3RFRC

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
210
Chain Sequence
ESVVDLRGMWIGLAVLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVAPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGAWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGWMALGVFGVVLQILGRIHALIGKEGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 75
structure length 210
sequence length 237
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3rfrC00
3RFRC 3CHXC 4PI2C 3RGBC 1YEWC 4PHZC 4PI0C
chains in the Genus database with same CATH superfamily
1K0OA 1IYIA 1IYHA 2HSNB 1SVMA 3M3MA 5F0GA 2WB9A 2FNOA 4KE3A 2N5FA 2X64A 4L5LA 5LCZA 3FR6A 5HFKA 6GSVA 1GSQA 1GSSA 1K0BA 3I6AA 3HJOA 3ERFA 3GSTA 4GSNA 1I1IP 4IBPA 1PMTA 3MAKA 1AQXA 1V2AA 4EC0A 1EV9A 1LBKA 4HJ2A 3GTUB 4ACSA 3FY7A 2UV8G 3VI7A 1XW5A 3P8WA 3W8SA 6GSXA 5JCUA 1G7OA 2VCZA 1Z9HA 2HNLA 2WVXA 1BAYA 4JBBA 5A1NB 3TOUA 3LYPA 4IGJA 6GSUA 4PX1A 4USSA 4KAEA 1A0FA 1GLPA 4KSMA 1V40A 3QAGA 3CSHA 2C8UA 1FW1A 2GLRA 5A4VA 2GTUA 1ZGNA 3IR4A 2HRAA 3QR6A 5ECHB 4BL7B 1G6YA 4PUAA 4JEDA 3ZMLA 4O7HA 5GSTA 3CSIA 2PVQA 4G0KA 4TOPA 1HNAA 1EEMA 3LXTA 5ECKB 4PTSA 4W66A 2LJRA 4MPGA 14GSA 2HSMA 5D9VA 3R3EA 2WVZA 5J5NA 2WZSA 4MP4A 2OADA 1BF5A 3IC8A 1F2EA 2UZ8A 3O3TA 3Q74A 4AKXB 5ECOB 5DJLA 1U88A 6GSWA 6GSTA 2C4JA 4PQHA 1K0MA 3IK7A 5ELGA 5EL8A 4KDYA 5JCWA 3ISOA 3VK9A 4ECJA 4BVXA 5F05A 17GSA 1XWGA 4J2FA 2A2SA 2HRKA 3EE2A 5ECSA 1GTAA 2C80A 2GSTA 5A5KA 5AIVA 5A5HA 5AIXA 4LMVA 1EOGA 4F03A 3ZFLA 5A4WA 1C72A 2ON5A 3SWLA 3LJRA 3KM6A 2OA7A 4ECCA 3DD3A 4MK3A 1ZL9A 2GSSA 4PXOA 5J4VA 2D2ZA 5IQYA 1YEWC 2O5VA 2YCDA 4PURA 5D9XA 4EDYA 4KX4A 5J40A 2WRTA 1K0NA 5G5FA 4F0BA 3GUSA 1GTUA 4EE0A 3IK9A 1M9AA 3R2QA 3N5OA 2WDUA 1XW6A 1OKTA 4ZB9A 1K0CA 5DAKB 9GSSA 5ECLB 2PMTA 2WW1A 2YV7A 1Y1UA 4LMWA 6GSYA 3G7IA 5ECPB 2HSNA 2PERA 3AY8A 4I97A 4E8EA 4OFTA 3WD6A 2CVDA 1YQ1A 4F0CA 3GSSA 3VWXA 2VCVA 4YAPA 5B7CA 4GF0A 1KBNA 1BYEA 2WW2A 4OMVA 1GUKA 4AKGA 2VCWA 3GH6A 1GTBA 3IBHA 1GSUA 4HI7A 4EXJA 4IQ1A 2IL3A 4KGIA 4PHZC 4ISDA 1AQVA 4IVFA 1GSDA 2NTOA 5ECMB 4NAXA 4E68A 1PA3A 1U87A 1TDIA 4HZ4A 4PNGA 