1PN9A

Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
209
structure length
209
Chain Sequence
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHCIPTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLYFDMGTLYQRFADYHYPQIFAKQPANPENEKKMKDAVGFLNTFLEGQEYAAGNDLTIADLSLAATIATYEVAGFDFAPYPNVAAWFARCKANAPGYALNQAGADEFKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase 1-6
publication title Structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae.
pubmed doi rcsb
source organism Anopheles gambiae
total genus 76
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1pn9A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1pn9A01
1GH2A 5B8BA 5D9XA 4IQ1A 1DSBA 1X0RA 4TKYA 1M99A 3UJ1A 4G0KA 3HHVA 2HSMB 3GURA 3CTGA 2EIQA 1A0FA 1EGOA 3HKRA 1CQGA 5KN2A 1JLWA 2CZ2A 4O92A 3A2VA 3GNJA 3M1GA 2HQTA 2LNTA 4EKZA 4EF0A 3Q6OA 3R3EA 1HNBA 5IO2A 1TRVA 5CO3A 5EY6A 1OC9B 3TDGA 2B5YA 2X8GA 5ID2A 1SYRA 1EEMA 5B7CA 4L0UA 3WYWA 3QDNA 2L4QA 3CSHA 2FY6A 5ECRB 5AN1A 3DWVA 3F4SA 1U87A 4KUNA 2A2RA 4FIWA 2D2ZA 2GSSA 3LSZA 3APSA 3GL3A 4F03A 3C1RA 5H5SA 5DJMA 1GUKA 4ML6A 2OA7A 2HRKB 2EC4A 4POKA 2GGTA 4KH7A 2H1AA 1BQ7A 4IN0A 3QCPA 5D73A 2LKUA 3DVWA 4JBBA 4IP6A 3MDKA 2WS2A 4G0LA 5IO0A 4ECIA 3FZ4A 2P5QA 4I2TA 1VF2A 3ZVJA 5CAXA 1R7HA 3M0FA 4HJ2A 3IAS2 1R4WA 2OJLA 2O8VB 2G2QA 3D6IA 4GRFA 2HSNB 3BD2A 4MK3A 3F8UA 1TK5B 4HU9A 1QGVA 4IGJA 5ECHB 3EE2A 1GULA 2PWJA 3TRQA 2C0EA 2IMDA 4EDYA 2GZYA 3KGKA 2H6XA 1ZGNA 4J57E 2WDUA 1K0DA 2GTUA 4ZB6A 3HJPA 5FWGA 3DVXA 4K1FA 1WP0A 1ST9A 1XOBA 4EDZA 2JZSA 3BBYA 6GSWA 1ERWA 3FW2A 3KP9A 2B7JA 3TRXA 4BVYA 3HD5A 2WFCA 2H70A 2IMIA 3PGTA 4I6XA 1EOHA 3LJRA 2YN1A 2F51A 2R37A 4HZ4A 1Z5YE 2XPEA 1WIKA 4X0XA 1G6WA 3LG6A 5HR0A 2QSIA 4POBA 1HD2A 2WZ9A 1OAZA 1GSDA 5IQYA 3CXGA 1NW2A 2Z9SA 2LJAA 3HVXA 1HQOA 2DJ0A 2HRNA 2B5EA 1IYHA 2E2MA 1VGLA 1FB0A 3FK8A 2HT9A 2LUSA 3QAGA 2B1KA 1WMJA 1T00A 3I6AA 1ZYEA 5D9TA 3VWVA 4RUVA 5B6NA 3FZ5A 1O7UA 3WT1A 2NDOA 4V1Ap 5H5RA 2CVDA 2CVKA 3GKKA 4TOPA 2GQMA 1BG5A 1EV9A 2DBCA 2VCZA 3GH9A 6GSYA 1G0TA 1J08A 2RM6A 3HA9A 4ML1A 1WOUA 2KP2A 5ENUA 2DJJA 3C73A 4J2FA 1KNGA 2HYXA 2ES7A 5J5NA 2PUKC 3LXZA 5JCGA 2VLTA 2FHEA 4CDOA 5ID2B 1OYJA 4LMWA 4WR5A 2XHFA 3RAZA 3GSTA 4QL7A 2VM1A 2VUPA 3TJJA 1E6BA 2WGRA 1WWJA 3MWHA 2V1MA 2V2GA 2QKEA 2CZ3A 2V6OA 2YWNA 5ECSA 2CA8A 5D9WA 3VLNA 4MA9A 1N8JA 3P8WA 3J7Yb 5CYYA 3TOUA 4DEJA 2H74A 3E3EA 2YCDA 3IRAA 5DAKA 4NMUA 4HEA2 2OBKA 3I69A 4PNFA 4TR4A 4G9HA 1MDKA 5JCUA 1GTBA 4PGTA 2G0FA 2A2SA 1OKDA 4ECCA 1PMTA 4FO5A 1KEBA 3KJYA 3C1SA 2B7KA 2C4JA 1H4OA 5CRHA 1X5CA 3HJOA 2TRCP 2F9SA 1PGTA 4PUFC 1AQXA 4KDYA 3CRTA 5HFKA 4KCEA 2YP6A 1GSFA 4OCFA 3R2QA 4MF6A 1Z7PA 5KN3A 4MZCA 2B5XA 3IE3A 5AGYA 22GSA 3TJGA 4AF2A 1YEXA 4I97A 1XWBA 2WB9A 4BPYA 3JCML 2VOCA 2FGXA 2PVOC 3IHQA 3GSSA 2O85A 2HSYA 5DBQA 1QFNA 4BL7B 4BVYB 4ZBAA 2OE0A 1JFUA 1ML6A 2HSMA 5F8BA 2FWEA 5LD0A 4P3YB 1TK8B 5FT3A 5ECLB 2LV3A 3CYNA 4EC0A 1ZL9A 4WR4A 5GSTA 2C8UA 1ERTA 5L71A 2GQLA 3ISOA 2FWHA 4ID0A 3E9JB 5ECNB 1W89A 1MD4A 2LQQA 3GMFA 5J9CA 2H75A 2KUCA 1SD8A 4NXIA 3W6GA 2O7KA 4L5OA 3OR5A 4K9ZA 3VURA 4L5LA 2I9HA 4ZB9A 4HJMA 3LEFA 2HI7A 4LMVA 1TJDA 3VI5A 1JZWA 2PMTA 4OD7A 4JRRA 4DSRA 4ZL9A 4KA0A 4JEDA 5G1KA 2FNOA 18GSA 4WXTA 3RHBA 1SU9A 1JLVA 2GZPA 2C3TA 2K9FA 2R5GA 1F3AA 1ZMAA 3FHKA 4JZQA 1OVNA 2BJXA 2KLXA 2RUFA 5F07A 1ZOFA 1XWAA 4GLTA 4NAXA 3LORA 3TKPA 3UEMA 5IMVA 3F4TA 1SD9A 4K6XA 4MABA 2B6MA 4FYBA 2X64A 2FWGA 2FUG2 5D9VA 4DSSA 4XIHA 1WJKA 5J4UA 3F9UA 2WCIA 2DJ1A 5A4WA 2H0GA 1A8YA 5DVBA 1S3AA 1TU7A 4MMMA 3QMXA 2JZRA 4KDXA 2E0QA 3VFIA 4GSNA 5IMZA 3VPQA 1TDIA 1OKTA 1PX6A 5DAKB 1MTCA 3ZMLA 3ZLPA 2VCXA 3UMAA 3BCKA 4OO4A 2J9HA 4O7HA 5D8IA 1T8EB 2X8HA 3IR4A 2TRXA 4K0NA 1XFLA 1FVJA 4TXOB 2OADA 3TKSC 2R4VA 1NHOA 5HFIA 4ZBDA 4OFNA 3S9FA 1GSYA 3FR9A 4RQXA 2DMMA 4MF5A 5LCZA 1QQ2A 2M80A 4CHSA 4WF5A 2K6VA 5B6MA 1G6YA 4NWYA 3EU4A 3KTLA 1I5GA 4WKWA 7GSSA 4KCAA 1M9BA 4F0CA 6GSTA 4NV2A 5ELGA 5LNKe 1U3IA 3RPPA 6GSUA 2RLIA 1V98A 3G7YA 2ZUPA 3APOA 2J23A 3DXBA 5J3RA 3M3MA 3KIJA 1MDJA 3IV4A 5HR1A 1M2AA 2DLXA 1BJXA 3CTFA 4PQ1A 4AJ7A 4PNGA 4HZ2A 4EVMA 2I3YA 2MMAA 2L6CA 4ACSA 5ECIB 2C1YA 2IPAA 3ZIVA 2AJQB 3ZVJD 3KM6A 1SK1A 4IELA 4RQRA 1TTZA 3H8QA 5IMFA 3ZTLA 1W4VA 5G5EA 3IPZA 1A0RP 2MYGA 1SJ6A 3K8NA 3EMPA 1VF3A 2IMEA 4JU5A 1UN2A 3F4RA 3GFKA 4XHMA 2VAFA 1QK8A 3DRNA 1R5AA 3VWWA 3UBLA 4ZIJA 3QR6A 5INYA 4TR1A 4EO3A 4EUYA 4EE0A 1XWCA 3E0UA 1B8XA 4NHWA 4PTSA 2ZCTA 3QFAC 2GS3A 3KZQA 3IDVA 4DSQA 1SL0B 4ZXGA 1F37A 3ZL5A 1V58A 3RDWA 4DSSB 2V6KA 1S3CA 2GT5A 5A4VA 3KXOA 1OC8A 4HOJA 1JZOA 3H79A 5ELAA 2LJRA 2WJUA 4IVFA 1U3AA 1I9DA 14GSA 3TGZA 5CRWA 1PKZA 1GSUA 5F05A 1K0AA 2H1DA 2MBSA 1USBA 4L8EA 2MMNA 2VCVA 4OMVA 1VRSD 3J7Yk 1Y6EA 4OFMA 1B4PA 3EINA 3FR3A 4N0VA 3SWLA 4BL7A 2GDRA 4IQAA 1CQHA 2HZEB 4MP4A 2VO4A 3WD6A 4IKHA 1M2DA 3HCZA 5G30A 3ZRDA 1FAAA 1PRXA 2L59A 1XVQA 4XCSA 2CAIA 2VL2C 1O73A 3ZMKA 5JCWA 3BJ5A 4K7IA 1X9WB 2L5OA 2HRFA 1GRXA 6GSXA 2LSTA 3SBCA 4HQZA 5DQYA 4ZILA 3L9SA 3FKFA 1GWCA 4MCUA 3VI7A 4F9ZA 1HNAA 4KAEA 4OFTA 4N10A 4G0IA 2VCWA 2IIYA 2NPBA 3UVTA 4MH3A 5GAND 4G2EA 1FW1A 1LJRA 3KP8A 1SKWB 4ECBA 4TXVA 3MAKA 2YOIA 4Q5FA 2CX3A 2KP1A 1VF4A 5DCHA 3H1NA 3TKQA 1TRWA 2PPTA 3FZAA 2L57A 1PKWA 3GRXA 2L6DA 2FCHA 4RI7A 1F6MC 4YQVA 2X8CA 2OBIA 1A2LA 2L4CA 4ISDA 5CRGA 1PL2A 3GV1A 2YNXA 1FO5A 1AIUA 4ZB8A 3IXRA 1PL1A 2XBQA 5A4UA 5EVOA 4K7OA 3D5JA 5HR2A 1XBSA 1RK4A 4TW5A 1X5DA 4MDCA 3HZ8A 5G31A 1LBKA 5COHA 1ACVA 1RW1A 3HJMA 2HZFA 1YZXA 4E8HA 4K2DA 1BX9A 4N0ZA 4OO5A 2ON5A 3VPTA 2H8LA 4XS4B 4TR1B 4KE3A 3I9V2 2XPDA 2OE3A 2XBIA 1XWGA 5CP1A 4LL1B 1TW9A 3F3QA 3M8NA 1FB6A 3KEBA 6GSVA 2LRNA 2F3MA 4V2LA 2LS5A 2C80A 2GZZA 4TXOA 4N30A 3F6DA 2RM5A 3N9JA 1O8WA 2K8SA 4LA1A 2DIZA 1JHBA 4AJ6A 3RBTA 3BCIA 3ZFLA 2AAWA 2ON7A 1MD3A 3UIWA 2VL3A 3F3RA 5J41A 3EYTA 1DE2A 2H6YA 4JE1A 4ZL7A 5IMDA 6GSSA 2F8FA 3A5WA 4KNDA 5DQSA 3KH9A 4YQUA 3TRPA 2GVPA 2I4AA 4BWQA 3UARA 4KX4A 2O89A 4MPGA 3EWLA 3GUSA 19GSA 10GSA 1H75A 1X5EA 3GX8A 1GL8A 1J9BA 4WBRD 1FVKA 4BA7A 5ABRA 4BVXA 4V1Ag 2CVBA 2K18A 3IBHA 3EC3A 1WE0A 4ULXA 3G7IA 2IN3A 1A8LA 5E4WA 5ECOB 1MEKA 4QQ7A 4GXZA 1AW9A 2O87A 1EGRA 4J56E 4MF7A 2LQOA 2IWTA 1TRSA 2VIMA 4MJBA 1U88A 5H5QA 1TKDB 2JL4A 2DC5A 1WPIA 2H72A 11GSA 2C0FA 2EIOA 4K8MA 2K8VA 1ZYQB 13GSA 1OC3A 1GLPA 4KSMA 2CAQA 4POLA 3VWUA 4X1UA 2E2GA 1TRUA 2LRCA 3HDCA 1RQMA 4PQHA 1SYXA 3H4KA 1M7TA 3GL5A 3L78A 3G7JA 2LJKA 3APQA 1K0BA 2VD0A 3ERGA 4F82A 4AJ8A 4HQSA 1B48A 2C0GA 16GSA 2C0DA 2YZHA 4OWYA 4LL4B 4HI7A 3DYRA 5IOXA 2XC2A 2ZNMA 4NPBA 2YPMA 1EP8A 3AY8A 9GSSA 2HRAA 2P31A 1GNEA 2GSQA 5JWQB 4FQUA 1M9AA 2NBSA 4IJ3A 1PA3A 4USSA 2NVLA 4LLRA 5AIVA 2FA4A 4F2IA 2MBTA 3W8SA 4YAVA 1BAYA 3FY7A 2IMFA 2H1GA 1T7PB 1QXHA 3HVVA 3LYKA 1AXDA 2HZEA 1FOVA 5HR3A 2H0IA 3QD9A 3CRUA 5EL8A 4V2MA 4I2UA 1XIYA 2CQ9A 1XOAA 5HQPA 2MZCA 1PQNA 1TI3A 1Z9HA 3MSZA 1A23A 1EEJA 3PINA 1THXA 3N5OA 1XVWA 1K3LA 3RPNA 2JZTA 3G9BA 2HNLA 5IM9A 1GTUA 1FHEA 1B9XC 2GSRA 5G2ZA 1GSQA 3TJFA 4N11A 2RIIA 1K3YA 5C04A 1LU4A 4YQMA 1K3OA 1S3DA 5DCGA 3TKSA 1J0FA 1ABAA 2C3QA 2AUVA 1T4YA 1Y25A 3CSIA 5KN0A 2OKAA 4NV5A 1BEDA 3EURA 2H66A 1GTAA 2OE1A 4NHZA 3KD0A 3ZIJA 1DBYA 4PUAA 2JADA 3O3TA 3PPUA 4BVXB 1M0UA 2HSHA 4JR6A 3DGQA 3QOUA 3CBUA 2B3SA 3ZREA 1XCCA 4YH2A 1NSWA 2H01A 1T3BA 1SJZA 3TCOA 3U6VA 4WETA 3UVHA 4GTUA 1Z6MA 4PX1A 2UZ8A 1QUWA 2PN8A 1MDIA 3TJBA 1U6TA 1ILOA 2VLVA 1SK0A 3FRCA 5ECQB 4X43A 1XXUA 3ME8A 4PURA 5JWOB 2PBJA 4XS4A 1XWKA 1KTEA 2L5LA 2PERA 4XRAA 2GQKA 2PGTA 5ECMB 3GKMA 1B4QA 2VM2A 5ECKB 3HYPA 2WRTA 4O32A 3WGEA 1AQWA 2PVQA 1Z6NA 8GSSA 3GN3A 3P90A 4EL1A 3NZNA 2H30A 5GAPD 4WF4A 20GSA 3KMNA 5F06A 3UOMA 4TR3A 4IW9A 4IS0A 3MNGA 3GH6A 5B8AA 4XRDA 1EWXA 4KF9A 1O6JA 2JSZA 2YJHA 4KB3A 2KHPA 2B1LA 1O8XA 5CRDA 2QGVA 3US3A 5J9BA 3QPMA 1V9WA 1EOGA 1V40A 3M9JA 4KDUA 3DEXA 1KBNA 3KH7A 5IIZA 1A24A 2IJYA 3TUEA 3KTBA 4G10A 4D73A 2HXKA 3KMOA 3TB2A 2FD3A 2YWIA 2OACA 5AIXA 2IFQA 3GHAA 3D22A 1Q98A 1O85A 1WRYA 3I43A 3FEUA 1HNCA 3O76A 3LWAA 3DD3A 5JWRB 1VF1A 4IBPA 3TKSE 2IL3A 3H93A 3ZITA 1PSQA 5DDLA 1NM3A 2V41A 3ED3A 4HUAA 1AQVA 2LTKA 1F2EA 2HE3A 2AYTA 1EZKA 2MMOA 3UAPA 1TXXA 4F0BA 4DVCA 3KCMA 1GLQA 3HVSA 3C8EA 2H19A 4OCEA 3VK9A 3C7MA 3IAM2 4BWSA 3QFBC 3VWXA 4FYCA 3HZ4A 5GSSA 3CSJA 1A2JA 5KEJA 4FH8A 5IOWA 4MPFA 5FHIA 5DALA 3M9KA 3GTUB 1BYEA 1ERVA 4Z7XA 1G7OA 2NTOA 2F8AA 3GKXA 5GZZB 2H73A 4MJEA 3Q18A 2DJ2A 3P7XA 2VL2A 1Z7RA 1XW6A 4O5RA 1XW5A 4H86A 4POMA 1GUHA 1Q4JA 4MH2A 1SKSB 4K7NA 3D4TA 2RUEA 4E8EA 1G7EA 4XTSA 3PR8A 1K0CA 5AISA 4Q5QA 1SL1B 2DJKA 3EVIA 2I81A 3HY2A 4XS6A 2JSYA 4PXOA 1PN9A 4MLYA 3DMLA 1F9MA 1GSSA 4Q5RA 3FZ9A 2KOKA 1AC1A 1YKAA 1EP7A 1K0MA 1TU8A 1UA5A 1YEPA 2GLRA 1YF1A 2H0HA 1PX7A 3IC8A 4JR4A 1B9YC 2YWMA 2VL9A 3ZFBA 1GNWA 1YKCA 3UBKA 3GX0A 4I8BA 3PH9A 1O81A 2DMLA 2C3NA 3P2AA 1T1VA 2BTOT 1YQ1A 3FYGA 2TIRA 3L0HA 1JZDA 2MMZA 1IYIA 1TP9A 3HXSA 3L9VA 2PU9C 1GUMA 1UVZA 1YJ6A 1K0NA 3IC4A 4HDEA 5IPGA 4WBJA 2YANA 3IK9A 1GTIA 17GSA 1YF0A 2AV4A 4MZBA 3L4NA 2HFDA 2EIRA 3D4MA 3LQ7A 3F0IA 1JZRA 12GSA 3NIVA 4D73B 4I5QA 4K0GA 5KN1A 4GSTA 1YY7A 2FA8A 1DUGA 3BOAA 2IFQB 4ILFA 3IA1A 2V32A 4MZWA 3D21A 1E2YA 5IPHA 2JU5A 2QC7A 2I1UA 3QAVA 3GKNA 3O6TA 1M2BA 3C71A 4FYUA 2VLUA 2VCQA 4TVEA 1K0OA 2CV4A 4KGIA 2N5FA 4IJIA 2BMXA 4TRXA 1X9MB 3A3TA 3W8JA 3V1WA 2VCTA 1A2MA 1R5PA 4G19A 4XS1A 1XPVA 4ZBBA 3QAWA 5ECPB 4AGSA 4IHUA 2YWOA 2H6ZA 5CREA 1ON4A 5HFGA 4YAPA 4HS1A 3F63A 5DALB 4KW6A 2YJ7A 3GYKA 1OC9A 2CT6A 3A2WA 2AB6A 3LFLA 5E59A 3IOSA 2YV9A 1SENA 2IMKA 2DIYA 5D93A 1SJIA 3FR6A 4GF0A 3WGXA 4ZL8A 3DIEA 1V2AA 2LEGA 5A5KA 3EMXA 2H71A 2H76A 4RI6A 5CNWA 2HRKA 1FG4A 1SKRB 4HU7A 3A2XA 4CW9A 2P5RA 1XZOA 4TR0A 3LYPA 2X99A 2R3XA 1C72A 1N2AA 3Q74A 2YV7A 1QMVA 3LGCA 3F6FA 1T4ZA 4ECJA 1ZZYA 3ZZXA 1THOA 4GQCA 3U5RE 3GA4A 2DSAA 3Q19A 4MJAA 1X9SB 4IP1A 2M46A 4GWRA 1EV4A 3RHCA 4L0WA 5DJLA 3L9UA 1R26A 2P0GA 5G1LA 5BMUA 3WT2A 2DJ3A 4WEYA 1DE1A 3D0ZA 1OE7A 3DKSA 3ME7A 1TK0B 2N5AA 1AAZA 5EPFA 2R2JA 3ERWA 3ZYWA 2N5BA 3NOFA 4V2NA 1ZCPA 4EXJA 3IK7A 2LRTA 2REMA 3TJKA 1Z3EA 2LNSA 4Q5NA 1AUCA 4MJCA 1ERUA 1V57A 4KSOA 1XW9A 1F3BA 2GT6A 1PD21 2A4VA 1HYUA 1GP1A 2AHEA 1OE8A 5C00A 2GSTA 4GSSA 1SL2B 2E7PA 2HLSA 2R6KA 1TOFA 4TN8A 1NHYA 3EU3A 1GSEA 3TOTA 5G5FA 3LXTA 5F0GA 5IMAA 4QL9A 3UL3A 2CX4A 1SK2A 2H1BA 2WULA 4GCIA 2FWFA 2FLSA 1YDKA 5D96A 3GTUA 3GIXA 1URMA 4PQIA 2VD1A 4GQFA 1UC7A 3TKRA 2ALBA 1TI1A 5IMCA 2M72A 3WGDA 3ERFA 3CMIA 2JACA 2YZUA
