22GSA

Human glutathione s-transferase p1-1 y49f mutant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLFGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUTATHIONE S-TRANSFERASE P1-1
publication title Thermodynamic description of the effect of the mutation Y49F on human glutathione transferase P1-1 in binding with glutathione and the inhibitor S-hexylglutathione.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1998-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 22gsA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 22gsA01
5JCGA 3CMIA 2VLVA 4WBRD 3PINA 1GTAA 2D2ZA 4EDYA 1A23A 4JE1A 3CRUA 1GUHA 1SL1B 4G0KA 3QCPA 2WS2A 3P8WA 4POMA 2X8GA 2AAWA 4MA9A 3V1WA 2I9HA 5DCGA 2M72A 1OKDA 2HSMB 3ZLPA 1AAZA 2PERA 1F3BA 4IW9A 1U88A 1LJRA 1ZYQB 3RBTA 2X8CA 3TRPA 4BA7A 5F06A 4BVYA 3IOSA 1TXXA 1AC1A 3DVXA 3UMAA 2KP1A 5EY6A 2CAIA 3UJ1A 1FW1A 2PVOC 3GMFA 2WB9A 3F0IA 2HZFA 3P2AA 1A2MA 1BYEA 4IS0A 5DBQA 4QL7A 1U6TA 2MMOA 3F4TA 1EWXA 2EIRA 5B7CA 3VURA 2LJAA 4WKWA 4O92A 2CVBA 4POLA 3GKNA 5J5NA 2VD1A 4XRDA 3ZRDA 4GSTA 4BPYA 4GCIA 4I8BA 4ZBAA 3I9V2 1AUCA 1ACVA 4FH8A 2GGTA 4NAXA 2X64A 4CHSA 2VM1A 1SKSB 2I1UA 5IMZA 1B4QA 3LG6A 4I5QA 2H6XA 3LEFA 3IXRA 2HRFA 2L6CA 3L9SA 3CRTA 2VLTA 1VF2A 3ZMLA 1F3AA 1Z7PA 1YQ1A 2YWOA 1SK1A 1E6BA 1S3DA 1VGLA 1ERVA 3QR6A 4I2UA 4NXIA 2A2RA 2EIOA 1SYXA 6GSVA 1T8EB 3MAKA 4IKHA 3MDKA 5ECHB 3QMXA 3DKSA 3HDCA 2JZTA 5ECLB 3L4NA 1UA5A 5IMAA 2H1GA 2PGTA 1A0FA 4ML1A 2FHEA 2L4CA 5JWQB 3BBYA 1YKAA 4ZBDA 1DE2A 2FA8A 5ECOB 1O73A 4N30A 4MJCA 2F8FA 4DSQA 3HA9A 2HFDA 2L5OA 3GH6A 3O3TA 5FWGA 3UL3A 3C7MA 2H01A 5BMUA 2H70A 1T1VA 2O85A 3TJBA 3RPNA 2DC5A 3UOMA 2YWMA 1ERTA 2KUCA 2QSIA 1EGOA 1VF1A 3GNJA 3RDWA 4EE0A 3FR6A 4PXOA 4L0WA 5D73A 6GSXA 1XWBA 2IIYA 4KDYA 1XXUA 3L9VA 1NM3A 2HZEA 4IQ1A 1V57A 4DEJA 2L59A 4AF2A 1R4WA 4OO5A 4HQZA 4MF7A 2MMNA 2KLXA 2YN1A 5C04A 3EMPA 1DE1A 1CQHA 1B9YC 3IBHA 3BCKA 3TGZA 6GSWA 1WP0A 2H71A 2MBTA 3L78A 1T3BA 3VLNA 3LSZA 1QQ2A 3UEMA 5CAXA 5ECPB 3M1GA 2DIZA 2XHFA 1O7UA 4F82A 5LCZA 4NV5A 1Y25A 1SL0B 3UIWA 5D93A 3MNGA 4FYCA 2OKAA 1XFLA 3LQ7A 1J9BA 1H4OA 3GTUB 4MK3A 4LLRA 2BTOT 5ELGA 4MPFA 4OWYA 3C1SA 3HVSA 1WPIA 5ID2B 3F63A 2H0IA 1MD4A 1TJDA 3KP9A 3ZL5A 1TI3A 4DSSA 1PRXA 1R5AA 1WRYA 3VI5A 3BD2A 4TN8A 1TW9A 1GRXA 2WZ9A 3R2QA 1K3OA 1SK2A 4EVMA 3W8SA 1WMJA 2LNTA 4XS4B 1V40A 3EC3A 2PVQA 2LJKA 5HR3A 2IMEA 4HUAA 3QAGA 4K9ZA 2MMZA 1FB0A 1THXA 3GN3A 2GLRA 2AHEA 2H76A 1WOUA 8GSSA 2JADA 3UVHA 4XS6A 3DMLA 1N8JA 4GSNA 1MDKA 1FO5A 3UARA 1YJ6A 2OADA 3FZ4A 3WYWA 3M0FA 3H93A 3GX0A 5J4UA 4WXTA 3LORA 2PN8A 5L71A 2GQLA 4BVYB 2BMXA 4XRAA 3I43A 3ZVJD 2YZUA 1YZXA 1KBNA 2C3TA 3VWXA 1EP8A 1ZL9A 2C4JA 2HSYA 3MWHA 4OMVA 4POKA 1Z7RA 4E8EA 1G7OA 1YF0A 2X99A 3C71A 2MMAA 3IRAA 4K8MA 3EINA 1USBA 1GSSA 2VAFA 4RI6A 2YV9A 3KIJA 4HEA2 1U3IA 4CW9A 2RM6A 1OKTA 2J9HA 11GSA 1MDIA 3ZREA 3GIXA 3AY8A 2DMLA 2I3YA 2XC2A 1URMA 4YQVA 1GTIA 1JZRA 2F3MA 2KHPA 1GTUA 2A2SA 2FLSA 2WGRA 4X43A 4HZ4A 5GAPD 3GURA 2FWGA 1ST9A 2DBCA 1CQGA 2B1LA 1GSUA 2QKEA 1X5EA 4ULXA 4GQCA 5GZZB 3BJ5A 2HI7A 3NZNA 1RQMA 4KGIA 4KX4A 4ZIJA 4TR1B 1T7PB 1ZMAA 2LTKA 2OBKA 3D0ZA 4KF9A 4OFMA 2YOIA 1R26A 3TKPA 4XS1A 2OACA 2PPTA 1TK5B 2VCXA 3EURA 3TKSE 5CP1A 2VCTA 3U6VA 5IQYA 2V41A 2XBQA 3ZZXA 2GDRA 4POBA 1GLPA 5A4VA 3WT1A 1LU4A 3FRCA 3HVVA 3G9BA 2ALBA 2R6KA 4EKZA 1DSBA 1GL8A 4KE3A 5IMVA 3N9JA 3E9JB 2IWTA 9GSSA 2DJ2A 4HDEA 4K2DA 2B7KA 2C3NA 2OE0A 1OYJA 3GRXA 3M8NA 2QGVA 1F2EA 3F4SA 2YWIA 4TXOA 2IFQA 2C1YA 2YZHA 2NBSA 2HZEB 3QD9A 3KJYA 5J3RA 4AJ7A 3GKXA 4PQ1A 1K0AA 1JZWA 1SENA 4RQRA 4MF5A 1EOGA 5GAND 1JFUA 2GZPA 3F4RA 3R3EA 2K18A 1XWGA 5ABRA 2I81A 3TJGA 3F9UA 2H74A 2DIYA 3C73A 3D6IA 5E4WA 1O81A 3ED3A 1PN9A 3IC8A 2O8VB 1OAZA 16GSA 5D96A 4IP1A 3KXOA 4ZILA 3CYNA 2GVPA 2JZSA 4KUNA 4J56E 1QFNA 1EGRA 3APOA 2FWEA 2VCQA 4L5LA 2JSYA 5G30A 2GSQA 3CBUA 4JBBA 5A4WA 4BWQA 5IPGA 2LQQA 2P31A 3DWVA 2FWHA 3HCZA 4PTSA 3EYTA 4BWSA 4F9ZA 1B8XA 4OD7A 3VPQA 18GSA 1A8YA 2RUEA 5KN1A 5DVBA 3GV1A 2F51A 4GTUA 4IHUA 3G7YA 4K7IA 3TOTA 2J23A 3ERFA 2CQ9A 1A8LA 3HJPA 1XWAA 5HFGA 5C00A 5B8BA 1AQXA 4DSSB 4MJEA 1PSQA 5A5KA 1XW6A 3M9JA 2HRKB 2L5LA 1QMVA 2K6VA 2AJQB 5B6MA 1FHEA 5IOWA 2V32A 4QQ7A 5DALA 3FZAA 3WGXA 3CTGA 1EP7A 1PX6A 4BL7A 5HR1A 3IC4A 1VF3A 3PPUA 2CV4A 2IMIA 5ELAA 6GSUA 3DYRA 2VUPA 3ZFBA 2ZNMA 4GLTA 2H73A 3NOFA 4V1Ap 5IOXA 5JWRB 3FY7A 1TKDB 1TK8B 1R7HA 3OR5A 2GQMA 4WBJA 19GSA 3ZITA 2HYXA 3Q18A 3H4KA 2HQTA 3P90A 2C0GA 4ECIA 2K8SA 2GQKA 4EUYA 1QUWA 3UBKA 2WFCA 2PMTA 4J2FA 4MJBA 1TU7A 4XCSA 4WR4A 1UC7A 4K0NA 1DBYA 4TR3A 2B5YA 5E59A 2HRNA 5AIXA 2QC7A 2IMDA 4G10A 4TR1A 1O8XA 1VF4A 5CRGA 2PUKC 3ISOA 1NSWA 4MH2A 2H1AA 5B6NA 5DQSA 2E7PA 4E8HA 4L8EA 1GSQA 3D4TA 1O85A 2OJLA 2G0FA 4TKYA 2FCHA 2OBIA 1BAYA 1NHOA 3GFKA 1JHBA 3GSSA 5G31A 4ILFA 3A2WA 2VL2A 5J9CA 2PBJA 3KMOA 2H6YA 1M9BA 5LNKe 1GSFA 2C3QA 3KMNA 2ZUPA 3J7Yb 4JEDA 4EL1A 1K0NA 2P5RA 1I5GA 1PGTA 1T4YA 2DLXA 4KSOA 5ENUA 1Q4JA 5DQYA 2HT9A 2NDOA 3BOAA 4IQAA 2LKUA 3GL5A 2CVDA 3CTFA 4KAEA 3CSHA 2HSHA 4TW5A 1Y6EA 4EXJA 2BJXA 1V2AA 5D9TA 1TI1A 2GSTA 4EO3A 1EEMA 1J0FA 1XOBA 3A3TA 4KA0A 4IJ3A 1BG5A 2VIMA 3P7XA 1V98A 5H5RA 3KTBA 2UZ8A 1RK4A 1YY7A 1MD3A 1OC3A 3QDNA 1JZDA 5KN0A 4NPBA 5A4UA 2GTUA 2O7KA 2LQOA 1HD2A 4L0UA 5CREA 4ID0A 4K1FA 4F0CA 5DDLA 5INYA 2RM5A 4IP6A 4Q5NA 1JLWA 3FZ9A 5HFIA 3Q19A 4TXVA 3F8UA 4HJ2A 1XVWA 2RUFA 5LD0A 4X0XA 4TXOB 3ERGA 1YKCA 2IFQB 3NIVA 1O8WA 1V9WA 3VK9A 3ZMKA 3ZFLA 2PWJA 2F9SA 4MDCA 5HFKA 2CAQA 2C8UA 4MH3A 5F05A 3WD6A 1O6JA 3KP8A 4V2NA 1X5CA 3H8QA 5D8IA 5FHIA 2ON7A 3IR4A 3N5OA 1ERUA 2YPMA 3IK7A 1G6YA 1OC9A 4TR0A 2HRKA 2B1KA 5CYYA 1HNBA 1ZOFA 3CSJA 3I69A 2G2QA 5JWOB 3EU4A 1EOHA 1AQWA 4YQMA 1BQ7A 1XWCA 2HLSA 3PH9A 3F6FA 1GNWA 1BEDA 1A2JA 5IM9A 1X9WB 3QOUA 5F0GA 3ZIVA 1SJIA 4MCUA 5ECIB 1R5PA 3L0HA 17GSA 3RHBA 1X5DA 4ZL8A 4NMUA 1F6MC 1KTEA 4XIHA 3H79A 4PGTA 5IIZA 12GSA 3ZIJA 4WF5A 3VI7A 1SJZA 4EF0A 4NHWA 1X9SB 3WT2A 4ZB6A 5IMDA 4KH7A 2AUVA 1SK0A 3IA1A 1UN2A 3ZVJA 3ZYWA 4IGJA 3VWWA 1K0OA 3KH9A 1B9XC 4F2IA 3QAVA 4KDXA 4MABA 3VWVA 1TRSA 1X9MB 4HQSA 5DALB 4BVXA 3LYPA 4BL7B 1YDKA 3G7IA 4Q5QA 1EV4A 2R3XA 2H72A 4YAPA 4I2TA 3DEXA 1TTZA 3DXBA 3HHVA 4O5RA 2R4VA 1G6WA 1WIKA 3VWUA 4ACSA 3LYKA 2TRCP 3VPTA 2P0GA 3FW2A 4IBPA 4G9HA 4MMMA 4HOJA 1J08A 5COHA 1FOVA 1K3YA 5AIVA 3VFIA 2WCIA 4HZ2A 4HU9A 3GA4A 4KCEA 2FUG2 2WULA 2OE3A 3E0UA 22GSA 4I97A 3A2VA 2VCZA 3TKRA 2CZ3A 4PQHA 1XIYA 2HNLA 5G1KA 3TJFA 1FB6A 3KM6A 2AV4A 2H1BA 3RAZA 3TB2A 1OC8A 2LUSA 2V1MA 3D21A 3APSA 2ES7A 2LS5A 2RLIA 2OE1A 1KNGA 2K9FA 3M9KA 1PL1A 1QGVA 2FWFA 2VL9A 1TDIA 1GNEA 2VM2A 4HS1A 2CA8A 1M0UA 1TK0B 2O89A 5JCUA 1ERWA 2M80A 3GL3A 2PU9C 3Q6OA 2H8LA 2E2GA 3FKFA 2VL3A 1XBSA 3EWLA 5ECQB 3UVTA 3TJKA 4ZXGA 1RW1A 2L57A 3E3EA 2HSNB 4D73A 1ILOA 1S3AA 5EPFA 4L5OA 1X0RA 2H0GA 7GSSA 4G0LA 3D4MA 4XHMA 2YANA 3D5JA 2IN3A 4YAVA 3DD3A 3GKMA 3HYPA 1SYRA 1WJKA 4V2LA 2DMMA 4CDOA 1A2LA 5KN3A 1A24A 1GSEA 1EZKA 3HJMA 4HU7A 2XPDA 2CVKA 4GF0A 4MZBA 3KH7A 4NHZA 2B5EA 5F8BA 3HD5A 1N2AA 4HI7A 5AN1A 5J9BA 5D9XA 1MEKA 5G5EA 5CRWA 4GWRA 2YWNA 3GKKA 3LWAA 2NPBA 4LL1B 4JRRA 4KB3A 3ZTLA 4PQIA 4TR4A 2LJRA 3LGCA 3TDGA 1PMTA 1PKWA 5KEJA 4K7NA 2LSTA 4ZBBA 4RUVA 3HZ4A 4LA1A 4GQFA 5B8AA 3IDVA 2YCDA 3LXTA 2V2GA 20GSA 3TCOA 1GSDA 2B5XA 1Z3EA 1M9AA 2IMKA 1HQOA 3GX8A 4G2EA 5D9WA 2N5AA 1HYUA 1GULA 1FAAA 1UVZA 1ON4A 4ZL9A 1M2AA 4AJ8A 3C8EA 3KTLA 1OC9B 1TOFA 3HZ8A 2ON5A 4ZL7A 1ML6A 3IPZA 4TRXA 2IJYA 1NW2A 3C1RA 1PX7A 4I6XA 4Q5RA 2JACA 1GUMA 3ME8A 4PNFA 4OCEA 1GP1A 1G7EA 3U5RE 3W8JA 4RI7A 3DVWA 2A4VA 3KD0A 4EC0A 4AGSA 1EEJA 2R37A 3QAWA 4KW6A 2E2MA 4P3YB 4TVEA 3A2XA 1BJXA 6GSYA 2H19A 2B3SA 2N5BA 1AW9A 4MF6A 2VD0A 1H75A 4OO4A 4Z7XA 3KEBA 2KOKA 1NHYA 2IMFA 1FVJA 4PUAA 3O76A 4QL9A 1Z9HA 1U3AA 5G1LA 5EVOA 4K6XA 3L9UA 2H30A 2XPEA 5IMCA 3ME7A 3IK9A 1MTCA 3UAPA 2LEGA 1THOA 4ECCA 3LFLA 1SJ6A 3TKSA 4BVXB 3TRXA 2LNSA 2YV7A 2B7JA 4IVFA 3EMXA 4MP4A 1DUGA 1K0CA 1F9MA 2OA7A 4WEYA 4ISDA 2LRTA 2FY6A 5HR0A 3EE2A 5H5SA 2V6KA 3O6TA 1M99A 4WETA 1XW5A 2ZCTA 2DJ1A 5G5FA 1PD21 3GH9A 1PKZA 5AGYA 1WE0A 1LBKA 1K3LA 5G2ZA 1F37A 2CT6A 1SKWB 5DJLA 1AIUA 1PA3A 2REMA 3QPMA 2MBSA 3FYGA 2C0FA 2NVLA 3HKRA 2YJ7A 4V2MA 4FYBA 5IO0A 1ZZYA 4KDUA 1A0RP 2I4AA 5DAKA 2DSAA 4GSSA 4ECBA 3APQA 1OVNA 1XVQA 4JR6A 3FHKA 5DJMA 5KN2A 3CSIA 4FIWA 1FG4A 2R2JA 4EDZA 2CZ2A 1ABAA 2KP2A 4WF4A 2VO4A 2WJUA 10GSA 4TOPA 4XTSA 2H66A 4OCFA 3WGDA 4G19A 2K8VA 4G0IA 3KGKA 2JSZA 2JU5A 5ECRB 1XWKA 2HRAA 4OFNA 3IAS2 1TP9A 4H86A 4YH2A 5ECKB 4KSMA 4N0ZA 2DJ3A 1QK8A 4J57E 4D73B 2EIQA 1E2YA 3F6DA 3RHCA 2C0DA 3GHAA 5JCWA 5ECMB 2GSSA 1BX9A 1Z6NA 3EU3A 1K0MA 4GXZA 4FQUA 3DRNA 3HXSA 1PQNA 4IELA 4LL4B 2B6MA 2HSMA 5D9VA 2YNXA 2EC4A 5IO2A 3DIEA 2FD3A 2L6DA 1SD9A 4X1UA 2GT5A 4PNGA 5CRDA 2AB6A 4HJMA 3G7JA 1TU8A 3QFAC 2YJHA 5CO3A 3ERWA 3S9FA 2RIIA 4O32A 2R5GA 1ZGNA 4PURA 1MDJA 3I6AA 1B4PA 5IPHA 2LV3A 2YP6A 4PX1A 2H75A 2NTOA 4LMVA 1JLVA 1SL2B 3RPPA 3PGTA 2HXKA 3J7Yk 5GSSA 3GSTA 3JCML 5IMFA 1Q98A 2DJ0A 3SWLA 2JL4A 1PL2A 4MZCA 2IPAA 4MZWA 1OE8A 1Z6MA 6GSTA 1SD8A 3FK8A 2VCWA 2VLUA 4FYUA 4JZQA 4N0VA 5HR2A 3CXGA 1QXHA 1C72A 5EL8A 2H1DA 3F3RA 2TIRA 1VRSD 2GZZA 4N10A 5J41A 3FR9A 2H0HA 4N11A 3EVIA 3TKQA 2E0QA 2HE3A 3PR8A 1M2BA 3GYKA 3TKSC 5HQPA 2GZYA 1XW9A 1GLQA 1GUKA 4NWYA 1HNCA 1AXDA 3TJJA 1YEXA 1GTBA 2JZRA 1Z5YE 5DCHA 3MSZA 2VL2C 5ECSA 1HNAA 4JU5A 4F03A 3BCIA 2CX4A 1AQVA 4IJIA 2FNOA 3IV4A 1YF1A 1B48A 3DGQA 2XBIA 2FGXA 4DSRA 4LMWA 2CX3A 5CNWA 2M46A 4O7HA 2GT6A 4MJAA 1I9DA 1XZOA 1TRWA 1OE7A 4PUFC 1T4ZA 2C0EA 1YEPA 1FVKA 4K7OA 3TRQA 4Q5FA 5H5QA 4F0BA 1K0BA 1M2DA 4MLYA 2C80A 2GSRA 1XCCA 4MPGA 4FO5A 1XOAA 3F3QA 2IL3A 2O87A 3IHQA 3QFBC 3M3MA 1V58A 13GSA 3WGEA 1XPVA 5F07A 4OFTA 4ECJA 2DJKA 2MZCA 1W4VA 4V1Ag 4RQXA 1TRVA 1K0DA 1WWJA 3HVXA 4ZB8A 3GUSA 3D22A 3FEUA 1KEBA 2DJJA 1T00A 2FA4A 1GWCA 1TRUA 2WRTA 1W89A 1G0TA 3A5WA 4KCAA 4JR4A 4AJ6A 3KCMA 4NV2A 5CRHA 3K8NA 2VCVA 1M7TA 2X8HA 3UBLA 3HY2A 5GSTA 1EV9A 3W6GA 1SU9A 4YQUA 1ZYEA 4IN0A 1IYHA 1GSYA 2TRXA 2P5QA 3IAM2 2MYGA 4K0GA 3FR3A 4GRFA 5ECNB 3LJRA 2AYTA 3US3A 3TUEA 2H6ZA 2V6OA 3IE3A 4WR5A 5AISA 3TOUA 2Z9SA 3Q74A 3LXZA 3GTUA 5DAKB 5FT3A 2LRNA 1SKRB 3FZ5A 1S3CA 3H1NA 2VOCA 5ID2A 4ML6A 2L4QA 3SBCA 1U87A 4USSA 2LRCA 2N5FA 6GSSA 1JZOA 2GS3A 2WDUA 4DVCA 1IYIA 3HJOA 2F8AA 14GSA 4ZB9A 1GH2A 1ZCPA 4KNDA 4XS4A 3KZQA
