22GSA

Human glutathione s-transferase p1-1 y49f mutant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLFGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title Thermodynamic description of the effect of the mutation Y49F on human glutathione transferase P1-1 in binding with glutathione and the inhibitor S-hexylglutathione.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 22gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 22gsA01
2IMFA 3WGEA 1AIUA 2FWEA 4I5QA 3IXRA 3TKSA 1I9DA 2EIOA 5IO0A 2ON5A 4RI6A 4ID0A 1SKSB 4TW5A 3G7IA 2WZ9A 5DCGA 4E8EA 1MDJA 2F8AA 4QQ7A 1TI3A 5HR2A 4OO4A 3KJYA 3DGQA 4ZXGA 1TXXA 1A2JA 4IGJA 4MF6A 3LJRA 2H6ZA 1O6JA 1OVNA 1XFLA 5IMVA 4L0UA 5GAPD 5DAKB 2YN1A 4I8BA 4F0CA 3J7Yb 4CHSA 2GGTA 4NPBA 3HVVA 5KN3A 4GSSA 1KTEA 1QGVA 4TXOB 3N9JA 2MBSA 2YV7A 3WD6A 2GVPA 1FB6A 3VWVA 2K9FA 1VF1A 3GKXA 3F4RA 1J9BA 3EVIA 4Q5QA 4YQUA 4BVXA 3CSJA 2PBJA 2O85A 2FY6A 2C80A 2ES7A 3LG6A 3TKRA 3W8SA 5DCHA 1A8YA 4GXZA 1XVQA 4LA1A 4NXIA 3H8QA 2AYTA 4GTUA 4PUFC 13GSA 4ZL7A 2DSAA 2YJHA 1HQOA 1SK1A 4XS4B 2FGXA 4FIWA 3ZRDA 4Q5NA 4HI7A 2X8CA 5CYYA 4LMVA 3KIJA 4DSQA 1K0CA 2DIYA 3QOUA 5F07A 3I69A 1XW9A 3U5RE 1TTZA 4OO5A 4MPFA 3VI5A 3F6FA 2JU5A 3IAS2 4ACSA 1UN2A 2KLXA 2LUSA 4HS1A 3FZ5A 4WBRD 2GT6A 1PA3A 4PNGA 2I81A 5B6MA 3GYKA 2YWNA 2O89A 5DJMA 1N2AA 2FNOA 2B3SA 4XTSA 3A5WA 2WFCA 3VWWA 2YWMA 1SL1B 4NWYA 4POKA 2OE1A 5D9TA 3LQ7A 3VI7A 4HZ4A 2R2JA 2GQKA 1OC3A 5EY6A 1Z5YE 2R5GA 2PU9C 3F8UA 3VLNA 5GSSA 2VCVA 1R26A 1JZDA 1BX9A 4OCFA 5KN0A 1XPVA 4XRDA 3G9BA 2WJUA 2GSRA 2DJ0A 1YEPA 2YZHA 4O5RA 5IO2A 4ECCA 8GSSA 2XC2A 2LRCA 3FKFA 3QAWA 1PL1A 4MCUA 4YH2A 4RQRA 2IFQB 2LV3A 1THOA 2HE3A 1TRWA 2LRTA 3IV4A 2LJRA 3VPTA 2L4QA 1Z7PA 4ZIJA 1ZCPA 3WGXA 3F4TA 2RM6A 2AJQB 3TKSE 5AIXA 2CAQA 4HU7A 4QL9A 1UVZA 2V2GA 4ZB8A 3GX0A 4GQFA 2MBTA 4EF0A 2MMZA 3GKKA 1USBA 3IRAA 4KGIA 1N8JA 4F03A 4NV2A 3A2WA 1F9MA 1TK0B 2ON7A 2LS5A 3PGTA 3GH6A 1Q98A 6GSSA 3DRNA 1NHYA 4IS0A 4MMMA 3KCMA 4I97A 1XBSA 5GZZB 1JHBA 4TRXA 1SD9A 5HFKA 3SBCA 1Z7RA 1DSBA 4XIHA 12GSA 3QDNA 1U6TA 2FCHA 4DVCA 5F8BA 1XOAA 2F9SA 2CX4A 4BVYB 1X9SB 2R4VA 1FAAA 7GSSA 4E8HA 4HEA2 2LJKA 3D4TA 4KDUA 4F9ZA 1GNWA 5GAND 3CMIA 4TKYA 4TR1B 2K18A 4POLA 1PRXA 4ECIA 4L8EA 5ELGA 5EVOA 3GH9A 3KP8A 1G0TA 4RI7A 4BWSA 1GTIA 4TR3A 1T1VA 3KH9A 3QFBC 4RUVA 1TRVA 3FYGA 2PMTA 3ZLPA 5ID2B 3UIWA 2C0GA 1OAZA 2HRKA 1I5GA 4EDZA 2A4VA 2H6XA 3DVWA 4IBPA 1GTAA 5JCWA 2WCIA 3L0HA 5CO3A 4MZCA 2LTKA 2P31A 1U88A 3HZ4A 1M9AA 2F3MA 20GSA 1WWJA 4GF0A 3A2VA 1GSYA 4IN0A 3GA4A 5IMAA 1K0BA 4P3YB 2HLSA 2IN3A 4X1UA 2MMOA 1BAYA 4V1Ap 5DALA 4MZWA 5IMZA 4GCIA 3KGKA 3ZZXA 2H1BA 1FG4A 2GSSA 4KB3A 5HQPA 2L5OA 1MD4A 1NM3A 4FYCA 5D73A 3DEXA 5ID2A 1JZOA 2M46A 2H72A 3US3A 1G6WA 2HZEB 1T3BA 3TOUA 3TJGA 3LWAA 2H74A 3E3EA 4KDXA 2RIIA 1TI1A 2VLUA 1GULA 1YF0A 2BMXA 1V40A 4KCEA 2WRTA 1Y25A 2O87A 1SJIA 2YWOA 3EMXA 1XW5A 1H75A 1GSSA 4IQ1A 1X9WB 4KA0A 4KE3A 5H5RA 4MJBA 4AGSA 1YEXA 2BJXA 4MJEA 2OJLA 4KCAA 4KUNA 2J23A 3NIVA 1XZOA 4N11A 4XS6A 5G31A 3D21A 3PR8A 5GSTA 4ZBBA 1AC1A 2LNTA 3W6GA 2AAWA 3IC8A 5J9BA 4HUAA 4TN8A 2HSMA 2B7KA 1QUWA 1T7PB 5CNWA 5KEJA 2Z9SA 4L5OA 4EO3A 5G1KA 3CTGA 5D9WA 2FD3A 4N10A 3ERGA 2X8HA 3BCKA 3TRXA 2GQLA 1F6MC 3CTFA 3BOAA 19GSA 4G19A 2KOKA 2WS2A 2PGTA 4GSTA 4XHMA 1S3AA 5KN1A 1M99A 1A8LA 5C00A 5D8IA 1ZMAA 3UBLA 1A24A 4G10A 5LCZA 3HVSA 1J0FA 5DBQA 4DSSA 1OC8A 2HFDA 1WRYA 1QQ2A 4EVMA 16GSA 1B9XC 4AJ8A 3GHAA 2VOCA 1GSFA 3IC4A 2QKEA 2IL3A 5B7CA 2F51A 4G0IA 2C4JA 3IHQA 3ZMKA 4H86A 1SKRB 3UMAA 3FW2A 2AUVA 2X8GA 4V2LA 1YJ6A 3IA1A 3M8NA 3KMOA 2L6CA 2I9HA 3QFAC 5CRGA 1SKWB 3F4SA 2VD0A 2GQMA 1ERWA 2HT9A 3BJ5A 4JR6A 1NHOA 4G0KA 2DMLA 2CT6A 6GSUA 5FT3A 4N30A 4O92A 2WGRA 1B4PA 4K0GA 1Z6NA 4K7NA 5AGYA 1BJXA 4MLYA 2B7JA 4USSA 2VL2A 3RPNA 5J9CA 1ERVA 2O7KA 4I6XA 1GSEA 1GUMA 3HJOA 3FR6A 2RM5A 3FZ4A 2YPMA 3F3RA 2AV4A 3F9UA 4YQVA 3E9JB 2FWGA 1M0UA 2DIZA 2GLRA 3D0ZA 3GSSA 3TJFA 5D96A 4HZ2A 1WMJA 1T4ZA 2VL3A 1FVJA 3HHVA 3GL5A 4LLRA 1GUHA 3I6AA 2H1DA 1A2MA 4ZILA 3L9UA 3VWUA 1PX6A 3GSTA 1XXUA 2MYGA 2IPAA 4TVEA 5EL8A 1A2LA 2UZ8A 3EU3A 3AY8A 3GNJA 5JCGA 3ISOA 1EWXA 3BCIA 2E0QA 2PN8A 2YP6A 2XBQA 3NZNA 1V9WA 1YQ1A 1K0OA 4D73B 5DAKA 4X0XA 5ECQB 3ZMLA 1B8XA 3TKSC 1M2DA 4TXOA 1QFNA 2H19A 3JCML 3LFLA 2XPDA 2VLVA 2YOIA 3CRTA 1AXDA 2TIRA 3L4NA 4N0VA 1EZKA 1RQMA 1FW1A 4HQSA 2NBSA 2VLTA 1A23A 2KP2A 1PQNA 1EGRA 4PQHA 1Q4JA 3EURA 2V6KA 3EE2A 4BL7B 2VCTA 3GV1A 1TK8B 2HXKA 4MF5A 3IPZA 3ZTLA 4XS4A 4ZL9A 2VCWA 5ECIB 2MMAA 4OMVA 3A2XA 5HR1A 3QD9A 4J2FA 2ALBA 2C8UA 5G30A 1EEMA 4WR4A 5DVBA 1SL0B 1M9BA 1X5EA 3ED3A 6GSTA 1R5AA 2BTOT 1R7HA 5HR0A 2CV4A 2HYXA 1LBKA 2C3QA 1NW2A 1A0RP 5CRWA 2DJ3A 3GKMA 4BPYA 2FWFA 2F8FA 2R3XA 3EMPA 5A4VA 3P7XA 1KBNA 4GQCA 5A5KA 1YKCA 1G6YA 3HY2A 4MH2A 1OKTA 2RUEA 1DE1A 4G0LA 5JCUA 1V57A 4G9HA 3APQA 2I4AA 2M80A 1YF1A 3EYTA 5B8BA 4TR4A 1TW9A 2VCXA 5DQSA 2PWJA 4WEYA 4AF2A 1AUCA 2RLIA 1T8EB 4K7OA 2GSQA 1SU9A 1TRUA 2N5AA 2CVDA 3BD2A 3C7MA 5ECNB 4MH3A 10GSA 3UJ1A 2H30A 1UA5A 4XRAA 1LJRA 5A4WA 1DUGA 4YAVA 4NHWA 2H0GA 2IFQA 4JE1A 2CQ9A 1XIYA 2YWIA 5ECHB 6GSWA 2VUPA 4I2UA 4NMUA 5IOXA 1EV9A 3FR9A 2G0FA 4PGTA 1EEJA 1F37A 3M0FA 3TRQA 4N0ZA 3WT1A 3BBYA 3GTUB 1QMVA 3M1GA 5ECPB 1X5DA 2MZCA 1XVWA 3KTLA 3F63A 1T00A 1YKAA 3C8EA 3F6DA 4MABA 2B5EA 3QPMA 2FUG2 4K1FA 4TR0A 1GNEA 2C0FA 1O81A 4FH8A 5D9XA 1ERUA 4V2MA 1R5PA 4NAXA 2HRAA 1X0RA 2QGVA 3DIEA 2KP1A 4EE0A 2LJAA 2IMKA 3ZL5A 5CAXA 2VM1A 3L9SA 2C3TA 2FLSA 4BVYA 4MP4A 1OYJA 4L0WA 1XWGA 4EKZA 4WF5A 2C3NA 3HCZA 3QAVA 2HRNA 2C0EA 1IYHA 5J5NA 2VM2A 4ECJA 2JL4A 1SK0A 4TR1A 1TOFA 1VF2A 3UEMA 2QC7A 1GWCA 1MDKA 1TU8A 3EINA 1GLPA 3ZVJA 1PKWA 2V6OA 5E59A 4DEJA 1B9YC 3KP9A 2XPEA 3TOTA 1R4WA 2HSYA 1AAZA 3D6IA 1SYRA 5KN2A 2B1KA 1XWBA 5IIZA 4XCSA 3TDGA 3ZIVA 2JACA 1K0MA 3TJKA 2DMMA 3UBKA 3TKPA 2GTUA 3C73A 1C72A 3CSHA 2R6KA 1EP8A 4ML6A 3KZQA 2O8VB 3KH7A 3QAGA 1ZGNA 1OC9B 4EDYA 3ZFBA 4DSRA 2CVKA 3APSA 3TRPA 2CA8A 3HJMA 2GZZA 1MDIA 1XWAA 4MF7A 2TRXA 5E4WA 2HNLA 1B48A 3H93A 1URMA 4PQ1A 1O85A 1PX7A 3EWLA 4WETA 1KEBA 1NSWA 4J56E 1K3YA 4WBJA 3V1WA 5IQYA 4WXTA 1O8WA 4LMWA 4JRRA 1ZYEA 2JZSA 3IR4A 3OR5A 1ZOFA 2P0GA 2PVOC 2R37A 3HVXA 1VGLA 4KF9A 3DWVA 3MNGA 4Q5RA 1WP0A 3Q18A 1PGTA 17GSA 2H1AA 2HZEA 5FHIA 4K9ZA 2YCDA 2PVQA 4GLTA 3CBUA 2AHEA 3D22A 3Q74A 4X43A 5CRDA 2TRCP 3WYWA 2C0DA 3CRUA 4NV5A 2IMEA 2VCZA 1OKDA 3F0IA 5CREA 1JFUA 1SENA 4ZB6A 1ST9A 1W89A 2NTOA 4F2IA 5B8AA 4EUYA 1TDIA 2L57A 3H79A 1K3LA 2CZ2A 5G5EA 5J41A 1ERTA 3KM6A 1T4YA 4ZB9A 4HQZA 1CQHA 3HYPA 3TB2A 1LU4A 3KTBA 1F2EA 6GSXA 2VL9A 1PL2A 3DKSA 5BMUA 2HQTA 3R3EA 3TKQA 4O7HA 5IMCA 2GS3A 1X9MB 3QMXA 1XWCA 2LSTA 3IBHA 3C1SA 3TCOA 5ECOB 3ZYWA 4ULXA 2WULA 1X5CA 5COHA 1WJKA 1QXHA 3MSZA 3ERWA 4ZBAA 5INYA 3C71A 2E2MA 1ZZYA 18GSA 2IMIA 3LGCA 1VRSD 5IPHA 3LEFA 1MTCA 1HNCA 1E6BA 2PUKC 3M9JA 4I2TA 5ECKB 4IP6A 3HXSA 5HFIA 4AJ6A 1K0AA 4MPGA 3P2AA 4F0BA 4OCEA 2JSYA 2OA7A 2ZNMA 4AJ7A 14GSA 2ZCTA 2OKAA 1HYUA 1FO5A 4PXOA 4LL1B 3GMFA 4K6XA 1DBYA 1OE8A 4L5LA 3P90A 1GTBA 3LYPA 1CQGA 2H76A 3L9VA 2LQOA 4POMA 4BVXB 1EOHA 3HD5A 3KEBA 4EXJA 4V1Ag 4ISDA 4KNDA 3DVXA 1TRSA 2P5QA 4IP1A 3L78A 1DE2A 2XBIA 3P8WA 1GRXA 3QCPA 1GTUA 4HOJA 1ZL9A 5D93A 2CX3A 3HZ8A 1TP9A 2N5BA 2AB6A 2OE3A 2PPTA 3Q19A 2IJYA 1F3BA 2ZUPA 2KHPA 1JLWA 5L71A 1MD3A 5ECSA 4CW9A 1SJ6A 3FRCA 1HNAA 2H0IA 2GT5A 3O6TA 3I9V2 1Z9HA 1TKDB 3RHBA 3MDKA 3RDWA 4IVFA 1ZYQB 2I1UA 5ECRB 1QK8A 4JU5A 3ZREA 2WDUA 1BG5A 2H75A 1A0FA 1THXA 3IK7A 5IMFA 2YV9A 3UARA 4CDOA 2A2RA 3VK9A 2HRFA 2VL2C 2JZTA 3D5JA 5ECMB 5ABRA 4IQAA 4HJMA 5LD0A 1JZWA 2IMDA 4K8MA 3R2QA 1H4OA 1PMTA 3CYNA 1AQWA 1OE7A 2LQQA 4G2EA 2CVBA 2JZRA 2H6YA 2YANA 4FYUA 5F05A 2OE0A 2EIQA 4D73A 2V41A 1SYXA 2NPBA 1SJZA 2PERA 2IIYA 3RBTA 3M9KA 3UAPA 3FK8A 4OWYA 1BYEA 2OBKA 3F3QA 1GH2A 2VCQA 3M3MA 3FHKA 5AISA 1XOBA 6GSVA 2M72A 5FWGA 4J57E 3ME7A 1GUKA 3WGDA 4F82A 4PUAA 4TOPA 3NOFA 4FO5A 2H1GA 3KMNA 3U6VA 1G7OA 22GSA 2FA8A 5IM9A 5AN1A 1YY7A 2L4CA 1SK2A 3GX8A 4BL7A 4ILFA 1GLQA 4V2NA 4GWRA 1HNBA 2OACA 3KD0A 3ZIJA 2L6DA 3EU4A 4MA9A 3HKRA 5B6NA 2LKUA 4GRFA 4IW9A 4ZBDA 3N5OA 2K6VA 1TJDA 1V2AA 2HSNB 3O3TA 2V1MA 3ZITA 4KW6A 3GUSA 2H8LA 4FQUA 5DJLA 5J3RA 4JR4A 4OFNA 1WPIA 1ON4A 4NHZA 3S9FA 2E7PA 4O32A 2DJJA 1EOGA 3DYRA 1ABAA 1TU7A 3C1RA 2NVLA 2DJKA 4ECBA 2HSHA 5H5QA 1M2AA 4MDCA 5G5FA 4WF4A 5ELAA 2VIMA 3ERFA 5AIVA 6GSYA 2E2GA 2KUCA 4PURA 5C04A 4JBBA 4KDYA 1GL8A 1O73A 3GFKA 1KNGA 5J4UA 1O7UA 2EIRA 5JWOB 3K8NA 1AQXA 2HRKB 5H5SA 3H1NA 2GZYA 3D4MA 2K8VA 4KAEA 11GSA 4WR5A 3IDVA 2C1YA 3HJPA 2YJ7A 4YAPA 1S3DA 1HD2A 1XW6A 2I3YA 4HU9A 1GSUA 1VF3A 3SWLA 4K2DA 5ECLB 2H0HA 4MK3A 3GIXA 2H73A 5JWQB 4FYBA 3PPUA 1JLVA 2YZUA 1WIKA 4HJ2A 1BQ7A 2GSTA 3HA9A 4OFMA 3LXTA 3GN3A 5F0GA 2N5FA 4ZL8A 1FHEA 1FVKA 2YNXA 3E0UA 3VURA 5DALB 4IJIA 2LEGA 4BWQA 2RUFA 4OD7A 1U87A 4IHUA 2CZ3A 3ME8A 3TJBA 3UOMA 2NDOA 3GTUA 3RPPA 2OADA 3IE3A 4YQMA 3PINA 3CXGA 3ZVJD 1Z3EA 3MWHA 3KXOA 3ZFLA 3GKNA 3O76A 4MZBA 4PNFA 4KSOA 1AW9A 4JEDA 2VAFA 2GDRA 3CSIA 1BEDA 1PSQA 1S3CA 2B6MA 4BA7A 3MAKA 1UC7A 4IELA 5ENUA 4MJAA 1TK5B 1G7EA 2D2ZA 2H71A 2B1LA 4OFTA 1V98A 3W8JA 4PQIA 2OBIA 2L5LA 2L59A 1GP1A 3HDCA 5DDLA 3APOA 3LYKA 5JWRB 2XHFA 1VF4A 1K0NA 3J7Yk 4GSNA 2JSZA 1GSDA 1K0DA 4Z7XA 4EC0A 1EGOA 3UVTA 2DC5A 2A2SA 1J08A 2QSIA 1ILOA 3LORA 3LXZA 1K3OA 2FWHA 3H4KA 2V32A 1Y6EA 4ML1A 2REMA 3GL3A 2VO4A 1E2YA 2DJ1A 3G7YA 1PKZA 2HSMB 3LSZA 1RW1A 3VWXA 1FOVA 1WOUA 1M2BA 1RK4A 2DLXA 1U3AA 5IPGA 3Q6OA 3TUEA 5D9VA 9GSSA 1OC9A 1FB0A 3GURA 3EC3A 4IJ3A 2HI7A 2P5RA 2LNSA 2EC4A 3UL3A 1W4VA 1M7TA 4PTSA 4WKWA 4KX4A 1ACVA 2JADA 4DSSB 3PH9A 1GSQA 1U3IA 2X64A 5LNKe 4EL1A 2FHEA 2K8SA 2H01A 4JZQA 3IK9A 2MMNA 2G2QA 3DXBA 1V58A 3TGZA 1IYIA 3FEUA 2WB9A 2HZFA 1AQVA 4Q5FA 3FZAA 3IAM2 3VFIA 1MEKA 3I43A 5G1LA 2GZPA 1XCCA 5EPFA 5G2ZA 3FY7A 4XS1A 1JZRA 5CRHA 5IOWA 3QR6A 3TJJA 4K7IA 3RHCA 1EP7A 1PN9A 2J9HA 3IOSA 1YZXA 4KSMA 4TXVA 2VD1A 2DBCA 4K0NA 4POBA 2B5YA 2H70A 3FZ9A 2FA4A 3FR3A 2B5XA 5HFGA 4IKHA 2H66A 3WT2A 2IWTA 4QL7A 1SD8A 3DMLA 1EV4A 1F3AA 5HR3A 1SL2B 2DJ2A 3DD3A 4RQXA 3G7JA 3GRXA 1O8XA 3A3TA 1ML6A 2X99A 3RAZA 3UVHA 5DQYA 4HDEA 3VPQA 1PD21 5CP1A 4LL4B 2CAIA 4KH7A 1B4QA 1WE0A 5A4UA 2LRNA 1YDKA 4MJCA 5IMDA 5F06A 1Z6MA 1XWKA 4PX1A