chains in the Genus database with same CATH superfamily
1GH2A 5B8BA 5D9XA 4IQ1A 1DSBA 1X0RA 4TKYA 1M99A 3UJ1A 4G0KA 3HHVA 2HSMB 3GURA 3CTGA 2EIQA 1A0FA 1EGOA 3HKRA 4AI6A 1CQGA 5KN2A 1JLWA 2CZ2A 4O92A 3A2VA 2X49A 3GNJA 3M1GA 2HQTA 2LNTA 4EKZA 4EF0A 3Q6OA 3R3EA 1HNBA 5IO2A 1TRVA 5CO3A 5EY6A 1OC9B 3TDGA 2B5YA 4FXYP 2X8GA 5ID2A 1SYRA 1EEMA 5B7CA 4L0UA 3TU3B 3WYWA 3QDNA 2L4QA 3CSHA 2FY6A 5ECRB 5AN1A 3DWVA 3F4SA 1U87A 4KUNA 2A2RA 4FIWA 2D2ZA 2GSSA 3LSZA 3APSA 3GL3A 4F03A 3C1RA 5H5SA 5DJMA 1GUKA 4ML6A 2OA7A 2HRKB 2EC4A 4POKA 2GGTA 4X4JA 4KH7A 2H1AA 1BQ7A 4IN0A 3QCPA 5D73A 2LKUA 3DVWA 4JBBA 4IP6A 3MDKA 2WS2A 5J4VA 4G0LA 5IO0A 4ECIA 3FZ4A 2P5QA 4I2TA 1VF2A 3ZVJA 5CAXA 1R7HA 3M0FA 4HJ2A 3IAS2 1R4WA 2OJLA 2O8VB 2G2QA 3D6IA 4GRFA 2HSNB 3BD2A 4MK3A 3F8UA 1TK5B 4HU9A 1QGVA 4IGJA 3CHXC 5ECHB 3EE2A 1GULA 2PWJA 3TRQA 2C0EA 2IMDA 4EDYA 2GZYA 3KGKA 2H6XA 1ZGNA 4J57E 2WDUA 1K0DA 2GTUA 4ZB6A 4ZB7A 3HJPA 5FWGA 3DVXA 4K1FA 1WP0A 1ST9A 1XOBA 4EDZA 2JZSA 3BBYA 1YVLA 6GSWA 1ERWA 3FW2A 3KP9A 2B7JA 3TRXA 4BVYA 3HD5A 2WFCA 2H70A 2IMIA 3PGTA 4I6XA 1EOHA 3LJRA 2YN1A 2F51A 2R37A 4HZ4A 1Z5YE 2XPEA 1WIKA 4X0XA 1G6WA 3LG6A 5HR0A 2QSIA 4POBA 1HD2A 2WZ9A 1OAZA 1GSDA 5IQYA 3CXGA 1NW2A 2Z9SA 2LJAA 3HVXA 1HQOA 2DJ0A 2HRNA 2B5EA 1IYHA 2E2MA 1VGLA 1FB0A 3FK8A 2HT9A 2LUSA 2O3EA 3QAGA 2B1KA 1WMJA 1T00A 3I6AA 1ZYEA 5D9TA 3VWVA 4RUVA 5B6NA 3FZ5A 1O7UA 3WT1A 4PI0C 2NDOA 4V1Ap 5H5RA 2CVDA 2CVKA 3GKKA 4TOPA 2GQMA 1BG5A 1EV9A 2DBCA 2VCZA 3GH9A 6GSYA 1G0TA 1J08A 2RM6A 3HA9A 4ML1A 1WOUA 2KP2A 5ENUA 2DJJA 3C73A 4J2FA 1KNGA 2HYXA 2ES7A 5J5NA 2PUKC 2VKZG 3LXZA 5JCGA 2VLTA 2FHEA 4CDOA 5ID2B 1OYJA 4LMWA 4WR5A 2XHFA 3RAZA 3GSTA 4QL7A 2VM1A 2VUPA 3TJJA 1E6BA 2WGRA 1WWJA 3MWHA 2V1MA 3RGBC 2V2GA 2QKEA 2CZ3A 2V6OA 2YWNA 5ECSA 2CA8A 5D9WA 3VLNA 4MA9A 1N8JA 3P8WA 3J7Yb 5CYYA 3TOUA 4DEJA 2H74A 3E3EA 2YCDA 3IRAA 5DAKA 4NMUA 4HEA2 2OBKA 3I69A 4PNFA 4TR4A 4G9HA 1MDKA 5JCUA 1GTBA 4PGTA 2G0FA 2A2SA 1OKDA 4ECCA 1PMTA 4FO5A 1KEBA 3KJYA 3C1SA 2WVXA 2B7KA 2C4JA 1H4OA 5CRHA 1X5CA 4N3ZA 3HJOA 2TRCP 2F9SA 1PGTA 4PUFC 1AQXA 4KDYA 3CRTA 5HFKA 4KCEA 2YP6A 1GSFA 4OCFA 3R2QA 4MF6A 1Z7PA 5KN3A 4MZCA 2B5XA 3IE3A 5AGYA 22GSA 3TJGA 4AF2A 1YEXA 4I97A 1XWBA 2WB9A 4BPYA 3JCML 2VOCA 2FGXA 4MNNA 2PVOC 3IHQA 3GSSA 2O85A 2HSYA 5DBQA 1QFNA 4BL7B 4BVYB 4ZBAA 2OE0A 1JFUA 1ML6A 2HSMA 5F8BA 2FWEA 5LD0A 4P3YB 1TK8B 5FT3A 5ECLB 2LV3A 3CYNA 4EC0A 1ZL9A 4WR4A 5GSTA 2C8UA 1ERTA 5L71A 2GQLA 3ISOA 2FWHA 4ID0A 3E9JB 4CY8A 5ECNB 1W89A 1MD4A 2LQQA 3GMFA 5J9CA 1M3JA 2H75A 2KUCA 2WW2A 1SD8A 4NXIA 3W6GA 2O7KA 4L5OA 3OR5A 4K9ZA 3VURA 4L5LA 2I9HA 4ZB9A 4HJMA 3LEFA 2HI7A 4LMVA 1TJDA 3VI5A 1JZWA 2PMTA 4OD7A 4JRRA 4DSRA 4ZL9A 4AKHA 4KA0A 4JEDA 5G1KA 2FNOA 18GSA 4WXTA 3RHBA 1SU9A 1JLVA 2GZPA 2C3TA 2K9FA 2R5GA 1F3AA 1ZMAA 3FHKA 4JZQA 1OVNA 2BJXA 2KLXA 2RUFA 5F07A 1ZOFA 1XWAA 4GLTA 4NAXA 3LORA 3TKPA 3UEMA 5IMVA 3F4TA 1SD9A 4K6XA 4MABA 2B6MA 4FYBA 2X64A 2FWGA 2FUG2 5D9VA 4DSSA 4XIHA 1WJKA 5J4UA 3F9UA 2WCIA 2DJ1A 5A4WA 2H0GA 1A8YA 5DVBA 1S3AA 1TU7A 4MMMA 3QMXA 5A1NB 2JZRA 4KDXA 2E0QA 3VFIA 4GSNA 5IMZA 3VPQA 1TDIA 1OKTA 1PX6A 5DAKB 1MTCA 3ZMLA 3ZLPA 2VCXA 3UMAA 3BCKA 4OO4A 2J9HA 4O7HA 5D8IA 1T8EB 2X8HA 3IR4A 2TRXA 4K0NA 1XFLA 1FVJA 4TXOB 2OADA 3TKSC 2R4VA 1NHOA 4YKGA 2WVXB 5HFIA 4ZBDA 4OFNA 3S9FA 1GSYA 3FR9A 4RQXA 2DMMA 4MF5A 5LCZA 1QQ2A 2M80A 4CHSA 4WF5A 2K6VA 5B6MA 1BF5A 1G6YA 4NWYA 3EU4A 3KTLA 1I5GA 4WKWA 7GSSA 4G01A 4KCAA 1M9BA 4F0CA 6GSTA 4NV2A 5ELGA 5LNKe 1U3IA 3RPPA 6GSUA 2RLIA 1V98A 3G7YA 2ZUPA 3APOA 2J23A 3DXBA 1SVLA 5J3RA 4K5SA 3M3MA 3KIJA 1MDJA 3IV4A 5HR1A 1M2AA 2DLXA 1BJXA 3CTFA 4PQ1A 4AJ7A 4PNGA 4HZ2A 4EVMA 2I3YA 2MMAA 2L6CA 4ACSA 5ECIB 2C1YA 2IPAA 3ZIVA 2AJQB 3ZVJD 3KM6A 1SK1A 4IELA 4RQRA 1TTZA 3H8QA 5IMFA 3ZTLA 4Z2RA 1W4VA 5G5EA 3IPZA 1A0RP 2MYGA 1SJ6A 3K8NA 3EMPA 1VF3A 2IMEA 4JU5A 1UN2A 3F4RA 3GFKA 4XHMA 2VAFA 1QK8A 3DRNA 1R5AA 3VWWA 3UBLA 4ZIJA 3QR6A 5INYA 4TR1A 4EO3A 4EUYA 4EE0A 4QMKA 1XWCA 3E0UA 1B8XA 4NHWA 4PTSA 2ZCTA 1ZYPA 3QFAC 2GS3A 3KZQA 3IDVA 4DSQA 5A5HA 1SL0B 1M3IA 4ZXGA 1F37A 3ZL5A 1V58A 3RDWA 2A2PA 4DSSB 2V6KA 4K5RA 1S3CA 2GT5A 5A4VA 3KXOA 1OC8A 4HOJA 2WW1A 1JZOA 3H79A 5ELAA 2LJRA 2WJUA 4IVFA 1U3AA 4CY6A 1I9DA 14GSA 3TGZA 5CRWA 1PKZA 1GSUA 5F05A 3RFRC 1K0AA 2H1DA 2MBSA 1USBA 4L8EA 2MMNA 2DKIA 2VCVA 4OMVA 4EIQA 2EFDA 1VRSD 3J7Yk 1Y6EA 4OFMA 1B4PA 3EINA 3FR3A 1SVMA 4N0VA 3SWLA 4BL7A 2GDRA 2EFHA 4IQAA 1Y1UA 1CQHA 2HZEB 4MP4A 2VO4A 3WD6A 4IKHA 1M2DA 3HCZA 5G30A 3ZRDA 1FAAA 1PRXA 2L59A 1XVQA 4XCSA 2R0GA 2CAIA 2VL2C 1O73A 3ZMKA 5JCWA 3BJ5A 4K7IA 1X9WB 2L5OA 2HRFA 1GRXA 6GSXA 2LSTA 3SBCA 4HQZA 5DQYA 4ZILA 3L9SA 3FKFA 1GWCA 4MCUA 3VI7A 4F9ZA 1YEWC 1HNAA 4KAEA 4OFTA 4N10A 4G0IA 2VCWA 2IIYA 2NPBA 3UVTA 4MH3A 5GAND 4G2EA 1FW1A 1LJRA 3KP8A 1SKWB 4ECBA 4TXVA 3MAKA 2YOIA 4Q5FA 2CX3A 2KP1A 1VF4A 5DCHA 3H1NA 4Z2TA 3TKQA 1TRWA 2PPTA 3FZAA 2L57A 1PKWA 3GRXA 2L6DA 4AKXB 2FCHA 4RI7A 1F6MC 4YQVA 2X8CA 2OBIA 1A2LA 3CWGA 4AKGA 2L4CA 4ISDA 5CRGA 1PL2A 3GV1A 2YNXA 1FO5A 1AIUA 2QA1A 4ZB8A 3IXRA 1PL1A 2O36A 2XBQA 5A4UA 5EVOA 4K7OA 3D5JA 5HR2A 5A1NA 1XBSA 1RK4A 4TW5A 1X5DA 4MDCA 3HZ8A 5G31A 1LBKA 5J40A 5COHA 4YKFA 1ACVA 1RW1A 3HJMA 2HZFA 1YZXA 4E8HA 4K2DA 1BX9A 4N0ZA 4OO5A 2ON5A 3VPTA 2H8LA 2R0PA 4XS4B 4TR1B 4PHZC 4KE3A 3MIXA 3I9V2 2XPDA 2OE3A 2XBIA 1XWGA 5CP1A 4LL1B 1TW9A 3F3QA 3M8NA 1FB6A 5A5HB 3KEBA 6GSVA 2LRNA 2F3MA 4V2LA 2LS5A 2C80A 2GZZA 4TXOA 4N30A 3F6DA 2RM5A 3N9JA 1O8WA 2K8SA 4LA1A 2DIZA 1JHBA 2O5VA 4AJ6A 3RBTA 3BCIA 3ZFLA 5KOWA 2AAWA 2ON7A 1MD3A 3UIWA 2VL3A 3F3RA 5J41A 3EYTA 1DE2A 2H6YA 4JE1A 4ZL7A 5IMDA 6GSSA 2F8FA 3A5WA 4KNDA 5DQSA 3KH9A 4YQUA 3TRPA 2GVPA 2I4AA 4BWQA 3UARA 4KX4A 2O89A 4MPGA 3EWLA 3GUSA 19GSA 10GSA 1H75A 1X5EA 3GX8A 1GL8A 1J9BA 4WBRD 1FVKA 4BA7A 5ABRA 4BVXA 4V1Ag 5J47A 2CVBA 2K18A 3IBHA 3EC3A 1WE0A 4ULXA 3G7IA 2IN3A 1A8LA 5E4WA 5ECOB 1MEKA 4QQ7A 4GXZA 1AW9A 2O87A 1EGRA 4J56E 4MF7A 2LQOA 2IWTA 1TRSA 2VIMA 4MJBA 1U88A 5H5QA 1TKDB 2JL4A 2DC5A 1WPIA 2H72A 11GSA 2C0FA 2EIOA 4K8MA 2K8VA 1ZYQB 1BG1A 13GSA 1OC3A 1N25A 1GLPA 4KSMA 2CAQA 4POLA 3VWUA 4X1UA 2E2GA 1TRUA 2LRCA 3HDCA 1RQMA 4PQHA 1SYXA 3H4KA 1M7TA 3GL5A 3L78A 3G7JA 2LJKA 3APQA 1K0BA 2VD0A 3ERGA 3FMWA 4F82A 4AJ8A 4HQSA 1B48A 2C0GA 16GSA 2C0DA 2YZHA 4OWYA 4LL4B 4HI7A 3DYRA 5IOXA 2XC2A 2ZNMA 4NPBA 2YPMA 1EP8A 3AY8A 9GSSA 2HRAA 2P31A 1GNEA 2GSQA 5JWQB 4FQUA 2OT3A 4AKIA 1M9AA 2NBSA 2WZSA 4IJ3A 1PA3A 4USSA 2NVLA 4LLRA 5AIVA 2FA4A 4F2IA 2MBTA 3W8SA 4YAVA 1BAYA 3FY7A 2IMFA 2H1GA 1T7PB 1QXHA 3HVVA 3LYKA 1AXDA 2HZEA 1FOVA 5HR3A 2H0IA 3QD9A 3EPTA 3CRUA 5EL8A 4V2MA 4I2UA 1XIYA 2CQ9A 1XOAA 5HQPA 2MZCA 1PQNA 1TI3A 1Z9HA 3HMJG 3MSZA 1A23A 1EEJA 3PINA 1THXA 3N5OA 1XVWA 1K3LA 3RPNA 2JZTA 3G9BA 2HNLA 5IM9A 1GTUA 1FHEA 1B9XC 2GSRA 5G2ZA 1GSQA 3TJFA 4N11A 2RIIA 1K3YA 5C04A 1LU4A 4YQMA 1K3OA 1S3DA 5DCGA 1SVOA 3TKSA 1J0FA 1ABAA 2A4HA 2C3QA 2AUVA 1T4YA 1Y25A 3CSIA 5KN0A 2OKAA 4NV5A 1BEDA 3EURA 3HVNA 2H66A 1GTAA 2OE1A 4NHZA 3KD0A 3ZIJA 1DBYA 4PUAA 2JADA 3O3TA 3PPUA 4BVXB 1M0UA 2HSHA 4BIKA 4JR6A 3DGQA 3QOUA 3MYDA 3CBUA 2B3SA 3ZREA 1XCCA 4YH2A 1NSWA 4O5UA 2H01A 1T3BA 1SJZA 3TCOA 4A5PA 3U6VA 4WETA 1S4BP 2WW3A 3UVHA 2WW0A 4GTUA 1Z6MA 4PX1A 2UZ8A 1QUWA 2PN8A 1MDIA 3TJBA 1U6TA 1ILOA 2VLVA 1SK0A 3FRCA 5ECQB 4X43A 1XXUA 3ME8A 4PURA 5JWOB 2PBJA 4XS4A 1XWKA 1KTEA 2L5LA 2PERA 4XRAA 2GQKA 2PGTA 5ECMB 4E68A 3GKMA 1B4QA 2VM2A 5ECKB 3HYPA 2WRTA 4O32A 3WGEA 1AQWA 2PVQA 1Z6NA 4Z2UA 8GSSA 3GN3A 3P90A 4EL1A 3NZNA 2H30A 5GAPD 4WF4A 20GSA 3KMNA 5F06A 3UOMA 4TR3A 4IW9A 4IS0A 3MNGA 3GH6A 5B8AA 4XRDA 2DKHA 1EWXA 4KF9A 1O6JA 2JSZA 2YJHA 4KB3A 2KHPA 2B1LA 1O8XA 5CRDA 2QGVA 3US3A 5J9BA 3QPMA 1V9WA 1EOGA 1V40A 3M9JA 4KDUA 3DEXA 1KBNA 3KH7A 5IIZA 1A24A 2IJYA 3TUEA 3KTBA 4G10A 4D73A 2HXKA 3KMOA 3TB2A 2FD3A 2YWIA 5BMUB 2OACA 5AIXA 2IFQA 3GHAA 3D22A 1Q98A 1O85A 1WRYA 3I43A 3FEUA 1HNCA 3O76A 1PFOA 3LWAA 3DD3A 5JWRB 1VF1A 4IBPA 3TKSE 2IL3A 3H93A 3ZITA 1PSQA 5DDLA 1NM3A 2V41A 3ED3A 4HUAA 3A5IA 1AQVA 2LTKA 1F2EA 2HE3A 2AYTA 1EZKA 2MMOA 3UAPA 1TXXA 4F0BA 4DVCA 3KCMA 1GLQA 3HVSA 3C8EA 2H19A 4OCEA 3VK9A 2WVYA 5A34A 3CQFA 3C7MA 3IAM2 4BWSA 2X4AA 3VWXA 3QFBC 4FYCA 3HZ4A 5GSSA 3CSJA 1A2JA 5KEJA 4FH8A 5IOWA 4MPFA 5FHIA 5DALA 3M9KA 3GTUB 1BYEA 1ERVA 4Z7XA 1G7OA 2NTOA 2F8AA 3GKXA 5GZZB 2H73A 4MJEA 3Q18A 2DJ2A 3P7XA 2VL2A 1Z7RA 1XW6A 4O5RA 1XW5A 1PN0A 4H86A 4POMA 1GUHA 1Q4JA 4MH2A 1SKSB 4K7NA 3D4TA 2RUEA 4E8EA 1G7EA 4XTSA 3PR8A 2R0CA 1K0CA 5AISA 4Q5QA 1SL1B 2DJKA 1ZYNA 3EVIA 2I81A 3HY2A 4XS6A 2JSYA 4PXOA 1PN9A 4HSCX 4MLYA 3DMLA 1F9MA 1GSSA 4Q5RA 3FZ9A 2KOKA 3LW9A 1AC1A 1YKAA 1EP7A 1K0MA 1TU8A 1UA5A 1YEPA 1S3RA 2GLRA 1YF1A 2H0HA 1PX7A 3IC8A 4JR4A 1B9YC 2WVZA 2YWMA 2VL9A 2EFEA 3ZFBA 1GNWA 1YKCA 3UBKA 3GX0A 4I8BA 3PH9A 1O81A 2DMLA 2C3NA 3P2AA 1T1VA 2BTOT 1YQ1A 3FYGA 2TIRA 3L0HA 1JZDA 2MMZA 1IYIA 1TP9A 3HXSA 3L9VA 2PU9C 1GUMA 1UVZA 1YJ6A 1K0NA 3IC4A 4HDEA 