chains in the Genus database with same CATH superfamily
5JCGA 3CMIA 2VLVA 4WBRD 3PINA 1GTAA 2D2ZA 4EDYA 1A23A 4JE1A 5A1NB 3CRUA 1GUHA 1SL1B 4G0KA 3QCPA 2WS2A 3P8WA 4POMA 2X8GA 2AAWA 4MA9A 3V1WA 2I9HA 5DCGA 2M72A 1OKDA 2HSMB 3ZLPA 1AAZA 2PERA 1F3BA 4IW9A 1U88A 1LJRA 1ZYQB 3RBTA 4ICYA 2X8CA 3TRPA 4BA7A 5F06A 4BVYA 3IOSA 1TXXA 1AC1A 3DVXA 3UMAA 2KP1A 5EY6A 2CAIA 3UJ1A 1FW1A 2PVOC 3GMFA 2WB9A 3F0IA 2HZFA 3P2AA 1A2MA 1BYEA 4IS0A 5DBQA 4QL7A 1U6TA 2MMOA 3F4TA 1EWXA 2EIRA 5B7CA 3VURA 2LJAA 5KOWA 4WKWA 4O92A 2CVBA 4POLA 3GKNA 5J5NA 2VD1A 4XRDA 3ZRDA 4GSTA 4BPYA 3CWGA 4GCIA 4I8BA 2X4AA 4ZBAA 3I9V2 1AUCA 1ACVA 4FH8A 2GGTA 4NAXA 2X64A 4CHSA 1PFOA 2VM1A 1SKSB 2I1UA 5IMZA 1B4QA 4G01A 3LG6A 4I5QA 2H6XA 3LEFA 3IXRA 2HRFA 4K5SA 2L6CA 3L9SA 3CRTA 2VLTA 1VF2A 3ZMLA 1F3AA 1Z7PA 1YQ1A 2YWOA 1SK1A 1E6BA 1S3DA 1VGLA 1ERVA 4O5UA 3QR6A 4O5QA 4I2UA 4NXIA 2A2RA 2EIOA 1SYXA 6GSVA 1T8EB 3MAKA 4IKHA 3MDKA 5ECHB 3QMXA 3DKSA 3HDCA 2JZTA 5ECLB 3L4NA 1UA5A 5IMAA 2H1GA 2PGTA 1A0FA 4ML1A 2FHEA 2L4CA 5JWQB 3BBYA 1YKAA 4ZBDA 1DE2A 2FA8A 5ECOB 1O73A 3HVNA 4N30A 4MJCA 2F8FA 4DSQA 3HA9A 2HFDA 2L5OA 3GH6A 3O3TA 5FWGA 3UL3A 3C7MA 2H01A 5BMUA 2H70A 1T1VA 2O85A 3TJBA 3RPNA 2DC5A 3UOMA 2YWMA 1ERTA 2KUCA 2QSIA 1EGOA 1VF1A 3GNJA 3RDWA 4EE0A 3FR6A 4PXOA 5J4VA 4L0WA 5D73A 6GSXA 1XWBA 2IIYA 4KDYA 1XXUA 3L9VA 2O3EA 1NM3A 2HZEA 4IQ1A 1V57A 4DEJA 2L59A 4AF2A 1R4WA 4OO5A 4HQZA 4MF7A 2MMNA 2KLXA 2YN1A 5C04A 3EMPA 5A34B 1DE1A 1CQHA 1B9YC 3IBHA 3BCKA 3TGZA 6GSWA 1WP0A 2H71A 2MBTA 3L78A 1T3BA 3VLNA 3LSZA 1QQ2A 3UEMA 5CAXA 5ECPB 3M1GA 2DIZA 2XHFA 1O7UA 1PN0A 4F82A 5LCZA 4NV5A 1Y25A 1SL0B 3UIWA 5D93A 3MNGA 4FYCA 2OKAA 1XFLA 3LQ7A 1J9BA 1H4OA 3GTUB 4MK3A 4GDFA 3MYDA 2BTOT 4LLRA 5ELGA 4MPFA 4OWYA 4YKGA 3LW9A 3C1SA 3HVSA 1WPIA 1N25A 5ID2B 3F63A 2H0IA 1MD4A 1TJDA 3KP9A 3ZL5A 1TI3A 4DSSA 2WZSA 1PRXA 1R5AA 1WRYA 3VI5A 3BD2A 4TN8A 1TW9A 1GRXA 2WZ9A 3R2QA 1K3OA 1SK2A 4EVMA 3W8SA 1WMJA 2LNTA 4XS4B 1V40A 3EC3A 2PVQA 2LJKA 5HR3A 2IMEA 4HUAA 3QAGA 2QA1A 4K9ZA 2MMZA 2EFHA 1FB0A 1THXA 3GN3A 3RFRC 2DKIA 2GLRA 2AHEA 2H76A 1WOUA 8GSSA 2JADA 3UVHA 4XS6A 3DMLA 3FMWA 1N8JA 4GSNA 1MDKA 1FO5A 3UARA 1YJ6A 2OADA 3FZ4A 3WYWA 3M0FA 3H93A 3GX0A 5J4UA 4WXTA 3LORA 2PN8A 5L71A 2GQLA 4BVYB 2BMXA 4XRAA 3I43A 3ZVJD 2YZUA 4EIQA 1YZXA 1KBNA 2C3TA 3VWXA 3CHXC 1EP8A 1ZL9A 2C4JA 2HSYA 3MWHA 4OMVA 4POKA 1Z7RA 4E8EA 1G7OA 1YF0A 2X99A 3C71A 2MMAA 3IRAA 4K8MA 3MIXA 3EINA 1USBA 1GSSA 2VAFA 4RI6A 2YV9A 3KIJA 4HEA2 1U3IA 4CW9A 2A4HA 2RM6A 1OKTA 2J9HA 11GSA 1MDIA 3ZREA 3GIXA 1S4BP 3AY8A 2I3YA 2DMLA 2XC2A 1URMA 4YQVA 1GTIA 1JZRA 2F3MA 2KHPA 1GTUA 2A2SA 2FLSA 2WGRA 4X43A 4HZ4A 5GAPD 1YEWC 3GURA 2FWGA 1ST9A 4AI6A 2DBCA 1CQGA 2B1LA 1GSUA 2QKEA 1X5EA 4ULXA 4GQCA 4K2XA 5GZZB 2WW0A 3BJ5A 2HI7A 3NZNA 1RQMA 4KGIA 4KX4A 4ZIJA 4TR1B 1T7PB 1ZMAA 2LTKA 5A34A 2OBKA 3D0ZA 4KF9A 4OFMA 2YOIA 1R26A 3TKPA 4XS1A 2OACA 2PPTA 1TK5B 2VCXA 3EURA 3TKSE 5CP1A 2VCTA 3U6VA 5IQYA 2V41A 2XBQA 3ZZXA 2GDRA 4POBA 1GLPA 5A4VA 3WT1A 1LU4A 3FRCA 3HVVA 3G9BA 2ALBA 2R6KA 4EKZA 1DSBA 1M3IA 1GL8A 4KE3A 4CY6A 5IMVA 3N9JA 3E9JB 2IWTA 9GSSA 2DJ2A 4HDEA 4K2DA 2O5VA 2B7KA 2C3NA 2OE0A 1OYJA 3GRXA 3M8NA 2WVZA 2QGVA 1F2EA 3F4SA 2YWIA 4TXOA 2IFQA 2C1YA 2YZHA 2NBSA 2HZEB 3QD9A 3KJYA 5J3RA 4AJ7A 3GKXA 4PQ1A 1K0AA 1JZWA 1SENA 4EIPA 4RQRA 4MF5A 1EOGA 5GAND 1JFUA 2GZPA 3F4RA 3R3EA 2K18A 1XWGA 5ABRA 3HMJG 2I81A 3TJGA 3A5IA 3F9UA 2H74A 2DIYA 3C73A 3D6IA 4A5PA 5E4WA 1O81A 3ED3A 1PN9A 3IC8A 2O8VB 1OAZA 16GSA 5D96A 4IP1A 3KXOA 4ZILA 3CYNA 2GVPA 2JZSA 4KUNA 4J56E 1QFNA 1EGRA 3APOA 2FWEA 2VCQA 4L5LA 2JSYA 5J4YA 5G30A 2GSQA 3CBUA 4JBBA 5A4WA 4BWQA 5IPGA 2LQQA 2P31A 3DWVA 2FWHA 3HCZA 4PTSA 3EYTA 4BWSA 4F9ZA 1B8XA 4OD7A 3VPQA 18GSA 1A8YA 2RUEA 2UV8G 5KN1A 5DVBA 3GV1A 2F51A 4GTUA 4IHUA 3G7YA 4K7IA 3TOTA 2J23A 3ERFA 2CQ9A 1A8LA 3HJPA 1XWAA 5HFGA 5C00A 5B8BA 1AQXA 4DSSB 4MJEA 2X49A 1PSQA 5A5KA 1XW6A 3M9JA 2HRKB 2L5LA 1QMVA 3RGBC 2K6VA 2AJQB 5B6MA 1FHEA 5IOWA 2V32A 4QQ7A 5DALA 3FZAA 3WGXA 3CTGA 1EP7A 1PX6A 4BL7A 5HR1A 3IC4A 1VF3A 3PPUA 2CV4A 2IMIA 5ELAA 6GSUA 3DYRA 2VUPA 3ZFBA 2ZNMA 4GLTA 2H73A 3NOFA 4V1Ap 5IOXA 4BIKA 1I1IP 5JWRB 3FY7A 1TKDB 1TK8B 2EFEA 1R7HA 3OR5A 2R0GA 2GQMA 4WBJA 19GSA 3ZITA 2HYXA 3Q18A 3H4KA 2HQTA 3P90A 2C0GA 4ECIA 2K8SA 2GQKA 4EUYA 1QUWA 3UBKA 2WFCA 2PMTA 4J2FA 4MJBA 1TU7A 4XCSA 4WR4A 1UC7A 4K0NA 1DBYA 4TR3A 2B5YA 2R0CA 5E59A 2HRNA 5AIXA 2QC7A 2IMDA 4G10A 4TR1A 1O8XA 1VF4A 5CRGA 2PUKC 3ISOA 1NSWA 4MH2A 2H1AA 5B6NA 5DQSA 2E7PA 4E8HA 4L8EA 1GSQA 3D4TA 2WW1A 1O85A 2OJLA 2G0FA 4TKYA 1SVOA 2FCHA 2OBIA 1BAYA 1NHOA 3GFKA 4MNNA 1JHBA 3GSSA 5G31A 4ILFA 3A2WA 2VL2A 5J9CA 2PBJA 3KMOA 2H6YA 1M9BA 5LNKe 2HSNA 1GSFA 2C3QA 3KMNA 2ZUPA 2VKZG 3J7Yb 4JEDA 4EL1A 1K0NA 2P5RA 1I5GA 1PGTA 1T4YA 2DLXA 4KSOA 5ENUA 1Q4JA 5DQYA 2HT9A 2NDOA 3BOAA 4IQAA 2LKUA 3GL5A 2CVDA 3CTFA 4KAEA 3CSHA 2HSHA 4K5RA 4TW5A 1Y6EA 4EXJA 2BJXA 1V2AA 5D9TA 1TI1A 2GSTA 4EO3A 1EEMA 1J0FA 1XOBA 3A3TA 4KA0A 4IJ3A 1BG5A 2VIMA 4Z2UA 3P7XA 4QMKA 1V98A 5H5RA 3KTBA 2UZ8A 1RK4A 1YY7A 1MD3A 1OC3A 3QDNA 1JZDA 5KN0A 4NPBA 5A4UA 2GTUA 2O7KA 2LQOA 1HD2A 4L0UA 5CREA 4ID0A 4K1FA 4F0CA 5DDLA 5INYA 2RM5A 4IP6A 4Q5NA 1JLWA 3FZ9A 5HFIA 3Q19A 4E68A 4TXVA 3F8UA 4HJ2A 1XVWA 2RUFA 5LD0A 4X0XA 4TXOB 3ERGA 4Z2RA 1YKCA 2IFQB 3NIVA 1O8WA 1V9WA 3VK9A 3ZMKA 3ZFLA 2PWJA 2F9SA 4MDCA 5HFKA 2CAQA 2C8UA 4MH3A 5F05A 3WD6A 1O6JA 3KP8A 4V2NA 1X5CA 3H8QA 5D8IA 5FHIA 2ON7A 3IR4A 3N5OA 1ERUA 2YPMA 3IK7A 1G6YA 1OC9A 4TR0A 2HRKA 2B1KA 5CYYA 1HNBA 1ZOFA 3CSJA 3I69A 2G2QA 5JWOB 3EU4A 1EOHA 1AQWA 4YQMA 1BQ7A 1XWCA 2HLSA 3PH9A 3F6FA 1GNWA 1BEDA 1A2JA 5IM9A 1X9WB 3QOUA 5F0GA 3ZIVA 1SJIA 4MCUA 5ECIB 1R5PA 3L0HA 17GSA 3RHBA 1X5DA 4ZL8A 4NMUA 1F6MC 1KTEA 4XIHA 1M3JA 3H79A 4PGTA 5IIZA 12GSA 3ZIJA 4WF5A 3VI7A 1SJZA 4EF0A 4NHWA 1X9SB 5J47A 3WT2A 4ZB6A 5IMDA 4KH7A 2AUVA 1SK0A 3IA1A 1UN2A 3ZVJA 3ZYWA 4IGJA 3VWWA 1K0OA 3KH9A 1B9XC 4F2IA 3QAVA 4KDXA 4MABA 3VWVA 1TRSA 1X9MB 4HQSA 5DALB 4BVXA 3LYPA 4BL7B 1YDKA 3G7IA 4Q5QA 1EV4A 2R3XA 2H72A 4YAPA 4I2TA 3DEXA 1TTZA 3DXBA 3HHVA 4O5RA 2R4VA 1G6WA 1WIKA 1SVLA 4ACSA 3VWUA 4Z2TA 3LYKA 2TRCP 3VPTA 2P0GA 3CQFA 3FW2A 5J40A 4IBPA 4G9HA 4MMMA 4HOJA 1J08A 5COHA 1FOVA 1K3YA 5AIVA 2WVXA 3VFIA 2WCIA 4HZ2A 4HU9A 3GA4A 4KCEA 2FUG2 2WULA 2OE3A 3E0UA 22GSA 4I97A 3A2VA 5BRTA 2VCZA 3TKRA 2CZ3A 4PQHA 1XIYA 2HNLA 5G1KA 3TJFA 1FB6A 3KM6A 2AV4A 2H1BA 3RAZA 3TB2A 1OC8A 2LUSA 2V1MA 3D21A 3APSA 2ES7A 2LS5A 2RLIA 2OE1A 1KNGA 2K9FA 3M9KA 1PL1A 1QGVA 2FWFA 2VL9A 1TDIA 1GNEA 2VM2A 4HS1A 2CA8A 1M0UA 1TK0B 2O89A 5JCUA 1ERWA 2EFCA 2M80A 3GL3A 2PU9C 3Q6OA 2H8LA 2E2GA 3FKFA 2DKHA 2VL3A 1XBSA 3EWLA 5ECQB 3UVTA 3TJKA 4ZXGA 1RW1A 2L57A 3E3EA 2HSNB 4D73A 1ILOA 1S3AA 5EPFA 4L5OA 1X0RA 2H0GA 7GSSA 4G0LA 3D4MA 4XHMA 2YANA 3D5JA 2OT3A 4ZB7A 2IN3A 4YAVA 3DD3A 3GKMA 3HYPA 1SYRA 1WJKA 4V2LA 2DMMA 4CDOA 1A2LA 5KN3A 1A24A 1GSEA 1EZKA 3HJMA 4HU7A 2XPDA 2CVKA 4GF0A 4MZBA 3KH7A 1BF5A 4NHZA 2B5EA 5F8BA 3HD5A 3EPTA 1N2AA 4HI7A 5AN1A 1XG8A 4YKFA 5J9BA 5D9XA 1MEKA 5G5EA 5CRWA 2YWNA 4GWRA 3GKKA 2R0PA 3LWAA 2NPBA 4LL1B 4JRRA 4KB3A 3ZTLA 1SVMA 4PQIA 4AKIA 4TR4A 2LJRA 3LGCA 3TDGA 1PMTA 1PKWA 5KEJA 4K7NA 2LSTA 4ZBBA 1Y1UA 4RUVA 3HZ4A 4LA1A 4GQFA 1FOHA 5B8AA 3IDVA 2YCDA 3LXTA 2V2GA 20GSA 3TCOA 1GSDA 2B5XA 1Z3EA 1M9AA 2IMKA 1HQOA 3GX8A 4G2EA 5D9WA 2N5AA 1HYUA 1GULA 1FAAA 1UVZA 1ON4A 4ZL9A 1M2AA 4AJ8A 3C8EA 3KTLA 1OC9B 4PI0C 1TOFA 2ON5A 3HZ8A 4ZL7A 1ML6A 3IPZA 4TRXA 2IJYA 1NW2A 3C1RA 1PX7A 4I6XA 4Q5RA 2JACA 1GUMA 3ME8A 4PNFA 4OCEA 1GP1A 1G7EA 3U5RE 3W8JA 4RI7A 3DVWA 3KD0A 2A4VA 4EC0A 4AGSA 1EEJA 2R37A 3QAWA 4KW6A 1S3RA 2QA2A 2E2MA 4P3YB 4TVEA 3A2XA 1BJXA 6GSYA 2H19A 2B3SA 2N5BA 1AW9A 4MF6A 2VD0A 1H75A 4OO4A 4Z7XA 3KEBA 2KOKA 1NHYA 2IMFA 1FVJA 4PUAA 3O76A 4QL9A 1Z9HA 1U3AA 5G1LA 5EVOA 4K6XA 3L9UA 2H30A 2XPEA 5IMCA 3ME7A 3IK9A 1MTCA 3UAPA 2LEGA 1THOA 4ECCA 3LFLA 5A5HA 1SJ6A 3TKSA 4BVXB 3TRXA 2LNSA 2YV7A 2B7JA 4IVFA 3EMXA 4MP4A 1DUGA 1K0CA 1F9MA 2OA7A 4WEYA 3IHGA 4ISDA 2LRTA 2FY6A 5HR0A 3EE2A 5H5SA 2V6KA 3O6TA 1BG1A 1M99A 4WETA 4CY8A 1XW5A 2ZCTA 2DJ1A 1ZYPA 5G5FA 1PD21 3GH9A 1PKZA 5AGYA 1WE0A 1LBKA 1K3LA 5G2ZA 1F37A 2WVXB 2CT6A 1SKWB 5DJLA 1AIUA 1PA3A 2REMA 3QPMA 1ZYNA 2MBSA 3FYGA 2C0FA 2NVLA 3HKRA 2YJ7A 4V2MA 4FYBA 5IO0A 1ZZYA 4KDUA 1A0RP 2I4AA 5DAKA 2DSAA 4GSSA 4ECBA 3APQA 1OVNA 1XVQA 4JR6A 4X4JA 3FHKA 5DJMA 5KN2A 3CSIA 4FIWA 1FG4A 2R2JA 4EDZA 2CZ2A 1ABAA 2KP2A 4WF4A 2VO4A 2WJUA 10GSA 4TOPA 4XTSA 2H66A 4OCFA 3WGDA 4G19A 2K8VA 4G0IA 3KGKA 2JSZA 2JU5A 4FXYP 5ECRB 1XWKA 2HRAA 4OFNA 3IAS2 1TP9A 2WW2A 4H86A 4YH2A 5ECKB 4PI2C 4KSMA 4N0ZA 2DJ3A 1QK8A 4J57E 4D73B 2EIQA 1E2YA 3F6DA 3RHCA 2C0DA 3GHAA 5KOXA 5A1NA 5JCWA 5ECMB 2GSSA 1BX9A 1Z6NA 3EU3A 1K0MA 4GXZA 4FQUA 3DRNA 3HXSA 1PQNA 4IELA 4LL4B 2B6MA 2HSMA 5D9VA 2YNXA 2EC4A 4AKHA 5IO2A 3DIEA 2FD3A 2L6DA 1SD9A 4X1UA 2GT5A 4PNGA 5CRDA 2AB6A 1YVLA 4AKGA 4HJMA 3G7JA 1TU8A 3QFAC 2YJHA 5CO3A 3ERWA 3S9FA 2RIIA 4O32A 2R5GA 1ZGNA 4PURA 1MDJA 3I6AA 