1MD4A

A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to valine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVVDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pi glutathione transferase
publication title Contribution of Glycine 146 to a Conserved Folding Module Affecting Stability and Refolding of Human Glutathione Transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1md4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1md4A01
2XPEA 4AF2A 2EIRA 3TKRA 4EVMA 3TDGA 2HRAA 1EV4A 3EC3A 3PR8A 3ZMKA 1WE0A 1OYJA 4J57E 5HFGA 3EE2A 2PUKC 3A2VA 4EE0A 2FD3A 2CZ3A 5B7CA 4ILFA 3WYWA 1O6JA 3WT1A 2GQMA 5D9WA 3D0ZA 1W4VA 3R3EA 1F9MA 3LJRA 2O8VB 4IW9A 5JWOB 1G6YA 5D9VA 1VGLA 3GUSA 1SKSB 3D4TA 4D73A 3F4TA 2F8AA 3VI5A 4HQSA 1EV9A 1A24A 5AIVA 2F8FA 1SD8A 1BAYA 4FYBA 2I1UA 4BL7B 3K8NA 4GTUA 3VPTA 2VO4A 1PD21 4K7IA 1OC9B 2OBKA 4GXZA 4E8EA 3ZLPA 1EGRA 2E0QA 2HZEB 1ERWA 2A2RA 1K0OA 5A4VA 2RLIA 1JLWA 4LMVA 2TIRA 1ZYQB 4F0CA 2HXKA 3IAM2 2AYTA 1I5GA 1YF1A 4MH2A 2LNTA 4FIWA 3RBTA 1TDIA 2BMXA 1T3BA 3GN3A 2H19A 2H71A 2H75A 2YWOA 3RHBA 1XWAA 1O81A 3LQ7A 2L6DA 1CQGA 1RQMA 2NBSA 3F8UA 3TRPA 2H0IA 2CQ9A 1GSDA 2YNXA 4KCAA 1TXXA 1X9WB 1GP1A 4BL7A 3DRNA 3HA9A 3LXTA 4NWYA 2H6YA 3O76A 3QFBC 1OC9A 2GS3A 5ECRB 2I4AA 1GTUA 5AGYA 3EU3A 3GL5A 4KGIA 1MEKA 3N5OA 1XW9A 1QGVA 1SENA 4TR3A 2L5OA 2R6KA 5ENUA 4DVCA 1F3BA 2PU9C 1XOAA 1E6BA 1OC3A 1ST9A 12GSA 1YZXA 2DMLA 2NVLA 3ISOA 2LNSA 3GX8A 1TP9A 2R3XA 11GSA 5DJMA 4LL1B 5IPGA 1Z9HA 4BVYB 4E8HA 3TJKA 5J3RA 1K0AA 4ZB9A 3APSA 1SJ6A 2YPMA 3M9JA 3GV1A 2OE0A 4BWSA 2FA8A 3HYPA 2PERA 1MD4A 1T8EB 4ECCA 1V40A 4NHWA 5IMZA 4LMWA 5HR2A 3FK8A 3CSHA 5H5SA 1TK8B 4MABA 1IYIA 4EKZA 4PQ1A 2JSZA 2XBQA 4K7NA 2JZSA 1FG4A 3US3A 1WWJA 3LFLA 2FWFA 4DEJA 1ZOFA 3CBUA 4TR0A 5DALB 3NOFA 3UEMA 5JWQB 4KCEA 5E4WA 2HQTA 4Q5FA 2J23A 3KH7A 2QKEA 5G5FA 1A0RP 1WPIA 4OFNA 17GSA 3M3MA 4BVYA 3FKFA 2YV7A 1WJKA 1TJDA 3F63A 2B5XA 3RAZA 1TI3A 3NIVA 2PVOC 3GURA 3C1SA 2VCTA 3A2WA 1ERVA 5ECLB 5A4WA 3Q74A 3D21A 2B5EA 4PTSA 4KDUA 3M1GA 1R5PA 4HJ2A 1GSSA 2O87A 2PBJA 4V2MA 1H75A 2LJAA 3H93A 4O92A 4WR5A 2EIQA 1ERTA 5C00A 2X8GA 3I9V2 3W6GA 3UIWA 2VOCA 3I6AA 2V32A 2OADA 3ZMLA 4WBJA 2HZFA 2CVDA 2FNOA 3ZVJD 1U87A 5J41A 4OO4A 4RI7A 3MSZA 4IP6A 4POLA 2RUFA 2OE1A 1B8XA 5DALA 4I5QA 2GLRA 4YAVA 2K8VA 6GSVA 1X0RA 4DSSB 2X8CA 3D22A 1GLQA 2FA4A 4I6XA 4KUNA 1URMA 2H73A 4KH7A 2B6MA 4PURA 5ID2B 1M9AA 1X5CA 5HFKA 3LXZA 2VCXA 1ZZYA 3S9FA 3BD2A 3L4NA 3PPUA 3QR6A 2V6KA 5ECKB 2L4CA 2C1YA 2B7JA 3HJPA 5G5EA 1ZYEA 1F3AA 2C0GA 8GSSA 5HR3A 1J9BA 2GTUA 5A4UA 1B9XC 3L78A 3TGZA 3F9UA 5ECSA 1LBKA 4YQVA 3GMFA 4F82A 1JFUA 1FHEA 1AUCA 4POBA 5KN0A 4K6XA 2PGTA 4JR4A 3DD3A 2IJYA 1JZDA 5CAXA 5B6NA 3KMOA 6GSUA 2RUEA 3Q19A 4CDOA 4ZL9A 2G0FA 2VL2C 13GSA 3KTLA 2FUG2 3KH9A 4MF5A 1ZL9A 2L4QA 1GH2A 2NDOA 3F3QA 4DSSA 4USSA 1T00A 3TKSE 1PN9A 1GSEA 2IPAA 5ID2A 2HSHA 1V98A 1X5DA 1ZGNA 2IMKA 5HR1A 1RK4A 4GLTA 5AISA 3HXSA 4GCIA 1NM3A 3MNGA 3G7JA 1MDJA 3IXRA 3GH6A 1X9MB 2HSNB 4ISDA 5JCWA 3HDCA 1UN2A 4ULXA 3QCPA 5CREA 2F9SA 2CA8A 4I97A 4Z7XA 1YY7A 3IDVA 2PWJA 2I9HA 1G7OA 4YQUA 2G2QA 1F37A 1O73A 3L9UA 4QL9A 3WGXA 2OJLA 2KP1A 2ES7A 2LSTA 2H1AA 5FWGA 1S3DA 1KTEA 2LTKA 1NW2A 1U88A 3TKSC 3H79A 2B5YA 2IMEA 6GSSA 2KUCA 1SU9A 1QK8A 2GZYA 1EGOA 2DIYA 3UAPA 4EDYA 4O7HA 4MZBA 4TXVA 2PMTA 4IVFA 2IMIA 2JL4A 1K3OA 4QL7A 2YCDA 5EPFA 2C3NA 3WGEA 1X9SB 5B8BA 3HJOA 2HNLA 4WXTA 2A4VA 4RQXA 1EOGA 3U6VA 3KM6A 3TJBA 6GSXA 2PN8A 1XVWA 5KN1A 1Z5YE 2LQQA 2DJ3A 1EZKA 1KNGA 1V57A 3N9JA 3UVHA 2P0GA 3TCOA 4ZB6A 1TTZA 2N5AA 4WKWA 4JZQA 2JSYA 1QUWA 3QD9A 3TJJA 1M7TA 4V2LA 2E2MA 3HKRA 3ZFLA 2AJQB 2VL2A 3M9KA 2O85A 1A2JA 4QQ7A 4MZCA 1F2EA 3C7MA 3J7Yk 5IM9A 3HCZA 3QPMA 1ON4A 2QGVA 1Y25A 3IPZA 2IL3A 1WIKA 2MMOA 3TRQA 3FYGA 3Q6OA 19GSA 3CSJA 3BCIA 5IO0A 2IIYA 4G2EA 3GNJA 2KLXA 1MDIA 4KSOA 3GHAA 1GL8A 4TOPA 3V1WA 4HU7A 2BTOT 3IV4A 3L9VA 2AUVA 3GX0A 3KXOA 3HJMA 3O6TA 4ZILA 3VWXA 3VURA 2VCVA 2MYGA 2B7KA 4G0IA 4NHZA 2GZPA 2J9HA 3UVTA 3C73A 1GLPA 1GNWA 4ZL8A 5CP1A 5GAND 3GFKA 2VLTA 3CTGA 5JCUA 1HNAA 2GSQA 2X64A 4XIHA 4JE1A 3CRUA 3EU4A 4ECJA 1G7EA 1PA3A 2H0GA 3CTFA 2CVBA 4XTSA 2IWTA 4OCFA 3FR6A 2L5LA 2VAFA 1YJ6A 4N0ZA 1BQ7A 5IQYA 4NXIA 3LYPA 5LNKe 5ECQB 1B4PA 2DBCA 3FZ5A 5J9CA 2YV9A 2XPDA 2VIMA 4L0UA 4K2DA 2GT5A 4X0XA 2MBTA 4EXJA 3GSSA 1A8YA 3ZREA 4HEA2 2H66A 2R37A 1ACVA 1OE7A 2N5FA 2V6OA 5IMDA 2LV3A 1KBNA 1NHOA 4BA7A 1J0FA 3GTUB 2N5BA 4MDCA 4K8MA 4IGJA 1XFLA 3TKQA 4LLRA 1CQHA 3C8EA 4POKA 3GKKA 1PL1A 2HZEA 1AAZA 2L57A 3IRAA 3TB2A 3G9BA 5EVOA 1WMJA 3ZYWA 2DIZA 1ERUA 2CV4A 3P8WA 1UA5A 1AQXA 1O8XA 3FZ4A 3C71A 3DXBA 2YN1A 2FWEA 3IE3A 2M80A 2H70A 5FHIA 4HOJA 2PVQA 2IFQB 5IOXA 2LJRA 3RPPA 3F4RA 5AN1A 2C0FA 1Q4JA 1DBYA 5D96A 4FO5A 4WBRD 3GA4A 2CZ2A 18GSA 3IBHA 4Q5RA 1PSQA 4IS0A 2GVPA 2KOKA 4K9ZA 5HR0A 2CAQA 4JRRA 4EC0A 3L9SA 3KCMA 5B6MA 2VD0A 3P7XA 5ECIB 3GTUA 2E2GA 2FLSA 3IR4A 5INYA 2H0HA 5CRDA 4PX1A 2Z9SA 3HVXA 4MPFA 3DIEA 1V2AA 4NMUA 4GSSA 3GSTA 2B1KA 2D2ZA 1UVZA 5CNWA 1GUMA 5HQPA 3KD0A 1PKZA 3CSIA 2X99A 2IFQA 4V1Ag 5H5RA 4YQMA 2EC4A 3KZQA 4H86A 1YKAA 1T4ZA 4G9HA 4ZBAA 5GAPD 4MP4A 4KAEA 2K8SA 3GKMA 2B1LA 2HYXA 5ECMB 2AAWA 1VF4A 2C80A 1AIUA 3VLNA 3R2QA 3ZL5A 1G0TA 1O85A 2EIOA 4OFMA 1UC7A 4TR4A 4ZB8A 4TW5A 2VM2A 4MJEA 3EMPA 4F2IA 4XS6A 3FHKA 4KNDA 5COHA 3ERWA 3GRXA 1SJIA 1SYXA 4J56E 5CRWA 2CX4A 2ZNMA 3L0HA 3LG6A 1ML6A 1QFNA 4GSNA 4TVEA 1V58A 3ZIVA 3PGTA 4PQIA 1WOUA 3OR5A 2FCHA 4BWQA 1YQ1A 3WGDA 1ABAA 5IO2A 3LSZA 4OFTA 3I69A 2LRTA 5F0GA 2H74A 4GQFA 1FB6A 3MDKA 1TRVA 3IA1A 2REMA 2DC5A 5CO3A 2FWHA 2H30A 1EP7A 5G30A 3GYKA 1FVKA 4GRFA 3APQA 2IN3A 1XWKA 1QMVA 5DAKB 1GTAA 1XIYA 3H4KA 4DSRA 3D5JA 2DJ2A 4WF5A 5D93A 4IHUA 4XS4B 16GSA 1J08A 2FY6A 1EEMA 1BYEA 4JU5A 2WJUA 2ON7A 2I3YA 4DSQA 2V2GA 3PINA 2GSTA 1K3LA 3QDNA 1IYHA 5ECOB 5IMFA 4RQRA 4EO3A 2VUPA 3J7Yb 1SD9A 2LRNA 1K3YA 3RDWA 3AY8A 3GL3A 3VWVA 3GKNA 3H8QA 3QMXA 4N10A 3EINA 3RPNA 1O8WA 2C0DA 3G7YA 3GH9A 3ZIJA 4FYUA 1THOA 1GNEA 3HY2A 2I81A 2GT6A 1V9WA 4N30A 3BCKA 4HU9A 3TRXA 1DUGA 3KEBA 1SL0B 5DAKA 2WB9A 20GSA 4GSTA 3LYKA 3LORA 5G1KA 4V2NA 5DJLA 4KX4A 4XS4A 1SKWB 3IC8A 9GSSA 2FGXA 1PGTA 1X5EA 4O32A 4RI6A 4L0WA 2XHFA 2CT6A 4X1UA 2KP2A 2IMDA 4I2TA 3IAS2 1S3AA 3TUEA 1TOFA 2DJ0A 4PGTA 4MPGA 4CW9A 1PMTA 1R26A 2HE3A 4V1Ap 3SWLA 3CXGA 1F6MC 4ID0A 4EDZA 2ON5A 1N2AA 3W8SA 4N0VA 4MF7A 3KMNA 1Y6EA 3MWHA 4IJ3A 5C04A 5IIZA 1OE8A 3IK7A 4G10A 4AJ8A 4HZ4A 2YP6A 4NV5A 3ED3A 2BJXA 2HT9A 3UMAA 3GIXA 1TRSA 3KIJA 1VF3A 1OAZA 2WS2A 3Q18A 5D8IA 4MZWA 1USBA 4FH8A 22GSA 3VPQA 4WETA 3G7IA 1K0NA 3KTBA 3A5WA 2WZ9A 5FT3A 4MK3A 4AJ7A 1M0UA 2M46A 3U5RE 4ML1A 3QFAC 2A2SA 2R4VA 2MMAA 2YZHA 3FZAA 2H1BA 5GSTA 1M2DA 5ELAA 5CRHA 1N8JA 2VL9A 1FW1A 6GSWA 3KP9A 1PRXA 2OBIA 1YEXA 1W89A 1M99A 4IELA 5IMAA 2LUSA 3QOUA 2FWGA 5BMUA 5DQSA 1GSUA 2H6ZA 2YZUA 3CYNA 3UJ1A 1EOHA 4Q5QA 1M9BA 1ZCPA 1Z7RA 1TI1A 2VCWA 6GSYA 5DBQA 4TKYA 2VLUA 1GSFA 2P31A 3SBCA 5IMCA 2WDUA 3FZ9A 2JZTA 2V1MA 4MJAA 3D4MA 4FQUA 2VD1A 1KEBA 4XCSA 3TJFA 2DJJA 4ZBBA 3KP8A 2LRCA 1YDKA 1XCCA 1LU4A 1TW9A 3D6IA 4OWYA 4O5RA 3LGCA 5ELGA 3UBLA 1XVQA 1VF2A 1TK0B 1MD3A 3F3RA 1JZWA 1K0MA 3M8NA 4MMMA 1A2LA 4OD7A 4AJ6A 2C0EA 1U3IA 3WT2A 4AGSA 3NZNA 5KN3A 1B4QA 3F6FA 4N11A 3TKSA 1FAAA 3E0UA 1HNBA 3BBYA 3FRCA 1G6WA 5D73A 2H01A 1YF0A 5EL8A 2QSIA 3WD6A 1GRXA 2HRKB 1BX9A 2O89A 2MMZA 2VCZA 2H1GA 2OA7A 4FYCA 2YJ7A 3C1RA 3GKXA 2C8UA 4I2UA 2HSMB 3RHCA 1NHYA 1MDKA 5B8AA 2VL3A 1DSBA 1XWCA 2M72A 1FOVA 3JCML 3DVWA 4HI7A 2VM1A 5DCGA 1VRSD 1EEJA 3PH9A 1ZMAA 1OC8A 4J2FA 1A2MA 3DGQA 4K0GA 2C3QA 5LD0A 2GQLA 3TOUA 5CYYA 2GZZA 2GSRA 3VWWA 3DWVA 2DJKA 2GSSA 2JZRA 5ABRA 4IN0A 3ZFBA 3DEXA 3IC4A 1Z7PA 2H76A 3ME8A 3CRTA 1LJRA 1VF1A 2CAIA 5KN2A 3TOTA 1JZOA 1RW1A 1FVJA 1GSQA 3FR3A 1AXDA 1WP0A 1GSYA 1WRYA 5F06A 2H1DA 2LQOA 3UBKA 2OACA 2HRKA 1JLVA 3M0FA 4EL1A 1T7PB 1EP8A 2ZCTA 3ZITA 3HVSA 3HHVA 2H6XA 1PX6A 5ECNB 4MF6A 2YWNA 5IOWA 2HSMA 5A5KA 4LL4B 2DLXA 1XWBA 4OMVA 1FB0A 1GTIA 4MLYA 4ZBDA 3BOAA 4KB3A 3O3TA 5LCZA 3VFIA 4HJMA 2K9FA 4MA9A 2C4JA 5ECHB 3IHQA 1FO5A 4MCUA 1R5AA 5H5QA 4IP1A 3LEFA 5IMVA 4WEYA 2F51A 3FW2A 1TRWA 3EWLA 2YWMA 3EYTA 2GGTA 4ZL7A 2L6CA 2DJ1A 5E59A 1C72A 3EURA 5J4UA 1XXUA 1PQNA 4HQZA 2RM5A 3TKPA 1XBSA 1H4OA 5L71A 1SKRB 4YAPA 2XBIA 3IOSA 2TRXA 3ZTLA 1QXHA 4OCEA 2FHEA 3QAVA 2HLSA 3EVIA 4TR1B 2H8LA 3FEUA 3HZ4A 2R2JA 2OE3A 2IMFA 2C3TA 1QQ2A 2ZUPA 5J5NA 1AW9A 4NAXA 2OKAA 1TK5B 1THXA 1TU8A 4PNGA 3E9JB 3ZVJA 5HFIA 1PX7A 3BJ5A 1R4WA 3HVVA 2P5RA 1SK1A 2HRNA 3LWAA 2H72A 1ILOA 1S3CA 1M2AA 5GZZB 1DE2A 1T4YA 2CX3A 2XC2A 1XWGA 2LEGA 2AV4A 4IJIA 5DQYA 3IK9A 4LA1A 2UZ8A 5KEJA 1SL2B 4BVXB 4P3YB 5G1LA 1Z3EA 1AC1A 2LJKA 4L5LA 2WFCA 1OKDA 4NV2A 4ML6A 2YOIA 4TR1A 4HS1A 2K18A 3E3EA 4TXOB 4ECBA 2DSAA 5GSSA 4RUVA 2YWIA 4IKHA 3F6DA 1MTCA 1PL2A 1A23A 4MJBA 1JHBA 1U6TA 3A3TA 5DCHA 3CMIA 4L5OA 3ME7A 4ACSA 1T1VA 4I8BA 4KDXA 4PUAA 3H1NA 1M2BA 2KHPA 1XPVA 4KA0A 2X8HA 1AQVA 4GQCA 2YJHA 3A2XA 4KSMA 2QC7A 1YEPA 4ZXGA 1XW6A 2JADA 5J9BA 5JCGA 5ECPB 4NPBA 1SYRA 4CHSA 2GQKA 5G2ZA 5F8BA 5DVBA 3W8JA 4XS1A 3UL3A 1U3AA 3UOMA 2CVKA 3HD5A 4JR6A 2DMMA 4BVXA 4IQAA 3ZZXA 1BJXA 2WRTA 2YANA 4EF0A 4MJCA 2MBSA 2VCQA 2MMNA 5F07A 2HRFA 1OVNA 3F0IA 1GUKA 4EUYA 4TRXA 1AQWA 3UARA 3P2AA 2B3SA 1TKDB 1YKCA 2K6VA 1K0CA 3FR9A 4TXOA 1K0DA 4BPYA 1BG5A 4G19A 2F3MA 3DMLA 1GWCA 2LS5A 4MH3A 4F9ZA 3VWUA 1TRUA 3FY7A 14GSA 4KF9A 4PUFC 2RIIA 4ZIJA 1XZOA 4OO5A 4F03A 2MZCA 4PXOA 1O7UA 1Z6NA 4HZ2A 1K0BA 2JU5A 2LKUA 2HSYA 4JEDA 3QAWA 4HDEA 3ERGA 1A8LA 1SK0A 4L8EA 1HYUA 4POMA 3I43A 4TN8A 4KE3A 4XHMA 1GUHA 4K1FA 5D9TA 3TJGA 2V41A 1E2YA 3ZRDA 4XRAA 5DDLA 1TU7A 4KW6A 3MAKA 5AIXA 4WR4A 2RM6A 1A0FA 5CRGA 3HZ8A 1EWXA 1HD2A 2L59A 3KJYA 2NPBA 2GDRA 4G0LA 2WCIA 3QAGA 4XRDA 1DE1A 1BEDA 3F4SA 2HFDA 3P90A 2WULA 1GTBA 1Z6MA 2TRCP 1B48A 2AHEA 4K0NA 3APOA 4PNFA 4YH2A 4WF4A 3VI7A 4PQHA 5EY6A 5G31A 1GULA 4KDYA 5F05A 3DYRA 4X43A 3ERFA 1PKWA 4IBPA 2NTOA 1R7HA 4K7OA 1XW5A 2JACA 5JWRB 4F0BA 4GF0A 4GWRA 1Q98A 5IPHA 5D9XA 4Q5NA 1HNCA 4G0KA 4JBBA 1JZRA 3EMXA 7GSSA 2HI7A 4HUAA 1SK2A 10GSA 1SJZA 3VK9A 1B9YC 4IQ1A 4ECIA 1HQOA 6GSTA 1NSWA 2AB6A 2P5QA 2WGRA 2ALBA 1SL1B 3KGKA 1XOBA 3DKSA 2O7KA 4D73B 3DVXA 2R5GA 1I9DA 2VLVA 2E7PA 2PPTA 1OKTA
