3RFRC

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
210
Chain Sequence
ESVVDLRGMWIGLAVLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVAPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGAWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGWMALGVFGVVLQILGRIHALIGKEGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
total genus 75
structure length 210
sequence length 237
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3rfrC00
3RFRC 4PI2C 3RGBC 1YEWC 4PHZC 3CHXC 4PI0C
chains in the Genus database with same CATH superfamily
3FR6A 4G10A 4F0CA 3C8EA 2GSTA 2DSAA 1OYJA 2CZ2A 1GSDA 18GSA 1GSEA 1R5AA 2HNLA 4OMVA 5ECIB 1ML6A 2HRAA 4MPGA 4MP4A 2FNOA 1PKWA 3UAPA 2HQTA 2H1LA 3UBLA 6GSYA 3KTLA 4JZQA 4IS0A 3M0FA 2WJUA 4W66A 2WB9A 3HJMA 2WS2A 2WW3A 4KDYA 1OKTA 3CRUA 1PKZA 1EV9A 4LMWA 4ZB8A 3PR8A 2NTOA 4KDUA 3M1GA 4PX1A 1HNCA 2EFCA 5A34B 4BL7B 3Q18A 1GNEA 4KDXA 5D73A 4PI0C 3R2QA 3IC8A 3Q19A 5J47A 2O36A 1EOGA 1GUMA 1M9BA 1XWKA 4GSTA 2CAIA 4I97A 4L5LA 5F8BA 5A5HA 2A2RA 5EY6A 5AIVA 5HFKA 3UBKA 1GUKA 4MF7A 5ECQB 4PXOA 3CWGA 5A34A 3IR4A 4RI7A 5J4UA 1RK4A 1YVLA 5J5NA 2WVZA 3ZFLA 1K0CA 2CVDA 4K0GA 4EDYA 3LXTA 4IBPA 2C3NA 3IK9A 4YQVA 4NAXA 4YQUA 3DGQA 2R3XA 3ERFA 3GX0A 1JLVA 1XW6A 4O92A 1M0UA 1UA5A 1SVLA 2C8UA 4LMVA 4MDCA 4ZBAA 4ZB7A 3L0HA 1KBNA 4PGTA 4YQMA 2WDUA 2OACA 3LSZA 5IQYA 4ZBDA 4N3ZA 5A4VA 2PVQA 3HKRA 5JCUA 3CHXC 2IMKA 1PN9A 2D2ZA 5FHIA 2HSMA 3LG6A 4ECIA 3F63A 1OE8A 5F0GA 4ID0A 1HQOA 1K0DA 2HSNB 1TW9A 3CBUA 4PURA 4HOJA 4IELA 5G5EA 2GTUA 5AISA 2VD1A 3D0ZA 4PTSA 2WZSA 4IKHA 4WR5A 2CA8A 5AGYA 4BVYB 2VCTA 3G7IA 1Z9HA 1VF3A 4EDZA 4KSMA 1GNWA 3UVHA 6GSWA 3QR6A 5DAKA 4AKIA 4WR4A 1PGTA 13GSA 6GSXA 4FXYP 5A1NB 4KGIA 4NHZA 5ECKB 1F3AA 3QAVA 1V2AA 2EFEA 1U87A 1YJ6A 3GSSA 3ISOA 1GWCA 4KF9A 5ECNB 3W8SA 2AAWA 2VCVA 3GURA 2UZ8A 4AKXB 5FT3A 1FHEA 6GSUA 5AN1A 3WYWA 3PGTA 12GSA 1XWGA 2R5GA 4BVXB 1B48A 2YCDA 7GSSA 1AQXA 1MTCA 1Y6EA 1E6BA 1LJRA 5AIXA 1BYEA 1GTBA 3IK7A 3H1NA 4HJ2A 1Q4JA 5J40A 3ERGA 4Q5NA 1A0FA 1K0OA 2FHEA 3QAWA 3RGBC 3KXOA 4G0LA 2WRTA 4GSSA 5FWGA 5DDLA 4GLTA 1JLWA 