chains in the Genus database with same CATH superfamily
2IMFA 3WGEA 1AIUA 2FWEA 4I5QA 4Z2RA 3IXRA 3TKSA 1I9DA 2EIOA 5IO0A 2ON5A 4RI6A 4ID0A 1ZYPA 1SKSB 4TW5A 3G7IA 2WZ9A 5DCGA 4E8EA 5J40A 1MDJA 2F8AA 4QQ7A 1TI3A 5HR2A 4OO4A 3KJYA 3DGQA 4ZXGA 1TXXA 1A2JA 5A5HA 4IGJA 4MF6A 3LJRA 2H6ZA 1O6JA 5A1NA 1OVNA 1XFLA 5IMVA 4L0UA 5GAPD 5DAKB 2YN1A 4I8BA 4F0CA 3J7Yb 4CHSA 2O3EA 2GGTA 4NPBA 3HVVA 5KN3A 4GSSA 1KTEA 1QGVA 2O36A 4TXOB 3N9JA 2MBSA 2YV7A 3WD6A 2GVPA 1FB6A 3VWVA 2K9FA 1VF1A 3GKXA 3F4RA 1J9BA 3EVIA 4Q5QA 4YQUA 4BVXA 3CSJA 2PBJA 2O85A 2FY6A 2C80A 2ES7A 3LG6A 3TKRA 3W8SA 5DCHA 1A8YA 4GXZA 1XVQA 4LA1A 4NXIA 3H8QA 2AYTA 4GTUA 4PUFC 13GSA 4ZL7A 2DSAA 2YJHA 1HQOA 1SK1A 4XS4B 2FGXA 4FIWA 3ZRDA 4Q5NA 4HI7A 2X8CA 5CYYA 4LMVA 3KIJA 4DSQA 1K0CA 2DIYA 3QOUA 5F07A 3I69A 1XW9A 3U5RE 1TTZA 4OO5A 4MPFA 3VI5A 3F6FA 2JU5A 3IAS2 4ACSA 1UN2A 2KLXA 2LUSA 4HS1A 3FZ5A 4WBRD 4Z2UA 2GT6A 1PA3A 4PNGA 2I81A 2EFDA 5B6MA 3GYKA 2YWNA 2O89A 5DJMA 1N2AA 2FNOA 2B3SA 4XTSA 3A5WA 2WFCA 3VWWA 2YWMA 1SL1B 4NWYA 4POKA 2OE1A 5D9TA 3LQ7A 3VI7A 4HZ4A 3TU3B 2R2JA 2GQKA 1OC3A 5EY6A 1Z5YE 2R5GA 2PU9C 3F8UA 3VLNA 5GSSA 2VCVA 1R26A 1JZDA 1BX9A 4OCFA 5KN0A 1XPVA 4XRDA 3G9BA 2WJUA 2GSRA 2DJ0A 1YEPA 2YZHA 3MYDA 4O5RA 5IO2A 5A34A 4ECCA 5BRTA 5J4YA 2R0CA 8GSSA 2XC2A 2LRCA 3FKFA 3QAWA 1PL1A 4MCUA 4YH2A 4RQRA 2IFQB 2LV3A 1THOA 2HE3A 1TRWA 2LRTA 3IV4A 2LJRA 4YKGA 3VPTA 2L4QA 1Z7PA 4ZIJA 1ZCPA 3WGXA 3F4TA 2RM6A 2AJQB 3TKSE 5AIXA 2CAQA 4HU7A 4QL9A 2DKHA 1UVZA 2V2GA 4ZB8A 3GX0A 4GQFA 2MBTA 4EF0A 2MMZA 3GKKA 1USBA 3IRAA 4KGIA 1N8JA 4F03A 4NV2A 3A2WA 1F9MA 1TK0B 2ON7A 2LS5A 3PGTA 3GH6A 5J47A 1Q98A 6GSSA 4CY6A 3DRNA 1NHYA 4IS0A 4MMMA 3KCMA 4I97A 1XBSA 5GZZB 1JHBA 4TRXA 1SD9A 5HFKA 3SBCA 1Z7RA 1DSBA 4XIHA 12GSA 3QDNA 1U6TA 2FCHA 4DVCA 5F8BA 1XOAA 2F9SA 2CX4A 4BVYB 1X9SB 2R4VA 1FAAA 7GSSA 2HSNA 4E8HA 4HEA2 2LJKA 3D4TA 2WVYA 4KDUA 4F9ZA 4ICYA 1GNWA 5GAND 3CMIA 4TKYA 4TR1B 2K18A 4POLA 1PRXA 4ECIA 4L8EA 5ELGA 5EVOA 3GH9A 3KP8A 1G0TA 4RI7A 4AKHA 4BWSA 1GTIA 2O5VA 4TR3A 1T1VA 3KH9A 3QFBC 4RUVA 1TRVA 3FYGA 2PMTA 3ZLPA 5ID2B 3UIWA 2C0GA 1OAZA 2HRKA 1I5GA 4EDZA 2A4VA 2H6XA 3DVWA 4IBPA 1GTAA 5JCWA 2WCIA 3L0HA 5CO3A 4MZCA 2LTKA 2P31A 1U88A 3HZ4A 1M9AA 2F3MA 20GSA 1WWJA 2WVXA 4GF0A 3A2VA 1GSYA 4MNNA 4IN0A 3GA4A 5IMAA 1K0BA 4P3YB 2HLSA 2IN3A 4X1UA 2MMOA 1BAYA 4V1Ap 5DALA 4MZWA 5IMZA 4GCIA 3KGKA 3ZZXA 2H1BA 1FG4A 2GSSA 4KB3A 5HQPA 2L5OA 1MD4A 1NM3A 4FYCA 5D73A 3DEXA 5ID2A 1JZOA 2M46A 2H72A 3US3A 1G6WA 2HZEB 1T3BA 3TOUA 3TJGA 3LWAA 2H74A 3E3EA 4KDXA 2RIIA 1TI1A 2VLUA 1GULA 1YF0A 2BMXA 1V40A 4KCEA 2WRTA 1Y25A 2O87A 1SJIA 2YWOA 3EMXA 1XW5A 1H75A 1GSSA 3EPTA 4IQ1A 1X9WB 4KA0A 4KE3A 5H5RA 4MJBA 4AGSA 1YEXA 2BJXA 4MJEA 2OJLA 4KCAA 4QMKA 4KUNA 2J23A 5BMUB 3NIVA 1XZOA 4N11A 5KOXA 4XS6A 5G31A 3D21A 3PR8A 5GSTA 2WW0A 4ZBBA 1AC1A 2LNTA 3W6GA 2AAWA 3IC8A 5J9BA 4HUAA 4TN8A 2HSMA 2B7KA 1QUWA 1T7PB 5CNWA 5KEJA 2Z9SA 4L5OA 4EO3A 5G1KA 1N25A 3CTGA 5D9WA 2FD3A 4N10A 3ERGA 4PI0C 2X8HA 3BCKA 3TRXA 2EFCA 1F6MC 2GQLA 3CTFA 3BOAA 19GSA 4G19A 2KOKA 2WS2A 2PGTA 4GSTA 4XHMA 1S3AA 5KN1A 1M99A 1A8LA 5C00A 5D8IA 1ZMAA 3UBLA 1A24A 4G10A 4K2XA 1SVMA 5LCZA 3HVSA 1J0FA 5DBQA 2OT3A 4DSSA 1OC8A 2HFDA 1WRYA 1QQ2A 4EVMA 16GSA 1B9XC 4AJ8A 3GHAA 1Y1UA 4ZB7A 2VOCA 1GSFA 3IC4A 2QKEA 2IL3A 5B7CA 2F51A 4G0IA 2C4JA 3IHQA 3ZMKA 4H86A 1SKRB 3UMAA 3FW2A 2AUVA 2X8GA 4V2LA 1YJ6A 3IA1A 3M8NA 3KMOA 2L6CA 2I9HA 3QFAC 5CRGA 1SKWB 3F4SA 2VD0A 2GQMA 1ERWA 2HT9A 3BJ5A 4JR6A 4W66A 1NHOA 4G0KA 2DMLA 2CT6A 6GSUA 5FT3A 4N30A 4O92A 2WGRA 1B4PA 4BIKA 4K0GA 1Z6NA 2DKIA 4K7NA 5AGYA 1BJXA 4MLYA 2B7JA 4USSA 2VL2A 3RPNA 5J9CA 1ERVA 2O7KA 4I6XA 1GSEA 1I1IP 2X49A 1GUMA 3HJOA 3FR6A 2RM5A 3FZ4A 2YPMA 3F3RA 2AV4A 3F9UA 4YQVA 3E9JB 2FWGA 1M0UA 2DIZA 2GLRA 3D0ZA 3GSSA 3TJFA 5D96A 4HZ2A 1WMJA 1T4ZA 2VL3A 4Z2TA 1FVJA 3HHVA 3GL5A 4LLRA 3I6AA 1GUHA 2H1DA 1A2MA 4ZILA 3L9UA 3VWUA 1SVLA 1PX6A 3GSTA 1XXUA 2MYGA 2IPAA 4TVEA 5EL8A 1A2LA 2UZ8A 2R0PA 3EU3A 3AY8A 3GNJA 5JCGA 3ISOA 1EWXA 3BCIA 2E0QA 4K5SA 2PN8A 2YP6A 2XBQA 3NZNA 1V9WA 1YQ1A 1K0OA 4D73B 5DAKA 1BG1A 4X0XA 5ECQB 3ZMLA 1B8XA 3TKSC 1M2DA 4TXOA 1QFNA 2H19A 3JCML 3LFLA 2XPDA 2VLVA 2YOIA 3CRTA 1AXDA 2TIRA 3L4NA 4N0VA 1EZKA 1RQMA 1FW1A 4AKXB 4HQSA 2NBSA 2VLTA 1A23A 2KP2A 1PQNA 1EGRA 4PQHA 3EURA 1Q4JA 2EFEA 2V6KA 3EE2A 4BL7B 2VCTA 3CQFA 4A5PA 3GV1A 1TK8B 2HXKA 4MF5A 3IPZA 3ZTLA 4XS4A 4ZL9A 2VCWA 5ECIB 2MMAA 4OMVA 3A2XA 5HR1A 3QD9A 4J2FA 2ALBA 2C8UA 5G30A 1EEMA 4WR4A 5DVBA 1SL0B 1M9BA 1X5EA 3ED3A 6GSTA 1R5AA 2BTOT 1R7HA 1SVOA 5HR0A 2CV4A 2HYXA 1LBKA 2C3QA 1NW2A 1A0RP 5CRWA 2DJ3A 3GKMA 4BPYA 2FWFA 2F8FA 2R3XA 3EMPA 5A4VA 3P7XA 1KBNA 4GQCA 5A5KA 1YKCA 1G6YA 3HY2A 4MH2A 1OKTA 2WW3A 2RUEA 1DE1A 4G0LA 5JCUA 1V57A 4G9HA 3APQA 2I4AA 2M80A 1YF1A 3EYTA 5B8BA 4TR4A 1TW9A 2VCXA 5DQSA 2PWJA 4WEYA 4AF2A 1AUCA 2RLIA 1T8EB 4K7OA 2GSQA 1SU9A 1TRUA 2N5AA 2CVDA 3BD2A 3C7MA 5ECNB 4MH3A 10GSA 3UJ1A 2H30A 1UA5A 4XRAA 1LJRA 5A4WA 1DUGA 4YAVA 4NHWA 2H0GA 2IFQA 4JE1A 2CQ9A 1XIYA 2YWIA 5ECHB 6GSWA 2VUPA 4I2UA 4NMUA 5IOXA 1EV9A 3FR9A 1M3JA 2G0FA 4PGTA 1EEJA 1F37A 3M0FA 3TRQA 4N0ZA 3WT1A 3BBYA 3GTUB 1QMVA 3M1GA 5ECPB 1X5DA 2MZCA 1XVWA 3KTLA 3F63A 1T00A 1YKAA 3C8EA 3F6DA 4MABA 2B5EA 3QPMA 2FUG2 3RFRC 4K1FA 4TR0A 1GNEA 2C0FA 1O81A 4FH8A 5D9XA 1ERUA 4V2MA 1R5PA 4NAXA 2HRAA 4AI6A 1X0RA 3RGBC 2QGVA 3DIEA 2KP1A 4X4JA 4EE0A 2LJAA 2IMKA 3ZL5A 5CAXA 2VM1A 3L9SA 2C3TA 2FLSA 4BVYA 4MP4A 1OYJA 4L0WA 1XWGA 4EKZA 4WF5A 2C3NA 3HCZA 3QAVA 2HRNA 2C0EA 1IYHA 5J5NA 2VM2A 4ECJA 2JL4A 1SK0A 2WVZA 4TR1A 1TOFA 1VF2A 3UEMA 2QC7A 1GWCA 1MDKA 1TU8A 3EINA 1GLPA 3ZVJA 1PKWA 2V6OA 5E59A 4DEJA 1B9YC 3KP9A 2XPEA 3TOTA 1R4WA 2HSYA 1AAZA 3D6IA 1SYRA 5KN2A 2B1KA 1XWBA 5IIZA 4XCSA 3TDGA 3ZIVA 2JACA 1K0MA 3TJKA 2DMMA 3UBKA 3TKPA 2GTUA 3C73A 1C72A 3CSHA 2R6KA 1EP8A 4ML6A 3KZQA 2EFHA 2O8VB 3QAGA 3KH7A 1ZGNA 1OC9B 4EDYA 3ZFBA 4DSRA 2CVKA 3APSA 3TRPA 2CA8A 4AKGA 3HJMA 2GZZA 1MDIA 1XWAA 4MF7A 2TRXA 5E4WA 2HNLA 1B48A 3H93A 1URMA 4PQ1A 1O85A 1PX7A 3EWLA 4WETA 1KEBA 1NSWA 4J56E 1K3YA 4WBJA 3V1WA 5IQYA 4WXTA 1O8WA 4LMWA 4JRRA 1ZYEA 2JZSA 3IR4A 3OR5A 1ZOFA 2P0GA 2PVOC 2R37A 3HVXA 1FOHA 1VGLA 4KF9A 3DWVA 3MNGA 4Q5RA 1WP0A 3Q18A 1PGTA 2H1AA 17GSA 2HZEA 5FHIA 2QA2A 4K9ZA 2YCDA 2PVQA 4GLTA 3CBUA 2AHEA 3D22A 3Q74A 4X43A 5CRDA 2TRCP 3WYWA 2C0DA 3CRUA 4NV5A 2IMEA 2VCZA 1OKDA 3F0IA 5CREA 1JFUA 1SENA 4ZB6A 1ST9A 1W89A 2NTOA 4F2IA 5B8AA 4EUYA 1TDIA 2L57A 3H79A 1K3LA 2CZ2A 5G5EA 5J41A 1ERTA 3KM6A 1T4YA 4ZB9A 4HQZA 1CQHA 3HYPA 3TB2A 1LU4A 3KTBA 1F2EA 6GSXA 2VL9A 1PL2A 3DKSA 5BMUA 4EIPA 2HQTA 3R3EA 3TKQA 4O7HA 5IMCA 2GS3A 1X9MB 3QMXA 1XWCA 2LSTA 3IBHA 3C1SA 3TCOA 5ECOB 3ZYWA 4PI2C 4ULXA 2WULA 1X5CA 5COHA 1S3RA 1WJKA 1QXHA 3MSZA 3ERWA 4ZBAA 5INYA 3C71A 2E2MA 1ZZYA 18GSA 2IMIA 3LGCA 1VRSD 4O5QA 5IPHA 3LEFA 1MTCA 1HNCA 1E6BA 2PUKC 3M9JA 2X4AA 4I2TA 5ECKB 4IP6A 5A5HB 3HXSA 5HFIA 3FMWA 4AJ6A 1K0AA 5A1NB 4MPGA 3P2AA 4F0BA 4OCEA 4HSCX 2JSYA 2OA7A 2ZNMA 4AJ7A 14GSA 2ZCTA 2OKAA 1HYUA 1FO5A 4PXOA 4LL1B 3GMFA 4K6XA 1DBYA 1OE8A 4L5LA 1GTBA 3LYPA 3P90A 1CQGA 2H76A 3L9VA 2LQOA 4POMA 4BVXB 1EOHA 1TXUA 3HD5A 3KEBA 4EXJA 4V1Ag 4ISDA 2R0GA 4KNDA 3DVXA 1TRSA 2P5QA 4IP1A 3L78A 1DE2A 2XBIA 3P8WA 4O5UA 1GRXA 3QCPA 1GTUA 4HOJA 4GDFA 1ZL9A 1BF5A 5D93A 2CX3A 3HZ8A 1TP9A 2N5BA 2AB6A 2OE3A 2PPTA 3Q19A 2IJYA 2ZUPA 1F3BA 2KHPA 1JLWA 5L71A 1MD3A 5ECSA 4CW9A 1SJ6A 3FRCA 1HNAA 2H0IA 2GT5A 3O6TA 3I9V2 1Z9HA 1TKDB 3RHBA 3MDKA 3RDWA 4IVFA 1ZYQB 4AKIA 2I1UA 3CHXC 5ECRB 1QK8A 4JU5A 3ZREA 2WDUA 1BG5A 2H75A 1A0FA 1THXA 3IK7A 5IMFA 2YV9A 3UARA 4CDOA 2A2RA 3VK9A 2HRFA 2VL2C 5A34B 2JZTA 1PN0A 3D5JA 5ECMB 5ABRA 2WW1A 4IQAA 4HJMA 5LD0A 1JZWA 2IMDA 1H4OA 3R2QA 4E68A 4K8MA 1PMTA 3CYNA 1AQWA 1OE7A 2LQQA 4G2EA 2CVBA 2JZRA 2H6YA 2YANA 4FYUA 5F05A 2OE0A 2EIQA 4D73A 3IHGA 2V41A 1SYXA 2NPBA 1SJZA 2PERA 2IIYA 5J4VA 3RBTA 3M9KA 3UAPA 3FK8A 4OWYA 1BYEA 2OBKA 2QA1A 1GH2A 3F3QA 2VCQA 3M3MA 3FHKA 5AISA 1XOBA 6GSVA 2M72A 4G01A 5FWGA 4J57E 4PHZC 3ME7A 1GUKA 3WGDA 4F82A 4PUAA 4TOPA 3NOFA 4FO5A 2H1GA 3KMNA 3U6VA 1G7OA 22GSA 2FA8A 5IM9A 5AN1A 1YY7A 2L4CA 1SK2A 3GX8A 4BL7A 4ILFA 1GLQA 4V2NA 4GWRA 1HNBA 2OACA 3KD0A 3ZIJA 2L6DA 3EU4A 4MA9A 3HKRA 1YEWC 5B6NA 2LKUA 4GRFA 4IW9A 4ZBDA 3N5OA 2K6VA 2UV8G 1TJDA 1V2AA 1M3IA 2HSNB 3O3TA 2V1MA 3ZITA 4KW6A 3GUSA 2H8LA 4FQUA 5DJLA 5J3RA 4JR4A 4OFNA 1WPIA 1ON4A 4NHZA 3S9FA 2E7PA 4O32A 2DJJA 1EOGA 3DYRA 1ABAA 2A2PA 1TU7A 3C1RA 2NVLA 2DJKA 4ECBA 4YKFA 2HSHA 5H5QA 1M2AA 4MDCA 5G5FA 4WF4A 5ELAA 2VIMA 3ERFA 5AIVA 6GSYA 2E2GA 2KUCA 4PURA 5C04A 4JBBA 4KDYA 2WW2A 1GL8A 1O73A 3GFKA 1KNGA 5J4UA 1O7UA 2EIRA 5JWOB 3K8NA 1AQXA 2HRKB 5H5SA 3H1NA 2GZYA 3D4MA 2K8VA 4KAEA 11GSA 4WR5A 3IDVA 2C1YA 3HJPA 2YJ7A 4YAPA 1S3DA 1HD2A 1XW6A 2I3YA 4HU9A 1GSUA 1VF3A 3SWLA 4K2DA 5ECLB 2H0HA 5KOWA 4MK3A 3GIXA 2H73A 5JWQB 4FYBA 2WVXB 3PPUA 1JLVA 2YZUA 1WIKA 4HJ2A 1BQ7A 2GSTA 3HA9A 4OFMA 3LXTA 3GN3A 5F0GA 2N5FA 4ZL8A 1FHEA 1FVKA 2YNXA 3E0UA 3VURA 5DALB 4IJIA 2LEGA 4BWQA 2RUFA 4OD7A 1U87A 4IHUA 2CZ3A 3ME8A 4CY8A 3TJBA 3UOMA 2NDOA 3GTUA 