L6C A;  2VCX A;  5CRE A;  3UL3 A;  4QL9 A;  2H70 A;  2R37 A;  2B5Y A;  1GNW A;  3FR3 A;  3N9J A;  3EMP A;  3HYP A;  4RUV A;  2X8H A;  3C7M A;  1ZOF A;  1EOG A;  1HNB A;  2WGR A;  2X8C A;  20GS A;  2HFD A;  5IO0 A;  4KDX A;  3EE2 A;  4EDZ A;  1ZZY A;  2PVQ A;  2LJR A;  1M0U A;  1G0T A;  3HCZ A;  2DML A;  4N30 A;  2H1A A;  1SL2 B;  1MDJ A;  1OC9 B;  7GSS A;  2X99 A;  3ZIT A;  4AF2 A;  5GSS A;  4D73 B;  2GQM A;  5IMA A;  1S3C A;  5IOW A;  5DAL B;  1U87 A;  4YAP A;  3APS A;  2I1U A;  2A2S A;  4LLR A;  3UAR A;  4WR4 A;  2VIM A;  5J4U A;  4GWR A;  16GS A;  3Q6O A;  3RAZ A;  4YQM A;  1TJD A;  3KM6 A;  1ERU A;  4TKY A;  5F0G A;  3RPN A;  2LNT A;  2WRT A;  2PUK C;  2GZY A;  2HRK B;  3D4T A;  3WGX A;  2RM5 A;  1XWA A;  3ZFL A;  1YJ6 A;  2OE1 A;  1O8W A;  4K0G A;  3F3Q A;  3CSI A;  1EGO A;  5H5R A;  3ZFB A;  3KJY A;  1JFU A;  5ECL B;  1GL8 A;  4WET A;  5A4U A;  2C0F A;  3HY2 A;  1ZYE A;  5F05 A;  1YKA A;  3F4R A;  1KTE A;  4G10 A;  2C1Y A;  2JZR A;  4TXO A;  2H0I A;  1ZGN A;  1TI3 A;  1MTC A;  4OFT A;  3DIE A;  2G0F A;  3UVT A;  4X43 A;  1X0R A;  4PQ1 A;  4PQI A;  5LD0 A;  5ECS A;  4JRR A;  4ZL9 A;  2HI7 A;  2H1G A;  1O7U A;  2G2Q A;  1GP1 A;  3UIW A;  1X9S B;  5B8B A;  5GZZ B;  1RK4 A;  1TXX A;  2AYT A;  3VLN A;  3VWU A;  1GTB A;  4LA1 A;  2V6K A;  3LYP A;  1SJ6 A;  5C04 A;  3TKS A;  5JCG A;  2I9H A;  4NPB A;  3DXB A;  3E9J B;  4Q5F A;  4XCS A;  4DSS A;  1EV4 A;  4Q5Q A;  4QL7 A;  4K9Z A;  1X9M B;  2KP2 A;  4ZBA A;  1ILO A;  3ZRE A;  3DVX A;  3GUR A;  5HR2 A;  3Q18 A;  2E2M A;  2EIR A;  1V40 A;  2JZS A;  2OAC A;  1YF0 A;  3LGC A;  1HNC A;  3L9U A;  2FGX A;  4FYB A;  3HJO A;  3KGK A;  1XOA A;  2R2J A;  4LL1 B;  2H71 A;  2K8V A;  2PMT A;  1AQV A;  1O85 A;  1RQM A;  4WXT A;  3KH9 A;  2XHF A;  2F8F A;  3BCK A;  3HXS A;  3A2V A;  1JLV A;  1T00 A;  3EVI A;  4ZXG A;  4TXV A;  5JWR B;  5L71 A;  3UVH A;  2DIY A;  1GTI A;  1SKS B;  1DUG A;  4OWY A;  3D0Z A;  3F4T A;  5IMC A;  5EY6 A;  1Z9H A;  5B6N A;  2M72 A;  3KMO A;  3VI7 A;  4HJ2 A;  1OC8 A;  2L5O A;  1LU4 A;  4IKH A;  4MJA A;  1B48 A;  2EIO A;  4EE0 A;  2D2Z A;  1QK8 A;  2LJK A;  1OE8 A;  2LQQ A;  3VWX A;  3D22 A;  4KF9 A;  5D8I A;  2C0E A;  2TIR A;  3TRP A;  2H6Z A;  1C72 A;  2QGV A;  3LYK A;  2MBT A;  3C1R A;  2VL2 C;  3F63 A;  5IMF A;  2RM6 A;  1FHE A;  3QAW A;  2DSA A;  3IK9 A;  2H01 A;  2IN3 A;  1PD2 1;  2O85 A;  2YCD A;  3W6G A;  1O6J A;  3WGD A;  4ZBD A;  2LS5 A;  4TXO B;  1K3O A;  3M0F A;  4TVE A;  4KB3 A;  4WBJ A;  1XW9 A;  1T8E B;  4CHS A;  4GSN A;  5D9V A;  4PNF A;  2H8L A;  1THO A;  3ED3 A;  4HOJ A;  1AC1 A;  1R5P A;  5HR1 A;  2LRN A;  3CRT A;  1EEM A;  2C8U A;  1OKD A;  4K7O A;  2TRC P;  3IA1 A;  3RHB A;  4ID0 A;  2O7K A;  4WEY A;  3WT1 A;  5FHI A;  4IP1 A;  4AJ6 A;  1TRU A;  1LJR A;  1NM3 A;  3F3R A;  4KA0 A;  4JBB A;  1A2J A;  3PR8 A;  2OKA A;  2WFC A;  2WS2 A;  2IL3 A;  4EF0 A;  2B5X A;  4BL7 A;  1EP7 A;  3U6V A;  1MD3 A;  5CNW A;  1PL2 A;  2VCV A;  3IC8 A;  4V2N A;  2MBS A;  4MJC A;  4HJM A;  3LXZ A;  1V9W A;  2I81 A;  2FNO A;  1HQO A;  1VF3 A;  2YZU A;  3M8N A;  3ERF A;  3S9F A;  4BPY A;  2V41 A;  2YV9 A;  3KXO A;  2J23 A;  3P7X A;  5KEJ A;  2DMM A;  2PN8 A;  5EVO A;  1FO5 A;  4ACS A;  3OR5 A;  1XFL A;  10GS A;  4WF5 A;  1PL1 A;  3LG6 A;  1GUH A;  1AQW A;  4X1U A;  3C71 A;  1UN2 A;  4DSR A;  3EIN A;  2ZUP A;  3WYW A;  1OC9 A;  1TK8 B;  2CVB A;  3D6I A;  1QFN A;  4O7H A;  2E2G A;  1GSU A;  4D73 A;  3TKS C;  5IIZ A;  2HZF A;  6GSU A;  3APO A;  1AQX A;  5CO3 A;  5DAL A;  1MDI A;  4HU9 A;  3LEF A;  3TKP A;  3ZVJ D;  1XXU A;  3DD3 A;  3D5J A;  2DLX A;  5E4W A;  5ELA A;  1ERT A;  2ALB A;  3C8E A;  3HDC A;  5HFI A;  4MP4 A;  1F6M C;  3TKQ A;  2OAD A;  3KMN A;  2H76 A;  1E2Y A;  1SKW B;  1NSW A;  4DEJ A;  1XW5 A;  2IMI A;  3EU3 A;  2GTU A;  4IBP A;  2LST A;  2YJ7 A;  3QDN A;  4L0W A;  4HZ2 A;  3Q74 A;  2HRK A;  1SYR A;  2ZNM A;  4G2E A;  5HR0 A;  2YWN A;  2I3Y A;  1TK0 B;  2NVL A;  4O32 A;  3DML A;  4IS0 A;  5KN0 A;  5D9X A;  5JWO B;  1OAZ A;  1AIU A;  4IP6 A;  2QKE A;  2AHE A;  3VK9 A;  3EMX A;  4NXI A;  1Z6N A;  1KBN A;  3E3E A;  2IWT A;  2KP1 A;  3A2W A;  4IEL A;  1GLP A;  3UEM A;  2GQL A;  1XCC A;  2B7J A;  4ZL8 A;  5IMD A;  5IQY A;  3VPT A;  3DYR A;  1SEN A;  4GF0 A;  1AW9 A;  5ID2 B;  2DJ1 A;  2K6V A;  4KDU A;  4EUY A;  2K18 A;  3RBT A;  1YQ1 A;  3I6A A;  2YAN A;  5IO2 A;  3GFK A;  3CTF A;  4ILF A;  3I43 A;  1QGV A;  5EL8 A;  3A5W A;  1ZL9 A;  4BL7 B;  5A5K A;  1TP9 A;  2LV3 A;  4Q5N A;  2YWM A;  4JR4 A;  1Z7R A;  4G19 A;  1J08 A;  3EWL A;  2LRC A;  4MK3 A;  3QAG A;  3LWA A;  1T4Y A;  4ZIL A;  1F9M A;  4KE3 A;  4RI6 A;  1O81 A;  3KCM A;  2CZ3 A;  1A8Y A;  1I5G A;  4BA7 A;  4HQZ A;  4MLY A;  1FOV A;  3J7Y b;  2VL2 A;  3C73 A;  2A2R A;  5IMZ A;  1HYU A;  3CXG A;  2GSR A;  3TJF A;  2HT9 A;  4PGT A;  1K0O A;  4OO4 A;  3KTB A;  4TW5 A;  3FHK A;  4JR6 A;  5B7C A;  2F8A A;  3G7I A;  3VI5 A;  3I9V 2;  1TK5 B;  19GS A;  3D4M A;  1K0C A;  4KSM A;  1F37 A;  2CV4 A;  1ZCP A;  4ECI A;  1K3L A;  1N8J A;  2VLV A;  2C3N A;  3GTU B;  2M46 A;  3US3 A;  1AXD A;  2VUP A;  3HJM A;  2VD0 A;  4L0U A;  5G31 A;  1PMT A;  3V1W A;  5KN3 A;  1T4Z A;  5G5F A;  3DRN A;  2HSN B;  3FZ4 A;  3ZVJ A;  4KDY A;  4OFM A;  1ZMA A;  3TCO A;  6GSX A;  3K8N A;  1SK0 A;  4ZBB A;  2L5L A;  1VF1 A;  1F2E A;  1MDK A;  3QFA C;  4X0X A;  2E7P A;  1ERW A;  1X5D A;  2KOK A;  3VWW A;  1XWK A;  4IQA A;  1S3D A;  1M99 A;  3IHQ A;  2O8V B;  1LBK A;  2VCQ A;  1PRX A;  2ZCT A;  5J3R A;  4N0Z A;  5CRH A;  4RQX A;  1O8X A;  5ABR A;  2BTO T;  5GAP D;  2P5Q A;  1GSE A;  1K0N A;  1GUM A;  2CVD A;  4QQ7 A;  3ZLP A;  2CZ2 A;  5ECR B;  4XIH A;  1SD8 A;  1XOB A;  4F82 A;  4K8M A;  5IPH A;  1ON4 A;  1A8L A;  4I8B A;  4IJ3 A;  3ME7 A;  2VM2 A;  3QAV A;  5IMV A;  4WKW A;  2AJQ B;  1SK2 A;  3KZQ A;  5D9W A;  5ECI B;  1Y6E A;  3FW2 A;  1XZO A;  1F3B A;  2K9F A;  3L9V A;  3CSJ A;  4FYU A;  3CBU A;  3HA9 A;  4K7I A;  4GQF A;  3GKN A;  4MCU A;  2ON5 A;  5CP1 A;  2GZP A;  1WJK A;  1OC3 A;  4RI7 A;  2FUG 2;  4XRA A;  1S3A A;  4FH8 A;  2V32 A;  1PX7 A;  4NHW A;  4DVC A;  3CTG A;  3FEU A;  2V2G A;  5AIV A;  1YEP A;  4WF4 A;  2B7K A;  2OBI A;  1JHB A;  1ST9 A;  1J0F A;  1QUW A;  3L9S A;  3MSZ A;  4EKZ A;  1ZYQ B;  2LJA A;  6GST A;  2HSM B;  2HRA A;  4EC0 A;  5KN1 A;  1G7E A;  5KN2 A;  3M9J A;  4N10 A;  2H30 A;  3FZ5 A;  1TW9 A;  4MPF A;  2Z9S A;  4KW6 A;  1M9B A;  1YZX A;  4I5Q A;  1DSB A;  2QC7 A;  4JU5 A;  3IRA A;  4ECC A;  3QPM A;  1SL1 B;  3SWL A;  2GST A;  4NV5 A;  3H1N A;  2F51 A;  2IME A;  4EDY A;  1QXH A;  5DCH A;  4PTS A;  3I69 A;  1A24 A;  3KEB A;  2VOC A;  4FQU A;  4YQU A;  2L57 A;  3GKK A;  4OCF A;  4NAX A;  4ML6 A;  4TR1 B;  4G0I A;  2DIZ A;  1X5E A;  2KLX A;  3IOS A;  2FD3 A;  4KAE A;  2IPA A;  1B8X A;  3VWV A;  2RUE A;  4OFN A; 
#chains in the Genus database with same CATH topology
 4PUA A;  3FZ9 A;  4AGS A;  2PGT A;  1FVK A;  2OA7 A;  4PNG A;  2C0D A;  4HDE A;  1UC7 A;  4XRD A;  1GWC A;  5IM9 A;  3H4K A;  2NDO A;  2O87 A;  4X4J A;  4TRX A;  2HRF A;  4GLT A;  5AIX A;  2CVK A;  3KTL A;  2YPM A;  4KCE A;  1GTU A;  4PUR A;  4ICY A;  4CDO A;  3GH9 A;  4MZC A;  2CT6 A;  2VL9 A;  4OO5 A;  3ZYW A;  4N0V A;  5BMU A;  4F0C A;  3TRQ A;  1GH2 A;  2FWG A;  3GKX A;  1GSY A;  4HS1 A;  3QCP A;  3GYK A;  2CQ9 A;  2YOI A;  5ECN B;  2PBJ A;  4EXJ A;  2LTK A;  1BJX A;  6GSS A;  4MPG A;  1KEB A;  2V1M A;  3IV4 A;  1Q4J A;  1BX9 A;  2OJL A;  2GDR A;  6GSV A;  4I6X A;  4GDF A;  3G9B A;  4XHM A;  2DJ2 A;  4GCI A;  3ZTL A;  2L4C A;  3HZ4 A;  3DGQ A;  4BWQ A;  5ID2 A;  3TJG A;  4HZ4 A;  3MDK A;  3O76 A;  3F9U A;  2JL4 A;  2PER A;  3UJ1 A;  4CW9 A;  3J7Y k;  1MEK A;  2DJJ A;  4K6X A;  2DKI A;  5AGY A;  4WBR D;  1FOH A;  2H75 A;  2MYG A;  2VCW A;  5JCW A;  4KUN A;  4V1A g;  2O89 A;  2O5V A;  5A4W A;  5G2Z A;  5ECO B;  12GS A;  3IDV A;  4MH3 A;  3LSZ A;  1RW1 A;  2IFQ B;  1EV9 A;  1TRW A;  5D96 A;  4HU7 A;  3TRX A;  1HNA A;  2HSH A;  1GLQ A;  1EOH A;  3HVX A;  5LNK e;  3RFR C;  2CA8 A;  5A5H A;  2E0Q A;  1Z3E A;  11GS A;  4KX4 A;  1V58 A;  5ELG A;  1VRS D;  1OKT A;  1ERV A;  4HUA A;  1H75 A;  1TI1 A;  3M9K A;  2PPT A;  5H5S A;  2IMK A;  4I2U A;  4HQS A;  4RQR A;  1A2M A;  3DVW A;  4YQV A;  2VL3 A;  3ME8 A;  2EFH A;  3F6F A;  3BD2 A;  1Z7P A;  4TR0 A;  5J4V A;  2B3S A;  2VLU A;  2JSZ A;  3MYD A;  4POB A;  4EL1 A;  3TOT A;  2HSY A;  2HLS A;  1VGL A;  2JZT A;  2LQO A;  3GTU A;  4F2I A;  3MNG A;  4LL4 B;  3TJJ A;  1EEJ A;  5FT3 A;  5BRT A;  2FWH A;  5J5N A;  3GNJ A;  4POL A;  3ZML A;  5G1K A;  1GSD A;  1YF1 A;  1IYH A;  2HSN A;  3EYT A;  3L0H A;  1Z6M A;  2MZC A;  3EC3 A;  2WCI A;  4OD7 A;  2H73 A;  4BVY B;  4JE1 A;  17GS A;  5DAK B;  3P90 A;  1M3I A;  3SBC A;  2N5F A;  5E59 A;  3TUE A;  4XS4 A;  1TDI A;  5ECQ B;  2R0C A;  3IBH A;  4NV2 A;  2R3X A;  2JU5 A;  3QD9 A;  9GSS A;  4GXZ A;  1G7O A;  2WVX A;  2XBI A;  3BBY A;  2WB9 A;  4F03 A;  2M80 A;  2LUS A;  3HVS A;  4MZW A;  2GSS A;  2HRN A;  1PKW A;  4G0L A;  5A1N A;  1PQN A;  2EFE A;  4ML1 A;  5AIS A;  3KD0 A;  1TRV A;  3UBL A;  4OCE A;  4EVM A;  5ENU A;  1SJI A;  1USB A;  3TGZ A;  4K0N A;  3A2X A;  4KSO A;  3TJK A;  3GSS A;  1W4V A;  1TKD B;  4MDC A;  1PGT A;  3GA4 A;  4J2F A;  2X49 A;  1HD2 A;  5DVB A;  5J9B A;  2K8S A;  2DBC A;  1N25 A;  1V98 A;  3MIX A;  1Z5Y E;  4AJ7 A;  3EPT A;  4XS6 A;  4DSQ A;  3HJP A;  1PSQ A;  2OBK A;  4GTU A;  2B1L