4WR4A

Crystal structure of gst mutated with halogenated tyrosine (7bgst-1)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
218
structure length
211
Chain Sequence
b'SSPILGYWKIKGLVQPTRLLLELEEKYEEHLERDEGDKWRNKKFELGLEFPNLPYIDGDVKLTQSMAIIRIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTLNGDHVTHPDFMLYDALDVVLMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase class-mu 26 kDa isozyme
publication title Protein stabilization utilizing a redefined codon
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase
total genus 67
structure length 211
sequence length 218
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2014-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4wr4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wr4A01
4ZL8A 5HFGA 4I5QA 1NW2A 2CAIA 3EINA 5JCUA 5G2ZA 2GSSA 2MMZA 4GXZA 1GUHA 4AJ7A 2CVDA 2CAQA 3UVHA 2GSRA 1I9DA 1X9WB 4MDCA 1XWGA 2DBCA 3HJPA 2WRTA 1M99A 1A8LA 1G7OA 5F05A 2LNSA 1JZWA 4J2FA 1F6MC 3H79A 3ZIVA 4O92A 3IV4A 2DIYA 4ZBBA 2L59A 3CXGA 2PERA 1JHBA 1EV4A 4N10A 12GSA 2MBSA 4F03A 3VWVA 4ZXGA 3TRQA 1YEXA 2K18A 3QFAC 3HDCA 4HS1A 4FIWA 2C0GA 2LEGA 2HSMA 2H74A 3HXSA 2ES7A 4HQZA 4MPFA 2IPAA 1O85A 3ME8A 5IMZA 3I9V2 2LQOA 1B4PA 2LRCA 1TK5B 5CP1A 4BPYA 1X5DA 1LJRA 4TR4A 1F3BA 3RAZA 1EEMA 1J9BA 2IMKA 3GKMA 2ZNMA 1FW1A 3KEBA 2M46A 1SL0B 3UMAA 2L4CA 1GNWA 1AW9A 2H1AA 2P5RA 3C7MA 4Q5RA 2GZPA 3TKQA 3IR4A 2VL2C 4G2EA 2HRNA 2VIMA 3ZL5A 3ME7A 1SL2B 4POKA 4YQUA 3M1GA 1M9AA 3US3A 1XWCA 3R3EA 1V58A 1YEPA 1MD3A 2VLUA 5B7CA 4MK3A 2HRFA 1U3AA 2XPEA 3GKKA 1VF1A 3E0UA 2AUVA 1BJXA 5F06A 2YZHA 1M9BA 4ILFA 2GZYA 4GF0A 2CX3A 1TRWA 2IMIA 3Q6OA 3FEUA 3TKRA 2G2QA 3IOSA 1T8EB 3ZTLA 2ALBA 4MH2A 4DSRA 3FYGA 4XS6A 2WCIA 2GSQA 1FB6A 1HNCA 1BAYA 6GSVA 1X5EA 3E9JB 3IDVA 3AY8A 1EOHA 2I4AA 4JR6A 4NMUA 4IS0A 4ISDA 1S3AA 2VCTA 5ECIB 4IVFA 4FYCA 5IMAA 3QOUA 1XFLA 2LUSA 5CNWA 3QD9A 2L5OA 1NSWA 2K9FA 2LS5A 5EPFA 1AAZA 2AJQB 5HR1A 5G31A 2B7KA 3GKNA 1QFNA 1GTUA 3HVVA 1EEJA 1OC9B 2GLRA 3IRAA 1AQXA 4ZB6A 1PX7A 1H4OA 1TXXA 3C8EA 1YF1A 14GSA 3Q19A 3K8NA 1TJDA 4MF6A 5A5KA 5ELAA 3BD2A 20GSA 5AGYA 5BMUA 4CW9A 3FK8A 4MF7A 3TKSA 3NZNA 4GSNA 5G1KA 3Q18A 1SJ6A 2C0FA 3I43A 4PQIA 4K8MA 4PX1A 2H73A 4FYUA 5FT3A 3CTFA 4HJ2A 4PQ1A 4GLTA 3TRPA 4YQVA 1ABAA 1JZDA 3TJFA 4IJIA 5G5EA 2OE1A 1UC7A 3F3RA 1Z6MA 4OMVA 3D5JA 2HSNB 3IK9A 2VCXA 2PU9C 1ZYQB 4KB3A 2AYTA 1WOUA 3VURA 4CHSA 3KIJA 3D4MA 4IQ1A 2HSYA 1X5CA 4MH3A 4LMWA 2HSHA 4HUAA 3D22A 5JWQB 1ZZYA 3FZ5A 3IC8A 17GSA 1YF0A 3DXBA 1GSFA 1K0BA 2DJ0A 2CQ9A 2H66A 1G0TA 4POBA 5D8IA 1TI3A 5G30A 3G7YA 4AJ6A 3PH9A 5DQSA 1T00A 2YWNA 2B5EA 3CSHA 3HHVA 4GTUA 1X9MB 1O8XA 4K0NA 3IBHA 3PR8A 1E2YA 3DKSA 4DSQA 3VPTA 1SYXA 4EVMA 2XHFA 1SKWB 1Z5YE 4FH8A 1U3IA 2O85A 3ERWA 1DBYA 5IMFA 4J56E 1MDIA 4OCEA 1C72A 1T1VA 2PUKC 2FY6A 4GRFA 2DMMA 5ELGA 3M9KA 2F3MA 1SK0A 5ID2A 4HU9A 2FWFA 2IMDA 3KD0A 1OKTA 5D9XA 3QDNA 3GFKA 1AIUA 4TXVA 2FA4A 5D9WA 3W8JA 1GUKA 3BOAA 2HFDA 2C3NA 1QQ2A 2N5AA 2G0FA 1BYEA 5DQYA 3EWLA 3HKRA 2H0HA 3FR9A 1IYHA 5A4VA 2B6MA 1MTCA 1U87A 2HE3A 4HI7A 1GNEA 1XWKA 4FYBA 2GTUA 4RI6A 4XRAA 1G7EA 1XW6A 2F9SA 4GWRA 4ZB8A 3UL3A 3GV1A 5C04A 5IOWA 2VCQA 3GTUA 5DJLA 2GQKA 2PN8A 1KNGA 4QL7A 3F6DA 2WGRA 1M7TA 5CRDA 3CTGA 1O73A 1ST9A 3CYNA 4KSOA 4FO5A 2C80A 4V1Ag 4K0GA 5AN1A 1SKSB 1XVQA 3GL3A 1K0DA 3ZRDA 3TOTA 4ZL9A 1PX6A 2H1BA 1JFUA 5J9BA 5AIXA 5J3RA 2HRKA 4MLYA 5HR0A 1PRXA 3VI7A 2PBJA 3F6FA 5D9TA 4ZILA 3CRTA 1ZL9A 4HEA2 3GSTA 2QC7A 5DJMA 2IFQA 18GSA 1PN9A 2YOIA 1B48A 1E6BA 7GSSA 3FR6A 1ZGNA 2IMEA 4ZBAA 1Z3EA 5G1LA 1HD2A 2YJHA 1A0RP 4WETA 1XPVA 2NTOA 1VF3A 4EL1A 4XIHA 1XOAA 4MA9A 2YV7A 1SK1A 1F37A 2FGXA 1GLPA 3WGEA 3FY7A 1GSYA 2C8UA 4EUYA 2GT6A 2H01A 3KM6A 4PURA 1B9XC 4OCFA 1WRYA 4ML6A 2CV4A 1T3BA 4IELA 2LQQA 3KGKA 3GN3A 4PTSA 3EC3A 3Q74A 4KAEA 3DRNA 3DMLA 3U5RE 2OE0A 3LGCA 4MPGA 1TOFA 4ECBA 3TUEA 3H4KA 5B8AA 2X99A 3HJMA 4L0UA 1TRUA 1K3YA 1ZYEA 3L9VA 4IGJA 1TRVA 3GTUB 2VCWA 6GSUA 5HFKA 2FA8A 2JZSA 1S3DA 1FAAA 2CT6A 4G0LA 1GTIA 2YCDA 1FG4A 3KP8A 5GAPD 2FLSA 1GL8A 2FHEA 4MJCA 3HD5A 1R5AA 3LQ7A 2HRKB 2YP6A 2C0DA 3W6GA 4YH2A 1VF2A 6GSWA 3QAGA 1YZXA 1SJIA 3ZIJA 4JR4A 3GUSA 5IMDA 3UVTA 3APQA 1J08A 3ZFLA 1RQMA 4NV5A 1H75A 1O81A 3EU3A 4BA7A 1N8JA 3EMXA 1NHOA 4K6XA 5ABRA 2N5FA 2IFQB 4DEJA 2LSTA 1OC9A 1PKWA 3NIVA 2C4JA 2HLSA 4KA0A 1EGRA 4ACSA 5IOXA 1TRSA 2VOCA 2R5GA 1FO5A 1O7UA 2YZUA 4JBBA 4JRRA 1HQOA 4TOPA 3FW2A 2FD3A 4I97A 1G6YA 2VO4A 1XBSA 3QAWA 5JWOB 4FQUA 4AF2A 3IAS2 3LSZA 1PGTA 3VLNA 1Y25A 5DALB 2JADA 1TW9A 3P8WA 4D73A 4L0WA 2LNTA 2HZFA 2EIRA 4KDYA 2OA7A 4MF5A 5D96A 2X64A 1EWXA 2C0EA 3SBCA 1TKDB 2EC4A 3TJJA 3FKFA 4V1Ap 4EC0A 3RPPA 3VI5A 2WDUA 4HZ4A 3JCML 4X43A 3TKSC 4ECJA 1BEDA 4MABA 4TR0A 3ZYWA 3QCPA 3ZVJA 3TGZA 4L5LA 4Z7XA 2VLVA 3IXRA 2KP1A 4GCIA 4F9ZA 4KF9A 2RM5A 2NVLA 1ERUA 1XVWA 1SKRB 2ZCTA 6GSSA 3APOA 4IJ3A 3ZVJD 2O8VB 5C00A 3ZITA 5LCZA 5ECSA 16GSA 4O5RA 1HYUA 1CQGA 1W4VA 4BVXB 3UBKA 3FHKA 4O7HA 1AQVA 4J57E 4MMMA 1YY7A 1F9MA 3P2AA 1THXA 5IIZA 3GYKA 1SJZA 1MDJA 1ERTA 5F0GA 1TU7A 3GL5A 3G9BA 3TJBA 2OBKA 1JLVA 5ECLB 5CREA 1SU9A 1A2JA 3HYPA 5DAKB 2VD1A 3VK9A 3IPZA 1AC1A 3EE2A 3A2XA 4NHWA 2L4QA 1ML6A 3FRCA 2B1LA 1GSQA 3TOUA 2GZZA 2VD0A 4N0VA 5GAND 1PL2A 2BJXA 4NWYA 1ZMAA 3CSIA 1EP7A 5IO0A 2V6OA 2H6YA 4TW5A 1IYIA 4BWQA 3ERGA 4EXJA 1A2LA 5H5RA 5D73A 3H8QA 3GX8A 4PUAA 6GSTA 3KTLA 3GIXA 3LEFA 3FZ9A 3O6TA 4K9ZA 2MYGA 1V9WA 1HNAA 1EP8A 4YAPA 3TDGA 3QMXA 1WWJA 2AV4A 4D73B 4DVCA 4JZQA 4LL4B 4F2IA 1OE8A 4JE1A 4V2NA 2J23A 2V1MA 1O8WA 2E7PA 3EURA 1XXUA 3CRUA 2HQTA 2RUEA 5B8BA 1TDIA 5IMVA 1K0CA 2HT9A 3P90A 4XHMA 2I3YA 1FVKA 2OACA 2F8AA 1M0UA 1OC8A 3LYKA 2P5QA 5IPGA 2AB6A 1OE7A 4DSSB 5DCHA 2VCVA 3TRXA 3IAM2 3TB2A 3KZQA 1K3LA 4OFTA 2LRTA 4XS4B 4RI7A 1AQWA 4POLA 4YAVA 3APSA 5B6NA 5ECHB 4TXOB 4HU7A 3F9UA 1K0NA 2YJ7A 1EV9A 1WP0A 2XPDA 2WZ9A 1EOGA 3MWHA 2YANA 4N11A 1DUGA 1N2AA 4MZWA 3V1WA 2JL4A 2R37A 3D0ZA 2DJJA 2X8CA 3LORA 1V57A 3M0FA 1Z9HA 4L8EA 3ZFBA 1R26A 4IBPA 3F8UA 4MJBA 4KSMA 2HRAA 1YJ6A 4QL9A 4X1UA 2HZEB 1GSDA 2KLXA 4ZB9A 2LJRA 5CRGA 3WGXA 4XS1A 3LG6A 4HJMA 2P31A 2DJ1A 5E59A 2B7JA 3F3QA 2O89A 1T7PB 2L6CA 1B8XA 3FR3A 3A5WA 1WJKA 3EVIA 1T4ZA 1A0FA 2IJYA 3PPUA 5CRHA 1VGLA 2RUFA 1MDKA 4NPBA 4NV2A 3LYPA 2OJLA 2H0IA 3C71A 1F2EA 1A8YA 2H75A 4ZIJA 11GSA 2KHPA 2BTOT 2KP2A 3PINA 3WGDA 3RDWA 1K3OA 2HI7A 5EVOA 1WIKA 3DWVA 4KDXA 5HR2A 2MZCA 3LFLA 4HDEA 1XW5A 3TCOA 4ZBDA 2IWTA 1FB0A 4EE0A 1Q4JA 3EMPA 4IN0A 2GVPA 4N0ZA 3GH6A 3A3TA 3QPMA 3RHBA 1MEKA 2D2ZA 4WR4A 4I2TA 4G19A 1LU4A 2EIQA 4EDZA 4RQXA 1YKCA 2LKUA 4XRDA 13GSA 4KDUA 2H19A 1X9SB 1V40A 3DGQA 2X8HA 2E2MA 2J9HA 4WBRD 1FHEA 5ECQB 5KN1A 1ERWA 1SD9A 5IO2A 3L78A 2DSAA 1I5GA 4RUVA 1EZKA 2V6KA 4WKWA 3TJKA 3KTBA 1M2AA 4G0KA 4EKZA 2DJ3A 2N5BA 1GSUA 5J4UA 1RK4A 2C3TA 4V2LA 2H70A 4LA1A 4K7IA 4G9HA 4K2DA 2YNXA 4GQCA 1WPIA 1GUMA 4X0XA 2IIYA 4USSA 2CX4A 2O87A 3GKXA 4NHZA 2TRCP 3HJOA 1GSSA 3L9SA 4K7OA 2DIZA 3BCIA 4TR3A 3GURA 4TRXA 4Q5NA 1K0MA 2B1KA 2H76A 3UBLA 3DEXA 2CZ2A 1VF4A 4AJ8A 2VLTA 4KX4A 2DJ2A 2MBTA 1PSQA 1USBA 5DALA 2YN1A 1UA5A 1ERVA 1S3CA 3LXTA 2YPMA 4NXIA 3VWUA 3I69A 3RPNA 4F82A 3H1NA 4OO4A 3WYWA 2FWGA 3HZ8A 4BWSA 2R2JA 4MJAA 4ECIA 1V2AA 3FZ4A 2KOKA 1EGOA 3HY2A 2LTKA 22GSA 1PL1A 1TK0B 2JSZA 4WF4A 1JZRA 3ERFA 1XZOA 2MMAA 4F0BA 5IQYA 1GH2A 4IP1A 5J5NA 4KUNA 1TK8B 5IM9A 2NPBA 2DMLA 4TVEA 5EL8A 2GDRA 4PNFA 4IQAA 2A4VA 3UAPA 3BBYA 4BVXA 1DE2A 1QUWA 3QFBC 1O6JA 3L9UA 1XCCA 2RIIA 4I6XA 1KTEA 3QR6A 5AIVA 1KEBA 3CMIA 1BX9A 1X0RA 4RQRA 3LJRA 1HNBA 5J41A 4I8BA 3O3TA 2LJKA 4Q5FA 2X8GA 1TU8A 2E2GA 5E4WA 1FOVA 2H1GA 9GSSA 2E0QA 2LRNA 2JU5A 4TR1A 4BVYB 2FUG2 1Z6NA 1JZOA 1F3AA 3WD6A 5DAKA 4ULXA 4H86A 1Q98A 2C1YA 3HVSA 4OWYA 1PA3A 1GTAA 4E8HA 1SYRA 5JWRB 4G10A 6GSXA 3ISOA 2WB9A 1SD8A 4BL7B 3GSSA 2H30A 5L71A 2CVBA 5IPHA 1SK2A 3KCMA 5DVBA 1M2BA 1XOBA 3ZREA 10GSA 1GP1A 5HFIA 2GQMA 3KMOA 4NAXA 3DD3A 1OVNA 5CO3A 3GH9A 5IMCA 3R2QA 5CYYA 2YWMA 2KUCA 3M9JA 5KN3A 3KXOA 2JZTA 5H5SA 2CVKA 2OBIA 3GMFA 2F51A 4HZ2A 2HNLA 2A2RA 5HR3A 1QK8A 2B5YA 4EO3A 1VRSD 3GRXA 4XTSA 4WF5A 4L5OA 5H5QA 2YWIA 1U6TA 3N9JA 1Z7PA 2H0GA 3VWXA 4DSSA 1RW1A 2RM6A 2QGVA 4XS4A 4MJEA 2R4VA 1NM3A 5EY6A 3U6VA 4KH7A 4TXOA 3J7Yk 3EU4A 2H6ZA 5ECPB 5LD0A 2ON5A 4MCUA 4EF0A 2BMXA 4PQHA 3ZMKA 1LBKA 2O7KA 5AISA 4GSTA 3VWWA 2DLXA 2JACA 3N5OA 2RLIA 1THOA 5B6MA 2VCZA 1OC3A 2L5LA 1TTZA 5ECOB 3C1RA 2JSYA 2OE3A 4TR1B 4KCEA 3UJ1A 4PUFC 1B4QA 2PPTA 5GZZB 4IKHA 1K0OA 1XW9A 5D93A 3PGTA 2QKEA 5KN2A 2H1DA 4WR5A 2HSMB 2I1UA 2HZEA 3UOMA 5DCGA 2R6KA 3LWAA 5ENUA 3I6AA 4WXTA 4I2UA 2HXKA 2YWOA 5J9CA 4TKYA 2DC5A 1GLQA 5F07A 3UIWA 2IL3A 2VL2A 4O32A 2GT5A 3TKPA 3FZAA 2VL3A 2H6XA 4HOJA 2K8SA 3UARA 3GNJA 1OKDA 4V2MA 4IHUA 4K1FA 1AUCA 2H72A 1DE1A 2GQLA 1G6WA 3SWLA 6GSYA 3RBTA 2CZ3A 3D21A 2GGTA 3EYTA 3GHAA 1PD21 1MD4A 4OO5A 5A4WA 2VAFA 1BG5A 3DVWA 3D4TA 2L57A 1QXHA 2A2SA 3UEMA 3L4NA 1WMJA 5CAXA 2VL9A 3WT1A 2AHEA 1XWAA 2PGTA 1OAZA 2OADA 4GQFA 2Z9SA 2CA8A 1GULA 5LNKe 4OFMA 4KE3A 3C1SA 3VPQA 2XBQA 1SENA 1V98A 1ACVA 3GX0A 2ON7A 5HQPA 2LJAA 2K6VA 1W89A 5CRWA 2FWHA 1FVJA 2TIRA 3HVXA 3F63A 3CBUA 1M2DA 1XWBA 1KBNA 2WS2A 2OKAA 3H93A 2GSTA 4N30A 2REMA 3P7XA 4TN8A 5DBQA 2IMFA 3BJ5A 3ZZXA 1YQ1A 2MMOA 3J7Yb 2M72A 1CQHA 2TRXA 1GRXA 2VUPA 4PGTA 4EDYA 1PKZA 4ZL7A 4HQSA 3F4SA 4GSSA 1WE0A 4ID0A 3HA9A 3IC4A 1AXDA 1QGVA 4KCAA 3MAKA 3VFIA 4MZCA 1QMVA 1GTBA 1UN2A 2H71A 5KEJA 3WT2A 3QAVA 1XIYA 2GS3A 2AAWA 5INYA 1J0FA 4JU5A 2M80A 1YKAA 4K7NA 1UVZA 2H8LA 3BCKA 2YV9A 3O76A 3MDKA 1B9YC 2I81A 3F0IA 3IE3A 4AGSA 5GSSA 4CDOA 2NBSA 3IK7A 3DYRA 3L0HA 4KGIA 3A2VA 3G7IA 5GSTA 2K8VA 1Y6EA 3A2WA 4PXOA 1ON4A 2EIOA 3TJGA 4IW9A 1Z7RA 3KH7A 3ZLPA 4F0CA 4YQMA 2PWJA 3OR5A 4LMVA 2WULA 4MZBA 3KH9A 2ZUPA 4POMA 3IA1A 1ZCPA 4QQ7A 1R5PA 4KNDA 2WJUA 4E8EA 2LV3A 3W8SA 2V41A 3KJYA 2PVQA 1PQNA 1U88A 5F8BA 2MMNA 1URMA 2V32A 5JCGA 3LXZA 4KW6A 4JEDA 1NHYA 2P0GA 2L6DA 1YDKA 3C73A 5ECKB 5JCWA 3HZ4A 2V2GA 2B3SA 4XCSA 3D6IA 3F4TA 4WEYA 1TI1A 4LL1B 5ECMB 1ZOFA 3M8NA 2XC2A 1T4YA 8GSSA 3GA4A 2JZRA 3E3EA 2IN3A 2VM1A 2DJKA 4Q5QA 1GSEA 3NOFA 2FNOA 3F4RA 4LLRA 5FHIA 5ECRB 2FWEA 2VM2A 1R4WA 4WBJA 4G0IA 2F8FA 4BVYA 3ZMLA 2FCHA 1GWCA 4P3YB 1JLWA 3CSJA 2I9HA 5A4UA 3TKSE 1A23A 1OYJA 4OFNA 2B5XA 3MSZA 4MP4A 19GSA 1SL1B 1ILOA 2WFCA 4BL7A 1TP9A 1K0AA 4ECCA 1A24A 5G5FA 1DSBA 5DDLA 2C3QA 1A2MA 5FWGA 3S9FA 1PMTA 3IHQA 3KMNA 5ID2B 2XBIA 5D9VA 3M3MA 5ECNB 3DIEA 2PVOC 5COHA 2QSIA 3DVXA 2HYXA 3HCZA 4OD7A 3KP9A 3RHCA 2UZ8A 4IP6A 4ML1A 1R7HA 2NDOA 3ED3A 2R3XA 5KN0A 3G7JA 1BQ7A 2PMTA 3MNGA 4PNGA