chains in the Genus database with same CATH superfamily
2XPEA 4AF2A 2EIRA 3TKRA 4EVMA 3TDGA 2HRAA 1EV4A 3EC3A 3PR8A 3ZMKA 1WE0A 1OYJA 4J57E 5HFGA 3EE2A 2PUKC 3A2VA 4EE0A 2FD3A 2CZ3A 5B7CA 4ILFA 3WYWA 1O6JA 3WT1A 2GQMA 5D9WA 3D0ZA 1W4VA 3R3EA 1F9MA 3LJRA 2O8VB 4IW9A 5JWOB 5J40A 1G6YA 5D9VA 1VGLA 3GUSA 3MIXA 1SKSB 1S3RA 3D4TA 4D73A 3F4TA 2F8AA 3VI5A 4HQSA 1EV9A 1A24A 5AIVA 2F8FA 1SD8A 1BAYA 4FYBA 2I1UA 4BL7B 3K8NA 4GTUA 3VPTA 2VO4A 1PD21 4K7IA 1OC9B 4FXYP 2OBKA 4GXZA 2VKZG 4E8EA 3ZLPA 1EGRA 2E0QA 2HZEB 1ERWA 2A2RA 1K0OA 5A4VA 2RLIA 1JLWA 4LMVA 2TIRA 1ZYQB 4F0CA 2HXKA 3IAM2 3CHXC 2AYTA 1I5GA 1YF1A 4MH2A 2LNTA 4QMKA 4FIWA 3RBTA 1TDIA 2BMXA 1T3BA 3GN3A 2H19A 2H71A 2H75A 2YWOA 3RHBA 1XWAA 1O81A 3LQ7A 2L6DA 1CQGA 1RQMA 1SVMA 4N3ZA 2NBSA 3F8UA 3TRPA 4Z2RA 2H0IA 2CQ9A 1GSDA 2YNXA 4KCAA 1TXXA 1X9WB 1GP1A 4BL7A 3DRNA 3HA9A 3LXTA 4NWYA 2H6YA 3O76A 3QFBC 1OC9A 2GS3A 5ECRB 2I4AA 1GTUA 5AGYA 3EU3A 3GL5A 4KGIA 1MEKA 3N5OA 1XW9A 1QGVA 1SENA 4TR3A 2L5OA 2R6KA 5ENUA 4DVCA 1F3BA 2PU9C 1XOAA 1E6BA 1OC3A 1ST9A 12GSA 1YZXA 2DMLA 2NVLA 3ISOA 2LNSA 3GX8A 1TP9A 2R3XA 11GSA 5DJMA 4LL1B 5IPGA 1Z9HA 4BVYB 4E8HA 3TJKA 5J3RA 1K0AA 4ZB9A 3APSA 1SJ6A 2YPMA 3M9JA 3GV1A 2OE0A 4BWSA 2FA8A 3HYPA 1S4BP 2PERA 1MD4A 1T8EB 4ECCA 1V40A 4NHWA 5IMZA 4LMWA 5HR2A 3FK8A 3CSHA 5H5SA 1ZYPA 1TK8B 4MABA 1IYIA 4EKZA 4PQ1A 2JSZA 2XBQA 4K7NA 2JZSA 1FG4A 3US3A 1WWJA 3LFLA 2FWFA 4DEJA 1ZOFA 3CBUA 4TR0A 5DALB 3NOFA 3UEMA 5JWQB 4KCEA 5E4WA 2HQTA 1TXUA 4Q5FA 2J23A 3KH7A 2QKEA 4Z2TA 5G5FA 3HMJG 1A0RP 1WPIA 4PI0C 4OFNA 17GSA 1ZYNA 3M3MA 4BVYA 3FKFA 2YV7A 1WJKA 1TJDA 3F63A 2B5XA 3RAZA 1TI3A 3NIVA 2PVOC 3GURA 3C1SA 2VCTA 3A2WA 1ERVA 5ECLB 5A4WA 3Q74A 3D21A 2B5EA 4PTSA 4KDUA 3M1GA 1R5PA 4HJ2A 1GSSA 2O87A 2PBJA 4V2MA 1H75A 2LJAA 3H93A 4O92A 4WR5A 2EIQA 1ERTA 5C00A 2X8GA 3I9V2 3W6GA 3UIWA 2VOCA 3I6AA 2V32A 2OADA 3ZMLA 4WBJA 2HZFA 2CVDA 4O5UA 2FNOA 3ZVJD 1U87A 5J41A 4OO4A 4RI7A 1BF5A 3MSZA 4IP6A 4POLA 2RUFA 2OE1A 4O5QA 1B8XA 5DALA 4I5QA 2GLRA 4YAVA 2K8VA 6GSVA 1X0RA 4DSSB 2X8CA 3D22A 1GLQA 2FA4A 4I6XA 4KUNA 1URMA 2H73A 4KH7A 2B6MA 4PURA 5ID2B 1M9AA 1X5CA 5HFKA 3LXZA 2VCXA 1ZZYA 3S9FA 4ICYA 3BD2A 2H1LA 3L4NA 3PPUA 3QR6A 2V6KA 5ECKB 2L4CA 2C1YA 2B7JA 3HJPA 5G5EA 1ZYEA 1F3AA 2C0GA 8GSSA 5HR3A 1J9BA 2GTUA 5A4UA 1B9XC 3L78A 3TGZA 3F9UA 5ECSA 1LBKA 4YQVA 3GMFA 4F82A 1JFUA 1FHEA 1AUCA 4POBA 5KN0A 4K6XA 2PGTA 4JR4A 3DD3A 2IJYA 1JZDA 5CAXA 5B6NA 4HSCX 3KMOA 6GSUA 2R0CA 2RUEA 2OT3A 3Q19A 4CDOA 2O5VA 4ZL9A 2G0FA 2VL2C 13GSA 3KTLA 2FUG2 3KH9A 4MF5A 1ZL9A 2L4QA 1GH2A 2NDOA 3F3QA 4DSSA 4USSA 1T00A 3TKSE 1PN9A 1GSEA 2IPAA 5ID2A 2WVZA 2HSHA 1V98A 1X5DA 2WW0A 1ZGNA 2IMKA 5HR1A 1RK4A 4GLTA 5AISA 3HXSA 4GCIA 1NM3A 3MNGA 3G7JA 1MDJA 3IXRA 3GH6A 1X9MB 2HSNB 4ISDA 5JCWA 3HDCA 1UN2A 1SVOA 4ULXA 3QCPA 5CREA 2F9SA 2CA8A 4I97A 4Z7XA 1YY7A 3IDVA 2PWJA 2I9HA 1G7OA 4YQUA 2G2QA 1F37A 1O73A 3L9UA 4QL9A 3WGXA 2OJLA 2KP1A 2ES7A 2LSTA 2H1AA 5FWGA 1S3DA 1KTEA 2LTKA 1NW2A 1U88A 5A34B 3TKSC 3H79A 2B5YA 2IMEA 6GSSA 2KUCA 1SU9A 1QK8A 2GZYA 1EGOA 2DIYA 3UAPA 4EDYA 4O7HA 4MZBA 4TXVA 2PMTA 4IVFA 2IMIA 2JL4A 1K3OA 4QL7A 2YCDA 5EPFA 2C3NA 3WGEA 1X9SB 5B8BA 3HJOA 2HNLA 4WXTA 4PI2C 4EIQA 2A4VA 4RQXA 1EOGA 3U6VA 3KM6A 3TJBA 6GSXA 2PN8A 1XVWA 5KN1A 1Z5YE 2LQQA 2DJ3A 1EZKA 1KNGA 4PHZC 1V57A 3N9JA 3UVHA 2P0GA 3TCOA 4ZB6A 1TTZA 2N5AA 5A34A 4WKWA 4JZQA 2JSYA 1QUWA 3QD9A 3TJJA 1M7TA 5A5HB 2E2MA 3HKRA 4V2LA 3ZFLA 2WW2A 2AJQB 2VL2A 3M9KA 2O85A 1I1IP 1A2JA 4QQ7A 4MZCA 1F2EA 3C7MA 3J7Yk 5IM9A 3HCZA 3QPMA 1ON4A 2QGVA 1Y25A 3IPZA 2IL3A 1WIKA 2MMOA 3TRQA 2R0PA 3FYGA 3Q6OA 19GSA 2QA2A 3CSJA 3BCIA 5IO0A 1M3IA 2IIYA 4G2EA 3GNJA 2KLXA 1MDIA 4KSOA 3GHAA 1GL8A 4TOPA 3V1WA 4HU7A 2BTOT 3IV4A 5BRTA 3L9VA 2AUVA 3GX0A 3KXOA 3HJMA 3O6TA 4ZILA 3VWXA 3VURA 2VCVA 2MYGA 2B7KA 4G0IA 4NHZA 2GZPA 2J9HA 3UVTA 3C73A 1GLPA 5A5HA 1GNWA 4ZL8A 5CP1A 5GAND 3GFKA 2VLTA 3CTGA 5JCUA 1HNAA 2GSQA 2X64A 4XIHA 4JE1A 3CRUA 3EU4A 4ECJA 1G7EA 1PA3A 2H0GA 3CTFA 2CVBA 4XTSA 2IWTA 4OCFA 3FR6A 4YKFA 2L5LA 2VAFA 1YJ6A 4N0ZA 1Y1UA 1BQ7A 2EFCA 5IQYA 4NXIA 3LYPA 1FOHA 5LNKe 5ECQB 1B4PA 2DBCA 3FZ5A 5J9CA 2YV9A 2XPDA 2VIMA 4CY8A 4L0UA 2O3EA 4K2DA 2GT5A 4X0XA 2MBTA 4EXJA 3GSSA 1A8YA 4MNNA 3ZREA 4HEA2 2H66A 2R37A 1ACVA 1OE7A 2N5FA 2V6OA 5IMDA 3EPTA 2LV3A 1KBNA 1NHOA 4BA7A 1J0FA 3GTUB 2N5BA 4MDCA 4K8MA 4IGJA 1XFLA 3TKQA 4LLRA 1CQHA 3C8EA 4Z2UA 4POKA 3GKKA 1PL1A 2HZEA 1AAZA 2L57A 3IRAA 3TB2A 3G9BA 3CWGA 5EVOA 1WMJA 3ZYWA 2DIZA 1ERUA 2CV4A 3P8WA 1UA5A 1AQXA 1O8XA 3FZ4A 3C71A 3DXBA 2YN1A 2FWEA 3IE3A 2M80A 2H70A 5FHIA 4HOJA 2PVQA 2IFQB 5IOXA 2LJRA 3HVNA 3RPPA 3F4RA 2X49A 5AN1A 2C0FA 1Q4JA 1DBYA 5D96A 4FO5A 4WBRD 3GA4A 2CZ2A 18GSA 3IBHA 4Q5RA 1PSQA 4IS0A 2GVPA 2KOKA 4K9ZA 5HR0A 2CAQA 4JRRA 4EC0A 3L9SA 3KCMA 3RGBC 5B6MA 2VD0A 3FMWA 3P7XA 5KOWA 5ECIB 3GTUA 2E2GA 2FLSA 3IR4A 5INYA 2H0HA 5CRDA 4PX1A 2Z9SA 3HVXA 4MPFA 3DIEA 1V2AA 4NMUA 4GSSA 3GSTA 2B1KA 2D2ZA 1UVZA 5CNWA 1GUMA 5HQPA 3KD0A 1PKZA 3CSIA 2X99A 2IFQA 4V1Ag 5H5RA 4YQMA 2EC4A 3KZQA 4H86A 1YKAA 1T4ZA 4G9HA 4ZBAA 5GAPD 4MP4A 4KAEA 2K8SA 2EFDA 3GKMA 2B1LA 2HYXA 5ECMB 2AAWA 4K5RA 1VF4A 1PN0A 2C80A 1AIUA 3VLNA 3R2QA 3ZL5A 1G0TA 2R0GA 1O85A 1YEWC 2EIOA 4OFMA 1UC7A 4TR4A 4ZB8A 4TW5A 2VM2A 4MJEA 3EMPA 4F2IA 4XS6A 3FHKA 4KNDA 5COHA 3ERWA 3GRXA 1SJIA 1SYXA 4J56E 5CRWA 4CY6A 2CX4A 2ZNMA 3L0HA 3LG6A 1ML6A 1YVLA 1QFNA 4GSNA 4TVEA 1V58A 3ZIVA 3PGTA 4PQIA 1WOUA 3OR5A 2FCHA 4BWQA 1YQ1A 3WGDA 1ABAA 5IO2A 3LSZA 4OFTA 3I69A 2LRTA 5F0GA 2H74A 4GQFA 1FB6A 3MDKA 1TRVA 3IA1A 2WVXB 2REMA 2DC5A 5CO3A 2FWHA 2H30A 1EP7A 5G30A 3GYKA 1FVKA 4GRFA 3APQA 2IN3A 1XWKA 1QMVA 5DAKB 1GTAA 1XIYA 3H4KA 4DSRA 3D5JA 2DJ2A 4WF5A 5D93A 4IHUA 4XS4B 16GSA 1J08A 1XG8A 2FY6A 1EEMA 1BYEA 4JU5A 2WJUA 2ON7A 2I3YA 4DSQA 2V2GA 3PINA 2GSTA 1K3LA 3QDNA 1IYHA 5ECOB 5IMFA 4RQRA 4EO3A 2VUPA 3J7Yb 1SD9A 2LRNA 1K3YA 3RDWA 3AY8A 3GL3A 4AKXB 3VWVA 3GKNA 3H8QA 3QMXA 4N10A 3EINA 3RPNA 2DKIA 1O8WA 2WVXA 2C0DA 3G7YA 3GH9A 3ZIJA 4FYUA 1THOA 1GNEA 3HY2A 2I81A 2GT6A 1V9WA 4N30A 3BCKA 4HU9A 3TRXA 1DUGA 3KEBA 1SL0B 5DAKA 2WB9A 20GSA 4GSTA 3LYKA 3LORA 2X4AA 5G1KA 4V2NA 5DJLA 4G01A 4KX4A 4XS4A 1SKWB 3IC8A 4E68A 9GSSA 2FGXA 1PGTA 1X5EA 4O32A 4RI6A 4L0WA 2XHFA 4ZB7A 2CT6A 4X1UA 2KP2A 2IMDA 4I2TA 3IAS2 1S3AA 3TUEA 1TOFA 2DJ0A 4PGTA 4MPGA 4CW9A 1PMTA 1R26A 2HE3A 4V1Ap 3A5IA 3SWLA 3CXGA 1F6MC 4ID0A 4EDZA 2ON5A 1N2AA 3W8SA 4N0VA 4MF7A 3KMNA 1Y6EA 4BIKA 5BMUB 3MWHA 4IJ3A 5C04A 5IIZA 1OE8A 3IK7A 4G10A 4AJ8A 4HZ4A 2YP6A 4NV5A 3ED3A 2HSNA 2BJXA 2HT9A 3GIXA 3UMAA 1TRSA 3KIJA 1VF3A 1OAZA 2WS2A 3Q18A 5D8IA 4MZWA 1USBA 4FH8A 22GSA 3VPQA 4WETA 3G7IA 1K0NA 3KTBA 3A5WA 2WZ9A 5FT3A 4MK3A 4AJ7A 1M0UA 2M46A 3U5RE 4ML1A 3QFAC 2A2SA 2R4VA 2MMAA 2YZHA 3FZAA 2H1BA 5GSTA 1M2DA 1PFOA 5ELAA 5CRHA 1N8JA 2VL9A 1FW1A 6GSWA 3KP9A 1PRXA 2OBIA 1YEXA 1W89A 1M99A 4IELA 5IMAA 2LUSA 3QOUA 2FWGA 5BMUA 5DQSA 1GSUA 2H6ZA 2YZUA 3CYNA 3UJ1A 1EOHA 3IHGA 4Q5QA 4YKGA 1M9BA 1ZCPA 1Z7RA 1TI1A 2VCWA 4X4JA 6GSYA 5DBQA 4TKYA 2VLUA 1GSFA 2P31A 3SBCA 5IMCA 2WDUA 3FZ9A 2JZTA 2V1MA 4MJAA 3D4MA 4FQUA 2VD1A 1KEBA 4XCSA 3TJFA 2DJJA 4ZBBA 3KP8A 2LRCA 1YDKA 1XCCA 1LU4A 1TW9A 3D6IA 4OWYA 4O5RA 3LGCA 4K5SA 5ELGA 3UBLA 1XVQA 1VF2A 4W66A 1TK0B 1SVLA 1MD3A 3F3RA 1JZWA 1K0MA 3M8NA 4MMMA 1A2LA 4OD7A 4AJ6A 2C0EA 1U3IA 3WT2A 4AGSA 3NZNA 5KN3A 1B4QA 3F6FA 4N11A 3TKSA 1FAAA 3E0UA 1HNBA 3BBYA 3FRCA 1G6WA 5D73A 2H01A 1YF0A 5EL8A 2QSIA 3WD6A 1GRXA 2HRKB 2O36A 1BX9A 2O89A 2MMZA 2VCZA 2H1GA 2OA7A 4FYCA 2YJ7A 3C1RA 3GKXA 2C8UA 4I2UA 2HSMB 3RHCA 1NHYA 1MDKA 5B8AA 2VL3A 1DSBA 1XWCA 2M72A 1FOVA 3JCML 3DVWA 3TU3B 4HI7A 2VM1A 5DCGA 1VRSD 1EEJA 3PH9A 1ZMAA 5J4YA 1OC8A 4J2FA 1A2MA 3DGQA 4K0GA 2C3QA 5LD0A 1BG1A 2GQLA 3TOUA 5CYYA 2GZZA 2GSRA 3VWWA 3DWVA 3MYDA 2DJKA 2GSSA 2JZRA 5ABRA 4IN0A 3ZFBA 3DEXA 3IC4A 1Z7PA 2H76A 3ME8A 3CRTA 1LJRA 1VF1A 2CAIA 5KN2A 3TOTA 1JZOA 1RW1A 1FVJA 1GSQA 3FR3A 1AXDA 1WP0A 1GSYA 1WRYA 5F06A 2H1DA 2LQOA 3UBKA 2OACA 2HRKA 1JLVA 3M0FA 4EL1A 1T7PB 1EP8A 2ZCTA 3ZITA 3HVSA 3HHVA 2H6XA 1PX6A 2EFEA 5ECNB 4MF6A 2YWNA 5IOWA 2HSMA 5A5KA 1M3JA 4LL4B 2DLXA 1XWBA 4OMVA 1FB0A 1GTIA 2WVYA 4MLYA 4ZBDA 3BOAA 4KB3A 3O3TA 5LCZA 3VFIA 4HJMA 2K9FA 1N25A 4MA9A 2C4JA 5ECHB 3IHQA 1FO5A 4MCUA 1R5AA 2QA1A 4IP1A 3LEFA 5H5QA 5IMVA 4WEYA 2F51A 3FW2A 1TRWA 3EWLA 2YWMA 3EYTA 2GGTA 4ZL7A 2L6CA 2WW1A 2DJ1A 5E59A 1C72A 3EURA 5J4UA 1XXUA 1PQNA 4HQZA 2RM5A 3TKPA 1XBSA 1H4OA 5L71A 1SKRB 4YAPA 2XBIA 3IOSA 2TRXA 3ZTLA 1QXHA 4AKGA 2FHEA 3QAVA 4OCEA 2HLSA 3EVIA 4TR1B 2H8LA 3FEUA 4AKIA 2R2JA 3HZ4A 2OE3A 2IMFA 2C3TA 1QQ2A 2ZUPA 5J5NA 1AW9A 4NAXA 2OKAA 1TK5B 2UV8G 1THXA 1TU8A 4PNGA 3E9JB 3ZVJA 5HFIA 1PX7A 3BJ5A 1R4WA 3HVVA 2P5RA 1SK1A 2HRNA 3LWAA 2H72A 2A2PA 1ILOA 1S3CA 1M2AA 2DKHA 5GZZB 1DE2A 1T4YA 2CX3A 2XC2A 1XWGA 2LEGA 2AV4A 4IJIA 5DQYA 3IK9A 4LA1A 2UZ8A 5KEJA 1SL2B 4BVXB 4P3YB 5G1LA 1Z3EA 1AC1A 2LJKA 5KOXA 4L5LA 2WFCA 1OKDA 4NV2A 4ML6A 2YOIA 4TR1A 4HS1A 2K18A 3E3EA 4TXOB 4ECBA 2DSAA 5GSSA 4RUVA 2YWIA 4IKHA 3F6DA 1MTCA 1PL2A 1A23A 4MJBA 1JHBA 1U6TA 3A3TA 5DCHA 3CMIA 