1MD4A

A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to valine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
208
structure length
208
Chain Sequence
b'PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVVDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pi glutathione transferase
publication title Contribution of Glycine 146 to a Conserved Folding Module Affecting Stability and Refolding of Human Glutathione Transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1md4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1md4A01
1V58A 5JWQB 1EZKA 3UEMA 2D2ZA 4MJEA 1ZCPA 8GSSA 4Q5NA 3QCPA 4I2TA 2H1DA 4KF9A 1QK8A 3VWXA 3I43A 3GKKA 4V1Ap 1WP0A 1PRXA 3GL3A 1PKZA 3S9FA 4L0UA 1MDJA 4ZB8A 2H6YA 3TJGA 3UOMA 4AF2A 1JHBA 5ECQB 1BJXA 3KM6A 1PA3A 5ECMB 2IMKA 4GSSA 3ZVJA 1GRXA 2MBTA 3QOUA 4MZBA 2H01A 2IMDA 4BVYB 3LWAA 2R6KA 1R26A 2HT9A 1YEPA 4ECJA 4JEDA 4TXOA 5ECSA 5GAPD 3TB2A 4DSSB 3LQ7A 2L5LA 2M80A 2CA8A 2YOIA 3DWVA 2X99A 3UIWA 1T4YA 2DJ2A 1FB0A 5B8AA 2C3NA 3L9UA 1OC9A 2LTKA 4EXJA 5H5QA 4O5RA 6GSVA 2DC5A 1T4ZA 3APOA 3MSZA 2VD1A 3FZAA 1R4WA 4IELA 3Q6OA 1FVKA 1XXUA 5A5KA 4O92A 3ZLPA 1QGVA 4ZL9A 2WFCA 1SKWB 17GSA 5G31A 2H72A 2O8VB 2VL3A 2C4JA 5CRGA 1A2MA 3OR5A 5D9TA 3LFLA 1WPIA 3WT1A 1YDKA 3LEFA 4MPGA 3TOUA 3KH9A 1VGLA 4BL7B 2GSQA 4FYCA 1J9BA 2HZFA 4NV2A 7GSSA 2P0GA 5KN0A 2CVDA 3HJPA 1V2AA 3F4RA 5H5RA 2VLTA 2VAFA 2GZYA 3QFBC 3C8EA 3ISOA 1GP1A 2VCTA 2OJLA 1DE2A 1USBA 1FG4A 4QL9A 1S3AA 5A4VA 4NHWA 4LA1A 2FY6A 4HU9A 3VFIA 4TR0A 2OKAA 3D4MA 2C8UA 4WR4A 4XS1A 4KSMA 3VPQA 5F8BA 1PQNA 5ECLB 1GL8A 2RM6A 1LBKA 3I69A 4JR4A 1K3LA 2FWGA 2OE1A 3ED3A 3IHQA 1XOBA 2B7KA 3UJ1A 1AAZA 2LUSA 1MD4A 4XCSA 1GWCA 1BQ7A 3TRPA 3IV4A 1RW1A 2RLIA 4KGIA 4TR3A 3GSTA 2GDRA 3HJMA 3FHKA 4IJIA 3FZ4A 3UMAA 1DE1A 3ZITA 5DQSA 2BMXA 1GLPA 3I6AA 2HSHA 4EKZA 1T3BA 1KNGA 4ML6A 4LMVA 1B9YC 3HZ8A 1SJIA 3H93A 3CMIA 4BVYA 1UN2A 4HS1A 1U6TA 1OYJA 1XVWA 2L5OA 3TKPA 5DALB 2R3XA 2NPBA 4G19A 4DSSA 5CO3A 1XOAA 3HY2A 4G10A 1CQGA 2XPEA 1AUCA 1S3DA 3N9JA 1NHYA 4F0CA 2V32A 4N0ZA 2O7KA 3FR3A 3UVHA 4FYBA 3D4TA 2CV4A 3EU4A 4MJCA 2UZ8A 2CVKA 1K0OA 2FGXA 3ERWA 3IBHA 1UC7A 2PMTA 5FHIA 4ZILA 2YWNA 1O81A 2HRFA 5AN1A 14GSA 3HHVA 1SYRA 5GSTA 3GN3A 4EC0A 2F51A 4TRXA 5ECIB 3WD6A 1HNAA 3H4KA 1FHEA 1WOUA 3BOAA 3W8JA 3GUSA 2GT5A 4ID0A 4PUFC 4EF0A 4BL7A 2ON5A 5ID2B 3GKXA 4AJ6A 1E2YA 1FAAA 2KUCA 3TJFA 3A5WA 3QPMA 2VCXA 1MD3A 3L78A 13GSA 2L6DA 3SBCA 2X8HA 2LV3A 4MK3A 1VRSD 3DIEA 1GULA 1X5CA 5JCGA 4MLYA 2C0DA 5DVBA 5G2ZA 5AIXA 3FRCA 4K1FA 3GSSA 1PL2A 3WGXA 2LRCA 3LYKA 1TI1A 3HXSA 1PGTA 3V1WA 2Z9SA 2V2GA 3D0ZA 2OE3A 1J0FA 2VUPA 4EE0A 4KSOA 4JZQA 4MF5A 2H0HA 2E2GA 2VLUA 2KHPA 3GV1A 1GNWA 5DJMA 3JCML 3A2WA 3QAVA 3U5RE 3KTBA 3VLNA 4LMWA 2QGVA 2XBIA 5D9WA 4QL7A 1O8XA 1WIKA 1TRWA 2JZRA 4HZ4A 2I1UA 2YANA 2NBSA 1X5DA 3VPTA 5J3RA 2ZNMA 3GL5A 4EDYA 3HYPA 1EOGA 5IMAA 2ES7A 4PXOA 4MJBA 1AXDA 5B7CA 5IPHA 4LL4B 3ME8A 1TU8A 4YQUA 2F8FA 1OKDA 1SK1A 4IBPA 1XW9A 4BWQA 2EIQA 2E0QA 2MMNA 2X8CA 1OC3A 5DALA 4MH3A 2VCVA 1I9DA 4K7OA 4K7IA 2IJYA 3ZRDA 4BPYA 1EV9A 2H71A 1PMTA 2VM1A 1EEMA 5IMDA 2I3YA 1X9MB 3TCOA 1SENA 3HCZA 4GTUA 1ERUA 3DXBA 3DRNA 1EP8A 3F0IA 3G7IA 4HZ2A 2GT6A 2HQTA 1U3IA 4MZCA 4K6XA 3DVXA 1JZDA 4IKHA 1TOFA 4HDEA 2IMEA 3F6DA 1OE7A 1NW2A 2DIZA 3A3TA 2C0EA 2JZTA 5HR0A 4KA0A 2DMLA 5ID2A 5AIVA 4POKA 4OWYA 3CTFA 4F0BA 2OE0A 2GVPA 3DVWA 2VL2C 1KEBA 4ZL8A 1GTBA 5IMVA 3G7YA 5CREA 3EURA 2AJQB 3IK9A 2GSSA 1Z7PA 5J41A 1BX9A 4H86A 2C1YA 2LQOA 3VWWA 1R5PA 1GUKA 2K6VA 2C3QA 1PSQA 1G0TA 2G0FA 3QAGA 2JU5A 4KCEA 4K9ZA 4K0NA 3FR9A 2HZEB 3GRXA 3J7Yb 3UBKA 2DSAA 4NHZA 2HRNA 5G1LA 4BA7A 4AGSA 1M9BA 2IL3A 2AHEA 5J5NA 1TW9A 3CSIA 1SU9A 4MDCA 4L5LA 1SJ6A 2YV7A 5D9XA 1MDKA 3F9UA 4NMUA 5HFGA 1M2DA 5F0GA 3TKSC 4O7HA 1JFUA 3CTGA 3D5JA 2CX3A 3HVXA 3WYWA 1F9MA 4KDYA 4KX4A 2EIOA 5B6NA 2BJXA 5CAXA 3E9JB 1SKRB 3BJ5A 1LJRA 3KEBA 3BBYA 5KN3A 2AV4A 2HRKB 4Q5FA 1VF2A 1VF3A 4E8EA 5A4WA 2EIRA 3GMFA 2MZCA 2PU9C 4ZB6A 5CRWA 4MPFA 4PQIA 5KEJA 3W6GA 3RBTA 2C80A 4GXZA 1K3YA 3MNGA 2VCWA 3O3TA 5ECNB 3QR6A 2LKUA 4MP4A 1OE8A 2CX4A 4ZIJA 4NPBA 1KTEA 3ZMLA 2H1GA 3IC4A 2V6OA 1M2AA 1TJDA 2LJAA 3RPPA 2B7JA 4ML1A 3D6IA 1SK0A 5LD0A 5J9CA 3LYPA 1B4PA 2DBCA 1SK2A 3FYGA 3GYKA 5IOWA 2REMA 1F6MC 3DEXA 1BG5A 2OBKA 3R3EA 11GSA 2AUVA 4XHMA 4F03A 4TVEA 1RQMA 5IPGA 1Y6EA 4ZB9A 4NAXA 2LRNA 3CSHA 1N2AA 4TOPA 4P3YB 1QFNA 1PN9A 2LNTA 6GSUA 3G7JA 2XBQA 3IPZA 3M1GA 1T00A 4BVXB 3VI7A 1TU7A 10GSA 1A0RP 4OFMA 1ABAA 5EVOA 4FYUA 2WCIA 2WDUA 5A4UA 2DIYA 2H66A 1R7HA 3GKNA 1IYHA 3GNJA 4MJAA 2TIRA 3L0HA 1F37A 2OACA 3BD2A 3TJBA 5B8BA 5IMCA 5EPFA 4GRFA 3LXTA 2YZHA 2FA8A 3HZ4A 2FWHA 5LNKe 4WBRD 3A2XA 3F8UA 1TK8B 2PERA 2VM2A 1TDIA 4RQXA 2K8VA 3D21A 1X9WB 5D73A 2L4CA 4IGJA 4I2UA 3E0UA 3KH7A 2PUKC 2RUFA 1Q98A 3KP8A 3C71A 1K0MA 1HNBA 5IM9A 1O7UA 1PKWA 2RM5A 2NDOA 1HNCA 5L71A 4TR4A 3F3QA 3PR8A 2C0GA 4GCIA 3LG6A 1A8YA 2B5EA 2PWJA 4JU5A 1IYIA 4N30A 1YJ6A 4Q5QA 2N5AA 1FOVA 4YAVA 3W8SA 3FR6A 1A2LA 3UAPA 4L5OA 3RAZA 1EOHA 16GSA 1AQVA 4TR1B 3ERFA 3IRAA 2B1KA 1AQXA 1TI3A 4TXVA 4NXIA 12GSA 2J23A 2HFDA 1GSDA 1OC8A 1GNEA 3MWHA 4J2FA 6GSTA 5G30A 3F4SA 5BMUA 1F3AA 3EU3A 4OO4A 3L9SA 2K18A 5ABRA 2YPMA 1A24A 1K0CA 2C3TA 4V2LA 3TRQA 2P5RA 2YJ7A 1H4OA 2CZ2A 3ZL5A 2VCZA 3IOSA 2ALBA 3HD5A 4O32A 1Q4JA 2VLVA 2N5FA 1TXXA 1YY7A 3L9VA 4PQ1A 3KMOA 2GTUA 5JWRB 4Q5RA 5G1KA 1XW5A 4IW9A 5CNWA 1NHOA 1AIUA 1JZOA 5IQYA 1WJKA 5DCHA 3IAM2 3GX0A 2H75A 3J7Yk 4BVXA 2MMAA 5FT3A 1EGOA 2LSTA 5DCGA 4PX1A 5J9BA 3C73A 4HOJA 1K0BA 1SYXA 1GTUA 3PPUA 2CAQA 4KAEA 1YEXA 3TUEA 5ECHB 4KCAA 4HUAA 3ERGA 1K0NA 2DJ3A 4KE3A 3KD0A 4QQ7A 4JE1A 3EVIA 5LCZA 3EYTA 1W89A 1R5AA 5HR2A 1GLQA 1EV4A 1ZZYA 2ON7A 3PH9A 2R37A 2XPDA 3WT2A 1OKTA 1QMVA 4XRDA 4PQHA 4XIHA 2YV9A 2MMOA 2FWEA 3LXZA 1O8WA 18GSA 1B48A 1TK5B 1MEKA 2JADA 2FA4A 4HJ2A 5F05A 2HSMB 3TKRA 1XWKA 2V41A 1X0RA 1ACVA 1ILOA 3M9JA 1M99A 2MBSA 4RUVA 3IE3A 2H1BA 2ZUPA 4PTSA 5HQPA 1SD8A 1XWGA 3O6TA 1YF0A 4GQFA 5DAKB 3Q18A 3SWLA 2H76A 1F3BA 2X8GA 2YNXA 1U87A 4TR1A 1YKCA 5ECKB 3TDGA 4TW5A 3H1NA 4ZBDA 2H70A 4OD7A 1YKAA 4DSRA 3P7XA 2QC7A 2J9HA 3RHCA 2H73A 3P8WA 1T8EB 5AISA 4FH8A 5GZZB 2M72A 2O89A 4EVMA 4OO5A 2I81A 3CYNA 2VO4A 4PNFA 2HXKA 3IAS2 4HEA2 3C1RA 1ERTA 3VWVA 2PVOC 3KGKA 1H75A 3G9BA 5DJLA 3GURA 2JL4A 1ON4A 2E2MA 2JSYA 1XCCA 5IO0A 5AGYA 2PN8A 4RI6A 3EMXA 4PUAA 4POMA 5CP1A 2A2SA 3L4NA 3GTUB 3M3MA 5DQYA 2M46A 2X64A 3QDNA 5GAND 3UARA 1K3OA 4KDXA 5DBQA 3GFKA 4L0WA 5HR3A 4USSA 3EWLA 3CXGA 6GSXA 4AJ8A 2I9HA 5JCWA 3DKSA 3AY8A 4GLTA 1G7EA 1M2BA 1ZGNA 3TOTA 1SJZA 2WRTA 4IS0A 3E3EA 1GUMA 4ECIA 2HI7A 2WULA 2EC4A 2VL2A 1Z9HA 5G5EA 3GKMA 1TTZA 20GSA 1XFLA 3LJRA 4EUYA 4I5QA 19GSA 3K8NA 2LS5A 4TKYA 2DLXA 2AB6A 2LJKA 4OFNA 1W4VA 4BWSA 4HI7A 4YH2A 1KBNA 2AAWA 1ZYQB 4MCUA 3CRTA 1WE0A 2FNOA 2FD3A 2YCDA 3ZIJA 3VK9A 3GH9A 2LJRA 3EE2A 1YQ1A 5COHA 5B6MA 4GQCA 4KDUA 4HQSA 3FKFA 1Z3EA 4YQMA 5CRHA 1FO5A 4K8MA 2HSMA 2H8LA 4HJMA 4OFTA 2CVBA 3TKSA 3P90A 1VF1A 3EINA 1VF4A 4WETA 5F07A 1MTCA 5E4WA 3UL3A 5IO2A 4PNGA 1PL1A 3HVVA 3CBUA 1ZOFA 2YZUA 5DAKA 2LEGA 4XTSA 2CQ9A 2FUG2 4GF0A 4GWRA 2TRCP 2VIMA 3KMNA 1GTAA 1M7TA 2NTOA 2H1AA 3O76A 4K7NA 4I97A 4KUNA 5DDLA 4ZXGA 3WGDA 3KXOA 3NZNA 2PPTA 3GX8A 3U6VA 3R2QA 1SD9A 2P5QA 1DSBA 1F2EA 2L57A 3NOFA 4IQAA 2B5YA 2F9SA 1PD21 3ZIVA 1XVQA 2OBIA 6GSWA 4XS4B 3FZ9A 1GSFA 1THOA 1AQWA 3US3A 3HVSA 4FIWA 3GTUA 1TP9A 2JACA 3QMXA 1YF1A 4WBJA 3IC8A 2A4VA 5D96A 4NWYA 1J08A 3IXRA 3LGCA 3QD9A 1EWXA 3UBLA 3GH6A 1ZL9A 4IP6A 1E6BA 22GSA 1NSWA 1SL2B 4X43A 2R2JA 5D93A 2LNSA 2H0GA 4N0VA 4Z7XA 1LU4A 3DYRA 2ZCTA 3IK7A 2IFQB 2P31A 2R5GA 1HD2A 6GSSA 4HU7A 4E8HA 4DSQA 3C1SA 3Q19A 2VD0A 3N5OA 1G7OA 2O87A 5CYYA 4G9HA 2GZZA 3NIVA 1WMJA 2HSYA 1GH2A 3RPNA 2PBJA 2FCHA 2YP6A 4X1UA 4L8EA 1EEJA 3ZYWA 2HZEA 4OCEA 3ZMKA 1AW9A 2A2RA 5IIZA 4IHUA 1WWJA 2VL9A 2IN3A 1X5EA 2BTOT 5C00A 4K2DA 3F6FA 4I6XA 2CT6A 1GSUA 1B4QA 1O85A 5ECOB 3QAWA 5HFKA 3CRUA 2GSTA 2B3SA 3A2VA 3APQA 2E7PA 1UA5A 1X9SB 2AYTA 2WGRA 5GSSA 4G0KA 2F8AA 2JSZA 1GSEA 3KIJA 1QQ2A 1Z5YE 2B1LA 4CW9A 5FWGA 1FB6A 5HFIA 1C72A 3BCIA 4MA9A 2R4VA 1FVJA 4F82A 4JRRA 2IPAA 3ME7A 2DJJA 1XBSA 1V9WA 2WS2A 2YWIA 1BAYA 5JCUA 2HRKA 4WF5A 1DBYA 4ILFA 3VWUA 4WKWA 1RK4A 4IQ1A 2H74A 5E59A 1ZMAA 5ECRB 2DJ0A 3ZFBA 3RHBA 2YN1A 1ERVA 3ZFLA 3TGZA 4F2IA 2DJ1A 4MF7A 1TRSA 1O73A 3F4TA 4XS4A 1TKDB 3VI5A 1DUGA 2YJHA 3Q74A 3FY7A 2L6CA 4XS6A 3ZREA 2KOKA 4FQUA 2WJUA 2XC2A 1JLWA 1PX6A 1OVNA 4RI7A 1JZWA 4KH7A 5IOXA 4G2EA 5EL8A 2G2QA 2VCQA 1BYEA 3TJKA 2FHEA 4JR6A 4MZWA 2H6XA 3DGQA 4EO3A 1U88A 2QSIA 4YQVA 4LL1B 2PVQA 2GQMA 2L59A 2IFQA 1BEDA 3WGEA 1YZXA 3QFAC 1N8JA 1GSQA 4EDZA 2RIIA 5ECPB 4ZBAA 1AC1A 1M9AA 4D73B 2KP1A 4OCFA 4WF4A 3DMLA 4N11A 2DJKA 4MMMA 2HRAA 4J56E 2LQQA 5INYA 3CSJA 3TJJA 3EC3A 4V2MA 2IIYA 4HQZA 1A2JA 2YWOA 2JZSA 4MH2A 1ST9A 1GSSA 1A8LA 2C0FA 4ECBA 1V57A 2PGTA 2GS3A 4WR5A 3ZZXA 4MABA 5HR1A 1QXHA 1ERWA 6GSYA 2HLSA 3M8NA 1XWBA 1JZRA 2GQKA 4PGTA 1XIYA 1GTIA 3MAKA 1A0FA 1SKSB 4ACSA 5IMZA 2K9FA 2V6KA 5ELGA 4WXTA 2IWTA 1SL1B 1EGRA 2NVLA 5F06A 2H6ZA 3LORA 4V1Ag 2WZ9A 4ISDA 2B5XA 4IJ3A 4J57E 4KNDA 3ZVJD 3M9KA 1QUWA 2VOCA 4TN8A 5KN1A 1ML6A 4YAPA 3UVTA 4IP1A 1MDIA 1Z6MA 3M0FA 1V98A 4KW6A 3H8QA 1K0DA 1T1VA 3GHAA 2GZPA 5IMFA 3KZQA 1ZYEA 2HYXA 4G0LA 4DVCA 4GSTA 2CZ3A 4CHSA 2HE3A 1K0AA 5G5FA 3KP9A 1FW1A 2IMFA 1NM3A 3FZ5A 4CDOA 1V40A 4IVFA 3F63A 3APSA 9GSSA 3FW2A 1CQHA 4RQRA 5ELAA 1B8XA 4N10A 3IR4A 1T7PB 2O85A 3MDKA 1SL0B 1PX7A 3PGTA 4NV5A 2FWFA 2HNLA 3VURA 3TRXA 1THXA 1U3AA 2XHFA 1GSYA 2TRXA 3IA1A 5CRDA 5C04A 1B9XC 3GIXA 3HDCA 2OA7A 3PINA 4FO5A 4TXOB 3D22A 4XRAA 1XWAA 4DEJA 4G0IA 5EY6A 3F3RA 3C7MA 1OC9B 2L4QA 4IN0A 2IMIA 3KTLA 2CAIA 1A23A 1G6WA 1TK0B 2H0IA 2OADA 4ZBBA 4D73A 3I9V2 4ZL7A 2KLXA 1URMA 1XWCA 4WEYA 1M0UA 3KCMA 1UVZA 4F9ZA 2QKEA 4ULXA 3LSZA 3HA9A 5J4UA 1G6YA 1Y25A 1EP7A 4MF6A 2LRTA 1TRVA 2FLSA 3RDWA 2YWMA 2N5BA 4V2NA 4PURA 5ENUA 4GSNA 4POBA 1TRUA 1HQOA 2K8SA 4ECCA 3GA4A 5H5SA 2H19A 4JBBA 2GSRA 2GQLA 4OMVA 1I5GA 1XZOA 2MMZA 1JLVA 1O6JA 2WB9A 1XW6A 2MYGA 3IDVA 4POLA 1Z6NA 1WRYA 5KN2A 3KJYA 1Z7RA 4X0XA 1XPVA 3H79A 4AJ7A 3EMPA 1HYUA 1GUHA 3ZTLA 4LLRA 2RUEA 5JWOB 2B6MA 1OAZA 2I4AA 3FEUA 3TKQA 2V1MA 5D8IA 3DD3A 4K0GA 3BCKA 3HKRA 2HSNB 3HJOA 2H30A 2GLRA 2KP2A 4EL1A 4I8BA 3FK8A 2DMMA 2GGTA 5D9VA 3TKSE 4KB3A 3P2AA 1S3CA 2F3MA