2WVYA 1B4PA 5IPHA 2LV3A 2YP6A 4PX1A 2H75A 2NTOA 4LMVA 1JLVA 1SL2B 3RPPA 3PGTA 2HXKA 3J7Yk 5GSSA 3GSTA 3JCML 5IMFA 1Q98A 4N3ZA 3SWLA 2DJ0A 2JL4A 1PL2A 4MZCA 2IPAA 4MZWA 1OE8A 1Z6MA 6GSTA 1SD8A 3FK8A 2VCWA 2VLUA 4FYUA 4JZQA 4N0VA 2H1LA 5HR2A 3CXGA 1QXHA 1C72A 5EL8A 2H1DA 3F3RA 4PHZC 2TIRA 1VRSD 2GZZA 4N10A 5J41A 3FR9A 2H0HA 4N11A 3EVIA 3TKQA 2E0QA 2HE3A 3PR8A 1M2BA 3GYKA 1TXUA 3TKSC 5HQPA 2GZYA 1XW9A 1GLQA 2A2PA 1GUKA 4NWYA 1HNCA 1AXDA 3TJJA 4W66A 1YEXA 1GTBA 2JZRA 1Z5YE 5DCHA 3MSZA 2VL2C 5ECSA 1HNAA 4JU5A 4F03A 3BCIA 2CX4A 1AQVA 4IJIA 2FNOA 3IV4A 1YF1A 1B48A 3DGQA 2XBIA 2FGXA 4DSRA 4LMWA 2CX3A 5CNWA 2M46A 4O7HA 2GT6A 4MJAA 1I9DA 1XZOA 1TRWA 1OE7A 4PUFC 1T4ZA 2C0EA 1YEPA 1FVKA 4K7OA 3TRQA 4Q5FA 5H5QA 4F0BA 1K0BA 1M2DA 4MLYA 2C80A 2GSRA 1XCCA 4MPGA 5A5HB 4FO5A 1XOAA 3F3QA 2IL3A 2EFDA 2O87A 3IHQA 3QFBC 3M3MA 1V58A 13GSA 3WGEA 1XPVA 5F07A 4OFTA 4ECJA 2DJKA 2MZCA 1W4VA 4V1Ag 4RQXA 1TRVA 1K0DA 1WWJA 3HVXA 4ZB8A 3GUSA 3D22A 3FEUA 1KEBA 2DJJA 1T00A 2FA4A 1GWCA 1TRUA 2WRTA 1W89A 1G0TA 3A5WA 4KCAA 4JR4A 4AJ6A 3TU3B 3KCMA 4NV2A 5CRHA 3K8NA 2VCVA 1M7TA 2X8HA 3UBLA 3HY2A 5GSTA 1EV9A 3W6GA 1SU9A 4YQUA 1ZYEA 4IN0A 5BMUB 1IYHA 1GSYA 2TRXA 2P5QA 2O36A 3IAM2 2MYGA 4K0GA 3FR3A 4GRFA 5ECNB 3LJRA 2AYTA 3US3A 3TUEA 2H6ZA 2V6OA 3IE3A 4WR5A 5AISA 3TOUA 2Z9SA 3Q74A 3LXZA 3GTUA 5DAKB 5FT3A 2LRNA 1SKRB 3FZ5A 1S3CA 3H1NA 2VOCA 2WW3A 5ID2A 4ML6A 2L4QA 3SBCA 1U87A 4USSA 4HSCX 2LRCA 2N5FA 6GSSA 1JZOA 4AKXB 2GS3A 2WDUA 4DVCA 1IYIA 3HJOA 2F8AA 14GSA 4ZB9A 1GH2A 1ZCPA 4KNDA 4XS4A 3KZQA
chains in the Genus database with same CATH topology
5JCGA 3CMIA 2VLVA 4WBRD 3PINA 1GTAA 2D2ZA 4EDYA 1A23A 4JE1A 5A1NB 3CRUA 1GUHA 1SL1B 4G0KA 3QCPA 2WS2A 3P8WA 4POMA 2X8GA 2AAWA 4MA9A 3V1WA 2I9HA 5DCGA 2M72A 1OKDA 2HSMB 3ZLPA 1AAZA 2PERA 1F3BA 4IW9A 1U88A 1LJRA 1ZYQB 3RBTA 4ICYA 2X8CA 3TRPA 4BA7A 5F06A 4BVYA 3IOSA 1TXXA 1AC1A 3DVXA 3UMAA 2KP1A 5EY6A 2CAIA 3UJ1A 1FW1A 2PVOC 3GMFA 2WB9A 3F0IA 2HZFA 3P2AA 1A2MA 1BYEA 4IS0A 5DBQA 4QL7A 1U6TA 2MMOA 3F4TA 1EWXA 2EIRA 5B7CA 3VURA 2LJAA 5KOWA 4WKWA 4O92A 2CVBA 4POLA 3GKNA 5J5NA 2VD1A 4XRDA 3ZRDA 4GSTA 4BPYA 3CWGA 4GCIA 4I8BA 2X4AA 4ZBAA 3I9V2 1AUCA 1ACVA 4FH8A 2GGTA 4NAXA 2X64A 4CHSA 2VM1A 1SKSB 2I1UA 5IMZA 1B4QA 4G01A 3LG6A 4I5QA 2H6XA 3LEFA 3IXRA 2HRFA 4K5SA 2L6CA 3L9SA 3CRTA 2VLTA 1VF2A 3ZMLA 1F3AA 1Z7PA 1YQ1A 2YWOA 1SK1A 1E6BA 1S3DA 1VGLA 1ERVA 4O5UA 3QR6A 4O5QA 4I2UA 4NXIA 2A2RA 2EIOA 1SYXA 6GSVA 1T8EB 3MAKA 4IKHA 3MDKA 5ECHB 3QMXA 3DKSA 3HDCA 2JZTA 5ECLB 3L4NA 1UA5A 5IMAA 2H1GA 2PGTA 1A0FA 4ML1A 2FHEA 2L4CA 5JWQB 3BBYA 1YKAA 4ZBDA 1DE2A 2FA8A 5ECOB 1O73A 4N30A 4MJCA 2F8FA 4DSQA 3HA9A 2HFDA 2L5OA 3GH6A 3O3TA 5FWGA 3UL3A 3C7MA 2H01A 5BMUA 2H70A 1T1VA 2O85A 3TJBA 3RPNA 2DC5A 3UOMA 2YWMA 1ERTA 2KUCA 2QSIA 1EGOA 1VF1A 3GNJA 3RDWA 4EE0A 3FR6A 4PXOA 5J4VA 4L0WA 5D73A 6GSXA 1XWBA 2IIYA 4KDYA 1XXUA 3L9VA 1NM3A 2HZEA 4IQ1A 1V57A 4DEJA 2L59A 4AF2A 1R4WA 4OO5A 4HQZA 4MF7A 2MMNA 2KLXA 2YN1A 5C04A 3EMPA 5A34B 1DE1A 1CQHA 1B9YC 3IBHA 3BCKA 3TGZA 6GSWA 1WP0A 2H71A 2MBTA 3L78A 1T3BA 3VLNA 3LSZA 1QQ2A 3UEMA 5CAXA 5ECPB 3M1GA 2DIZA 2XHFA 1O7UA 1PN0A 4F82A 5LCZA 4NV5A 1Y25A 1SL0B 3UIWA 5D93A 3MNGA 4FYCA 2OKAA 1XFLA 3LQ7A 1J9BA 1H4OA 3GTUB 4MK3A 4GDFA 3MYDA 2BTOT 4LLRA 5ELGA 4MPFA 4OWYA 4YKGA 3LW9A 3C1SA 3HVSA 1WPIA 1N25A 5ID2B 3F63A 2H0IA 1MD4A 1TJDA 3KP9A 3ZL5A 1TI3A 4DSSA 1PRXA 1R5AA 1WRYA 3VI5A 3BD2A 4TN8A 1TW9A 1GRXA 2WZ9A 3R2QA 1K3OA 1SK2A 4EVMA 3W8SA 1WMJA 2LNTA 4XS4B 1V40A 3EC3A 2PVQA 2LJKA 5HR3A 2IMEA 4HUAA 3QAGA 2QA1A 4K9ZA 2MMZA 2EFHA 1FB0A 1THXA 3GN3A 2DKIA 2GLRA 2AHEA 2H76A 1WOUA 8GSSA 2JADA 3UVHA 4XS6A 3DMLA 3FMWA 1N8JA 4GSNA 1MDKA 1FO5A 3UARA 1YJ6A 2OADA 3FZ4A 3WYWA 3M0FA 3H93A 3GX0A 5J4UA 4WXTA 3LORA 2PN8A 5L71A 2GQLA 4BVYB 2BMXA 4XRAA 3I43A 3ZVJD 2YZUA 4EIQA 1YZXA 1KBNA 2C3TA 3VWXA 1EP8A 1ZL9A 2C4JA 2HSYA 3MWHA 4OMVA 4POKA 1Z7RA 4E8EA 1G7OA 1YF0A 2X99A 3C71A 2MMAA 3IRAA 4K8MA 3MIXA 3EINA 1USBA 1GSSA 2VAFA 4RI6A 2YV9A 3KIJA 4HEA2 1U3IA 4CW9A 2A4HA 2RM6A 1OKTA 2J9HA 11GSA 1MDIA 3ZREA 3GIXA 3AY8A 2DMLA 2I3YA 2XC2A 1URMA 4YQVA 1GTIA 1JZRA 2F3MA 2KHPA 1GTUA 2A2SA 2FLSA 2WGRA 4X43A 4HZ4A 5GAPD 3GURA 2FWGA 1ST9A 4AI6A 2DBCA 1CQGA 2B1LA 1GSUA 2QKEA 1X5EA 4ULXA 4GQCA 4K2XA 5GZZB 3BJ5A 2HI7A 3NZNA 1RQMA 4KGIA 4KX4A 4ZIJA 4TR1B 1T7PB 1ZMAA 2LTKA 5A34A 2OBKA 3D0ZA 4KF9A 4OFMA 2YOIA 1R26A 3TKPA 4XS1A 2OACA 2PPTA 1TK5B 2VCXA 3EURA 3TKSE 5CP1A 2VCTA 3U6VA 5IQYA 2V41A 2XBQA 3ZZXA 2GDRA 4POBA 1GLPA 5A4VA 3WT1A 1LU4A 3FRCA 3HVVA 3G9BA 2ALBA 2R6KA 4EKZA 1DSBA 1GL8A 4KE3A 4CY6A 5IMVA 3N9JA 3E9JB 2IWTA 9GSSA 2DJ2A 4HDEA 4K2DA 2O5VA 2B7KA 2C3NA 2OE0A 1OYJA 3GRXA 3M8NA 2QGVA 1F2EA 3F4SA 2YWIA 4TXOA 2IFQA 2C1YA 2YZHA 2NBSA 2HZEB 3QD9A 3KJYA 5J3RA 4AJ7A 3GKXA 4PQ1A 1K0AA 1JZWA 1SENA 4EIPA 4RQRA 4MF5A 1EOGA 5GAND 1JFUA 2GZPA 3F4RA 3R3EA 2K18A 1XWGA 5ABRA 3HMJG 2I81A 3TJGA 3A5IA 3F9UA 2H74A 2DIYA 3C73A 3D6IA 4A5PA 5E4WA 1O81A 3ED3A 1PN9A 3IC8A 2O8VB 1OAZA 16GSA 5D96A 4IP1A 3KXOA 4ZILA 3CYNA 2GVPA 2JZSA 4KUNA 4J56E 1QFNA 1EGRA 3APOA 2FWEA 2VCQA 4L5LA 2JSYA 5J4YA 5G30A 2GSQA 3CBUA 4JBBA 5A4WA 4BWQA 5IPGA 2LQQA 2P31A 3DWVA 2FWHA 3HCZA 4PTSA 3EYTA 4BWSA 4F9ZA 1B8XA 4OD7A 3VPQA 18GSA 1A8YA 2RUEA 2UV8G 5KN1A 5DVBA 3GV1A 2F51A 4GTUA 4IHUA 3G7YA 4K7IA 3TOTA 2J23A 3ERFA 2CQ9A 1A8LA 3HJPA 1XWAA 5HFGA 5C00A 5B8BA 1AQXA 4DSSB 4MJEA 2X49A 1PSQA 5A5KA 1XW6A 3M9JA 2HRKB 2L5LA 1QMVA 2K6VA 2AJQB 5B6MA 1FHEA 5IOWA 2V32A 4QQ7A 5DALA 3FZAA 3WGXA 3CTGA 1EP7A 1PX6A 4BL7A 5HR1A 3IC4A 1VF3A 3PPUA 2CV4A 2IMIA 5ELAA 6GSUA 3DYRA 2VUPA 3ZFBA 2ZNMA 4GLTA 2H73A 3NOFA 4V1Ap 5IOXA 5JWRB 3FY7A 1TKDB 1TK8B 2EFEA 1R7HA 3OR5A 2R0GA 2GQMA 4WBJA 19GSA 3ZITA 2HYXA 3Q18A 3H4KA 2HQTA 3P90A 2C0GA 4ECIA 2K8SA 2GQKA 4EUYA 1QUWA 3UBKA 2WFCA 2PMTA 4J2FA 4MJBA 1TU7A 4XCSA 4WR4A 1UC7A 4K0NA 1DBYA 4TR3A 2B5YA 2R0CA 5E59A 2HRNA 5AIXA 2QC7A 2IMDA 4G10A 4TR1A 1O8XA 1VF4A 5CRGA 2PUKC 3ISOA 1NSWA 4MH2A 2H1AA 5B6NA 5DQSA 2E7PA 4E8HA 4L8EA 1GSQA 3D4TA 1O85A 2OJLA 2G0FA 4TKYA 1SVOA 2FCHA 2OBIA 1BAYA 1NHOA 3GFKA 4MNNA 1JHBA 3GSSA 5G31A 4ILFA 3A2WA 2VL2A 5J9CA 2PBJA 3KMOA 2H6YA 1M9BA 5LNKe 2HSNA 1GSFA 2C3QA 3KMNA 2ZUPA 2VKZG 3J7Yb 4JEDA 4EL1A 1K0NA 2P5RA 1I5GA 1PGTA 1T4YA 2DLXA 4KSOA 5ENUA 1Q4JA 5DQYA 2HT9A 2NDOA 3BOAA 4IQAA 2LKUA 3GL5A 2CVDA 3CTFA 4KAEA 3CSHA 2HSHA 4K5RA 4TW5A 1Y6EA 4EXJA 2BJXA 1V2AA 5D9TA 1TI1A 2GSTA 4EO3A 1EEMA 1J0FA 1XOBA 3A3TA 4KA0A 4IJ3A 1BG5A 2VIMA 4Z2UA 3P7XA 4QMKA 1V98A 5H5RA 3KTBA 2UZ8A 1RK4A 1YY7A 1MD3A 1OC3A 3QDNA 1JZDA 5KN0A 4NPBA 5A4UA 2GTUA 2O7KA 2LQOA 1HD2A 4L0UA 5CREA 4ID0A 4K1FA 4F0CA 5DDLA 5INYA 2RM5A 4IP6A 4Q5NA 1JLWA 3FZ9A 5HFIA 3Q19A 4E68A 4TXVA 3F8UA 4HJ2A 1XVWA 2RUFA 5LD0A 4X0XA 4TXOB 3ERGA 4Z2RA 1YKCA 2IFQB 3NIVA 1O8WA 1V9WA 3VK9A 3ZMKA 3ZFLA 2PWJA 2F9SA 4MDCA 5HFKA 2CAQA 2C8UA 4MH3A 5F05A 3WD6A 1O6JA 3KP8A 4V2NA 1X5CA 3H8QA 5D8IA 5FHIA 2ON7A 3IR4A 3N5OA 1ERUA 2YPMA 3IK7A 1G6YA 1OC9A 4TR0A 2HRKA 2B1KA 5CYYA 1HNBA 1ZOFA 3CSJA 3I69A 2G2QA 5JWOB 3EU4A 1EOHA 1AQWA 4YQMA 1BQ7A 1XWCA 2HLSA 3PH9A 3F6FA 1GNWA 1BEDA 1A2JA 5IM9A 1X9WB 3QOUA 5F0GA 3ZIVA 1SJIA 4MCUA 5ECIB 1R5PA 3L0HA 17GSA 3RHBA 1X5DA 4ZL8A 4NMUA 1F6MC 1KTEA 4XIHA 3H79A 4PGTA 5IIZA 12GSA 3ZIJA 4WF5A 3VI7A 1SJZA 4EF0A 4NHWA 1X9SB 5J47A 3WT2A 4ZB6A 5IMDA 4KH7A 2AUVA 1SK0A 3IA1A 1UN2A 3ZVJA 3ZYWA 4IGJA 3VWWA 1K0OA 3KH9A 1B9XC 4F2IA 3QAVA 4KDXA 4MABA 3VWVA 1TRSA 1X9MB 4HQSA 5DALB 4BVXA 3LYPA 4BL7B 1YDKA 3G7IA 4Q5QA 1EV4A 2R3XA 2H72A 4YAPA 4I2TA 3DEXA 1TTZA 3DXBA 3HHVA 4O5RA 2R4VA 1G6WA 1WIKA 1SVLA 4ACSA 3VWUA 4Z2TA 3LYKA 2TRCP 3VPTA 2P0GA 3FW2A 5J40A 4IBPA 4G9HA 4MMMA 4HOJA 1J08A 5COHA 1FOVA 1K3YA 5AIVA 3VFIA 2WCIA 4HZ2A 4HU9A 3GA4A 4KCEA 2FUG2 2WULA 2OE3A 3E0UA 22GSA 4I97A 3A2VA 5BRTA 2VCZA 3TKRA 2CZ3A 4PQHA 1XIYA 2HNLA 5G1KA 3TJFA 1FB6A 3KM6A 2AV4A 2H1BA 3RAZA 3TB2A 1OC8A 2LUSA 2V1MA 3D21A 3APSA 2ES7A 2LS5A 2RLIA 2OE1A 1KNGA 2K9FA 3M9KA 1PL1A 1QGVA 2FWFA 2VL9A 1TDIA 1GNEA 2VM2A 4HS1A 2CA8A 1M0UA 1TK0B 2O89A 5JCUA 1ERWA 2EFCA 2M80A 3GL3A 2PU9C 3Q6OA 2H8LA 2E2GA 3FKFA 2DKHA 2VL3A 1XBSA 3EWLA 5ECQB 3UVTA 3TJKA 4ZXGA 1RW1A 2L57A 3E3EA 2HSNB 4D73A 1ILOA 1S3AA 5EPFA 4L5OA 1X0RA 2H0GA 7GSSA 4G0LA 3D4MA 4XHMA 2YANA 3D5JA 2OT3A 4ZB7A 2IN3A 4YAVA 3DD3A 3GKMA 3HYPA 1SYRA 1WJKA 4V2LA 2DMMA 4CDOA 1A2LA 5KN3A 1A24A 1GSEA 1EZKA 3HJMA 4HU7A 2XPDA 2CVKA 4GF0A 4MZBA 3KH7A 1BF5A 4NHZA 2B5EA 5F8BA 3HD5A 3EPTA 1N2AA 4HI7A 5AN1A 4YKFA 5J9BA 5D9XA 1MEKA 5G5EA 5CRWA 2YWNA 4GWRA 3GKKA 2R0PA 3LWAA 2NPBA 4LL1B 4JRRA 4KB3A 3ZTLA 1SVMA 4PQIA 4AKIA 4TR4A 2LJRA 3LGCA 3TDGA 1PMTA 1PKWA 5KEJA 4K7NA 2LSTA 4ZBBA 1Y1UA 4RUVA 3HZ4A 4LA1A 4GQFA 1FOHA 5B8AA 3IDVA 2YCDA 3LXTA 2V2GA 20GSA 3TCOA 1GSDA 2B5XA 1Z3EA 1M9AA 2IMKA 1HQOA 3GX8A 4G2EA 5D9WA 2N5AA 1HYUA 1GULA 1FAAA 1UVZA 1ON4A 4ZL9A 1M2AA 4AJ8A 3C8EA 3KTLA 1OC9B 1TOFA 3HZ8A 2ON5A 4ZL7A 1ML6A 3IPZA 4TRXA 2IJYA 1NW2A 3C1RA 1PX7A 4I6XA 4Q5RA 2JACA 1GUMA 3ME8A 4PNFA 4OCEA 1GP1A 1G7EA 3U5RE 3W8JA 4RI7A 3DVWA 2A4VA 3KD0A 4EC0A 4AGSA 1EEJA 2R37A 3QAWA 4KW6A 2QA2A 2E2MA 4P3YB 4TVEA 3A2XA 1BJXA 6GSYA 2H19A 2B3SA 2N5BA 1AW9A 4MF6A 2VD0A 1H75A 4OO4A 4Z7XA 3KEBA 2KOKA 1NHYA 2IMFA 1FVJA 4PUAA 3O76A 4QL9A 1Z9HA 1U3AA 5G1LA 5EVOA 4K6XA 3L9UA 2H30A 2XPEA 5IMCA 3ME7A 3IK9A 1MTCA 3UAPA 2LEGA 1THOA 4ECCA 3LFLA 5A5HA 1SJ6A 3TKSA 4BVXB 3TRXA 2LNSA 2YV7A 2B7JA 4IVFA 3EMXA 4MP4A 1DUGA 1K0CA 1F9MA 2OA7A 4WEYA 3IHGA 4ISDA 2LRTA 2FY6A 5HR0A 3EE2A 5H5SA 2V6KA 3O6TA 1BG1A 1M99A 4WETA 4CY8A 1XW5A 2ZCTA 2DJ1A 1ZYPA 5G5FA 1PD21 3GH9A 1PKZA 5AGYA 1WE0A 1LBKA 1K3LA 5G2ZA 1F37A 2CT6A 1SKWB 5DJLA 1AIUA 1PA3A 2REMA 3QPMA 1ZYNA 2MBSA 3FYGA 2C0FA 