1MD4A

A folding mutant of human class pi glutathione transferase, created by mutating glycine 146 of the wild-type protein to valine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
208
structure length
208
Chain Sequence
PYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVVDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords pi glutathione transferase
publication title Contribution of Glycine 146 to a Conserved Folding Module Affecting Stability and Refolding of Human Glutathione Transferase P1-1
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1md4A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1md4A01
2IN3A 3ISOA 5KN1A 3BBYA 3APQA 3HA9A 4XHMA 4O5RA 2L4QA 1I9DA 2H30A 3M9KA 2VCWA 1X5DA 3DD3A 5B8AA 4PQIA 2N5BA 1EZKA 3VFIA 2O8VB 2C3NA 1DE1A 5CRGA 2AJQB 4TR1A 3VWVA 3WGXA 1OVNA 2MMZA 4G9HA 4KH7A 1VRSD 1C72A 5LCZA 1ZL9A 1GH2A 3ME7A 5AIXA 4TN8A 2LJAA 1GLQA 1OC8A 2GSRA 2R6KA 4LA1A 2C8UA 2LUSA 1NHYA 4IELA 2OJLA 4F03A 5A5KA 5JCWA 4BA7A 3VURA 4TXVA 4WBJA 5D96A 3IC4A 3CTGA 3FEUA 4EUYA 3ZRDA 4KX4A 4TR1B 1GUHA 5HFKA 1MTCA 4ZB8A 2O85A 1TOFA 3C71A 1MEKA 4TKYA 4MPGA 3F4RA 1UC7A 4ZIJA 2RM5A 2VCZA 1WMJA 2B5XA 1GSEA 1SJIA 2M46A 3F6FA 3VWUA 3DYRA 2WRTA 4H86A 2ZNMA 2TIRA 3TKSA 3TJGA 3KP8A 2GQKA 1AIUA 3HJOA 1WP0A 1O7UA 4I97A 4FYCA 2CZ2A 3GL5A 3KMOA 1EWXA 1PX7A 2G0FA 4BL7A 2B7JA 3ZREA 4KF9A 5CRDA 2L5OA 2JU5A 2JSZA 2ON5A 1SENA 2ES7A 1EP7A 4YQUA 4OFMA 2GZPA 2LQOA 2B1KA 4YH2A 4I5QA 2I81A 3R2QA 6GSUA 1G7OA 1LU4A 4XCSA 4QL7A 2AB6A 1TRSA 5L71A 4OO4A 4O32A 1SK0A 1M0UA 4MMMA 4BVXA 1FAAA 2DJ2A 2H6YA 2WULA 3IK9A 2M72A 3IA1A 5F05A 3FK8A 1BG5A 4XS4A 11GSA 1O85A 3L0HA 1AC1A 1SD9A 2DMLA 1XVWA 1R26A 1K3OA 5ENUA 2DSAA 1AQXA 3TJKA 3HY2A 3ERGA 3ZL5A 4BL7B 4NAXA 1YZXA 3DMLA 5CRHA 4X43A 2VL2C 2JL4A 3GKMA 2VIMA 4MP4A 2CV4A 3UMAA 4K7OA 1YQ1A 4ACSA 1ZOFA 1TU8A 1PKZA 2HT9A 5GZZB 4GTUA 1MD4A 4WR4A 3UJ1A 4BVXB 1T1VA 1BAYA 1A8YA 1KEBA 5EVOA 3L9VA 1XPVA 4XS4B 3KH7A 3LSZA 1ERWA 5DBQA 5JWQB 5J41A 5JCUA 2FCHA 2MBSA 1U3IA 3DGQA 4MJCA 4I6XA 