3GTUA 2CAIA 2VCQA 4L5OA 3LFLA 1YVLA 1M9BA 1E6BA 6GSSA 2DC5A 1M0UA 1BX9A 5A1NA 5AN1A 3GX0A 1YKCA 3VPTA 5AISA 1XWKA 5F8BA 4EDZA 10GSA 4RI6A 2R3XA 4ZB8A 2VO4A 3LG6A 3U6VA 1F3AA 1YY7A 3DGQA 4BL7A 2EFEA 11GSA 2WJUA 1Y6EA 3QAWA 4IS0A 4HZ2A 1BG1A 2C3TA 3O76A 5A34B 4MPFA 4G01A 4ZB6A 3M0FA 1MD3A 1GWCA 2GSQA 3KXOA 1U3IA 3LQ7A 3M1GA 3CHXC 4IQAA 3RBTA 1GUMA 2VD1A 4PI0C 1GLQA 2HQTA 3TU3B 4G10A 1HNBA 4KH7A 1VF4A 4E8HA 1GSYA 5BMUB 1PKWA 4L8EA 4QQ7A 2H1LA 1GSFA 2V6KA 3UAPA 4O92A 5ECQB 4DEJA 2AB6A 4Q5FA 4OFMA 1MTCA 2PBJA 1B4PA 1B48A 4ZBBA 5ECIB 3VPQA 4MDCA 3M8NA 4BVYB 4IJIA 2EFCA 18GSA 1BG5A 1MD4A 1R5AA 1M99A 3TGZA 4YH2A 22GSA 4JZQA 5D73A 3RGBC 4KF9A 1GNWA 1HQOA 3UBLA 3ERGA 3LYKA 4GSTA 5J4UA 1TXUA 1OE7A 3QAVA 3Q19A 4RI7A 16GSA 5F07A 1F3BA 3KJYA 5DAKA 1N2AA 3BBYA 3ZMKA 3UBKA 3VI5A 5ELAA 1FHEA 2ON7A 3PPUA 1UA5A 1TW9A 2JL4A 1PD21 2YV9A 5ECNB 2OT3A 2IMKA 5EVOA 4YQMA 3CRUA 20GSA 2WVYA 5FT3A 3KMNA 5J4YA 3EINA 4Q5NA 2CZ2A 4ID0A 2CZ3A 3F6DA 5DQSA 2WW0A 1OYJA 1G6WA 4OFNA 4KDUA 1K3YA 4AGSA 4AI6A 4PI2C 4QMKA 3FYGA 3PGTA 1PX7A 3NIVA 2F8FA 3FR9A 4AKIA 13GSA 1AXDA 2C3QA 4MZWA 4ZB7A 5DJMA 2VCXA 1DUGA 2R4VA 2R5GA 1AW9A 1GNEA 1PN9A 4IELA 3KMOA 4YAVA 2VKZG 4IW9A 2VD0A 3HKRA 5A4UA 3PR8A 2PGTA 3N9JA 4PQIA 1K0DA 1S4BP 1PL2A 3CRTA 3C8EA 3LSZA 5A34A 3WYWA 2VCTA 4G9HA 1GSEA 2WW3A 5EY6A 3RFRC 1GUHA 3UVHA 5J47A 2WVXB 4N0VA 5GZZB 1PGTA 1YJ6A 3IE3A 4NHWA 1AQWA 1ML6A 3TOTA 1HNCA 3VURA 4N3ZA 1K3OA 2WS2A 7GSSA 3FRCA 4K0GA 3FR3A 2CA8A 3LXZA 4ECBA 4Q5QA 1RK4A 4GDFA 5LD0A 4G0LA 2R6KA 3VLNA 2GSRA 5BMUA 4ZBAA 4MF6A 5KEJA 5G5EA 1K3LA 4HOJA 2DSAA 4FXYP 4AKHA 5J41A 3UARA 5DDLA 2IMIA 4PNFA 4PGTA 2AHEA 3CSJA 2HSMB 1LJRA 4IKHA 4BVYA 4MF5A 1GTIA 4WR5A 2EFHA 2O36A 2F3MA 2J9HA 4ECIA 1VF1A 1K0AA 3HMJG 1PKZA 5ECRB 5FWGA 19GSA 4YQUA 2CAQA 5DALA 1Q4JA 3F6FA 1NHYA 1JZRA 3MDKA 5DALB 2AAWA 1PX6A 2GDRA 2OACA 4BVXB 3CBUA 2HRKB 4G19A 3D0ZA 4GTUA 1YDKA 2A2RA 3HJMA 5F06A 1EOHA 1EV4A 5D9TA 5A5HB 1SVLA 4YQVA 4FQUA 4NHZA 3ZFBA 4WR4A 1GULA 3F63A 1JLWA 4K0NA 4G0IA 1B8XA 1JLVA 5DCGA 2C3NA 4ZBDA 3Q18A 8GSSA 3GURA 3P90A 2FHEA 1VF2A 4GSSA 1PL1A 1TU7A 3L0HA 4MF7A 12GSA 4Q5RA 1SVOA 1TU8A 2O3EA 3I69A 3KTLA 5D9WA 5GSSA 5FHIA 2EFDA 3H1NA 3CWGA 4GLTA 3G7JA 5AGYA 1USBA 1N25A 4ZXGA 4GCIA 1OE8A 1VF3A 4KDXA 4CHSA
