4EXJA

Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
222
structure length
221
Chain Sequence
VMAILYTGPTGNGRKPLVLGKLLNAPIKVHMFHPTKDIQEDWYLKLNPAGIVPTLVDDKGTPITESNNILLYIADTYDKEHKFFYSLKQDPKLYWEQNELLFYQATQFQSQTLTIANANYQNGHIDENIAQYVLSSFEKVFAFMETKLSGRDWFVGDKFTIVDIAFLVGEHRRRERLHNSPIWIDLKENFPNVEKWFQRAIAFENVEEILKEHAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title Crystal structure of glutathione s-transferase like protein lelg_03239 (target efi-501752) from lodderomyces elongisporus
rcsb
source organism Lodderomyces elongisporus nrrl yb-4239
molecule tags Structural genomics, unknown function
total genus 73
structure length 221
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4exjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4exjA01
2C3TA 3LQ7A 2H76A 4RQRA 2MMZA 5HFKA 4ILFA 2L4CA 1GUHA 4EC0A 4TR4A 5D9XA 4WBRD 2K18A 1ML6A 1K0NA 3R3EA 1TRWA 1ERVA 2N5AA 2DJ3A 4TXOB 3QFAC 1JZWA 1IYHA 2OKAA 2TRXA 6GSXA 3KIJA 1BJXA 3A3TA 2LQOA 2IMKA 4O7HA 1QK8A 1J9BA 4TR3A 1Z7PA 2O7KA 1HQOA 2GT6A 1URMA 3G7YA 1SD9A 1YKAA 3DRNA 4POMA 2I9HA 4GSTA 1FW1A 2CVKA 5IPGA 2PVOC 4J2FA 4F2IA 2P31A 4YQVA 2VCVA 2V2GA 4BPYA 3QDNA 4DSQA 1UC7A 2GSQA 1U88A 1U87A 4MJEA 4KE3A 2K6VA 5HR1A 2FWEA 3LYPA 2H0HA 1QUWA 4OWYA 2WFCA 3Q74A 4K0NA 3IAS2 4MF6A 1OE8A 2VL2A 4GQFA 3UOMA 3IR4A 4HQZA 1OYJA 1QGVA 3FRCA 3WYWA 2JACA 1SYRA 4MH2A 2CZ3A 1HNAA 1X9SB 1SENA 4NHWA 4KDYA 3FR6A 4ZBDA 4XIHA 1ERTA 4TKYA 4HJMA 3LSZA 3APQA 3ZZXA 2AV4A 4NMUA 1S3AA 5D96A 4YQUA 4KCEA 2YJHA 3TKSA 2MBSA 4RUVA 4ZB6A 2FWFA 1XW5A 3CSIA 4IJ3A 2FGXA 4OO4A 3VFIA 4KCAA 1VGLA 3F3QA 1ZGNA 4IJIA 3O3TA 4JBBA 1A8YA 1FAAA 3CSJA 1XWCA 4IS0A 1XWBA 1IYIA 3L9VA 5G1LA 4TW5A 1EV4A 3KEBA 2VCQA 5IMCA 2HXKA 2VOCA 1M0UA 5HFGA 1O6JA 10GSA 5EY6A 4ZB8A 4X43A 3CXGA 1B8XA 2QGVA 1J0FA 3D22A 3D21A 3LWAA 2VD0A 5IMZA 5ID2B 2D2ZA 4O32A 3UAPA 1ERWA 3TJKA 1Z9HA 4IQ1A 5HQPA 16GSA 1Y6EA 2CAQA 3ERWA 3S9FA 2X99A 2BMXA 3MNGA 2VL3A 2VM2A 4K9ZA 2B5XA 1LBKA 5C04A 3G7JA 4ACSA 1XWGA 2O89A 3C73A 4YAPA 1GNWA 3CBUA 1S3DA 2HFDA 4XTSA 5LNKe 5GZZB 4EE0A 3FEUA 3IC8A 4MJBA 3I9V2 1B4PA 4K7NA 1RW1A 2JL4A 2N5BA 2E2GA 2OADA 2VO4A 1B9YC 1UA5A 4YAVA 2WRTA 11GSA 3VPTA 2H73A 1ERUA 2R37A 4ZL9A 3P2AA 4BVXA 4L5LA 2JZRA 4G19A 5DCGA 1GLQA 4IBPA 1GP1A 3ME7A 1KTEA 2LKUA 4TN8A 1PD21 1USBA 3EU3A 1TK0B 3KZQA 4KH7A 4F03A 4JRRA 3TCOA 2JADA 6GSWA 1ILOA 4BL7A 4MF5A 3PH9A 5J3RA 3ME8A 2UZ8A 5DAKA 1ZZYA 1SKRB 1Z3EA 4RI6A 5J5NA 2XBQA 3DVWA 5B6NA 1TJDA 4PQIA 2P0GA 1EEJA 2FHEA 1GSDA 3PR8A 1XVQA 2P5RA 1PX6A 2HZFA 3CTFA 3QCPA 2RLIA 3MAKA 2VL2C 4LMVA 4JU5A 5D9TA 4IELA 2H30A 1ZOFA 4NXIA 2GZPA 4GLTA 3H8QA 1KNGA 4YH2A 3QAVA 1EEMA 2XHFA 1BQ7A 2CA8A 4MPFA 2VUPA 4EO3A 1F6MC 2GLRA 3ZITA 3DEXA 1EGOA 1FB6A 2C0FA 1PL2A 1GRXA 4G0LA 2YP6A 1TU8A 3ZTLA 5CO3A 4K2DA 22GSA 4TVEA 3W8JA 1SK0A 1Z6NA 5ECIB 1ZYEA 5F06A 1J08A 4E8HA 2O8VB 2WJUA 2OBKA 3KH9A 1O8XA 3TKSC 5IO2A 4XS6A 2A2SA 2OE1A 3M1GA 4KDUA 1OVNA 4V2MA 2V32A 4KNDA 2H1BA 4TXOA 1PN9A 3J7Yk 2L57A 5IM9A 4EXJA 1ON4A 2HRNA 1FO5A 2MMAA 1AW9A 2K8VA 5IOWA 2BTOT 2NTOA 3BCKA 2HT9A 2HQTA 4NAXA 2V41A 2C1YA 1PSQA 4IHUA 4I2UA 1OE7A 1THOA 1XOAA 1AQWA 4GSSA 1RK4A 3F4SA 1WPIA 1FHEA 3IC4A 4Q5QA 2DLXA 2V6OA 3HHVA 3FK8A 2V6KA 3TJBA 4G2EA 1TRVA 2H74A 3E9JB 1G0TA 1FVJA 4EKZA 2J9HA 1XW9A 4WR4A 1K3LA 1ZCPA 4KSMA 5IO0A 4MJAA 1GSEA 5IQYA 1YEXA 3DXBA 2F9SA 3HCZA 1TXXA 4QL7A 2ON5A 2O87A 4ZXGA 5F8BA 4D73B 4MH3A 3DGQA 5GSTA 1HYUA 8GSSA 2O85A 1K0DA 3ERFA 4BA7A 3D4TA 3H4KA 3DIEA 7GSSA 4PGTA 4ZBBA 2QSIA 20GSA 4MDCA 5ECNB 1ACVA 3BD2A 4DSRA 1R5AA 2TIRA 4FYCA 2HRFA 1VRSD 1PQNA 3LJRA 2X8GA 1K3OA 4EDYA 4NHZA 2GGTA 5HFIA 1BG5A 2OA7A 3H1NA 9GSSA 3ZMKA 2C0DA 4K7IA 4ECJA 1AAZA 1WE0A 4QQ7A 5A4WA 2PBJA 4O5RA 4MZBA 1HNBA 1R5PA 1K0MA 4HQSA 1T4ZA 1RQMA 5A5KA 5IIZA 4BL7B 5DALA 3ZL5A 2H0IA 2GSRA 5GAPD 1OC8A 2HI7A 2DSAA 4G0IA 5ELAA 1G6YA 3GKMA 3CYNA 2NDOA 1M2BA 1M99A 5H5SA 1M2DA 5JWQB 3KP8A 4P3YB 1CQHA 1FOVA 1GUMA 1TW9A 1OC9A 5AIVA 4NPBA 1AQXA 2F51A 5JWOB 4PQ1A 2QKEA 4ZB9A 2K8SA 1TKDB 3V1WA 1SL0B 1TI1A 1WRYA 3GMFA 1V57A 2Z9SA 1X5EA 2KOKA 5JCWA 1T8EB 1W89A 1GUKA 3GN3A 1PKWA 3EU4A 4IP1A 2C0GA 1CQGA 2H0GA 5JCUA 3MDKA 1AC1A 4HU9A 1YY7A 1TRSA 4KUNA 3CMIA 4MZCA 1GNEA 3FW2A 4L0WA 1VF3A 3TKRA 1MD3A 1F3BA 4GSNA 4HS1A 4RI7A 3GUSA 3F4TA 3Q18A 5BMUA 4ECCA 3P7XA 2FWGA 5EVOA 3EC3A 3W6GA 3ZRDA 3US3A 4GXZA 4OFTA 2IL3A 5ECPB 2H1GA 2PGTA 2H6YA 1GSQA 2H6ZA 3TDGA 4AJ7A 5J9CA 5EPFA 1MTCA 1VF2A 2R5GA 3GX8A 2HZEB 3UBKA 4RQXA 1YKCA 4MP4A 3J7Yb 2VCZA 1PRXA 1GULA 2LNSA 4DSSB 4GTUA 3O76A 2VLVA 1PA3A 1EWXA 1C72A 3ZMLA 1EP7A 2H71A 3HXSA 2B3SA 2ZNMA 3VK9A 3DYRA 1GH2A 4EVMA 4MLYA 5KN0A 3GURA 3QFBC 1YEPA 2EIQA 4K1FA 5FT3A 2GQLA 3HVXA 4MK3A 5D73A 3M9JA 1O73A 5IMVA 3DWVA 4GRFA 2CAIA 2P5QA 1EP8A 2YOIA 3AY8A 3F63A 1ST9A 1YF1A 3VWWA 2A2RA 5B7CA 2YANA 1XXUA 3F4RA 4MJCA 2GT5A 1DSBA 3A2XA 3QD9A 5F05A 1A0RP 3LYKA 2YV9A 3F6DA 3G9BA 1U3AA 5H5RA 3GNJA 1MD4A 1PL1A 3DMLA 3HJOA 1O8WA 2X8HA 2F3MA 1EOGA 3M8NA 3H79A 1DUGA 3UJ1A 1KBNA 2YN1A 4IP6A 5DALB 3HDCA 4F0CA 2YCDA 3A5WA 4XRAA 4K7OA 5E59A 1JFUA 1M7TA 2KHPA 2DIZA 1XVWA 5ECLB 3FY7A 4KW6A 3IA1A 3C1SA 4PXOA 2HSHA 2LTKA 3TKSE 5GSSA 2H70A 3GSSA 3GYKA 1WIKA 4KSOA 17GSA 3IRAA 6GSTA 1E2YA 3VI5A 1OC9B 1Z7RA 5DVBA 1T7PB 3RHCA 2XC2A 3BJ5A 3KMOA 2TRCP 3ZFLA 2IFQB 3Q6OA 2FLSA 5JWRB 4IW9A 1OAZA 1ZMAA 2B5EA 2CZ2A 3C8EA 1R4WA 1THXA 4D73A 4FYUA 4NWYA 1G7EA 5E4WA 4IGJA 1TK8B 2KP2A 4OCEA 2C3NA 4NV5A 2DMLA 3TRQA 4K0GA 2HNLA 1V98A 1X0RA 4N0ZA 1NHOA 1E6BA 4AGSA 1U6TA 5JCGA 4PNGA 2AAWA 1JLVA 5H5QA 4IN0A 4WXTA 4BWSA 2AYTA 2JZSA 3EWLA 2FCHA 3WGXA 2L5OA 5CRGA 2DIYA 4FYBA 1UVZA 2RIIA 3GL3A 1LU4A 4POKA 2EIOA 1Z5YE 5A4UA 2KP1A 2AUVA 3DD3A 2YV7A 3RAZA 5ECHB 3N5OA 3TOTA 3SBCA 1TRUA 5B8AA 5INYA 2H6XA 2PERA 1M9BA 1GSSA 4HDEA 3TRPA 2YWMA 3TB2A 3LG6A 1QQ2A 3IDVA 2L59A 2WB9A 2R4VA 4K6XA 2LRNA 1SYXA 1EOHA 5CP1A 1A24A 4HU7A 5DBQA 4L5OA 1V40A 4MA9A 5FWGA 2H01A 2I81A 1GTIA 3IXRA 3KTBA 3GV1A 2HSYA 3L9SA 4NV2A 2ZUPA 3UARA 3G7IA 2MYGA 5CRWA 1K3YA 2C80A 3HKRA 5J4UA 1PX7A 5ECKB 5A4VA 1HD2A 2LV3A 3U5RE 5IMAA 4G0KA 1JZOA 3SWLA 5DJMA 2PPTA 3ZYWA 3IAM2 2KUCA 3A2VA 2DJJA 2X8CA 3KM6A 3VWUA 5HR3A 2FNOA 1ZL9A 3R2QA 1Q98A 3GIXA 5DJLA 2RUFA 1K0BA 3D0ZA 1H4OA 2DC5A 1F9MA 3TKPA 3O6TA 2GZZA 2HZEA 1T4YA 2IMEA 4CW9A 4V1Ag 1H75A 4KB3A 1JHBA 2CT6A 1OC3A 1F2EA 3QPMA 3MSZA 4JEDA 3P90A 5B6MA 4DSSA 1X5CA 4WETA 4Q5NA 2GQMA 1PGTA 2PMTA 5KEJA 4IVFA 2OBIA 5LCZA 3M0FA 5B8BA 1XPVA 2MZCA 3L78A 2EIRA 3LXTA 1FG4A 1SD8A 5IMDA 4F82A 2LSTA 4TR1B 5KN3A 4JR4A 4TR0A 1JZDA 2MMNA 5CRDA 3UVTA 1PKZA 1B4QA 1NHYA 4TRXA 5ECSA 3RPPA 2ES7A 3D6IA 3IBHA 4OFNA 1T1VA 3WGDA 6GSSA 2RM6A 4QL9A 2IMFA 4TXVA 2GTUA 4Z7XA 4F0BA 2WZ9A 2CVBA 2XPEA 3WD6A 3ED3A 2K9FA 3KTLA 5ABRA 5G30A 4G10A 2B5YA 5AN1A 3GH9A 5D8IA 5CYYA 1FB0A 3GHAA 5CNWA 1AIUA 5ECMB 1MDIA 3APSA 4POLA 3DVXA 1M9AA 3M9KA 3EVIA 5G5EA 1V9WA 1QXHA 2WGRA 3HYPA 5ECRB 2GZYA 3HY2A 4WR5A 3PGTA 4H86A 2B7KA 4J56E 1SKSB 2MMOA 3FZ4A 3GTUA 4WF5A 3IHQA 2DBCA 2PU9C 1R26A 3W8SA 2H19A 2PUKC 4ZIJA 4V1Ap 3F8UA 1F3AA 3TKQA 1A23A 4N0VA 3TRXA 2IMDA 3VPQA 1N2AA 2IFQA 2YPMA 3FZ5A 2VCTA 4O92A 3BCIA 4XHMA 3ISOA 2LJKA 3ZREA 1NM3A 3L0HA 3VURA 2IWTA 1KEBA 2IMIA 4I8BA 2AHEA 2LNTA 2VAFA 2OE0A 3QOUA 4ECIA 5KN2A 3RBTA 1XCCA 3WT2A 4KX4A 3GKKA 3K8NA 3IV4A 1Q4JA 4IQAA 3GRXA 1DE1A 3KCMA 1TP9A 3KGKA 4PUFC 1GLPA 1EGRA 4KDXA 4JE1A 2WULA 3QMXA 2ZCTA 4XS4B 2VCXA 3F3RA 2H8LA 3PPUA 3L4NA 3C7MA 4ZL7A 5F0GA 3VI7A 3HZ4A 4ISDA 1DE2A 2CVDA 2GDRA 5IPHA 2LUSA 3EMPA 3NZNA 4FO5A 3EMXA 2E2MA 1SK2A 3OR5A 4DVCA 1WJKA 5L71A 2YWNA 1XZOA 4E8EA 3RDWA 6GSYA 3IPZA 1FVKA 2LJRA 1GSFA 4X0XA 4PUAA 2REMA 1YF0A 4KGIA 1W4VA 4POBA 2WS2A 3KXOA 3PINA 5G31A 1G6WA 14GSA 2LRCA 1M2AA 1TDIA 3FR9A 2LQQA 2IIYA 1GSYA 4EUYA 2VIMA 2YNXA 2XPDA 5J41A 2FWHA 2M46A 1VF4A 3F9UA 4OMVA 3RHBA 5CAXA 4N10A 2OJLA 2RM5A 2IPAA 3M3MA 3QR6A 3IOSA 1I5GA 3TGZA 4KF9A 5IOXA 5DQYA 1YDKA 2LS5A 2L5LA 1SJ6A 2AJQB 2M72A 2AB6A 1TI3A 1UN2A 4DEJA 2RUEA 3UMAA 2R6KA 3MWHA 3KH7A 4WKWA 3CTGA 1WOUA 3IE3A 4I5QA 2HSNB 4LA1A 2HYXA 1Z6MA 1O7UA 3CSHA 4BVYB 1OKDA 5HR0A 2X64A 2CQ9A 6GSVA 2H1DA 1K0CA 3F0IA 4LLRA 2HLSA 4YQMA 5AIXA 1XWKA 4N11A 2MBTA 2A4VA 5AGYA 1VF1A 1YZXA 4WF4A 1A2JA 2YJ7A 3GTUB 4JZQA 1AXDA 1JZRA 3Q19A 1U3IA 3EINA 3TOUA 1S3CA 5CRHA 2HSMB 1O85A 4XS1A 3CRUA 1GTUA 5D9WA 18GSA 4I6XA 2J23A 2CX4A 1EZKA 3BOAA 4JR6A 5CREA 5LD0A 1G7OA 19GSA 5F07A 5DCHA 4PTSA 1AQVA 4TR1A 5FHIA 4ULXA 3UEMA 3U6VA 2GS3A 4MMMA 3UBLA 4L8EA 2C4JA 13GSA 4V2LA 4CDOA 3HA9A 2H1AA 4MCUA 3GH6A 3N9JA 2DJKA 2PN8A 3A2WA 4XRDA 2HRAA 4V2NA 2GSSA 2G0FA 1I9DA 2VM1A 4OFMA 3TUEA 2VD1A 1V58A 4AF2A 3L9UA 2L6CA 3HJPA 5J9BA 2DMMA 2IJYA 2B6MA 2I4AA 1WP0A 2YWOA 3C71A 3GL5A 4GQCA 4ZBAA 2N5FA 3LFLA 4OD7A 3FZAA 1YJ6A 2B1LA 3LORA 4WEYA 2WCIA 3KJYA 4PX1A 3UL3A 2C3QA 3VWVA 4Q5RA 3E3EA 3HZ8A 1XBSA 5DDLA 3P8WA 1GL8A 4FQUA 1WWJA 4LL1B 5COHA 2LRTA 4KA0A 4FIWA 2DJ2A 4GF0A 1XIYA 4HZ4A 4I97A 2R2JA 2GVPA 3QAGA 4J57E 3CRTA 2VL9A 1T3BA 1GSUA 2NBSA 4ZL8A 2XBIA 4CHSA 3E0UA 2NPBA 4EL1A 2EC4A 4MABA 1JLWA 1GWCA 1XW6A 3GX0A 3IK9A 3I6AA 3NIVA 4ECBA 2C0EA 2FY6A 1YQ1A 4BWQA 3KD0A 2VCWA 3ZVJD 4AJ8A 4L0UA 5G1KA 1SK1A 5ELGA 3JCML 2G2QA 2KLXA 2HRKA 1TK5B 2CV4A 2L4QA 1A2LA 3VLNA 3WGEA 4EDZA 2F8FA 1WMJA 4FH8A 4F9ZA 2OACA 3APOA 1ABAA 4XS4A 5D9VA 1XWAA 3EE2A 2DJ1A 3KP9A 3NOFA 2JSYA 4I2TA 1N8JA 2OE3A 1A0FA 5AISA 3F6FA 1O81A 3GKNA 3ZVJA 3ERGA 2VLUA 5GAND 4PURA 1SJIA 5ENUA 4MF7A 4HOJA 2CX3A 4GWRA 3GFKA 3ZLPA 4EF0A 1SL1B 1SU9A 2ON7A 2ALBA 2H66A 3HJMA 4OCFA 3ZIVA 1SKWB 2E7PA 4N30A 2I1UA 1QMVA 2C8UA 4Q5FA 1V2AA 3HD5A 5D93A 4GCIA 1BEDA 3LGCA 5DQSA 2B1KA 1MEKA 2HE3A 2JU5A 3WT1A 5IMFA 1X9MB 5KN1A 2H75A 4LL4B 4G9HA 4IKHA 4KAEA 4PQHA 1B9XC 2YWIA 2FA8A 3EYTA 1MDJA 4HJ2A 3LXZA 4K8MA 5HR2A 4ZILA 2H72A 1TOFA 2GQKA 3C1RA 4ML6A 1OKTA 1AUCA 3TJFA 1BAYA 1K0AA 3RPNA 3GSTA 3QAWA 3FR3A 5G2ZA 1SJZA 1BYEA 4TOPA 1F37A 3IK7A 4HZ2A 1GTBA 2FUG2 1X9WB 2V1MA 4ID0A 1B48A 3HVVA 2PWJA 3DKSA 2QC7A 1A2MA 1A8LA 2FD3A 3I69A 3GKXA 1ZYQB 1XOBA 4WBJA 4XCSA 4BVYA 1NSWA 4BVXB 1K0OA 3TJJA 3LEFA 5ECQB 2DJ0A 4PNFA 2JSZA 2JZTA 1LJRA 3EURA 1SL2B 3VWXA 1BX9A 3TJGA 2GSTA 3GA4A 1DBYA 4AJ6A 2LJAA 2PVQA 4ML1A 2BJXA 1R7HA 3I43A 1TTZA 1MDKA 3FKFA 1QFNA 1Y25A 2HSMA 3ZFBA 4HUAA 5DAKB 3FHKA 1TU7A 4OO5A 3ZIJA 2WDUA 2I3YA 2F8AA 1X5DA 4X1UA 3H93A 5EL8A 3D4MA 2YZUA 3BBYA 5ID2A 4USSA 3HVSA 5ECOB 2YZHA 1GTAA 3UVHA 5C00A 1XFLA 1EV9A 2HRKB 1T00A 3UIWA 1HNCA 6GSUA 2R3XA 2NVLA 4MZWA 4MPGA 1NW2A 5G5FA 4LMWA 3KMNA 4HEA2 2E0QA 3FZ9A 2M80A 2B7JA 2FA4A 4HI7A 1PMTA 2IN3A 3D5JA 2VLTA 12GSA 3FYGA 2LEGA 2L6DA