5IPGA 4WBJA 2YANA 3IK9A 1GTIA 17GSA 1YF0A 2AV4A 4MZBA 3L4NA 2HFDA 2EIRA 3D4MA 3LQ7A 3F0IA 1JZRA 12GSA 3NIVA 4D73B 4I5QA 4K0GA 5KN1A 4GSTA 1YY7A 2FA8A 1DUGA 3BOAA 2IFQB 4ILFA 3IA1A 2V32A 4MZWA 3D21A 1E2YA 5IPHA 2JU5A 2QC7A 2I1UA 3QAVA 3GKNA 3O6TA 1M2BA 3C71A 4FYUA 2VLUA 2VCQA 4TVEA 1K0OA 2CV4A 4KGIA 2N5FA 4K2XA 4IJIA 2BMXA 4TRXA 1X9MB 3A3TA 3W8JA 3V1WA 2VCTA 1A2MA 1R5PA 4G19A 4XS1A 1XPVA 4ZBBA 3QAWA 5A34B 5ECPB 4AGSA 4IHUA 2YWOA 2H6ZA 5CREA 1ON4A 5HFGA 4YAPA 4HS1A 3F63A 5BRTA 5DALB 4KW6A 2YJ7A 3GYKA 1OC9A 1I1IP 2CT6A 3A2WA 2AB6A 3LFLA 5E59A 3IOSA 2YV9A 1SENA 2IMKA 4O5QA 2DIYA 5D93A 1SJIA 3FR6A 4GF0A 3WGXA 4ZL8A 3DIEA 1V2AA 2LEGA 5A5KA 3EMXA 2H71A 2H76A 4PI2C 4RI6A 5CNWA 2HRKA 1FG4A 1SKRB 4HU7A 3A2XA 4CW9A 2P5RA 1XZOA 1TXUA 3LYPA 4TR0A 2X99A 2R3XA 1C72A 1N2AA 3Q74A 2YV7A 3IHGA 1QMVA 3LGCA 3F6FA 1T4ZA 2EFCA 4ECJA 1ZZYA 3ZZXA 1THOA 4GQCA 3U5RE 3GA4A 2DSAA 3Q19A 4MJAA 1X9SB 4IP1A 2M46A 4GWRA 2HSNA 1EV4A 3RHCA 4L0WA 5DJLA 3L9UA 1R26A 2P0GA 5G1LA 5BMUA 3WT2A 2DJ3A 4W66A 4WEYA 1DE1A 3D0ZA 1OE7A 3DKSA 3ME7A 1TK0B 2N5AA 1AAZA 5EPFA 2R2JA 2QA2A 2H1LA 3ERWA 3ZYWA 2N5BA 3NOFA 4V2NA 1ZCPA 4EXJA 3IK7A 2LRTA 2REMA 3TJKA 1Z3EA 2LNSA 4Q5NA 1FOHA 1AUCA 4MJCA 1ERUA 1V57A 4KSOA 1XW9A 1F3BA 2GT6A 4EIPA 1PD21 2A4VA 1HYUA 1GP1A 2AHEA 1OE8A 5C00A 2GSTA 4GSSA 4ICYA 1SL2B 2E7PA 1XG8A 2HLSA 2R6KA 1TOFA 4TN8A 1NHYA 3EU3A 1GSEA 3TOTA 5J4YA 5G5FA 3LXTA 5F0GA 5IMAA 4QL9A 3UL3A 5KOXA 2CX4A 1SK2A 2H1BA 2WULA 4GCIA 2FWFA 2FLSA 1YDKA 4GDFA 5D96A 3GTUA 3GIXA 1URMA 4PQIA 2VD1A 4GQFA 1UC7A 3TKRA 2ALBA 1TI1A 5IMCA 2M72A 3WGDA 3ERFA 2UV8G 3CMIA 2JACA 2YZUA
chains in the Genus database with same CATH topology
1GH2A 5B8BA 5D9XA 4IQ1A 1DSBA 1X0RA 4TKYA 1M99A 3UJ1A 4G0KA 3HHVA 2HSMB 3GURA 3CTGA 2EIQA 1A0FA 1EGOA 3HKRA 4AI6A 1CQGA 5KN2A 1JLWA 2CZ2A 4O92A 3A2VA 2X49A 3GNJA 3M1GA 2HQTA 2LNTA 4EKZA 4EF0A 3Q6OA 3R3EA 1HNBA 5IO2A 1TRVA 5CO3A 5EY6A 1OC9B 3TDGA 2B5YA 2X8GA 5ID2A 1SYRA 1EEMA 5B7CA 4L0UA 3TU3B 3WYWA 3QDNA 2L4QA 3CSHA 2FY6A 5ECRB 5AN1A 3DWVA 3F4SA 1U87A 4KUNA 2A2RA 4FIWA 2D2ZA 2GSSA 3LSZA 3APSA 3GL3A 4F03A 3C1RA 5H5SA 5DJMA 1GUKA 4ML6A 2OA7A 2HRKB 2EC4A 4POKA 2GGTA 4X4JA 4KH7A 2H1AA 1BQ7A 4IN0A 3QCPA 5D73A 2LKUA 3DVWA 4JBBA 4IP6A 3MDKA 2WS2A 5J4VA 4G0LA 5IO0A 4ECIA 3FZ4A 2P5QA 4I2TA 1VF2A 3ZVJA 5CAXA 1R7HA 3M0FA 4HJ2A 3IAS2 1R4WA 2OJLA 2O8VB 2G2QA 3D6IA 4GRFA 2HSNB 3BD2A 4MK3A 3F8UA 1TK5B 4HU9A 1QGVA 4IGJA 5ECHB 3EE2A 1GULA 2PWJA 3TRQA 2C0EA 2IMDA 4EDYA 2GZYA 3KGKA 2H6XA 1ZGNA 4J57E 2WDUA 1K0DA 2GTUA 4ZB6A 4ZB7A 3HJPA 5FWGA 3DVXA 4K1FA 1WP0A 1ST9A 1XOBA 4EDZA 2JZSA 3BBYA 1YVLA 6GSWA 1ERWA 3FW2A 3KP9A 2B7JA 3TRXA 4BVYA 3HD5A 2WFCA 2H70A 2IMIA 3PGTA 4I6XA 1EOHA 3LJRA 2YN1A 2F51A 2R37A 4HZ4A 1Z5YE 2XPEA 1WIKA 4X0XA 1G6WA 3LG6A 5HR0A 2QSIA 4POBA 1HD2A 2WZ9A 1OAZA 1GSDA 5IQYA 3CXGA 1NW2A 2Z9SA 2LJAA 3HVXA 1HQOA 2DJ0A 2HRNA 2B5EA 1IYHA 2E2MA 1VGLA 1FB0A 3FK8A 2HT9A 2LUSA 3QAGA 2B1KA 1WMJA 1T00A 3I6AA 1ZYEA 5D9TA 3VWVA 4RUVA 5B6NA 3FZ5A 1O7UA 3WT1A 2NDOA 4V1Ap 5H5RA 2CVDA 2CVKA 3GKKA 4TOPA 2GQMA 1BG5A 1EV9A 2DBCA 2VCZA 3GH9A 6GSYA 1G0TA 1J08A 2RM6A 3HA9A 4ML1A 1WOUA 2KP2A 5ENUA 2DJJA 3C73A 4J2FA 1KNGA 2HYXA 2ES7A 5J5NA 2PUKC 2VKZG 3LXZA 5JCGA 2VLTA 2FHEA 4CDOA 5ID2B 1OYJA 4LMWA 4WR5A 2XHFA 3RAZA 3GSTA 4QL7A 2VM1A 2VUPA 3TJJA 1E6BA 2WGRA 1WWJA 3MWHA 2V1MA 2V2GA 2QKEA 2CZ3A 2V6OA 2YWNA 5ECSA 2CA8A 5D9WA 3VLNA 4MA9A 1N8JA 3P8WA 3J7Yb 5CYYA 3TOUA 4DEJA 2H74A 3E3EA 2YCDA 3IRAA 5DAKA 4NMUA 4HEA2 2OBKA 3I69A 4PNFA 4TR4A 4G9HA 1MDKA 5JCUA 1GTBA 4PGTA 2G0FA 2A2SA 1OKDA 4ECCA 1PMTA 4FO5A 1KEBA 3KJYA 3C1SA 2B7KA 2C4JA 1H4OA 5CRHA 1X5CA 4N3ZA 3HJOA 2TRCP 2F9SA 1PGTA 4PUFC 1AQXA 4KDYA 3CRTA 5HFKA 4KCEA 2YP6A 1GSFA 4OCFA 3R2QA 4MF6A 1Z7PA 5KN3A 4MZCA 2B5XA 3IE3A 5AGYA 22GSA 3TJGA 4AF2A 1YEXA 4I97A 1XWBA 2WB9A 4BPYA 3JCML 2VOCA 2FGXA 4MNNA 2PVOC 3IHQA 3GSSA 2O85A 2HSYA 5DBQA 1QFNA 4BL7B 4BVYB 4ZBAA 2OE0A 1JFUA 1ML6A 2HSMA 5F8BA 2FWEA 5LD0A 4P3YB 1TK8B 5FT3A 5ECLB 2LV3A 3CYNA 4EC0A 1ZL9A 4WR4A 5GSTA 2C8UA 1ERTA 5L71A 2GQLA 3ISOA 2FWHA 4ID0A 3E9JB 4CY8A 5ECNB 1W89A 1MD4A 2LQQA 3GMFA 5J9CA 2H75A 2KUCA 1SD8A 4NXIA 3W6GA 2O7KA 4L5OA 3OR5A 4K9ZA 3VURA 4L5LA 2I9HA 4ZB9A 4HJMA 3LEFA 2HI7A 4LMVA 1TJDA 3VI5A 1JZWA 2PMTA 4OD7A 4JRRA 4DSRA 4ZL9A 4AKHA 4KA0A 4JEDA 5G1KA 2FNOA 18GSA 4WXTA 3RHBA 1SU9A 1JLVA 2GZPA 2C3TA 2K9FA 2R5GA 1F3AA 1ZMAA 3FHKA 4JZQA 1OVNA 2BJXA 2KLXA 2RUFA 5F07A 1ZOFA 1XWAA 4GLTA 4NAXA 3LORA 3TKPA 3UEMA 5IMVA 3F4TA 1SD9A 4K6XA 4MABA 2B6MA 4FYBA 2X64A 2FWGA 2FUG2 5D9VA 4DSSA 4XIHA 1WJKA 5J4UA 3F9UA 2WCIA 2DJ1A 5A4WA 2H0GA 1A8YA 5DVBA 1S3AA 1TU7A 4MMMA 3QMXA 5A1NB 2JZRA 4KDXA 2E0QA 3VFIA 4GSNA 5IMZA 3VPQA 1TDIA 1OKTA 1PX6A 5DAKB 1MTCA 3ZMLA 3ZLPA 2VCXA 3UMAA 3BCKA 4OO4A 2J9HA 4O7HA 5D8IA 1T8EB 2X8HA 3IR4A 2TRXA 4K0NA 1XFLA 1FVJA 4TXOB 2OADA 3TKSC 2R4VA 1NHOA 4YKGA 5HFIA 4ZBDA 4OFNA 3S9FA 1GSYA 3FR9A 4RQXA 2DMMA 4MF5A 5LCZA 1QQ2A 2M80A 4CHSA 4WF5A 2K6VA 5B6MA 1BF5A 1G6YA 4NWYA 3EU4A 3KTLA 1I5GA 4WKWA 7GSSA 4G01A 4KCAA 1M9BA 4F0CA 6GSTA 4NV2A 5ELGA 5LNKe 1U3IA 3RPPA 6GSUA 2RLIA 1V98A 3G7YA 2ZUPA 3APOA 2J23A 3DXBA 1SVLA 5J3RA 4K5SA 3M3MA 3KIJA 1MDJA 3IV4A 5HR1A 1M2AA 2DLXA 1BJXA 3CTFA 4PQ1A 4AJ7A 4PNGA 4HZ2A 4EVMA 2I3YA 2MMAA 2L6CA 4ACSA 5ECIB 2C1YA 2IPAA 3ZIVA 2AJQB 3ZVJD 3KM6A 1SK1A 4IELA 4RQRA 1TTZA 3H8QA 5IMFA 3ZTLA 4Z2RA 1W4VA 5G5EA 3IPZA 1A0RP 2MYGA 1SJ6A 3K8NA 3EMPA 1VF3A 2IMEA 4JU5A 1UN2A 3F4RA 3GFKA 4XHMA 2VAFA 1QK8A 3DRNA 1R5AA 3VWWA 3UBLA 4ZIJA 3QR6A 5INYA 4TR1A 4EO3A 4EUYA 4EE0A 4QMKA 1XWCA 3E0UA 1B8XA 4NHWA 4PTSA 2ZCTA 1ZYPA 3QFAC 2GS3A 3KZQA 3IDVA 4DSQA 5A5HA 1SL0B 4ZXGA 1F37A 3ZL5A 1V58A 3RDWA 2A2PA 4DSSB 2V6KA 4K5RA 1S3CA 2GT5A 5A4VA 3KXOA 1OC8A 4HOJA 1JZOA 3H79A 5ELAA 2LJRA 2WJUA 4IVFA 1U3AA 4CY6A 1I9DA 14GSA 3TGZA 5CRWA 1PKZA 1GSUA 5F05A 1K0AA 2H1DA 2MBSA 1USBA 4L8EA 2MMNA 2DKIA 2VCVA 4OMVA 4EIQA 2EFDA 1VRSD 3J7Yk 1Y6EA 4OFMA 1B4PA 3EINA 3FR3A 1SVMA 4N0VA 3SWLA 4BL7A 2GDRA 2EFHA 4IQAA 1Y1UA 1CQHA 2HZEB 4MP4A 2VO4A 3WD6A 4IKHA 1M2DA 3HCZA 5G30A 3ZRDA 1FAAA 1PRXA 2L59A 1XVQA 4XCSA 2R0GA 2CAIA 2VL2C 1O73A 3ZMKA 5JCWA 3BJ5A 4K7IA 1X9WB 2L5OA 2HRFA 1GRXA 6GSXA 2LSTA 3SBCA 4HQZA 5DQYA 4ZILA 3L9SA 3FKFA 1GWCA 4MCUA 3VI7A 4F9ZA 1HNAA 4KAEA 4OFTA 4N10A 4G0IA 2VCWA 2IIYA 2NPBA 3UVTA 4MH3A 5GAND 4G2EA 1FW1A 1LJRA 3KP8A 1SKWB 4ECBA 4TXVA 3MAKA 2YOIA 4Q5FA 2CX3A 2KP1A 1VF4A 5DCHA 3H1NA 4Z2TA 3TKQA 1TRWA 2PPTA 3FZAA 2L57A 1PKWA 3GRXA 2L6DA 4AKXB 2FCHA 4RI7A 1F6MC 4YQVA 2X8CA 2OBIA 1A2LA 3CWGA 4AKGA 2L4CA 4ISDA 5CRGA 1PL2A 3GV1A 2YNXA 1FO5A 1AIUA 2QA1A 4ZB8A 3IXRA 1PL1A 2XBQA 5A4UA 5EVOA 4K7OA 3D5JA 5HR2A 5A1NA 1XBSA 1RK4A 4TW5A 1X5DA 4MDCA 3HZ8A 5G31A 1LBKA 5J40A 5COHA 4YKFA 1ACVA 1RW1A 3HJMA 2HZFA 1YZXA 4E8HA 4K2DA 1BX9A 4N0ZA 4OO5A 2ON5A 3VPTA 2H8LA 2R0PA 4XS4B 4TR1B 4KE3A 3MIXA 3I9V2 2XPDA 2OE3A 2XBIA 1XWGA 5CP1A 4LL1B 1TW9A 3F3QA 3M8NA 1FB6A 5A5HB 3KEBA 6GSVA 2LRNA 2F3MA 4V2LA 2LS5A 2C80A 2GZZA 4TXOA 4N30A 3F6DA 2RM5A 3N9JA 1O8WA 2K8SA 4LA1A 2DIZA 1JHBA 2O5VA 4AJ6A 3RBTA 3BCIA 3ZFLA 5KOWA 2AAWA 2ON7A 1MD3A 3UIWA 2VL3A 3F3RA 5J41A 3EYTA 1DE2A 2H6YA 4JE1A 4ZL7A 5IMDA 6GSSA 2F8FA 3A5WA 4KNDA 5DQSA 3KH9A 4YQUA 3TRPA 2GVPA 2I4AA 4BWQA 3UARA 4KX4A 2O89A 4MPGA 3EWLA 3GUSA 19GSA 10GSA 1H75A 1X5EA 3GX8A 1GL8A 1J9BA 4WBRD 1FVKA 4BA7A 5ABRA 4BVXA 4V1Ag 5J47A 2CVBA 2K18A 3IBHA 3EC3A 1WE0A 4ULXA 3G7IA 2IN3A 1A8LA 5E4WA 5ECOB 1MEKA 4QQ7A 4GXZA 1AW9A 2O87A 1EGRA 4J56E 4MF7A 2LQOA 2IWTA 1TRSA 2VIMA 4MJBA 1U88A 5H5QA 1TKDB 2JL4A 2DC5A 1WPIA 2H72A 11GSA 2C0FA 2EIOA 4K8MA 2K8VA 1ZYQB 1BG1A 13GSA 1OC3A 1N25A 1GLPA 4KSMA 2CAQA 4POLA 3VWUA 4X1UA 2E2GA 1TRUA 2LRCA 3HDCA 1RQMA 4PQHA 1SYXA 3H4KA 1M7TA 3GL5A 3L78A 3G7JA 2LJKA 3APQA 1K0BA 2VD0A 3ERGA 3FMWA 4F82A 4AJ8A 4HQSA 1B48A 2C0GA 16GSA 2C0DA 2YZHA 4OWYA 4LL4B 4HI7A 3DYRA 5IOXA 2XC2A 2ZNMA 4NPBA 2YPMA 1EP8A 3AY8A 9GSSA 2HRAA 2P31A 1GNEA 2GSQA 5JWQB 4FQUA 2OT3A 4AKIA 1M9AA 2NBSA 4IJ3A 1PA3A 4USSA 2NVLA 4LLRA 5AIVA 2FA4A 4F2IA 2MBTA 3W8SA 4YAVA 1BAYA 3FY7A 2IMFA 2H1GA 1T7PB 1QXHA 3HVVA 3LYKA 1AXDA 2HZEA 1FOVA 5HR3A 2H0IA 3QD9A 3EPTA 3CRUA 5EL8A 4V2MA 4I2UA 1XIYA 2CQ9A 1XOAA 5HQPA 2MZCA 1PQNA 1TI3A 1Z9HA 3HMJG 3MSZA 1A23A 1EEJA 3PINA 1THXA 3N5OA 1XVWA 1K3LA 3RPNA 2JZTA 3G9BA 2HNLA 5IM9A 1GTUA 1FHEA 1B9XC 2GSRA 5G2ZA 1GSQA 3TJFA 4N11A 2RIIA 1K3YA 5C04A 1LU4A 4YQMA 1K3OA 1S3DA 5DCGA 1SVOA 3TKSA 1J0FA 1ABAA 2A4HA 2C3QA 2AUVA 1T4YA 1Y25A 3CSIA 5KN0A 2OKAA 4NV5A 1BEDA 3EURA 2H66A 1GTAA 2OE1A 4NHZA 3KD0A 3ZIJA 1DBYA 4PUAA 2JADA 3O3TA 3PPUA 4BVXB 1M0UA 2HSHA 4JR6A 3DGQA 3QOUA 3MYDA 3CBUA 2B3SA 3ZREA 1XCCA 4YH2A 1NSWA 4O5UA 2H01A 1T3BA 1SJZA 3TCOA 4A5PA 3U6VA 4WETA 3UVHA 4GTUA 1Z6MA 4PX1A 2UZ8A 1QUWA 2PN8A 1MDIA 3TJBA 1U6TA 1ILOA 2VLVA 1SK0A 3FRCA 5ECQB 4X43A 1XXUA 3ME8A 4PURA 5JWOB 2PBJA 4XS4A 1XWKA 1KTEA 2L5LA 2PERA 4XRAA 2GQKA 2PGTA 5ECMB 4E68A 3GKMA 1B4QA 2VM2A 5ECKB 3HYPA 2WRTA 4O32A 3WGEA 1AQWA 2PVQA 1Z6NA 4Z2UA 8GSSA 3GN3A 3P90A 4EL1A 3NZNA 2H30A 5GAPD 4WF4A 20GSA 3KMNA 5F06A 3UOMA 4TR3A 4IW9A 4IS0A 3MNGA 3GH6A 5B8AA 4XRDA 2DKHA 1EWXA 4KF9A 1O6JA 2JSZA 2YJHA 4KB3A 2KHPA 2B1LA 1O8XA 5CRDA 2QGVA 3US3A 5J9BA 3QPMA 1V9WA 1EOGA 1V40A 3M9JA 4KDUA 3DEXA 1KBNA 3KH7A 5IIZA 1A24A 2IJYA 3TUEA 3KTBA 4G10A 4D73A 2HXKA 3KMOA 3TB2A 2FD3A 2YWIA 5BMUB 2OACA 5AIXA 2IFQA 3GHAA 3D22A 1Q98A 1O85A 1WRYA 3I43A 3FEUA 1HNCA 3O76A 3LWAA 3DD3A 5JWRB 1VF1A 4IBPA 3TKSE 2IL3A 3H93A 3ZITA 1PSQA 5DDLA 1NM3A 2V41A 3ED3A 4HUAA 3A5IA 1AQVA 2LTKA 1F2EA 2HE3A 2AYTA 1EZKA 2MMOA 3UAPA 1TXXA 4F0BA 4DVCA 3KCMA 1GLQA 3HVSA 3C8EA 2H19A 4OCEA 3VK9A 5A34A 3C7MA 3IAM2 4BWSA 2X4AA 3VWXA 3QFBC 4FYCA 3HZ4A 5GSSA 