3RPPA 2OADA 3IE3A 4YQMA 3PINA 3CXGA 3ZVJD 1Z3EA 3KXOA 3GKNA 3ZFLA 3MWHA 2WZSA 3O76A 4MZBA 4PNFA 4KSOA 1AW9A 4JEDA 2VAFA 2GDRA 3CSIA 1BEDA 1PSQA 1S3CA 2B6MA 4BA7A 4EIQA 3MAKA 1UC7A 4IELA 5ENUA 4MJAA 1TK5B 1G7EA 2D2ZA 2H71A 2B1LA 4OFTA 1V98A 3W8JA 4PQIA 2OBIA 2L5LA 2L59A 1GP1A 3A5IA 3HDCA 5DDLA 3APOA 3LYKA 5JWRB 2XHFA 4N3ZA 1VF4A 1K0NA 3J7Yk 4GSNA 2JSZA 1GSDA 1K0DA 4Z7XA 4EC0A 1EGOA 3UVTA 2DC5A 2A2SA 1J08A 2QSIA 1ILOA 3LORA 3LXZA 1K3OA 4FXYP 2FWHA 3H4KA 1S4BP 2V32A 1Y6EA 4ML1A 2REMA 3GL3A 2VO4A 1E2YA 2DJ1A 3G7YA 1PKZA 2HSMB 3LSZA 1RW1A 3VWXA 1FOVA 1WOUA 1M2BA 1RK4A 2DLXA 1U3AA 5IPGA 3Q6OA 3CWGA 3TUEA 5D9VA 9GSSA 1OC9A 1FB0A 3GURA 3EC3A 4IJ3A 3HVNA 2HI7A 2P5RA 2LNSA 2EC4A 3UL3A 1W4VA 1M7TA 4PTSA 4WKWA 4KX4A 1ACVA 2JADA 4DSSB 3PH9A 1GSQA 1U3IA 2X64A 5LNKe 4EL1A 2FHEA 2K8SA 2H01A 4JZQA 3MIXA 2H1LA 3IK9A 2MMNA 2G2QA 3DXBA 1YVLA 1V58A 3TGZA 1IYIA 3FEUA 2WB9A 2HZFA 1AQVA 4Q5FA 3FZAA 3IAM2 3VFIA 1MEKA 3I43A 5G1LA 2GZPA 1XCCA 5EPFA 5G2ZA 3FY7A 4XS1A 1JZRA 5CRHA 5IOWA 3QR6A 1XG8A 3TJJA 4K7IA 3RHCA 1EP7A 1PN9A 2J9HA 3IOSA 3HMJG 1YZXA 4KSMA 4TXVA 2VD1A 2DBCA 4K0NA 4POBA 3LW9A 1ZYNA 3FZ9A 2B5YA 2H70A 2FA4A 3FR3A 2B5XA 5HFGA 4IKHA 2H66A 3WT2A 2IWTA 4QL7A 1SD8A 3DMLA 1EV4A 1F3AA 5HR3A 1SL2B 2A4HA 2DJ2A 2VKZG 3DD3A 4RQXA 3G7JA 4K5RA 3GRXA 1O8XA 3A3TA 1ML6A 2X99A 3RAZA 3UVHA 5DQYA 4HDEA 3VPQA 1PD21 5CP1A 4LL4B 2CAIA 4KH7A 1B4QA 1WE0A 5A4UA 2LRNA 1YDKA 1PFOA 4MJCA 5IMDA 5F06A 1Z6MA 1XWKA 4PX1A
chains in the Genus database with same CATH topology
2IMFA 3WGEA 1AIUA 2FWEA 4I5QA 4Z2RA 3IXRA 3TKSA 1I9DA 2EIOA 5IO0A 2ON5A 4RI6A 4ID0A 1ZYPA 1SKSB 4TW5A 3G7IA 2WZ9A 5DCGA 4E8EA 5J40A 1MDJA 2F8AA 4QQ7A 1TI3A 5HR2A 4OO4A 3KJYA 3DGQA 4ZXGA 1TXXA 1A2JA 5A5HA 4IGJA 4MF6A 3LJRA 2H6ZA 1O6JA 5A1NA 1OVNA 1XFLA 5IMVA 4L0UA 5GAPD 5DAKB 2YN1A 4I8BA 4F0CA 3J7Yb 4CHSA 2GGTA 4NPBA 3HVVA 5KN3A 4GSSA 1KTEA 1QGVA 4TXOB 3N9JA 2MBSA 2YV7A 3WD6A 2GVPA 1FB6A 3VWVA 2K9FA 1VF1A 3GKXA 3F4RA 1J9BA 3EVIA 4Q5QA 4YQUA 4BVXA 3CSJA 2PBJA 2O85A 2FY6A 2C80A 2ES7A 3LG6A 3TKRA 3W8SA 5DCHA 1A8YA 4GXZA 1XVQA 4LA1A 4NXIA 3H8QA 2AYTA 4GTUA 4PUFC 13GSA 4ZL7A 2DSAA 2YJHA 1HQOA 1SK1A 4XS4B 2FGXA 4FIWA 3ZRDA 4Q5NA 4HI7A 2X8CA 5CYYA 4LMVA 3KIJA 4DSQA 1K0CA 2DIYA 3QOUA 5F07A 3I69A 1XW9A 3U5RE 1TTZA 4OO5A 4MPFA 3VI5A 3F6FA 2JU5A 3IAS2 4ACSA 1UN2A 2KLXA 2LUSA 4HS1A 3FZ5A 4WBRD 4Z2UA 2GT6A 1PA3A 4PNGA 2I81A 2EFDA 5B6MA 3GYKA 2YWNA 2O89A 5DJMA 1N2AA 2FNOA 2B3SA 4XTSA 3A5WA 2WFCA 3VWWA 2YWMA 1SL1B 4NWYA 4POKA 2OE1A 5D9TA 3LQ7A 3VI7A 4HZ4A 3TU3B 2R2JA 2GQKA 1OC3A 5EY6A 1Z5YE 2R5GA 2PU9C 3F8UA 3VLNA 5GSSA 2VCVA 1R26A 1JZDA 1BX9A 4OCFA 5KN0A 1XPVA 4XRDA 3G9BA 2WJUA 2GSRA 2DJ0A 1YEPA 2YZHA 3MYDA 4O5RA 5IO2A 5A34A 4ECCA 5BRTA 5J4YA 2R0CA 8GSSA 2XC2A 2LRCA 3FKFA 3QAWA 1PL1A 4MCUA 4YH2A 4RQRA 2IFQB 2LV3A 1THOA 2HE3A 1TRWA 2LRTA 3IV4A 2LJRA 4YKGA 3VPTA 2L4QA 1Z7PA 4ZIJA 1ZCPA 3WGXA 3F4TA 2RM6A 2AJQB 3TKSE 5AIXA 2CAQA 4HU7A 4QL9A 2DKHA 1UVZA 2V2GA 4ZB8A 3GX0A 4GQFA 2MBTA 4EF0A 2MMZA 3GKKA 1USBA 3IRAA 4KGIA 1N8JA 4F03A 4NV2A 3A2WA 1F9MA 1TK0B 2ON7A 2LS5A 3PGTA 3GH6A 5J47A 1Q98A 6GSSA 4CY6A 3DRNA 1NHYA 4IS0A 4MMMA 3KCMA 4I97A 1XBSA 5GZZB 1JHBA 4TRXA 1SD9A 5HFKA 3SBCA 1Z7RA 1DSBA 4XIHA 12GSA 3QDNA 1U6TA 2FCHA 4DVCA 5F8BA 1XOAA 2F9SA 2CX4A 4BVYB 1X9SB 2R4VA 1FAAA 7GSSA 2HSNA 4E8HA 4HEA2 2LJKA 3D4TA 4KDUA 4F9ZA 4ICYA 1GNWA 5GAND 3CMIA 4TKYA 4TR1B 2K18A 4POLA 1PRXA 4ECIA 4L8EA 5ELGA 5EVOA 3GH9A 3KP8A 1G0TA 4RI7A 4AKHA 4BWSA 1GTIA 2O5VA 4TR3A 1T1VA 3KH9A 3QFBC 4RUVA 1TRVA 3FYGA 2PMTA 3ZLPA 5ID2B 3UIWA 2C0GA 1OAZA 2HRKA 1I5GA 4EDZA 2A4VA 2H6XA 3DVWA 4IBPA 1GTAA 5JCWA 2WCIA 3L0HA 5CO3A 4MZCA 2LTKA 2P31A 1U88A 3HZ4A 1M9AA 2F3MA 20GSA 1WWJA 4GF0A 3A2VA 1GSYA 4MNNA 4IN0A 3GA4A 5IMAA 1K0BA 4P3YB 2HLSA 2IN3A 4X1UA 2MMOA 1BAYA 4V1Ap 5DALA 4MZWA 5IMZA 4GCIA 3KGKA 3ZZXA 2H1BA 1FG4A 2GSSA 4KB3A 5HQPA 2L5OA 1MD4A 1NM3A 4FYCA 5D73A 3DEXA 5ID2A 1JZOA 2M46A 2H72A 3US3A 1G6WA 2HZEB 1T3BA 3TOUA 3TJGA 3LWAA 2H74A 3E3EA 4KDXA 2RIIA 1TI1A 2VLUA 1GULA 1YF0A 2BMXA 1V40A 4KCEA 2WRTA 1Y25A 2O87A 1SJIA 2YWOA 3EMXA 1XW5A 1H75A 1GSSA 4IQ1A 3EPTA 1X9WB 4KA0A 4KE3A 5H5RA 4MJBA 4AGSA 1YEXA 2BJXA 4MJEA 2OJLA 4KCAA 4QMKA 4KUNA 2J23A 5BMUB 3NIVA 1XZOA 4N11A 5KOXA 4XS6A 5G31A 3D21A 3PR8A 5GSTA 4ZBBA 1AC1A 2LNTA 3W6GA 2AAWA 3IC8A 5J9BA 4HUAA 4TN8A 2HSMA 2B7KA 1QUWA 1T7PB 5CNWA 5KEJA 2Z9SA 4L5OA 4EO3A 5G1KA 1N25A 3CTGA 5D9WA 2FD3A 4N10A 3ERGA 2X8HA 3BCKA 3TRXA 2EFCA 1F6MC 2GQLA 3CTFA 3BOAA 19GSA 4G19A 2KOKA 2WS2A 2PGTA 4GSTA 4XHMA 1S3AA 5KN1A 1M99A 1A8LA 5C00A 5D8IA 1ZMAA 3UBLA 1A24A 4G10A 4K2XA 1SVMA 5LCZA 3HVSA 1J0FA 5DBQA 2OT3A 4DSSA 1OC8A 2HFDA 1WRYA 1QQ2A 4EVMA 16GSA 1B9XC 4AJ8A 3GHAA 1Y1UA 4ZB7A 2VOCA 1GSFA 3IC4A 2QKEA 2IL3A 5B7CA 2F51A 4G0IA 2C4JA 3IHQA 3ZMKA 4H86A 1SKRB 3UMAA 3FW2A 2AUVA 2X8GA 4V2LA 1YJ6A 3IA1A 3M8NA 3KMOA 2L6CA 2I9HA 3QFAC 5CRGA 1SKWB 3F4SA 2VD0A 2GQMA 1ERWA 2HT9A 3BJ5A 4JR6A 4W66A 1NHOA 4G0KA 2DMLA 2CT6A 6GSUA 5FT3A 4N30A 4O92A 2WGRA 1B4PA 4K0GA 1Z6NA 2DKIA 4K7NA 5AGYA 1BJXA 4MLYA 2B7JA 4USSA 2VL2A 3RPNA 5J9CA 1ERVA 2O7KA 4I6XA 1GSEA 2X49A 1GUMA 3HJOA 3FR6A 2RM5A 3FZ4A 2YPMA 3F3RA 2AV4A 3F9UA 4YQVA 3E9JB 2FWGA 1M0UA 2DIZA 2GLRA 3D0ZA 3GSSA 3TJFA 5D96A 4HZ2A 1WMJA 1T4ZA 2VL3A 4Z2TA 1FVJA 3HHVA 3GL5A 4LLRA 3I6AA 1GUHA 2H1DA 1A2MA 4ZILA 3L9UA 3VWUA 1SVLA 1PX6A 3GSTA 1XXUA 2MYGA 2IPAA 4TVEA 5EL8A 1A2LA 2UZ8A 2R0PA 3EU3A 3AY8A 3GNJA 5JCGA 3ISOA 1EWXA 3BCIA 2E0QA 4K5SA 2PN8A 2YP6A 2XBQA 3NZNA 1V9WA 1YQ1A 1K0OA 4D73B 5DAKA 1BG1A 4X0XA 5ECQB 3ZMLA 1B8XA 3TKSC 1M2DA 4TXOA 1QFNA 2H19A 3JCML 3LFLA 2XPDA 2VLVA 2YOIA 3CRTA 1AXDA 2TIRA 3L4NA 4N0VA 1EZKA 1RQMA 1FW1A 4AKXB 4HQSA 2NBSA 2VLTA 1A23A 2KP2A 1PQNA 1EGRA 4PQHA 1Q4JA 3EURA 2EFEA 2V6KA 3EE2A 4BL7B 2VCTA 4A5PA 3GV1A 1TK8B 2HXKA 4MF5A 3IPZA 3ZTLA 4XS4A 4ZL9A 2VCWA 5ECIB 2MMAA 4OMVA 3A2XA 5HR1A 3QD9A 4J2FA 2ALBA 2C8UA 5G30A 1EEMA 4WR4A 5DVBA 1SL0B 1M9BA 1X5EA 3ED3A 6GSTA 1R5AA 2BTOT 1R7HA 1SVOA 5HR0A 2CV4A 2HYXA 1LBKA 2C3QA 1NW2A 1A0RP 5CRWA 2DJ3A 3GKMA 4BPYA 2FWFA 2F8FA 2R3XA 3EMPA 5A4VA 3P7XA 1KBNA 4GQCA 5A5KA 1YKCA 1G6YA 3HY2A 4MH2A 1OKTA 2RUEA 1DE1A 4G0LA 5JCUA 1V57A 4G9HA 3APQA 2I4AA 2M80A 1YF1A 3EYTA 5B8BA 4TR4A 1TW9A 2VCXA 5DQSA 2PWJA 4WEYA 4AF2A 1AUCA 2RLIA 1T8EB 4K7OA 2GSQA 1SU9A 1TRUA 2N5AA 2CVDA 3BD2A 3C7MA 5ECNB 4MH3A 10GSA 3UJ1A 2H30A 1UA5A 4XRAA 1LJRA 5A4WA 1DUGA 4YAVA 4NHWA 2H0GA 2IFQA 4JE1A 2CQ9A 1XIYA 2YWIA 5ECHB 6GSWA 2VUPA 4I2UA 4NMUA 5IOXA 1EV9A 3FR9A 2G0FA 4PGTA 1EEJA 1F37A 3M0FA 3TRQA 4N0ZA 3WT1A 3BBYA 3GTUB 1QMVA 3M1GA 5ECPB 1X5DA 2MZCA 1XVWA 3KTLA 3F63A 1T00A 1YKAA 3C8EA 3F6DA 4MABA 2B5EA 3QPMA 2FUG2 4K1FA 4TR0A 1GNEA 2C0FA 1O81A 4FH8A 5D9XA 1ERUA 4V2MA 1R5PA 4NAXA 2HRAA 4AI6A 1X0RA 2QGVA 3DIEA 2KP1A 4X4JA 4EE0A 2LJAA 2IMKA 3ZL5A 5CAXA 2VM1A 3L9SA 2C3TA 2FLSA 4BVYA 4MP4A 1OYJA 4L0WA 1XWGA 4EKZA 4WF5A 2C3NA 3HCZA 3QAVA 2HRNA 2C0EA 1IYHA 5J5NA 2VM2A 4ECJA 2JL4A 1SK0A 4TR1A 1TOFA 1VF2A 3UEMA 2QC7A 1GWCA 1MDKA 1TU8A 3EINA 1GLPA 3ZVJA 1PKWA 2V6OA 5E59A 4DEJA 1B9YC 3KP9A 2XPEA 3TOTA 1R4WA 2HSYA 1AAZA 3D6IA 1SYRA 5KN2A 2B1KA 1XWBA 5IIZA 4XCSA 3TDGA 3ZIVA 2JACA 1K0MA 3TJKA 2DMMA 3UBKA 3TKPA 2GTUA 3C73A 1C72A 3CSHA 2R6KA 1EP8A 4ML6A 3KZQA 2EFHA 2O8VB 3KH7A 3QAGA 1ZGNA 1OC9B 4EDYA 3ZFBA 4DSRA 2CVKA 3APSA 3TRPA 2CA8A 4AKGA 3HJMA 2GZZA 1MDIA 1XWAA 4MF7A 2TRXA 5E4WA 2HNLA 1B48A 3H93A 1URMA 4PQ1A 1O85A 1PX7A 3EWLA 4WETA 1KEBA 1NSWA 4J56E 1K3YA 4WBJA 3V1WA 5IQYA 4WXTA 1O8WA 4LMWA 4JRRA 1ZYEA 2JZSA 3IR4A 3OR5A 1ZOFA 2P0GA 2PVOC 2R37A 3HVXA 1FOHA 1VGLA 4KF9A 3DWVA 3MNGA 4Q5RA 1WP0A 3Q18A 1PGTA 2H1AA 17GSA 2HZEA 5FHIA 2QA2A 4K9ZA 2YCDA 2PVQA 4GLTA 3CBUA 2AHEA 3D22A 3Q74A 4X43A 5CRDA 2TRCP 3WYWA 2C0DA 3CRUA 4NV5A 2IMEA 2VCZA 1OKDA 3F0IA 5CREA 1JFUA 1SENA 4ZB6A 1ST9A 1W89A 2NTOA 4F2IA 5B8AA 4EUYA 1TDIA 2L57A 3H79A 1K3LA 2CZ2A 5G5EA 5J41A 1ERTA 3KM6A 1T4YA 4ZB9A 4HQZA 1CQHA 3HYPA 3TB2A 1LU4A 3KTBA 1F2EA 6GSXA 2VL9A 1PL2A 3DKSA 5BMUA 4EIPA 2HQTA 3R3EA 3TKQA 4O7HA 5IMCA 2GS3A 1X9MB 3QMXA 1XWCA 2LSTA 3IBHA 3C1SA 3TCOA 5ECOB 3ZYWA 4ULXA 2WULA 1X5CA 5COHA 1WJKA 1QXHA 3MSZA 3ERWA 4ZBAA 5INYA 3C71A 2E2MA 1ZZYA 18GSA 2IMIA 3LGCA 1VRSD 4O5QA 5IPHA 3LEFA 1MTCA 1HNCA 1E6BA 2PUKC 3M9JA 2X4AA 4I2TA 5ECKB 4IP6A 5A5HB 3HXSA 5HFIA 3FMWA 4AJ6A 1K0AA 5A1NB 4MPGA 3P2AA 4F0BA 4OCEA 2JSYA 2OA7A 2ZNMA 4AJ7A 14GSA 2ZCTA 2OKAA 1HYUA 1FO5A 4PXOA 4LL1B 3GMFA 4K6XA 1DBYA 1OE8A 4L5LA 1GTBA 3LYPA 3P90A 1CQGA 2H76A 3L9VA 2LQOA 4POMA 4BVXB 1EOHA 1TXUA 3HD5A 3KEBA 4EXJA 4V1Ag 4ISDA 2R0GA 4KNDA 3DVXA 1TRSA 2P5QA 4IP1A 3L78A 1DE2A 2XBIA 3P8WA 4O5UA 1GRXA 3QCPA 1GTUA 4HOJA 4GDFA 1ZL9A 1BF5A 5D93A 2CX3A 3HZ8A 1TP9A 2N5BA 2AB6A 2OE3A 2PPTA 3Q19A 2IJYA 1F3BA 2ZUPA 2KHPA 1JLWA 5L71A 1MD3A 5ECSA 4CW9A 1SJ6A 3FRCA 1HNAA 2H0IA 2GT5A 3O6TA 3I9V2 1Z9HA 1TKDB 3RHBA 3MDKA 3RDWA 4IVFA 1ZYQB 4AKIA 2I1UA 5ECRB 1QK8A 4JU5A 3ZREA 2WDUA 1BG5A 2H75A 1A0FA 1THXA 3IK7A 5IMFA 2YV9A 3UARA 4CDOA 2A2RA 3VK9A 2HRFA 2VL2C 5A34B 2JZTA 1PN0A 3D5JA 5ECMB 5ABRA 4IQAA 4HJMA 5LD0A 1JZWA 2IMDA 1H4OA 3R2QA 4E68A 4K8MA 1PMTA 3CYNA 1AQWA 1OE7A 2LQQA 4G2EA 2CVBA 2JZRA 2H6YA 2YANA 4FYUA 5F05A 2OE0A 2EIQA 4D73A 3IHGA 2V41A 1SYXA 2NPBA 1SJZA 2PERA 2IIYA 5J4VA 3RBTA 3M9KA 3UAPA 3FK8A 4OWYA 1BYEA 2OBKA 2QA1A 1GH2A 3F3QA 2VCQA 3M3MA 3FHKA 5AISA 1XOBA 6GSVA 2M72A 4G01A 5FWGA 4J57E 3ME7A 1GUKA 3WGDA 4F82A 4PUAA 4TOPA 3NOFA 4FO5A 2H1GA 3KMNA 3U6VA 1G7OA 22GSA 2FA8A 5IM9A 5AN1A 1YY7A 2L4CA 1SK2A 3GX8A 4BL7A 4ILFA 1GLQA 4V2NA 4GWRA 1HNBA 2OACA 3KD0A 3ZIJA 2L6DA 3EU4A 4MA9A 3HKRA 5B6NA 2LKUA 4GRFA 4IW9A 4ZBDA 3N5OA 2K6VA 2UV8G 1TJDA 1V2AA 2HSNB 3O3TA 2V1MA 