chains in the Genus database with same CATH superfamily
4ZL8A 5HFGA 4I5QA 1NW2A 2CAIA 3EINA 5JCUA 5G2ZA 2GSSA 2MMZA 3IHGA 4GXZA 1GUHA 4AJ7A 2CVDA 2CAQA 3UVHA 2GSRA 1I9DA 1X9WB 4MDCA 1XWGA 2DBCA 3HJPA 2WRTA 1M99A 1A8LA 1G7OA 5F05A 2LNSA 1JZWA 4J2FA 1F6MC 3H79A 3ZIVA 4O92A 3IV4A 2DIYA 4ZBBA 2L59A 3CXGA 2PERA 1JHBA 1EV4A 4N10A 12GSA 2MBSA 4F03A 3VWVA 4ZXGA 3TRQA 1YEXA 2K18A 3QFAC 3HDCA 4HS1A 4FIWA 2C0GA 2LEGA 2HSMA 2H74A 3HXSA 2ES7A 4HQZA 4MPFA 2IPAA 1O85A 3ME8A 5IMZA 3I9V2 2LQOA 1B4PA 4K5SA 2LRCA 1TK5B 5CP1A 4BPYA 1X5DA 4AKXB 1LJRA 4TR4A 1F3BA 3RAZA 1EEMA 1J9BA 2IMKA 3GKMA 2ZNMA 1FW1A 3KEBA 2M46A 1SL0B 3UMAA 2L4CA 1GNWA 1AW9A 2H1AA 2P5RA 3C7MA 4Q5RA 2GZPA 3TKQA 3IR4A 2EFEA 3HMJG 2VL2C 4G2EA 2HRNA 2VIMA 3ZL5A 1SVMA 3ME7A 1SL2B 4POKA 4YQUA 3M1GA 1M9AA 3US3A 1XWCA 3R3EA 1V58A 1YEPA 1MD3A 2VLUA 5B7CA 4MK3A 2HRFA 2QA2A 1U3AA 2XPEA 3GKKA 1VF1A 3E0UA 2AUVA 1BJXA 5F06A 2YZHA 1M9BA 4ILFA 2GZYA 2X4AA 4GF0A 2CX3A 1TRWA 2IMIA 3Q6OA 3FEUA 3TKRA 2G2QA 3IOSA 1T8EB 3ZTLA 2ALBA 4Z2RA 4MH2A 4DSRA 2EFCA 3FYGA 4XS6A 2WCIA 2GSQA 4W66A 4O5UA 1FB6A 1HNCA 1BAYA 6GSVA 1X5EA 3E9JB 3IDVA 2WVXB 3AY8A 1EOHA 2I4AA 4JR6A 4NMUA 4IS0A 4ISDA 1S3AA 2VCTA 5ECIB 4IVFA 4FYCA 5KOWA 5IMAA 3QOUA 3EPTA 1XFLA 2LUSA 3HVNA 5CNWA 3QD9A 2L5OA 1NSWA 2K9FA 2LS5A 1ZYNA 5EPFA 1AAZA 5J40A 5HR1A 2AJQB 5G31A 2B7KA 3GKNA 1QFNA 1GTUA 3HVVA 1EEJA 1OC9B 2GLRA 1S4BP 3IRAA 1AQXA 4ZB6A 1PX7A 1H4OA 1SVLA 1TXXA 3C8EA 1YF1A 14GSA 3Q19A 3K8NA 1TJDA 4MF6A 5A5KA 5ELAA 3BD2A 20GSA 5AGYA 5BMUA 4CW9A 3FK8A 4MF7A 3TKSA 3NZNA 4GSNA 5G1KA 3Q18A 1SJ6A 2C0FA 3I43A 4PQIA 4K8MA 4PX1A 2H73A 4FYUA 5FT3A 3CTFA 4HJ2A 4PQ1A 4GLTA 3TRPA 4YQVA 1ABAA 1JZDA 3TJFA 4IJIA 5G5EA 2OE1A 1UC7A 3CQFA 3F3RA 1Y1UA 1Z6MA 4OMVA 3D5JA 2HSNB 3IK9A 2VCXA 2PU9C 1ZYQB 4KB3A 2AYTA 5A5HB 1WOUA 3VURA 4CHSA 3KIJA 3D4MA 4IQ1A 2HSYA 1X5CA 4MH3A 4LMWA 2HSHA 4HUAA 3D22A 5JWQB 1ZZYA 3FZ5A 4GDFA 3IC8A 17GSA 1YF0A 3DXBA 1GSFA 1K0BA 2DJ0A 2CQ9A 2H66A 1G0TA 4POBA 5D8IA 1TI3A 5G30A 3G7YA 4AJ6A 3PH9A 5DQSA 1T00A 2YWNA 3LW9A 2B5EA 3CSHA 3HHVA 4GTUA 1X9MB 1O8XA 4K0NA 3IBHA 4CY6A 3PR8A 1E2YA 3DKSA 4DSQA 3VPTA 1SYXA 4EVMA 2XHFA 1SKWB 1Z5YE 4FH8A 1U3IA 2O85A 3ERWA 1DBYA 5IMFA 1FOHA 4J56E 1MDIA 4OCEA 1C72A 1T1VA 2PUKC 5BMUB 2FY6A 4GRFA 2DMMA 5ELGA 3M9KA 2F3MA 1SK0A 5ID2A 4HU9A 2FWFA 2IMDA 3KD0A 1OKTA 5D9XA 3QDNA 3GFKA 1AIUA 4TXVA 2FA4A 5D9WA 3W8JA 1GUKA 3BOAA 2HFDA 2C3NA 2WVZA 1QQ2A 1M3IA 2G0FA 2N5AA 1BYEA 5DQYA 3EWLA 3HKRA 2H0HA 4PI0C 3FR9A 1IYHA 5A4VA 2B6MA 1MTCA 1U87A 2QA1A 2HE3A 4HI7A 1GNEA 1XWKA 4FYBA 2GTUA 4RI6A 4XRAA 4YKGA 4A5PA 1G7EA 1XW6A 2F9SA 4GWRA 4ZB8A 3UL3A 3GV1A 5C04A 5IOWA 2VCQA 3GTUA 5DJLA 2GQKA 2PN8A 1KNGA 4QL7A 3F6DA 2WGRA 1M7TA 5CRDA 3CTGA 1O73A 1ST9A 3CYNA 4KSOA 4FO5A 2C80A 4V1Ag 4K0GA 5AN1A 1SKSB 1XVQA 3GL3A 1K0DA 3ZRDA 3TOTA 4ZL9A 1PX6A 2H1BA 1JFUA 5J9BA 5AIXA 5J3RA 2HRKA 4MLYA 5HR0A 1PRXA 3VI7A 2PBJA 3F6FA 5D9TA 4ZILA 4PI2C 2WW3A 1SVOA 3CRTA 1M3JA 1ZL9A 4HEA2 3GSTA 2EFDA 2QC7A 5DJMA 2IFQA 18GSA 1PN9A 2YOIA 1B48A 1E6BA 7GSSA 3FR6A 1ZGNA 2IMEA 4ZBAA 1Z3EA 5G1LA 1HD2A 2YJHA 1A0RP 4WETA 1XPVA 2NTOA 1VF3A 4EL1A 4XIHA 1XOAA 4MA9A 2YV7A 1SK1A 1F37A 2FGXA 1GLPA 4AKHA 3WGEA 3FY7A 1GSYA 2C8UA 4EUYA 2GT6A 2H01A 2VKZG 3KM6A 4PURA 1B9XC 4OCFA 1WRYA 4ML6A 2CV4A 1T3BA 4IELA 2LQQA 3KGKA 3GN3A 4PTSA 3EC3A 3Q74A 1BF5A 4KAEA 3DRNA 3DMLA 3U5RE 2OE0A 3LGCA 4MPGA 1TOFA 4ECBA 1ZYPA 3TUEA 3H4KA 5B8AA 2X99A 3HJMA 4L0UA 1TRUA 1K3YA 1ZYEA 4BIKA 3L9VA 4IGJA 1TRVA 3GTUB 2VCWA 6GSUA 5HFKA 2FA8A 2JZSA 1S3DA 1FAAA 2CT6A 4G0LA 1GTIA 2YCDA 1FG4A 3KP8A 5GAPD 2WVXA 2FLSA 1GL8A 2FHEA 4MJCA 3HD5A 1R5AA 3LQ7A 2HRKB 2YP6A 2C0DA 3W6GA 4YH2A 1VF2A 6GSWA 3QAGA 1YZXA 1SJIA 3ZIJA 4JR4A 3GUSA 5IMDA 3UVTA 3APQA 1J08A 3ZFLA 1RQMA 4NV5A 1H75A 1O81A 3EU3A 4BA7A 1N8JA 3EMXA 1NHOA 4K6XA 5ABRA 2N5FA 2IFQB 4DEJA 2LSTA 1OC9A 1PKWA 3NIVA 2C4JA 2HLSA 4KA0A 1EGRA 2OT3A 4ACSA 1XG8A 5IOXA 1N25A 2X49A 1TRSA 2VOCA 2R5GA 1FO5A 1O7UA 2YZUA 4JBBA 4JRRA 2WVYA 1HQOA 4TOPA 3FW2A 2FD3A 4I97A 2WW0A 1G6YA 2VO4A 1XBSA 3QAWA 5JWOB 4FQUA 4AF2A 3IAS2 3A5IA 3LSZA 1PGTA 3VLNA 1Y25A 5DALB 2JADA 1TW9A 3P8WA 4D73A 4L0WA 2LNTA 2HZFA 2EIRA 5J47A 4KDYA 2OA7A 4MF5A 4E68A 5D96A 2X64A 1EWXA 2C0EA 3SBCA 1TKDB 2EC4A 3TJJA 3FKFA 4V1Ap 4EC0A 3RPPA 3VI5A 2WDUA 4HZ4A 3JCML 4X43A 3TKSC 4ECJA 1BEDA 4MABA 4TR0A 3ZYWA 3QCPA 3ZVJA 3TGZA 2HSNA 4L5LA 4Z7XA 2VLVA 3IXRA 5A5HA 2KP1A 4GCIA 4F9ZA 4KF9A 2RM5A 2NVLA 1ERUA 1XVWA 1SKRB 2ZCTA 6GSSA 3APOA 4IJ3A 3ZVJD 2O8VB 5C00A 3ZITA 5LCZA 5ECSA 16GSA 4O5RA 1HYUA 1CQGA 1W4VA 4BVXB 3UBKA 3FHKA 4O7HA 1AQVA 4J57E 2H1LA 4MMMA 1YY7A 1F9MA 3P2AA 1THXA 5IIZA 3GYKA 1SJZA 1MDJA 1ERTA 5F0GA 1TU7A 3GL5A 3G9BA 3TJBA 2OBKA 1JLVA 5ECLB 5CREA 1SU9A 1A2JA 3HYPA 5DAKB 2VD1A 3VK9A 3IPZA 1AC1A 3EE2A 3A2XA 4NHWA 2L4QA 1ML6A 3FRCA 2B1LA 1GSQA 3TOUA 2GZZA 4Z2UA 2VD0A 4N0VA 5GAND 1PL2A 2BJXA 4NWYA 1ZMAA 3CSIA 1EP7A 5IO0A 2V6OA 2H6YA 4TW5A 1IYIA 4BWQA 3ERGA 4EXJA 1A2LA 5H5RA 5D73A 3H8QA 3GX8A 4PUAA 6GSTA 3KTLA 3GIXA 3LEFA 3FZ9A 3O6TA 4K9ZA 2MYGA 1V9WA 1HNAA 1EP8A 4O5QA 4YAPA 3TDGA 3QMXA 1PFOA 1WWJA 2AV4A 4D73B 4DVCA 4JZQA 5A34A 1YEWC 4LL4B 4F2IA 1OE8A 4JE1A 4V2NA 2A2PA 2J23A 2UV8G 2V1MA 1O8WA 2E7PA 3EURA 1XXUA 3CRUA 2HQTA 2RUEA 5B8BA 1TDIA 5IMVA 1K0CA 2HT9A 3P90A 4XHMA 2I3YA 1FVKA 2OACA 2F8AA 1M0UA 1TXUA 1OC8A 4EIQA 3LYKA 2P5QA 5IPGA 2AB6A 1OE7A 4DSSB 5DCHA 2VCVA 3TRXA 3IAM2 3TB2A 3KZQA 1K3LA 4OFTA 2LRTA 4XS4B 4RI7A 1AQWA 4POLA 4YAVA 3APSA 4YKFA 5ECHB 4TXOB 5B6NA 4HU7A 3F9UA 1K0NA 2YJ7A 1EV9A 1WP0A 2XPDA 2WZ9A 1EOGA 3MWHA 2YANA 4N11A 1DUGA 1N2AA 3MIXA 4MZWA 3V1WA 2JL4A 2R37A 3D0ZA 1PN0A 2DJJA 2X8CA 3LORA 1V57A 3M0FA 1Z9HA 4L8EA 3ZFBA 1R26A 4IBPA 3F8UA 4MJBA 4KSMA 2HRAA 1YJ6A 4QL9A 4X1UA 2O5VA 2HZEB 1GSDA 2KLXA 4ZB9A 2LJRA 5CRGA 3WGXA 4XS1A 3LG6A 4HJMA 2P31A 4FXYP 2DJ1A 5E59A 2B7JA 3F3QA 2O89A 1T7PB 2L6CA 1B8XA 3FR3A 3A5WA 4AI6A 1WJKA 3EVIA 1T4ZA 1A0FA 2IJYA 3PPUA 5A34B 5CRHA 1VGLA 2RUFA 1MDKA 4NPBA 4NV2A 3LYPA 2OJLA 2H0IA 3C71A 1F2EA 1A8YA 2H75A 4ZIJA 11GSA 2KHPA 2BTOT 2KP2A 3PINA 3WGDA 3RDWA 1I1IP 1K3OA 2HI7A 5EVOA 1WIKA 3DWVA 4KDXA 5HR2A 2MZCA 3LFLA 4HDEA 1XW5A 3TCOA 4ZBDA 2IWTA 1FB0A 4EE0A 1Q4JA 3EMPA 4IN0A 2GVPA 4N0ZA 3GH6A 3A3TA 3QPMA 3RHBA 1MEKA 2D2ZA 4WR4A 4I2TA 4G19A 1LU4A 2EIQA 4EDZA 4RQXA 1YKCA 2LKUA 3RGBC 4XRDA 13GSA 4KDUA 2H19A 1X9SB 1V40A 3DGQA 2X8HA 2E2MA 2J9HA 4WBRD 1FHEA 5ECQB 5KN1A 1ERWA 1SD9A 5IO2A 4G01A 3L78A 2DSAA 1I5GA 4RUVA 1EZKA 2V6KA 4WKWA 3TJKA 3KTBA 1M2AA 4G0KA 5A1NB 4EKZA 2DJ3A 2N5BA 1GSUA 5J4UA 1RK4A 2C3TA 4V2LA 2H70A 4LA1A 4K7IA 4G9HA 4K2DA 2YNXA 4GQCA 1WPIA 1GUMA 4X0XA 1BG1A 4USSA 2IIYA 2CX4A 2O87A 3GKXA 3CHXC 4NHZA 2TRCP 3HJOA 1GSSA 3L9SA 4K7OA 2DIZA 3BCIA 4TR3A 3GURA 4TRXA 4Q5NA 1K0MA 2B1KA 2H76A 3UBLA 3DEXA 2CZ2A 1VF4A 4AJ8A 2VLTA 4KX4A 2DJ2A 2MBTA 1PSQA 5KOXA 1USBA 5DALA 2YN1A 1UA5A 1ERVA 1S3CA 3LXTA 2YPMA 4NXIA 3VWUA 2R0GA 3I69A 3RPNA 4F82A 3H1NA 4OO4A 3WYWA 2FWGA 3HZ8A 4BWSA 2R2JA 4MJAA 4ECIA 1V2AA 3FZ4A 2KOKA 1EGOA 3HY2A 2LTKA 22GSA 1PL1A 1TK0B 2EFHA 3CWGA 2JSZA 4WF4A 1JZRA 3ERFA 1XZOA 2MMAA 4F0BA 5IQYA 1GH2A 4IP1A 5J5NA 4KUNA 1TK8B 5IM9A 2NPBA 2DMLA 4TVEA 5EL8A 2GDRA 4PNFA 2R0PA 2O3EA 4IQAA 2A4VA 3UAPA 3BBYA 4BVXA 4ICYA 1DE2A 1QUWA 3QFBC 1O6JA 3L9UA 1XCCA 2RIIA 4I6XA 1KTEA 3QR6A 5AIVA 1KEBA 3CMIA 1BX9A 1X0RA 4RQRA 3LJRA 1HNBA 5J41A 4I8BA 3O3TA 2LJKA 4Q5FA 2X8GA 1TU8A 2E2GA 5E4WA 1FOVA 2H1GA 9GSSA 2E0QA 2LRNA 2JU5A 4TR1A 4BVYB 2FUG2 1Z6NA 1JZOA 1F3AA 3WD6A 5DAKA 4ULXA 4H86A 1Q98A 2C1YA 3HVSA 4OWYA 1PA3A 1GTAA 4E8HA 1SYRA 5JWRB 4G10A 6GSXA 3ISOA 2WB9A 4HSCX 1SD8A 4BL7B 3GSSA 2H30A 5L71A 2CVBA 5IPHA 4K2XA 1SK2A 3KCMA 5DVBA 1M2BA 1XOBA 3ZREA 10GSA 4Z2TA 1GP1A 5HFIA 2GQMA 3KMOA 4NAXA 3DD3A 1OVNA 5CO3A 3GH9A 5IMCA 3R2QA 5CYYA 2YWMA 2KUCA 3M9JA 5KN3A 3KXOA 1YVLA 3RFRC 2JZTA 5H5SA 2CVKA 2OBIA 3GMFA 5BRTA 4N3ZA 2F51A 4HZ2A 2HNLA 2A2RA 5HR3A 1QK8A 2B5YA 2WW2A 4EO3A 1VRSD 3GRXA 4MNNA 4XTSA 4WF5A 4L5OA 5H5QA 2YWIA 1U6TA 3N9JA 1Z7PA 2H0GA 3VWXA 4DSSA 1RW1A 2RM6A 2QGVA 4XS4A 4MJEA 2R4VA 1NM3A 5EY6A 3U6VA 2DKIA 4KH7A 4TXOA 3J7Yk 3EU4A 2H6ZA 5ECPB 5LD0A 2ON5A 4MCUA 4EF0A 2BMXA 4PQHA 3ZMKA 1LBKA 2O7KA 5J4VA 5AISA 4GSTA 3VWWA 2DLXA 2JACA 3N5OA 2RLIA 1THOA 5B6MA 2VCZA 1OC3A 2L5LA 1TTZA 4K5RA 5ECOB 3C1RA 2JSYA 2OE3A 4TR1B 4KCEA 3UJ1A 4PUFC 1B4QA 2PPTA 5GZZB 4IKHA 1K0OA 1XW9A 5D93A 3PGTA 2QKEA 5KN2A 2H1DA 4WR5A 2HSMB 2I1UA 2HZEA 3UOMA 5DCGA 2R6KA 3LWAA 5ENUA 3I6AA 4WXTA 4PHZC 4I2UA 2HXKA 2YWOA 5J9CA 4TKYA 2DC5A 1GLQA 5F07A 3UIWA 2IL3A 2VL2A 4O32A 2GT5A 3TKPA 3FZAA 2VL3A 2WZSA 2H6XA 4AKIA 4HOJA 2K8SA 3UARA 3GNJA 1OKDA 4V2MA 4IHUA 4K1FA 1AUCA 2H72A 2O36A 1DE1A 2GQLA 1G6WA 3SWLA 6GSYA 3RBTA 2CZ3A 3D21A 2GGTA 3EYTA 3GHAA 1PD21 1MD4A 4OO5A 5A4WA 2VAFA 1BG5A 3DVWA 3D4TA 2L57A 1QXHA 2A2SA 3UEMA 4ZB7A 3L4NA 1WMJA 5CAXA 2VL9A 3WT1A 