5A4UA 3ZMLA 4EE0A 2LJRA 2R4VA 1EOHA 2HRKB 3LFLA 4OFMA 4E8EA 1B8XA 4IW9A 2C4JA 1M9AA 3FR3A 3EE2A 4GTUA 5D9VA 3ZMKA 1Y1UA 4ECCA 5DCGA 5DJLA 3LYPA 2X64A 5J4YA 3VLNA 5ECLB 2F3MA 4G9HA 1G6WA 3MAKA 3VPTA 3LQ7A 1GSFA 3TU3B 1I1IP 2V6KA 5ECOB 3KM6A 5EL8A 4EC0A 1TDIA 1JZRA 4GF0A 3M8NA 4BL7A 5GSSA 3MDKA 4PHZC 4JEDA 4MPFA 1G7OA 1AXDA 1F2EA 1N2AA 5J41A 4IQ1A 1GSUA 3SWLA 4F03A 3TOTA 5F07A 4ACSA 5JCWA 1MD4A 4TOPA 4GSNA 4ECJA 5DJMA 2A2SA 2YV7A 4E8HA 2JL4A 4MZWA 1YKCA 3LJRA 1ZGNA 4G0KA 3GTUB 17GSA 5EVOA 1OE7A 1G6YA 1B4PA 1BAYA 2WVXB 3O3TA 4O7HA 4AGSA 4AI6A 1BG5A 3LXZA 5DALB 1EV4A 5ECPB 4YAVA 1K0AA 2WW1A 5LD0A 4DEJA 5DQSA 2GDRA 4GCIA 1SVMA 1VF1A 2VKZG 4MK3A 3FY7A 2HSNA 4HZ4A 2EFHA 3NIVA 3M3MA 3U6VA 2VCZA 4FQUA 3EINA 3VI7A 5ECHB 8GSSA 2VCWA 3BBYA 2EFDA 3IE3A 5A5KA 4EXJA 4YH2A 1ZL9A 2VD0A 4BVYA 4MF6A 3VPQA 3DD3A 4Q5RA 4USSA 1IYIA 1S4BP 3N9JA 2ON7A 4J2FA 5F06A 1GUHA 5A1NA 1BG1A 5ELGA 3GH6A 4OFNA 1TU7A 4AKGA 5BMUB 10GSA 4PUAA 2CAQA 1EEMA 1V40A 4K0NA 1LBKA 2WW2A 22GSA 2GSQA 3CSJA 1FW1A 3QAGA 4PNGA 2CZ3A 4AKHA 2UV8G 11GSA 5D9TA 1USBA 3P90A 4OFTA 3TGZA 4N0VA 3VI5A 4BVXA 5B7CA 5BMUA 1GSYA 2GSRA 5G5FA 3LYKA 4Q5FA 4F0BA 4G01A 1N25A 1PD21 4IGJA 5GSTA 1SVOA 3G7JA 4PQIA 3CRTA 2ON5A 4L8EA 1PX7A 3VK9A 3N5OA 2DC5A 3R3EA 2C3TA 2J9HA 5ELAA 4GDFA 1GSQA 5LCZA 4ISDA 2HRKA 3UARA 2YV9A 4Q5QA 2PBJA 3KMOA 6GSTA 2AB6A 5D9XA 5A5HB 1F3BA 1PMTA 3RFRC 2PGTA 1VF4A 3PPUA 3I69A 3IBHA 1YQ1A 4ECBA 3F6FA 4IVFA 14GSA 4G19A 3KMNA 4PI2C 1XW5A 1GTAA 3FYGA 4G0IA 1AQVA 2WVYA 1M99A 3RBTA 1HNAA 5KEJA 1U3IA 2N5FA 16GSA 3VWXA 3HJOA 3VURA 4NHWA 1GLQA 1YEWC 3FRCA 5ECSA 1PL1A 1K0NA 1HNBA 1MD3A 2C3QA 2OA7A 3ZFBA 9GSSA 3CSHA 2O3EA 1K3YA 1IYHA 4ZB6A 1NHYA 1YDKA 4IQAA 2PMTA 4KAEA 4HI7A 4PNFA 1TU8A 1YY7A 2R6KA 3F6DA 3WD6A 2HSMB 4IJIA 1U88A 4KH7A 1AW9A 3O76A 1K0MA 6GSVA 4E68A 4KX4A 1AQWA 1K3OA 4HZ2A 4QQ7A 1BX9A 3Q74A 4MF5A 4PQHA 3GTUA 3GUSA 20GSA 4CHSA 1C72A 2OADA 1GTUA 2AHEA 2WW0A 2WVXA 4QMKA 4ZBBA 2GLRA 4RI6A 5DALA 1PL2A 5D9WA 1K0BA 5ECMB 5J4VA 5DAKB 1TXUA 1VF2A 1DUGA 2C80A 2VCQA 5GZZB 3KJYA 6GSSA 3I6AA 5ECRB 1K3LA 4ZXGA 3AY8A 4YAPA 1BF5A 2GSSA 3FR9A 3CSIA 2IMIA 4ZB9A 2F8FA 1GSSA 2PERA 5A4WA 2VCXA 4JBBA 4L5OA 3TOUA 2IL3A 1PX6A 2VO4A 2OT3A 5F05A 1PA3A 1GULA 3GSTA 1GTIA 3P8WA 2O5VA 3HMJG 19GSA 1GLPA 4KE3A