3ZITA 4KW6A 3GUSA 2H8LA 4FQUA 5DJLA 5J3RA 4JR4A 4OFNA 1WPIA 1ON4A 4NHZA 3S9FA 2E7PA 4O32A 2DJJA 1EOGA 3DYRA 1ABAA 2A2PA 1TU7A 3C1RA 2NVLA 2DJKA 4ECBA 4YKFA 2HSHA 5H5QA 1M2AA 4MDCA 5G5FA 4WF4A 5ELAA 2VIMA 3ERFA 5AIVA 6GSYA 2E2GA 2KUCA 4PURA 5C04A 4JBBA 4KDYA 1GL8A 1O73A 3GFKA 1KNGA 5J4UA 1O7UA 2EIRA 5JWOB 3K8NA 1AQXA 2HRKB 5H5SA 3H1NA 2GZYA 3D4MA 2K8VA 4KAEA 11GSA 4WR5A 3IDVA 2C1YA 3HJPA 2YJ7A 4YAPA 1S3DA 1HD2A 1XW6A 2I3YA 4HU9A 1GSUA 1VF3A 3SWLA 4K2DA 5ECLB 2H0HA 5KOWA 4MK3A 3GIXA 2H73A 5JWQB 4FYBA 3PPUA 1JLVA 2YZUA 1WIKA 4HJ2A 1BQ7A 2GSTA 3HA9A 4OFMA 3LXTA 3GN3A 5F0GA 2N5FA 4ZL8A 1FHEA 1FVKA 2YNXA 3E0UA 3VURA 5DALB 4IJIA 2LEGA 4BWQA 2RUFA 4OD7A 1U87A 4IHUA 2CZ3A 3ME8A 4CY8A 3TJBA 3UOMA 2NDOA 3GTUA 3RPPA 2OADA 3IE3A 4YQMA 3PINA 3CXGA 3ZVJD 1Z3EA 3MWHA 3KXOA 3ZFLA 3GKNA 3O76A 4MZBA 4PNFA 4KSOA 1AW9A 4JEDA 2VAFA 2GDRA 3CSIA 1BEDA 1PSQA 1S3CA 2B6MA 4BA7A 4EIQA 3MAKA 1UC7A 4IELA 5ENUA 4MJAA 1TK5B 1G7EA 2D2ZA 2H71A 2B1LA 4OFTA 1V98A 3W8JA 4PQIA 2OBIA 2L5LA 2L59A 1GP1A 3A5IA 3HDCA 5DDLA 3APOA 3LYKA 5JWRB 2XHFA 4N3ZA 1VF4A 1K0NA 3J7Yk 4GSNA 2JSZA 1GSDA 1K0DA 4Z7XA 4EC0A 1EGOA 3UVTA 2DC5A 2A2SA 1J08A 2QSIA 1ILOA 3LORA 3LXZA 1K3OA 2FWHA 3H4KA 2V32A 1Y6EA 4ML1A 2REMA 3GL3A 2VO4A 1E2YA 2DJ1A 3G7YA 1PKZA 2HSMB 3LSZA 1RW1A 3VWXA 1FOVA 1WOUA 1M2BA 1RK4A 2DLXA 1U3AA 5IPGA 3Q6OA 3CWGA 3TUEA 5D9VA 9GSSA 1OC9A 1FB0A 3GURA 3EC3A 4IJ3A 2HI7A 2P5RA 2LNSA 2EC4A 3UL3A 1W4VA 1M7TA 4PTSA 4WKWA 4KX4A 1ACVA 2JADA 4DSSB 3PH9A 1GSQA 1U3IA 2X64A 5LNKe 4EL1A 2FHEA 2K8SA 2H01A 4JZQA 3MIXA 2H1LA 3IK9A 2MMNA 2G2QA 3DXBA 1YVLA 1V58A 3TGZA 1IYIA 3FEUA 2WB9A 2HZFA 1AQVA 4Q5FA 3FZAA 3IAM2 3VFIA 1MEKA 3I43A 5G1LA 2GZPA 1XCCA 5EPFA 5G2ZA 3FY7A 4XS1A 1JZRA 5CRHA 5IOWA 3QR6A 3TJJA 4K7IA 3RHCA 1EP7A 1PN9A 2J9HA 3IOSA 3HMJG 1YZXA 4KSMA 4TXVA 2VD1A 2DBCA 4K0NA 4POBA 3LW9A 1ZYNA 3FZ9A 2B5YA 2H70A 2FA4A 3FR3A 2B5XA 5HFGA 4IKHA 2H66A 3WT2A 2IWTA 4QL7A 1SD8A 3DMLA 1EV4A 1F3AA 5HR3A 1SL2B 2A4HA 2DJ2A 2VKZG 3DD3A 4RQXA 3G7JA 4K5RA 3GRXA 1O8XA 3A3TA 1ML6A 2X99A 3RAZA 3UVHA 5DQYA 4HDEA 3VPQA 1PD21 5CP1A 4LL4B 2CAIA 4KH7A 1B4QA 1WE0A 5A4UA 2LRNA 1YDKA 4MJCA 5IMDA 5F06A 1Z6MA 1XWKA 4PX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMF A;  3WGE A;  1AIU A;  2FWE A;  4I5Q A;  3IXR A;  3TKS A;  1I9D A;  2EIO A;  5IO0 A;  2ON5 A;  4RI6 A;  4ID0 A;  1SKS B;  4TW5 A;  3G7I A;  2WZ9 A;  5DCG A;  4E8E A;  1MDJ A;  2F8A A;  4QQ7 A;  1TI3 A;  5HR2 A;  4OO4 A;  3KJY A;  3DGQ A;  4ZXG A;  1TXX A;  1A2J A;  4IGJ A;  4MF6 A;  3LJR A;  2H6Z A;  1O6J A;  1OVN A;  1XFL A;  5IMV A;  4L0U A;  5GAP D;  5DAK B;  2YN1 A;  4I8B A;  4F0C A;  3J7Y b;  4CHS A;  2GGT A;  4NPB A;  3HVV A;  5KN3 A;  4GSS A;  1KTE A;  1QGV A;  4TXO B;  3N9J A;  2MBS A;  2YV7 A;  3WD6 A;  2GVP A;  1FB6 A;  3VWV A;  2K9F A;  1VF1 A;  3GKX A;  3F4R A;  1J9B A;  3EVI A;  4Q5Q A;  4YQU A;  4BVX A;  3CSJ A;  2PBJ A;  2O85 A;  2FY6 A;  2C80 A;  2ES7 A;  3LG6 A;  3TKR A;  3W8S A;  5DCH A;  1A8Y A;  4GXZ A;  1XVQ A;  4LA1 A;  4NXI A;  3H8Q A;  2AYT A;  4GTU A;  4PUF C;  13GS A;  4ZL7 A;  2DSA A;  2YJH A;  1HQO A;  1SK1 A;  4XS4 B;  2FGX A;  4FIW A;  3ZRD A;  4Q5N A;  4HI7 A;  2X8C A;  5CYY A;  4LMV A;  3KIJ A;  4DSQ A;  1K0C A;  2DIY A;  3QOU A;  5F07 A;  3I69 A;  1XW9 A;  3U5R E;  1TTZ A;  4OO5 A;  4MPF A;  3VI5 A;  3F6F A;  2JU5 A;  3IAS 2;  4ACS A;  1UN2 A;  2KLX A;  2LUS A;  4HS1 A;  3FZ5 A;  4WBR D;  2GT6 A;  1PA3 A;  4PNG A;  2I81 A;  5B6M A;  3GYK A;  2YWN A;  2O89 A;  5DJM A;  1N2A A;  2FNO A;  2B3S A;  4XTS A;  3A5W A;  2WFC A;  3VWW A;  2YWM A;  1SL1 B;  4NWY A;  4POK A;  2OE1 A;  5D9T A;  3LQ7 A;  3VI7 A;  4HZ4 A;  2R2J A;  2GQK A;  1OC3 A;  5EY6 A;  1Z5Y E;  2R5G A;  2PU9 C;  3F8U A;  3VLN A;  5GSS A;  2VCV A;  1R26 A;  1JZD A;  1BX9 A;  4OCF A;  5KN0 A;  1XPV A;  4XRD A;  3G9B A;  2WJU A;  2GSR A;  2DJ0 A;  1YEP A;  2YZH A;  4O5R A;  5IO2 A;  4ECC A;  8GSS A;  2XC2 A;  2LRC A;  3FKF A;  3QAW A;  1PL1 A;  4MCU A;  4YH2 A;  4RQR A;  2IFQ B;  2LV3 A;  1THO A;  2HE3 A;  1TRW A;  2LRT A;  3IV4 A;  2LJR A;  3VPT A;  2L4Q A;  1Z7P A;  4ZIJ A;  1ZCP A;  3WGX A;  3F4T A;  2RM6 A;  2AJQ B;  3TKS E;  5AIX A;  2CAQ A;  4HU7 A;  4QL9 A;  1UVZ A;  2V2G A;  4ZB8 A;  3GX0 A;  4GQF A;  2MBT A;  4EF0 A;  2MMZ A;  3GKK A;  1USB A;  3IRA A;  4KGI A;  1N8J A;  4F03 A;  4NV2 A;  3A2W A;  1F9M A;  1TK0 B;  2ON7 A;  2LS5 A;  3PGT A;  3GH6 A;  1Q98 A;  6GSS A;  3DRN A;  1NHY A;  4IS0 A;  4MMM A;  3KCM A;  4I97 A;  1XBS A;  5GZZ B;  1JHB A;  4TRX A;  1SD9 A;  5HFK A;  3SBC A;  1Z7R A;  1DSB A;  4XIH A;  12GS A;  3QDN A;  1U6T A;  2FCH A;  4DVC A;  5F8B A;  1XOA A;  2F9S A;  2CX4 A;  4BVY B;  1X9S B;  2R4V A;  1FAA A;  7GSS A;  4E8H A;  4HEA 2;  2LJK A;  3D4T A;  4KDU A;  4F9Z A;  1GNW A;  5GAN D;  3CMI A;  4TKY A;  4TR1 B;  2K18 A;  4POL A;  1PRX A;  4ECI A;  4L8E A;  5ELG A;  5EVO A;  3GH9 A;  3KP8 A;  1G0T A;  4RI7 A;  4BWS A;  1GTI A;  4TR3 A;  1T1V A;  3KH9 A;  3QFB C;  4RUV A;  1TRV A;  3FYG A;  2PMT A;  3ZLP A;  5ID2 B;  3UIW A;  2C0G A;  1OAZ A;  2HRK A;  1I5G A;  4EDZ A;  2A4V A;  2H6X A;  3DVW A;  4IBP A;  1GTA A;  5JCW A;  2WCI A;  3L0H A;  5CO3 A;  4MZC A;  2LTK A;  2P31 A;  1U88 A;  3HZ4 A;  1M9A A;  2F3M A;  20GS A;  1WWJ A;  4GF0 A;  3A2V A;  1GSY A;  4IN0 A;  3GA4 A;  5IMA A;  1K0B A;  4P3Y B;  2HLS A;  2IN3 A;  4X1U A;  2MMO A;  1BAY A;  4V1A p;  5DAL A;  4MZW A;  5IMZ A;  4GCI A;  3KGK A;  3ZZX A;  2H1B A;  1FG4 A;  2GSS A;  4KB3 A;  5HQP A;  2L5O A;  1MD4 A;  1NM3 A;  4FYC A;  5D73 A;  3DEX A;  5ID2 A;  1JZO A;  2M46 A;  2H72 A;  3US3 A;  1G6W A;  2HZE B;  1T3B A;  3TOU A;  3TJG A;  3LWA A;  2H74 A;  3E3E A;  4KDX A;  2RII A;  1TI1 A;  2VLU A;  1GUL A;  1YF0 A;  2BMX A;  1V40 A;  4KCE A;  2WRT A;  1Y25 A;  2O87 A;  1SJI A;  2YWO A;  3EMX A;  1XW5 A;  1H75 A;  1GSS A;  4IQ1 A;  1X9W B;  4KA0 A;  4KE3 A;  5H5R A;  4MJB A;  4AGS A;  1YEX A;  2BJX A;  4MJE A;  2OJL A;  4KCA A;  4KUN A;  2J23 A;  3NIV A;  1XZO A;  4N11 A;  4XS6 A;  5G31 A;  3D21 A;  3PR8 A;  5GST A;  4ZBB A;  1AC1 A;  2LNT A;  3W6G A;  2AAW A;  3IC8 A;  5J9B A;  4HUA A;  4TN8 A;  2HSM A;  2B7K A;  1QUW A;  1T7P B;  5CNW A;  5KEJ A;  2Z9S A;  4L5O A;  4EO3 A;  5G1K A;  3CTG A;  5D9W A;  2FD3 A;  4N10 A;  3ERG A;  2X8H A;  3BCK A;  3TRX A;  2GQL A;  1F6M C;  3CTF A;  3BOA A;  19GS A;  4G19 A;  2KOK A;  2WS2 A;  2PGT A;  4GST A;  4XHM A;  1S3A A;  5KN1 A;  1M99 A;  1A8L A;  5C00 A;  5D8I A;  1ZMA A;  3UBL A;  1A24 A;  4G10 A;  5LCZ A;  3HVS A;  1J0F A;  5DBQ A;  4DSS A;  1OC8 A;  2HFD A;  1WRY A;  1QQ2 A;  4EVM A;  16GS A;  1B9X C;  4AJ8 A;  3GHA A;  2VOC A;  1GSF A;  3IC4 A;  2QKE A;  2IL3 A;  5B7C A;  2F51 A;  4G0I A;  2C4J A;  3IHQ A;  3ZMK A;  4H86 A;  1SKR B;  3UMA A;  3FW2 A;  2AUV A;  2X8G A;  4V2L A;  1YJ6 A;  3IA1 A;  3M8N A;  3KMO A;  2L6C A;  2I9H A;  3QFA C;  5CRG A;  1SKW B;  3F4S A;  2VD0 A;  2GQM A;  1ERW A;  2HT9 A;  3BJ5 A;  4JR6 A;  1NHO A;  4G0K A;  2DML A;  2CT6 A;  6GSU A;  5FT3 A;  4N30 A;  4O92 A;  2WGR A;  1B4P A;  4K0G A;  1Z6N A;  4K7N A;  5AGY A;  1BJX A;  4MLY A;  2B7J A;  4USS A;  2VL2 A;  3RPN A;  5J9C A;  1ERV A;  2O7K A;  4I6X A;  1GSE A;  1GUM A;  3HJO A;  3FR6 A;  2RM5 A;  3FZ4 A;  2YPM A;  3F3R A;  2AV4 A;  3F9U A;  4YQV A;  3E9J B;  2FWG A;  1M0U A;  2DIZ A;  2GLR A;  3D0Z A;  3GSS A;  3TJF A;  5D96 A;  4HZ2 A;  1WMJ A;  1T4Z A;  2VL3 A;  1FVJ A;  3HHV A;  3GL5 A;  4LLR A;  1GUH A;  3I6A A;  2H1D A;  1A2M A;  4ZIL A;  3L9U A;  3VWU A;  1PX6 A;  3GST A;  1XXU A;  2MYG A;  2IPA A;  4TVE A;  5EL8 A;  1A2L A;  2UZ8 A;  3EU3 A;  3AY8 A;  3GNJ A;  5JCG A;  3ISO A;  1EWX A;  3BCI A;  2E0Q A;  2PN8 A;  2YP6 A;  2XBQ A;  3NZN A;  1V9W A;  1YQ1 A;  1K0O A;  4D73 B;  5DAK A;  4X0X A;  5ECQ B;  3ZML A;  1B8X A;  3TKS C;  1M2D A;  4TXO A;  1QFN A;  2H19 A;  3JCM L;  3LFL A;  2XPD A;  2VLV A;  2YOI A;  3CRT A;  1AXD A;  2TIR A;  3L4N A;  4N0V A;  1EZK A;  1RQM A;  1FW1 A;  4HQS A;  2NBS A;  2VLT A;  1A23 A;  2KP2 A;  1PQN A;  1EGR A;  4PQH A;  1Q4J A;  3EUR A;  2V6K A;  3EE2 A;  4BL7 B;  2VCT A;  3GV1 A;  1TK8 B;  2HXK A;  4MF5 A;  3IPZ A;  3ZTL A;  4XS4 A;  4ZL9 A;  2VCW A;  5ECI B;  2MMA A;  4OMV A;  3A2X A;  5HR1 A;  3QD9 A;  4J2F A;  2ALB A;  2C8U A;  5G30 A;  1EEM A;  4WR4 A;  5DVB A;  1SL0 B;  1M9B A;  1X5E A;  3ED3 A;  6GST A;  1R5A A;  2BTO T;  1R7H A;  5HR0 A;  2CV4 A;  2HYX A;  1LBK A;  2C3Q A;  1NW2 A;  1A0R P;  5CRW A;  2DJ3 A;  3GKM A;  4BPY A;  2FWF A;  2F8F A;  2R3X A;  3EMP A;  5A4V A;  3P7X A;  1KBN A;  4GQC A;  5A5K A;  1YKC A;  1G6Y A;  3HY2 A;  4MH2 A;  1OKT A;  2RUE A;  1DE1 A;  4G0L A;  5JCU A;  1V57 A;  4G9H A;  3APQ A;  2I4A A;  2M80 A;  1YF1 A;  3EYT A;  5B8B A;  4TR4 A;  1TW9 A;  2VCX A;  5DQS A;  2PWJ A;  4WEY A;  4AF2 A;  1AUC A;  2RLI A;  1T8E B;  4K7O A;  2GSQ A;  1SU9 A;  1TRU A;  2N5A A;  2CVD A;  3BD2 A;  3C7M A;  5ECN B;  4MH3 A;  10GS A;  3UJ1 A;  2H30 A;  1UA5 A;  4XRA A;  1LJR A;  5A4W A;  1DUG A;  4YAV A;  4NHW A;  2H0G A;  2IFQ A;  4JE1 A;  2CQ9 A;  1XIY A;  2YWI A;  5ECH B;  6GSW A;  2VUP A;  4I2U A;  4NMU A;  5IOX A;  1EV9 A;  3FR9 A;  2G0F A;  4PGT A;  1EEJ A;  1F37 A;  3M0F A;  3TRQ A;  4N0Z A;  3WT1 A;  3BBY A;  3GTU B;  1QMV A;  3M1G A;  5ECP B;  1X5D A;  2MZC A;  1XVW A;  3KTL A;  3F63 A;  1T00 A;  1YKA A;  3C8E A;  3F6D A;  4MAB A;  2B5E A;  3QPM A;  2FUG 2;  4K1F A;  4TR0 A;  1GNE A;  2C0F A;  1O81 A;  4FH8 A;  5D9X A;  1ERU A;  4V2M A;  1R5P A;  4NAX A;  2HRA A;  1X0R A;  2QGV A;  3DIE