2AHEA 1XWAA 2PGTA 1OAZA 2OADA 4GQFA 2Z9SA 2CA8A 1GULA 5LNKe 4OFMA 4KE3A 3C1SA 3VPQA 2XBQA 1SENA 1V98A 1ACVA 3GX0A 2ON7A 5HQPA 2LJAA 2K6VA 1W89A 5CRWA 2FWHA 1FVJA 2TIRA 3HVXA 3F63A 3CBUA 1M2DA 1XWBA 1KBNA 2WS2A 2OKAA 3H93A 2GSTA 4N30A 2REMA 3P7XA 4TN8A 5DBQA 2IMFA 3BJ5A 3ZZXA 1YQ1A 2MMOA 3J7Yb 2M72A 1CQHA 2TRXA 1GRXA 2VUPA 4PGTA 4EDYA 1PKZA 4ZL7A 4HQSA 3F4SA 4GSSA 1WE0A 4ID0A 3HA9A 3IC4A 2R0CA 1AXDA 1QGVA 4KCAA 3MAKA 4CY8A 3VFIA 4MZCA 1QMVA 1GTBA 1UN2A 2H71A 5KEJA 3WT2A 3QAVA 1XIYA 2GS3A 2AAWA 5INYA 1J0FA 4JU5A 2M80A 5A1NA 1YKAA 4K7NA 1UVZA 2H8LA 3BCKA 2YV9A 3O76A 3MDKA 1B9YC 2I81A 3F0IA 3IE3A 4AGSA 5GSSA 4CDOA 2NBSA 3IK7A 3DYRA 3L0HA 4KGIA 3A2VA 3G7IA 5GSTA 2K8VA 1Y6EA 3A2WA 4EIPA 4PXOA 1ON4A 2EIOA 3TJGA 4IW9A 1Z7RA 3KH7A 3ZLPA 4X4JA 4F0CA 4YQMA 2PWJA 3OR5A 4LMVA 2WULA 4MZBA 3KH9A 2ZUPA 4POMA 3IA1A 1ZCPA 4QQ7A 1R5PA 4KNDA 2WJUA 4E8EA 2LV3A 3W8SA 2V41A 3KJYA 2PVQA 1PQNA 1U88A 5F8BA 2MMNA 1URMA 2V32A 5JCGA 3LXZA 4KW6A 4JEDA 1NHYA 2P0GA 2L6DA 1YDKA 3C73A 5ECKB 5JCWA 3HZ4A 2V2GA 2B3SA 4XCSA 3D6IA 3F4TA 4WEYA 1TI1A 4LL1B 5ECMB 4QMKA 1ZOFA 3M8NA 2XC2A 1T4YA 8GSSA 5J4YA 3GA4A 2JZRA 3E3EA 2A4HA 2IN3A 2VM1A 2DJKA 4Q5QA 1GSEA 3NOFA 2FNOA 4AKGA 3F4RA 4LLRA 5FHIA 5ECRB 2FWEA 2DKHA 2VM2A 1R4WA 4WBJA 4G0IA 2F8FA 4BVYA 3ZMLA 2FCHA 1GWCA 3MYDA 4P3YB 1JLWA 3CSJA 3FMWA 2I9HA 5A4UA 3TKSE 1A23A 2WW1A 1OYJA 4OFNA 2B5XA 3MSZA 4MP4A 19GSA 1S3RA 1SL1B 1ILOA 2WFCA 4BL7A 1TP9A 1K0AA 4ECCA 1A24A 5G5FA 1DSBA 5DDLA 2C3QA 1A2MA 5FWGA 3S9FA 1PMTA 3IHQA 3KMNA 5ID2B 2XBIA 5D9VA 3M3MA 5ECNB 3DIEA 2PVOC 5COHA 2QSIA 3DVXA 2HYXA 3HCZA 3TU3B 4OD7A 3KP9A 3RHCA 2UZ8A 4IP6A 4ML1A 1R7HA 2NDOA 3ED3A 2R3XA 5KN0A 3G7JA 1BQ7A 2PMTA 3MNGA 4PNGA
chains in the Genus database with same CATH topology
4ZL8A 5HFGA 4I5QA 1NW2A 2CAIA 3EINA 5JCUA 5G2ZA 2GSSA 2MMZA 3IHGA 4GXZA 1GUHA 4AJ7A 2CVDA 2CAQA 3UVHA 2GSRA 1I9DA 1X9WB 4MDCA 1XWGA 2DBCA 3HJPA 2WRTA 1M99A 1A8LA 1G7OA 5F05A 2LNSA 1JZWA 4J2FA 1F6MC 3H79A 3ZIVA 4O92A 3IV4A 2DIYA 4ZBBA 2L59A 3CXGA 2PERA 1JHBA 1EV4A 4N10A 12GSA 2MBSA 4F03A 3VWVA 4ZXGA 3TRQA 1YEXA 2K18A 3QFAC 3HDCA 4HS1A 4FIWA 2C0GA 2LEGA 2HSMA 2H74A 3HXSA 2ES7A 4HQZA 4MPFA 2IPAA 1O85A 3ME8A 5IMZA 3I9V2 2LQOA 1B4PA 4K5SA 2LRCA 1TK5B 5CP1A 4BPYA 1X5DA 4AKXB 1LJRA 4TR4A 1F3BA 3RAZA 1EEMA 1J9BA 2IMKA 3GKMA 2ZNMA 1FW1A 3KEBA 2M46A 1SL0B 3UMAA 2L4CA 1GNWA 1AW9A 2H1AA 2P5RA 3C7MA 4Q5RA 2GZPA 3TKQA 3IR4A 2EFEA 3HMJG 2VL2C 4G2EA 2HRNA 2VIMA 3ZL5A 1SVMA 3ME7A 1SL2B 4POKA 4YQUA 3M1GA 1M9AA 3US3A 1XWCA 3R3EA 1V58A 1YEPA 1MD3A 2VLUA 5B7CA 4MK3A 2HRFA 2QA2A 1U3AA 2XPEA 3GKKA 1VF1A 3E0UA 2AUVA 1BJXA 5F06A 2YZHA 1M9BA 4ILFA 2GZYA 2X4AA 4GF0A 2CX3A 1TRWA 2IMIA 3Q6OA 3FEUA 3TKRA 2G2QA 3IOSA 1T8EB 3ZTLA 2ALBA 4Z2RA 4MH2A 4DSRA 2EFCA 3FYGA 4XS6A 2WCIA 2GSQA 4W66A 4O5UA 1FB6A 1HNCA 1BAYA 6GSVA 1X5EA 3E9JB 3IDVA 3AY8A 1EOHA 2I4AA 4JR6A 4NMUA 4IS0A 4ISDA 1S3AA 2VCTA 5ECIB 4IVFA 4FYCA 5KOWA 5IMAA 3QOUA 3EPTA 1XFLA 2LUSA 5CNWA 3QD9A 2L5OA 1NSWA 2K9FA 2LS5A 1ZYNA 5EPFA 1AAZA 5J40A 5HR1A 2AJQB 5G31A 2B7KA 3GKNA 1QFNA 1GTUA 3HVVA 1EEJA 1OC9B 2GLRA 3IRAA 1AQXA 4ZB6A 1PX7A 1H4OA 1SVLA 1TXXA 3C8EA 1YF1A 14GSA 3Q19A 3K8NA 1TJDA 4MF6A 5A5KA 5ELAA 3BD2A 20GSA 5AGYA 5BMUA 4CW9A 3FK8A 4MF7A 3TKSA 3NZNA 4GSNA 5G1KA 3Q18A 1SJ6A 2C0FA 3I43A 4PQIA 4K8MA 4PX1A 2H73A 4FYUA 5FT3A 3CTFA 4HJ2A 4PQ1A 4GLTA 3TRPA 4YQVA 1ABAA 1JZDA 3TJFA 4IJIA 5G5EA 2OE1A 1UC7A 3F3RA 1Y1UA 1Z6MA 4OMVA 3D5JA 2HSNB 3IK9A 2VCXA 2PU9C 1ZYQB 4KB3A 2AYTA 5A5HB 1WOUA 3VURA 4CHSA 3KIJA 3D4MA 4IQ1A 2HSYA 1X5CA 4MH3A 4LMWA 2HSHA 4HUAA 3D22A 5JWQB 1ZZYA 3FZ5A 4GDFA 3IC8A 17GSA 1YF0A 3DXBA 1GSFA 1K0BA 2DJ0A 2CQ9A 2H66A 1G0TA 4POBA 5D8IA 1TI3A 5G30A 3G7YA 4AJ6A 3PH9A 5DQSA 1T00A 2YWNA 3LW9A 2B5EA 3CSHA 3HHVA 4GTUA 1X9MB 1O8XA 4K0NA 3IBHA 4CY6A 3PR8A 1E2YA 3DKSA 4DSQA 3VPTA 1SYXA 4EVMA 2XHFA 1SKWB 1Z5YE 4FH8A 1U3IA 2O85A 3ERWA 1DBYA 5IMFA 1FOHA 4J56E 1MDIA 4OCEA 1C72A 1T1VA 2PUKC 5BMUB 2FY6A 4GRFA 2DMMA 5ELGA 3M9KA 2F3MA 1SK0A 5ID2A 4HU9A 2FWFA 2IMDA 3KD0A 1OKTA 5D9XA 3QDNA 3GFKA 1AIUA 4TXVA 2FA4A 5D9WA 3W8JA 1GUKA 3BOAA 2HFDA 2C3NA 1QQ2A 2N5AA 2G0FA 1BYEA 5DQYA 3EWLA 3HKRA 2H0HA 3FR9A 1IYHA 5A4VA 2B6MA 1MTCA 1U87A 2QA1A 2HE3A 4HI7A 1GNEA 1XWKA 4FYBA 2GTUA 4RI6A 4XRAA 4YKGA 4A5PA 1G7EA 1XW6A 2F9SA 4GWRA 4ZB8A 3UL3A 3GV1A 5C04A 5IOWA 2VCQA 3GTUA 5DJLA 2GQKA 2PN8A 1KNGA 4QL7A 3F6DA 2WGRA 1M7TA 5CRDA 3CTGA 1O73A 1ST9A 3CYNA 4KSOA 4FO5A 2C80A 4V1Ag 4K0GA 5AN1A 1SKSB 1XVQA 3GL3A 1K0DA 3ZRDA 3TOTA 4ZL9A 1PX6A 2H1BA 1JFUA 5J9BA 5AIXA 5J3RA 2HRKA 4MLYA 5HR0A 1PRXA 3VI7A 2PBJA 3F6FA 5D9TA 4ZILA 3CRTA 1SVOA 1ZL9A 4HEA2 3GSTA 2EFDA 2QC7A 5DJMA 2IFQA 18GSA 1PN9A 2YOIA 1B48A 1E6BA 7GSSA 3FR6A 1ZGNA 2IMEA 4ZBAA 1Z3EA 5G1LA 1HD2A 2YJHA 1A0RP 4WETA 1XPVA 2NTOA 1VF3A 4EL1A 4XIHA 1XOAA 4MA9A 2YV7A 1SK1A 1F37A 2FGXA 1GLPA 4AKHA 3WGEA 3FY7A 1GSYA 2C8UA 4EUYA 2GT6A 2H01A 2VKZG 3KM6A 4PURA 1B9XC 4OCFA 1WRYA 4ML6A 2CV4A 1T3BA 4IELA 2LQQA 3KGKA 3GN3A 4PTSA 3EC3A 3Q74A 1BF5A 4KAEA 3DRNA 3DMLA 3U5RE 2OE0A 3LGCA 4MPGA 1TOFA 4ECBA 1ZYPA 3TUEA 3H4KA 5B8AA 2X99A 3HJMA 4L0UA 1TRUA 1K3YA 1ZYEA 3L9VA 4IGJA 1TRVA 3GTUB 2VCWA 6GSUA 5HFKA 2FA8A 2JZSA 1S3DA 1FAAA 2CT6A 4G0LA 1GTIA 2YCDA 1FG4A 3KP8A 5GAPD 2FLSA 1GL8A 2FHEA 4MJCA 3HD5A 1R5AA 3LQ7A 2HRKB 2YP6A 2C0DA 3W6GA 4YH2A 1VF2A 6GSWA 3QAGA 1YZXA 1SJIA 3ZIJA 4JR4A 3GUSA 5IMDA 3UVTA 3APQA 1J08A 3ZFLA 1RQMA 4NV5A 1H75A 1O81A 3EU3A 4BA7A 1N8JA 3EMXA 1NHOA 4K6XA 5ABRA 2N5FA 2IFQB 4DEJA 2LSTA 1OC9A 1PKWA 3NIVA 2C4JA 2HLSA 4KA0A 1EGRA 2OT3A 4ACSA 5IOXA 1N25A 2X49A 1TRSA 2VOCA 2R5GA 1FO5A 1O7UA 2YZUA 4JBBA 4JRRA 1HQOA 4TOPA 3FW2A 2FD3A 4I97A 1G6YA 2VO4A 1XBSA 3QAWA 5JWOB 4FQUA 4AF2A 3IAS2 3A5IA 3LSZA 1PGTA 3VLNA 1Y25A 5DALB 2JADA 1TW9A 3P8WA 4D73A 4L0WA 2LNTA 2HZFA 2EIRA 5J47A 4KDYA 2OA7A 4MF5A 4E68A 5D96A 2X64A 1EWXA 2C0EA 3SBCA 1TKDB 2EC4A 3TJJA 3FKFA 4V1Ap 4EC0A 3RPPA 3VI5A 2WDUA 4HZ4A 3JCML 4X43A 3TKSC 4ECJA 1BEDA 4MABA 4TR0A 3ZYWA 3QCPA 3ZVJA 3TGZA 2HSNA 4L5LA 4Z7XA 2VLVA 3IXRA 5A5HA 2KP1A 4GCIA 4F9ZA 4KF9A 2RM5A 2NVLA 1ERUA 1XVWA 1SKRB 2ZCTA 6GSSA 3APOA 4IJ3A 3ZVJD 2O8VB 5C00A 3ZITA 5LCZA 5ECSA 16GSA 4O5RA 1HYUA 1CQGA 1W4VA 4BVXB 3UBKA 3FHKA 4O7HA 1AQVA 4J57E 2H1LA 4MMMA 1YY7A 1F9MA 3P2AA 1THXA 5IIZA 3GYKA 1SJZA 1MDJA 1ERTA 5F0GA 1TU7A 3GL5A 3G9BA 3TJBA 2OBKA 1JLVA 5ECLB 5CREA 1SU9A 1A2JA 3HYPA 5DAKB 2VD1A 3VK9A 3IPZA 1AC1A 3EE2A 3A2XA 4NHWA 2L4QA 1ML6A 3FRCA 2B1LA 1GSQA 3TOUA 2GZZA 4Z2UA 2VD0A 4N0VA 5GAND 1PL2A 2BJXA 4NWYA 1ZMAA 3CSIA 1EP7A 5IO0A 2V6OA 2H6YA 4TW5A 1IYIA 4BWQA 3ERGA 4EXJA 1A2LA 5H5RA 5D73A 3H8QA 3GX8A 4PUAA 6GSTA 3KTLA 3GIXA 3LEFA 3FZ9A 3O6TA 4K9ZA 2MYGA 1V9WA 1HNAA 1EP8A 4O5QA 4YAPA 3TDGA 3QMXA 1WWJA 2AV4A 4D73B 4DVCA 4JZQA 5A34A 4LL4B 4F2IA 1OE8A 4JE1A 4V2NA 2A2PA 2J23A 2UV8G 2V1MA 1O8WA 2E7PA 3EURA 1XXUA 3CRUA 2HQTA 2RUEA 5B8BA 1TDIA 5IMVA 1K0CA 2HT9A 3P90A 4XHMA 2I3YA 1FVKA 2OACA 2F8AA 1M0UA 1TXUA 1OC8A 4EIQA 3LYKA 2P5QA 5IPGA 2AB6A 1OE7A 4DSSB 5DCHA 2VCVA 3TRXA 3IAM2 3TB2A 3KZQA 1K3LA 4OFTA 2LRTA 4XS4B 4RI7A 1AQWA 4POLA 4YAVA 3APSA 4YKFA 5ECHB 4TXOB 5B6NA 4HU7A 3F9UA 1K0NA 2YJ7A 1EV9A 1WP0A 2XPDA 2WZ9A 1EOGA 3MWHA 2YANA 4N11A 1DUGA 1N2AA 3MIXA 4MZWA 3V1WA 2JL4A 2R37A 3D0ZA 1PN0A 2DJJA 2X8CA 3LORA 1V57A 3M0FA 1Z9HA 4L8EA 3ZFBA 1R26A 4IBPA 3F8UA 4MJBA 4KSMA 2HRAA 1YJ6A 4QL9A 4X1UA 2O5VA 2HZEB 1GSDA 2KLXA 4ZB9A 2LJRA 5CRGA 3WGXA 4XS1A 3LG6A 4HJMA 2P31A 2DJ1A 5E59A 2B7JA 3F3QA 2O89A 1T7PB 2L6CA 1B8XA 3FR3A 3A5WA 4AI6A 1WJKA 3EVIA 1T4ZA 1A0FA 2IJYA 3PPUA 5A34B 5CRHA 1VGLA 2RUFA 1MDKA 4NPBA 4NV2A 3LYPA 2OJLA 2H0IA 3C71A 1F2EA 1A8YA 2H75A 4ZIJA 11GSA 2KHPA 2BTOT 2KP2A 3PINA 3WGDA 3RDWA 1K3OA 2HI7A 5EVOA 1WIKA 3DWVA 4KDXA 5HR2A 2MZCA 3LFLA 4HDEA 1XW5A 3TCOA 4ZBDA 2IWTA 1FB0A 4EE0A 1Q4JA 3EMPA 4IN0A 2GVPA 4N0ZA 3GH6A 3A3TA 3QPMA 3RHBA 1MEKA 2D2ZA 4WR4A 4I2TA 4G19A 1LU4A 2EIQA 4EDZA 4RQXA 1YKCA 2LKUA 4XRDA 13GSA 4KDUA 2H19A 1X9SB 1V40A 3DGQA 2X8HA 2E2MA 2J9HA 4WBRD 1FHEA 5ECQB 5KN1A 1ERWA 1SD9A 5IO2A 4G01A 3L78A 2DSAA 1I5GA 4RUVA 1EZKA 2V6KA 4WKWA 3TJKA 3KTBA 1M2AA 4G0KA 5A1NB 4EKZA 2DJ3A 2N5BA 1GSUA 5J4UA 1RK4A 2C3TA 4V2LA 2H70A 4LA1A 4K7IA 4G9HA 4K2DA 2YNXA 4GQCA 1WPIA 1GUMA 4X0XA 1BG1A 4USSA 2IIYA 2CX4A 2O87A 3GKXA 4NHZA 2TRCP 3HJOA 1GSSA 3L9SA 4K7OA 2DIZA 3BCIA 4TR3A 3GURA 4TRXA 4Q5NA 1K0MA 2B1KA 2H76A 3UBLA 3DEXA 2CZ2A 1VF4A 4AJ8A 2VLTA 4KX4A 2DJ2A 2MBTA 1PSQA 5KOXA 1USBA 5DALA 2YN1A 1UA5A 1ERVA 1S3CA 3LXTA 2YPMA 4NXIA 3VWUA 2R0GA 3I69A 3RPNA 4F82A 3H1NA 4OO4A 3WYWA 2FWGA 3HZ8A 4BWSA 2R2JA 4MJAA 4ECIA 1V2AA 3FZ4A 2KOKA 1EGOA 3HY2A 2LTKA 22GSA 1PL1A 1TK0B 2EFHA 3CWGA 2JSZA 4WF4A 1JZRA 3ERFA 1XZOA 2MMAA 4F0BA 5IQYA 1GH2A 4IP1A 5J5NA 4KUNA 1TK8B 5IM9A 2NPBA 2DMLA 4TVEA 5EL8A 2GDRA 4PNFA 2R0PA 4IQAA 2A4VA 3UAPA 3BBYA 4BVXA 4ICYA 1DE2A 1QUWA 3QFBC 1O6JA 3L9UA 1XCCA 2RIIA 4I6XA 1KTEA 3QR6A 5AIVA 1KEBA 3CMIA 1BX9A 1X0RA 4RQRA 3LJRA 1HNBA 5J41A 4I8BA 3O3TA 2LJKA 4Q5FA 2X8GA 1TU8A 2E2GA 5E4WA 1FOVA 2H1GA 9GSSA 2E0QA 2LRNA 2JU5A 4TR1A 4BVYB 2FUG2 1Z6NA 1JZOA 1F3AA 3WD6A 5DAKA 4ULXA 4H86A 1Q98A 2C1YA 3HVSA 4OWYA 1PA3A 1GTAA 4E8HA 1SYRA 5JWRB 4G10A 6GSXA 3ISOA 2WB9A 1SD8A 4BL7B 3GSSA 2H30A 5L71A 2CVBA 5IPHA 4K2XA 1SK2A 3KCMA 5DVBA 1M2BA 1XOBA 3ZREA 10GSA 4Z2TA 1GP1A 5HFIA 2GQMA 3KMOA 4NAXA 3DD3A 1OVNA 5CO3A 3GH9A 5IMCA 3R2QA 5CYYA 2YWMA 2KUCA 3M9JA 5KN3A 3KXOA 1YVLA 2JZTA 5H5SA 2CVKA 2OBIA 3GMFA 5BRTA 4N3ZA 2F51A 4HZ2A 2HNLA 2A2RA 5HR3A 1QK8A 2B5YA 4EO3A 1VRSD 3GRXA 4MNNA 4XTSA 4WF5A 4L5OA 5H5QA 2YWIA 1U6TA 3N9JA 1Z7PA 2H0GA 3VWXA 4DSSA 1RW1A 2RM6A 2QGVA 4XS4A 4MJEA 2R4VA 1NM3A 5EY6A 3U6VA 2DKIA 4KH7A 4TXOA 3J7Yk 3EU4A 2H6ZA 5ECPB 5LD0A 2ON5A 4MCUA 