chains in the Genus database with same CATH superfamily
2C3TA 3LQ7A 2H76A 4RQRA 2MMZA 5HFKA 4ILFA 2L4CA 1GUHA 4EC0A 4TR4A 5D9XA 4WBRD 2K18A 1ML6A 1K0NA 3R3EA 1TRWA 1ERVA 2N5AA 2DJ3A 4TXOB 3QFAC 1JZWA 1IYHA 2OKAA 2TRXA 6GSXA 3KIJA 1BJXA 3A3TA 2LQOA 2IMKA 4O7HA 1QK8A 1J9BA 4TR3A 1Z7PA 2O7KA 1HQOA 2GT6A 1URMA 3G7YA 1SD9A 1YKAA 3DRNA 4POMA 2I9HA 4GSTA 1FW1A 2CVKA 5IPGA 2PVOC 4J2FA 4F2IA 2P31A 4YQVA 2VCVA 2V2GA 4BPYA 3QDNA 4DSQA 1UC7A 2GSQA 1U88A 1U87A 4MJEA 4KE3A 2K6VA 5HR1A 2FWEA 3LYPA 2H0HA 1QUWA 4OWYA 2WFCA 3Q74A 4GDFA 4K0NA 3IAS2 4MF6A 1OE8A 2VL2A 4GQFA 3UOMA 3RFRC 3IR4A 4HQZA 1OYJA 2O5VA 1QGVA 3FRCA 3WYWA 2JACA 1SYRA 4MH2A 2CZ3A 1HNAA 1X9SB 1SENA 4NHWA 4KDYA 4K5RA 3FR6A 4ZBDA 4XIHA 1ERTA 5A1NA 4TKYA 4HJMA 3LSZA 3APQA 3ZZXA 3HMJG 2AV4A 4NMUA 1S3AA 5D96A 2H1LA 4YQUA 4KCEA 2YJHA 3TKSA 2MBSA 4RUVA 4ZB6A 2FWFA 2X49A 1XW5A 3CSIA 4IJ3A 2FGXA 4OO4A 3VFIA 4KCAA 1VGLA 3F3QA 1ZGNA 4IJIA 3O3TA 4JBBA 1A8YA 1FAAA 3CSJA 1XWCA 4IS0A 1XWBA 4K2XA 4Z2UA 1IYIA 3L9VA 5G1LA 4TW5A 1EV4A 3KEBA 2VCQA 5IMCA 2EFCA 2HXKA 2VOCA 1M0UA 5HFGA 1O6JA 10GSA 5EY6A 4ZB8A 4X43A 3CXGA 1B8XA 2QGVA 1J0FA 3D22A 3D21A 3LWAA 2VD0A 5IMZA 5ID2B 2D2ZA 4O32A 3UAPA 1ERWA 3TJKA 1Z9HA 4IQ1A 5HQPA 16GSA 1Y6EA 2CAQA 3ERWA 3S9FA 2X99A 2BMXA 2VL3A 2VM2A 3MNGA 4K9ZA 2B5XA 1LBKA 5C04A 3G7JA 4ACSA 1XWGA 2O89A 3C73A 4YAPA 1GNWA 3CBUA 1S3DA 2HFDA 4XTSA 5LNKe 5GZZB 4EE0A 3FEUA 3IC8A 4MJBA 3I9V2 1B4PA 4K7NA 1RW1A 2JL4A 2N5BA 2E2GA 2OADA 2VO4A 1B9YC 1UA5A 4YAVA 2WRTA 11GSA 3A5IA 3VPTA 2H73A 1ERUA 2R37A 4ZL9A 3P2AA 4BVXA 4L5LA 2JZRA 4AKXB 4G19A 5DCGA 2R0PA 1GLQA 4IBPA 1GP1A 3ME7A 1KTEA 2LKUA 4TN8A 1PD21 1USBA 3EU3A 1TK0B 3KZQA 4KH7A 4F03A 4JRRA 3TCOA 2JADA 6GSWA 1ILOA 4BL7A 4MF5A 3PH9A 5J3RA 3ME8A 2UZ8A 5DAKA 1ZZYA 1SKRB 1Z3EA 4RI6A 5J5NA 2XBQA 3DVWA 5B6NA 1TJDA 4PQIA 2P0GA 1EEJA 2FHEA 1GSDA 3PR8A 1XVQA 2P5RA 1PX6A 4W66A 2HZFA 4BIKA 3CTFA 3QCPA 2RLIA 3MAKA 2VL2C 4LMVA 4JU5A 5D9TA 4IELA 2H30A 1ZOFA 4NXIA 2GZPA 4GLTA 3H8QA 1KNGA 4YH2A 1EEMA 3QAVA 4Z2TA 2XHFA 1BQ7A 2CA8A 4MPFA 2VUPA 4EO3A 1F6MC 2GLRA 3ZITA 3DEXA 1EGOA 1FB6A 2C0FA 1PL2A 1GRXA 4G0LA 2YP6A 1TU8A 3ZTLA 5CO3A 4K2DA 22GSA 4TVEA 3W8JA 1SK0A 1Z6NA 5ECIB 1ZYEA 5F06A 1J08A 4E8HA 2O8VB 2WJUA 2OBKA 3KH9A 1O8XA 4YKGA 3TKSC 5IO2A 4XS6A 2A2SA 2OE1A 3M1GA 4KDUA 1OVNA 4AKIA 4V2MA 2V32A 4KNDA 2H1BA 4TXOA 1PN9A 3J7Yk 2L57A 5IM9A 4EXJA 1ON4A 2HRNA 4PI2C 1FO5A 2O3EA 2MMAA 1AW9A 2K8VA 5IOWA 2BTOT 2NTOA 3BCKA 2HT9A 2WW0A 2HQTA 4NAXA 2V41A 2C1YA 1PSQA 4IHUA 4I2UA 1OE7A 1THOA 1XOAA 1AQWA 4GSSA 1RK4A 3F4SA 1WPIA 1FHEA 2EFEA 3IC4A 4Q5QA 2DLXA 2V6OA 3HHVA 3FK8A 2V6KA 3TJBA 4G2EA 1TRVA 2H74A 3E9JB 1G0TA 1FVJA 4EKZA 2J9HA 1XW9A 4WR4A 1K3LA 1ZCPA 4KSMA 5IO0A 4MJAA 1GSEA 5IQYA 1YEXA 3DXBA 2F9SA 3HCZA 1TXXA 4QL7A 2ON5A 2O87A 4ZXGA 5F8BA 4D73B 5J4VA 4MH3A 3DGQA 5GSTA 1HYUA 8GSSA 2O85A 1K0DA 3ERFA 4BA7A 3D4TA 3H4KA 3DIEA 7GSSA 4PGTA 4ZBBA 2QSIA 20GSA 4MDCA 5ECNB 1ACVA 3BD2A 4DSRA 1R5AA 2TIRA 4FYCA 2HRFA 1VRSD 1PQNA 3LJRA 2X8GA 1K3OA 2WW1A 4EDYA 2WVXA 4NHZA 2GGTA 5HFIA 1BG5A 2OA7A 3H1NA 9GSSA 3ZMKA 5KOWA 2C0DA 4K7IA 4ECJA 4K5SA 1AAZA 1WE0A 5A5HB 4QQ7A 5A4WA 2PBJA 4O5RA 4MZBA 1HNBA 1R5PA 1K0MA 4HQSA 1T4ZA 1RQMA 5A5KA 5IIZA 5J47A 4BL7B 5DALA 3ZL5A 2H0IA 2GSRA 5GAPD 1OC8A 2HI7A 2DSAA 4G0IA 5ELAA 1G6YA 3GKMA 3CYNA 2NDOA 1M2BA 1M99A 5H5SA 1M2DA 5JWQB 3KP8A 4P3YB 1CQHA 1FOVA 2WW2A 3CQFA 1GUMA 1TW9A 1OC9A 5AIVA 4NPBA 1AQXA 2F51A 2WVYA 5JWOB 4PQ1A 2QKEA 4ZB9A 2K8SA 1TKDB 3V1WA 1SL0B 1TI1A 1WRYA 3GMFA 1V57A 2Z9SA 1X5EA 2KOKA 5JCWA 1YVLA 1T8EB 1W89A 1GUKA 3GN3A 1PKWA 3EU4A 4IP1A 2C0GA 1CQGA 2H0GA 5JCUA 3MDKA 1AC1A 4HU9A 1YY7A 1TRSA 4KUNA 3CMIA 4MZCA 4CY6A 1GNEA 3FW2A 4L0WA 1VF3A 3TKRA 1MD3A 1F3BA 4GSNA 4HS1A 4RI7A 3GUSA 3F4TA 3Q18A 5BMUA 4ECCA 2QA2A 3P7XA 2FWGA 5EVOA 3EC3A 3W6GA 3ZRDA 3US3A 4GXZA 4OFTA 2IL3A 5ECPB 2H1GA 2PGTA 2H6YA 1GSQA 2H6ZA 3TDGA 4AJ7A 5J9CA 5EPFA 1MTCA 1VF2A 2R5GA 3GX8A 2HZEB 3UBKA 4RQXA 1YKCA 4MP4A 3J7Yb 2VCZA 1PRXA 4EIPA 1GULA 2WZSA 2LNSA 4DSSB 4GTUA 3O76A 2VLVA 1PA3A 1EWXA 1C72A 3ZMLA 1EP7A 2H71A 3HXSA 2B3SA 2ZNMA 3VK9A 3DYRA 1GH2A 4EVMA 2VKZG 4MLYA 5KN0A 3GURA 3QFBC 4O5QA 1YEPA 2EIQA 4K1FA 5FT3A 2GQLA 3HVXA 4MK3A 4FXYP 5D73A 1SVOA 3M9JA 2EFDA 3IHGA 1O73A 5IMVA 3DWVA 4HSCX 4GRFA 2CAIA 2P5QA 1EP8A 2YOIA 3AY8A 3F63A 1ST9A 1YF1A 3VWWA 2A2RA 5B7CA 2YANA 1XXUA 3F4RA 4MJCA 2GT5A 2WVXB 1DSBA 3A2XA 3QD9A 5F05A 1A0RP 3LYKA 3CWGA 2YV9A 3F6DA 3G9BA 4QMKA 2UV8G 1U3AA 5A34B 5H5RA 3GNJA 1MD4A 1PL1A 3DMLA 3HJOA 4PI0C 1O8WA 2X8HA 2F3MA 1EOGA 3M8NA 3H79A 1DUGA 3UJ1A 1KBNA 2YN1A 4IP6A 5DALB 3HDCA 4F0CA 2YCDA 3A5WA 4XRAA 4K7OA 5E59A 5J40A 1JFUA 1M3JA 1M7TA 2KHPA 2A2PA 2DIZA 1XVWA 5ECLB 3FY7A 4KW6A 3IA1A 4EIQA 3C1SA 4PXOA 2HSHA 2LTKA 3TKSE 5GSSA 2H70A 3GSSA 3GYKA 1WIKA 1PFOA 17GSA 3IRAA 6GSTA 1E2YA 3VI5A 4KSOA 1OC9B 1Z7RA 5DVBA 1T7PB 3RHCA 2XC2A 3BJ5A 1Y1UA 3KMOA 2TRCP 3ZFLA 2IFQB 3Q6OA 2FLSA 5JWRB 4IW9A 4ZB7A 1OAZA 1ZMAA 2B5EA 2CZ2A 3C8EA 1R4WA 1THXA 4D73A 4FYUA 4NWYA 1G7EA 5E4WA 4IGJA 1TK8B 2KP2A 4OCEA 2C3NA 4NV5A 2DMLA 3TRQA 4K0GA 2HNLA 1V98A 1BF5A 1X0RA 4N0ZA 1NHOA 1E6BA 5BMUB 4AGSA 1U6TA 5JCGA 1I1IP 4PNGA 2AAWA 2X4AA 1JLVA 5H5QA 4IN0A 4WXTA 4BWSA 5KOXA 2AYTA 2JZSA 3EWLA 2FCHA 3WGXA 5BRTA 5A5HA 2L5OA 5CRGA 4G01A 2DIYA 4FYBA 1UVZA 2RIIA 3GL3A 1LU4A 4POKA 2EIOA 1Z5YE 5A4UA 2KP1A 4A5PA 2AUVA 3DD3A 2YV7A 4PHZC 5ECHB 3N5OA 3TOTA 3RAZA 1TRUA 3SBCA 5B8AA 5INYA 2H6XA 2PERA 1M9BA 1GSSA 4HDEA 3TRPA 2YWMA 3TB2A 3LG6A 1QQ2A 3IDVA 2L59A 2WB9A 1XG8A 2R4VA 4K6XA 2LRNA 1SYXA 1EOHA 5CP1A 1A24A 4HU7A 5DBQA 4L5OA 1V40A 4MA9A 5FWGA 2H01A 2I81A 1GTIA 3IXRA 3KTBA 3GV1A 2O36A 2HSYA 3L9SA 4NV2A 2ZUPA 3UARA 2R0GA 3G7IA 2MYGA 5CRWA 2EFHA 1K3YA 2C80A 3HKRA 5J4UA 1PX7A 5ECKB 5A4VA 1HD2A 2LV3A 3U5RE 5IMAA 4G0KA 1JZOA 3SWLA 5DJMA 2PPTA 3ZYWA 3IAM2 2KUCA 3A2VA 2DJJA 2X8CA 3KM6A 3VWUA 5HR3A 2FNOA 1ZL9A 3R2QA 1Q98A 3GIXA 5DJLA 2RUFA 1K0BA 3D0ZA 1H4OA 2DC5A 1F9MA 3TKPA 3O6TA 2GZZA 2HZEA 1T4YA 2IMEA 4CW9A 4V1Ag 1H75A 4KB3A 1JHBA 2CT6A 1OC3A 1F2EA 3QPMA 3MSZA 4JEDA 3P90A 5B6MA 4DSSA 1X5CA 4WETA 4Q5NA 2GQMA 1PGTA 2PMTA 5KEJA 4IVFA 2OBIA 1N25A 5LCZA 3M0FA 5B8BA 1XPVA 2MZCA 3L78A 2EIRA 3LXTA 1FG4A 1SD8A 5IMDA 4F82A 2LSTA 4TR1B 5KN3A 4JR4A 4TR0A 1JZDA 2MMNA 5CRDA 3UVTA 1PKZA 1B4QA 1NHYA 4TRXA 5ECSA 3RPPA 2ES7A 3D6IA 3IBHA 4OFNA 1T1VA 3WGDA 6GSSA 2RM6A 4QL9A 2IMFA 4TXVA 2GTUA 4Z7XA 4F0BA 2WZ9A 2CVBA 2XPEA 3WD6A 3ED3A 2K9FA 3KTLA 5ABRA 5G30A 4G10A 2B5YA 5AN1A 3GH9A 5D8IA 5CYYA 1FB0A 5A34A 3GHAA 5CNWA 1AIUA 1ZYPA 5ECMB 1MDIA 3APSA 4POLA 3DVXA 1M9AA 3M9KA 3EVIA 5G5EA 1V9WA 1QXHA 2WGRA 3HYPA 4YKFA 5ECRB 2GZYA 3HY2A 4WR5A 3PGTA 1TXUA 4H86A 2B7KA 4AKGA 4J56E 1SKSB 2WVZA 2MMOA 3FZ4A 3GTUA 4WF5A 3IHQA 2DBCA 2PU9C 1R26A 3W8SA 2H19A 2PUKC 4ZIJA 4V1Ap 3F8UA 1F3AA 3HVNA 3TKQA 1A23A 4N0VA 3TRXA 2IMDA 3VPQA 4X4JA 1N2AA 2IFQA 2YPMA 3FZ5A 2VCTA 4O92A 3BCIA 4XHMA 3ISOA 4CY8A 2LJKA 3ZREA 1NM3A 3L0HA 3VURA 2IWTA 1KEBA 2IMIA 4I8BA 2AHEA 2LNTA 2VAFA 2OE0A 3QOUA 4ECIA 1SVMA 5KN2A 3RBTA 1XCCA 3WT2A 4KX4A 3GKKA 3K8NA 3IV4A 1S3RA 1Q4JA 4IQAA 3GRXA 1DE1A 3KCMA 1TP9A 3KGKA 4PUFC 1GLPA 1EGRA 4KDXA 4JE1A 2WULA 1BG1A 3QMXA 2ZCTA 4XS4B 2VCXA 3F3RA 2H8LA 3PPUA 3L4NA 3C7MA 4ICYA 4ZL7A 5F0GA 3VI7A 3HZ4A 4ISDA 1DE2A 2CVDA 2GDRA 5IPHA 2LUSA 3EMPA 3NZNA 4FO5A 3EMXA 2E2MA 1SK2A 3OR5A 4DVCA 1WJKA 5L71A 2YWNA 1XZOA 4E8EA 3RDWA 6GSYA 3IPZA 1FVKA 2LJRA 4MNNA 1GSFA 4Z2RA 2OT3A 4E68A 4X0XA 4PUAA 2REMA 1YF0A 4KGIA 1W4VA 4POBA 2WS2A 3KXOA 3PINA 5G31A 1G6WA 14GSA 2LRCA 1M2AA 1TDIA 3FR9A 2LQQA 2IIYA 1GSYA 4EUYA 2VIMA 2YNXA 2XPDA 5J41A 2FWHA 2M46A 1VF4A 3F9UA 4OMVA 3RHBA 5CAXA 4N10A 2OJLA 2RM5A 2IPAA 3M3MA 3QR6A 3IOSA 1I5GA 3TGZA 4KF9A 5IOXA 5DQYA 1YDKA 2LS5A 2L5LA 1SJ6A 2AJQB 2M72A 2AB6A 1TI3A 1UN2A 4DEJA 2RUEA 3MYDA 3UMAA 2R6KA 3MWHA 3KH7A 4WKWA 3CTGA 1WOUA 3IE3A 4I5QA 2HSNB 4LA1A 2HYXA 1Z6MA 1O7UA 3CSHA 4BVYB 1OKDA 5HR0A 2X64A 2CQ9A 6GSVA 2H1DA 1K0CA 3F0IA 4LLRA 2HLSA 4YQMA 5AIXA 1XWKA 4N11A 2MBTA 2A4VA 5AGYA 1VF1A 1YZXA 4WF4A 1A2JA 2YJ7A 3GTUB 4JZQA 1AXDA 1JZRA 3Q19A 1U3IA 3EINA 3TOUA 4AKHA 4N3ZA 1S3CA 5CRHA 2HSMB 4O5UA 1O85A 4XS1A 3CRUA 1GTUA 5D9WA 18GSA 4I6XA 2J23A 2DKIA 2CX4A 1EZKA 3BOAA 4JR6A 5CREA 5LD0A 1G7OA 19GSA 5F07A 3RGBC 5DCHA 4PTSA 1AQVA 4TR1A 5FHIA 3EPTA 4ULXA 3UEMA 3U6VA 2GS3A 4MMMA 3UBLA 4L8EA 2C4JA 13GSA 4V2LA 4CDOA 3HA9A 2H1AA 4MCUA 3GH6A 3N9JA 2DJKA 2PN8A 3A2WA 4XRDA 2HRAA 4V2NA 2GSSA 2G0FA 1I9DA 2VM1A 4OFMA 3TUEA 2VD1A 1V58A 4AF2A 3L9UA 2L6CA 3HJPA 5J9BA 3CHXC 2DMMA 2IJYA 2B6MA 2I4AA 1WP0A 2YWOA 3C71A 3GL5A 4GQCA 4ZBAA 2N5FA 3LFLA 4OD7A 3FZAA 1YJ6A 2B1LA 3LORA 1ZYNA 4WEYA 2WCIA 3KJYA 4PX1A 3UL3A 2C3QA 3VWVA 4Q5RA 3E3EA 3HZ8A 1XBSA 5DDLA 3P8WA 1GL8A 4FQUA 1WWJA 4LL1B 5COHA 2LRTA 4KA0A 4FIWA 2DJ2A 4GF0A 1XIYA 4HZ4A 4I97A 2R2JA 2GVPA 3QAGA 4J57E 3CRTA 2VL9A 