chains in the Genus database with same CATH topology
3RFRC 3CHXC 4PI2C 3RGBC 1YEWC 4PHZC 4PI0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFR C;  3CHX C;  4PI2 C;  3RGB C;  1YEW C;  4PHZ C;  4PI0 C; 
#chains in the Genus database with same CATH topology
 1K0O A;  1IYI A;  1IYH A;  2HSN B;  1SVM A;  3M3M A;  5F0G A;  2WB9 A;  2FNO A;  4KE3 A;  2N5F A;  2X64 A;  4L5L A;  5LCZ A;  3FR6 A;  5HFK A;  6GSV A;  1GSQ A;  1GSS A;  1K0B A;  3I6A A;  3HJO A;  3ERF A;  3GST A;  4GSN A;  1I1I P;  4IBP A;  1PMT A;  3MAK A;  1AQX A;  1V2A A;  4EC0 A;  1EV9 A;  1LBK A;  4HJ2 A;  3GTU B;  4ACS A;  3FY7 A;  2UV8 G;  3VI7 A;  1XW5 A;  3P8W A;  3W8S A;  6GSX A;  5JCU A;  1G7O A;  2VCZ A;  1Z9H A;  2HNL A;  2WVX A;  1BAY A;  4JBB A;  5A1N B;  3TOU A;  3LYP A;  4IGJ A;  6GSU A;  4PX1 A;  4USS A;  4KAE A;  1A0F A;  1GLP A;  4KSM A;  1V40 A;  3QAG A;  3CSH A;  2C8U A;  1FW1 A;  2GLR A;  5A4V A;  2GTU A;  1ZGN A;  3IR4 A;  2HRA A;  3QR6 A;  5ECH B;  4BL7 B;  1G6Y A;  4PUA A;  4JED A;  3ZML A;  4O7H A;  5GST A;  3CSI A;  2PVQ A;  4G0K A;  4TOP A;  1HNA A;  1EEM A;  3LXT A;  5ECK B;  4PTS A;  4W66 A;  2LJR A;  4MPG A;  14GS A;  2HSM A;  5D9V A;  3R3E A;  2WVZ A;  5J5N A;  2WZS A;  4MP4 A;  2OAD A;  1BF5 A;  3IC8 A;  1F2E A;  2UZ8 A;  3O3T A;  3Q74 A;  4AKX B;  5ECO B;  5DJL A;  1U88 A;  6GSW A;  6GST A;  2C4J A;  4PQH A;  1K0M A;  3IK7 A;  5ELG A;  5EL8 A;  4KDY A;  5JCW A;  3ISO A;  3VK9 A;  4ECJ A;  4BVX A;  5F05 A;  17GS A;  1XWG A;  4J2F A;  2A2S A;  2HRK A;  3EE2 A;  5ECS A;  1GTA A;  2C80 A;  2GST A;  5A5K A;  5AIV A;  5A5H A;  5AIX A;  4LMV A;  1EOG A;  4F03 A;  3ZFL A;  5A4W A;  1C72 A;  2ON5 A;  3SWL A;  3LJR A;  3KM6 A;  2OA7 A;  4ECC A;  3DD3 A;  4MK3 A;  1ZL9 A;  2GSS A;  4PXO A;  5J4V A;  2D2Z A;  5IQY A;  1YEW C;  2O5V A;  2YCD A;  4PUR A;  5D9X A;  4EDY A;  4KX4 A;  5J40 A;  2WRT A;  1K0N A;  5G5F A;  4F0B A;  3GUS A;  1GTU