3CSJA 1A2JA 5KEJA 4FH8A 5IOWA 4MPFA 5FHIA 5DALA 3M9KA 3GTUB 1BYEA 1ERVA 4Z7XA 1G7OA 2NTOA 2F8AA 3GKXA 5GZZB 2H73A 4MJEA 3Q18A 2DJ2A 3P7XA 2VL2A 1Z7RA 1XW6A 4O5RA 1XW5A 1PN0A 4H86A 4POMA 1GUHA 1Q4JA 4MH2A 1SKSB 4K7NA 3D4TA 2RUEA 4E8EA 1G7EA 4XTSA 3PR8A 2R0CA 1K0CA 5AISA 4Q5QA 1SL1B 2DJKA 1ZYNA 3EVIA 2I81A 3HY2A 4XS6A 2JSYA 4PXOA 1PN9A 4MLYA 3DMLA 1F9MA 1GSSA 4Q5RA 3FZ9A 2KOKA 3LW9A 1AC1A 1YKAA 1EP7A 1K0MA 1TU8A 1UA5A 1YEPA 2GLRA 1YF1A 2H0HA 1PX7A 3IC8A 4JR4A 1B9YC 2YWMA 2VL9A 2EFEA 3ZFBA 1GNWA 1YKCA 3UBKA 3GX0A 4I8BA 3PH9A 1O81A 2DMLA 2C3NA 3P2AA 1T1VA 2BTOT 1YQ1A 3FYGA 2TIRA 3L0HA 1JZDA 2MMZA 1IYIA 1TP9A 3HXSA 3L9VA 2PU9C 1GUMA 1UVZA 1YJ6A 1K0NA 3IC4A 4HDEA 5IPGA 4WBJA 2YANA 3IK9A 1GTIA 17GSA 1YF0A 2AV4A 4MZBA 3L4NA 2HFDA 2EIRA 3D4MA 3LQ7A 3F0IA 1JZRA 12GSA 3NIVA 4D73B 4I5QA 4K0GA 5KN1A 4GSTA 1YY7A 2FA8A 1DUGA 3BOAA 2IFQB 4ILFA 3IA1A 2V32A 4MZWA 3D21A 1E2YA 5IPHA 2JU5A 2QC7A 2I1UA 3QAVA 3GKNA 3O6TA 1M2BA 3C71A 4FYUA 2VLUA 2VCQA 4TVEA 1K0OA 2CV4A 4KGIA 2N5FA 4K2XA 4IJIA 2BMXA 4TRXA 1X9MB 3A3TA 3W8JA 3V1WA 2VCTA 1A2MA 1R5PA 4G19A 4XS1A 1XPVA 4ZBBA 3QAWA 5A34B 5ECPB 4AGSA 4IHUA 2YWOA 2H6ZA 5CREA 1ON4A 5HFGA 4YAPA 4HS1A 3F63A 5BRTA 5DALB 4KW6A 2YJ7A 3GYKA 1OC9A 2CT6A 3A2WA 2AB6A 3LFLA 5E59A 3IOSA 2YV9A 1SENA 2IMKA 4O5QA 2DIYA 5D93A 1SJIA 3FR6A 4GF0A 3WGXA 4ZL8A 3DIEA 1V2AA 2LEGA 5A5KA 3EMXA 2H71A 2H76A 4RI6A 5CNWA 2HRKA 1FG4A 1SKRB 4HU7A 3A2XA 4CW9A 2P5RA 1XZOA 1TXUA 3LYPA 4TR0A 2X99A 2R3XA 1C72A 1N2AA 3Q74A 2YV7A 3IHGA 1QMVA 3LGCA 3F6FA 1T4ZA 2EFCA 4ECJA 1ZZYA 3ZZXA 1THOA 4GQCA 3U5RE 3GA4A 2DSAA 3Q19A 4MJAA 1X9SB 4IP1A 2M46A 4GWRA 2HSNA 1EV4A 3RHCA 4L0WA 5DJLA 3L9UA 1R26A 2P0GA 5G1LA 5BMUA 3WT2A 2DJ3A 4W66A 4WEYA 1DE1A 3D0ZA 1OE7A 3DKSA 3ME7A 1TK0B 2N5AA 1AAZA 5EPFA 2R2JA 2QA2A 2H1LA 3ERWA 3ZYWA 2N5BA 3NOFA 4V2NA 1ZCPA 4EXJA 3IK7A 2LRTA 2REMA 3TJKA 1Z3EA 2LNSA 4Q5NA 1FOHA 1AUCA 4MJCA 1ERUA 1V57A 4KSOA 1XW9A 1F3BA 2GT6A 4EIPA 1PD21 2A4VA 1HYUA 1GP1A 2AHEA 1OE8A 5C00A 2GSTA 4GSSA 4ICYA 1SL2B 2E7PA 2HLSA 2R6KA 1TOFA 4TN8A 1NHYA 3EU3A 1GSEA 3TOTA 5J4YA 5G5FA 3LXTA 5F0GA 5IMAA 4QL9A 3UL3A 5KOXA 2CX4A 1SK2A 2H1BA 2WULA 4GCIA 2FWFA 2FLSA 1YDKA 4GDFA 5D96A 3GTUA 3GIXA 1URMA 4PQIA 2VD1A 4GQFA 1UC7A 3TKRA 2ALBA 1TI1A 5IMCA 2M72A 3WGDA 3ERFA 2UV8G 3CMIA 2JACA 2YZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH2 A;  5B8B A;  5D9X A;  4IQ1 A;  1DSB A;  1X0R A;  4TKY A;  1M99 A;  3UJ1 A;  4G0K A;  3HHV A;  2HSM B;  3GUR A;  3CTG A;  2EIQ A;  1A0F A;  1EGO A;  3HKR A;  1CQG A;  5KN2 A;  1JLW A;  2CZ2 A;  4O92 A;  3A2V A;  3GNJ A;  3M1G A;  2HQT A;  2LNT A;  4EKZ A;  4EF0 A;  3Q6O A;  3R3E A;  1HNB A;  5IO2 A;  1TRV A;  5CO3 A;  5EY6 A;  1OC9 B;  3TDG A;  2B5Y A;  2X8G A;  5ID2 A;  1SYR A;  1EEM A;  5B7C A;  4L0U A;  3WYW A;  3QDN A;  2L4Q A;  3CSH A;  2FY6 A;  5ECR B;  5AN1 A;  3DWV A;  3F4S A;  1U87 A;  4KUN A;  2A2R A;  4FIW A;  2D2Z A;  2GSS A;  3LSZ A;  3APS A;  3GL3 A;  4F03 A;  3C1R A;  5H5S A;  5DJM A;  1GUK A;  4ML6 A;  2OA7 A;  2HRK B;  2EC4 A;  4POK A;  2GGT A;  4KH7 A;  2H1A A;  1BQ7 A;  4IN0 A;  3QCP A;  5D73 A;  2LKU A;  3DVW A;  4JBB A;  4IP6 A;  3MDK A;  2WS2 A;  4G0L A;  5IO0 A;  4ECI A;  3FZ4 A;  2P5Q A;  4I2T A;  1VF2 A;  3ZVJ A;  5CAX A;  1R7H A;  3M0F A;  4HJ2 A;  3IAS 2;  1R4W A;  2OJL A;  2O8V B;  2G2Q A;  3D6I A;  4GRF A;  2HSN B;  3BD2 A;  4MK3 A;  3F8U A;  1TK5 B;  4HU9 A;  1QGV A;  4IGJ A;  5ECH B;  3EE2 A;  1GUL A;  2PWJ A;  3TRQ A;  2C0E A;  2IMD A;  4EDY A;  2GZY A;  3KGK A;  2H6X A;  1ZGN A;  4J57 E;  2WDU A;  1K0D A;  2GTU A;  4ZB6 A;  3HJP A;  5FWG A;  3DVX A;  4K1F A;  1WP0 A;  1ST9 A;  1XOB A;  4EDZ A;  2JZS A;  3BBY A;  6GSW A;  1ERW A;  3FW2 A;  3KP9 A;  2B7J A;  3TRX A;  4BVY A;  3HD5 A;  2WFC A;  2H70 A;  2IMI A;  3PGT A;  4I6X A;  1EOH A;  3LJR A;  2YN1 A;  2F51 A;  2R37 A;  4HZ4 A;  1Z5Y E;  2XPE A;  1WIK A;  4X0X A;  1G6W A;  3LG6 A;  5HR0 A;  2QSI A;  4POB A;  1HD2 A;  2WZ9 A;  1OAZ A;  1GSD A;  5IQY A;  3CXG A;  1NW2 A;  2Z9S A;  2LJA A;  3HVX A;  1HQO A;  2DJ0 A;  2HRN A;  2B5E A;  1IYH A;  2E2M A;  1VGL A;  1FB0 A;  3FK8 A;  2HT9 A;  2LUS A;  3QAG A;  2B1K A;  1WMJ A;  1T00 A;  3I6A A;  1ZYE A;  5D9T A;  3VWV A;  4RUV A;  5B6N A;  3FZ5 A;  1O7U A;  3WT1 A;  2NDO A;  4V1A p;  5H5R A;  2CVD A;  2CVK A;  3GKK A;  4TOP A;  2GQM A;  1BG5 A;  1EV9 A;  2DBC A;  2VCZ A;  3GH9 A;  6GSY A;  1G0T A;  1J08 A;  2RM6 A;  3HA9 A;  4ML1 A;  1WOU A;  2KP2 A;  5ENU A;  2DJJ A;  3C73 A;  4J2F A;  1KNG A;  2HYX A;  2ES7 A;  5J5N A;  2PUK C;  3LXZ A;  5JCG A;  2VLT A;  2FHE A;  4CDO A;  5ID2 B;  1OYJ A;  4LMW A;  4WR5 A;  2XHF A;  3RAZ A;  3GST A;  4QL7 A;  2VM1 A;  2VUP A;  3TJJ A;  1E6B A;  2WGR A;  1WWJ A;  3MWH A;  2V1M A;  2V2G A;  2QKE A;  2CZ3 A;  2V6O A;  2YWN A;  5ECS A;  2CA8 A;  5D9W A;  3VLN A;  4MA9 A;  1N8J A;  3P8W A;  3J7Y b;  5CYY A;  3TOU A;  4DEJ A;  2H74 A;  3E3E A;  2YCD A;  3IRA A;  5DAK A;  4NMU A;  4HEA 2;  2OBK A;  3I69 A;  4PNF A;  4TR4 A;  4G9H A;  1MDK A;  5JCU A;  1GTB A;  4PGT A;  2G0F A;  2A2S A;  1OKD A;  4ECC A;  1PMT A;  4FO5 A;  1KEB A;  3KJY A;  3C1S A;  2B7K A;  2C4J A;  1H4O A;  5CRH A;  1X5C A;  3HJO A;  2TRC P;  2F9S A;  1PGT A;  4PUF C;  1AQX A;  4KDY A;  3CRT A;  5HFK A;  4KCE A;  2YP6 A;  1GSF A;  4OCF A;  3R2Q A;  4MF6 A;  1Z7P A;  5KN3 A;  4MZC A;  2B5X A;  3IE3 A;  5AGY A;  22GS A;  3TJG A;  4AF2 A;  1YEX A;  4I97 A;  1XWB A;  2WB9 A;  4BPY A;  3JCM L;  2VOC A;  2FGX A;  2PVO C;  3IHQ A;  3GSS A;  2O85 A;  2HSY A;  5DBQ A;  1QFN A;  4BL7 B;  4BVY B;  4ZBA A;  2OE0 A;  1JFU A;  1ML6 A;  2HSM A;  5F8B A;  2FWE A;  5LD0 A;  4P3Y B;  1TK8 B;  5FT3 A;  5ECL B;  2LV3 A;  3CYN A;  4EC0 A;  1ZL9 A;  4WR4 A;  5GST A;  2C8U A;  1ERT A;  5L71 A;  2GQL A;  3ISO A;  2FWH A;  4ID0 A;  3E9J B;  5ECN B;  1W89 A;  1MD4 A;  2LQQ A;  3GMF A;  5J9C A;  2H75 A;  2KUC A;  1SD8 A;  4NXI A;  3W6G A;  2O7K A;  4L5O A;  3OR5 A;  4K9Z A;  3VUR A;  4L5L A;  2I9H A;  4ZB9 A;  4HJM A;  3LEF A;  2HI7 A;  4LMV A;  1TJD A;  3VI5 A;  1JZW A;  2PMT A;  4OD7 A;  4JRR A;  4DSR A;  4ZL9 A;  4KA0 A;  4JED A;  5G1K A;  2FNO A;  18GS A;  4WXT A;  3RHB A;  1SU9 A;  1JLV A;  2GZP A;  2C3T A;  2K9F A;  2R5G A;  1F3A A;  1ZMA A;  3FHK A;  4JZQ A;  1OVN A;  2BJX A;  2KLX A;  2RUF A;  5F07 A;  1ZOF A;  1XWA A;  4GLT A;  4NAX A;  3LOR A;  3TKP A;  3UEM A;  5IMV A;  3F4T A;  1SD9 A;  4K6X A;  4MAB A;  2B6M A;  4FYB A;  2X64 A;  2FWG A;  2FUG 2;  5D9V A;  4DSS A;  4XIH A;  1WJK A;  5J4U A;  3F9U A;  2WCI A;  2DJ1 A;  5A4W A;  2H0G A;  1A8Y A;  5DVB A;  1S3A A;  1TU7 A;  4MMM A;  3QMX A;  2JZR A;  4KDX A;  2E0Q A;  3VFI A;  4GSN A;  5IMZ A;  3VPQ A;  1TDI A;  1OKT A;  1PX6 A;  5DAK B;  1MTC A;  3ZML A;  3ZLP A;  2VCX A;  3UMA A;  3BCK A;  4OO4 A;  2J9H A;  4O7H A;  5D8I A;  1T8E B;  2X8H A;  3IR4 A;  2TRX A;  4K0N A;  1XFL A;  1FVJ A;  4TXO B;  2OAD A;  3TKS C;  2R4V A;  1NHO A;  5HFI A;  4ZBD A;  4OFN A;  3S9F A;  1GSY A;  3FR9 A;  4RQX A;  2DMM A;  4MF5 A;  5LCZ A;  1QQ2 A;  2M80 A;  4CHS A;  4WF5 A;  2K6V A;  5B6M A;  1G6Y A;  4NWY A;  3EU4 A;  3KTL A;  1I5G A;  4WKW A;  7GSS A;  4KCA A;  1M9B A;  4F0C A;  6GST A;  4NV2 A;  5ELG A;  5LNK e;  1U3I A;  3RPP A;  6GSU A;  2RLI A;  1V98 A;  3G7Y A;  2ZUP A;  3APO A;  2J23 A;  3DXB A;  5J3R A;  3M3M A;  3KIJ A;  1MDJ A;  3IV4 A;  5HR1 A;  1M2A A;  2DLX A;  1BJX A;  3CTF A;  4PQ1 A;  4AJ7 A;  4PNG A;  4HZ2 A;  4EVM A;  2I3Y A;  2MMA A;  2L6C A;  4ACS A;  5ECI B;  2C1Y A;  2IPA A;  3ZIV A;  2AJQ B;  3ZVJ D;  3KM6 A;  1SK1 A;  4IEL A;  4RQR A;  1TTZ A;  3H8Q A;  5IMF A;  3ZTL A;  1W4V A;  5G5E A;  3IPZ A;  1A0R P;  2MYG A;  1SJ6 A;  3K8N A;  3EMP A;  1VF3 A;  2IME A;  4JU5 A;  1UN2 A;  3F4R A;  3GFK A;  4XHM A;  2VAF A;  1QK8 A;  3DRN A;  1R5A A;  3VWW A;  3UBL A;  4ZIJ A;  3QR6 A;  5INY A;  4TR1 A;  4EO3 A;  4EUY A;  4EE0 A;  1XWC A;  3E0U A;  1B8X A;  4NHW A;  4PTS A;  2ZCT A;  3QFA C;  2GS3 A;  3KZQ A;  3IDV A;  4DSQ A;  1SL0 B;  4ZXG A;  1F37 A;  3ZL5 A;  1V58 A;  3RDW A;  4DSS B;  2V6K A;  1S3C A;  2GT5 A;  5A4V A;  3KXO A;  1OC8 A;  4HOJ A;  1JZO A;  3H79 A;  5ELA A;  2LJR A;  2WJU A;  4IVF A;  1U3A A;  1I9D A;  14GS A;  3TGZ A;  5CRW A;  1PKZ A;  1GSU A;  5F05 A;  1K0A A;  2H1D A;  2MBS A;  1USB A;  4L8E A;  2MMN A;  2VCV A;  4OMV A;  1VRS D;  3J7Y k;  1Y6E A;  4OFM A;  1B4P A;  3EIN A;  3FR3 A;  4N0V A;  3SWL A;  4BL7 A;  2GDR A;  4IQA A;  1CQH A;  2HZE B;  4MP4 A;  2VO4 A;  3WD6 A;  4IKH A;  1M2D A;  3HCZ A;  5G30 A;  3ZRD A;  1FAA A;  1PRX A;  2L59 A;  1XVQ A;  4XCS A;  2CAI A;  2VL2 C;  1O73 A;  3ZMK A;  5JCW A;  3BJ5 A;  4K7I A;  1X9W B;  2L5O A;  2HRF A;  1GRX A;  6GSX A;  2LST A;  3SBC A;  4HQZ A;  5DQY A;  4ZIL A;  3L9S A;  3FKF A;  1GWC A;  4MCU A;  3VI7 A;  4F9Z A;  1HNA A;  4KAE A;  4OFT A;  4N10 A;  4G0I A;  2VCW A;  2IIY A;  2NPB A;  3UVT A;  4MH3 A;  5GAN D;  4G2E A;  1FW1 A;  1LJR A;  3KP8 A;  1SKW B;  4ECB A;  4TXV A;  3MAK A;  2YOI A;  4Q5F A;  2CX3 A;  2KP1 A;  1VF4 A;  5DCH A;  3H1N A;  3TKQ A;  1TRW A;  2PPT A;  3FZA A;  2L57 A;  1PKW A;  3GRX A;  2L6D A;  2FCH A;  4RI7 A;  1F6M C;  4YQV A;  2X8C A;  2OBI A;  1A2L A;  2L4C A;  4ISD A;  5CRG A;  1PL2 A;  3GV1 A;  2YNX A;  1FO5 A;  1AIU A;  4ZB8 A;  3IXR A;  1PL1 A;  2XBQ A;  5A4U A;  5EVO A;  4K7O A;  3D5J A;  5HR2 A;  1XBS A;  1RK4 A;  4TW5 A;  1X5D A;  4MDC A;  3HZ8 A;  5G31 A;  1LBK A;  5COH A;  1ACV A;  1RW1 A;  3HJM A;  2HZF A;  1YZX A;  4E8H A;  4K2D A;  1BX9 A;  4N0Z A;  4OO5 A;  2ON5 A;  3VPT A;  2H8L