4L5OA 3ME7A 4ACSA 1T1VA 4I8BA 4KDXA 4PUAA 3H1NA 1M2BA 2KHPA 1XPVA 4KA0A 2X8HA 1AQVA 4GQCA 2YJHA 3A2XA 4KSMA 2QC7A 1YEPA 4ZXGA 1XW6A 2JADA 5J9BA 5JCGA 5ECPB 4NPBA 1SYRA 4CHSA 2GQKA 5G2ZA 5F8BA 5DVBA 3W8JA 4XS1A 4AKHA 3UL3A 1U3AA 3UOMA 4EIPA 2CVKA 3HD5A 4JR6A 3CQFA 2DMMA 4BVXA 4IQAA 3ZZXA 1BJXA 2WRTA 2YANA 4AI6A 4EF0A 4MJCA 2MBSA 2VCQA 2MMNA 5F07A 2HRFA 1OVNA 3F0IA 1GUKA 4EUYA 4TRXA 1AQWA 3UARA 3P2AA 2B3SA 3RFRC 1TKDB 1YKCA 2K6VA 1K0CA 3FR9A 4A5PA 4TXOA 1K0DA 4BPYA 1BG5A 4G19A 2F3MA 3DMLA 1GWCA 2LS5A 4MH3A 4F9ZA 3VWUA 1TRUA 3FY7A 14GSA 4KF9A 4PUFC 2RIIA 4ZIJA 1XZOA 4OO5A 4F03A 2MZCA 4PXOA 1O7UA 1Z6NA 4HZ2A 1K0BA 2JU5A 2LKUA 2HSYA 4JEDA 3QAWA 4HDEA 3ERGA 1A8LA 1SK0A 5J4VA 4L8EA 1HYUA 4POMA 3I43A 4TN8A 4KE3A 4XHMA 1GUHA 4K1FA 5D9TA 3TJGA 2V41A 1E2YA 3ZRDA 4XRAA 5DDLA 1TU7A 2WW3A 4KW6A 3MAKA 5AIXA 4WR4A 2RM6A 1A0FA 5CRGA 5A1NB 3HZ8A 1EWXA 1HD2A 2L59A 3KJYA 2NPBA 2GDRA 4G0LA 2EFHA 3QAGA 2WCIA 4XRDA 1DE1A 1BEDA 3F4SA 2HFDA 3P90A 2WULA 1GTBA 1Z6MA 2TRCP 1B48A 2AHEA 4K0NA 3APOA 4PNFA 2WZSA 4YH2A 4WF4A 3VI7A 4PQHA 5EY6A 5G31A 1GULA 4KDYA 5F05A 3DYRA 4X43A 3ERFA 1PKWA 4IBPA 2NTOA 1R7HA 4K7OA 1XW5A 2JACA 2A4HA 5JWRB 4F0BA 4GF0A 4GWRA 1Q98A 5IPHA 5D9XA 4Q5NA 1HNCA 4G0KA 4JBBA 1JZRA 3EMXA 7GSSA 2HI7A 4HUAA 1SK2A 3LW9A 10GSA 1SJZA 3VK9A 1B9YC 4IQ1A 4ECIA 1HQOA 6GSTA 1NSWA 2AB6A 4GDFA 2P5QA 2WGRA 2ALBA 1SL1B 3KGKA 1XOBA 3DKSA 2O7KA 5A1NA 4D73B 3DVXA 2R5GA 1I9DA 5J47A 2VLVA 2E7PA 4K2XA 2PPTA 1OKTA
chains in the Genus database with same CATH topology
2XPEA 4AF2A 2EIRA 3TKRA 4EVMA 3TDGA 2HRAA 1EV4A 3EC3A 3PR8A 3ZMKA 1WE0A 1OYJA 4J57E 5HFGA 3EE2A 2PUKC 3A2VA 4EE0A 2FD3A 2CZ3A 5B7CA 4ILFA 3WYWA 1O6JA 3WT1A 2GQMA 5D9WA 3D0ZA 1W4VA 3R3EA 1F9MA 3LJRA 2O8VB 4IW9A 5JWOB 5J40A 1G6YA 5D9VA 1VGLA 3GUSA 3MIXA 1SKSB 3D4TA 4D73A 3F4TA 2F8AA 3VI5A 4HQSA 1EV9A 1A24A 5AIVA 2F8FA 1SD8A 1BAYA 4FYBA 2I1UA 4BL7B 3K8NA 4GTUA 3VPTA 2VO4A 1PD21 4K7IA 1OC9B 2OBKA 4GXZA 2VKZG 4E8EA 3ZLPA 1EGRA 2E0QA 2HZEB 1ERWA 2A2RA 1K0OA 5A4VA 2RLIA 1JLWA 4LMVA 2TIRA 1ZYQB 4F0CA 2HXKA 3IAM2 2AYTA 1I5GA 1YF1A 4MH2A 2LNTA 4QMKA 4FIWA 3RBTA 1TDIA 2BMXA 1T3BA 3GN3A 2H19A 2H71A 2H75A 2YWOA 3RHBA 1XWAA 1O81A 3LQ7A 2L6DA 1CQGA 1RQMA 1SVMA 4N3ZA 2NBSA 3F8UA 3TRPA 4Z2RA 2H0IA 2CQ9A 1GSDA 2YNXA 4KCAA 1TXXA 1X9WB 1GP1A 4BL7A 3DRNA 3HA9A 3LXTA 4NWYA 2H6YA 3O76A 3QFBC 1OC9A 2GS3A 5ECRB 2I4AA 1GTUA 5AGYA 3EU3A 3GL5A 4KGIA 1MEKA 3N5OA 1XW9A 1QGVA 1SENA 4TR3A 2L5OA 2R6KA 5ENUA 4DVCA 1F3BA 2PU9C 1XOAA 1E6BA 1OC3A 1ST9A 12GSA 1YZXA 2DMLA 2NVLA 3ISOA 2LNSA 3GX8A 1TP9A 2R3XA 11GSA 5DJMA 4LL1B 5IPGA 1Z9HA 4BVYB 4E8HA 3TJKA 5J3RA 1K0AA 4ZB9A 3APSA 1SJ6A 2YPMA 3M9JA 3GV1A 2OE0A 4BWSA 2FA8A 3HYPA 2PERA 1MD4A 1T8EB 4ECCA 1V40A 4NHWA 5IMZA 4LMWA 5HR2A 3FK8A 3CSHA 5H5SA 1ZYPA 1TK8B 4MABA 1IYIA 4EKZA 4PQ1A 2JSZA 2XBQA 4K7NA 2JZSA 1FG4A 3US3A 1WWJA 3LFLA 2FWFA 4DEJA 1ZOFA 3CBUA 4TR0A 5DALB 3NOFA 3UEMA 5JWQB 4KCEA 5E4WA 2HQTA 1TXUA 4Q5FA 2J23A 3KH7A 2QKEA 4Z2TA 5G5FA 3HMJG 1A0RP 1WPIA 4OFNA 17GSA 1ZYNA 3M3MA 4BVYA 3FKFA 2YV7A 1WJKA 1TJDA 3F63A 2B5XA 3RAZA 1TI3A 3NIVA 2PVOC 3GURA 3C1SA 2VCTA 3A2WA 1ERVA 5ECLB 5A4WA 3Q74A 3D21A 2B5EA 4PTSA 4KDUA 3M1GA 1R5PA 4HJ2A 1GSSA 2O87A 2PBJA 4V2MA 1H75A 2LJAA 3H93A 4O92A 4WR5A 2EIQA 1ERTA 5C00A 2X8GA 3I9V2 3W6GA 3UIWA 2VOCA 3I6AA 2V32A 2OADA 3ZMLA 4WBJA 2HZFA 2CVDA 4O5UA 2FNOA 3ZVJD 1U87A 5J41A 4OO4A 4RI7A 1BF5A 3MSZA 4IP6A 4POLA 2RUFA 2OE1A 4O5QA 1B8XA 5DALA 4I5QA 2GLRA 4YAVA 2K8VA 6GSVA 1X0RA 4DSSB 2X8CA 3D22A 1GLQA 2FA4A 4I6XA 4KUNA 1URMA 2H73A 4KH7A 2B6MA 4PURA 5ID2B 1M9AA 1X5CA 5HFKA 3LXZA 2VCXA 1ZZYA 3S9FA 4ICYA 3BD2A 2H1LA 3L4NA 3PPUA 3QR6A 2V6KA 5ECKB 2L4CA 2C1YA 2B7JA 3HJPA 5G5EA 1ZYEA 1F3AA 2C0GA 8GSSA 5HR3A 1J9BA 2GTUA 5A4UA 1B9XC 3L78A 3TGZA 3F9UA 5ECSA 1LBKA 4YQVA 3GMFA 4F82A 1JFUA 1FHEA 1AUCA 4POBA 5KN0A 4K6XA 2PGTA 4JR4A 3DD3A 2IJYA 1JZDA 5CAXA 5B6NA 3KMOA 6GSUA 2R0CA 2RUEA 2OT3A 3Q19A 4CDOA 2O5VA 4ZL9A 2G0FA 2VL2C 13GSA 3KTLA 3KH9A 2FUG2 4MF5A 1ZL9A 2L4QA 1GH2A 2NDOA 3F3QA 4DSSA 4USSA 1T00A 3TKSE 1PN9A 1GSEA 2IPAA 5ID2A 2HSHA 1V98A 1X5DA 1ZGNA 2IMKA 5HR1A 1RK4A 4GLTA 5AISA 3HXSA 4GCIA 1NM3A 3MNGA 3G7JA 1MDJA 3IXRA 3GH6A 1X9MB 2HSNB 4ISDA 5JCWA 3HDCA 1UN2A 1SVOA 4ULXA 3QCPA 5CREA 2F9SA 2CA8A 4I97A 4Z7XA 1YY7A 3IDVA 2PWJA 2I9HA 1G7OA 4YQUA 2G2QA 1F37A 1O73A 3L9UA 4QL9A 3WGXA 2OJLA 2KP1A 2ES7A 2LSTA 2H1AA 5FWGA 1S3DA 1KTEA 2LTKA 1NW2A 1U88A 5A34B 3TKSC 3H79A 2B5YA 2IMEA 6GSSA 2KUCA 1SU9A 1QK8A 2GZYA 1EGOA 2DIYA 3UAPA 4EDYA 4O7HA 4MZBA 4TXVA 2PMTA 4IVFA 2IMIA 2JL4A 1K3OA 4QL7A 2YCDA 5EPFA 2C3NA 3WGEA 1X9SB 5B8BA 3HJOA 2HNLA 4WXTA 4EIQA 2A4VA 4RQXA 1EOGA 3U6VA 3KM6A 3TJBA 6GSXA 2PN8A 1XVWA 5KN1A 1Z5YE 2LQQA 2DJ3A 1EZKA 1KNGA 1V57A 3N9JA 3UVHA 2P0GA 3TCOA 4ZB6A 1TTZA 2N5AA 5A34A 4WKWA 4JZQA 2JSYA 1QUWA 3QD9A 3TJJA 1M7TA 5A5HB 2E2MA 3HKRA 4V2LA 3ZFLA 2AJQB 2VL2A 3M9KA 2O85A 1A2JA 4QQ7A 4MZCA 1F2EA 3C7MA 3J7Yk 5IM9A 3HCZA 3QPMA 1ON4A 2QGVA 1Y25A 3IPZA 2IL3A 1WIKA 2MMOA 3TRQA 2R0PA 3FYGA 3Q6OA 19GSA 2QA2A 3CSJA 3BCIA 5IO0A 2IIYA 4G2EA 3GNJA 2KLXA 1MDIA 4KSOA 3GHAA 1GL8A 4TOPA 3V1WA 4HU7A 2BTOT 3IV4A 5BRTA 3L9VA 2AUVA 3GX0A 3KXOA 3HJMA 3O6TA 4ZILA 3VWXA 3VURA 2VCVA 2MYGA 2B7KA 4G0IA 4NHZA 2GZPA 2J9HA 3UVTA 3C73A 1GLPA 5A5HA 1GNWA 4ZL8A 5CP1A 5GAND 3GFKA 2VLTA 3CTGA 5JCUA 1HNAA 2GSQA 2X64A 4XIHA 4JE1A 3CRUA 3EU4A 4ECJA 1G7EA 1PA3A 2H0GA 3CTFA 2CVBA 4XTSA 2IWTA 4OCFA 3FR6A 4YKFA 2L5LA 2VAFA 1YJ6A 4N0ZA 1Y1UA 1BQ7A 2EFCA 5IQYA 4NXIA 3LYPA 1FOHA 5LNKe 5ECQB 1B4PA 2DBCA 3FZ5A 5J9CA 2YV9A 2XPDA 2VIMA 4CY8A 4L0UA 4K2DA 2GT5A 4X0XA 2MBTA 4EXJA 3GSSA 1A8YA 4MNNA 3ZREA 4HEA2 2H66A 2R37A 1ACVA 1OE7A 2N5FA 2V6OA 5IMDA 3EPTA 2LV3A 1KBNA 1NHOA 4BA7A 1J0FA 3GTUB 2N5BA 4MDCA 4K8MA 4IGJA 1XFLA 3TKQA 4LLRA 1CQHA 3C8EA 4Z2UA 4POKA 3GKKA 1PL1A 2HZEA 1AAZA 2L57A 3IRAA 3TB2A 3G9BA 3CWGA 5EVOA 1WMJA 3ZYWA 2DIZA 1ERUA 2CV4A 3P8WA 1UA5A 1AQXA 1O8XA 3FZ4A 3C71A 3DXBA 2YN1A 2FWEA 3IE3A 2M80A 2H70A 5FHIA 4HOJA 2PVQA 2IFQB 5IOXA 2LJRA 3RPPA 3F4RA 2X49A 5AN1A 2C0FA 1Q4JA 1DBYA 5D96A 4FO5A 4WBRD 3GA4A 2CZ2A 18GSA 3IBHA 4Q5RA 1PSQA 4IS0A 2GVPA 2KOKA 4K9ZA 5HR0A 2CAQA 4JRRA 4EC0A 3L9SA 3KCMA 5B6MA 2VD0A 3FMWA 3P7XA 5KOWA 5ECIB 3GTUA 2E2GA 2FLSA 3IR4A 5INYA 2H0HA 5CRDA 4PX1A 2Z9SA 3HVXA 4MPFA 3DIEA 1V2AA 4NMUA 4GSSA 3GSTA 2B1KA 2D2ZA 1UVZA 5CNWA 1GUMA 5HQPA 3KD0A 1PKZA 3CSIA 2X99A 2IFQA 4V1Ag 5H5RA 4YQMA 2EC4A 3KZQA 4H86A 1YKAA 1T4ZA 4G9HA 4ZBAA 5GAPD 4MP4A 4KAEA 2K8SA 2EFDA 3GKMA 2B1LA 2HYXA 5ECMB 2AAWA 4K5RA 1VF4A 1PN0A 2C80A 1AIUA 3VLNA 3R2QA 3ZL5A 1G0TA 2R0GA 1O85A 2EIOA 4OFMA 1UC7A 4TR4A 4ZB8A 4TW5A 2VM2A 4MJEA 3EMPA 4F2IA 4XS6A 3FHKA 4KNDA 5COHA 3ERWA 3GRXA 1SJIA 1SYXA 4J56E 5CRWA 4CY6A 2CX4A 2ZNMA 3L0HA 3LG6A 1ML6A 1YVLA 1QFNA 4GSNA 4TVEA 1V58A 3ZIVA 3PGTA 4PQIA 1WOUA 3OR5A 2FCHA 4BWQA 1YQ1A 3WGDA 1ABAA 5IO2A 3LSZA 4OFTA 3I69A 2LRTA 5F0GA 2H74A 4GQFA 1FB6A 3MDKA 1TRVA 3IA1A 2REMA 2DC5A 5CO3A 2FWHA 2H30A 1EP7A 5G30A 3GYKA 1FVKA 4GRFA 3APQA 2IN3A 1XWKA 1QMVA 5DAKB 1GTAA 1XIYA 3H4KA 4DSRA 3D5JA 2DJ2A 4WF5A 5D93A 4IHUA 4XS4B 16GSA 1J08A 2FY6A 1EEMA 1BYEA 4JU5A 2WJUA 2ON7A 2I3YA 4DSQA 2V2GA 3PINA 2GSTA 1K3LA 3QDNA 1IYHA 5ECOB 5IMFA 4RQRA 4EO3A 2VUPA 3J7Yb 1SD9A 2LRNA 1K3YA 3RDWA 3AY8A 3GL3A 4AKXB 3VWVA 3GKNA 3H8QA 3QMXA 4N10A 3EINA 3RPNA 2DKIA 1O8WA 2C0DA 3G7YA 3GH9A 3ZIJA 4FYUA 1THOA 1GNEA 3HY2A 2I81A 2GT6A 1V9WA 4N30A 3BCKA 4HU9A 3TRXA 1DUGA 3KEBA 1SL0B 5DAKA 2WB9A 20GSA 4GSTA 3LYKA 3LORA 2X4AA 5G1KA 4V2NA 5DJLA 4G01A 4KX4A 4XS4A 1SKWB 3IC8A 4E68A 9GSSA 2FGXA 1PGTA 1X5EA 4O32A 4RI6A 4L0WA 2XHFA 4ZB7A 2CT6A 4X1UA 2KP2A 2IMDA 4I2TA 3IAS2 1S3AA 3TUEA 1TOFA 2DJ0A 4PGTA 4MPGA 4CW9A 1PMTA 1R26A 2HE3A 4V1Ap 3A5IA 3SWLA 3CXGA 1F6MC 4ID0A 4EDZA 2ON5A 1N2AA 3W8SA 4N0VA 4MF7A 3KMNA 1Y6EA 5BMUB 3MWHA 4IJ3A 5C04A 5IIZA 1OE8A 3IK7A 4G10A 4AJ8A 4HZ4A 2YP6A 4NV5A 3ED3A 2HSNA 2BJXA 2HT9A 3GIXA 3UMAA 1TRSA 3KIJA 1VF3A 1OAZA 2WS2A 3Q18A 5D8IA 4MZWA 1USBA 4FH8A 22GSA 3VPQA 4WETA 3G7IA 1K0NA 3KTBA 3A5WA 2WZ9A 5FT3A 4MK3A 4AJ7A 1M0UA 2M46A 3U5RE 4ML1A 3QFAC 2A2SA 2R4VA 2MMAA 2YZHA 3FZAA 2H1BA 5GSTA 1M2DA 5ELAA 5CRHA 1N8JA 2VL9A 1FW1A 6GSWA 3KP9A 1PRXA 2OBIA 1YEXA 1W89A 1M99A 4IELA 5IMAA 2LUSA 3QOUA 2FWGA 5BMUA 5DQSA 1GSUA 2H6ZA 2YZUA 3CYNA 3UJ1A 1EOHA 3IHGA 4Q5QA 4YKGA 1M9BA 1ZCPA 1Z7RA 1TI1A 2VCWA 4X4JA 6GSYA 5DBQA 4TKYA 2VLUA 1GSFA 2P31A 3SBCA 5IMCA 2WDUA 3FZ9A 2JZTA 2V1MA 4MJAA 3D4MA 4FQUA 2VD1A 1KEBA 4XCSA 3TJFA 2DJJA 4ZBBA 3KP8A 2LRCA 1YDKA 1XCCA 1LU4A 1TW9A 3D6IA 4OWYA 4O5RA 3LGCA 4K5SA 5ELGA 3UBLA 1XVQA 1VF2A 4W66A 1TK0B 1SVLA 1MD3A 3F3RA 1JZWA 1K0MA 3M8NA 4MMMA 1A2LA 4OD7A 4AJ6A 2C0EA 1U3IA 3WT2A 4AGSA 3NZNA 5KN3A 1B4QA 3F6FA 4N11A 3TKSA 1FAAA 3E0UA 1HNBA 3BBYA 3FRCA 1G6WA 5D73A 2H01A 1YF0A 5EL8A 2QSIA 3WD6A 1GRXA 2HRKB 1BX9A 2O89A 2MMZA 2VCZA 2H1GA 2OA7A 4FYCA 2YJ7A 3C1RA 3GKXA 2C8UA 4I2UA 2HSMB 3RHCA 1NHYA 1MDKA 5B8AA 2VL3A 1DSBA 1XWCA 2M72A 1FOVA 3JCML 3DVWA 3TU3B 4HI7A 2VM1A 5DCGA 1VRSD 1EEJA 3PH9A 1ZMAA 5J4YA 1OC8A 4J2FA 1A2MA 3DGQA 4K0GA 2C3QA 5LD0A 1BG1A 2GQLA 3TOUA 5CYYA 2GZZA 2GSRA 3VWWA 3DWVA 3MYDA 2DJKA 2GSSA 2JZRA 5ABRA 4IN0A 3ZFBA 3DEXA 3IC4A 1Z7PA 2H76A 3ME8A 3CRTA 1LJRA 1VF1A 2CAIA 5KN2A 3TOTA 1JZOA 1RW1A 1FVJA 1GSQA 3FR3A 1AXDA 1WP0A 1GSYA 1WRYA 5F06A 2H1DA 2LQOA 3UBKA 2OACA 2HRKA 1JLVA 3M0FA 4EL1A 1T7PB 1EP8A 2ZCTA 3ZITA 3HVSA 3HHVA 2H6XA 1PX6A 2EFEA 5ECNB 4MF6A 2YWNA 5IOWA 2HSMA 5A5KA 4LL4B 2DLXA 1XWBA 4OMVA 1FB0A 1GTIA 4MLYA 4ZBDA 3BOAA 4KB3A 3O3TA 5LCZA 3VFIA 4HJMA 2K9FA 1N25A 4MA9A 2C4JA 5ECHB 3IHQA 1FO5A 4MCUA 1R5AA 2QA1A 4IP1A 3LEFA 5H5QA 5IMVA 4WEYA 2F51A 3FW2A 1TRWA 3EWLA 2YWMA 