chains in the Genus database with same CATH superfamily
1V58A 5JWQB 1EZKA 3UEMA 2D2ZA 4MJEA 1ZCPA 4Z2TA 8GSSA 4Q5NA 3QCPA 4I2TA 2H1DA 4KF9A 1QK8A 3VWXA 3I43A 3GKKA 4V1Ap 1WP0A 1PRXA 3GL3A 1PKZA 3S9FA 4L0UA 1MDJA 4ZB8A 2H6YA 3TJGA 3UOMA 4AF2A 1JHBA 4ICYA 5ECQB 1BJXA 3KM6A 1PA3A 5ECMB 2IMKA 4GSSA 5A34A 3ZVJA 1GRXA 2MBTA 3QOUA 4MZBA 2H01A 2IMDA 4BVYB 3LWAA 2R6KA 1R26A 2HT9A 1YEPA 4ECJA 4JEDA 4TXOA 5ECSA 5GAPD 4W66A 3TB2A 4DSSB 3LQ7A 2L5LA 2M80A 2CA8A 2YOIA 3DWVA 2X99A 3UIWA 1T4YA 2DJ2A 1FB0A 5B8AA 2C3NA 3L9UA 1OC9A 2LTKA 4EXJA 2QA1A 5H5QA 4O5RA 6GSVA 2DC5A 1T4ZA 3APOA 3MSZA 2VD1A 3FZAA 1R4WA 4IELA 3Q6OA 1FVKA 3RGBC 1XXUA 5A5KA 4O92A 3ZLPA 1QGVA 4ZL9A 2WW3A 2WFCA 1SKWB 17GSA 5G31A 2H72A 2O8VB 2VL3A 2C4JA 5CRGA 1A2MA 3OR5A 5D9TA 3LFLA 1WPIA 3WT1A 1YDKA 3LEFA 4MPGA 3TOUA 3KH9A 1VGLA 4BL7B 2GSQA 4FYCA 1J9BA 2HZFA 4NV2A 7GSSA 2P0GA 5KN0A 2CVDA 3HJPA 1V2AA 4A5PA 3F4RA 5H5RA 2VLTA 2VAFA 2GZYA 3QFBC 3C8EA 3ISOA 1GP1A 2VCTA 2OJLA 1DE2A 1USBA 1FG4A 4QL9A 1S3AA 5A4VA 4NHWA 4LA1A 2EFEA 2FY6A 4HU9A 3VFIA 4TR0A 2OKAA 3D4MA 2C8UA 4WR4A 4XS1A 2WW1A 4KSMA 3VPQA 5F8BA 1PQNA 2OT3A 5ECLB 1GL8A 2RM6A 1LBKA 3I69A 2HSNA 4JR4A 1K3LA 2FWGA 2OE1A 3ED3A 3IHQA 1XOBA 2B7KA 3UJ1A 1AAZA 2LUSA 1MD4A 4XCSA 1GWCA 1BQ7A 3TRPA 3IV4A 1RW1A 2RLIA 4KGIA 4TR3A 3GSTA 2GDRA 3HJMA 3RFRC 2WW0A 4IJIA 3FHKA 3FZ4A 3UMAA 1DE1A 3ZITA 5DQSA 2BMXA 1GLPA 3I6AA 2HSHA 4EKZA 4MNNA 1T3BA 1KNGA 4ML6A 4LMVA 4BIKA 1B9YC 3HZ8A 1SJIA 3H93A 4AKIA 3CMIA 4BVYA 1UN2A 4HS1A 1U6TA 1OYJA 1XVWA 2L5OA 3TKPA 5DALB 2R3XA 2NPBA 4G19A 4DSSA 5CO3A 1XOAA 3HY2A 4G10A 1CQGA 4EIQA 2XPEA 1AUCA 1S3DA 3N9JA 1NHYA 4F0CA 2V32A 4N0ZA 2O7KA 3FR3A 3UVHA 4FYBA 3D4TA 2CV4A 3EU4A 4MJCA 2UZ8A 2CVKA 1K0OA 2FGXA 3ERWA 3IBHA 1UC7A 2PMTA 5FHIA 4ZILA 3HMJG 2YWNA 1O81A 2HRFA 5AN1A 14GSA 3HHVA 1SYRA 5GSTA 3GN3A 4EC0A 2F51A 4TRXA 5ECIB 3WD6A 2WVXB 1HNAA 3H4KA 1FHEA 1WOUA 3BOAA 3W8JA 3GUSA 2GT5A 4ID0A 4PUFC 4EF0A 4BL7A 2ON5A 5J4VA 5ID2B 3GKXA 4AJ6A 1E2YA 1FAAA 2KUCA 3TJFA 3A5WA 3QPMA 2VCXA 1MD3A 1S4BP 1YVLA 2DKHA 3L78A 13GSA 2L6DA 3SBCA 2X8HA 2LV3A 4MK3A 1VRSD 3DIEA 1GULA 1N25A 1X5CA 5JCGA 4MLYA 2C0DA 5DVBA 5G2ZA 5AIXA 3FRCA 4K1FA 3GSSA 1PL2A 3WGXA 2LRCA 3LYKA 1TI1A 3HXSA 1PGTA 3V1WA 2Z9SA 2V2GA 3MIXA 3D0ZA 2OE3A 1J0FA 2VUPA 4EE0A 4KSOA 4JZQA 4MF5A 2H0HA 2E2GA 2VLUA 2KHPA 3GV1A 1GNWA 5DJMA 3JCML 3A2WA 3QAVA 3U5RE 3KTBA 3VLNA 4LMWA 2QGVA 2XBIA 2A2PA 5D9WA 4QL7A 1O8XA 1WIKA 1TRWA 2JZRA 4HZ4A 2I1UA 2YANA 1SVMA 2NBSA 1X5DA 3VPTA 5J3RA 2ZNMA 3GL5A 4EDYA 3HYPA 1EOGA 2X49A 2EFHA 5IMAA 2ES7A 4PXOA 4MJBA 1AXDA 5B7CA 5IPHA 4LL4B 3ME8A 1TU8A 4YQUA 2F8FA 1OKDA 1SK1A 4IBPA 1XW9A 4BWQA 2EIQA 2E0QA 2MMNA 2X8CA 1OC3A 5DALA 3EPTA 4MH3A 2VCVA 1I9DA 4K7OA 4K7IA 4K2XA 2IJYA 3ZRDA 4BPYA 1EV9A 2H71A 2EFCA 1PMTA 2VM1A 1EEMA 5IMDA 2I3YA 1X9MB 3TCOA 1SENA 3HCZA 4GTUA 1ERUA 3DXBA 3DRNA 3CHXC 1EP8A 3F0IA 3G7IA 4HZ2A 2GT6A 2HQTA 1U3IA 4MZCA 1M3IA 4K6XA 3DVXA 1JZDA 2WVXA 4IKHA 1TOFA 4HDEA 2IMEA 3F6DA 1OE7A 1NW2A 2DIZA 3A3TA 2C0EA 2JZTA 5HR0A 4KA0A 2DMLA 5ID2A 5AIVA 4POKA 4OWYA 3CTFA 4F0BA 2OE0A 2QA2A 2GVPA 3DVWA 2VL2C 1KEBA 4ZL8A 1GTBA 5IMVA 3G7YA 5CREA 3EURA 2AJQB 3IK9A 2GSSA 1Z7PA 5J41A 1BX9A 4H86A 2C1YA 1XG8A 2LQOA 3VWWA 1R5PA 1GUKA 2K6VA 2C3QA 1PSQA 1G0TA 2G0FA 3QAGA 2JU5A 4KCEA 4K9ZA 4K0NA 3FR9A 2HZEB 3GRXA 3J7Yb 3UBKA 2DSAA 4K5SA 4NHZA 2HRNA 5G1LA 4BA7A 4AGSA 1M9BA 2IL3A 2AHEA 5J5NA 1TW9A 3CSIA 1SU9A 4MDCA 4L5LA 1SJ6A 2YV7A 5D9XA 1MDKA 3F9UA 4NMUA 5HFGA 1M2DA 5F0GA 3TKSC 4O7HA 1JFUA 3CTGA 3D5JA 1BF5A 2CX3A 3HVXA 3WYWA 1F9MA 4KDYA 4KX4A 2EIOA 5B6NA 2BJXA 5CAXA 3E9JB 1SKRB 3BJ5A 1LJRA 3KEBA 3BBYA 5KN3A 2AV4A 2HRKB 4Q5FA 1VF2A 1VF3A 4E8EA 5A4WA 2EIRA 2WZSA 3GMFA 2MZCA 4AKXB 2PU9C 4ZB6A 5CRWA 4MPFA 4PQIA 5KEJA 3W6GA 3RBTA 2C80A 3CWGA 4GXZA 1K3YA 3MNGA 2VCWA 2WVYA 3O3TA 5ECNB 3QR6A 2LKUA 1FOHA 4MP4A 1OE8A 2CX4A 4ZIJA 4NPBA 1KTEA 3ZMLA 2H1GA 3IC4A 2V6OA 1M2AA 1TJDA 2LJAA 3RPPA 5BMUB 2B7JA 4ML1A 3D6IA 1SK0A 5LD0A 1PN0A 5J9CA 3LYPA 1B4PA 2DBCA 1SK2A 3FYGA 3GYKA 5IOWA 2REMA 1F6MC 3DEXA 1BG5A 2OBKA 3R3EA 11GSA 2AUVA 4XHMA 4F03A 4TVEA 1RQMA 5IPGA 1Y6EA 4ZB9A 4NAXA 2LRNA 3CSHA 1N2AA 4TOPA 4P3YB 1QFNA 1PN9A 2LNTA 6GSUA 3G7JA 2XBQA 3IPZA 3M1GA 1T00A 4BVXB 3VI7A 1TU7A 10GSA 1A0RP 4OFMA 1ABAA 5EVOA 4FYUA 2WCIA 2WDUA 5A4UA 2DIYA 2H66A 1R7HA 3GKNA 1IYHA 3GNJA 4MJAA 2TIRA 3L0HA 1F37A 2OACA 3BD2A 3TJBA 5B8BA 5IMCA 5EPFA 4GRFA 3LXTA 2YZHA 2FA8A 3HZ4A 2FWHA 5LNKe 4WBRD 3A2XA 3F8UA 1TK8B 2PERA 2VM2A 1TDIA 4RQXA 2K8VA 3D21A 1X9WB 5D73A 2L4CA 4IGJA 4I2UA 3E0UA 3KH7A 2PUKC 2RUFA 1Q98A 5J47A 3KP8A 3C71A 1K0MA 1HNBA 5IM9A 1O7UA 1PKWA 2RM5A 5BRTA 1SVLA 4O5UA 2NDOA 1HNCA 5L71A 4K5RA 4TR4A 3F3QA 3PR8A 2C0GA 4GCIA 3LG6A 1A8YA 2B5EA 2PWJA 4JU5A 1IYIA 4N30A 1YJ6A 4Q5QA 2N5AA 1FOVA 4YAVA 1ZYNA 3W8SA 3FR6A 1A2LA 3UAPA 4L5OA 3RAZA 1EOHA 16GSA 1AQVA 4TR1B 3ERFA 3IRAA 2B1KA 1AQXA 1TI3A 4TXVA 4NXIA 12GSA 2J23A 2HFDA 1GSDA 1OC8A 1GNEA 3MWHA 4J2FA 6GSTA 4FXYP 5G30A 3F4SA 5BMUA 1F3AA 2O36A 3EU3A 4OO4A 4Z2RA 3L9SA 2K18A 5ABRA 2YPMA 1A24A 1K0CA 2C3TA 4V2LA 3TRQA 2P5RA 2YJ7A 4CY6A 1H4OA 2CZ2A 3ZL5A 1Y1UA 2VCZA 3IOSA 2ALBA 3HD5A 4O32A 1Q4JA 2VLVA 2X4AA 2N5FA 1TXXA 1YY7A 3L9VA 4PQ1A 3KMOA 2GTUA 5JWRB 4Q5RA 5G1KA 4YKFA 1XW5A 4IW9A 5CNWA 1NHOA 1AIUA 1JZOA 5IQYA 1WJKA 5DCHA 3IAM2 4HSCX 3GX0A 2H75A 3J7Yk 4BVXA 2MMAA 5FT3A 1EGOA 2LSTA 5DCGA 4PX1A 5J9BA 3C73A 4HOJA 1K0BA 1SYXA 3HVNA 1GTUA 3PPUA 2CAQA 4KAEA 1YEXA 3TUEA 5ECHB 4KCAA 4HUAA 3ERGA 1K0NA 2DJ3A 4KE3A 3KD0A 4QQ7A 4JE1A 3A5IA 3EVIA 5LCZA 3EYTA 1W89A 1R5AA 5HR2A 1GLQA 1EV4A 1ZZYA 2ON7A 3PH9A 5A1NB 2XPDA 2R37A 3WT2A 1OKTA 1QMVA 3TU3B 4XRDA 4PQHA 4XIHA 2YV9A 2MMOA 2FWEA 3LXZA 1O8WA 18GSA 1S3RA 1B48A 1TK5B 1MEKA 2JADA 2FA4A 4HJ2A 5F05A 2HSMB 3TKRA 1XWKA 2V41A 1X0RA 1ACVA 1ILOA 3M9JA 1M99A 2MBSA 4RUVA 3IE3A 2H1BA 2ZUPA 4PTSA 5HQPA 1SD8A 1XWGA 3O6TA 1YF0A 4GQFA 5DAKB 3Q18A 3SWLA 2H76A 1F3BA 1PFOA 2X8GA 2YNXA 1U87A 4TR1A 1YKCA 5ECKB 3TDGA 4TW5A 3H1NA 4ZBDA 2H70A 4OD7A 1YKAA 4DSRA 3P7XA 2QC7A 2J9HA 3RHCA 2H73A 3P8WA 3LW9A 1T8EB 5AISA 4FH8A 5GZZB 2M72A 2O89A 4EVMA 4OO5A 2I81A 3CYNA 2VO4A 4PNFA 2HXKA 3IHGA 3IAS2 4HEA2 3C1RA 1ERTA 3VWVA 2PVOC 3KGKA 1H75A 3G9BA 5DJLA 3GURA 2JL4A 1ON4A 2E2MA 2JSYA 1XCCA 5IO0A 5AGYA 2PN8A 4RI6A 3EMXA 4PUAA 4POMA 5CP1A 2A2SA 3L4NA 3GTUB 3M3MA 5DQYA 2M46A 1M3JA 2X64A 3QDNA 5GAND 3UARA 1K3OA 4KDXA 5DBQA 3GFKA 4L0WA 5HR3A 4USSA 3EWLA 2A4HA 3CXGA 6GSXA 4AJ8A 2I9HA 5JCWA 3DKSA 3AY8A 4GLTA 1G7EA 1M2BA 1ZGNA 3TOTA 1SJZA 2WRTA 4IS0A 3E3EA 1YEWC 2R0PA 1GUMA 4ECIA 2HI7A 2WULA 2R0GA 2EC4A 2VL2A 1Z9HA 5G5EA 3GKMA 1TTZA 20GSA 1XFLA 3LJRA 4EUYA 4I5QA 19GSA 3K8NA 2LS5A 4TKYA 2DLXA 2AB6A 2LJKA 4OFNA 1W4VA 4BWSA 4HI7A 4YH2A 1KBNA 2AAWA 1ZYQB 4MCUA 3CRTA 5A1NA 1WE0A 2FNOA 2FD3A 2YCDA 3ZIJA 2O3EA 3VK9A 3GH9A 2LJRA 3EE2A 1YQ1A 5COHA 5B6MA 4GQCA 4KDUA 4HQSA 3FKFA 1Z3EA 4YQMA 1SVOA 5J4YA 5CRHA 1FO5A 2O5VA 4K8MA 2HSMA 2H8LA 4HJMA 4OFTA 2CVBA 3TKSA 3P90A 1VF1A 3EINA 1VF4A 4WETA 5F07A 1MTCA 5E4WA 3UL3A 5IO2A 4PNGA 1PL1A 3HVVA 3CBUA 1ZOFA 2YZUA 5DAKA 2LEGA 4XTSA 2CQ9A 2FUG2 4GF0A 4GWRA 2TRCP 2VIMA 3KMNA 1GTAA 1M7TA 2NTOA 4E68A 2H1AA 3O76A 4K7NA 4I97A 4KUNA 5DDLA 4ZXGA 3WGDA 3KXOA 3NZNA 2PPTA 3GX8A 3U6VA 3R2QA 1SD9A 2P5QA 1DSBA 1F2EA 2L57A 3NOFA 4IQAA 2B5YA 2F9SA 1PD21 3ZIVA 1XVQA 2OBIA 6GSWA 4XS4B 3FZ9A 1GSFA 1THOA 1AQWA 3US3A 3HVSA 4FIWA 3GTUA 1TP9A 2JACA 3QMXA 1YF1A 4WBJA 3IC8A 2A4VA 5D96A 4NWYA 1J08A 3IXRA 3LGCA 3QD9A 1EWXA 3UBLA 3GH6A 1ZL9A 4IP6A 1E6BA 22GSA 4AI6A 1NSWA 1SL2B 4X43A 2R2JA 5D93A 2LNSA 2H0GA 4N0VA 4Z7XA 2R0CA 1LU4A 3DYRA 2ZCTA 3IK7A 2IFQB 2P31A 2R5GA 1HD2A 6GSSA 4HU7A 4E8HA 4PI0C 4DSQA 3C1SA 3Q19A 2VD0A 3N5OA 1G7OA 2O87A 5CYYA 4G9HA 2GZZA 3NIVA 4CY8A 1WMJA 2HSYA 1GH2A 3RPNA 2PBJA 2FCHA 2YP6A 4X1UA 4L8EA 1EEJA 3ZYWA 2HZEA 4OCEA 3ZMKA 1AW9A 2A2RA 5IIZA 4IHUA 1WWJA 2VL9A 2IN3A 1X5EA 5KOWA 2BTOT 5C00A 4K2DA 3F6FA 4I6XA 2CT6A 1GSUA 1B4QA 1O85A 5ECOB 3QAWA 5HFKA 3CRUA 2GSTA 2B3SA 3A2VA 3APQA 4Z2UA 2E7PA 1UA5A 1X9SB 2AYTA 2WGRA 5GSSA 4G0KA 2F8AA 2JSZA 1GSEA 3KIJA 1QQ2A 1Z5YE 2B1LA 4CW9A 4AKHA 5FWGA 1FB6A 5HFIA 1C72A 3BCIA 4MA9A 2R4VA 1FVJA 4F82A 4JRRA 2IPAA 3ME7A 2DJJA 1XBSA 1V9WA 2WS2A 2YWIA 1BAYA 5JCUA 2HRKA 4WF5A 1DBYA 4ILFA 3VWUA 4AKGA 4WKWA 1RK4A 4IQ1A 2H74A 5E59A 1ZMAA 5ECRB 2DJ0A 3ZFBA 3RHBA 2YN1A 4N3ZA 1ERVA 3ZFLA 1BG1A 3TGZA 4F2IA 3FMWA 2DJ1A 4MF7A 1TRSA 1O73A 3F4TA 4XS4A 1TKDB 3VI5A 1DUGA 2YJHA 3Q74A 3FY7A 2L6CA 4XS6A 3ZREA 2KOKA 4FQUA 2WJUA 2XC2A 1JLWA 1PX6A 1OVNA 4RI7A 1JZWA 4KH7A 5IOXA 4G2EA 5EL8A 2G2QA 2VCQA 1BYEA 3TJKA 2FHEA 4JR6A 4MZWA 2H6XA 3DGQA 4EO3A 1U88A 2QSIA 4YQVA 4LL1B 2PVQA 2GQMA 2L59A 2IFQA 1BEDA 3WGEA 1YZXA 3QFAC 1N8JA 1GSQA 4EDZA 2RIIA 5ECPB 4ZBAA 1AC1A 1M9AA 4D73B 2KP1A 4OCFA 2UV8G 4WF4A 3DMLA 4N11A 2DJKA 4MMMA 2HRAA 4J56E 2LQQA 5INYA 3CSJA 3TJJA 3EC3A 4V2MA 2IIYA 4HQZA 1A2JA 2YWOA 2JZSA 4MH2A 1ST9A 5J40A 1GSSA 1A8LA 2C0FA 4ECBA 1V57A 2PGTA 2GS3A 4WR5A 3ZZXA 4MABA 5HR1A 1QXHA 1ERWA 6GSYA 2HLSA 