A;  4XS4 B;  4TR1 B;  4KE3 A;  3I9V 2;  2XPD A;  2OE3 A;  2XBI A;  1XWG A;  5CP1 A;  4LL1 B;  1TW9 A;  3F3Q A;  3M8N A;  1FB6 A;  3KEB A;  6GSV A;  2LRN A;  2F3M A;  4V2L A;  2LS5 A;  2C80 A;  2GZZ A;  4TXO A;  4N30 A;  3F6D A;  2RM5 A;  3N9J A;  1O8W A;  2K8S A;  4LA1 A;  2DIZ A;  1JHB A;  4AJ6 A;  3RBT A;  3BCI A;  3ZFL A;  2AAW A;  2ON7 A;  1MD3 A;  3UIW A;  2VL3 A;  3F3R A;  5J41 A;  3EYT A;  1DE2 A;  2H6Y A;  4JE1 A;  4ZL7 A;  5IMD A;  6GSS A;  2F8F A;  3A5W A;  4KND A;  5DQS A;  3KH9 A;  4YQU A;  3TRP A;  2GVP A;  2I4A A;  4BWQ A;  3UAR A;  4KX4 A;  2O89 A;  4MPG A;  3EWL A;  3GUS A;  19GS A;  10GS A;  1H75 A;  1X5E A;  3GX8 A;  1GL8 A;  1J9B A;  4WBR D;  1FVK A;  4BA7 A;  5ABR A;  4BVX A;  4V1A g;  2CVB A;  2K18 A;  3IBH A;  3EC3 A;  1WE0 A;  4ULX A;  3G7I A;  2IN3 A;  1A8L A;  5E4W A;  5ECO B;  1MEK A;  4QQ7 A;  4GXZ A;  1AW9 A;  2O87 A;  1EGR A;  4J56 E;  4MF7 A;  2LQO A;  2IWT A;  1TRS A;  2VIM A;  4MJB A;  1U88 A;  5H5Q A;  1TKD B;  2JL4 A;  2DC5 A;  1WPI A;  2H72 A;  11GS A;  2C0F A;  2EIO A;  4K8M A;  2K8V A;  1ZYQ B;  13GS A;  1OC3 A;  1GLP A;  4KSM A;  2CAQ A;  4POL A;  3VWU A;  4X1U A;  2E2G A;  1TRU A;  2LRC A;  3HDC A;  1RQM A;  4PQH A;  1SYX A;  3H4K A;  1M7T A;  3GL5 A;  3L78 A;  3G7J A;  2LJK A;  3APQ A;  1K0B A;  2VD0 A;  3ERG A;  4F82 A;  4AJ8 A;  4HQS A;  1B48 A;  2C0G A;  16GS A;  2C0D A;  2YZH A;  4OWY A;  4LL4 B;  4HI7 A;  3DYR A;  5IOX A;  2XC2 A;  2ZNM A;  4NPB A;  2YPM A;  1EP8 A;  3AY8 A;  9GSS A;  2HRA A;  2P31 A;  1GNE A;  2GSQ A;  5JWQ B;  4FQU A;  1M9A A;  2NBS A;  4IJ3 A;  1PA3 A;  4USS A;  2NVL A;  4LLR A;  5AIV A;  2FA4 A;  4F2I A;  2MBT A;  3W8S A;  4YAV A;  1BAY A;  3FY7 A;  2IMF A;  2H1G A;  1T7P B;  1QXH A;  3HVV A;  3LYK A;  1AXD A;  2HZE A;  1FOV A;  5HR3 A;  2H0I A;  3QD9 A;  3CRU A;  5EL8 A;  4V2M A;  4I2U A;  1XIY A;  2CQ9 A;  1XOA A;  5HQP A;  2MZC A;  1PQN A;  1TI3 A;  1Z9H A;  3MSZ A;  1A23 A;  1EEJ A;  3PIN A;  1THX A;  3N5O A;  1XVW A;  1K3L A;  3RPN A;  2JZT A;  3G9B A;  2HNL A;  5IM9 A;  1GTU A;  1FHE A;  1B9X C;  2GSR A;  5G2Z A;  1GSQ A;  3TJF A;  4N11 A;  2RII A;  1K3Y A;  5C04 A;  1LU4 A;  4YQM A;  1K3O A;  1S3D A;  5DCG A;  3TKS A;  1J0F A;  1ABA A;  2C3Q A;  2AUV A;  1T4Y A;  1Y25 A;  3CSI A;  5KN0 A;  2OKA A;  4NV5 A;  1BED A;  3EUR A;  2H66 A;  1GTA A;  2OE1 A;  4NHZ A;  3KD0 A;  3ZIJ A;  1DBY A;  4PUA A;  2JAD A;  3O3T A;  3PPU A;  4BVX B;  1M0U A;  2HSH A;  4JR6 A;  3DGQ A;  3QOU A;  3CBU A;  2B3S A;  3ZRE A;  1XCC A;  4YH2 A;  1NSW A;  2H01 A;  1T3B A;  1SJZ A;  3TCO A;  3U6V A;  4WET A;  3UVH A;  4GTU A;  1Z6M A;  4PX1 A;  2UZ8 A;  1QUW A;  2PN8 A;  1MDI A;  3TJB A;  1U6T A;  1ILO A;  2VLV A;  1SK0 A;  3FRC A;  5ECQ B;  4X43 A;  1XXU A;  3ME8 A;  4PUR A;  5JWO B;  2PBJ A;  4XS4 A;  1XWK A;  1KTE A;  2L5L A;  2PER A;  4XRA A;  2GQK A;  2PGT A;  5ECM B;  3GKM A;  1B4Q A;  2VM2 A;  5ECK B;  3HYP A;  2WRT A;  4O32 A;  3WGE A;  1AQW A;  2PVQ A;  1Z6N A;  8GSS A;  3GN3 A;  3P90 A;  4EL1 A;  3NZN A;  2H30 A;  5GAP D;  4WF4 A;  20GS A;  3KMN A;  5F06 A;  3UOM A;  4TR3 A;  4IW9 A;  4IS0 A;  3MNG A;  3GH6 A;  5B8A A;  4XRD A;  1EWX A;  4KF9 A;  1O6J A;  2JSZ A;  2YJH A;  4KB3 A;  2KHP A;  2B1L A;  1O8X A;  5CRD A;  2QGV A;  3US3 A;  5J9B A;  3QPM A;  1V9W A;  1EOG A;  1V40 A;  3M9J A;  4KDU A;  3DEX A;  1KBN A;  3KH7 A;  5IIZ A;  1A24 A;  2IJY A;  3TUE A;  3KTB A;  4G10 A;  4D73 A;  2HXK A;  3KMO A;  3TB2 A;  2FD3 A;  2YWI A;  2OAC A;  5AIX A;  2IFQ A;  3GHA A;  3D22 A;  1Q98 A;  1O85 A;  1WRY A;  3I43 A;  3FEU A;  1HNC A;  3O76 A;  3LWA A;  3DD3 A;  5JWR B;  1VF1 A;  4IBP A;  3TKS E;  2IL3 A;  3H93 A;  3ZIT A;  1PSQ A;  5DDL A;  1NM3 A;  2V41 A;  3ED3 A;  4HUA A;  1AQV A;  2LTK A;  1F2E A;  2HE3 A;  2AYT A;  1EZK A;  2MMO A;  3UAP A;  1TXX A;  4F0B A;  4DVC A;  3KCM A;  1GLQ A;  3HVS A;  3C8E A;  2H19 A;  4OCE A;  3VK9 A;  3C7M A;  3IAM 2;  4BWS A;  3QFB C;  3VWX A;  4FYC A;  3HZ4 A;  5GSS A;  3CSJ A;  1A2J A;  5KEJ A;  4FH8 A;  5IOW A;  4MPF A;  5FHI A;  5DAL A;  3M9K A;  3GTU B;  1BYE A;  1ERV A;  4Z7X A;  1G7O A;  2NTO A;  2F8A A;  3GKX A;  5GZZ B;  2H73 A;  4MJE A;  3Q18 A;  2DJ2 A;  3P7X A;  2VL2 A;  1Z7R A;  1XW6 A;  4O5R A;  1XW5 A;  4H86 A;  4POM A;  1GUH A;  1Q4J A;  4MH2 A;  1SKS B;  4K7N A;  3D4T A;  2RUE A;  4E8E A;  1G7E A;  4XTS A;  3PR8 A;  1K0C A;  5AIS A;  4Q5Q A;  1SL1 B;  2DJK A;  3EVI A;  2I81 A;  3HY2 A;  4XS6 A;  2JSY A;  4PXO A;  1PN9 A;  4MLY A;  3DML A;  1F9M A;  1GSS A;  4Q5R A;  3FZ9 A;  2KOK A;  1AC1 A;  1YKA A;  1EP7 A;  1K0M A;  1TU8 A;  1UA5 A;  1YEP A;  2GLR A;  1YF1 A;  2H0H A;  1PX7 A;  3IC8 A;  4JR4 A;  1B9Y C;  2YWM A;  2VL9 A;  3ZFB A;  1GNW A;  1YKC A;  3UBK A;  3GX0 A;  4I8B A;  3PH9 A;  1O81 A;  2DML A;  2C3N A;  3P2A A;  1T1V A;  2BTO T;  1YQ1 A;  3FYG A;  2TIR A;  3L0H A;  1JZD A;  2MMZ A;  1IYI A;  1TP9 A;  3HXS A;  3L9V A;  2PU9 C;  1GUM A;  1UVZ A;  1YJ6 A;  1K0N A;  3IC4 A;  4HDE A;  5IPG A;  4WBJ A;  2YAN A;  3IK9 A;  1GTI A;  17GS A;  1YF0 A;  2AV4 A;  4MZB A;  3L4N A;  2HFD A;  2EIR A;  3D4M A;  3LQ7 A;  3F0I A;  1JZR A;  12GS A;  3NIV A;  4D73 B;  4I5Q A;  4K0G A;  5KN1 A;  4GST A;  1YY7 A;  2FA8 A;  1DUG A;  3BOA A;  2IFQ B;  4ILF A;  3IA1 A;  2V32 A;  4MZW A;  3D21 A;  1E2Y A;  5IPH A;  2JU5 A;  2QC7 A;  2I1U A;  3QAV A;  3GKN A;  3O6T A;  1M2B A;  3C71 A;  4FYU A;  2VLU A;  2VCQ A;  4TVE A;  1K0O A;  2CV4 A;  4KGI A;  2N5F A;  4IJI A;  2BMX A;  4TRX A;  1X9M B;  3A3T A;  3W8J A;  3V1W A;  2VCT A;  1A2M A;  1R5P A;  4G19 A;  4XS1 A;  1XPV A;  4ZBB A;  3QAW A;  5ECP B;  4AGS A;  4IHU A;  2YWO A;  2H6Z A;  5CRE A;  1ON4 A;  5HFG A;  4YAP A;  4HS1 A;  3F63 A;  5DAL B;  4KW6 A;  2YJ7 A;  3GYK A;  1OC9 A;  2CT6 A;  3A2W A;  2AB6 A;  3LFL A;  5E59 A;  3IOS A;  2YV9 A;  1SEN A;  2IMK A;  2DIY A;  5D93 A;  1SJI A;  3FR6 A;  4GF0 A;  3WGX A;  4ZL8 A;  3DIE A;  1V2A A;  2LEG A;  5A5K A;  3EMX A;  2H71 A;  2H76 A;  4RI6 A;  5CNW A;  2HRK A;  1FG4 A;  1SKR B;  4HU7 A;  3A2X A;  4CW9 A;  2P5R A;  1XZO A;  4TR0 A;  3LYP A;  2X99 A;  2R3X A;  1C72 A;  1N2A A;  3Q74 A;  2YV7 A;  1QMV A;  3LGC A;  3F6F A;  1T4Z A;  4ECJ A;  1ZZY A;  3ZZX A;  1THO A;  4GQC A;  3U5R E;  3GA4 A;  2DSA A;  3Q19 A;  4MJA A;  1X9S B;  4IP1 A;  2M46 A;  4GWR A;  1EV4 A;  3RHC A;  4L0W A;  5DJL A;  3L9U A;  1R26 A;  2P0G A;  5G1L A;  5BMU A;  3WT2 A;  2DJ3 A;  4WEY A;  1DE1 A;  3D0Z A;  1OE7 A;  3DKS A;  3ME7 A;  1TK0 B;  2N5A A;  1AAZ A;  5EPF A;  2R2J A;  3ERW A;  3ZYW A;  2N5B A;  3NOF A;  4V2N A;  1ZCP A;  4EXJ A;  3IK7 A;  2LRT A;  2REM A;  3TJK A;  1Z3E A;  2LNS A;  4Q5N A;  1AUC A;  4MJC A;  1ERU A;  1V57 A;  4KSO A;  1XW9 A;  1F3B A;  2GT6 A;  1PD2 1;  2A4V A;  1HYU A;  1GP1 A;  2AHE A;  1OE8 A;  5C00 A;  2GST A;  4GSS A;  1SL2 B;  2E7P A;  2HLS A;  2R6K A;  1TOF A;  4TN8 A;  1NHY A;  3EU3 A;  1GSE A;  3TOT A;  5G5F A;  3LXT A;  5F0G A;  5IMA A;  4QL9 A;  3UL3 A;  2CX4 A;  1SK2 A;  2H1B A;  2WUL A;  4GCI A;  2FWF A;  2FLS A;  1YDK A;  5D96 A;  3GTU A;  3GIX A;  1URM A;  4PQI A;  2VD1 A;  4GQF A;  1UC7 A;  3TKR A;  2ALB A;  1TI1 A;  5IMC A;  2M72 A;  3WGD A;  3ERF A;  3CMI A;  2JAC A;  2YZU A; 
#chains in the Genus database with same CATH topology
 1GH2 A;  5B8B A;  5D9X A;  4IQ1 A;  1DSB A;  1X0R A;  4TKY A;  1M99 A;  3UJ1 A;  4G0K A;  3HHV A;  2HSM B;  3GUR A;  3CTG A;  2EIQ A;  1A0F A;  1EGO A;  3HKR A;  4AI6 A;  1CQG A;  5KN2 A;  1JLW A;  2CZ2 A;  4O92 A;  3A2V A;  2X49 A;  3GNJ A;  3M1G A;  2HQT A;  2LNT A;  4EKZ A;  4EF0 A;  3Q6O A;  3R3E A;  1HNB A;  5IO2 A;  1TRV A;  5CO3 A;  5EY6 A;  1OC9 B;  3TDG A;  2B5Y A;  4FXY P;  2X8G A;  5ID2 A;  1SYR A;  1EEM A;  5B7C A;  4L0U A;  3TU3 B;  3WYW A;  3QDN A;  2L4Q A;  3CSH A;  2FY6 A;  5ECR B;  5AN1 A;  3DWV A;  3F4S A;  1U87 A;  4KUN A;  2A2R A;  4FIW A;  2D2Z A;  2GSS A;  3LSZ A;  3APS A;  3GL3 A;  4F03 A;  3C1R A;  5H5S A;  5DJM A;  1GUK A;  4ML6 A;  2OA7 A;  2HRK B;  2EC4 A;  4POK A;  2GGT A;  4X4J A;  4KH7 A;  2H1A A;  1BQ7 A;  4IN0 A;  3QCP A;  5D73 A;  2LKU A;  3DVW A;  4JBB A;  4IP6 A;  3MDK A;  2WS2 A;  5J4V A;  4G0L A;  5IO0 A;  4ECI A;  3FZ4 A;  2P5Q A;  4I2T A;  1VF2 A;  3ZVJ A;  5CAX A;  1R7H A;  3M0F A;  4HJ2 A;  3IAS 2;  1R4W A;  2OJL A;  2O8V B;  2G2Q A;  3D6I A;  4GRF A;  2HSN B;  3BD2 A;  4MK3 A;  3F8U A;  1TK5 B;  4HU9 A;  1QGV A;  4IGJ A;  3CHX C;  5ECH B;  3EE2 A;  1GUL A;  2PWJ A;  3TRQ A;  2C0E A;  2IMD A;  4EDY A;  2GZY A;  3KGK A;  2H6X A;  1ZGN A;  4J57 E;  2WDU A;  1K0D A;  2GTU A;  4ZB6 A;  4ZB7 A;  3HJP A;  5FWG A;  3DVX A;  4K1F A;  1WP0 A;  1ST9 A;  1XOB A;  4EDZ A;  2JZS A;  3BBY A;  1YVL A;  6GSW A;  1ERW A;  3FW2 A;  3KP9 A;  2B7J A;  3TRX A;  4BVY A;  3HD5 A;  2WFC A;  2H70 A;  2IMI A;  3PGT A;  4I6X A;  1EOH A;  3LJR A;  2YN1 A;  2F51 A;  2R37 A;  4HZ4 A;  1Z5Y E;  2XPE A;  1WIK A;  4X0X A;  1G6W A;  3LG6 A;  5HR0 A;  2QSI A;  4POB A;  1HD2 A;  2WZ9 A;  1OAZ A;  1GSD A;  5IQY A;  3CXG A;  1NW2 A;  2Z9S A;  2LJA A;  3HVX A;  1HQO A;  2DJ0 A;  2HRN A;  2B5E A;  1IYH A;  2E2M A;  1VGL A;  1FB0 A;  3FK8 A;  2HT9 A;  2LUS A;  2O3E A;  3QAG A;  2B1K A;  1WMJ A;  1T00 A;  3I6A A;  1ZYE A;  5D9T A;  3VWV A;  4RUV A;  5B6N A;  3FZ5 A;  1O7U A;  3WT1 A;  4PI0 C;  2NDO A;  4V1A p;  5H5R A;  2CVD A;  2CVK A;  3GKK A;  4TOP A;  2GQM A;  1BG5 A;  1EV9 A;  2DBC A;  2VCZ A;  3GH9 A;  6GSY A;  1G0T A;  1J08 A;  2RM6 A;  3HA9 A;  4ML1 A;  1WOU A;  2KP2 A;  5ENU A;  2DJJ A;  3C73 A;  4J2F A;  1KNG A;  