4EF0A 2BMXA 4PQHA 3ZMKA 1LBKA 2O7KA 5J4VA 5AISA 4GSTA 3VWWA 2DLXA 2JACA 3N5OA 2RLIA 1THOA 5B6MA 2VCZA 1OC3A 2L5LA 1TTZA 4K5RA 5ECOB 3C1RA 2JSYA 2OE3A 4TR1B 4KCEA 3UJ1A 4PUFC 1B4QA 2PPTA 5GZZB 4IKHA 1K0OA 1XW9A 5D93A 3PGTA 2QKEA 5KN2A 2H1DA 4WR5A 2HSMB 2I1UA 2HZEA 3UOMA 5DCGA 2R6KA 3LWAA 5ENUA 3I6AA 4WXTA 4I2UA 2HXKA 2YWOA 5J9CA 4TKYA 2DC5A 1GLQA 5F07A 3UIWA 2IL3A 2VL2A 4O32A 2GT5A 3TKPA 3FZAA 2VL3A 2H6XA 4AKIA 4HOJA 2K8SA 3UARA 3GNJA 1OKDA 4V2MA 4IHUA 4K1FA 1AUCA 2H72A 1DE1A 2GQLA 1G6WA 3SWLA 6GSYA 3RBTA 2CZ3A 3D21A 2GGTA 3EYTA 3GHAA 1PD21 1MD4A 4OO5A 5A4WA 2VAFA 1BG5A 3DVWA 3D4TA 2L57A 1QXHA 2A2SA 3UEMA 4ZB7A 3L4NA 1WMJA 5CAXA 2VL9A 3WT1A 2AHEA 1XWAA 2PGTA 1OAZA 2OADA 4GQFA 2Z9SA 2CA8A 1GULA 5LNKe 4OFMA 4KE3A 3C1SA 3VPQA 2XBQA 1SENA 1V98A 1ACVA 3GX0A 2ON7A 5HQPA 2LJAA 2K6VA 1W89A 5CRWA 2FWHA 1FVJA 2TIRA 3HVXA 3F63A 3CBUA 1M2DA 1XWBA 1KBNA 2WS2A 2OKAA 3H93A 2GSTA 4N30A 2REMA 3P7XA 4TN8A 5DBQA 2IMFA 3BJ5A 3ZZXA 1YQ1A 2MMOA 3J7Yb 2M72A 1CQHA 2TRXA 1GRXA 2VUPA 4PGTA 4EDYA 1PKZA 4ZL7A 4HQSA 3F4SA 4GSSA 1WE0A 4ID0A 3HA9A 3IC4A 2R0CA 1AXDA 1QGVA 4KCAA 3MAKA 4CY8A 3VFIA 4MZCA 1QMVA 1GTBA 1UN2A 2H71A 5KEJA 3WT2A 3QAVA 1XIYA 2GS3A 2AAWA 5INYA 1J0FA 4JU5A 2M80A 5A1NA 1YKAA 4K7NA 1UVZA 2H8LA 3BCKA 2YV9A 3O76A 3MDKA 1B9YC 2I81A 3F0IA 3IE3A 4AGSA 5GSSA 4CDOA 2NBSA 3IK7A 3DYRA 3L0HA 4KGIA 3A2VA 3G7IA 5GSTA 2K8VA 1Y6EA 3A2WA 4EIPA 4PXOA 1ON4A 2EIOA 3TJGA 4IW9A 1Z7RA 3KH7A 3ZLPA 4X4JA 4F0CA 4YQMA 2PWJA 3OR5A 4LMVA 2WULA 4MZBA 3KH9A 2ZUPA 4POMA 3IA1A 1ZCPA 4QQ7A 1R5PA 4KNDA 2WJUA 4E8EA 2LV3A 3W8SA 2V41A 3KJYA 2PVQA 1PQNA 1U88A 5F8BA 2MMNA 1URMA 2V32A 5JCGA 3LXZA 4KW6A 4JEDA 1NHYA 2P0GA 2L6DA 1YDKA 3C73A 5ECKB 5JCWA 3HZ4A 2V2GA 2B3SA 4XCSA 3D6IA 3F4TA 4WEYA 1TI1A 4LL1B 5ECMB 4QMKA 1ZOFA 3M8NA 2XC2A 1T4YA 8GSSA 5J4YA 3GA4A 2JZRA 3E3EA 2A4HA 2IN3A 2VM1A 2DJKA 4Q5QA 1GSEA 3NOFA 2FNOA 4AKGA 3F4RA 4LLRA 5FHIA 5ECRB 2FWEA 2DKHA 2VM2A 1R4WA 4WBJA 4G0IA 2F8FA 4BVYA 3ZMLA 2FCHA 1GWCA 3MYDA 4P3YB 1JLWA 3CSJA 3FMWA 2I9HA 5A4UA 3TKSE 1A23A 1OYJA 4OFNA 2B5XA 3MSZA 4MP4A 19GSA 1SL1B 1ILOA 2WFCA 4BL7A 1TP9A 1K0AA 4ECCA 1A24A 5G5FA 1DSBA 5DDLA 2C3QA 1A2MA 5FWGA 3S9FA 1PMTA 3IHQA 3KMNA 5ID2B 2XBIA 5D9VA 3M3MA 5ECNB 3DIEA 2PVOC 5COHA 2QSIA 3DVXA 2HYXA 3HCZA 3TU3B 4OD7A 3KP9A 3RHCA 2UZ8A 4IP6A 4ML1A 1R7HA 2NDOA 3ED3A 2R3XA 5KN0A 3G7JA 1BQ7A 2PMTA 3MNGA 4PNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZL8 A;  5HFG A;  4I5Q A;  1NW2 A;  2CAI A;  3EIN A;  5JCU A;  5G2Z A;  2GSS A;  2MMZ A;  4GXZ A;  1GUH A;  4AJ7 A;  2CVD A;  2CAQ A;  3UVH A;  2GSR A;  1I9D A;  1X9W B;  4MDC A;  1XWG A;  2DBC A;  3HJP A;  2WRT A;  1M99 A;  1A8L A;  1G7O A;  5F05 A;  2LNS A;  1JZW A;  4J2F A;  1F6M C;  3H79 A;  3ZIV A;  4O92 A;  3IV4 A;  2DIY A;  4ZBB A;  2L59 A;  3CXG A;  2PER A;  1JHB A;  1EV4 A;  4N10 A;  12GS A;  2MBS A;  4F03 A;  3VWV A;  4ZXG A;  3TRQ A;  1YEX A;  2K18 A;  3QFA C;  3HDC A;  4HS1 A;  4FIW A;  2C0G A;  2LEG A;  2HSM A;  2H74 A;  3HXS A;  2ES7 A;  4HQZ A;  4MPF A;  2IPA A;  1O85 A;  3ME8 A;  5IMZ A;  3I9V 2;  2LQO A;  1B4P A;  2LRC A;  1TK5 B;  5CP1 A;  4BPY A;  1X5D A;  1LJR A;  4TR4 A;  1F3B A;  3RAZ A;  1EEM A;  1J9B A;  2IMK A;  3GKM A;  2ZNM A;  1FW1 A;  3KEB A;  2M46 A;  1SL0 B;  3UMA A;  2L4C A;  1GNW A;  1AW9 A;  2H1A A;  2P5R A;  3C7M A;  4Q5R A;  2GZP A;  3TKQ A;  3IR4 A;  2VL2 C;  4G2E A;  2HRN A;  2VIM A;  3ZL5 A;  3ME7 A;  1SL2 B;  4POK A;  4YQU A;  3M1G A;  1M9A A;  3US3 A;  1XWC A;  3R3E A;  1V58 A;  1YEP A;  1MD3 A;  2VLU A;  5B7C A;  4MK3 A;  2HRF A;  1U3A A;  2XPE A;  3GKK A;  1VF1 A;  3E0U A;  2AUV A;  1BJX A;  5F06 A;  2YZH A;  1M9B A;  4ILF A;  2GZY A;  4GF0 A;  2CX3 A;  1TRW A;  2IMI A;  3Q6O A;  3FEU A;  3TKR A;  2G2Q A;  3IOS A;  1T8E B;  3ZTL A;  2ALB A;  4MH2 A;  4DSR A;  3FYG A;  4XS6 A;  2WCI A;  2GSQ A;  1FB6 A;  1HNC A;  1BAY A;  6GSV A;  1X5E A;  3E9J B;  3IDV A;  3AY8 A;  1EOH A;  2I4A A;  4JR6 A;  4NMU A;  4IS0 A;  4ISD A;  1S3A A;  2VCT A;  5ECI B;  4IVF A;  4FYC A;  5IMA A;  3QOU A;  1XFL A;  2LUS A;  5CNW A;  3QD9 A;  2L5O A;  1NSW A;  2K9F A;  2LS5 A;  5EPF A;  1AAZ A;  2AJQ B;  5HR1 A;  5G31 A;  2B7K A;  3GKN A;  1QFN A;  1GTU A;  3HVV A;  1EEJ A;  1OC9 B;  2GLR A;  3IRA A;  1AQX A;  4ZB6 A;  1PX7 A;  1H4O A;  1TXX A;  3C8E A;  1YF1 A;  14GS A;  3Q19 A;  3K8N A;  1TJD A;  4MF6 A;  5A5K A;  5ELA A;  3BD2 A;  20GS A;  5AGY A;  5BMU A;  4CW9 A;  3FK8 A;  4MF7 A;  3TKS A;  3NZN A;  4GSN A;  5G1K A;  3Q18 A;  1SJ6 A;  2C0F A;  3I43 A;  4PQI A;  4K8M A;  4PX1 A;  2H73 A;  4FYU A;  5FT3 A;  3CTF A;  4HJ2 A;  4PQ1 A;  4GLT A;  3TRP A;  4YQV A;  1ABA A;  1JZD A;  3TJF A;  4IJI A;  5G5E A;  2OE1 A;  1UC7 A;  3F3R A;  1Z6M A;  4OMV A;  3D5J A;  2HSN B;  3IK9 A;  2VCX A;  2PU9 C;  1ZYQ B;  4KB3 A;  2AYT A;  1WOU A;  3VUR A;  4CHS A;  3KIJ A;  3D4M A;  4IQ1 A;  2HSY A;  1X5C A;  4MH3 A;  4LMW A;  2HSH A;  4HUA A;  3D22 A;  5JWQ B;  1ZZY A;  3FZ5 A;  3IC8 A;  17GS A;  1YF0 A;  3DXB A;  1GSF A;  1K0B A;  2DJ0 A;  2CQ9 A;  2H66 A;  1G0T A;  4POB A;  5D8I A;  1TI3 A;  5G30 A;  3G7Y A;  4AJ6 A;  3PH9 A;  5DQS A;  1T00 A;  2YWN A;  2B5E A;  3CSH A;  3HHV A;  4GTU A;  1X9M B;  1O8X A;  4K0N A;  3IBH A;  3PR8 A;  1E2Y A;  3DKS A;  4DSQ A;  3VPT A;  1SYX A;  4EVM A;  2XHF A;  1SKW B;  1Z5Y E;  4FH8 A;  1U3I A;  2O85 A;  3ERW A;  1DBY A;  5IMF A;  4J56 E;  1MDI A;  4OCE A;  1C72 A;  1T1V A;  2PUK C;  2FY6 A;  4GRF A;  2DMM A;  5ELG A;  3M9K A;  2F3M A;  1SK0 A;  5ID2 A;  4HU9 A;  2FWF A;  2IMD A;  3KD0 A;  1OKT A;  5D9X A;  3QDN A;  3GFK A;  1AIU A;  4TXV A;  2FA4 A;  5D9W A;  3W8J A;  1GUK A;  3BOA A;  2HFD A;  2C3N A;  1QQ2 A;  2N5A A;  2G0F A;  1BYE A;  5DQY A;  3EWL A;  3HKR A;  2H0H A;  3FR9 A;  1IYH A;  5A4V A;  2B6M A;  1MTC A;  1U87 A;  2HE3 A;  4HI7 A;  1GNE A;  1XWK A;  4FYB A;  2GTU A;  4RI6 A;  4XRA A;  1G7E A;  1XW6 A;  2F9S A;  4GWR A;  4ZB8 A;  3UL3 A;  3GV1 A;  5C04 A;  5IOW A;  2VCQ A;  3GTU A;  5DJL A;  2GQK A;  2PN8 A;  1KNG A;  4QL7 A;  3F6D A;  2WGR A;  1M7T A;  5CRD A;  3CTG A;  1O73 A;  1ST9 A;  3CYN A;  4KSO A;  4FO5 A;  2C80 A;  4V1A g;  4K0G A;  5AN1 A;  1SKS B;  1XVQ A;  3GL3 A;  1K0D A;  3ZRD A;  3TOT A;  4ZL9 A;  1PX6 A;  2H1B A;  1JFU A;  5J9B A;  5AIX A;  5J3R A;  2HRK A;  4MLY A;  5HR0 A;  1PRX A;  3VI7 A;  2PBJ A;  3F6F A;  5D9T A;  4ZIL A;  3CRT A;  1ZL9 A;  4HEA 2;  3GST A;  2QC7 A;  5DJM A;  2IFQ A;  18GS A;  1PN9 A;  2YOI A;  1B48 A;  1E6B A;  7GSS A;  3FR6 A;  1ZGN A;  2IME A;  4ZBA A;  1Z3E A;  5G1L A;  1HD2 A;  2YJH A;  1A0R P;  4WET A;  1XPV A;  2NTO A;  1VF3 A;  4EL1 A;  4XIH A;  1XOA A;  4MA9 A;  2YV7 A;  1SK1 A;  1F37 A;  2FGX A;  1GLP A;  3WGE A;  3FY7 A;  1GSY A;  2C8U A;  4EUY A;  2GT6 A;  2H01 A;  3KM6 A;  4PUR A;  1B9X C;  4OCF A;  1WRY A;  4ML6 A;  2CV4 A;  1T3B A;  4IEL A;  2LQQ A;  3KGK A;  3GN3 A;  4PTS A;  3EC3 A;  3Q74 A;  4KAE A;  3DRN A;  3DML A;  3U5R E;  2OE0 A;  3LGC A;  4MPG A;  1TOF A;  4ECB A;  3TUE A;  3H4K A;  5B8A A;  2X99 A;  3HJM A;  4L0U A;  1TRU A;  1K3Y A;  1ZYE A;  3L9V A;  4IGJ A;  1TRV A;  3GTU B;  2VCW A;  6GSU A;  5HFK A;  2FA8 A;  2JZS A;  1S3D A;  1FAA A;  2CT6 A;  4G0L A;  1GTI A;  2YCD A;  1FG4 A;  3KP8 A;  5GAP D;  2FLS A;  1GL8 A;  2FHE A;  4MJC A;  3HD5 A;  1R5A A;  3LQ7 A;  2HRK B;  2YP6 A;  2C0D A;  3W6G A;  4YH2 A;  1VF2 A;  6GSW A;  3QAG A;  1YZX A;  1SJI A;  3ZIJ A;  4JR4 A;  3GUS A;  5IMD A;  3UVT A;  3APQ A;  1J08 A;  3ZFL A;  1RQM A;  4NV5 A;  1H75 A;  1O81 A;  3EU3 A;  4BA7 A;  1N8J A;  3EMX A;  1NHO A;  4K6X A;  5ABR A;  2N5F A;  2IFQ B;  4DEJ A;  2LST A;  1OC9 A;  1PKW A;  3NIV A;  2C4J A;  2HLS A;  4KA0 A;  1EGR A;  4ACS A;  5IOX A;  1TRS A;  2VOC A;  2R5G A;  1FO5 A;  1O7U A;  2YZU A;  4JBB A;  4JRR A;  1HQO A;  4TOP A;  3FW2 A;  2FD3 A;  4I97 A;  1G6Y A;  2VO4 A;  1XBS A;  3QAW A;  5JWO B;  4FQU A;  4AF2 A;  3IAS 2;  3LSZ A;  1PGT A;  3VLN A;  1Y25 A;  5DAL B;  2JAD A;  1TW9 A;  3P8W A;  4D73 A;  4L0W A;  2LNT A;  2HZF A;  2EIR A;  4KDY A;  2OA7 A;  4MF5 A;  5D96 A;  2X64 A;  1EWX A;  2C0E A;  3SBC A;  1TKD B;  2EC4 A;  3TJJ A;  3FKF A;  4V1A p;  4EC0 A;  3RPP A;  3VI5 A;  2WDU A;  4HZ4 A;  3JCM L;  4X43 A;  3TKS C;  4ECJ A;  1BED A;  4MAB A;  4TR0 A;  3ZYW A;  3QCP A;  3ZVJ A;  3TGZ A;  4L5L A;  4Z7X A;  2VLV A;  3IXR A;  2KP1 A;  4GCI A;  4F9Z A;  4KF9 A;  2RM5 A;  2NVL A;  1ERU A;  1XVW A;  1SKR B;  2ZCT A;  6GSS A;  3APO A;  4IJ3 A;  3ZVJ D;  2O8V B;  5C00 A;  3ZIT A;  5LCZ A;  5ECS A;  16GS A;  4O5R A;  1HYU A;  1CQG A;  1W4V A;  4BVX B;  3UBK A;  3FHK A;  4O7H A;  1AQV A;  4J57 E;  4MMM A;  1YY7 A;  1F9M A;  3P2A A;  1THX A;  5IIZ A;  3GYK A;  1SJZ A;  1MDJ A;  1ERT A;  5F0G A;  1TU7 A;  3GL5 A;  3G9B A;  3TJB A;  2OBK A;  1JLV A;  5ECL B;  5CRE A;  1SU9 A;  1A2J A;  3HYP A;  5DAK B;  2VD1 A;  3VK9 A;  3IPZ A;  1AC1 A;  3EE2 A;  3A2X A;  4NHW A;  2L4Q A;  1ML6 A;  3FRC A;  2B1L A;  1GSQ A;  3TOU A;  2GZZ A;  2VD0 A;  4N0V A;  5GAN D;  1PL2 A;  2BJX A;  4NWY A;  1ZMA A;  3CSI A;  1EP7 A;  5IO0 A;  2V6O A;  2H6Y A;  4TW5 A;  1IYI A;  4BWQ A;  3ERG A;  4EXJ A;  1A2L A;  5H5R A;  5D73 A;  3H8Q A;  3GX8 A;  4PUA A;  6GST A;  3KTL A;  3GIX A;  3LEF A;  3FZ9 A;  3O6T A;  4K9Z A;  2MYG A;  1V9W A;  1HNA A;  1EP8 A;  4YAP A;  3TDG A;  3QMX A;  1WWJ A;  2AV4 A;  4D73 B;  4DVC A;  4JZQ A;  4LL4 B;  4F2I A;  1OE8 A;  4JE1 A;  4V2N A;  2J23 A;  2V1M A;  1O8W A;  2E7P A;  3EUR A;  1XXU A;  3CRU A;  2HQT A;  2RUE A;  5B8B A;  1TDI A;  5IMV A;  1K0C A;  2HT9 A;  3P90 A;  4XHM A;  2I3Y