4WR4A

Crystal structure of gst mutated with halogenated tyrosine (7bgst-1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
211
Chain Sequence
SSPILGYWKIKGLVQPTRLLLELEEKYEEHLERDEGDKWRNKKFELGLEFPNLPYIDGDVKLTQSMAIIRIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTLNGDHVTHPDFMLYDALDVVLMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Protein stabilization utilizing a redefined codon
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 67
structure length 211
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4wr4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wr4A01
1TKDB 4IQ1A 2VAFA 4PGTA 3LYPA 5IOWA 1EGOA 1X5CA 1KTEA 4O92A 1TU7A 3SBCA 4ZBAA 4H86A 4D73B 1PN9A 4KGIA 4GWRA 4FO5A 3WT1A 3LXZA 1XW5A 4GF0A 4MH2A 2H19A 4OFMA 2DSAA 4Q5FA 3WYWA 2FWHA 3VK9A 3GH6A 3TJGA 4V1Ap 1CQHA 3CTFA 2AYTA 4NWYA 4ISDA 2BMXA 2GS3A 2AB6A 1SJIA 3BCKA 1SJZA 2X8HA 2FUG2 4KUNA 4TXVA 3Q18A 1UVZA 1YKAA 3S9FA 4JR4A 5ECPB 3C1RA 3R3EA 3VURA 4XRAA 2J9HA 3FK8A 4MF6A 1TI1A 4V2LA 5EY6A 1GSSA 2X8GA 1EOHA 2P5QA 2MMNA 1FVJA 3EMPA 2E0QA 4NXIA 5J5NA 4V2MA 2VCXA 5J3RA 1T4ZA 2EIOA 2VCWA 14GSA 1USBA 2L6CA 1F37A 3I6AA 4L0UA 3QMXA 5B6NA 3A2XA 5D96A 3UBKA 5C00A 2LSTA 2X99A 5D73A 1GP1A 3CSIA 2MMZA 2HRKA 1EEMA 3ZFBA 2DJ3A 1WIKA 3VPTA 1FG4A 4KNDA 1FO5A 4Q5RA 5DJLA 2WULA 2ON7A 5HFKA 4K2DA 2N5FA 1G6WA 1GUHA 1RK4A 5IPHA 1PGTA 2UZ8A 3LFLA 2HT9A 1SK0A 3N9JA 1YDKA 4XTSA 4EL1A 3RHCA 13GSA 2DJJA 4OFNA 2VCQA 3F4SA 3MSZA 4NV2A 2E2GA 1BAYA 4N30A 2N5BA 1O73A 3LYKA 3TDGA 3D4MA 3IK7A 4F82A 1YKCA 1A0RP 2OADA 3F6DA 1GWCA 2HYXA 8GSSA 1SKRB 1ST9A 1AC1A 3ZVJD 1SYXA 2EC4A 1Q4JA 3BCIA 2JSZA 3FR9A 3APQA 1ON4A 3L9UA 16GSA 3ZREA 2GVPA 3TOTA 4POKA 2GSSA 2YJ7A 3GSSA 5ECHB 2H72A 2LRTA 2PVOC 1V40A 4GQCA 5L71A 2C0FA 3ZMLA 5D9XA 3FW2A 1GUMA 2E2MA 2F51A 2XPDA 3FRCA 2EIRA 2H74A 1QQ2A 1MEKA 3IA1A 4RQXA 4DSQA 2Z9SA 1ZYEA 1UC7A 1XWKA 2IMDA 4PUFC 1NHOA 5INYA 2GT6A 5A4UA 3ZYWA 3J7Yk 1XVQA 3H93A 2L57A 5EVOA 2BJXA 3P90A 3TJBA 3Q19A 1URMA 1XIYA 5ECIB 2VCZA 1WOUA 2DLXA 3IAM2 3W8JA 1A24A 3APOA 4DSSB 4MJBA 22GSA 5HR3A 1LJRA 2OBKA 2CX3A 1H75A 1BG5A 1EP7A 3WT2A 4OD7A 1TXXA 2PMTA 2GDRA 1YF0A 2IFQB 4CDOA 3M1GA 1GRXA 4L8EA 2PUKC 4WETA 5IMZA 1JZWA 3NOFA 1G7OA 2MBSA 2IWTA 5KN2A 1GNEA 4GSSA 6GSSA 1R5PA 2HSYA 4XS4A 2AUVA 2R3XA 2HSMA 1OC9A 1SL2B 3L78A 4RUVA 2I81A 2MYGA 1E2YA 4FH8A 5F8BA 3GA4A 2P0GA 3ZRDA 3CSJA 4PURA 3ED3A 3IDVA 3DXBA 2RUFA 3HJMA 3NIVA 4OWYA 4K8MA 2L5OA 3P7XA 1YZXA 3CSHA 2TRCP 4MF7A 2YV7A 4AF2A 2IMEA 1JZRA 3TKPA 3GTUA 4EXJA 4RQRA 3DIEA 4YQUA 3M9KA 3RAZA 4TR1A 3GV1A 1EV9A 2GQKA 1TK0B 4BVYB 2CVDA 2F8AA 4MH3A 4MF5A 3F8UA 3IHQA 5G5FA 4KDXA 3CBUA 3QR6A 4BVXB 4LMVA 1S3AA 4KSOA 5IMAA 2B7JA 3QDNA 1TU8A 2F8FA 2PVQA 5IOXA 2C3TA 5LNKe 5ECLB 3TRPA 4E8HA 2YN1A 3GX0A 3D6IA 3UEMA 4KDYA 2FCHA 2YP6A 3GYKA 4GSNA 3UIWA 2XBIA 3HVVA 2H70A 3KTBA 1T8EB 1EV4A 1AXDA 3VFIA 3ZL5A 2HFDA 2I1UA 2RM5A 3UL3A 3VWUA 1MTCA 4LMWA 3TKSE 1XXUA 3BBYA 3KCMA 2P31A 1XWCA 4BL7A 3DKSA 4IJIA 3HA9A 1GSEA 1JZDA 2LNSA 3CYNA 1F3AA 4X1UA 3VWVA 2N5AA 3A3TA 4AGSA 3IXRA 4K7NA 4KSMA 1V57A 3GH9A 3KGKA 2DJ2A 1AQVA 3L9SA 2QSIA 3ISOA 4TOPA 5IPGA 4LL4B 1J9BA 5G2ZA 2B7KA 1NHYA 4F0CA 5DALB 3TJFA 3F6FA 5DDLA 6GSVA 2OACA 2VUPA 1K0CA 1M7TA 3TJJA 2EIQA 4K9ZA 3BD2A 3IPZA 4I6XA 2HSNB 4GLTA 4KCEA 1N2AA 1QMVA 2CVKA 2K9FA 3AY8A 2LRNA 1A2LA 4MJCA 5DCHA 2R5GA 1ACVA 1JFUA 2WJUA 2NPBA 5HR2A 4ZBBA 3Q6OA 1F9MA 1Z9HA 5JCUA 3D5JA 5ENUA 2DJ0A 2WZ9A 1XOAA 3LG6A 1MDKA 5IMVA 2FNOA 1LBKA 4O7HA 4AJ7A 5ECOB 2B1KA 1BYEA 3KMNA 1B48A 2K6VA 2VCTA 2H0GA 2JADA 2R6KA 3EE2A 1ML6A 4TW5A 5GZZB 4WR5A 2MZCA 4YAVA 5ABRA 4ECIA 1EOGA 1EGRA 1A2JA 2F3MA 2AHEA 1ERTA 2C1YA 5IM9A 3TRXA 3D22A 3IRAA 2FA4A 5B6MA 2CX4A 1KEBA 1XW6A 5G5EA 3EVIA 2KLXA 4N11A 1PRXA 2H71A 4OCFA 2V6KA 2KUCA 4IS0A 4D73A 2HE3A 1X5EA 4HUAA 4BPYA 5AN1A 1V98A 2R37A 2GGTA 1SK1A 5J4UA 3A5WA 3DGQA 2AAWA 2LJKA 3GFKA 3Q74A 5JCWA 3F4RA 2O8VB 2NVLA 2YWOA 1SU9A 5IMFA 3HJPA 2WCIA 2ZNMA 3TB2A 3EMXA 2HXKA 4ML1A 4POBA 3MDKA 1SJ6A 2REMA 2XBQA 1J0FA 6GSYA 3KD0A 3PGTA 4G10A 2A2RA 3FKFA 3EYTA 4TXOA 2M46A 2HRAA 1BEDA 5BMUA 1ZGNA 4IP6A 5CRGA 2WRTA 3G9BA 4TKYA 4TR3A 1PA3A 1DBYA 2OA7A 1M99A 1M2AA 1R4WA 2VCVA 3TRQA 1Y6EA 2DIZA 2DC5A 5ELGA 2JACA 2LUSA 2V32A 4HQSA 5KN0A 3M0FA 1R7HA 5GAPD 4MK3A 4PXOA 3GKMA 4MMMA 4ML6A 2FWFA 6GSUA 4I2TA 3IOSA 3DVWA 2YJHA 4G0LA 4XIHA 3GHAA 4MJAA 2CV4A 1Z3EA 1TDIA 3E9JB 3KJYA 1B9YC 1Z6MA 2H0IA 2C0GA 2H75A 3DWVA 1PKWA 4PQHA 1F3BA 5A4WA 1PD21 2QKEA 5KEJA 5FT3A 4QQ7A 1X0RA 3RPNA 3VI5A 2IMIA 2FWGA 4JRRA 4G2EA 1QFNA 2HZEB 2LQQA 3NZNA 4HU7A 1R5AA 4XS1A 2O87A 4OFTA 5B7CA 2E7PA 4GTUA 2LS5A 4POLA 3A2VA 3P8WA 3F4TA 4G9HA 3A2WA 2O89A 1AQXA 1SKSB 2R4VA 4MABA 3CTGA 20GSA 1GTUA 2M80A 5AIVA 1IYIA 1LU4A 3CRUA 1K0AA 5JWQB 2KP2A 3WGDA 3UAPA 3IAS2 3ME7A 3TCOA 3E3EA 4IW9A 4P3YB 3DEXA 2LKUA 3LJRA 4WR4A 4GCIA 2G0FA 1DSBA 2VM1A 1T3BA 1HNCA 2GTUA 1A8YA 4KAEA 4J57E 4AJ8A 4EUYA 1SD8A 1T7PB 1U6TA 1TW9A 2IL3A 4XCSA 1ERWA 3ERWA 2IJYA 4XHMA 3TOUA 2H76A 2HQTA 4V2NA 2LEGA 4WXTA 1EP8A 3LWAA 4TR0A 4YQVA 3G7YA 2FLSA 1PMTA 3ERFA 1X5DA 1ILOA 1YY7A 1TI3A 4RI6A 1BX9A 4JZQA 5H5QA 1TK5B 5ELAA 3CXGA 2H73A 3DMLA 2LV3A 5F05A 3W6GA 2LTKA 4IJ3A 3ME8A 5F0GA 1HQOA 5J9CA 1OKDA 4ZB6A 3UJ1A 5C04A 2IFQA 2YZUA 3QAVA 4HS1A 4F0BA 3WGEA 3FYGA 1K0MA 3IBHA 4HI7A 4N10A 5CRWA 5HQPA 1PX7A 1U88A 5CRHA 1GSUA 5KN1A 1WWJA 2NTOA 1G7EA 3M3MA 2JU5A 2JZTA 3P2AA 4Q5NA 5CREA 5H5SA 2HLSA 1SL0B 3F0IA 2P5RA 1V9WA 1KNGA 3HZ8A 2C4JA 4O32A 1HNBA 2C3QA 1W4VA 1G0TA 2C0EA 1WRYA 2C3NA 1ZMAA 4ECBA 3US3A 1OVNA 3UVTA 5JWOB 1QGVA 3IC4A 2H0HA 4EC0A 3EU4A 4XRDA 3QPMA 4HOJA 2YNXA 2OE1A 5AIXA 4XS4B 1BQ7A 2B5EA 4WEYA 3IE3A 4ULXA 2H1GA 2XHFA 3JCML 3MWHA 4BVYA 2CT6A 1K0BA 3EU3A 1XFLA 5E59A 3RDWA 4ECCA 5JCGA 1VF3A 3KMOA 2RUEA 3QOUA 2HRFA 5ECRB 1G6YA 3TGZA 4BVXA 1T1VA 1OE8A 1TJDA 3EINA 1XW9A 3LXTA 5AISA 1V2AA 2PPTA 12GSA 4PUAA 1TTZA 4NPBA 1GL8A 4PNGA 1TRWA 4NV5A 5ECNB 1DUGA 5GSTA 3OR5A 3W8SA 2FGXA 5IO2A 3KZQA 2ZUPA 2JZRA 3G7IA 2H6ZA 5ECKB 1THOA 1PQNA 2WS2A 2VLTA 3IR4A 5DAKB 5IMCA 4MPFA 4JR6A 2FA8A 1EWXA 4BA7A 1M2DA 1Y25A 5G1KA 2TRXA 5J9BA 2B3SA 2RM6A 2YPMA 3H79A 4PX1A 4EKZA 1SK2A 3GKXA 3VLNA 1O85A 4YAPA 3FZAA 4JU5A 2I9HA 1X9MB 3G7JA 4WF4A 3EURA 3L0HA 4RI7A 4OO5A 4PNFA 5DVBA 3VPQA 2FHEA 2RLIA 5AGYA 4I97A 2H30A 4OCEA 1PL2A 1NM3A 1XVWA 4G0IA 4DSRA 3PH9A 4FYUA 4EVMA 3FZ5A 2H6XA 3KEBA 2XPEA 1B8XA 2VL2A 4ZILA 3GUSA 3DRNA 3LSZA 5JWRB 3FHKA 1GLQA 4KCAA 3ZITA 4N0VA 9GSSA 4K7IA 4NHWA 4MZBA 3QAWA 4HJ2A 5DALA 4QL7A 3QAGA 1YJ6A 1FB6A 1GSYA 5EPFA 3CRTA 2YWMA 4OO4A 4MA9A 4PQIA 1MDJA 1C72A 3GL3A 1ZL9A 2CVBA 2HNLA 5J41A 2OE3A 3GMFA 3LORA 2DIYA 3M8NA 3D0ZA 4LL1B 5IIZA 4KX4A 1XOBA 1K3YA 3R2QA 4E8EA 2J23A 1OAZA 4K7OA 2GLRA 4F03A 1MDIA 4I5QA 2GZPA 2H8LA 3UMAA 2KHPA 1KBNA 2V2GA 1O8WA 5DQYA 3GURA 2VLUA 3EWLA 3FR6A 4ECJA 1BJXA 5ID2A 4MP4A 1XCCA 1HD2A 3O76A 5IO0A 2H1AA 4ZL7A 1FHEA 1H4OA 1WP0A 1W89A 3PPUA 1JLWA 1MD4A 1YF1A 2VD0A 2C80A 3HYPA 3QFBC 1QK8A 3HVSA 2WGRA 1OE7A 1ERUA 3O3TA 3BJ5A 4ZL8A 1U3IA 3LQ7A 2HZFA 3KH7A 3FEUA 4MZCA 1B4PA 3ZLPA 1HNAA 2ALBA 2L5LA 3ZFLA 1DE2A 2QGVA 5CP1A 3DVXA 2L6DA 1GSQA 2JZSA 3C73A 1MD3A 3K8NA 4ZL9A 1ERVA 2VLVA 4WBRD 4AJ6A 2LJAA 4WBJA 2GT5A 2B5XA 3HXSA 5D9TA 1F2EA 4MPGA 1WE0A 1VGLA 4F2IA 4YQMA 1K0DA 1SYRA 5H5RA 5A5KA 3KIJA 11GSA 4X43A 4MJEA 3PR8A 3TKSA 5B8BA 4JBBA 2H66A 3U6VA 2H1BA 1XZOA 3GIXA 5HFIA 1A0FA 1AW9A 4ACSA 1YQ1A 4J2FA 1R26A 5HR1A 4PTSA 1EZKA 3UOMA 4ZB9A 4EF0A 4L0WA 2LJRA 2I4AA 4FIWA 3GNJA 4TXOB 4POMA 5G30A 4J56E 2PBJA 2NBSA 2GZYA 2CZ2A 3H4KA 1PSQA 17GSA 5ECQB 4KB3A 1M2BA 2A2SA 1K3OA 4USSA 3D21A 2AJQB 2LRCA 3QD9A 7GSSA 2HZEA 1FW1A 4Q5QA 3FR3A 5DCGA 3MNGA 1TP9A 5D9VA 2DJ1A 3ERGA 6GSTA 1K0OA 4O5RA 2VOCA 3HVXA 4LA1A 3F63A 1ZCPA 4QL9A 5LD0A 2DBCA 1X9SB 3HZ4A 1GULA 2X64A 2H1DA 4IKHA 3KXOA 3UBLA 1AIUA 2HRKB 2NDOA 4KDUA 3H8QA 5HR0A 5G1LA 5CRDA 4NHZA 4G0KA 3KTLA 4F9ZA 2KOKA 2GSQA 1OC3A 3ZVJA 4HEA2 4GRFA 1EEJA 1Z7RA 4KE3A 6GSWA 4K0GA 4K0NA 2VL3A 5D8IA 1VRSD 2ON5A 3ZIJA 5CAXA 1O6JA 3FZ9A 2KP1A 2B1LA 3CMIA 2WDUA 4GXZA 4KW6A 2IMKA 3VWXA 1NW2A 1TOFA 1THXA 2JSYA 5F06A 3N5OA 4GSTA 4CHSA 3C1SA 2CZ3A 1XWAA 5DJMA 2GQMA 2C0DA 3BOAA 5ECMB 5DQSA 1A2MA 1O8XA 1HYUA 3IK9A 1XWBA 2H01A 1ZZYA 4OMVA 1O81A 3HHVA 3TJKA 3ZZXA 3HCZA 2DMMA 2A4VA 1TRVA 2DJKA 3FZ4A 3HD5A 1T4YA 1FOVA 6GSXA 4L5OA 4IN0A 3F3RA 1E6BA 3GX8A 2FWEA 1SL1B 2VIMA 4BWSA 2I3YA 5A4VA 3F3QA 3TUEA 1OKTA 4HU9A 2MMAA 2GSTA 2YOIA 1JLVA 4DVCA 2L59A 2M72A 4JEDA 3GSTA 1FVKA 4DSSA 1SKWB 4JE1A 1SENA 2DMLA 1FAAA 4CW9A 1ABAA 1TK8B 2IN3A 1Z7PA 1U3AA 2L4CA 1A8LA 2LNTA 1GTBA 1Z5YE 3I43A 4GQFA 3D4TA 1TRSA 5CNWA 3UARA 3HY2A 2VM2A 1VF4A 2VD1A 3E0UA 3FY7A 3LEFA 2MBTA 1AUCA 3PINA 3J7Yb 1FB0A 3KH9A 3O6TA 5HFGA 1AQWA 4HZ4A 3V1WA 1VF2A 4ZIJA 4PQ1A 1F6MC 4LLRA 2JL4A 1S3DA 2O85A 2X8CA 4I2UA 1Q98A 1K0NA 4V1Ag 2PERA 5GSSA 2GQLA 4HDEA 2O7KA 2VO4A 1IYHA 1PKZA 1GSDA 3ZIVA 4X0XA 3C71A 5KN3A 2PN8A 2XC2A 3L9VA 2WFCA 2GZZA 1JZOA 4DEJA 2YV9A 3VI7A 4HJMA 3KM6A 3HKRA 2K8VA 2GSRA 2CAIA 3IV4A 2HSMB 1OC9B 2IMFA 1GTAA 3MAKA 5CO3A 2YZHA 3C8EA 3F9UA 4IBPA 2OE0A 2R2JA 2LQOA 3SWLA 2YWNA 1GH2A 2YCDA 1O7UA 2FD3A 4IVFA 2V6OA 1M9BA 2V1MA 4KA0A 5IQYA 2IIYA 4NMUA 4IELA 3HDCA 2TIRA 1B9XC 2G2QA 4EDYA 1RW1A 4ZXGA 2L4QA 2IPAA 1GSFA 3GTUB 2K8SA 2B5YA 1VF1A 1U87A 5DAKA 4TR1B 3UVHA 1NSWA 2VL2C 2QC7A 3GN3A 1WPIA 1YEPA 1S3CA 4TRXA 4TVEA 2HSHA 2B6MA 2PWJA 1M9AA 1DE1A 4K1FA 4EO3A 2D2ZA 18GSA 4EE0A 4HQZA 4MCUA 4N0ZA 4XS6A 1M0UA 4ZBDA 1OC8A 3GKKA 2YANA 3U5RE 2OJLA 1PL1A 2WB9A 2HI7A 3IC8A 4G19A 5G31A 2YWIA 5FHIA 2K18A 5IMDA 4MZWA 1XBSA 1T00A 3H1NA 4ZB8A 5GAND 1RQMA 2F9SA 3VWWA 3APSA 1XWGA 4MDCA 3RPPA 1QUWA 4ILFA 5D93A 1JHBA 4KH7A 1SD9A 3KP8A 4YH2A 10GSA 1AAZA 2CQ9A 1QXHA 3WGXA 5COHA 5ECSA 4BL7B 1ZOFA 1OYJA 2V41A 5LCZA 3QFAC 1ZYQB 1GTIA 3I69A 2ES7A 4TR4A 2BTOT 1A23A 3RBTA 5F07A 2VL9A 3C7MA 1I9DA 3I9V2 2H6YA 1GNWA 3QCPA 3DYRA 1WMJA 4BWQA 4I8BA 1UN2A 1YEXA 2C8UA 2OBIA 1B4QA 2ZCTA 3WD6A 2FY6A 4L5LA 2CAQA 2PGTA 4TN8A 5E4WA 5EL8A 4HZ2A 3GKNA 3HJOA 4WF5A 4NAXA 3ZMKA 4FYBA 2MMOA 5B8AA 4ID0A 4IQAA 3GL5A 4IHUA 3M9JA 4IGJA 4EDZA 1V58A 1N8JA 1CQGA 1UA5A 1I5GA 4FQUA 5D9WA 3L4NA 3LGCA 3GRXA 3DD3A 5FWGA 1K3LA 5CYYA 3EC3A 1XPVA 5DBQA 1TRUA 2HRNA 1PX6A 1GUKA 2RIIA 4KF9A 5ID2B 3TKSC 4FYCA 19GSA 2PU9C 3RHBA 3ZTLA 1WJKA 1Z6NA 2CA8A 2OKAA 1J08A 1X9WB 4K6XA 3KP9A 4WKWA 4Z7XA 4MLYA 1GLPA 3TKRA 4IP1A 2AV4A 3TKQA