A;  2KP1 A;  4EE0 A;  2LJA A;  2IMK A;  3ZL5 A;  5CAX A;  2VM1 A;  3L9S A;  2C3T A;  2FLS A;  4BVY A;  4MP4 A;  1OYJ A;  4L0W A;  1XWG A;  4EKZ A;  4WF5 A;  2C3N A;  3HCZ A;  3QAV A;  2HRN A;  2C0E A;  1IYH A;  5J5N A;  2VM2 A;  4ECJ A;  2JL4 A;  1SK0 A;  4TR1 A;  1TOF A;  1VF2 A;  3UEM A;  2QC7 A;  1GWC A;  1MDK A;  1TU8 A;  3EIN A;  1GLP A;  3ZVJ A;  1PKW A;  2V6O A;  5E59 A;  4DEJ A;  1B9Y C;  3KP9 A;  2XPE A;  3TOT A;  1R4W A;  2HSY A;  1AAZ A;  3D6I A;  1SYR A;  5KN2 A;  2B1K A;  1XWB A;  5IIZ A;  4XCS A;  3TDG A;  3ZIV A;  2JAC A;  1K0M A;  3TJK A;  2DMM A;  3UBK A;  3TKP A;  2GTU A;  3C73 A;  1C72 A;  3CSH A;  2R6K A;  1EP8 A;  4ML6 A;  3KZQ A;  2O8V B;  3KH7 A;  3QAG A;  1ZGN A;  1OC9 B;  4EDY A;  3ZFB A;  4DSR A;  2CVK A;  3APS A;  3TRP A;  2CA8 A;  3HJM A;  2GZZ A;  1MDI A;  1XWA A;  4MF7 A;  2TRX A;  5E4W A;  2HNL A;  1B48 A;  3H93 A;  1URM A;  4PQ1 A;  1O85 A;  1PX7 A;  3EWL A;  4WET A;  1KEB A;  1NSW A;  4J56 E;  1K3Y A;  4WBJ A;  3V1W A;  5IQY A;  4WXT A;  1O8W A;  4LMW A;  4JRR A;  1ZYE A;  2JZS A;  3IR4 A;  3OR5 A;  1ZOF A;  2P0G A;  2PVO C;  2R37 A;  3HVX A;  1VGL A;  4KF9 A;  3DWV A;  3MNG A;  4Q5R A;  1WP0 A;  3Q18 A;  1PGT A;  17GS A;  2H1A A;  2HZE A;  5FHI A;  4K9Z A;  2YCD A;  2PVQ A;  4GLT A;  3CBU A;  2AHE A;  3D22 A;  3Q74 A;  4X43 A;  5CRD A;  2TRC P;  3WYW A;  2C0D A;  3CRU A;  4NV5 A;  2IME A;  2VCZ A;  1OKD A;  3F0I A;  5CRE A;  1JFU A;  1SEN A;  4ZB6 A;  1ST9 A;  1W89 A;  2NTO A;  4F2I A;  5B8A A;  4EUY A;  1TDI A;  2L57 A;  3H79 A;  1K3L A;  2CZ2 A;  5G5E A;  5J41 A;  1ERT A;  3KM6 A;  1T4Y A;  4ZB9 A;  4HQZ A;  1CQH A;  3HYP A;  3TB2 A;  1LU4 A;  3KTB A;  1F2E A;  6GSX A;  2VL9 A;  1PL2 A;  3DKS A;  5BMU A;  2HQT A;  3R3E A;  3TKQ A;  4O7H A;  5IMC A;  2GS3 A;  1X9M B;  3QMX A;  1XWC A;  2LST A;  3IBH A;  3C1S A;  3TCO A;  5ECO B;  3ZYW A;  4ULX A;  2WUL A;  1X5C A;  5COH A;  1WJK A;  1QXH A;  3MSZ A;  3ERW A;  4ZBA A;  5INY A;  3C71 A;  2E2M A;  1ZZY A;  18GS A;  2IMI A;  3LGC A;  1VRS D;  5IPH A;  3LEF A;  1MTC A;  1HNC A;  1E6B A;  2PUK C;  3M9J A;  4I2T A;  5ECK B;  4IP6 A;  3HXS A;  5HFI A;  4AJ6 A;  1K0A A;  4MPG A;  3P2A A;  4F0B A;  4OCE A;  2JSY A;  2OA7 A;  2ZNM A;  4AJ7 A;  14GS A;  2ZCT A;  2OKA A;  1HYU A;  1FO5 A;  4PXO A;  4LL1 B;  3GMF A;  4K6X A;  1DBY A;  1OE8 A;  4L5L A;  3P90 A;  1GTB A;  3LYP A;  1CQG A;  2H76 A;  3L9V A;  2LQO A;  4POM A;  4BVX B;  1EOH A;  3HD5 A;  3KEB A;  4EXJ A;  4V1A g;  4ISD A;  4KND A;  3DVX A;  1TRS A;  2P5Q A;  4IP1 A;  3L78 A;  1DE2 A;  2XBI A;  3P8W A;  1GRX A;  3QCP A;  1GTU A;  4HOJ A;  1ZL9 A;  5D93 A;  2CX3 A;  3HZ8 A;  1TP9 A;  2N5B A;  2AB6 A;  2OE3 A;  2PPT A;  3Q19 A;  2IJY A;  1F3B A;  2ZUP A;  2KHP A;  1JLW A;  5L71 A;  1MD3 A;  5ECS A;  4CW9 A;  1SJ6 A;  3FRC A;  1HNA A;  2H0I A;  2GT5 A;  3O6T A;  3I9V 2;  1Z9H A;  1TKD B;  3RHB A;  3MDK A;  3RDW A;  4IVF A;  1ZYQ B;  2I1U A;  5ECR B;  1QK8 A;  4JU5 A;  3ZRE A;  2WDU A;  1BG5 A;  2H75 A;  1A0F A;  1THX A;  3IK7 A;  5IMF A;  2YV9 A;  3UAR A;  4CDO A;  2A2R A;  3VK9 A;  2HRF A;  2VL2 C;  2JZT A;  3D5J A;  5ECM B;  5ABR A;  4IQA A;  4HJM A;  5LD0 A;  1JZW A;  2IMD A;  4K8M A;  3R2Q A;  1H4O A;  1PMT A;  3CYN A;  1AQW A;  1OE7 A;  2LQQ A;  4G2E A;  2CVB A;  2JZR A;  2H6Y A;  2YAN A;  4FYU A;  5F05 A;  2OE0 A;  2EIQ A;  4D73 A;  2V41 A;  1SYX A;  2NPB A;  1SJZ A;  2PER A;  2IIY A;  3RBT A;  3M9K A;  3UAP A;  3FK8 A;  4OWY A;  1BYE A;  2OBK A;  3F3Q A;  1GH2 A;  2VCQ A;  3M3M A;  3FHK A;  5AIS A;  1XOB A;  6GSV A;  2M72 A;  5FWG A;  4J57 E;  3ME7 A;  1GUK A;  3WGD A;  4F82 A;  4PUA A;  4TOP A;  3NOF A;  4FO5 A;  2H1G A;  3KMN A;  3U6V A;  1G7O A;  22GS A;  2FA8 A;  5IM9 A;  5AN1 A;  1YY7 A;  2L4C A;  1SK2 A;  3GX8 A;  4BL7 A;  4ILF A;  1GLQ A;  4V2N A;  4GWR A;  1HNB A;  2OAC A;  3KD0 A;  3ZIJ A;  2L6D A;  3EU4 A;  4MA9 A;  3HKR A;  5B6N A;  2LKU A;  4GRF A;  4IW9 A;  4ZBD A;  3N5O A;  2K6V A;  1TJD A;  1V2A A;  2HSN B;  3O3T A;  2V1M A;  3ZIT A;  4KW6 A;  3GUS A;  2H8L A;  4FQU A;  5DJL A;  5J3R A;  4JR4 A;  4OFN A;  1WPI A;  1ON4 A;  4NHZ A;  3S9F A;  2E7P A;  4O32 A;  2DJJ A;  1EOG A;  3DYR A;  1ABA A;  1TU7 A;  3C1R A;  2NVL A;  2DJK A;  4ECB A;  2HSH A;  5H5Q A;  1M2A A;  4MDC A;  5G5F A;  4WF4 A;  5ELA A;  2VIM A;  3ERF A;  5AIV A;  6GSY A;  2E2G A;  2KUC A;  4PUR A;  5C04 A;  4JBB A;  4KDY A;  1GL8 A;  1O73 A;  3GFK A;  1KNG A;  5J4U A;  1O7U A;  2EIR A;  5JWO B;  3K8N A;  1AQX A;  2HRK B;  5H5S A;  3H1N A;  2GZY A;  3D4M A;  2K8V A;  4KAE A;  11GS A;  4WR5 A;  3IDV A;  2C1Y A;  3HJP A;  2YJ7 A;  4YAP A;  1S3D A;  1HD2 A;  1XW6 A;  2I3Y A;  4HU9 A;  1GSU A;  1VF3 A;  3SWL A;  4K2D A;  5ECL B;  2H0H A;  4MK3 A;  3GIX A;  2H73 A;  5JWQ B;  4FYB A;  3PPU A;  1JLV A;  2YZU A;  1WIK A;  4HJ2 A;  1BQ7 A;  2GST A;  3HA9 A;  4OFM A;  3LXT A;  3GN3 A;  5F0G A;  2N5F A;  4ZL8 A;  1FHE A;  1FVK A;  2YNX A;  3E0U A;  3VUR A;  5DAL B;  4IJI A;  2LEG A;  4BWQ A;  2RUF A;  4OD7 A;  1U87 A;  4IHU A;  2CZ3 A;  3ME8 A;  3TJB A;  3UOM A;  2NDO A;  3GTU A;  3RPP A;  2OAD A;  3IE3 A;  4YQM A;  3PIN A;  3CXG A;  3ZVJ D;  1Z3E A;  3MWH A;  3KXO A;  3ZFL A;  3GKN A;  3O76 A;  4MZB A;  4PNF A;  4KSO A;  1AW9 A;  4JED A;  2VAF A;  2GDR A;  3CSI A;  1BED A;  1PSQ A;  1S3C A;  2B6M A;  4BA7 A;  3MAK A;  1UC7 A;  4IEL A;  5ENU A;  4MJA A;  1TK5 B;  1G7E A;  2D2Z A;  2H71 A;  2B1L A;  4OFT A;  1V98 A;  3W8J A;  4PQI A;  2OBI A;  2L5L A;  2L59 A;  1GP1 A;  3HDC A;  5DDL A;  3APO A;  3LYK A;  5JWR B;  2XHF A;  1VF4 A;  1K0N A;  3J7Y k;  4GSN A;  2JSZ A;  1GSD A;  1K0D A;  4Z7X A;  4EC0 A;  1EGO A;  3UVT A;  2DC5 A;  2A2S A;  1J08 A;  2QSI A;  1ILO A;  3LOR A;  3LXZ A;  1K3O A;  2FWH A;  3H4K A;  2V32 A;  1Y6E A;  4ML1 A;  2REM A;  3GL3 A;  2VO4 A;  1E2Y A;  2DJ1 A;  3G7Y A;  1PKZ A;  2HSM B;  3LSZ A;  1RW1 A;  3VWX A;  1FOV A;  1WOU A;  1M2B A;  1RK4 A;  2DLX A;  1U3A A;  5IPG A;  3Q6O A;  3TUE A;  5D9V A;  9GSS A;  1OC9 A;  1FB0 A;  3GUR A;  3EC3 A;  4IJ3 A;  2HI7 A;  2P5R A;  2LNS A;  2EC4 A;  3UL3 A;  1W4V A;  1M7T A;  4PTS A;  4WKW A;  4KX4 A;  1ACV A;  2JAD A;  4DSS B;  3PH9 A;  1GSQ A;  1U3I A;  2X64 A;  5LNK e;  4EL1 A;  2FHE A;  2K8S A;  2H01 A;  4JZQ A;  3IK9 A;  2MMN A;  2G2Q A;  3DXB A;  1V58 A;  3TGZ A;  1IYI A;  3FEU A;  2WB9 A;  2HZF A;  1AQV A;  4Q5F A;  3FZA A;  3IAM 2;  3VFI A;  1MEK A;  3I43 A;  5G1L A;  2GZP A;  1XCC A;  5EPF A;  5G2Z A;  3FY7 A;  4XS1 A;  1JZR A;  5CRH A;  5IOW A;  3QR6 A;  3TJJ A;  4K7I A;  3RHC A;  1EP7 A;  1PN9 A;  2J9H A;  3IOS A;  1YZX A;  4KSM A;  4TXV A;  2VD1 A;  2DBC A;  4K0N A;  4POB A;  2B5Y A;  2H70 A;  3FZ9 A;  2FA4 A;  3FR3 A;  2B5X A;  5HFG A;  4IKH A;  2H66 A;  3WT2 A;  2IWT A;  4QL7 A;  1SD8 A;  3DML A;  1EV4 A;  1F3A A;  5HR3 A;  1SL2 B;  2DJ2 A;  3DD3 A;  4RQX A;  3G7J A;  3GRX A;  1O8X A;  3A3T A;  1ML6 A;  2X99 A;  3RAZ A;  3UVH A;  5DQY A;  4HDE A;  3VPQ A;  1PD2 1;  5CP1 A;  4LL4 B;  2CAI A;  4KH7 A;  1B4Q A;  1WE0 A;  5A4U A;  2LRN A;  1YDK A;  4MJC A;  5IMD A;  5F06 A;  1Z6M A;  1XWK A;  4PX1 A; 
#chains in the Genus database with same CATH topology
 2IMF A;  3WGE A;  1AIU A;  2FWE A;  4I5Q A;  4Z2R A;  3IXR A;  3TKS A;  1I9D A;  2EIO A;  5IO0 A;  2ON5 A;  4RI6 A;  4ID0 A;  1ZYP A;  1SKS B;  4TW5 A;  3G7I A;  2WZ9 A;  5DCG A;  4E8E A;  5J40 A;  1MDJ A;  2F8A A;  4QQ7 A;  1TI3 A;  5HR2 A;  4OO4 A;  3KJY A;  3DGQ A;  4ZXG A;  1TXX A;  1A2J A;  5A5H A;  4IGJ A;  4MF6 A;  3LJR A;  2H6Z A;  1O6J A;  5A1N A;  1OVN A;  1XFL A;  5IMV A;  4L0U A;  5GAP D;  5DAK B;  2YN1 A;  4I8B A;  4F0C A;  3J7Y b;  4CHS A;  2O3E A;  2GGT A;  4NPB A;  3HVV A;  5KN3 A;  4GSS A;  1KTE A;  1QGV A;  2O36 A;  4TXO B;  3N9J A;  2MBS A;  2YV7 A;  3WD6 A;  2GVP A;  1FB6 A;  3VWV A;  2K9F A;  1VF1 A;  3GKX A;  3F4R A;  1J9B A;  3EVI A;  4Q5Q A;  4YQU A;  4BVX A;  3CSJ A;  2PBJ A;  2O85 A;  2FY6 A;  2C80 A;  2ES7 A;  3LG6 A;  3TKR A;  3W8S A;  5DCH A;  1A8Y A;  4GXZ A;  1XVQ A;  4LA1 A;  4NXI A;  3H8Q A;  2AYT A;  4GTU A;  4PUF C;  13GS A;  4ZL7 A;  2DSA A;  2YJH A;  1HQO A;  1SK1 A;  4XS4 B;  2FGX A;  4FIW A;  3ZRD A;  4Q5N A;  4HI7 A;  2X8C A;  5CYY A;  4LMV A;  3KIJ A;  4DSQ A;  1K0C A;  2DIY A;  3QOU A;  5F07 A;  3I69 A;  1XW9 A;  3U5R E;  1TTZ A;  4OO5 A;  4MPF A;  3VI5 A;  3F6F A;  2JU5 A;  3IAS 2;  4ACS A;  1UN2 A;  2KLX A;  2LUS A;  4HS1 A;  3FZ5 A;  4WBR D;  4Z2U A;  2GT6 A;  1PA3 A;  4PNG A;  2I81 A;  2EFD A;  5B6M A;  3GYK A;  2YWN A;  2O89 A;  5DJM A;  1N2A A;  2FNO A;  2B3S A;  4XTS A;  3A5W A;  2WFC A;  3VWW A;  2YWM A;  1SL1 B;  4NWY A;  4POK A;  2OE1 A;  5D9T A;  3LQ7 A;  3VI7 A;  4HZ4 A;  3TU3 B;  2R2J A;  2GQK A;  1OC3 A;  5EY6 A;  1Z5Y E;  2R5G A;  2PU9 C;  3F8U A;  3VLN A;  5GSS A;  2VCV A;  1R26 A;  1JZD A;  1BX9 A;  4OCF A;  5KN0 A;  1XPV A;  4XRD A;  3G9B A;  2WJU A;  2GSR A;  2DJ0 A;  1YEP A;  2YZH A;  3MYD A;  4O5R A;  5IO2 A;  5A34 A;  4ECC A;  5BRT A;  5J4Y A;  2R0C A;  8GSS A;  2XC2 A;  2LRC A;  3FKF A;  3QAW A;  1PL1 A;  4MCU A;  4YH2 A;  4RQR A;  2IFQ B;  2LV3 A;  1THO A;  2HE3 A;  1TRW A;  2LRT A;  3IV4 A;  2LJR A;  4YKG A;  3VPT A;  2L4Q A;  1Z7P A;  4ZIJ A;  1ZCP A;  3WGX A;  3F4T A;  2RM6 A;  2AJQ B;  3TKS E;  5AIX A;  2CAQ A;  4HU7 A;  4QL9 A;  2DKH A;  1UVZ A;  2V2G A;  4ZB8 A;  3GX0 A;  4GQF A;  2MBT A;  4EF0 A;  2MMZ A;  3GKK A;  1USB A;  3IRA A;  4KGI A;  1N8J A;  4F03 A;  4NV2 A;  3A2W A;  1F9M A;  1TK0 B;  2ON7 A;  2LS5 A;  3PGT A;  