A;  1DE2 A;  1GSF A;  1KNG A;  1G6Y A;  1JZO A;  2P5R A;  3RPP A;  3PGT A;  4IQ1 A;  2N5B A;  2LEG A;  4JED A;  5HFK A;  2BMX A;  1H4O A;  1AUC A;  4MJB A;  3F4S A;  2HE3 A;  5IOX A;  4PI2 C;  4O5R A;  3HMJ G;  2H72 A;  8GSS A;  1WOU A;  2PU9 C;  5GAN D;  2HSM A;  1QMV A;  3EUR A;  3ZRD A;  3LJR A;  1CQG A;  3O6T A;  3CRU A;  3VUR A;  1UVZ A;  3MAK A;  2LKU A;  4IJI A;  2F3M A;  4WR5 A;  1DE1 A;  6GSY A;  1X5C A;  2KHP A;  4YH2 A;  2J9H A;  1OYJ A;  1BED A;  2XBQ A;  3EU4 A;  2I4A A;  5CYY A;  1NHY A;  3P8W A;  3CSH A;  1M2D A;  5ECK B;  2YZH A;  1PX6 A;  1GNE A;  4POK A;  4Z7X A;  4YAV A;  5D73 A;  4MAB A;  2TRX A;  2EIQ A;  4ZB6 A;  4L8E A;  3A3T A;  3WD6 A;  4TN8 A;  1EZK A;  1I9D A;  4KGI A;  3KP9 A;  3HKR A;  3G7Y A;  2WW0 A;  4TR1 A;  4Z2U A;  3VFI A;  1K0B A;  4MNN A;  4MH2 A;  2R0P A;  1TU7 A;  3HHV A;  4ISD A;  4PXO A;  1SK1 A;  2QSI A;  1SL0 B;  2LRT A;  4XTS A;  2VM1 A;  3IAS 2;  3ZZX A;  1JZR A;  2HZE B;  4J57 E;  18GS A;  1M7T A;  3IPZ A;  4I2T A;  1EWX A;  3IR4 A;  2B1K A;  4GQC A;  4XS4 B;  3IAM 2;  3FYG A;  4HI7 A;  1FAA A;  3CYN A;  4AJ8 A;  4K2D A;  4LMV A;  3FR6 A;  4FIW A;  4GSS A;  2NTO A;  2WVX B;  1T1V A;  3ERW A;  5DDL A;  3H79 A;  1XVQ A;  3GL5 A;  5GST A;  2ES7 A;  2AV4 A;  4CY6 A;  4L5O A;  1FG4 A;  3PIN A;  3BOA A;  2WDU A;  4HEA 2;  1TU8 A;  3TOU A;  5IPG A;  2NPB A;  1PFO A;  1WMJ A;  1R26 A;  4LMW A;  3HD5 A;  3IK7 A;  1M2A A;  3NOF A;  3F6D A;  2H1L A;  1WP0 A;  4JZQ A;  1V57 A;  2CAI A;  2GT5 A;  4EO3 A;  1Y25 A;  1GSQ A;  14GS A;  4O92 A;  2WUL A;  3UOM A;  5DBQ A;  4GRF A;  2GZZ A;  1M9A A;  1WRY A;  5CRG A;  2GSQ A;  1FB0 A;  1YVL A;  2YJH A;  5HQP A;  3M1G A;  3LQ7 A;  2R4V A;  1XPV A;  5CRD A;  1JZD A;  2H0G A;  3L4N A;  2FCH A;  1GTA A;  4N11 A;  3L78 A;  5HR3 A;  1A0R P;  1EP8 A;  4ZIJ A;  3GV1 A;  3GMF A;  3GH6 A;  1ML6 A;  2YNX A;  2H1D A;  1W89 A;  2REM A;  1J9B A;  4NHZ A;  1SVM A;  3APQ A;  1THX A;  2H6Y A;  2H74 A;  2WVY A;  1TTZ A;  2IFQ A;  4POM A;  2HNL A;  3GX8 A;  3GL3 A;  3E0U A;  5G5E A;  2L59 A;  2IJY A;  4F9Z A;  1SKR B;  1Q98 A;  4TOP A;  2HYX A;  1G6W A;  3ISO A;  2JAC A;  3Q19 A;  4BIK A;  4ULX A;  4MF7 A;  2PVO C;  1M3J A;  3ZIV A;  3TKS E;  3GX0 A;  2C3T A;  4PI0 C;  2LNS A;  3QFB C;  3P2A A;  4P3Y B;  4F0B A;  4V1A p;  1UA5 A;  4IVF A;  2EC4 A;  2N5A A;  2DJK A;  4L5L A;  4OMV A;  1XWC A;  4USS A;  4IGJ A;  3LFL A;  2RII A;  5F07 A;  1K0A A;  2H0H A;  1FB6 A;  3MWH A;  4MJE A;  1F3A A;  6GSW A;  3M3M A;  5G30 A;  3ZL5 A;  1WIK A;  1B9Y C;  2WZ9 A;  1PKZ A;  2GS3 A;  4NMU A;  3O3T A;  3GHA A;  2X64 A;  2IIY A;  5EPF A;  1NW2 A;  5JCU A;  4BVY A;  5DAK A;  2AB6 A;  1S3R A;  2L4Q A;  1IYI A;  5J41 A;  1A23 A;  2FA8 A;  3GUS A;  1T3B A;  1WPI A;  1BAY A;  1YY7 A;  3DKS A;  2C4J A;  3FR9 A;  4XS1 A;  1U3A A;  1ACV A;  2HQT A;  3TJB A;  3R3E A;  1A0F A;  4FO5 A;  4J56 E;  2FA4 A;  2GVP A;  5HFG A;  1VF2 A;  5DCG A;  1M2B A;  1GRX A;  2IMD A;  4EIQ A;  2A4V A;  2DJ0 A;  3KIJ A;  3F0I A;  4Z2R A;  5CAX A;  5F8B A;  4MZB A;  3VPQ A;  1U3I A;  2OE0 A;  1PN9 A;  4ECB A;  2HXK A;  3NIV A;  2BJX A;  1TOF A;  2YV7 A;  4AKG A;  1SYX A;  2L6D A;  1K0M A;  1XWG A;  3FY7 A;  5J40 A;  5H5Q A;  2WW3 A;  2C80 A;  22GS A;  2VLT A;  4ZB7 A;  1EGR A;  2VO4 A;  3RHC A;  5ECH B;  4IW9 A;  1BYE A;  4MMM A;  3H8Q A;  5D9T A;  2R6K A;  2VCZ A;  5DJM A;  1A2L A;  1K0D A;  2F9S A;  5DQY A;  3N5O A;  2V6O A;  2H6X A;  4PQH A;  2CX4 A;  2MMA A;  5JWQ B;  4G0K A;  2YWI A;  2C0G A;  3QMX A;  4DSS B;  2FY6 A;  1QQ2 A;  2JSY A;  5B8A A;  3RDW A;  3FMW A;  4MA9 A;  3F8U A;  4Q5R A;  1B9X C;  2JAD A;  4K7N A;  3PPU A;  13GS A;  3IXR A;  5CRW A;  5G1L A;  3W8J A;  1GUK A;  5LCZ A;  1R4W A;  4BVX A;  5COH A;  5DJL A;  3TB2 A;  4I97 A;  1TRS A;  3HVV A;  1JLW A;  2AAW A;  1OE7 A;  3LW9 A;  3PH9 A;  2FWF A;  1E6B A;  2H19 A;  3U5R E;  2C3Q A;  4MF6 A;  3TDG A;  2YP6 A;  2MMO A;  2IMF A;  1PA3 A;  1XIY A;  1NHO A;  1T7P B;  2UZ8 A;  2NBS A;  3H93 A;  5AN1 A;  2GLR A;  1GSS A;  2RLI A;  2P0G A;  4H86 A;  4IHU A;  4K1F A;  2VCT A;  4E8E A;  4E8H A;  2CAQ A;  3IC4 A;  1GUL A;  1BG5 A;  3LXT A;  2H1B A;  3KP8 A;  1FW1 A;  3BJ5 A;  4ECJ A;  4AKI A;  2DC5 A;  1FVJ A;  3IE3 A;  1SU9 A;  4V2L A;  4KND A;  1YDK A;  2B6M A;  5C00 A;  2HZE A;  5DQS A;  2PWJ A;  2GGT A;  4PUF C;  5D93 A;  3W8S A;  1XWB A;  3ERG A;  1R7H A;  3QOU A;  5A4V A;  2YWO A;  2VD1 A;  3GN3 A;  1O73 A;  4ZB9 A;  1SJZ A;  2XPE A;  2WW2 A;  1XG8 A;  1BQ7 A;  1MD4 A;  1URM A;  3FRC A;  4MF5 A;  1AAZ A;  4KH7 A;  2P31 A;  5F06 A;  4YKG A;  5J9C A;  1R5A A;  3QR6 A;  3AY8 A;  2MMN A;  2KUC A;  1X9W B;  1XBS A;  1WWJ A;  5ECP B;  1U6T A;  4FYC A;  2CX3 A;  