3EYTA 2GGTA 4ZL7A 2L6CA 2DJ1A 5E59A 1C72A 3EURA 5J4UA 1XXUA 1PQNA 4HQZA 2RM5A 3TKPA 1XBSA 1H4OA 5L71A 1SKRB 4YAPA 2XBIA 3IOSA 2TRXA 3ZTLA 1QXHA 4AKGA 2FHEA 3QAVA 4OCEA 2HLSA 3EVIA 4TR1B 2H8LA 3FEUA 4AKIA 2R2JA 3HZ4A 2OE3A 2IMFA 2C3TA 1QQ2A 2ZUPA 5J5NA 1AW9A 4NAXA 2OKAA 1TK5B 2UV8G 1THXA 1TU8A 4PNGA 3E9JB 3ZVJA 5HFIA 1PX7A 3BJ5A 1R4WA 3HVVA 2P5RA 1SK1A 2HRNA 3LWAA 2H72A 2A2PA 1ILOA 1S3CA 1M2AA 2DKHA 5GZZB 1DE2A 1T4YA 2CX3A 2XC2A 1XWGA 2LEGA 2AV4A 4IJIA 5DQYA 3IK9A 4LA1A 2UZ8A 5KEJA 1SL2B 4BVXB 4P3YB 5G1LA 1Z3EA 1AC1A 2LJKA 5KOXA 4L5LA 2WFCA 1OKDA 4NV2A 4ML6A 2YOIA 4TR1A 4HS1A 2K18A 3E3EA 4TXOB 4ECBA 2DSAA 5GSSA 4RUVA 2YWIA 4IKHA 3F6DA 1MTCA 1PL2A 1A23A 4MJBA 1JHBA 1U6TA 3A3TA 5DCHA 3CMIA 4L5OA 3ME7A 4ACSA 1T1VA 4I8BA 4KDXA 4PUAA 3H1NA 1M2BA 2KHPA 1XPVA 4KA0A 2X8HA 1AQVA 4GQCA 2YJHA 3A2XA 4KSMA 2QC7A 1YEPA 4ZXGA 1XW6A 2JADA 5J9BA 5JCGA 5ECPB 4NPBA 1SYRA 4CHSA 2GQKA 5G2ZA 5F8BA 5DVBA 3W8JA 4XS1A 4AKHA 3UL3A 1U3AA 3UOMA 4EIPA 2CVKA 3HD5A 4JR6A 2DMMA 4BVXA 4IQAA 3ZZXA 1BJXA 2WRTA 2YANA 4AI6A 4EF0A 4MJCA 2MBSA 2VCQA 2MMNA 5F07A 2HRFA 1OVNA 3F0IA 1GUKA 4EUYA 4TRXA 1AQWA 3UARA 3P2AA 2B3SA 1TKDB 1YKCA 2K6VA 1K0CA 3FR9A 4A5PA 4TXOA 1K0DA 4BPYA 1BG5A 4G19A 2F3MA 3DMLA 1GWCA 2LS5A 4MH3A 4F9ZA 3VWUA 1TRUA 3FY7A 14GSA 4KF9A 4PUFC 2RIIA 4ZIJA 1XZOA 4OO5A 4F03A 2MZCA 4PXOA 1O7UA 1Z6NA 4HZ2A 1K0BA 2JU5A 2LKUA 2HSYA 4JEDA 3QAWA 4HDEA 3ERGA 1A8LA 1SK0A 5J4VA 4L8EA 1HYUA 4POMA 3I43A 4TN8A 4KE3A 4XHMA 1GUHA 4K1FA 5D9TA 3TJGA 2V41A 1E2YA 3ZRDA 4XRAA 5DDLA 1TU7A 4KW6A 3MAKA 5AIXA 4WR4A 2RM6A 1A0FA 5CRGA 5A1NB 3HZ8A 1EWXA 1HD2A 2L59A 3KJYA 2NPBA 2GDRA 4G0LA 2EFHA 3QAGA 2WCIA 4XRDA 1DE1A 1BEDA 3F4SA 2HFDA 3P90A 2WULA 1GTBA 1Z6MA 2TRCP 1B48A 2AHEA 4K0NA 3APOA 4PNFA 4YH2A 4WF4A 3VI7A 4PQHA 5EY6A 5G31A 1GULA 4KDYA 5F05A 3DYRA 4X43A 3ERFA 1PKWA 4IBPA 2NTOA 1R7HA 4K7OA 1XW5A 2JACA 2A4HA 5JWRB 4F0BA 4GF0A 4GWRA 1Q98A 5IPHA 5D9XA 4Q5NA 1HNCA 4G0KA 4JBBA 1JZRA 3EMXA 7GSSA 2HI7A 4HUAA 1SK2A 3LW9A 10GSA 1SJZA 3VK9A 1B9YC 4IQ1A 4ECIA 1HQOA 6GSTA 1NSWA 2AB6A 4GDFA 2P5QA 2WGRA 2ALBA 1SL1B 3KGKA 1XOBA 3DKSA 2O7KA 5A1NA 4D73B 3DVXA 2R5GA 1I9DA 5J47A 2VLVA 2E7PA 4K2XA 2PPTA 1OKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPE A;  4AF2 A;  2EIR A;  3TKR A;  4EVM A;  3TDG A;  2HRA A;  1EV4 A;  3EC3 A;  3PR8 A;  3ZMK A;  1WE0 A;  1OYJ A;  4J57 E;  5HFG A;  3EE2 A;  2PUK C;  3A2V A;  4EE0 A;  2FD3 A;  2CZ3 A;  5B7C A;  4ILF A;  3WYW A;  1O6J A;  3WT1 A;  2GQM A;  5D9W A;  3D0Z A;  1W4V A;  3R3E A;  1F9M A;  3LJR A;  2O8V B;  4IW9 A;  5JWO B;  1G6Y A;  5D9V A;  1VGL A;  3GUS A;  1SKS B;  3D4T A;  4D73 A;  3F4T A;  2F8A A;  3VI5 A;  4HQS A;  1EV9 A;  1A24 A;  5AIV A;  2F8F A;  1SD8 A;  1BAY A;  4FYB A;  2I1U A;  4BL7 B;  3K8N A;  4GTU A;  3VPT A;  2VO4 A;  1PD2 1;  4K7I A;  1OC9 B;  2OBK A;  4GXZ A;  4E8E A;  3ZLP A;  1EGR A;  2E0Q A;  2HZE B;  1ERW A;  2A2R A;  1K0O A;  5A4V A;  2RLI A;  1JLW A;  4LMV A;  2TIR A;  1ZYQ B;  4F0C A;  2HXK A;  3IAM 2;  2AYT A;  1I5G A;  1YF1 A;  4MH2 A;  2LNT A;  4FIW A;  3RBT A;  1TDI A;  2BMX A;  1T3B A;  3GN3 A;  2H19 A;  2H71 A;  2H75 A;  2YWO A;  3RHB A;  1XWA A;  1O81 A;  3LQ7 A;  2L6D A;  1CQG A;  1RQM A;  2NBS A;  3F8U A;  3TRP A;  2H0I A;  2CQ9 A;  1GSD A;  2YNX A;  4KCA A;  1TXX A;  1X9W B;  1GP1 A;  4BL7 A;  3DRN A;  3HA9 A;  3LXT A;  4NWY A;  2H6Y A;  3O76 A;  3QFB C;  1OC9 A;  2GS3 A;  5ECR B;  2I4A A;  1GTU A;  5AGY A;  3EU3 A;  3GL5 A;  4KGI A;  1MEK A;  3N5O A;  1XW9 A;  1QGV A;  1SEN A;  4TR3 A;  2L5O A;  2R6K A;  5ENU A;  4DVC A;  1F3B A;  2PU9 C;  1XOA A;  1E6B A;  1OC3 A;  1ST9 A;  12GS A;  1YZX A;  2DML A;  2NVL A;  3ISO A;  2LNS A;  3GX8 A;  1TP9 A;  2R3X A;  11GS A;  5DJM A;  4LL1 B;  5IPG A;  1Z9H A;  4BVY B;  4E8H A;  3TJK A;  5J3R A;  1K0A A;  4ZB9 A;  3APS A;  1SJ6 A;  2YPM A;  3M9J A;  3GV1 A;  2OE0 A;  4BWS A;  2FA8 A;  3HYP A;  2PER A;  1MD4 A;  1T8E B;  4ECC A;  1V40 A;  4NHW A;  5IMZ A;  4LMW A;  5HR2 A;  3FK8 A;  3CSH A;  5H5S A;  1TK8 B;  4MAB A;  1IYI A;  4EKZ A;  4PQ1 A;  2JSZ A;  2XBQ A;  4K7N A;  2JZS A;  1FG4 A;  3US3 A;  1WWJ A;  3LFL A;  2FWF A;  4DEJ A;  1ZOF A;  3CBU A;  4TR0 A;  5DAL B;  3NOF A;  3UEM A;  5JWQ B;  4KCE A;  5E4W A;  2HQT A;  4Q5F A;  2J23 A;  3KH7 A;  2QKE A;  5G5F A;  1A0R P;  1WPI A;  4OFN A;  17GS A;  3M3M A;  4BVY A;  3FKF A;  2YV7 A;  1WJK A;  1TJD A;  3F63 A;  2B5X A;  3RAZ A;  1TI3 A;  3NIV A;  2PVO C;  3GUR A;  3C1S A;  2VCT A;  3A2W A;  1ERV A;  5ECL B;  5A4W A;  3Q74 A;  3D21 A;  2B5E A;  4PTS A;  4KDU A;  3M1G A;  1R5P A;  4HJ2 A;  1GSS A;  2O87 A;  2PBJ A;  4V2M A;  1H75 A;  2LJA A;  3H93 A;  4O92 A;  4WR5 A;  2EIQ A;  1ERT A;  5C00 A;  2X8G A;  3I9V 2;  3W6G A;  3UIW A;  2VOC A;  3I6A A;  2V32 A;  2OAD A;  3ZML A;  4WBJ A;  2HZF A;  2CVD A;  2FNO A;  3ZVJ D;  1U87 A;  5J41 A;  4OO4 A;  4RI7 A;  3MSZ A;  4IP6 A;  4POL A;  2RUF A;  2OE1 A;  1B8X A;  5DAL A;  4I5Q A;  2GLR A;  4YAV A;  2K8V A;  6GSV A;  1X0R A;  4DSS B;  2X8C A;  3D22 A;  1GLQ A;  2FA4 A;  4I6X A;  4KUN A;  1URM A;  2H73 A;  4KH7 A;  2B6M A;  4PUR A;  5ID2 B;  1M9A A;  1X5C A;  5HFK A;  3LXZ A;  2VCX A;  1ZZY A;  3S9F A;  3BD2 A;  3L4N A;  3PPU A;  3QR6 A;  2V6K A;  5ECK B;  2L4C A;  2C1Y A;  2B7J A;  3HJP A;  5G5E A;  1ZYE A;  1F3A A;  2C0G A;  8GSS A;  5HR3 A;  1J9B A;  2GTU A;  5A4U A;  1B9X C;  3L78 A;  3TGZ A;  3F9U A;  5ECS A;  1LBK A;  4YQV A;  3GMF A;  4F82 A;  1JFU A;  1FHE A;  1AUC A;  4POB A;  5KN0 A;  4K6X A;  2PGT A;  4JR4 A;  3DD3 A;  2IJY A;  1JZD A;  5CAX A;  5B6N A;  3KMO A;  6GSU A;  2RUE A;  3Q19 A;  4CDO A;  4ZL9 A;  2G0F A;  2VL2 C;  13GS A;  3KTL A;  2FUG 2;  3KH9 A;  4MF5 A;  1ZL9 A;  2L4Q A;  1GH2 A;  2NDO A;  3F3Q A;  4DSS A;  4USS A;  1T00 A;  3TKS E;  1PN9 A;  1GSE A;  2IPA A;  5ID2 A;  2HSH A;  1V98 A;  1X5D A;  1ZGN A;  2IMK A;  5HR1 A;  1RK4 A;  4GLT A;  5AIS A;  3HXS A;  4GCI A;  1NM3 A;  3MNG A;  3G7J A;  1MDJ A;  3IXR A;  3GH6 A;  1X9M B;  2HSN B;  4ISD A;  5JCW A;  3HDC A;  1UN2 A;  4ULX A;  3QCP A;  5CRE A;  2F9S A;  2CA8 A;  4I97 A;  4Z7X A;  1YY7 A;  3IDV A;  2PWJ A;  2I9H A;  1G7O A;  4YQU A;  2G2Q A;  1F37 A;  1O73 A;  3L9U A;  4QL9 A;  3WGX A;  2OJL A;  2KP1 A;  2ES7 A;  2LST A;  2H1A A;  5FWG A;  1S3D A;  1KTE A;  2LTK A;  1NW2 A;  1U88 A;  3TKS C;  3H79 A;  2B5Y A;  2IME A;  6GSS A;  2KUC A;  1SU9 A;  1QK8 A;  2GZY A;  1EGO A;  2DIY A;  3UAP A;  4EDY A;  4O7H A;  4MZB A;  4TXV A;  2PMT A;  4IVF A;  2IMI A;  2JL4 A;  1K3O A;  4QL7 A;  2YCD A;  5EPF A;  2C3N A;  3WGE A;  1X9S B;  5B8B A;  3HJO A;  2HNL A;  4WXT A;  2A4V A;  4RQX A;  1EOG A;  3U6V A;  3KM6 A;  3TJB A;  6GSX A;  2PN8 A;  1XVW A;  5KN1 A;  1Z5Y E;  2LQQ A;  2DJ3 A;  1EZK A;  1KNG A;  1V57 A;  3N9J A;  3UVH A;  2P0G A;  3TCO A;  4ZB6 A;  1TTZ A;  2N5A A;  4WKW A;  4JZQ A;  2JSY A;  1QUW A;  3QD9 A;  3TJJ A;  1M7T A;  4V2L A;  2E2M A;  3HKR A;  3ZFL A;  2AJQ B;  2VL2 A;  3M9K A;  2O85 A;  1A2J A;  4QQ7 A;  4MZC A;  1F2E A;  3C7M A;  3J7Y k;  5IM9 A;  3HCZ A;  3QPM A;  1ON4 A;  2QGV A;  1Y25 A;  3IPZ A;  2IL3 A;  1WIK A;  2MMO A;  3TRQ A;  3FYG A;  3Q6O A;  19GS A;  3CSJ A;  3BCI A;  5IO0 A;  2IIY A;  4G2E A;  3GNJ A;  2KLX A;  1MDI A;  4KSO A;  3GHA A;  1GL8 A;  4TOP A;  3V1W A;  4HU7 A;  2BTO T;  3IV4 A;  3L9V A;  2AUV A;  3GX0 A;  3KXO A;  3HJM A;  3O6T A;  4ZIL A;  3VWX A;  3VUR A;  2VCV A;  2MYG A;  2B7K A;  4G0I A;  4NHZ A;  2GZP A;  2J9H A;  3UVT A;  3C73 A;  1GLP A;  1GNW A;  4ZL8 A;  5CP1 A;  5GAN D;  3GFK A;  2VLT A;  3CTG A;  5JCU A;  1HNA A;  2GSQ A;  2X64 A;  4XIH A;  4JE1 A;  3CRU A;  3EU4 A;  4ECJ A;  1G7E A;  1PA3 A;  2H0G A;  3CTF A;  2CVB A;  4XTS A;  2IWT A;  4OCF A;  3FR6 A;  2L5L A;  2VAF A;  1YJ6 A;  4N0Z A;  1BQ7 A;  5IQY A;  4NXI A;  3LYP A;  5LNK e;  5ECQ B;  1B4P A;  2DBC A;  3FZ5 A;  5J9C A;  2YV9 A;  2XPD A;  2VIM A;  4L0U A;  4K2D A;  2GT5 A;  4X0X A;  2MBT A;  4EXJ A;  3GSS A;  1A8Y A;  3ZRE A;  4HEA 2;  2H66 A;  2R37 A;  1ACV A;  1OE7 A;  2N5F A;  2V6O A;  5IMD A;  2LV3 A;  1KBN A;  1NHO A;  4BA7 A;  1J0F A;  3GTU B;  2N5B A;  4MDC A;  4K8M A;  4IGJ A;  1XFL A;  3TKQ A;  4LLR A;  1CQH A;  3C8E A;  4POK A;  3GKK A;  1PL1 A;  2HZE A;  1AAZ A;  2L57 A;  3IRA A;  3TB2 A;  3G9B A;  5EVO A;  1WMJ A;  3ZYW A;  2DIZ A;  1ERU A;  2CV4 A;  3P8W A;  1UA5 A;  1AQX A;  1O8X A;  3FZ4 A;  3C71 A;  3DXB A;  2YN1 A;  2FWE A;  3IE3 A;  2M80 A;  2H70 A;  5FHI A;  4HOJ A;  2PVQ A;  2IFQ B;  5IOX A;  2LJR A;  3RPP A;  3F4R A;  5AN1 A;  2C0F A;  1Q4J A;  1DBY A;  5D96 A;  4FO5 A;  4WBR D;  3GA4 A;  2CZ2 A;  18GS A;  3IBH A;  4Q5R A;  1PSQ A;  4IS0 A;  2GVP A;  2KOK A;  4K9Z A;  5HR0 A;  2CAQ A;  4JRR A;  4EC0 A;  3L9S A;  3KCM A;  5B6M A;  2VD0 A;  3P7X A;  5ECI B;  3GTU A;  2E2G A;  2FLS A;  3IR4 A;  5INY A;  2H0H A;  5CRD A;  4PX1 A;  2Z9S A;  3HVX A;  4MPF A;  3DIE A;  1V2A A;  4NMU A;  4GSS A;  3GST A;  2B1K A;  2D2Z A;  1UVZ A;  5CNW A;  1GUM A;  5HQP A;  3KD0 A;  1PKZ A;  3CSI A;  2X99 A;  2IFQ A;  4V1A g;  5H5R A;  4YQM A;  2EC4 A;  3KZQ A;  4H86 A;  1YKA A;  1T4Z A;  4G9H A;  4ZBA A;  5GAP D;  4MP4 A;  4KAE A;  2K8S A;  3GKM A;  2B1L A;  2HYX A;  5ECM B;  2AAW A;  1VF4 A;  2C80 A;  1AIU A;  3VLN A;  3R2Q A;  3ZL5 A;  1G0T A;  1O85 A;  2EIO A;  4OFM A;  1UC7 A;  4TR4 A;  4ZB8 A;  4TW5 A;  2VM2 A;  4MJE A;  3EMP A;  4F2I A;  4XS6 A;  3FHK A;  4KND A;  5COH A;  3ERW A;  3GRX A;  1SJI A;  1SYX A;  4J56 E;  5CRW A;  2CX4 A;  2ZNM A;  3L0H A;  3LG6 A;  1ML6 A;  1QFN A;  4GSN A;  