chains in the Genus database with same CATH superfamily
1TKDB 4IQ1A 2WW2A 2VAFA 4PGTA 3LYPA 4EIQA 5IOWA 1EGOA 1X5CA 1YEWC 1KTEA 4O92A 1TU7A 3SBCA 4ZBAA 4H86A 4D73B 1PN9A 4KGIA 5KOXA 4GWRA 4FO5A 3WT1A 3LXZA 1XW5A 4GF0A 4MH2A 2H19A 4OFMA 2DSAA 4Q5FA 3WYWA 2FWHA 3VK9A 3GH6A 3TJGA 4V1Ap 1CQHA 3CTFA 2AYTA 4NWYA 4ISDA 2BMXA 2GS3A 2AB6A 1SJIA 3BCKA 1SJZA 2X8HA 2FUG2 4KUNA 4TXVA 3Q18A 1UVZA 1YKAA 3S9FA 4JR4A 5ECPB 3C1RA 3R3EA 3VURA 4XRAA 2J9HA 3FK8A 4MF6A 1TI1A 3MYDA 5BMUB 4V2LA 5EY6A 1GSSA 2X8GA 1EOHA 2P5QA 2MMNA 1FVJA 3EMPA 2E0QA 4NXIA 5J5NA 4V2MA 2VCXA 5J3RA 1T4ZA 2EIOA 2VCWA 14GSA 1USBA 2L6CA 1F37A 3I6AA 4L0UA 3QMXA 5B6NA 3A2XA 5D96A 3UBKA 5C00A 4PI2C 2LSTA 2X99A 5D73A 1GP1A 3CSIA 2MMZA 2HRKA 1EEMA 3ZFBA 2DJ3A 1WIKA 3VPTA 1FG4A 4KNDA 1FO5A 4Q5RA 5DJLA 2WULA 2ON7A 5HFKA 4K2DA 1I1IP 2N5FA 1G6WA 1GUHA 1RK4A 5IPHA 1PGTA 2UZ8A 3LFLA 2HT9A 1SK0A 3N9JA 4K5RA 1YDKA 2R0CA 4XTSA 4EL1A 3RHCA 13GSA 2DJJA 4OFNA 2VCQA 3F4SA 3MSZA 4NV2A 2E2GA 1BAYA 4N30A 4W66A 2N5BA 1O73A 3LYKA 3TDGA 1M3IA 3D4MA 3IK7A 4F82A 1YKCA 1A0RP 2OADA 3F6DA 1GWCA 2HYXA 1YVLA 8GSSA 1SKRB 1ST9A 1AC1A 3ZVJD 1SYXA 2EC4A 1Q4JA 3BCIA 2JSZA 3FR9A 3APQA 1ON4A 3L9UA 16GSA 3ZREA 2GVPA 5J40A 3TOTA 1S3RA 4POKA 2GSSA 2YJ7A 3GSSA 5ECHB 2H72A 2LRTA 2PVOC 1V40A 4GQCA 5L71A 2C0FA 3ZMLA 5D9XA 3FW2A 1GUMA 2E2MA 2F51A 2XPDA 3FRCA 2EIRA 4A5PA 2H74A 1QQ2A 1MEKA 3IA1A 4RQXA 4DSQA 2Z9SA 1S4BP 1ZYEA 1UC7A 1XWKA 2IMDA 4PUFC 1NHOA 5INYA 2GT6A 5A4UA 3ZYWA 3J7Yk 1XVQA 3H93A 2L57A 5EVOA 3RFRC 2BJXA 3P90A 3TJBA 3Q19A 1URMA 1XIYA 5ECIB 2VCZA 1WOUA 2DLXA 3IAM2 3W8JA 1A24A 3APOA 4DSSB 4MJBA 22GSA 5HR3A 1LJRA 2OBKA 2CX3A 1H75A 1BG5A 1EP7A 3WT2A 4OD7A 1TXXA 2PMTA 2GDRA 1YF0A 2IFQB 4CDOA 3M1GA 1GRXA 4L8EA 2PUKC 4WETA 5IMZA 1JZWA 3NOFA 1G7OA 2MBSA 2IWTA 5KN2A 1GNEA 4GSSA 6GSSA 1R5PA 2HSYA 4XS4A 2AUVA 2R3XA 2HSMA 1OC9A 1SL2B 4PHZC 3L78A 4RUVA 2I81A 2MYGA 4CY8A 1E2YA 4FH8A 5F8BA 3GA4A 2P0GA 3ZRDA 3CSJA 4PURA 3ED3A 3IDVA 3DXBA 2RUFA 3HJMA 3NIVA 2X49A 4OWYA 4K8MA 2L5OA 3P7XA 1YZXA 3CSHA 2TRCP 4MF7A 4Z2RA 2YV7A 3EPTA 4AF2A 1N25A 2IMEA 1JZRA 4O5QA 3TKPA 4Z2UA 3GTUA 4EXJA 4RQRA 3DIEA 4YQUA 3M9KA 3RAZA 4TR1A 3GV1A 2DKHA 2DKIA 1EV9A 2GQKA 1TK0B 4BVYB 2CVDA 2F8AA 4MH3A 4MF5A 4GDFA 3F8UA 3IHQA 5G5FA 4KDXA 3CBUA 3QR6A 4BVXB 4LMVA 1S3AA 4KSOA 5IMAA 4AKIA 2B7JA 3QDNA 1TU8A 2F8FA 2PVQA 5IOXA 2C3TA 5LNKe 5ECLB 3TRPA 4E8HA 2YN1A 3GX0A 3D6IA 3UEMA 4KDYA 2FCHA 2YP6A 3GYKA 4GSNA 3UIWA 2XBIA 3HVVA 2H70A 3KTBA 1T8EB 1EV4A 4O5UA 1AXDA 3VFIA 3ZL5A 2HFDA 2I1UA 2RM5A 3UL3A 3VWUA 1MTCA 4LMWA 3TKSE 1XXUA 3BBYA 3KCMA 2P31A 2OT3A 1XWCA 4BL7A 3DKSA 4IJIA 3HA9A 1GSEA 1JZDA 2WZSA 3HMJG 4AI6A 2LNSA 3CYNA 1F3AA 4X1UA 3VWVA 2N5AA 3A3TA 4AGSA 3IXRA 4K7NA 4KSMA 1V57A 3GH9A 3KGKA 2DJ2A 1AQVA 1PFOA 3L9SA 2QSIA 3ISOA 4TOPA 5IPGA 4LL4B 1J9BA 5G2ZA 2B7KA 4G01A 1NHYA 4F0CA 5DALB 3TJFA 3F6FA 5DDLA 6GSVA 2OACA 2VUPA 1K0CA 1M7TA 3TJJA 2EIQA 2A4HA 4K9ZA 3BD2A 3IPZA 4I6XA 2HSNB 4GLTA 4BIKA 4KCEA 1N2AA 1QMVA 2CVKA 4Z2TA 2K9FA 2WW0A 3AY8A 2LRNA 1A2LA 4MJCA 5DCHA 2R5GA 1ACVA 1JFUA 2WJUA 2NPBA 4YKFA 5HR2A 4ZBBA 3Q6OA 1F9MA 2O36A 1Z9HA 5JCUA 3D5JA 5ENUA 2DJ0A 2WZ9A 1XOAA 3LG6A 1MDKA 5IMVA 2FNOA 1LBKA 4O7HA 4AJ7A 5ECOB 2B1KA 3HVNA 1BYEA 3KMNA 1B48A 2K6VA 2VCTA 2H0GA 2JADA 2R6KA 3EE2A 1ML6A 4TW5A 5GZZB 4WR5A 2MZCA 4YAVA 5ABRA 5A1NA 4ECIA 1EOGA 1EGRA 1A2JA 2F3MA 2AHEA 1ERTA 2C1YA 5IM9A 3TRXA 3D22A 2WVZA 3IRAA 2H1LA 2FA4A 5B6MA 2CX4A 1KEBA 1XW6A 5G5EA 3EVIA 2KLXA 4N11A 1PRXA 2H71A 4OCFA 2V6KA 2KUCA 4IS0A 4D73A 2HE3A 1X5EA 4HUAA 4BPYA 5AN1A 1PN0A 3IHGA 1V98A 2R37A 2GGTA 1SK1A 5J4UA 3A5WA 2EFCA 3DGQA 2AAWA 2LJKA 3GFKA 3Q74A 5JCWA 3F4RA 2O8VB 2NVLA 2YWOA 1SU9A 5IMFA 3HJPA 2WCIA 2ZNMA 3TB2A 3EMXA 2HXKA 4ML1A 4POBA 3MDKA 1SJ6A 2REMA 2XBQA 1J0FA 6GSYA 3KD0A 3PGTA 4G10A 2A2RA 3FKFA 3EYTA 4TXOA 2M46A 2HRAA 3A5IA 1BEDA 5BMUA 1ZGNA 4IP6A 5CRGA 2WRTA 3G9BA 4TKYA 2WVXB 4TR3A 1PA3A 1DBYA 2OA7A 1M99A 1M2AA 3TU3B 1R4WA 1SVMA 2VCVA 3TRQA 1Y6EA 2DIZA 2DC5A 1Y1UA 4CY6A 5ELGA 2UV8G 2JACA 2LUSA 2V32A 4HQSA 5KN0A 3M0FA 1R7HA 5GAPD 4MK3A 4PXOA 3GKMA 4MMMA 4ML6A 2FWFA 6GSUA 4I2TA 3IOSA 3DVWA 2YJHA 4G0LA 4XIHA 3GHAA 4MJAA 2CV4A 1Z3EA 1TDIA 3E9JB 3KJYA 1B9YC 1Z6MA 2H0IA 2C0GA 2H75A 3DWVA 4PI0C 1PKWA 4PQHA 2VKZG 1F3BA 5A4WA 1PD21 2QKEA 5KEJA 5FT3A 4QQ7A 1X0RA 2EFHA 4FXYP 3RPNA 3VI5A 3CWGA 2IMIA 2FWGA 4JRRA 4G2EA 1QFNA 2HZEB 2LQQA 3NZNA 4HU7A 1R5AA 4XS1A 2O87A 4OFTA 5B7CA 2E7PA 4GTUA 2LS5A 4POLA 3A2VA 3P8WA 3F4TA 4G9HA 3A2WA 2O89A 1AQXA 1SKSB 2R4VA 4MABA 3CTGA 20GSA 1GTUA 2M80A 5AIVA 1IYIA 1LU4A 3CRUA 1K0AA 5JWQB 2KP2A 3WGDA 3UAPA 3IAS2 3MIXA 3ME7A 3TCOA 3E3EA 4IW9A 4P3YB 3DEXA 2LKUA 3LJRA 4WR4A 4GCIA 2G0FA 1DSBA 5A5HB 2VM1A 1T3BA 1HNCA 2GTUA 1A8YA 2O5VA 4KAEA 4J57E 4AJ8A 4EUYA 1SD8A 1T7PB 1U6TA 1TW9A 2IL3A 4XCSA 1ERWA 3ERWA 2IJYA 4XHMA 3TOUA 2H76A 2HQTA 2WW1A 4V2NA 2LEGA 4WXTA 1EP8A 3LWAA 2O3EA 4TR0A 4YQVA 3G7YA 2FLSA 1PMTA 3ERFA 1X5DA 1ILOA 1YY7A 1TI3A 2R0GA 4RI6A 1BX9A 4JZQA 5H5QA 1TK5B 5ELAA 3CXGA 2H73A 3LW9A 3DMLA 2LV3A 1SVLA 5F05A 3W6GA 2LTKA 4IJ3A 3ME8A 5F0GA 1HQOA 5J9CA 1OKDA 4ZB6A 3UJ1A 5C04A 2IFQA 2YZUA 3QAVA 4HS1A 4F0BA 3WGEA 3FYGA 4AKXB 1K0MA 3IBHA 4HI7A 4N10A 5CRWA 5HQPA 1PX7A 1U88A 5CRHA 1GSUA 5KN1A 1WWJA 2NTOA 1G7EA 3M3MA 2JU5A 2JZTA 3P2AA 4Q5NA 5CREA 5H5SA 2HLSA 1SL0B 3F0IA 2P5RA 1V9WA 1KNGA 3HZ8A 2C4JA 4O32A 1HNBA 2C3QA 1W4VA 1G0TA 2C0EA 1WRYA 2C3NA 1ZMAA 4ECBA 3US3A 1OVNA 3UVTA 5JWOB 1QGVA 3IC4A 2H0HA 4EC0A 3EU4A 4XRDA 3QPMA 4HOJA 2YNXA 2OE1A 5AIXA 4XS4B 1BQ7A 2B5EA 4WEYA 3IE3A 4E68A 4ULXA 2H1GA 2XHFA 3JCML 3MWHA 4BVYA 2CT6A 1K0BA 3EU3A 1XFLA 5E59A 3RDWA 4ECCA 5JCGA 1VF3A 3KMOA 2RUEA 3QOUA 2HRFA 5ECRB 1G6YA 3TGZA 4BVXA 1T1VA 1OE8A 1TJDA 3EINA 1XW9A 3LXTA 5AISA 1V2AA 2PPTA 12GSA 4PUAA 1TTZA 4NPBA 1GL8A 4PNGA 1TRWA 4NV5A 5ECNB 1DUGA 5GSTA 3OR5A 3W8SA 2FGXA 5IO2A 3KZQA 2ZUPA 2JZRA 3G7IA 2H6ZA 5ECKB 1THOA 1PQNA 2WS2A 2VLTA 3IR4A 5DAKB 5IMCA 4MPFA 4JR6A 2FA8A 1EWXA 4BA7A 1M2DA 1Y25A 5G1KA 2TRXA 1ZYNA 5J9BA 3RGBC 2B3SA 2RM6A 2YPMA 3H79A 4PX1A 4EKZA 1SK2A 1FOHA 3GKXA 3VLNA 1O85A 4YAPA 3FZAA 4JU5A 2I9HA 1X9MB 3G7JA 4WF4A 3EURA 3L0HA 4RI7A 4OO5A 4PNFA 2QA1A 3VPQA 5DVBA 2FHEA 2RLIA 5AGYA 4I97A 2H30A 4OCEA 1PL2A 1NM3A 1XVWA 4G0IA 4DSRA 3PH9A 4FYUA 4EVMA 3FZ5A 2H6XA 3KEBA 2XPEA 1B8XA 2VL2A 4ZILA 3GUSA 3DRNA 3LSZA 5JWRB 3FHKA 1GLQA 4KCAA 3ZITA 4N0VA 9GSSA 4K7IA 4NHWA 4MZBA 3QAWA 4HJ2A 5DALA 4QL7A 3QAGA 1YJ6A 1FB6A 1M3JA 1GSYA 5EPFA 3CRTA 2YWMA 4OO4A 4MA9A 2HSNA 4PQIA 1MDJA 1C72A 3GL3A 1ZL9A 2CVBA 2HNLA 5J41A 2OE3A 3GMFA 3LORA 2DIYA 3M8NA 3D0ZA 4LL1B 5IIZA 4KX4A 1XOBA 1K3YA 3R2QA 4E8EA 2J23A 1OAZA 4K7OA 2GLRA 4F03A 1MDIA 4I5QA 2GZPA 2H8LA 3UMAA 2KHPA 1KBNA 2V2GA 1O8WA 5DQYA 5J4YA 5J47A 3FMWA 3GURA 2QA2A 2VLUA 3EWLA 3FR6A 4ECJA 1BJXA 5ID2A 4MP4A 1XCCA 1HD2A 3O76A 5IO0A 2H1AA 4ZL7A 1FHEA 1H4OA 1WP0A 1W89A 3PPUA 1JLWA 1MD4A 1YF1A 2VD0A 2C80A 3HYPA 3QFBC 1QK8A 3HVSA 5A34B 2WGRA 1OE7A 1ERUA 3O3TA 3BJ5A 4ZL8A 1U3IA 3LQ7A 2HZFA 3KH7A 3FEUA 4MZCA 1B4PA 3ZLPA 1HNAA 2ALBA 2L5LA 3ZFLA 1DE2A 2QGVA 5CP1A 3DVXA 2L6DA 1GSQA 2JZSA 3C73A 1TXUA 1MD3A 3K8NA 4ZL9A 1ERVA 2VLVA 4WBRD 4AJ6A 2LJAA 4WBJA 2GT5A 2B5XA 3HXSA 5D9TA 1F2EA 2EFDA 4MPGA 1WE0A 1VGLA 2R0PA 4F2IA 2WVXA 4YQMA 1K0DA 1SYRA 5H5RA 5A5KA 3KIJA 11GSA 4X43A 4MJEA 3PR8A 3TKSA 5B8BA 4JBBA 2H66A 3U6VA 2H1BA 1XZOA 3GIXA 5HFIA 1A0FA 1AW9A 4ACSA 1YQ1A 4J2FA 1R26A 5HR1A 4PTSA 1EZKA 3UOMA 4ZB9A 4EF0A 4L0WA 2LJRA 2I4AA 4FIWA 3GNJA 4TXOB 4POMA 5G30A 4J56E 2PBJA 2NBSA 2GZYA 2CZ2A 3H4KA 1PSQA 17GSA 5ECQB 4KB3A 1M2BA 2A2SA 1K3OA 4USSA 3D21A 2AJQB 2LRCA 4AKHA 2WVYA 3QD9A 7GSSA 2HZEA 1FW1A 4Q5QA 3FR3A 5DCGA 3MNGA 1TP9A 5D9VA 2DJ1A 3ERGA 1XG8A 6GSTA 1K0OA 4O5RA 2VOCA 3HVXA 4LA1A 3F63A 1ZCPA 4QL9A 5LD0A 2DBCA 1X9SB 3HZ4A 1GULA 2X64A 2H1DA 4IKHA 3KXOA 3UBLA 1AIUA 2HRKB 2NDOA 4KDUA 3H8QA 1SVOA 5HR0A 5G1LA 5CRDA 1ZYPA 4NHZA 4G0KA 3KTLA 4F9ZA 2KOKA 2GSQA 1OC3A 3ZVJA 4HEA2 4GRFA 1EEJA 1Z7RA 4KE3A 6GSWA 4K0GA 4K0NA 2VL3A 5D8IA 1VRSD 2ON5A 3ZIJA 5CAXA 1O6JA 3FZ9A 2KP1A 2B1LA 3CMIA 2WDUA 4GXZA 4KW6A 4X4JA 2IMKA 3VWXA 1NW2A 1TOFA 1THXA 2JSYA 5F06A 3N5OA 4GSTA 4CHSA 3C1SA 2CZ3A 1XWAA 5DJMA 4K5SA 5A5HA 2GQMA 2C0DA 3BOAA 5ECMB 5DQSA 1A2MA 1O8XA 1HYUA 3IK9A 1XWBA 2H01A 1ZZYA 4OMVA 1O81A 3HHVA 3TJKA 3ZZXA 3HCZA 2DMMA 2A4VA 1TRVA 2DJKA 2EFEA 3FZ4A 3HD5A 1T4YA 1FOVA 6GSXA 4EIPA 4L5OA 4IN0A 3F3RA 1E6BA 3GX8A 2FWEA 1SL1B 2VIMA 4BWSA 2I3YA 5A4VA 3F3QA 3TUEA 1OKTA 4HU9A 2MMAA 2GSTA 2YOIA 1JLVA 4DVCA 2L59A 2M72A 4JEDA 3GSTA 1FVKA 4DSSA 1SKWB 4JE1A 1SENA 2DMLA 1FAAA 4CW9A 1ABAA 1TK8B 2IN3A 1Z7PA 1U3AA 2L4CA 1A8LA 2LNTA 1GTBA 1Z5YE 3I43A 4GQFA 3D4TA 1TRSA 5CNWA 3UARA 3HY2A 2VM2A 1VF4A 2VD1A 3E0UA 3FY7A 3LEFA 2MBTA 1AUCA 3PINA 3J7Yb 1FB0A 3KH9A 3O6TA 5HFGA 1AQWA 4HZ4A 3V1WA 1VF2A 4ZIJA 4PQ1A 1F6MC 4LLRA 2JL4A 1S3DA 2O85A 2X8CA 4I2UA 1Q98A 1K0NA 4V1Ag 2PERA 5GSSA 2GQLA 4HDEA 3CHXC 2O7KA 2WW3A 2VO4A 1IYHA 1PKZA 1GSDA 3ZIVA 4X0XA 3C71A 5KN3A 