3M8NA 1XWBA 1JZRA 3CQFA 2GQKA 4PGTA 1XIYA 1GTIA 3MAKA 1A0FA 1SKSB 4ACSA 1I1IP 5IMZA 2K9FA 2V6KA 5ELGA 4WXTA 2IWTA 1SL1B 1EGRA 2NVLA 5F06A 2H6ZA 3LORA 4V1Ag 2WZ9A 4ISDA 2B5XA 4IJ3A 4J57E 4KNDA 3ZVJD 3M9KA 1QUWA 2WVZA 2VOCA 4G01A 4TN8A 5KN1A 1ML6A 5A5HB 4YAPA 3UVTA 4IP1A 1MDIA 4QMKA 1Z6MA 3M0FA 1V98A 4KW6A 3H8QA 1K0DA 1T1VA 3GHAA 2GZPA 5IMFA 3KZQA 1ZYEA 2HYXA 4G0LA 4DVCA 4GSTA 2CZ3A 1TXUA 4CHSA 2HE3A 1K0AA 5G5FA 3KP9A 1FW1A 2IMFA 2EFDA 1NM3A 3FZ5A 4CDOA 1V40A 4IVFA 3F63A 3APSA 9GSSA 3FW2A 1CQHA 4RQRA 5ELAA 4YKGA 1B8XA 4N10A 4X4JA 4EIPA 3IR4A 1T7PB 2O85A 3MDKA 1SL0B 1PX7A 3PGTA 4NV5A 2FWFA 2HNLA 3VURA 3TRXA 1THXA 1U3AA 2XHFA 1GSYA 5A34B 2TRXA 3IA1A 5CRDA 5C04A 1B9XC 3GIXA 3HDCA 2OA7A 3PINA 4FO5A 4TXOB 3D22A 4XRAA 1XWAA 4DEJA 4G0IA 5EY6A 3F3RA 3C7MA 1OC9B 2L4QA 4IN0A 2IMIA 3KTLA 2CAIA 4PI2C 1A23A 1G6WA 1TK0B 2H0IA 2OADA 4ZBBA 4D73A 3I9V2 4ZL7A 2KLXA 1URMA 1XWCA 4WEYA 1M0UA 3KCMA 1UVZA 4F9ZA 4PHZC 2QKEA 4ULXA 3LSZA 3HA9A 5J4UA 1G6YA 1Y25A 1EP7A 4MF6A 2LRTA 1TRVA 2FLSA 3RDWA 2YWMA 2N5BA 4GDFA 4V2NA 4PURA 5KOXA 5ENUA 4GSNA 2WW2A 4POBA 1TRUA 2DKIA 1HQOA 2K8SA 4ECCA 3GA4A 5H5SA 2H19A 4JBBA 2GSRA 2VKZG 2GQLA 3MYDA 4OMVA 1I5GA 1XZOA 2MMZA 1JLVA 1O6JA 2WB9A 1XW6A 2MYGA 3IDVA 4POLA 1Z6NA 1WRYA 5KN2A 4O5QA 4ZB7A 3KJYA 1Z7RA 4X0XA 1XPVA 3H79A 4AJ7A 3EMPA 1HYUA 1GUHA 3ZTLA 4LLRA 2RUEA 5JWOB 2B6MA 1OAZA 2I4AA 5A5HA 3FEUA 3TKQA 2V1MA 5D8IA 3DD3A 4K0GA 3BCKA 3HKRA 2H1LA 2HSNB 1ZYPA 3HJOA 2H30A 2GLRA 2KP2A 4EL1A 4I8BA 3FK8A 2DMMA 2GGTA 5D9VA 3TKSE 4KB3A 3P2AA 1S3CA 2F3MA
chains in the Genus database with same CATH topology
1V58A 5JWQB 1EZKA 3UEMA 2D2ZA 4MJEA 1ZCPA 4Z2TA 8GSSA 4Q5NA 3QCPA 4I2TA 2H1DA 4KF9A 1QK8A 3VWXA 3I43A 3GKKA 4V1Ap 1WP0A 1PRXA 3GL3A 1PKZA 3S9FA 4L0UA 1MDJA 4ZB8A 2H6YA 3TJGA 3UOMA 4AF2A 1JHBA 4ICYA 5ECQB 1BJXA 3KM6A 1PA3A 5ECMB 2IMKA 4GSSA 5A34A 3ZVJA 1GRXA 2MBTA 3QOUA 4MZBA 2H01A 2IMDA 4BVYB 3LWAA 2R6KA 1R26A 2HT9A 1YEPA 4ECJA 4JEDA 4TXOA 5ECSA 5GAPD 4W66A 3TB2A 4DSSB 3LQ7A 2L5LA 2M80A 2CA8A 2YOIA 3DWVA 2X99A 3UIWA 1T4YA 2DJ2A 1FB0A 5B8AA 2C3NA 3L9UA 1OC9A 2LTKA 4EXJA 2QA1A 5H5QA 4O5RA 6GSVA 2DC5A 1T4ZA 3APOA 3MSZA 2VD1A 3FZAA 1R4WA 4IELA 3Q6OA 1FVKA 1XXUA 5A5KA 4O92A 3ZLPA 1QGVA 4ZL9A 2WFCA 1SKWB 17GSA 5G31A 2H72A 2O8VB 2VL3A 2C4JA 5CRGA 1A2MA 3OR5A 5D9TA 3LFLA 1WPIA 3WT1A 1YDKA 3LEFA 4MPGA 3TOUA 3KH9A 1VGLA 4BL7B 2GSQA 4FYCA 1J9BA 2HZFA 4NV2A 7GSSA 2P0GA 5KN0A 2CVDA 3HJPA 1V2AA 4A5PA 3F4RA 5H5RA 2VLTA 2VAFA 2GZYA 3QFBC 3C8EA 3ISOA 1GP1A 2VCTA 2OJLA 1DE2A 1USBA 1FG4A 4QL9A 1S3AA 5A4VA 4NHWA 4LA1A 2EFEA 2FY6A 4HU9A 3VFIA 4TR0A 2OKAA 3D4MA 2C8UA 4WR4A 4XS1A 4KSMA 3VPQA 5F8BA 1PQNA 2OT3A 5ECLB 1GL8A 2RM6A 1LBKA 3I69A 2HSNA 4JR4A 1K3LA 2FWGA 2OE1A 3ED3A 3IHQA 1XOBA 2B7KA 3UJ1A 1AAZA 2LUSA 1MD4A 4XCSA 1GWCA 1BQ7A 3TRPA 3IV4A 1RW1A 2RLIA 4KGIA 4TR3A 3GSTA 2GDRA 3HJMA 3FHKA 4IJIA 3FZ4A 3UMAA 1DE1A 3ZITA 5DQSA 2BMXA 1GLPA 3I6AA 2HSHA 4EKZA 4MNNA 1T3BA 1KNGA 4ML6A 4LMVA 1B9YC 3HZ8A 1SJIA 3H93A 4AKIA 3CMIA 4BVYA 1UN2A 4HS1A 1U6TA 1OYJA 1XVWA 2L5OA 3TKPA 5DALB 2R3XA 2NPBA 4G19A 4DSSA 5CO3A 1XOAA 3HY2A 4G10A 1CQGA 4EIQA 2XPEA 1AUCA 1S3DA 3N9JA 1NHYA 4F0CA 2V32A 4N0ZA 2O7KA 3FR3A 3UVHA 4FYBA 3D4TA 2CV4A 3EU4A 4MJCA 2UZ8A 2CVKA 1K0OA 2FGXA 3ERWA 3IBHA 1UC7A 2PMTA 5FHIA 4ZILA 3HMJG 2YWNA 1O81A 2HRFA 5AN1A 14GSA 3HHVA 1SYRA 5GSTA 3GN3A 4EC0A 2F51A 4TRXA 5ECIB 3WD6A 1HNAA 3H4KA 1FHEA 1WOUA 3BOAA 3W8JA 3GUSA 2GT5A 4ID0A 4PUFC 4EF0A 4BL7A 2ON5A 5J4VA 5ID2B 3GKXA 4AJ6A 1E2YA 1FAAA 2KUCA 3TJFA 3A5WA 3QPMA 2VCXA 1MD3A 1YVLA 2DKHA 3L78A 13GSA 2L6DA 3SBCA 2X8HA 2LV3A 4MK3A 1VRSD 3DIEA 1GULA 1N25A 1X5CA 5JCGA 4MLYA 2C0DA 5DVBA 5G2ZA 5AIXA 3FRCA 4K1FA 3GSSA 1PL2A 3WGXA 2LRCA 3LYKA 1TI1A 3HXSA 1PGTA 3V1WA 2Z9SA 2V2GA 3MIXA 3D0ZA 2OE3A 1J0FA 2VUPA 4EE0A 4KSOA 4JZQA 4MF5A 2H0HA 2E2GA 2VLUA 2KHPA 3GV1A 1GNWA 5DJMA 3JCML 3A2WA 3QAVA 3U5RE 3KTBA 3VLNA 4LMWA 2QGVA 2XBIA 2A2PA 5D9WA 4QL7A 1O8XA 1WIKA 1TRWA 2JZRA 4HZ4A 2I1UA 2YANA 1SVMA 2NBSA 1X5DA 3VPTA 5J3RA 2ZNMA 3GL5A 4EDYA 3HYPA 1EOGA 2X49A 2EFHA 5IMAA 2ES7A 4PXOA 4MJBA 1AXDA 5B7CA 5IPHA 4LL4B 3ME8A 1TU8A 4YQUA 2F8FA 1OKDA 1SK1A 4IBPA 1XW9A 4BWQA 2EIQA 2E0QA 2MMNA 2X8CA 1OC3A 5DALA 3EPTA 4MH3A 2VCVA 1I9DA 4K7OA 4K7IA 4K2XA 2IJYA 3ZRDA 4BPYA 1EV9A 2H71A 2EFCA 1PMTA 2VM1A 1EEMA 5IMDA 2I3YA 1X9MB 3TCOA 1SENA 3HCZA 4GTUA 1ERUA 3DXBA 3DRNA 1EP8A 3F0IA 3G7IA 4HZ2A 2GT6A 2HQTA 1U3IA 4MZCA 4K6XA 3DVXA 1JZDA 4IKHA 1TOFA 4HDEA 2IMEA 3F6DA 1OE7A 1NW2A 2DIZA 3A3TA 2C0EA 2JZTA 5HR0A 4KA0A 2DMLA 5ID2A 5AIVA 4POKA 4OWYA 3CTFA 4F0BA 2OE0A 2QA2A 2GVPA 3DVWA 2VL2C 1KEBA 4ZL8A 1GTBA 5IMVA 3G7YA 5CREA 3EURA 2AJQB 3IK9A 2GSSA 1Z7PA 5J41A 1BX9A 4H86A 2C1YA 2LQOA 3VWWA 1R5PA 1GUKA 2K6VA 2C3QA 1PSQA 1G0TA 2G0FA 3QAGA 2JU5A 4KCEA 4K9ZA 4K0NA 3FR9A 2HZEB 3GRXA 3J7Yb 3UBKA 2DSAA 4K5SA 4NHZA 2HRNA 5G1LA 4BA7A 4AGSA 1M9BA 2IL3A 2AHEA 5J5NA 1TW9A 3CSIA 1SU9A 4MDCA 4L5LA 1SJ6A 2YV7A 5D9XA 1MDKA 3F9UA 4NMUA 5HFGA 1M2DA 5F0GA 3TKSC 4O7HA 1JFUA 3CTGA 3D5JA 1BF5A 2CX3A 3HVXA 3WYWA 1F9MA 4KDYA 4KX4A 2EIOA 5B6NA 2BJXA 5CAXA 3E9JB 1SKRB 3BJ5A 1LJRA 3KEBA 3BBYA 5KN3A 2AV4A 2HRKB 4Q5FA 1VF2A 1VF3A 4E8EA 5A4WA 2EIRA 3GMFA 2MZCA 4AKXB 2PU9C 4ZB6A 5CRWA 4MPFA 4PQIA 5KEJA 3W6GA 3RBTA 2C80A 3CWGA 4GXZA 1K3YA 3MNGA 2VCWA 3O3TA 5ECNB 3QR6A 2LKUA 1FOHA 4MP4A 1OE8A 2CX4A 4ZIJA 4NPBA 1KTEA 3ZMLA 2H1GA 3IC4A 2V6OA 1M2AA 1TJDA 2LJAA 3RPPA 5BMUB 2B7JA 4ML1A 3D6IA 1SK0A 5LD0A 1PN0A 5J9CA 3LYPA 1B4PA 2DBCA 1SK2A 3FYGA 3GYKA 5IOWA 2REMA 1F6MC 3DEXA 1BG5A 2OBKA 3R3EA 11GSA 2AUVA 4XHMA 4F03A 4TVEA 1RQMA 5IPGA 1Y6EA 4ZB9A 4NAXA 2LRNA 3CSHA 1N2AA 4TOPA 4P3YB 1QFNA 1PN9A 2LNTA 6GSUA 3G7JA 2XBQA 3IPZA 3M1GA 1T00A 4BVXB 3VI7A 1TU7A 10GSA 1A0RP 4OFMA 1ABAA 5EVOA 4FYUA 2WCIA 2WDUA 5A4UA 2DIYA 2H66A 1R7HA 3GKNA 1IYHA 3GNJA 4MJAA 2TIRA 3L0HA 1F37A 2OACA 3BD2A 3TJBA 5B8BA 5IMCA 5EPFA 4GRFA 3LXTA 2YZHA 2FA8A 3HZ4A 2FWHA 5LNKe 4WBRD 3A2XA 3F8UA 1TK8B 2PERA 2VM2A 1TDIA 4RQXA 2K8VA 3D21A 1X9WB 5D73A 2L4CA 4IGJA 4I2UA 3E0UA 3KH7A 2PUKC 2RUFA 1Q98A 5J47A 3KP8A 3C71A 1K0MA 1HNBA 5IM9A 1O7UA 1PKWA 2RM5A 5BRTA 1SVLA 4O5UA 2NDOA 1HNCA 5L71A 4K5RA 4TR4A 3F3QA 3PR8A 2C0GA 4GCIA 3LG6A 1A8YA 2B5EA 2PWJA 4JU5A 1IYIA 4N30A 1YJ6A 4Q5QA 2N5AA 1FOVA 4YAVA 1ZYNA 3W8SA 3FR6A 1A2LA 3UAPA 4L5OA 3RAZA 1EOHA 16GSA 1AQVA 4TR1B 3ERFA 3IRAA 2B1KA 1AQXA 1TI3A 4TXVA 4NXIA 12GSA 2J23A 2HFDA 1GSDA 1OC8A 1GNEA 3MWHA 4J2FA 6GSTA 5G30A 3F4SA 5BMUA 1F3AA 3EU3A 4OO4A 4Z2RA 3L9SA 2K18A 5ABRA 2YPMA 1A24A 1K0CA 2C3TA 4V2LA 3TRQA 2P5RA 2YJ7A 4CY6A 1H4OA 2CZ2A 3ZL5A 1Y1UA 2VCZA 3IOSA 2ALBA 3HD5A 4O32A 1Q4JA 2VLVA 2X4AA 2N5FA 1TXXA 1YY7A 3L9VA 4PQ1A 3KMOA 2GTUA 5JWRB 4Q5RA 5G1KA 4YKFA 1XW5A 4IW9A 5CNWA 1NHOA 1AIUA 1JZOA 5IQYA 1WJKA 5DCHA 3IAM2 3GX0A 2H75A 3J7Yk 4BVXA 2MMAA 5FT3A 1EGOA 2LSTA 5DCGA 4PX1A 5J9BA 3C73A 4HOJA 1K0BA 1SYXA 1GTUA 3PPUA 2CAQA 4KAEA 1YEXA 3TUEA 5ECHB 4KCAA 4HUAA 3ERGA 1K0NA 2DJ3A 4KE3A 3KD0A 4QQ7A 4JE1A 3A5IA 3EVIA 5LCZA 3EYTA 1W89A 1R5AA 5HR2A 1GLQA 1EV4A 1ZZYA 2ON7A 3PH9A 5A1NB 2XPDA 2R37A 3WT2A 1OKTA 1QMVA 3TU3B 4XRDA 4PQHA 4XIHA 2YV9A 2MMOA 2FWEA 3LXZA 1O8WA 18GSA 1B48A 1TK5B 1MEKA 2JADA 2FA4A 4HJ2A 5F05A 2HSMB 3TKRA 1XWKA 2V41A 1X0RA 1ACVA 1ILOA 3M9JA 1M99A 2MBSA 4RUVA 3IE3A 2H1BA 2ZUPA 4PTSA 5HQPA 1SD8A 1XWGA 3O6TA 1YF0A 4GQFA 5DAKB 3Q18A 3SWLA 2H76A 1F3BA 2X8GA 2YNXA 1U87A 4TR1A 1YKCA 5ECKB 3TDGA 4TW5A 3H1NA 4ZBDA 2H70A 4OD7A 1YKAA 4DSRA 3P7XA 2QC7A 2J9HA 3RHCA 2H73A 3P8WA 3LW9A 1T8EB 5AISA 4FH8A 5GZZB 2M72A 2O89A 4EVMA 4OO5A 2I81A 3CYNA 2VO4A 4PNFA 2HXKA 3IHGA 3IAS2 4HEA2 3C1RA 1ERTA 3VWVA 2PVOC 3KGKA 1H75A 3G9BA 5DJLA 3GURA 2JL4A 1ON4A 2E2MA 2JSYA 1XCCA 5IO0A 5AGYA 2PN8A 4RI6A 3EMXA 4PUAA 4POMA 5CP1A 2A2SA 3L4NA 3GTUB 3M3MA 5DQYA 2M46A 2X64A 3QDNA 5GAND 3UARA 1K3OA 4KDXA 5DBQA 3GFKA 4L0WA 5HR3A 4USSA 3EWLA 2A4HA 3CXGA 6GSXA 4AJ8A 2I9HA 5JCWA 3DKSA 3AY8A 4GLTA 1G7EA 1M2BA 1ZGNA 3TOTA 1SJZA 2WRTA 4IS0A 3E3EA 2R0PA 1GUMA 4ECIA 2HI7A 2WULA 2R0GA 2EC4A 2VL2A 1Z9HA 5G5EA 3GKMA 1TTZA 20GSA 1XFLA 3LJRA 4EUYA 4I5QA 19GSA 3K8NA 2LS5A 4TKYA 2DLXA 2AB6A 2LJKA 4OFNA 1W4VA 4BWSA 4HI7A 4YH2A 1KBNA 2AAWA 1ZYQB 4MCUA 3CRTA 5A1NA 1WE0A 2FNOA 2FD3A 2YCDA 3ZIJA 3VK9A 3GH9A 2LJRA 3EE2A 1YQ1A 5COHA 5B6MA 4GQCA 4KDUA 4HQSA 3FKFA 1Z3EA 4YQMA 1SVOA 5J4YA 5CRHA 1FO5A 2O5VA 4K8MA 2HSMA 2H8LA 4HJMA 4OFTA 2CVBA 3TKSA 3P90A 1VF1A 3EINA 1VF4A 4WETA 5F07A 1MTCA 5E4WA 3UL3A 5IO2A 4PNGA 1PL1A 3HVVA 3CBUA 1ZOFA 2YZUA 5DAKA 2LEGA 4XTSA 2CQ9A 2FUG2 4GF0A 4GWRA 2TRCP 2VIMA 3KMNA 1GTAA 1M7TA 2NTOA 4E68A 2H1AA 3O76A 4K7NA 4I97A 4KUNA 5DDLA 4ZXGA 3WGDA 3KXOA 3NZNA 2PPTA 3GX8A 3U6VA 3R2QA 1SD9A 2P5QA 1DSBA 1F2EA 2L57A 3NOFA 4IQAA 2B5YA 2F9SA 1PD21 3ZIVA 1XVQA 2OBIA 6GSWA 4XS4B 3FZ9A 1GSFA 1THOA 1AQWA 3US3A 3HVSA 4FIWA 3GTUA 1TP9A 2JACA 3QMXA 1YF1A 4WBJA 3IC8A 2A4VA 5D96A 4NWYA 1J08A 3IXRA 3LGCA 3QD9A 1EWXA 3UBLA 3GH6A 1ZL9A 4IP6A 1E6BA 22GSA 4AI6A 1NSWA 1SL2B 4X43A 2R2JA 5D93A 2LNSA 2H0GA 4N0VA 4Z7XA 2R0CA 1LU4A 3DYRA 2ZCTA 3IK7A 2IFQB 2P31A 2R5GA 1HD2A 6GSSA 4HU7A 4E8HA 4DSQA 3C1SA 3Q19A 2VD0A 3N5OA 1G7OA 2O87A 5CYYA 4G9HA 2GZZA 3NIVA 4CY8A 1WMJA 2HSYA 1GH2A 3RPNA 2PBJA 2FCHA 2YP6A 4X1UA 4L8EA 1EEJA 3ZYWA 2HZEA 4OCEA 3ZMKA 1AW9A 2A2RA 5IIZA 4IHUA 1WWJA 2VL9A 2IN3A 1X5EA 5KOWA 2BTOT 5C00A 4K2DA 3F6FA 4I6XA 2CT6A 1GSUA 1B4QA 1O85A 5ECOB 3QAWA 5HFKA 3CRUA 2GSTA 2B3SA 3A2VA 3APQA 4Z2UA 2E7PA 1UA5A 1X9SB 2AYTA 2WGRA 5GSSA 4G0KA 2F8AA 2JSZA 1GSEA 3KIJA 1QQ2A 1Z5YE 2B1LA 4CW9A 4AKHA 5FWGA 1FB6A 5HFIA 1C72A 3BCIA 4MA9A 2R4VA 1FVJA 4F82A 4JRRA 2IPAA 3ME7A 2DJJA 1XBSA 1V9WA 2WS2A 2YWIA 1BAYA 5JCUA 2HRKA 4WF5A 1DBYA 4ILFA 3VWUA 4AKGA 