4TVE A;  1V58 A;  3ZIV A;  3PGT A;  4PQI A;  1WOU A;  3OR5 A;  2FCH A;  4BWQ A;  1YQ1 A;  3WGD A;  1ABA A;  5IO2 A;  3LSZ A;  4OFT A;  3I69 A;  2LRT A;  5F0G A;  2H74 A;  4GQF A;  1FB6 A;  3MDK A;  1TRV A;  3IA1 A;  2REM A;  2DC5 A;  5CO3 A;  2FWH A;  2H30 A;  1EP7 A;  5G30 A;  3GYK A;  1FVK A;  4GRF A;  3APQ A;  2IN3 A;  1XWK A;  1QMV A;  5DAK B;  1GTA A;  1XIY A;  3H4K A;  4DSR A;  3D5J A;  2DJ2 A;  4WF5 A;  5D93 A;  4IHU A;  4XS4 B;  16GS A;  1J08 A;  2FY6 A;  1EEM A;  1BYE A;  4JU5 A;  2WJU A;  2ON7 A;  2I3Y A;  4DSQ A;  2V2G A;  3PIN A;  2GST A;  1K3L A;  3QDN A;  1IYH A;  5ECO B;  5IMF A;  4RQR A;  4EO3 A;  2VUP A;  3J7Y b;  1SD9 A;  2LRN A;  1K3Y A;  3RDW A;  3AY8 A;  3GL3 A;  3VWV A;  3GKN A;  3H8Q A;  3QMX A;  4N10 A;  3EIN A;  3RPN A;  1O8W A;  2C0D A;  3G7Y A;  3GH9 A;  3ZIJ A;  4FYU A;  1THO A;  1GNE A;  3HY2 A;  2I81 A;  2GT6 A;  1V9W A;  4N30 A;  3BCK A;  4HU9 A;  3TRX A;  1DUG A;  3KEB A;  1SL0 B;  5DAK A;  2WB9 A;  20GS A;  4GST A;  3LYK A;  3LOR A;  5G1K A;  4V2N A;  5DJL A;  4KX4 A;  4XS4 A;  1SKW B;  3IC8 A;  9GSS A;  2FGX A;  1PGT A;  1X5E A;  4O32 A;  4RI6 A;  4L0W A;  2XHF A;  2CT6 A;  4X1U A;  2KP2 A;  2IMD A;  4I2T A;  3IAS 2;  1S3A A;  3TUE A;  1TOF A;  2DJ0 A;  4PGT A;  4MPG A;  4CW9 A;  1PMT A;  1R26 A;  2HE3 A;  4V1A p;  3SWL A;  3CXG A;  1F6M C;  4ID0 A;  4EDZ A;  2ON5 A;  1N2A A;  3W8S A;  4N0V A;  4MF7 A;  3KMN A;  1Y6E A;  3MWH A;  4IJ3 A;  5C04 A;  5IIZ A;  1OE8 A;  3IK7 A;  4G10 A;  4AJ8 A;  4HZ4 A;  2YP6 A;  4NV5 A;  3ED3 A;  2BJX A;  2HT9 A;  3UMA A;  3GIX A;  1TRS A;  3KIJ A;  1VF3 A;  1OAZ A;  2WS2 A;  3Q18 A;  5D8I A;  4MZW A;  1USB A;  4FH8 A;  22GS A;  3VPQ A;  4WET A;  3G7I A;  1K0N A;  3KTB A;  3A5W A;  2WZ9 A;  5FT3 A;  4MK3 A;  4AJ7 A;  1M0U A;  2M46 A;  3U5R E;  4ML1 A;  3QFA C;  2A2S A;  2R4V A;  2MMA A;  2YZH A;  3FZA A;  2H1B A;  5GST A;  1M2D A;  5ELA A;  5CRH A;  1N8J A;  2VL9 A;  1FW1 A;  6GSW A;  3KP9 A;  1PRX A;  2OBI A;  1YEX A;  1W89 A;  1M99 A;  4IEL A;  5IMA A;  2LUS A;  3QOU A;  2FWG A;  5BMU A;  5DQS A;  1GSU A;  2H6Z A;  2YZU A;  3CYN A;  3UJ1 A;  1EOH A;  4Q5Q A;  1M9B A;  1ZCP A;  1Z7R A;  1TI1 A;  2VCW A;  6GSY A;  5DBQ A;  4TKY A;  2VLU A;  1GSF A;  2P31 A;  3SBC A;  5IMC A;  2WDU A;  3FZ9 A;  2JZT A;  2V1M A;  4MJA A;  3D4M A;  4FQU A;  2VD1 A;  1KEB A;  4XCS A;  3TJF A;  2DJJ A;  4ZBB A;  3KP8 A;  2LRC A;  1YDK A;  1XCC A;  1LU4 A;  1TW9 A;  3D6I A;  4OWY A;  4O5R A;  3LGC A;  5ELG A;  3UBL A;  1XVQ A;  1VF2 A;  1TK0 B;  1MD3 A;  3F3R A;  1JZW A;  1K0M A;  3M8N A;  4MMM A;  1A2L A;  4OD7 A;  4AJ6 A;  2C0E A;  1U3I A;  3WT2 A;  4AGS A;  3NZN A;  5KN3 A;  1B4Q A;  3F6F A;  4N11 A;  3TKS A;  1FAA A;  3E0U A;  1HNB A;  3BBY A;  3FRC A;  1G6W A;  5D73 A;  2H01 A;  1YF0 A;  5EL8 A;  2QSI A;  3WD6 A;  1GRX A;  2HRK B;  1BX9 A;  2O89 A;  2MMZ A;  2VCZ A;  2H1G A;  2OA7 A;  4FYC A;  2YJ7 A;  3C1R A;  3GKX A;  2C8U A;  4I2U A;  2HSM B;  3RHC A;  1NHY A;  1MDK A;  5B8A A;  2VL3 A;  1DSB A;  1XWC A;  2M72 A;  1FOV A;  3JCM L;  3DVW A;  4HI7 A;  2VM1 A;  5DCG A;  1VRS D;  1EEJ A;  3PH9 A;  1ZMA A;  1OC8 A;  4J2F A;  1A2M A;  3DGQ A;  4K0G A;  2C3Q A;  5LD0 A;  2GQL A;  3TOU A;  5CYY A;  2GZZ A;  2GSR A;  3VWW A;  3DWV A;  2DJK A;  2GSS A;  2JZR A;  5ABR A;  4IN0 A;  3ZFB A;  3DEX A;  3IC4 A;  1Z7P A;  2H76 A;  3ME8 A;  3CRT A;  1LJR A;  1VF1 A;  2CAI A;  5KN2 A;  3TOT A;  1JZO A;  1RW1 A;  1FVJ A;  1GSQ A;  3FR3 A;  1AXD A;  1WP0 A;  1GSY A;  1WRY A;  5F06 A;  2H1D A;  2LQO A;  3UBK A;  2OAC A;  2HRK A;  1JLV A;  3M0F A;  4EL1 A;  1T7P B;  1EP8 A;  2ZCT A;  3ZIT A;  3HVS A;  3HHV A;  2H6X A;  1PX6 A;  5ECN B;  4MF6 A;  2YWN A;  5IOW A;  2HSM A;  5A5K A;  4LL4 B;  2DLX A;  1XWB A;  4OMV A;  1FB0 A;  1GTI A;  4MLY A;  4ZBD A;  3BOA A;  4KB3 A;  3O3T A;  5LCZ A;  3VFI A;  4HJM A;  2K9F A;  4MA9 A;  2C4J A;  5ECH B;  3IHQ A;  1FO5 A;  4MCU A;  1R5A A;  5H5Q A;  4IP1 A;  3LEF A;  5IMV A;  4WEY A;  2F51 A;  3FW2 A;  1TRW A;  3EWL A;  2YWM A;  3EYT A;  2GGT A;  4ZL7 A;  2L6C A;  2DJ1 A;  5E59 A;  1C72 A;  3EUR A;  5J4U A;  1XXU A;  1PQN A;  4HQZ A;  2RM5 A;  3TKP A;  1XBS A;  1H4O A;  5L71 A;  1SKR B;  4YAP A;  2XBI A;  3IOS A;  2TRX A;  3ZTL A;  1QXH A;  4OCE A;  2FHE A;  3QAV A;  2HLS A;  3EVI A;  4TR1 B;  2H8L A;  3FEU A;  3HZ4 A;  2R2J A;  2OE3 A;  2IMF A;  2C3T A;  1QQ2 A;  2ZUP A;  5J5N A;  1AW9 A;  4NAX A;  2OKA A;  1TK5 B;  1THX A;  1TU8 A;  4PNG A;  3E9J B;  3ZVJ A;  5HFI A;  1PX7 A;  3BJ5 A;  1R4W A;  3HVV A;  2P5R A;  1SK1 A;  2HRN A;  3LWA A;  2H72 A;  1ILO A;  1S3C A;  1M2A A;  5GZZ B;  1DE2 A;  1T4Y A;  2CX3 A;  2XC2 A;  1XWG A;  2LEG A;  2AV4 A;  4IJI A;  5DQY A;  3IK9 A;  4LA1 A;  2UZ8 A;  5KEJ A;  1SL2 B;  4BVX B;  4P3Y B;  5G1L A;  1Z3E A;  1AC1 A;  2LJK A;  4L5L A;  2WFC A;  1OKD A;  4NV2 A;  4ML6 A;  2YOI A;  4TR1 A;  4HS1 A;  2K18 A;  3E3E A;  4TXO B;  4ECB A;  2DSA A;  5GSS A;  4RUV A;  2YWI A;  4IKH A;  3F6D A;  1MTC A;  1PL2 A;  1A23 A;  4MJB A;  1JHB A;  1U6T A;  3A3T A;  5DCH A;  3CMI A;  4L5O A;  3ME7 A;  4ACS A;  1T1V A;  4I8B A;  4KDX A;  4PUA A;  3H1N A;  1M2B A;  2KHP A;  1XPV A;  4KA0 A;  2X8H A;  1AQV A;  4GQC A;  2YJH A;  3A2X A;  4KSM A;  2QC7 A;  1YEP A;  4ZXG A;  1XW6 A;  2JAD A;  5J9B A;  5JCG A;  5ECP B;  4NPB A;  1SYR A;  4CHS A;  2GQK A;  5G2Z A;  5F8B A;  5DVB A;  3W8J A;  4XS1 A;  3UL3 A;  1U3A A;  3UOM A;  2CVK A;  3HD5 A;  4JR6 A;  2DMM A;  4BVX A;  4IQA A;  3ZZX A;  1BJX A;  2WRT A;  2YAN A;  4EF0 A;  4MJC A;  2MBS A;  2VCQ A;  2MMN A;  5F07 A;  2HRF A;  1OVN A;  3F0I A;  1GUK A;  4EUY A;  4TRX A;  1AQW A;  3UAR A;  3P2A A;  2B3S A;  1TKD B;  1YKC A;  2K6V A;  1K0C A;  3FR9 A;  4TXO A;  1K0D A;  4BPY A;  1BG5 A;  4G19 A;  2F3M A;  3DML A;  1GWC A;  2LS5 A;  4MH3 A;  4F9Z A;  3VWU A;  1TRU A;  3FY7 A;  14GS A;  4KF9 A;  4PUF C;  2RII A;  4ZIJ A;  1XZO A;  4OO5 A;  4F03 A;  2MZC A;  4PXO A;  1O7U A;  1Z6N A;  4HZ2 A;  1K0B A;  2JU5 A;  2LKU A;  2HSY A;  4JED A;  3QAW A;  4HDE A;  3ERG A;  1A8L A;  1SK0 A;  4L8E A;  1HYU A;  4POM A;  3I43 A;  4TN8 A;  4KE3 A;  4XHM A;  1GUH A;  4K1F A;  5D9T A;  3TJG A;  2V41 A;  1E2Y A;  3ZRD A;  4XRA A;  5DDL A;  1TU7 A;  4KW6 A;  3MAK A;  5AIX A;  4WR4 A;  2RM6 A;  1A0F A;  5CRG A;  3HZ8 A;  1EWX A;  1HD2 A;  2L59 A;  3KJY A;  2NPB A;  2GDR A;  4G0L A;  2WCI A;  3QAG A;  4XRD A;  1DE1 A;  1BED A;  3F4S A;  2HFD A;  3P90 A;  2WUL A;  1GTB A;  1Z6M A;  2TRC P;  1B48 A;  2AHE A;  4K0N A;  3APO A;  4PNF A;  4YH2 A;  4WF4 A;  3VI7 A;  4PQH A;  5EY6 A;  5G31 A;  1GUL A;  4KDY A;  5F05 A;  3DYR A;  4X43 A;  3ERF A;  1PKW A;  4IBP A;  2NTO A;  1R7H A;  4K7O A;  1XW5 A;  2JAC A;  5JWR B;  4F0B A;  4GF0 A;  4GWR A;  1Q98 A;  5IPH A;  5D9X A;  4Q5N A;  1HNC A;  4G0K A;  4JBB A;  1JZR A;  3EMX A;  7GSS A;  2HI7 A;  4HUA A;  1SK2 A;  10GS A;  1SJZ A;  3VK9 A;  1B9Y C;  4IQ1 A;  4ECI A;  1HQO A;  6GST A;  1NSW A;  2AB6 A;  2P5Q A;  2WGR A;  2ALB A;  1SL1 B;  3KGK A;  1XOB A;  3DKS A;  2O7K A;  4D73 B;  3DVX A;  2R5G A;  1I9D A;  2VLV A;  2E7P A;  2PPT A;  1OKT A; 
#chains in the Genus database with same CATH topology
 2XPE A;  4AF2 A;  2EIR A;  3TKR A;  4EVM A;  3TDG A;  2HRA A;  1EV4 A;  3EC3 A;  3PR8 A;  3ZMK A;  1WE0 A;  1OYJ A;  4J57 E;  5HFG A;  3EE2 A;  2PUK C;  3A2V A;  4EE0 A;  2FD3 A;  2CZ3 A;  5B7C A;  4ILF A;  3WYW A;  1O6J A;  3WT1 A;  2GQM A;  5D9W A;  3D0Z A;  1W4V A;  3R3E A;  1F9M A;  3LJR A;  2O8V B;  4IW9 A;  5JWO B;  5J40 A;  1G6Y A;  5D9V A;  1VGL A;  3GUS A;  3MIX A;  1SKS B;  1S3R A;  3D4T A;  4D73 A;  3F4T A;  2F8A A;  3VI5 A;  4HQS A;  1EV9 A;  1A24 A;  5AIV A;  2F8F A;  1SD8 A;  1BAY A;  4FYB A;  2I1U A;  4BL7 B;  3K8N A;  4GTU A;  3VPT A;  2VO4 A;  1PD2 1;  4K7I A;  1OC9 B;  4FXY P;  2OBK A;  4GXZ A;  2VKZ G;  4E8E A;  3ZLP A;  1EGR A;  2E0Q A;  2HZE B;  1ERW A;  2A2R A;  1K0O A;  5A4V A;  2RLI A;  1JLW A;  4LMV A;  2TIR A;  1ZYQ B;  4F0C A;  2HXK A;  3IAM 2;  3CHX C;  2AYT A;  1I5G A;  1YF1 A;  4MH2 A;  2LNT A;  4QMK A;  4FIW A;  3RBT A;  1TDI A;  2BMX A;  1T3B A;  3GN3 A;  2H19 A;  2H71 A;  2H75 A;  2YWO A;  3RHB A;  1XWA A;  1O81 A;  3LQ7 A;  2L6D A;  1CQG A;  1RQM A;  1SVM A;  4N3Z A;  2NBS A;  3F8U A;  3TRP A;  4Z2R A;  2H0I A;  2CQ9 A;  1GSD A;  2YNX A;  4KCA A;  1TXX A;  1X9W B;  1GP1 A;  4BL7 A;  3DRN A;  3HA9 A;  3LXT A;  4NWY A;  2H6Y A;  3O76 A;  3QFB C;  1OC9 A;  2GS3 A;  5ECR B;  2I4A A;  1GTU A;  5AGY A;  3EU3 A;  3GL5 A;  4KGI A;  1MEK A;  3N5O A;  1XW9 A;  1QGV A;  1SEN A;  4TR3 A;  2L5O A;  2R6K A;  5ENU A;  4DVC A;  1F3B A;  2PU9 C;  1XOA A;  1E6B A;  1OC3 A;  1ST9 A;  12GS A;  1YZX A;  2DML A;  2NVL A;  3ISO A;  2LNS A;  3GX8 A;  1TP9 A;  2R3X A;  11GS A;  5DJM A;  4LL1 B;  5IPG A;  1Z9H A;  4BVY B;  4E8H A;  3TJK A;  5J3R A;  1K0A A;  4ZB9 A;  3APS A;  1SJ6 A;  2YPM A;  3M9J A;  3GV1 A;  2OE0 A;  4BWS A;  2FA8 A;  3HYP A;  1S4B P;  2PER A;  1MD4 A;  1T8E B;  4ECC A;  1V40 A;  4NHW A;  5IMZ A;  4LMW A;  5HR2 A;  3FK8 A;  3CSH A;  5H5S A;  1ZYP A;  1TK8 B;  4MAB A;  1IYI A;  4EKZ A;  4PQ1 A;  2JSZ A;  2XBQ A;  4K7N A;  2JZS A;  1FG4 A;  3US3 A;  1WWJ A;  3LFL A;  2FWF A;  4DEJ A;  1ZOF A;  3CBU A;  4TR0 A;  5DAL B;  3NOF A;  3UEM A;  5JWQ B;  4KCE A;  5E4W A;  2HQT A;  1TXU A;  4Q5F A;  2J23 A;  3KH7 A;  2QKE A;  4Z2T A;  5G5F A;  3HMJ G;  1A0R P;  1WPI A;  4PI0 C;  4OFN A;  17GS A;  1ZYN A;  3M3M A;  4BVY A;  3FKF A;  2YV7 A;  1WJK A;  1TJD A;  3F63 A;  2B5X A;  