chains in the Genus database with same CATH topology
3RFRC 4PI2C 3RGBC 1YEWC 4PHZC 3CHXC 4PI0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFR C;  4PI2 C;  3RGB C;  1YEW C;  4PHZ C;  3CHX C;  4PI0 C; 
#chains in the Genus database with same CATH topology
 3FR6 A;  4G10 A;  4F0C A;  3C8E A;  2GST A;  2DSA A;  1OYJ A;  2CZ2 A;  1GSD A;  18GS A;  1GSE A;  1R5A A;  2HNL A;  4OMV A;  5ECI B;  1ML6 A;  2HRA A;  4MPG A;  4MP4 A;  2FNO A;  1PKW A;  3UAP A;  2HQT A;  2H1L A;  3UBL A;  6GSY A;  3KTL A;  4JZQ A;  4IS0 A;  3M0F A;  2WJU A;  4W66 A;  2WB9 A;  3HJM A;  2WS2 A;  2WW3 A;  4KDY A;  1OKT A;  3CRU A;  1PKZ A;  1EV9 A;  4LMW A;  4ZB8 A;  3PR8 A;  2NTO A;  4KDU A;  3M1G A;  4PX1 A;  1HNC A;  2EFC A;  5A34 B;  4BL7 B;  3Q18 A;  1GNE A;  4KDX A;  5D73 A;  4PI0 C;  3R2Q A;  3IC8 A;  3Q19 A;  5J47 A;  2O36 A;  1EOG A;  1GUM A;  1M9B A;  1XWK A;  4GST A;  2CAI A;  4I97 A;  4L5L A;  5F8B A;  5A5H A;  2A2R A;  5EY6 A;  5AIV A;  5HFK A;  3UBK A;  1GUK A;  4MF7 A;  5ECQ B;  4PXO A;  3CWG A;  5A34 A;  3IR4 A;  4RI7 A;  5J4U A;  1RK4 A;  1YVL A;  5J5N A;  2WVZ A;  3ZFL A;  1K0C A;  2CVD A;  4K0G A;  4EDY A;  3LXT A;  4IBP A;  2C3N A;  3IK9 A;  4YQV A;  4NAX A;  4YQU A;  3DGQ A;  2R3X A;  3ERF A;  3GX0 A;  1JLV A;  1XW6 A;  4O92 A;  1M0U A;  1UA5 A;  1SVL A;  2C8U A;  4LMV A;  4MDC A;  4ZBA A;  4ZB7 A;  3L0H A;  1KBN A;  4PGT A;  4YQM A;  2WDU A;  2OAC A;  3LSZ A;  5IQY A;  4ZBD A;  4N3Z A;  5A4V A;  2PVQ A;  3HKR A;  5JCU A;  3CHX C;  2IMK A;  1PN9 A;  2D2Z A;  5FHI A;  2HSM A;  3LG6 A;  4ECI A;  3F63 A;  1OE8 A;  5F0G A;  4ID0 A;  1HQO A;  1K0D A;  2HSN B;  1TW9 A;  3CBU A;  4PUR A;  4HOJ A;  4IEL A;  5G5E A;  2GTU A;  5AIS A;  2VD1 A;  3D0Z A;  4PTS A;  2WZS A;  4IKH A;  4WR5 A;  2CA8 A;  5AGY A;  4BVY B;  2VCT A;  3G7I A;  1Z9H A;  1VF3 A;  4EDZ A;  4KSM A;  1GNW A;  3UVH A;  6GSW A;  3QR6 A;  5DAK A;  4AKI A;  4WR4 A;  