4EO3A 2UZ8A 2OE3A 4MZWA 3W8JA 2MYGA 1EP8A 4EDZA 4PXOA 1H75A 4P3YB 1M9AA 2F51A 1GULA 2WJUA 4FYBA 1K0NA 3OR5A 1XVQA 2YNXA 1ILOA 2DJ0A 2V2GA 4HQZA 17GSA 4BVYA 4V1Ag 3V1WA 5DCHA 2R4VA 1HD2A 2L5LA 1PGTA 4OWYA 2IPAA 2YANA 2OA7A 4J2FA 2XPEA 1NSWA 4BPYA 1R4WA 3VPTA 3CSJA 14GSA 1RK4A 1EGOA 2L57A 3FKFA 4NPBA 1WE0A 2B1LA 4EE0A 4NV2A 3TB2A 5D73A 4AJ8A 4IKHA 1OAZA 2IL3A 2VD1A 2YV9A 4XRAA 1EOHA 2FGXA 4BWQA 3GH6A 5A4UA 2BJXA 3ME8A 4BVYB 1WWJA 5F8BA 2L59A 1Y6EA 4JR4A 3TKRA 3ZFBA 1AQWA 1FOVA 3PR8A 1JZDA 5KEJA 3QAGA 4IQAA 5IMCA 3D6IA 2LTKA 3FHKA 4IJIA 5HR0A 2XC2A 3LXZA 3ZIVA 5IO0A 3M3MA 3IAS2 5F0GA 4JZQA 1SL0B 2F3MA 1M7TA 3MNGA 4K2DA 4ECBA 3P8WA 1U87A 4RI6A 3E3EA 3L9SA 1OE8A 4ZB9A 2EC4A 2F8AA 2AUVA 4ECJA 4IS0A 4JBBA 2A2SA 4PNGA 1E6BA 2B5EA 4MABA 2R2JA 3Q19A 2HXKA 4F9ZA 3ZITA 5CAXA 4MA9A 2H76A 4GSTA 3GX8A 1MD3A 3Q18A 3IBHA 1Z7RA 5GAND 2X99A 5LNKe 2LS5A 4G19A 1TI3A 2BTOT 2VD0A 3HJPA 2GTUA 5J3RA 3C1SA 3MDKA 4YAPA 2B7KA 3EU4A 1TK0B 4KE3A 2KLXA 2LV3A 3TJFA 5E59A 1M9BA 7GSSA 5D8IA 4RQRA 4IVFA 1JZOA 3ZLPA 1PL1A 4RI7A 1A2LA 4HS1A 3HD5A 5IIZA 1CQGA 2DJ1A 4AGSA 1K0OA 1IYHA 4TRXA 1BJXA 3A2WA 2I4AA 3DKSA 1PX6A 4GF0A 2M80A 2CX3A 2I9HA 2ZUPA 1QQ2A 3A5WA 3QR6A 2ZCTA 1OC3A 1B4PA 1F37A 1YKCA 1PSQA 1ZGNA 5EL8A 1KNGA 1XCCA 4K9ZA 1TK5B 6GSTA 2PWJA 1TP9A 3FR6A 3D4MA 5H5SA 1N8JA 3N5OA 3ZMLA 2HRFA 3ED3A 1GWCA 2YJHA 2QC7A 3P7XA 2CT6A 1BYEA 3IE3A 5AISA 1ACVA 2KP1A 2RIIA 3C8EA 3CSHA 2A4VA 3GHAA 3O6TA 5J4UA 5E4WA 4Q5QA 1GSSA 4WF4A 4ECCA 3D22A 3DEXA 3VK9A 5IQYA 2YOIA 1K0DA 2WDUA 1DUGA 1V2AA 5C00A 4TW5A 3APSA 1M2BA 2LKUA 4FQUA 2IMIA 3EURA 4WBRD 1A0FA 2N5FA 3M1GA 1YF0A 1GTAA 1ZYEA 3RAZA 1GUKA 5FT3A 6GSYA 4OD7A 3N9JA 2V6OA 1NW2A 5CYYA 1EV4A 18GSA 3TOUA 2GSSA 4ILFA 3TRXA 1SU9A 2IMEA 5A4VA 5AIVA 6GSVA 3KXOA 2LEGA 1J0FA 2EIOA 4G0LA 3LXTA 3UAPA 3KZQA 1GL8A 1USBA 3W8SA 4XS1A 1QK8A 4MH3A 2H0GA 1FB0A 2JACA 3QFAC 2YWOA 5INYA 3TKQA 4PGTA 2GGTA 5GSSA 5JCGA 4DSSA 3BJ5A 3VI5A 1A2MA 1O8XA 4PUAA 2HZFA 3ZTLA 4KDUA 2HSNB 2YCDA 1O73A 3GIXA 4FO5A 1SKWB 1SJZA 2KOKA 3LYKA 2D2ZA 