2NVLA 3HKRA 2YJ7A 4V2MA 4FYBA 5IO0A 1ZZYA 4KDUA 1A0RP 2I4AA 5DAKA 2DSAA 4GSSA 4ECBA 3APQA 1OVNA 1XVQA 4JR6A 4X4JA 3FHKA 5DJMA 5KN2A 3CSIA 4FIWA 1FG4A 2R2JA 4EDZA 2CZ2A 1ABAA 2KP2A 4WF4A 2VO4A 2WJUA 10GSA 4TOPA 4XTSA 2H66A 4OCFA 3WGDA 4G19A 2K8VA 4G0IA 3KGKA 2JSZA 2JU5A 5ECRB 1XWKA 2HRAA 4OFNA 3IAS2 1TP9A 4H86A 4YH2A 5ECKB 4KSMA 4N0ZA 2DJ3A 1QK8A 4J57E 4D73B 2EIQA 1E2YA 3F6DA 3RHCA 2C0DA 3GHAA 5KOXA 5A1NA 5JCWA 5ECMB 2GSSA 1BX9A 1Z6NA 3EU3A 1K0MA 4GXZA 4FQUA 3DRNA 3HXSA 1PQNA 4IELA 4LL4B 2B6MA 2HSMA 5D9VA 2YNXA 2EC4A 4AKHA 5IO2A 3DIEA 2FD3A 2L6DA 1SD9A 4X1UA 2GT5A 4PNGA 5CRDA 2AB6A 1YVLA 4AKGA 4HJMA 3G7JA 1TU8A 3QFAC 2YJHA 5CO3A 3ERWA 3S9FA 2RIIA 4O32A 2R5GA 1ZGNA 4PURA 1MDJA 3I6AA 1B4PA 5IPHA 2LV3A 2YP6A 4PX1A 2H75A 2NTOA 4LMVA 1JLVA 1SL2B 3RPPA 3PGTA 2HXKA 3J7Yk 5GSSA 3GSTA 3JCML 5IMFA 1Q98A 4N3ZA 3SWLA 2DJ0A 2JL4A 1PL2A 4MZCA 2IPAA 4MZWA 1OE8A 1Z6MA 6GSTA 1SD8A 3FK8A 2VCWA 2VLUA 4FYUA 4JZQA 4N0VA 2H1LA 5HR2A 3CXGA 1QXHA 1C72A 5EL8A 2H1DA 3F3RA 2TIRA 1VRSD 2GZZA 4N10A 5J41A 3FR9A 2H0HA 4N11A 3EVIA 3TKQA 2E0QA 2HE3A 3PR8A 1M2BA 3GYKA 1TXUA 3TKSC 5HQPA 2GZYA 1XW9A 1GLQA 2A2PA 1GUKA 4NWYA 1HNCA 1AXDA 3TJJA 4W66A 1YEXA 1GTBA 2JZRA 1Z5YE 5DCHA 3MSZA 2VL2C 5ECSA 1HNAA 4JU5A 4F03A 3BCIA 2CX4A 1AQVA 4IJIA 2FNOA 3IV4A 1YF1A 1B48A 3DGQA 2XBIA 2FGXA 4DSRA 4LMWA 2CX3A 5CNWA 2M46A 4O7HA 2GT6A 4MJAA 1I9DA 1XZOA 1TRWA 1OE7A 4PUFC 1T4ZA 2C0EA 1YEPA 1FVKA 4K7OA 3TRQA 4Q5FA 5H5QA 4F0BA 1K0BA 1M2DA 4MLYA 2C80A 2GSRA 1XCCA 4MPGA 5A5HB 4FO5A 1XOAA 3F3QA 2IL3A 2EFDA 2O87A 3IHQA 3QFBC 3M3MA 1V58A 13GSA 3WGEA 1XPVA 5F07A 4OFTA 4ECJA 2DJKA 2MZCA 1W4VA 4V1Ag 4RQXA 1TRVA 1K0DA 1WWJA 3HVXA 4ZB8A 3GUSA 3D22A 3FEUA 1KEBA 2DJJA 1T00A 2FA4A 1GWCA 1TRUA 2WRTA 1W89A 1G0TA 3A5WA 4KCAA 4JR4A 4AJ6A 3TU3B 3KCMA 4NV2A 5CRHA 3K8NA 2VCVA 1M7TA 2X8HA 3UBLA 3HY2A 5GSTA 1EV9A 3W6GA 1SU9A 4YQUA 1ZYEA 4IN0A 5BMUB 1IYHA 1GSYA 2TRXA 2P5QA 3IAM2 2MYGA 4K0GA 3FR3A 4GRFA 5ECNB 3LJRA 2AYTA 3US3A 3TUEA 2H6ZA 2V6OA 3IE3A 4WR5A 5AISA 3TOUA 2Z9SA 3Q74A 3LXZA 3GTUA 5DAKB 5FT3A 2LRNA 1SKRB 3FZ5A 1S3CA 3H1NA 2VOCA 5ID2A 4ML6A 2L4QA 3SBCA 1U87A 4USSA 2LRCA 2N5FA 6GSSA 1JZOA 4AKXB 2GS3A 2WDUA 4DVCA 1IYIA 3HJOA 2F8AA 14GSA 4ZB9A 1GH2A 1ZCPA 4KNDA 4XS4A 3KZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCG A;  3CMI A;  2VLV A;  4WBR D;  3PIN A;  1GTA A;  2D2Z A;  4EDY A;  1A23 A;  4JE1 A;  3CRU A;  1GUH A;  1SL1 B;  4G0K A;  3QCP A;  2WS2 A;  3P8W A;  4POM A;  2X8G A;  2AAW A;  4MA9 A;  3V1W A;  2I9H A;  5DCG A;  2M72 A;  1OKD A;  2HSM B;  3ZLP A;  1AAZ A;  2PER A;  1F3B A;  4IW9 A;  1U88 A;  1LJR A;  1ZYQ B;  3RBT A;  2X8C A;  3TRP A;  4BA7 A;  5F06 A;  4BVY A;  3IOS A;  1TXX A;  1AC1 A;  3DVX A;  3UMA A;  2KP1 A;  5EY6 A;  2CAI A;  3UJ1 A;  1FW1 A;  2PVO C;  3GMF A;  2WB9 A;  3F0I A;  2HZF A;  3P2A A;  1A2M A;  1BYE A;  4IS0 A;  5DBQ A;  4QL7 A;  1U6T A;  2MMO A;  3F4T A;  1EWX A;  2EIR A;  5B7C A;  3VUR A;  2LJA A;  4WKW A;  4O92 A;  2CVB A;  4POL A;  3GKN A;  5J5N A;  2VD1 A;  4XRD A;  3ZRD A;  4GST A;  4BPY A;  4GCI A;  4I8B A;  4ZBA A;  3I9V 2;  1AUC A;  1ACV A;  4FH8 A;  2GGT A;  4NAX A;  2X64 A;  4CHS A;  2VM1 A;  1SKS B;  2I1U A;  5IMZ A;  1B4Q A;  3LG6 A;  4I5Q A;  2H6X A;  3LEF A;  3IXR A;  2HRF A;  2L6C A;  3L9S A;  3CRT A;  2VLT A;  1VF2 A;  3ZML A;  1F3A A;  1Z7P A;  1YQ1 A;  2YWO A;  1SK1 A;  1E6B A;  1S3D A;  1VGL A;  1ERV A;  3QR6 A;  4I2U A;  4NXI A;  2A2R A;  2EIO A;  1SYX A;  6GSV A;  1T8E B;  3MAK A;  4IKH A;  3MDK A;  5ECH B;  3QMX A;  3DKS A;  3HDC A;  2JZT A;  5ECL B;  3L4N A;  1UA5 A;  5IMA A;  2H1G A;  2PGT A;  1A0F A;  4ML1 A;  2FHE A;  2L4C A;  5JWQ B;  3BBY A;  1YKA A;  4ZBD A;  1DE2 A;  2FA8 A;  5ECO B;  1O73 A;  4N30 A;  4MJC A;  2F8F A;  4DSQ A;  3HA9 A;  2HFD A;  2L5O A;  3GH6 A;  3O3T A;  5FWG A;  3UL3 A;  3C7M A;  2H01 A;  5BMU A;  2H70 A;  1T1V A;  2O85 A;  3TJB A;  3RPN A;  2DC5 A;  3UOM A;  2YWM A;  1ERT A;  2KUC A;  2QSI A;  1EGO A;  1VF1 A;  3GNJ A;  3RDW A;  4EE0 A;  3FR6 A;  4PXO A;  4L0W A;  5D73 A;  6GSX A;  1XWB A;  2IIY A;  4KDY A;  1XXU A;  3L9V A;  1NM3 A;  2HZE A;  4IQ1 A;  1V57 A;  4DEJ A;  2L59 A;  4AF2 A;  1R4W A;  4OO5 A;  4HQZ A;  4MF7 A;  2MMN A;  2KLX A;  2YN1 A;  5C04 A;  3EMP A;  1DE1 A;  1CQH A;  1B9Y C;  3IBH A;  3BCK A;  3TGZ A;  6GSW A;  1WP0 A;  2H71 A;  2MBT A;  3L78 A;  1T3B A;  3VLN A;  3LSZ A;  1QQ2 A;  3UEM A;  5CAX A;  5ECP B;  3M1G A;  2DIZ A;  2XHF A;  1O7U A;  4F82 A;  5LCZ A;  4NV5 A;  1Y25 A;  1SL0 B;  3UIW A;  5D93 A;  3MNG A;  4FYC A;  2OKA A;  1XFL A;  3LQ7 A;  1J9B A;  1H4O A;  3GTU B;  4MK3 A;  4LLR A;  2BTO T;  5ELG A;  4MPF A;  4OWY A;  3C1S A;  3HVS A;  1WPI A;  5ID2 B;  3F63 A;  2H0I A;  1MD4 A;  1TJD A;  3KP9 A;  3ZL5 A;  1TI3 A;  4DSS A;  1PRX A;  1R5A A;  1WRY A;  3VI5 A;  3BD2 A;  4TN8 A;  1TW9 A;  1GRX A;  2WZ9 A;  3R2Q A;  1K3O A;  1SK2 A;  4EVM A;  3W8S A;  1WMJ A;  2LNT A;  4XS4 B;  1V40 A;  3EC3 A;  2PVQ A;  2LJK A;  5HR3 A;  2IME A;  4HUA A;  3QAG A;  4K9Z A;  2MMZ A;  1FB0 A;  1THX A;  3GN3 A;  2GLR A;  2AHE A;  2H76 A;  1WOU A;  8GSS A;  2JAD A;  3UVH A;  4XS6 A;  3DML A;  1N8J A;  4GSN A;  1MDK A;  1FO5 A;  3UAR A;  1YJ6 A;  2OAD A;  3FZ4 A;  3WYW A;  3M0F A;  3H93 A;  3GX0 A;  5J4U A;  4WXT A;  3LOR A;  2PN8 A;  5L71 A;  2GQL A;  4BVY B;  2BMX A;  4XRA A;  3I43 A;  3ZVJ D;  2YZU A;  1YZX A;  1KBN A;  2C3T A;  3VWX A;  1EP8 A;  1ZL9 A;  2C4J A;  2HSY A;  3MWH A;  4OMV A;  4POK A;  1Z7R A;  4E8E A;  1G7O A;  1YF0 A;  2X99 A;  3C71 A;  2MMA A;  3IRA A;  4K8M A;  3EIN A;  1USB A;  1GSS A;  2VAF A;  4RI6 A;  2YV9 A;  3KIJ A;  4HEA 2;  1U3I A;  4CW9 A;  2RM6 A;  1OKT A;  2J9H A;  11GS A;  1MDI A;  3ZRE A;  3GIX A;  3AY8 A;  2DML A;  2I3Y A;  2XC2 A;  1URM A;  4YQV A;  1GTI A;  1JZR A;  2F3M A;  2KHP A;  1GTU A;  2A2S A;  2FLS A;  2WGR A;  4X43 A;  4HZ4 A;  5GAP D;  3GUR A;  2FWG A;  1ST9 A;  2DBC A;  1CQG A;  2B1L A;  1GSU A;  2QKE A;  1X5E A;  4ULX A;  4GQC A;  5GZZ B;  3BJ5 A;  2HI7 A;  3NZN A;  1RQM A;  4KGI A;  4KX4 A;  4ZIJ A;  4TR1 B;  1T7P B;  1ZMA A;  2LTK A;  2OBK A;  3D0Z A;  4KF9 A;  4OFM A;  2YOI A;  1R26 A;  3TKP A;  4XS1 A;  2OAC A;  2PPT A;  1TK5 B;  2VCX A;  3EUR A;  3TKS E;  5CP1 A;  2VCT A;  3U6V A;  5IQY A;  2V41 A;  2XBQ A;  3ZZX A;  2GDR A;  4POB A;  1GLP A;  5A4V A;  3WT1 A;  1LU4 A;  3FRC A;  3HVV A;  3G9B A;  2ALB A;  2R6K A;  4EKZ A;  1DSB A;  1GL8 A;  4KE3 A;  5IMV A;  3N9J A;  3E9J B;  2IWT A;  9GSS A;  2DJ2 A;  4HDE A;  4K2D A;  2B7K A;  2C3N A;  2OE0 A;  1OYJ A;  3GRX A;  3M8N A;  2QGV A;  1F2E A;  3F4S A;  2YWI A;  4TXO A;  2IFQ A;  2C1Y A;  2YZH A;  2NBS A;  2HZE B;  3QD9 A;  3KJY A;  5J3R A;  4AJ7 A;  3GKX A;  4PQ1 A;  1K0A A;  1JZW A;  1SEN A;  4RQR A;  4MF5 A;  1EOG A;  5GAN D;  1JFU A;  2GZP A;  3F4R A;  3R3E A;  2K18 A;  1XWG A;  5ABR A;  2I81 A;  3TJG A;  3F9U A;  2H74 A;  2DIY A;  3C73 A;  3D6I A;  5E4W A;  1O81 A;  3ED3 A;  1PN9 A;  3IC8 A;  2O8V B;  1OAZ A;  16GS A;  5D96 A;  4IP1 A;  3KXO A;  4ZIL A;  3CYN A;  2GVP A;  2JZS A;  4KUN A;  4J56 E;  1QFN A;  1EGR A;  3APO A;  2FWE A;  2VCQ A;  4L5L A;  2JSY A;  5G30 A;  2GSQ A;  3CBU A;  4JBB A;  5A4W A;  4BWQ A;  5IPG A;  2LQQ A;  2P31 A;  3DWV A;  2FWH A;  3HCZ A;  4PTS A;  3EYT A;  4BWS A;  4F9Z A;  1B8X A;  4OD7 A;  3VPQ A;  18GS A;  1A8Y A;  2RUE A;  5KN1 A;  5DVB A;  3GV1 A;  2F51 A;  4GTU A;  4IHU A;  3G7Y A;  4K7I A;  3TOT A;  2J23 A;  3ERF A;  2CQ9 A;  1A8L A;  3HJP A;  1XWA A;  5HFG A;  5C00 A;  5B8B A;  1AQX A;  4DSS B;  4MJE A;  1PSQ A;  5A5K A;  1XW6 A;  3M9J A;  2HRK B;  2L5L A;  1QMV A;  2K6V A;  2AJQ B;  5B6M A;  1FHE A;  5IOW A;  2V32 A;  4QQ7 A;  5DAL A;  3FZA A;  3WGX A;  3CTG A;  1EP7 A;  1PX6 A;  4BL7 A;  5HR1 A;  3IC4 A;  1VF3 A;  3PPU A;  2CV4 A;  2IMI A;  5ELA A;  6GSU A;  3DYR A;  2VUP A;  3ZFB A;  2ZNM A;  4GLT A;  2H73 A;  3NOF A;  4V1A p;  5IOX A;  5JWR B;  3FY7 A;  1TKD B;  1TK8 B;  1R7H A;  3OR5 A;  2GQM A;  4WBJ A;  19GS A;  3ZIT A;  2HYX A;  3Q18 A;  3H4K A;  2HQT A;  3P90 A;  2C0G A;  4ECI A;  2K8S A;  2GQK A;  4EUY A;  1QUW A;  3UBK A;  2WFC A;  2PMT A;  4J2F A;  4MJB A;  1TU7 A;  4XCS A;  4WR4 A;  1UC7 A;  4K0N A;  1DBY A;  4TR3 A;  2B5Y A;  5E59 A;  2HRN A;  5AIX A;  2QC7 A;  2IMD A;  4G10 A;  4TR1 A;  1O8X A;  1VF4 A;  5CRG A;  2PUK C;  3ISO A;  1NSW A;  4MH2 A;  2H1A A;  5B6N A;  5DQS A;  2E7P A;  4E8H A;  4L8E A;  1GSQ A;  3D4T A;  1O85 A;  2OJL A;  2G0F A;  4TKY A;  2FCH A;  2OBI A;  1BAY A;  1NHO A;  3GFK A;  1JHB A;  3GSS A;  5G31 A;  4ILF A;  3A2W A;  2VL2 A;  5J9C A;  2PBJ A;  3KMO A;  2H6Y A;  1M9B A;  5LNK e;  1GSF A;  2C3Q A;  3KMN A;  2ZUP A;  3J7Y b;  4JED A;  4EL1 A;  1K0N A;  2P5R A;  1I5G A;  1PGT A;  1T4Y A;  2DLX A;  4KSO A;  5ENU A;  1Q4J A;  5DQY A;  2HT9 A;  2NDO A;  3BOA A;  4IQA A;  2LKU A;  3GL5 A;  2CVD A;  3CTF A;  4KAE A;  3CSH A;  2HSH A;  4TW5 A;  1Y6E A;  4EXJ A;  2BJX A;  1V2A A;  5D9T A;  1TI1 A;  2GST A;  4EO3 A;  1EEM A;  1J0F A;  1XOB A;  3A3T A;  4KA0 A;  4IJ3 A;  1BG5 A;  2VIM A;  3P7X A;  1V98 A;  5H5R A;  3KTB A;  2UZ8 A;  1RK4 A;  1YY7 A;  1MD3 A;  1OC3 A;  3QDN A;  1JZD A;  5KN0 A;  4NPB A;  5A4U A;  2GTU A;  2O7K A;  2LQO A;  1HD2 A;  4L0U A;  5CRE A;  4ID0 A;  4K1F A;  4F0C A;  5DDL A;  5INY A;  2RM5 A;  4IP6 A;  4Q5N A;  1JLW A;  3FZ9 A;  5HFI A;  3Q19 A;  4TXV A;  3F8U A;  4HJ2 A;  1XVW A;  2RUF A;  5LD0 A;  4X0X A;  4TXO B;  3ERG A;  1YKC A;  2IFQ B;  3NIV A;  1O8W A;  1V9W A;  3VK9 A;  3ZMK A;  3ZFL A;  2PWJ A;  2F9S A;  4MDC