1T3BA 1GSUA 2NBSA 4ZL8A 2XBIA 4CHSA 3E0UA 2NPBA 4EL1A 2EC4A 2QA1A 4MABA 1JLWA 3TU3B 1GWCA 1XW6A 2R0CA 3GX0A 3IK9A 3I6AA 3NIVA 4ECBA 1M3IA 2C0EA 1YQ1A 2FY6A 4BWQA 3KD0A 2VCWA 3ZVJD 4AJ8A 4L0UA 5G1KA 1SK1A 5ELGA 3JCML 2G2QA 2KLXA 2HRKA 1TK5B 2CV4A 2L4QA 1A2LA 3VLNA 3WGEA 4EDZA 2F8FA 1WMJA 4FH8A 4F9ZA 2OACA 3APOA 1ABAA 4XS4A 5D9VA 1XWAA 3EE2A 2DJ1A 3KP9A 3NOFA 2JSYA 4I2TA 1N8JA 5A1NB 2OE3A 1A0FA 5AISA 3F6FA 1O81A 3GKNA 3ZVJA 3ERGA 2VLUA 5GAND 4PURA 1SJIA 5ENUA 4MF7A 4HOJA 2CX3A 4GWRA 3GFKA 3ZLPA 4EF0A 1SL1B 1SU9A 2ON7A 2ALBA 2H66A 3HJMA 4OCFA 3ZIVA 1SKWB 2E7PA 4N30A 2I1UA 1QMVA 2C8UA 4Q5FA 1V2AA 3HD5A 5D93A 4GCIA 1BEDA 3LGCA 5DQSA 2B1KA 1MEKA 2HE3A 2JU5A 3WT1A 5IMFA 1X9MB 5KN1A 1YEWC 2H75A 4LL4B 4G9HA 4IKHA 4KAEA 4PQHA 1B9XC 2YWIA 2FA8A 3EYTA 1MDJA 4HJ2A 3LXZA 1PN0A 4K8MA 5HR2A 4ZILA 2H72A 1TOFA 2GQKA 3C1RA 4ML6A 1FOHA 1OKTA 1AUCA 3TJFA 1BAYA 1K0AA 3RPNA 3LW9A 3GSTA 3QAWA 3FR3A 5G2ZA 1SJZA 1BYEA 4TOPA 1F37A 3IK7A 4HZ2A 1GTBA 2FUG2 1X9WB 2WW3A 2V1MA 4ID0A 1B48A 3HVVA 2PWJA 2HSNA 3DKSA 2QC7A 1A2MA 1A8LA 2FD3A 3I69A 3GKXA 1ZYQB 1XOBA 4WBJA 4XCSA 4BVYA 1NSWA 4BVXB 1K0OA 3TJJA 5ECQB 2DJ0A 3LEFA 4PNFA 2JSZA 3MIXA 2JZTA 1LJRA 3EURA 1SL2B 3VWXA 5J4YA 1BX9A 1SVLA 3TJGA 2GSTA 3GA4A 1DBYA 4AJ6A 2LJAA 2PVQA 4ML1A 2BJXA 1R7HA 3I43A 1TTZA 1MDKA 3FKFA 1QFNA 1Y25A 2HSMA 3ZFBA 2DKHA 4HUAA 5DAKB 3FHKA 1TU7A 3FMWA 4OO5A 3ZIJA 2WDUA 2I3YA 2F8AA 1X5DA 1S4BP 4X1UA 3H93A 5EL8A 3D4MA 2YZUA 2A4HA 3BBYA 5ID2A 4USSA 3HVSA 5ECOB 2YZHA 1GTAA 3UVHA 5C00A 1XFLA 1EV9A 2HRKB 1T00A 3UIWA 1HNCA 6GSUA 2R3XA 2NVLA 4MZWA 4MPGA 1NW2A 5G5FA 4LMWA 3KMNA 4HEA2 4AI6A 2E0QA 3FZ9A 2M80A 2B7JA 2FA4A 4HI7A 1PMTA 2IN3A 3D5JA 2VLTA 12GSA 3FYGA 2LEGA 2L6DA
chains in the Genus database with same CATH topology
2C3TA 3LQ7A 2H76A 4RQRA 2MMZA 5HFKA 4ILFA 2L4CA 1GUHA 4EC0A 4TR4A 5D9XA 4WBRD 2K18A 1ML6A 1K0NA 3R3EA 1TRWA 1ERVA 2N5AA 2DJ3A 4TXOB 3QFAC 1JZWA 1IYHA 2OKAA 2TRXA 6GSXA 3KIJA 1BJXA 3A3TA 2LQOA 2IMKA 4O7HA 1QK8A 1J9BA 4TR3A 1Z7PA 2O7KA 1HQOA 2GT6A 1URMA 3G7YA 1SD9A 1YKAA 3DRNA 4POMA 2I9HA 4GSTA 1FW1A 2CVKA 5IPGA 2PVOC 4J2FA 4F2IA 2P31A 4YQVA 2VCVA 2V2GA 4BPYA 3QDNA 4DSQA 1UC7A 2GSQA 1U88A 1U87A 4MJEA 4KE3A 2K6VA 5HR1A 2FWEA 3LYPA 2H0HA 1QUWA 4OWYA 2WFCA 3Q74A 4GDFA 4K0NA 3IAS2 4MF6A 1OE8A 2VL2A 4GQFA 3UOMA 3IR4A 4HQZA 1OYJA 2O5VA 1QGVA 3FRCA 3WYWA 2JACA 1SYRA 4MH2A 2CZ3A 1HNAA 1X9SB 1SENA 4NHWA 4KDYA 4K5RA 3FR6A 4ZBDA 4XIHA 1ERTA 5A1NA 4TKYA 4HJMA 3LSZA 3APQA 3ZZXA 3HMJG 2AV4A 4NMUA 1S3AA 5D96A 2H1LA 4YQUA 4KCEA 2YJHA 3TKSA 2MBSA 4RUVA 4ZB6A 2FWFA 2X49A 1XW5A 3CSIA 4IJ3A 2FGXA 4OO4A 3VFIA 4KCAA 1VGLA 3F3QA 1ZGNA 4IJIA 3O3TA 4JBBA 1A8YA 1FAAA 3CSJA 1XWCA 4IS0A 1XWBA 4K2XA 4Z2UA 1IYIA 3L9VA 5G1LA 4TW5A 1EV4A 3KEBA 2VCQA 5IMCA 2EFCA 2HXKA 2VOCA 1M0UA 5HFGA 1O6JA 10GSA 5EY6A 4ZB8A 4X43A 3CXGA 1B8XA 2QGVA 1J0FA 3D22A 3D21A 3LWAA 2VD0A 5IMZA 5ID2B 2D2ZA 4O32A 3UAPA 1ERWA 3TJKA 1Z9HA 4IQ1A 5HQPA 16GSA 1Y6EA 2CAQA 3ERWA 3S9FA 2X99A 2BMXA 3MNGA 2VL3A 2VM2A 4K9ZA 2B5XA 1LBKA 5C04A 3G7JA 4ACSA 1XWGA 2O89A 3C73A 4YAPA 1GNWA 3CBUA 1S3DA 2HFDA 4XTSA 5LNKe 5GZZB 4EE0A 3FEUA 3IC8A 4MJBA 3I9V2 1B4PA 4K7NA 1RW1A 2JL4A 2N5BA 2E2GA 2OADA 2VO4A 1B9YC 1UA5A 4YAVA 2WRTA 11GSA 3A5IA 3VPTA 2H73A 1ERUA 2R37A 4ZL9A 3P2AA 4BVXA 4L5LA 2JZRA 4AKXB 4G19A 5DCGA 2R0PA 1GLQA 4IBPA 1GP1A 3ME7A 1KTEA 2LKUA 4TN8A 1PD21 1USBA 3EU3A 1TK0B 3KZQA 4KH7A 4F03A 4JRRA 3TCOA 2JADA 6GSWA 1ILOA 4BL7A 4MF5A 3PH9A 5J3RA 3ME8A 2UZ8A 5DAKA 1ZZYA 1SKRB 1Z3EA 4RI6A 5J5NA 2XBQA 3DVWA 5B6NA 1TJDA 4PQIA 2P0GA 1EEJA 2FHEA 1GSDA 3PR8A 1XVQA 2P5RA 1PX6A 4W66A 2HZFA 3CTFA 3QCPA 2RLIA 3MAKA 2VL2C 4LMVA 4JU5A 5D9TA 4IELA 2H30A 1ZOFA 4NXIA 2GZPA 4GLTA 3H8QA 1KNGA 4YH2A 1EEMA 3QAVA 4Z2TA 2XHFA 1BQ7A 2CA8A 4MPFA 2VUPA 4EO3A 1F6MC 2GLRA 3ZITA 3DEXA 1EGOA 1FB6A 2C0FA 1PL2A 1GRXA 4G0LA 2YP6A 1TU8A 3ZTLA 5CO3A 4K2DA 22GSA 4TVEA 3W8JA 1SK0A 1Z6NA 5ECIB 1ZYEA 5F06A 1J08A 4E8HA 2O8VB 2WJUA 2OBKA 3KH9A 1O8XA 4YKGA 3TKSC 5IO2A 4XS6A 2A2SA 2OE1A 3M1GA 4KDUA 1OVNA 4AKIA 4V2MA 2V32A 4KNDA 2H1BA 4TXOA 1PN9A 3J7Yk 2L57A 5IM9A 4EXJA 1ON4A 2HRNA 1FO5A 2MMAA 1AW9A 2K8VA 5IOWA 2BTOT 2NTOA 3BCKA 2HT9A 2HQTA 4NAXA 2V41A 2C1YA 1PSQA 4IHUA 4I2UA 1OE7A 1THOA 1XOAA 1AQWA 4GSSA 1RK4A 3F4SA 1WPIA 1FHEA 2EFEA 3IC4A 4Q5QA 2DLXA 2V6OA 3HHVA 3FK8A 2V6KA 3TJBA 4G2EA 1TRVA 2H74A 3E9JB 1G0TA 1FVJA 4EKZA 2J9HA 1XW9A 4WR4A 1K3LA 1ZCPA 4KSMA 5IO0A 4MJAA 1GSEA 5IQYA 1YEXA 3DXBA 2F9SA 3HCZA 1TXXA 4QL7A 2ON5A 2O87A 4ZXGA 5F8BA 4D73B 5J4VA 4MH3A 3DGQA 5GSTA 1HYUA 8GSSA 2O85A 1K0DA 3ERFA 4BA7A 3D4TA 3H4KA 3DIEA 7GSSA 4PGTA 4ZBBA 2QSIA 20GSA 4MDCA 5ECNB 1ACVA 3BD2A 4DSRA 1R5AA 2TIRA 4FYCA 2HRFA 1VRSD 1PQNA 3LJRA 2X8GA 1K3OA 4EDYA 4NHZA 2GGTA 5HFIA 1BG5A 2OA7A 3H1NA 9GSSA 3ZMKA 5KOWA 2C0DA 4K7IA 4ECJA 4K5SA 1AAZA 1WE0A 5A5HB 4QQ7A 5A4WA 2PBJA 4O5RA 4MZBA 1HNBA 1R5PA 1K0MA 4HQSA 1T4ZA 1RQMA 5A5KA 5IIZA 5J47A 4BL7B 5DALA 3ZL5A 2H0IA 2GSRA 5GAPD 1OC8A 2HI7A 2DSAA 4G0IA 5ELAA 1G6YA 3GKMA 3CYNA 2NDOA 1M2BA 1M99A 5H5SA 1M2DA 5JWQB 3KP8A 4P3YB 1CQHA 1FOVA 1GUMA 1TW9A 1OC9A 5AIVA 4NPBA 1AQXA 2F51A 5JWOB 4PQ1A 2QKEA 4ZB9A 2K8SA 1TKDB 3V1WA 1SL0B 1TI1A 1WRYA 3GMFA 1V57A 2Z9SA 1X5EA 2KOKA 5JCWA 1YVLA 1T8EB 1W89A 1GUKA 3GN3A 1PKWA 3EU4A 4IP1A 2C0GA 1CQGA 2H0GA 5JCUA 3MDKA 1AC1A 4HU9A 1YY7A 1TRSA 4KUNA 3CMIA 4MZCA 4CY6A 1GNEA 3FW2A 4L0WA 1VF3A 3TKRA 1MD3A 1F3BA 4GSNA 4HS1A 4RI7A 3GUSA 3F4TA 3Q18A 5BMUA 4ECCA 2QA2A 3P7XA 2FWGA 5EVOA 3EC3A 3W6GA 3ZRDA 3US3A 4GXZA 4OFTA 2IL3A 5ECPB 2H1GA 2PGTA 2H6YA 1GSQA 2H6ZA 3TDGA 4AJ7A 5J9CA 5EPFA 1MTCA 1VF2A 2R5GA 3GX8A 2HZEB 3UBKA 4RQXA 1YKCA 4MP4A 3J7Yb 2VCZA 1PRXA 4EIPA 1GULA 2LNSA 4DSSB 4GTUA 3O76A 2VLVA 1PA3A 1EWXA 1C72A 3ZMLA 1EP7A 2H71A 3HXSA 2B3SA 2ZNMA 3VK9A 3DYRA 1GH2A 4EVMA 2VKZG 4MLYA 5KN0A 3GURA 3QFBC 4O5QA 1YEPA 2EIQA 4K1FA 5FT3A 2GQLA 3HVXA 4MK3A 5D73A 1SVOA 3M9JA 2EFDA 3IHGA 1O73A 5IMVA 3DWVA 4GRFA 2CAIA 2P5QA 1EP8A 2YOIA 3AY8A 3F63A 1ST9A 1YF1A 3VWWA 2A2RA 5B7CA 2YANA 1XXUA 3F4RA 4MJCA 2GT5A 1DSBA 3A2XA 3QD9A 5F05A 1A0RP 3LYKA 3CWGA 2YV9A 3F6DA 3G9BA 4QMKA 2UV8G 1U3AA 5A34B 5H5RA 3GNJA 1MD4A 1PL1A 3DMLA 3HJOA 1O8WA 2X8HA 2F3MA 1EOGA 3M8NA 3H79A 1DUGA 3UJ1A 1KBNA 2YN1A 4IP6A 5DALB 3HDCA 4F0CA 2YCDA 3A5WA 4XRAA 4K7OA 5E59A 5J40A 1JFUA 1M7TA 2KHPA 2A2PA 2DIZA 1XVWA 5ECLB 3FY7A 4KW6A 3IA1A 4EIQA 3C1SA 4PXOA 2HSHA 2LTKA 3TKSE 5GSSA 2H70A 3GSSA 3GYKA 1WIKA 4KSOA 17GSA 3IRAA 6GSTA 1E2YA 3VI5A 1OC9B 1Z7RA 5DVBA 1T7PB 3RHCA 2XC2A 3BJ5A 1Y1UA 3KMOA 2TRCP 3ZFLA 2IFQB 3Q6OA 2FLSA 5JWRB 4IW9A 4ZB7A 1OAZA 1ZMAA 2B5EA 2CZ2A 3C8EA 1R4WA 1THXA 4D73A 4FYUA 4NWYA 1G7EA 5E4WA 4IGJA 1TK8B 2KP2A 4OCEA 2C3NA 4NV5A 2DMLA 3TRQA 4K0GA 2HNLA 1V98A 1BF5A 1X0RA 4N0ZA 1NHOA 1E6BA 5BMUB 4AGSA 1U6TA 5JCGA 4PNGA 2AAWA 2X4AA 1JLVA 5H5QA 4IN0A 4WXTA 4BWSA 5KOXA 2AYTA 2JZSA 3EWLA 2FCHA 3WGXA 5BRTA 5A5HA 2L5OA 5CRGA 4G01A 2DIYA 4FYBA 1UVZA 2RIIA 3GL3A 1LU4A 4POKA 2EIOA 1Z5YE 5A4UA 2KP1A 4A5PA 2AUVA 3DD3A 2YV7A 3RAZA 5ECHB 3N5OA 3TOTA 3SBCA 1TRUA 5B8AA 5INYA 2H6XA 2PERA 1M9BA 1GSSA 4HDEA 3TRPA 2YWMA 3TB2A 3LG6A 1QQ2A 3IDVA 2L59A 2WB9A 2R4VA 4K6XA 2LRNA 1SYXA 1EOHA 5CP1A 1A24A 4HU7A 5DBQA 4L5OA 1V40A 4MA9A 5FWGA 2H01A 2I81A 1GTIA 3IXRA 3KTBA 3GV1A 2HSYA 3L9SA 4NV2A 2ZUPA 3UARA 2R0GA 3G7IA 2MYGA 5CRWA 2EFHA 1K3YA 2C80A 3HKRA 5J4UA 1PX7A 5ECKB 5A4VA 1HD2A 2LV3A 3U5RE 5IMAA 4G0KA 1JZOA 3SWLA 5DJMA 2PPTA 3ZYWA 3IAM2 2KUCA 3A2VA 2DJJA 2X8CA 3KM6A 3VWUA 5HR3A 2FNOA 1ZL9A 3R2QA 1Q98A 3GIXA 5DJLA 2RUFA 1K0BA 3D0ZA 1H4OA 2DC5A 1F9MA 3TKPA 3O6TA 2GZZA 2HZEA 1T4YA 2IMEA 4CW9A 4V1Ag 1H75A 4KB3A 1JHBA 2CT6A 1OC3A 1F2EA 3QPMA 3MSZA 4JEDA 3P90A 5B6MA 4DSSA 1X5CA 4WETA 4Q5NA 2GQMA 1PGTA 2PMTA 5KEJA 4IVFA 2OBIA 1N25A 5LCZA 3M0FA 5B8BA 1XPVA 2MZCA 3L78A 2EIRA 3LXTA 1FG4A 1SD8A 5IMDA 4F82A 2LSTA 4TR1B 5KN3A 4JR4A 4TR0A 1JZDA 2MMNA 5CRDA 3UVTA 1PKZA 1B4QA 1NHYA 4TRXA 5ECSA 3RPPA 2ES7A 3D6IA 3IBHA 4OFNA 1T1VA 3WGDA 6GSSA 2RM6A 4QL9A 2IMFA 4TXVA 2GTUA 4Z7XA 4F0BA 2WZ9A 2CVBA 2XPEA 3WD6A 3ED3A 2K9FA 3KTLA 5ABRA 5G30A 4G10A 2B5YA 5AN1A 3GH9A 5D8IA 5CYYA 1FB0A 5A34A 3GHAA 5CNWA 1AIUA 1ZYPA 5ECMB 1MDIA 3APSA 4POLA 3DVXA 1M9AA 3M9KA 3EVIA 5G5EA 1V9WA 1QXHA 2WGRA 3HYPA 4YKFA 5ECRB 2GZYA 3HY2A 4WR5A 3PGTA 1TXUA 4H86A 2B7KA 4AKGA 4J56E 1SKSB 2MMOA 3FZ4A 3GTUA 4WF5A 3IHQA 2DBCA 2PU9C 1R26A 3W8SA 2H19A 2PUKC 4ZIJA 4V1Ap 3F8UA 1F3AA 3TKQA 1A23A 4N0VA 3TRXA 2IMDA 3VPQA 4X4JA 1N2AA 2IFQA 2YPMA 3FZ5A 2VCTA 4O92A 3BCIA 4XHMA 3ISOA 4CY8A 2LJKA 3ZREA 1NM3A 3L0HA 3VURA 2IWTA 1KEBA 2IMIA 4I8BA 2AHEA 2LNTA 2VAFA 2OE0A 3QOUA 4ECIA 1SVMA 5KN2A 3RBTA 1XCCA 3WT2A 4KX4A 3GKKA 3K8NA 3IV4A 1Q4JA 4IQAA 3GRXA 1DE1A 3KCMA 1TP9A 3KGKA 4PUFC 1GLPA 1EGRA 4KDXA 4JE1A 2WULA 1BG1A 3QMXA 2ZCTA 4XS4B 2VCXA 3F3RA 2H8LA 3PPUA 3L4NA 3C7MA 4ICYA 4ZL7A 5F0GA 3VI7A 3HZ4A 4ISDA 1DE2A 2CVDA 2GDRA 5IPHA 2LUSA 3EMPA 3NZNA 4FO5A 3EMXA 2E2MA 1SK2A 3OR5A 4DVCA 1WJKA 5L71A 2YWNA 1XZOA 4E8EA 3RDWA 6GSYA 3IPZA 1FVKA 2LJRA 4MNNA 1GSFA 4Z2RA 2OT3A 4E68A 4X0XA 4PUAA 2REMA 1YF0A 4KGIA 1W4VA 4POBA 2WS2A 3KXOA 3PINA 5G31A 1G6WA 14GSA 2LRCA 1M2AA 1TDIA 3FR9A 2LQQA 2IIYA 1GSYA 4EUYA 2VIMA 2YNXA 2XPDA 5J41A 2FWHA 2M46A 1VF4A 3F9UA 4OMVA 3RHBA 5CAXA 4N10A 2OJLA 2RM5A 2IPAA 3M3MA 3QR6A 3IOSA 1I5GA 3TGZA 4KF9A 5IOXA 5DQYA 1YDKA 2LS5A 2L5LA 1SJ6A 2AJQB 2M72A 2AB6A 1TI3A 1UN2A 4DEJA 2RUEA 3MYDA 3UMAA 2R6KA 3MWHA 3KH7A 4WKWA 3CTGA 1WOUA 3IE3A 4I5QA 2HSNB 4LA1A 2HYXA 1Z6MA 1O7UA 3CSHA 4BVYB 1OKDA 5HR0A 2X64A 2CQ9A 6GSVA 2H1DA 1K0CA 3F0IA 4LLRA 2HLSA 4YQMA 5AIXA 1XWKA 4N11A 2MBTA 2A4VA 5AGYA 1VF1A 1YZXA 4WF4A 1A2JA 2YJ7A 3GTUB 4JZQA 1AXDA 1JZRA 3Q19A 1U3IA 3EINA 3TOUA 4AKHA 4N3ZA 1S3CA 5CRHA 2HSMB 