3RAZ A;  1TI3 A;  3NIV A;  2PVO C;  3GUR A;  3C1S A;  2VCT A;  3A2W A;  1ERV A;  5ECL B;  5A4W A;  3Q74 A;  3D21 A;  2B5E A;  4PTS A;  4KDU A;  3M1G A;  1R5P A;  4HJ2 A;  1GSS A;  2O87 A;  2PBJ A;  4V2M A;  1H75 A;  2LJA A;  3H93 A;  4O92 A;  4WR5 A;  2EIQ A;  1ERT A;  5C00 A;  2X8G A;  3I9V 2;  3W6G A;  3UIW A;  2VOC A;  3I6A A;  2V32 A;  2OAD A;  3ZML A;  4WBJ A;  2HZF A;  2CVD A;  4O5U A;  2FNO A;  3ZVJ D;  1U87 A;  5J41 A;  4OO4 A;  4RI7 A;  1BF5 A;  3MSZ A;  4IP6 A;  4POL A;  2RUF A;  2OE1 A;  4O5Q A;  1B8X A;  5DAL A;  4I5Q A;  2GLR A;  4YAV A;  2K8V A;  6GSV A;  1X0R A;  4DSS B;  2X8C A;  3D22 A;  1GLQ A;  2FA4 A;  4I6X A;  4KUN A;  1URM A;  2H73 A;  4KH7 A;  2B6M A;  4PUR A;  5ID2 B;  1M9A A;  1X5C A;  5HFK A;  3LXZ A;  2VCX A;  1ZZY A;  3S9F A;  4ICY A;  3BD2 A;  2H1L A;  3L4N A;  3PPU A;  3QR6 A;  2V6K A;  5ECK B;  2L4C A;  2C1Y A;  2B7J A;  3HJP A;  5G5E A;  1ZYE A;  1F3A A;  2C0G A;  8GSS A;  5HR3 A;  1J9B A;  2GTU A;  5A4U A;  1B9X C;  3L78 A;  3TGZ A;  3F9U A;  5ECS A;  1LBK A;  4YQV A;  3GMF A;  4F82 A;  1JFU A;  1FHE A;  1AUC A;  4POB A;  5KN0 A;  4K6X A;  2PGT A;  4JR4 A;  3DD3 A;  2IJY A;  1JZD A;  5CAX A;  5B6N A;  4HSC X;  3KMO A;  6GSU A;  2R0C A;  2RUE A;  2OT3 A;  3Q19 A;  4CDO A;  2O5V A;  4ZL9 A;  2G0F A;  2VL2 C;  13GS A;  3KTL A;  2FUG 2;  3KH9 A;  4MF5 A;  1ZL9 A;  2L4Q A;  1GH2 A;  2NDO A;  3F3Q A;  4DSS A;  4USS A;  1T00 A;  3TKS E;  1PN9 A;  1GSE A;  2IPA A;  5ID2 A;  2WVZ A;  2HSH A;  1V98 A;  1X5D A;  2WW0 A;  1ZGN A;  2IMK A;  5HR1 A;  1RK4 A;  4GLT A;  5AIS A;  3HXS A;  4GCI A;  1NM3 A;  3MNG A;  3G7J A;  1MDJ A;  3IXR A;  3GH6 A;  1X9M B;  2HSN B;  4ISD A;  5JCW A;  3HDC A;  1UN2 A;  1SVO A;  4ULX A;  3QCP A;  5CRE A;  2F9S A;  2CA8 A;  4I97 A;  4Z7X A;  1YY7 A;  3IDV A;  2PWJ A;  2I9H A;  1G7O A;  4YQU A;  2G2Q A;  1F37 A;  1O73 A;  3L9U A;  4QL9 A;  3WGX A;  2OJL A;  2KP1 A;  2ES7 A;  2LST A;  2H1A A;  5FWG A;  1S3D A;  1KTE A;  2LTK A;  1NW2 A;  1U88 A;  5A34 B;  3TKS C;  3H79 A;  2B5Y A;  2IME A;  6GSS A;  2KUC A;  1SU9 A;  1QK8 A;  2GZY A;  1EGO A;  2DIY A;  3UAP A;  4EDY A;  4O7H A;  4MZB A;  4TXV A;  2PMT A;  4IVF A;  2IMI A;  2JL4 A;  1K3O A;  4QL7 A;  2YCD A;  5EPF A;  2C3N A;  3WGE A;  1X9S B;  5B8B A;  3HJO A;  2HNL A;  4WXT A;  4PI2 C;  4EIQ A;  2A4V A;  4RQX A;  1EOG A;  3U6V A;  3KM6 A;  3TJB A;  6GSX A;  2PN8 A;  1XVW A;  5KN1 A;  1Z5Y E;  2LQQ A;  2DJ3 A;  1EZK A;  1KNG A;  4PHZ C;  1V57 A;  3N9J A;  3UVH A;  2P0G A;  3TCO A;  4ZB6 A;  1TTZ A;  2N5A A;  5A34 A;  4WKW A;  4JZQ A;  2JSY A;  1QUW A;  3QD9 A;  3TJJ A;  1M7T A;  5A5H B;  2E2M A;  3HKR A;  4V2L A;  3ZFL A;  2WW2 A;  2AJQ B;  2VL2 A;  3M9K A;  2O85 A;  1I1I P;  1A2J A;  4QQ7 A;  4MZC A;  1F2E A;  3C7M A;  3J7Y k;  5IM9 A;  3HCZ A;  3QPM A;  1ON4 A;  2QGV A;  1Y25 A;  3IPZ A;  2IL3 A;  1WIK A;  2MMO A;  3TRQ A;  2R0P A;  3FYG A;  3Q6O A;  19GS A;  2QA2 A;  3CSJ A;  3BCI A;  5IO0 A;  1M3I A;  2IIY A;  4G2E A;  3GNJ A;  2KLX A;  1MDI A;  4KSO A;  3GHA A;  1GL8 A;  4TOP A;  3V1W A;  4HU7 A;  2BTO T;  3IV4 A;  5BRT A;  3L9V A;  2AUV A;  3GX0 A;  3KXO A;  3HJM A;  3O6T A;  4ZIL A;  3VWX A;  3VUR A;  2VCV A;  2MYG A;  2B7K A;  4G0I A;  4NHZ A;  2GZP A;  2J9H A;  3UVT A;  3C73 A;  1GLP A;  5A5H A;  1GNW A;  4ZL8 A;  5CP1 A;  5GAN D;  3GFK A;  2VLT A;  3CTG A;  5JCU A;  1HNA A;  2GSQ A;  2X64 A;  4XIH A;  4JE1 A;  3CRU A;  3EU4 A;  4ECJ A;  1G7E A;  1PA3 A;  2H0G A;  3CTF A;  2CVB A;  4XTS A;  2IWT A;  4OCF A;  3FR6 A;  4YKF A;  2L5L A;  2VAF A;  1YJ6 A;  4N0Z A;  1Y1U A;  1BQ7 A;  2EFC A;  5IQY A;  4NXI A;  3LYP A;  1FOH A;  5LNK e;  5ECQ B;  1B4P A;  2DBC A;  3FZ5 A;  5J9C A;  2YV9 A;  2XPD A;  2VIM A;  4CY8 A;  4L0U A;  2O3E A;  4K2D A;  2GT5 A;  4X0X A;  2MBT A;  4EXJ A;  3GSS A;  1A8Y A;  4MNN A;  3ZRE A;  4HEA 2;  2H66 A;  2R37 A;  1ACV A;  1OE7 A;  2N5F A;  2V6O A;  5IMD A;  3EPT A;  2LV3 A;  1KBN A;  1NHO A;  4BA7 A;  1J0F A;  3GTU B;  2N5B A;  4MDC A;  4K8M A;  4IGJ A;  1XFL A;  3TKQ A;  4LLR A;  1CQH A;  3C8E A;  4Z2U A;  4POK A;  3GKK A;  1PL1 A;  2HZE A;  1AAZ A;  2L57 A;  3IRA A;  3TB2 A;  3G9B A;  3CWG A;  5EVO A;  1WMJ A;  3ZYW A;  2DIZ A;  1ERU A;  2CV4 A;  3P8W A;  1UA5 A;  1AQX A;  1O8X A;  3FZ4 A;  3C71 A;  3DXB A;  2YN1 A;  2FWE A;  3IE3 A;  2M80 A;  2H70 A;  5FHI A;  4HOJ A;  2PVQ A;  2IFQ B;  5IOX A;  2LJR A;  3HVN A;  3RPP A;  3F4R A;  2X49 A;  5AN1 A;  2C0F A;  1Q4J A;  1DBY A;  5D96 A;  4FO5 A;  4WBR D;  3GA4 A;  2CZ2 A;  18GS A;  3IBH A;  4Q5R A;  1PSQ A;  4IS0 A;  2GVP A;  2KOK A;  4K9Z A;  5HR0 A;  2CAQ A;  4JRR A;  4EC0 A;  3L9S A;  3KCM A;  3RGB C;  5B6M A;  2VD0 A;  3FMW A;  3P7X A;  5KOW A;  5ECI B;  3GTU A;  2E2G A;  2FLS A;  3IR4 A;  5INY A;  2H0H A;  5CRD A;  4PX1 A;  2Z9S A;  3HVX A;  4MPF A;  3DIE A;  1V2A A;  4NMU A;  4GSS A;  3GST A;  2B1K A;  2D2Z A;  1UVZ A;  5CNW A;  1GUM A;  5HQP A;  3KD0 A;  1PKZ A;  3CSI A;  2X99 A;  2IFQ A;  4V1A g;  5H5R A;  4YQM A;  2EC4 A;  3KZQ A;  4H86 A;  1YKA A;  1T4Z A;  4G9H A;  4ZBA A;  5GAP D;  4MP4 A;  4KAE A;  2K8S A;  2EFD A;  3GKM A;  2B1L A;  2HYX A;  5ECM B;  2AAW A;  4K5R A;  1VF4 A;  1PN0 A;  2C80 A;  1AIU A;  3VLN A;  3R2Q A;  3ZL5 A;  1G0T A;  2R0G A;  1O85 A;  1YEW C;  2EIO A;  4OFM A;  1UC7 A;  4TR4 A;  4ZB8 A;  4TW5 A;  2VM2 A;  4MJE A;  3EMP A;  4F2I A;  4XS6 A;  3FHK A;  4KND A;  5COH A;  3ERW A;  3GRX A;  1SJI A;  1SYX A;  4J56 E;  5CRW A;  4CY6 A;  2CX4 A;  2ZNM A;  3L0H A;  3LG6 A;  1ML6 A;  1YVL A;  1QFN A;  4GSN A;  4TVE A;  1V58 A;  3ZIV A;  3PGT A;  4PQI A;  1WOU A;  3OR5 A;  2FCH A;  4BWQ A;  1YQ1 A;  3WGD A;  1ABA A;  5IO2 A;  3LSZ A;  4OFT A;  3I69 A;  2LRT A;  5F0G A;  2H74 A;  4GQF A;  1FB6 A;  3MDK A;  1TRV A;  3IA1 A;  2WVX B;  2REM A;  2DC5 A;  5CO3 A;  2FWH A;  2H30 A;  1EP7 A;  5G30 A;  3GYK A;  1FVK A;  4GRF A;  3APQ A;  2IN3 A;  1XWK A;  1QMV A;  5DAK B;  1GTA A;  1XIY A;  3H4K A;  4DSR A;  3D5J A;  2DJ2 A;  4WF5 A;  5D93 A;  4IHU A;  4XS4 B;  16GS A;  1J08 A;  1XG8 A;  2FY6 A;  1EEM A;  1BYE A;  4JU5 A;  2WJU A;  2ON7 A;  2I3Y A;  4DSQ A;  2V2G A;  3PIN A;  2GST A;  1K3L A;  3QDN A;  1IYH A;  5ECO B;  5IMF A;  4RQR A;  4EO3 A;  2VUP A;  3J7Y b;  1SD9 A;  2LRN A;  1K3Y A;  3RDW A;  3AY8 A;  3GL3 A;  4AKX B;  3VWV A;  3GKN A;  3H8Q A;  3QMX A;  4N10 A;  3EIN A;  3RPN A;  2DKI A;  1O8W A;  2WVX A;  2C0D A;  3G7Y A;  3GH9 A;  3ZIJ A;  4FYU A;  1THO A;  1GNE A;  3HY2 A;  2I81 A;  2GT6 A;  1V9W A;  4N30 A;  3BCK A;  4HU9 A;  3TRX A;  1DUG A;  3KEB A;  1SL0 B;  5DAK A;  2WB9 A;  20GS A;  4GST A;  3LYK A;  3LOR A;  2X4A A;  5G1K A;  4V2N A;  5DJL A;  4G01 A;  4KX4 A;  4XS4 A;  1SKW B;  3IC8 A;  4E68 A;  9GSS A;  2FGX A;  1PGT A;  1X5E A;  4O32 A;  4RI6 A;  4L0W A;  2XHF A;  4ZB7 A;  2CT6 A;  4X1U A;  2KP2 A;  2IMD A;  4I2T A;  3IAS 2;  1S3A A;  3TUE A;  1TOF A;  2DJ0 A;  4PGT A;  4MPG A;  4CW9 A;  1PMT A;  1R26 A;  2HE3 A;  4V1A p;  3A5I A;  3SWL A;  3CXG A;  1F6M C;  4ID0 A;  4EDZ A;  2ON5 A;  1N2A A;  3W8S A;  4N0V A;  4MF7 A;  3KMN A;  1Y6E A;  4BIK A;  5BMU B;  3MWH A;  4IJ3 A;  5C04 A;  5IIZ A;  1OE8 A;  3IK7 A;  4G10 A;  4AJ8 A;  4HZ4 A;  2YP6 A;  4NV5 A;  3ED3 A;  2HSN A;  2BJX A;  2HT9 A;  3GIX A;  3UMA A;  1TRS A;  3KIJ A;  1VF3 A;  1OAZ A;  2WS2 A;  3Q18 A;  5D8I A;  4MZW A;  1USB A;  4FH8 A;  22GS A;  3VPQ A;  4WET A;  3G7I A;  1K0N A;  3KTB A;  3A5W A;  2WZ9 A;  5FT3 A;  4MK3 A;  4AJ7 A;  1M0U A;  2M46 A;  3U5R E;  4ML1 A;  3QFA C;  2A2S A;  2R4V A;  2MMA A;  2YZH A;  3FZA A;  2H1B A;  5GST A;  1M2D A;  1PFO A;  5ELA A;  5CRH A;  1N8J A;  2VL9 A;  1FW1 A;  6GSW A;  3KP9 A;  1PRX A;  2OBI A;  1YEX A;  1W89 A;  1M99 A;  4IEL A;  5IMA A;  2LUS A;  3QOU A;  2FWG A;  5BMU A;  5DQS A;  1GSU A;  2H6Z A;  2YZU A;  3CYN A;  3UJ1 A;  1EOH A;  3IHG A;  4Q5Q A;  4YKG A;  1M9B A;  1ZCP A;  1Z7R A;  1TI1 A;  2VCW A;  4X4J A;  6GSY A;  5DBQ A;  4TKY A;  2VLU A;  1GSF A;  2P31 A;  3SBC A;  5IMC A;  2WDU A;  3FZ9 A;  2JZT A;  2V1M A;  4MJA A;  3D4M A;  4FQU A;  2VD1 A;  1KEB A;  4XCS A;  3TJF A;  2DJJ A;  4ZBB A;  3KP8 A;  2LRC A;  1YDK A;  1XCC A;  1LU4 A;  1TW9 A;  3D6I A;  4OWY A;  4O5R A;  3LGC A;  4K5S A;  5ELG A;  3UBL A;  1XVQ A;  1VF2 A;  4W66 A;  1TK0 B;  1SVL A;  1MD3 A;  3F3R A;  1JZW A;  1K0M A;  3M8N A;  4MMM A;  1A2L A;  4OD7 A;  4AJ6 A;  2C0E A;  1U3I A;  3WT2 A;  4AGS A;  3NZN A;  5KN3 A;  1B4Q A;  3F6F A;  4N11 A;  3TKS A;  1FAA A;  3E0U A;  1HNB A;  3BBY A;  3FRC A;  1G6W A;  5D73 A;  2H01 A;  1YF0 A;  5EL8 A;  2QSI A;  3WD6 A;  1GRX A;  2HRK B;  2O36 A;  1BX9 A;  2O89 A;  2MMZ A;  2VCZ A;  2H1G A;  2OA7 A;  4FYC A;  2YJ7 A;  3C1R A;  3GKX A;  2C8U A;  4I2U A;  2HSM B;  3RHC A;  1NHY A;  1MDK A;  5B8A A;  2VL3 A;  1DSB A;  1XWC A;  2M72 A;  1FOV A;  3JCM L;  3DVW A;  3TU3 B;  4HI7 A;  2VM1 A;  5DCG A;  1VRS D;  1EEJ A;  3PH9 A;  1ZMA A;  5J4Y A;  1OC8 A;  4J2F A;  1A2M A;  3DGQ A;  4K0G A;  2C3Q A;  5LD0 A;  1BG1 A;  2GQL A;  3TOU A;  5CYY A;  2GZZ A;  2GSR A;  3VWW A;  3DWV A;  3MYD A;  2DJK A;  2GSS A;  2JZR A;  5ABR A;  4IN0 A;  3ZFB A;  3DEX A;  3IC4 A;  1Z7P A;  2H76 A;  3ME8 A;  3CRT A;  1LJR A;  1VF1 A;  2CAI A;  5KN2 A;  3TOT A;  1JZO A;  1RW1 A;  1FVJ A;  1GSQ A;  3FR3 A;  1AXD A;  1WP0 A;  1GSY A;  1WRY A;  5F06 A;  2H1D A;  2LQO A;  3UBK A;  2OAC A;  2HRK A;  1JLV A;  3M0F A;  4EL1 A;  1T7P B;  1EP8 A;  2ZCT A;  3ZIT A;  3HVS A;  3HHV A;  2H6X A;  1PX6 A;  2EFE A;  5ECN B;  4MF6 A;  2YWN