A;  4EE0 A;  3IK9 A;  1M9A A;  3R2Q A;  3N5O A;  2WDU A;  1XW6 A;  1OKT A;  4ZB9 A;  1K0C A;  5DAK B;  9GSS A;  5ECL B;  2PMT A;  2WW1 A;  2YV7 A;  1Y1U A;  4LMW A;  6GSY A;  3G7I A;  5ECP B;  2HSN A;  2PER A;  3AY8 A;  4I97 A;  4E8E A;  4OFT A;  3WD6 A;  2CVD A;  1YQ1 A;  4F0C A;  3GSS A;  3VWX A;  2VCV A;  4YAP A;  5B7C A;  4GF0 A;  1KBN A;  1BYE A;  2WW2 A;  4OMV A;  1GUK A;  4AKG A;  2VCW A;  3GH6 A;  1GTB A;  3IBH A;  1GSU A;  4HI7 A;  4EXJ A;  4IQ1 A;  2IL3 A;  4KGI A;  4PHZ C;  4ISD A;  1AQV A;  4IVF A;  1GSD A;  2NTO A;  5ECM B;  4NAX A;  4E68 A;  1PA3 A;  1U87 A;  1TDI A;  4HZ4 A;  4PNG A;  3GTU A;  2CAI A;  2VCQ A;  4L5O A;  3LFL A;  1YVL A;  1M9B A;  1E6B A;  6GSS A;  2DC5 A;  1M0U A;  1BX9 A;  5A1N A;  5AN1 A;  3GX0 A;  1YKC A;  3VPT A;  5AIS A;  1XWK A;  5F8B A;  4EDZ A;  10GS A;  4RI6 A;  2R3X A;  4ZB8 A;  2VO4 A;  3LG6 A;  3U6V A;  1F3A A;  1YY7 A;  3DGQ A;  4BL7 A;  2EFE A;  11GS A;  2WJU A;  1Y6E A;  3QAW A;  4IS0 A;  4HZ2 A;  1BG1 A;  2C3T A;  3O76 A;  5A34 B;  4MPF A;  4G01 A;  4ZB6 A;  3M0F A;  1MD3 A;  1GWC A;  2GSQ A;  3KXO A;  1U3I A;  3LQ7 A;  3M1G A;  3CHX C;  4IQA A;  3RBT A;  1GUM A;  2VD1 A;  4PI0 C;  1GLQ A;  2HQT A;  3TU3 B;  4G10 A;  1HNB A;  4KH7 A;  1VF4 A;  4E8H A;  1GSY A;  5BMU B;  1PKW A;  4L8E A;  4QQ7 A;  2H1L A;  1GSF A;  2V6K A;  3UAP A;  4O92 A;  5ECQ B;  4DEJ A;  2AB6 A;  4Q5F A;  4OFM A;  1MTC A;  2PBJ A;  1B4P A;  1B48 A;  4ZBB A;  5ECI B;  3VPQ A;  4MDC A;  3M8N A;  4BVY B;  4IJI A;  2EFC A;  18GS A;  1BG5 A;  1MD4 A;  1R5A A;  1M99 A;  3TGZ A;  4YH2 A;  22GS A;  4JZQ A;  5D73 A;  3RGB C;  4KF9 A;  1GNW A;  1HQO A;  3UBL A;  3ERG A;  3LYK A;  4GST A;  5J4U A;  1TXU A;  1OE7 A;  3QAV A;  3Q19 A;  4RI7 A;  16GS A;  5F07 A;  1F3B A;  3KJY A;  5DAK A;  1N2A A;  3BBY A;  3ZMK A;  3UBK A;  3VI5 A;  5ELA A;  1FHE A;  2ON7 A;  3PPU A;  1UA5 A;  1TW9 A;  2JL4 A;  1PD2 1;  2YV9 A;  5ECN B;  2OT3 A;  2IMK A;  5EVO A;  4YQM A;  3CRU A;  20GS A;  2WVY A;  5FT3 A;  3KMN A;  5J4Y A;  3EIN A;  4Q5N A;  2CZ2 A;  4ID0 A;  2CZ3 A;  3F6D A;  5DQS