2DJ3 A;  3GRX A;  4G9H A;  5FWG A;  1JZW A;  3GKM A;  1OVN A;  2FHE A;  2GT6 A;  2YN1 A;  2AUV A;  3D21 A;  1YEX A;  3DEX A;  3WT2 A;  2XC2 A;  2UV8 G;  1B4P A;  3R2Q A;  4ZL7 A;  2DKH A;  5B6M A;  1N2A A;  3C1S A;  2R5G A;  1ABA A;  3ZIJ A;  4GST A;  1CQH A;  2ON7 A;  2FLS A;  5ECM B;  3CWG A;  4AI6 A;  4PX1 A;  3CMI A;  3HZ8 A;  4TR4 A;  4TR3 A;  5INY A;  3WGE A;  2WJU A;  1K3Y A;  3KH7 A;  2X8G A;  2GQK A;  3FZA A;  4EIP A;  3NZN A;  3G7J A;  3JCM L;  4BWS A;  1YKC A;  3GIX A;  3LOR A;  3TKR A;  4KCA A;  1U88 A;  1WE0 A;  1B4Q A;  4NWY A;  2MMZ A;  3GST A;  3UBK A;  2RUF A;  3FK8 A;  4V2M A;  2VAF A;  1V2A A;  3ZMK A;  4ZB8 A;  3DWV A;  1DBY A;  3BCI A;  2OE3 A;  1SD9 A;  4BVX B;  1XW6 A;  1VF4 A;  2B5E A;  3UMA A;  2FWE A;  3UAP A;  1XVW A;  4IN0 A;  3FKF A;  2H66 A;  2XPD A;  2L6C A;  2VCX A;  5CRE A;  1Y1U A;  3UL3 A;  4QL9 A;  2H70 A;  2R37 A;  4N3Z A;  2A2P A;  2B5Y A;  1GNW A;  3FR3 A;  3N9J A;  3EMP A;  3HYP A;  4RUV A;  2X8H A;  3C7M A;  1ZOF A;  1EOG A;  1HNB A;  2WGR A;  2X8C A;  20GS A;  2HFD A;  5IO0 A;  4KDX A;  3EE2 A;  4EDZ A;  1ZZY A;  2PVQ A;  2LJR A;  4FXY P;  1M0U A;  1G0T A;  3HCZ A;  2DML A;  4N30 A;  2H1A A;  1SL2 B;  1MDJ A;  1OC9 B;  7GSS A;  2X99 A;  3ZIT A;  4HSC X;  5GSS A;  4AF2 A;  4D73 B;  2GQM A;  5IMA A;  1S3C A;  5IOW A;  5KOX A;  5DAL B;  4K5S A;  1U87 A;  4YAP A;  3APS A;  3A5I A;  2I1U A;  2A2S A;  4LLR A;  3UAR A;  4WR4 A;  2VIM A;  5J4U A;  4GWR A;  16GS A;  3Q6O A;  3RAZ A;  4YQM A;  1TJD A;  3KM6 A;  1ERU A;  4TKY A;  5F0G A;  5J47 A;  3RPN A;  2LNT A;  2WRT A;  2PUK C;  2GZY A;  5A34 B;  2HRK B;  3D4T A;  3WGX A;  2RM5 A;  1XWA A;  3ZFL A;  1YJ6 A;  2OE1 A;  1O8W A;  4K0G A;  3F3Q A;  3CSI A;  1EGO A;  5H5R A;  1TXU A;  3ZFB A;  3KJY A;  1JFU A;  5ECL B;  1GL8 A;  4WET A;  5A4U A;  2C0F A;  3HY2 A;  3F4R A;  5F05 A;  1YKA A;  1ZYE A;  3TU3 B;  1KTE A;  4G10 A;  2C1Y A;  2JZR A;  4TXO A;  2H0I A;  1ZGN A;  1TI3 A;  1MTC A;  4OFT A;  3DIE A;  2A4H A;  2G0F A;  3UVT A;  4X43 A;  1X0R A;  4PQ1 A;  4PQI A;  5LD0 A;  5ECS A;  4JRR A;  4ZL9 A;  2HI7 A;  2H1G A;  1O7U A;  2G2Q A;  1GP1 A;  3UIW A;  1X9S B;  5B8B A;  5GZZ B;  1RK4 A;  1TXX A;  2AYT A;  4Z2T A;  3VLN A;  3VWU A;  1GTB A;  1I1I P;  2V6K A;  4LA1 A;  3LYP A;  1SJ6 A;  5C04 A;  3TKS A;  5JCG A;  4YKF A;  2I9H A;  4NPB A;  3DXB A;  3E9J B;  4Q5F A;  4XCS A;  4DSS A;  1EV4 A;  4Q5Q A;  4QL7 A;  4K9Z A;  1X9M B;  2KP2 A;  2EFC A;  4ZBA A;  1ILO A;  3ZRE A;  1YEW C;  3DVX A;  3GUR A;  2O3E A;  5HR2 A;  3Q18 A;  2E2M A;  2EIR A;  1V40 A;  2JZS A;  2OAC A;  1YF0 A;  3LGC A;  1HNC A;  3L9U A;  2FGX A;  4FYB A;  3HJO A;  3KGK A;  1XOA A;  2R2J A;  4LL1 B;  2H71 A;  2WZS A;  2K8V A;  2PMT A;  1AQV A;  1O85 A;  1RQM A;  4WXT A;  3KH9 A;  2XHF A;  2F8F A;  3BCK A;  3HXS A;  3A2V A;  1JLV A;  1T00 A;  3EVI A;  4ZXG A;  4TXV A;  5JWR B;  5L71 A;  3UVH A;  2DIY A;  1GTI A;  1SKS B;  1DUG A;  4OWY A;  3D0Z A;  3F4T A;  5IMC A;  5EY6 A;  1Z9H A;  5B6N A;  2M72 A;  3KMO A;  3VI7 A;  4HJ2 A;  1OC8 A;  2L5O A;  1LU4 A;  4IKH A;  1SVO A;  4MJA A;  1B48 A;  2EIO A;  4EE0 A;  2D2Z A;  1QK8 A;  2LJK A;  4AKX B;  1OE8 A;  2LQQ A;  3VWX A;  3D22 A;  4KF9 A;  5D8I A;  2C0E A;  2TIR A;  3TRP A;  2H6Z A;  1C72 A;  2QGV A;  3LYK A;  2MBT A;  3C1R A;  2VL2 C;  3F63 A;  5IMF A;  2RM6 A;  1FHE A;  3QAW A;  2DSA A;  3IK9 A;  2H01 A;  2IN3 A;  1PD2 1;  2O85 A;  2YCD A;  3W6G A;  1O6J A;  3WGD A;  4ZBD A;  2LS5 A;  4TXO B;  1K3O A;  3M0F A;  4TVE A;  4KB3 A;  4WBJ A;  1XW9 A;  1T8E B;  4CHS A;  4GSN A;  5D9V A;  4PNF A;  2H8L A;  2VKZ G;  2R0G A;  1S4B P;  1THO A;  3ED3 A;  4HOJ A;  1AC1 A;  1R5P A;  5HR1 A;  2LRN A;  3CRT A;  1EEM A;  2C8U A;  1OKD A;  4K7O A;  2TRC P;  3IA1 A;  3RHB A;  4ID0 A;  2O7K A;  4WEY A;  3WT1 A;  5FHI A;  4IP1 A;  4AJ6 A;  1TRU A;  2WW1 A;  1LJR A;  1NM3 A;  3F3R A;  4KA0 A;  4JBB A;  1A2J A;  3PR8 A;  2OKA A;  2WFC A;  2WS2 A;  4O5Q A;  2IL3 A;  4EF0 A;  2B5X A;  4BL7 A;  1EP7 A;  3U6V A;  1MD3 A;  5CNW A;  1PL2 A;  2VCV A;  3IC8 A;  4V2N A;  2MBS A;  4MJC A;  4HJM A;  3LXZ A;  1V9W A;  2I81 A;  2FNO A;  1HQO A;  1VF3 A;  2YZU A;  3M8N A;  3ERF A;  3S9F A;  4BPY A;  2QA1 A;  2V41 A;  2YV9 A;  3KXO A;  2X4A A;  2J23 A;  3P7X A;  4A5P A;  5KEJ A;  2DMM A;  2PN8 A;  5EVO A;  1FO5 A;  4ACS A;  3OR5 A;  1XFL A;  10GS A;  4WF5 A;  1PL1 A;  3LG6 A;  1GUH A;  1AQW A;  4X1U A;  3C71 A;  1UN2 A;  4DSR A;  3EIN A;  2ZUP A;  3WYW A;  1OC9 A;  1TK8 B;  2CVB A;  3D6I A;  1QFN A;  4O7H A;  2E2G A;  1GSU A;  4D73 A;  3TKS C;  5IIZ A;  2HZF A;  6GSU A;  3APO A;  1AQX A;  5CO3 A;  5DAL A;  1MDI A;  1BF5 A;  4HU9 A;  3LEF A;  3TKP A;  3ZVJ D;  1XXU A;  