2PN8A 2XC2A 4ZB7A 3L9VA 2WFCA 2GZZA 1JZOA 4DEJA 2YV9A 3VI7A 4MNNA 4HJMA 3KM6A 3HKRA 2K8VA 2GSRA 2CAIA 3IV4A 2HSMB 1OC9B 2IMFA 1GTAA 3MAKA 5CO3A 2YZHA 3C8EA 3F9UA 4IBPA 2OE0A 2R2JA 2LQOA 3SWLA 4N3ZA 2YWNA 1GH2A 2YCDA 1O7UA 2FD3A 4IVFA 3CQFA 1BF5A 2V6OA 1M9BA 2X4AA 2V1MA 4KA0A 5IQYA 2IIYA 4NMUA 4IELA 3HDCA 2TIRA 1B9XC 2G2QA 4EDYA 1RW1A 4ZXGA 2L4QA 2IPAA 1GSFA 3GTUB 2K8SA 2B5YA 1VF1A 1U87A 5DAKA 4TR1B 3UVHA 1NSWA 2VL2C 2QC7A 3GN3A 1WPIA 1YEPA 1S3CA 4TRXA 4TVEA 2HSHA 2B6MA 2PWJA 1M9AA 1DE1A 4K1FA 4EO3A 2D2ZA 18GSA 4EE0A 4HQZA 4MCUA 4N0ZA 4XS6A 1M0UA 4ZBDA 1OC8A 5J4VA 2A2PA 3GKKA 2YANA 3U5RE 2OJLA 1PL1A 2WB9A 2HI7A 3IC8A 4G19A 5G31A 2YWIA 5FHIA 2K18A 5IMDA 4MZWA 1XBSA 1T00A 3H1NA 4ZB8A 5GAND 1RQMA 2F9SA 3VWWA 3APSA 5BRTA 1XWGA 4MDCA 3RPPA 1QUWA 1BG1A 4ILFA 5D93A 1JHBA 4KH7A 1SD9A 3KP8A 4YH2A 4YKGA 10GSA 1AAZA 2CQ9A 1QXHA 3WGXA 5COHA 5ECSA 4BL7B 1ZOFA 1OYJA 2V41A 5LCZA 3QFAC 1ZYQB 1GTIA 3I69A 2ES7A 4TR4A 2BTOT 1A23A 3RBTA 5F07A 2VL9A 3C7MA 1I9DA 3I9V2 4ICYA 2H6YA 1GNWA 3QCPA 3DYRA 1WMJA 4K2XA 4BWQA 4I8BA 1UN2A 1YEXA 2C8UA 2OBIA 1B4QA 2ZCTA 3WD6A 2FY6A 4L5LA 2CAQA 2PGTA 4TN8A 5E4WA 5EL8A 4HZ2A 3GKNA 3HJOA 4WF5A 4NAXA 3ZMKA 4FYBA 2MMOA 5B8AA 4ID0A 4IQAA 3GL5A 4IHUA 3M9JA 4IGJA 4EDZA 1V58A 1N8JA 1CQGA 1UA5A 4AKGA 1I5GA 4FQUA 5D9WA 3L4NA 3LGCA 5A34A 3GRXA 3DD3A 5FWGA 1K3LA 5CYYA 3EC3A 1XPVA 5DBQA 1TRUA 2HRNA 1PX6A 1GUKA 2RIIA 4KF9A 5ID2B 3TKSC 4FYCA 19GSA 2PU9C 3RHBA 5A1NB 4HSCX 3ZTLA 1WJKA 1Z6NA 2CA8A 2OKAA 1J08A 1X9WB 4K6XA 3KP9A 4WKWA 4Z7XA 4MLYA 4QMKA 1GLPA 5KOWA 3TKRA 4IP1A 2AV4A 3TKQA
chains in the Genus database with same CATH topology
1TKDB 4IQ1A 2VAFA 4PGTA 3LYPA 4EIQA 5IOWA 1EGOA 1X5CA 1KTEA 4O92A 1TU7A 3SBCA 4ZBAA 4H86A 4D73B 1PN9A 4KGIA 5KOXA 4GWRA 4FO5A 3WT1A 3LXZA 1XW5A 4GF0A 4MH2A 2H19A 4OFMA 2DSAA 4Q5FA 3WYWA 2FWHA 3VK9A 3GH6A 3TJGA 4V1Ap 1CQHA 3CTFA 2AYTA 4NWYA 4ISDA 2BMXA 2GS3A 2AB6A 1SJIA 3BCKA 1SJZA 2X8HA 2FUG2 4KUNA 4TXVA 3Q18A 1UVZA 1YKAA 3S9FA 4JR4A 5ECPB 3C1RA 3R3EA 3VURA 4XRAA 2J9HA 3FK8A 4MF6A 1TI1A 3MYDA 5BMUB 4V2LA 5EY6A 1GSSA 2X8GA 1EOHA 2P5QA 2MMNA 1FVJA 3EMPA 2E0QA 4NXIA 5J5NA 4V2MA 2VCXA 5J3RA 1T4ZA 2EIOA 2VCWA 14GSA 1USBA 2L6CA 1F37A 3I6AA 4L0UA 3QMXA 5B6NA 3A2XA 5D96A 3UBKA 5C00A 2LSTA 2X99A 5D73A 1GP1A 3CSIA 2MMZA 2HRKA 1EEMA 3ZFBA 2DJ3A 1WIKA 3VPTA 1FG4A 4KNDA 1FO5A 4Q5RA 5DJLA 2WULA 2ON7A 5HFKA 4K2DA 2N5FA 1G6WA 1GUHA 1RK4A 5IPHA 1PGTA 2UZ8A 3LFLA 2HT9A 1SK0A 3N9JA 4K5RA 1YDKA 2R0CA 4XTSA 4EL1A 3RHCA 13GSA 2DJJA 4OFNA 2VCQA 3F4SA 3MSZA 4NV2A 2E2GA 1BAYA 4N30A 4W66A 2N5BA 1O73A 3LYKA 3TDGA 3D4MA 3IK7A 4F82A 1YKCA 1A0RP 2OADA 3F6DA 1GWCA 2HYXA 1YVLA 8GSSA 1SKRB 1ST9A 1AC1A 3ZVJD 1SYXA 2EC4A 1Q4JA 3BCIA 2JSZA 3FR9A 3APQA 1ON4A 3L9UA 16GSA 3ZREA 2GVPA 5J40A 3TOTA 4POKA 2GSSA 2YJ7A 3GSSA 5ECHB 2H72A 2LRTA 2PVOC 1V40A 4GQCA 5L71A 2C0FA 3ZMLA 5D9XA 3FW2A 1GUMA 2E2MA 2F51A 2XPDA 3FRCA 2EIRA 4A5PA 2H74A 1QQ2A 1MEKA 3IA1A 4RQXA 4DSQA 2Z9SA 1ZYEA 1UC7A 1XWKA 2IMDA 4PUFC 1NHOA 5INYA 2GT6A 5A4UA 3ZYWA 3J7Yk 1XVQA 3H93A 2L57A 5EVOA 2BJXA 3P90A 3TJBA 3Q19A 1URMA 1XIYA 5ECIB 2VCZA 1WOUA 2DLXA 3IAM2 3W8JA 1A24A 3APOA 4DSSB 4MJBA 22GSA 5HR3A 1LJRA 2OBKA 2CX3A 1H75A 1BG5A 1EP7A 3WT2A 4OD7A 1TXXA 2PMTA 2GDRA 1YF0A 2IFQB 4CDOA 3M1GA 1GRXA 4L8EA 2PUKC 4WETA 5IMZA 1JZWA 3NOFA 1G7OA 2MBSA 2IWTA 5KN2A 1GNEA 4GSSA 6GSSA 1R5PA 2HSYA 4XS4A 2AUVA 2R3XA 2HSMA 1OC9A 1SL2B 3L78A 4RUVA 2I81A 2MYGA 4CY8A 1E2YA 4FH8A 5F8BA 3GA4A 2P0GA 3ZRDA 3CSJA 4PURA 3ED3A 3IDVA 3DXBA 2RUFA 3HJMA 3NIVA 2X49A 4OWYA 4K8MA 2L5OA 3P7XA 1YZXA 3CSHA 2TRCP 4MF7A 4Z2RA 2YV7A 3EPTA 4AF2A 1N25A 2IMEA 1JZRA 4O5QA 3TKPA 4Z2UA 3GTUA 4EXJA 4RQRA 3DIEA 4YQUA 3M9KA 3RAZA 4TR1A 3GV1A 2DKHA 2DKIA 1EV9A 2GQKA 1TK0B 4BVYB 2CVDA 2F8AA 4MH3A 4MF5A 4GDFA 3F8UA 3IHQA 5G5FA 4KDXA 3CBUA 3QR6A 4BVXB 4LMVA 1S3AA 4KSOA 5IMAA 4AKIA 2B7JA 3QDNA 1TU8A 2F8FA 2PVQA 5IOXA 2C3TA 5LNKe 5ECLB 3TRPA 4E8HA 2YN1A 3GX0A 3D6IA 3UEMA 4KDYA 2FCHA 2YP6A 3GYKA 4GSNA 3UIWA 2XBIA 3HVVA 2H70A 3KTBA 1T8EB 1EV4A 4O5UA 1AXDA 3VFIA 3ZL5A 2HFDA 2I1UA 2RM5A 3UL3A 3VWUA 1MTCA 4LMWA 3TKSE 1XXUA 3BBYA 3KCMA 2P31A 2OT3A 1XWCA 4BL7A 3DKSA 4IJIA 3HA9A 1GSEA 1JZDA 3HMJG 4AI6A 2LNSA 3CYNA 1F3AA 4X1UA 3VWVA 2N5AA 3A3TA 4AGSA 3IXRA 4K7NA 4KSMA 1V57A 3GH9A 3KGKA 2DJ2A 1AQVA 3L9SA 2QSIA 3ISOA 4TOPA 5IPGA 4LL4B 1J9BA 5G2ZA 2B7KA 4G01A 1NHYA 4F0CA 5DALB 3TJFA 3F6FA 5DDLA 6GSVA 2OACA 2VUPA 1K0CA 1M7TA 3TJJA 2EIQA 2A4HA 4K9ZA 3BD2A 3IPZA 4I6XA 2HSNB 4GLTA 4KCEA 1N2AA 1QMVA 2CVKA 4Z2TA 2K9FA 3AY8A 2LRNA 1A2LA 4MJCA 5DCHA 2R5GA 1ACVA 1JFUA 2WJUA 2NPBA 4YKFA 5HR2A 4ZBBA 3Q6OA 1F9MA 1Z9HA 5JCUA 3D5JA 5ENUA 2DJ0A 2WZ9A 1XOAA 3LG6A 1MDKA 5IMVA 2FNOA 1LBKA 4O7HA 4AJ7A 5ECOB 2B1KA 1BYEA 3KMNA 1B48A 2K6VA 2VCTA 2H0GA 2JADA 2R6KA 3EE2A 1ML6A 4TW5A 5GZZB 4WR5A 2MZCA 4YAVA 5ABRA 5A1NA 4ECIA 1EOGA 1EGRA 1A2JA 2F3MA 2AHEA 1ERTA 2C1YA 5IM9A 3TRXA 3D22A 3IRAA 2H1LA 2FA4A 5B6MA 2CX4A 1KEBA 1XW6A 5G5EA 3EVIA 2KLXA 4N11A 1PRXA 2H71A 4OCFA 2V6KA 2KUCA 4IS0A 4D73A 2HE3A 1X5EA 4HUAA 4BPYA 5AN1A 1PN0A 3IHGA 1V98A 2R37A 2GGTA 1SK1A 5J4UA 3A5WA 2EFCA 3DGQA 2AAWA 2LJKA 3GFKA 3Q74A 5JCWA 3F4RA 2O8VB 2NVLA 2YWOA 1SU9A 5IMFA 3HJPA 2WCIA 2ZNMA 3TB2A 3EMXA 2HXKA 4ML1A 4POBA 3MDKA 1SJ6A 2REMA 2XBQA 1J0FA 6GSYA 3KD0A 3PGTA 4G10A 2A2RA 3FKFA 3EYTA 4TXOA 2M46A 2HRAA 3A5IA 1BEDA 5BMUA 1ZGNA 4IP6A 5CRGA 2WRTA 3G9BA 4TKYA 4TR3A 1PA3A 1DBYA 2OA7A 1M99A 1M2AA 3TU3B 1R4WA 1SVMA 2VCVA 3TRQA 1Y6EA 2DIZA 2DC5A 1Y1UA 4CY6A 5ELGA 2UV8G 2JACA 2LUSA 2V32A 4HQSA 5KN0A 3M0FA 1R7HA 5GAPD 4MK3A 4PXOA 3GKMA 4MMMA 4ML6A 2FWFA 6GSUA 4I2TA 3IOSA 3DVWA 2YJHA 4G0LA 4XIHA 3GHAA 4MJAA 2CV4A 1Z3EA 1TDIA 3E9JB 3KJYA 1B9YC 1Z6MA 2H0IA 2C0GA 2H75A 3DWVA 1PKWA 4PQHA 2VKZG 1F3BA 5A4WA 1PD21 2QKEA 5KEJA 5FT3A 4QQ7A 1X0RA 2EFHA 3RPNA 3VI5A 3CWGA 2IMIA 2FWGA 4JRRA 4G2EA 1QFNA 2HZEB 2LQQA 3NZNA 4HU7A 1R5AA 4XS1A 2O87A 4OFTA 5B7CA 2E7PA 4GTUA 2LS5A 4POLA 3A2VA 3P8WA 3F4TA 4G9HA 3A2WA 2O89A 1AQXA 1SKSB 2R4VA 4MABA 3CTGA 20GSA 1GTUA 2M80A 5AIVA 1IYIA 1LU4A 3CRUA 1K0AA 5JWQB 2KP2A 3WGDA 3UAPA 3IAS2 3MIXA 3ME7A 3TCOA 3E3EA 4IW9A 4P3YB 3DEXA 2LKUA 3LJRA 4WR4A 4GCIA 2G0FA 1DSBA 5A5HB 2VM1A 1T3BA 1HNCA 2GTUA 1A8YA 2O5VA 4KAEA 4J57E 4AJ8A 4EUYA 1SD8A 1T7PB 1U6TA 1TW9A 2IL3A 4XCSA 1ERWA 3ERWA 2IJYA 4XHMA 3TOUA 2H76A 2HQTA 4V2NA 2LEGA 4WXTA 1EP8A 3LWAA 4TR0A 4YQVA 3G7YA 2FLSA 1PMTA 3ERFA 1X5DA 1ILOA 1YY7A 1TI3A 4RI6A 2R0GA 1BX9A 4JZQA 5H5QA 1TK5B 5ELAA 3CXGA 2H73A 3LW9A 3DMLA 2LV3A 1SVLA 5F05A 3W6GA 2LTKA 4IJ3A 3ME8A 5F0GA 1HQOA 5J9CA 1OKDA 4ZB6A 3UJ1A 5C04A 2IFQA 2YZUA 3QAVA 4HS1A 4F0BA 3WGEA 3FYGA 4AKXB 1K0MA 3IBHA 4HI7A 4N10A 5CRWA 5HQPA 1PX7A 1U88A 5CRHA 1GSUA 5KN1A 1WWJA 2NTOA 1G7EA 3M3MA 2JU5A 2JZTA 3P2AA 4Q5NA 5CREA 5H5SA 2HLSA 1SL0B 3F0IA 2P5RA 1V9WA 1KNGA 3HZ8A 2C4JA 4O32A 1HNBA 2C3QA 1W4VA 1G0TA 2C0EA 1WRYA 2C3NA 1ZMAA 4ECBA 3US3A 1OVNA 3UVTA 5JWOB 1QGVA 3IC4A 2H0HA 4EC0A 3EU4A 4XRDA 3QPMA 4HOJA 2YNXA 2OE1A 5AIXA 4XS4B 1BQ7A 2B5EA 4WEYA 3IE3A 4E68A 4ULXA 2H1GA 2XHFA 3JCML 3MWHA 4BVYA 2CT6A 1K0BA 3EU3A 1XFLA 5E59A 3RDWA 4ECCA 5JCGA 1VF3A 3KMOA 2RUEA 3QOUA 2HRFA 5ECRB 1G6YA 3TGZA 4BVXA 1T1VA 1OE8A 1TJDA 3EINA 1XW9A 3LXTA 5AISA 1V2AA 2PPTA 12GSA 4PUAA 1TTZA 4NPBA 1GL8A 4PNGA 1TRWA 4NV5A 5ECNB 1DUGA 5GSTA 3OR5A 3W8SA 2FGXA 5IO2A 3KZQA 2ZUPA 2JZRA 3G7IA 2H6ZA 5ECKB 1THOA 1PQNA 2WS2A 2VLTA 3IR4A 5DAKB 5IMCA 4MPFA 4JR6A 2FA8A 1EWXA 4BA7A 1M2DA 1Y25A 5G1KA 2TRXA 1ZYNA 5J9BA 2B3SA 2RM6A 2YPMA 3H79A 4PX1A 4EKZA 1SK2A 1FOHA 3GKXA 3VLNA 1O85A 4YAPA 3FZAA 4JU5A 2I9HA 1X9MB 3G7JA 4WF4A 3EURA 3L0HA 4RI7A 4OO5A 4PNFA 2QA1A 3VPQA 5DVBA 2FHEA 2RLIA 5AGYA 4I97A 2H30A 4OCEA 1PL2A 1NM3A 1XVWA 4G0IA 4DSRA 3PH9A 4FYUA 4EVMA 3FZ5A 2H6XA 3KEBA 2XPEA 1B8XA 2VL2A 4ZILA 3GUSA 3DRNA 3LSZA 5JWRB 3FHKA 1GLQA 4KCAA 3ZITA 4N0VA 9GSSA 4K7IA 4NHWA 4MZBA 3QAWA 4HJ2A 5DALA 4QL7A 3QAGA 1YJ6A 1FB6A 1GSYA 5EPFA 3CRTA 2YWMA 4OO4A 4MA9A 2HSNA 4PQIA 1MDJA 1C72A 3GL3A 1ZL9A 2CVBA 2HNLA 5J41A 2OE3A 3GMFA 3LORA 2DIYA 3M8NA 3D0ZA 4LL1B 5IIZA 4KX4A 1XOBA 1K3YA 3R2QA 4E8EA 2J23A 1OAZA 4K7OA 2GLRA 4F03A 1MDIA 4I5QA 2GZPA 2H8LA 3UMAA 2KHPA 1KBNA 2V2GA 1O8WA 5DQYA 5J4YA 5J47A 3FMWA 3GURA 2QA2A 2VLUA 3EWLA 3FR6A 4ECJA 1BJXA 5ID2A 4MP4A 1XCCA 1HD2A 3O76A 5IO0A 2H1AA 4ZL7A 1FHEA 1H4OA 1WP0A 1W89A 3PPUA 1JLWA 1MD4A 1YF1A 2VD0A 2C80A 3HYPA 3QFBC 1QK8A 3HVSA 5A34B 2WGRA 1OE7A 1ERUA 3O3TA 3BJ5A 4ZL8A 1U3IA 3LQ7A 2HZFA 3KH7A 3FEUA 4MZCA 1B4PA 3ZLPA 1HNAA 2ALBA 2L5LA 3ZFLA 1DE2A 2QGVA 5CP1A 3DVXA 2L6DA 1GSQA 2JZSA 3C73A 1TXUA 1MD3A 3K8NA 4ZL9A 1ERVA 2VLVA 4WBRD 4AJ6A 2LJAA 4WBJA 2GT5A 2B5XA 3HXSA 5D9TA 1F2EA 2EFDA 4MPGA 1WE0A 1VGLA 2R0PA 4F2IA 4YQMA 1K0DA 1SYRA 5H5RA 5A5KA 3KIJA 11GSA 4X43A 4MJEA 3PR8A 3TKSA 5B8BA 4JBBA 2H66A 3U6VA 2H1BA 1XZOA 3GIXA 5HFIA 1A0FA 1AW9A 4ACSA 1YQ1A 4J2FA 1R26A 5HR1A 4PTSA 1EZKA 3UOMA 4ZB9A 4EF0A 4L0WA 2LJRA 2I4AA 4FIWA 3GNJA 4TXOB 4POMA 5G30A 4J56E 2PBJA 2NBSA 2GZYA 2CZ2A 3H4KA 1PSQA 17GSA 5ECQB 4KB3A 1M2BA 2A2SA 1K3OA 4USSA 3D21A 2AJQB 2LRCA 4AKHA 3QD9A 7GSSA 2HZEA 1FW1A 4Q5QA 3FR3A 5DCGA 3MNGA 1TP9A 5D9VA 2DJ1A 3ERGA 6GSTA 1K0OA 4O5RA 2VOCA 3HVXA 4LA1A 3F63A 1ZCPA 4QL9A 5LD0A 2DBCA 1X9SB 3HZ4A 1GULA 2X64A 2H1DA 4IKHA 3KXOA 3UBLA 1AIUA 2HRKB 2NDOA 4KDUA 3H8QA 1SVOA 5HR0A 5G1LA 5CRDA 1ZYPA 4NHZA 4G0KA 3KTLA 4F9ZA 2KOKA 2GSQA 1OC3A 3ZVJA 4HEA2 4GRFA 1EEJA 1Z7RA 4KE3A 6GSWA 4K0GA 4K0NA 2VL3A 5D8IA 1VRSD 2ON5A 3ZIJA 5CAXA 1O6JA 3FZ9A 2KP1A 2B1LA 3CMIA 2WDUA 4GXZA 4KW6A 4X4JA 2IMKA 3VWXA 1NW2A 1TOFA 1THXA 2JSYA 5F06A 3N5OA 4GSTA 4CHSA 3C1SA 2CZ3A 1XWAA 5DJMA 4K5SA 5A5HA 2GQMA 2C0DA 3BOAA 5ECMB 5DQSA 1A2MA 1O8XA 1HYUA 3IK9A 1XWBA 