22GSA 3TUEA 2PN8A 2GS3A 5LD0A 5J5NA 4NHWA 2VLUA 3IAM2 1T4YA 3GKKA 4MJEA 1FO5A 2LRTA 2VLTA 4MLYA 1XXUA 4WEYA 2H1GA 2HI7A 5AGYA 3Q74A 4G10A 2VCXA 4D73A 2V6KA 2X8HA 2HE3A 4I2TA 4DSSB 3CRTA 1K0CA 4EF0A 4L5OA 1YY7A 5CREA 4POBA 4O7HA 1Z3EA 3C73A 1XIYA 2H0IA 3RPNA 2H71A 2GSTA 3AY8A 4KA0A 5COHA 4HOJA 1MDJA 1K0AA 3WYWA 5IMZA 3JCML 2FWGA 4IQ1A 1XWAA 4PNFA 1YEXA 3G7JA 1URMA 5IO2A 4HZ2A 1XW6A 4D73B 4F82A 1XW5A 1UVZA 2H74A 5DJMA 1O8WA 1GTIA 3KMNA 2KUCA 5DQSA 1B9XC 1PKWA 3F8UA 3TKSC 2HRNA 2Z9SA 3S9FA 2BMXA 3QCPA 4IJ3A 2QGVA 1PD21 3F3RA 5IOWA 3HVSA 3H93A 2E7PA 3D4TA 4KUNA 2L6DA 1K3YA 2R5GA 2DJJA 2WZ9A 1XWBA 2YZHA 3CXGA 2EIQA 5IMFA 4XIHA 2CAQA 1YJ6A 19GSA 2JZRA 1AXDA 3F6DA 2X8GA 3KM6A 4XS6A 3BCKA 3FZ4A 5ECRB 1QXHA 2AHEA 1TJDA 3M8NA 2PUKC 2IMKA 3U5RE 4KCEA 4N30A 3ERWA 1SL1B 2DLXA 1X5EA 3HVVA 2HSHA 2FWEA 5KN0A 3KTLA 4WF5A 2WFCA 3H8QA 1FG4A 2HLSA 2KP2A 5F07A 1MDKA 2WS2A 3VLNA 3IPZA 3TJBA 1GTUA 2DJKA 1M2DA 2J9HA 2REMA 3EINA 3FR9A 1QMVA 1TW9A 2FNOA 4O92A 3VPQA 4MZBA 5ECLB 4N11A 4HZ4A 4MZCA 4OCEA 2OE1A 4MH2A 4WETA 4POMA 2HSYA 5IOXA 1XOAA 4EC0A 2P31A 4N10A 1TRWA 4F0CA 1GUMA 3GH9A 5IMDA 1PQNA 2DJ3A 3EC3A 2GVPA 1THOA 5ECHB 5DDLA 1F6MC 4JR6A 2VAFA 2VUPA 1I5GA 2ON7A 1ML6A 4IN0A 4FIWA 1JLVA 3F4SA 3EYTA 4Q5NA 2QKEA 5HR2A 1HNBA 4PQHA 1WRYA 1XFLA 1T4ZA 1AW9A 2N5AA 3UVTA 5ECSA 5D9TA 2DIYA 3WGDA 4LL4B 5JWOB 4FYUA 5IMVA 1VF4A 1V98A 3L4NA 2OACA 2F9SA 4KSMA 2LJKA 2CVDA 4ID0A 1SJ6A 4V2MA 4GLTA 1B9YC 4ML6A 1KTEA 4KDXA 2YJ7A 5D93A 5HFIA 3DIEA 1S3DA 4LL1B 3E0UA 2H01A 1M2AA 2VLVA 2I1UA 1U3AA 3P90A 1Y25A 2H70A 4KCAA 1VF3A 4JE1A 5ABRA 5CNWA 5EPFA 1Z9HA 3DWVA 3I6AA 3QAWA 2NTOA 5DAKA 4HQSA 2E2MA 1EGRA 4GCIA 4L0WA 2IMDA 4WXTA 4HU7A 5KN2A 5HFGA 1Q4JA 3F3QA 3UARA 2RUFA 3WD6A 13GSA 2VO4A 1U88A 4MDCA 1EOGA 1A8LA 3LEFA 3UOMA 1EEJA 2YP6A 4MJBA 4DSQA 2QSIA 4GQFA 3UL3A 2LRCA 2KHPA 4IGJA 5JWRB 4K0GA 3NZNA 3TRPA 4ZB6A 5DAKB 2HQTA 1THXA 5J9BA 1TXXA 1PRXA 2XPDA 1E2YA 3EVIA 3QFBC 2XBIA 4G2EA 2MMAA 2L6CA 2H6XA 2VCTA 3P2AA 2GQLA 1UN2A 1CQHA 3GNJA 2V32A 5H5RA 2HNLA 1JZRA 