3GH6 A;  5J47 A;  1Q98 A;  6GSS A;  4CY6 A;  3DRN A;  1NHY A;  4IS0 A;  4MMM A;  3KCM A;  4I97 A;  1XBS A;  5GZZ B;  1JHB A;  4TRX A;  1SD9 A;  5HFK A;  3SBC A;  1Z7R A;  1DSB A;  4XIH A;  12GS A;  3QDN A;  1U6T A;  2FCH A;  4DVC A;  5F8B A;  1XOA A;  2F9S A;  2CX4 A;  4BVY B;  1X9S B;  2R4V A;  1FAA A;  7GSS A;  2HSN A;  4E8H A;  4HEA 2;  2LJK A;  3D4T A;  2WVY A;  4KDU A;  4F9Z A;  4ICY A;  1GNW A;  5GAN D;  3CMI A;  4TKY A;  4TR1 B;  2K18 A;  4POL A;  1PRX A;  4ECI A;  4L8E A;  5ELG A;  5EVO A;  3GH9 A;  3KP8 A;  1G0T A;  4RI7 A;  4AKH A;  4BWS A;  1GTI A;  2O5V A;  4TR3 A;  1T1V A;  3KH9 A;  3QFB C;  4RUV A;  1TRV A;  3FYG A;  2PMT A;  3ZLP A;  5ID2 B;  3UIW A;  2C0G A;  1OAZ A;  2HRK A;  1I5G A;  4EDZ A;  2A4V A;  2H6X A;  3DVW A;  4IBP A;  1GTA A;  5JCW A;  2WCI A;  3L0H A;  5CO3 A;  4MZC A;  2LTK A;  2P31 A;  1U88 A;  3HZ4 A;  1M9A A;  2F3M A;  20GS A;  1WWJ A;  2WVX A;  4GF0 A;  3A2V A;  1GSY A;  4MNN A;  4IN0 A;  3GA4 A;  5IMA A;  1K0B A;  4P3Y B;  2HLS A;  2IN3 A;  4X1U A;  2MMO A;  1BAY A;  4V1A p;  5DAL A;  4MZW A;  5IMZ A;  4GCI A;  3KGK A;  3ZZX A;  2H1B A;  1FG4 A;  2GSS A;  4KB3 A;  5HQP A;  2L5O A;  1MD4 A;  1NM3 A;  4FYC A;  5D73 A;  3DEX A;  5ID2 A;  1JZO A;  2M46 A;  2H72 A;  3US3 A;  1G6W A;  2HZE B;  1T3B A;  3TOU A;  3TJG A;  3LWA A;  2H74 A;  3E3E A;  4KDX A;  2RII A;  1TI1 A;  2VLU A;  1GUL A;  1YF0 A;  2BMX A;  1V40 A;  4KCE A;  2WRT A;  1Y25 A;  2O87 A;  1SJI A;  2YWO A;  3EMX A;  1XW5 A;  1H75 A;  1GSS A;  3EPT A;  4IQ1 A;  1X9W B;  4KA0 A;  4KE3 A;  5H5R A;  4MJB A;  4AGS A;  1YEX A;  2BJX A;  4MJE A;  2OJL A;  4KCA A;  4QMK A;  4KUN A;  2J23 A;  5BMU B;  3NIV A;  1XZO A;  4N11 A;  5KOX A;  4XS6 A;  5G31 A;  3D21 A;  3PR8 A;  5GST A;  2WW0 A;  4ZBB A;  1AC1 A;  2LNT A;  3W6G A;  2AAW A;  3IC8 A;  5J9B A;  4HUA A;  4TN8 A;  2HSM A;  2B7K A;  1QUW A;  1T7P B;  5CNW A;  5KEJ A;  2Z9S A;  4L5O A;  4EO3 A;  5G1K A;  1N25 A;  3CTG A;  5D9W A;  2FD3 A;  4N10 A;  3ERG A;  4PI0 C;  2X8H A;  3BCK A;  3TRX A;  2EFC A;  1F6M C;  2GQL A;  3CTF A;  3BOA A;  19GS A;  4G19 A;  2KOK A;  2WS2 A;  2PGT A;  4GST A;  4XHM A;  1S3A A;  5KN1 A;  1M99 A;  1A8L A;  5C00 A;  5D8I A;  1ZMA A;  3UBL A;  1A24 A;  4G10 A;  4K2X A;  1SVM A;  5LCZ A;  3HVS A;  1J0F A;  5DBQ A;  2OT3 A;  4DSS A;  1OC8 A;  2HFD A;  1WRY A;  1QQ2 A;  4EVM A;  16GS A;  1B9X C;  4AJ8 A;  3GHA A;  1Y1U A;  4ZB7 A;  2VOC A;  1GSF A;  3IC4 A;  2QKE A;  2IL3 A;  5B7C A;  2F51 A;  4G0I A;  2C4J A;  3IHQ A;  3ZMK A;  4H86 A;  1SKR B;  3UMA A;  3FW2 A;  2AUV A;  2X8G A;  4V2L A;  1YJ6 A;  3IA1 A;  3M8N A;  3KMO A;  2L6C A;  2I9H A;  3QFA C;  5CRG A;  1SKW B;  3F4S A;  2VD0 A;  2GQM A;  1ERW A;  2HT9 A;  3BJ5 A;  4JR6 A;  4W66 A;  1NHO A;  4G0K A;  2DML A;  2CT6 A;  6GSU A;  5FT3 A;  4N30 A;  4O92 A;  2WGR A;  1B4P A;  4BIK A;  4K0G A;  1Z6N A;  2DKI A;  4K7N A;  5AGY A;  1BJX A;  4MLY A;  2B7J A;  4USS A;  2VL2 A;  3RPN A;  5J9C A;  1ERV A;  2O7K A;  4I6X A;  1GSE A;  1I1I P;  2X49 A;  1GUM A;  3HJO A;  3FR6 A;  2RM5 A;  3FZ4 A;  2YPM A;  3F3R A;  2AV4 A;  3F9U A;  4YQV A;  3E9J B;  2FWG A;  1M0U A;  2DIZ A;  2GLR A;  3D0Z A;  3GSS A;  3TJF A;  5D96 A;  4HZ2 A;  1WMJ A;  1T4Z A;  2VL3 A;  4Z2T A;  1FVJ A;  3HHV A;  3GL5 A;  4LLR A;  3I6A A;  1GUH A;  2H1D A;  1A2M A;  4ZIL A;  3L9U A;  3VWU A;  1SVL A;  1PX6 A;  3GST A;  1XXU A;  2MYG A;  2IPA A;  4TVE A;  5EL8 A;  1A2L A;  2UZ8 A;  2R0P A;  3EU3 A;  3AY8 A;  3GNJ A;  5JCG A;  3ISO A;  1EWX A;  3BCI A;  2E0Q A;  4K5S A;  2PN8 A;  2YP6 A;  2XBQ A;  3NZN A;  1V9W A;  1YQ1 A;  1K0O A;  4D73 B;  5DAK A;  1BG1 A;  4X0X A;  5ECQ B;  3ZML A;  1B8X A;  3TKS C;  1M2D A;  4TXO A;  1QFN A;  2H19 A;  3JCM L;  3LFL A;  2XPD A;  2VLV A;  2YOI A;  3CRT A;  1AXD A;  2TIR A;  3L4N A;  4N0V A;  1EZK A;  1RQM A;  1FW1 A;  4AKX B;  4HQS A;  2NBS A;  2VLT A;  1A23 A;  2KP2 A;  1PQN A;  1EGR A;  4PQH A;  3EUR A;  1Q4J A;  2EFE A;  2V6K A;  3EE2 A;  4BL7 B;  2VCT A;  3CQF A;  4A5P A;  3GV1 A;  1TK8 B;  2HXK A;  4MF5 A;  3IPZ A;  3ZTL A;  4XS4 A;  4ZL9 A;  2VCW A;  5ECI B;  2MMA A;  4OMV A;  3A2X A;  5HR1 A;  3QD9 A;  4J2F A;  2ALB A;  2C8U A;  5G30 A;  1EEM A;  4WR4 A;  5DVB A;  1SL0 B;  1M9B A;  1X5E A;  3ED3 A;  6GST A;  1R5A A;  2BTO T;  1R7H A;  1SVO A;  5HR0 A;  2CV4 A;  2HYX A;  1LBK A;  2C3Q A;  1NW2 A;  1A0R P;  5CRW A;  2DJ3 A;  3GKM A;  4BPY A;  2FWF A;  2F8F A;  2R3X A;  3EMP A;  5A4V A;  3P7X A;  1KBN A;  4GQC A;  5A5K A;  1YKC A;  1G6Y A;  3HY2 A;  4MH2 A;  1OKT A;  2WW3 A;  2RUE A;  1DE1 A;  4G0L A;  5JCU A;  1V57 A;  4G9H A;  3APQ A;  2I4A A;  2M80 A;  1YF1 A;  3EYT A;  5B8B A;  4TR4 A;  1TW9 A;  2VCX A;  5DQS A;  2PWJ A;  4WEY A;  4AF2 A;  1AUC A;  2RLI A;  1T8E B;  4K7O A;  2GSQ A;  1SU9 A;  1TRU A;  2N5A A;  2CVD A;  3BD2 A;  3C7M A;  5ECN B;  4MH3 A;  10GS A;  3UJ1 A;  2H30 A;  1UA5 A;  4XRA A;  1LJR A;  5A4W A;  1DUG A;  4YAV A;  4NHW A;  2H0G A;  2IFQ A;  4JE1 A;  2CQ9 A;  1XIY A;  2YWI A;  5ECH B;  6GSW A;  2VUP A;  4I2U A;  4NMU A;  5IOX A;  1EV9 A;  3FR9 A;  1M3J A;  2G0F A;  4PGT A;  1EEJ A;  1F37 A;  3M0F A;  3TRQ A;  4N0Z A;  3WT1 A;  3BBY A;  3GTU B;  1QMV A;  3M1G A;  5ECP B;  1X5D A;  2MZC A;  1XVW A;  3KTL A;  3F63 A;  1T00 A;  1YKA A;  3C8E A;  3F6D A;  4MAB A;  2B5E A;  3QPM A;  2FUG 2;  3RFR C;  4K1F A;  4TR0 A;  1GNE A;  2C0F A;  1O81 A;  4FH8 A;  5D9X A;  1ERU A;  4V2M A;  1R5P A;  4NAX A;  2HRA A;  4AI6 A;  1X0R A;  3RGB C;  2QGV A;  3DIE A;  2KP1 A;  4X4J A;  4EE0 A;  2LJA A;  2IMK A;  3ZL5 A;  5CAX A;  2VM1 A;  3L9S A;  2C3T A;  2FLS A;  4BVY A;  4MP4 A;  1OYJ A;  4L0W A;  1XWG A;  4EKZ A;  4WF5 A;  2C3N A;  3HCZ A;  3QAV A;  2HRN A;  2C0E A;  1IYH A;  5J5N A;  2VM2 A;  4ECJ A;  2JL4 A;  1SK0 A;  2WVZ A;  4TR1 A;  1TOF A;  1VF2 A;  3UEM A;  2QC7 A;  1GWC A;  1MDK A;  1TU8 A;  3EIN A;  1GLP A;  3ZVJ A;  1PKW A;  2V6O A;  5E59 A;  4DEJ A;  1B9Y C;  3KP9 A;  2XPE A;  3TOT A;  1R4W A;  2HSY A;  1AAZ A;  3D6I A;  1SYR A;  5KN2 A;  2B1K A;  1XWB A;  5IIZ A;  4XCS A;  3TDG A;  3ZIV A;  2JAC A;  1K0M A;  3TJK A;  2DMM A;  3UBK A;  3TKP A;  2GTU A;  3C73 A;  1C72 A;  3CSH A;  2R6K A;  1EP8 A;  4ML6 A;  3KZQ A;  2EFH A;  2O8V B;  3QAG A;  3KH7 A;  1ZGN A;  1OC9 B;  4EDY A;  3ZFB A;  4DSR A;  2CVK A;  3APS A;  3TRP A;  2CA8 A;  4AKG A;  3HJM A;  2GZZ A;  1MDI A;  1XWA A;  4MF7 A;  2TRX A;  5E4W A;  2HNL A;  1B48 A;  3H93 A;  1URM A;  4PQ1 A;  1O85 A;  1PX7 A;  3EWL A;  4WET A;  1KEB A;  1NSW A;  4J56 E;  1K3Y A;  4WBJ A;  3V1W A;  5IQY A;  4WXT A;  1O8W A;  4LMW A;  4JRR A;  1ZYE A;  2JZS A;  3IR4 A;  3OR5 A;  1ZOF A;  2P0G A;  2PVO C;  2R37 A;  3HVX A;  1FOH A;  1VGL A;  4KF9 A;  3DWV A;  3MNG A;  4Q5R A;  1WP0 A;  3Q18 A;  1PGT A;  2H1A A;  17GS A;  2HZE A;  5FHI A;  2QA2 A;  4K9Z A;  2YCD A;  2PVQ A;  4GLT A;  3CBU A;  2AHE A;  3D22 A;  3Q74 A;  4X43 A;  5CRD A;  2TRC P;  3WYW A;  2C0D A;  3CRU A;  4NV5 A;  2IME A;  2VCZ A;  1OKD A;  3F0I A;  5CRE A;  1JFU A;  1SEN A;  4ZB6 A;  1ST9 A;  1W89 A;  2NTO A;  4F2I A;  5B8A A;  4EUY A;  1TDI A;  2L57 A;  3H79 A;  1K3L A;  2CZ2 A;  5G5E A;  5J41 A;  1ERT A;  3KM6 A;  1T4Y A;  4ZB9 A;  4HQZ A;  1CQH A;  3HYP A;  3TB2 A;  1LU4 A;  3KTB A;  1F2E A;  6GSX A;  2VL9 A;  1PL2 A;  3DKS A;  5BMU A;  4EIP A;  2HQT A;  3R3E A;  3TKQ A;  4O7H A;  5IMC A;  2GS3 A;  1X9M B;  3QMX A;  1XWC A;  2LST A;  3IBH A;  3C1S A;  3TCO A;  5ECO B;  3ZYW A;  4PI2 C;  4ULX A;  2WUL A;  1X5C A;  5COH A;  1S3R A;  1WJK A;  1QXH A;  3MSZ A;  3ERW A;  4ZBA A;  5INY A;  3C71 A;  2E2M A;  1ZZY A;  18GS A;  2IMI A;  3LGC A;  1VRS D;  4O5Q A;  5IPH A;  3LEF A;  1MTC A;  1HNC A;  1E6B A;  2PUK C;  3M9J A;  2X4A A;  4I2T A;  5ECK B;  4IP6 A;  5A5H B;  3HXS A;  5HFI A;  3FMW A;  4AJ6 A;  1K0A A;  5A1N B;  4MPG A;  3P2A A;  4F0B A;  4OCE A;  4HSC X;  2JSY A;  2OA7 A;  2ZNM A;  4AJ7 A;  14GS A;  2ZCT A;  2OKA A;  1HYU A;  1FO5 A;  4PXO A;  4LL1 B;  3GMF A;  4K6X A;  1DBY A;  1OE8 A;  4L5L A;  1GTB A;  3LYP A;  3P90 A;  1CQG A;  2H76 A;  3L9V A;  2LQO A;  4POM A;  4BVX B;  1EOH A;  1TXU A;  3HD5 A;  3KEB A;  4EXJ A;  4V1A g;  4ISD A;  2R0G A;  4KND A;  3DVX A;  1TRS A;  2P5Q A;  4IP1 A;  3L78 A;  1DE2 A;  2XBI A;  3P8W A;  4O5U A;  1GRX A;  3QCP A;  1GTU A;  4HOJ A;  4GDF A;  1ZL9 A;  1BF5 A;  5D93 A;  2CX3 A;  3HZ8 A;  1TP9 A;  2N5B A;  2AB6 A;  2OE3 A;  2PPT A;  3Q19 A;  2IJY A;  2ZUP A;  1F3B A;  2KHP A;  1JLW A;  5L71 A;  1MD3 A;  5ECS A;  4CW9 A;  1SJ6 A;  3FRC A;  1HNA A;  2H0I A;  2GT5 A;  3O6T A;  3I9V 2;  1Z9H A;  1TKD B;  3RHB A;  3MDK A;  3RDW A;  4IVF A;  1ZYQ B;  4AKI A;  2I1U A;  3CHX C;  5ECR B;  1QK8 A;  4JU5 A;  3ZRE A;  2WDU A;  1BG5 A;  2H75 A;  1A0F A;  1THX A;  3IK7 A;  5IMF A;  2YV9 A;  3UAR A;  4CDO A;  2A2R A;  3VK9 A;  2HRF A;  2VL2 C;  5A34 B;  2JZT A;  1PN0 A;  3D5J A;  5ECM B;  5ABR A;  2WW1 A;  4IQA A;  4HJM A;  5LD0 A;  1JZW A;  2IMD A;  1H4O A;  3R2Q A;  4E68 A;  4K8M A;  1PMT A;  3CYN A;  1AQW A;  1OE7 A;  2LQQ A;  4G2E A;  2CVB A;  2JZR A;  2H6Y A;  2YAN A;  4FYU A;  5F05 A;  2OE0 A;  2EIQ A;  4D73 A;  3IHG A;  2V41 A;  1SYX A;  2NPB A;  1SJZ A;  2PER A;  2IIY A;  5J4V A;  3RBT A;  3M9K A;  3UAP A;  3FK8 A;  4OWY A;  1BYE A;  2OBK A;  2QA1 A;  1GH2 A;  3F3Q A;  2VCQ A;  3M3M A;  3FHK A;  5AIS A;  1XOB A;  6GSV A;  2M72 A;  4G01 A;  5FWG A;  4J57 E;  4PHZ C;  3ME7 A;  1GUK A;  3WGD A;  4F82 A;  4PUA A;  4TOP A;  3NOF A;  4FO5 A;  2H1G A;  3KMN A;  3U6V A;  