A;  5HFK A;  2CAQ A;  2C8U A;  4MH3 A;  5F05 A;  3WD6 A;  1O6J A;  3KP8 A;  4V2N A;  1X5C A;  3H8Q A;  5D8I A;  5FHI A;  2ON7 A;  3IR4 A;  3N5O A;  1ERU A;  2YPM A;  3IK7 A;  1G6Y A;  1OC9 A;  4TR0 A;  2HRK A;  2B1K A;  5CYY A;  1HNB A;  1ZOF A;  3CSJ A;  3I69 A;  2G2Q A;  5JWO B;  3EU4 A;  1EOH A;  1AQW A;  4YQM A;  1BQ7 A;  1XWC A;  2HLS A;  3PH9 A;  3F6F A;  1GNW A;  1BED A;  1A2J A;  5IM9 A;  1X9W B;  3QOU A;  5F0G A;  3ZIV A;  1SJI A;  4MCU A;  5ECI B;  1R5P A;  3L0H A;  17GS A;  3RHB A;  1X5D A;  4ZL8 A;  4NMU A;  1F6M C;  1KTE A;  4XIH A;  3H79 A;  4PGT A;  5IIZ A;  12GS A;  3ZIJ A;  4WF5 A;  3VI7 A;  1SJZ A;  4EF0 A;  4NHW A;  1X9S B;  3WT2 A;  4ZB6 A;  5IMD A;  4KH7 A;  2AUV A;  1SK0 A;  3IA1 A;  1UN2 A;  3ZVJ A;  3ZYW A;  4IGJ A;  3VWW A;  1K0O A;  3KH9 A;  1B9X C;  4F2I A;  3QAV A;  4KDX A;  4MAB A;  3VWV A;  1TRS A;  1X9M B;  4HQS A;  5DAL B;  4BVX A;  3LYP A;  4BL7 B;  1YDK A;  3G7I A;  4Q5Q A;  1EV4 A;  2R3X A;  2H72 A;  4YAP A;  4I2T A;  3DEX A;  1TTZ A;  3DXB A;  3HHV A;  4O5R A;  2R4V A;  1G6W A;  1WIK A;  3VWU A;  4ACS A;  3LYK A;  2TRC P;  3VPT A;  2P0G A;  3FW2 A;  4IBP A;  4G9H A;  4MMM A;  4HOJ A;  1J08 A;  5COH A;  1FOV A;  1K3Y A;  5AIV A;  3VFI A;  2WCI A;  4HZ2 A;  4HU9 A;  3GA4 A;  4KCE A;  2FUG 2;  2WUL A;  2OE3 A;  3E0U A;  22GS A;  4I97 A;  3A2V A;  2VCZ A;  3TKR A;  2CZ3 A;  4PQH A;  1XIY A;  2HNL A;  5G1K A;  3TJF A;  1FB6 A;  3KM6 A;  2AV4 A;  2H1B A;  3RAZ A;  3TB2 A;  1OC8 A;  2LUS A;  2V1M A;  3D21 A;  3APS A;  2ES7 A;  2LS5 A;  2RLI A;  2OE1 A;  1KNG A;  2K9F A;  3M9K A;  1PL1 A;  1QGV A;  2FWF A;  2VL9 A;  1TDI A;  1GNE A;  2VM2 A;  4HS1 A;  2CA8 A;  1M0U A;  1TK0 B;  2O89 A;  5JCU A;  1ERW A;  2M80 A;  3GL3 A;  2PU9 C;  3Q6O A;  2H8L A;  2E2G A;  3FKF A;  2VL3 A;  1XBS A;  3EWL A;  5ECQ B;  3UVT A;  3TJK A;  4ZXG A;  1RW1 A;  2L57 A;  3E3E A;  2HSN B;  4D73 A;  1ILO A;  1S3A A;  5EPF A;  4L5O A;  1X0R A;  2H0G A;  7GSS A;  4G0L A;  3D4M A;  4XHM A;  2YAN A;  3D5J A;  2IN3 A;  4YAV A;  3DD3 A;  3GKM A;  3HYP A;  1SYR A;  1WJK A;  4V2L A;  2DMM A;  4CDO A;  1A2L A;  5KN3 A;  1A24 A;  1GSE A;  1EZK A;  3HJM A;  4HU7 A;  2XPD A;  2CVK A;  4GF0 A;  4MZB A;  3KH7 A;  4NHZ A;  2B5E A;  5F8B A;  3HD5 A;  1N2A A;  4HI7 A;  5AN1 A;  5J9B A;  5D9X A;  1MEK A;  5G5E A;  5CRW A;  4GWR A;  2YWN A;  3GKK A;  3LWA A;  2NPB A;  4LL1 B;  4JRR A;  4KB3 A;  3ZTL A;  4PQI A;  4TR4 A;  2LJR A;  3LGC A;  3TDG A;  1PMT A;  1PKW A;  5KEJ A;  4K7N A;  2LST A;  4ZBB A;  4RUV A;  3HZ4 A;  4LA1 A;  4GQF A;  5B8A A;  3IDV A;  2YCD A;  3LXT A;  2V2G A;  20GS A;  3TCO A;  1GSD A;  2B5X A;  1Z3E A;  1M9A A;  2IMK A;  1HQO A;  3GX8 A;  4G2E A;  5D9W A;  2N5A A;  1HYU A;  1GUL A;  1FAA A;  1UVZ A;  1ON4 A;  4ZL9 A;  1M2A A;  4AJ8 A;  3C8E A;  3KTL A;  1OC9 B;  1TOF A;  3HZ8 A;  2ON5 A;  4ZL7 A;  1ML6 A;  3IPZ A;  4TRX A;  2IJY A;  1NW2 A;  3C1R A;  1PX7 A;  4I6X A;  4Q5R A;  2JAC A;  1GUM A;  3ME8 A;  4PNF A;  4OCE A;  1GP1 A;  1G7E A;  3U5R E;  3W8J A;  4RI7 A;  3DVW A;  2A4V A;  3KD0 A;  4EC0 A;  4AGS A;  1EEJ A;  2R37 A;  3QAW A;  4KW6 A;  2E2M A;  4P3Y B;  4TVE A;  3A2X A;  1BJX A;  6GSY A;  2H19 A;  2B3S A;  2N5B A;  1AW9 A;  4MF6 A;  2VD0 A;  1H75 A;  4OO4 A;  4Z7X A;  3KEB A;  2KOK A;  1NHY A;  2IMF A;  1FVJ A;  4PUA A;  3O76 A;  4QL9 A;  1Z9H A;  1U3A A;  5G1L A;  5EVO A;  4K6X A;  3L9U A;  2H30 A;  2XPE A;  5IMC A;  3ME7 A;  3IK9 A;  1MTC A;  3UAP A;  2LEG A;  1THO A;  4ECC A;  3LFL A;  1SJ6 A;  3TKS A;  4BVX B;  3TRX A;  2LNS A;  2YV7 A;  2B7J A;  4IVF A;  3EMX A;  4MP4 A;  1DUG A;  1K0C A;  1F9M A;  2OA7 A;  4WEY A;  4ISD A;  2LRT A;  2FY6 A;  5HR0 A;  3EE2 A;  5H5S A;  2V6K A;  3O6T A;  1M99 A;  4WET A;  1XW5 A;  2ZCT A;  2DJ1 A;  5G5F A;  1PD2 1;  3GH9 A;  1PKZ A;  5AGY A;  1WE0 A;  1LBK A;  1K3L A;  5G2Z A;  1F37 A;  2CT6 A;  1SKW B;  5DJL A;  1AIU A;  1PA3 A;  2REM A;  3QPM A;  2MBS A;  3FYG A;  2C0F A;  2NVL A;  3HKR A;  2YJ7 A;  4V2M A;  4FYB A;  5IO0 A;  1ZZY A;  4KDU A;  1A0R P;  2I4A A;  5DAK A;  2DSA A;  4GSS A;  4ECB A;  3APQ A;  1OVN A;  1XVQ A;  4JR6 A;  3FHK A;  5DJM A;  5KN2 A;  3CSI A;  4FIW A;  1FG4 A;  2R2J A;  4EDZ A;  2CZ2 A;  1ABA A;  2KP2 A;  4WF4 A;  2VO4 A;  2WJU A;  10GS A;  4TOP A;  4XTS A;  2H66 A;  4OCF A;  3WGD A;  4G19 A;  2K8V A;  4G0I A;  3KGK A;  2JSZ A;  2JU5 A;  5ECR B;  1XWK A;  2HRA A;  4OFN A;  3IAS 2;  1TP9 A;  4H86 A;  4YH2 A;  5ECK B;  4KSM A;  4N0Z A;  2DJ3 A;  1QK8 A;  4J57 E;  4D73 B;  2EIQ A;  1E2Y A;  3F6D A;  3RHC A;  2C0D A;  3GHA A;  5JCW A;  5ECM B;  2GSS A;  1BX9 A;  1Z6N A;  3EU3 A;  1K0M A;  4GXZ A;  4FQU A;  3DRN A;  3HXS A;  1PQN A;  4IEL A;  4LL4 B;  2B6M A;  2HSM A;  5D9V A;  2YNX A;  2EC4 A;  5IO2 A;  3DIE A;  2FD3 A;  2L6D A;  1SD9 A;  4X1U A;  2GT5 A;  4PNG A;  5CRD A;  2AB6 A;  4HJM A;  3G7J A;  1TU8 A;  3QFA C;  2YJH A;  5CO3 A;  3ERW A;  3S9F A;  2RII A;  4O32 A;  2R5G A;  1ZGN A;  4PUR A;  1MDJ A;  3I6A A;  1B4P A;  5IPH A;  2LV3 A;  2YP6 A;  4PX1 A;  2H75 A;  2NTO A;  4LMV A;  1JLV A;  1SL2 B;  3RPP A;  3PGT A;  2HXK A;  3J7Y k;  5GSS A;  3GST A;  3JCM L;  5IMF A;  1Q98 A;  2DJ0 A;  3SWL A;  2JL4 A;  1PL2 A;  4MZC A;  2IPA A;  4MZW A;  1OE8 A;  1Z6M A;  6GST A;  1SD8 A;  3FK8 A;  2VCW A;  2VLU A;  4FYU A;  4JZQ A;  4N0V A;  5HR2 A;  3CXG A;  1QXH A;  1C72 A;  5EL8 A;  2H1D A;  3F3R A;  2TIR A;  1VRS D;  2GZZ A;  4N10 A;  5J41 A;  3FR9 A;  2H0H A;  4N11 A;  3EVI A;  3TKQ A;  2E0Q A;  2HE3 A;  3PR8 A;  1M2B A;  3GYK A;  3TKS C;  5HQP A;  2GZY A;  1XW9 A;  1GLQ A;  1GUK A;  4NWY A;  1HNC A;  1AXD A;  3TJJ A;  1YEX A;  1GTB A;  2JZR A;  1Z5Y E;  5DCH A;  3MSZ A;  2VL2 C;  5ECS A;  1HNA A;  4JU5 A;  4F03 A;  3BCI A;  2CX4 A;  1AQV A;  4IJI A;  2FNO A;  3IV4 A;  1YF1 A;  1B48 A;  3DGQ A;  2XBI A;  2FGX A;  4DSR A;  4LMW A;  2CX3 A;  5CNW A;  2M46 A;  4O7H A;  2GT6 A;  4MJA A;  1I9D A;  1XZO A;  1TRW A;  1OE7 A;  4PUF C;  1T4Z A;  2C0E A;  1YEP A;  1FVK A;  4K7O A;  3TRQ A;  4Q5F A;  5H5Q A;  4F0B A;  1K0B A;  1M2D A;  4MLY A;  2C80 A;  2GSR A;  1XCC A;  4MPG A;  4FO5 A;  1XOA A;  3F3Q A;  2IL3 A;  2O87 A;  3IHQ A;  3QFB C;  3M3M A;  1V58 A;  13GS A;  3WGE A;  1XPV A;  5F07 A;  4OFT A;  4ECJ A;  2DJK A;  2MZC A;  1W4V A;  4V1A g;  4RQX A;  1TRV A;  1K0D A;  1WWJ A;  3HVX A;  4ZB8 A;  3GUS A;  3D22 A;  3FEU A;  1KEB A;  2DJJ A;  1T00 A;  2FA4 A;  1GWC A;  1TRU A;  2WRT A;  1W89 A;  1G0T A;  3A5W A;  4KCA A;  4JR4 A;  4AJ6 A;  3KCM A;  4NV2 A;  5CRH A;  3K8N A;  2VCV A;  1M7T A;  2X8H A;  3UBL A;  3HY2 A;  5GST A;  1EV9 A;  3W6G A;  1SU9 A;  4YQU A;  1ZYE A;  4IN0 A;  1IYH A;  1GSY A;  2TRX A;  2P5Q A;  3IAM 2;  2MYG A;  4K0G A;  3FR3 A;  4GRF A;  5ECN B;  3LJR A;  2AYT A;  3US3 A;  3TUE A;  2H6Z A;  2V6O A;  3IE3 A;  4WR5 A;  5AIS A;  3TOU A;  2Z9S A;  3Q74 A;  3LXZ A;  3GTU A;  5DAK B;  5FT3 A;  2LRN A;  1SKR B;  3FZ5 A;  1S3C A;  3H1N A;  2VOC A;  5ID2 A;  4ML6 A;  2L4Q A;  3SBC A;  1U87 A;  4USS A;  2LRC A;  2N5F A;  6GSS A;  1JZO A;  2GS3 A;  2WDU A;  4DVC A;  1IYI A;  3HJO A;  2F8A A;  14GS A;  4ZB9 A;  1GH2 A;  1ZCP A;  4KND A;  4XS4 A;  3KZQ A; 
#chains in the Genus database with same CATH topology
 5JCG A;  3CMI A;  2VLV A;  4WBR D;  3PIN A;  1GTA A;  2D2Z A;  4EDY A;  1A23 A;  4JE1 A;  5A1N B;  3CRU A;  1GUH A;  1SL1 B;  4G0K A;  3QCP A;  2WS2 A;  3P8W A;  4POM A;  2X8G A;  2AAW A;  4MA9 A;  3V1W A;  2I9H A;  5DCG A;  2M72 A;  1OKD A;  2HSM B;  3ZLP A;  1AAZ A;  2PER A;  1F3B A;  4IW9 A;  1U88 A;  1LJR A;  1ZYQ B;  3RBT A;  4ICY A;  2X8C A;  3TRP A;  4BA7 A;  5F06 A;  4BVY A;  3IOS A;  1TXX A;  1AC1 A;  3DVX A;  3UMA A;  2KP1 A;  5EY6 A;  2CAI A;  3UJ1 A;  1FW1 A;  2PVO C;  3GMF A;  2WB9 A;  3F0I A;  2HZF A;  3P2A A;  1A2M A;  1BYE A;  4IS0 A;  5DBQ A;  4QL7 A;  1U6T A;  2MMO A;  3F4T A;  1EWX A;  2EIR A;  5B7C A;  3VUR A;  2LJA A;  5KOW A;  4WKW A;  4O92 A;  2CVB A;  4POL A;  3GKN A;  5J5N A;  2VD1 A;  4XRD A;  3ZRD A;  4GST A;  4BPY A;  3CWG A;  4GCI A;  4I8B A;  2X4A A;  4ZBA A;  3I9V 2;  1AUC A;  1ACV A;  4FH8 A;  2GGT A;  4NAX A;  2X64 A;  4CHS A;  1PFO A;  2VM1 A;  1SKS B;  2I1U A;  5IMZ A;  1B4Q A;  4G01 A;  3LG6 A;  4I5Q A;  2H6X A;  3LEF A;  3IXR A;  2HRF A;  4K5S A;  2L6C A;  3L9S A;  3CRT A;  2VLT A;  1VF2 A;  3ZML A;  1F3A A;  1Z7P A;  1YQ1 A;  2YWO A;  1SK1 A;  1E6B A;  1S3D A;  1VGL A;  1ERV A;  4O5U A;  3QR6 A;  4O5Q A;  4I2U A;  4NXI A;  2A2R A;  2EIO A;  1SYX A;  6GSV A;  1T8E B;  3MAK A;  4IKH A;  3MDK A;  5ECH B;  3QMX A;  3DKS A;  3HDC A;  2JZT A;  5ECL B;  3L4N A;  1UA5 A;  5IMA A;  2H1G A;  2PGT A;  1A0F A;  4ML1 A;  2FHE A;  2L4C A;  5JWQ B;  3BBY A;  1YKA A;  4ZBD A;  1DE2 A;  2FA8 A;  5ECO B;  1O73 A;  3HVN A;  4N30 A;  4MJC A;  2F8F A;  4DSQ A;  3HA9 A;  2HFD A;  2L5O A;  3GH6 A;  3O3T A;  5FWG A;  3UL3 A;  3C7M A;  2H01 A;  5BMU A;  2H70 A;  1T1V A;  2O85 A;  3TJB A;  3RPN A;  2DC5 A;  3UOM A;  2YWM A;  1ERT A;  2KUC A;  2QSI A;  1EGO A;  1VF1 A;  3GNJ A;  3RDW A;  4EE0 A;  3FR6 A;  4PXO A;  5J4V A;  4L0W A;  5D73 A;  6GSX A;  1XWB A;  2IIY A;  4KDY A;  1XXU A;  3L9V A;  2O3E A;  1NM3 A;  2HZE A;  4IQ1 A;  1V57 A;  4DEJ A;  2L59 A;  4AF2 A;  1R4W A;  4OO5 A;  4HQZ A;  4MF7 A;  2MMN A;  2KLX A;  2YN1 A;  5C04 A;  3EMP A;  5A34 B;  1DE1 A;  1CQH A;  1B9Y C;  3IBH A;  3BCK A;  3TGZ A;  6GSW A;  1WP0 A;  2H71 A;  2MBT A;  3L78 A;  1T3B A;  3VLN A;  3LSZ A;  1QQ2 A;  3UEM A;  5CAX A;  5ECP B;  3M1G A;  2DIZ A;  2XHF A;  1O7U A;  