3CYNA 4ZBDA 4ULXA 4PTSA 1J9BA 1HNCA 4N0ZA 4L5LA 10GSA 2K8SA 2TRXA 5HQPA 2LRNA 1T00A 1ZYQB 3TJJA 4F2IA 1DBYA 4GSNA 3GFKA 2J23A 4JU5A 4V2NA 3O76A 1XWKA 2NVLA 1TTZA 2VCQA 2P5RA 5G31A 2YPMA 3HKRA 1SKRB 3FRCA 2NPBA 2TRCP 1F9MA 4I8BA 2JSYA 1B4QA 4K7IA 2GDRA 1GNEA 2LNTA 3L78A 1OKTA 3R3EA 2GT5A 1A24A 2H73A 2CA8A 3GN3A 3KP9A 2X64A 1XOBA 4ZL7A 1N2AA 2K8VA 1S3CA 5DJLA 2MMNA 3RHCA 3ERFA 4MPFA 2VM1A 3NOFA 4KNDA 4ZBAA 2AYTA 3A3TA 5GSTA 5D9XA 4ZBBA 2H1AA 2A2RA 2HRAA 1JZWA 3KD0A 2OKAA 5B6MA 2C3QA 3MWHA 1G6WA 3GL3A 3LWAA 4KSOA 5C04A 20GSA 2YN1A 3G7YA 1A2JA 1LBKA 3HZ8A 3I69A 1GTBA 3DVXA 1SD8A 3EWLA 4ISDA 2YZUA 2CVKA 5KN3A 5H5QA 4N0VA 1BX9A 3NIVA 2MBTA 3GSSA 4XRDA 5DQYA 3LG6A 3KGKA 3PINA 2H19A 1X9SB 3GSTA 12GSA 4PURA 3G7IA 1KBNA 2FA4A 5CO3A 1X9WB 2F8FA 5D9WA 1DE2A 2FWHA 2LJRA 4KW6A 1TKDB 2IJYA 4MJAA 3BOAA 1GSQA 4LMVA 3HJMA 4YQVA 3GMFA 3CMIA 4EKZA 2I3YA 1MDIA 3H4KA 2DIZA 2JADA 2B3SA 1FVKA 5FWGA 1SYXA 1PA3A 5IM9A 1HNAA 5ECPB 2HRKA 4Q5RA 1V40A 2ALBA 1YKAA 4EL1A 4USSA 5HR1A 4GRFA 3HYPA 2H66A 4HEA2 4MF5A 2C0DA 3ZVJD 3VWXA 3IOSA 3M0FA 4F0BA 1EEMA 4TXOA 2JZSA 1TDIA 1XW9A 4ZL8A 5HR3A 3Q6OA 5B7CA 9GSSA 3I43A 1AUCA 5B8BA 4MF6A 4LMWA 3WGEA 3FZAA 4K0NA 5EY6A 2NBSA 2RLIA 4K7NA 1TK8B 4GQCA 1VF2A 2H0HA 3O3TA 3L9UA 4HU9A 1AQVA 2HRKB 1BQ7A 4EDYA 4OO5A 3ZFLA 3FR3A 3TKSE 3LQ7A 2YWIA 2B6MA 2FY6A 3IV4A 3RBTA 4GSSA 3HXSA 4AF2A 3LFLA 3F0IA 3APOA 2PMTA 4Z7XA 5G2ZA 4K6XA 1K3LA 5G1KA 4TXOB 3U6VA 3IC8A 2RM6A 3HVXA 3A2XA 3FY7A 3DVWA 1GSYA 3QPMA 4POKA 1B8XA 2XBQA 3CSIA 3M9JA 5G5EA 3ZVJA 3TOTA 2C3TA 16GSA 4X0XA 1GNWA 5ELGA 3IRAA 3GKNA 1ERUA 1JHBA 2H6ZA 4EXJA 3MAKA 3A2VA 2VL2A 1ZMAA 5A4WA 2O7KA 3BCIA 2H1BA 2RUEA 1FHEA 3KH9A 4ZL9A 5IPHA 1GP1A 3D0ZA 1A0RP 1WIKA 2AV4A 4IHUA 3TGZA 3KIJA 2YWNA 3UBLA 1ST9A 3TKPA 5DCGA 1PN9A 3IK7A 3G9BA 1X5CA 4QQ7A 4WKWA 1QGVA 5FHIA 2L4CA 3D5JA 2WCIA 3DRNA 1V9WA 2K6VA 3EMXA 3J7Yk 1IYIA 4KB3A 2CX4A 1GSDA 3ZMKA 4POLA 3GUSA 2WGRA 3HCZA 3RHBA 4MK3A 1TU7A 4E8EA 4OCFA 5F06A 4DEJA 4IBPA 2EIRA 3CTFA 4AJ7A 3CRUA 1Z7PA 1WJKA 5G30A 1T3BA 2CQ9A 