4WKWA 1RK4A 4IQ1A 2H74A 5E59A 1ZMAA 5ECRB 2DJ0A 3ZFBA 3RHBA 2YN1A 4N3ZA 1ERVA 3ZFLA 1BG1A 3TGZA 4F2IA 3FMWA 2DJ1A 4MF7A 1TRSA 1O73A 3F4TA 4XS4A 1TKDB 3VI5A 1DUGA 2YJHA 3Q74A 3FY7A 2L6CA 4XS6A 3ZREA 2KOKA 4FQUA 2WJUA 2XC2A 1JLWA 1PX6A 1OVNA 4RI7A 1JZWA 4KH7A 5IOXA 4G2EA 5EL8A 2G2QA 2VCQA 1BYEA 3TJKA 2FHEA 4JR6A 4MZWA 2H6XA 3DGQA 4EO3A 1U88A 2QSIA 4YQVA 4LL1B 2PVQA 2GQMA 2L59A 2IFQA 1BEDA 3WGEA 1YZXA 3QFAC 1N8JA 1GSQA 4EDZA 2RIIA 5ECPB 4ZBAA 1AC1A 1M9AA 4D73B 2KP1A 4OCFA 2UV8G 4WF4A 3DMLA 4N11A 2DJKA 4MMMA 2HRAA 4J56E 2LQQA 5INYA 3CSJA 3TJJA 3EC3A 4V2MA 2IIYA 4HQZA 1A2JA 2YWOA 2JZSA 4MH2A 1ST9A 5J40A 1GSSA 1A8LA 2C0FA 4ECBA 1V57A 2PGTA 2GS3A 4WR5A 3ZZXA 4MABA 5HR1A 1QXHA 1ERWA 6GSYA 2HLSA 3M8NA 1XWBA 1JZRA 2GQKA 4PGTA 1XIYA 1GTIA 3MAKA 1A0FA 1SKSB 4ACSA 5IMZA 2K9FA 2V6KA 5ELGA 4WXTA 2IWTA 1SL1B 1EGRA 2NVLA 5F06A 2H6ZA 3LORA 4V1Ag 2WZ9A 4ISDA 2B5XA 4IJ3A 4J57E 4KNDA 3ZVJD 3M9KA 1QUWA 2VOCA 4G01A 4TN8A 5KN1A 1ML6A 5A5HB 4YAPA 3UVTA 4IP1A 1MDIA 4QMKA 1Z6MA 3M0FA 1V98A 4KW6A 3H8QA 1K0DA 1T1VA 3GHAA 2GZPA 5IMFA 3KZQA 1ZYEA 2HYXA 4G0LA 4DVCA 4GSTA 2CZ3A 1TXUA 4CHSA 2HE3A 1K0AA 5G5FA 3KP9A 1FW1A 2IMFA 2EFDA 1NM3A 3FZ5A 4CDOA 1V40A 4IVFA 3F63A 3APSA 9GSSA 3FW2A 1CQHA 4RQRA 5ELAA 4YKGA 1B8XA 4N10A 4X4JA 4EIPA 3IR4A 1T7PB 2O85A 3MDKA 1SL0B 1PX7A 3PGTA 4NV5A 2FWFA 2HNLA 3VURA 3TRXA 1THXA 1U3AA 2XHFA 1GSYA 5A34B 2TRXA 3IA1A 5CRDA 5C04A 1B9XC 3GIXA 3HDCA 2OA7A 3PINA 4FO5A 4TXOB 3D22A 4XRAA 1XWAA 4DEJA 4G0IA 5EY6A 3F3RA 3C7MA 1OC9B 2L4QA 4IN0A 2IMIA 3KTLA 2CAIA 1A23A 1G6WA 1TK0B 2H0IA 2OADA 4ZBBA 4D73A 3I9V2 4ZL7A 2KLXA 1URMA 1XWCA 4WEYA 1M0UA 3KCMA 1UVZA 4F9ZA 2QKEA 4ULXA 3LSZA 3HA9A 5J4UA 1G6YA 1Y25A 1EP7A 4MF6A 2LRTA 1TRVA 2FLSA 3RDWA 2YWMA 2N5BA 4GDFA 4V2NA 4PURA 5KOXA 5ENUA 4GSNA 4POBA 1TRUA 2DKIA 1HQOA 2K8SA 4ECCA 3GA4A 5H5SA 2H19A 4JBBA 2GSRA 2VKZG 2GQLA 3MYDA 4OMVA 1I5GA 1XZOA 2MMZA 1JLVA 1O6JA 2WB9A 1XW6A 2MYGA 3IDVA 4POLA 1Z6NA 1WRYA 5KN2A 4O5QA 4ZB7A 3KJYA 1Z7RA 4X0XA 1XPVA 3H79A 4AJ7A 3EMPA 1HYUA 1GUHA 3ZTLA 4LLRA 2RUEA 5JWOB 2B6MA 1OAZA 2I4AA 5A5HA 3FEUA 3TKQA 2V1MA 5D8IA 3DD3A 4K0GA 3BCKA 3HKRA 2H1LA 2HSNB 1ZYPA 3HJOA 2H30A 2GLRA 2KP2A 4EL1A 4I8BA 3FK8A 2DMMA 2GGTA 5D9VA 3TKSE 4KB3A 3P2AA 1S3CA 2F3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V58 A;  5JWQ B;  1EZK A;  3UEM A;  2D2Z A;  4MJE A;  1ZCP A;  8GSS A;  4Q5N A;  3QCP A;  4I2T A;  2H1D A;  4KF9 A;  1QK8 A;  3VWX A;  3I43 A;  3GKK A;  4V1A p;  1WP0 A;  1PRX A;  3GL3 A;  1PKZ A;  3S9F A;  4L0U A;  1MDJ A;  4ZB8 A;  2H6Y A;  3TJG A;  3UOM A;  4AF2 A;  1JHB A;  5ECQ B;  1BJX A;  3KM6 A;  1PA3 A;  5ECM B;  2IMK A;  4GSS A;  3ZVJ A;  1GRX A;  2MBT A;  3QOU A;  4MZB A;  2H01 A;  2IMD A;  4BVY B;  3LWA A;  2R6K A;  1R26 A;  2HT9 A;  1YEP A;  4ECJ A;  4JED A;  4TXO A;  5ECS A;  5GAP D;  3TB2 A;  4DSS B;  3LQ7 A;  2L5L A;  2M80 A;  2CA8 A;  2YOI A;  3DWV A;  2X99 A;  3UIW A;  1T4Y A;  2DJ2 A;  1FB0 A;  5B8A A;  2C3N A;  3L9U A;  1OC9 A;  2LTK A;  4EXJ A;  5H5Q A;  4O5R A;  6GSV A;  2DC5 A;  1T4Z A;  3APO A;  3MSZ A;  2VD1 A;  3FZA A;  1R4W A;  4IEL A;  3Q6O A;  1FVK A;  1XXU A;  5A5K A;  4O92 A;  3ZLP A;  1QGV A;  4ZL9 A;  2WFC A;  1SKW B;  17GS A;  5G31 A;  2H72 A;  2O8V B;  2VL3 A;  2C4J A;  5CRG A;  1A2M A;  3OR5 A;  5D9T A;  3LFL A;  1WPI A;  3WT1 A;  1YDK A;  3LEF A;  4MPG A;  3TOU A;  3KH9 A;  1VGL A;  4BL7 B;  2GSQ A;  4FYC A;  1J9B A;  2HZF A;  4NV2 A;  7GSS A;  2P0G A;  5KN0 A;  2CVD A;  3HJP A;  1V2A A;  3F4R A;  5H5R A;  2VLT A;  2VAF A;  2GZY A;  3QFB C;  3C8E A;  3ISO A;  1GP1 A;  2VCT A;  2OJL A;  1DE2 A;  1USB A;  1FG4 A;  4QL9 A;  1S3A A;  5A4V A;  4NHW A;  4LA1 A;  2FY6 A;  4HU9 A;  3VFI A;  4TR0 A;  2OKA A;  3D4M A;  2C8U A;  4WR4 A;  4XS1 A;  4KSM A;  3VPQ A;  5F8B A;  1PQN A;  5ECL B;  1GL8 A;  2RM6 A;  1LBK A;  3I69 A;  4JR4 A;  1K3L A;  2FWG A;  2OE1 A;  3ED3 A;  3IHQ A;  1XOB A;  2B7K A;  3UJ1 A;  1AAZ A;  2LUS A;  1MD4 A;  4XCS A;  1GWC A;  1BQ7 A;  3TRP A;  3IV4 A;  1RW1 A;  2RLI A;  4KGI A;  4TR3 A;  3GST A;  2GDR A;  3HJM A;  3FHK A;  4IJI A;  3FZ4 A;  3UMA A;  1DE1 A;  3ZIT A;  5DQS A;  2BMX A;  1GLP A;  3I6A A;  2HSH A;  4EKZ A;  1T3B A;  1KNG A;  4ML6 A;  4LMV A;  1B9Y C;  3HZ8 A;  1SJI A;  3H93 A;  3CMI A;  4BVY A;  1UN2 A;  4HS1 A;  1U6T A;  1OYJ A;  1XVW A;  2L5O A;  3TKP A;  5DAL B;  2R3X A;  2NPB A;  4G19 A;  4DSS A;  5CO3 A;  1XOA A;  3HY2 A;  4G10 A;  1CQG A;  2XPE A;  1AUC A;  1S3D A;  3N9J A;  1NHY A;  4F0C A;  2V32 A;  4N0Z A;  2O7K A;  3FR3 A;  3UVH A;  4FYB A;  3D4T A;  2CV4 A;  3EU4 A;  4MJC A;  2UZ8 A;  2CVK A;  1K0O A;  2FGX A;  3ERW A;  3IBH A;  1UC7 A;  2PMT A;  5FHI A;  4ZIL A;  2YWN A;  1O81 A;  2HRF A;  5AN1 A;  14GS A;  3HHV A;  1SYR A;  5GST A;  3GN3 A;  4EC0 A;  2F51 A;  4TRX A;  5ECI B;  3WD6 A;  1HNA A;  3H4K A;  1FHE A;  1WOU A;  3BOA A;  3W8J A;  3GUS A;  2GT5 A;  4ID0 A;  4PUF C;  4EF0 A;  4BL7 A;  2ON5 A;  5ID2 B;  3GKX A;  4AJ6 A;  1E2Y A;  1FAA A;  2KUC A;  3TJF A;  3A5W A;  3QPM A;  2VCX A;  1MD3 A;  3L78 A;  13GS A;  2L6D A;  3SBC A;  2X8H A;  2LV3 A;  4MK3 A;  1VRS D;  3DIE A;  1GUL A;  1X5C A;  5JCG A;  4MLY A;  2C0D A;  5DVB A;  5G2Z A;  5AIX A;  3FRC A;  4K1F A;  3GSS A;  1PL2 A;  3WGX A;  2LRC A;  3LYK A;  1TI1 A;  3HXS A;  1PGT A;  3V1W A;  2Z9S A;  2V2G A;  3D0Z A;  2OE3 A;  1J0F A;  2VUP A;  4EE0 A;  4KSO A;  4JZQ A;  4MF5 A;  2H0H A;  2E2G A;  2VLU A;  2KHP A;  3GV1 A;  1GNW A;  5DJM A;  3JCM L;  3A2W A;  3QAV A;  3U5R E;  3KTB A;  3VLN A;  4LMW A;  2QGV A;  2XBI A;  5D9W A;  4QL7 A;  1O8X A;  1WIK A;  1TRW A;  2JZR A;  4HZ4 A;  2I1U A;  2YAN A;  2NBS A;  1X5D A;  3VPT A;  5J3R A;  2ZNM A;  3GL5 A;  4EDY A;  3HYP A;  1EOG A;  5IMA A;  2ES7 A;  4PXO A;  4MJB A;  1AXD A;  5B7C A;  5IPH A;  4LL4 B;  3ME8 A;  1TU8 A;  4YQU A;  2F8F A;  1OKD A;  1SK1 A;  4IBP A;  1XW9 A;  4BWQ A;  2EIQ A;  2E0Q A;  2MMN A;  2X8C A;  1OC3 A;  5DAL A;  4MH3 A;  2VCV A;  1I9D A;  4K7O A;  4K7I A;  2IJY A;  3ZRD A;  4BPY A;  1EV9 A;  2H71 A;  1PMT A;  2VM1 A;  1EEM A;  5IMD A;  2I3Y A;  1X9M B;  3TCO A;  1SEN A;  3HCZ A;  4GTU A;  1ERU A;  3DXB A;  3DRN A;  1EP8 A;  3F0I A;  3G7I A;  4HZ2 A;  2GT6 A;  2HQT A;  1U3I A;  4MZC A;  4K6X A;  3DVX A;  1JZD A;  4IKH A;  1TOF A;  4HDE A;  2IME A;  3F6D A;  1OE7 A;  1NW2 A;  2DIZ A;  3A3T A;  2C0E A;  2JZT A;  5HR0 A;  4KA0 A;  2DML A;  5ID2 A;  5AIV A;  4POK A;  4OWY A;  3CTF A;  4F0B A;  2OE0 A;  2GVP A;  3DVW A;  2VL2 C;  1KEB A;  4ZL8 A;  1GTB A;  5IMV A;  3G7Y A;  5CRE A;  3EUR A;  2AJQ B;  3IK9 A;  2GSS A;  1Z7P A;  5J41 A;  1BX9 A;  4H86 A;  2C1Y A;  2LQO A;  3VWW A;  1R5P A;  1GUK A;  2K6V A;  2C3Q A;  1PSQ A;  1G0T A;  2G0F A;  3QAG A;  2JU5 A;  4KCE A;  4K9Z A;  4K0N A;  3FR9 A;  2HZE B;  3GRX A;  3J7Y b;  3UBK A;  2DSA A;  4NHZ A;  2HRN A;  5G1L A;  4BA7 A;  4AGS A;  1M9B A;  2IL3 A;  2AHE A;  5J5N A;  1TW9 A;  3CSI A;  1SU9 A;  4MDC A;  4L5L A;  1SJ6 A;  2YV7 A;  5D9X A;  1MDK A;  3F9U A;  4NMU A;  5HFG A;  1M2D A;  5F0G A;  3TKS C;  4O7H A;  1JFU A;  3CTG A;  3D5J A;  2CX3 A;  3HVX A;  3WYW A;  1F9M A;  4KDY A;  4KX4 A;  2EIO A;  5B6N A;  2BJX A;  5CAX A;  3E9J B;  1SKR B;  3BJ5 A;  1LJR A;  3KEB A;  3BBY A;  5KN3 A;  2AV4 A;  2HRK B;  4Q5F A;  1VF2 A;  1VF3 A;  4E8E A;  5A4W A;  2EIR A;  3GMF A;  2MZC A;  2PU9 C;  4ZB6 A;  5CRW A;  4MPF A;  4PQI A;  5KEJ A;  3W6G A;  3RBT A;  2C80 A;  4GXZ A;  1K3Y A;  3MNG A;  2VCW A;  3O3T A;  5ECN B;  3QR6 A;  2LKU A;  4MP4 A;  1OE8 A;  2CX4 A;  4ZIJ A;  4NPB A;  1KTE A;  3ZML A;  2H1G A;  3IC4 A;  2V6O A;  1M2A A;  1TJD A;  2LJA A;  3RPP A;  2B7J A;  4ML1 A;  3D6I A;  1SK0 A;  5LD0 A;  5J9C A;  3LYP A;  1B4P A;  2DBC A;  1SK2 A;  3FYG A;  3GYK A;  5IOW A;  2REM A;  1F6M C;  3DEX A;  1BG5 A;  2OBK A;  3R3E A;  11GS A;  2AUV A;  4XHM A;  4F03 A;  4TVE A;  1RQM A;  5IPG A;  1Y6E A;  4ZB9 A;  4NAX A;  2LRN A;  3CSH A;  1N2A A;  4TOP A;  4P3Y B;  1QFN A;  1PN9 A;  2LNT A;  6GSU A;  3G7J A;  2XBQ A;  3IPZ A;  3M1G A;  1T00 A;  4BVX B;  3VI7 A;  1TU7 A;  10GS A;  1A0R P;  4OFM A;  1ABA A;  5EVO A;  4FYU A;  2WCI A;  2WDU A;  5A4U A;  2DIY A;  2H66 A;  1R7H A;  3GKN A;  1IYH A;  3GNJ A;  4MJA A;  2TIR A;  3L0H A;  1F37 A;  2OAC A;  3BD2 A;  3TJB A;  5B8B A;  5IMC A;  5EPF A;  4GRF A;  3LXT A;  2YZH A;  2FA8 A;  3HZ4 A;  2FWH A;  5LNK e;  4WBR D;  3A2X A;  3F8U A;  1TK8 B;  2PER A;  2VM2 A;  1TDI A;  4RQX A;  2K8V A;  3D21 A;  1X9W B;  5D73 A;  2L4C A;  4IGJ A;  4I2U A;  3E0U A;  3KH7 A;  2PUK C;  2RUF A;  1Q98 A;  3KP8 A;  3C71 A;  1K0M A;  1HNB A;  5IM9 A;  1O7U A;  1PKW A;  2RM5 A;  2NDO A;  1HNC A;  5L71 A;  4TR4 A;  3F3Q A;  3PR8 A;  2C0G A;  4GCI A;  3LG6 A;  1A8Y A;  2B5E A;  2PWJ A;  4JU5 A;  1IYI A;  4N30 A;  1YJ6 A;  4Q5Q A;  2N5A A;  1FOV A;  4YAV A;  3W8S A;  3FR6 A;  1A2L A;  3UAP A;  4L5O A;  3RAZ A;  1EOH A;  16GS A;  1AQV A;  4TR1 B;  3ERF A;  3IRA A;  2B1K A;  1AQX A;  1TI3 A;  4TXV A;  4NXI A;  12GS A;  2J23 A;  2HFD A;  1GSD A;  1OC8 A;  1GNE A;  3MWH A;  4J2F A;  6GST A;  5G30 A;  3F4S A;  5BMU A;  1F3A A;  3EU3 A;  4OO4 A;  3L9S A;  2K18 A;  5ABR A;  2YPM A;  1A24 A;  1K0C A;  2C3T A;  4V2L A;  3TRQ A;  2P5R A;  2YJ7 A;  1H4O A;  2CZ2 A;  3ZL5 A;  2VCZ A;  3IOS A;  2ALB A;  3HD5 A;  4O32 A;  1Q4J A;  2VLV A;  2N5F A;  1TXX A;  1YY7 A;  3L9V A;  4PQ1 A;  3KMO A;  2GTU A;  5JWR B;  4Q5R A;  5G1K A;  1XW5 A;  4IW9 A;  5CNW A;  1NHO A;  1AIU A;  1JZO A;  5IQY A;  1WJK A;  5DCH A;  3IAM 2;  3GX0 A;  2H75 A;  3J7Y k;  4BVX A;  2MMA