3DD3 A;  3D5J A;  2DLX A;  5E4W A;  5ELA A;  1ERT A;  2ALB A;  3C8E A;  3HDC A;  5HFI A;  4MP4 A;  4AKH A;  1F6M C;  3TKQ A;  2OAD A;  3KMN A;  2H76 A;  1E2Y A;  1SKW B;  1NSW A;  4DEJ A;  1XW5 A;  2IMI A;  3EU3 A;  2GTU A;  5A34 A;  4IBP A;  2LST A;  2YJ7 A;  3QDN A;  4L0W A;  4HZ2 A;  3Q74 A;  2HRK A;  1SYR A;  2ZNM A;  4G2E A;  5BMU B;  5HR0 A;  2YWN A;  2I3Y A;  1TK0 B;  2NVL A;  4O32 A;  3DML A;  4IS0 A;  5KN0 A;  4K5R A;  5D9X A;  5JWO B;  4CY8 A;  1OAZ A;  1AIU A;  2QKE A;  2AHE A;  3VK9 A;  3EMX A;  4IP6 A;  4NXI A;  1Z6N A;  1KBN A;  3E3E A;  4G01 A;  2KP1 A;  2IWT A;  3A2W A;  4IEL A;  1GLP A;  4W66 A;  3UEM A;  2GQL A;  2OT3 A;  1XCC A;  2B7J A;  4ZL8 A;  5IMD A;  5IQY A;  3VPT A;  3DYR A;  1SEN A;  4GF0 A;  1AW9 A;  5ID2 B;  2DJ1 A;  5J4Y A;  2K6V A;  4KDU A;  4EUY A;  2K18 A;  3RBT A;  1YQ1 A;  3I6A A;  2YAN A;  5IO2 A;  3GFK A;  4O5U A;  3CTF A;  4ILF A;  3I43 A;  1QGV A;  5EL8 A;  4E68 A;  3A5W A;  1ZL9 A;  4BL7 B;  5A5K A;  1TP9 A;  2QA2 A;  2LV3 A;  4Q5N A;  2YWM A;  4JR4 A;  1Z7R A;  4G19 A;  1J08 A;  3EWL A;  2LRC A;  4MK3 A;  3QAG A;  3LWA A;  1T4Y A;  4ZIL A;  1F9M A;  4KE3 A;  4RI6 A;  1O81 A;  3KCM A;  2EFD A;  2CZ3 A;  5A5H B;  1A8Y A;  1I5G A;  4BA7 A;  4HQZ A;  4MLY A;  1FOV A;  3J7Y b;  2VL2 A;  3C73 A;  2A2R A;  5IMZ A;  1HYU A;  3CXG A;  2GSR A;  3TJF A;  2HT9 A;  4PGT A;  1K0O A;  4OO4 A;  3KTB A;  4TW5 A;  3FHK A;  4JR6 A;  5B7C A;  2F8A A;  3G7I A;  3VI5 A;  3I9V 2;  1TK5 B;  19GS A;  3D4M A;  1K0C A;  4KSM A;  1F37 A;  2CV4 A;  1ZCP A;  4ECI A;  1K3L A;  1N8J A;  2VLV A;  2C3N A;  3GTU B;  2M46 A;  3US3 A;  1AXD A;  2VUP A;  3HJM A;  2VD0 A;  4L0U A;  5G31 A;  1PMT A;  3V1W A;  5KN3 A;  1T4Z A;  5G5F A;  3DRN A;  2HSN B;  3FZ4 A;  3ZVJ A;  4KDY A;  4OFM A;  1ZMA A;  3TCO A;  6GSX A;  3K8N A;  1SK0 A;  4ZBB A;  2L5L A;  1VF1 A;  1F2E A;  1MDK A;  3QFA C;  4X0X A;  2E7P A;  1ERW A;  1X5D A;  2KOK A;  3VWW A;  1XWK A;  4IQA A;  1S3D A;  1M99 A;  3IHQ A;  2O8V B;  1LBK A;  1BG1 A;  2VCQ A;  1PRX A;  2ZCT A;  3CQF A;  5J3R A;  4N0Z A;  5CRH A;  4RQX A;  1O8X A;  5ABR A;  2BTO T;  5GAP D;  2P5Q A;  1GSE A;  1K0N A;  1GUM A;  2CVD A;  1SVL A;  4QQ7 A;  3ZLP A;  2CZ2 A;  5A1N B;  5ECR B;  4XIH A;  1SD8 A;  2WVZ A;  1XOB A;  4F82 A;  4K8M A;  5IPH A;  1ON4 A;  4K2X A;  1A8L A;  4I8B A;  4IJ3 A;  3ME7 A;  2VM2 A;  3QAV A;  5IMV A;  4WKW A;  4QMK A;  2AJQ B;  1SK2 A;  3KZQ A;  5D9W A;  5KOW A;  5ECI B;  1Y6E A;  3FW2 A;  1XZO A;  1ZYN A;  1F3B A;  2K9F A;  3L9V A;  3CSJ A;  4FYU A;  3CBU A;  3HA9 A;  4K7I A;  4GQF A;  3GKN A;  4MCU A;  2ON5 A;  5CP1 A;  2GZP A;  1WJK A;  1OC3 A;  4RI7 A;  2FUG 2;  4XRA A;  1S3A A;  4FH8 A;  2V32 A;  1PN0 A;  1PX7 A;  4NHW A;  4DVC A;  3CTG A;  3FEU A;  2V2G A;  5AIV A;  1YEP A;  4WF4 A;  2B7K A;  2OBI A;  1JHB A;  1ST9 A;  1J0F A;  1QUW A;  3L9S A;  3MSZ A;  4EKZ A;  1ZYQ B;  2LJA A;  6GST A;  2HSM B;  2HRA A;  4EC0 A;  5KN1 A;  1G7E A;  5KN2 A;  3M9J A;  4N10 A;  2H30 A;  3FZ5 A;  3IHG A;  1TW9 A;  3HVN A;  4MPF A;  2Z9S A;  4KW6 A;  1M9B A;  4PHZ C;  1YZX A;  4I5Q A;  1DSB A;  1ZYP A;  2QC7 A;  4JU5 A;  3IRA A;  4ECC A;  3RGB C;  3QPM A;  1SL1 B;  3SWL A;  2GST A;  4NV5 A;  3H1N A;  2F51 A;  2IME A;  4EDY A;  1QXH A;  5DCH A;  4PTS A;  3I69 A;  1A24 A;  3KEB A;  2VOC A;  4FQU A;  4YQU A;  2L57 A;  2O36 A;  3GKK A;  4OCF A;  4NAX A;  4ML6 A;  4TR1 B;  4G0I A;  2DIZ A;  1X5E A;  2KLX A;  3IOS A;  2FD3 A;  4KAE A;  2IPA A;  1B8X A;  3CHX C;  3VWV A;  2RUE A;  4OFN A; 
#chains in the Genus database with same CATH homology
 4PUA A;  3FZ9 A;  4AGS A;  2PGT A;  1FVK A;  2OA7 A;  4PNG A;  2C0D A;  4HDE A;  1UC7 A;  4XRD A;  1GWC A;  5IM9 A;  3H4K A;  2NDO A;  2O87 A;  4X4J A;  4TRX A;  2HRF A;  4GLT A;  5AIX A;  2CVK A;  3KTL A;  2YPM A;  4KCE A;  1GTU A;  4PUR A;  4ICY A;  4CDO A;  3GH9 A;  4MZC A;  2CT6 A;  2VL9 A;  4OO5 A;  3ZYW A;  4N0V A;  5BMU A;  4F0C A;  3TRQ A;  1GH2 A;  2FWG A;  3GKX A;  1GSY A;  4HS1 A;  3QCP A;  3GYK A;  2CQ9 A;  2YOI A;  5ECN B;  2PBJ A;  4EXJ A;  2LTK A;  1BJX A;  6GSS A;  4MPG A;  1KEB A;  2V1M A;  3IV4 A;  1Q4J A;  1BX9 A;  2OJL A;  2GDR A;  6GSV A;  4I6X A;  4GDF A;  3G9B A;  4XHM A;  2DJ2 A;  4GCI A;  3ZTL A;  2L4C A;  3HZ4 A;  3DGQ A;  4BWQ A;  5ID2 A;  3TJG A;  4HZ4 A;  3MDK A;  3O76 A;  3F9U A;  2JL4 A;  2PER A;  3UJ1 A;  4CW9 A;  3J7Y k;  1MEK A;  2DJJ A;  4K6X A;  2DKI A;  5AGY A;  4WBR D;  1FOH A;  2H75 A;  2MYG A;  2VCW A;  5JCW A;  4KUN A;  4V1A g;  2O89 A;  2O5V A;  5A4W A;  5G2Z A;  5ECO B;  12GS A;  3IDV A;  4MH3 A;  3LSZ A;  1RW1 A;  2IFQ B;  1EV9 A;  1TRW A;  5D96 A;  4HU7 A;  3TRX A;  1HNA A;  2HSH A;  1GLQ A;  1EOH A;  3HVX A;  5LNK