1G7O A;  22GS A;  2FA8 A;  5IM9 A;  5AN1 A;  1YY7 A;  2L4C A;  1SK2 A;  3GX8 A;  4BL7 A;  4ILF A;  1GLQ A;  4V2N A;  4GWR A;  1HNB A;  2OAC A;  3KD0 A;  3ZIJ A;  2L6D A;  3EU4 A;  4MA9 A;  3HKR A;  1YEW C;  5B6N A;  2LKU A;  4GRF A;  4IW9 A;  4ZBD A;  3N5O A;  2K6V A;  2UV8 G;  1TJD A;  1V2A A;  1M3I A;  2HSN B;  3O3T A;  2V1M A;  3ZIT A;  4KW6 A;  3GUS A;  2H8L A;  4FQU A;  5DJL A;  5J3R A;  4JR4 A;  4OFN A;  1WPI A;  1ON4 A;  4NHZ A;  3S9F A;  2E7P A;  4O32 A;  2DJJ A;  1EOG A;  3DYR A;  1ABA A;  2A2P A;  1TU7 A;  3C1R A;  2NVL A;  2DJK A;  4ECB A;  4YKF A;  2HSH A;  5H5Q A;  1M2A A;  4MDC A;  5G5F A;  4WF4 A;  5ELA A;  2VIM A;  3ERF A;  5AIV A;  6GSY A;  2E2G A;  2KUC A;  4PUR A;  5C04 A;  4JBB A;  4KDY A;  2WW2 A;  1GL8 A;  1O73 A;  3GFK A;  1KNG A;  5J4U A;  1O7U A;  2EIR A;  5JWO B;  3K8N A;  1AQX A;  2HRK B;  5H5S A;  3H1N A;  2GZY A;  3D4M A;  2K8V A;  4KAE A;  11GS A;  4WR5 A;  3IDV A;  2C1Y A;  3HJP A;  2YJ7 A;  4YAP A;  1S3D A;  1HD2 A;  1XW6 A;  2I3Y A;  4HU9 A;  1GSU A;  1VF3 A;  3SWL A;  4K2D A;  5ECL B;  2H0H A;  5KOW A;  4MK3 A;  3GIX A;  2H73 A;  5JWQ B;  4FYB A;  2WVX B;  3PPU A;  1JLV A;  2YZU A;  1WIK A;  4HJ2 A;  1BQ7 A;  2GST A;  3HA9 A;  4OFM A;  3LXT A;  3GN3 A;  5F0G A;  2N5F A;  4ZL8 A;  1FHE A;  1FVK A;  2YNX A;  3E0U A;  3VUR A;  5DAL B;  4IJI A;  2LEG A;  4BWQ A;  2RUF A;  4OD7 A;  1U87 A;  4IHU A;  2CZ3 A;  3ME8 A;  4CY8 A;  3TJB A;  3UOM A;  2NDO A;  3GTU A;  3RPP A;  2OAD A;  3IE3 A;  4YQM A;  3PIN A;  3CXG A;  3ZVJ D;  1Z3E A;  3KXO A;  3GKN A;  3ZFL A;  3MWH A;  2WZS A;  3O76 A;  4MZB A;  4PNF A;  4KSO A;  1AW9 A;  4JED A;  2VAF A;  2GDR A;  3CSI A;  1BED A;  1PSQ A;  1S3C A;  2B6M A;  4BA7 A;  4EIQ A;  3MAK A;  1UC7 A;  4IEL A;  5ENU A;  4MJA A;  1TK5 B;  1G7E A;  2D2Z A;  2H71 A;  2B1L A;  4OFT A;  1V98 A;  3W8J A;  4PQI A;  2OBI A;  2L5L A;  2L59 A;  1GP1 A;  3A5I A;  3HDC A;  5DDL A;  3APO A;  3LYK A;  5JWR B;  2XHF A;  4N3Z A;  1VF4 A;  1K0N A;  3J7Y k;  4GSN A;  2JSZ A;  1GSD A;  1K0D A;  4Z7X A;  4EC0 A;  1EGO A;  3UVT A;  2DC5 A;  2A2S A;  1J08 A;  2QSI A;  1ILO A;  3LOR A;  3LXZ A;  1K3O A;  4FXY P;  2FWH A;  3H4K A;  1S4B P;  2V32 A;  1Y6E A;  4ML1 A;  2REM A;  3GL3 A;  2VO4 A;  1E2Y A;  2DJ1 A;  3G7Y A;  1PKZ A;  2HSM B;  3LSZ A;  1RW1 A;  3VWX A;  1FOV A;  1WOU A;  1M2B A;  1RK4 A;  2DLX A;  1U3A A;  5IPG A;  3Q6O A;  3CWG A;  3TUE A;  5D9V A;  9GSS A;  1OC9 A;  1FB0 A;  3GUR A;  3EC3 A;  4IJ3 A;  3HVN A;  2HI7 A;  2P5R A;  2LNS A;  2EC4 A;  3UL3 A;  1W4V A;  1M7T A;  4PTS A;  4WKW A;  4KX4 A;  1ACV A;  2JAD A;  4DSS B;  3PH9 A;  1GSQ A;  1U3I A;  2X64 A;  5LNK e;  4EL1 A;  2FHE A;  2K8S A;  2H01 A;  4JZQ A;  3MIX A;  2H1L A;  3IK9 A;  2MMN A;  2G2Q A;  3DXB A;  1YVL A;  1V58 A;  3TGZ A;  1IYI A;  3FEU A;  2WB9 A;  2HZF A;  1AQV A;  4Q5F A;  3FZA A;  3IAM 2;  3VFI A;  1MEK A;  3I43 A;  5G1L A;  2GZP A;  1XCC A;  5EPF A;  5G2Z A;  3FY7 A;  4XS1 A;  1JZR A;  5CRH A;  5IOW A;  3QR6 A;  1XG8 A;  3TJJ A;  4K7I A;  3RHC A;  1EP7 A;  1PN9 A;  2J9H A;  3IOS A;  3HMJ G;  1YZX A;  4KSM A;  4TXV A;  2VD1 A;  2DBC A;  4K0N A;  4POB A;  3LW9 A;  1ZYN A;  3FZ9 A;  2B5Y A;  2H70 A;  2FA4 A;  3FR3 A;  2B5X A;  5HFG A;  4IKH A;  2H66 A;  3WT2 A;  2IWT A;  4QL7 A;  1SD8 A;  3DML A;  1EV4 A;  1F3A A;  5HR3 A;  1SL2 B;  2A4H A;  2DJ2 A;  2VKZ G;  3DD3 A;  4RQX A;  3G7J A;  4K5R A;  3GRX A;  1O8X A;  3A3T A;  1ML6 A;  2X99 A;  3RAZ A;  3UVH A;  5DQY A;  4HDE A;  3VPQ A;  1PD2 1;  5CP1 A;  4LL4 B;  2CAI A;  4KH7 A;  1B4Q A;  1WE0 A;  5A4U A;  2LRN A;  1YDK A;  1PFO A;  4MJC A;  5IMD A;  5F06 A;  1Z6M A;  1XWK A;  4PX1 A; 
#chains in the Genus database with same CATH homology
 2IMF A;  3WGE A;  1AIU A;  2FWE A;  4I5Q A;  4Z2R A;  3IXR A;  3TKS A;  1I9D A;  2EIO A;  5IO0 A;  2ON5 A;  4RI6 A;  4ID0 A;  1ZYP A;  1SKS B;  4TW5 A;  3G7I A;  2WZ9 A;  5DCG A;  4E8E A;  5J40 A;  1MDJ A;  2F8A A;  4QQ7 A;  1TI3 A;  5HR2 A;  4OO4 A;  3KJY A;  3DGQ A;  4ZXG A;  1TXX A;  1A2J A;  5A5H A;  4IGJ A;  4MF6 A;  3LJR A;  2H6Z A;  1O6J A;  5A1N A;  1OVN A;  1XFL A;  5IMV A;  4L0U A;  5GAP D;  5DAK B;  2YN1 A;  4I8B A;  4F0C A;  3J7Y b;  4CHS A;  2GGT A;  4NPB A;  3HVV A;  5KN3 A;  4GSS A;  1KTE A;  1QGV A;  4TXO B;  3N9J A;  2MBS A;  2YV7 A;  3WD6 A;  2GVP A;  1FB6 A;  3VWV A;  2K9F A;  1VF1 A;  3GKX A;  3F4R A;  1J9B A;  3EVI A;  4Q5Q A;  4YQU A;  4BVX A;  3CSJ A;  2PBJ A;  2O85 A;  2FY6 A;  2C80 A;  2ES7 A;  3LG6 A;  3TKR A;  3W8S A;  5DCH A;  1A8Y A;  4GXZ A;  1XVQ A;  4LA1 A;  4NXI A;  3H8Q A;  2AYT A;  4GTU A;  4PUF C;  13GS A;  4ZL7 A;  2DSA A;  2YJH A;  1HQO A;  1SK1 A;  4XS4 B;  2FGX A;  4FIW A;  3ZRD A;  4Q5N A;  4HI7 A;  2X8C A;  5CYY A;  4LMV A;  3KIJ A;  4DSQ A;  1K0C A;  2DIY A;  3QOU A;  5F07 A;  3I69 A;  1XW9 A;  3U5R E;  1TTZ A;  4OO5 A;  4MPF A;  3VI5 A;  3F6F A;  2JU5 A;  3IAS 2;  4ACS A;  1UN2 A;  2KLX A;  2LUS A;  4HS1 A;  3FZ5 A;  4WBR D;  4Z2U A;  2GT6 A;  1PA3 A;  4PNG A;  2I81 A;  2EFD A;  5B6M A;  3GYK A;  2YWN A;  2O89 A;  5DJM A;  1N2A A;  2FNO A;  2B3S A;  4XTS A;  3A5W A;  2WFC A;  3VWW A;  2YWM A;  1SL1 B;  4NWY A;  4POK A;  2OE1 A;  5D9T A;  3LQ7 A;  3VI7 A;  4HZ4 A;  3TU3 B;  2R2J A;  2GQK A;  1OC3 A;  5EY6 A;  1Z5Y E;  2R5G A;  2PU9 C;  3F8U A;  3VLN A;  5GSS A;  2VCV A;  1R26 A;  1JZD A;  1BX9 A;  4OCF A;  5KN0 A;  1XPV A;  4XRD A;  3G9B A;  2WJU A;  2GSR A;  2DJ0 A;  1YEP A;  2YZH A;  3MYD A;  4O5R A;  5IO2 A;  5A34 A;  4ECC A;  5BRT A;  5J4Y A;  2R0C A;  8GSS A;  2XC2 A;  2LRC A;  3FKF A;  3QAW A;  1PL1 A;  4MCU A;  4YH2 A;  4RQR A;  2IFQ B;  2LV3 A;  1THO A;  2HE3 A;  1TRW A;  2LRT A;  3IV4 A;  2LJR A;  4YKG A;  3VPT A;  2L4Q A;  1Z7P A;  4ZIJ A;  1ZCP A;  3WGX A;  3F4T A;  2RM6 A;  2AJQ B;  3TKS E;  5AIX A;  2CAQ A;  4HU7 A;  4QL9 A;  2DKH A;  1UVZ A;  2V2G A;  4ZB8 A;  3GX0 A;  4GQF A;  2MBT A;  4EF0 A;  2MMZ A;  3GKK A;  1USB A;  3IRA A;  4KGI A;  1N8J A;  4F03 A;  4NV2 A;  3A2W A;  1F9M A;  1TK0 B;  2ON7 A;  2LS5 A;  3PGT A;  3GH6 A;  5J47 A;  1Q98 A;  6GSS A;  4CY6 A;  3DRN A;  1NHY A;  4IS0 A;  4MMM A;  3KCM A;  4I97 A;  1XBS A;  5GZZ B;  1JHB A;  4TRX A;  1SD9 A;  5HFK A;  3SBC A;  1Z7R A;  1DSB A;  4XIH A;  12GS A;  3QDN A;  1U6T A;  2FCH A;  4DVC A;  5F8B A;  1XOA A;  2F9S A;  2CX4 A;  4BVY B;  1X9S B;  2R4V A;  1FAA A;  7GSS A;  2HSN A;  4E8H A;  4HEA 2;  2LJK A;  3D4T A;  4KDU A;  4F9Z A;  4ICY A;  1GNW A;  5GAN D;  3CMI A;  4TKY A;  4TR1 B;  2K18 A;  4POL A;  1PRX A;  4ECI A;  4L8E A;  5ELG A;  5EVO A;  3GH9 A;  3KP8 A;  1G0T A;  4RI7 A;  4AKH A;  4BWS A;  1GTI A;  2O5V A;  4TR3 A;  1T1V A;  3KH9 A;  3QFB C;  4RUV A;  1TRV A;  3FYG A;  2PMT A;  3ZLP A;  5ID2 B;  3UIW A;  2C0G A;  1OAZ A;  2HRK A;  1I5G A;  4EDZ A;  2A4V A;  2H6X A;  3DVW A;  4IBP A;  1GTA A;  5JCW A;  2WCI A;  3L0H A;  5CO3 A;  4MZC A;  2LTK A;  2P31 A;  1U88 A;  3HZ4 A;  1M9A A;  2F3M A;  20GS A;  1WWJ A;  4GF0 A;  3A2V A;  1GSY A;  4MNN A;  4IN0 A;  3GA4 A;  5IMA A;  1K0B A;  4P3Y B;  2HLS A;  2IN3 A;  4X1U A;  2MMO A;  1BAY A;  4V1A p;  5DAL A;  4MZW A;  5IMZ A;  4GCI A;  3KGK A;  3ZZX A;  2H1B A;  1FG4 A;  2GSS A;  4KB3 A;  5HQP A;  2L5O A;  1MD4 A;  1NM3 A;  4FYC A;  5D73 A;  3DEX A;  5ID2 A;  1JZO A;  2M46 A;  2H72 A;  3US3 A;  1G6W A;  2HZE B;  1T3B A;  3TOU A;  3TJG A;  3LWA A;  2H74 A;  3E3E A;  4KDX A;  2RII A;  1TI1 A;  2VLU A;  1GUL A;  1YF0 A;  2BMX A;  1V40 A;  4KCE A;  2WRT A;  1Y25 A;  2O87 A;  1SJI A;  2YWO A;  3EMX A;  1XW5 A;  1H75 A;  1GSS A;  4IQ1 A;  3EPT A;  1X9W B;  4KA0 A;  4KE3 A;  5H5R A;  4MJB A;  4AGS A;  1YEX A;  2BJX A;  4MJE A;  2OJL A;  4KCA A;  4QMK A;  4KUN A;  2J23 A;  5BMU B;  3NIV A;  1XZO A;  4N11 A;  5KOX A;  4XS6 A;  5G31 A;  3D21 A;  3PR8 A;  5GST A;  4ZBB A;  1AC1 A;  2LNT A;  3W6G A;  2AAW A;  3IC8 A;  5J9B A;  4HUA A;  4TN8 A;  2HSM A;  2B7K A;  1QUW A;  1T7P B;  5CNW A;  5KEJ A;  2Z9S A;  4L5O A;  4EO3 A;  5G1K A;  1N25 A;  3CTG A;  5D9W A;  2FD3 A;  4N10 A;  3ERG A;  2X8H A;  3BCK A;  3TRX A;  2EFC A;  1F6M C;  2GQL A;  3CTF A;  3BOA A;  19GS A;  4G19 A;  2KOK A;  2WS2 A;  2PGT A;  4GST A;  4XHM A;  1S3A A;  5KN1 A;  1M99 A;  1A8L A;  5C00 A;  5D8I A;  1ZMA A;  3UBL A;  1A24 A;  4G10 A;  4K2X A;  1SVM A;  5LCZ A;  3HVS A;  1J0F A;  5DBQ A;  2OT3 A;  4DSS A;  1OC8 A;  2HFD A;  1WRY A;  1QQ2 A;  4EVM A;  16GS A;  1B9X C;  4AJ8 A;  3GHA A;  1Y1U A;  4ZB7 A;  2VOC A;  1GSF A;  3IC4 A;  2QKE A;  2IL3 A;  5B7C A;  2F51 A;  4G0I A;  2C4J A;  3IHQ A;  3ZMK A;  4H86 A;  1SKR B;  3UMA A;  3FW2 A;  2AUV A;  2X8G A;  4V2L A;  1YJ6 A;  3IA1 A;  3M8N A;  3KMO A;  2L6C A;  2I9H A;  3QFA C;  5CRG A;  1SKW B;  3F4S A;  2VD0 A;  2GQM A;  1ERW A;  2HT9 A;  3BJ5 A;  4JR6 A;  4W66 A;  1NHO A;  4G0K A;  2DML A;  2CT6 A;  6GSU A;  5FT3 A;  4N30 A;  4O92 A;  2WGR A;  1B4P A;  4K0G A;  1Z6N A;  2DKI A;  4K7N A;  5AGY A;  1BJX A;  4MLY A;  2B7J A;  4USS A;  2VL2 A;  3RPN A;  5J9C A;  1ERV A;  2O7K A;  4I6X A;  1GSE A;  2X49 A;  1GUM A;  3HJO A;  3FR6 A;  2RM5 A;  3FZ4 A;  2YPM A;  3F3R A;  2AV4 A;  3F9U A;  4YQV A;  3E9J B;  2FWG A;  1M0U A;  2DIZ A;  2GLR A;  3D0Z A;  3GSS A;  3TJF A;  5D96 A;  4HZ2 A;  1WMJ A;  1T4Z A;  2VL3 A;  4Z2T A;  1FVJ A;  3HHV A;  3GL5 A;  4LLR A;  3I6A A;  1GUH A;  2H1D A;  1A2M A;  4ZIL A;  3L9U A;  3VWU A;  1SVL A;  1PX6 A;  3GST A;  1XXU A;  2MYG A;  2IPA A;  4TVE A;  5EL8 A;  1A2L A;  2UZ8 A;  2R0P A;  3EU3 A;  3AY8 A;  3GNJ A;  5JCG A;  3ISO