A;  5FT3 A;  1EGO A;  2LST A;  5DCG A;  4PX1 A;  5J9B A;  3C73 A;  4HOJ A;  1K0B A;  1SYX A;  1GTU A;  3PPU A;  2CAQ A;  4KAE A;  1YEX A;  3TUE A;  5ECH B;  4KCA A;  4HUA A;  3ERG A;  1K0N A;  2DJ3 A;  4KE3 A;  3KD0 A;  4QQ7 A;  4JE1 A;  3EVI A;  5LCZ A;  3EYT A;  1W89 A;  1R5A A;  5HR2 A;  1GLQ A;  1EV4 A;  1ZZY A;  2ON7 A;  3PH9 A;  2R37 A;  2XPD A;  3WT2 A;  1OKT A;  1QMV A;  4XRD A;  4PQH A;  4XIH A;  2YV9 A;  2MMO A;  2FWE A;  3LXZ A;  1O8W A;  18GS A;  1B48 A;  1TK5 B;  1MEK A;  2JAD A;  2FA4 A;  4HJ2 A;  5F05 A;  2HSM B;  3TKR A;  1XWK A;  2V41 A;  1X0R A;  1ACV A;  1ILO A;  3M9J A;  1M99 A;  2MBS A;  4RUV A;  3IE3 A;  2H1B A;  2ZUP A;  4PTS A;  5HQP A;  1SD8 A;  1XWG A;  3O6T A;  1YF0 A;  4GQF A;  5DAK B;  3Q18 A;  3SWL A;  2H76 A;  1F3B A;  2X8G A;  2YNX A;  1U87 A;  4TR1 A;  1YKC A;  5ECK B;  3TDG A;  4TW5 A;  3H1N A;  4ZBD A;  2H70 A;  4OD7 A;  1YKA A;  4DSR A;  3P7X A;  2QC7 A;  2J9H A;  3RHC A;  2H73 A;  3P8W A;  1T8E B;  5AIS A;  4FH8 A;  5GZZ B;  2M72 A;  2O89 A;  4EVM A;  4OO5 A;  2I81 A;  3CYN A;  2VO4 A;  4PNF A;  2HXK A;  3IAS 2;  4HEA 2;  3C1R A;  1ERT A;  3VWV A;  2PVO C;  3KGK A;  1H75 A;  3G9B A;  5DJL A;  3GUR A;  2JL4 A;  1ON4 A;  2E2M A;  2JSY A;  1XCC A;  5IO0 A;  5AGY A;  2PN8 A;  4RI6 A;  3EMX A;  4PUA A;  4POM A;  5CP1 A;  2A2S A;  3L4N A;  3GTU B;  3M3M A;  5DQY A;  2M46 A;  2X64 A;  3QDN A;  5GAN D;  3UAR A;  1K3O A;  4KDX A;  5DBQ A;  3GFK A;  4L0W A;  5HR3 A;  4USS A;  3EWL A;  3CXG A;  6GSX A;  4AJ8 A;  2I9H A;  5JCW A;  3DKS A;  3AY8 A;  4GLT A;  1G7E A;  1M2B A;  1ZGN A;  3TOT A;  1SJZ A;  2WRT A;  4IS0 A;  3E3E A;  1GUM A;  4ECI A;  2HI7 A;  2WUL A;  2EC4 A;  2VL2 A;  1Z9H A;  5G5E A;  3GKM A;  1TTZ A;  20GS A;  1XFL A;  3LJR A;  4EUY A;  4I5Q A;  19GS A;  3K8N A;  2LS5 A;  4TKY A;  2DLX A;  2AB6 A;  2LJK A;  4OFN A;  1W4V A;  4BWS A;  4HI7 A;  4YH2 A;  1KBN A;  2AAW A;  1ZYQ B;  4MCU A;  3CRT A;  1WE0 A;  2FNO A;  2FD3 A;  2YCD A;  3ZIJ A;  3VK9 A;  3GH9 A;  2LJR A;  3EE2 A;  1YQ1 A;  5COH A;  5B6M A;  4GQC A;  4KDU A;  4HQS A;  3FKF A;  1Z3E A;  4YQM A;  5CRH A;  1FO5 A;  4K8M A;  2HSM A;  2H8L A;  4HJM A;  4OFT A;  2CVB A;  3TKS A;  3P90 A;  1VF1 A;  3EIN A;  1VF4 A;  4WET A;  5F07 A;  1MTC A;  5E4W A;  3UL3 A;  5IO2 A;  4PNG A;  1PL1 A;  3HVV A;  3CBU A;  1ZOF A;  2YZU A;  5DAK A;  2LEG A;  4XTS A;  2CQ9 A;  2FUG 2;  4GF0 A;  4GWR A;  2TRC P;  2VIM A;  3KMN A;  1GTA A;  1M7T A;  2NTO A;  2H1A A;  3O76 A;  4K7N A;  4I97 A;  4KUN A;  5DDL A;  4ZXG A;  3WGD A;  3KXO A;  3NZN A;  2PPT A;  3GX8 A;  3U6V A;  3R2Q A;  1SD9 A;  2P5Q A;  1DSB A;  1F2E A;  2L57 A;  3NOF A;  4IQA A;  2B5Y A;  2F9S A;  1PD2 1;  3ZIV A;  1XVQ A;  2OBI A;  6GSW A;  4XS4 B;  3FZ9 A;  1GSF A;  1THO A;  1AQW A;  3US3 A;  3HVS A;  4FIW A;  3GTU A;  1TP9 A;  2JAC A;  3QMX A;  1YF1 A;  4WBJ A;  3IC8 A;  2A4V A;  5D96 A;  4NWY A;  1J08 A;  3IXR A;  3LGC A;  3QD9 A;  1EWX A;  3UBL A;  3GH6 A;  1ZL9 A;  4IP6 A;  1E6B A;  22GS A;  1NSW A;  1SL2 B;  4X43 A;  2R2J A;  5D93 A;  2LNS A;  2H0G A;  4N0V A;  4Z7X A;  1LU4 A;  3DYR A;  2ZCT A;  3IK7 A;  2IFQ B;  2P31 A;  2R5G A;  1HD2 A;  6GSS A;  4HU7 A;  4E8H A;  4DSQ A;  3C1S A;  3Q19 A;  2VD0 A;  3N5O A;  1G7O A;  2O87 A;  5CYY A;  4G9H A;  2GZZ A;  3NIV A;  1WMJ A;  2HSY A;  1GH2 A;  3RPN A;  2PBJ A;  2FCH A;  2YP6 A;  4X1U A;  4L8E A;  1EEJ A;  3ZYW A;  2HZE A;  4OCE A;  3ZMK A;  1AW9 A;  2A2R A;  5IIZ A;  4IHU A;  1WWJ A;  2VL9 A;  2IN3 A;  1X5E A;  2BTO T;  5C00 A;  4K2D A;  3F6F A;  4I6X A;  2CT6 A;  1GSU A;  1B4Q A;  1O85 A;  5ECO B;  3QAW A;  5HFK A;  3CRU A;  2GST A;  2B3S A;  3A2V A;  3APQ A;  2E7P A;  1UA5 A;  1X9S B;  2AYT A;  2WGR A;  5GSS A;  4G0K A;  2F8A A;  2JSZ A;  1GSE A;  3KIJ A;  1QQ2 A;  1Z5Y E;  2B1L A;  4CW9 A;  5FWG A;  1FB6 A;  5HFI A;  1C72 A;  3BCI A;  4MA9 A;  2R4V A;  1FVJ A;  4F82 A;  4JRR A;  2IPA A;  3ME7 A;  2DJJ A;  1XBS A;  1V9W A;  2WS2 A;  2YWI A;  1BAY A;  5JCU A;  2HRK A;  4WF5 A;  1DBY A;  4ILF A;  3VWU A;  4WKW A;  1RK4 A;  4IQ1 A;  2H74 A;  5E59 A;  1ZMA A;  5ECR B;  2DJ0 A;  3ZFB A;  3RHB A;  2YN1 A;  1ERV A;  3ZFL A;  3TGZ A;  4F2I A;  2DJ1 A;  4MF7 A;  1TRS A;  1O73 A;  3F4T A;  4XS4 A;  1TKD B;  3VI5 A;  1DUG A;  2YJH A;  3Q74 A;  3FY7 A;  2L6C A;  4XS6 A;  3ZRE A;  2KOK A;  4FQU A;  2WJU A;  2XC2 A;  1JLW A;  1PX6 A;  1OVN A;  4RI7 A;  1JZW A;  4KH7 A;  5IOX A;  4G2E A;  5EL8 A;  2G2Q A;  2VCQ A;  1BYE A;  3TJK A;  2FHE A;  4JR6 A;  4MZW A;  2H6X A;  3DGQ A;  4EO3 A;  1U88 A;  2QSI A;  4YQV A;  4LL1 B;  2PVQ A;  2GQM A;  2L59 A;  2IFQ A;  1BED A;  3WGE A;  1YZX A;  3QFA C;  1N8J A;  1GSQ A;  4EDZ A;  2RII A;  5ECP B;  4ZBA A;  1AC1 A;  1M9A A;  4D73 B;  2KP1 A;  4OCF A;  4WF4 A;  3DML A;  4N11 A;  2DJK A;  4MMM A;  2HRA A;  4J56 E;  2LQQ A;  5INY A;  3CSJ A;  3TJJ A;  3EC3 A;  4V2M A;  2IIY A;  4HQZ A;  1A2J A;  2YWO A;  2JZS A;  4MH2 A;  1ST9 A;  1GSS A;  1A8L A;  2C0F A;  4ECB A;  1V57 A;  2PGT A;  2GS3 A;  4WR5 A;  3ZZX A;  4MAB A;  5HR1 A;  1QXH A;  1ERW A;  6GSY A;  2HLS A;  3M8N A;  1XWB A;  1JZR A;  2GQK A;  4PGT A;  1XIY A;  1GTI A;  3MAK A;  1A0F A;  1SKS B;  4ACS A;  5IMZ A;  2K9F A;  2V6K A;  5ELG A;  4WXT A;  2IWT A;  1SL1 B;  1EGR A;  2NVL A;  5F06 A;  2H6Z A;  3LOR A;  4V1A g;  2WZ9 A;  4ISD A;  2B5X A;  4IJ3 A;  4J57 E;  4KND A;  3ZVJ D;  3M9K A;  1QUW A;  2VOC A;  4TN8 A;  5KN1 A;  1ML6 A;  4YAP A;  3UVT A;  4IP1 A;  1MDI A;  1Z6M A;  3M0F A;  1V98 A;  4KW6 A;  3H8Q A;  1K0D A;  1T1V A;  3GHA A;  2GZP A;  5IMF A;  3KZQ A;  1ZYE A;  2HYX A;  4G0L A;  4DVC A;  4GST A;  2CZ3 A;  4CHS A;  2HE3 A;  1K0A A;  5G5F A;  3KP9 A;  1FW1 A;  2IMF A;  1NM3 A;  3FZ5 A;  4CDO A;  1V40 A;  4IVF A;  3F63 A;  3APS A;  9GSS A;  3FW2 A;  1CQH A;  4RQR A;  5ELA A;  1B8X A;  4N10 A;  3IR4 A;  1T7P B;  2O85 A;  3MDK A;  1SL0 B;  1PX7 A;  3PGT A;  4NV5 A;  2FWF A;  2HNL A;  3VUR A;  3TRX A;  1THX A;  1U3A A;  2XHF A;  1GSY A;  2TRX A;  3IA1 A;  5CRD A;  5C04 A;  1B9X C;  3GIX A;  3HDC A;  2OA7 A;  3PIN A;  4FO5 A;  4TXO B;  3D22 A;  4XRA A;  1XWA A;  4DEJ A;  4G0I A;  5EY6 A;  3F3R A;  3C7M A;  1OC9 B;  2L4Q A;  4IN0 A;  2IMI A;  3KTL A;  2CAI A;  1A23 A;  1G6W A;  1TK0 B;  2H0I A;  2OAD A;  4ZBB A;  4D73 A;  3I9V 2;  4ZL7 A;  2KLX A;  1URM A;  1XWC A;  4WEY A;  1M0U A;  3KCM A;  1UVZ A;  4F9Z A;  2QKE A;  4ULX A;  3LSZ A;  3HA9 A;  5J4U A;  1G6Y A;  1Y25 A;  1EP7 A;  4MF6 A;  2LRT A;  1TRV A;  2FLS A;  3RDW A;  2YWM A;  2N5B A;  4V2N A;  4PUR A;  5ENU A;  4GSN A;  4POB A;  1TRU A;  1HQO A;  2K8S A;  4ECC A;  3GA4 A;  5H5S A;  2H19 A;  4JBB A;  2GSR A;  2GQL A;  4OMV A;  1I5G A;  1XZO A;  2MMZ A;  1JLV A;  1O6J A;  2WB9 A;  1XW6 A;  2MYG A;  3IDV A;  4POL A;  1Z6N A;  1WRY A;  5KN2 A;  3KJY A;  1Z7R A;  4X0X A;  1XPV A;  3H79 A;  4AJ7 A;  3EMP A;  1HYU A;  1GUH A;  3ZTL A;  4LLR A;  2RUE A;  5JWO B;  2B6M A;  1OAZ A;  2I4A A;  3FEU A;  3TKQ A;  2V1M A;  5D8I A;  3DD3 A;  4K0G A;  3BCK A;  3HKR A;  2HSN B;  3HJO A;  2H30 A;  2GLR A;  2KP2 A;  4EL1 A;  4I8B A;  3FK8 A;  2DMM A;  2GGT A;  5D9V A;  3TKS E;  4KB3 A;  3P2A A;  1S3C A;  2F3M A; 
#chains in the Genus database with same CATH topology
 1V58 A;  5JWQ B;  1EZK A;  3UEM A;  2D2Z A;  4MJE A;  1ZCP A;  4Z2T A;  8GSS A;  4Q5N A;  3QCP A;  4I2T A;  2H1D A;  4KF9 A;  1QK8 A;  3VWX A;  3I43 A;  3GKK A;  4V1A p;  1WP0 A;  1PRX A;  3GL3 A;  1PKZ A;  3S9F A;  4L0U A;  1MDJ A;  4ZB8 A;  2H6Y A;  3TJG A;  3UOM A;  4AF2 A;  1JHB A;  4ICY A;  5ECQ B;  1BJX A;  3KM6 A;  1PA3 A;  5ECM B;  2IMK A;  4GSS A;  5A34 A;  3ZVJ A;  1GRX A;  2MBT A;  3QOU A;  4MZB A;  2H01 A;  2IMD A;  4BVY B;  3LWA A;  2R6K A;  1R26 A;  2HT9 A;  1YEP A;  4ECJ A;  4JED A;  4TXO A;  5ECS A;  5GAP D;  4W66 A;  3TB2 A;  4DSS B;  3LQ7 A;  2L5L A;  2M80 A;  2CA8 A;  2YOI A;  3DWV A;  2X99 A;  3UIW A;  1T4Y A;  2DJ2 A;  1FB0 A;  5B8A A;  2C3N A;  3L9U A;  1OC9 A;  2LTK A;  4EXJ A;  2QA1 A;  5H5Q A;  4O5R A;  6GSV A;  2DC5 A;  1T4Z A;  3APO A;  3MSZ A;  2VD1 A;  3FZA A;  1R4W A;  4IEL A;  3Q6O A;  1FVK A;  3RGB C;  1XXU A;  5A5K A;  4O92 A;  3ZLP A;  1QGV A;  4ZL9 A;  2WW3 A;  2WFC A;  1SKW B;  17GS A;  5G31 A;  2H72 A;  2O8V B;  2VL3 A;  2C4J A;  5CRG A;  1A2M A;  3OR5 A;  5D9T A;  3LFL A;  1WPI A;  3WT1 A;  1YDK A;  3LEF A;  4MPG A;  3TOU A;  3KH9 A;  1VGL A;  4BL7 B;  2GSQ A;  4FYC A;  1J9B A;  2HZF A;  4NV2 A;  7GSS A;  2P0G A;  5KN0 A;  2CVD A;  3HJP A;  1V2A A;  4A5P A;  3F4R A;  5H5R A;  2VLT A;  2VAF A;  2GZY A;  3QFB C;  3C8E A;  3ISO A;  1GP1 A;  2VCT A;  2OJL A;  1DE2 A;  1USB A;  1FG4 A;  4QL9 A;  1S3A A;  5A4V A;  4NHW A;  4LA1 A;  2EFE A;  2FY6 A;  4HU9 A;  3VFI A;  4TR0 A;  2OKA A;  3D4M A;  2C8U A;  4WR4 A;  4XS1 A;  2WW1 A;  4KSM A;  3VPQ A;  5F8B A;  1PQN A;  2OT3 A;  5ECL B;  1GL8 A;  2RM6 A;  1LBK A;  3I69 A;  2HSN A;  4JR4 A;  1K3L A;  2FWG A;  2OE1 A;  3ED3 A;  3IHQ A;  1XOB A;  2B7K A;  3UJ1 A;  1AAZ A;  2LUS A;  1MD4 A;  4XCS A;  1GWC A;  1BQ7 A;  3TRP A;  3IV4 A;  1RW1 A;  2RLI A;  4KGI A;  4TR3 A;  3GST A;  2GDR A;  3HJM A;  3RFR C;  2WW0 A;  4IJI A;  3FHK A;  3FZ4 A;  3UMA A;  1DE1 A;  3ZIT A;  5DQS A;  2BMX A;  1GLP A;  3I6A A;  2HSH A;  4EKZ A;  4MNN A;  1T3B A;  1KNG A;  4ML6 A;  4LMV A;  4BIK A;  1B9Y C;  3HZ8 A;  1SJI A;  3H93 A;  4AKI A;  3CMI A;  4BVY A;  1UN2 A;  4HS1 A;  1U6T A;  1OYJ A;  1XVW A;  2L5O A;  3TKP A;  5DAL B;  2R3X A;  2NPB A;  4G19 A;  4DSS A;  5CO3 A;  1XOA A;  3HY2 A;  4G10 A;  1CQG