A;  1FVK A;  2OAC A;  2F8A A;  1M0U A;  1OC8 A;  3LYK A;  2P5Q A;  5IPG A;  2AB6 A;  1OE7 A;  4DSS B;  5DCH A;  2VCV A;  3TRX A;  3IAM 2;  3TB2 A;  3KZQ A;  1K3L A;  4OFT A;  2LRT A;  4XS4 B;  4RI7 A;  1AQW A;  4POL A;  4YAV A;  3APS A;  5B6N A;  5ECH B;  4TXO B;  4HU7 A;  3F9U A;  1K0N A;  2YJ7 A;  1EV9 A;  1WP0 A;  2XPD A;  2WZ9 A;  1EOG A;  3MWH A;  2YAN A;  4N11 A;  1DUG A;  1N2A A;  4MZW A;  3V1W A;  2JL4 A;  2R37 A;  3D0Z A;  2DJJ A;  2X8C A;  3LOR A;  1V57 A;  3M0F A;  1Z9H A;  4L8E A;  3ZFB A;  1R26 A;  4IBP A;  3F8U A;  4MJB A;  4KSM A;  2HRA A;  1YJ6 A;  4QL9 A;  4X1U A;  2HZE B;  1GSD A;  2KLX A;  4ZB9 A;  2LJR A;  5CRG A;  3WGX A;  4XS1 A;  3LG6 A;  4HJM A;  2P31 A;  2DJ1 A;  5E59 A;  2B7J A;  3F3Q A;  2O89 A;  1T7P B;  2L6C A;  1B8X A;  3FR3 A;  3A5W A;  1WJK A;  3EVI A;  1T4Z A;  1A0F A;  2IJY A;  3PPU A;  5CRH A;  1VGL A;  2RUF A;  1MDK A;  4NPB A;  4NV2 A;  3LYP A;  2OJL A;  2H0I A;  3C71 A;  1F2E A;  1A8Y A;  2H75 A;  4ZIJ A;  11GS A;  2KHP A;  2BTO T;  2KP2 A;  3PIN A;  3WGD A;  3RDW A;  1K3O A;  2HI7 A;  5EVO A;  1WIK A;  3DWV A;  4KDX A;  5HR2 A;  2MZC A;  3LFL A;  4HDE A;  1XW5 A;  3TCO A;  4ZBD A;  2IWT A;  1FB0 A;  4EE0 A;  1Q4J A;  3EMP A;  4IN0 A;  2GVP A;  4N0Z A;  3GH6 A;  3A3T A;  3QPM A;  3RHB A;  1MEK A;  2D2Z A;  4WR4 A;  4I2T A;  4G19 A;  1LU4 A;  2EIQ A;  4EDZ A;  4RQX A;  1YKC A;  2LKU A;  4XRD A;  13GS A;  4KDU A;  2H19 A;  1X9S B;  1V40 A;  3DGQ A;  2X8H A;  2E2M A;  2J9H A;  4WBR D;  1FHE A;  5ECQ B;  5KN1 A;  1ERW A;  1SD9 A;  5IO2 A;  3L78 A;  2DSA A;  1I5G A;  4RUV A;  1EZK A;  2V6K A;  4WKW A;  3TJK A;  3KTB A;  1M2A A;  4G0K A;  4EKZ A;  2DJ3 A;  2N5B A;  1GSU A;  5J4U A;  1RK4 A;  2C3T A;  4V2L A;  2H70 A;  4LA1 A;  4K7I A;  4G9H A;  4K2D A;  2YNX A;  4GQC A;  1WPI A;  1GUM A;  4X0X A;  2IIY A;  4USS A;  2CX4 A;  2O87 A;  3GKX A;  4NHZ A;  2TRC P;  3HJO A;  1GSS A;  3L9S A;  4K7O A;  2DIZ A;  3BCI A;  4TR3 A;  3GUR A;  4TRX A;  4Q5N A;  1K0M A;  2B1K A;  2H76 A;  3UBL A;  3DEX A;  2CZ2 A;  1VF4 A;  4AJ8 A;  2VLT A;  4KX4 A;  2DJ2 A;  2MBT A;  1PSQ A;  1USB A;  5DAL A;  2YN1 A;  1UA5 A;  1ERV A;  1S3C A;  3LXT A;  2YPM A;  4NXI A;  3VWU A;  3I69 A;  3RPN A;  4F82 A;  3H1N A;  4OO4 A;  3WYW A;  2FWG A;  3HZ8 A;  4BWS A;  2R2J A;  4MJA A;  4ECI A;  1V2A A;  3FZ4 A;  2KOK A;  1EGO A;  3HY2 A;  2LTK A;  22GS A;  1PL1 A;  1TK0 B;  2JSZ A;  4WF4 A;  1JZR A;  3ERF A;  1XZO A;  2MMA A;  4F0B A;  5IQY A;  1GH2 A;  4IP1 A;  5J5N A;  4KUN A;  1TK8 B;  5IM9 A;  2NPB A;  2DML A;  4TVE A;  5EL8 A;  2GDR A;  4PNF A;  4IQA A;  2A4V A;  3UAP A;  3BBY A;  4BVX A;  1DE2 A;  1QUW A;  3QFB C;  1O6J A;  3L9U A;  1XCC A;  2RII A;  4I6X A;  1KTE A;  3QR6 A;  5AIV A;  1KEB A;  3CMI A;  1BX9 A;  1X0R A;  4RQR A;  3LJR A;  1HNB A;  5J41 A;  4I8B A;  3O3T A;  2LJK A;  4Q5F A;  2X8G A;  1TU8 A;  2E2G A;  5E4W A;  1FOV A;  2H1G A;  9GSS A;  2E0Q A;  2LRN A;  2JU5 A;  4TR1 A;  4BVY B;  2FUG 2;  1Z6N A;  1JZO A;  1F3A A;  3WD6 A;  5DAK A;  4ULX A;  4H86 A;  1Q98 A;  2C1Y A;  3HVS A;  4OWY A;  1PA3 A;  1GTA A;  4E8H A;  1SYR A;  5JWR B;  4G10 A;  6GSX A;  3ISO A;  2WB9 A;  1SD8 A;  4BL7 B;  3GSS A;  2H30 A;  5L71 A;  2CVB A;  5IPH A;  1SK2 A;  3KCM A;  5DVB A;  1M2B A;  1XOB A;  3ZRE A;  10GS A;  1GP1 A;  5HFI A;  2GQM A;  3KMO A;  4NAX A;  3DD3 A;  1OVN A;  5CO3 A;  3GH9 A;  5IMC A;  3R2Q A;  5CYY A;  2YWM A;  2KUC A;  3M9J A;  5KN3 A;  3KXO A;  2JZT A;  5H5S A;  2CVK A;  2OBI A;  3GMF A;  2F51 A;  4HZ2 A;  2HNL A;  2A2R A;  5HR3 A;  1QK8 A;  2B5Y A;  4EO3 A;  1VRS D;  3GRX A;  4XTS A;  4WF5 A;  4L5O A;  5H5Q A;  2YWI A;  1U6T A;  3N9J A;  1Z7P A;  2H0G A;  3VWX A;  4DSS A;  1RW1 A;  2RM6 A;  2QGV A;  4XS4 A;  4MJE A;  2R4V A;  1NM3 A;  5EY6 A;  3U6V A;  4KH7 A;  4TXO A;  3J7Y k;  3EU4 A;  2H6Z A;  5ECP B;  5LD0 A;  2ON5 A;  4MCU A;  4EF0 A;  2BMX A;  4PQH A;  3ZMK A;  1LBK A;  2O7K A;  5AIS A;  4GST A;  3VWW A;  2DLX A;  2JAC A;  3N5O A;  2RLI A;  1THO A;  5B6M A;  2VCZ A;  1OC3 A;  2L5L A;  1TTZ A;  5ECO B;  3C1R A;  2JSY A;  2OE3 A;  4TR1 B;  4KCE A;  3UJ1 A;  4PUF C;  1B4Q A;  2PPT A;  5GZZ B;  4IKH A;  1K0O A;  1XW9 A;  5D93 A;  3PGT A;  2QKE A;  5KN2 A;  2H1D A;  4WR5 A;  2HSM B;  2I1U A;  2HZE A;  3UOM A;  5DCG A;  2R6K A;  3LWA A;  5ENU A;  3I6A A;  4WXT A;  4I2U A;  2HXK A;  2YWO A;  5J9C A;  4TKY A;  2DC5 A;  1GLQ A;  5F07 A;  3UIW A;  2IL3 A;  2VL2 A;  4O32 A;  2GT5 A;  3TKP A;  3FZA A;  2VL3 A;  2H6X A;  4HOJ A;  2K8S A;  3UAR A;  3GNJ A;  1OKD A;  4V2M A;  4IHU A;  4K1F A;  1AUC A;  2H72 A;  1DE1 A;  2GQL A;  1G6W A;  3SWL A;  6GSY A;  3RBT A;  2CZ3 A;  3D21 A;  2GGT A;  3EYT A;  3GHA A;  1PD2 1;  1MD4 A;  4OO5 A;  5A4W A;  2VAF A;  1BG5 A;  3DVW A;  3D4T A;  2L57 A;  1QXH A;  2A2S A;  3UEM A;  3L4N A;  1WMJ A;  5CAX A;  2VL9 A;  3WT1 A;  2AHE A;  1XWA A;  2PGT A;  1OAZ A;  2OAD A;  4GQF A;  2Z9S A;  2CA8 A;  1GUL A;  5LNK e;  4OFM A;  4KE3 A;  3C1S A;  3VPQ A;  2XBQ A;  1SEN A;  1V98 A;  1ACV A;  3GX0 A;  2ON7 A;  5HQP A;  2LJA A;  2K6V A;  1W89 A;  5CRW A;  2FWH A;  1FVJ A;  2TIR A;  3HVX A;  3F63 A;  3CBU A;  1M2D A;  1XWB A;  1KBN A;  2WS2 A;  2OKA A;  3H93 A;  2GST A;  4N30 A;  2REM A;  3P7X A;  4TN8 A;  5DBQ A;  2IMF A;  3BJ5 A;  3ZZX A;  1YQ1 A;  2MMO A;  3J7Y b;  2M72 A;  1CQH A;  2TRX A;  1GRX A;  2VUP A;  4PGT A;  4EDY A;  1PKZ A;  4ZL7 A;  4HQS A;  3F4S A;  4GSS A;  1WE0 A;  4ID0 A;  3HA9 A;  3IC4 A;  1AXD A;  1QGV A;  4KCA A;  3MAK A;  3VFI A;  4MZC A;  1QMV A;  1GTB A;  1UN2 A;  2H71 A;  5KEJ A;  3WT2 A;  3QAV A;  1XIY A;  2GS3 A;  2AAW A;  5INY A;  1J0F A;  4JU5 A;  2M80 A;  1YKA A;  4K7N A;  1UVZ A;  2H8L A;  3BCK A;  2YV9 A;  3O76 A;  3MDK A;  1B9Y C;  2I81 A;  3F0I A;  3IE3 A;  4AGS A;  5GSS A;  4CDO A;  2NBS A;  3IK7 A;  3DYR A;  3L0H A;  4KGI A;  3A2V A;  3G7I A;  5GST A;  2K8V A;  1Y6E A;  3A2W A;  4PXO A;  1ON4 A;  2EIO A;  3TJG A;  4IW9 A;  1Z7R A;  3KH7 A;  3ZLP A;  4F0C A;  4YQM A;  2PWJ A;  3OR5 A;  4LMV A;  2WUL A;  4MZB A;  3KH9 A;  2ZUP A;  4POM A;  3IA1 A;  1ZCP A;  4QQ7 A;  1R5P A;  4KND A;  2WJU A;  4E8E A;  2LV3 A;  3W8S A;  2V41 A;  3KJY A;  2PVQ A;  1PQN A;  1U88 A;  5F8B A;  2MMN A;  1URM A;  2V32 A;  5JCG A;  3LXZ A;  4KW6 A;  4JED A;  1NHY A;  2P0G A;  2L6D A;  1YDK A;  3C73 A;  5ECK B;  5JCW A;  3HZ4 A;  2V2G A;  2B3S A;  4XCS A;  3D6I A;  3F4T A;  4WEY A;  1TI1 A;  4LL1 B;  5ECM B;  1ZOF A;  3M8N A;  2XC2 A;  1T4Y A;  8GSS A;  3GA4 A;  2JZR A;  3E3E A;  2IN3 A;  2VM1 A;  2DJK A;  4Q5Q A;  1GSE A;  3NOF A;  2FNO A;  3F4R A;  4LLR A;  5FHI A;  5ECR B;  2FWE A;  2VM2 A;  1R4W A;  4WBJ A;  4G0I A;  2F8F A;  4BVY A;  3ZML A;  2FCH A;  1GWC A;  4P3Y B;  1JLW A;  3CSJ A;  2I9H A;  5A4U A;  3TKS E;  1A23 A;  1OYJ A;  4OFN A;  2B5X A;  3MSZ A;  4MP4 A;  19GS A;  1SL1 B;  1ILO A;  2WFC A;  4BL7 A;  1TP9 A;  1K0A A;  4ECC A;  1A24 A;  5G5F A;  1DSB A;  5DDL A;  2C3Q A;  1A2M A;  5FWG A;  3S9F A;  1PMT A;  3IHQ A;  3KMN A;  5ID2 B;  2XBI A;  5D9V A;  3M3M A;  5ECN B;  3DIE A;  2PVO C;  5COH A;  2QSI A;  3DVX A;  2HYX A;  3HCZ A;  4OD7 A;  3KP9 A;  3RHC A;  2UZ8 A;  4IP6 A;  4ML1 A;  1R7H A;  2NDO A;  3ED3 A;  2R3X A;  5KN0 A;  3G7J A;  1BQ7 A;  2PMT A;  3MNG A;  4PNG A; 
#chains in the Genus database with same CATH topology
 4ZL8 A;  5HFG A;  4I5Q A;  1NW2 A;  2CAI A;  3EIN A;  5JCU A;  5G2Z A;  2GSS A;  2MMZ A;  3IHG A;  4GXZ A;  1GUH A;  4AJ7 A;  2CVD A;  2CAQ A;  3UVH A;  2GSR A;  1I9D A;  1X9W B;  4MDC A;  1XWG A;  2DBC A;  3HJP A;  2WRT A;  1M99 A;  1A8L A;  1G7O A;  5F05 A;  2LNS A;  1JZW A;  4J2F A;  1F6M C;  3H79 A;  3ZIV A;  4O92 A;  3IV4 A;  2DIY A;  4ZBB A;  2L59 A;  3CXG A;  2PER A;  1JHB A;  1EV4 A;  4N10 A;  12GS A;  2MBS A;  4F03 A;  3VWV A;  4ZXG A;  3TRQ A;  1YEX A;  2K18 A;  3QFA C;  3HDC A;  4HS1 A;  4FIW A;  2C0G A;  2LEG A;  2HSM A;  2H74 A;  3HXS A;  2ES7 A;  4HQZ A;  4MPF A;  2IPA A;  1O85 A;  3ME8 A;  5IMZ A;  3I9V 2;  2LQO A;  1B4P A;  4K5S A;  2LRC A;  1TK5 B;  5CP1 A;  4BPY A;  1X5D A;  4AKX B;  1LJR A;  4TR4 A;  1F3B A;  3RAZ A;  1EEM A;  1J9B A;  2IMK A;  3GKM A;  2ZNM A;  1FW1 A;  3KEB A;  2M46 A;  1SL0 B;  3UMA A;  2L4C A;  1GNW A;  1AW9 A;  2H1A A;  2P5R A;  3C7M A;  4Q5R A;  2GZP A;  3TKQ A;  3IR4 A;  2EFE A;  3HMJ G;  2VL2 C;  4G2E A;  2HRN A;  2VIM A;  3ZL5 A;  1SVM A;  3ME7 A;  1SL2 B;  4POK A;  4YQU A;  3M1G A;  1M9A A;  3US3 A;  1XWC A;  3R3E A;  1V58 A;  1YEP A;  1MD3 A;  2VLU A;  5B7C A;  4MK3 A;  2HRF A;  2QA2 A;  1U3A A;  2XPE A;  3GKK A;  1VF1 A;  3E0U A;  2AUV A;  1BJX A;  5F06 A;  2YZH A;  1M9B A;  4ILF A;  2GZY A;  2X4A A;  4GF0 A;  2CX3 A;  1TRW A;  2IMI A;  3Q6O A;  3FEU A;  3TKR A;  2G2Q A;  3IOS A;  1T8E B;  3ZTL A;  2ALB A;  4Z2R A;  4MH2 A;  4DSR A;  2EFC A;  3FYG A;  4XS6 A;  2WCI A;  2GSQ A;  4W66 A;  4O5U A;  1FB6 A;  1HNC A;  1BAY A;  6GSV A;  1X5E A;  3E9J B;  3IDV A;  2WVX B;  3AY8 A;  1EOH A;  2I4A A;  4JR6 A;  4NMU A;  4IS0 A;  4ISD A;  1S3A A;  2VCT A;  5ECI B;  4IVF A;  4FYC A;  5KOW A;  5IMA A;  3QOU A;  3EPT A;  1XFL A;  2LUS A;  3HVN A;  5CNW A;  3QD9 A;  2L5O A;  1NSW A;  2K9F A;  2LS5 A;  1ZYN A;  5EPF A;  1AAZ A;  5J40 A;  5HR1 A;  2AJQ B;  5G31 A;  2B7K A;  3GKN A;  1QFN A;  1GTU A;  3HVV A;  1EEJ A;  1OC9 B;  2GLR A;  1S4B P;  3IRA A;  1AQX A;  4ZB6 A;  1PX7 A;  1H4O A;  1SVL A;  1TXX A;  3C8E A;  1YF1 A;  14GS A;  3Q19 A;  3K8N A;  1TJD A;  4MF6 A;  5A5K A;  5ELA A;  3BD2 A;  20GS A;  5AGY A;  5BMU A;  4CW9 A;  3FK8 A;  4MF7 A;  3TKS