2H01A 1ZZYA 4OMVA 1O81A 3HHVA 3TJKA 3ZZXA 3HCZA 2DMMA 2A4VA 1TRVA 2DJKA 2EFEA 3FZ4A 3HD5A 1T4YA 1FOVA 6GSXA 4EIPA 4L5OA 4IN0A 3F3RA 1E6BA 3GX8A 2FWEA 1SL1B 2VIMA 4BWSA 2I3YA 5A4VA 3F3QA 3TUEA 1OKTA 4HU9A 2MMAA 2GSTA 2YOIA 1JLVA 4DVCA 2L59A 2M72A 4JEDA 3GSTA 1FVKA 4DSSA 1SKWB 4JE1A 1SENA 2DMLA 1FAAA 4CW9A 1ABAA 1TK8B 2IN3A 1Z7PA 1U3AA 2L4CA 1A8LA 2LNTA 1GTBA 1Z5YE 3I43A 4GQFA 3D4TA 1TRSA 5CNWA 3UARA 3HY2A 2VM2A 1VF4A 2VD1A 3E0UA 3FY7A 3LEFA 2MBTA 1AUCA 3PINA 3J7Yb 1FB0A 3KH9A 3O6TA 5HFGA 1AQWA 4HZ4A 3V1WA 1VF2A 4ZIJA 4PQ1A 1F6MC 4LLRA 2JL4A 1S3DA 2O85A 2X8CA 4I2UA 1Q98A 1K0NA 4V1Ag 2PERA 5GSSA 2GQLA 4HDEA 2O7KA 2VO4A 1IYHA 1PKZA 1GSDA 3ZIVA 4X0XA 3C71A 5KN3A 2PN8A 2XC2A 4ZB7A 3L9VA 2WFCA 2GZZA 1JZOA 4DEJA 2YV9A 3VI7A 4MNNA 4HJMA 3KM6A 3HKRA 2K8VA 2GSRA 2CAIA 3IV4A 2HSMB 1OC9B 2IMFA 1GTAA 3MAKA 5CO3A 2YZHA 3C8EA 3F9UA 4IBPA 2OE0A 2R2JA 2LQOA 3SWLA 4N3ZA 2YWNA 1GH2A 2YCDA 1O7UA 2FD3A 4IVFA 1BF5A 2V6OA 1M9BA 2X4AA 2V1MA 4KA0A 5IQYA 2IIYA 4NMUA 4IELA 3HDCA 2TIRA 1B9XC 2G2QA 4EDYA 1RW1A 4ZXGA 2L4QA 2IPAA 1GSFA 3GTUB 2K8SA 2B5YA 1VF1A 1U87A 5DAKA 4TR1B 3UVHA 1NSWA 2VL2C 2QC7A 3GN3A 1WPIA 1YEPA 1S3CA 4TRXA 4TVEA 2HSHA 2B6MA 2PWJA 1M9AA 1DE1A 4K1FA 4EO3A 2D2ZA 18GSA 4EE0A 4HQZA 4MCUA 4N0ZA 4XS6A 1M0UA 4ZBDA 1OC8A 5J4VA 2A2PA 3GKKA 2YANA 3U5RE 2OJLA 1PL1A 2WB9A 2HI7A 3IC8A 4G19A 5G31A 2YWIA 5FHIA 2K18A 5IMDA 4MZWA 1XBSA 1T00A 3H1NA 4ZB8A 5GAND 1RQMA 2F9SA 3VWWA 3APSA 5BRTA 1XWGA 4MDCA 3RPPA 1QUWA 1BG1A 4ILFA 5D93A 1JHBA 4KH7A 1SD9A 3KP8A 4YH2A 4YKGA 10GSA 1AAZA 2CQ9A 1QXHA 3WGXA 5COHA 5ECSA 4BL7B 1ZOFA 1OYJA 2V41A 5LCZA 3QFAC 1ZYQB 1GTIA 3I69A 2ES7A 4TR4A 2BTOT 1A23A 3RBTA 5F07A 2VL9A 3C7MA 1I9DA 3I9V2 4ICYA 2H6YA 1GNWA 3QCPA 3DYRA 1WMJA 4K2XA 4BWQA 4I8BA 1UN2A 1YEXA 2C8UA 2OBIA 1B4QA 2ZCTA 3WD6A 2FY6A 4L5LA 2CAQA 2PGTA 4TN8A 5E4WA 5EL8A 4HZ2A 3GKNA 3HJOA 4WF5A 4NAXA 3ZMKA 4FYBA 2MMOA 5B8AA 4ID0A 4IQAA 3GL5A 4IHUA 3M9JA 4IGJA 4EDZA 1V58A 1N8JA 1CQGA 1UA5A 4AKGA 1I5GA 4FQUA 5D9WA 3L4NA 3LGCA 5A34A 3GRXA 3DD3A 5FWGA 1K3LA 5CYYA 3EC3A 1XPVA 5DBQA 1TRUA 2HRNA 1PX6A 1GUKA 2RIIA 4KF9A 5ID2B 3TKSC 4FYCA 19GSA 2PU9C 3RHBA 5A1NB 3ZTLA 1WJKA 1Z6NA 2CA8A 2OKAA 1J08A 1X9WB 4K6XA 3KP9A 4WKWA 4Z7XA 4MLYA 4QMKA 1GLPA 5KOWA 3TKRA 4IP1A 2AV4A 3TKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKD B;  4IQ1 A;  2VAF A;  4PGT A;  3LYP A;  5IOW A;  1EGO A;  1X5C A;  1KTE A;  4O92 A;  1TU7 A;  3SBC A;  4ZBA A;  4H86 A;  4D73 B;  1PN9 A;  4KGI A;  4GWR A;  4FO5 A;  3WT1 A;  3LXZ A;  1XW5 A;  4GF0 A;  4MH2 A;  2H19 A;  4OFM A;  2DSA A;  4Q5F A;  3WYW A;  2FWH A;  3VK9 A;  3GH6 A;  3TJG A;  4V1A p;  1CQH A;  3CTF A;  2AYT A;  4NWY A;  4ISD A;  2BMX A;  2GS3 A;  2AB6 A;  1SJI A;  3BCK A;  1SJZ A;  2X8H A;  2FUG 2;  4KUN A;  4TXV A;  3Q18 A;  1UVZ A;  1YKA A;  3S9F A;  4JR4 A;  5ECP B;  3C1R A;  3R3E A;  3VUR A;  4XRA A;  2J9H A;  3FK8 A;  4MF6 A;  1TI1 A;  4V2L A;  5EY6 A;  1GSS A;  2X8G A;  1EOH A;  2P5Q A;  2MMN A;  1FVJ A;  3EMP A;  2E0Q A;  4NXI A;  5J5N A;  4V2M A;  2VCX A;  5J3R A;  1T4Z A;  2EIO A;  2VCW A;  14GS A;  1USB A;  2L6C A;  1F37 A;  3I6A A;  4L0U A;  3QMX A;  5B6N A;  3A2X A;  5D96 A;  3UBK A;  5C00 A;  2LST A;  2X99 A;  5D73 A;  1GP1 A;  3CSI A;  2MMZ A;  2HRK A;  1EEM A;  3ZFB A;  2DJ3 A;  1WIK A;  3VPT A;  1FG4 A;  4KND A;  1FO5 A;  4Q5R A;  5DJL A;  2WUL A;  2ON7 A;  5HFK A;  4K2D A;  2N5F A;  1G6W A;  1GUH A;  1RK4 A;  5IPH A;  1PGT A;  2UZ8 A;  3LFL A;  2HT9 A;  1SK0 A;  3N9J A;  1YDK A;  4XTS A;  4EL1 A;  3RHC A;  13GS A;  2DJJ A;  4OFN A;  2VCQ A;  3F4S A;  3MSZ A;  4NV2 A;  2E2G A;  1BAY A;  4N30 A;  2N5B A;  1O73 A;  3LYK A;  3TDG A;  3D4M A;  3IK7 A;  4F82 A;  1YKC A;  1A0R P;  2OAD A;  3F6D A;  1GWC A;  2HYX A;  8GSS A;  1SKR B;  1ST9 A;  1AC1 A;  3ZVJ D;  1SYX A;  2EC4 A;  1Q4J A;  3BCI A;  2JSZ A;  3FR9 A;  3APQ A;  1ON4 A;  3L9U A;  16GS A;  3ZRE A;  2GVP A;  3TOT A;  4POK A;  2GSS A;  2YJ7 A;  3GSS A;  5ECH B;  2H72 A;  2LRT A;  2PVO C;  1V40 A;  4GQC A;  5L71 A;  2C0F A;  3ZML A;  5D9X A;  3FW2 A;  1GUM A;  2E2M A;  2F51 A;  2XPD A;  3FRC A;  2EIR A;  2H74 A;  1QQ2 A;  1MEK A;  3IA1 A;  4RQX A;  4DSQ A;  2Z9S A;  1ZYE A;  1UC7 A;  1XWK A;  2IMD A;  4PUF C;  1NHO A;  5INY A;  2GT6 A;  5A4U A;  3ZYW A;  3J7Y k;  1XVQ A;  3H93 A;  2L57 A;  5EVO A;  2BJX A;  3P90 A;  3TJB A;  3Q19 A;  1URM A;  1XIY A;  5ECI B;  2VCZ A;  1WOU A;  2DLX A;  3IAM 2;  3W8J A;  1A24 A;  3APO A;  4DSS B;  4MJB A;  22GS A;  5HR3 A;  1LJR A;  2OBK A;  2CX3 A;  1H75 A;  1BG5 A;  1EP7 A;  3WT2 A;  4OD7 A;  1TXX A;  2PMT A;  2GDR A;  1YF0 A;  2IFQ B;  4CDO A;  3M1G A;  1GRX A;  4L8E A;  2PUK C;  4WET A;  5IMZ A;  1JZW A;  3NOF A;  1G7O A;  2MBS A;  2IWT A;  5KN2 A;  1GNE A;  4GSS A;  6GSS A;  1R5P A;  2HSY A;  4XS4 A;  2AUV A;  2R3X A;  2HSM A;  1OC9 A;  1SL2 B;  3L78 A;  4RUV A;  2I81 A;  2MYG A;  1E2Y A;  4FH8 A;  5F8B A;  3GA4 A;  2P0G A;  3ZRD A;  3CSJ A;  4PUR A;  3ED3 A;  3IDV A;  3DXB A;  2RUF A;  3HJM A;  3NIV A;  4OWY A;  4K8M A;  2L5O A;  3P7X A;  1YZX A;  3CSH A;  2TRC P;  4MF7 A;  2YV7 A;  4AF2 A;  2IME A;  1JZR A;  3TKP A;  3GTU A;  4EXJ A;  4RQR A;  3DIE A;  4YQU A;  3M9K A;  3RAZ A;  4TR1 A;  3GV1 A;  1EV9 A;  2GQK A;  1TK0 B;  4BVY B;  2CVD A;  2F8A A;  4MH3 A;  4MF5 A;  3F8U A;  3IHQ A;  5G5F A;  4KDX A;  3CBU A;  3QR6 A;  4BVX B;  4LMV A;  1S3A A;  4KSO A;  5IMA A;  2B7J A;  3QDN A;  1TU8 A;  2F8F A;  2PVQ A;  5IOX A;  2C3T A;  5LNK e;  5ECL B;  3TRP A;  4E8H A;  2YN1 A;  3GX0 A;  3D6I A;  3UEM A;  4KDY A;  2FCH A;  2YP6 A;  3GYK A;  4GSN A;  3UIW A;  2XBI A;  3HVV A;  2H70 A;  3KTB A;  1T8E B;  1EV4 A;  1AXD A;  3VFI A;  3ZL5 A;  2HFD A;  2I1U A;  2RM5 A;  3UL3 A;  3VWU A;  1MTC A;  4LMW A;  3TKS E;  1XXU A;  3BBY A;  3KCM A;  2P31 A;  1XWC A;  4BL7 A;  3DKS A;  4IJI A;  3HA9 A;  1GSE A;  1JZD A;  2LNS A;  3CYN A;  1F3A A;  4X1U A;  3VWV A;  2N5A A;  3A3T A;  4AGS A;  3IXR A;  4K7N A;  4KSM A;  1V57 A;  3GH9 A;  3KGK A;  2DJ2 A;  1AQV A;  3L9S A;  2QSI A;  3ISO A;  4TOP A;  5IPG A;  4LL4 B;  1J9B A;  5G2Z A;  2B7K A;  1NHY A;  4F0C A;  5DAL B;  3TJF A;  3F6F A;  5DDL A;  6GSV A;  2OAC A;  2VUP A;  1K0C A;  1M7T A;  3TJJ A;  2EIQ A;  4K9Z A;  3BD2 A;  3IPZ A;  4I6X A;  2HSN B;  4GLT A;  4KCE A;  1N2A A;  1QMV A;  2CVK A;  2K9F A;  3AY8 A;  2LRN A;  1A2L A;  4MJC A;  5DCH A;  2R5G A;  1ACV A;  1JFU A;  2WJU A;  2NPB A;  5HR2 A;  4ZBB A;  3Q6O A;  1F9M A;  1Z9H A;  5JCU A;  3D5J A;  5ENU A;  2DJ0 A;  2WZ9 A;  1XOA A;  3LG6 A;  1MDK A;  5IMV A;  2FNO A;  1LBK A;  4O7H A;  4AJ7 A;  5ECO B;  2B1K A;  1BYE A;  3KMN A;  1B48 A;  2K6V A;  2VCT A;  2H0G A;  2JAD A;  2R6K A;  3EE2 A;  1ML6 A;  4TW5 A;  5GZZ B;  4WR5 A;  2MZC A;  4YAV A;  5ABR A;  4ECI A;  1EOG A;  1EGR A;  1A2J A;  2F3M A;  2AHE A;  1ERT A;  2C1Y A;  5IM9 A;  3TRX A;  3D22 A;  3IRA A;  2FA4 A;  5B6M A;  2CX4 A;  1KEB A;  1XW6 A;  5G5E A;  3EVI A;  2KLX A;  4N11 A;  1PRX A;  2H71 A;  4OCF A;  2V6K A;  2KUC A;  4IS0 A;  4D73 A;  2HE3 A;  1X5E A;  4HUA A;  4BPY A;  5AN1 A;  1V98 A;  2R37 A;  2GGT A;  1SK1 A;  5J4U A;  3A5W A;  3DGQ A;  2AAW A;  2LJK A;  3GFK A;  3Q74 A;  5JCW A;  3F4R A;  2O8V B;  2NVL A;  2YWO A;  1SU9 A;  5IMF A;  3HJP A;  2WCI A;  2ZNM A;  3TB2 A;  3EMX A;  2HXK A;  4ML1 A;  4POB A;  3MDK A;  1SJ6 A;  2REM A;  2XBQ A;  1J0F A;  6GSY A;  3KD0 A;  3PGT A;  4G10 A;  2A2R A;  3FKF A;  3EYT A;  4TXO A;  2M46 A;  2HRA A;  1BED A;  5BMU A;  1ZGN A;  4IP6 A;  5CRG A;  2WRT A;  3G9B A;  4TKY A;  4TR3 A;  1PA3 A;  1DBY A;  2OA7 A;  1M99 A;  1M2A A;  1R4W A;  2VCV A;  3TRQ A;  1Y6E A;  2DIZ A;  2DC5 A;  5ELG A;  2JAC A;  2LUS A;  2V32 A;  4HQS A;  5KN0 A;  3M0F A;  1R7H A;  5GAP D;  4MK3 A;  4PXO A;  3GKM A;  4MMM A;  4ML6 A;  2FWF A;  6GSU A;  4I2T A;  3IOS A;  3DVW A;  2YJH A;  4G0L A;  4XIH A;  3GHA A;  4MJA A;  2CV4 A;  1Z3E A;  1TDI A;  3E9J B;  3KJY A;  1B9Y C;  1Z6M A;  2H0I A;  2C0G A;  2H75 A;  3DWV A;  1PKW A;  4PQH A;  1F3B A;  5A4W A;  1PD2 1;  2QKE A;  5KEJ A;  5FT3 A;  4QQ7 A;  1X0R A;  3RPN A;  3VI5 A;  2IMI A;  2FWG A;  4JRR A;  4G2E A;  1QFN A;  2HZE B;  2LQQ A;  3NZN A;  4HU7 A;  1R5A A;  4XS1 A;  2O87 A;  4OFT A;  5B7C A;  2E7P A;  4GTU A;  2LS5 A;  4POL A;  3A2V A;  3P8W A;  3F4T A;  4G9H A;  3A2W A;  2O89 A;  1AQX A;  1SKS B;  2R4V A;  4MAB A;  3CTG A;  20GS A;  1GTU A;  2M80 A;  5AIV A;  1IYI A;  1LU4 A;  3CRU A;  1K0A A;  5JWQ B;  2KP2 A;  3WGD A;  3UAP A;  3IAS 2;  3ME7 A;  3TCO A;  3E3E A;  4IW9 A;  4P3Y B;  3DEX A;  2LKU A;  3LJR A;  4WR4 A;  4GCI A;  2G0F A;  1DSB A;  2VM1 A;  1T3B A;  1HNC A;  2GTU A;  1A8Y A;  4KAE A;  4J57 E;  4AJ8 A;  4EUY A;  1SD8 A;  1T7P B;  1U6T A;  1TW9 A;  2IL3 A;  4XCS A;  1ERW A;  3ERW A;  2IJY A;  4XHM A;  3TOU A;  2H76 A;  2HQT A;  4V2N A;  2LEG A;  4WXT A;  1EP8 A;  3LWA A;  4TR0 A;  4YQV A;  3G7Y A;  2FLS A;  1PMT A;  3ERF A;  1X5D A;  1ILO A;  1YY7 A;  1TI3 A;  4RI6 A;  1BX9 A;  4JZQ A;  5H5Q A;  1TK5 B;  5ELA A;  3CXG A;  2H73 A;  3DML A;  2LV3 A;  5F05 A;  3W6G A;  2LTK A;  4IJ3 A;  3ME8 A;  5F0G A;  1HQO A;  5J9C A;  1OKD A;  4ZB6 A;  3UJ1 A;  5C04 A;  2IFQ A;  2YZU A;  3QAV A;  4HS1 A;  4F0B A;  3WGE A;  3FYG A;  1K0M A;  3IBH A;  4HI7 A;  4N10 A;  5CRW A;  5HQP A;  1PX7 A;  1U88 A;  5CRH A;  1GSU A;  5KN1 A;  1WWJ A;  2NTO A;  1G7E A;  3M3M A;  2JU5 A;  2JZT A;  3P2A A;  4Q5N A;  5CRE A;  5H5S A;  2HLS A;  1SL0 B;  3F0I A;  2P5R A;  1V9W A;  1KNG A;  3HZ8 A;  2C4J A;  4O32 A;  1HNB A;  2C3Q A;  1W4V A;  1G0T A;  2C0E