3RFRC

Crystal structure of particulate methane monooxygenase (pmmo) from methylocystis sp. strain m
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
210
Chain Sequence
b'ESVVDLRGMWIGLAVLNVFYLIVRIYEQVFGWRAGLDSFAPEFQTYWMSILWTEIPLELVSGLGLAGYLWKTRDRNVDAVAPREEMRRLVVLVQWLVVYGIAIYWGASFFTEQDGAWHMTVIRDTDFTPSHIIEFYMSYPIYSVIAVGAFFYAKTRIPYFAHGYSLAFLIVAIGPFMIIPNVGWMALGVFGVVLQILGRIHALIGKEGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PmoB
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 75
structure length 210
sequence length 237
chains with identical sequence G, K
ec nomenclature
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04896 AmoC Ammonia monooxygenase/methane monooxygenase, subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.50 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Particulate methane monooxygenase subunit c2. Chain: C 3rfrC00
4PI0C 4PI2C 3RGBC 1YEWC 3RFRC 3CHXC 4PHZC
chains in the Genus database with same CATH superfamily
1Y6EA 2X64A 4GDFA 1TU8A 4MF7A 2GDRA 5DCGA 3VI7A 5J4YA 4WR5A 3TGZA 3I6AA 8GSSA 1PL1A 1PKWA 11GSA 4ECBA 5A34A 1YKCA 3F6FA 1SVMA 1OKTA 1K3YA 2PERA 4RI6A 3VPQA 4ZB6A 5A5HA 1M9AA 4JBBA 4PXOA 5ECOB 12GSA 3MAKA 4O92A 4LMWA 1F2EA 5F06A 4L5LA 1FHEA 3FR3A 4MK3A 1RK4A 4ISDA 1IYHA 4PUAA 2HSMB 4IKHA 1BG1A 5J4VA 1PMTA 1C72A 4MF6A 3GSSA 1K3OA 2HSNB 2WDUA 3KM6A 4KDUA 6GSUA 3ERGA 4EC0A 3HMJG 1B48A 4CHSA 3NIVA 1DUGA 3W8SA 3BBYA 1HNBA 5EY6A 1MD4A 2WW0A 1M99A 4HZ2A 1PKZA 2ON5A 3O3TA 5ECRB 4L8EA 2PVQA 4IS0A 20GSA 3N5OA 4ZB7A 4ID0A 2IMIA 3IC8A 1OE7A 4K0NA 2VD0A 5AIXA 3LJRA 4KGIA 1K0MA 2H1LA 4KX4A 1USBA 1YJ6A 2A2RA 5GSSA 4WR4A 2J9HA 1K0CA 4G01A 4KH7A 4YQVA 5ECSA 4QQ7A 3LXTA 3GTUA 3ZFBA 1LJRA 3DD3A 1K0DA 1U3IA 1AQWA 4G0LA 3F63A 4I97A 3GUSA 1GULA 2JL4A 3KMOA 4ACSA 4Q5RA 1AW9A 1AQVA 1B4PA 4MZWA 1Y1UA 2IL3A 3R2QA 2UZ8A 5ELAA 4AKHA 3ZMKA 2EFHA 3H1NA 4KSMA 4PNGA 1AQXA 3VWXA 4G10A 3KXOA 2OADA 4ZB9A 4G0KA 1VF2A 2ON7A 4BL7A 1VF3A 2DC5A 1K3LA 2VCXA 5J47A 5AIVA 2R6KA 5DDLA 2N5FA 4GTUA 1Z9HA 5KEJA 1K0AA 4Q5FA 4L5OA 3UAPA 1XWGA 3Q74A 3RFRC 2YV9A 3G7JA 1TXUA 3LSZA 4HZ4A 4HJ2A 3HJOA 3LG6A 2WZSA 3CSIA 5DJMA 4TOPA 5J41A 2V6KA 5A5KA 3UARA 