A;  3NZN A;  4GSN A;  5G1K A;  3Q18 A;  1SJ6 A;  2C0F A;  3I43 A;  4PQI A;  4K8M A;  4PX1 A;  2H73 A;  4FYU A;  5FT3 A;  3CTF A;  4HJ2 A;  4PQ1 A;  4GLT A;  3TRP A;  4YQV A;  1ABA A;  1JZD A;  3TJF A;  4IJI A;  5G5E A;  2OE1 A;  1UC7 A;  3CQF A;  3F3R A;  1Y1U A;  1Z6M A;  4OMV A;  3D5J A;  2HSN B;  3IK9 A;  2VCX A;  2PU9 C;  1ZYQ B;  4KB3 A;  2AYT A;  5A5H B;  1WOU A;  3VUR A;  4CHS A;  3KIJ A;  3D4M A;  4IQ1 A;  2HSY A;  1X5C A;  4MH3 A;  4LMW A;  2HSH A;  4HUA A;  3D22 A;  5JWQ B;  1ZZY A;  3FZ5 A;  4GDF A;  3IC8 A;  17GS A;  1YF0 A;  3DXB A;  1GSF A;  1K0B A;  2DJ0 A;  2CQ9 A;  2H66 A;  1G0T A;  4POB A;  5D8I A;  1TI3 A;  5G30 A;  3G7Y A;  4AJ6 A;  3PH9 A;  5DQS A;  1T00 A;  2YWN A;  3LW9 A;  2B5E A;  3CSH A;  3HHV A;  4GTU A;  1X9M B;  1O8X A;  4K0N A;  3IBH A;  4CY6 A;  3PR8 A;  1E2Y A;  3DKS A;  4DSQ A;  3VPT A;  1SYX A;  4EVM A;  2XHF A;  1SKW B;  1Z5Y E;  4FH8 A;  1U3I A;  2O85 A;  3ERW A;  1DBY A;  5IMF A;  1FOH A;  4J56 E;  1MDI A;  4OCE A;  1C72 A;  1T1V A;  2PUK C;  5BMU B;  2FY6 A;  4GRF A;  2DMM A;  5ELG A;  3M9K A;  2F3M A;  1SK0 A;  5ID2 A;  4HU9 A;  2FWF A;  2IMD A;  3KD0 A;  1OKT A;  5D9X A;  3QDN A;  3GFK A;  1AIU A;  4TXV A;  2FA4 A;  5D9W A;  3W8J A;  1GUK A;  3BOA A;  2HFD A;  2C3N A;  2WVZ A;  1QQ2 A;  1M3I A;  2G0F A;  2N5A A;  1BYE A;  5DQY A;  3EWL A;  3HKR A;  2H0H A;  4PI0 C;  3FR9 A;  1IYH A;  5A4V A;  2B6M A;  1MTC A;  1U87 A;  2QA1 A;  2HE3 A;  4HI7 A;  1GNE A;  1XWK A;  4FYB A;  2GTU A;  4RI6 A;  4XRA A;  4YKG A;  4A5P A;  1G7E A;  1XW6 A;  2F9S A;  4GWR A;  4ZB8 A;  3UL3 A;  3GV1 A;  5C04 A;  5IOW A;  2VCQ A;  3GTU A;  5DJL A;  2GQK A;  2PN8 A;  1KNG A;  4QL7 A;  3F6D A;  2WGR A;  1M7T A;  5CRD A;  3CTG A;  1O73 A;  1ST9 A;  3CYN A;  4KSO A;  4FO5 A;  2C80 A;  4V1A g;  4K0G A;  5AN1 A;  1SKS B;  1XVQ A;  3GL3 A;  1K0D A;  3ZRD A;  3TOT A;  4ZL9 A;  1PX6 A;  2H1B A;  1JFU A;  5J9B A;  5AIX A;  5J3R A;  2HRK A;  4MLY A;  5HR0 A;  1PRX A;  3VI7 A;  2PBJ A;  3F6F A;  5D9T A;  4ZIL A;  4PI2 C;  2WW3 A;  1SVO A;  3CRT A;  1M3J A;  1ZL9 A;  4HEA 2;  3GST A;  2EFD A;  2QC7 A;  5DJM A;  2IFQ A;  18GS A;  1PN9 A;  2YOI A;  1B48 A;  1E6B A;  7GSS A;  3FR6 A;  1ZGN A;  2IME A;  4ZBA A;  1Z3E A;  5G1L A;  1HD2 A;  2YJH A;  1A0R P;  4WET A;  1XPV A;  2NTO A;  1VF3 A;  4EL1 A;  4XIH A;  1XOA A;  4MA9 A;  2YV7 A;  1SK1 A;  1F37 A;  2FGX A;  1GLP A;  4AKH A;  3WGE A;  3FY7 A;  1GSY A;  2C8U A;  4EUY A;  2GT6 A;  2H01 A;  2VKZ G;  3KM6 A;  4PUR A;  1B9X C;  4OCF A;  1WRY A;  4ML6 A;  2CV4 A;  1T3B A;  4IEL A;  2LQQ A;  3KGK A;  3GN3 A;  4PTS A;  3EC3 A;  3Q74 A;  1BF5 A;  4KAE A;  3DRN A;  3DML A;  3U5R E;  2OE0 A;  3LGC A;  4MPG A;  1TOF A;  4ECB A;  1ZYP A;  3TUE A;  3H4K A;  5B8A A;  2X99 A;  3HJM A;  4L0U A;  1TRU A;  1K3Y A;  1ZYE A;  4BIK A;  3L9V A;  4IGJ A;  1TRV A;  3GTU B;  2VCW A;  6GSU A;  5HFK A;  2FA8 A;  2JZS A;  1S3D A;  1FAA A;  2CT6 A;  4G0L A;  1GTI A;  2YCD A;  1FG4 A;  3KP8 A;  5GAP D;  2WVX A;  2FLS A;  1GL8 A;  2FHE A;  4MJC A;  3HD5 A;  1R5A A;  3LQ7 A;  2HRK B;  2YP6 A;  2C0D A;  3W6G A;  4YH2 A;  1VF2 A;  6GSW A;  3QAG A;  1YZX A;  1SJI A;  3ZIJ A;  4JR4 A;  3GUS A;  5IMD A;  3UVT A;  3APQ A;  1J08 A;  3ZFL A;  1RQM A;  4NV5 A;  1H75 A;  1O81 A;  3EU3 A;  4BA7 A;  1N8J A;  3EMX A;  1NHO A;  4K6X A;  5ABR A;  2N5F A;  2IFQ B;  4DEJ A;  2LST A;  1OC9 A;  1PKW A;  3NIV A;  2C4J A;  2HLS A;  4KA0 A;  1EGR A;  2OT3 A;  4ACS A;  1XG8 A;  5IOX A;  1N25 A;  2X49 A;  1TRS A;  2VOC A;  2R5G A;  1FO5 A;  1O7U A;  2YZU A;  4JBB A;  4JRR A;  2WVY A;  1HQO A;  4TOP A;  3FW2 A;  2FD3 A;  4I97 A;  2WW0 A;  1G6Y A;  2VO4 A;  1XBS A;  3QAW A;  5JWO B;  4FQU A;  4AF2 A;  3IAS 2;  3A5I A;  3LSZ A;  1PGT A;  3VLN A;  1Y25 A;  5DAL B;  2JAD A;  1TW9 A;  3P8W A;  4D73 A;  4L0W A;  2LNT A;  2HZF A;  2EIR A;  5J47 A;  4KDY A;  2OA7 A;  4MF5 A;  4E68 A;  5D96 A;  2X64 A;  1EWX A;  2C0E A;  3SBC A;  1TKD B;  2EC4 A;  3TJJ A;  3FKF A;  4V1A p;  4EC0 A;  3RPP A;  3VI5 A;  2WDU A;  4HZ4 A;  3JCM L;  4X43 A;  3TKS C;  4ECJ A;  1BED A;  4MAB A;  4TR0 A;  3ZYW A;  3QCP A;  3ZVJ A;  3TGZ A;  2HSN A;  4L5L A;  4Z7X A;  2VLV A;  3IXR A;  5A5H A;  2KP1 A;  4GCI A;  4F9Z A;  4KF9 A;  2RM5 A;  2NVL A;  1ERU A;  1XVW A;  1SKR B;  2ZCT A;  6GSS A;  3APO A;  4IJ3 A;  3ZVJ D;  2O8V B;  5C00 A;  3ZIT A;  5LCZ A;  5ECS A;  16GS A;  4O5R A;  1HYU A;  1CQG A;  1W4V A;  4BVX B;  3UBK A;  3FHK A;  4O7H A;  1AQV A;  4J57 E;  2H1L A;  4MMM A;  1YY7 A;  1F9M A;  3P2A A;  1THX A;  5IIZ A;  3GYK A;  1SJZ A;  1MDJ A;  1ERT A;  5F0G A;  1TU7 A;  3GL5 A;  3G9B A;  3TJB A;  2OBK A;  1JLV A;  5ECL B;  5CRE A;  1SU9 A;  1A2J A;  3HYP A;  5DAK B;  2VD1 A;  3VK9 A;  3IPZ A;  1AC1 A;  3EE2 A;  3A2X A;  4NHW A;  2L4Q A;  1ML6 A;  3FRC A;  2B1L A;  1GSQ A;  3TOU A;  2GZZ A;  4Z2U A;  2VD0 A;  4N0V A;  5GAN D;  1PL2 A;  2BJX A;  4NWY A;  1ZMA A;  3CSI A;  1EP7 A;  5IO0 A;  2V6O A;  2H6Y A;  4TW5 A;  1IYI A;  4BWQ A;  3ERG A;  4EXJ A;  1A2L A;  5H5R A;  5D73 A;  3H8Q A;  3GX8 A;  4PUA A;  6GST A;  3KTL A;  3GIX A;  3LEF A;  3FZ9 A;  3O6T A;  4K9Z A;  2MYG A;  1V9W A;  1HNA A;  1EP8 A;  4O5Q A;  4YAP A;  3TDG A;  3QMX A;  1PFO A;  1WWJ A;  2AV4 A;  4D73 B;  4DVC A;  4JZQ A;  5A34 A;  1YEW C;  4LL4 B;  4F2I A;  1OE8 A;  4JE1 A;  4V2N A;  2A2P A;  2J23 A;  2UV8 G;  2V1M A;  1O8W A;  2E7P A;  3EUR A;  1XXU A;  3CRU A;  2HQT A;  2RUE A;  5B8B A;  1TDI A;  5IMV A;  1K0C A;  2HT9 A;  3P90 A;  4XHM A;  2I3Y A;  1FVK A;  2OAC A;  2F8A A;  1M0U A;  1TXU A;  1OC8 A;  4EIQ A;  3LYK A;  2P5Q A;  5IPG A;  2AB6 A;  1OE7 A;  4DSS B;  5DCH A;  2VCV A;  3TRX A;  3IAM 2;  3TB2 A;  3KZQ A;  1K3L A;  4OFT A;  2LRT A;  4XS4 B;  4RI7 A;  1AQW A;  4POL A;  4YAV A;  3APS A;  4YKF A;  5ECH B;  4TXO B;  5B6N A;  4HU7 A;  3F9U A;  1K0N A;  2YJ7 A;  1EV9 A;  1WP0 A;  2XPD A;  2WZ9 A;  1EOG A;  3MWH A;  2YAN A;  4N11 A;  1DUG A;  1N2A A;  3MIX A;  4MZW A;  3V1W A;  2JL4 A;  2R37 A;  3D0Z A;  1PN0 A;  2DJJ A;  2X8C A;  3LOR A;  1V57 A;  3M0F A;  1Z9H A;  4L8E A;  3ZFB A;  1R26 A;  4IBP A;  3F8U A;  4MJB A;  4KSM A;  2HRA A;  1YJ6 A;  4QL9 A;  4X1U A;  2O5V A;  2HZE B;  1GSD A;  2KLX A;  4ZB9 A;  2LJR A;  5CRG A;  3WGX A;  4XS1 A;  3LG6 A;  4HJM A;  2P31 A;  4FXY P;  2DJ1 A;  5E59 A;  2B7J A;  3F3Q A;  2O89 A;  1T7P B;  2L6C A;  1B8X A;  3FR3 A;  3A5W A;  4AI6 A;  1WJK A;  3EVI A;  1T4Z A;  1A0F A;  2IJY A;  3PPU A;  5A34 B;  5CRH A;  1VGL A;  2RUF A;  1MDK A;  4NPB A;  4NV2 A;  3LYP A;  2OJL A;  2H0I A;  3C71 A;  1F2E A;  1A8Y A;  2H75 A;  4ZIJ A;  11GS A;  2KHP A;  2BTO T;  2KP2 A;  3PIN A;  3WGD A;  3RDW A;  1I1I P;  1K3O A;  2HI7 A;  5EVO A;  1WIK A;  3DWV A;  4KDX A;  5HR2 A;  2MZC A;  3LFL A;  4HDE A;  1XW5 A;  3TCO A;  4ZBD A;  2IWT A;  1FB0 A;  4EE0 A;  1Q4J A;  3EMP A;  4IN0 A;  2GVP A;  4N0Z A;  3GH6 A;  3A3T A;  3QPM A;  3RHB A;  1MEK A;  2D2Z A;  4WR4 A;  4I2T A;  4G19 A;  1LU4 A;  2EIQ A;  4EDZ A;  4RQX A;  1YKC A;  2LKU A;  3RGB C;  4XRD A;  13GS A;  4KDU A;  2H19 A;  1X9S B;  1V40 A;  3DGQ A;  2X8H A;  2E2M A;  2J9H A;  4WBR D;  1FHE A;  5ECQ B;  5KN1 A;  1ERW A;  1SD9 A;  5IO2 A;  4G01 A;  3L78 A;  2DSA A;  1I5G A;  4RUV A;  1EZK A;  2V6K A;  4WKW A;  3TJK A;  3KTB A;  1M2A A;  4G0K A;  5A1N B;  4EKZ A;  2DJ3 A;  2N5B A;  1GSU A;  5J4U A;  1RK4 A;  2C3T A;  4V2L A;  2H70 A;  4LA1 A;  4K7I A;  4G9H A;  4K2D A;  2YNX A;  4GQC A;  1WPI A;  1GUM A;  4X0X A;  1BG1 A;  4USS A;  2IIY A;  2CX4 A;  2O87 A;  3GKX A;  3CHX C;  4NHZ A;  2TRC P;  3HJO A;  1GSS A;  3L9S A;  4K7O A;  2DIZ A;  3BCI A;  4TR3 A;  3GUR A;  4TRX A;  4Q5N A;  1K0M A;  2B1K A;  2H76 A;  3UBL A;  3DEX A;  2CZ2 A;  1VF4 A;  4AJ8 A;  2VLT A;  4KX4 A;  2DJ2 A;  2MBT A;  1PSQ A;  5KOX A;  1USB A;  5DAL A;  2YN1 A;  1UA5 A;  1ERV A;  1S3C A;  3LXT A;  2YPM A;  4NXI A;  3VWU A;  2R0G A;  3I69 A;  3RPN A;  4F82 A;  3H1N A;  4OO4 A;  3WYW A;  2FWG A;  3HZ8 A;  4BWS A;  2R2J A;  4MJA A;  4ECI A;  1V2A A;  3FZ4 A;  2KOK A;  1EGO A;  3HY2 A;  2LTK A;  22GS A;  1PL1 A;  1TK0 B;  2EFH A;  3CWG A;  2JSZ A;  4WF4 A;  1JZR A;  3ERF A;  1XZO A;  2MMA A;  4F0B A;  5IQY A;  1GH2 A;  4IP1 A;  5J5N A;  4KUN A;  1TK8 B;  5IM9 A;  2NPB A;  2DML A;  4TVE A;  5EL8 A;  2GDR A;  4PNF A;  2R0P A;  2O3E A;  4IQA A;  2A4V A;  3UAP A;  3BBY A;  4BVX A;  4ICY A;  1DE2 A;  1QUW A;  3QFB C;  1O6J A;  3L9U A;  1XCC A;  2RII A;  4I6X A;  1KTE A;  3QR6 A;  5AIV A;  1KEB A;  3CMI A;  1BX9 A;  1X0R A;  4RQR A;  3LJR A;  1HNB A;  5J41 A;  4I8B A;  3O3T A;  2LJK A;  4Q5F A;  2X8G A;  1TU8 A;  2E2G A;  5E4W A;  1FOV A;  2H1G A;  9GSS A;  2E0Q A;  2LRN A;  2JU5 A;  4TR1 A;  4BVY B;  2FUG 2;  1Z6N A;  1JZO A;  1F3A A;  3WD6 A;  5DAK A;  4ULX A;  4H86 A;  1Q98 A;  2C1Y A;  3HVS A;  4OWY A;  1PA3 A;  1GTA A;  4E8H A;  1SYR A;  5JWR B;  4G10 A;  6GSX A;  3ISO A;  2WB9 A;  4HSC X;  1SD8 A;  4BL7 B;  3GSS A;  2H30 A;  5L71 A;  2CVB A;  5IPH A;  4K2X A;  1SK2 A;  3KCM A;  5DVB A;  1M2B A;  1XOB A;  3ZRE A;  10GS A;  4Z2T A;  1GP1 A;  5HFI A;  2GQM A;  3KMO A;  4NAX A;  3DD3 A;  1OVN A;  5CO3 A;  3GH9 A;  5IMC A;  3R2Q A;  5CYY A;  2YWM A;  2KUC A;  3M9J A;  5KN3 A;  3KXO A;  1YVL A;  3RFR C;  2JZT A;  5H5S A;  2CVK A;  2OBI A;  3GMF A;  5BRT A;  4N3Z A;  2F51 A;  4HZ2 A;  2HNL A;  2A2R A;  5HR3 A;  1QK8 A;  2B5Y A;  2WW2 A;  4EO3 A;  1VRS D;  3GRX A;  4MNN A;  4XTS A;  4WF5 A;  4L5O A;  5H5Q A;  2YWI A;  1U6T A;  3N9J A;  1Z7P A;  2H0G A;  3VWX A;  4DSS A;  1RW1 A;  2RM6 A;  2QGV