A;  1WRY A;  2C3N A;  1ZMA A;  4ECB A;  3US3 A;  1OVN A;  3UVT A;  5JWO B;  1QGV A;  3IC4 A;  2H0H A;  4EC0 A;  3EU4 A;  4XRD A;  3QPM A;  4HOJ A;  2YNX A;  2OE1 A;  5AIX A;  4XS4 B;  1BQ7 A;  2B5E A;  4WEY A;  3IE3 A;  4ULX A;  2H1G A;  2XHF A;  3JCM L;  3MWH A;  4BVY A;  2CT6 A;  1K0B A;  3EU3 A;  1XFL A;  5E59 A;  3RDW A;  4ECC A;  5JCG A;  1VF3 A;  3KMO A;  2RUE A;  3QOU A;  2HRF A;  5ECR B;  1G6Y A;  3TGZ A;  4BVX A;  1T1V A;  1OE8 A;  1TJD A;  3EIN A;  1XW9 A;  3LXT A;  5AIS A;  1V2A A;  2PPT A;  12GS A;  4PUA A;  1TTZ A;  4NPB A;  1GL8 A;  4PNG A;  1TRW A;  4NV5 A;  5ECN B;  1DUG A;  5GST A;  3OR5 A;  3W8S A;  2FGX A;  5IO2 A;  3KZQ A;  2ZUP A;  2JZR A;  3G7I A;  2H6Z A;  5ECK B;  1THO A;  1PQN A;  2WS2 A;  2VLT A;  3IR4 A;  5DAK B;  5IMC A;  4MPF A;  4JR6 A;  2FA8 A;  1EWX A;  4BA7 A;  1M2D A;  1Y25 A;  5G1K A;  2TRX A;  5J9B A;  2B3S A;  2RM6 A;  2YPM A;  3H79 A;  4PX1 A;  4EKZ A;  1SK2 A;  3GKX A;  3VLN A;  1O85 A;  4YAP A;  3FZA A;  4JU5 A;  2I9H A;  1X9M B;  3G7J A;  4WF4 A;  3EUR A;  3L0H A;  4RI7 A;  4OO5 A;  4PNF A;  5DVB A;  3VPQ A;  2FHE A;  2RLI A;  5AGY A;  4I97 A;  2H30 A;  4OCE A;  1PL2 A;  1NM3 A;  1XVW A;  4G0I A;  4DSR A;  3PH9 A;  4FYU A;  4EVM A;  3FZ5 A;  2H6X A;  3KEB A;  2XPE A;  1B8X A;  2VL2 A;  4ZIL A;  3GUS A;  3DRN A;  3LSZ A;  5JWR B;  3FHK A;  1GLQ A;  4KCA A;  3ZIT A;  4N0V A;  9GSS A;  4K7I A;  4NHW A;  4MZB A;  3QAW A;  4HJ2 A;  5DAL A;  4QL7 A;  3QAG A;  1YJ6 A;  1FB6 A;  1GSY A;  5EPF A;  3CRT A;  2YWM A;  4OO4 A;  4MA9 A;  4PQI A;  1MDJ A;  1C72 A;  3GL3 A;  1ZL9 A;  2CVB A;  2HNL A;  5J41 A;  2OE3 A;  3GMF A;  3LOR A;  2DIY A;  3M8N A;  3D0Z A;  4LL1 B;  5IIZ A;  4KX4 A;  1XOB A;  1K3Y A;  3R2Q A;  4E8E A;  2J23 A;  1OAZ A;  4K7O A;  2GLR A;  4F03 A;  1MDI A;  4I5Q A;  2GZP A;  2H8L A;  3UMA A;  2KHP A;  1KBN A;  2V2G A;  1O8W A;  5DQY A;  3GUR A;  2VLU A;  3EWL A;  3FR6 A;  4ECJ A;  1BJX A;  5ID2 A;  4MP4 A;  1XCC A;  1HD2 A;  3O76 A;  5IO0 A;  2H1A A;  4ZL7 A;  1FHE A;  1H4O A;  1WP0 A;  1W89 A;  3PPU A;  1JLW A;  1MD4 A;  1YF1 A;  2VD0 A;  2C80 A;  3HYP A;  3QFB C;  1QK8 A;  3HVS A;  2WGR A;  1OE7 A;  1ERU A;  3O3T A;  3BJ5 A;  4ZL8 A;  1U3I A;  3LQ7 A;  2HZF A;  3KH7 A;  3FEU A;  4MZC A;  1B4P A;  3ZLP A;  1HNA A;  2ALB A;  2L5L A;  3ZFL A;  1DE2 A;  2QGV A;  5CP1 A;  3DVX A;  2L6D A;  1GSQ A;  2JZS A;  3C73 A;  1MD3 A;  3K8N A;  4ZL9 A;  1ERV A;  2VLV A;  4WBR D;  4AJ6 A;  2LJA A;  4WBJ A;  2GT5 A;  2B5X A;  3HXS A;  5D9T A;  1F2E A;  4MPG A;  1WE0 A;  1VGL A;  4F2I A;  4YQM A;  1K0D A;  1SYR A;  5H5R A;  5A5K A;  3KIJ A;  11GS A;  4X43 A;  4MJE A;  3PR8 A;  3TKS A;  5B8B A;  4JBB A;  2H66 A;  3U6V A;  2H1B A;  1XZO A;  3GIX A;  5HFI A;  1A0F A;  1AW9 A;  4ACS A;  1YQ1 A;  4J2F A;  1R26 A;  5HR1 A;  4PTS A;  1EZK A;  3UOM A;  4ZB9 A;  4EF0 A;  4L0W A;  2LJR A;  2I4A A;  4FIW A;  3GNJ A;  4TXO B;  4POM A;  5G30 A;  4J56 E;  2PBJ A;  2NBS A;  2GZY A;  2CZ2 A;  3H4K A;  1PSQ A;  17GS A;  5ECQ B;  4KB3 A;  1M2B A;  2A2S A;  1K3O A;  4USS A;  3D21 A;  2AJQ B;  2LRC A;  3QD9 A;  7GSS A;  2HZE A;  1FW1 A;  4Q5Q A;  3FR3 A;  5DCG A;  3MNG A;  1TP9 A;  5D9V A;  2DJ1 A;  3ERG A;  6GST A;  1K0O A;  4O5R A;  2VOC A;  3HVX A;  4LA1 A;  3F63 A;  1ZCP A;  4QL9 A;  5LD0 A;  2DBC A;  1X9S B;  3HZ4 A;  1GUL A;  2X64 A;  2H1D A;  4IKH A;  3KXO A;  3UBL A;  1AIU A;  2HRK B;  2NDO A;  4KDU A;  3H8Q A;  5HR0 A;  5G1L A;  5CRD A;  4NHZ A;  4G0K A;  3KTL A;  4F9Z A;  2KOK A;  2GSQ A;  1OC3 A;  3ZVJ A;  4HEA 2;  4GRF A;  1EEJ A;  1Z7R A;  4KE3 A;  6GSW A;  4K0G A;  4K0N A;  2VL3 A;  5D8I A;  1VRS D;  2ON5 A;  3ZIJ A;  5CAX A;  1O6J A;  3FZ9 A;  2KP1 A;  2B1L A;  3CMI A;  2WDU A;  4GXZ A;  4KW6 A;  2IMK A;  3VWX A;  1NW2 A;  1TOF A;  1THX A;  2JSY A;  5F06 A;  3N5O A;  4GST A;  4CHS A;  3C1S A;  2CZ3 A;  1XWA A;  5DJM A;  2GQM A;  2C0D A;  3BOA A;  5ECM B;  5DQS A;  1A2M A;  1O8X A;  1HYU A;  3IK9 A;  1XWB A;  2H01 A;  1ZZY A;  4OMV A;  1O81 A;  3HHV A;  3TJK A;  3ZZX A;  3HCZ A;  2DMM A;  2A4V A;  1TRV A;  2DJK A;  3FZ4 A;  3HD5 A;  1T4Y A;  1FOV A;  6GSX A;  4L5O A;  4IN0 A;  3F3R A;  1E6B A;  3GX8 A;  2FWE A;  1SL1 B;  2VIM A;  4BWS A;  2I3Y A;  5A4V A;  3F3Q A;  3TUE A;  1OKT A;  4HU9 A;  2MMA A;  2GST A;  2YOI A;  1JLV A;  4DVC A;  2L59 A;  2M72 A;  4JED A;  3GST A;  1FVK A;  4DSS A;  1SKW B;  4JE1 A;  1SEN A;  2DML A;  1FAA A;  4CW9 A;  1ABA A;  1TK8 B;  2IN3 A;  1Z7P A;  1U3A A;  2L4C A;  1A8L A;  2LNT A;  1GTB A;  1Z5Y E;  3I43 A;  4GQF A;  3D4T A;  1TRS A;  5CNW A;  3UAR A;  3HY2 A;  2VM2 A;  1VF4 A;  2VD1 A;  3E0U A;  3FY7 A;  3LEF A;  2MBT A;  1AUC A;  3PIN A;  3J7Y b;  1FB0 A;  3KH9 A;  3O6T A;  5HFG A;  1AQW A;  4HZ4 A;  3V1W A;  1VF2 A;  4ZIJ A;  4PQ1 A;  1F6M C;  4LLR A;  2JL4 A;  1S3D A;  2O85 A;  2X8C A;  4I2U A;  1Q98 A;  1K0N A;  4V1A g;  2PER A;  5GSS A;  2GQL A;  4HDE A;  2O7K A;  2VO4 A;  1IYH A;  1PKZ A;  1GSD A;  3ZIV A;  4X0X A;  3C71 A;  5KN3 A;  2PN8 A;  2XC2 A;  3L9V A;  2WFC A;  2GZZ A;  1JZO A;  4DEJ A;  2YV9 A;  3VI7 A;  4HJM A;  3KM6 A;  3HKR A;  2K8V A;  2GSR A;  2CAI A;  3IV4 A;  2HSM B;  1OC9 B;  2IMF A;  1GTA A;  3MAK A;  5CO3 A;  2YZH A;  3C8E A;  3F9U A;  4IBP A;  2OE0 A;  2R2J A;  2LQO A;  3SWL A;  2YWN A;  1GH2 A;  2YCD A;  1O7U A;  2FD3 A;  4IVF A;  2V6O A;  1M9B A;  2V1M A;  4KA0 A;  5IQY A;  2IIY A;  4NMU A;  4IEL A;  3HDC A;  2TIR A;  1B9X C;  2G2Q A;  4EDY A;  1RW1 A;  4ZXG A;  2L4Q A;  2IPA A;  1GSF A;  3GTU B;  2K8S A;  2B5Y A;  1VF1 A;  1U87 A;  5DAK A;  4TR1 B;  3UVH A;  1NSW A;  2VL2 C;  2QC7 A;  3GN3 A;  1WPI A;  1YEP A;  1S3C A;  4TRX A;  4TVE A;  2HSH A;  2B6M A;  2PWJ A;  1M9A A;  1DE1 A;  4K1F A;  4EO3 A;  2D2Z A;  18GS A;  4EE0 A;  4HQZ A;  4MCU A;  4N0Z A;  4XS6 A;  1M0U A;  4ZBD A;  1OC8 A;  3GKK A;  2YAN A;  3U5R E;  2OJL A;  1PL1 A;  2WB9 A;  2HI7 A;  3IC8 A;  4G19 A;  5G31 A;  2YWI A;  5FHI A;  2K18 A;  5IMD A;  4MZW A;  1XBS A;  1T00 A;  3H1N A;  4ZB8 A;  5GAN D;  1RQM A;  2F9S A;  3VWW A;  3APS A;  1XWG A;  4MDC A;  3RPP A;  1QUW A;  4ILF A;  5D93 A;  1JHB A;  4KH7 A;  1SD9 A;  3KP8 A;  4YH2 A;  10GS A;  1AAZ A;  2CQ9 A;  1QXH A;  3WGX A;  5COH A;  5ECS A;  4BL7 B;  1ZOF A;  1OYJ A;  2V41 A;  5LCZ A;  3QFA C;  1ZYQ B;  1GTI A;  3I69 A;  2ES7 A;  4TR4 A;  2BTO T;  1A23 A;  3RBT A;  5F07 A;  2VL9 A;  3C7M A;  1I9D A;  3I9V 2;  2H6Y A;  1GNW A;  3QCP A;  3DYR A;  1WMJ A;  4BWQ A;  4I8B A;  1UN2 A;  1YEX A;  2C8U A;  2OBI A;  1B4Q A;  2ZCT A;  3WD6 A;  2FY6 A;  4L5L A;  2CAQ A;  2PGT A;  4TN8 A;  5E4W A;  5EL8 A;  4HZ2 A;  3GKN A;  3HJO A;  4WF5 A;  4NAX A;  3ZMK A;  4FYB A;  2MMO A;  5B8A A;  4ID0 A;  4IQA A;  3GL5 A;  4IHU A;  3M9J A;  4IGJ A;  4EDZ A;  1V58 A;  1N8J A;  1CQG A;  1UA5 A;  1I5G A;  4FQU A;  5D9W A;  3L4N A;  3LGC A;  3GRX A;  3DD3 A;  5FWG A;  1K3L A;  5CYY A;  3EC3 A;  1XPV A;  5DBQ A;  1TRU A;  2HRN A;  1PX6 A;  1GUK A;  2RII A;  4KF9 A;  5ID2 B;  3TKS C;  4FYC A;  19GS A;  2PU9 C;  3RHB A;  3ZTL A;  1WJK A;  1Z6N A;  2CA8 A;  2OKA A;  1J08 A;  1X9W B;  4K6X A;  3KP9 A;  4WKW A;  4Z7X A;  4MLY A;  1GLP A;  3TKR A;  4IP1 A;  2AV4 A;  3TKQ A; 
#chains in the Genus database with same CATH topology
 1TKD B;  4IQ1 A;  2WW2 A;  2VAF A;  4PGT A;  3LYP A;  4EIQ A;  5IOW A;  1EGO A;  1X5C A;  1YEW C;  1KTE A;  4O92 A;  1TU7 A;  3SBC A;  4ZBA A;  4H86 A;  4D73 B;  1PN9 A;  4KGI A;  5KOX A;  4GWR A;  4FO5 A;  3WT1 A;  3LXZ A;  1XW5 A;  4GF0 A;  4MH2 A;  2H19 A;  4OFM A;  2DSA A;  4Q5F A;  3WYW A;  2FWH A;  3VK9 A;  3GH6 A;  3TJG A;  4V1A p;  1CQH A;  3CTF A;  2AYT A;  4NWY A;  4ISD A;  2BMX A;  2GS3 A;  2AB6 A;  1SJI A;  3BCK A;  1SJZ A;  2X8H A;  2FUG 2;  4KUN A;  4TXV A;  3Q18 A;  1UVZ A;  1YKA A;  3S9F A;  4JR4 A;  5ECP B;  3C1R A;  3R3E A;  3VUR A;  4XRA A;  2J9H A;  3FK8 A;  4MF6 A;  1TI1 A;  3MYD A;  5BMU B;  4V2L A;  5EY6 A;  1GSS A;  2X8G A;  1EOH A;  2P5Q A;  2MMN A;  1FVJ A;  3EMP A;  2E0Q A;  4NXI A;  5J5N A;  4V2M A;  2VCX A;  5J3R A;  1T4Z A;  2EIO A;  2VCW A;  14GS A;  1USB A;  2L6C A;  1F37 A;  3I6A A;  4L0U A;  3QMX A;  5B6N A;  3A2X A;  5D96 A;  3UBK A;  5C00 A;  4PI2 C;  2LST A;  2X99 A;  5D73 A;  1GP1 A;  3CSI A;  2MMZ A;  2HRK A;  1EEM A;  3ZFB A;  2DJ3 A;  1WIK A;  3VPT A;  1FG4 A;  4KND A;  1FO5 A;  4Q5R A;  5DJL A;  2WUL A;  2ON7 A;  5HFK A;  4K2D A;  1I1I P;  2N5F A;  1G6W A;  1GUH A;  1RK4 A;  5IPH A;  1PGT A;  2UZ8 A;  3LFL A;  2HT9 A;  1SK0 A;  3N9J A;  4K5R A;  1YDK A;  2R0C A;  4XTS A;  4EL1 A;  3RHC A;  13GS A;  2DJJ A;  4OFN A;  2VCQ A;  3F4S A;  3MSZ A;  4NV2 A;  2E2G A;  1BAY A;  4N30 A;  4W66 A;  2N5B A;  1O73 A;  3LYK A;  3TDG A;  1M3I A;  3D4M A;  3IK7 A;  4F82 A;  1YKC A;  1A0R P;  2OAD A;  3F6D A;  1GWC A;  2HYX A;  1YVL A;  8GSS A;  1SKR B;  1ST9 A;  1AC1 A;  3ZVJ D;  1SYX A;  2EC4 A;  1Q4J A;  3BCI A;  2JSZ A;  3FR9 A;  3APQ A;  1ON4 A;  3L9U A;  16GS A;  3ZRE A;  2GVP A;  5J40 A;  3TOT A;  1S3R A;  4POK A;  2GSS A;  2YJ7 A;  3GSS A;  5ECH B;  2H72 A;  2LRT A;  2PVO C;  1V40 A;  4GQC A;  5L71 A;  2C0F A;  3ZML A;  5D9X A;  3FW2 A;  1GUM A;  2E2M A;  2F51 A;  2XPD A;  3FRC A;  2EIR A;  4A5P A;  2H74 A;  1QQ2 A;  1MEK A;  3IA1 A;  4RQX A;  4DSQ A;  2Z9S A;  1S4B P;  1ZYE A;  1UC7 A;  1XWK A;  2IMD A;  4PUF C;  1NHO A;  5INY A;  2GT6 A;  5A4U A;  3ZYW A;  3J7Y k;  1XVQ A;  3H93 A;  2L57 A;  5EVO A;  3RFR C;  2BJX A;  3P90 A;  3TJB A;  3Q19 A;  1URM A;  1XIY A;  5ECI B;  2VCZ A;  1WOU A;  2DLX A;  3IAM 2;  3W8J