A;  1EWX A;  3BCI A;  2E0Q A;  4K5S A;  2PN8 A;  2YP6 A;  2XBQ A;  3NZN A;  1V9W A;  1YQ1 A;  1K0O A;  4D73 B;  5DAK A;  1BG1 A;  4X0X A;  5ECQ B;  3ZML A;  1B8X A;  3TKS C;  1M2D A;  4TXO A;  1QFN A;  2H19 A;  3JCM L;  3LFL A;  2XPD A;  2VLV A;  2YOI A;  3CRT A;  1AXD A;  2TIR A;  3L4N A;  4N0V A;  1EZK A;  1RQM A;  1FW1 A;  4AKX B;  4HQS A;  2NBS A;  2VLT A;  1A23 A;  2KP2 A;  1PQN A;  1EGR A;  4PQH A;  1Q4J A;  3EUR A;  2EFE A;  2V6K A;  3EE2 A;  4BL7 B;  2VCT A;  4A5P A;  3GV1 A;  1TK8 B;  2HXK A;  4MF5 A;  3IPZ A;  3ZTL A;  4XS4 A;  4ZL9 A;  2VCW A;  5ECI B;  2MMA A;  4OMV A;  3A2X A;  5HR1 A;  3QD9 A;  4J2F A;  2ALB A;  2C8U A;  5G30 A;  1EEM A;  4WR4 A;  5DVB A;  1SL0 B;  1M9B A;  1X5E A;  3ED3 A;  6GST A;  1R5A A;  2BTO T;  1R7H A;  1SVO A;  5HR0 A;  2CV4 A;  2HYX A;  1LBK A;  2C3Q A;  1NW2 A;  1A0R P;  5CRW A;  2DJ3 A;  3GKM A;  4BPY A;  2FWF A;  2F8F A;  2R3X A;  3EMP A;  5A4V A;  3P7X A;  1KBN A;  4GQC A;  5A5K A;  1YKC A;  1G6Y A;  3HY2 A;  4MH2 A;  1OKT A;  2RUE A;  1DE1 A;  4G0L A;  5JCU A;  1V57 A;  4G9H A;  3APQ A;  2I4A A;  2M80 A;  1YF1 A;  3EYT A;  5B8B A;  4TR4 A;  1TW9 A;  2VCX A;  5DQS A;  2PWJ A;  4WEY A;  4AF2 A;  1AUC A;  2RLI A;  1T8E B;  4K7O A;  2GSQ A;  1SU9 A;  1TRU A;  2N5A A;  2CVD A;  3BD2 A;  3C7M A;  5ECN B;  4MH3 A;  10GS A;  3UJ1 A;  2H30 A;  1UA5 A;  4XRA A;  1LJR A;  5A4W A;  1DUG A;  4YAV A;  4NHW A;  2H0G A;  2IFQ A;  4JE1 A;  2CQ9 A;  1XIY A;  2YWI A;  5ECH B;  6GSW A;  2VUP A;  4I2U A;  4NMU A;  5IOX A;  1EV9 A;  3FR9 A;  2G0F A;  4PGT A;  1EEJ A;  1F37 A;  3M0F A;  3TRQ A;  4N0Z A;  3WT1 A;  3BBY A;  3GTU B;  1QMV A;  3M1G A;  5ECP B;  1X5D A;  2MZC A;  1XVW A;  3KTL A;  3F63 A;  1T00 A;  1YKA A;  3C8E A;  3F6D A;  4MAB A;  2B5E A;  3QPM A;  2FUG 2;  4K1F A;  4TR0 A;  1GNE A;  2C0F A;  1O81 A;  4FH8 A;  5D9X A;  1ERU A;  4V2M A;  1R5P A;  4NAX A;  2HRA A;  4AI6 A;  1X0R A;  2QGV A;  3DIE A;  2KP1 A;  4X4J A;  4EE0 A;  2LJA A;  2IMK A;  3ZL5 A;  5CAX A;  2VM1 A;  3L9S A;  2C3T A;  2FLS A;  4BVY A;  4MP4 A;  1OYJ A;  4L0W A;  1XWG A;  4EKZ A;  4WF5 A;  2C3N A;  3HCZ A;  3QAV A;  2HRN A;  2C0E A;  1IYH A;  5J5N A;  2VM2 A;  4ECJ A;  2JL4 A;  1SK0 A;  4TR1 A;  1TOF A;  1VF2 A;  3UEM A;  2QC7 A;  1GWC A;  1MDK A;  1TU8 A;  3EIN A;  1GLP A;  3ZVJ A;  1PKW A;  2V6O A;  5E59 A;  4DEJ A;  1B9Y C;  3KP9 A;  2XPE A;  3TOT A;  1R4W A;  2HSY A;  1AAZ A;  3D6I A;  1SYR A;  5KN2 A;  2B1K A;  1XWB A;  5IIZ A;  4XCS A;  3TDG A;  3ZIV A;  2JAC A;  1K0M A;  3TJK A;  2DMM A;  3UBK A;  3TKP A;  2GTU A;  3C73 A;  1C72 A;  3CSH A;  2R6K A;  1EP8 A;  4ML6 A;  3KZQ A;  2EFH A;  2O8V B;  3KH7 A;  3QAG A;  1ZGN A;  1OC9 B;  4EDY A;  3ZFB A;  4DSR A;  2CVK A;  3APS A;  3TRP A;  2CA8 A;  4AKG A;  3HJM A;  2GZZ A;  1MDI A;  1XWA A;  4MF7 A;  2TRX A;  5E4W A;  2HNL A;  1B48 A;  3H93 A;  1URM A;  4PQ1 A;  1O85 A;  1PX7 A;  3EWL A;  4WET A;  1KEB A;  1NSW A;  4J56 E;  1K3Y A;  4WBJ A;  3V1W A;  5IQY A;  4WXT A;  1O8W A;  4LMW A;  4JRR A;  1ZYE A;  2JZS A;  3IR4 A;  3OR5 A;  1ZOF A;  2P0G A;  2PVO C;  2R37 A;  3HVX A;  1FOH A;  1VGL A;  4KF9 A;  3DWV A;  3MNG A;  4Q5R A;  1WP0 A;  3Q18 A;  1PGT A;  2H1A A;  17GS A;  2HZE A;  5FHI A;  2QA2 A;  4K9Z A;  2YCD A;  2PVQ A;  4GLT A;  3CBU A;  2AHE A;  3D22 A;  3Q74 A;  4X43 A;  5CRD A;  2TRC P;  3WYW A;  2C0D A;  3CRU A;  4NV5 A;  2IME A;  2VCZ A;  1OKD A;  3F0I A;  5CRE A;  1JFU A;  1SEN A;  4ZB6 A;  1ST9 A;  1W89 A;  2NTO A;  4F2I A;  5B8A A;  4EUY A;  1TDI A;  2L57 A;  3H79 A;  1K3L A;  2CZ2 A;  5G5E A;  5J41 A;  1ERT A;  3KM6 A;  1T4Y A;  4ZB9 A;  4HQZ A;  1CQH A;  3HYP A;  3TB2 A;  1LU4 A;  3KTB A;  1F2E A;  6GSX A;  2VL9 A;  1PL2 A;  3DKS A;  5BMU A;  4EIP A;  2HQT A;  3R3E A;  3TKQ A;  4O7H A;  5IMC A;  2GS3 A;  1X9M B;  3QMX A;  1XWC A;  2LST A;  3IBH A;  3C1S A;  3TCO A;  5ECO B;  3ZYW A;  4ULX A;  2WUL A;  1X5C A;  5COH A;  1WJK A;  1QXH A;  3MSZ A;  3ERW A;  4ZBA A;  5INY A;  3C71 A;  2E2M A;  1ZZY A;  18GS A;  2IMI A;  3LGC A;  1VRS D;  4O5Q A;  5IPH A;  3LEF A;  1MTC A;  1HNC A;  1E6B A;  2PUK C;  3M9J A;  2X4A A;  4I2T A;  5ECK B;  4IP6 A;  5A5H B;  3HXS A;  5HFI A;  3FMW A;  4AJ6 A;  1K0A A;  5A1N B;  4MPG A;  3P2A A;  4F0B A;  4OCE A;  2JSY A;  2OA7 A;  2ZNM A;  4AJ7 A;  14GS A;  2ZCT A;  2OKA A;  1HYU A;  1FO5 A;  4PXO A;  4LL1 B;  3GMF A;  4K6X A;  1DBY A;  1OE8 A;  4L5L A;  1GTB A;  3LYP A;  3P90 A;  1CQG A;  2H76 A;  3L9V A;  2LQO A;  4POM A;  4BVX B;  1EOH A;  1TXU A;  3HD5 A;  3KEB A;  4EXJ A;  4V1A g;  4ISD A;  2R0G A;  4KND A;  3DVX A;  1TRS A;  2P5Q A;  4IP1 A;  3L78 A;  1DE2 A;  2XBI A;  3P8W A;  4O5U A;  1GRX A;  3QCP A;  1GTU A;  4HOJ A;  4GDF A;  1ZL9 A;  1BF5 A;  5D93 A;  2CX3 A;  3HZ8 A;  1TP9 A;  2N5B A;  2AB6 A;  2OE3 A;  2PPT A;  3Q19 A;  2IJY A;  1F3B A;  2ZUP A;  2KHP A;  1JLW A;  5L71 A;  1MD3 A;  5ECS A;  4CW9 A;  1SJ6 A;  3FRC A;  1HNA A;  2H0I A;  2GT5 A;  3O6T A;  3I9V 2;  1Z9H A;  1TKD B;  3RHB A;  3MDK A;  3RDW A;  4IVF A;  1ZYQ B;  4AKI A;  2I1U A;  5ECR B;  1QK8 A;  4JU5 A;  3ZRE A;  2WDU A;  1BG5 A;  2H75 A;  1A0F A;  1THX A;  3IK7 A;  5IMF A;  2YV9 A;  3UAR A;  4CDO A;  2A2R A;  3VK9 A;  2HRF A;  2VL2 C;  5A34 B;  2JZT A;  1PN0 A;  3D5J A;  5ECM B;  5ABR A;  4IQA A;  4HJM A;  5LD0 A;  1JZW A;  2IMD A;  1H4O A;  3R2Q A;  4E68 A;  4K8M A;  1PMT A;  3CYN A;  1AQW A;  1OE7 A;  2LQQ A;  4G2E A;  2CVB A;  2JZR A;  2H6Y A;  2YAN A;  4FYU A;  5F05 A;  2OE0 A;  2EIQ A;  4D73 A;  3IHG A;  2V41 A;  1SYX A;  2NPB A;  1SJZ A;  2PER A;  2IIY A;  5J4V A;  3RBT A;  3M9K A;  3UAP A;  3FK8 A;  4OWY A;  1BYE A;  2OBK A;  2QA1 A;  1GH2 A;  3F3Q A;  2VCQ A;  3M3M A;  3FHK A;  5AIS A;  1XOB A;  6GSV A;  2M72 A;  4G01 A;  5FWG A;  4J57 E;  3ME7 A;  1GUK A;  3WGD A;  4F82 A;  4PUA A;  4TOP A;  3NOF A;  4FO5 A;  2H1G A;  3KMN A;  3U6V A;  1G7O A;  22GS A;  2FA8 A;  5IM9 A;  5AN1 A;  1YY7 A;  2L4C A;  1SK2 A;  3GX8 A;  4BL7 A;  4ILF A;  1GLQ A;  4V2N A;  4GWR A;  1HNB A;  2OAC A;  3KD0 A;  3ZIJ A;  2L6D A;  3EU4 A;  4MA9 A;  3HKR A;  5B6N A;  2LKU A;  4GRF A;  4IW9 A;  4ZBD A;  3N5O A;  2K6V A;  2UV8 G;  1TJD A;  1V2A A;  2HSN B;  3O3T A;  2V1M A;  3ZIT A;  4KW6 A;  3GUS A;  2H8L A;  4FQU A;  5DJL A;  5J3R A;  4JR4 A;  4OFN A;  1WPI A;  1ON4 A;  4NHZ A;  3S9F A;  2E7P A;  4O32 A;  2DJJ A;  1EOG A;  3DYR A;  1ABA A;  2A2P A;  1TU7 A;  3C1R A;  2NVL A;  2DJK A;  4ECB A;  4YKF A;  2HSH A;  5H5Q A;  1M2A A;  4MDC A;  5G5F A;  4WF4 A;  5ELA A;  2VIM A;  3ERF A;  5AIV A;  6GSY A;  2E2G A;  2KUC A;  4PUR A;  5C04 A;  4JBB A;  4KDY A;  1GL8 A;  1O73 A;  3GFK A;  1KNG A;  5J4U A;  1O7U A;  2EIR A;  5JWO B;  3K8N A;  1AQX A;  2HRK B;  5H5S A;  3H1N A;  2GZY A;  3D4M A;  2K8V A;  4KAE A;  11GS A;  4WR5 A;  3IDV A;  2C1Y A;  3HJP A;  2YJ7 A;  4YAP A;  1S3D A;  1HD2 A;  1XW6 A;  2I3Y A;  4HU9 A;  1GSU A;  1VF3 A;  3SWL A;  4K2D A;  5ECL B;  2H0H A;  5KOW A;  4MK3 A;  3GIX A;  2H73 A;  5JWQ B;  4FYB A;  3PPU A;  1JLV A;  2YZU A;  1WIK A;  4HJ2 A;  1BQ7 A;  2GST A;  3HA9 A;  4OFM A;  3LXT A;  3GN3 A;  5F0G A;  2N5F A;  4ZL8 A;  1FHE A;  1FVK A;  2YNX A;  3E0U A;  3VUR A;  5DAL B;  4IJI A;  2LEG A;  4BWQ A;  2RUF A;  4OD7 A;  1U87 A;  4IHU A;  2CZ3 A;  3ME8 A;  4CY8 A;  3TJB A;  3UOM A;  2NDO A;  3GTU A;  3RPP A;  2OAD A;  3IE3 A;  4YQM A;  3PIN A;  3CXG A;  3ZVJ D;  1Z3E A;  3MWH A;  3KXO A;  3ZFL A;  3GKN A;  3O76 A;  4MZB A;  4PNF A;  4KSO A;  1AW9 A;  4JED A;  2VAF A;  2GDR A;  3CSI A;  1BED A;  1PSQ A;  1S3C A;  2B6M A;  4BA7 A;  4EIQ A;  3MAK A;  1UC7 A;  4IEL A;  5ENU A;  4MJA A;  1TK5 B;  1G7E A;  2D2Z A;  2H71 A;  2B1L A;  4OFT A;  1V98 A;  3W8J A;  4PQI A;  2OBI A;  2L5L A;  2L59 A;  1GP1 A;  3A5I A;  3HDC A;  5DDL A;  3APO A;  3LYK A;  5JWR B;  2XHF A;  4N3Z A;  1VF4 A;  1K0N A;  3J7Y k;  4GSN A;  2JSZ A;  1GSD A;  1K0D A;  4Z7X A;  4EC0 A;  1EGO A;  3UVT A;  2DC5 A;  2A2S A;  1J08 A;  2QSI A;  1ILO A;  3LOR A;  3LXZ A;  1K3O A;  2FWH A;  3H4K A;  2V32 A;  1Y6E A;  4ML1 A;  2REM A;  3GL3 A;  2VO4 A;  1E2Y A;  2DJ1 A;  3G7Y A;  1PKZ A;  2HSM B;  3LSZ A;  1RW1 A;  3VWX A;  1FOV A;  1WOU A;  1M2B A;  1RK4 A;  2DLX A;  1U3A A;  5IPG A;  3Q6O A;  3CWG A;  3TUE A;  5D9V A;  9GSS A;  1OC9 A;  1FB0 A;  3GUR A;  3EC3 A;  4IJ3 A;  2HI7 A;  2P5R A;  2LNS A;  2EC4 A;  3UL3 A;  1W4V A;  1M7T A;  4PTS A;  4WKW A;  4KX4 A;  1ACV A;  2JAD A;  4DSS B;  3PH9 A;  1GSQ A;  1U3I A;  2X64 A;  5LNK e;  4EL1 A;  2FHE A;  2K8S A;  2H01 A;  4JZQ A;  3MIX A;  2H1L A;  3IK9 A;  2MMN A;  2G2Q A;  3DXB A;  1YVL A;  1V58 A;  3TGZ A;  1IYI A;  3FEU A;  2WB9 A;  2HZF A;  1AQV A;  4Q5F A;  3FZA A;  3IAM 2;  3VFI A;  1MEK A;  3I43 A;  5G1L A;  2GZP A;  1XCC A;  5EPF A;  5G2Z A;  3FY7 A;  4XS1 A;  1JZR A;  5CRH A;  5IOW A;  3QR6 A;  3TJJ A;  4K7I A;  3RHC A;  1EP7 A;  1PN9 A;  2J9H A;  3IOS A;  3HMJ G;  1YZX A;  4KSM A;  4TXV A;  2VD1 A;  2DBC A;  4K0N A;  4POB A;  3LW9 A;  1ZYN A;  3FZ9 A;  2B5Y A;  2H70 A;  2FA4 A;  3FR3 A;  2B5X A;  5HFG A;  4IKH A;  2H66 A;  3WT2 A;  2IWT A;  4QL7 A;  1SD8 A;  3DML A;  1EV4 A;  1F3A A;  5HR3 A;  1SL2 B;  2A4H A;  2DJ2 A;  2VKZ G;  3DD3 A;  4RQX A;  3G7J A;  4K5R A;  3GRX A;  1O8X A;  3A3T A;  1ML6 A;  2X99 A;  3RAZ A;  3UVH A;  5DQY A;  4HDE A;  3VPQ A;  1PD2 1;  5CP1 A;  4LL4 B;  2CAI A;  4KH7 A;  1B4Q A;  1WE0 A;  5A4U A;  2LRN A;  1YDK A;  4MJC A;  5IMD A;  5F06 A;  1Z6M A;  1XWK A;  4PX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...