2F3MA 4OFTA 3QR6A 3FR9A 3IK7A 2YCDA 4GSNA 3UBLA 2O36A 3O76A 3GSTA 3N9JA 14GSA 1GSDA 4USSA 4ZXGA 1EOGA 2VCVA 3IK9A 1BG5A 5FT3A 4MPFA 3CHXC 2VCWA 5DALA 1R5AA 4ZB8A 6GSTA 5B7CA 1ZGNA 4PTSA 1LBKA 1K0OA 5A4VA 4BVYA 13GSA 2WVXB 2EFDA 1FW1A 5J40A 2OA7A 1V2AA 3RGBC 3TOTA 1PL2A 3I69A 18GSA 3WYWA 1YY7A 5LD0A 3M3MA 4FXYP 3CBUA 4YH2A 5IQYA 4LMVA 3EINA 2CAIA 5A4UA 4ECIA 4J2FA 4IW9A 4PI2C 1V40A 1JZRA 1JLVA 4G0IA 1PN9A 4AKXB 6GSWA 4PQIA 3VURA 2GLRA 1XW6A 3FY7A 2R5GA 2WVZA 1PGTA 4G9HA 5A4WA 2O3EA 2F8FA 2NTOA 1F3BA 1EOHA 1AXDA 2C3NA 1GSFA 3CRUA 3GURA 5ECIB 3KTLA 4E8EA 4PQHA 4KF9A 5GZZB 3CWGA 3GH6A 2VCQA 3ISOA 6GSVA 4MP4A 2GSSA 3PGTA 1GTBA 1GLPA 4PURA 1GWCA 3RBTA 3ZFLA 4YQUA 1UA5A 3PPUA 2EFEA 3EE2A 3VPTA 1ZL9A 4OMVA 2CVDA 1GLQA 4N0VA 2DSAA 4O7HA 4KDXA 17GSA 5D9WA 1G7OA 3PR8A 2CZ3A 1PA3A 1I1IP 2WVXA 4ZBAA 3TOUA 1GUKA 1YVLA 3M8NA 5ELGA 3CSHA 5DAKB 3F6DA 5G5EA 2HSMA 19GSA 2CAQA 1HQOA 5ECMB 1GSEA 1ML6A 5GSTA 2WJUA 2PMTA 3R3EA 4BVXB 2HSNA 2OACA 5F07A 1HNAA 5LCZA 3HKRA 1G6YA 3Q18A 3ERFA 4AI6A 1K0NA 1F3AA 1N25A 4EDZA 5AN1A 4F03A 5A34B 3KJYA 3VLNA 6GSYA 5D9XA 1IYIA 3UBKA 2AB6A 2GSTA 1BF5A 2O5VA 4IVFA 4ZBDA 5ECPB 3IR4A 2C4JA 1MTCA 3FYGA 4GSSA 4F0CA 1VF4A 4PHZC 1SVLA 5HFKA 1KBNA 5F8BA 1U88A 4E68A 5F0GA 4FQUA 1BYEA 6GSSA 3U6VA 3WD6A 2CZ2A 4GF0A 3LYPA 1YEWC 6GSXA 4OFMA 2LJRA 16GSA 2WS2A 1EEMA 3AY8A 1SVOA 1K0BA 5D9VA 5ECHB 1EV4A 1XW5A 4GSTA 1TW9A 4DEJA 4NHWA 5G5FA 1U87A 4Q5QA 2GTUA 1GUHA 4IGJA 4MDCA 22GSA 2GSRA 5F05A 4BVXA 4MF5A 3QAGA 3UVHA 3VK9A 4PNFA 2AHEA 3M0FA 4NHZA 3CSJA 4N3ZA 2R3XA 2CA8A 1GSUA 3C8EA 1GSYA 4JZQA 1GNWA 1VF1A 2C3QA 3LXZA 5EVOA 2WW1A 2R4VA 4AKIA 1A0FA 3G7IA 4OFNA 3VI5A 4GCIA 2HRKB 5BMUB 4AKGA 1GNEA 3KMNA 3FR6A 2FNOA 10GSA 9GSSA 3LYKA 5AISA 2C80A 2GSQA 4KE3A 4E8HA 3Q19A 2HNLA 2WW3A 2IMKA 1HNCA 2WRTA 3FRCA 5J5NA 3IE3A 3GTUB 5ECNB 1GUMA 2VKZG 4PI0C 3LFLA 3CRTA 2HRAA 5JCWA 3P90A 5AGYA 3SWLA 1M0UA 1XWKA 5D73A 4HI7A 4EDYA 3L0HA 3LQ7A 2OT3A 1PX6A 4EXJA 3QAWA 1EV9A 1PD21 1S4BP 1TU7A 1GTAA 1GSQA 4BL7B 1E6BA 4HOJA 4IBPA 7GSSA 3IBHA 2VCTA 2WB9A 4G19A 5DJLA 1GTUA 4ECJA 4EE0A 5FHIA 3P8WA 5A1NB 4KAEA 1BX9A 3HJMA 2PBJA 2VD1A 2YV7A 4NAXA 2HQTA 4IELA 4IQ1A 3ZMLA 2WW2A 5BMUA 2HRKA 1TDIA 