4O5UA 1O85A 4XS1A 3CRUA 1GTUA 5D9WA 18GSA 4I6XA 2J23A 2DKIA 2CX4A 1EZKA 3BOAA 4JR6A 5CREA 5LD0A 1G7OA 19GSA 5F07A 5DCHA 4PTSA 1AQVA 4TR1A 5FHIA 3EPTA 4ULXA 3UEMA 3U6VA 2GS3A 4MMMA 3UBLA 4L8EA 2C4JA 13GSA 4V2LA 4CDOA 3HA9A 2H1AA 4MCUA 3GH6A 3N9JA 2DJKA 2PN8A 3A2WA 4XRDA 2HRAA 4V2NA 2GSSA 2G0FA 1I9DA 2VM1A 4OFMA 3TUEA 2VD1A 1V58A 4AF2A 3L9UA 2L6CA 3HJPA 5J9BA 2DMMA 2IJYA 2B6MA 2I4AA 1WP0A 2YWOA 3C71A 3GL5A 4GQCA 4ZBAA 2N5FA 3LFLA 4OD7A 3FZAA 1YJ6A 2B1LA 3LORA 1ZYNA 4WEYA 2WCIA 3KJYA 4PX1A 3UL3A 2C3QA 3VWVA 4Q5RA 3E3EA 3HZ8A 1XBSA 5DDLA 3P8WA 1GL8A 4FQUA 1WWJA 4LL1B 5COHA 2LRTA 4KA0A 4FIWA 2DJ2A 4GF0A 1XIYA 4HZ4A 4I97A 2R2JA 2GVPA 3QAGA 4J57E 3CRTA 2VL9A 1T3BA 1GSUA 2NBSA 4ZL8A 2XBIA 4CHSA 3E0UA 2NPBA 4EL1A 2EC4A 2QA1A 4MABA 1JLWA 3TU3B 1GWCA 1XW6A 2R0CA 3GX0A 3IK9A 3I6AA 3NIVA 4ECBA 2C0EA 2FY6A 1YQ1A 4BWQA 3KD0A 2VCWA 3ZVJD 4AJ8A 4L0UA 5G1KA 1SK1A 5ELGA 3JCML 2G2QA 2KLXA 2HRKA 1TK5B 2CV4A 2L4QA 1A2LA 3VLNA 3WGEA 4EDZA 2F8FA 1WMJA 4FH8A 4F9ZA 2OACA 3APOA 1ABAA 4XS4A 5D9VA 1XWAA 3EE2A 2DJ1A 3KP9A 3NOFA 2JSYA 4I2TA 1N8JA 5A1NB 2OE3A 1A0FA 5AISA 3F6FA 1O81A 3GKNA 3ZVJA 3ERGA 2VLUA 5GAND 4PURA 1SJIA 5ENUA 4MF7A 4HOJA 2CX3A 4GWRA 3GFKA 3ZLPA 4EF0A 1SL1B 1SU9A 2ON7A 2ALBA 2H66A 3HJMA 4OCFA 3ZIVA 1SKWB 2E7PA 4N30A 2I1UA 1QMVA 2C8UA 4Q5FA 1V2AA 3HD5A 5D93A 4GCIA 1BEDA 3LGCA 5DQSA 2B1KA 1MEKA 2HE3A 2JU5A 3WT1A 5IMFA 1X9MB 5KN1A 2H75A 4LL4B 4G9HA 4IKHA 4KAEA 4PQHA 1B9XC 2YWIA 2FA8A 3EYTA 1MDJA 4HJ2A 3LXZA 1PN0A 4K8MA 5HR2A 4ZILA 2H72A 1TOFA 2GQKA 3C1RA 4ML6A 1FOHA 1OKTA 1AUCA 3TJFA 1BAYA 1K0AA 3RPNA 3LW9A 3GSTA 3QAWA 3FR3A 5G2ZA 1SJZA 1BYEA 4TOPA 1F37A 3IK7A 4HZ2A 1GTBA 2FUG2 1X9WB 2V1MA 4ID0A 1B48A 3HVVA 2PWJA 2HSNA 3DKSA 2QC7A 1A2MA 1A8LA 2FD3A 3I69A 3GKXA 1ZYQB 1XOBA 4WBJA 4XCSA 4BVYA 1NSWA 4BVXB 1K0OA 3TJJA 3LEFA 5ECQB 2DJ0A 4PNFA 2JSZA 3MIXA 2JZTA 1LJRA 3EURA 1SL2B 3VWXA 5J4YA 1BX9A 1SVLA 3TJGA 2GSTA 3GA4A 1DBYA 4AJ6A 2LJAA 2PVQA 4ML1A 2BJXA 1R7HA 3I43A 1TTZA 1MDKA 3FKFA 1QFNA 1Y25A 2HSMA 3ZFBA 2DKHA 4HUAA 5DAKB 3FHKA 1TU7A 3FMWA 4OO5A 3ZIJA 2WDUA 2I3YA 2F8AA 1X5DA 4X1UA 3H93A 5EL8A 3D4MA 2YZUA 2A4HA 3BBYA 5ID2A 4USSA 3HVSA 5ECOB 2YZHA 1GTAA 3UVHA 5C00A 1XFLA 1EV9A 2HRKB 1T00A 3UIWA 1HNCA 6GSUA 2R3XA 2NVLA 4MZWA 4MPGA 1NW2A 5G5FA 4LMWA 3KMNA 4HEA2 4AI6A 2E0QA 3FZ9A 2M80A 2B7JA 2FA4A 4HI7A 1PMTA 2IN3A 3D5JA 2VLTA 12GSA 3FYGA 2LEGA 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3T A;  3LQ7 A;  2H76 A;  4RQR A;  2MMZ A;  5HFK A;  4ILF A;  2L4C A;  1GUH A;  4EC0 A;  4TR4 A;  5D9X A;  4WBR D;  2K18 A;  1ML6 A;  1K0N A;  3R3E A;  1TRW A;  1ERV A;  2N5A A;  2DJ3 A;  4TXO B;  3QFA C;  1JZW A;  1IYH A;  2OKA A;  2TRX A;  6GSX A;  3KIJ A;  1BJX A;  3A3T A;  2LQO A;  2IMK A;  4O7H A;  1QK8 A;  1J9B A;  4TR3 A;  1Z7P A;  2O7K A;  1HQO A;  2GT6 A;  1URM A;  3G7Y A;  1SD9 A;  1YKA A;  3DRN A;  4POM A;  2I9H A;  4GST A;  1FW1 A;  2CVK A;  5IPG A;  2PVO C;  4J2F A;  4F2I A;  2P31 A;  4YQV A;  2VCV A;  2V2G A;  4BPY A;  3QDN A;  4DSQ A;  1UC7 A;  2GSQ A;  1U88 A;  1U87 A;  4MJE A;  4KE3 A;  2K6V A;  5HR1 A;  2FWE A;  3LYP A;  2H0H A;  1QUW A;  4OWY A;  2WFC A;  3Q74 A;  4K0N A;  3IAS 2;  4MF6 A;  1OE8 A;  2VL2 A;  4GQF A;  3UOM A;  3IR4 A;  4HQZ A;  1OYJ A;  1QGV A;  3FRC A;  3WYW A;  2JAC A;  1SYR A;  4MH2 A;  2CZ3 A;  1HNA A;  1X9S B;  1SEN A;  4NHW A;  4KDY A;  3FR6 A;  4ZBD A;  4XIH A;  1ERT A;  4TKY A;  4HJM A;  3LSZ A;  3APQ A;  3ZZX A;  2AV4 A;  4NMU A;  1S3A A;  5D96 A;  4YQU A;  4KCE A;  2YJH A;  3TKS A;  2MBS A;  4RUV A;  4ZB6 A;  2FWF A;  1XW5 A;  3CSI A;  4IJ3 A;  2FGX A;  4OO4 A;  3VFI A;  4KCA A;  1VGL A;  3F3Q A;  1ZGN A;  4IJI A;  3O3T A;  4JBB A;  1A8Y A;  1FAA A;  3CSJ A;  1XWC A;  4IS0 A;  1XWB A;  1IYI A;  3L9V A;  5G1L A;  4TW5 A;  1EV4 A;  3KEB A;  2VCQ A;  5IMC A;  2HXK A;  2VOC A;  1M0U A;  5HFG A;  1O6J A;  10GS A;  5EY6 A;  4ZB8 A;  4X43 A;  3CXG A;  1B8X A;  2QGV A;  1J0F A;  3D22 A;  3D21 A;  3LWA A;  2VD0 A;  5IMZ A;  5ID2 B;  2D2Z A;  4O32 A;  3UAP A;  1ERW A;  3TJK A;  1Z9H A;  4IQ1 A;  5HQP A;  16GS A;  1Y6E A;  2CAQ A;  3ERW A;  3S9F A;  2X99 A;  2BMX A;  3MNG A;  2VL3 A;  2VM2 A;  4K9Z A;  2B5X A;  1LBK A;  5C04 A;  3G7J A;  4ACS A;  1XWG A;  2O89 A;  3C73 A;  4YAP A;  1GNW A;  3CBU A;  1S3D A;  2HFD A;  4XTS A;  5LNK e;  5GZZ B;  4EE0 A;  3FEU A;  3IC8 A;  4MJB A;  3I9V 2;  1B4P A;  4K7N A;  1RW1 A;  2JL4 A;  2N5B A;  2E2G A;  2OAD A;  2VO4 A;  1B9Y C;  1UA5 A;  4YAV A;  2WRT A;  11GS A;  3VPT A;  2H73 A;  1ERU A;  2R37 A;  4ZL9 A;  3P2A A;  4BVX A;  4L5L A;  2JZR A;  4G19 A;  5DCG A;  1GLQ A;  4IBP A;  1GP1 A;  3ME7 A;  1KTE A;  2LKU A;  4TN8 A;  1PD2 1;  1USB A;  3EU3 A;  1TK0 B;  3KZQ A;  4KH7 A;  4F03 A;  4JRR A;  3TCO A;  2JAD A;  6GSW A;  1ILO A;  4BL7 A;  4MF5 A;  3PH9 A;  5J3R A;  3ME8 A;  2UZ8 A;  5DAK A;  1ZZY A;  1SKR B;  1Z3E A;  4RI6 A;  5J5N A;  2XBQ A;  3DVW A;  5B6N A;  1TJD A;  4PQI A;  2P0G A;  1EEJ A;  2FHE A;  1GSD A;  3PR8 A;  1XVQ A;  2P5R A;  1PX6 A;  2HZF A;  3CTF A;  3QCP A;  2RLI A;  3MAK A;  2VL2 C;  4LMV A;  4JU5 A;  5D9T A;  4IEL A;  2H30 A;  1ZOF A;  4NXI A;  2GZP A;  4GLT A;  3H8Q A;  1KNG A;  4YH2 A;  3QAV A;  1EEM A;  2XHF A;  1BQ7 A;  2CA8 A;  4MPF A;  2VUP A;  4EO3 A;  1F6M C;  2GLR A;  3ZIT A;  3DEX A;  1EGO A;  1FB6 A;  2C0F A;  1PL2 A;  1GRX A;  4G0L A;  2YP6 A;  1TU8 A;  3ZTL A;  5CO3 A;  4K2D A;  22GS A;  4TVE A;  3W8J A;  1SK0 A;  1Z6N A;  5ECI B;  1ZYE A;  5F06 A;  1J08 A;  4E8H A;  2O8V B;  2WJU A;  2OBK A;  3KH9 A;  1O8X A;  3TKS C;  5IO2 A;  4XS6 A;  2A2S A;  2OE1 A;  3M1G A;  4KDU A;  1OVN A;  4V2M A;  2V32 A;  4KND A;  2H1B A;  4TXO A;  1PN9 A;  3J7Y k;  2L57 A;  5IM9 A;  4EXJ A;  1ON4 A;  2HRN A;  1FO5 A;  2MMA A;  1AW9 A;  2K8V A;  5IOW A;  2BTO T;  2NTO A;  3BCK A;  2HT9 A;  2HQT A;  4NAX A;  2V41 A;  2C1Y A;  1PSQ A;  4IHU A;  4I2U A;  1OE7 A;  1THO A;  1XOA A;  1AQW A;  4GSS A;  1RK4 A;  3F4S A;  1WPI A;  1FHE A;  3IC4 A;  4Q5Q A;  2DLX A;  2V6O A;  3HHV A;  3FK8 A;  2V6K A;  3TJB A;  4G2E A;  1TRV A;  2H74 A;  3E9J B;  1G0T A;  1FVJ A;  4EKZ A;  2J9H A;  1XW9 A;  4WR4 A;  1K3L A;  1ZCP A;  4KSM A;  5IO0 A;  4MJA A;  1GSE A;  5IQY A;  1YEX A;  3DXB A;  2F9S A;  3HCZ A;  1TXX A;  4QL7 A;  2ON5 A;  2O87 A;  4ZXG A;  5F8B A;  4D73 B;  4MH3 A;  3DGQ A;  5GST A;  1HYU A;  8GSS A;  2O85 A;  1K0D A;  3ERF A;  4BA7 A;  3D4T A;  3H4K A;  3DIE A;  7GSS A;  4PGT A;  4ZBB A;  2QSI A;  20GS A;  4MDC A;  5ECN B;  1ACV A;  3BD2 A;  4DSR A;  1R5A A;  2TIR A;  4FYC A;  2HRF A;  1VRS D;  1PQN A;  3LJR A;  2X8G A;  1K3O A;  4EDY A;  4NHZ A;  2GGT A;  5HFI A;  1BG5 A;  2OA7 A;  3H1N A;  9GSS A;  3ZMK A;  2C0D A;  4K7I A;  4ECJ A;  1AAZ A;  1WE0 A;  4QQ7 A;  5A4W A;  2PBJ A;  4O5R A;  4MZB A;  1HNB A;  1R5P A;  1K0M A;  4HQS A;  1T4Z A;  1RQM A;  5A5K A;  5IIZ A;  4BL7 B;  5DAL A;  3ZL5 A;  2H0I A;  2GSR A;  5GAP D;  1OC8 A;  2HI7 A;  2DSA A;  4G0I A;  5ELA A;  1G6Y A;  3GKM A;  3CYN A;  2NDO A;  1M2B A;  1M99 A;  5H5S A;  1M2D A;  5JWQ B;  3KP8 A;  4P3Y B;  1CQH A;  1FOV A;  1GUM A;  1TW9 A;  1OC9 A;  5AIV A;  4NPB A;  1AQX A;  2F51 A;  5JWO B;  4PQ1 A;  2QKE A;  4ZB9 A;  2K8S A;  1TKD B;  3V1W A;  1SL0 B;  1TI1 A;  1WRY A;  3GMF A;  1V57 A;  2Z9S A;  1X5E A;  2KOK A;  5JCW A;  1T8E B;  1W89 A;  1GUK A;  3GN3 A;  1PKW A;  3EU4 A;  4IP1 A;  2C0G A;  1CQG A;  2H0G A;  5JCU A;  3MDK A;  1AC1 A;  4HU9 A;  1YY7 A;  1TRS A;  4KUN A;  3CMI A;  4MZC A;  1GNE A;  3FW2 A;  4L0W A;  1VF3 A;  3TKR A;  1MD3 A;  1F3B A;  4GSN A;  4HS1 A;  4RI7 A;  3GUS A;  3F4T A;  3Q18 A;  5BMU A;  4ECC A;  3P7X A;  2FWG A;  5EVO A;  3EC3 A;  3W6G A;  3ZRD A;  3US3 A;  4GXZ A;  4OFT A;  2IL3 A;  5ECP B;  2H1G A;  2PGT A;  2H6Y A;  1GSQ A;  2H6Z A;  3TDG A;  4AJ7 A;  5J9C A;  5EPF A;  1MTC A;  1VF2 A;  2R5G A;  3GX8 A;  2HZE B;  3UBK A;  4RQX A;  1YKC A;  4MP4 A;  3J7Y b;  2VCZ A;  1PRX A;  1GUL A;  2LNS A;  4DSS B;  4GTU A;  3O76 A;  2VLV A;  1PA3 A;  1EWX A;  1C72 A;  3ZML A;  1EP7 A;  2H71 A;  3HXS A;  2B3S A;  2ZNM A;  3VK9 A;  3DYR A;  1GH2 A;  4EVM A;  4MLY A;  5KN0 A;  3GUR A;  3QFB C;  1YEP A;  2EIQ A;  4K1F A;  5FT3 A;  2GQL A;  3HVX A;  4MK3 A;  5D73 A;  3M9J A;  1O73 A;  5IMV A;  3DWV A;  4GRF A;  2CAI A;  2P5Q A;  1EP8 A;  2YOI A;  3AY8 A;  3F63 A;  1ST9 A;  1YF1 A;  3VWW A;  2A2R A;  5B7C A;  2YAN A;  1XXU A;  3F4R A;  4MJC A;  2GT5 A;  1DSB A;  3A2X A;  3QD9 A;  5F05 A;  1A0R P;  3LYK A;  2YV9 A;  3F6D A;  3G9B A;  1U3A A;  5H5R A;  3GNJ A;  1MD4 A;  1PL1 A;  3DML A;  3HJO A;  1O8W A;  2X8H A;  2F3M A;  1EOG A;  3M8N A;  3H79 A;  1DUG A;  3UJ1 A;  1KBN A;  2YN1 A;  4IP6 A;  5DAL B;  3HDC A;  4F0C A;  2YCD A;  3A5W A;  4XRA A;  4K7O A;  5E59 A;  1JFU A;  1M7T A;  2KHP A;  2DIZ A;  1XVW A;  5ECL B;  3FY7 A;  4KW6 A;  3IA1 A;  3C1S A;  4PXO A;  2HSH A;  2LTK A;  3TKS E;  5GSS A;  2H70 A;  3GSS A;  3GYK A;  1WIK A;  4KSO A;  17GS A;  3IRA A;  6GST A;  1E2Y A;  3VI5 A;  1OC9 B;  1Z7R A;  5DVB A;  1T7P B;  3RHC A;  2XC2 A;  3BJ5 A;  3KMO A;  2TRC P;  3ZFL A;  2IFQ B;  3Q6O A;  2FLS A;  5JWR B;  4IW9 A;  1OAZ A;  1ZMA A;  2B5E A;  2CZ2 A;  3C8E A;  1R4W A;  1THX A;  4D73 A;  4FYU A;  4NWY A;  1G7E A;  5E4W A;  4IGJ A;  1TK8 B;  2KP2 A;  4OCE A;  2C3N A;  4NV5 A;  2DML A;  3TRQ A;  4K0G A;  2HNL A;  1V98 A;  1X0R A;  4N0Z A;  1NHO A;  1E6B A;  4AGS A;  1U6T A;  5JCG A;  4PNG A;  2AAW A;  1JLV A;  5H5Q A;  4IN0 A;  4WXT A;  4BWS A;  2AYT A;  2JZS A;  3EWL A;  2FCH A;  3WGX A;  2L5O A;  5CRG A;  2DIY A;  4FYB A;  1UVZ A;  2RII A;  