A;  4EIQ A;  2XPE A;  1AUC A;  1S3D A;  3N9J A;  1NHY A;  4F0C A;  2V32 A;  4N0Z A;  2O7K A;  3FR3 A;  3UVH A;  4FYB A;  3D4T A;  2CV4 A;  3EU4 A;  4MJC A;  2UZ8 A;  2CVK A;  1K0O A;  2FGX A;  3ERW A;  3IBH A;  1UC7 A;  2PMT A;  5FHI A;  4ZIL A;  3HMJ G;  2YWN A;  1O81 A;  2HRF A;  5AN1 A;  14GS A;  3HHV A;  1SYR A;  5GST A;  3GN3 A;  4EC0 A;  2F51 A;  4TRX A;  5ECI B;  3WD6 A;  2WVX B;  1HNA A;  3H4K A;  1FHE A;  1WOU A;  3BOA A;  3W8J A;  3GUS A;  2GT5 A;  4ID0 A;  4PUF C;  4EF0 A;  4BL7 A;  2ON5 A;  5J4V A;  5ID2 B;  3GKX A;  4AJ6 A;  1E2Y A;  1FAA A;  2KUC A;  3TJF A;  3A5W A;  3QPM A;  2VCX A;  1MD3 A;  1S4B P;  1YVL A;  2DKH A;  3L78 A;  13GS A;  2L6D A;  3SBC A;  2X8H A;  2LV3 A;  4MK3 A;  1VRS D;  3DIE A;  1GUL A;  1N25 A;  1X5C A;  5JCG A;  4MLY A;  2C0D A;  5DVB A;  5G2Z A;  5AIX A;  3FRC A;  4K1F A;  3GSS A;  1PL2 A;  3WGX A;  2LRC A;  3LYK A;  1TI1 A;  3HXS A;  1PGT A;  3V1W A;  2Z9S A;  2V2G A;  3MIX A;  3D0Z A;  2OE3 A;  1J0F A;  2VUP A;  4EE0 A;  4KSO A;  4JZQ A;  4MF5 A;  2H0H A;  2E2G A;  2VLU A;  2KHP A;  3GV1 A;  1GNW A;  5DJM A;  3JCM L;  3A2W A;  3QAV A;  3U5R E;  3KTB A;  3VLN A;  4LMW A;  2QGV A;  2XBI A;  2A2P A;  5D9W A;  4QL7 A;  1O8X A;  1WIK A;  1TRW A;  2JZR A;  4HZ4 A;  2I1U A;  2YAN A;  1SVM A;  2NBS A;  1X5D A;  3VPT A;  5J3R A;  2ZNM A;  3GL5 A;  4EDY A;  3HYP A;  1EOG A;  2X49 A;  2EFH A;  5IMA A;  2ES7 A;  4PXO A;  4MJB A;  1AXD A;  5B7C A;  5IPH A;  4LL4 B;  3ME8 A;  1TU8 A;  4YQU A;  2F8F A;  1OKD A;  1SK1 A;  4IBP A;  1XW9 A;  4BWQ A;  2EIQ A;  2E0Q A;  2MMN A;  2X8C A;  1OC3 A;  5DAL A;  3EPT A;  4MH3 A;  2VCV A;  1I9D A;  4K7O A;  4K7I A;  4K2X A;  2IJY A;  3ZRD A;  4BPY A;  1EV9 A;  2H71 A;  2EFC A;  1PMT A;  2VM1 A;  1EEM A;  5IMD A;  2I3Y A;  1X9M B;  3TCO A;  1SEN A;  3HCZ A;  4GTU A;  1ERU A;  3DXB A;  3DRN A;  3CHX C;  1EP8 A;  3F0I A;  3G7I A;  4HZ2 A;  2GT6 A;  2HQT A;  1U3I A;  4MZC A;  1M3I A;  4K6X A;  3DVX A;  1JZD A;  2WVX A;  4IKH A;  1TOF A;  4HDE A;  2IME A;  3F6D A;  1OE7 A;  1NW2 A;  2DIZ A;  3A3T A;  2C0E A;  2JZT A;  5HR0 A;  4KA0 A;  2DML A;  5ID2 A;  5AIV A;  4POK A;  4OWY A;  3CTF A;  4F0B A;  2OE0 A;  2QA2 A;  2GVP A;  3DVW A;  2VL2 C;  1KEB A;  4ZL8 A;  1GTB A;  5IMV A;  3G7Y A;  5CRE A;  3EUR A;  2AJQ B;  3IK9 A;  2GSS A;  1Z7P A;  5J41 A;  1BX9 A;  4H86 A;  2C1Y A;  1XG8 A;  2LQO A;  3VWW A;  1R5P A;  1GUK A;  2K6V A;  2C3Q A;  1PSQ A;  1G0T A;  2G0F A;  3QAG A;  2JU5 A;  4KCE A;  4K9Z A;  4K0N A;  3FR9 A;  2HZE B;  3GRX A;  3J7Y b;  3UBK A;  2DSA A;  4K5S A;  4NHZ A;  2HRN A;  5G1L A;  4BA7 A;  4AGS A;  1M9B A;  2IL3 A;  2AHE A;  5J5N A;  1TW9 A;  3CSI A;  1SU9 A;  4MDC A;  4L5L A;  1SJ6 A;  2YV7 A;  5D9X A;  1MDK A;  3F9U A;  4NMU A;  5HFG A;  1M2D A;  5F0G A;  3TKS C;  4O7H A;  1JFU A;  3CTG A;  3D5J A;  1BF5 A;  2CX3 A;  3HVX A;  3WYW A;  1F9M A;  4KDY A;  4KX4 A;  2EIO A;  5B6N A;  2BJX A;  5CAX A;  3E9J B;  1SKR B;  3BJ5 A;  1LJR A;  3KEB A;  3BBY A;  5KN3 A;  2AV4 A;  2HRK B;  4Q5F A;  1VF2 A;  1VF3 A;  4E8E A;  5A4W A;  2EIR A;  2WZS A;  3GMF A;  2MZC A;  4AKX B;  2PU9 C;  4ZB6 A;  5CRW A;  4MPF A;  4PQI A;  5KEJ A;  3W6G A;  3RBT A;  2C80 A;  3CWG A;  4GXZ A;  1K3Y A;  3MNG A;  2VCW A;  2WVY A;  3O3T A;  5ECN B;  3QR6 A;  2LKU A;  1FOH A;  4MP4 A;  1OE8 A;  2CX4 A;  4ZIJ A;  4NPB A;  1KTE A;  3ZML A;  2H1G A;  3IC4 A;  2V6O A;  1M2A A;  1TJD A;  2LJA A;  3RPP A;  5BMU B;  2B7J A;  4ML1 A;  3D6I A;  1SK0 A;  5LD0 A;  1PN0 A;  5J9C A;  3LYP A;  1B4P A;  2DBC A;  1SK2 A;  3FYG A;  3GYK A;  5IOW A;  2REM A;  1F6M C;  3DEX A;  1BG5 A;  2OBK A;  3R3E A;  11GS A;  2AUV A;  4XHM A;  4F03 A;  4TVE A;  1RQM A;  5IPG A;  1Y6E A;  4ZB9 A;  4NAX A;  2LRN A;  3CSH A;  1N2A A;  4TOP A;  4P3Y B;  1QFN A;  1PN9 A;  2LNT A;  6GSU A;  3G7J A;  2XBQ A;  3IPZ A;  3M1G A;  1T00 A;  4BVX B;  3VI7 A;  1TU7 A;  10GS A;  1A0R P;  4OFM A;  1ABA A;  5EVO A;  4FYU A;  2WCI A;  2WDU A;  5A4U A;  2DIY A;  2H66 A;  1R7H A;  3GKN A;  1IYH A;  3GNJ A;  4MJA A;  2TIR A;  3L0H A;  1F37 A;  2OAC A;  3BD2 A;  3TJB A;  5B8B A;  5IMC A;  5EPF A;  4GRF A;  3LXT A;  2YZH A;  2FA8 A;  3HZ4 A;  2FWH A;  5LNK e;  4WBR D;  3A2X A;  3F8U A;  1TK8 B;  2PER A;  2VM2 A;  1TDI A;  4RQX A;  2K8V A;  3D21 A;  1X9W B;  5D73 A;  2L4C A;  4IGJ A;  4I2U A;  3E0U A;  3KH7 A;  2PUK C;  2RUF A;  1Q98 A;  5J47 A;  3KP8 A;  3C71 A;  1K0M A;  1HNB A;  5IM9 A;  1O7U A;  1PKW A;  2RM5 A;  5BRT A;  1SVL A;  4O5U A;  2NDO A;  1HNC A;  5L71 A;  4K5R A;  4TR4 A;  3F3Q A;  3PR8 A;  2C0G A;  4GCI A;  3LG6 A;  1A8Y A;  2B5E A;  2PWJ A;  4JU5 A;  1IYI A;  4N30 A;  1YJ6 A;  4Q5Q A;  2N5A A;  1FOV A;  4YAV A;  1ZYN A;  3W8S A;  3FR6 A;  1A2L A;  3UAP A;  4L5O A;  3RAZ A;  1EOH A;  16GS A;  1AQV A;  4TR1 B;  3ERF A;  3IRA A;  2B1K A;  1AQX A;  1TI3 A;  4TXV A;  4NXI A;  12GS A;  2J23 A;  2HFD A;  1GSD A;  1OC8 A;  1GNE A;  3MWH A;  4J2F A;  6GST A;  4FXY P;  5G30 A;  3F4S A;  5BMU A;  1F3A A;  2O36 A;  3EU3 A;  4OO4 A;  4Z2R A;  3L9S A;  2K18 A;  5ABR A;  2YPM A;  1A24 A;  1K0C A;  2C3T A;  4V2L A;  3TRQ A;  2P5R A;  2YJ7 A;  4CY6 A;  1H4O A;  2CZ2 A;  3ZL5 A;  1Y1U A;  2VCZ A;  3IOS A;  2ALB A;  3HD5 A;  4O32 A;  1Q4J A;  2VLV A;  2X4A A;  2N5F A;  1TXX A;  1YY7 A;  3L9V A;  4PQ1 A;  3KMO A;  2GTU A;  5JWR B;  4Q5R A;  5G1K A;  4YKF A;  1XW5 A;  4IW9 A;  5CNW A;  1NHO A;  1AIU A;  1JZO A;  5IQY A;  1WJK A;  5DCH A;  3IAM 2;  4HSC X;  3GX0 A;  2H75 A;  3J7Y k;  4BVX A;  2MMA A;  5FT3 A;  1EGO A;  2LST A;  5DCG A;  4PX1 A;  5J9B A;  3C73 A;  4HOJ A;  1K0B A;  1SYX A;  3HVN A;  1GTU A;  3PPU A;  2CAQ A;  4KAE A;  1YEX A;  3TUE A;  5ECH B;  4KCA A;  4HUA A;  3ERG A;  1K0N A;  2DJ3 A;  4KE3 A;  3KD0 A;  4QQ7 A;  4JE1 A;  3A5I A;  3EVI A;  5LCZ A;  3EYT A;  1W89 A;  1R5A A;  5HR2 A;  1GLQ A;  1EV4 A;  1ZZY A;  2ON7 A;  3PH9 A;  5A1N B;  2XPD A;  2R37 A;  3WT2 A;  1OKT A;  1QMV A;  3TU3 B;  4XRD A;  4PQH A;  4XIH A;  2YV9 A;  2MMO A;  2FWE A;  3LXZ A;  1O8W A;  18GS A;  1S3R A;  1B48 A;  1TK5 B;  1MEK A;  2JAD A;  2FA4 A;  4HJ2 A;  5F05 A;  2HSM B;  3TKR A;  1XWK A;  2V41 A;  1X0R A;  1ACV A;  1ILO A;  3M9J A;  1M99 A;  2MBS A;  4RUV A;  3IE3 A;  2H1B A;  2ZUP A;  4PTS A;  5HQP A;  1SD8 A;  1XWG A;  3O6T A;  1YF0 A;  4GQF A;  5DAK B;  3Q18 A;  3SWL A;  2H76 A;  1F3B A;  1PFO A;  2X8G A;  2YNX A;  1U87 A;  4TR1 A;  1YKC A;  5ECK B;  3TDG A;  4TW5 A;  3H1N A;  4ZBD A;  2H70 A;  4OD7 A;  1YKA A;  4DSR A;  3P7X A;  2QC7 A;  2J9H A;  3RHC A;  2H73 A;  3P8W A;  3LW9 A;  1T8E B;  5AIS A;  4FH8 A;  5GZZ B;  2M72 A;  2O89 A;  4EVM A;  4OO5 A;  2I81 A;  3CYN A;  2VO4 A;  4PNF A;  2HXK A;  3IHG A;  3IAS 2;  4HEA 2;  3C1R A;  1ERT A;  3VWV A;  2PVO C;  3KGK A;  1H75 A;  3G9B A;  5DJL A;  3GUR A;  2JL4 A;  1ON4 A;  2E2M A;  2JSY A;  1XCC A;  5IO0 A;  5AGY A;  2PN8 A;  4RI6 A;  3EMX A;  4PUA A;  4POM A;  5CP1 A;  2A2S A;  3L4N A;  3GTU B;  3M3M A;  5DQY A;  2M46 A;  1M3J A;  2X64 A;  3QDN A;  5GAN D;  3UAR A;  1K3O A;  4KDX A;  5DBQ A;  3GFK A;  4L0W A;  5HR3 A;  4USS A;  3EWL A;  2A4H A;  3CXG A;  6GSX A;  4AJ8 A;  2I9H A;  5JCW A;  3DKS A;  3AY8 A;  4GLT A;  1G7E A;  1M2B A;  1ZGN A;  3TOT A;  1SJZ A;  2WRT A;  4IS0 A;  3E3E A;  1YEW C;  2R0P A;  1GUM A;  4ECI A;  2HI7 A;  2WUL A;  2R0G A;  2EC4 A;  2VL2 A;  1Z9H A;  5G5E A;  3GKM A;  1TTZ A;  20GS A;  1XFL A;  3LJR A;  4EUY A;  4I5Q A;  19GS A;  3K8N A;  2LS5 A;  4TKY A;  2DLX A;  2AB6 A;  2LJK A;  4OFN A;  1W4V A;  4BWS A;  4HI7 A;  4YH2 A;  1KBN A;  2AAW A;  1ZYQ B;  4MCU A;  3CRT A;  5A1N A;  1WE0 A;  2FNO A;  2FD3 A;  2YCD A;  3ZIJ A;  2O3E A;  3VK9 A;  3GH9 A;  2LJR A;  3EE2 A;  1YQ1 A;  5COH A;  5B6M A;  4GQC A;  4KDU A;  4HQS A;  3FKF A;  1Z3E A;  4YQM A;  1SVO A;  5J4Y A;  5CRH A;  1FO5 A;  2O5V A;  4K8M A;  2HSM A;  2H8L A;  4HJM A;  4OFT A;  2CVB A;  3TKS A;  3P90 A;  1VF1 A;  3EIN A;  1VF4 A;  4WET A;  5F07 A;  1MTC A;  5E4W A;  3UL3 A;  5IO2 A;  4PNG A;  1PL1 A;  3HVV A;  3CBU A;  1ZOF A;  2YZU A;  5DAK A;  2LEG A;  4XTS A;  2CQ9 A;  2FUG 2;  4GF0 A;  4GWR A;  2TRC P;  2VIM A;  3KMN A;  1GTA A;  1M7T A;  2NTO A;  4E68 A;  2H1A A;  3O76 A;  4K7N A;  4I97 A;  4KUN A;  5DDL A;  4ZXG A;  3WGD A;  3KXO A;  3NZN A;  2PPT A;  3GX8 A;  3U6V A;  3R2Q A;  1SD9 A;  2P5Q A;  1DSB A;  1F2E A;  2L57 A;  3NOF A;  4IQA A;  2B5Y A;  2F9S A;  1PD2 1;  3ZIV A;  1XVQ A;  2OBI A;  6GSW A;  4XS4 B;  3FZ9 A;  1GSF A;  1THO A;  1AQW A;  3US3 A;  3HVS A;  4FIW A;  3GTU A;  1TP9 A;  2JAC A;  3QMX A;  1YF1 A;  4WBJ A;  3IC8 A;  2A4V A;  5D96 A;  4NWY A;  1J08 A;  3IXR A;  3LGC A;  3QD9 A;  1EWX A;  3UBL A;  3GH6 A;  1ZL9 A;  4IP6 A;  1E6B A;  22GS A;  4AI6 A;  1NSW A;  1SL2 B;  4X43 A;  2R2J A;  5D93 A;  2LNS A;  2H0G A;  4N0V A;  4Z7X A;  2R0C A;  1LU4 A;  3DYR A;  2ZCT A;  3IK7 A;  2IFQ B;  2P31 A;  2R5G A;  1HD2 A;  6GSS A;  4HU7 A;  4E8H A;  4PI0 C;  4DSQ A;  3C1S A;  3Q19 A;  2VD0 A;  3N5O A;  1G7O A;  2O87 A;  5CYY A;  4G9H A;  2GZZ A;  3NIV A;  4CY8 A;  1WMJ A;  2HSY A;  1GH2 A;  3RPN A;  2PBJ A;  2FCH A;  2YP6 A;  4X1U A;  4L8E A;  1EEJ A;  3ZYW A;  2HZE A;  4OCE A;  3ZMK A;  1AW9 A;  2A2R A;  5IIZ A;  4IHU A;  1WWJ A;  2VL9 A;  2IN3 A;  1X5E A;  5KOW A;  2BTO T;  5C00 A;  4K2D A;  3F6F A;  4I6X A;  2CT6 A;  1GSU A;  1B4Q A;  1O85 A;  5ECO B;  3QAW A;  5HFK A;  3CRU A;  2GST A;  2B3S A;  3A2V A;  3APQ A;  4Z2U A;  2E7P A;  1UA5 A;  1X9S B;  2AYT A;  2WGR A;  5GSS A;  4G0K A;  2F8A A;  2JSZ A;  1GSE A;  