2C3TA 4MPGA 5J4UA 4IJIA 1OYJA 1PX7A 4F0BA 1YDKA 3QAVA 3M1GA 3GX0A 5ECQB 1NHYA 1GTIA 2A2SA 4W66A 1M9BA 1JLWA 1GSSA 2D2ZA 2C8UA 4YAPA 5A5HB 5FWGA 1B8XA 4JEDA 4PX1A 4YAVA 5DALB 5JCUA 4IQAA 5ECKB 4YQMA 3MDKA 4BVYB 1BAYA 2VCZA 5DQSA 2WVYA 4ZBBA 4QMKA 2FHEA 4AGSA 1N2AA 4PGTA 1OE8A 3D0ZA 4RI7A 5D9TA 1G6WA 4KDYA 1MD3A 2UV8G 5A1NA 2AAWA 4GLTA 1Q4JA 4K0GA 5DAKA 2EFCA 4Q5NA 4ECCA 2VO4A 5EL8A 1YQ1A 2PGTA 5ECLB 3DGQA 3TU3B
chains in the Genus database with same CATH topology
4PI0C 4PI2C 3RGBC 1YEWC 3RFRC 3CHXC 4PHZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI0 C;  4PI2 C;  3RGB C;  1YEW C;  3RFR C;  3CHX C;  4PHZ C; 
#chains in the Genus database with same CATH topology
 1Y6E A;  2X64 A;  4GDF A;  1TU8 A;  4MF7 A;  2GDR A;  5DCG A;  3VI7 A;  5J4Y A;  4WR5 A;  3TGZ A;  3I6A A;  8GSS A;  1PL1 A;  1PKW A;  11GS A;  4ECB A;  5A34 A;  1YKC A;  3F6F A;  1SVM A;  1OKT A;  1K3Y A;  2PER A;  4RI6 A;  3VPQ A;  4ZB6 A;  5A5H A;  1M9A A;  4JBB A;  4PXO A;  5ECO B;  12GS A;  3MAK A;  4O92 A;  4LMW A;  1F2E A;  5F06 A;  4L5L A;  1FHE A;  3FR3 A;  4MK3 A;  1RK4 A;  4ISD A;  1IYH A;  4PUA A;  2HSM B;  4IKH A;  1BG1 A;  5J4V A;  1PMT A;  1C72 A;  4MF6 A;  3GSS A;  1K3O A;  2HSN B;  2WDU A;  3KM6 A;  4KDU A;  6GSU A;  3ERG A;  4EC0 A;  3HMJ G;  1B48 A;  4CHS A;  3NIV A;  1DUG A;  3W8S A;  3BBY A;  1HNB A;  5EY6 A;  1MD4 A;  2WW0 A;  1M99 A;  4HZ2 A;  1PKZ A;  2ON5 A;  3O3T A;  5ECR B;  4L8E A;  2PVQ A;  4IS0 A;  20GS A;  3N5O A;  4ZB7 A;  4ID0 A;  2IMI A;  3IC8 A;  1OE7 A;  4K0N A;  2VD0 A;  5AIX A;  3LJR A;  4KGI A;  1K0M A;  2H1L A;  4KX4 A;  1USB A;  1YJ6 A;  2A2R A;  5GSS A;  4WR4 A;  2J9H A;  1K0C A;  4G01 A;  4KH7 A;  4YQV A;  5ECS A;  4QQ7 A;  3LXT A;  3GTU A;  3ZFB A;  1LJR A;  3DD3 A;  1K0D A;  1U3I A;  1AQW A;  4G0L A;  3F63 A;  4I97 A;  3GUS A;  1GUL A;  2JL4 A;  3KMO A;  4ACS A;  4Q5R A;  1AW9 A;  1AQV A;  1B4P A;  4MZW A;  1Y1U A;  2IL3 A;  3R2Q A;  2UZ8 A;  5ELA A;  4AKH A;  3ZMK A;  2EFH A;  3H1N A;  4KSM A;  4PNG A;  1AQX A;  3VWX A;  4G10 A;  3KXO A;  2OAD A;  4ZB9 A;  4G0K A;  1VF2 A;  2ON7 A;  4BL7 A;  1VF3 A;  2DC5 A;  1K3L A;  2VCX A;  5J47 A;  5AIV A;  2R6K