3GL3 A;  1LU4 A;  4POK A;  2EIO A;  1Z5Y E;  5A4U A;  2KP1 A;  2AUV A;  3DD3 A;  2YV7 A;  3RAZ A;  5ECH B;  3N5O A;  3TOT A;  3SBC A;  1TRU A;  5B8A A;  5INY A;  2H6X A;  2PER A;  1M9B A;  1GSS A;  4HDE A;  3TRP A;  2YWM A;  3TB2 A;  3LG6 A;  1QQ2 A;  3IDV A;  2L59 A;  2WB9 A;  2R4V A;  4K6X A;  2LRN A;  1SYX A;  1EOH A;  5CP1 A;  1A24 A;  4HU7 A;  5DBQ A;  4L5O A;  1V40 A;  4MA9 A;  5FWG A;  2H01 A;  2I81 A;  1GTI A;  3IXR A;  3KTB A;  3GV1 A;  2HSY A;  3L9S A;  4NV2 A;  2ZUP A;  3UAR A;  3G7I A;  2MYG A;  5CRW A;  1K3Y A;  2C80 A;  3HKR A;  5J4U A;  1PX7 A;  5ECK B;  5A4V A;  1HD2 A;  2LV3 A;  3U5R E;  5IMA A;  4G0K A;  1JZO A;  3SWL A;  5DJM A;  2PPT A;  3ZYW A;  3IAM 2;  2KUC A;  3A2V A;  2DJJ A;  2X8C A;  3KM6 A;  3VWU A;  5HR3 A;  2FNO A;  1ZL9 A;  3R2Q A;  1Q98 A;  3GIX A;  5DJL A;  2RUF A;  1K0B A;  3D0Z A;  1H4O A;  2DC5 A;  1F9M A;  3TKP A;  3O6T A;  2GZZ A;  2HZE A;  1T4Y A;  2IME A;  4CW9 A;  4V1A g;  1H75 A;  4KB3 A;  1JHB A;  2CT6 A;  1OC3 A;  1F2E A;  3QPM A;  3MSZ A;  4JED A;  3P90 A;  5B6M A;  4DSS A;  1X5C A;  4WET A;  4Q5N A;  2GQM A;  1PGT A;  2PMT A;  5KEJ A;  4IVF A;  2OBI A;  5LCZ A;  3M0F A;  5B8B A;  1XPV A;  2MZC A;  3L78 A;  2EIR A;  3LXT A;  1FG4 A;  1SD8 A;  5IMD A;  4F82 A;  2LST A;  4TR1 B;  5KN3 A;  4JR4 A;  4TR0 A;  1JZD A;  2MMN A;  5CRD A;  3UVT A;  1PKZ A;  1B4Q A;  1NHY A;  4TRX A;  5ECS A;  3RPP A;  2ES7 A;  3D6I A;  3IBH A;  4OFN A;  1T1V A;  3WGD A;  6GSS A;  2RM6 A;  4QL9 A;  2IMF A;  4TXV A;  2GTU A;  4Z7X A;  4F0B A;  2WZ9 A;  2CVB A;  2XPE A;  3WD6 A;  3ED3 A;  2K9F A;  3KTL A;  5ABR A;  5G30 A;  4G10 A;  2B5Y A;  5AN1 A;  3GH9 A;  5D8I A;  5CYY A;  1FB0 A;  3GHA A;  5CNW A;  1AIU A;  5ECM B;  1MDI A;  3APS A;  4POL A;  3DVX A;  1M9A A;  3M9K A;  3EVI A;  5G5E A;  1V9W A;  1QXH A;  2WGR A;  3HYP A;  5ECR B;  2GZY A;  3HY2 A;  4WR5 A;  3PGT A;  4H86 A;  2B7K A;  4J56 E;  1SKS B;  2MMO A;  3FZ4 A;  3GTU A;  4WF5 A;  3IHQ A;  2DBC A;  2PU9 C;  1R26 A;  3W8S A;  2H19 A;  2PUK C;  4ZIJ A;  4V1A p;  3F8U A;  1F3A A;  3TKQ A;  1A23 A;  4N0V A;  3TRX A;  2IMD A;  3VPQ A;  1N2A A;  2IFQ A;  2YPM A;  3FZ5 A;  2VCT A;  4O92 A;  3BCI A;  4XHM A;  3ISO A;  2LJK A;  3ZRE A;  1NM3 A;  3L0H A;  3VUR A;  2IWT A;  1KEB A;  2IMI A;  4I8B A;  2AHE A;  2LNT A;  2VAF A;  2OE0 A;  3QOU A;  4ECI A;  5KN2 A;  3RBT A;  1XCC A;  3WT2 A;  4KX4 A;  3GKK A;  3K8N A;  3IV4 A;  1Q4J A;  4IQA A;  3GRX A;  1DE1 A;  3KCM A;  1TP9 A;  3KGK A;  4PUF C;  1GLP A;  1EGR A;  4KDX A;  4JE1 A;  2WUL A;  3QMX A;  2ZCT A;  4XS4 B;  2VCX A;  3F3R A;  2H8L A;  3PPU A;  3L4N A;  3C7M A;  4ZL7 A;  5F0G A;  3VI7 A;  3HZ4 A;  4ISD A;  1DE2 A;  2CVD A;  2GDR A;  5IPH A;  2LUS A;  3EMP A;  3NZN A;  4FO5 A;  3EMX A;  2E2M A;  1SK2 A;  3OR5 A;  4DVC A;  1WJK A;  5L71 A;  2YWN A;  1XZO A;  4E8E A;  3RDW A;  6GSY A;  3IPZ A;  1FVK A;  2LJR A;  1GSF A;  4X0X A;  4PUA A;  2REM A;  1YF0 A;  4KGI A;  1W4V A;  4POB A;  2WS2 A;  3KXO A;  3PIN A;  5G31 A;  1G6W A;  14GS A;  2LRC A;  1M2A A;  1TDI A;  3FR9 A;  2LQQ A;  2IIY A;  1GSY A;  4EUY A;  2VIM A;  2YNX A;  2XPD A;  5J41 A;  2FWH A;  2M46 A;  1VF4 A;  3F9U A;  4OMV A;  3RHB A;  5CAX A;  4N10 A;  2OJL A;  2RM5 A;  2IPA A;  3M3M A;  3QR6 A;  3IOS A;  1I5G A;  3TGZ A;  4KF9 A;  5IOX A;  5DQY A;  1YDK A;  2LS5 A;  2L5L A;  1SJ6 A;  2AJQ B;  2M72 A;  2AB6 A;  1TI3 A;  1UN2 A;  4DEJ A;  2RUE A;  3UMA A;  2R6K A;  3MWH A;  3KH7 A;  4WKW A;  3CTG A;  1WOU A;  3IE3 A;  4I5Q A;  2HSN B;  4LA1 A;  2HYX A;  1Z6M A;  1O7U A;  3CSH A;  4BVY B;  1OKD A;  5HR0 A;  2X64 A;  2CQ9 A;  6GSV A;  2H1D A;  1K0C A;  3F0I A;  4LLR A;  2HLS A;  4YQM A;  5AIX A;  1XWK A;  4N11 A;  2MBT A;  2A4V A;  5AGY A;  1VF1 A;  1YZX A;  4WF4 A;  1A2J A;  2YJ7 A;  3GTU B;  4JZQ A;  1AXD A;  1JZR A;  3Q19 A;  1U3I A;  3EIN A;  3TOU A;  1S3C A;  5CRH A;  2HSM B;  1O85 A;  4XS1 A;  3CRU A;  1GTU A;  5D9W A;  18GS A;  4I6X A;  2J23 A;  2CX4 A;  1EZK A;  3BOA A;  4JR6 A;  5CRE A;  5LD0 A;  1G7O A;  19GS A;  5F07 A;  5DCH A;  4PTS A;  1AQV A;  4TR1 A;  5FHI A;  4ULX A;  3UEM A;  3U6V A;  2GS3 A;  4MMM A;  3UBL A;  4L8E A;  2C4J A;  13GS A;  4V2L A;  4CDO A;  3HA9 A;  2H1A A;  4MCU A;  3GH6 A;  3N9J A;  2DJK A;  2PN8 A;  3A2W A;  4XRD A;  2HRA A;  4V2N A;  2GSS A;  2G0F A;  1I9D A;  2VM1 A;  4OFM A;  3TUE A;  2VD1 A;  1V58 A;  4AF2 A;  3L9U A;  2L6C A;  3HJP A;  5J9B A;  2DMM A;  2IJY A;  2B6M A;  2I4A A;  1WP0 A;  2YWO A;  3C71 A;  3GL5 A;  4GQC A;  4ZBA A;  2N5F A;  3LFL A;  4OD7 A;  3FZA A;  1YJ6 A;  2B1L A;  3LOR A;  4WEY A;  2WCI A;  3KJY A;  4PX1 A;  3UL3 A;  2C3Q A;  3VWV A;  4Q5R A;  3E3E A;  3HZ8 A;  1XBS A;  5DDL A;  3P8W A;  1GL8 A;  4FQU A;  1WWJ A;  4LL1 B;  5COH A;  2LRT A;  4KA0 A;  4FIW A;  2DJ2 A;  4GF0 A;  1XIY A;  4HZ4 A;  4I97 A;  2R2J A;  2GVP A;  3QAG A;  4J57 E;  3CRT A;  2VL9 A;  1T3B A;  1GSU A;  2NBS A;  4ZL8 A;  2XBI A;  4CHS A;  3E0U A;  2NPB A;  4EL1 A;  2EC4 A;  4MAB A;  1JLW A;  1GWC A;  1XW6 A;  3GX0 A;  3IK9 A;  3I6A A;  3NIV A;  4ECB A;  2C0E A;  2FY6 A;  1YQ1 A;  4BWQ A;  3KD0 A;  2VCW A;  3ZVJ D;  4AJ8 A;  4L0U A;  5G1K A;  1SK1 A;  5ELG A;  3JCM L;  2G2Q A;  2KLX A;  2HRK A;  1TK5 B;  2CV4 A;  2L4Q A;  1A2L A;  3VLN A;  3WGE A;  4EDZ A;  2F8F A;  1WMJ A;  4FH8 A;  4F9Z A;  2OAC A;  3APO A;  1ABA A;  4XS4 A;  5D9V A;  1XWA A;  3EE2 A;  2DJ1 A;  3KP9 A;  3NOF A;  2JSY A;  4I2T A;  1N8J A;  2OE3 A;  1A0F A;  5AIS A;  3F6F A;  1O81 A;  3GKN A;  3ZVJ A;  3ERG A;  2VLU A;  5GAN D;  4PUR A;  1SJI A;  5ENU A;  4MF7 A;  4HOJ A;  2CX3 A;  4GWR A;  3GFK A;  3ZLP A;  4EF0 A;  1SL1 B;  1SU9 A;  2ON7 A;  2ALB A;  2H66 A;  3HJM A;  4OCF A;  3ZIV A;  1SKW B;  2E7P A;  4N30 A;  2I1U A;  1QMV A;  2C8U A;  4Q5F A;  1V2A A;  3HD5 A;  5D93 A;  4GCI A;  1BED A;  3LGC A;  5DQS A;  2B1K A;  1MEK A;  2HE3 A;  2JU5 A;  3WT1 A;  5IMF A;  1X9M B;  5KN1 A;  2H75 A;  4LL4 B;  4G9H A;  4IKH A;  4KAE A;  4PQH A;  1B9X C;  2YWI A;  2FA8 A;  3EYT A;  1MDJ A;  4HJ2 A;  3LXZ A;  4K8M A;  5HR2 A;  4ZIL A;  2H72 A;  1TOF A;  2GQK A;  3C1R A;  4ML6 A;  1OKT A;  1AUC A;  3TJF A;  1BAY A;  1K0A A;  3RPN A;  3GST A;  3QAW A;  3FR3 A;  5G2Z A;  1SJZ A;  1BYE A;  4TOP A;  1F37 A;  3IK7 A;  4HZ2 A;  1GTB A;  2FUG 2;  1X9W B;  2V1M A;  4ID0 A;  1B48 A;  3HVV A;  2PWJ A;  3DKS A;  2QC7 A;  1A2M A;  1A8L A;  2FD3 A;  3I69 A;  3GKX A;  1ZYQ B;  1XOB A;  4WBJ A;  4XCS A;  4BVY A;  1NSW A;  4BVX B;  1K0O A;  3TJJ A;  3LEF A;  5ECQ B;  2DJ0 A;  4PNF A;  2JSZ A;  2JZT A;  1LJR A;  3EUR A;  1SL2 B;  3VWX A;  1BX9 A;  3TJG A;  2GST A;  3GA4 A;  1DBY A;  4AJ6 A;  2LJA A;  2PVQ A;  4ML1 A;  2BJX A;  1R7H A;  3I43 A;  1TTZ A;  1MDK A;  3FKF A;  1QFN A;  1Y25 A;  2HSM A;  3ZFB A;  4HUA A;  5DAK B;  3FHK A;  1TU7 A;  4OO5 A;  3ZIJ A;  2WDU A;  2I3Y A;  2F8A A;  1X5D A;  4X1U A;  3H93 A;  5EL8 A;  3D4M A;  2YZU A;  3BBY A;  5ID2 A;  4USS A;  3HVS A;  5ECO B;  2YZH A;  1GTA A;  3UVH A;  5C00 A;  1XFL A;  1EV9 A;  2HRK B;  1T00 A;  3UIW A;  1HNC A;  6GSU A;  2R3X A;  2NVL A;  4MZW A;  4MPG A;  1NW2 A;  5G5F A;  4LMW A;  3KMN A;  4HEA 2;  2E0Q A;  3FZ9 A;  2M80 A;  2B7J A;  2FA4 A;  4HI7 A;  1PMT A;  2IN3 A;  3D5J A;  2VLT A;  12GS A;  3FYG A;  2LEG A;  2L6D A; 
#chains in the Genus database with same CATH topology
 2C3T A;  3LQ7 A;  2H76 A;  4RQR A;  2MMZ A;  5HFK A;  4ILF A;  2L4C A;  1GUH A;  4EC0 A;  4TR4 A;  5D9X A;  4WBR D;  2K18 A;  1ML6 A;  1K0N A;  3R3E A;  1TRW A;  1ERV A;  2N5A A;  2DJ3 A;  4TXO B;  3QFA C;  1JZW A;  1IYH A;  2OKA A;  2TRX A;  6GSX A;  3KIJ A;  1BJX A;  3A3T A;  2LQO A;  2IMK A;  4O7H A;  1QK8 A;  1J9B A;  4TR3 A;  1Z7P A;  2O7K A;  1HQO A;  2GT6 A;  1URM A;  3G7Y A;  1SD9 A;  1YKA A;  3DRN A;  4POM A;  2I9H A;  4GST A;  1FW1 A;  2CVK A;  5IPG A;  2PVO C;  4J2F A;  4F2I A;  2P31 A;  4YQV A;  2VCV A;  2V2G A;  4BPY A;  3QDN A;  4DSQ A;  1UC7 A;  2GSQ A;  1U88 A;  1U87 A;  4MJE A;  4KE3 A;  2K6V A;  5HR1 A;  2FWE A;  3LYP A;  2H0H A;  1QUW A;  4OWY A;  2WFC A;  3Q74 A;  4GDF A;  4K0N A;  3IAS 2;  4MF6 A;  1OE8 A;  2VL2 A;  4GQF A;  3UOM A;  3RFR C;  3IR4 A;  4HQZ A;  1OYJ A;  2O5V A;  1QGV A;  3FRC A;  3WYW A;  2JAC A;  1SYR A;  4MH2 A;  2CZ3 A;  1HNA A;  1X9S B;  1SEN A;  4NHW A;  4KDY A;  4K5R A;  3FR6 A;  4ZBD A;  4XIH A;  1ERT A;  5A1N A;  4TKY A;  4HJM A;  3LSZ A;  3APQ A;  3ZZX A;  3HMJ G;  2AV4 A;  4NMU A;  1S3A A;  5D96 A;  2H1L A;  4YQU A;  4KCE A;  2YJH A;  3TKS A;  2MBS A;  4RUV A;  4ZB6 A;  2FWF A;  2X49 A;  1XW5 A;  3CSI A;  4IJ3 A;  2FGX A;  4OO4 A;  3VFI A;  4KCA A;  1VGL A;  3F3Q A;  1ZGN A;  4IJI A;  3O3T A;  4JBB A;  1A8Y A;  1FAA A;  3CSJ A;  1XWC A;  4IS0 A;  1XWB A;  4K2X A;  4Z2U A;  1IYI A;  3L9V A;  5G1L A;  4TW5 A;  1EV4 A;  3KEB A;  2VCQ A;  5IMC A;  2EFC A;  2HXK A;  2VOC A;  1M0U A;  5HFG A;  1O6J A;  10GS A;  5EY6 A;  4ZB8 A;  4X43 A;  3CXG A;  1B8X A;  2QGV A;  1J0F A;  3D22 A;  3D21 A;  3LWA A;  2VD0 A;  5IMZ A;  5ID2 B;  2D2Z A;  4O32 A;  3UAP A;  1ERW A;  3TJK A;  1Z9H A;  4IQ1 A;  5HQP A;  16GS A;  1Y6E A;  2CAQ A;  3ERW A;  3S9F A;  2X99 A;  2BMX A;  2VL3 A;  2VM2 A;  3MNG A;  4K9Z A;  2B5X A;  1LBK A;  5C04 A;  3G7J A;  4ACS A;  1XWG A;  2O89 A;  3C73 A;  4YAP A;  1GNW A;  3CBU A;  1S3D A;  2HFD A;  4XTS A;  5LNK e;  5GZZ B;  4EE0 A;  3FEU A;  3IC8 A;  4MJB A;  3I9V 2;  1B4P A;  4K7N A;  1RW1 A;  2JL4 A;  2N5B A;  2E2G A;  2OAD A;  2VO4 A;  1B9Y C;  1UA5 A;  4YAV A;  2WRT A;  11GS A;  3A5I A;  3VPT A;  2H73 A;  1ERU A;  2R37 A;  