A;  5IOW A;  2HSM A;  5A5K A;  1M3J A;  4LL4 B;  2DLX A;  1XWB A;  4OMV A;  1FB0 A;  1GTI A;  2WVY A;  4MLY A;  4ZBD A;  3BOA A;  4KB3 A;  3O3T A;  5LCZ A;  3VFI A;  4HJM A;  2K9F A;  1N25 A;  4MA9 A;  2C4J A;  5ECH B;  3IHQ A;  1FO5 A;  4MCU A;  1R5A A;  2QA1 A;  4IP1 A;  3LEF A;  5H5Q A;  5IMV A;  4WEY A;  2F51 A;  3FW2 A;  1TRW A;  3EWL A;  2YWM A;  3EYT A;  2GGT A;  4ZL7 A;  2L6C A;  2WW1 A;  2DJ1 A;  5E59 A;  1C72 A;  3EUR A;  5J4U A;  1XXU A;  1PQN A;  4HQZ A;  2RM5 A;  3TKP A;  1XBS A;  1H4O A;  5L71 A;  1SKR B;  4YAP A;  2XBI A;  3IOS A;  2TRX A;  3ZTL A;  1QXH A;  4AKG A;  2FHE A;  3QAV A;  4OCE A;  2HLS A;  3EVI A;  4TR1 B;  2H8L A;  3FEU A;  4AKI A;  2R2J A;  3HZ4 A;  2OE3 A;  2IMF A;  2C3T A;  1QQ2 A;  2ZUP A;  5J5N A;  1AW9 A;  4NAX A;  2OKA A;  1TK5 B;  2UV8 G;  1THX A;  1TU8 A;  4PNG A;  3E9J B;  3ZVJ A;  5HFI A;  1PX7 A;  3BJ5 A;  1R4W A;  3HVV A;  2P5R A;  1SK1 A;  2HRN A;  3LWA A;  2H72 A;  2A2P A;  1ILO A;  1S3C A;  1M2A A;  2DKH A;  5GZZ B;  1DE2 A;  1T4Y A;  2CX3 A;  2XC2 A;  1XWG A;  2LEG A;  2AV4 A;  4IJI A;  5DQY A;  3IK9 A;  4LA1 A;  2UZ8 A;  5KEJ A;  1SL2 B;  4BVX B;  4P3Y B;  5G1L A;  1Z3E A;  1AC1 A;  2LJK A;  5KOX A;  4L5L A;  2WFC A;  1OKD A;  4NV2 A;  4ML6 A;  2YOI A;  4TR1 A;  4HS1 A;  2K18 A;  3E3E A;  4TXO B;  4ECB A;  2DSA A;  5GSS A;  4RUV A;  2YWI A;  4IKH A;  3F6D A;  1MTC A;  1PL2 A;  1A23 A;  4MJB A;  1JHB A;  1U6T A;  3A3T A;  5DCH A;  3CMI A;  4L5O A;  3ME7 A;  4ACS A;  1T1V A;  4I8B A;  4KDX A;  4PUA A;  3H1N A;  1M2B A;  2KHP A;  1XPV A;  4KA0 A;  2X8H A;  1AQV A;  4GQC A;  2YJH A;  3A2X A;  4KSM A;  2QC7 A;  1YEP A;  4ZXG A;  1XW6 A;  2JAD A;  5J9B A;  5JCG A;  5ECP B;  4NPB A;  1SYR A;  4CHS A;  2GQK A;  5G2Z A;  5F8B A;  5DVB A;  3W8J A;  4XS1 A;  4AKH A;  3UL3 A;  1U3A A;  3UOM A;  4EIP A;  2CVK A;  3HD5 A;  4JR6 A;  3CQF A;  2DMM A;  4BVX A;  4IQA A;  3ZZX A;  1BJX A;  2WRT A;  2YAN A;  4AI6 A;  4EF0 A;  4MJC A;  2MBS A;  2VCQ A;  2MMN A;  5F07 A;  2HRF A;  1OVN A;  3F0I A;  1GUK A;  4EUY A;  4TRX A;  1AQW A;  3UAR A;  3P2A A;  2B3S A;  3RFR C;  1TKD B;  1YKC A;  2K6V A;  1K0C A;  3FR9 A;  4A5P A;  4TXO A;  1K0D A;  4BPY A;  1BG5 A;  4G19 A;  2F3M A;  3DML A;  1GWC A;  2LS5 A;  4MH3 A;  4F9Z A;  3VWU A;  1TRU A;  3FY7 A;  14GS A;  4KF9 A;  4PUF C;  2RII A;  4ZIJ A;  1XZO A;  4OO5 A;  4F03 A;  2MZC A;  4PXO A;  1O7U A;  1Z6N A;  4HZ2 A;  1K0B A;  2JU5 A;  2LKU A;  2HSY A;  4JED A;  3QAW A;  4HDE A;  3ERG A;  1A8L A;  1SK0 A;  5J4V A;  4L8E A;  1HYU A;  4POM A;  3I43 A;  4TN8 A;  4KE3 A;  4XHM A;  1GUH A;  4K1F A;  5D9T A;  3TJG A;  2V41 A;  1E2Y A;  3ZRD A;  4XRA A;  5DDL A;  1TU7 A;  2WW3 A;  4KW6 A;  3MAK A;  5AIX A;  4WR4 A;  2RM6 A;  1A0F A;  5CRG A;  5A1N B;  3HZ8 A;  1EWX A;  1HD2 A;  2L59 A;  3KJY A;  2NPB A;  2GDR A;  4G0L A;  2EFH A;  3QAG A;  2WCI A;  4XRD A;  1DE1 A;  1BED A;  3F4S A;  2HFD A;  3P90 A;  2WUL A;  1GTB A;  1Z6M A;  2TRC P;  1B48 A;  2AHE A;  4K0N A;  3APO A;  4PNF A;  2WZS A;  4YH2 A;  4WF4 A;  3VI7 A;  4PQH A;  5EY6 A;  5G31 A;  1GUL A;  4KDY A;  5F05 A;  3DYR A;  4X43 A;  3ERF A;  1PKW A;  4IBP A;  2NTO A;  1R7H A;  4K7O A;  1XW5 A;  2JAC A;  2A4H A;  5JWR B;  4F0B A;  4GF0 A;  4GWR A;  1Q98 A;  5IPH A;  5D9X A;  4Q5N A;  1HNC A;  4G0K A;  4JBB A;  1JZR A;  3EMX A;  7GSS A;  2HI7 A;  4HUA A;  1SK2 A;  3LW9 A;  10GS A;  1SJZ A;  3VK9 A;  1B9Y C;  4IQ1 A;  4ECI A;  1HQO A;  6GST A;  1NSW A;  2AB6 A;  4GDF A;  2P5Q A;  2WGR A;  2ALB A;  1SL1 B;  3KGK A;  1XOB A;  3DKS A;  2O7K A;  5A1N A;  4D73 B;  3DVX A;  2R5G A;  1I9D A;  5J47 A;  2VLV A;  2E7P A;  4K2X A;  2PPT A;  1OKT A; 
#chains in the Genus database with same CATH homology
 2XPE A;  4AF2 A;  2EIR A;  3TKR A;  4EVM A;  3TDG A;  2HRA A;  1EV4 A;  3EC3 A;  3PR8 A;  3ZMK A;  1WE0 A;  1OYJ A;  4J57 E;  5HFG A;  3EE2 A;  2PUK C;  3A2V A;  4EE0 A;  2FD3 A;  2CZ3 A;  5B7C A;  4ILF A;  3WYW A;  1O6J A;  3WT1 A;  2GQM A;  5D9W A;  3D0Z A;  1W4V A;  3R3E A;  1F9M A;  3LJR A;  2O8V B;  4IW9 A;  5JWO B;  5J40 A;  1G6Y A;  5D9V A;  1VGL A;  3GUS A;  3MIX A;  1SKS B;  3D4T A;  4D73 A;  3F4T A;  2F8A A;  3VI5 A;  4HQS A;  1EV9 A;  1A24 A;  5AIV A;  2F8F A;  1SD8 A;  1BAY A;  4FYB A;  2I1U A;  4BL7 B;  3K8N A;  4GTU A;  3VPT A;  2VO4 A;  1PD2 1;  4K7I A;  1OC9 B;  2OBK A;  4GXZ A;  2VKZ G;  4E8E A;  3ZLP A;  1EGR A;  2E0Q A;  2HZE B;  1ERW A;  2A2R A;  1K0O A;  5A4V A;  2RLI A;  1JLW A;  4LMV A;  2TIR A;  1ZYQ B;  4F0C A;  2HXK A;  3IAM 2;  2AYT A;  1I5G A;  1YF1 A;  4MH2 A;  2LNT A;  4QMK A;  4FIW A;  3RBT A;  1TDI A;  2BMX A;  1T3B A;  3GN3 A;  2H19 A;  2H71 A;  2H75 A;  2YWO A;  3RHB A;  1XWA A;  1O81 A;  3LQ7 A;  2L6D A;  1CQG A;  1RQM A;  1SVM A;  4N3Z A;  2NBS A;  3F8U A;  3TRP A;  4Z2R A;  2H0I A;  2CQ9 A;  1GSD A;  2YNX A;  4KCA A;  1TXX A;  1X9W B;  1GP1 A;  4BL7 A;  3DRN A;  3HA9 A;  3LXT A;  4NWY A;  2H6Y A;  3O76 A;  3QFB C;  1OC9 A;  2GS3 A;  5ECR B;  2I4A A;  1GTU A;  5AGY A;  3EU3 A;  3GL5 A;  4KGI A;  1MEK A;  3N5O A;  1XW9 A;  1QGV A;  1SEN A;  4TR3 A;  2L5O A;  2R6K A;  5ENU A;  4DVC A;  1F3B A;  2PU9 C;  1XOA A;  1E6B A;  1OC3 A;  1ST9 A;  12GS A;  1YZX A;  2DML A;  2NVL A;  3ISO A;  2LNS A;  3GX8 A;  1TP9 A;  2R3X A;  11GS A;  5DJM A;  4LL1 B;  5IPG A;  1Z9H A;  4BVY B;  4E8H A;  3TJK A;  5J3R A;  1K0A A;  4ZB9 A;  3APS A;  1SJ6 A;  2YPM A;  3M9J A;  3GV1 A;  2OE0 A;  4BWS A;  2FA8 A;  3HYP A;  2PER A;  1MD4 A;  1T8E B;  4ECC A;  1V40 A;  4NHW A;  5IMZ A;  4LMW A;  5HR2 A;  3FK8 A;  3CSH A;  5H5S A;  1ZYP A;  1TK8 B;  4MAB A;  1IYI A;  4EKZ A;  4PQ1 A;  2JSZ A;  2XBQ A;  4K7N A;  2JZS A;  1FG4 A;  3US3 A;  1WWJ A;  3LFL A;  2FWF A;  4DEJ A;  1ZOF A;  3CBU A;  4TR0 A;  5DAL B;  3NOF A;  3UEM A;  5JWQ B;  4KCE A;  5E4W A;  2HQT A;  1TXU A;  4Q5F A;  2J23 A;  3KH7 A;  2QKE A;  4Z2T A;  5G5F A;  3HMJ G;  1A0R P;  1WPI A;  4OFN A;  17GS A;  1ZYN A;  3M3M A;  4BVY A;  3FKF A;  2YV7 A;  1WJK A;  1TJD A;  3F63 A;  2B5X A;  3RAZ A;  1TI3 A;  3NIV A;  2PVO C;  3GUR A;  3C1S A;  2VCT A;  3A2W A;  1ERV A;  5ECL B;  5A4W A;  3Q74 A;  3D21 A;  2B5E A;  4PTS A;  4KDU A;  3M1G A;  1R5P A;  4HJ2 A;  1GSS A;  2O87 A;  2PBJ A;  4V2M A;  1H75 A;  2LJA A;  3H93 A;  4O92 A;  4WR5 A;  2EIQ A;  1ERT A;  5C00 A;  2X8G A;  3I9V 2;  3W6G A;  3UIW A;  2VOC A;  3I6A A;  2V32 A;  2OAD A;  3ZML A;  4WBJ A;  2HZF A;  2CVD A;  4O5U A;  2FNO A;  3ZVJ D;  1U87 A;  5J41 A;  4OO4 A;  4RI7 A;  1BF5 A;  3MSZ A;  4IP6 A;  4POL A;  2RUF A;  2OE1 A;  4O5Q A;  1B8X A;  5DAL A;  4I5Q A;  2GLR A;  4YAV A;  2K8V A;  6GSV A;  1X0R A;  4DSS B;  2X8C A;  3D22 A;  1GLQ A;  2FA4 A;  4I6X A;  4KUN A;  1URM A;  2H73 A;  4KH7 A;  2B6M A;  4PUR A;  5ID2 B;  1M9A A;  1X5C A;  5HFK A;  3LXZ A;  2VCX A;  1ZZY A;  3S9F A;  4ICY A;  3BD2 A;  2H1L A;  3L4N A;  3PPU A;  3QR6 A;  2V6K A;  5ECK B;  2L4C A;  2C1Y A;  2B7J A;  3HJP A;  5G5E A;  1ZYE A;  1F3A A;  2C0G A;  8GSS A;  5HR3 A;  1J9B A;  2GTU A;  5A4U A;  1B9X C;  3L78 A;  3TGZ A;  3F9U A;  5ECS A;  1LBK A;  4YQV A;  3GMF A;  4F82 A;  1JFU A;  1FHE A;  1AUC A;  4POB A;  5KN0 A;  4K6X A;  2PGT A;  4JR4 A;  3DD3 A;  2IJY A;  1JZD A;  5CAX A;  5B6N A;  3KMO A;  6GSU A;  2R0C A;  2RUE A;  2OT3 A;  3Q19 A;  4CDO A;  2O5V A;  4ZL9 A;  2G0F A;  2VL2 C;  13GS A;  3KTL A;  3KH9 A;  2FUG 2;  4MF5 A;  1ZL9 A;  2L4Q A;  1GH2 A;  2NDO A;  3F3Q A;  4DSS A;  4USS A;  1T00 A;  3TKS E;  1PN9 A;  1GSE A;  2IPA A;  5ID2 A;  2HSH A;  1V98 A;  1X5D A;  1ZGN A;  2IMK A;  5HR1 A;  1RK4 A;  4GLT A;  5AIS A;  3HXS A;  4GCI A;  1NM3 A;  3MNG A;  3G7J A;  1MDJ A;  3IXR A;  3GH6 A;  1X9M B;  2HSN B;  4ISD A;  5JCW A;  3HDC A;  1UN2 A;  1SVO A;  4ULX A;  3QCP A;  5CRE A;  2F9S A;  2CA8 A;  4I97 A;  4Z7X A;  1YY7 A;  3IDV A;  2PWJ A;  2I9H A;  1G7O A;  4YQU A;  2G2Q A;  1F37 A;  1O73 A;  3L9U A;  4QL9 A;  3WGX A;  2OJL A;  2KP1 A;  2ES7 A;  2LST A;  2H1A A;  5FWG A;  1S3D A;  1KTE A;  2LTK A;  1NW2 A;  1U88 A;  5A34 B;  3TKS C;  3H79 A;  2B5Y A;  2IME A;  6GSS A;  2KUC A;  1SU9 A;  1QK8 A;  2GZY A;  1EGO A;  2DIY A;  3UAP A;  4EDY A;  4O7H A;  4MZB A;  4TXV A;  2PMT A;  4IVF A;  2IMI A;  2JL4 A;  1K3O A;  4QL7 A;  2YCD A;  5EPF A;  2C3N A;  3WGE A;  1X9S B;  5B8B A;  3HJO A;  2HNL A;  4WXT A;  4EIQ A;  2A4V A;  4RQX A;  1EOG A;  3U6V A;  3KM6 A;  3TJB A;  6GSX A;  2PN8 A;  1XVW A;  5KN1 A;  1Z5Y E;  2LQQ A;  2DJ3 A;  1EZK A;  1KNG A;  1V57 A;  3N9J A;  3UVH A;  2P0G A;  3TCO A;  4ZB6 A;  1TTZ A;  2N5A A;  5A34 A;  4WKW A;  4JZQ A;  2JSY A;  1QUW A;  3QD9 A;  3TJJ A;  1M7T A;  5A5H B;  2E2M A;  3HKR A;  4V2L A;  3ZFL A;  2AJQ B;  2VL2 A;  3M9K A;  2O85 A;  1A2J A;  4QQ7 A;  4MZC A;  1F2E A;  3C7M A;  3J7Y k;  5IM9 A;  3HCZ A;  3QPM A;  1ON4 A;  2QGV A;  1Y25 A;  3IPZ A;  2IL3 A;  1WIK A;  2MMO A;  3TRQ A;  2R0P A;  3FYG A;  3Q6O A;  19GS A;  2QA2 A;  3CSJ A;  3BCI A;  5IO0 A;  2IIY A;  4G2E A;  3GNJ A;  2KLX A;  1MDI A;  4KSO A;  3GHA A;  1GL8 A;  4TOP A;  3V1W A;  4HU7 A;  2BTO T;  3IV4 A;  5BRT A;  3L9V A;  2AUV A;  3GX0 A;  3KXO A;  3HJM A;  3O6T A;  4ZIL A;  3VWX A;  3VUR A;  2VCV A;  2MYG A;  2B7K A;  4G0I A;  4NHZ A;  2GZP A;  2J9H A;  3UVT A;  3C73 A;  1GLP A;  5A5H A;  1GNW A;  4ZL8 A;  5CP1 A;  5GAN D;  3GFK A;  2VLT A;  3CTG A;  5JCU A;  1HNA A;  2GSQ A;  2X64 A;  4XIH A;  4JE1 A;  3CRU A;  3EU4 A;  4ECJ A;  1G7E A;  1PA3 A;  2H0G A;  3CTF A;  2CVB A;  4XTS A;  2IWT A;  4OCF A;  3FR6 A;  4YKF A;  2L5L A;  2VAF