A;  1A24 A;  3APO A;  4DSS B;  4MJB A;  22GS A;  5HR3 A;  1LJR A;  2OBK A;  2CX3 A;  1H75 A;  1BG5 A;  1EP7 A;  3WT2 A;  4OD7 A;  1TXX A;  2PMT A;  2GDR A;  1YF0 A;  2IFQ B;  4CDO A;  3M1G A;  1GRX A;  4L8E A;  2PUK C;  4WET A;  5IMZ A;  1JZW A;  3NOF A;  1G7O A;  2MBS A;  2IWT A;  5KN2 A;  1GNE A;  4GSS A;  6GSS A;  1R5P A;  2HSY A;  4XS4 A;  2AUV A;  2R3X A;  2HSM A;  1OC9 A;  1SL2 B;  4PHZ C;  3L78 A;  4RUV A;  2I81 A;  2MYG A;  4CY8 A;  1E2Y A;  4FH8 A;  5F8B A;  3GA4 A;  2P0G A;  3ZRD A;  3CSJ A;  4PUR A;  3ED3 A;  3IDV A;  3DXB A;  2RUF A;  3HJM A;  3NIV A;  2X49 A;  4OWY A;  4K8M A;  2L5O A;  3P7X A;  1YZX A;  3CSH A;  2TRC P;  4MF7 A;  4Z2R A;  2YV7 A;  3EPT A;  4AF2 A;  1N25 A;  2IME A;  1JZR A;  4O5Q A;  3TKP A;  4Z2U A;  3GTU A;  4EXJ A;  4RQR A;  3DIE A;  4YQU A;  3M9K A;  3RAZ A;  4TR1 A;  3GV1 A;  2DKH A;  2DKI A;  1EV9 A;  2GQK A;  1TK0 B;  4BVY B;  2CVD A;  2F8A A;  4MH3 A;  4MF5 A;  4GDF A;  3F8U A;  3IHQ A;  5G5F A;  4KDX A;  3CBU A;  3QR6 A;  4BVX B;  4LMV A;  1S3A A;  4KSO A;  5IMA A;  4AKI A;  2B7J A;  3QDN A;  1TU8 A;  2F8F A;  2PVQ A;  5IOX A;  2C3T A;  5LNK e;  5ECL B;  3TRP A;  4E8H A;  2YN1 A;  3GX0 A;  3D6I A;  3UEM A;  4KDY A;  2FCH A;  2YP6 A;  3GYK A;  4GSN A;  3UIW A;  2XBI A;  3HVV A;  2H70 A;  3KTB A;  1T8E B;  1EV4 A;  4O5U A;  1AXD A;  3VFI A;  3ZL5 A;  2HFD A;  2I1U A;  2RM5 A;  3UL3 A;  3VWU A;  1MTC A;  4LMW A;  3TKS E;  1XXU A;  3BBY A;  3KCM A;  2P31 A;  2OT3 A;  1XWC A;  4BL7 A;  3DKS A;  4IJI A;  3HA9 A;  1GSE A;  1JZD A;  2WZS A;  3HMJ G;  4AI6 A;  2LNS A;  3CYN A;  1F3A A;  4X1U A;  3VWV A;  2N5A A;  3A3T A;  4AGS A;  3IXR A;  4K7N A;  4KSM A;  1V57 A;  3GH9 A;  3KGK A;  2DJ2 A;  1AQV A;  1PFO A;  3L9S A;  2QSI A;  3ISO A;  4TOP A;  5IPG A;  4LL4 B;  1J9B A;  5G2Z A;  2B7K A;  4G01 A;  1NHY A;  4F0C A;  5DAL B;  3TJF A;  3F6F A;  5DDL A;  6GSV A;  2OAC A;  2VUP A;  1K0C A;  1M7T A;  3TJJ A;  2EIQ A;  2A4H A;  4K9Z A;  3BD2 A;  3IPZ A;  4I6X A;  2HSN B;  4GLT A;  4BIK A;  4KCE A;  1N2A A;  1QMV A;  2CVK A;  4Z2T A;  2K9F A;  2WW0 A;  3AY8 A;  2LRN A;  1A2L A;  4MJC A;  5DCH A;  2R5G A;  1ACV A;  1JFU A;  2WJU A;  2NPB A;  4YKF A;  5HR2 A;  4ZBB A;  3Q6O A;  1F9M A;  2O36 A;  1Z9H A;  5JCU A;  3D5J A;  5ENU A;  2DJ0 A;  2WZ9 A;  1XOA A;  3LG6 A;  1MDK A;  5IMV A;  2FNO A;  1LBK A;  4O7H A;  4AJ7 A;  5ECO B;  2B1K A;  3HVN A;  1BYE A;  3KMN A;  1B48 A;  2K6V A;  2VCT A;  2H0G A;  2JAD A;  2R6K A;  3EE2 A;  1ML6 A;  4TW5 A;  5GZZ B;  4WR5 A;  2MZC A;  4YAV A;  5ABR A;  5A1N A;  4ECI A;  1EOG A;  1EGR A;  1A2J A;  2F3M A;  2AHE A;  1ERT A;  2C1Y A;  5IM9 A;  3TRX A;  3D22 A;  2WVZ A;  3IRA A;  2H1L A;  2FA4 A;  5B6M A;  2CX4 A;  1KEB A;  1XW6 A;  5G5E A;  3EVI A;  2KLX A;  4N11 A;  1PRX A;  2H71 A;  4OCF A;  2V6K A;  2KUC A;  4IS0 A;  4D73 A;  2HE3 A;  1X5E A;  4HUA A;  4BPY A;  5AN1 A;  1PN0 A;  3IHG A;  1V98 A;  2R37 A;  2GGT A;  1SK1 A;  5J4U A;  3A5W A;  2EFC A;  3DGQ A;  2AAW A;  2LJK A;  3GFK A;  3Q74 A;  5JCW A;  3F4R A;  2O8V B;  2NVL A;  2YWO A;  1SU9 A;  5IMF A;  3HJP A;  2WCI A;  2ZNM A;  3TB2 A;  3EMX A;  2HXK A;  4ML1 A;  4POB A;  3MDK A;  1SJ6 A;  2REM A;  2XBQ A;  1J0F A;  6GSY A;  3KD0 A;  3PGT A;  4G10 A;  2A2R A;  3FKF A;  3EYT A;  4TXO A;  2M46 A;  2HRA A;  3A5I A;  1BED A;  5BMU A;  1ZGN A;  4IP6 A;  5CRG A;  2WRT A;  3G9B A;  4TKY A;  2WVX B;  4TR3 A;  1PA3 A;  1DBY A;  2OA7 A;  1M99 A;  1M2A A;  3TU3 B;  1R4W A;  1SVM A;  2VCV A;  3TRQ A;  1Y6E A;  2DIZ A;  2DC5 A;  1Y1U A;  4CY6 A;  5ELG A;  2UV8 G;  2JAC A;  2LUS A;  2V32 A;  4HQS A;  5KN0 A;  3M0F A;  1R7H A;  5GAP D;  4MK3 A;  4PXO A;  3GKM A;  4MMM A;  4ML6 A;  2FWF A;  6GSU A;  4I2T A;  3IOS A;  3DVW A;  2YJH A;  4G0L A;  4XIH A;  3GHA A;  4MJA A;  2CV4 A;  1Z3E A;  1TDI A;  3E9J B;  3KJY A;  1B9Y C;  1Z6M A;  2H0I A;  2C0G A;  2H75 A;  3DWV A;  4PI0 C;  1PKW A;  4PQH A;  2VKZ G;  1F3B A;  5A4W A;  1PD2 1;  2QKE A;  5KEJ A;  5FT3 A;  4QQ7 A;  1X0R A;  2EFH A;  4FXY P;  3RPN A;  3VI5 A;  3CWG A;  2IMI A;  2FWG A;  4JRR A;  4G2E A;  1QFN A;  2HZE B;  2LQQ A;  3NZN A;  4HU7 A;  1R5A A;  4XS1 A;  2O87 A;  4OFT A;  5B7C A;  2E7P A;  4GTU A;  2LS5 A;  4POL A;  3A2V A;  3P8W A;  3F4T A;  4G9H A;  3A2W A;  2O89 A;  1AQX A;  1SKS B;  2R4V A;  4MAB A;  3CTG A;  20GS A;  1GTU A;  2M80 A;  5AIV A;  1IYI A;  1LU4 A;  3CRU A;  1K0A A;  5JWQ B;  2KP2 A;  3WGD A;  3UAP A;  3IAS 2;  3MIX A;  3ME7 A;  3TCO A;  3E3E A;  4IW9 A;  4P3Y B;  3DEX A;  2LKU A;  3LJR A;  4WR4 A;  4GCI A;  2G0F A;  1DSB A;  5A5H B;  2VM1 A;  1T3B A;  1HNC A;  2GTU A;  1A8Y A;  2O5V A;  4KAE A;  4J57 E;  4AJ8 A;  4EUY A;  1SD8 A;  1T7P B;  1U6T A;  1TW9 A;  2IL3 A;  4XCS A;  1ERW A;  3ERW A;  2IJY A;  4XHM A;  3TOU A;  2H76 A;  2HQT A;  2WW1 A;  4V2N A;  2LEG A;  4WXT A;  1EP8 A;  3LWA A;  2O3E A;  4TR0 A;  4YQV A;  3G7Y A;  2FLS A;  1PMT A;  3ERF A;  1X5D A;  1ILO A;  1YY7 A;  1TI3 A;  2R0G A;  4RI6 A;  1BX9 A;  4JZQ A;  5H5Q A;  1TK5 B;  5ELA A;  3CXG A;  2H73 A;  3LW9 A;  3DML A;  2LV3 A;  1SVL A;  5F05 A;  3W6G A;  2LTK A;  4IJ3 A;  3ME8 A;  5F0G A;  1HQO A;  5J9C A;  1OKD A;  4ZB6 A;  3UJ1 A;  5C04 A;  2IFQ A;  2YZU A;  3QAV A;  4HS1 A;  4F0B A;  3WGE A;  3FYG A;  4AKX B;  1K0M A;  3IBH A;  4HI7 A;  4N10 A;  5CRW A;  5HQP A;  1PX7 A;  1U88 A;  5CRH A;  1GSU A;  5KN1 A;  1WWJ A;  2NTO A;  1G7E A;  3M3M A;  2JU5 A;  2JZT A;  3P2A A;  4Q5N A;  5CRE A;  5H5S A;  2HLS A;  1SL0 B;  3F0I A;  2P5R A;  1V9W A;  1KNG A;  3HZ8 A;  2C4J A;  4O32 A;  1HNB A;  2C3Q A;  1W4V A;  1G0T A;  2C0E A;  1WRY A;  2C3N A;  1ZMA A;  4ECB A;  3US3 A;  1OVN A;  3UVT A;  5JWO B;  1QGV A;  3IC4 A;  2H0H A;  4EC0 A;  3EU4 A;  4XRD A;  3QPM A;  4HOJ A;  2YNX A;  2OE1 A;  5AIX A;  4XS4 B;  1BQ7 A;  2B5E A;  4WEY A;  3IE3 A;  4E68 A;  4ULX A;  2H1G A;  2XHF A;  3JCM L;  3MWH A;  4BVY A;  2CT6 A;  1K0B A;  3EU3 A;  1XFL A;  5E59 A;  3RDW A;  4ECC A;  5JCG A;  1VF3 A;  3KMO A;  2RUE A;  3QOU A;  2HRF A;  5ECR B;  1G6Y A;  3TGZ A;  4BVX A;  1T1V A;  1OE8 A;  1TJD A;  3EIN A;  1XW9 A;  3LXT A;  5AIS A;  1V2A A;  2PPT A;  12GS A;  4PUA A;  1TTZ A;  4NPB A;  1GL8 A;  4PNG A;  1TRW A;  4NV5 A;  5ECN B;  1DUG A;  5GST A;  3OR5 A;  3W8S A;  2FGX A;  5IO2 A;  3KZQ A;  2ZUP A;  2JZR A;  3G7I A;  2H6Z A;  5ECK B;  1THO A;  1PQN A;  2WS2 A;  2VLT A;  3IR4 A;  5DAK B;  5IMC A;  4MPF A;  4JR6 A;  2FA8 A;  1EWX A;  4BA7 A;  1M2D A;  1Y25 A;  5G1K A;  2TRX A;  1ZYN A;  5J9B A;  3RGB C;  2B3S A;  2RM6 A;  2YPM A;  3H79 A;  4PX1 A;  4EKZ A;  1SK2 A;  1FOH A;  3GKX A;  3VLN A;  1O85 A;  4YAP A;  3FZA A;  4JU5 A;  2I9H A;  1X9M B;  3G7J A;  4WF4 A;  3EUR A;  3L0H A;  4RI7 A;  4OO5 A;  4PNF A;  2QA1 A;  3VPQ A;  5DVB A;  2FHE A;  2RLI A;  5AGY A;  4I97 A;  2H30 A;  4OCE A;  1PL2 A;  1NM3 A;  1XVW A;  4G0I A;  4DSR A;  3PH9 A;  4FYU A;  4EVM A;  3FZ5 A;  2H6X A;  3KEB A;  2XPE A;  1B8X A;  2VL2 A;  4ZIL A;  3GUS A;  3DRN A;  3LSZ A;  5JWR B;  3FHK A;  1GLQ A;  4KCA A;  3ZIT A;  4N0V A;  9GSS A;  4K7I A;  4NHW A;  4MZB A;  3QAW A;  4HJ2 A;  5DAL A;  4QL7 A;  3QAG A;  1YJ6 A;  1FB6 A;  1M3J A;  1GSY A;  5EPF A;  3CRT A;  2YWM A;  4OO4 A;  4MA9 A;  2HSN A;  4PQI A;  1MDJ A;  1C72 A;  3GL3 A;  1ZL9 A;  2CVB A;  2HNL A;  5J41 A;  2OE3 A;  3GMF A;  3LOR A;  2DIY A;  3M8N A;  3D0Z A;  4LL1 B;  5IIZ A;  4KX4 A;  1XOB A;  1K3Y A;  3R2Q A;  4E8E A;  2J23 A;  1OAZ A;  4K7O A;  2GLR A;  4F03 A;  1MDI A;  4I5Q A;  2GZP A;  2H8L A;  3UMA A;  2KHP A;  1KBN A;  2V2G A;  1O8W A;  5DQY A;  5J4Y A;  5J47 A;  3FMW A;  3GUR A;  2QA2 A;  2VLU A;  3EWL A;  3FR6 A;  4ECJ A;  1BJX A;  5ID2 A;  4MP4 A;  1XCC A;  1HD2 A;  3O76 A;  5IO0 A;  2H1A A;  4ZL7 A;  1FHE A;  1H4O A;  1WP0 A;  1W89 A;  3PPU A;  1JLW A;  1MD4 A;  1YF1 A;  2VD0 A;  2C80 A;  3HYP A;  3QFB C;  1QK8 A;  3HVS A;  5A34 B;  2WGR A;  1OE7 A;  1ERU A;  3O3T A;  3BJ5 A;  4ZL8 A;  1U3I A;  3LQ7 A;  2HZF A;  3KH7 A;  3FEU A;  4MZC A;  1B4P A;  3ZLP A;  1HNA A;  2ALB A;  2L5L A;  3ZFL A;  1DE2 A;  2QGV A;  5CP1 A;  3DVX A;  2L6D A;  1GSQ A;  2JZS A;  3C73 A;  1TXU A;  1MD3 A;  3K8N A;  4ZL9 A;  1ERV A;  2VLV A;  4WBR D;  4AJ6 A;  2LJA A;  4WBJ A;  2GT5 A;  2B5X A;  3HXS A;  5D9T A;  1F2E A;  2EFD A;  4MPG A;  1WE0 A;  1VGL A;  2R0P A;  4F2I A;  2WVX A;  4YQM A;  1K0D A;  1SYR A;  5H5R A;  5A5K A;  3KIJ A;  11GS A;  4X43 A;  4MJE A;  3PR8 A;  3TKS A;  5B8B A;  4JBB A;  2H66 A;  3U6V A;  2H1B A;  1XZO A;  3GIX A;  5HFI A;  1A0F A;  1AW9 A;  4ACS A;  1YQ1 A;  4J2F A;  1R26 A;  5HR1 A;  4PTS A;  1EZK A;  3UOM A;  4ZB9 A;  4EF0 A;  4L0W A;  2LJR A;  2I4A A;  4FIW A;  3GNJ A;  4TXO B;  4POM A;  5G30 A;  4J56 E;  2PBJ A;  2NBS A;  2GZY A;  2CZ2 A;  3H4K A;  1PSQ A;  17GS A;  5ECQ B;  4KB3 A;  1M2B A;  2A2S A;  1K3O A;  4USS A;  3D21 A;  2AJQ B;  2LRC A;  4AKH A;  2WVY A;  3QD9 A;  7GSS A;  2HZE A;  1FW1 A;  4Q5Q A;  3FR3 A;  5DCG A;  3MNG A;  1TP9 A;  5D9V A;  2DJ1 A;  3ERG A;  1XG8 A;  6GST A;  1K0O A;  4O5R A;  2VOC A;  3HVX A;  4LA1 A;  3F63 A;  1ZCP A;  4QL9 A;  5LD0 A;  2DBC A;  1X9S B;  3HZ4 A;  1GUL A;  2X64 A;  2H1D A;  4IKH A;  3KXO A;  3UBL A;  1AIU A;  2HRK B;  2NDO A;  4KDU A;  3H8Q A;  1SVO A;  5HR0 A;  5G1L A;  5CRD A;  1ZYP A;  4NHZ A;  4G0K A;  3KTL A;  4F9Z A;  2KOK A;  2GSQ A;  1OC3 A;  3ZVJ A;  4HEA 2;  4GRF A;  1EEJ A;  1Z7R A;  4KE3 A;  6GSW A;  4K0G A;  4K0N A;  2VL3 A;  5D8I A;  1VRS D;  2ON5 A;  3ZIJ A;  5CAX A;  1O6J A;  3FZ9 A;  2KP1 A;  2B1L A;  3CMI A;  