4ZL9 A;  3P2A A;  4BVX A;  4L5L A;  2JZR A;  4AKX B;  4G19 A;  5DCG A;  2R0P A;  1GLQ A;  4IBP A;  1GP1 A;  3ME7 A;  1KTE A;  2LKU A;  4TN8 A;  1PD2 1;  1USB A;  3EU3 A;  1TK0 B;  3KZQ A;  4KH7 A;  4F03 A;  4JRR A;  3TCO A;  2JAD A;  6GSW A;  1ILO A;  4BL7 A;  4MF5 A;  3PH9 A;  5J3R A;  3ME8 A;  2UZ8 A;  5DAK A;  1ZZY A;  1SKR B;  1Z3E A;  4RI6 A;  5J5N A;  2XBQ A;  3DVW A;  5B6N A;  1TJD A;  4PQI A;  2P0G A;  1EEJ A;  2FHE A;  1GSD A;  3PR8 A;  1XVQ A;  2P5R A;  1PX6 A;  4W66 A;  2HZF A;  4BIK A;  3CTF A;  3QCP A;  2RLI A;  3MAK A;  2VL2 C;  4LMV A;  4JU5 A;  5D9T A;  4IEL A;  2H30 A;  1ZOF A;  4NXI A;  2GZP A;  4GLT A;  3H8Q A;  1KNG A;  4YH2 A;  1EEM A;  3QAV A;  4Z2T A;  2XHF A;  1BQ7 A;  2CA8 A;  4MPF A;  2VUP A;  4EO3 A;  1F6M C;  2GLR A;  3ZIT A;  3DEX A;  1EGO A;  1FB6 A;  2C0F A;  1PL2 A;  1GRX A;  4G0L A;  2YP6 A;  1TU8 A;  3ZTL A;  5CO3 A;  4K2D A;  22GS A;  4TVE A;  3W8J A;  1SK0 A;  1Z6N A;  5ECI B;  1ZYE A;  5F06 A;  1J08 A;  4E8H A;  2O8V B;  2WJU A;  2OBK A;  3KH9 A;  1O8X A;  4YKG A;  3TKS C;  5IO2 A;  4XS6 A;  2A2S A;  2OE1 A;  3M1G A;  4KDU A;  1OVN A;  4AKI A;  4V2M A;  2V32 A;  4KND A;  2H1B A;  4TXO A;  1PN9 A;  3J7Y k;  2L57 A;  5IM9 A;  4EXJ A;  1ON4 A;  2HRN A;  4PI2 C;  1FO5 A;  2O3E A;  2MMA A;  1AW9 A;  2K8V A;  5IOW A;  2BTO T;  2NTO A;  3BCK A;  2HT9 A;  2WW0 A;  2HQT A;  4NAX A;  2V41 A;  2C1Y A;  1PSQ A;  4IHU A;  4I2U A;  1OE7 A;  1THO A;  1XOA A;  1AQW A;  4GSS A;  1RK4 A;  3F4S A;  1WPI A;  1FHE A;  2EFE A;  3IC4 A;  4Q5Q A;  2DLX A;  2V6O A;  3HHV A;  3FK8 A;  2V6K A;  3TJB A;  4G2E A;  1TRV A;  2H74 A;  3E9J B;  1G0T A;  1FVJ A;  4EKZ A;  2J9H A;  1XW9 A;  4WR4 A;  1K3L A;  1ZCP A;  4KSM A;  5IO0 A;  4MJA A;  1GSE A;  5IQY A;  1YEX A;  3DXB A;  2F9S A;  3HCZ A;  1TXX A;  4QL7 A;  2ON5 A;  2O87 A;  4ZXG A;  5F8B A;  4D73 B;  5J4V A;  4MH3 A;  3DGQ A;  5GST A;  1HYU A;  8GSS A;  2O85 A;  1K0D A;  3ERF A;  4BA7 A;  3D4T A;  3H4K A;  3DIE A;  7GSS A;  4PGT A;  4ZBB A;  2QSI A;  20GS A;  4MDC A;  5ECN B;  1ACV A;  3BD2 A;  4DSR A;  1R5A A;  2TIR A;  4FYC A;  2HRF A;  1VRS D;  1PQN A;  3LJR A;  2X8G A;  1K3O A;  2WW1 A;  4EDY A;  2WVX A;  4NHZ A;  2GGT A;  5HFI A;  1BG5 A;  2OA7 A;  3H1N A;  9GSS A;  3ZMK A;  5KOW A;  2C0D A;  4K7I A;  4ECJ A;  4K5S A;  1AAZ A;  1WE0 A;  5A5H B;  4QQ7 A;  5A4W A;  2PBJ A;  4O5R A;  4MZB A;  1HNB A;  1R5P A;  1K0M A;  4HQS A;  1T4Z A;  1RQM A;  5A5K A;  5IIZ A;  5J47 A;  4BL7 B;  5DAL A;  3ZL5 A;  2H0I A;  2GSR A;  5GAP D;  1OC8 A;  2HI7 A;  2DSA A;  4G0I A;  5ELA A;  1G6Y A;  3GKM A;  3CYN A;  2NDO A;  1M2B A;  1M99 A;  5H5S A;  1M2D A;  5JWQ B;  3KP8 A;  4P3Y B;  1CQH A;  1FOV A;  2WW2 A;  3CQF A;  1GUM A;  1TW9 A;  1OC9 A;  5AIV A;  4NPB A;  1AQX A;  2F51 A;  2WVY A;  5JWO B;  4PQ1 A;  2QKE A;  4ZB9 A;  2K8S A;  1TKD B;  3V1W A;  1SL0 B;  1TI1 A;  1WRY A;  3GMF A;  1V57 A;  2Z9S A;  1X5E A;  2KOK A;  5JCW A;  1YVL A;  1T8E B;  1W89 A;  1GUK A;  3GN3 A;  1PKW A;  3EU4 A;  4IP1 A;  2C0G A;  1CQG A;  2H0G A;  5JCU A;  3MDK A;  1AC1 A;  4HU9 A;  1YY7 A;  1TRS A;  4KUN A;  3CMI A;  4MZC A;  4CY6 A;  1GNE A;  3FW2 A;  4L0W A;  1VF3 A;  3TKR A;  1MD3 A;  1F3B A;  4GSN A;  4HS1 A;  4RI7 A;  3GUS A;  3F4T A;  3Q18 A;  5BMU A;  4ECC A;  2QA2 A;  3P7X A;  2FWG A;  5EVO A;  3EC3 A;  3W6G A;  3ZRD A;  3US3 A;  4GXZ A;  4OFT A;  2IL3 A;  5ECP B;  2H1G A;  2PGT A;  2H6Y A;  1GSQ A;  2H6Z A;  3TDG A;  4AJ7 A;  5J9C A;  5EPF A;  1MTC A;  1VF2 A;  2R5G A;  3GX8 A;  2HZE B;  3UBK A;  4RQX A;  1YKC A;  4MP4 A;  3J7Y b;  2VCZ A;  1PRX A;  4EIP A;  1GUL A;  2WZS A;  2LNS A;  4DSS B;  4GTU A;  3O76 A;  2VLV A;  1PA3 A;  1EWX A;  1C72 A;  3ZML A;  1EP7 A;  2H71 A;  3HXS A;  2B3S A;  2ZNM A;  3VK9 A;  3DYR A;  1GH2 A;  4EVM A;  2VKZ G;  4MLY A;  5KN0 A;  3GUR A;  3QFB C;  4O5Q A;  1YEP A;  2EIQ A;  4K1F A;  5FT3 A;  2GQL A;  3HVX A;  4MK3 A;  4FXY P;  5D73 A;  1SVO A;  3M9J A;  2EFD A;  3IHG A;  1O73 A;  5IMV A;  3DWV A;  4HSC X;  4GRF A;  2CAI A;  2P5Q A;  1EP8 A;  2YOI A;  3AY8 A;  3F63 A;  1ST9 A;  1YF1 A;  3VWW A;  2A2R A;  5B7C A;  2YAN A;  1XXU A;  3F4R A;  4MJC A;  2GT5 A;  2WVX B;  1DSB A;  3A2X A;  3QD9 A;  5F05 A;  1A0R P;  3LYK A;  3CWG A;  2YV9 A;  3F6D A;  3G9B A;  4QMK A;  2UV8 G;  1U3A A;  5A34 B;  5H5R A;  3GNJ A;  1MD4 A;  1PL1 A;  3DML A;  3HJO A;  4PI0 C;  1O8W A;  2X8H A;  2F3M A;  1EOG A;  3M8N A;  3H79 A;  1DUG A;  3UJ1 A;  1KBN A;  2YN1 A;  4IP6 A;  5DAL B;  3HDC A;  4F0C A;  2YCD A;  3A5W A;  4XRA A;  4K7O A;  5E59 A;  5J40 A;  1JFU A;  1M3J A;  1M7T A;  2KHP A;  2A2P A;  2DIZ A;  1XVW A;  5ECL B;  3FY7 A;  4KW6 A;  3IA1 A;  4EIQ A;  3C1S A;  4PXO A;  2HSH A;  2LTK A;  3TKS E;  5GSS A;  2H70 A;  3GSS A;  3GYK A;  1WIK A;  1PFO A;  17GS A;  3IRA A;  6GST A;  1E2Y A;  3VI5 A;  4KSO A;  1OC9 B;  1Z7R A;  5DVB A;  1T7P B;  3RHC A;  2XC2 A;  3BJ5 A;  1Y1U A;  3KMO A;  2TRC P;  3ZFL A;  2IFQ B;  3Q6O A;  2FLS A;  5JWR B;  4IW9 A;  4ZB7 A;  1OAZ A;  1ZMA A;  2B5E A;  2CZ2 A;  3C8E A;  1R4W A;  1THX A;  4D73 A;  4FYU A;  4NWY A;  1G7E A;  5E4W A;  4IGJ A;  1TK8 B;  2KP2 A;  4OCE A;  2C3N A;  4NV5 A;  2DML A;  3TRQ A;  4K0G A;  2HNL A;  1V98 A;  1BF5 A;  1X0R A;  4N0Z A;  1NHO A;  1E6B A;  5BMU B;  4AGS A;  1U6T A;  5JCG A;  1I1I P;  4PNG A;  2AAW A;  2X4A A;  1JLV A;  5H5Q A;  4IN0 A;  4WXT A;  4BWS A;  5KOX A;  2AYT A;  2JZS A;  3EWL A;  2FCH A;  3WGX A;  5BRT A;  5A5H A;  2L5O A;  5CRG A;  4G01 A;  2DIY A;  4FYB A;  1UVZ A;  2RII A;  3GL3 A;  1LU4 A;  4POK A;  2EIO A;  1Z5Y E;  5A4U A;  2KP1 A;  4A5P A;  2AUV A;  3DD3 A;  2YV7 A;  4PHZ C;  5ECH B;  3N5O A;  3TOT A;  3RAZ A;  1TRU A;  3SBC A;  5B8A A;  5INY A;  2H6X A;  2PER A;  1M9B A;  1GSS A;  4HDE A;  3TRP A;  2YWM A;  3TB2 A;  3LG6 A;  1QQ2 A;  3IDV A;  2L59 A;  2WB9 A;  1XG8 A;  2R4V A;  4K6X A;  2LRN A;  1SYX A;  1EOH A;  5CP1 A;  1A24 A;  4HU7 A;  5DBQ A;  4L5O A;  1V40 A;  4MA9 A;  5FWG A;  2H01 A;  2I81 A;  1GTI A;  3IXR A;  3KTB A;  3GV1 A;  2O36 A;  2HSY A;  3L9S A;  4NV2 A;  2ZUP A;  3UAR A;  2R0G A;  3G7I A;  2MYG A;  5CRW A;  2EFH A;  1K3Y A;  2C80 A;  3HKR A;  5J4U A;  1PX7 A;  5ECK B;  5A4V A;  1HD2 A;  2LV3 A;  3U5R E;  5IMA A;  4G0K A;  1JZO A;  3SWL A;  5DJM A;  2PPT A;  3ZYW A;  3IAM 2;  2KUC A;  3A2V A;  2DJJ A;  2X8C A;  3KM6 A;  3VWU A;  5HR3 A;  2FNO A;  1ZL9 A;  3R2Q A;  1Q98 A;  3GIX A;  5DJL A;  2RUF A;  1K0B A;  3D0Z A;  1H4O A;  2DC5 A;  1F9M A;  3TKP A;  3O6T A;  2GZZ A;  2HZE A;  1T4Y A;  2IME A;  4CW9 A;  4V1A g;  1H75 A;  4KB3 A;  1JHB A;  2CT6 A;  1OC3 A;  1F2E A;  3QPM A;  3MSZ A;  4JED A;  3P90 A;  5B6M A;  4DSS A;  1X5C A;  4WET A;  4Q5N A;  2GQM A;  1PGT A;  2PMT A;  5KEJ A;  4IVF A;  2OBI A;  1N25 A;  5LCZ A;  3M0F A;  5B8B A;  1XPV A;  2MZC A;  3L78 A;  2EIR A;  3LXT A;  1FG4 A;  1SD8 A;  5IMD A;  4F82 A;  2LST A;  4TR1 B;  5KN3 A;  4JR4 A;  4TR0 A;  1JZD A;  2MMN A;  5CRD A;  3UVT A;  1PKZ A;  1B4Q A;  1NHY A;  4TRX A;  5ECS A;  3RPP A;  2ES7 A;  3D6I A;  3IBH A;  4OFN A;  1T1V A;  3WGD A;  6GSS A;  2RM6 A;  4QL9 A;  2IMF A;  4TXV A;  2GTU A;  4Z7X A;  4F0B A;  2WZ9 A;  2CVB A;  2XPE A;  3WD6 A;  3ED3 A;  2K9F A;  3KTL A;  5ABR A;  5G30 A;  4G10 A;  2B5Y A;  5AN1 A;  3GH9 A;  5D8I A;  5CYY A;  1FB0 A;  5A34 A;  3GHA A;  5CNW A;  1AIU A;  1ZYP A;  5ECM B;  1MDI A;  3APS A;  4POL A;  3DVX A;  1M9A A;  3M9K A;  3EVI A;  5G5E A;  1V9W A;  1QXH A;  2WGR A;  3HYP A;  4YKF A;  5ECR B;  2GZY A;  3HY2 A;  4WR5 A;  3PGT A;  1TXU A;  4H86 A;  2B7K A;  4AKG A;  4J56 E;  1SKS B;  2WVZ A;  2MMO A;  3FZ4 A;  3GTU A;  4WF5 A;  3IHQ A;  2DBC A;  2PU9 C;  1R26 A;  3W8S A;  2H19 A;  2PUK C;  4ZIJ A;  4V1A p;  3F8U A;  1F3A A;  3HVN A;  3TKQ A;  1A23 A;  4N0V A;  3TRX A;  2IMD A;  3VPQ A;  4X4J A;  1N2A A;  2IFQ A;  2YPM A;  3FZ5 A;  2VCT A;  4O92 A;  3BCI A;  4XHM A;  3ISO A;  4CY8 A;  2LJK A;  3ZRE A;  1NM3 A;  3L0H A;  3VUR A;  2IWT A;  1KEB A;  2IMI A;  4I8B A;  2AHE A;  2LNT A;  2VAF A;  2OE0 A;  3QOU A;  4ECI A;  1SVM A;  5KN2 A;  3RBT A;  1XCC A;  3WT2 A;  4KX4 A;  3GKK A;  3K8N A;  3IV4 A;  1S3R A;  1Q4J A;  4IQA A;  3GRX A;  1DE1 A;  3KCM A;  1TP9 A;  3KGK A;  4PUF C;  1GLP A;  1EGR A;  4KDX A;  4JE1 A;  2WUL A;  1BG1 A;  3QMX A;  2ZCT A;  4XS4 B;  2VCX A;  3F3R A;  2H8L A;  3PPU A;  3L4N A;  3C7M A;  4ICY A;  4ZL7 A;  5F0G A;  3VI7 A;  3HZ4 A;  4ISD A;  1DE2 A;  2CVD A;  2GDR A;  5IPH A;  2LUS A;  3EMP A;  3NZN A;  4FO5 A;  3EMX A;  2E2M A;  1SK2 A;  3OR5 A;  4DVC A;  1WJK A;  5L71 A;  2YWN A;  1XZO A;  4E8E A;  3RDW A;  6GSY A;  3IPZ A;  1FVK A;  2LJR A;  4MNN A;  1GSF A;  4Z2R A;  2OT3 A;  4E68 A;  4X0X A;  4PUA A;  2REM A;  1YF0 A;  4KGI A;  1W4V A;  4POB A;  2WS2 A;  3KXO A;  3PIN A;  5G31 A;  1G6W A;  14GS A;  2LRC A;  1M2A A;  1TDI A;  3FR9 A;  2LQQ A;  2IIY A;  1GSY A;  4EUY A;  2VIM A;  2YNX A;  2XPD A;  5J41 A;  2FWH A;  2M46 A;  1VF4 A;  3F9U A;  4OMV A;  3RHB A;  5CAX A;  4N10 A;  2OJL A;  2RM5 A;  2IPA A;  3M3M A;  3QR6 A;  3IOS A;  1I5G A;  3TGZ A;  4KF9 A;  5IOX A;  5DQY A;  1YDK A;  2LS5 A;  2L5L A;  1SJ6 A;  2AJQ B;  2M72 A;  2AB6 A;  1TI3 A;  1UN2 A;  4DEJ A;  2RUE A;  3MYD A;  3UMA A;  2R6K A;  3MWH A;  3KH7 A;  4WKW A;  3CTG A;  1WOU A;  3IE3 A;  4I5Q A;  2HSN B;  4LA1 A;  2HYX A;  1Z6M A;  1O7U A;  3CSH A;  4BVY B;  1OKD A;  5HR0 A;  2X64 A;  2CQ9 A;  6GSV A;  2H1D A;  1K0C A;  3F0I A;  4LLR A;  2HLS A;  4YQM A;  5AIX A;  1XWK A;  4N11 A;  2MBT A;  2A4V A;  5AGY A;  1VF1 A;  1YZX A;  4WF4 A;  