2HYX A;  2ES7 A;  5J5N A;  2PUK C;  2VKZ G;  3LXZ A;  5JCG A;  2VLT A;  2FHE A;  4CDO A;  5ID2 B;  1OYJ A;  4LMW A;  4WR5 A;  2XHF A;  3RAZ A;  3GST A;  4QL7 A;  2VM1 A;  2VUP A;  3TJJ A;  1E6B A;  2WGR A;  1WWJ A;  3MWH A;  2V1M A;  3RGB C;  2V2G A;  2QKE A;  2CZ3 A;  2V6O A;  2YWN A;  5ECS A;  2CA8 A;  5D9W A;  3VLN A;  4MA9 A;  1N8J A;  3P8W A;  3J7Y b;  5CYY A;  3TOU A;  4DEJ A;  2H74 A;  3E3E A;  2YCD A;  3IRA A;  5DAK A;  4NMU A;  4HEA 2;  2OBK A;  3I69 A;  4PNF A;  4TR4 A;  4G9H A;  1MDK A;  5JCU A;  1GTB A;  4PGT A;  2G0F A;  2A2S A;  1OKD A;  4ECC A;  1PMT A;  4FO5 A;  1KEB A;  3KJY A;  3C1S A;  2WVX A;  2B7K A;  2C4J A;  1H4O A;  5CRH A;  1X5C A;  4N3Z A;  3HJO A;  2TRC P;  2F9S A;  1PGT A;  4PUF C;  1AQX A;  4KDY A;  3CRT A;  5HFK A;  4KCE A;  2YP6 A;  1GSF A;  4OCF A;  3R2Q A;  4MF6 A;  1Z7P A;  5KN3 A;  4MZC A;  2B5X A;  3IE3 A;  5AGY A;  22GS A;  3TJG A;  4AF2 A;  1YEX A;  4I97 A;  1XWB A;  2WB9 A;  4BPY A;  3JCM L;  2VOC A;  2FGX A;  4MNN A;  2PVO C;  3IHQ A;  3GSS A;  2O85 A;  2HSY A;  5DBQ A;  1QFN A;  4BL7 B;  4BVY B;  4ZBA A;  2OE0 A;  1JFU A;  1ML6 A;  2HSM A;  5F8B A;  2FWE A;  5LD0 A;  4P3Y B;  1TK8 B;  5FT3 A;  5ECL B;  2LV3 A;  3CYN A;  4EC0 A;  1ZL9 A;  4WR4 A;  5GST A;  2C8U A;  1ERT A;  5L71 A;  2GQL A;  3ISO A;  2FWH A;  4ID0 A;  3E9J B;  4CY8 A;  5ECN B;  1W89 A;  1MD4 A;  2LQQ A;  3GMF A;  5J9C A;  1M3J A;  2H75 A;  2KUC A;  2WW2 A;  1SD8 A;  4NXI A;  3W6G A;  2O7K A;  4L5O A;  3OR5 A;  4K9Z A;  3VUR A;  4L5L A;  2I9H A;  4ZB9 A;  4HJM A;  3LEF A;  2HI7 A;  4LMV A;  1TJD A;  3VI5 A;  1JZW A;  2PMT A;  4OD7 A;  4JRR A;  4DSR A;  4ZL9 A;  4AKH A;  4KA0 A;  4JED A;  5G1K A;  2FNO A;  18GS A;  4WXT A;  3RHB A;  1SU9 A;  1JLV A;  2GZP A;  2C3T A;  2K9F A;  2R5G A;  1F3A A;  1ZMA A;  3FHK A;  4JZQ A;  1OVN A;  2BJX A;  2KLX A;  2RUF A;  5F07 A;  1ZOF A;  1XWA A;  4GLT A;  4NAX A;  3LOR A;  3TKP A;  3UEM A;  5IMV A;  3F4T A;  1SD9 A;  4K6X A;  4MAB A;  2B6M A;  4FYB A;  2X64 A;  2FWG A;  2FUG 2;  5D9V A;  4DSS A;  4XIH A;  1WJK A;  5J4U A;  3F9U A;  2WCI A;  2DJ1 A;  5A4W A;  2H0G A;  1A8Y A;  5DVB A;  1S3A A;  1TU7 A;  4MMM A;  3QMX A;  5A1N B;  2JZR A;  4KDX A;  2E0Q A;  3VFI A;  4GSN A;  5IMZ A;  3VPQ A;  1TDI A;  1OKT A;  1PX6 A;  5DAK B;  1MTC A;  3ZML A;  3ZLP A;  2VCX A;  3UMA A;  3BCK A;  4OO4 A;  2J9H A;  4O7H A;  5D8I A;  1T8E B;  2X8H A;  3IR4 A;  2TRX A;  4K0N A;  1XFL A;  1FVJ A;  4TXO B;  2OAD A;  3TKS C;  2R4V A;  1NHO A;  4YKG A;  2WVX B;  5HFI A;  4ZBD A;  4OFN A;  3S9F A;  1GSY A;  3FR9 A;  4RQX A;  2DMM A;  4MF5 A;  5LCZ A;  1QQ2 A;  2M80 A;  4CHS A;  4WF5 A;  2K6V A;  5B6M A;  1BF5 A;  1G6Y A;  4NWY A;  3EU4 A;  3KTL A;  1I5G A;  4WKW A;  7GSS A;  4G01 A;  4KCA A;  1M9B A;  4F0C A;  6GST A;  4NV2 A;  5ELG A;  5LNK e;  1U3I A;  3RPP A;  6GSU A;  2RLI A;  1V98 A;  3G7Y A;  2ZUP A;  3APO A;  2J23 A;  3DXB A;  1SVL A;  5J3R A;  4K5S A;  3M3M A;  3KIJ A;  1MDJ A;  3IV4 A;  5HR1 A;  1M2A A;  2DLX A;  1BJX A;  3CTF A;  4PQ1 A;  4AJ7 A;  4PNG A;  4HZ2 A;  4EVM A;  2I3Y A;  2MMA A;  2L6C A;  4ACS A;  5ECI B;  2C1Y A;  2IPA A;  3ZIV A;  2AJQ B;  3ZVJ D;  3KM6 A;  1SK1 A;  4IEL A;  4RQR A;  1TTZ A;  3H8Q A;  5IMF A;  3ZTL A;  4Z2R A;  1W4V A;  5G5E A;  3IPZ A;  1A0R P;  2MYG A;  1SJ6 A;  3K8N A;  3EMP A;  1VF3 A;  2IME A;  4JU5 A;  1UN2 A;  3F4R A;  3GFK A;  4XHM A;  2VAF A;  1QK8 A;  3DRN A;  1R5A A;  3VWW A;  3UBL A;  4ZIJ A;  3QR6 A;  5INY A;  4TR1 A;  4EO3 A;  4EUY A;  4EE0 A;  4QMK A;  1XWC A;  3E0U A;  1B8X A;  4NHW A;  4PTS A;  2ZCT A;  1ZYP A;  3QFA C;  2GS3 A;  3KZQ A;  3IDV A;  4DSQ A;  5A5H A;  1SL0 B;  1M3I A;  4ZXG A;  1F37 A;  3ZL5 A;  1V58 A;  3RDW A;  2A2P A;  4DSS B;  2V6K A;  4K5R A;  1S3C A;  2GT5 A;  5A4V A;  3KXO A;  1OC8 A;  4HOJ A;  2WW1 A;  1JZO A;  3H79 A;  5ELA A;  2LJR A;  2WJU A;  4IVF A;  1U3A A;  4CY6 A;  1I9D A;  14GS A;  3TGZ A;  5CRW A;  1PKZ A;  1GSU A;  5F05 A;  3RFR C;  1K0A A;  2H1D A;  2MBS A;  1USB A;  4L8E A;  2MMN A;  2DKI A;  2VCV A;  4OMV A;  4EIQ A;  2EFD A;  1VRS D;  3J7Y k;  1Y6E A;  4OFM A;  1B4P A;  3EIN A;  3FR3 A;  1SVM A;  4N0V A;  3SWL A;  4BL7 A;  2GDR A;  2EFH A;  4IQA A;  1Y1U A;  1CQH A;  2HZE B;  4MP4 A;  2VO4 A;  3WD6 A;  4IKH A;  1M2D A;  3HCZ A;  5G30 A;  3ZRD A;  1FAA A;  1PRX A;  2L59 A;  1XVQ A;  4XCS A;  2R0G A;  2CAI A;  2VL2 C;  1O73 A;  3ZMK A;  5JCW A;  3BJ5 A;  4K7I A;  1X9W B;  2L5O A;  2HRF A;  1GRX A;  6GSX A;  2LST A;  3SBC A;  4HQZ A;  5DQY A;  4ZIL A;  3L9S A;  3FKF A;  1GWC A;  4MCU A;  3VI7 A;  4F9Z A;  1YEW C;  1HNA A;  4KAE A;  4OFT A;  4N10 A;  4G0I A;  2VCW A;  2IIY A;  2NPB A;  3UVT A;  4MH3 A;  5GAN D;  4G2E A;  1FW1 A;  1LJR A;  3KP8 A;  1SKW B;  4ECB A;  4TXV A;  3MAK A;  2YOI A;  4Q5F A;  2CX3 A;  2KP1 A;  1VF4 A;  5DCH A;  3H1N A;  4Z2T A;  3TKQ A;  1TRW A;  2PPT A;  3FZA A;  2L57 A;  1PKW A;  3GRX A;  2L6D A;  4AKX B;  2FCH A;  4RI7 A;  1F6M C;  4YQV A;  2X8C A;  2OBI A;  1A2L A;  3CWG A;  4AKG A;  2L4C A;  4ISD A;  5CRG A;  1PL2 A;  3GV1 A;  2YNX A;  1FO5 A;  1AIU A;  2QA1 A;  4ZB8 A;  3IXR A;  1PL1 A;  2O36 A;  2XBQ A;  5A4U A;  5EVO A;  4K7O A;  3D5J A;  5HR2 A;  5A1N A;  1XBS A;  1RK4 A;  4TW5 A;  1X5D A;  4MDC A;  3HZ8 A;  5G31 A;  1LBK A;  5J40 A;  5COH A;  4YKF A;  1ACV A;  1RW1 A;  3HJM A;  2HZF A;  1YZX A;  4E8H A;  4K2D A;  1BX9 A;  4N0Z A;  4OO5 A;  2ON5 A;  3VPT A;  2H8L A;  2R0P A;  4XS4 B;  4TR1 B;  4PHZ C;  4KE3 A;  3MIX A;  3I9V 2;  2XPD A;  2OE3 A;  2XBI A;  1XWG A;  5CP1 A;  4LL1 B;  1TW9 A;  3F3Q A;  3M8N A;  1FB6 A;  5A5H B;  3KEB A;  6GSV A;  2LRN A;  2F3M A;  4V2L A;  2LS5 A;  2C80 A;  2GZZ A;  4TXO A;  4N30 A;  3F6D A;  2RM5 A;  3N9J A;  1O8W A;  2K8S A;  4LA1 A;  2DIZ A;  1JHB A;  2O5V A;  4AJ6 A;  3RBT A;  3BCI A;  3ZFL A;  5KOW A;  2AAW A;  2ON7 A;  1MD3 A;  3UIW A;  2VL3 A;  3F3R A;  5J41 A;  3EYT A;  1DE2 A;  2H6Y A;  4JE1 A;  4ZL7 A;  5IMD A;  6GSS A;  2F8F A;  3A5W A;  4KND A;  5DQS A;  3KH9 A;  4YQU A;  3TRP A;  2GVP A;  2I4A A;  4BWQ A;  3UAR A;  4KX4 A;  2O89 A;  4MPG A;  3EWL A;  3GUS A;  19GS A;  10GS A;  1H75 A;  1X5E A;  3GX8 A;  1GL8 A;  1J9B A;  4WBR D;  1FVK A;  4BA7 A;  5ABR A;  4BVX A;  4V1A g;  5J47 A;  2CVB A;  2K18 A;  3IBH A;  3EC3 A;  1WE0 A;  4ULX A;  3G7I A;  2IN3 A;  1A8L A;  5E4W A;  5ECO B;  1MEK A;  4QQ7 A;  4GXZ A;  1AW9 A;  2O87 A;  1EGR A;  4J56 E;  4MF7 A;  2LQO A;  2IWT A;  1TRS A;  2VIM A;  4MJB A;  1U88 A;  5H5Q A;  1TKD B;  2JL4 A;  2DC5 A;  1WPI A;  2H72 A;  11GS A;  2C0F A;  2EIO A;  4K8M A;  2K8V A;  1ZYQ B;  1BG1 A;  13GS A;  1OC3 A;  1N25 A;  1GLP A;  4KSM A;  2CAQ A;  4POL A;  3VWU A;  4X1U A;  2E2G A;  1TRU A;  2LRC A;  3HDC A;  1RQM A;  4PQH A;  1SYX A;  3H4K A;  1M7T A;  3GL5 A;  3L78 A;  3G7J A;  2LJK A;  3APQ A;  1K0B A;  2VD0 A;  3ERG A;  3FMW A;  4F82 A;  4AJ8 A;  4HQS A;  1B48 A;  2C0G A;  16GS A;  2C0D A;  2YZH A;  4OWY A;  4LL4 B;  4HI7 A;  3DYR A;  5IOX A;  2XC2 A;  2ZNM A;  4NPB A;  2YPM A;  1EP8 A;  3AY8 A;  9GSS A;  2HRA A;  2P31 A;  1GNE A;  2GSQ A;  5JWQ B;  4FQU A;  2OT3 A;  4AKI A;  1M9A A;  2NBS A;  2WZS A;  4IJ3 A;  1PA3 A;  4USS A;  2NVL A;  4LLR A;  5AIV A;  2FA4 A;  4F2I A;  2MBT A;  3W8S A;  4YAV A;  1BAY A;  3FY7 A;  2IMF A;  2H1G A;  1T7P B;  1QXH A;  3HVV A;  3LYK A;  1AXD A;  2HZE A;  1FOV A;  5HR3 A;  2H0I A;  3QD9 A;  3EPT A;  3CRU A;  5EL8 A;  4V2M A;  4I2U A;  1XIY A;  2CQ9 A;  1XOA A;  5HQP A;  2MZC A;  1PQN A;  1TI3 A;  1Z9H A;  3HMJ G;  3MSZ A;  1A23 A;  1EEJ A;  3PIN A;  1THX A;  3N5O A;  1XVW A;  1K3L A;  3RPN A;  2JZT A;  3G9B A;  2HNL A;  5IM9 A;  1GTU A;  1FHE A;  1B9X C;  2GSR A;  5G2Z A;  1GSQ A;  3TJF A;  4N11 A;  2RII A;  1K3Y A;  5C04 A;  1LU4 A;  4YQM A;  1K3O A;  1S3D A;  5DCG A;  1SVO A;  3TKS A;  1J0F A;  1ABA A;  2A4H A;  2C3Q A;  2AUV A;  1T4Y A;  1Y25 A;  3CSI A;  5KN0 A;  2OKA A;  4NV5 A;  1BED A;  3EUR A;  3HVN A;  2H66 A;  1GTA A;  2OE1 A;  4NHZ A;  3KD0 A;  3ZIJ A;  1DBY A;  4PUA A;  2JAD A;  3O3T A;  3PPU A;  4BVX B;  1M0U A;  2HSH A;  4BIK A;  4JR6 A;  3DGQ A;  3QOU A;  3MYD A;  3CBU A;  2B3S A;  3ZRE A;  1XCC A;  4YH2 A;  1NSW A;  4O5U A;  2H01 A;  1T3B A;  1SJZ A;  3TCO A;  4A5P A;  3U6V A;  4WET A;  1S4B P;  2WW3 A;  3UVH A;  2WW0 A;  4GTU A;  1Z6M A;  4PX1 A;  2UZ8 A;  1QUW A;  2PN8 A;  1MDI A;  3TJB A;  1U6T A;  1ILO A;  2VLV A;  1SK0 A;  3FRC A;  5ECQ B;  4X43 A;  1XXU A;  3ME8 A;  4PUR A;  5JWO B;  2PBJ A;  4XS4 A;  1XWK A;  1KTE A;  2L5L A;  2PER A;  4XRA A;  2GQK A;  2PGT A;  5ECM B;  4E68 A;  3GKM A;  1B4Q A;  2VM2 A;  5ECK B;  3HYP A;  2WRT A;  4O32 A;  3WGE A;  1AQW A;  2PVQ A;  1Z6N A;  4Z2U A;  8GSS A;  3GN3 A;  3P90 A;  4EL1 A;  3NZN A;  2H30 A;  5GAP D;  4WF4 A;  20GS A;  3KMN A;  5F06 A;  3UOM A;  4TR3 A;  4IW9 A;  4IS0 A;  3MNG A;  3GH6 A;  5B8A A;  4XRD A;  2DKH A;  1EWX A;  4KF9 A;  1O6J A;  2JSZ A;  2YJH A;  4KB3 A;  2KHP A;  2B1L A;  1O8X A;  5CRD A;  2QGV A;  3US3 A;  5J9B A;  3QPM A;  1V9W A;  1EOG A;  1V40 A;  3M9J A;  4KDU A;  3DEX A;  1KBN A;  3KH7 A;  5IIZ A;  1A24 A;  2IJY A;  3TUE A;  3KTB A;  4G10 A;  4D73 A;  2HXK A;  3KMO A;  3TB2 A;  2FD3 A;  2YWI A;  5BMU B;  2OAC A;  5AIX A;  2IFQ A;  3GHA A;  3D22 A;  1Q98 A;  1O85 A;  1WRY A;  3I43 A;  3FEU A;  1HNC A;  3O76 A;  1PFO A;  3LWA A;  3DD3 A;  5JWR B;  1VF1 A;  4IBP A;  3TKS E;  2IL3 A;  3H93 A;  3ZIT A;  1PSQ A;  5DDL A;  1NM3 A;  2V41 A;  3ED3 A;  4HUA A;  3A5I A;  1AQV A;  2LTK A;  1F2E A;  2HE3 A;  2AYT A;  1EZK