3KIJ A;  1QQ2 A;  1Z5Y E;  2B1L A;  4CW9 A;  4AKH A;  5FWG A;  1FB6 A;  5HFI A;  1C72 A;  3BCI A;  4MA9 A;  2R4V A;  1FVJ A;  4F82 A;  4JRR A;  2IPA A;  3ME7 A;  2DJJ A;  1XBS A;  1V9W A;  2WS2 A;  2YWI A;  1BAY A;  5JCU A;  2HRK A;  4WF5 A;  1DBY A;  4ILF A;  3VWU A;  4AKG A;  4WKW A;  1RK4 A;  4IQ1 A;  2H74 A;  5E59 A;  1ZMA A;  5ECR B;  2DJ0 A;  3ZFB A;  3RHB A;  2YN1 A;  4N3Z A;  1ERV A;  3ZFL A;  1BG1 A;  3TGZ A;  4F2I A;  3FMW A;  2DJ1 A;  4MF7 A;  1TRS A;  1O73 A;  3F4T A;  4XS4 A;  1TKD B;  3VI5 A;  1DUG A;  2YJH A;  3Q74 A;  3FY7 A;  2L6C A;  4XS6 A;  3ZRE A;  2KOK A;  4FQU A;  2WJU A;  2XC2 A;  1JLW A;  1PX6 A;  1OVN A;  4RI7 A;  1JZW A;  4KH7 A;  5IOX A;  4G2E A;  5EL8 A;  2G2Q A;  2VCQ A;  1BYE A;  3TJK A;  2FHE A;  4JR6 A;  4MZW A;  2H6X A;  3DGQ A;  4EO3 A;  1U88 A;  2QSI A;  4YQV A;  4LL1 B;  2PVQ A;  2GQM A;  2L59 A;  2IFQ A;  1BED A;  3WGE A;  1YZX A;  3QFA C;  1N8J A;  1GSQ A;  4EDZ A;  2RII A;  5ECP B;  4ZBA A;  1AC1 A;  1M9A A;  4D73 B;  2KP1 A;  4OCF A;  2UV8 G;  4WF4 A;  3DML A;  4N11 A;  2DJK A;  4MMM A;  2HRA A;  4J56 E;  2LQQ A;  5INY A;  3CSJ A;  3TJJ A;  3EC3 A;  4V2M A;  2IIY A;  4HQZ A;  1A2J A;  2YWO A;  2JZS A;  4MH2 A;  1ST9 A;  5J40 A;  1GSS A;  1A8L A;  2C0F A;  4ECB A;  1V57 A;  2PGT A;  2GS3 A;  4WR5 A;  3ZZX A;  4MAB A;  5HR1 A;  1QXH A;  1ERW A;  6GSY A;  2HLS A;  3M8N A;  1XWB A;  1JZR A;  3CQF A;  2GQK A;  4PGT A;  1XIY A;  1GTI A;  3MAK A;  1A0F A;  1SKS B;  4ACS A;  1I1I P;  5IMZ A;  2K9F A;  2V6K A;  5ELG A;  4WXT A;  2IWT A;  1SL1 B;  1EGR A;  2NVL A;  5F06 A;  2H6Z A;  3LOR A;  4V1A g;  2WZ9 A;  4ISD A;  2B5X A;  4IJ3 A;  4J57 E;  4KND A;  3ZVJ D;  3M9K A;  1QUW A;  2WVZ A;  2VOC A;  4G01 A;  4TN8 A;  5KN1 A;  1ML6 A;  5A5H B;  4YAP A;  3UVT A;  4IP1 A;  1MDI A;  4QMK A;  1Z6M A;  3M0F A;  1V98 A;  4KW6 A;  3H8Q A;  1K0D A;  1T1V A;  3GHA A;  2GZP A;  5IMF A;  3KZQ A;  1ZYE A;  2HYX A;  4G0L A;  4DVC A;  4GST A;  2CZ3 A;  1TXU A;  4CHS A;  2HE3 A;  1K0A A;  5G5F A;  3KP9 A;  1FW1 A;  2IMF A;  2EFD A;  1NM3 A;  3FZ5 A;  4CDO A;  1V40 A;  4IVF A;  3F63 A;  3APS A;  9GSS A;  3FW2 A;  1CQH A;  4RQR A;  5ELA A;  4YKG A;  1B8X A;  4N10 A;  4X4J A;  4EIP A;  3IR4 A;  1T7P B;  2O85 A;  3MDK A;  1SL0 B;  1PX7 A;  3PGT A;  4NV5 A;  2FWF A;  2HNL A;  3VUR A;  3TRX A;  1THX A;  1U3A A;  2XHF A;  1GSY A;  5A34 B;  2TRX A;  3IA1 A;  5CRD A;  5C04 A;  1B9X C;  3GIX A;  3HDC A;  2OA7 A;  3PIN A;  4FO5 A;  4TXO B;  3D22 A;  4XRA A;  1XWA A;  4DEJ A;  4G0I A;  5EY6 A;  3F3R A;  3C7M A;  1OC9 B;  2L4Q A;  4IN0 A;  2IMI A;  3KTL A;  2CAI A;  4PI2 C;  1A23 A;  1G6W A;  1TK0 B;  2H0I A;  2OAD A;  4ZBB A;  4D73 A;  3I9V 2;  4ZL7 A;  2KLX A;  1URM A;  1XWC A;  4WEY A;  1M0U A;  3KCM A;  1UVZ A;  4F9Z A;  4PHZ C;  2QKE A;  4ULX A;  3LSZ A;  3HA9 A;  5J4U A;  1G6Y A;  1Y25 A;  1EP7 A;  4MF6 A;  2LRT A;  1TRV A;  2FLS A;  3RDW A;  2YWM A;  2N5B A;  4GDF A;  4V2N A;  4PUR A;  5KOX A;  5ENU A;  4GSN A;  2WW2 A;  4POB A;  1TRU A;  2DKI A;  1HQO A;  2K8S A;  4ECC A;  3GA4 A;  5H5S A;  2H19 A;  4JBB A;  2GSR A;  2VKZ G;  2GQL A;  3MYD A;  4OMV A;  1I5G A;  1XZO A;  2MMZ A;  1JLV A;  1O6J A;  2WB9 A;  1XW6 A;  2MYG A;  3IDV A;  4POL A;  1Z6N A;  1WRY A;  5KN2 A;  4O5Q A;  4ZB7 A;  3KJY A;  1Z7R A;  4X0X A;  1XPV A;  3H79 A;  4AJ7 A;  3EMP A;  1HYU A;  1GUH A;  3ZTL A;  4LLR A;  2RUE A;  5JWO B;  2B6M A;  1OAZ A;  2I4A A;  5A5H A;  3FEU A;  3TKQ A;  2V1M A;  5D8I A;  3DD3 A;  4K0G A;  3BCK A;  3HKR A;  2H1L A;  2HSN B;  1ZYP A;  3HJO A;  2H30 A;  2GLR A;  2KP2 A;  4EL1 A;  4I8B A;  3FK8 A;  2DMM A;  2GGT A;  5D9V A;  3TKS E;  4KB3 A;  3P2A A;  1S3C A;  2F3M A; 
#chains in the Genus database with same CATH homology
 1V58 A;  5JWQ B;  1EZK A;  3UEM A;  2D2Z A;  4MJE A;  1ZCP A;  4Z2T A;  8GSS A;  4Q5N A;  3QCP A;  4I2T A;  2H1D A;  4KF9 A;  1QK8 A;  3VWX A;  3I43 A;  3GKK A;  4V1A p;  1WP0 A;  1PRX A;  3GL3 A;  1PKZ A;  3S9F A;  4L0U A;  1MDJ A;  4ZB8 A;  2H6Y A;  3TJG A;  3UOM A;  4AF2 A;  1JHB A;  4ICY A;  5ECQ B;  1BJX A;  3KM6 A;  1PA3 A;  5ECM B;  2IMK A;  4GSS A;  5A34 A;  3ZVJ A;  1GRX A;  2MBT A;  3QOU A;  4MZB A;  2H01 A;  2IMD A;  4BVY B;  3LWA A;  2R6K A;  1R26 A;  2HT9 A;  1YEP A;  4ECJ A;  4JED A;  4TXO A;  5ECS A;  5GAP D;  4W66 A;  3TB2 A;  4DSS B;  3LQ7 A;  2L5L A;  2M80 A;  2CA8 A;  2YOI A;  3DWV A;  2X99 A;  3UIW A;  1T4Y A;  2DJ2 A;  1FB0 A;  5B8A A;  2C3N A;  3L9U A;  1OC9 A;  2LTK A;  4EXJ A;  2QA1 A;  5H5Q A;  4O5R A;  6GSV A;  2DC5 A;  1T4Z A;  3APO A;  3MSZ A;  2VD1 A;  3FZA A;  1R4W A;  4IEL A;  3Q6O A;  1FVK A;  1XXU A;  5A5K A;  4O92 A;  3ZLP A;  1QGV A;  4ZL9 A;  2WFC A;  1SKW B;  17GS A;  5G31 A;  2H72 A;  2O8V B;  2VL3 A;  2C4J A;  5CRG A;  1A2M A;  3OR5 A;  5D9T A;  3LFL A;  1WPI A;  3WT1 A;  1YDK A;  3LEF A;  4MPG A;  3TOU A;  3KH9 A;  1VGL A;  4BL7 B;  2GSQ A;  4FYC A;  1J9B A;  2HZF A;  4NV2 A;  7GSS A;  2P0G A;  5KN0 A;  2CVD A;  3HJP A;  1V2A A;  4A5P A;  3F4R A;  5H5R A;  2VLT A;  2VAF A;  2GZY A;  3QFB C;  3C8E A;  3ISO A;  1GP1 A;  2VCT A;  2OJL A;  1DE2 A;  1USB A;  1FG4 A;  4QL9 A;  1S3A A;  5A4V A;  4NHW A;  4LA1 A;  2EFE A;  2FY6 A;  4HU9 A;  3VFI A;  4TR0 A;  2OKA A;  3D4M A;  2C8U A;  4WR4 A;  4XS1 A;  4KSM A;  3VPQ A;  5F8B A;  1PQN A;  2OT3 A;  5ECL B;  1GL8 A;  2RM6 A;  1LBK A;  3I69 A;  2HSN A;  4JR4 A;  1K3L A;  2FWG A;  2OE1 A;  3ED3 A;  3IHQ A;  1XOB A;  2B7K A;  3UJ1 A;  1AAZ A;  2LUS A;  1MD4 A;  4XCS A;  1GWC A;  1BQ7 A;  3TRP A;  3IV4 A;  1RW1 A;  2RLI A;  4KGI A;  4TR3 A;  3GST A;  2GDR A;  3HJM A;  3FHK A;  4IJI A;  3FZ4 A;  3UMA A;  1DE1 A;  3ZIT A;  5DQS A;  2BMX A;  1GLP A;  3I6A A;  2HSH A;  4EKZ A;  4MNN A;  1T3B A;  1KNG A;  4ML6 A;  4LMV A;  1B9Y C;  3HZ8 A;  1SJI A;  3H93 A;  4AKI A;  3CMI A;  4BVY A;  1UN2 A;  4HS1 A;  1U6T A;  1OYJ A;  1XVW A;  2L5O A;  3TKP A;  5DAL B;  2R3X A;  2NPB A;  4G19 A;  4DSS A;  5CO3 A;  1XOA A;  3HY2 A;  4G10 A;  1CQG A;  4EIQ A;  2XPE A;  1AUC A;  1S3D A;  3N9J A;  1NHY A;  4F0C A;  2V32 A;  4N0Z A;  2O7K A;  3FR3 A;  3UVH A;  4FYB A;  3D4T A;  2CV4 A;  3EU4 A;  4MJC A;  2UZ8 A;  2CVK A;  1K0O A;  2FGX A;  3ERW A;  3IBH A;  1UC7 A;  2PMT A;  5FHI A;  4ZIL A;  3HMJ G;  2YWN A;  1O81 A;  2HRF A;  5AN1 A;  14GS A;  3HHV A;  1SYR A;  5GST A;  3GN3 A;  4EC0 A;  2F51 A;  4TRX A;  5ECI B;  3WD6 A;  1HNA A;  3H4K A;  1FHE A;  1WOU A;  3BOA A;  3W8J A;  3GUS A;  2GT5 A;  4ID0 A;  4PUF C;  4EF0 A;  4BL7 A;  2ON5 A;  5J4V A;  5ID2 B;  3GKX A;  4AJ6 A;  1E2Y A;  1FAA A;  2KUC A;  3TJF A;  3A5W A;  3QPM A;  2VCX A;  1MD3 A;  1YVL A;  2DKH A;  3L78 A;  13GS A;  2L6D A;  3SBC A;  2X8H A;  2LV3 A;  4MK3 A;  1VRS D;  3DIE A;  1GUL A;  1N25 A;  1X5C A;  5JCG A;  4MLY A;  2C0D A;  5DVB A;  5G2Z A;  5AIX A;  3FRC A;  4K1F A;  3GSS A;  1PL2 A;  3WGX A;  2LRC A;  3LYK A;  1TI1 A;  3HXS A;  1PGT A;  3V1W A;  2Z9S A;  2V2G A;  3MIX A;  3D0Z A;  2OE3 A;  1J0F A;  2VUP A;  4EE0 A;  4KSO A;  4JZQ A;  4MF5 A;  2H0H A;  2E2G A;  2VLU A;  2KHP A;  3GV1 A;  1GNW A;  5DJM A;  3JCM L;  3A2W A;  3QAV A;  3U5R E;  3KTB A;  3VLN A;  4LMW A;  2QGV A;  2XBI A;  2A2P A;  5D9W A;  4QL7 A;  1O8X A;  1WIK A;  1TRW A;  2JZR A;  4HZ4 A;  2I1U A;  2YAN A;  1SVM A;  2NBS A;  1X5D A;  3VPT A;  5J3R A;  2ZNM A;  3GL5 A;  4EDY A;  3HYP A;  1EOG A;  2X49 A;  2EFH A;  5IMA A;  2ES7 A;  4PXO A;  4MJB A;  1AXD A;  5B7C A;  5IPH A;  4LL4 B;  3ME8 A;  1TU8 A;  4YQU A;  2F8F A;  1OKD A;  1SK1 A;  4IBP A;  1XW9 A;  4BWQ A;  2EIQ A;  2E0Q A;  2MMN A;  2X8C A;  1OC3 A;  5DAL A;  3EPT A;  4MH3 A;  2VCV A;  1I9D A;  4K7O A;  4K7I A;  4K2X A;  2IJY A;  3ZRD A;  4BPY A;  1EV9 A;  2H71 A;  2EFC A;  1PMT A;  2VM1 A;  1EEM A;  5IMD A;  2I3Y A;  1X9M B;  3TCO A;  1SEN A;  3HCZ A;  4GTU A;  1ERU A;  3DXB A;  3DRN A;  1EP8 A;  3F0I A;  3G7I A;  4HZ2 A;  2GT6 A;  2HQT A;  1U3I A;  4MZC A;  4K6X A;  3DVX A;  1JZD A;  4IKH A;  1TOF A;  4HDE A;  2IME A;  3F6D A;  1OE7 A;  1NW2 A;  2DIZ A;  3A3T A;  2C0E A;  2JZT A;  5HR0 A;  4KA0 A;  2DML A;  5ID2 A;  5AIV A;  4POK A;  4OWY A;  3CTF A;  4F0B A;  2OE0 A;  2QA2 A;  2GVP A;  3DVW A;  2VL2 C;  1KEB A;  4ZL8 A;  1GTB A;  5IMV A;  3G7Y A;  5CRE A;  3EUR A;  2AJQ B;  3IK9 A;  2GSS A;  1Z7P A;  5J41 A;  1BX9 A;  4H86 A;  2C1Y A;  2LQO A;  3VWW A;  1R5P A;  1GUK A;  2K6V A;  2C3Q A;  1PSQ A;  1G0T A;  2G0F A;  3QAG A;  2JU5 A;  4KCE A;  4K9Z A;  4K0N A;  3FR9 A;  2HZE B;  3GRX A;  3J7Y b;  3UBK A;  2DSA A;  4K5S A;  4NHZ A;  2HRN A;  5G1L A;  4BA7 A;  4AGS A;  1M9B A;  2IL3 A;  2AHE A;  5J5N A;  1TW9 A;  3CSI A;  1SU9 A;  4MDC A;  4L5L A;  1SJ6 A;  2YV7 A;  5D9X A;  1MDK A;  3F9U A;  4NMU A;  5HFG A;  1M2D A;  5F0G A;  3TKS C;  4O7H A;  1JFU A;  3CTG A;  3D5J A;  1BF5 A;  2CX3 A;  3HVX A;  3WYW A;  1F9M A;  4KDY A;  4KX4 A;  2EIO A;  5B6N A;  2BJX A;  5CAX A;  3E9J B;  1SKR B;  3BJ5 A;  1LJR A;  3KEB A;  3BBY A;  5KN3 A;  2AV4 A;  2HRK B;  4Q5F A;  1VF2 A;  1VF3 A;  4E8E A;  5A4W A;  2EIR A;  3GMF A;  2MZC A;  4AKX B;  2PU9 C;  4ZB6 A;  5CRW A;  4MPF A;  4PQI A;  5KEJ A;  3W6G A;  3RBT A;  2C80 A;  3CWG A;  4GXZ A;  1K3Y A;  3MNG A;  2VCW A;  3O3T A;  5ECN B;  3QR6 A;  2LKU A;  1FOH A;  4MP4 A;  1OE8 A;  2CX4 A;  4ZIJ A;  4NPB A;  1KTE A;  3ZML A;  2H1G A;  3IC4 A;  2V6O A;  1M2A A;  1TJD A;  2LJA A;  3RPP A;  5BMU B;  2B7J A;  4ML1 A;  3D6I A;  1SK0 A;  5LD0 A;  1PN0 A;  5J9C A;  3LYP A;  1B4P A;  2DBC A;  1SK2 A;  3FYG A;  3GYK A;  5IOW A;  2REM A;  