A;  1YJ6 A;  4N0Z A;  1Y1U A;  1BQ7 A;  2EFC A;  5IQY A;  4NXI A;  3LYP A;  1FOH A;  5LNK e;  5ECQ B;  1B4P A;  2DBC A;  3FZ5 A;  5J9C A;  2YV9 A;  2XPD A;  2VIM A;  4CY8 A;  4L0U A;  4K2D A;  2GT5 A;  4X0X A;  2MBT A;  4EXJ A;  3GSS A;  1A8Y A;  4MNN A;  3ZRE A;  4HEA 2;  2H66 A;  2R37 A;  1ACV A;  1OE7 A;  2N5F A;  2V6O A;  5IMD A;  3EPT A;  2LV3 A;  1KBN A;  1NHO A;  4BA7 A;  1J0F A;  3GTU B;  2N5B A;  4MDC A;  4K8M A;  4IGJ A;  1XFL A;  3TKQ A;  4LLR A;  1CQH A;  3C8E A;  4Z2U A;  4POK A;  3GKK A;  1PL1 A;  2HZE A;  1AAZ A;  2L57 A;  3IRA A;  3TB2 A;  3G9B A;  3CWG A;  5EVO A;  1WMJ A;  3ZYW A;  2DIZ A;  1ERU A;  2CV4 A;  3P8W A;  1UA5 A;  1AQX A;  1O8X A;  3FZ4 A;  3C71 A;  3DXB A;  2YN1 A;  2FWE A;  3IE3 A;  2M80 A;  2H70 A;  5FHI A;  4HOJ A;  2PVQ A;  2IFQ B;  5IOX A;  2LJR A;  3RPP A;  3F4R A;  2X49 A;  5AN1 A;  2C0F A;  1Q4J A;  1DBY A;  5D96 A;  4FO5 A;  4WBR D;  3GA4 A;  2CZ2 A;  18GS A;  3IBH A;  4Q5R A;  1PSQ A;  4IS0 A;  2GVP A;  2KOK A;  4K9Z A;  5HR0 A;  2CAQ A;  4JRR A;  4EC0 A;  3L9S A;  3KCM A;  5B6M A;  2VD0 A;  3FMW A;  3P7X A;  5KOW A;  5ECI B;  3GTU A;  2E2G A;  2FLS A;  3IR4 A;  5INY A;  2H0H A;  5CRD A;  4PX1 A;  2Z9S A;  3HVX A;  4MPF A;  3DIE A;  1V2A A;  4NMU A;  4GSS A;  3GST A;  2B1K A;  2D2Z A;  1UVZ A;  5CNW A;  1GUM A;  5HQP A;  3KD0 A;  1PKZ A;  3CSI A;  2X99 A;  2IFQ A;  4V1A g;  5H5R A;  4YQM A;  2EC4 A;  3KZQ A;  4H86 A;  1YKA A;  1T4Z A;  4G9H A;  4ZBA A;  5GAP D;  4MP4 A;  4KAE A;  2K8S A;  2EFD A;  3GKM A;  2B1L A;  2HYX A;  5ECM B;  2AAW A;  4K5R A;  1VF4 A;  1PN0 A;  2C80 A;  1AIU A;  3VLN A;  3R2Q A;  3ZL5 A;  1G0T A;  2R0G A;  1O85 A;  2EIO A;  4OFM A;  1UC7 A;  4TR4 A;  4ZB8 A;  4TW5 A;  2VM2 A;  4MJE A;  3EMP A;  4F2I A;  4XS6 A;  3FHK A;  4KND A;  5COH A;  3ERW A;  3GRX A;  1SJI A;  1SYX A;  4J56 E;  5CRW A;  4CY6 A;  2CX4 A;  2ZNM A;  3L0H A;  3LG6 A;  1ML6 A;  1YVL A;  1QFN A;  4GSN A;  4TVE A;  1V58 A;  3ZIV A;  3PGT A;  4PQI A;  1WOU A;  3OR5 A;  2FCH A;  4BWQ A;  1YQ1 A;  3WGD A;  1ABA A;  5IO2 A;  3LSZ A;  4OFT A;  3I69 A;  2LRT A;  5F0G A;  2H74 A;  4GQF A;  1FB6 A;  3MDK A;  1TRV A;  3IA1 A;  2REM A;  2DC5 A;  5CO3 A;  2FWH A;  2H30 A;  1EP7 A;  5G30 A;  3GYK A;  1FVK A;  4GRF A;  3APQ A;  2IN3 A;  1XWK A;  1QMV A;  5DAK B;  1GTA A;  1XIY A;  3H4K A;  4DSR A;  3D5J A;  2DJ2 A;  4WF5 A;  5D93 A;  4IHU A;  4XS4 B;  16GS A;  1J08 A;  2FY6 A;  1EEM A;  1BYE A;  4JU5 A;  2WJU A;  2ON7 A;  2I3Y A;  4DSQ A;  2V2G A;  3PIN A;  2GST A;  1K3L A;  3QDN A;  1IYH A;  5ECO B;  5IMF A;  4RQR A;  4EO3 A;  2VUP A;  3J7Y b;  1SD9 A;  2LRN A;  1K3Y A;  3RDW A;  3AY8 A;  3GL3 A;  4AKX B;  3VWV A;  3GKN A;  3H8Q A;  3QMX A;  4N10 A;  3EIN A;  3RPN A;  2DKI A;  1O8W A;  2C0D A;  3G7Y A;  3GH9 A;  3ZIJ A;  4FYU A;  1THO A;  1GNE A;  3HY2 A;  2I81 A;  2GT6 A;  1V9W A;  4N30 A;  3BCK A;  4HU9 A;  3TRX A;  1DUG A;  3KEB A;  1SL0 B;  5DAK A;  2WB9 A;  20GS A;  4GST A;  3LYK A;  3LOR A;  2X4A A;  5G1K A;  4V2N A;  5DJL A;  4G01 A;  4KX4 A;  4XS4 A;  1SKW B;  3IC8 A;  4E68 A;  9GSS A;  2FGX A;  1PGT A;  1X5E A;  4O32 A;  4RI6 A;  4L0W A;  2XHF A;  4ZB7 A;  2CT6 A;  4X1U A;  2KP2 A;  2IMD A;  4I2T A;  3IAS 2;  1S3A A;  3TUE A;  1TOF A;  2DJ0 A;  4PGT A;  4MPG A;  4CW9 A;  1PMT A;  1R26 A;  2HE3 A;  4V1A p;  3A5I A;  3SWL A;  3CXG A;  1F6M C;  4ID0 A;  4EDZ A;  2ON5 A;  1N2A A;  3W8S A;  4N0V A;  4MF7 A;  3KMN A;  1Y6E A;  5BMU B;  3MWH A;  4IJ3 A;  5C04 A;  5IIZ A;  1OE8 A;  3IK7 A;  4G10 A;  4AJ8 A;  4HZ4 A;  2YP6 A;  4NV5 A;  3ED3 A;  2HSN A;  2BJX A;  2HT9 A;  3GIX A;  3UMA A;  1TRS A;  3KIJ A;  1VF3 A;  1OAZ A;  2WS2 A;  3Q18 A;  5D8I A;  4MZW A;  1USB A;  4FH8 A;  22GS A;  3VPQ A;  4WET A;  3G7I A;  1K0N A;  3KTB A;  3A5W A;  2WZ9 A;  5FT3 A;  4MK3 A;  4AJ7 A;  1M0U A;  2M46 A;  3U5R E;  4ML1 A;  3QFA C;  2A2S A;  2R4V A;  2MMA A;  2YZH A;  3FZA A;  2H1B A;  5GST A;  1M2D A;  5ELA A;  5CRH A;  1N8J A;  2VL9 A;  1FW1 A;  6GSW A;  3KP9 A;  1PRX A;  2OBI A;  1YEX A;  1W89 A;  1M99 A;  4IEL A;  5IMA A;  2LUS A;  3QOU A;  2FWG A;  5BMU A;  5DQS A;  1GSU A;  2H6Z A;  2YZU A;  3CYN A;  3UJ1 A;  1EOH A;  3IHG A;  4Q5Q A;  4YKG A;  1M9B A;  1ZCP A;  1Z7R A;  1TI1 A;  2VCW A;  4X4J A;  6GSY A;  5DBQ A;  4TKY A;  2VLU A;  1GSF A;  2P31 A;  3SBC A;  5IMC A;  2WDU A;  3FZ9 A;  2JZT A;  2V1M A;  4MJA A;  3D4M A;  4FQU A;  2VD1 A;  1KEB A;  4XCS A;  3TJF A;  2DJJ A;  4ZBB A;  3KP8 A;  2LRC A;  1YDK A;  1XCC A;  1LU4 A;  1TW9 A;  3D6I A;  4OWY A;  4O5R A;  3LGC A;  4K5S A;  5ELG A;  3UBL A;  1XVQ A;  1VF2 A;  4W66 A;  1TK0 B;  1SVL A;  1MD3 A;  3F3R A;  1JZW A;  1K0M A;  3M8N A;  4MMM A;  1A2L A;  4OD7 A;  4AJ6 A;  2C0E A;  1U3I A;  3WT2 A;  4AGS A;  3NZN A;  5KN3 A;  1B4Q A;  3F6F A;  4N11 A;  3TKS A;  1FAA A;  3E0U A;  1HNB A;  3BBY A;  3FRC A;  1G6W A;  5D73 A;  2H01 A;  1YF0 A;  5EL8 A;  2QSI A;  3WD6 A;  1GRX A;  2HRK B;  1BX9 A;  2O89 A;  2MMZ A;  2VCZ A;  2H1G A;  2OA7 A;  4FYC A;  2YJ7 A;  3C1R A;  3GKX A;  2C8U A;  4I2U A;  2HSM B;  3RHC A;  1NHY A;  1MDK A;  5B8A A;  2VL3 A;  1DSB A;  1XWC A;  2M72 A;  1FOV A;  3JCM L;  3DVW A;  3TU3 B;  4HI7 A;  2VM1 A;  5DCG A;  1VRS D;  1EEJ A;  3PH9 A;  1ZMA A;  5J4Y A;  1OC8 A;  4J2F A;  1A2M A;  3DGQ A;  4K0G A;  2C3Q A;  5LD0 A;  1BG1 A;  2GQL A;  3TOU A;  5CYY A;  2GZZ A;  2GSR A;  3VWW A;  3DWV A;  3MYD A;  2DJK A;  2GSS A;  2JZR A;  5ABR A;  4IN0 A;  3ZFB A;  3DEX A;  3IC4 A;  1Z7P A;  2H76 A;  3ME8 A;  3CRT A;  1LJR A;  1VF1 A;  2CAI A;  5KN2 A;  3TOT A;  1JZO A;  1RW1 A;  1FVJ A;  1GSQ A;  3FR3 A;  1AXD A;  1WP0 A;  1GSY A;  1WRY A;  5F06 A;  2H1D A;  2LQO A;  3UBK A;  2OAC A;  2HRK A;  1JLV A;  3M0F A;  4EL1 A;  1T7P B;  1EP8 A;  2ZCT A;  3ZIT A;  3HVS A;  3HHV A;  2H6X A;  1PX6 A;  2EFE A;  5ECN B;  4MF6 A;  2YWN A;  5IOW A;  2HSM A;  5A5K A;  4LL4 B;  2DLX A;  1XWB A;  4OMV A;  1FB0 A;  1GTI A;  4MLY A;  4ZBD A;  3BOA A;  4KB3 A;  3O3T A;  5LCZ A;  3VFI A;  4HJM A;  2K9F A;  1N25 A;  4MA9 A;  2C4J A;  5ECH B;  3IHQ A;  1FO5 A;  4MCU A;  1R5A A;  2QA1 A;  4IP1 A;  3LEF A;  5H5Q A;  5IMV A;  4WEY A;  2F51 A;  3FW2 A;  1TRW A;  3EWL A;  2YWM A;  3EYT A;  2GGT A;  4ZL7 A;  2L6C A;  2DJ1 A;  5E59 A;  1C72 A;  3EUR A;  5J4U A;  1XXU A;  1PQN A;  4HQZ A;  2RM5 A;  3TKP A;  1XBS A;  1H4O A;  5L71 A;  1SKR B;  4YAP A;  2XBI A;  3IOS A;  2TRX A;  3ZTL A;  1QXH A;  4AKG A;  2FHE A;  3QAV A;  4OCE A;  2HLS A;  3EVI A;  4TR1 B;  2H8L A;  3FEU A;  4AKI A;  2R2J A;  3HZ4 A;  2OE3 A;  2IMF A;  2C3T A;  1QQ2 A;  2ZUP A;  5J5N A;  1AW9 A;  4NAX A;  2OKA A;  1TK5 B;  2UV8 G;  1THX A;  1TU8 A;  4PNG A;  3E9J B;  3ZVJ A;  5HFI A;  1PX7 A;  3BJ5 A;  1R4W A;  3HVV A;  2P5R A;  1SK1 A;  2HRN A;  3LWA A;  2H72 A;  2A2P A;  1ILO A;  1S3C A;  1M2A A;  2DKH A;  5GZZ B;  1DE2 A;  1T4Y A;  2CX3 A;  2XC2 A;  1XWG A;  2LEG A;  2AV4 A;  4IJI A;  5DQY A;  3IK9 A;  4LA1 A;  2UZ8 A;  5KEJ A;  1SL2 B;  4BVX B;  4P3Y B;  5G1L A;  1Z3E A;  1AC1 A;  2LJK A;  5KOX A;  4L5L A;  2WFC A;  1OKD A;  4NV2 A;  4ML6 A;  2YOI A;  4TR1 A;  4HS1 A;  2K18 A;  3E3E A;  4TXO B;  4ECB A;  2DSA A;  5GSS A;  4RUV A;  2YWI A;  4IKH A;  3F6D A;  1MTC A;  1PL2 A;  1A23 A;  4MJB A;  1JHB A;  1U6T A;  3A3T A;  5DCH A;  3CMI A;  4L5O A;  3ME7 A;  4ACS A;  1T1V A;  4I8B A;  4KDX A;  4PUA A;  3H1N A;  1M2B A;  2KHP A;  1XPV A;  4KA0 A;  2X8H A;  1AQV A;  4GQC A;  2YJH A;  3A2X A;  4KSM A;  2QC7 A;  1YEP A;  4ZXG A;  1XW6 A;  2JAD A;  5J9B A;  5JCG A;  5ECP B;  4NPB A;  1SYR A;  4CHS A;  2GQK A;  5G2Z A;  5F8B A;  5DVB A;  3W8J A;  4XS1 A;  4AKH A;  3UL3 A;  1U3A A;  3UOM A;  4EIP A;  2CVK A;  3HD5 A;  4JR6 A;  2DMM A;  4BVX A;  4IQA A;  3ZZX A;  1BJX A;  2WRT A;  2YAN A;  4AI6 A;  4EF0 A;  4MJC A;  2MBS A;  2VCQ A;  2MMN A;  5F07 A;  2HRF A;  1OVN A;  3F0I A;  1GUK A;  4EUY A;  4TRX A;  1AQW A;  3UAR A;  3P2A A;  2B3S A;  1TKD B;  1YKC A;  2K6V A;  1K0C A;  3FR9 A;  4A5P A;  4TXO A;  1K0D A;  4BPY A;  1BG5 A;  4G19 A;  2F3M A;  3DML A;  1GWC A;  2LS5 A;  4MH3 A;  4F9Z A;  3VWU A;  1TRU A;  3FY7 A;  14GS A;  4KF9 A;  4PUF C;  2RII A;  4ZIJ A;  1XZO A;  4OO5 A;  4F03 A;  2MZC A;  4PXO A;  1O7U A;  1Z6N A;  4HZ2 A;  1K0B A;  2JU5 A;  2LKU A;  2HSY A;  4JED A;  3QAW A;  4HDE A;  3ERG A;  1A8L A;  1SK0 A;  5J4V A;  4L8E A;  1HYU A;  4POM A;  3I43 A;  4TN8 A;  4KE3 A;  4XHM A;  1GUH A;  4K1F A;  5D9T A;  3TJG A;  2V41 A;  1E2Y A;  3ZRD A;  4XRA A;  5DDL A;  1TU7 A;  4KW6 A;  3MAK A;  5AIX A;  4WR4 A;  2RM6 A;  1A0F A;  5CRG A;  5A1N B;  3HZ8 A;  1EWX A;  1HD2 A;  2L59 A;  3KJY A;  2NPB A;  2GDR A;  4G0L A;  2EFH A;  3QAG A;  2WCI A;  4XRD A;  1DE1 A;  1BED A;  3F4S A;  2HFD A;  3P90 A;  2WUL A;  1GTB A;  1Z6M A;  2TRC P;  1B48 A;  2AHE A;  4K0N A;  3APO A;  4PNF A;  4YH2 A;  4WF4 A;  3VI7 A;  4PQH A;  5EY6 A;  5G31 A;  1GUL A;  4KDY A;  5F05 A;  3DYR A;  4X43 A;  3ERF A;  1PKW A;  4IBP A;  2NTO A;  1R7H A;  4K7O A;  1XW5 A;  2JAC A;  2A4H A;  5JWR B;  4F0B A;  4GF0 A;  4GWR A;  1Q98 A;  5IPH A;  5D9X A;  4Q5N A;  1HNC A;  4G0K A;  4JBB A;  1JZR A;  3EMX A;  7GSS A;  2HI7 A;  4HUA A;  1SK2 A;  3LW9 A;  10GS A;  1SJZ A;  3VK9 A;  1B9Y C;  4IQ1 A;  4ECI A;  1HQO A;  6GST A;  1NSW A;  2AB6 A;  4GDF A;  2P5Q A;  2WGR A;  2ALB A;  1SL1 B;  3KGK A;  1XOB A;  3DKS A;  2O7K A;  5A1N A;  4D73 B;  3DVX A;  2R5G A;  1I9D A;  5J47 A;  2VLV A;  2E7P A;  4K2X A;  2PPT A;  1OKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...