A;  4XS4 A;  4MJE A;  2R4V A;  1NM3 A;  5EY6 A;  3U6V A;  2DKI A;  4KH7 A;  4TXO A;  3J7Y k;  3EU4 A;  2H6Z A;  5ECP B;  5LD0 A;  2ON5 A;  4MCU A;  4EF0 A;  2BMX A;  4PQH A;  3ZMK A;  1LBK A;  2O7K A;  5J4V A;  5AIS A;  4GST A;  3VWW A;  2DLX A;  2JAC A;  3N5O A;  2RLI A;  1THO A;  5B6M A;  2VCZ A;  1OC3 A;  2L5L A;  1TTZ A;  4K5R A;  5ECO B;  3C1R A;  2JSY A;  2OE3 A;  4TR1 B;  4KCE A;  3UJ1 A;  4PUF C;  1B4Q A;  2PPT A;  5GZZ B;  4IKH A;  1K0O A;  1XW9 A;  5D93 A;  3PGT A;  2QKE A;  5KN2 A;  2H1D A;  4WR5 A;  2HSM B;  2I1U A;  2HZE A;  3UOM A;  5DCG A;  2R6K A;  3LWA A;  5ENU A;  3I6A A;  4WXT A;  4PHZ C;  4I2U A;  2HXK A;  2YWO A;  5J9C A;  4TKY A;  2DC5 A;  1GLQ A;  5F07 A;  3UIW A;  2IL3 A;  2VL2 A;  4O32 A;  2GT5 A;  3TKP A;  3FZA A;  2VL3 A;  2WZS A;  2H6X A;  4AKI A;  4HOJ A;  2K8S A;  3UAR A;  3GNJ A;  1OKD A;  4V2M A;  4IHU A;  4K1F A;  1AUC A;  2H72 A;  2O36 A;  1DE1 A;  2GQL A;  1G6W A;  3SWL A;  6GSY A;  3RBT A;  2CZ3 A;  3D21 A;  2GGT A;  3EYT A;  3GHA A;  1PD2 1;  1MD4 A;  4OO5 A;  5A4W A;  2VAF A;  1BG5 A;  3DVW A;  3D4T A;  2L57 A;  1QXH A;  2A2S A;  3UEM A;  4ZB7 A;  3L4N A;  1WMJ A;  5CAX A;  2VL9 A;  3WT1 A;  2AHE A;  1XWA A;  2PGT A;  1OAZ A;  2OAD A;  4GQF A;  2Z9S A;  2CA8 A;  1GUL A;  5LNK e;  4OFM A;  4KE3 A;  3C1S A;  3VPQ A;  2XBQ A;  1SEN A;  1V98 A;  1ACV A;  3GX0 A;  2ON7 A;  5HQP A;  2LJA A;  2K6V A;  1W89 A;  5CRW A;  2FWH A;  1FVJ A;  2TIR A;  3HVX A;  3F63 A;  3CBU A;  1M2D A;  1XWB A;  1KBN A;  2WS2 A;  2OKA A;  3H93 A;  2GST A;  4N30 A;  2REM A;  3P7X A;  4TN8 A;  5DBQ A;  2IMF A;  3BJ5 A;  3ZZX A;  1YQ1 A;  2MMO A;  3J7Y b;  2M72 A;  1CQH A;  2TRX A;  1GRX A;  2VUP A;  4PGT A;  4EDY A;  1PKZ A;  4ZL7 A;  4HQS A;  3F4S A;  4GSS A;  1WE0 A;  4ID0 A;  3HA9 A;  3IC4 A;  2R0C A;  1AXD A;  1QGV A;  4KCA A;  3MAK A;  4CY8 A;  3VFI A;  4MZC A;  1QMV A;  1GTB A;  1UN2 A;  2H71 A;  5KEJ A;  3WT2 A;  3QAV A;  1XIY A;  2GS3 A;  2AAW A;  5INY A;  1J0F A;  4JU5 A;  2M80 A;  5A1N A;  1YKA A;  4K7N A;  1UVZ A;  2H8L A;  3BCK A;  2YV9 A;  3O76 A;  3MDK A;  1B9Y C;  2I81 A;  3F0I A;  3IE3 A;  4AGS A;  5GSS A;  4CDO A;  2NBS A;  3IK7 A;  3DYR A;  3L0H A;  4KGI A;  3A2V A;  3G7I A;  5GST A;  2K8V A;  1Y6E A;  3A2W A;  4EIP A;  4PXO A;  1ON4 A;  2EIO A;  3TJG A;  4IW9 A;  1Z7R A;  3KH7 A;  3ZLP A;  4X4J A;  4F0C A;  4YQM A;  2PWJ A;  3OR5 A;  4LMV A;  2WUL A;  4MZB A;  3KH9 A;  2ZUP A;  4POM A;  3IA1 A;  1ZCP A;  4QQ7 A;  1R5P A;  4KND A;  2WJU A;  4E8E A;  2LV3 A;  3W8S A;  2V41 A;  3KJY A;  2PVQ A;  1PQN A;  1U88 A;  5F8B A;  2MMN A;  1URM A;  2V32 A;  5JCG A;  3LXZ A;  4KW6 A;  4JED A;  1NHY A;  2P0G A;  2L6D A;  1YDK A;  3C73 A;  5ECK B;  5JCW A;  3HZ4 A;  2V2G A;  2B3S A;  4XCS A;  3D6I A;  3F4T A;  4WEY A;  1TI1 A;  4LL1 B;  5ECM B;  4QMK A;  1ZOF A;  3M8N A;  2XC2 A;  1T4Y A;  8GSS A;  5J4Y A;  3GA4 A;  2JZR A;  3E3E A;  2A4H A;  2IN3 A;  2VM1 A;  2DJK A;  4Q5Q A;  1GSE A;  3NOF A;  2FNO A;  4AKG A;  3F4R A;  4LLR A;  5FHI A;  5ECR B;  2FWE A;  2DKH A;  2VM2 A;  1R4W A;  4WBJ A;  4G0I A;  2F8F A;  4BVY A;  3ZML A;  2FCH A;  1GWC A;  3MYD A;  4P3Y B;  1JLW A;  3CSJ A;  3FMW A;  2I9H A;  5A4U A;  3TKS E;  1A23 A;  2WW1 A;  1OYJ A;  4OFN A;  2B5X A;  3MSZ A;  4MP4 A;  19GS A;  1S3R A;  1SL1 B;  1ILO A;  2WFC A;  4BL7 A;  1TP9 A;  1K0A A;  4ECC A;  1A24 A;  5G5F A;  1DSB A;  5DDL A;  2C3Q A;  1A2M A;  5FWG A;  3S9F A;  1PMT A;  3IHQ A;  3KMN A;  5ID2 B;  2XBI A;  5D9V A;  3M3M A;  5ECN B;  3DIE A;  2PVO C;  5COH A;  2QSI A;  3DVX A;  2HYX A;  3HCZ A;  3TU3 B;  4OD7 A;  3KP9 A;  3RHC A;  2UZ8 A;  4IP6 A;  4ML1 A;  1R7H A;  2NDO A;  3ED3 A;  2R3X A;  5KN0 A;  3G7J A;  1BQ7 A;  2PMT A;  3MNG A;  4PNG A; 
#chains in the Genus database with same CATH homology
 4ZL8 A;  5HFG A;  4I5Q A;  1NW2 A;  2CAI A;  3EIN A;  5JCU A;  5G2Z A;  2GSS A;  2MMZ A;  3IHG A;  4GXZ A;  1GUH A;  4AJ7 A;  2CVD A;  2CAQ A;  3UVH A;  2GSR A;  1I9D A;  1X9W B;  4MDC A;  1XWG A;  2DBC A;  3HJP A;  2WRT A;  1M99 A;  1A8L A;  1G7O A;  5F05 A;  2LNS A;  1JZW A;  4J2F A;  1F6M C;  3H79 A;  3ZIV A;  4O92 A;  3IV4 A;  2DIY A;  4ZBB A;  2L59 A;  3CXG A;  2PER A;  1JHB A;  1EV4 A;  4N10 A;  12GS A;  2MBS A;  4F03 A;  3VWV A;  4ZXG A;  3TRQ A;  1YEX A;  2K18 A;  3QFA C;  3HDC A;  4HS1 A;  4FIW A;  2C0G A;  2LEG A;  2HSM A;  2H74 A;  3HXS A;  2ES7 A;  4HQZ A;  4MPF A;  2IPA A;  1O85 A;  3ME8 A;  5IMZ A;  3I9V 2;  2LQO A;  1B4P A;  4K5S A;  2LRC A;  1TK5 B;  5CP1 A;  4BPY A;  1X5D A;  4AKX B;  1LJR A;  4TR4 A;  1F3B A;  3RAZ A;  1EEM A;  1J9B A;  2IMK A;  3GKM A;  2ZNM A;  1FW1 A;  3KEB A;  2M46 A;  1SL0 B;  3UMA A;  2L4C A;  1GNW A;  1AW9 A;  2H1A A;  2P5R A;  3C7M A;  4Q5R A;  2GZP A;  3TKQ A;  3IR4 A;  2EFE A;  3HMJ G;  2VL2 C;  4G2E A;  2HRN A;  2VIM A;  3ZL5 A;  1SVM A;  3ME7 A;  1SL2 B;  4POK A;  4YQU A;  3M1G A;  1M9A A;  3US3 A;  1XWC A;  3R3E A;  1V58 A;  1YEP A;  1MD3 A;  2VLU A;  5B7C A;  4MK3 A;  2HRF A;  2QA2 A;  1U3A A;  2XPE A;  3GKK A;  1VF1 A;  3E0U A;  2AUV A;  1BJX A;  5F06 A;  2YZH A;  1M9B A;  4ILF A;  2GZY A;  2X4A A;  4GF0 A;  2CX3 A;  1TRW A;  2IMI A;  3Q6O A;  3FEU A;  3TKR A;  2G2Q A;  3IOS A;  1T8E B;  3ZTL A;  2ALB A;  4Z2R A;  4MH2 A;  4DSR A;  2EFC A;  3FYG A;  4XS6 A;  2WCI A;  2GSQ A;  4W66 A;  4O5U A;  1FB6 A;  1HNC A;  1BAY A;  6GSV A;  1X5E A;  3E9J B;  3IDV A;  3AY8 A;  1EOH A;  2I4A A;  4JR6 A;  4NMU A;  4IS0 A;  4ISD A;  1S3A A;  2VCT A;  5ECI B;  4IVF A;  4FYC A;  5KOW A;  5IMA A;  3QOU A;  3EPT A;  1XFL A;  2LUS A;  5CNW A;  3QD9 A;  2L5O A;  1NSW A;  2K9F A;  2LS5 A;  1ZYN A;  5EPF A;  1AAZ A;  5J40 A;  5HR1 A;  2AJQ B;  5G31 A;  2B7K A;  3GKN A;  1QFN A;  1GTU A;  3HVV A;  1EEJ A;  1OC9 B;  2GLR A;  3IRA A;  1AQX A;  4ZB6 A;  1PX7 A;  1H4O A;  1SVL A;  1TXX A;  3C8E A;  1YF1 A;  14GS A;  3Q19 A;  3K8N A;  1TJD A;  4MF6 A;  5A5K A;  5ELA A;  3BD2 A;  20GS A;  5AGY A;  5BMU A;  4CW9 A;  3FK8 A;  4MF7 A;  3TKS A;  3NZN A;  4GSN A;  5G1K A;  3Q18 A;  1SJ6 A;  2C0F A;  3I43 A;  4PQI A;  4K8M A;  4PX1 A;  2H73 A;  4FYU A;  5FT3 A;  3CTF A;  4HJ2 A;  4PQ1 A;  4GLT A;  3TRP A;  4YQV A;  1ABA A;  1JZD A;  3TJF A;  4IJI A;  5G5E A;  2OE1 A;  1UC7 A;  3F3R A;  1Y1U A;  1Z6M A;  4OMV A;  3D5J A;  2HSN B;  3IK9 A;  2VCX A;  2PU9 C;  1ZYQ B;  4KB3 A;  2AYT A;  5A5H B;  1WOU A;  3VUR A;  4CHS A;  3KIJ A;  3D4M A;  4IQ1 A;  2HSY A;  1X5C A;  4MH3 A;  4LMW A;  2HSH A;  4HUA A;  3D22 A;  5JWQ B;  1ZZY A;  3FZ5 A;  4GDF A;  3IC8 A;  17GS A;  1YF0 A;  3DXB A;  1GSF A;  1K0B A;  2DJ0 A;  2CQ9 A;  2H66 A;  1G0T A;  4POB A;  5D8I A;  1TI3 A;  5G30 A;  3G7Y A;  4AJ6 A;  3PH9 A;  5DQS A;  1T00 A;  2YWN A;  3LW9 A;  2B5E A;  3CSH A;  3HHV A;  4GTU A;  1X9M B;  1O8X A;  4K0N A;  3IBH A;  4CY6 A;  3PR8 A;  1E2Y A;  3DKS A;  4DSQ A;  3VPT A;  1SYX A;  4EVM A;  2XHF A;  1SKW B;  1Z5Y E;  4FH8 A;  1U3I A;  2O85 A;  3ERW A;  1DBY A;  5IMF A;  1FOH A;  4J56 E;  1MDI A;  4OCE A;  1C72 A;  1T1V A;  2PUK C;  5BMU B;  2FY6 A;  4GRF A;  2DMM A;  5ELG A;  3M9K A;  2F3M A;  1SK0 A;  5ID2 A;  4HU9 A;  2FWF A;  2IMD A;  3KD0 A;  1OKT A;  5D9X A;  3QDN A;  3GFK A;  1AIU A;  4TXV A;  2FA4 A;  5D9W A;  3W8J A;  1GUK A;  3BOA A;  2HFD A;  2C3N A;  1QQ2 A;  2N5A A;  2G0F A;  1BYE A;  5DQY A;  3EWL A;  3HKR A;  2H0H A;  3FR9 A;  1IYH A;  5A4V A;  2B6M A;  1MTC A;  1U87 A;  2QA1 A;  2HE3 A;  4HI7 A;  1GNE A;  1XWK A;  4FYB A;  2GTU A;  4RI6 A;  4XRA A;  4YKG A;  4A5P A;  1G7E A;  1XW6 A;  2F9S A;  4GWR A;  4ZB8 A;  3UL3 A;  3GV1 A;  5C04 A;  5IOW A;  2VCQ A;  3GTU A;  5DJL A;  2GQK A;  2PN8 A;  1KNG A;  4QL7 A;  3F6D A;  2WGR A;  1M7T A;  5CRD A;  3CTG A;  1O73 A;  1ST9 A;  3CYN A;  4KSO A;  4FO5 A;  2C80 A;  4V1A g;  4K0G A;  5AN1 A;  1SKS B;  1XVQ A;  3GL3 A;  1K0D A;  3ZRD A;  3TOT A;  4ZL9 A;  1PX6 A;  2H1B A;  1JFU A;  5J9B A;  5AIX A;  5J3R A;  2HRK A;  4MLY A;  5HR0 A;  1PRX A;  3VI7 A;  2PBJ A;  3F6F A;  5D9T A;  4ZIL A;  3CRT A;  1SVO A;  1ZL9 A;  4HEA 2;  3GST A;  2EFD A;  2QC7 A;  5DJM A;  2IFQ A;  18GS A;  1PN9 A;  2YOI A;  1B48 A;  1E6B A;  7GSS A;  3FR6 A;  1ZGN A;  2IME A;  4ZBA A;  1Z3E A;  5G1L A;  1HD2 A;  2YJH A;  1A0R P;  4WET A;  1XPV A;  2NTO A;  1VF3 A;  4EL1 A;  4XIH A;  1XOA A;  4MA9 A;  2YV7 A;  1SK1 A;  1F37 A;  2FGX A;  1GLP A;  4AKH A;  3WGE A;  3FY7 A;  1GSY A;  2C8U A;  4EUY A;  2GT6 A;  2H01 A;  2VKZ G;  3KM6 A;  4PUR A;  1B9X C;  4OCF A;  1WRY A;  4ML6 A;  2CV4 A;  1T3B A;  4IEL A;  2LQQ A;  3KGK A;  3GN3 A;  4PTS A;  3EC3 A;  3Q74 A;  1BF5 A;  4KAE A;  3DRN A;  3DML A;  3U5R E;  2OE0 A;  3LGC A;  4MPG A;  1TOF A;  4ECB A;  1ZYP A;  3TUE A;  3H4K A;  5B8A A;  2X99 A;  3HJM A;  4L0U A;  1TRU A;  1K3Y A;  1ZYE A;  3L9V A;  4IGJ A;  1TRV A;  3GTU B;  2VCW A;  6GSU A;  5HFK A;  2FA8 A;  2JZS A;  1S3D A;  1FAA A;  2CT6 A;  4G0L A;  1GTI A;  2YCD A;  1FG4 A;  3KP8 A;  5GAP D;  2FLS A;  1GL8 A;  2FHE A;  4MJC A;  3HD5 A;  1R5A A;  3LQ7 A;  2HRK B;  2YP6 A;  2C0D A;  3W6G A;  4YH2 A;  1VF2 A;  6GSW A;  3QAG A;  1YZX A;  1SJI A;  3ZIJ A;  4JR4 A;  3GUS A;  5IMD A;  3UVT A;  3APQ A;  1J08 A;  3ZFL A;  1RQM A;  4NV5 A;  1H75 A;  1O81 A;  3EU3 A;  4BA7 A;  1N8J A;  3EMX A;  1NHO A;  4K6X A;  5ABR A;  2N5F A;  2IFQ B;  4DEJ A;  2LST A;  1OC9 A;  1PKW A;  3NIV A;  2C4J A;  2HLS A;  4KA0 A;  1EGR A;  2OT3 A;  4ACS A;  5IOX A;  1N25 A;  2X49 A;  1TRS A;  2VOC A;  2R5G A;  1FO5 A;  1O7U A;  2YZU A;  4JBB A;  4JRR A;  1HQO A;  4TOP A;  3FW2 A;  2FD3 A;  4I97 A;  1G6Y