1A2J A;  2YJ7 A;  3GTU B;  4JZQ A;  1AXD A;  1JZR A;  3Q19 A;  1U3I A;  3EIN A;  3TOU A;  4AKH A;  4N3Z A;  1S3C A;  5CRH A;  2HSM B;  4O5U A;  1O85 A;  4XS1 A;  3CRU A;  1GTU A;  5D9W A;  18GS A;  4I6X A;  2J23 A;  2DKI A;  2CX4 A;  1EZK A;  3BOA A;  4JR6 A;  5CRE A;  5LD0 A;  1G7O A;  19GS A;  5F07 A;  3RGB C;  5DCH A;  4PTS A;  1AQV A;  4TR1 A;  5FHI A;  3EPT A;  4ULX A;  3UEM A;  3U6V A;  2GS3 A;  4MMM A;  3UBL A;  4L8E A;  2C4J A;  13GS A;  4V2L A;  4CDO A;  3HA9 A;  2H1A A;  4MCU A;  3GH6 A;  3N9J A;  2DJK A;  2PN8 A;  3A2W A;  4XRD A;  2HRA A;  4V2N A;  2GSS A;  2G0F A;  1I9D A;  2VM1 A;  4OFM A;  3TUE A;  2VD1 A;  1V58 A;  4AF2 A;  3L9U A;  2L6C A;  3HJP A;  5J9B A;  3CHX C;  2DMM A;  2IJY A;  2B6M A;  2I4A A;  1WP0 A;  2YWO A;  3C71 A;  3GL5 A;  4GQC A;  4ZBA A;  2N5F A;  3LFL A;  4OD7 A;  3FZA A;  1YJ6 A;  2B1L A;  3LOR A;  1ZYN A;  4WEY A;  2WCI A;  3KJY A;  4PX1 A;  3UL3 A;  2C3Q A;  3VWV A;  4Q5R A;  3E3E A;  3HZ8 A;  1XBS A;  5DDL A;  3P8W A;  1GL8 A;  4FQU A;  1WWJ A;  4LL1 B;  5COH A;  2LRT A;  4KA0 A;  4FIW A;  2DJ2 A;  4GF0 A;  1XIY A;  4HZ4 A;  4I97 A;  2R2J A;  2GVP A;  3QAG A;  4J57 E;  3CRT A;  2VL9 A;  1T3B A;  1GSU A;  2NBS A;  4ZL8 A;  2XBI A;  4CHS A;  3E0U A;  2NPB A;  4EL1 A;  2EC4 A;  2QA1 A;  4MAB A;  1JLW A;  3TU3 B;  1GWC A;  1XW6 A;  2R0C A;  3GX0 A;  3IK9 A;  3I6A A;  3NIV A;  4ECB A;  1M3I A;  2C0E A;  1YQ1 A;  2FY6 A;  4BWQ A;  3KD0 A;  2VCW A;  3ZVJ D;  4AJ8 A;  4L0U A;  5G1K A;  1SK1 A;  5ELG A;  3JCM L;  2G2Q A;  2KLX A;  2HRK A;  1TK5 B;  2CV4 A;  2L4Q A;  1A2L A;  3VLN A;  3WGE A;  4EDZ A;  2F8F A;  1WMJ A;  4FH8 A;  4F9Z A;  2OAC A;  3APO A;  1ABA A;  4XS4 A;  5D9V A;  1XWA A;  3EE2 A;  2DJ1 A;  3KP9 A;  3NOF A;  2JSY A;  4I2T A;  1N8J A;  5A1N B;  2OE3 A;  1A0F A;  5AIS A;  3F6F A;  1O81 A;  3GKN A;  3ZVJ A;  3ERG A;  2VLU A;  5GAN D;  4PUR A;  1SJI A;  5ENU A;  4MF7 A;  4HOJ A;  2CX3 A;  4GWR A;  3GFK A;  3ZLP A;  4EF0 A;  1SL1 B;  1SU9 A;  2ON7 A;  2ALB A;  2H66 A;  3HJM A;  4OCF A;  3ZIV A;  1SKW B;  2E7P A;  4N30 A;  2I1U A;  1QMV A;  2C8U A;  4Q5F A;  1V2A A;  3HD5 A;  5D93 A;  4GCI A;  1BED A;  3LGC A;  5DQS A;  2B1K A;  1MEK A;  2HE3 A;  2JU5 A;  3WT1 A;  5IMF A;  1X9M B;  5KN1 A;  1YEW C;  2H75 A;  4LL4 B;  4G9H A;  4IKH A;  4KAE A;  4PQH A;  1B9X C;  2YWI A;  2FA8 A;  3EYT A;  1MDJ A;  4HJ2 A;  3LXZ A;  1PN0 A;  4K8M A;  5HR2 A;  4ZIL A;  2H72 A;  1TOF A;  2GQK A;  3C1R A;  4ML6 A;  1FOH A;  1OKT A;  1AUC A;  3TJF A;  1BAY A;  1K0A A;  3RPN A;  3LW9 A;  3GST A;  3QAW A;  3FR3 A;  5G2Z A;  1SJZ A;  1BYE A;  4TOP A;  1F37 A;  3IK7 A;  4HZ2 A;  1GTB A;  2FUG 2;  1X9W B;  2WW3 A;  2V1M A;  4ID0 A;  1B48 A;  3HVV A;  2PWJ A;  2HSN A;  3DKS A;  2QC7 A;  1A2M A;  1A8L A;  2FD3 A;  3I69 A;  3GKX A;  1ZYQ B;  1XOB A;  4WBJ A;  4XCS A;  4BVY A;  1NSW A;  4BVX B;  1K0O A;  3TJJ A;  5ECQ B;  2DJ0 A;  3LEF A;  4PNF A;  2JSZ A;  3MIX A;  2JZT A;  1LJR A;  3EUR A;  1SL2 B;  3VWX A;  5J4Y A;  1BX9 A;  1SVL A;  3TJG A;  2GST A;  3GA4 A;  1DBY A;  4AJ6 A;  2LJA A;  2PVQ A;  4ML1 A;  2BJX A;  1R7H A;  3I43 A;  1TTZ A;  1MDK A;  3FKF A;  1QFN A;  1Y25 A;  2HSM A;  3ZFB A;  2DKH A;  4HUA A;  5DAK B;  3FHK A;  1TU7 A;  3FMW A;  4OO5 A;  3ZIJ A;  2WDU A;  2I3Y A;  2F8A A;  1X5D A;  1S4B P;  4X1U A;  3H93 A;  5EL8 A;  3D4M A;  2YZU A;  2A4H A;  3BBY A;  5ID2 A;  4USS A;  3HVS A;  5ECO B;  2YZH A;  1GTA A;  3UVH A;  5C00 A;  1XFL A;  1EV9 A;  2HRK B;  1T00 A;  3UIW A;  1HNC A;  6GSU A;  2R3X A;  2NVL A;  4MZW A;  4MPG A;  1NW2 A;  5G5F A;  4LMW A;  3KMN A;  4HEA 2;  4AI6 A;  2E0Q A;  3FZ9 A;  2M80 A;  2B7J A;  2FA4 A;  4HI7 A;  1PMT A;  2IN3 A;  3D5J A;  2VLT A;  12GS A;  3FYG A;  2LEG A;  2L6D A; 
#chains in the Genus database with same CATH homology
 2C3T A;  3LQ7 A;  2H76 A;  4RQR A;  2MMZ A;  5HFK A;  4ILF A;  2L4C A;  1GUH A;  4EC0 A;  4TR4 A;  5D9X A;  4WBR D;  2K18 A;  1ML6 A;  1K0N A;  3R3E A;  1TRW A;  1ERV A;  2N5A A;  2DJ3 A;  4TXO B;  3QFA C;  1JZW A;  1IYH A;  2OKA A;  2TRX A;  6GSX A;  3KIJ A;  1BJX A;  3A3T A;  2LQO A;  2IMK A;  4O7H A;  1QK8 A;  1J9B A;  4TR3 A;  1Z7P A;  2O7K A;  1HQO A;  2GT6 A;  1URM A;  3G7Y A;  1SD9 A;  1YKA A;  3DRN A;  4POM A;  2I9H A;  4GST A;  1FW1 A;  2CVK A;  5IPG A;  2PVO C;  4J2F A;  4F2I A;  2P31 A;  4YQV A;  2VCV A;  2V2G A;  4BPY A;  3QDN A;  4DSQ A;  1UC7 A;  2GSQ A;  1U88 A;  1U87 A;  4MJE A;  4KE3 A;  2K6V A;  5HR1 A;  2FWE A;  3LYP A;  2H0H A;  1QUW A;  4OWY A;  2WFC A;  3Q74 A;  4GDF A;  4K0N A;  3IAS 2;  4MF6 A;  1OE8 A;  2VL2 A;  4GQF A;  3UOM A;  3IR4 A;  4HQZ A;  1OYJ A;  2O5V A;  1QGV A;  3FRC A;  3WYW A;  2JAC A;  1SYR A;  4MH2 A;  2CZ3 A;  1HNA A;  1X9S B;  1SEN A;  4NHW A;  4KDY A;  4K5R A;  3FR6 A;  4ZBD A;  4XIH A;  1ERT A;  5A1N A;  4TKY A;  4HJM A;  3LSZ A;  3APQ A;  3ZZX A;  3HMJ G;  2AV4 A;  4NMU A;  1S3A A;  5D96 A;  2H1L A;  4YQU A;  4KCE A;  2YJH A;  3TKS A;  2MBS A;  4RUV A;  4ZB6 A;  2FWF A;  2X49 A;  1XW5 A;  3CSI A;  4IJ3 A;  2FGX A;  4OO4 A;  3VFI A;  4KCA A;  1VGL A;  3F3Q A;  1ZGN A;  4IJI A;  3O3T A;  4JBB A;  1A8Y A;  1FAA A;  3CSJ A;  1XWC A;  4IS0 A;  1XWB A;  4K2X A;  4Z2U A;  1IYI A;  3L9V A;  5G1L A;  4TW5 A;  1EV4 A;  3KEB A;  2VCQ A;  5IMC A;  2EFC A;  2HXK A;  2VOC A;  1M0U A;  5HFG A;  1O6J A;  10GS A;  5EY6 A;  4ZB8 A;  4X43 A;  3CXG A;  1B8X A;  2QGV A;  1J0F A;  3D22 A;  3D21 A;  3LWA A;  2VD0 A;  5IMZ A;  5ID2 B;  2D2Z A;  4O32 A;  3UAP A;  1ERW A;  3TJK A;  1Z9H A;  4IQ1 A;  5HQP A;  16GS A;  1Y6E A;  2CAQ A;  3ERW A;  3S9F A;  2X99 A;  2BMX A;  3MNG A;  2VL3 A;  2VM2 A;  4K9Z A;  2B5X A;  1LBK A;  5C04 A;  3G7J A;  4ACS A;  1XWG A;  2O89 A;  3C73 A;  4YAP A;  1GNW A;  3CBU A;  1S3D A;  2HFD A;  4XTS A;  5LNK e;  5GZZ B;  4EE0 A;  3FEU A;  3IC8 A;  4MJB A;  3I9V 2;  1B4P A;  4K7N A;  1RW1 A;  2JL4 A;  2N5B A;  2E2G A;  2OAD A;  2VO4 A;  1B9Y C;  1UA5 A;  4YAV A;  2WRT A;  11GS A;  3A5I A;  3VPT A;  2H73 A;  1ERU A;  2R37 A;  4ZL9 A;  3P2A A;  4BVX A;  4L5L A;  2JZR A;  4AKX B;  4G19 A;  5DCG A;  2R0P A;  1GLQ A;  4IBP A;  1GP1 A;  3ME7 A;  1KTE A;  2LKU A;  4TN8 A;  1PD2 1;  1USB A;  3EU3 A;  1TK0 B;  3KZQ A;  4KH7 A;  4F03 A;  4JRR A;  3TCO A;  2JAD A;  6GSW A;  1ILO A;  4BL7 A;  4MF5 A;  3PH9 A;  5J3R A;  3ME8 A;  2UZ8 A;  5DAK A;  1ZZY A;  1SKR B;  1Z3E A;  4RI6 A;  5J5N A;  2XBQ A;  3DVW A;  5B6N A;  1TJD A;  4PQI A;  2P0G A;  1EEJ A;  2FHE A;  1GSD A;  3PR8 A;  1XVQ A;  2P5R A;  1PX6 A;  4W66 A;  2HZF A;  3CTF A;  3QCP A;  2RLI A;  3MAK A;  2VL2 C;  4LMV A;  4JU5 A;  5D9T A;  4IEL A;  2H30 A;  1ZOF A;  4NXI A;  2GZP A;  4GLT A;  3H8Q A;  1KNG A;  4YH2 A;  1EEM A;  3QAV A;  4Z2T A;  2XHF A;  1BQ7 A;  2CA8 A;  4MPF A;  2VUP A;  4EO3 A;  1F6M C;  2GLR A;  3ZIT A;  3DEX A;  1EGO A;  1FB6 A;  2C0F A;  1PL2 A;  1GRX A;  4G0L A;  2YP6 A;  1TU8 A;  3ZTL A;  5CO3 A;  4K2D A;  22GS A;  4TVE A;  3W8J A;  1SK0 A;  1Z6N A;  5ECI B;  1ZYE A;  5F06 A;  1J08 A;  4E8H A;  2O8V B;  2WJU A;  2OBK A;  3KH9 A;  1O8X A;  4YKG A;  3TKS C;  5IO2 A;  4XS6 A;  2A2S A;  2OE1 A;  3M1G A;  4KDU A;  1OVN A;  4AKI A;  4V2M A;  2V32 A;  4KND A;  2H1B A;  4TXO A;  1PN9 A;  3J7Y k;  2L57 A;  5IM9 A;  4EXJ A;  1ON4 A;  2HRN A;  1FO5 A;  2MMA A;  1AW9 A;  2K8V A;  5IOW A;  2BTO T;  2NTO A;  3BCK A;  2HT9 A;  2HQT A;  4NAX A;  2V41 A;  2C1Y A;  1PSQ A;  4IHU A;  4I2U A;  1OE7 A;  1THO A;  1XOA A;  1AQW A;  4GSS A;  1RK4 A;  3F4S A;  1WPI A;  1FHE A;  2EFE A;  3IC4 A;  4Q5Q A;  2DLX A;  2V6O A;  3HHV A;  3FK8 A;  2V6K A;  3TJB A;  4G2E A;  1TRV A;  2H74 A;  3E9J B;  1G0T A;  1FVJ A;  4EKZ A;  2J9H A;  1XW9 A;  4WR4 A;  1K3L A;  1ZCP A;  4KSM A;  5IO0 A;  4MJA A;  1GSE A;  5IQY A;  1YEX A;  3DXB A;  2F9S A;  3HCZ A;  1TXX A;  4QL7 A;  2ON5 A;  2O87 A;  4ZXG A;  5F8B A;  4D73 B;  5J4V A;  4MH3 A;  3DGQ A;  5GST A;  1HYU A;  8GSS A;  2O85 A;  1K0D A;  3ERF A;  4BA7 A;  3D4T A;  3H4K A;  3DIE A;  7GSS A;  4PGT A;  4ZBB A;  2QSI A;  20GS A;  4MDC A;  5ECN B;  1ACV A;  3BD2 A;  4DSR A;  1R5A A;  2TIR A;  4FYC A;  2HRF A;  1VRS D;  1PQN A;  3LJR A;  2X8G A;  1K3O A;  4EDY A;  4NHZ A;  2GGT A;  5HFI A;  1BG5 A;  2OA7 A;  3H1N A;  9GSS A;  3ZMK A;  5KOW A;  2C0D A;  4K7I A;  4ECJ A;  4K5S A;  1AAZ A;  1WE0 A;  5A5H B;  4QQ7 A;  5A4W A;  2PBJ A;  4O5R A;  4MZB A;  1HNB A;  1R5P A;  1K0M A;  4HQS A;  1T4Z A;  1RQM A;  5A5K A;  5IIZ A;  5J47 A;  4BL7 B;  5DAL A;  3ZL5 A;  2H0I A;  2GSR A;  5GAP D;  1OC8 A;  2HI7 A;  2DSA A;  4G0I A;  5ELA A;  1G6Y A;  3GKM A;  3CYN A;  2NDO A;  1M2B A;  1M99 A;  5H5S A;  1M2D A;  5JWQ B;  3KP8 A;  4P3Y B;  1CQH A;  1FOV A;  1GUM A;  1TW9 A;  1OC9 A;  5AIV A;  4NPB A;  1AQX A;  2F51 A;  5JWO B;  4PQ1 A;  2QKE A;  4ZB9 A;  2K8S A;  1TKD B;  3V1W A;  1SL0 B;  1TI1 A;  1WRY A;  3GMF A;  1V57 A;  2Z9S A;  1X5E A;  2KOK A;  5JCW A;  1YVL A;  1T8E B;  1W89 A;  1GUK A;  3GN3 A;  1PKW A;  3EU4 A;  4IP1 A;  2C0G A;  1CQG A;  2H0G A;  5JCU A;  3MDK A;  1AC1 A;  4HU9 A;  1YY7 A;  1TRS A;  4KUN A;  3CMI A;  4MZC A;  4CY6 A;  1GNE A;  3FW2 A;  4L0W A;  1VF3 A;  3TKR A;  1MD3 A;  1F3B A;  4GSN A;  4HS1 A;  4RI7 A;  3GUS A;  3F4T A;  3Q18 A;  5BMU A;  4ECC A;  2QA2 A;  3P7X A;  2FWG A;  5EVO A;  3EC3 A;  3W6G A;  3ZRD A;  3US3 A;  4GXZ A;  4OFT A;  2IL3 A;  5ECP B;  2H1G A;  2PGT A;  2H6Y A;  1GSQ A;  2H6Z A;  3TDG A;  4AJ7 A;  5J9C A;  5EPF A;  1MTC A;  1VF2 A;  2R5G A;  3GX8 A;  2HZE B;  3UBK A;  4RQX A;  1YKC A;  4MP4 A;  3J7Y b;  2VCZ A;  1PRX A;  4EIP A;  