A;  2MMO A;  3UAP A;  1TXX A;  4F0B A;  4DVC A;  3KCM A;  1GLQ A;  3HVS A;  3C8E A;  2H19 A;  4OCE A;  3VK9 A;  2WVY A;  5A34 A;  3CQF A;  3C7M A;  3IAM 2;  4BWS A;  2X4A A;  3VWX A;  3QFB C;  4FYC A;  3HZ4 A;  5GSS A;  3CSJ A;  1A2J A;  5KEJ A;  4FH8 A;  5IOW A;  4MPF A;  5FHI A;  5DAL A;  3M9K A;  3GTU B;  1BYE A;  1ERV A;  4Z7X A;  1G7O A;  2NTO A;  2F8A A;  3GKX A;  5GZZ B;  2H73 A;  4MJE A;  3Q18 A;  2DJ2 A;  3P7X A;  2VL2 A;  1Z7R A;  1XW6 A;  4O5R A;  1XW5 A;  1PN0 A;  4H86 A;  4POM A;  1GUH A;  1Q4J A;  4MH2 A;  1SKS B;  4K7N A;  3D4T A;  2RUE A;  4E8E A;  1G7E A;  4XTS A;  3PR8 A;  2R0C A;  1K0C A;  5AIS A;  4Q5Q A;  1SL1 B;  2DJK A;  1ZYN A;  3EVI A;  2I81 A;  3HY2 A;  4XS6 A;  2JSY A;  4PXO A;  1PN9 A;  4HSC X;  4MLY A;  3DML A;  1F9M A;  1GSS A;  4Q5R A;  3FZ9 A;  2KOK A;  3LW9 A;  1AC1 A;  1YKA A;  1EP7 A;  1K0M A;  1TU8 A;  1UA5 A;  1YEP A;  1S3R A;  2GLR A;  1YF1 A;  2H0H A;  1PX7 A;  3IC8 A;  4JR4 A;  1B9Y C;  2WVZ A;  2YWM A;  2VL9 A;  2EFE A;  3ZFB A;  1GNW A;  1YKC A;  3UBK A;  3GX0 A;  4I8B A;  3PH9 A;  1O81 A;  2DML A;  2C3N A;  3P2A A;  1T1V A;  2BTO T;  1YQ1 A;  3FYG A;  2TIR A;  3L0H A;  1JZD A;  2MMZ A;  1IYI A;  1TP9 A;  3HXS A;  3L9V A;  2PU9 C;  1GUM A;  1UVZ A;  1YJ6 A;  1K0N A;  3IC4 A;  4HDE A;  5IPG A;  4WBJ A;  2YAN A;  3IK9 A;  1GTI A;  17GS A;  1YF0 A;  2AV4 A;  4MZB A;  3L4N A;  2HFD A;  2EIR A;  3D4M A;  3LQ7 A;  3F0I A;  1JZR A;  12GS A;  3NIV A;  4D73 B;  4I5Q A;  4K0G A;  5KN1 A;  4GST A;  1YY7 A;  2FA8 A;  1DUG A;  3BOA A;  2IFQ B;  4ILF A;  3IA1 A;  2V32 A;  4MZW A;  3D21 A;  1E2Y A;  5IPH A;  2JU5 A;  2QC7 A;  2I1U A;  3QAV A;  3GKN A;  3O6T A;  1M2B A;  3C71 A;  4FYU A;  2VLU A;  2VCQ A;  4TVE A;  1K0O A;  2CV4 A;  4KGI A;  2N5F A;  4K2X A;  4IJI A;  2BMX A;  4TRX A;  1X9M B;  3A3T A;  3W8J A;  3V1W A;  2VCT A;  1A2M A;  1R5P A;  4G19 A;  4XS1 A;  1XPV A;  4ZBB A;  3QAW A;  5A34 B;  5ECP B;  4AGS A;  4IHU A;  2YWO A;  2H6Z A;  5CRE A;  1ON4 A;  5HFG A;  4YAP A;  4HS1 A;  3F63 A;  5BRT A;  5DAL B;  4KW6 A;  2YJ7 A;  3GYK A;  1OC9 A;  1I1I P;  2CT6 A;  3A2W A;  2AB6 A;  3LFL A;  5E59 A;  3IOS A;  2YV9 A;  1SEN A;  2IMK A;  4O5Q A;  2DIY A;  5D93 A;  1SJI A;  3FR6 A;  4GF0 A;  3WGX A;  4ZL8 A;  3DIE A;  1V2A A;  2LEG A;  5A5K A;  3EMX A;  2H71 A;  2H76 A;  4PI2 C;  4RI6 A;  5CNW A;  2HRK A;  1FG4 A;  1SKR B;  4HU7 A;  3A2X A;  4CW9 A;  2P5R A;  1XZO A;  1TXU A;  3LYP A;  4TR0 A;  2X99 A;  2R3X A;  1C72 A;  1N2A A;  3Q74 A;  2YV7 A;  3IHG A;  1QMV A;  3LGC A;  3F6F A;  1T4Z A;  2EFC A;  4ECJ A;  1ZZY A;  3ZZX A;  1THO A;  4GQC A;  3U5R E;  3GA4 A;  2DSA A;  3Q19 A;  4MJA A;  1X9S B;  4IP1 A;  2M46 A;  4GWR A;  2HSN A;  1EV4 A;  3RHC A;  4L0W A;  5DJL A;  3L9U A;  1R26 A;  2P0G A;  5G1L A;  5BMU A;  3WT2 A;  2DJ3 A;  4W66 A;  4WEY A;  1DE1 A;  3D0Z A;  1OE7 A;  3DKS A;  3ME7 A;  1TK0 B;  2N5A A;  1AAZ A;  5EPF A;  2R2J A;  2QA2 A;  2H1L A;  3ERW A;  3ZYW A;  2N5B A;  3NOF A;  4V2N A;  1ZCP A;  4EXJ A;  3IK7 A;  2LRT A;  2REM A;  3TJK A;  1Z3E A;  2LNS A;  4Q5N A;  1FOH A;  1AUC A;  4MJC A;  1ERU A;  1V57 A;  4KSO A;  1XW9 A;  1F3B A;  2GT6 A;  4EIP A;  1PD2 1;  2A4V A;  1HYU A;  1GP1 A;  2AHE A;  1OE8 A;  5C00 A;  2GST A;  4GSS A;  4ICY A;  1SL2 B;  2E7P A;  1XG8 A;  2HLS A;  2R6K A;  1TOF A;  4TN8 A;  1NHY A;  3EU3 A;  1GSE A;  3TOT A;  5J4Y A;  5G5F A;  3LXT A;  5F0G A;  5IMA A;  4QL9 A;  3UL3 A;  5KOX A;  2CX4 A;  1SK2 A;  2H1B A;  2WUL A;  4GCI A;  2FWF A;  2FLS A;  1YDK A;  4GDF A;  5D96 A;  3GTU A;  3GIX A;  1URM A;  4PQI A;  2VD1 A;  4GQF A;  1UC7 A;  3TKR A;  2ALB A;  1TI1 A;  5IMC A;  2M72 A;  3WGD A;  3ERF A;  2UV8 G;  3CMI A;  2JAC A;  2YZU A; 
#chains in the Genus database with same CATH homology
 1GH2 A;  5B8B A;  5D9X A;  4IQ1 A;  1DSB A;  1X0R A;  4TKY A;  1M99 A;  3UJ1 A;  4G0K A;  3HHV A;  2HSM B;  3GUR A;  3CTG A;  2EIQ A;  1A0F A;  1EGO A;  3HKR A;  4AI6 A;  1CQG A;  5KN2 A;  1JLW A;  2CZ2 A;  4O92 A;  3A2V A;  2X49 A;  3GNJ A;  3M1G A;  2HQT A;  2LNT A;  4EKZ A;  4EF0 A;  3Q6O A;  3R3E A;  1HNB A;  5IO2 A;  1TRV A;  5CO3 A;  5EY6 A;  1OC9 B;  3TDG A;  2B5Y A;  2X8G A;  5ID2 A;  1SYR A;  1EEM A;  5B7C A;  4L0U A;  3TU3 B;  3WYW A;  3QDN A;  2L4Q A;  3CSH A;  2FY6 A;  5ECR B;  5AN1 A;  3DWV A;  3F4S A;  1U87 A;  4KUN A;  2A2R A;  4FIW A;  2D2Z A;  2GSS A;  3LSZ A;  3APS A;  3GL3 A;  4F03 A;  3C1R A;  5H5S A;  5DJM A;  1GUK A;  4ML6 A;  2OA7 A;  2HRK B;  2EC4 A;  4POK A;  2GGT A;  4X4J A;  4KH7 A;  2H1A A;  1BQ7 A;  4IN0 A;  3QCP A;  5D73 A;  2LKU A;  3DVW A;  4JBB A;  4IP6 A;  3MDK A;  2WS2 A;  5J4V A;  4G0L A;  5IO0 A;  4ECI A;  3FZ4 A;  2P5Q A;  4I2T A;  1VF2 A;  3ZVJ A;  5CAX A;  1R7H A;  3M0F A;  4HJ2 A;  3IAS 2;  1R4W A;  2OJL A;  2O8V B;  2G2Q A;  3D6I A;  4GRF A;  2HSN B;  3BD2 A;  4MK3 A;  3F8U A;  1TK5 B;  4HU9 A;  1QGV A;  4IGJ A;  5ECH B;  3EE2 A;  1GUL A;  2PWJ A;  3TRQ A;  2C0E A;  2IMD A;  4EDY A;  2GZY A;  3KGK A;  2H6X A;  1ZGN A;  4J57 E;  2WDU A;  1K0D A;  2GTU A;  4ZB6 A;  4ZB7 A;  3HJP A;  5FWG A;  3DVX A;  4K1F A;  1WP0 A;  1ST9 A;  1XOB A;  4EDZ A;  2JZS A;  3BBY A;  1YVL A;  6GSW A;  1ERW A;  3FW2 A;  3KP9 A;  2B7J A;  3TRX A;  4BVY A;  3HD5 A;  2WFC A;  2H70 A;  2IMI A;  3PGT A;  4I6X A;  1EOH A;  3LJR A;  2YN1 A;  2F51 A;  2R37 A;  4HZ4 A;  1Z5Y E;  2XPE A;  1WIK A;  4X0X A;  1G6W A;  3LG6 A;  5HR0 A;  2QSI A;  4POB A;  1HD2 A;  2WZ9 A;  1OAZ A;  1GSD A;  5IQY A;  3CXG A;  1NW2 A;  2Z9S A;  2LJA A;  3HVX A;  1HQO A;  2DJ0 A;  2HRN A;  2B5E A;  1IYH A;  2E2M A;  1VGL A;  1FB0 A;  3FK8 A;  2HT9 A;  2LUS A;  3QAG A;  2B1K A;  1WMJ A;  1T00 A;  3I6A A;  1ZYE A;  5D9T A;  3VWV A;  4RUV A;  5B6N A;  3FZ5 A;  1O7U A;  3WT1 A;  2NDO A;  4V1A p;  5H5R A;  2CVD A;  2CVK A;  3GKK A;  4TOP A;  2GQM A;  1BG5 A;  1EV9 A;  2DBC A;  2VCZ A;  3GH9 A;  6GSY A;  1G0T A;  1J08 A;  2RM6 A;  3HA9 A;  4ML1 A;  1WOU A;  2KP2 A;  5ENU A;  2DJJ A;  3C73 A;  4J2F A;  1KNG A;  2HYX A;  2ES7 A;  5J5N A;  2PUK C;  2VKZ G;  3LXZ A;  5JCG A;  2VLT A;  2FHE A;  4CDO A;  5ID2 B;  1OYJ A;  4LMW A;  4WR5 A;  2XHF A;  3RAZ A;  3GST A;  4QL7 A;  2VM1 A;  2VUP A;  3TJJ A;  1E6B A;  2WGR A;  1WWJ A;  3MWH A;  2V1M A;  2V2G A;  2QKE A;  2CZ3 A;  2V6O A;  2YWN A;  5ECS A;  2CA8 A;  5D9W A;  3VLN A;  4MA9 A;  1N8J A;  3P8W A;  3J7Y b;  5CYY A;  3TOU A;  4DEJ A;  2H74 A;  3E3E A;  2YCD A;  3IRA A;  5DAK A;  4NMU A;  4HEA 2;  2OBK A;  3I69 A;  4PNF A;  4TR4 A;  4G9H A;  1MDK A;  5JCU A;  1GTB A;  4PGT A;  2G0F A;  2A2S A;  1OKD A;  4ECC A;  1PMT A;  4FO5 A;  1KEB A;  3KJY A;  3C1S A;  2B7K A;  2C4J A;  1H4O A;  5CRH A;  1X5C A;  4N3Z A;  3HJO A;  2TRC P;  2F9S A;  1PGT A;  4PUF C;  1AQX A;  4KDY A;  3CRT A;  5HFK A;  4KCE A;  2YP6 A;  1GSF A;  4OCF A;  3R2Q A;  4MF6 A;  1Z7P A;  5KN3 A;  4MZC A;  2B5X A;  3IE3 A;  5AGY A;  22GS A;  3TJG A;  4AF2 A;  1YEX A;  4I97 A;  1XWB A;  2WB9 A;  4BPY A;  3JCM L;  2VOC A;  2FGX A;  4MNN A;  2PVO C;  3IHQ A;  3GSS A;  2O85 A;  2HSY A;  5DBQ A;  1QFN A;  4BL7 B;  4BVY B;  4ZBA A;  2OE0 A;  1JFU A;  1ML6 A;  2HSM A;  5F8B A;  2FWE A;  5LD0 A;  4P3Y B;  1TK8 B;  5FT3 A;  5ECL B;  2LV3 A;  3CYN A;  4EC0 A;  1ZL9 A;  4WR4 A;  5GST A;  2C8U A;  1ERT A;  5L71 A;  2GQL A;  3ISO A;  2FWH A;  4ID0 A;  3E9J B;  4CY8 A;  5ECN B;  1W89 A;  1MD4 A;  2LQQ A;  3GMF A;  5J9C A;  2H75 A;  2KUC A;  1SD8 A;  4NXI A;  3W6G A;  2O7K A;  4L5O A;  3OR5 A;  4K9Z A;  3VUR A;  4L5L A;  2I9H A;  4ZB9 A;  4HJM A;  3LEF A;  2HI7 A;  4LMV A;  1TJD A;  3VI5 A;  1JZW A;  2PMT A;  4OD7 A;  4JRR A;  4DSR A;  4ZL9 A;  4AKH A;  4KA0 A;  4JED A;  5G1K A;  2FNO A;  18GS A;  4WXT A;  3RHB A;  1SU9 A;  1JLV A;  2GZP A;  2C3T A;  2K9F A;  2R5G A;  1F3A A;  1ZMA A;  3FHK A;  4JZQ A;  1OVN A;  2BJX A;  2KLX A;  2RUF A;  5F07 A;  1ZOF A;  1XWA A;  4GLT A;  4NAX A;  3LOR A;  3TKP A;  3UEM A;  5IMV A;  3F4T A;  1SD9 A;  4K6X A;  4MAB A;  2B6M A;  4FYB A;  2X64 A;  2FWG A;  2FUG 2;  5D9V A;  4DSS A;  4XIH A;  1WJK A;  5J4U A;  3F9U A;  2WCI A;  2DJ1 A;  5A4W A;  2H0G A;  1A8Y A;  5DVB A;  1S3A A;  1TU7 A;  4MMM A;  3QMX A;  5A1N B;  2JZR A;  4KDX A;  2E0Q A;  3VFI A;  4GSN A;  5IMZ A;  3VPQ A;  1TDI A;  1OKT A;  1PX6 A;  5DAK B;  1MTC A;  3ZML A;  3ZLP A;  2VCX A;  3UMA A;  3BCK A;  4OO4 A;  2J9H A;  4O7H A;  5D8I A;  1T8E B;  2X8H A;  3IR4 A;  2TRX A;  4K0N A;  1XFL A;  1FVJ A;  4TXO B;  2OAD A;  3TKS C;  2R4V A;  1NHO A;  4YKG A;  5HFI A;  4ZBD A;  4OFN A;  3S9F A;  1GSY A;  3FR9 A;  4RQX A;  2DMM A;  4MF5 A;  5LCZ A;  1QQ2 A;  2M80 A;  4CHS A;  4WF5 A;  2K6V A;  5B6M A;  1BF5 A;  1G6Y A;  4NWY A;  3EU4 A;  3KTL A;  1I5G A;  4WKW A;  7GSS A;  4G01 A;  4KCA A;  1M9B A;  4F0C A;  6GST A;  4NV2 A;  5ELG A;  5LNK e;  1U3I A;  3RPP A;  6GSU A;  2RLI A;  1V98 A;  3G7Y A;  2ZUP A;  3APO A;  2J23 A;  3DXB A;  1SVL A;  5J3R A;  4K5S A;  3M3M A;  3KIJ A;  1MDJ A;  3IV4 A;  5HR1 A;  1M2A A;  2DLX A;  1BJX A;  3CTF A;  4PQ1 A;  4AJ7 A;  4PNG A;  4HZ2 A;  4EVM A;  2I3Y A;  2MMA A;  2L6C A;  4ACS A;  5ECI B;  2C1Y A;  2IPA A;  3ZIV A;  2AJQ B;  3ZVJ D;  3KM6 A;  1SK1 A;  4IEL A;  4RQR A;  1TTZ A;  3H8Q A;  5IMF A;  3ZTL A;  4Z2R A;  1W4V A;  5G5E A;  3IPZ A;  1A0R P;  2MYG A;  1SJ6 A;  3K8N A;  3EMP A;  1VF3 A;  2IME A;  4JU5 A;  1UN2 A;  3F4R A;  3GFK A;  4XHM A;  2VAF A;  1QK8 A;  3DRN A;  1R5A A;  3VWW A;  3UBL A;  4ZIJ A;  3QR6 A;  5INY A;  4TR1 A;  4EO3 A;  4EUY A;  4EE0 A;  4QMK A;  1XWC A;  3E0U A;  1B8X A;  4NHW A;  