1PN0 A;  4F82 A;  5LCZ A;  4NV5 A;  1Y25 A;  1SL0 B;  3UIW A;  5D93 A;  3MNG A;  4FYC A;  2OKA A;  1XFL A;  3LQ7 A;  1J9B A;  1H4O A;  3GTU B;  4MK3 A;  4GDF A;  3MYD A;  2BTO T;  4LLR A;  5ELG A;  4MPF A;  4OWY A;  4YKG A;  3LW9 A;  3C1S A;  3HVS A;  1WPI A;  1N25 A;  5ID2 B;  3F63 A;  2H0I A;  1MD4 A;  1TJD A;  3KP9 A;  3ZL5 A;  1TI3 A;  4DSS A;  2WZS A;  1PRX A;  1R5A A;  1WRY A;  3VI5 A;  3BD2 A;  4TN8 A;  1TW9 A;  1GRX A;  2WZ9 A;  3R2Q A;  1K3O A;  1SK2 A;  4EVM A;  3W8S A;  1WMJ A;  2LNT A;  4XS4 B;  1V40 A;  3EC3 A;  2PVQ A;  2LJK A;  5HR3 A;  2IME A;  4HUA A;  3QAG A;  2QA1 A;  4K9Z A;  2MMZ A;  2EFH A;  1FB0 A;  1THX A;  3GN3 A;  3RFR C;  2DKI A;  2GLR A;  2AHE A;  2H76 A;  1WOU A;  8GSS A;  2JAD A;  3UVH A;  4XS6 A;  3DML A;  3FMW A;  1N8J A;  4GSN A;  1MDK A;  1FO5 A;  3UAR A;  1YJ6 A;  2OAD A;  3FZ4 A;  3WYW A;  3M0F A;  3H93 A;  3GX0 A;  5J4U A;  4WXT A;  3LOR A;  2PN8 A;  5L71 A;  2GQL A;  4BVY B;  2BMX A;  4XRA A;  3I43 A;  3ZVJ D;  2YZU A;  4EIQ A;  1YZX A;  1KBN A;  2C3T A;  3VWX A;  3CHX C;  1EP8 A;  1ZL9 A;  2C4J A;  2HSY A;  3MWH A;  4OMV A;  4POK A;  1Z7R A;  4E8E A;  1G7O A;  1YF0 A;  2X99 A;  3C71 A;  2MMA A;  3IRA A;  4K8M A;  3MIX A;  3EIN A;  1USB A;  1GSS A;  2VAF A;  4RI6 A;  2YV9 A;  3KIJ A;  4HEA 2;  1U3I A;  4CW9 A;  2A4H A;  2RM6 A;  1OKT A;  2J9H A;  11GS A;  1MDI A;  3ZRE A;  3GIX A;  1S4B P;  3AY8 A;  2I3Y A;  2DML A;  2XC2 A;  1URM A;  4YQV A;  1GTI A;  1JZR A;  2F3M A;  2KHP A;  1GTU A;  2A2S A;  2FLS A;  2WGR A;  4X43 A;  4HZ4 A;  5GAP D;  1YEW C;  3GUR A;  2FWG A;  1ST9 A;  4AI6 A;  2DBC A;  1CQG A;  2B1L A;  1GSU A;  2QKE A;  1X5E A;  4ULX A;  4GQC A;  4K2X A;  5GZZ B;  2WW0 A;  3BJ5 A;  2HI7 A;  3NZN A;  1RQM A;  4KGI A;  4KX4 A;  4ZIJ A;  4TR1 B;  1T7P B;  1ZMA A;  2LTK A;  5A34 A;  2OBK A;  3D0Z A;  4KF9 A;  4OFM A;  2YOI A;  1R26 A;  3TKP A;  4XS1 A;  2OAC A;  2PPT A;  1TK5 B;  2VCX A;  3EUR A;  3TKS E;  5CP1 A;  2VCT A;  3U6V A;  5IQY A;  2V41 A;  2XBQ A;  3ZZX A;  2GDR A;  4POB A;  1GLP A;  5A4V A;  3WT1 A;  1LU4 A;  3FRC A;  3HVV A;  3G9B A;  2ALB A;  2R6K A;  4EKZ A;  1DSB A;  1M3I A;  1GL8 A;  4KE3 A;  4CY6 A;  5IMV A;  3N9J A;  3E9J B;  2IWT A;  9GSS A;  2DJ2 A;  4HDE A;  4K2D A;  2O5V A;  2B7K A;  2C3N A;  2OE0 A;  1OYJ A;  3GRX A;  3M8N A;  2WVZ A;  2QGV A;  1F2E A;  3F4S A;  2YWI A;  4TXO A;  2IFQ A;  2C1Y A;  2YZH A;  2NBS A;  2HZE B;  3QD9 A;  3KJY A;  5J3R A;  4AJ7 A;  3GKX A;  4PQ1 A;  1K0A A;  1JZW A;  1SEN A;  4EIP A;  4RQR A;  4MF5 A;  1EOG A;  5GAN D;  1JFU A;  2GZP A;  3F4R A;  3R3E A;  2K18 A;  1XWG A;  5ABR A;  3HMJ G;  2I81 A;  3TJG A;  3A5I A;  3F9U A;  2H74 A;  2DIY A;  3C73 A;  3D6I A;  4A5P A;  5E4W A;  1O81 A;  3ED3 A;  1PN9 A;  3IC8 A;  2O8V B;  1OAZ A;  16GS A;  5D96 A;  4IP1 A;  3KXO A;  4ZIL A;  3CYN A;  2GVP A;  2JZS A;  4KUN A;  4J56 E;  1QFN A;  1EGR A;  3APO A;  2FWE A;  2VCQ A;  4L5L A;  2JSY A;  5J4Y A;  5G30 A;  2GSQ A;  3CBU A;  4JBB A;  5A4W A;  4BWQ A;  5IPG A;  2LQQ A;  2P31 A;  3DWV A;  2FWH A;  3HCZ A;  4PTS A;  3EYT A;  4BWS A;  4F9Z A;  1B8X A;  4OD7 A;  3VPQ A;  18GS A;  1A8Y A;  2RUE A;  2UV8 G;  5KN1 A;  5DVB A;  3GV1 A;  2F51 A;  4GTU A;  4IHU A;  3G7Y A;  4K7I A;  3TOT A;  2J23 A;  3ERF A;  2CQ9 A;  1A8L A;  3HJP A;  1XWA A;  5HFG A;  5C00 A;  5B8B A;  1AQX A;  4DSS B;  4MJE A;  2X49 A;  1PSQ A;  5A5K A;  1XW6 A;  3M9J A;  2HRK B;  2L5L A;  1QMV A;  3RGB C;  2K6V A;  2AJQ B;  5B6M A;  1FHE A;  5IOW A;  2V32 A;  4QQ7 A;  5DAL A;  3FZA A;  3WGX A;  3CTG A;  1EP7 A;  1PX6 A;  4BL7 A;  5HR1 A;  3IC4 A;  1VF3 A;  3PPU A;  2CV4 A;  2IMI A;  5ELA A;  6GSU A;  3DYR A;  2VUP A;  3ZFB A;  2ZNM A;  4GLT A;  2H73 A;  3NOF A;  4V1A p;  5IOX A;  4BIK A;  1I1I P;  5JWR B;  3FY7 A;  1TKD B;  1TK8 B;  2EFE A;  1R7H A;  3OR5 A;  2R0G A;  2GQM A;  4WBJ A;  19GS A;  3ZIT A;  2HYX A;  3Q18 A;  3H4K A;  2HQT A;  3P90 A;  2C0G A;  4ECI A;  2K8S A;  2GQK A;  4EUY A;  1QUW A;  3UBK A;  2WFC A;  2PMT A;  4J2F A;  4MJB A;  1TU7 A;  4XCS A;  4WR4 A;  1UC7 A;  4K0N A;  1DBY A;  4TR3 A;  2B5Y A;  2R0C A;  5E59 A;  2HRN A;  5AIX A;  2QC7 A;  2IMD A;  4G10 A;  4TR1 A;  1O8X A;  1VF4 A;  5CRG A;  2PUK C;  3ISO A;  1NSW A;  4MH2 A;  2H1A A;  5B6N A;  5DQS A;  2E7P A;  4E8H A;  4L8E A;  1GSQ A;  3D4T A;  2WW1 A;  1O85 A;  2OJL A;  2G0F A;  4TKY A;  1SVO A;  2FCH A;  2OBI A;  1BAY A;  1NHO A;  3GFK A;  4MNN A;  1JHB A;  3GSS A;  5G31 A;  4ILF A;  3A2W A;  2VL2 A;  5J9C A;  2PBJ A;  3KMO A;  2H6Y A;  1M9B A;  5LNK e;  2HSN A;  1GSF A;  2C3Q A;  3KMN A;  2ZUP A;  2VKZ G;  3J7Y b;  4JED A;  4EL1 A;  1K0N A;  2P5R A;  1I5G A;  1PGT A;  1T4Y A;  2DLX A;  4KSO A;  5ENU A;  1Q4J A;  5DQY A;  2HT9 A;  2NDO A;  3BOA A;  4IQA A;  2LKU A;  3GL5 A;  2CVD A;  3CTF A;  4KAE A;  3CSH A;  2HSH A;  4K5R A;  4TW5 A;  1Y6E A;  4EXJ A;  2BJX A;  1V2A A;  5D9T A;  1TI1 A;  2GST A;  4EO3 A;  1EEM A;  1J0F A;  1XOB A;  3A3T A;  4KA0 A;  4IJ3 A;  1BG5 A;  2VIM A;  4Z2U A;  3P7X A;  4QMK A;  1V98 A;  5H5R A;  3KTB A;  2UZ8 A;  1RK4 A;  1YY7 A;  1MD3 A;  1OC3 A;  3QDN A;  1JZD A;  5KN0 A;  4NPB A;  5A4U A;  2GTU A;  2O7K A;  2LQO A;  1HD2 A;  4L0U A;  5CRE A;  4ID0 A;  4K1F A;  4F0C A;  5DDL A;  5INY A;  2RM5 A;  4IP6 A;  4Q5N A;  1JLW A;  3FZ9 A;  5HFI A;  3Q19 A;  4E68 A;  4TXV A;  3F8U A;  4HJ2 A;  1XVW A;  2RUF A;  5LD0 A;  4X0X A;  4TXO B;  3ERG A;  4Z2R A;  1YKC A;  2IFQ B;  3NIV A;  1O8W A;  1V9W A;  3VK9 A;  3ZMK A;  3ZFL A;  2PWJ A;  2F9S A;  4MDC A;  5HFK A;  2CAQ A;  2C8U A;  4MH3 A;  5F05 A;  3WD6 A;  1O6J A;  3KP8 A;  4V2N A;  1X5C A;  3H8Q A;  5D8I A;  5FHI A;  2ON7 A;  3IR4 A;  3N5O A;  1ERU A;  2YPM A;  3IK7 A;  1G6Y A;  1OC9 A;  4TR0 A;  2HRK A;  2B1K A;  5CYY A;  1HNB A;  1ZOF A;  3CSJ A;  3I69 A;  2G2Q A;  5JWO B;  3EU4 A;  1EOH A;  1AQW A;  4YQM A;  1BQ7 A;  1XWC A;  2HLS A;  3PH9 A;  3F6F A;  1GNW A;  1BED A;  1A2J A;  5IM9 A;  1X9W B;  3QOU A;  5F0G A;  3ZIV A;  1SJI A;  4MCU A;  5ECI B;  1R5P A;  3L0H A;  17GS A;  3RHB A;  1X5D A;  4ZL8 A;  4NMU A;  1F6M C;  1KTE A;  4XIH A;  1M3J A;  3H79 A;  4PGT A;  5IIZ A;  12GS A;  3ZIJ A;  4WF5 A;  3VI7 A;  1SJZ A;  4EF0 A;  4NHW A;  1X9S B;  5J47 A;  3WT2 A;  4ZB6 A;  5IMD A;  4KH7 A;  2AUV A;  1SK0 A;  3IA1 A;  1UN2 A;  3ZVJ A;  3ZYW A;  4IGJ A;  3VWW A;  1K0O A;  3KH9 A;  1B9X C;  4F2I A;  3QAV A;  4KDX A;  4MAB A;  3VWV A;  1TRS A;  1X9M B;  4HQS A;  5DAL B;  4BVX A;  3LYP A;  4BL7 B;  1YDK A;  3G7I A;  4Q5Q A;  1EV4 A;  2R3X A;  2H72 A;  4YAP A;  4I2T A;  3DEX A;  1TTZ A;  3DXB A;  3HHV A;  4O5R A;  2R4V A;  1G6W A;  1WIK A;  1SVL A;  4ACS A;  3VWU A;  4Z2T A;  3LYK A;  2TRC P;  3VPT A;  2P0G A;  3CQF A;  3FW2 A;  5J40 A;  4IBP A;  4G9H A;  4MMM A;  4HOJ A;  1J08 A;  5COH A;  1FOV A;  1K3Y A;  5AIV A;  2WVX A;  3VFI A;  2WCI A;  4HZ2 A;  4HU9 A;  3GA4 A;  4KCE A;  2FUG 2;  2WUL A;  2OE3 A;  3E0U A;  22GS A;  4I97 A;  3A2V A;  5BRT A;  2VCZ A;  3TKR A;  2CZ3 A;  4PQH A;  1XIY A;  2HNL A;  5G1K A;  3TJF A;  1FB6 A;  3KM6 A;  2AV4 A;  2H1B A;  3RAZ A;  3TB2 A;  1OC8 A;  2LUS A;  2V1M A;  3D21 A;  3APS A;  2ES7 A;  2LS5 A;  2RLI A;  2OE1 A;  1KNG A;  2K9F A;  3M9K A;  1PL1 A;  1QGV A;  2FWF A;  2VL9 A;  1TDI A;  1GNE A;  2VM2 A;  4HS1 A;  2CA8 A;  1M0U A;  1TK0 B;  2O89 A;  5JCU A;  1ERW A;  2EFC A;  2M80 A;  3GL3 A;  2PU9 C;  3Q6O A;  2H8L A;  2E2G A;  3FKF A;  2DKH A;  2VL3 A;  1XBS A;  3EWL A;  5ECQ B;  3UVT A;  3TJK A;  4ZXG A;  1RW1 A;  2L57 A;  3E3E A;  2HSN B;  4D73 A;  1ILO A;  1S3A A;  5EPF A;  4L5O A;  1X0R A;  2H0G A;  7GSS A;  4G0L A;  3D4M A;  4XHM A;  2YAN A;  3D5J A;  2OT3 A;  4ZB7 A;  2IN3 A;  4YAV A;  3DD3 A;  3GKM A;  3HYP A;  1SYR A;  1WJK A;  4V2L A;  2DMM A;  4CDO A;  1A2L A;  5KN3 A;  1A24 A;  1GSE A;  1EZK A;  3HJM A;  4HU7 A;  2XPD A;  2CVK A;  4GF0 A;  4MZB A;  3KH7 A;  1BF5 A;  4NHZ A;  2B5E A;  5F8B A;  3HD5 A;  3EPT A;  1N2A A;  4HI7 A;  5AN1 A;  1XG8 A;  4YKF A;  5J9B A;  5D9X A;  1MEK A;  5G5E A;  5CRW A;  2YWN A;  4GWR A;  3GKK A;  2R0P A;  3LWA A;  2NPB A;  4LL1 B;  4JRR A;  4KB3 A;  3ZTL A;  1SVM A;  4PQI A;  4AKI A;  4TR4 A;  2LJR A;  3LGC A;  3TDG A;  1PMT A;  1PKW A;  5KEJ A;  4K7N A;  2LST A;  4ZBB A;  1Y1U A;  4RUV A;  3HZ4 A;  4LA1 A;  4GQF A;  1FOH A;  5B8A A;  3IDV A;  2YCD A;  3LXT A;  2V2G A;  20GS A;  3TCO A;  1GSD A;  2B5X A;  1Z3E A;  1M9A A;  2IMK A;  1HQO A;  3GX8 A;  4G2E A;  5D9W A;  2N5A A;  1HYU A;  1GUL A;  1FAA A;  1UVZ A;  1ON4 A;  4ZL9 A;  1M2A A;  4AJ8 A;  3C8E A;  3KTL A;  1OC9 B;  4PI0 C;  1TOF A;  2ON5 A;  3HZ8 A;  4ZL7 A;  1ML6 A;  3IPZ A;  4TRX A;  2IJY A;  1NW2 A;  3C1R A;  1PX7 A;  4I6X A;  4Q5R A;  2JAC A;  1GUM A;  3ME8 A;  4PNF A;  4OCE A;  1GP1 A;  1G7E A;  3U5R E;  3W8J A;  4RI7 A;  3DVW A;  3KD0 A;  2A4V A;  4EC0 A;  4AGS A;  1EEJ A;  2R37 A;  3QAW A;  4KW6 A;  1S3R A;  2QA2 A;  2E2M A;  4P3Y B;  4TVE A;  3A2X A;  1BJX A;  6GSY A;  2H19 A;  2B3S A;  2N5B A;  1AW9 A;  4MF6 A;  2VD0 A;  1H75 A;  4OO4 A;  4Z7X A;  3KEB A;  2KOK A;  1NHY A;  2IMF A;  1FVJ A;  4PUA A;  3O76 A;  4QL9 A;  1Z9H A;  1U3A A;  5G1L A;  5EVO A;  4K6X A;  3L9U A;  2H30 A;  2XPE A;  5IMC A;  3ME7 A;  3IK9 A;  1MTC A;  3UAP A;  2LEG A;  1THO A;  4ECC A;  3LFL A;  5A5H A;  1SJ6 A;  3TKS A;  4BVX B;  3TRX A;  2LNS A;  2YV7 A;  2B7J A;  4IVF A;  3EMX A;  4MP4 A;  1DUG A;  1K0C A;  1F9M A;  2OA7 A;  4WEY A;  3IHG A;  4ISD A;  2LRT A;  2FY6 A;  5HR0 A;  3EE2 A;  5H5S A;  2V6K A;  3O6T A;  1BG1 A;  