e;  2CA8 A;  5A5H A;  2E0Q A;  1Z3E A;  11GS A;  4KX4 A;  1V58 A;  5ELG A;  1VRS D;  1OKT A;  1ERV A;  4HUA A;  1H75 A;  1TI1 A;  3M9K A;  2PPT A;  5H5S A;  2IMK A;  4I2U A;  4HQS A;  4RQR A;  1A2M A;  3DVW A;  4YQV A;  2VL3 A;  3ME8 A;  2EFH A;  3F6F A;  3BD2 A;  1Z7P A;  4TR0 A;  5J4V A;  2B3S A;  2VLU A;  2JSZ A;  3MYD A;  4POB A;  4EL1 A;  3TOT A;  2HSY A;  2HLS A;  1VGL A;  2JZT A;  2LQO A;  3GTU A;  4F2I A;  3MNG A;  4LL4 B;  3TJJ A;  1EEJ A;  5FT3 A;  5BRT A;  2FWH A;  5J5N A;  3GNJ A;  4POL A;  3ZML A;  5G1K A;  1GSD A;  1YF1 A;  1IYH A;  2HSN A;  3EYT A;  3L0H A;  1Z6M A;  2MZC A;  3EC3 A;  2WCI A;  4OD7 A;  2H73 A;  4BVY B;  4JE1 A;  17GS A;  5DAK B;  3P90 A;  3SBC A;  2N5F A;  5E59 A;  3TUE A;  4XS4 A;  1TDI A;  5ECQ B;  2R0C A;  3IBH A;  4NV2 A;  2R3X A;  2JU5 A;  3QD9 A;  9GSS A;  4GXZ A;  1G7O A;  2XBI A;  3BBY A;  2WB9 A;  4F03 A;  2M80 A;  2LUS A;  3HVS A;  4MZW A;  2GSS A;  2HRN A;  1PKW A;  4G0L A;  5A1N A;  1PQN A;  2EFE A;  4ML1 A;  5AIS A;  3KD0 A;  1TRV A;  3UBL A;  4OCE A;  4EVM A;  5ENU A;  1SJI A;  1USB A;  3TGZ A;  4K0N A;  3A2X A;  4KSO A;  3TJK A;  3GSS A;  1W4V A;  1TKD B;  4MDC A;  1PGT A;  3GA4 A;  4J2F A;  2X49 A;  1HD2 A;  5DVB A;  5J9B A;  2K8S A;  2DBC A;  1N25 A;  1V98 A;  3MIX A;  1Z5Y E;  4AJ7 A;  3EPT A;  4XS6 A;  4DSQ A;  3HJP A;  1PSQ A;  2OBK A;  4GTU A;  2B1L A;  1DE2 A;  1GSF A;  1KNG A;  1G6Y A;  1JZO A;  2P5R A;  3RPP A;  3PGT A;  4IQ1 A;  2N5B A;  2LEG A;  4JED A;  5HFK A;  2BMX A;  1H4O A;  1AUC A;  4MJB A;  3F4S A;  2HE3 A;  5IOX A;  4O5R A;  3HMJ G;  2H72 A;  8GSS A;  1WOU A;  2PU9 C;  5GAN D;  2HSM A;  1QMV A;  3EUR A;  3ZRD A;  3LJR A;  1CQG A;  3O6T A;  3CRU A;  3VUR A;  1UVZ A;  3MAK A;  2LKU A;  4IJI A;  2F3M A;  4WR5 A;  1DE1 A;  6GSY A;  1X5C A;  2KHP A;  4YH2 A;  2J9H A;  1OYJ A;  1BED A;  2XBQ A;  3EU4 A;  2I4A A;  5CYY A;  1NHY A;  3P8W A;  3CSH A;  1M2D A;  5ECK B;  2YZH A;  1PX6 A;  1GNE A;  4POK A;  4Z7X A;  4YAV A;  5D73 A;  4MAB A;  2TRX A;  2EIQ A;  4ZB6 A;  4L8E A;  3A3T A;  3WD6 A;  4TN8 A;  1EZK A;  1I9D A;  4KGI A;  3KP9 A;  3HKR A;  3G7Y A;  4TR1 A;  4Z2U A;  3VFI A;  1K0B A;  4MNN A;  4MH2 A;  2R0P A;  1TU7 A;  3HHV A;  4ISD A;  4PXO A;  1SK1 A;  2QSI A;  1SL0 B;  2LRT A;  4XTS A;  2VM1 A;  3IAS 2;  3ZZX A;  1JZR A;  2HZE B;  4J57 E;  18GS A;  1M7T A;  3IPZ A;  4I2T A;  1EWX A;  3IR4 A;  2B1K A;  4GQC A;  4XS4 B;  3IAM 2;  3FYG A;  4HI7 A;  1FAA A;  3CYN A;  4AJ8 A;  4K2D A;  4LMV A;  3FR6 A;  4FIW A;  4GSS A;  2NTO A;  1T1V A;  3ERW A;  5DDL A;  3H79 A;  1XVQ A;  3GL5 A;  5GST A;  2ES7 A;  2AV4 A;  4CY6 A;  4L5O A;  1FG4 A;  3PIN A;  3BOA A;  2WDU A;  4HEA 2;  1TU8 A;  3TOU A;  5IPG A;  2NPB A;  1WMJ A;  1R26 A;  4LMW A;  3HD5 A;  3IK7 A;  1M2A A;  3NOF A;  3F6D A;  2H1L A;  1WP0 A;  4JZQ A;  1V57 A;  2CAI A;  2GT5 A;  4EO3 A;  1Y25 A;  1GSQ A;  14GS A;  4O92 A;  2WUL A;  3UOM A;  5DBQ A;  4GRF A;  2GZZ A;  1M9A A;  1WRY A;  5CRG A;  2GSQ A;  1FB0 A;  1YVL A;  2YJH A;  5HQP A;  3M1G A;  3LQ7 A;  2R4V A;  1XPV A;  5CRD A;  1JZD A;  2H0G A;  3L4N A;  2FCH A;  1GTA A;  4N11 A;  3L78 A;  5HR3 A;  1A0R P;  1EP8 A;  4ZIJ A;  3GV1 A;  3GMF A;  3GH6 A;  1ML6 A;  2YNX A;  2H1D A;  1W89 A;  2REM A;  1J9B A;  4NHZ A;  1SVM A;  3APQ A;  1THX A;  2H6Y A;  2H74 A;  1TTZ A;  2IFQ A;  4POM A;  2HNL A;  3GX8 A;  3GL3 A;  3E0U A;  5G5E A;  2L59 A;  2IJY A;  4F9Z A;  1SKR B;  1Q98 A;  4TOP A;  2HYX A;  1G6W A;  3ISO A;  2JAC A;  3Q19 A;  4ULX A;  4MF7 A;  2PVO C;  3ZIV A;  3TKS E;  3GX0 A;  2C3T A;  2LNS A;  3QFB C;  3P2A A;  4P3Y B;  4F0B A;  4V1A p;  1UA5 A;  4IVF A;  2EC4 A;  2N5A A;  2DJK A;  4L5L A;  4OMV A;  1XWC A;  4USS A;  4IGJ A;  3LFL A;  2RII A;  5F07 A;  1K0A A;  2H0H A;  1FB6 A;  3MWH A;  4MJE A;  1F3A A;  6GSW A;  3M3M A;  5G30 A;  3ZL5 A;  1WIK A;  1B9Y C;  2WZ9 A;  1PKZ A;  2GS3 A;  4NMU A;  3O3T A;  3GHA A;  2X64 A;  2IIY A;  5EPF A;  1NW2 A;  5JCU A;  4BVY A;  5DAK A;  2AB6 A;  2L4Q A;  1IYI A;  5J41 A;  1A23 A;  2FA8 A;  3GUS A;  1T3B A;  1WPI A;  1BAY A;  1YY7 A;  3DKS A;  2C4J A;  3FR9 A;  4XS1 A;  1U3A A;  1ACV A;  2HQT A;  3TJB A;  3R3E A;  1A0F A;  4FO5 A;  4J56 E;  2FA4 A;  2GVP A;  5HFG A;  1VF2 A;  5DCG A;  1M2B A;  1GRX A;  2IMD A;  4EIQ A;  2A4V A;  2DJ0 A;  3KIJ A;  3F0I A;  4Z2R A;  5CAX A;  5F8B A;  4MZB A;  3VPQ A;  1U3I A;  2OE0 A;  1PN9 A;  4ECB A;  2HXK A;  3NIV A;  2BJX A;  1TOF A;  2YV7 A;  4AKG A;  1SYX A;  2L6D A;  1K0M A;  1XWG A;  3FY7 A;  5J40 A;  5H5Q A;  2C80 A;  22GS A;  2VLT A;  4ZB7 A;  1EGR A;  2VO4 A;  3RHC A;  5ECH B;  4IW9 A;  1BYE A;  4MMM A;  3H8Q A;  5D9T A;  2R6K A;  2VCZ A;  5DJM A;  1A2L A;  1K0D A;  2F9S A;  5DQY A;  