A;  2VO4 A;  1XBS A;  3QAW A;  5JWO B;  4FQU A;  4AF2 A;  3IAS 2;  3A5I A;  3LSZ A;  1PGT A;  3VLN A;  1Y25 A;  5DAL B;  2JAD A;  1TW9 A;  3P8W A;  4D73 A;  4L0W A;  2LNT A;  2HZF A;  2EIR A;  5J47 A;  4KDY A;  2OA7 A;  4MF5 A;  4E68 A;  5D96 A;  2X64 A;  1EWX A;  2C0E A;  3SBC A;  1TKD B;  2EC4 A;  3TJJ A;  3FKF A;  4V1A p;  4EC0 A;  3RPP A;  3VI5 A;  2WDU A;  4HZ4 A;  3JCM L;  4X43 A;  3TKS C;  4ECJ A;  1BED A;  4MAB A;  4TR0 A;  3ZYW A;  3QCP A;  3ZVJ A;  3TGZ A;  2HSN A;  4L5L A;  4Z7X A;  2VLV A;  3IXR A;  5A5H A;  2KP1 A;  4GCI A;  4F9Z A;  4KF9 A;  2RM5 A;  2NVL A;  1ERU A;  1XVW A;  1SKR B;  2ZCT A;  6GSS A;  3APO A;  4IJ3 A;  3ZVJ D;  2O8V B;  5C00 A;  3ZIT A;  5LCZ A;  5ECS A;  16GS A;  4O5R A;  1HYU A;  1CQG A;  1W4V A;  4BVX B;  3UBK A;  3FHK A;  4O7H A;  1AQV A;  4J57 E;  2H1L A;  4MMM A;  1YY7 A;  1F9M A;  3P2A A;  1THX A;  5IIZ A;  3GYK A;  1SJZ A;  1MDJ A;  1ERT A;  5F0G A;  1TU7 A;  3GL5 A;  3G9B A;  3TJB A;  2OBK A;  1JLV A;  5ECL B;  5CRE A;  1SU9 A;  1A2J A;  3HYP A;  5DAK B;  2VD1 A;  3VK9 A;  3IPZ A;  1AC1 A;  3EE2 A;  3A2X A;  4NHW A;  2L4Q A;  1ML6 A;  3FRC A;  2B1L A;  1GSQ A;  3TOU A;  2GZZ A;  4Z2U A;  2VD0 A;  4N0V A;  5GAN D;  1PL2 A;  2BJX A;  4NWY A;  1ZMA A;  3CSI A;  1EP7 A;  5IO0 A;  2V6O A;  2H6Y A;  4TW5 A;  1IYI A;  4BWQ A;  3ERG A;  4EXJ A;  1A2L A;  5H5R A;  5D73 A;  3H8Q A;  3GX8 A;  4PUA A;  6GST A;  3KTL A;  3GIX A;  3LEF A;  3FZ9 A;  3O6T A;  4K9Z A;  2MYG A;  1V9W A;  1HNA A;  1EP8 A;  4O5Q A;  4YAP A;  3TDG A;  3QMX A;  1WWJ A;  2AV4 A;  4D73 B;  4DVC A;  4JZQ A;  5A34 A;  4LL4 B;  4F2I A;  1OE8 A;  4JE1 A;  4V2N A;  2A2P A;  2J23 A;  2UV8 G;  2V1M A;  1O8W A;  2E7P A;  3EUR A;  1XXU A;  3CRU A;  2HQT A;  2RUE A;  5B8B A;  1TDI A;  5IMV A;  1K0C A;  2HT9 A;  3P90 A;  4XHM A;  2I3Y A;  1FVK A;  2OAC A;  2F8A A;  1M0U A;  1TXU A;  1OC8 A;  4EIQ A;  3LYK A;  2P5Q A;  5IPG A;  2AB6 A;  1OE7 A;  4DSS B;  5DCH A;  2VCV A;  3TRX A;  3IAM 2;  3TB2 A;  3KZQ A;  1K3L A;  4OFT A;  2LRT A;  4XS4 B;  4RI7 A;  1AQW A;  4POL A;  4YAV A;  3APS A;  4YKF A;  5ECH B;  4TXO B;  5B6N A;  4HU7 A;  3F9U A;  1K0N A;  2YJ7 A;  1EV9 A;  1WP0 A;  2XPD A;  2WZ9 A;  1EOG A;  3MWH A;  2YAN A;  4N11 A;  1DUG A;  1N2A A;  3MIX A;  4MZW A;  3V1W A;  2JL4 A;  2R37 A;  3D0Z A;  1PN0 A;  2DJJ A;  2X8C A;  3LOR A;  1V57 A;  3M0F A;  1Z9H A;  4L8E A;  3ZFB A;  1R26 A;  4IBP A;  3F8U A;  4MJB A;  4KSM A;  2HRA A;  1YJ6 A;  4QL9 A;  4X1U A;  2O5V A;  2HZE B;  1GSD A;  2KLX A;  4ZB9 A;  2LJR A;  5CRG A;  3WGX A;  4XS1 A;  3LG6 A;  4HJM A;  2P31 A;  2DJ1 A;  5E59 A;  2B7J A;  3F3Q A;  2O89 A;  1T7P B;  2L6C A;  1B8X A;  3FR3 A;  3A5W A;  4AI6 A;  1WJK A;  3EVI A;  1T4Z A;  1A0F A;  2IJY A;  3PPU A;  5A34 B;  5CRH A;  1VGL A;  2RUF A;  1MDK A;  4NPB A;  4NV2 A;  3LYP A;  2OJL A;  2H0I A;  3C71 A;  1F2E A;  1A8Y A;  2H75 A;  4ZIJ A;  11GS A;  2KHP A;  2BTO T;  2KP2 A;  3PIN A;  3WGD A;  3RDW A;  1K3O A;  2HI7 A;  5EVO A;  1WIK A;  3DWV A;  4KDX A;  5HR2 A;  2MZC A;  3LFL A;  4HDE A;  1XW5 A;  3TCO A;  4ZBD A;  2IWT A;  1FB0 A;  4EE0 A;  1Q4J A;  3EMP A;  4IN0 A;  2GVP A;  4N0Z A;  3GH6 A;  3A3T A;  3QPM A;  3RHB A;  1MEK A;  2D2Z A;  4WR4 A;  4I2T A;  4G19 A;  1LU4 A;  2EIQ A;  4EDZ A;  4RQX A;  1YKC A;  2LKU A;  4XRD A;  13GS A;  4KDU A;  2H19 A;  1X9S B;  1V40 A;  3DGQ A;  2X8H A;  2E2M A;  2J9H A;  4WBR D;  1FHE A;  5ECQ B;  5KN1 A;  1ERW A;  1SD9 A;  5IO2 A;  4G01 A;  3L78 A;  2DSA A;  1I5G A;  4RUV A;  1EZK A;  2V6K A;  4WKW A;  3TJK A;  3KTB A;  1M2A A;  4G0K A;  5A1N B;  4EKZ A;  2DJ3 A;  2N5B A;  1GSU A;  5J4U A;  1RK4 A;  2C3T A;  4V2L A;  2H70 A;  4LA1 A;  4K7I A;  4G9H A;  4K2D A;  2YNX A;  4GQC A;  1WPI A;  1GUM A;  4X0X A;  1BG1 A;  4USS A;  2IIY A;  2CX4 A;  2O87 A;  3GKX A;  4NHZ A;  2TRC P;  3HJO A;  1GSS A;  3L9S A;  4K7O A;  2DIZ A;  3BCI A;  4TR3 A;  3GUR A;  4TRX A;  4Q5N A;  1K0M A;  2B1K A;  2H76 A;  3UBL A;  3DEX A;  2CZ2 A;  1VF4 A;  4AJ8 A;  2VLT A;  4KX4 A;  2DJ2 A;  2MBT A;  1PSQ A;  5KOX A;  1USB A;  5DAL A;  2YN1 A;  1UA5 A;  1ERV A;  1S3C A;  3LXT A;  2YPM A;  4NXI A;  3VWU A;  2R0G A;  3I69 A;  3RPN A;  4F82 A;  3H1N A;  4OO4 A;  3WYW A;  2FWG A;  3HZ8 A;  4BWS A;  2R2J A;  4MJA A;  4ECI A;  1V2A A;  3FZ4 A;  2KOK A;  1EGO A;  3HY2 A;  2LTK A;  22GS A;  1PL1 A;  1TK0 B;  2EFH A;  3CWG A;  2JSZ A;  4WF4 A;  1JZR A;  3ERF A;  1XZO A;  2MMA A;  4F0B A;  5IQY A;  1GH2 A;  4IP1 A;  5J5N A;  4KUN A;  1TK8 B;  5IM9 A;  2NPB A;  2DML A;  4TVE A;  5EL8 A;  2GDR A;  4PNF A;  2R0P A;  4IQA A;  2A4V A;  3UAP A;  3BBY A;  4BVX A;  4ICY A;  1DE2 A;  1QUW A;  3QFB C;  1O6J A;  3L9U A;  1XCC A;  2RII A;  4I6X A;  1KTE A;  3QR6 A;  5AIV A;  1KEB A;  3CMI A;  1BX9 A;  1X0R A;  4RQR A;  3LJR A;  1HNB A;  5J41 A;  4I8B A;  3O3T A;  2LJK A;  4Q5F A;  2X8G A;  1TU8 A;  2E2G A;  5E4W A;  1FOV A;  2H1G A;  9GSS A;  2E0Q A;  2LRN A;  2JU5 A;  4TR1 A;  4BVY B;  2FUG 2;  1Z6N A;  1JZO A;  1F3A A;  3WD6 A;  5DAK A;  4ULX A;  4H86 A;  1Q98 A;  2C1Y A;  3HVS A;  4OWY A;  1PA3 A;  1GTA A;  4E8H A;  1SYR A;  5JWR B;  4G10 A;  6GSX A;  3ISO A;  2WB9 A;  1SD8 A;  4BL7 B;  3GSS A;  2H30 A;  5L71 A;  2CVB A;  5IPH A;  4K2X A;  1SK2 A;  3KCM A;  5DVB A;  1M2B A;  1XOB A;  3ZRE A;  10GS A;  4Z2T A;  1GP1 A;  5HFI A;  2GQM A;  3KMO A;  4NAX A;  3DD3 A;  1OVN A;  5CO3 A;  3GH9 A;  5IMC A;  3R2Q A;  5CYY A;  2YWM A;  2KUC A;  3M9J A;  5KN3 A;  3KXO A;  1YVL A;  2JZT A;  5H5S A;  2CVK A;  2OBI A;  3GMF A;  5BRT A;  4N3Z A;  2F51 A;  4HZ2 A;  2HNL A;  2A2R A;  5HR3 A;  1QK8 A;  2B5Y A;  4EO3 A;  1VRS D;  3GRX A;  4MNN A;  4XTS A;  4WF5 A;  4L5O A;  5H5Q A;  2YWI A;  1U6T A;  3N9J A;  1Z7P A;  2H0G A;  3VWX A;  4DSS A;  1RW1 A;  2RM6 A;  2QGV A;  4XS4 A;  4MJE A;  2R4V A;  1NM3 A;  5EY6 A;  3U6V A;  2DKI A;  4KH7 A;  4TXO A;  3J7Y k;  3EU4 A;  2H6Z A;  5ECP B;  5LD0 A;  2ON5 A;  4MCU A;  4EF0 A;  2BMX A;  4PQH A;  3ZMK A;  1LBK A;  2O7K A;  5J4V A;  5AIS A;  4GST A;  3VWW A;  2DLX A;  2JAC A;  3N5O A;  2RLI A;  1THO A;  5B6M A;  2VCZ A;  1OC3 A;  2L5L A;  1TTZ A;  4K5R A;  5ECO B;  3C1R A;  2JSY A;  2OE3 A;  4TR1 B;  4KCE A;  3UJ1 A;  4PUF C;  1B4Q A;  2PPT A;  5GZZ B;  4IKH A;  1K0O A;  1XW9 A;  5D93 A;  3PGT A;  2QKE A;  5KN2 A;  2H1D A;  4WR5 A;  2HSM B;  2I1U A;  2HZE A;  3UOM A;  5DCG A;  2R6K A;  3LWA A;  5ENU A;  3I6A A;  4WXT A;  4I2U A;  2HXK A;  2YWO A;  5J9C A;  4TKY A;  2DC5 A;  1GLQ A;  5F07 A;  3UIW A;  2IL3 A;  2VL2 A;  4O32 A;  2GT5 A;  3TKP A;  3FZA A;  2VL3 A;  2H6X A;  4AKI A;  4HOJ A;  2K8S A;  3UAR A;  3GNJ A;  1OKD A;  4V2M A;  4IHU A;  4K1F A;  1AUC A;  2H72 A;  1DE1 A;  2GQL A;  1G6W A;  3SWL A;  6GSY A;  3RBT A;  2CZ3 A;  3D21 A;  2GGT A;  3EYT A;  3GHA A;  1PD2 1;  1MD4 A;  4OO5 A;  5A4W A;  2VAF A;  1BG5 A;  3DVW A;  3D4T A;  2L57 A;  1QXH A;  2A2S A;  3UEM A;  4ZB7 A;  3L4N A;  1WMJ A;  5CAX A;  2VL9 A;  3WT1 A;  2AHE A;  1XWA A;  2PGT A;  1OAZ A;  2OAD A;  4GQF A;  2Z9S A;  2CA8 A;  1GUL A;  5LNK e;  4OFM A;  4KE3 A;  3C1S A;  3VPQ A;  2XBQ A;  1SEN A;  1V98 A;  1ACV A;  3GX0 A;  2ON7 A;  5HQP A;  2LJA A;  2K6V A;  1W89 A;  5CRW A;  2FWH A;  1FVJ A;  2TIR A;  3HVX A;  3F63 A;  3CBU A;  1M2D A;  1XWB A;  1KBN A;  2WS2 A;  2OKA A;  3H93 A;  2GST A;  4N30 A;  2REM A;  3P7X A;  4TN8 A;  5DBQ A;  2IMF A;  3BJ5 A;  3ZZX A;  1YQ1 A;  2MMO A;  3J7Y b;  2M72 A;  1CQH A;  2TRX A;  1GRX A;  2VUP A;  4PGT A;  4EDY A;  1PKZ A;  4ZL7 A;  4HQS A;  3F4S A;  4GSS A;  1WE0 A;  4ID0 A;  3HA9 A;  3IC4 A;  2R0C A;  1AXD A;  1QGV A;  4KCA A;  3MAK A;  4CY8 A;  3VFI A;  4MZC A;  1QMV A;  1GTB A;  1UN2 A;  2H71 A;  5KEJ A;  3WT2 A;  3QAV A;  1XIY A;  2GS3 A;  2AAW A;  5INY A;  1J0F A;  4JU5 A;  2M80 A;  5A1N A;  1YKA A;  4K7N A;  1UVZ A;  2H8L A;  3BCK A;  2YV9 A;  3O76 A;  3MDK A;  1B9Y C;  2I81 A;  3F0I A;  3IE3 A;  4AGS A;  5GSS A;  4CDO A;  2NBS A;  3IK7 A;  3DYR A;  3L0H A;  4KGI A;  3A2V A;  3G7I A;  5GST A;  2K8V A;  1Y6E A;  3A2W A;  4EIP A;  4PXO A;  1ON4 A;  2EIO A;  3TJG A;  4IW9 A;  1Z7R A;  3KH7 A;  3ZLP A;  4X4J A;  4F0C A;  4YQM A;  2PWJ A;  3OR5 A;  4LMV A;  2WUL A;  4MZB A;  3KH9 A;  2ZUP A;  4POM A;  3IA1 A;  1ZCP A;  4QQ7 A;  1R5P A;  4KND A;  2WJU A;  4E8E A;  2LV3 A;  3W8S A;  2V41 A;  3KJY A;  2PVQ A;  1PQN A;  1U88 A;  5F8B A;  2MMN A;  1URM A;  2V32 A;  5JCG A;  3LXZ A;  4KW6 A;  4JED A;  1NHY A;  2P0G A;  2L6D A;  1YDK A;  3C73 A;  5ECK B;  5JCW A;  3HZ4 A;  2V2G A;  2B3S A;  4XCS A;  3D6I A;  3F4T A;  4WEY A;  1TI1 A;  4LL1 B;  5ECM B;  4QMK A;  1ZOF A;  3M8N A;  2XC2 A;  1T4Y A;  8GSS A;  5J4Y A;  3GA4 A;  2JZR A;  3E3E A;  2A4H A;  2IN3 A;  2VM1 A;  2DJK A;  4Q5Q A;  1GSE A;  3NOF A;  2FNO A;  4AKG A;  3F4R A;  4LLR A;  5FHI A;  5ECR B;  2FWE A;  2DKH A;  2VM2 A;  1R4W A;  4WBJ A;  4G0I A;  2F8F A;  4BVY A;  3ZML A;  2FCH A;  1GWC A;  3MYD A;  4P3Y B;  1JLW A;  3CSJ A;  3FMW A;  2I9H A;  5A4U A;  3TKS E;  1A23 A;  1OYJ A;  4OFN A;  2B5X A;  3MSZ A;  4MP4 A;  19GS A;  1SL1 B;  1ILO A;  2WFC A;  4BL7 A;  1TP9 A;  1K0A A;  4ECC A;  1A24 A;  5G5F A;  1DSB A;  5DDL A;  2C3Q A;  1A2M A;  5FWG A;  3S9F A;  1PMT A;  3IHQ A;  3KMN A;  5ID2 B;  2XBI A;  5D9V A;  3M3M A;  5ECN B;  3DIE A;  2PVO C;  5COH A;  2QSI A;  3DVX A;  2HYX A;  3HCZ A;  3TU3 B;  4OD7 A;  3KP9 A;  3RHC A;  2UZ8 A;  4IP6 A;  4ML1 A;  1R7H A;  2NDO A;  3ED3 A;  2R3X A;  5KN0 A;  3G7J A;  1BQ7 A;  2PMT A;  3MNG A;  4PNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...