1F6M C;  3DEX A;  1BG5 A;  2OBK A;  3R3E A;  11GS A;  2AUV A;  4XHM A;  4F03 A;  4TVE A;  1RQM A;  5IPG A;  1Y6E A;  4ZB9 A;  4NAX A;  2LRN A;  3CSH A;  1N2A A;  4TOP A;  4P3Y B;  1QFN A;  1PN9 A;  2LNT A;  6GSU A;  3G7J A;  2XBQ A;  3IPZ A;  3M1G A;  1T00 A;  4BVX B;  3VI7 A;  1TU7 A;  10GS A;  1A0R P;  4OFM A;  1ABA A;  5EVO A;  4FYU A;  2WCI A;  2WDU A;  5A4U A;  2DIY A;  2H66 A;  1R7H A;  3GKN A;  1IYH A;  3GNJ A;  4MJA A;  2TIR A;  3L0H A;  1F37 A;  2OAC A;  3BD2 A;  3TJB A;  5B8B A;  5IMC A;  5EPF A;  4GRF A;  3LXT A;  2YZH A;  2FA8 A;  3HZ4 A;  2FWH A;  5LNK e;  4WBR D;  3A2X A;  3F8U A;  1TK8 B;  2PER A;  2VM2 A;  1TDI A;  4RQX A;  2K8V A;  3D21 A;  1X9W B;  5D73 A;  2L4C A;  4IGJ A;  4I2U A;  3E0U A;  3KH7 A;  2PUK C;  2RUF A;  1Q98 A;  5J47 A;  3KP8 A;  3C71 A;  1K0M A;  1HNB A;  5IM9 A;  1O7U A;  1PKW A;  2RM5 A;  5BRT A;  1SVL A;  4O5U A;  2NDO A;  1HNC A;  5L71 A;  4K5R A;  4TR4 A;  3F3Q A;  3PR8 A;  2C0G A;  4GCI A;  3LG6 A;  1A8Y A;  2B5E A;  2PWJ A;  4JU5 A;  1IYI A;  4N30 A;  1YJ6 A;  4Q5Q A;  2N5A A;  1FOV A;  4YAV A;  1ZYN A;  3W8S A;  3FR6 A;  1A2L A;  3UAP A;  4L5O A;  3RAZ A;  1EOH A;  16GS A;  1AQV A;  4TR1 B;  3ERF A;  3IRA A;  2B1K A;  1AQX A;  1TI3 A;  4TXV A;  4NXI A;  12GS A;  2J23 A;  2HFD A;  1GSD A;  1OC8 A;  1GNE A;  3MWH A;  4J2F A;  6GST A;  5G30 A;  3F4S A;  5BMU A;  1F3A A;  3EU3 A;  4OO4 A;  4Z2R A;  3L9S A;  2K18 A;  5ABR A;  2YPM A;  1A24 A;  1K0C A;  2C3T A;  4V2L A;  3TRQ A;  2P5R A;  2YJ7 A;  4CY6 A;  1H4O A;  2CZ2 A;  3ZL5 A;  1Y1U A;  2VCZ A;  3IOS A;  2ALB A;  3HD5 A;  4O32 A;  1Q4J A;  2VLV A;  2X4A A;  2N5F A;  1TXX A;  1YY7 A;  3L9V A;  4PQ1 A;  3KMO A;  2GTU A;  5JWR B;  4Q5R A;  5G1K A;  4YKF A;  1XW5 A;  4IW9 A;  5CNW A;  1NHO A;  1AIU A;  1JZO A;  5IQY A;  1WJK A;  5DCH A;  3IAM 2;  3GX0 A;  2H75 A;  3J7Y k;  4BVX A;  2MMA A;  5FT3 A;  1EGO A;  2LST A;  5DCG A;  4PX1 A;  5J9B A;  3C73 A;  4HOJ A;  1K0B A;  1SYX A;  1GTU A;  3PPU A;  2CAQ A;  4KAE A;  1YEX A;  3TUE A;  5ECH B;  4KCA A;  4HUA A;  3ERG A;  1K0N A;  2DJ3 A;  4KE3 A;  3KD0 A;  4QQ7 A;  4JE1 A;  3A5I A;  3EVI A;  5LCZ A;  3EYT A;  1W89 A;  1R5A A;  5HR2 A;  1GLQ A;  1EV4 A;  1ZZY A;  2ON7 A;  3PH9 A;  5A1N B;  2XPD A;  2R37 A;  3WT2 A;  1OKT A;  1QMV A;  3TU3 B;  4XRD A;  4PQH A;  4XIH A;  2YV9 A;  2MMO A;  2FWE A;  3LXZ A;  1O8W A;  18GS A;  1B48 A;  1TK5 B;  1MEK A;  2JAD A;  2FA4 A;  4HJ2 A;  5F05 A;  2HSM B;  3TKR A;  1XWK A;  2V41 A;  1X0R A;  1ACV A;  1ILO A;  3M9J A;  1M99 A;  2MBS A;  4RUV A;  3IE3 A;  2H1B A;  2ZUP A;  4PTS A;  5HQP A;  1SD8 A;  1XWG A;  3O6T A;  1YF0 A;  4GQF A;  5DAK B;  3Q18 A;  3SWL A;  2H76 A;  1F3B A;  2X8G A;  2YNX A;  1U87 A;  4TR1 A;  1YKC A;  5ECK B;  3TDG A;  4TW5 A;  3H1N A;  4ZBD A;  2H70 A;  4OD7 A;  1YKA A;  4DSR A;  3P7X A;  2QC7 A;  2J9H A;  3RHC A;  2H73 A;  3P8W A;  3LW9 A;  1T8E B;  5AIS A;  4FH8 A;  5GZZ B;  2M72 A;  2O89 A;  4EVM A;  4OO5 A;  2I81 A;  3CYN A;  2VO4 A;  4PNF A;  2HXK A;  3IHG A;  3IAS 2;  4HEA 2;  3C1R A;  1ERT A;  3VWV A;  2PVO C;  3KGK A;  1H75 A;  3G9B A;  5DJL A;  3GUR A;  2JL4 A;  1ON4 A;  2E2M A;  2JSY A;  1XCC A;  5IO0 A;  5AGY A;  2PN8 A;  4RI6 A;  3EMX A;  4PUA A;  4POM A;  5CP1 A;  2A2S A;  3L4N A;  3GTU B;  3M3M A;  5DQY A;  2M46 A;  2X64 A;  3QDN A;  5GAN D;  3UAR A;  1K3O A;  4KDX A;  5DBQ A;  3GFK A;  4L0W A;  5HR3 A;  4USS A;  3EWL A;  2A4H A;  3CXG A;  6GSX A;  4AJ8 A;  2I9H A;  5JCW A;  3DKS A;  3AY8 A;  4GLT A;  1G7E A;  1M2B A;  1ZGN A;  3TOT A;  1SJZ A;  2WRT A;  4IS0 A;  3E3E A;  2R0P A;  1GUM A;  4ECI A;  2HI7 A;  2WUL A;  2R0G A;  2EC4 A;  2VL2 A;  1Z9H A;  5G5E A;  3GKM A;  1TTZ A;  20GS A;  1XFL A;  3LJR A;  4EUY A;  4I5Q A;  19GS A;  3K8N A;  2LS5 A;  4TKY A;  2DLX A;  2AB6 A;  2LJK A;  4OFN A;  1W4V A;  4BWS A;  4HI7 A;  4YH2 A;  1KBN A;  2AAW A;  1ZYQ B;  4MCU A;  3CRT A;  5A1N A;  1WE0 A;  2FNO A;  2FD3 A;  2YCD A;  3ZIJ A;  3VK9 A;  3GH9 A;  2LJR A;  3EE2 A;  1YQ1 A;  5COH A;  5B6M A;  4GQC A;  4KDU A;  4HQS A;  3FKF A;  1Z3E A;  4YQM A;  1SVO A;  5J4Y A;  5CRH A;  1FO5 A;  2O5V A;  4K8M A;  2HSM A;  2H8L A;  4HJM A;  4OFT A;  2CVB A;  3TKS A;  3P90 A;  1VF1 A;  3EIN A;  1VF4 A;  4WET A;  5F07 A;  1MTC A;  5E4W A;  3UL3 A;  5IO2 A;  4PNG A;  1PL1 A;  3HVV A;  3CBU A;  1ZOF A;  2YZU A;  5DAK A;  2LEG A;  4XTS A;  2CQ9 A;  2FUG 2;  4GF0 A;  4GWR A;  2TRC P;  2VIM A;  3KMN A;  1GTA A;  1M7T A;  2NTO A;  4E68 A;  2H1A A;  3O76 A;  4K7N A;  4I97 A;  4KUN A;  5DDL A;  4ZXG A;  3WGD A;  3KXO A;  3NZN A;  2PPT A;  3GX8 A;  3U6V A;  3R2Q A;  1SD9 A;  2P5Q A;  1DSB A;  1F2E A;  2L57 A;  3NOF A;  4IQA A;  2B5Y A;  2F9S A;  1PD2 1;  3ZIV A;  1XVQ A;  2OBI A;  6GSW A;  4XS4 B;  3FZ9 A;  1GSF A;  1THO A;  1AQW A;  3US3 A;  3HVS A;  4FIW A;  3GTU A;  1TP9 A;  2JAC A;  3QMX A;  1YF1 A;  4WBJ A;  3IC8 A;  2A4V A;  5D96 A;  4NWY A;  1J08 A;  3IXR A;  3LGC A;  3QD9 A;  1EWX A;  3UBL A;  3GH6 A;  1ZL9 A;  4IP6 A;  1E6B A;  22GS A;  4AI6 A;  1NSW A;  1SL2 B;  4X43 A;  2R2J A;  5D93 A;  2LNS A;  2H0G A;  4N0V A;  4Z7X A;  2R0C A;  1LU4 A;  3DYR A;  2ZCT A;  3IK7 A;  2IFQ B;  2P31 A;  2R5G A;  1HD2 A;  6GSS A;  4HU7 A;  4E8H A;  4DSQ A;  3C1S A;  3Q19 A;  2VD0 A;  3N5O A;  1G7O A;  2O87 A;  5CYY A;  4G9H A;  2GZZ A;  3NIV A;  4CY8 A;  1WMJ A;  2HSY A;  1GH2 A;  3RPN A;  2PBJ A;  2FCH A;  2YP6 A;  4X1U A;  4L8E A;  1EEJ A;  3ZYW A;  2HZE A;  4OCE A;  3ZMK A;  1AW9 A;  2A2R A;  5IIZ A;  4IHU A;  1WWJ A;  2VL9 A;  2IN3 A;  1X5E A;  5KOW A;  2BTO T;  5C00 A;  4K2D A;  3F6F A;  4I6X A;  2CT6 A;  1GSU A;  1B4Q A;  1O85 A;  5ECO B;  3QAW A;  5HFK A;  3CRU A;  2GST A;  2B3S A;  3A2V A;  3APQ A;  4Z2U A;  2E7P A;  1UA5 A;  1X9S B;  2AYT A;  2WGR A;  5GSS A;  4G0K A;  2F8A A;  2JSZ A;  1GSE A;  3KIJ A;  1QQ2 A;  1Z5Y E;  2B1L A;  4CW9 A;  4AKH A;  5FWG A;  1FB6 A;  5HFI A;  1C72 A;  3BCI A;  4MA9 A;  2R4V A;  1FVJ A;  4F82 A;  4JRR A;  2IPA A;  3ME7 A;  2DJJ A;  1XBS A;  1V9W A;  2WS2 A;  2YWI A;  1BAY A;  5JCU A;  2HRK A;  4WF5 A;  1DBY A;  4ILF A;  3VWU A;  4AKG A;  4WKW A;  1RK4 A;  4IQ1 A;  2H74 A;  5E59 A;  1ZMA A;  5ECR B;  2DJ0 A;  3ZFB A;  3RHB A;  2YN1 A;  4N3Z A;  1ERV A;  3ZFL A;  1BG1 A;  3TGZ A;  4F2I A;  3FMW A;  2DJ1 A;  4MF7 A;  1TRS A;  1O73 A;  3F4T A;  4XS4 A;  1TKD B;  3VI5 A;  1DUG A;  2YJH A;  3Q74 A;  3FY7 A;  2L6C A;  4XS6 A;  3ZRE A;  2KOK A;  4FQU A;  2WJU A;  2XC2 A;  1JLW A;  1PX6 A;  1OVN A;  4RI7 A;  1JZW A;  4KH7 A;  5IOX A;  4G2E A;  5EL8 A;  2G2Q A;  2VCQ A;  1BYE A;  3TJK A;  2FHE A;  4JR6 A;  4MZW A;  2H6X A;  3DGQ A;  4EO3 A;  1U88 A;  2QSI A;  4YQV A;  4LL1 B;  2PVQ A;  2GQM A;  2L59 A;  2IFQ A;  1BED A;  3WGE A;  1YZX A;  3QFA C;  1N8J A;  1GSQ A;  4EDZ A;  2RII A;  5ECP B;  4ZBA A;  1AC1 A;  1M9A A;  4D73 B;  2KP1 A;  4OCF A;  2UV8 G;  4WF4 A;  3DML A;  4N11 A;  2DJK A;  4MMM A;  2HRA A;  4J56 E;  2LQQ A;  5INY A;  3CSJ A;  3TJJ A;  3EC3 A;  4V2M A;  2IIY A;  4HQZ A;  1A2J A;  2YWO A;  2JZS A;  4MH2 A;  1ST9 A;  5J40 A;  1GSS A;  1A8L A;  2C0F A;  4ECB A;  1V57 A;  2PGT A;  2GS3 A;  4WR5 A;  3ZZX A;  4MAB A;  5HR1 A;  1QXH A;  1ERW A;  6GSY A;  2HLS A;  3M8N A;  1XWB A;  1JZR A;  2GQK A;  4PGT A;  1XIY A;  1GTI A;  3MAK A;  1A0F A;  1SKS B;  4ACS A;  5IMZ A;  2K9F A;  2V6K A;  5ELG A;  4WXT A;  2IWT A;  1SL1 B;  1EGR A;  2NVL A;  5F06 A;  2H6Z A;  3LOR A;  4V1A g;  2WZ9 A;  4ISD A;  2B5X A;  4IJ3 A;  4J57 E;  4KND A;  3ZVJ D;  3M9K A;  1QUW A;  2VOC A;  4G01 A;  4TN8 A;  5KN1 A;  1ML6 A;  5A5H B;  4YAP A;  3UVT A;  4IP1 A;  1MDI A;  4QMK A;  1Z6M A;  3M0F A;  1V98 A;  4KW6 A;  3H8Q A;  1K0D A;  1T1V A;  3GHA A;  2GZP A;  5IMF A;  3KZQ A;  1ZYE A;  2HYX A;  4G0L A;  4DVC A;  4GST A;  2CZ3 A;  1TXU A;  4CHS A;  2HE3 A;  1K0A A;  5G5F A;  3KP9 A;  1FW1 A;  2IMF A;  2EFD A;  1NM3 A;  3FZ5 A;  4CDO A;  1V40 A;  4IVF A;  3F63 A;  3APS A;  9GSS A;  3FW2 A;  1CQH A;  4RQR A;  5ELA A;  4YKG A;  1B8X A;  4N10 A;  4X4J A;  4EIP A;  3IR4 A;  1T7P B;  2O85 A;  3MDK A;  1SL0 B;  1PX7 A;  3PGT A;  4NV5 A;  2FWF A;  2HNL A;  3VUR A;  3TRX A;  1THX A;  1U3A A;  2XHF A;  1GSY A;  5A34 B;  2TRX A;  3IA1 A;  5CRD A;  5C04 A;  1B9X C;  3GIX A;  3HDC A;  2OA7 A;  3PIN A;  4FO5 A;  4TXO B;  3D22 A;  4XRA A;  1XWA A;  4DEJ A;  4G0I A;  5EY6 A;  3F3R A;  3C7M A;  1OC9 B;  2L4Q A;  4IN0 A;  2IMI A;  3KTL A;  2CAI A;  1A23 A;  1G6W A;  1TK0 B;  2H0I A;  2OAD A;  4ZBB A;  4D73 A;  3I9V 2;  4ZL7 A;  2KLX A;  1URM A;  1XWC A;  4WEY A;  1M0U A;  3KCM A;  1UVZ A;  4F9Z A;  2QKE A;  4ULX A;  3LSZ A;  3HA9 A;  5J4U A;  1G6Y A;  1Y25 A;  1EP7 A;  4MF6 A;  2LRT A;  1TRV A;  2FLS A;  3RDW A;  2YWM A;  2N5B A;  4GDF A;  4V2N A;  4PUR A;  5KOX A;  5ENU A;  4GSN A;  4POB A;  1TRU A;  2DKI A;  1HQO A;  2K8S A;  4ECC A;  3GA4 A;  5H5S A;  2H19 A;  4JBB A;  2GSR A;  2VKZ G;  2GQL A;  3MYD A;  4OMV A;  1I5G A;  1XZO A;  2MMZ A;  1JLV A;  1O6J A;  2WB9 A;  1XW6 A;  2MYG A;  3IDV A;  4POL A;  1Z6N A;  1WRY A;  5KN2 A;  4O5Q A;  4ZB7 A;  3KJY A;  1Z7R A;  4X0X A;  1XPV A;  3H79 A;  4AJ7 A;  3EMP A;  1HYU A;  1GUH A;  3ZTL A;  4LLR A;  2RUE A;  5JWO B;  2B6M A;  1OAZ A;  2I4A A;  5A5H A;  3FEU A;  3TKQ A;  2V1M A;  5D8I A;  3DD3 A;  4K0G A;  3BCK A;  3HKR A;  2H1L A;  2HSN B;  1ZYP A;  3HJO A;  2H30 A;  2GLR A;  2KP2 A;  4EL1 A;  4I8B A;  3FK8 A;  2DMM A;  2GGT A;  5D9V A;  3TKS E;  4KB3 A;  3P2A A;  1S3C A;  2F3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...