3N5O A;  2V6O A;  2H6X A;  4PQH A;  2CX4 A;  2MMA A;  5JWQ B;  4G0K A;  2YWI A;  2C0G A;  3QMX A;  4DSS B;  2FY6 A;  1QQ2 A;  2JSY A;  5B8A A;  3RDW A;  3FMW A;  4MA9 A;  3F8U A;  4Q5R A;  1B9X C;  2JAD A;  4K7N A;  3PPU A;  13GS A;  3IXR A;  5CRW A;  5G1L A;  3W8J A;  1GUK A;  5LCZ A;  1R4W A;  4BVX A;  5COH A;  5DJL A;  3TB2 A;  4I97 A;  1TRS A;  3HVV A;  1JLW A;  2AAW A;  1OE7 A;  3LW9 A;  3PH9 A;  2FWF A;  1E6B A;  2H19 A;  3U5R E;  2C3Q A;  4MF6 A;  3TDG A;  2YP6 A;  2MMO A;  2IMF A;  1PA3 A;  1XIY A;  1NHO A;  1T7P B;  2UZ8 A;  2NBS A;  3H93 A;  5AN1 A;  2GLR A;  1GSS A;  2RLI A;  2P0G A;  4H86 A;  4IHU A;  4K1F A;  2VCT A;  4E8E A;  4E8H A;  2CAQ A;  3IC4 A;  1GUL A;  1BG5 A;  3LXT A;  2H1B A;  3KP8 A;  1FW1 A;  3BJ5 A;  4ECJ A;  4AKI A;  2DC5 A;  1FVJ A;  3IE3 A;  1SU9 A;  4V2L A;  4KND A;  1YDK A;  2B6M A;  5C00 A;  2HZE A;  5DQS A;  2PWJ A;  2GGT A;  4PUF C;  5D93 A;  3W8S A;  1XWB A;  3ERG A;  1R7H A;  3QOU A;  5A4V A;  2YWO A;  2VD1 A;  3GN3 A;  1O73 A;  4ZB9 A;  1SJZ A;  2XPE A;  1BQ7 A;  1MD4 A;  1URM A;  3FRC A;  4MF5 A;  1AAZ A;  4KH7 A;  2P31 A;  5F06 A;  4YKG A;  5J9C A;  1R5A A;  3QR6 A;  3AY8 A;  2MMN A;  2KUC A;  1X9W B;  1XBS A;  1WWJ A;  5ECP B;  1U6T A;  4FYC A;  2CX3 A;  2DJ3 A;  3GRX A;  4G9H A;  5FWG A;  1JZW A;  3GKM A;  1OVN A;  2FHE A;  2GT6 A;  2YN1 A;  2AUV A;  3D21 A;  1YEX A;  3DEX A;  3WT2 A;  2XC2 A;  2UV8 G;  1B4P A;  3R2Q A;  4ZL7 A;  2DKH A;  5B6M A;  1N2A A;  3C1S A;  2R5G A;  1ABA A;  3ZIJ A;  4GST A;  1CQH A;  2ON7 A;  2FLS A;  5ECM B;  3CWG A;  4AI6 A;  4PX1 A;  3CMI A;  3HZ8 A;  4TR4 A;  4TR3 A;  5INY A;  3WGE A;  2WJU A;  1K3Y A;  3KH7 A;  2X8G A;  2GQK A;  3FZA A;  4EIP A;  3NZN A;  3G7J A;  3JCM L;  4BWS A;  1YKC A;  3GIX A;  3LOR A;  3TKR A;  4KCA A;  1U88 A;  1WE0 A;  1B4Q A;  4NWY A;  2MMZ A;  3GST A;  3UBK A;  2RUF A;  3FK8 A;  4V2M A;  2VAF A;  1V2A A;  3ZMK A;  4ZB8 A;  3DWV A;  1DBY A;  3BCI A;  2OE3 A;  1SD9 A;  4BVX B;  1XW6 A;  1VF4 A;  2B5E A;  3UMA A;  2FWE A;  3UAP A;  1XVW A;  4IN0 A;  3FKF A;  2H66 A;  2XPD A;  2L6C A;  2VCX A;  5CRE A;  1Y1U A;  3UL3 A;  4QL9 A;  2H70 A;  2R37 A;  4N3Z A;  2A2P A;  2B5Y A;  1GNW A;  3FR3 A;  3N9J A;  3EMP A;  3HYP A;  4RUV A;  2X8H A;  3C7M A;  1ZOF A;  1EOG A;  1HNB A;  2WGR A;  2X8C A;  20GS A;  2HFD A;  5IO0 A;  4KDX A;  3EE2 A;  4EDZ A;  1ZZY A;  2PVQ A;  2LJR A;  1M0U A;  1G0T A;  3HCZ A;  2DML A;  4N30 A;  2H1A A;  1SL2 B;  1MDJ A;  1OC9 B;  7GSS A;  2X99 A;  3ZIT A;  4AF2 A;  5GSS A;  4D73 B;  2GQM A;  5IMA A;  1S3C A;  5IOW A;  5KOX A;  5DAL B;  4K5S A;  1U87 A;  4YAP A;  3APS A;  3A5I A;  2I1U A;  2A2S A;  4LLR A;  3UAR A;  4WR4 A;  2VIM A;  5J4U A;  4GWR A;  16GS A;  3Q6O A;  3RAZ A;  4YQM A;  1TJD A;  3KM6 A;  1ERU A;  4TKY A;  5F0G A;  5J47 A;  3RPN A;  2LNT A;  2WRT A;  2PUK C;  2GZY A;  5A34 B;  2HRK B;  3D4T A;  3WGX A;  2RM5 A;  1XWA A;  3ZFL A;  1YJ6 A;  2OE1 A;  1O8W A;  4K0G A;  3F3Q A;  3CSI A;  1EGO A;  5H5R A;  1TXU A;  3ZFB A;  3KJY A;  1JFU A;  5ECL B;  1GL8 A;  4WET A;  5A4U A;  2C0F A;  3HY2 A;  3F4R A;  5F05 A;  1YKA A;  1ZYE A;  3TU3 B;  1KTE A;  4G10 A;  2C1Y A;  2JZR A;  4TXO A;  2H0I A;  1ZGN A;  1TI3 A;  1MTC A;  4OFT A;  3DIE A;  2A4H A;  2G0F A;  3UVT A;  4X43 A;  1X0R A;  4PQ1 A;  4PQI A;  5LD0 A;  5ECS A;  4JRR A;  4ZL9 A;  2HI7 A;  2H1G A;  1O7U A;  2G2Q A;  1GP1 A;  3UIW A;  1X9S B;  5B8B A;  5GZZ B;  1RK4 A;  1TXX A;  2AYT A;  4Z2T A;  3VLN A;  3VWU A;  1GTB A;  4LA1 A;  2V6K A;  3LYP A;  1SJ6 A;  5C04 A;  3TKS A;  5JCG A;  4YKF A;  2I9H A;  4NPB A;  3DXB A;  3E9J B;  4Q5F A;  4XCS A;  4DSS A;  1EV4 A;  4Q5Q A;  4QL7 A;  4K9Z A;  1X9M B;  2KP2 A;  2EFC A;  4ZBA A;  1ILO A;  3ZRE A;  3DVX A;  3GUR A;  5HR2 A;  3Q18 A;  2E2M A;  2EIR A;  1V40 A;  2JZS A;  2OAC A;  1YF0 A;  3LGC A;  1HNC A;  3L9U A;  2FGX A;  4FYB A;  3HJO A;  3KGK A;  1XOA A;  2R2J A;  4LL1 B;  2H71 A;  2K8V A;  2PMT A;  1AQV A;  1O85 A;  1RQM A;  4WXT A;  3KH9 A;  2XHF A;  2F8F A;  3BCK A;  3HXS A;  3A2V A;  1JLV A;  1T00 A;  3EVI A;  4ZXG A;  4TXV A;  5JWR B;  5L71 A;  3UVH A;  2DIY A;  1GTI A;  1SKS B;  1DUG A;  4OWY A;  3D0Z A;  3F4T A;  5IMC A;  5EY6 A;  1Z9H A;  5B6N A;  2M72 A;  3KMO A;  3VI7 A;  4HJ2 A;  1OC8 A;  2L5O A;  1LU4 A;  4IKH A;  1SVO A;  4MJA A;  1B48 A;  2EIO A;  4EE0 A;  2D2Z A;  1QK8 A;  2LJK A;  4AKX B;  1OE8 A;  2LQQ A;  3VWX A;  3D22 A;  4KF9 A;  5D8I A;  2C0E A;  2TIR A;  3TRP A;  2H6Z A;  1C72 A;  2QGV A;  3LYK A;  2MBT A;  3C1R A;  2VL2 C;  3F63 A;  5IMF A;  2RM6 A;  1FHE A;  3QAW A;  2DSA A;  3IK9 A;  2H01 A;  2IN3 A;  1PD2 1;  2O85 A;  2YCD A;  3W6G A;  1O6J A;  3WGD A;  4ZBD A;  2LS5 A;  4TXO B;  