1PGT A;  13GS A;  6GSX A;  4FXY P;  5A1N B;  4KGI A;  4NHZ A;  5ECK B;  1F3A A;  3QAV A;  1V2A A;  2EFE A;  1U87 A;  1YJ6 A;  3GSS A;  3ISO A;  1GWC A;  4KF9 A;  5ECN B;  3W8S A;  2AAW A;  2VCV A;  3GUR A;  2UZ8 A;  4AKX B;  5FT3 A;  1FHE A;  6GSU A;  5AN1 A;  3WYW A;  3PGT A;  12GS A;  1XWG A;  2R5G A;  4BVX B;  1B48 A;  2YCD A;  7GSS A;  1AQX A;  1MTC A;  1Y6E A;  1E6B A;  1LJR A;  5AIX A;  1BYE A;  1GTB A;  3IK7 A;  3H1N A;  4HJ2 A;  1Q4J A;  5J40 A;  3ERG A;  4Q5N A;  1A0F A;  1K0O A;  2FHE A;  3QAW A;  3RGB C;  3KXO A;  4G0L A;  2WRT A;  4GSS A;  5FWG A;  5DDL A;  4GLT A;  1JLW A;  5A4U A;  3ZML A;  4EE0 A;  2LJR A;  2R4V A;  1EOH A;  2HRK B;  3LFL A;  4OFM A;  4E8E A;  1B8X A;  4IW9 A;  2C4J A;  1M9A A;  3FR3 A;  3EE2 A;  4GTU A;  5D9V A;  3ZMK A;  1Y1U A;  4ECC A;  5DCG A;  5DJL A;  3LYP A;  2X64 A;  5J4Y A;  3VLN A;  5ECL B;  2F3M A;  4G9H A;  1G6W A;  3MAK A;  3VPT A;  3LQ7 A;  1GSF A;  3TU3 B;  1I1I P;  2V6K A;  5ECO B;  3KM6 A;  5EL8 A;  4EC0 A;  1TDI A;  1JZR A;  4GF0 A;  3M8N A;  4BL7 A;  5GSS A;  3MDK A;  4PHZ C;  4JED A;  4MPF A;  1G7O A;  1AXD A;  1F2E A;  1N2A A;  5J41 A;  4IQ1 A;  1GSU A;  3SWL A;  4F03 A;  3TOT A;  5F07 A;  4ACS A;  5JCW A;  1MD4 A;  4TOP A;  4GSN A;  4ECJ A;  5DJM A;  2A2S A;  2YV7 A;  4E8H A;  2JL4 A;  4MZW A;  1YKC A;  3LJR A;  1ZGN A;  4G0K A;  3GTU B;  17GS A;  5EVO A;  1OE7 A;  1G6Y A;  1B4P A;  1BAY A;  2WVX B;  3O3T A;  4O7H A;  4AGS A;  4AI6 A;  1BG5 A;  3LXZ A;  5DAL B;  1EV4 A;  5ECP B;  4YAV A;  1K0A A;  2WW1 A;  5LD0 A;  4DEJ A;  5DQS A;  2GDR A;  4GCI A;  1SVM A;  1VF1 A;  2VKZ G;  4MK3 A;  3FY7 A;  2HSN A;  4HZ4 A;  2EFH A;  3NIV A;  3M3M A;  3U6V A;  2VCZ A;  4FQU A;  3EIN A;  3VI7 A;  5ECH B;  8GSS A;  2VCW A;  3BBY A;  2EFD A;  3IE3 A;  5A5K A;  4EXJ A;  4YH2 A;  1ZL9 A;  2VD0 A;  4BVY A;  4MF6 A;  3VPQ A;  3DD3 A;  4Q5R A;  4USS A;  1IYI A;  1S4B P;  3N9J A;  2ON7 A;  4J2F A;  5F06 A;  1GUH A;  5A1N A;  1BG1 A;  5ELG A;  3GH6 A;  4OFN A;  1TU7 A;  4AKG A;  5BMU B;  10GS A;  4PUA A;  2CAQ A;  1EEM A;  1V40 A;  4K0N A;  1LBK