1M99 A;  4WET A;  4CY8 A;  1XW5 A;  2ZCT A;  2DJ1 A;  1ZYP A;  5G5F A;  1PD2 1;  3GH9 A;  1PKZ A;  5AGY A;  1WE0 A;  1LBK A;  1K3L A;  5G2Z A;  1F37 A;  2WVX B;  2CT6 A;  1SKW B;  5DJL A;  1AIU A;  1PA3 A;  2REM A;  3QPM A;  1ZYN A;  2MBS A;  3FYG A;  2C0F A;  2NVL A;  3HKR A;  2YJ7 A;  4V2M A;  4FYB A;  5IO0 A;  1ZZY A;  4KDU A;  1A0R P;  2I4A A;  5DAK A;  2DSA A;  4GSS A;  4ECB A;  3APQ A;  1OVN A;  1XVQ A;  4JR6 A;  4X4J A;  3FHK A;  5DJM A;  5KN2 A;  3CSI A;  4FIW A;  1FG4 A;  2R2J A;  4EDZ A;  2CZ2 A;  1ABA A;  2KP2 A;  4WF4 A;  2VO4 A;  2WJU A;  10GS A;  4TOP A;  4XTS A;  2H66 A;  4OCF A;  3WGD A;  4G19 A;  2K8V A;  4G0I A;  3KGK A;  2JSZ A;  2JU5 A;  4FXY P;  5ECR B;  1XWK A;  2HRA A;  4OFN A;  3IAS 2;  1TP9 A;  2WW2 A;  4H86 A;  4YH2 A;  5ECK B;  4PI2 C;  4KSM A;  4N0Z A;  2DJ3 A;  1QK8 A;  4J57 E;  4D73 B;  2EIQ A;  1E2Y A;  3F6D A;  3RHC A;  2C0D A;  3GHA A;  5KOX A;  5A1N A;  5JCW A;  5ECM B;  2GSS A;  1BX9 A;  1Z6N A;  3EU3 A;  1K0M A;  4GXZ A;  4FQU A;  3DRN A;  3HXS A;  1PQN A;  4IEL A;  4LL4 B;  2B6M A;  2HSM A;  5D9V A;  2YNX A;  2EC4 A;  4AKH A;  5IO2 A;  3DIE A;  2FD3 A;  2L6D A;  1SD9 A;  4X1U A;  2GT5 A;  4PNG A;  5CRD A;  2AB6 A;  1YVL A;  4AKG A;  4HJM A;  3G7J A;  1TU8 A;  3QFA C;  2YJH A;  5CO3 A;  3ERW A;  3S9F A;  2RII A;  4O32 A;  2R5G A;  1ZGN A;  4PUR A;  1MDJ A;  3I6A A;  2WVY A;  1B4P A;  5IPH A;  2LV3 A;  2YP6 A;  4PX1 A;  2H75 A;  2NTO A;  4LMV A;  1JLV A;  1SL2 B;  3RPP A;  3PGT A;  2HXK A;  3J7Y k;  5GSS A;  3GST A;  3JCM L;  5IMF A;  1Q98 A;  4N3Z A;  3SWL A;  2DJ0 A;  2JL4 A;  1PL2 A;  4MZC A;  2IPA A;  4MZW A;  1OE8 A;  1Z6M A;  6GST A;  1SD8 A;  3FK8 A;  2VCW A;  2VLU A;  4FYU A;  4JZQ A;  4N0V A;  2H1L A;  5HR2 A;  3CXG A;  1QXH A;  1C72 A;  5EL8 A;  2H1D A;  3F3R A;  4PHZ C;  2TIR A;  1VRS D;  2GZZ A;  4N10 A;  5J41 A;  3FR9 A;  2H0H A;  4N11 A;  3EVI A;  3TKQ A;  2E0Q A;  2HE3 A;  3PR8 A;  1M2B A;  3GYK A;  1TXU A;  3TKS C;  5HQP A;  2GZY A;  1XW9 A;  1GLQ A;  2A2P A;  1GUK A;  4NWY A;  1HNC A;  1AXD A;  3TJJ A;  4W66 A;  1YEX A;  1GTB A;  2JZR A;  1Z5Y E;  5DCH A;  3MSZ A;  2VL2 C;  5ECS A;  1HNA A;  4JU5 A;  4F03 A;  3BCI A;  2CX4 A;  1AQV A;  4IJI A;  2FNO A;  3IV4 A;  1YF1 A;  1B48 A;  3DGQ A;  2XBI A;  2FGX A;  4DSR A;  4LMW A;  2CX3 A;  5CNW A;  2M46 A;  4O7H A;  2GT6 A;  4MJA A;  1I9D A;  1XZO A;  1TRW A;  1OE7 A;  4PUF C;  1T4Z A;  2C0E A;  1YEP A;  1FVK A;  4K7O A;  3TRQ A;  4Q5F A;  5H5Q A;  4F0B A;  1K0B A;  1M2D A;  4MLY A;  2C80 A;  2GSR A;  1XCC A;  4MPG A;  5A5H B;  4FO5 A;  1XOA A;  3F3Q A;  2IL3 A;  2EFD A;  2O87 A;  3IHQ A;  3QFB C;  3M3M A;  1V58 A;  13GS A;  3WGE A;  1XPV A;  5F07 A;  4OFT A;  4ECJ A;  2DJK A;  2MZC A;  1W4V A;  4V1A g;  4RQX A;  1TRV A;  1K0D A;  1WWJ A;  3HVX A;  4ZB8 A;  3GUS A;  3D22 A;  3FEU A;  1KEB A;  2DJJ A;  1T00 A;  2FA4 A;  1GWC A;  1TRU A;  2WRT A;  1W89 A;  1G0T A;  3A5W A;  4KCA A;  4JR4 A;  4AJ6 A;  3TU3 B;  3KCM A;  4NV2 A;  5CRH A;  3K8N A;  2VCV A;  1M7T A;  2X8H A;  3UBL A;  3HY2 A;  5GST A;  1EV9 A;  3W6G A;  1SU9 A;  4YQU A;  1ZYE A;  4IN0 A;  5BMU B;  1IYH A;  1GSY A;  2TRX A;  2P5Q A;  2O36 A;  3IAM 2;  2MYG A;  4K0G A;  3FR3 A;  4GRF A;  5ECN B;  3LJR A;  2AYT A;  3US3 A;  3TUE A;  2H6Z A;  2V6O A;  3IE3 A;  4WR5 A;  5AIS A;  3TOU A;  2Z9S A;  3Q74 A;  3LXZ A;  3GTU A;  5DAK B;  5FT3 A;  2LRN A;  1SKR B;  3FZ5 A;  1S3C A;  3H1N A;  2VOC A;  2WW3 A;  5ID2 A;  4ML6 A;  2L4Q A;  3SBC A;  1U87 A;  4USS A;  4HSC X;  2LRC A;  2N5F A;  6GSS A;  1JZO A;  4AKX B;  2GS3 A;  2WDU A;  4DVC A;  1IYI A;  3HJO A;  2F8A A;  14GS A;  4ZB9 A;  1GH2 A;  1ZCP A;  4KND A;  4XS4 A;  3KZQ A; 
#chains in the Genus database with same CATH homology
 5JCG A;  3CMI A;  2VLV A;  4WBR D;  3PIN A;  1GTA A;  2D2Z A;  4EDY A;  1A23 A;  4JE1 A;  5A1N B;  3CRU A;  1GUH A;  1SL1 B;  4G0K A;  3QCP A;  2WS2 A;  3P8W A;  4POM A;  2X8G A;  2AAW A;  4MA9 A;  3V1W A;  2I9H A;  5DCG A;  2M72 A;  1OKD A;  2HSM B;  3ZLP A;  1AAZ A;  2PER A;  1F3B A;  4IW9 A;  1U88 A;  1LJR A;  1ZYQ B;  3RBT A;  4ICY A;  2X8C A;  3TRP A;  4BA7 A;  5F06 A;  4BVY A;  3IOS A;  1TXX A;  1AC1 A;  3DVX A;  3UMA A;  2KP1 A;  5EY6 A;  2CAI A;  3UJ1 A;  1FW1 A;  2PVO C;  3GMF A;  2WB9 A;  3F0I A;  2HZF A;  3P2A A;  1A2M A;  1BYE A;  4IS0 A;  5DBQ A;  4QL7 A;  1U6T A;  2MMO A;  3F4T A;  1EWX A;  2EIR A;  5B7C A;  3VUR A;  2LJA A;  5KOW A;  4WKW A;  4O92 A;  2CVB A;  4POL A;  3GKN A;  5J5N A;  2VD1 A;  4XRD A;  3ZRD A;  4GST A;  4BPY A;  3CWG A;  4GCI A;  4I8B A;  2X4A A;  4ZBA A;  3I9V 2;  1AUC A;  1ACV A;  4FH8 A;  2GGT A;  4NAX A;  2X64 A;  4CHS A;  2VM1 A;  1SKS B;  2I1U A;  5IMZ A;  1B4Q A;  4G01 A;  3LG6 A;  4I5Q A;  2H6X A;  3LEF A;  3IXR A;  2HRF A;  4K5S A;  2L6C A;  3L9S A;  3CRT A;  2VLT A;  1VF2 A;  3ZML A;  1F3A A;  1Z7P A;  1YQ1 A;  2YWO A;  1SK1 A;  1E6B A;  1S3D A;  1VGL A;  1ERV A;  4O5U A;  3QR6 A;  4O5Q A;  4I2U A;  4NXI A;  2A2R A;  2EIO A;  1SYX A;  6GSV A;  1T8E B;  3MAK A;  4IKH A;  3MDK A;  5ECH B;  3QMX A;  3DKS A;  3HDC A;  2JZT A;  5ECL B;  3L4N A;  1UA5 A;  5IMA A;  2H1G A;  2PGT A;  1A0F A;  4ML1 A;  2FHE A;  2L4C A;  5JWQ B;  3BBY A;  1YKA A;  4ZBD A;  1DE2 A;  2FA8 A;  5ECO B;  1O73 A;  4N30 A;  4MJC A;  2F8F A;  4DSQ A;  3HA9 A;  2HFD A;  2L5O A;  3GH6 A;  3O3T A;  5FWG A;  3UL3 A;  3C7M A;  2H01 A;  5BMU A;  2H70 A;  1T1V A;  2O85 A;  3TJB A;  3RPN A;  2DC5 A;  3UOM A;  2YWM A;  1ERT A;  2KUC A;  2QSI A;  1EGO A;  1VF1 A;  3GNJ A;  3RDW A;  4EE0 A;  3FR6 A;  4PXO A;  5J4V A;  4L0W A;  5D73 A;  6GSX A;  1XWB A;  2IIY A;  4KDY A;  1XXU A;  3L9V A;  1NM3 A;  2HZE A;  4IQ1 A;  1V57 A;  4DEJ A;  2L59 A;  4AF2 A;  1R4W A;  4OO5 A;  4HQZ A;  4MF7 A;  2MMN A;  2KLX A;  2YN1 A;  5C04 A;  3EMP A;  5A34 B;  1DE1 A;  1CQH A;  1B9Y C;  3IBH A;  3BCK A;  3TGZ A;  6GSW A;  1WP0 A;  2H71 A;  2MBT A;  3L78 A;  1T3B A;  3VLN A;  3LSZ A;  1QQ2 A;  3UEM A;  5CAX A;  5ECP B;  3M1G A;  2DIZ A;  2XHF A;  1O7U A;  1PN0 A;  4F82 A;  5LCZ A;  4NV5 A;  1Y25 A;  1SL0 B;  3UIW A;  5D93 A;  3MNG A;  4FYC A;  2OKA A;  1XFL A;  3LQ7 A;  1J9B A;  1H4O A;  3GTU B;  4MK3 A;  4GDF A;  3MYD A;  2BTO T;  4LLR A;  5ELG A;  4MPF A;  4OWY A;  4YKG A;  3LW9 A;  3C1S A;  3HVS A;  1WPI A;  1N25 A;  5ID2 B;  3F63 A;  2H0I A;  1MD4 A;  1TJD A;  3KP9 A;  3ZL5 A;  1TI3 A;  4DSS A;  1PRX A;  1R5A A;  1WRY A;  3VI5 A;  3BD2 A;  4TN8 A;  1TW9 A;  1GRX A;  2WZ9 A;  3R2Q A;  1K3O A;  1SK2 A;  4EVM A;  3W8S A;  1WMJ A;  2LNT A;  4XS4 B;  1V40 A;  3EC3 A;  2PVQ A;  2LJK A;  5HR3 A;  2IME A;  4HUA A;  3QAG A;  2QA1 A;  4K9Z A;  2MMZ A;  2EFH A;  1FB0 A;  1THX A;  3GN3 A;  2DKI A;  2GLR A;  2AHE A;  2H76 A;  1WOU A;  8GSS A;  2JAD A;  3UVH A;  4XS6 A;  3DML A;  3FMW A;  1N8J A;  4GSN A;  1MDK A;  1FO5 A;  3UAR A;  1YJ6 A;  2OAD A;  3FZ4 A;  3WYW A;  3M0F A;  3H93 A;  3GX0 A;  5J4U A;  4WXT A;  3LOR A;  2PN8 A;  5L71 A;  2GQL A;  4BVY B;  2BMX A;  4XRA A;  3I43 A;  3ZVJ D;  2YZU A;  4EIQ A;  1YZX A;  1KBN A;  2C3T A;  3VWX A;  1EP8 A;  1ZL9 A;  2C4J A;  2HSY A;  3MWH A;  4OMV A;  4POK A;  1Z7R A;  4E8E A;  1G7O A;  1YF0 A;  2X99 A;  3C71 A;  2MMA A;  3IRA A;  4K8M A;  3MIX A;  3EIN A;  1USB A;  1GSS A;  2VAF A;  4RI6 A;  2YV9 A;  3KIJ A;  4HEA 2;  1U3I A;  4CW9 A;  2A4H A;  2RM6 A;  1OKT A;  2J9H A;  11GS A;  1MDI A;  3ZRE A;  3GIX A;  3AY8 A;  2DML A;  2I3Y A;  2XC2 A;  1URM A;  4YQV A;  1GTI A;  1JZR A;  2F3M A;  2KHP A;  1GTU A;  2A2S A;  2FLS A;  2WGR A;  4X43 A;  4HZ4 A;  5GAP D;  3GUR A;  2FWG A;  1ST9 A;  4AI6 A;  2DBC A;  1CQG A;  2B1L A;  1GSU A;  2QKE A;  1X5E A;  4ULX A;  4GQC A;  4K2X A;  5GZZ B;  3BJ5 A;  2HI7 A;  3NZN A;  1RQM A;  4KGI A;  4KX4 A;  4ZIJ A;  4TR1 B;  1T7P B;  1ZMA A;  2LTK A;  5A34 A;  2OBK A;  3D0Z A;  4KF9 A;  4OFM A;  2YOI A;  1R26 A;  3TKP A;  4XS1 A;  2OAC A;  2PPT A;  1TK5 B;  2VCX A;  3EUR A;  3TKS E;  5CP1 A;  2VCT A;  3U6V A;  5IQY A;  2V41 A;  2XBQ A;  3ZZX A;  2GDR A;  4POB A;  1GLP A;  5A4V A;  3WT1 A;  1LU4 A;  3FRC A;  3HVV A;  3G9B A;  2ALB A;  2R6K A;  4EKZ A;  1DSB A;  1GL8 A;  4KE3 A;  4CY6 A;  5IMV A;  3N9J A;  3E9J B;  2IWT A;  9GSS A;  2DJ2 A;  4HDE A;  4K2D A;  2O5V A;  2B7K A;  2C3N A;  2OE0 A;  1OYJ A;  3GRX A;  3M8N A;  2QGV A;  1F2E A;  3F4S A;  2YWI A;  4TXO A;  2IFQ A;  2C1Y A;  2YZH A;  2NBS A;  2HZE B;  3QD9 A;  3KJY A;  5J3R A;  4AJ7 A;  3GKX A;  4PQ1 A;  1K0A A;  1JZW A;  1SEN A;  4EIP A;  4RQR A;  4MF5 A;  1EOG A;  5GAN D;  1JFU A;  2GZP A;  3F4R A;  3R3E A;  2K18 A;  1XWG A;  5ABR A;  3HMJ G;  2I81 A;  3TJG A;  3A5I A;  3F9U A;  2H74 A;  2DIY A;  3C73 A;  3D6I A;  4A5P A;  5E4W A;  1O81 A;  3ED3 A;  1PN9 A;  3IC8 A;  2O8V B;  1OAZ A;  16GS A;  5D96 A;  4IP1 A;  3KXO A;  4ZIL A;  3CYN A;  2GVP A;  2JZS A;  4KUN A;  4J56 E;  1QFN A;  1EGR A;  3APO A;  2FWE A;  2VCQ A;  4L5L A;  2JSY A;  5J4Y A;  5G30 A;  2GSQ A;  3CBU A;  4JBB A;  5A4W A;  4BWQ A;  5IPG A;  2LQQ A;  2P31 A;  3DWV A;  2FWH A;  3HCZ A;  4PTS A;  3EYT A;  4BWS A;  4F9Z A;  1B8X A;  4OD7 A;  3VPQ A;  18GS A;  1A8Y A;  2RUE A;  2UV8 G;  5KN1 A;  5DVB A;  3GV1 A;  2F51 A;  4GTU A;  4IHU A;  3G7Y A;  4K7I A;  3TOT A;  2J23 A;  3ERF A;  2CQ9 A;  1A8L A;  3HJP A;  1XWA A;  5HFG A;  5C00 A;  5B8B A;  1AQX A;  4DSS B;  4MJE A;  2X49 A;  1PSQ A;  5A5K A;  1XW6 A;  3M9J A;  2HRK B;  2L5L A;  1QMV A;  2K6V A;  2AJQ B;  5B6M A;  1FHE A;  5IOW A;  2V32 A;  4QQ7 A;  5DAL A;  3FZA A;  3WGX A;  3CTG A;  1EP7 A;  1PX6 