2WDU A;  4GXZ A;  4KW6 A;  4X4J A;  2IMK A;  3VWX A;  1NW2 A;  1TOF A;  1THX A;  2JSY A;  5F06 A;  3N5O A;  4GST A;  4CHS A;  3C1S A;  2CZ3 A;  1XWA A;  5DJM A;  4K5S A;  5A5H A;  2GQM A;  2C0D A;  3BOA A;  5ECM B;  5DQS A;  1A2M A;  1O8X A;  1HYU A;  3IK9 A;  1XWB A;  2H01 A;  1ZZY A;  4OMV A;  1O81 A;  3HHV A;  3TJK A;  3ZZX A;  3HCZ A;  2DMM A;  2A4V A;  1TRV A;  2DJK A;  2EFE A;  3FZ4 A;  3HD5 A;  1T4Y A;  1FOV A;  6GSX A;  4EIP A;  4L5O A;  4IN0 A;  3F3R A;  1E6B A;  3GX8 A;  2FWE A;  1SL1 B;  2VIM A;  4BWS A;  2I3Y A;  5A4V A;  3F3Q A;  3TUE A;  1OKT A;  4HU9 A;  2MMA A;  2GST A;  2YOI A;  1JLV A;  4DVC A;  2L59 A;  2M72 A;  4JED A;  3GST A;  1FVK A;  4DSS A;  1SKW B;  4JE1 A;  1SEN A;  2DML A;  1FAA A;  4CW9 A;  1ABA A;  1TK8 B;  2IN3 A;  1Z7P A;  1U3A A;  2L4C A;  1A8L A;  2LNT A;  1GTB A;  1Z5Y E;  3I43 A;  4GQF A;  3D4T A;  1TRS A;  5CNW A;  3UAR A;  3HY2 A;  2VM2 A;  1VF4 A;  2VD1 A;  3E0U A;  3FY7 A;  3LEF A;  2MBT A;  1AUC A;  3PIN A;  3J7Y b;  1FB0 A;  3KH9 A;  3O6T A;  5HFG A;  1AQW A;  4HZ4 A;  3V1W A;  1VF2 A;  4ZIJ A;  4PQ1 A;  1F6M C;  4LLR A;  2JL4 A;  1S3D A;  2O85 A;  2X8C A;  4I2U A;  1Q98 A;  1K0N A;  4V1A g;  2PER A;  5GSS A;  2GQL A;  4HDE A;  3CHX C;  2O7K A;  2WW3 A;  2VO4 A;  1IYH A;  1PKZ A;  1GSD A;  3ZIV A;  4X0X A;  3C71 A;  5KN3 A;  2PN8 A;  2XC2 A;  4ZB7 A;  3L9V A;  2WFC A;  2GZZ A;  1JZO A;  4DEJ A;  2YV9 A;  3VI7 A;  4MNN A;  4HJM A;  3KM6 A;  3HKR A;  2K8V A;  2GSR A;  2CAI A;  3IV4 A;  2HSM B;  1OC9 B;  2IMF A;  1GTA A;  3MAK A;  5CO3 A;  2YZH A;  3C8E A;  3F9U A;  4IBP A;  2OE0 A;  2R2J A;  2LQO A;  3SWL A;  4N3Z A;  2YWN A;  1GH2 A;  2YCD A;  1O7U A;  2FD3 A;  4IVF A;  3CQF A;  1BF5 A;  2V6O A;  1M9B A;  2X4A A;  2V1M A;  4KA0 A;  5IQY A;  2IIY A;  4NMU A;  4IEL A;  3HDC A;  2TIR A;  1B9X C;  2G2Q A;  4EDY A;  1RW1 A;  4ZXG A;  2L4Q A;  2IPA A;  1GSF A;  3GTU B;  2K8S A;  2B5Y A;  1VF1 A;  1U87 A;  5DAK A;  4TR1 B;  3UVH A;  1NSW A;  2VL2 C;  2QC7 A;  3GN3 A;  1WPI A;  1YEP A;  1S3C A;  4TRX A;  4TVE A;  2HSH A;  2B6M A;  2PWJ A;  1M9A A;  1DE1 A;  4K1F A;  4EO3 A;  2D2Z A;  18GS A;  4EE0 A;  4HQZ A;  4MCU A;  4N0Z A;  4XS6 A;  1M0U A;  4ZBD A;  1OC8 A;  5J4V A;  2A2P A;  3GKK A;  2YAN A;  3U5R E;  2OJL A;  1PL1 A;  2WB9 A;  2HI7 A;  3IC8 A;  4G19 A;  5G31 A;  2YWI A;  5FHI A;  2K18 A;  5IMD A;  4MZW A;  1XBS A;  1T00 A;  3H1N A;  4ZB8 A;  5GAN D;  1RQM A;  2F9S A;  3VWW A;  3APS A;  5BRT A;  1XWG A;  4MDC A;  3RPP A;  1QUW A;  1BG1 A;  4ILF A;  5D93 A;  1JHB A;  4KH7 A;  1SD9 A;  3KP8 A;  4YH2 A;  4YKG A;  10GS A;  1AAZ A;  2CQ9 A;  1QXH A;  3WGX A;  5COH A;  5ECS A;  4BL7 B;  1ZOF A;  1OYJ A;  2V41 A;  5LCZ A;  3QFA C;  1ZYQ B;  1GTI A;  3I69 A;  2ES7 A;  4TR4 A;  2BTO T;  1A23 A;  3RBT A;  5F07 A;  2VL9 A;  3C7M A;  1I9D A;  3I9V 2;  4ICY A;  2H6Y A;  1GNW A;  3QCP A;  3DYR A;  1WMJ A;  4K2X A;  4BWQ A;  4I8B A;  1UN2 A;  1YEX A;  2C8U A;  2OBI A;  1B4Q A;  2ZCT A;  3WD6 A;  2FY6 A;  4L5L A;  2CAQ A;  2PGT A;  4TN8 A;  5E4W A;  5EL8 A;  4HZ2 A;  3GKN A;  3HJO A;  4WF5 A;  4NAX A;  3ZMK A;  4FYB A;  2MMO A;  5B8A A;  4ID0 A;  4IQA A;  3GL5 A;  4IHU A;  3M9J A;  4IGJ A;  4EDZ A;  1V58 A;  1N8J A;  1CQG A;  1UA5 A;  4AKG A;  1I5G A;  4FQU A;  5D9W A;  3L4N A;  3LGC A;  5A34 A;  3GRX A;  3DD3 A;  5FWG A;  1K3L A;  5CYY A;  3EC3 A;  1XPV A;  5DBQ A;  1TRU A;  2HRN A;  1PX6 A;  1GUK A;  2RII A;  4KF9 A;  5ID2 B;  3TKS C;  4FYC A;  19GS A;  2PU9 C;  3RHB A;  5A1N B;  4HSC X;  3ZTL A;  1WJK A;  1Z6N A;  2CA8 A;  2OKA A;  1J08 A;  1X9W B;  4K6X A;  3KP9 A;  4WKW A;  4Z7X A;  4MLY A;  4QMK A;  1GLP A;  5KOW A;  3TKR A;  4IP1 A;  2AV4 A;  3TKQ A; 
#chains in the Genus database with same CATH homology
 1TKD B;  4IQ1 A;  2VAF A;  4PGT A;  3LYP A;  4EIQ A;  5IOW A;  1EGO A;  1X5C A;  1KTE A;  4O92 A;  1TU7 A;  3SBC A;  4ZBA A;  4H86 A;  4D73 B;  1PN9 A;  4KGI A;  5KOX A;  4GWR A;  4FO5 A;  3WT1 A;  3LXZ A;  1XW5 A;  4GF0 A;  4MH2 A;  2H19 A;  4OFM A;  2DSA A;  4Q5F A;  3WYW A;  2FWH A;  3VK9 A;  3GH6 A;  3TJG A;  4V1A p;  1CQH A;  3CTF A;  2AYT A;  4NWY A;  4ISD A;  2BMX A;  2GS3 A;  2AB6 A;  1SJI A;  3BCK A;  1SJZ A;  2X8H A;  2FUG 2;  4KUN A;  4TXV A;  3Q18 A;  1UVZ A;  1YKA A;  3S9F A;  4JR4 A;  5ECP B;  3C1R A;  3R3E A;  3VUR A;  4XRA A;  2J9H A;  3FK8 A;  4MF6 A;  1TI1 A;  3MYD A;  5BMU B;  4V2L A;  5EY6 A;  1GSS A;  2X8G A;  1EOH A;  2P5Q A;  2MMN A;  1FVJ A;  3EMP A;  2E0Q A;  4NXI A;  5J5N A;  4V2M A;  2VCX A;  5J3R A;  1T4Z A;  2EIO A;  2VCW A;  14GS A;  1USB A;  2L6C A;  1F37 A;  3I6A A;  4L0U A;  3QMX A;  5B6N A;  3A2X A;  5D96 A;  3UBK A;  5C00 A;  2LST A;  2X99 A;  5D73 A;  1GP1 A;  3CSI A;  2MMZ A;  2HRK A;  1EEM A;  3ZFB A;  2DJ3 A;  1WIK A;  3VPT A;  1FG4 A;  4KND A;  1FO5 A;  4Q5R A;  5DJL A;  2WUL A;  2ON7 A;  5HFK A;  4K2D A;  2N5F A;  1G6W A;  1GUH A;  1RK4 A;  5IPH A;  1PGT A;  2UZ8 A;  3LFL A;  2HT9 A;  1SK0 A;  3N9J A;  4K5R A;  1YDK A;  2R0C A;  4XTS A;  4EL1 A;  3RHC A;  13GS A;  2DJJ A;  4OFN A;  2VCQ A;  3F4S A;  3MSZ A;  4NV2 A;  2E2G A;  1BAY A;  4N30 A;  4W66 A;  2N5B A;  1O73 A;  3LYK A;  3TDG A;  3D4M A;  3IK7 A;  4F82 A;  1YKC A;  1A0R P;  2OAD A;  3F6D A;  1GWC A;  2HYX A;  1YVL A;  8GSS A;  1SKR B;  1ST9 A;  1AC1 A;  3ZVJ D;  1SYX A;  2EC4 A;  1Q4J A;  3BCI A;  2JSZ A;  3FR9 A;  3APQ A;  1ON4 A;  3L9U A;  16GS A;  3ZRE A;  2GVP A;  5J40 A;  3TOT A;  4POK A;  2GSS A;  2YJ7 A;  3GSS A;  5ECH B;  2H72 A;  2LRT A;  2PVO C;  1V40 A;  4GQC A;  5L71 A;  2C0F A;  3ZML A;  5D9X A;  3FW2 A;  1GUM A;  2E2M A;  2F51 A;  2XPD A;  3FRC A;  2EIR A;  4A5P A;  2H74 A;  1QQ2 A;  1MEK A;  3IA1 A;  4RQX A;  4DSQ A;  2Z9S A;  1ZYE A;  1UC7 A;  1XWK A;  2IMD A;  4PUF C;  1NHO A;  5INY A;  2GT6 A;  5A4U A;  3ZYW A;  3J7Y k;  1XVQ A;  3H93 A;  2L57 A;  5EVO A;  2BJX A;  3P90 A;  3TJB A;  3Q19 A;  1URM A;  1XIY A;  5ECI B;  2VCZ A;  1WOU A;  2DLX A;  3IAM 2;  3W8J A;  1A24 A;  3APO A;  4DSS B;  4MJB A;  22GS A;  5HR3 A;  1LJR A;  2OBK A;  2CX3 A;  1H75 A;  1BG5 A;  1EP7 A;  3WT2 A;  4OD7 A;  1TXX A;  2PMT A;  2GDR A;  1YF0 A;  2IFQ B;  4CDO A;  3M1G A;  1GRX A;  4L8E A;  2PUK C;  4WET A;  5IMZ A;  1JZW A;  3NOF A;  1G7O A;  2MBS A;  2IWT A;  5KN2 A;  1GNE A;  4GSS A;  6GSS A;  1R5P A;  2HSY A;  4XS4 A;  2AUV A;  2R3X A;  2HSM A;  1OC9 A;  1SL2 B;  3L78 A;  4RUV A;  2I81 A;  2MYG A;  4CY8 A;  1E2Y A;  4FH8 A;  5F8B A;  3GA4 A;  2P0G A;  3ZRD A;  3CSJ A;  4PUR A;  3ED3 A;  3IDV A;  3DXB A;  2RUF A;  3HJM A;  3NIV A;  2X49 A;  4OWY A;  4K8M A;  2L5O A;  3P7X A;  1YZX A;  3CSH A;  2TRC P;  4MF7 A;  4Z2R A;  2YV7 A;  3EPT A;  4AF2 A;  1N25 A;  2IME A;  1JZR A;  4O5Q A;  3TKP A;  4Z2U A;  3GTU A;  4EXJ A;  4RQR A;  3DIE A;  4YQU A;  3M9K A;  3RAZ A;  4TR1 A;  3GV1 A;  2DKH A;  2DKI A;  1EV9 A;  2GQK A;  1TK0 B;  4BVY B;  2CVD A;  2F8A A;  4MH3 A;  4MF5 A;  4GDF A;  3F8U A;  3IHQ A;  5G5F A;  4KDX A;  3CBU A;  3QR6 A;  4BVX B;  4LMV A;  1S3A A;  4KSO A;  5IMA A;  4AKI A;  2B7J A;  3QDN A;  1TU8 A;  2F8F A;  2PVQ A;  5IOX A;  2C3T A;  5LNK e;  5ECL B;  3TRP A;  4E8H A;  2YN1 A;  3GX0 A;  3D6I A;  3UEM A;  4KDY A;  2FCH A;  2YP6 A;  3GYK A;  4GSN A;  3UIW A;  2XBI A;  3HVV A;  2H70 A;  3KTB A;  1T8E B;  1EV4 A;  4O5U A;  1AXD A;  3VFI A;  3ZL5 A;  2HFD A;  2I1U A;  2RM5 A;  3UL3 A;  3VWU A;  1MTC A;  4LMW A;  3TKS E;  1XXU A;  3BBY A;  3KCM A;  2P31 A;  2OT3 A;  1XWC A;  4BL7 A;  3DKS A;  4IJI A;  3HA9 A;  1GSE A;  1JZD A;  3HMJ G;  4AI6 A;  2LNS A;  3CYN A;  1F3A A;  4X1U A;  3VWV A;  2N5A A;  3A3T A;  4AGS A;  3IXR A;  4K7N A;  4KSM A;  1V57 A;  3GH9 A;  3KGK A;  2DJ2 A;  1AQV A;  3L9S A;  2QSI A;  3ISO A;  4TOP A;  5IPG A;  4LL4 B;  1J9B A;  5G2Z A;  2B7K A;  4G01 A;  1NHY A;  4F0C A;  5DAL B;  3TJF A;  3F6F A;  5DDL A;  6GSV A;  2OAC A;  2VUP A;  1K0C A;  1M7T A;  3TJJ A;  2EIQ A;  2A4H A;  4K9Z A;  3BD2 A;  3IPZ A;  4I6X A;  2HSN B;  4GLT A;  4KCE A;  1N2A A;  1QMV A;  2CVK A;  4Z2T A;  2K9F A;  3AY8 A;  2LRN A;  1A2L A;  4MJC A;  5DCH A;  2R5G A;  1ACV A;  1JFU A;  2WJU A;  2NPB A;  4YKF A;  5HR2 A;  4ZBB A;  3Q6O A;  1F9M A;  1Z9H A;  5JCU A;  3D5J A;  5ENU A;  2DJ0 A;  2WZ9 A;  1XOA A;  3LG6 A;  1MDK A;  5IMV A;  2FNO A;  1LBK A;  4O7H A;  4AJ7 A;  5ECO B;  2B1K A;  1BYE A;  3KMN A;  1B48 A;  2K6V A;  2VCT A;  2H0G A;  2JAD A;  2R6K A;  3EE2 A;  1ML6 A;  4TW5 A;  5GZZ B;  4WR5 A;  2MZC A;  4YAV A;  5ABR A;  5A1N A;  4ECI A;  1EOG A;  1EGR A;  1A2J A;  2F3M A;  2AHE A;  1ERT A;  2C1Y A;  5IM9 A;  3TRX A;  3D22 A;  3IRA A;  2H1L A;  2FA4 A;  5B6M A;  2CX4 A;  1KEB A;  1XW6 A;  5G5E A;  3EVI A;  2KLX A;  4N11 A;  1PRX A;  2H71 A;  4OCF A;  2V6K A;  2KUC A;  4IS0 A;  4D73 A;  2HE3 A;  1X5E A;  4HUA A;  4BPY A;  5AN1 A;  1PN0 A;  3IHG A;  1V98 A;  2R37 A;  2GGT A;  1SK1 A;  5J4U A;  3A5W A;  2EFC A;  3DGQ A;  2AAW A;  2LJK A;  3GFK A;  3Q74 A;  5JCW A;  3F4R A;  2O8V B;  2NVL A;  2YWO A;  1SU9 A;  5IMF A;  3HJP A;  2WCI A;  2ZNM A;  3TB2 A;  3EMX A;  2HXK A;  4ML1 A;  4POB A;  3MDK A;  1SJ6 A;  2REM A;  2XBQ A;  1J0F A;  6GSY A;  3KD0 A;  3PGT A;  4G10 A;  2A2R A;  3FKF A;  3EYT A;  4TXO A;  2M46 A;  2HRA A;  3A5I A;  1BED A;  5BMU A;  1ZGN A;  4IP6 A;  5CRG A;  2WRT A;  3G9B A;  4TKY A;  4TR3 A;  1PA3 A;  1DBY A;  2OA7 A;  1M99 A;  1M2A A;  3TU3 B;  1R4W A;  1SVM A;  2VCV A;  3TRQ A;  1Y6E A;  2DIZ A;  2DC5 A;  1Y1U A;  4CY6 A;  5ELG A;  2UV8 G;  2JAC A;  2LUS A;  2V32 A;  4HQS A;  5KN0 A;  3M0F