A;  5DDL A;  2N5F A;  4GTU A;  1Z9H A;  5KEJ A;  1K0A A;  4Q5F A;  4L5O A;  3UAP A;  1XWG A;  3Q74 A;  3RFR C;  2YV9 A;  3G7J A;  1TXU A;  3LSZ A;  4HZ4 A;  4HJ2 A;  3HJO A;  3LG6 A;  2WZS A;  3CSI A;  5DJM A;  4TOP A;  5J41 A;  2V6K A;  5A5K A;  3UAR A;  2F3M A;  4OFT A;  3QR6 A;  3FR9 A;  3IK7 A;  2YCD A;  4GSN A;  3UBL A;  2O36 A;  3O76 A;  3GST A;  3N9J A;  14GS A;  1GSD A;  4USS A;  4ZXG A;  1EOG A;  2VCV A;  3IK9 A;  1BG5 A;  5FT3 A;  4MPF A;  3CHX C;  2VCW A;  5DAL A;  1R5A A;  4ZB8 A;  6GST A;  5B7C A;  1ZGN A;  4PTS A;  1LBK A;  1K0O A;  5A4V A;  4BVY A;  13GS A;  2WVX B;  2EFD A;  1FW1 A;  5J40 A;  2OA7 A;  1V2A A;  3RGB C;  3TOT A;  1PL2 A;  3I69 A;  18GS A;  3WYW A;  1YY7 A;  5LD0 A;  3M3M A;  4FXY P;  3CBU A;  4YH2 A;  5IQY A;  4LMV A;  3EIN A;  2CAI A;  5A4U A;  4ECI A;  4J2F A;  4IW9 A;  4PI2 C;  1V40 A;  1JZR A;  1JLV A;  4G0I A;  1PN9 A;  4AKX B;  6GSW A;  4PQI A;  3VUR A;  2GLR A;  1XW6 A;  3FY7 A;  2R5G A;  2WVZ A;  1PGT A;  4G9H A;  5A4W A;  2O3E A;  2F8F A;  2NTO A;  1F3B A;  1EOH A;  1AXD A;  2C3N A;  1GSF A;  3CRU A;  3GUR A;  5ECI B;  3KTL A;  4E8E A;  4PQH A;  4KF9 A;  5GZZ B;  3CWG A;  3GH6 A;  2VCQ A;  3ISO A;  6GSV A;  4MP4 A;  2GSS A;  3PGT A;  1GTB A;  1GLP A;  4PUR A;  1GWC A;  3RBT A;  3ZFL A;  4YQU A;  1UA5 A;  3PPU A;  2EFE A;  3EE2 A;  3VPT A;  1ZL9 A;  4OMV A;  2CVD A;  1GLQ A;  4N0V A;  2DSA A;  4O7H A;  4KDX A;  17GS A;  5D9W A;  1G7O A;  3PR8 A;  2CZ3 A;  1PA3 A;  1I1I P;  2WVX A;  4ZBA A;  3TOU A;  1GUK A;  1YVL A;  3M8N A;  5ELG A;  3CSH A;  5DAK B;  3F6D A;  5G5E A;  2HSM A;  19GS A;  2CAQ A;  1HQO A;  5ECM B;  1GSE A;  1ML6 A;  5GST A;  2WJU A;  2PMT A;  3R3E A;  4BVX B;  2HSN A;  2OAC A;  5F07 A;  1HNA A;  5LCZ A;  3HKR A;  1G6Y A;  3Q18 A;  3ERF A;  4AI6 A;  1K0N A;  1F3A A;  1N25 A;  4EDZ A;  5AN1 A;  4F03 A;  5A34 B;  3KJY A;  3VLN A;  6GSY A;  5D9X A;  1IYI A;  3UBK A;  2AB6 A;  2GST A;  1BF5 A;  2O5V A;  4IVF A;  4ZBD A;  5ECP B;  3IR4 A;  2C4J A;  1MTC A;  3FYG A;  4GSS A;  4F0C A;  1VF4 A;  4PHZ C;  1SVL A;  5HFK A;  1KBN A;  5F8B A;  1U88 A;  4E68 A;  5F0G A;  4FQU A;  1BYE A;  6GSS A;  3U6V A;  3WD6 A;  