A;  4BL7 A;  5HR1 A;  3IC4 A;  1VF3 A;  3PPU A;  2CV4 A;  2IMI A;  5ELA A;  6GSU A;  3DYR A;  2VUP A;  3ZFB A;  2ZNM A;  4GLT A;  2H73 A;  3NOF A;  4V1A p;  5IOX A;  5JWR B;  3FY7 A;  1TKD B;  1TK8 B;  2EFE A;  1R7H A;  3OR5 A;  2R0G A;  2GQM A;  4WBJ A;  19GS A;  3ZIT A;  2HYX A;  3Q18 A;  3H4K A;  2HQT A;  3P90 A;  2C0G A;  4ECI A;  2K8S A;  2GQK A;  4EUY A;  1QUW A;  3UBK A;  2WFC A;  2PMT A;  4J2F A;  4MJB A;  1TU7 A;  4XCS A;  4WR4 A;  1UC7 A;  4K0N A;  1DBY A;  4TR3 A;  2B5Y A;  2R0C A;  5E59 A;  2HRN A;  5AIX A;  2QC7 A;  2IMD A;  4G10 A;  4TR1 A;  1O8X A;  1VF4 A;  5CRG A;  2PUK C;  3ISO A;  1NSW A;  4MH2 A;  2H1A A;  5B6N A;  5DQS A;  2E7P A;  4E8H A;  4L8E A;  1GSQ A;  3D4T A;  1O85 A;  2OJL A;  2G0F A;  4TKY A;  1SVO A;  2FCH A;  2OBI A;  1BAY A;  1NHO A;  3GFK A;  4MNN A;  1JHB A;  3GSS A;  5G31 A;  4ILF A;  3A2W A;  2VL2 A;  5J9C A;  2PBJ A;  3KMO A;  2H6Y A;  1M9B A;  5LNK e;  2HSN A;  1GSF A;  2C3Q A;  3KMN A;  2ZUP A;  2VKZ G;  3J7Y b;  4JED A;  4EL1 A;  1K0N A;  2P5R A;  1I5G A;  1PGT A;  1T4Y A;  2DLX A;  4KSO A;  5ENU A;  1Q4J A;  5DQY A;  2HT9 A;  2NDO A;  3BOA A;  4IQA A;  2LKU A;  3GL5 A;  2CVD A;  3CTF A;  4KAE A;  3CSH A;  2HSH A;  4K5R A;  4TW5 A;  1Y6E A;  4EXJ A;  2BJX A;  1V2A A;  5D9T A;  1TI1 A;  2GST A;  4EO3 A;  1EEM A;  1J0F A;  1XOB A;  3A3T A;  4KA0 A;  4IJ3 A;  1BG5 A;  2VIM A;  4Z2U A;  3P7X A;  4QMK A;  1V98 A;  5H5R A;  3KTB A;  2UZ8 A;  1RK4 A;  1YY7 A;  1MD3 A;  1OC3 A;  3QDN A;  1JZD A;  5KN0 A;  4NPB A;  5A4U A;  2GTU A;  2O7K A;  2LQO A;  1HD2 A;  4L0U A;  5CRE A;  4ID0 A;  4K1F A;  4F0C A;  5DDL A;  5INY A;  2RM5 A;  4IP6 A;  4Q5N A;  1JLW A;  3FZ9 A;  5HFI A;  3Q19 A;  4E68 A;  4TXV A;  3F8U A;  4HJ2 A;  1XVW A;  2RUF A;  5LD0 A;  4X0X A;  4TXO B;  3ERG A;  4Z2R A;  1YKC A;  2IFQ B;  3NIV A;  1O8W A;  1V9W A;  3VK9 A;  3ZMK A;  3ZFL A;  2PWJ A;  2F9S A;  4MDC A;  5HFK A;  2CAQ A;  2C8U A;  4MH3 A;  5F05 A;  3WD6 A;  1O6J A;  3KP8 A;  4V2N A;  1X5C A;  3H8Q A;  5D8I A;  5FHI A;  2ON7 A;  3IR4 A;  3N5O A;  1ERU A;  2YPM A;  3IK7 A;  1G6Y A;  1OC9 A;  4TR0 A;  2HRK A;  2B1K A;  5CYY A;  1HNB A;  1ZOF A;  3CSJ A;  3I69 A;  2G2Q A;  5JWO B;  3EU4 A;  1EOH A;  1AQW A;  4YQM A;  1BQ7 A;  1XWC A;  2HLS A;  3PH9 A;  3F6F A;  1GNW A;  1BED A;  1A2J A;  5IM9 A;  1X9W B;  3QOU A;  5F0G A;  3ZIV A;  1SJI A;  4MCU A;  5ECI B;  1R5P A;  3L0H A;  17GS A;  3RHB A;  1X5D A;  4ZL8 A;  4NMU A;  1F6M C;  1KTE A;  4XIH A;  3H79 A;  4PGT A;  5IIZ A;  12GS A;  3ZIJ A;  4WF5 A;  3VI7 A;  1SJZ A;  4EF0 A;  4NHW A;  1X9S B;  5J47 A;  3WT2 A;  4ZB6 A;  5IMD A;  4KH7 A;  2AUV A;  1SK0 A;  3IA1 A;  1UN2 A;  3ZVJ A;  3ZYW A;  4IGJ A;  3VWW A;  1K0O A;  3KH9 A;  1B9X C;  4F2I A;  3QAV A;  4KDX A;  4MAB A;  3VWV A;  1TRS A;  1X9M B;  4HQS A;  5DAL B;  4BVX A;  3LYP A;  4BL7 B;  1YDK A;  3G7I A;  4Q5Q A;  1EV4 A;  2R3X A;  2H72 A;  4YAP A;  4I2T A;  3DEX A;  1TTZ A;  3DXB A;  3HHV A;  4O5R A;  2R4V A;  1G6W A;  1WIK A;  1SVL A;  4ACS A;  3VWU A;  4Z2T A;  3LYK A;  2TRC P;  3VPT A;  2P0G A;  3FW2 A;  5J40 A;  4IBP A;  4G9H A;  4MMM A;  4HOJ A;  1J08 A;  5COH A;  1FOV A;  1K3Y A;  5AIV A;  3VFI A;  2WCI A;  4HZ2 A;  4HU9 A;  3GA4 A;  4KCE A;  2FUG 2;  2WUL A;  2OE3 A;  3E0U A;  22GS A;  4I97 A;  3A2V A;  5BRT A;  2VCZ A;  3TKR A;  2CZ3 A;  4PQH A;  1XIY A;  2HNL A;  5G1K A;  3TJF A;  1FB6 A;  3KM6 A;  2AV4 A;  2H1B A;  3RAZ A;  3TB2 A;  1OC8 A;  2LUS A;  2V1M A;  3D21 A;  3APS A;  2ES7 A;  2LS5 A;  2RLI A;  2OE1 A;  1KNG A;  2K9F A;  3M9K A;  1PL1 A;  1QGV A;  2FWF A;  2VL9 A;  1TDI A;  1GNE A;  2VM2 A;  4HS1 A;  2CA8 A;  1M0U A;  1TK0 B;  2O89 A;  5JCU A;  1ERW A;  2EFC A;  2M80 A;  3GL3 A;  2PU9 C;  3Q6O A;  2H8L A;  2E2G A;  3FKF A;  2DKH A;  2VL3 A;  1XBS A;  3EWL A;  5ECQ B;  3UVT A;  3TJK A;  4ZXG A;  1RW1 A;  2L57 A;  3E3E A;  2HSN B;  4D73 A;  1ILO A;  1S3A A;  5EPF A;  4L5O A;  1X0R A;  2H0G A;  7GSS A;  4G0L A;  3D4M A;  4XHM A;  2YAN A;  3D5J A;  2OT3 A;  4ZB7 A;  2IN3 A;  4YAV A;  3DD3 A;  3GKM A;  3HYP A;  1SYR A;  1WJK A;  4V2L A;  2DMM A;  4CDO A;  1A2L A;  5KN3 A;  1A24 A;  1GSE A;  1EZK A;  3HJM A;  4HU7 A;  2XPD A;  2CVK A;  4GF0 A;  4MZB A;  3KH7 A;  1BF5 A;  4NHZ A;  2B5E A;  5F8B A;  3HD5 A;  3EPT A;  1N2A A;  4HI7 A;  5AN1 A;  4YKF A;  5J9B A;  5D9X A;  1MEK A;  5G5E A;  5CRW A;  2YWN A;  4GWR A;  3GKK A;  2R0P A;  3LWA A;  2NPB A;  4LL1 B;  4JRR A;  4KB3 A;  3ZTL A;  1SVM A;  4PQI A;  4AKI A;  4TR4 A;  2LJR A;  3LGC A;  3TDG A;  1PMT A;  1PKW A;  5KEJ A;  4K7N A;  2LST A;  4ZBB A;  1Y1U A;  4RUV A;  3HZ4 A;  4LA1 A;  4GQF A;  1FOH A;  5B8A A;  3IDV A;  2YCD A;  3LXT A;  2V2G A;  20GS A;  3TCO A;  1GSD A;  2B5X A;  1Z3E A;  1M9A A;  2IMK A;  1HQO A;  3GX8 A;  4G2E A;  5D9W A;  2N5A A;  1HYU A;  1GUL A;  1FAA A;  1UVZ A;  1ON4 A;  4ZL9 A;  1M2A A;  4AJ8 A;  3C8E A;  3KTL A;  1OC9 B;  1TOF A;  3HZ8 A;  2ON5 A;  4ZL7 A;  1ML6 A;  3IPZ A;  4TRX A;  2IJY A;  1NW2 A;  3C1R A;  1PX7 A;  4I6X A;  4Q5R A;  2JAC A;  1GUM A;  3ME8 A;  4PNF A;  4OCE A;  1GP1 A;  1G7E A;  3U5R E;  3W8J A;  4RI7 A;  3DVW A;  2A4V A;  3KD0 A;  4EC0 A;  4AGS A;  1EEJ A;  2R37 A;  3QAW A;  4KW6 A;  2QA2 A;  2E2M A;  4P3Y B;  4TVE A;  3A2X A;  1BJX A;  6GSY A;  2H19 A;  2B3S A;  2N5B A;  1AW9 A;  4MF6 A;  2VD0 A;  1H75 A;  4OO4 A;  4Z7X A;  3KEB A;  2KOK A;  1NHY A;  2IMF A;  1FVJ A;  4PUA A;  3O76 A;  4QL9 A;  1Z9H A;  1U3A A;  5G1L A;  5EVO A;  4K6X A;  3L9U A;  2H30 A;  2XPE A;  5IMC A;  3ME7 A;  3IK9 A;  1MTC A;  3UAP A;  2LEG A;  1THO A;  4ECC A;  3LFL A;  5A5H A;  1SJ6 A;  3TKS A;  4BVX B;  3TRX A;  2LNS A;  2YV7 A;  2B7J A;  4IVF A;  3EMX A;  4MP4 A;  1DUG A;  1K0C A;  1F9M A;  2OA7 A;  4WEY A;  3IHG A;  4ISD A;  2LRT A;  2FY6 A;  5HR0 A;  3EE2 A;  5H5S A;  2V6K A;  3O6T A;  1BG1 A;  1M99 A;  4WET A;  4CY8 A;  1XW5 A;  2ZCT A;  2DJ1 A;  1ZYP A;  5G5F A;  1PD2 1;  3GH9 A;  1PKZ A;  5AGY A;  1WE0 A;  1LBK A;  1K3L A;  5G2Z A;  1F37 A;  2CT6 A;  1SKW B;  5DJL A;  1AIU A;  1PA3 A;  2REM A;  3QPM A;  1ZYN A;  2MBS A;  3FYG A;  2C0F A;  2NVL A;  3HKR A;  2YJ7 A;  4V2M A;  4FYB A;  5IO0 A;  1ZZY A;  4KDU A;  1A0R P;  2I4A A;  5DAK A;  2DSA A;  4GSS A;  4ECB A;  3APQ A;  1OVN A;  1XVQ A;  4JR6 A;  4X4J A;  3FHK A;  5DJM A;  5KN2 A;  3CSI A;  4FIW A;  1FG4 A;  2R2J A;  4EDZ A;  2CZ2 A;  1ABA A;  2KP2 A;  4WF4 A;  2VO4 A;  2WJU A;  10GS A;  4TOP A;  4XTS A;  2H66 A;  4OCF A;  3WGD A;  4G19 A;  2K8V A;  4G0I A;  3KGK A;  2JSZ A;  2JU5 A;  5ECR B;  1XWK A;  2HRA A;  4OFN A;  3IAS 2;  1TP9 A;  4H86 A;  4YH2 A;  5ECK B;  4KSM A;  4N0Z A;  2DJ3 A;  1QK8 A;  4J57 E;  4D73 B;  2EIQ A;  1E2Y A;  3F6D A;  3RHC A;  2C0D A;  3GHA A;  5KOX A;  5A1N A;  5JCW A;  5ECM B;  2GSS A;  1BX9 A;  1Z6N A;  3EU3 A;  1K0M A;  4GXZ A;  4FQU A;  3DRN A;  3HXS A;  1PQN A;  4IEL A;  4LL4 B;  2B6M A;  2HSM A;  5D9V A;  2YNX A;  2EC4 A;  4AKH A;  5IO2 A;  3DIE A;  2FD3 A;  2L6D A;  1SD9 A;  4X1U A;  2GT5 A;  4PNG A;  5CRD A;  2AB6 A;  1YVL A;  4AKG A;  4HJM A;  3G7J A;  1TU8 A;  3QFA C;  2YJH A;  5CO3 A;  3ERW A;  3S9F A;  2RII A;  4O32 A;  2R5G A;  1ZGN A;  4PUR A;  1MDJ A;  3I6A A;  1B4P A;  5IPH A;  2LV3 A;  2YP6 A;  4PX1 A;  2H75 A;  2NTO A;  4LMV A;  1JLV A;  1SL2 B;  3RPP A;  3PGT A;  2HXK A;  3J7Y k;  5GSS A;  3GST A;  3JCM L;  5IMF A;  1Q98 A;  4N3Z A;  3SWL A;  2DJ0 A;  2JL4 A;  1PL2 A;  4MZC A;  2IPA A;  4MZW A;  1OE8 A;  1Z6M A;  6GST A;  1SD8 A;  3FK8 A;  2VCW A;  2VLU A;  4FYU A;  4JZQ A;  4N0V A;  2H1L A;  5HR2 A;  3CXG A;  1QXH A;  1C72 A;  5EL8 A;  2H1D A;  3F3R A;  2TIR A;  1VRS D;  2GZZ A;  4N10 A;  5J41 A;  3FR9 A;  2H0H A;  4N11 A;  3EVI A;  3TKQ A;  2E0Q A;  2HE3 A;  3PR8 A;  1M2B A;  3GYK A;  1TXU A;  3TKS C;  5HQP A;  2GZY A;  1XW9 A;  1GLQ A;  2A2P A;  1GUK A;  4NWY A;  1HNC A;  1AXD A;  3TJJ A;  4W66 A;  1YEX A;  1GTB A;  2JZR A;  1Z5Y E;  5DCH A;  3MSZ A;  2VL2 C;  5ECS A;  1HNA A;  4JU5 A;  4F03 A;  3BCI A;  2CX4 A;  1AQV A;  4IJI A;  2FNO A;  3IV4 A;  1YF1 A;  1B48 A;  3DGQ A;  2XBI A;  2FGX A;  4DSR A;  4LMW A;  2CX3 A;  5CNW A;  2M46 A;  4O7H A;  2GT6 A;  4MJA A;  1I9D A;  1XZO A;  1TRW A;  1OE7 A;  4PUF C;  1T4Z A;  2C0E A;  1YEP A;  1FVK A;  4K7O A;  3TRQ A;  4Q5F A;  5H5Q A;  4F0B A;  1K0B A;  1M2D A;  4MLY A;  2C80 A;  2GSR A;  1XCC A;  4MPG A;  5A5H B;  4FO5 A;  1XOA A;  3F3Q A;  2IL3 A;  2EFD A;  2O87 A;  3IHQ A;  3QFB C;  3M3M A;  1V58 A;  13GS A;  3WGE A;  1XPV A;  5F07 A;  4OFT A;  4ECJ A;  2DJK A;  2MZC A;  1W4V A;  4V1A g;  4RQX A;  1TRV A;  1K0D A;  1WWJ A;  3HVX A;  4ZB8 A;  3GUS A;  3D22 A;  3FEU A;  1KEB A;  2DJJ A;  1T00 A;  2FA4 A;  1GWC A;  1TRU A;  2WRT A;  1W89 A;  1G0T A;  3A5W A;  4KCA A;  4JR4 A;  4AJ6 A;  3TU3 B;  3KCM A;  4NV2 A;  5CRH A;  3K8N A;  2VCV A;  1M7T A;  2X8H A;  3UBL A;  3HY2 A;  5GST A;  1EV9 A;  3W6G A;  1SU9 A;  4YQU A;  1ZYE A;  4IN0 A;  5BMU B;  1IYH A;  1GSY A;  2TRX A;  2P5Q A;  3IAM 2;  2MYG A;  4K0G A;  3FR3 A;  4GRF A;  5ECN B;  3LJR A;  2AYT A;  3US3 A;  3TUE A;  2H6Z A;  2V6O A;  3IE3 A;  4WR5 A;  5AIS A;  3TOU A;  2Z9S A;  3Q74 A;  3LXZ A;  3GTU A;  5DAK B;  5FT3 A;  2LRN A;  1SKR B;  3FZ5 A;  1S3C A;  3H1N A;  2VOC A;  5ID2 A;  4ML6 A;  2L4Q A;  3SBC A;  1U87 A;  4USS A;  2LRC A;  2N5F A;  6GSS A;  1JZO A;  4AKX B;  2GS3 A;  2WDU A;  4DVC A;  1IYI A;  3HJO A;  2F8A A;  14GS A;  4ZB9 A;  1GH2 A;  1ZCP A;  4KND A;  4XS4 A;  3KZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...