A;  2WW2 A;  22GS A;  2GSQ A;  3CSJ A;  1FW1 A;  3QAG A;  4PNG A;  2CZ3 A;  4AKH A;  2UV8 G;  11GS A;  5D9T A;  1USB A;  3P90 A;  4OFT A;  3TGZ A;  4N0V A;  3VI5 A;  4BVX A;  5B7C A;  5BMU A;  1GSY A;  2GSR A;  5G5F A;  3LYK A;  4Q5F A;  4F0B A;  4G01 A;  1N25 A;  1PD2 1;  4IGJ A;  5GST A;  1SVO A;  3G7J A;  4PQI A;  3CRT A;  2ON5 A;  4L8E A;  1PX7 A;  3VK9 A;  3N5O A;  2DC5 A;  3R3E A;  2C3T A;  2J9H A;  5ELA A;  4GDF A;  1GSQ A;  5LCZ A;  4ISD A;  2HRK A;  3UAR A;  2YV9 A;  4Q5Q A;  2PBJ A;  3KMO A;  6GST A;  2AB6 A;  5D9X A;  5A5H B;  1F3B A;  1PMT A;  3RFR C;  2PGT A;  1VF4 A;  3PPU A;  3I69 A;  3IBH A;  1YQ1 A;  4ECB A;  3F6F A;  4IVF A;  14GS A;  4G19 A;  3KMN A;  4PI2 C;  1XW5 A;  1GTA A;  3FYG A;  4G0I A;  1AQV A;  2WVY A;  1M99 A;  3RBT A;  1HNA A;  5KEJ A;  1U3I A;  2N5F A;  16GS A;  3VWX A;  3HJO A;  3VUR A;  4NHW A;  1GLQ A;  1YEW C;  3FRC A;  5ECS A;  1PL1 A;  1K0N A;  1HNB A;  1MD3 A;  2C3Q A;  2OA7 A;  3ZFB A;  9GSS A;  3CSH A;  2O3E A;  1K3Y A;  1IYH A;  4ZB6 A;  1NHY A;  1YDK A;  4IQA A;  2PMT A;  4KAE A;  4HI7 A;  4PNF A;  1TU8 A;  1YY7 A;  2R6K A;  3F6D A;  3WD6 A;  2HSM B;  4IJI A;  1U88 A;  4KH7 A;  1AW9 A;  3O76 A;  1K0M A;  6GSV A;  4E68 A;  4KX4 A;  1AQW A;  1K3O A;  4HZ2 A;  4QQ7 A;  1BX9 A;  3Q74 A;  4MF5 A;  4PQH A;  3GTU A;  3GUS A;  20GS A;  4CHS A;  1C72 A;  2OAD A;  1GTU A;  2AHE A;  2WW0 A;  2WVX A;  4QMK A;  4ZBB A;  2GLR A;  4RI6 A;  5DAL A;  1PL2 A;  5D9W A;  1K0B A;  5ECM B;  5J4V A;  5DAK B;  1TXU A;  1VF2 A;  1DUG A;  2C80 A;  2VCQ A;  5GZZ B;  3KJY A;  6GSS A;  3I6A A;  5ECR B;  1K3L A;  4ZXG A;  3AY8 A;  4YAP A;  1BF5 A;  2GSS A;  3FR9 A;  3CSI A;  2IMI A;  4ZB9 A;  2F8F A;  1GSS A;  2PER A;  5A4W A;  2VCX A;  4JBB A;  4L5O A;  3TOU A;  2IL3 A;  1PX6 A;  2VO4 A;  2OT3 A;  5F05 A;  1PA3 A;  1GUL A;  3GST A;  1GTI A;  3P8W A;  2O5V A;  3HMJ G;  19GS A;  1GLP A;  4KE3 A; 
#chains in the Genus database with same CATH homology
 3RFR C;  4PI2 C;  3RGB C;  1YEW C;  4PHZ C;  3CHX C;  4PI0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...