2CZ2 A;  4GF0 A;  3LYP A;  1YEW C;  6GSX A;  4OFM A;  2LJR A;  16GS A;  2WS2 A;  1EEM A;  3AY8 A;  1SVO A;  1K0B A;  5D9V A;  5ECH B;  1EV4 A;  1XW5 A;  4GST A;  1TW9 A;  4DEJ A;  4NHW A;  5G5F A;  1U87 A;  4Q5Q A;  2GTU A;  1GUH A;  4IGJ A;  4MDC A;  22GS A;  2GSR A;  5F05 A;  4BVX A;  4MF5 A;  3QAG A;  3UVH A;  3VK9 A;  4PNF A;  2AHE A;  3M0F A;  4NHZ A;  3CSJ A;  4N3Z A;  2R3X A;  2CA8 A;  1GSU A;  3C8E A;  1GSY A;  4JZQ A;  1GNW A;  1VF1 A;  2C3Q A;  3LXZ A;  5EVO A;  2WW1 A;  2R4V A;  4AKI A;  1A0F A;  3G7I A;  4OFN A;  3VI5 A;  4GCI A;  2HRK B;  5BMU B;  4AKG A;  1GNE A;  3KMN A;  3FR6 A;  2FNO A;  10GS A;  9GSS A;  3LYK A;  5AIS A;  2C80 A;  2GSQ A;  4KE3 A;  4E8H A;  3Q19 A;  2HNL A;  2WW3 A;  2IMK A;  1HNC A;  2WRT A;  3FRC A;  5J5N A;  3IE3 A;  3GTU B;  5ECN B;  1GUM A;  2VKZ G;  4PI0 C;  3LFL A;  3CRT A;  2HRA A;  5JCW A;  3P90 A;  5AGY A;  3SWL A;  1M0U A;  1XWK A;  5D73 A;  4HI7 A;  4EDY A;  3L0H A;  3LQ7 A;  2OT3 A;  1PX6 A;  4EXJ A;  3QAW A;  1EV9 A;  1PD2 1;  1S4B P;  1TU7 A;  1GTA A;  1GSQ A;  4BL7 B;  1E6B A;  4HOJ A;  4IBP A;  7GSS A;  3IBH A;  2VCT A;  2WB9 A;  4G19 A;  5DJL A;  1GTU A;  4ECJ A;  4EE0 A;  5FHI A;  3P8W A;  5A1N B;  4KAE A;  1BX9 A;  3HJM A;  2PBJ A;  2VD1 A;  2YV7 A;  4NAX A;  2HQT A;  4IEL A;  4IQ1 A;  3ZML A;  2WW2 A;  5BMU A;  2HRK A;  1TDI A;  2C3T A;  4MPG A;  5J4U A;  4IJI A;  1OYJ A;  1PX7 A;  4F0B A;  1YDK A;  3QAV A;  3M1G A;  3GX0 A;  5ECQ B;  1NHY A;  1GTI A;  2A2S A;  4W66 A;  1M9B A;  1JLW A;  1GSS A;  2D2Z A;  2C8U A;  4YAP A;  5A5H B;  5FWG A;  1B8X A;  4JED A;  4PX1 A;  4YAV A;  5DAL B;  5JCU A;  4IQA A;  5ECK B;  4YQM A;  3MDK A;  4BVY B;  1BAY A;  2VCZ A;  5DQS A;  2WVY A;  4ZBB A;  4QMK A;  2FHE A;  4AGS A;  1N2A A;  4PGT A;  1OE8 A;  3D0Z A;  4RI7 A;  5D9T A;  1G6W A;  4KDY A;  1MD3 A;  2UV8 G;  5A1N A;  2AAW A;  4GLT A;  1Q4J A;  4K0G A;  5DAK A;  2EFC A;  4Q5N A;  4ECC A;  2VO4 A;  5EL8 A;  1YQ1 A;  2PGT A;  5ECL B;  3DGQ A;  3TU3 B; 
#chains in the Genus database with same CATH homology
 4PI0 C;  4PI2 C;  3RGB C;  1YEW C;  3RFR C;  3CHX C;  4PHZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...