4PTS A;  2ZCT A;  1ZYP A;  3QFA C;  2GS3 A;  3KZQ A;  3IDV A;  4DSQ A;  5A5H A;  1SL0 B;  4ZXG A;  1F37 A;  3ZL5 A;  1V58 A;  3RDW A;  2A2P A;  4DSS B;  2V6K A;  4K5R A;  1S3C A;  2GT5 A;  5A4V A;  3KXO A;  1OC8 A;  4HOJ A;  1JZO A;  3H79 A;  5ELA A;  2LJR A;  2WJU A;  4IVF A;  1U3A A;  4CY6 A;  1I9D A;  14GS A;  3TGZ A;  5CRW A;  1PKZ A;  1GSU A;  5F05 A;  1K0A A;  2H1D A;  2MBS A;  1USB A;  4L8E A;  2MMN A;  2DKI A;  2VCV A;  4OMV A;  4EIQ A;  2EFD A;  1VRS D;  3J7Y k;  1Y6E A;  4OFM A;  1B4P A;  3EIN A;  3FR3 A;  1SVM A;  4N0V A;  3SWL A;  4BL7 A;  2GDR A;  2EFH A;  4IQA A;  1Y1U A;  1CQH A;  2HZE B;  4MP4 A;  2VO4 A;  3WD6 A;  4IKH A;  1M2D A;  3HCZ A;  5G30 A;  3ZRD A;  1FAA A;  1PRX A;  2L59 A;  1XVQ A;  4XCS A;  2R0G A;  2CAI A;  2VL2 C;  1O73 A;  3ZMK A;  5JCW A;  3BJ5 A;  4K7I A;  1X9W B;  2L5O A;  2HRF A;  1GRX A;  6GSX A;  2LST A;  3SBC A;  4HQZ A;  5DQY A;  4ZIL A;  3L9S A;  3FKF A;  1GWC A;  4MCU A;  3VI7 A;  4F9Z A;  1HNA A;  4KAE A;  4OFT A;  4N10 A;  4G0I A;  2VCW A;  2IIY A;  2NPB A;  3UVT A;  4MH3 A;  5GAN D;  4G2E A;  1FW1 A;  1LJR A;  3KP8 A;  1SKW B;  4ECB A;  4TXV A;  3MAK A;  2YOI A;  4Q5F A;  2CX3 A;  2KP1 A;  1VF4 A;  5DCH A;  3H1N A;  4Z2T A;  3TKQ A;  1TRW A;  2PPT A;  3FZA A;  2L57 A;  1PKW A;  3GRX A;  2L6D A;  4AKX B;  2FCH A;  4RI7 A;  1F6M C;  4YQV A;  2X8C A;  2OBI A;  1A2L A;  3CWG A;  4AKG A;  2L4C A;  4ISD A;  5CRG A;  1PL2 A;  3GV1 A;  2YNX A;  1FO5 A;  1AIU A;  2QA1 A;  4ZB8 A;  3IXR A;  1PL1 A;  2XBQ A;  5A4U A;  5EVO A;  4K7O A;  3D5J A;  5HR2 A;  5A1N A;  1XBS A;  1RK4 A;  4TW5 A;  1X5D A;  4MDC A;  3HZ8 A;  5G31 A;  1LBK A;  5J40 A;  5COH A;  4YKF A;  1ACV A;  1RW1 A;  3HJM A;  2HZF A;  1YZX A;  4E8H A;  4K2D A;  1BX9 A;  4N0Z A;  4OO5 A;  2ON5 A;  3VPT A;  2H8L A;  2R0P A;  4XS4 B;  4TR1 B;  4KE3 A;  3MIX A;  3I9V 2;  2XPD A;  2OE3 A;  2XBI A;  1XWG A;  5CP1 A;  4LL1 B;  1TW9 A;  3F3Q A;  3M8N A;  1FB6 A;  5A5H B;  3KEB A;  6GSV A;  2LRN A;  2F3M A;  4V2L A;  2LS5 A;  2C80 A;  2GZZ A;  4TXO A;  4N30 A;  3F6D A;  2RM5 A;  3N9J A;  1O8W A;  2K8S A;  4LA1 A;  2DIZ A;  1JHB A;  2O5V A;  4AJ6 A;  3RBT A;  3BCI A;  3ZFL A;  5KOW A;  2AAW A;  2ON7 A;  1MD3 A;  3UIW A;  2VL3 A;  3F3R A;  5J41 A;  3EYT A;  1DE2 A;  2H6Y A;  4JE1 A;  4ZL7 A;  5IMD A;  6GSS A;  2F8F A;  3A5W A;  4KND A;  5DQS A;  3KH9 A;  4YQU A;  3TRP A;  2GVP A;  2I4A A;  4BWQ A;  3UAR A;  4KX4 A;  2O89 A;  4MPG A;  3EWL A;  3GUS A;  19GS A;  10GS A;  1H75 A;  1X5E A;  3GX8 A;  1GL8 A;  1J9B A;  4WBR D;  1FVK A;  4BA7 A;  5ABR A;  4BVX A;  4V1A g;  5J47 A;  2CVB A;  2K18 A;  3IBH A;  3EC3 A;  1WE0 A;  4ULX A;  3G7I A;  2IN3 A;  1A8L A;  5E4W A;  5ECO B;  1MEK A;  4QQ7 A;  4GXZ A;  1AW9 A;  2O87 A;  1EGR A;  4J56 E;  4MF7 A;  2LQO A;  2IWT A;  1TRS A;  2VIM A;  4MJB A;  1U88 A;  5H5Q A;  1TKD B;  2JL4 A;  2DC5 A;  1WPI A;  2H72 A;  11GS A;  2C0F A;  2EIO A;  4K8M A;  2K8V A;  1ZYQ B;  1BG1 A;  13GS A;  1OC3 A;  1N25 A;  1GLP A;  4KSM A;  2CAQ A;  4POL A;  3VWU A;  4X1U A;  2E2G A;  1TRU A;  2LRC A;  3HDC A;  1RQM A;  4PQH A;  1SYX A;  3H4K A;  1M7T A;  3GL5 A;  3L78 A;  3G7J A;  2LJK A;  3APQ A;  1K0B A;  2VD0 A;  3ERG A;  3FMW A;  4F82 A;  4AJ8 A;  4HQS A;  1B48 A;  2C0G A;  16GS A;  2C0D A;  2YZH A;  4OWY A;  4LL4 B;  4HI7 A;  3DYR A;  5IOX A;  2XC2 A;  2ZNM A;  4NPB A;  2YPM A;  1EP8 A;  3AY8 A;  9GSS A;  2HRA A;  2P31 A;  1GNE A;  2GSQ A;  5JWQ B;  4FQU A;  2OT3 A;  4AKI A;  1M9A A;  2NBS A;  4IJ3 A;  1PA3 A;  4USS A;  2NVL A;  4LLR A;  5AIV A;  2FA4 A;  4F2I A;  2MBT A;  3W8S A;  4YAV A;  1BAY A;  3FY7 A;  2IMF A;  2H1G A;  1T7P B;  1QXH A;  3HVV A;  3LYK A;  1AXD A;  2HZE A;  1FOV A;  5HR3 A;  2H0I A;  3QD9 A;  3EPT A;  3CRU A;  5EL8 A;  4V2M A;  4I2U A;  1XIY A;  2CQ9 A;  1XOA A;  5HQP A;  2MZC A;  1PQN A;  1TI3 A;  1Z9H A;  3HMJ G;  3MSZ A;  1A23 A;  1EEJ A;  3PIN A;  1THX A;  3N5O A;  1XVW A;  1K3L A;  3RPN A;  2JZT A;  3G9B A;  2HNL A;  5IM9 A;  1GTU A;  1FHE A;  1B9X C;  2GSR A;  5G2Z A;  1GSQ A;  3TJF A;  4N11 A;  2RII A;  1K3Y A;  5C04 A;  1LU4 A;  4YQM A;  1K3O A;  1S3D A;  5DCG A;  1SVO A;  3TKS A;  1J0F A;  1ABA A;  2A4H A;  2C3Q A;  2AUV A;  1T4Y A;  1Y25 A;  3CSI A;  5KN0 A;  2OKA A;  4NV5 A;  1BED A;  3EUR A;  2H66 A;  1GTA A;  2OE1 A;  4NHZ A;  3KD0 A;  3ZIJ A;  1DBY A;  4PUA A;  2JAD A;  3O3T A;  3PPU A;  4BVX B;  1M0U A;  2HSH A;  4JR6 A;  3DGQ A;  3QOU A;  3MYD A;  3CBU A;  2B3S A;  3ZRE A;  1XCC A;  4YH2 A;  1NSW A;  4O5U A;  2H01 A;  1T3B A;  1SJZ A;  3TCO A;  4A5P A;  3U6V A;  4WET A;  3UVH A;  4GTU A;  1Z6M A;  4PX1 A;  2UZ8 A;  1QUW A;  2PN8 A;  1MDI A;  3TJB A;  1U6T A;  1ILO A;  2VLV A;  1SK0 A;  3FRC A;  5ECQ B;  4X43 A;  1XXU A;  3ME8 A;  4PUR A;  5JWO B;  2PBJ A;  4XS4 A;  1XWK A;  1KTE A;  2L5L A;  2PER A;  4XRA A;  2GQK A;  2PGT A;  5ECM B;  4E68 A;  3GKM A;  1B4Q A;  2VM2 A;  5ECK B;  3HYP A;  2WRT A;  4O32 A;  3WGE A;  1AQW A;  2PVQ A;  1Z6N A;  4Z2U A;  8GSS A;  3GN3 A;  3P90 A;  4EL1 A;  3NZN A;  2H30 A;  5GAP D;  4WF4 A;  20GS A;  3KMN A;  5F06 A;  3UOM A;  4TR3 A;  4IW9 A;  4IS0 A;  3MNG A;  3GH6 A;  5B8A A;  4XRD A;  2DKH A;  1EWX A;  4KF9 A;  1O6J A;  2JSZ A;  2YJH A;  4KB3 A;  2KHP A;  2B1L A;  1O8X A;  5CRD A;  2QGV A;  3US3 A;  5J9B A;  3QPM A;  1V9W A;  1EOG A;  1V40 A;  3M9J A;  4KDU A;  3DEX A;  1KBN A;  3KH7 A;  5IIZ A;  1A24 A;  2IJY A;  3TUE A;  3KTB A;  4G10 A;  4D73 A;  2HXK A;  3KMO A;  3TB2 A;  2FD3 A;  2YWI A;  5BMU B;  2OAC A;  5AIX A;  2IFQ A;  3GHA A;  3D22 A;  1Q98 A;  1O85 A;  1WRY A;  3I43 A;  3FEU A;  1HNC A;  3O76 A;  3LWA A;  3DD3 A;  5JWR B;  1VF1 A;  4IBP A;  3TKS E;  2IL3 A;  3H93 A;  3ZIT A;  1PSQ A;  5DDL A;  1NM3 A;  2V41 A;  3ED3 A;  4HUA A;  3A5I A;  1AQV A;  2LTK A;  1F2E A;  2HE3 A;  2AYT A;  1EZK A;  2MMO A;  3UAP A;  1TXX A;  4F0B A;  4DVC A;  3KCM A;  1GLQ A;  3HVS A;  3C8E A;  2H19 A;  4OCE A;  3VK9 A;  5A34 A;  3C7M A;  3IAM 2;  4BWS A;  2X4A A;  3VWX A;  3QFB C;  4FYC A;  3HZ4 A;  5GSS A;  3CSJ A;  1A2J A;  5KEJ A;  4FH8 A;  5IOW A;  4MPF A;  5FHI A;  5DAL A;  3M9K A;  3GTU B;  1BYE A;  1ERV A;  4Z7X A;  1G7O A;  2NTO A;  2F8A A;  3GKX A;  5GZZ B;  2H73 A;  4MJE A;  3Q18 A;  2DJ2 A;  3P7X A;  2VL2 A;  1Z7R A;  1XW6 A;  4O5R A;  1XW5 A;  1PN0 A;  4H86 A;  4POM A;  1GUH A;  1Q4J A;  4MH2 A;  1SKS B;  4K7N A;  3D4T A;  2RUE A;  4E8E A;  1G7E A;  4XTS A;  3PR8 A;  2R0C A;  1K0C A;  5AIS A;  4Q5Q A;  1SL1 B;  2DJK A;  1ZYN A;  3EVI A;  2I81 A;  3HY2 A;  4XS6 A;  2JSY A;  4PXO A;  1PN9 A;  4MLY A;  3DML A;  1F9M A;  1GSS A;  4Q5R A;  3FZ9 A;  2KOK A;  3LW9 A;  1AC1 A;  1YKA A;  1EP7 A;  1K0M A;  1TU8 A;  1UA5 A;  1YEP A;  2GLR A;  1YF1 A;  2H0H A;  1PX7 A;  3IC8 A;  4JR4 A;  1B9Y C;  2YWM A;  2VL9 A;  2EFE A;  3ZFB A;  1GNW A;  1YKC A;  3UBK A;  3GX0 A;  4I8B A;  3PH9 A;  1O81 A;  2DML A;  2C3N A;  3P2A A;  1T1V A;  2BTO T;  1YQ1 A;  3FYG A;  2TIR A;  3L0H A;  1JZD A;  2MMZ A;  1IYI A;  1TP9 A;  3HXS A;  3L9V A;  2PU9 C;  1GUM A;  1UVZ A;  1YJ6 A;  1K0N A;  3IC4 A;  4HDE A;  5IPG A;  4WBJ A;  2YAN A;  3IK9 A;  1GTI A;  17GS A;  1YF0 A;  2AV4 A;  4MZB A;  3L4N A;  2HFD A;  2EIR A;  3D4M A;  3LQ7 A;  3F0I A;  1JZR A;  12GS A;  3NIV A;  4D73 B;  4I5Q A;  4K0G A;  5KN1 A;  4GST A;  1YY7 A;  2FA8 A;  1DUG A;  3BOA A;  2IFQ B;  4ILF A;  3IA1 A;  2V32 A;  4MZW A;  3D21 A;  1E2Y A;  5IPH A;  2JU5 A;  2QC7 A;  2I1U A;  3QAV A;  3GKN A;  3O6T A;  1M2B A;  3C71 A;  4FYU A;  2VLU A;  2VCQ A;  4TVE A;  1K0O A;  2CV4 A;  4KGI A;  2N5F A;  4K2X A;  4IJI A;  2BMX A;  4TRX A;  1X9M B;  3A3T A;  3W8J A;  3V1W A;  2VCT A;  1A2M A;  1R5P A;  4G19 A;  4XS1 A;  1XPV A;  4ZBB A;  3QAW A;  5A34 B;  5ECP B;  4AGS A;  4IHU A;  2YWO A;  2H6Z A;  5CRE A;  1ON4 A;  5HFG A;  4YAP A;  4HS1 A;  3F63 A;  5BRT A;  5DAL B;  4KW6 A;  2YJ7 A;  3GYK A;  1OC9 A;  2CT6 A;  3A2W A;  2AB6 A;  3LFL A;  5E59 A;  3IOS A;  2YV9 A;  1SEN A;  2IMK A;  4O5Q A;  2DIY A;  5D93 A;  1SJI A;  3FR6 A;  4GF0 A;  3WGX A;  4ZL8 A;  3DIE A;  1V2A A;  2LEG A;  5A5K A;  3EMX A;  2H71 A;  2H76 A;  4RI6 A;  5CNW A;  2HRK A;  1FG4 A;  1SKR B;  4HU7 A;  3A2X A;  4CW9 A;  2P5R A;  1XZO A;  1TXU A;  3LYP A;  4TR0 A;  2X99 A;  2R3X A;  1C72 A;  1N2A A;  3Q74 A;  2YV7 A;  3IHG A;  1QMV A;  3LGC A;  3F6F A;  1T4Z A;  2EFC A;  4ECJ A;  1ZZY A;  3ZZX A;  1THO A;  4GQC A;  3U5R E;  3GA4 A;  2DSA A;  3Q19 A;  4MJA A;  1X9S B;  4IP1 A;  2M46 A;  4GWR A;  2HSN A;  1EV4 A;  3RHC A;  4L0W A;  5DJL A;  3L9U A;  1R26 A;  2P0G A;  5G1L A;  5BMU A;  3WT2 A;  2DJ3 A;  4W66 A;  4WEY A;  1DE1 A;  3D0Z A;  1OE7 A;  3DKS A;  3ME7 A;  1TK0 B;  2N5A A;  1AAZ A;  5EPF A;  2R2J A;  2QA2 A;  2H1L A;  3ERW A;  3ZYW A;  2N5B A;  3NOF A;  4V2N A;  1ZCP A;  4EXJ A;  3IK7 A;  2LRT A;  2REM A;  3TJK A;  1Z3E A;  2LNS A;  4Q5N A;  1FOH A;  1AUC A;  4MJC A;  1ERU A;  1V57 A;  4KSO A;  1XW9 A;  1F3B A;  2GT6 A;  4EIP A;  1PD2 1;  2A4V A;  1HYU A;  1GP1 A;  2AHE A;  1OE8 A;  5C00 A;  2GST A;  4GSS A;  4ICY A;  1SL2 B;  2E7P A;  2HLS A;  2R6K A;  1TOF A;  4TN8 A;  1NHY A;  3EU3 A;  1GSE A;  3TOT A;  5J4Y A;  5G5F A;  3LXT A;  5F0G A;  5IMA A;  4QL9 A;  3UL3 A;  5KOX A;  2CX4 A;  1SK2 A;  2H1B A;  2WUL A;  4GCI A;  2FWF A;  2FLS A;  1YDK A;  4GDF A;  5D96 A;  3GTU A;  3GIX A;  1URM A;  4PQI A;  2VD1 A;  4GQF A;  1UC7 A;  3TKR A;  2ALB A;  1TI1 A;  5IMC A;  2M72 A;  3WGD A;  3ERF A;  2UV8 G;  3CMI A;  2JAC A;  2YZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...