A;  1R7H A;  5GAP D;  4MK3 A;  4PXO A;  3GKM A;  4MMM A;  4ML6 A;  2FWF A;  6GSU A;  4I2T A;  3IOS A;  3DVW A;  2YJH A;  4G0L A;  4XIH A;  3GHA A;  4MJA A;  2CV4 A;  1Z3E A;  1TDI A;  3E9J B;  3KJY A;  1B9Y C;  1Z6M A;  2H0I A;  2C0G A;  2H75 A;  3DWV A;  1PKW A;  4PQH A;  2VKZ G;  1F3B A;  5A4W A;  1PD2 1;  2QKE A;  5KEJ A;  5FT3 A;  4QQ7 A;  1X0R A;  2EFH A;  3RPN A;  3VI5 A;  3CWG A;  2IMI A;  2FWG A;  4JRR A;  4G2E A;  1QFN A;  2HZE B;  2LQQ A;  3NZN A;  4HU7 A;  1R5A A;  4XS1 A;  2O87 A;  4OFT A;  5B7C A;  2E7P A;  4GTU A;  2LS5 A;  4POL A;  3A2V A;  3P8W A;  3F4T A;  4G9H A;  3A2W A;  2O89 A;  1AQX A;  1SKS B;  2R4V A;  4MAB A;  3CTG A;  20GS A;  1GTU A;  2M80 A;  5AIV A;  1IYI A;  1LU4 A;  3CRU A;  1K0A A;  5JWQ B;  2KP2 A;  3WGD A;  3UAP A;  3IAS 2;  3MIX A;  3ME7 A;  3TCO A;  3E3E A;  4IW9 A;  4P3Y B;  3DEX A;  2LKU A;  3LJR A;  4WR4 A;  4GCI A;  2G0F A;  1DSB A;  5A5H B;  2VM1 A;  1T3B A;  1HNC A;  2GTU A;  1A8Y A;  2O5V A;  4KAE A;  4J57 E;  4AJ8 A;  4EUY A;  1SD8 A;  1T7P B;  1U6T A;  1TW9 A;  2IL3 A;  4XCS A;  1ERW A;  3ERW A;  2IJY A;  4XHM A;  3TOU A;  2H76 A;  2HQT A;  4V2N A;  2LEG A;  4WXT A;  1EP8 A;  3LWA A;  4TR0 A;  4YQV A;  3G7Y A;  2FLS A;  1PMT A;  3ERF A;  1X5D A;  1ILO A;  1YY7 A;  1TI3 A;  4RI6 A;  2R0G A;  1BX9 A;  4JZQ A;  5H5Q A;  1TK5 B;  5ELA A;  3CXG A;  2H73 A;  3LW9 A;  3DML A;  2LV3 A;  1SVL A;  5F05 A;  3W6G A;  2LTK A;  4IJ3 A;  3ME8 A;  5F0G A;  1HQO A;  5J9C A;  1OKD A;  4ZB6 A;  3UJ1 A;  5C04 A;  2IFQ A;  2YZU A;  3QAV A;  4HS1 A;  4F0B A;  3WGE A;  3FYG A;  4AKX B;  1K0M A;  3IBH A;  4HI7 A;  4N10 A;  5CRW A;  5HQP A;  1PX7 A;  1U88 A;  5CRH A;  1GSU A;  5KN1 A;  1WWJ A;  2NTO A;  1G7E A;  3M3M A;  2JU5 A;  2JZT A;  3P2A A;  4Q5N A;  5CRE A;  5H5S A;  2HLS A;  1SL0 B;  3F0I A;  2P5R A;  1V9W A;  1KNG A;  3HZ8 A;  2C4J A;  4O32 A;  1HNB A;  2C3Q A;  1W4V A;  1G0T A;  2C0E A;  1WRY A;  2C3N A;  1ZMA A;  4ECB A;  3US3 A;  1OVN A;  3UVT A;  5JWO B;  1QGV A;  3IC4 A;  2H0H A;  4EC0 A;  3EU4 A;  4XRD A;  3QPM A;  4HOJ A;  2YNX A;  2OE1 A;  5AIX A;  4XS4 B;  1BQ7 A;  2B5E A;  4WEY A;  3IE3 A;  4E68 A;  4ULX A;  2H1G A;  2XHF A;  3JCM L;  3MWH A;  4BVY A;  2CT6 A;  1K0B A;  3EU3 A;  1XFL A;  5E59 A;  3RDW A;  4ECC A;  5JCG A;  1VF3 A;  3KMO A;  2RUE A;  3QOU A;  2HRF A;  5ECR B;  1G6Y A;  3TGZ A;  4BVX A;  1T1V A;  1OE8 A;  1TJD A;  3EIN A;  1XW9 A;  3LXT A;  5AIS A;  1V2A A;  2PPT A;  12GS A;  4PUA A;  1TTZ A;  4NPB A;  1GL8 A;  4PNG A;  1TRW A;  4NV5 A;  5ECN B;  1DUG A;  5GST A;  3OR5 A;  3W8S A;  2FGX A;  5IO2 A;  3KZQ A;  2ZUP A;  2JZR A;  3G7I A;  2H6Z A;  5ECK B;  1THO A;  1PQN A;  2WS2 A;  2VLT A;  3IR4 A;  5DAK B;  5IMC A;  4MPF A;  4JR6 A;  2FA8 A;  1EWX A;  4BA7 A;  1M2D A;  1Y25 A;  5G1K A;  2TRX A;  1ZYN A;  5J9B A;  2B3S A;  2RM6 A;  2YPM A;  3H79 A;  4PX1 A;  4EKZ A;  1SK2 A;  1FOH A;  3GKX A;  3VLN A;  1O85 A;  4YAP A;  3FZA A;  4JU5 A;  2I9H A;  1X9M B;  3G7J A;  4WF4 A;  3EUR A;  3L0H A;  4RI7 A;  4OO5 A;  4PNF A;  2QA1 A;  3VPQ A;  5DVB A;  2FHE A;  2RLI A;  5AGY A;  4I97 A;  2H30 A;  4OCE A;  1PL2 A;  1NM3 A;  1XVW A;  4G0I A;  4DSR A;  3PH9 A;  4FYU A;  4EVM A;  3FZ5 A;  2H6X A;  3KEB A;  2XPE A;  1B8X A;  2VL2 A;  4ZIL A;  3GUS A;  3DRN A;  3LSZ A;  5JWR B;  3FHK A;  1GLQ A;  4KCA A;  3ZIT A;  4N0V A;  9GSS A;  4K7I A;  4NHW A;  4MZB A;  3QAW A;  4HJ2 A;  5DAL A;  4QL7 A;  3QAG A;  1YJ6 A;  1FB6 A;  1GSY A;  5EPF A;  3CRT A;  2YWM A;  4OO4 A;  4MA9 A;  2HSN A;  4PQI A;  1MDJ A;  1C72 A;  3GL3 A;  1ZL9 A;  2CVB A;  2HNL A;  5J41 A;  2OE3 A;  3GMF A;  3LOR A;  2DIY A;  3M8N A;  3D0Z A;  4LL1 B;  5IIZ A;  4KX4 A;  1XOB A;  1K3Y A;  3R2Q A;  4E8E A;  2J23 A;  1OAZ A;  4K7O A;  2GLR A;  4F03 A;  1MDI A;  4I5Q A;  2GZP A;  2H8L A;  3UMA A;  2KHP A;  1KBN A;  2V2G A;  1O8W A;  5DQY A;  5J4Y A;  5J47 A;  3FMW A;  3GUR A;  2QA2 A;  2VLU A;  3EWL A;  3FR6 A;  4ECJ A;  1BJX A;  5ID2 A;  4MP4 A;  1XCC A;  1HD2 A;  3O76 A;  5IO0 A;  2H1A A;  4ZL7 A;  1FHE A;  1H4O A;  1WP0 A;  1W89 A;  3PPU A;  1JLW A;  1MD4 A;  1YF1 A;  2VD0 A;  2C80 A;  3HYP A;  3QFB C;  1QK8 A;  3HVS A;  5A34 B;  2WGR A;  1OE7 A;  1ERU A;  3O3T A;  3BJ5 A;  4ZL8 A;  1U3I A;  3LQ7 A;  2HZF A;  3KH7 A;  3FEU A;  4MZC A;  1B4P A;  3ZLP A;  1HNA A;  2ALB A;  2L5L A;  3ZFL A;  1DE2 A;  2QGV A;  5CP1 A;  3DVX A;  2L6D A;  1GSQ A;  2JZS A;  3C73 A;  1TXU A;  1MD3 A;  3K8N A;  4ZL9 A;  1ERV A;  2VLV A;  4WBR D;  4AJ6 A;  2LJA A;  4WBJ A;  2GT5 A;  2B5X A;  3HXS A;  5D9T A;  1F2E A;  2EFD A;  4MPG A;  1WE0 A;  1VGL A;  2R0P A;  4F2I A;  4YQM A;  1K0D A;  1SYR A;  5H5R A;  5A5K A;  3KIJ A;  11GS A;  4X43 A;  4MJE A;  3PR8 A;  3TKS A;  5B8B A;  4JBB A;  2H66 A;  3U6V A;  2H1B A;  1XZO A;  3GIX A;  5HFI A;  1A0F A;  1AW9 A;  4ACS A;  1YQ1 A;  4J2F A;  1R26 A;  5HR1 A;  4PTS A;  1EZK A;  3UOM A;  4ZB9 A;  4EF0 A;  4L0W A;  2LJR A;  2I4A A;  4FIW A;  3GNJ A;  4TXO B;  4POM A;  5G30 A;  4J56 E;  2PBJ A;  2NBS A;  2GZY A;  2CZ2 A;  3H4K A;  1PSQ A;  17GS A;  5ECQ B;  4KB3 A;  1M2B A;  2A2S A;  1K3O A;  4USS A;  3D21 A;  2AJQ B;  2LRC A;  4AKH A;  3QD9 A;  7GSS A;  2HZE A;  1FW1 A;  4Q5Q A;  3FR3 A;  5DCG A;  3MNG A;  1TP9 A;  5D9V A;  2DJ1 A;  3ERG A;  6GST A;  1K0O A;  4O5R A;  2VOC A;  3HVX A;  4LA1 A;  3F63 A;  1ZCP A;  4QL9 A;  5LD0 A;  2DBC A;  1X9S B;  3HZ4 A;  1GUL A;  2X64 A;  2H1D A;  4IKH A;  3KXO A;  3UBL A;  1AIU A;  2HRK B;  2NDO A;  4KDU A;  3H8Q A;  1SVO A;  5HR0 A;  5G1L A;  5CRD A;  1ZYP A;  4NHZ A;  4G0K A;  3KTL A;  4F9Z A;  2KOK A;  2GSQ A;  1OC3 A;  3ZVJ A;  4HEA 2;  4GRF A;  1EEJ A;  1Z7R A;  4KE3 A;  6GSW A;  4K0G A;  4K0N A;  2VL3 A;  5D8I A;  1VRS D;  2ON5 A;  3ZIJ A;  5CAX A;  1O6J A;  3FZ9 A;  2KP1 A;  2B1L A;  3CMI A;  2WDU A;  4GXZ A;  4KW6 A;  4X4J A;  2IMK A;  3VWX A;  1NW2 A;  1TOF A;  1THX A;  2JSY A;  5F06 A;  3N5O A;  4GST A;  4CHS A;  3C1S A;  2CZ3 A;  1XWA A;  5DJM A;  4K5S A;  5A5H A;  2GQM A;  2C0D A;  3BOA A;  5ECM B;  5DQS A;  1A2M A;  1O8X A;  1HYU A;  3IK9 A;  1XWB A;  2H01 A;  1ZZY A;  4OMV A;  1O81 A;  3HHV A;  3TJK A;  3ZZX A;  3HCZ A;  2DMM A;  2A4V A;  1TRV A;  2DJK A;  2EFE A;  3FZ4 A;  3HD5 A;  1T4Y A;  1FOV A;  6GSX A;  4EIP A;  4L5O A;  4IN0 A;  3F3R A;  1E6B A;  3GX8 A;  2FWE A;  1SL1 B;  2VIM A;  4BWS A;  2I3Y A;  5A4V A;  3F3Q A;  3TUE A;  1OKT A;  4HU9 A;  2MMA A;  2GST A;  2YOI A;  1JLV A;  4DVC A;  2L59 A;  2M72 A;  4JED A;  3GST A;  1FVK A;  4DSS A;  1SKW B;  4JE1 A;  1SEN A;  2DML A;  1FAA A;  4CW9 A;  1ABA A;  1TK8 B;  2IN3 A;  1Z7P A;  1U3A A;  2L4C A;  1A8L A;  2LNT A;  1GTB A;  1Z5Y E;  3I43 A;  4GQF A;  3D4T A;  1TRS A;  5CNW A;  3UAR A;  3HY2 A;  2VM2 A;  1VF4 A;  2VD1 A;  3E0U A;  3FY7 A;  3LEF A;  2MBT A;  1AUC A;  3PIN A;  3J7Y b;  1FB0 A;  3KH9 A;  3O6T A;  5HFG A;  1AQW A;  4HZ4 A;  3V1W A;  1VF2 A;  4ZIJ A;  4PQ1 A;  1F6M C;  4LLR A;  2JL4 A;  1S3D A;  2O85 A;  2X8C A;  4I2U A;  1Q98 A;  1K0N A;  4V1A g;  2PER A;  5GSS A;  2GQL A;  4HDE A;  2O7K A;  2VO4 A;  1IYH A;  1PKZ A;  1GSD A;  3ZIV A;  4X0X A;  3C71 A;  5KN3 A;  2PN8 A;  2XC2 A;  4ZB7 A;  3L9V A;  2WFC A;  2GZZ A;  1JZO A;  4DEJ A;  2YV9 A;  3VI7 A;  4MNN A;  4HJM A;  3KM6 A;  3HKR A;  2K8V A;  2GSR A;  2CAI A;  3IV4 A;  2HSM B;  1OC9 B;  2IMF A;  1GTA A;  3MAK A;  5CO3 A;  2YZH A;  3C8E A;  3F9U A;  4IBP A;  2OE0 A;  2R2J A;  2LQO A;  3SWL A;  4N3Z A;  2YWN A;  1GH2 A;  2YCD A;  1O7U A;  2FD3 A;  4IVF A;  1BF5 A;  2V6O A;  1M9B A;  2X4A A;  2V1M A;  4KA0 A;  5IQY A;  2IIY A;  4NMU A;  4IEL A;  3HDC A;  2TIR A;  1B9X C;  2G2Q A;  4EDY A;  1RW1 A;  4ZXG A;  2L4Q A;  2IPA A;  1GSF A;  3GTU B;  2K8S A;  2B5Y A;  1VF1 A;  1U87 A;  5DAK A;  4TR1 B;  3UVH A;  1NSW A;  2VL2 C;  2QC7 A;  3GN3 A;  1WPI A;  1YEP A;  1S3C A;  4TRX A;  4TVE A;  2HSH A;  2B6M A;  2PWJ A;  1M9A A;  1DE1 A;  4K1F A;  4EO3 A;  2D2Z A;  18GS A;  4EE0 A;  4HQZ A;  4MCU A;  4N0Z A;  4XS6 A;  1M0U A;  4ZBD A;  1OC8 A;  5J4V A;  2A2P A;  3GKK A;  2YAN A;  3U5R E;  2OJL A;  1PL1 A;  2WB9 A;  2HI7 A;  3IC8 A;  4G19 A;  5G31 A;  2YWI A;  5FHI A;  2K18 A;  5IMD A;  4MZW A;  1XBS A;  1T00 A;  3H1N A;  4ZB8 A;  5GAN D;  1RQM A;  2F9S A;  3VWW A;  3APS A;  5BRT A;  1XWG A;  4MDC A;  3RPP A;  1QUW A;  1BG1 A;  4ILF A;  5D93 A;  1JHB A;  4KH7 A;  1SD9 A;  3KP8 A;  4YH2 A;  4YKG A;  10GS A;  1AAZ A;  2CQ9 A;  1QXH A;  3WGX A;  5COH A;  5ECS A;  4BL7 B;  1ZOF A;  1OYJ A;  2V41 A;  5LCZ A;  3QFA C;  1ZYQ B;  1GTI A;  3I69 A;  2ES7 A;  4TR4 A;  2BTO T;  1A23 A;  3RBT A;  5F07 A;  2VL9 A;  3C7M A;  1I9D A;  3I9V 2;  4ICY A;  2H6Y A;  1GNW A;  3QCP A;  3DYR A;  1WMJ A;  4K2X A;  4BWQ A;  4I8B A;  1UN2 A;  1YEX A;  2C8U A;  2OBI A;  1B4Q A;  2ZCT A;  3WD6 A;  2FY6 A;  4L5L A;  2CAQ A;  2PGT A;  4TN8 A;  5E4W A;  5EL8 A;  4HZ2 A;  3GKN A;  3HJO A;  4WF5 A;  4NAX A;  3ZMK A;  4FYB A;  2MMO A;  5B8A A;  4ID0 A;  4IQA A;  3GL5 A;  4IHU A;  3M9J A;  4IGJ A;  4EDZ A;  1V58 A;  1N8J A;  1CQG A;  1UA5 A;  4AKG A;  1I5G A;  4FQU A;  5D9W A;  3L4N A;  3LGC A;  5A34 A;  3GRX A;  3DD3 A;  5FWG A;  1K3L A;  5CYY A;  3EC3 A;  1XPV A;  5DBQ A;  1TRU A;  2HRN A;  1PX6 A;  1GUK A;  2RII A;  4KF9 A;  5ID2 B;  3TKS C;  4FYC A;  19GS A;  2PU9 C;  3RHB A;  5A1N B;  3ZTL A;  1WJK A;  1Z6N A;  2CA8 A;  2OKA A;  1J08 A;  1X9W B;  4K6X A;  3KP9 A;  4WKW A;  4Z7X A;  4MLY A;  4QMK A;  1GLP A;  5KOW A;  3TKR A;  4IP1 A;  2AV4 A;  3TKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...