1K3O A;  3M0F A;  4TVE A;  4KB3 A;  4WBJ A;  1XW9 A;  1T8E B;  4CHS A;  4GSN A;  5D9V A;  4PNF A;  2H8L A;  2VKZ G;  2R0G A;  1THO A;  3ED3 A;  4HOJ A;  1AC1 A;  1R5P A;  5HR1 A;  2LRN A;  3CRT A;  1EEM A;  2C8U A;  1OKD A;  4K7O A;  2TRC P;  3IA1 A;  3RHB A;  4ID0 A;  2O7K A;  4WEY A;  3WT1 A;  5FHI A;  4IP1 A;  4AJ6 A;  1TRU A;  1LJR A;  1NM3 A;  3F3R A;  4KA0 A;  4JBB A;  1A2J A;  3PR8 A;  2OKA A;  2WFC A;  2WS2 A;  4O5Q A;  2IL3 A;  4EF0 A;  2B5X A;  4BL7 A;  1EP7 A;  3U6V A;  1MD3 A;  5CNW A;  1PL2 A;  2VCV A;  3IC8 A;  4V2N A;  2MBS A;  4MJC A;  4HJM A;  3LXZ A;  1V9W A;  2I81 A;  2FNO A;  1HQO A;  1VF3 A;  2YZU A;  3M8N A;  3ERF A;  3S9F A;  4BPY A;  2QA1 A;  2V41 A;  2YV9 A;  3KXO A;  2X4A A;  2J23 A;  3P7X A;  4A5P A;  5KEJ A;  2DMM A;  2PN8 A;  5EVO A;  1FO5 A;  4ACS A;  3OR5 A;  1XFL A;  10GS A;  4WF5 A;  1PL1 A;  3LG6 A;  1GUH A;  1AQW A;  4X1U A;  3C71 A;  1UN2 A;  4DSR A;  3EIN A;  2ZUP A;  3WYW A;  1OC9 A;  1TK8 B;  2CVB A;  3D6I A;  1QFN A;  4O7H A;  2E2G A;  1GSU A;  4D73 A;  3TKS C;  5IIZ A;  2HZF A;  6GSU A;  3APO A;  1AQX A;  5CO3 A;  5DAL A;  1MDI A;  1BF5 A;  4HU9 A;  3LEF A;  3TKP A;  3ZVJ D;  1XXU A;  3DD3 A;  3D5J A;  2DLX A;  5E4W A;  5ELA A;  1ERT A;  2ALB A;  3C8E A;  3HDC A;  5HFI A;  4MP4 A;  4AKH A;  1F6M C;  3TKQ A;  2OAD A;  3KMN A;  2H76 A;  1E2Y A;  1SKW B;  1NSW A;  4DEJ A;  1XW5 A;  2IMI A;  3EU3 A;  2GTU A;  5A34 A;  4IBP A;  2LST A;  2YJ7 A;  3QDN A;  4L0W A;  4HZ2 A;  3Q74 A;  2HRK A;  1SYR A;  2ZNM A;  4G2E A;  5BMU B;  5HR0 A;  2YWN A;  2I3Y A;  1TK0 B;  2NVL A;  4O32 A;  3DML A;  4IS0 A;  5KN0 A;  4K5R A;  5D9X A;  5JWO B;  4CY8 A;  1OAZ A;  1AIU A;  2QKE A;  2AHE A;  3VK9 A;  3EMX A;  4IP6 A;  4NXI A;  1Z6N A;  1KBN A;  3E3E A;  4G01 A;  2KP1 A;  2IWT A;  3A2W A;  4IEL A;  1GLP A;  4W66 A;  3UEM A;  2GQL A;  2OT3 A;  1XCC A;  2B7J A;  4ZL8 A;  5IMD A;  5IQY A;  3VPT A;  3DYR A;  1SEN A;  4GF0 A;  1AW9 A;  5ID2 B;  2DJ1 A;  5J4Y A;  2K6V A;  4KDU A;  4EUY A;  2K18 A;  3RBT A;  1YQ1 A;  3I6A A;  2YAN A;  5IO2 A;  3GFK A;  4O5U A;  3CTF A;  4ILF A;  3I43 A;  1QGV A;  5EL8 A;  4E68 A;  3A5W A;  1ZL9 A;  4BL7 B;  5A5K A;  1TP9 A;  2QA2 A;  2LV3 A;  4Q5N A;  2YWM A;  4JR4 A;  1Z7R A;  4G19 A;  1J08 A;  3EWL A;  2LRC A;  4MK3 A;  3QAG A;  3LWA A;  1T4Y A;  4ZIL A;  1F9M A;  4KE3 A;  4RI6 A;  1O81 A;  3KCM A;  2EFD A;  2CZ3 A;  5A5H B;  1A8Y A;  1I5G A;  4BA7 A;  4HQZ A;  4MLY A;  1FOV A;  3J7Y b;  2VL2 A;  3C73 A;  2A2R A;  5IMZ A;  1HYU A;  3CXG A;  2GSR A;  3TJF A;  2HT9 A;  4PGT A;  1K0O A;  4OO4 A;  3KTB A;  4TW5 A;  3FHK A;  4JR6 A;  5B7C A;  2F8A A;  3G7I A;  3VI5 A;  3I9V 2;  1TK5 B;  19GS A;  3D4M A;  1K0C A;  4KSM A;  1F37 A;  2CV4 A;  1ZCP A;  4ECI A;  1K3L A;  1N8J A;  2VLV A;  2C3N A;  3GTU B;  2M46 A;  3US3 A;  1AXD A;  2VUP A;  3HJM A;  2VD0 A;  4L0U A;  5G31 A;  1PMT A;  3V1W A;  5KN3 A;  1T4Z A;  5G5F A;  3DRN A;  2HSN B;  3FZ4 A;  3ZVJ A;  4KDY A;  4OFM A;  1ZMA A;  3TCO A;  6GSX A;  3K8N A;  1SK0 A;  4ZBB A;  2L5L A;  1VF1 A;  1F2E A;  1MDK A;  3QFA C;  4X0X A;  2E7P A;  1ERW A;  1X5D A;  2KOK A;  3VWW A;  1XWK A;  4IQA A;  1S3D A;  1M99 A;  3IHQ A;  2O8V B;  1LBK A;  1BG1 A;  2VCQ A;  1PRX A;  2ZCT A;  5J3R A;  4N0Z A;  5CRH A;  4RQX A;  1O8X A;  5ABR A;  2BTO T;  5GAP D;  2P5Q A;  1GSE A;  1K0N A;  1GUM A;  2CVD A;  1SVL A;  4QQ7 A;  3ZLP A;  2CZ2 A;  5A1N B;  5ECR B;  4XIH A;  1SD8 A;  1XOB A;  4F82 A;  4K8M A;  5IPH A;  1ON4 A;  4K2X A;  1A8L A;  4I8B A;  4IJ3 A;  3ME7 A;  2VM2 A;  3QAV A;  5IMV A;  4WKW A;  4QMK A;  2AJQ B;  1SK2 A;  3KZQ A;  5D9W A;  5KOW A;  5ECI B;  1Y6E A;  3FW2 A;  1XZO A;  1ZYN A;  1F3B A;  2K9F A;  3L9V A;  3CSJ A;  4FYU A;  3CBU A;  3HA9 A;  4K7I A;  4GQF A;  3GKN A;  4MCU A;  2ON5 A;  5CP1 A;  2GZP A;  1WJK A;  1OC3 A;  4RI7 A;  2FUG 2;  4XRA A;  1S3A A;  4FH8 A;  2V32 A;  1PN0 A;  1PX7 A;  4NHW A;  4DVC A;  3CTG A;  3FEU A;  2V2G A;  5AIV A;  1YEP A;  4WF4 A;  2B7K A;  2OBI A;  1JHB A;  1ST9 A;  1J0F A;  1QUW A;  3L9S A;  3MSZ A;  4EKZ A;  1ZYQ B;  2LJA A;  6GST A;  2HSM B;  2HRA A;  4EC0 A;  5KN1 A;  1G7E A;  5KN2 A;  3M9J A;  4N10 A;  2H30 A;  3FZ5 A;  3IHG A;  1TW9 A;  4MPF A;  2Z9S A;  4KW6 A;  1M9B A;  1YZX A;  4I5Q A;  1DSB A;  1ZYP A;  2QC7 A;  4JU5 A;  3IRA A;  4ECC A;  3QPM A;  1SL1 B;  3SWL A;  2GST A;  4NV5 A;  3H1N A;  2F51 A;  2IME A;  4EDY A;  1QXH A;  5DCH A;  4PTS A;  3I69 A;  1A24 A;  3KEB A;  2VOC A;  4FQU A;  4YQU A;  2L57 A;  3GKK A;  4OCF A;  4NAX A;  4ML6 A;  4TR1 B;  4G0I A;  2DIZ A;  1X5E A;  2KLX A;  3IOS A;  2FD3 A;  4KAE A;  2IPA A;  1B8X A;  3VWV A;  2RUE A;  4OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...