A;  2WW0 A;  1OYJ A;  1G6W A;  4OFN A;  4KDU A;  1K3Y A;  4AGS A;  4AI6 A;  4PI2 C;  4QMK A;  3FYG A;  3PGT A;  1PX7 A;  3NIV A;  2F8F A;  3FR9 A;  4AKI A;  13GS A;  1AXD A;  2C3Q A;  4MZW A;  4ZB7 A;  5DJM A;  2VCX A;  1DUG A;  2R4V A;  2R5G A;  1AW9 A;  1GNE A;  1PN9 A;  4IEL A;  3KMO A;  4YAV A;  2VKZ G;  4IW9 A;  2VD0 A;  3HKR A;  5A4U A;  3PR8 A;  2PGT A;  3N9J A;  4PQI A;  1K0D A;  1S4B P;  1PL2 A;  3CRT A;  3C8E A;  3LSZ A;  5A34 A;  3WYW A;  2VCT A;  4G9H A;  1GSE A;  2WW3 A;  5EY6 A;  3RFR C;  1GUH A;  3UVH A;  5J47 A;  2WVX B;  4N0V A;  5GZZ B;  1PGT A;  1YJ6 A;  3IE3 A;  4NHW A;  1AQW A;  1ML6 A;  3TOT A;  1HNC A;  3VUR A;  4N3Z A;  1K3O A;  2WS2 A;  7GSS A;  3FRC A;  4K0G A;  3FR3 A;  2CA8 A;  3LXZ A;  4ECB A;  4Q5Q A;  1RK4 A;  4GDF A;  5LD0 A;  4G0L A;  2R6K A;  3VLN A;  2GSR A;  5BMU A;  4ZBA A;  4MF6 A;  5KEJ A;  5G5E A;  1K3L A;  4HOJ A;  2DSA A;  4FXY P;  4AKH A;  5J41 A;  3UAR A;  5DDL A;  2IMI A;  4PNF A;  4PGT A;  2AHE A;  3CSJ A;  2HSM B;  1LJR A;  4IKH A;  4BVY A;  4MF5 A;  1GTI A;  4WR5 A;  2EFH A;  2O36 A;  2F3M A;  2J9H A;  4ECI A;  1VF1 A;  1K0A A;  3HMJ G;  1PKZ A;  5ECR B;  5FWG A;  19GS A;  4YQU A;  2CAQ A;  5DAL A;  1Q4J A;  3F6F A;  1NHY A;  1JZR A;  3MDK A;  5DAL B;  2AAW A;  1PX6 A;  2GDR A;  2OAC A;  4BVX B;  3CBU A;  2HRK B;  4G19 A;  3D0Z A;  4GTU A;  1YDK A;  2A2R A;  3HJM A;  5F06 A;  1EOH A;  1EV4 A;  5D9T A;  5A5H B;  1SVL A;  4YQV A;  4FQU A;  4NHZ A;  3ZFB A;  4WR4 A;  1GUL A;  3F63 A;  1JLW A;  4K0N A;  4G0I A;  1B8X A;  1JLV A;  5DCG A;  2C3N A;  4ZBD A;  3Q18 A;  8GSS A;  3GUR A;  3P90 A;  2FHE A;  1VF2 A;  4GSS A;  1PL1 A;  1TU7 A;  3L0H A;  4MF7 A;  12GS A;  4Q5R A;  1SVO A;  1TU8 A;  2O3E A;  3I69 A;  3KTL A;  5D9W A;  5GSS A;  5FHI A;  2EFD A;  3H1N A;  3CWG A;  4GLT A;  3G7J A;  5AGY A;  1USB A;  1N25 A;  4ZXG A;  4GCI A;  1OE8 A;  1VF3 A;  4KDX A;  4CHS A; 
#chains in the Genus database with same CATH homology
 3RFR C;  3CHX C;  4PI2 C;  3RGB C;  1YEW C;  4PHZ C;  4PI0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...