1GUL A;  2LNS A;  4DSS B;  4GTU A;  3O76 A;  2VLV A;  1PA3 A;  1EWX A;  1C72 A;  3ZML A;  1EP7 A;  2H71 A;  3HXS A;  2B3S A;  2ZNM A;  3VK9 A;  3DYR A;  1GH2 A;  4EVM A;  2VKZ G;  4MLY A;  5KN0 A;  3GUR A;  3QFB C;  4O5Q A;  1YEP A;  2EIQ A;  4K1F A;  5FT3 A;  2GQL A;  3HVX A;  4MK3 A;  5D73 A;  1SVO A;  3M9J A;  2EFD A;  3IHG A;  1O73 A;  5IMV A;  3DWV A;  4GRF A;  2CAI A;  2P5Q A;  1EP8 A;  2YOI A;  3AY8 A;  3F63 A;  1ST9 A;  1YF1 A;  3VWW A;  2A2R A;  5B7C A;  2YAN A;  1XXU A;  3F4R A;  4MJC A;  2GT5 A;  1DSB A;  3A2X A;  3QD9 A;  5F05 A;  1A0R P;  3LYK A;  3CWG A;  2YV9 A;  3F6D A;  3G9B A;  4QMK A;  2UV8 G;  1U3A A;  5A34 B;  5H5R A;  3GNJ A;  1MD4 A;  1PL1 A;  3DML A;  3HJO A;  1O8W A;  2X8H A;  2F3M A;  1EOG A;  3M8N A;  3H79 A;  1DUG A;  3UJ1 A;  1KBN A;  2YN1 A;  4IP6 A;  5DAL B;  3HDC A;  4F0C A;  2YCD A;  3A5W A;  4XRA A;  4K7O A;  5E59 A;  5J40 A;  1JFU A;  1M7T A;  2KHP A;  2A2P A;  2DIZ A;  1XVW A;  5ECL B;  3FY7 A;  4KW6 A;  3IA1 A;  4EIQ A;  3C1S A;  4PXO A;  2HSH A;  2LTK A;  3TKS E;  5GSS A;  2H70 A;  3GSS A;  3GYK A;  1WIK A;  4KSO A;  17GS A;  3IRA A;  6GST A;  1E2Y A;  3VI5 A;  1OC9 B;  1Z7R A;  5DVB A;  1T7P B;  3RHC A;  2XC2 A;  3BJ5 A;  1Y1U A;  3KMO A;  2TRC P;  3ZFL A;  2IFQ B;  3Q6O A;  2FLS A;  5JWR B;  4IW9 A;  4ZB7 A;  1OAZ A;  1ZMA A;  2B5E A;  2CZ2 A;  3C8E A;  1R4W A;  1THX A;  4D73 A;  4FYU A;  4NWY A;  1G7E A;  5E4W A;  4IGJ A;  1TK8 B;  2KP2 A;  4OCE A;  2C3N A;  4NV5 A;  2DML A;  3TRQ A;  4K0G A;  2HNL A;  1V98 A;  1BF5 A;  1X0R A;  4N0Z A;  1NHO A;  1E6B A;  5BMU B;  4AGS A;  1U6T A;  5JCG A;  4PNG A;  2AAW A;  2X4A A;  1JLV A;  5H5Q A;  4IN0 A;  4WXT A;  4BWS A;  5KOX A;  2AYT A;  2JZS A;  3EWL A;  2FCH A;  3WGX A;  5BRT A;  5A5H A;  2L5O A;  5CRG A;  4G01 A;  2DIY A;  4FYB A;  1UVZ A;  2RII A;  3GL3 A;  1LU4 A;  4POK A;  2EIO A;  1Z5Y E;  5A4U A;  2KP1 A;  4A5P A;  2AUV A;  3DD3 A;  2YV7 A;  3RAZ A;  5ECH B;  3N5O A;  3TOT A;  3SBC A;  1TRU A;  5B8A A;  5INY A;  2H6X A;  2PER A;  1M9B A;  1GSS A;  4HDE A;  3TRP A;  2YWM A;  3TB2 A;  3LG6 A;  1QQ2 A;  3IDV A;  2L59 A;  2WB9 A;  2R4V A;  4K6X A;  2LRN A;  1SYX A;  1EOH A;  5CP1 A;  1A24 A;  4HU7 A;  5DBQ A;  4L5O A;  1V40 A;  4MA9 A;  5FWG A;  2H01 A;  2I81 A;  1GTI A;  3IXR A;  3KTB A;  3GV1 A;  2HSY A;  3L9S A;  4NV2 A;  2ZUP A;  3UAR A;  2R0G A;  3G7I A;  2MYG A;  5CRW A;  2EFH A;  1K3Y A;  2C80 A;  3HKR A;  5J4U A;  1PX7 A;  5ECK B;  5A4V A;  1HD2 A;  2LV3 A;  3U5R E;  5IMA A;  4G0K A;  1JZO A;  3SWL A;  5DJM A;  2PPT A;  3ZYW A;  3IAM 2;  2KUC A;  3A2V A;  2DJJ A;  2X8C A;  3KM6 A;  3VWU A;  5HR3 A;  2FNO A;  1ZL9 A;  3R2Q A;  1Q98 A;  3GIX A;  5DJL A;  2RUF A;  1K0B A;  3D0Z A;  1H4O A;  2DC5 A;  1F9M A;  3TKP A;  3O6T A;  2GZZ A;  2HZE A;  1T4Y A;  2IME A;  4CW9 A;  4V1A g;  1H75 A;  4KB3 A;  1JHB A;  2CT6 A;  1OC3 A;  1F2E A;  3QPM A;  3MSZ A;  4JED A;  3P90 A;  5B6M A;  4DSS A;  1X5C A;  4WET A;  4Q5N A;  2GQM A;  1PGT A;  2PMT A;  5KEJ A;  4IVF A;  2OBI A;  1N25 A;  5LCZ A;  3M0F A;  5B8B A;  1XPV A;  2MZC A;  3L78 A;  2EIR A;  3LXT A;  1FG4 A;  1SD8 A;  5IMD A;  4F82 A;  2LST A;  4TR1 B;  5KN3 A;  4JR4 A;  4TR0 A;  1JZD A;  2MMN A;  5CRD A;  3UVT A;  1PKZ A;  1B4Q A;  1NHY A;  4TRX A;  5ECS A;  3RPP A;  2ES7 A;  3D6I A;  3IBH A;  4OFN A;  1T1V A;  3WGD A;  6GSS A;  2RM6 A;  4QL9 A;  2IMF A;  4TXV A;  2GTU A;  4Z7X A;  4F0B A;  2WZ9 A;  2CVB A;  2XPE A;  3WD6 A;  3ED3 A;  2K9F A;  3KTL A;  5ABR A;  5G30 A;  4G10 A;  2B5Y A;  5AN1 A;  3GH9 A;  5D8I A;  5CYY A;  1FB0 A;  5A34 A;  3GHA A;  5CNW A;  1AIU A;  1ZYP A;  5ECM B;  1MDI A;  3APS A;  4POL A;  3DVX A;  1M9A A;  3M9K A;  3EVI A;  5G5E A;  1V9W A;  1QXH A;  2WGR A;  3HYP A;  4YKF A;  5ECR B;  2GZY A;  3HY2 A;  4WR5 A;  3PGT A;  1TXU A;  4H86 A;  2B7K A;  4AKG A;  4J56 E;  1SKS B;  2MMO A;  3FZ4 A;  3GTU A;  4WF5 A;  3IHQ A;  2DBC A;  2PU9 C;  1R26 A;  3W8S A;  2H19 A;  2PUK C;  4ZIJ A;  4V1A p;  3F8U A;  1F3A A;  3TKQ A;  1A23 A;  4N0V A;  3TRX A;  2IMD A;  3VPQ A;  4X4J A;  1N2A A;  2IFQ A;  2YPM A;  3FZ5 A;  2VCT A;  4O92 A;  3BCI A;  4XHM A;  3ISO A;  4CY8 A;  2LJK A;  3ZRE A;  1NM3 A;  3L0H A;  3VUR A;  2IWT A;  1KEB A;  2IMI A;  4I8B A;  2AHE A;  2LNT A;  2VAF A;  2OE0 A;  3QOU A;  4ECI A;  1SVM A;  5KN2 A;  3RBT A;  1XCC A;  3WT2 A;  4KX4 A;  3GKK A;  3K8N A;  3IV4 A;  1Q4J A;  4IQA A;  3GRX A;  1DE1 A;  3KCM A;  1TP9 A;  3KGK A;  4PUF C;  1GLP A;  1EGR A;  4KDX A;  4JE1 A;  2WUL A;  1BG1 A;  3QMX A;  2ZCT A;  4XS4 B;  2VCX A;  3F3R A;  2H8L A;  3PPU A;  3L4N A;  3C7M A;  4ICY A;  4ZL7 A;  5F0G A;  3VI7 A;  3HZ4 A;  4ISD A;  1DE2 A;  2CVD A;  2GDR A;  5IPH A;  2LUS A;  3EMP A;  3NZN A;  4FO5 A;  3EMX A;  2E2M A;  1SK2 A;  3OR5 A;  4DVC A;  1WJK A;  5L71 A;  2YWN A;  1XZO A;  4E8E A;  3RDW A;  6GSY A;  3IPZ A;  1FVK A;  2LJR A;  4MNN A;  1GSF A;  4Z2R A;  2OT3 A;  4E68 A;  4X0X A;  4PUA A;  2REM A;  1YF0 A;  4KGI A;  1W4V A;  4POB A;  2WS2 A;  3KXO A;  3PIN A;  5G31 A;  1G6W A;  14GS A;  2LRC A;  1M2A A;  1TDI A;  3FR9 A;  2LQQ A;  2IIY A;  1GSY A;  4EUY A;  2VIM A;  2YNX A;  2XPD A;  5J41 A;  2FWH A;  2M46 A;  1VF4 A;  3F9U A;  4OMV A;  3RHB A;  5CAX A;  4N10 A;  2OJL A;  2RM5 A;  2IPA A;  3M3M A;  3QR6 A;  3IOS A;  1I5G A;  3TGZ A;  4KF9 A;  5IOX A;  5DQY A;  1YDK A;  2LS5 A;  2L5L A;  1SJ6 A;  2AJQ B;  2M72 A;  2AB6 A;  1TI3 A;  1UN2 A;  4DEJ A;  2RUE A;  3MYD A;  3UMA A;  2R6K A;  3MWH A;  3KH7 A;  4WKW A;  3CTG A;  1WOU A;  3IE3 A;  4I5Q A;  2HSN B;  4LA1 A;  2HYX A;  1Z6M A;  1O7U A;  3CSH A;  4BVY B;  1OKD A;  5HR0 A;  2X64 A;  2CQ9 A;  6GSV A;  2H1D A;  1K0C A;  3F0I A;  4LLR A;  2HLS A;  4YQM A;  5AIX A;  1XWK A;  4N11 A;  2MBT A;  2A4V A;  5AGY A;  1VF1 A;  1YZX A;  4WF4 A;  1A2J A;  2YJ7 A;  3GTU B;  4JZQ A;  1AXD A;  1JZR A;  3Q19 A;  1U3I A;  3EIN A;  3TOU A;  4AKH A;  4N3Z A;  1S3C A;  5CRH A;  2HSM B;  4O5U A;  1O85 A;  4XS1 A;  3CRU A;  1GTU A;  5D9W A;  18GS A;  4I6X A;  2J23 A;  2DKI A;  2CX4 A;  1EZK A;  3BOA A;  4JR6 A;  5CRE A;  5LD0 A;  1G7O A;  19GS A;  5F07 A;  5DCH A;  4PTS A;  1AQV A;  4TR1 A;  5FHI A;  3EPT A;  4ULX A;  3UEM A;  3U6V A;  2GS3 A;  4MMM A;  3UBL A;  4L8E A;  2C4J A;  13GS A;  4V2L A;  4CDO A;  3HA9 A;  2H1A A;  4MCU A;  3GH6 A;  3N9J A;  2DJK A;  2PN8 A;  3A2W A;  4XRD A;  2HRA A;  4V2N A;  2GSS A;  2G0F A;  1I9D A;  2VM1 A;  4OFM A;  3TUE A;  2VD1 A;  1V58 A;  4AF2 A;  3L9U A;  2L6C A;  3HJP A;  5J9B A;  2DMM A;  2IJY A;  2B6M A;  2I4A A;  1WP0 A;  2YWO A;  3C71 A;  3GL5 A;  4GQC A;  4ZBA A;  2N5F A;  3LFL A;  4OD7 A;  3FZA A;  1YJ6 A;  2B1L A;  3LOR A;  1ZYN A;  4WEY A;  2WCI A;  3KJY A;  4PX1 A;  3UL3 A;  2C3Q A;  3VWV A;  4Q5R A;  3E3E A;  3HZ8 A;  1XBS A;  5DDL A;  3P8W A;  1GL8 A;  4FQU A;  1WWJ A;  4LL1 B;  5COH A;  2LRT A;  4KA0 A;  4FIW A;  2DJ2 A;  4GF0 A;  1XIY A;  4HZ4 A;  4I97 A;  2R2J A;  2GVP A;  3QAG A;  4J57 E;  3CRT A;  2VL9 A;  1T3B A;  1GSU A;  2NBS A;  4ZL8 A;  2XBI A;  4CHS A;  3E0U A;  2NPB A;  4EL1 A;  2EC4 A;  2QA1 A;  4MAB A;  1JLW A;  3TU3 B;  1GWC A;  1XW6 A;  2R0C A;  3GX0 A;  3IK9 A;  3I6A A;  3NIV A;  4ECB A;  2C0E A;  2FY6 A;  1YQ1 A;  4BWQ A;  3KD0 A;  2VCW A;  3ZVJ D;  4AJ8 A;  4L0U A;  5G1K A;  1SK1 A;  5ELG A;  3JCM L;  2G2Q A;  2KLX A;  2HRK A;  1TK5 B;  2CV4 A;  2L4Q A;  1A2L A;  3VLN A;  3WGE A;  4EDZ A;  2F8F A;  1WMJ A;  4FH8 A;  4F9Z A;  2OAC A;  3APO A;  1ABA A;  4XS4 A;  5D9V A;  1XWA A;  3EE2 A;  2DJ1 A;  3KP9 A;  3NOF A;  2JSY A;  4I2T A;  1N8J A;  5A1N B;  2OE3 A;  1A0F A;  5AIS A;  3F6F A;  1O81 A;  3GKN A;  3ZVJ A;  3ERG A;  2VLU A;  5GAN D;  4PUR A;  1SJI A;  5ENU A;  4MF7 A;  4HOJ A;  2CX3 A;  4GWR A;  3GFK A;  3ZLP A;  4EF0 A;  1SL1 B;  1SU9 A;  2ON7 A;  2ALB A;  2H66 A;  3HJM A;  4OCF A;  3ZIV A;  1SKW B;  2E7P A;  4N30 A;  2I1U A;  1QMV A;  2C8U A;  4Q5F A;  1V2A A;  3HD5 A;  5D93 A;  4GCI A;  1BED A;  3LGC A;  5DQS A;  2B1K A;  1MEK A;  2HE3 A;  2JU5 A;  3WT1 A;  5IMF A;  1X9M B;  5KN1 A;  2H75 A;  4LL4 B;  4G9H A;  4IKH A;  4KAE A;  4PQH A;  1B9X C;  2YWI A;  2FA8 A;  3EYT A;  1MDJ A;  4HJ2 A;  3LXZ A;  1PN0 A;  4K8M A;  5HR2 A;  4ZIL A;  2H72 A;  1TOF A;  2GQK A;  3C1R A;  4ML6 A;  1FOH A;  1OKT A;  1AUC A;  3TJF A;  1BAY A;  1K0A A;  3RPN A;  3LW9 A;  3GST A;  3QAW A;  3FR3 A;  5G2Z A;  1SJZ A;  1BYE A;  4TOP A;  1F37 A;  3IK7 A;  4HZ2 A;  1GTB A;  2FUG 2;  1X9W B;  2V1M A;  4ID0 A;  1B48 A;  3HVV A;  2PWJ A;  2HSN A;  3DKS A;  2QC7 A;  1A2M A;  1A8L A;  2FD3 A;  3I69 A;  3GKX A;  1ZYQ B;  1XOB A;  4WBJ A;  4XCS A;  4BVY A;  1NSW A;  4BVX B;  1K0O A;  3TJJ A;  3LEF A;  5ECQ B;  2DJ0 A;  4PNF A;  2JSZ A;  3MIX A;  2JZT A;  1LJR A;  3EUR A;  1SL2 B;  3VWX A;  5J4Y A;  1BX9 A;  1SVL A;  3TJG A;  2GST A;  3GA4 A;  1DBY A;  4AJ6 A;  2LJA A;  2PVQ A;  4ML1 A;  2BJX A;  1R7H A;  3I43 A;  1TTZ A;  1MDK A;  3FKF A;  1QFN A;  1Y25 A;  2HSM A;  3ZFB A;  2DKH A;  4HUA A;  5DAK B;  3FHK A;  1TU7 A;  3FMW A;  4OO5 A;  3ZIJ A;  2WDU A;  2I3Y A;  2F8A A;  1X5D A;  4X1U A;  3H93 A;  5EL8 A;  3D4M A;  2YZU A;  2A4H A;  3BBY A;  5ID2 A;  4USS A;  3HVS A;  5ECO B;  2YZH A;  1GTA A;  3UVH A;  5C00 A;  1XFL A;  1EV9 A;  2HRK B;  1T00 A;  3UIW A;  1HNC A;  6GSU A;  2R3X A;  2NVL A;  4MZW A;  4MPG A;  1NW2 A;  5G5F A;  4LMW A;  3KMN A;  4HEA 2;  4AI6 A;  2E0Q A;  3FZ9 A;  2M80 A;  2B7J A;  2FA4 A;  4HI7 A;  1PMT A;  2IN3 A;  3D5J A;  2VLT A;  12GS A;  3FYG A;  2LEG A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...