1TI1A 4RQXA 1XWGA 1QUWA 3IDVA 4CHSA 2PVOC 4HDEA 4G0KA 1Z5YE 2IWTA 3IR4A 1XBSA 2PPTA 2PERA 4RUVA 2XHFA 1TRUA 3GX0A 4X1UA 1BEDA 4L0UA 1FB6A 5ECQB 1TRVA 3QMXA 2PGTA 4OMVA 3UVHA 4JRRA 4TR4A 2LSTA 1G0TA 4OFTA 3H79A 2FD3A 1X9MB 5ECKB 2IFQA 3UBKA 4DVCA 4K8MA 3GKXA 1Z6NA 4AJ6A 5G1LA 4ECIA 2LQQA 5ELAA 3GV1A 2V1MA 1F3BA 4ZXGA 3IXRA 4BWSA 4TR0A 6GSWA 1JLWA 3K8NA 4HJ2A 2WB9A 1VF1A 3QAVA 3RPPA 2CZ3A 5IMAA 2O89A 3GA4A 4LLRA 1H4OA 1V58A 4MCUA 3TCOA 2MMOA 4IW9A 2C80A 5GAPD 5ECNB 5DALA 1SK2A 3VWWA 2H8LA 1YEPA 4E8HA 2IFQB 3C1RA 3HHVA 2FA8A 4V2LA 4FH8A 3HDCA 2FLSA 1JFUA 2GSQA 6GSXA 1ABAA 2V41A 3CBUA 1W89A 4GWRA 1HQOA 3QDNA 1SK1A 1LJRA 4K1FA 1ERTA 4KGIA 5CRWA 3SBCA 3W6GA 3F9UA 1XZOA 2P0GA 2VL3A 2PU9C 2LNSA 2C1YA 1ON4A 1NM3A 2C0FA 2FWFA 3I9V2 2CVBA 1GSFA 4YQMA 4HI7A 3SWLA 3C7MA 2VOCA 4QL9A 1F3AA 4CW9A 5DALB 1WOUA 1RW1A 3RDWA 4PX1A 1PL2A 2OBIA 4HJMA 3LGCA 2IMFA 4V1Ap 1OYJA 4I2UA 3US3A 1K0MA 5AN1A 4ML1A 3UEMA 2GZZA 4KAEA 4J57E 4NV5A 2OE0A 3IHQA 2R37A 2DBCA 1ERVA 1T8EB 4DSRA 5CP1A 2P5QA 1V57A 3PH9A 2HSMA 2HFDA 3FW2A 2DC5A 4G0IA 1U6TA 3GURA 2VM2A 4MF7A 1WPIA 4NWYA 3H1NA 2HZEA 3KJYA 3QD9A 4WR5A 1Q98A 1A23A 3ZIJA 2O87A 3MSZA 1GRXA 5G5FA 2X8CA 1AAZA 1OC9A 2CAIA 4XTSA 3KCMA 2E2GA 2NDOA 4PUFC 3F63A 3KTBA 2OBKA 1YDKA 2AAWA 1FVJA 3EMPA 2GZYA 2B5YA 5BMUA 3GTUA 2H72A 4YAVA 5DVBA 4HUAA 3J7Yb 2DMMA 2VCVA 1XWCA 3DXBA 2HSMB 5ID2A 1FW1A 2E0QA 3GYKA 3PGTA 2YWMA 3WT1A 2JZTA 3FZ9A 1R7HA 1OE7A 6GSSA 1QFNA 3D21A 3QOUA 2YV7A 4TR3A 2MZCA 4GXZA 2HZEB 1SL2B 1HYUA 8GSSA 1SKSB 5ECIB 2GT6A 1OC9B 3E9JB 4TOPA 2K18A 3EE2A 3LJRA 3PPUA 1ZCPA 3F4TA 2C4JA 1O6JA 2H75A 3WT2A 4EVMA 3GTUB 2FHEA 3BD2A 1UA5A 1M99A 2GQMA 1YF1A 1Z6MA 2C0EA 1S3AA 2G2QA 1T7PB 1GSUA 5B6NA 1OKDA 3FYGA 4Q5FA 2C0GA 5ID2B 4TVEA 1VGLA 1ZZYA 1K0BA 4IP6A 4J56E 1W4VA 2H1DA 4IP1A 1J08A 1F2EA 4PQ1A 1R5PA 3HZ4A 4L8EA 2IIYA 2PVQA 4NMUA 1GLPA 1O81A 1SYRA 3ZYWA 2FUG2 2VL9A 1NHOA 5ECOB 4NHZA 2R3XA 1R5AA 1RQMA 3KEBA 2GLRA 5D9VA 4OFNA 3VI7A 3UIWA 1DSBA 3TRQA 4ZILA 3LORA 2OADA 4CDOA 5ECMB 4KDYA 3EU3A 3ZZXA 1B48A 3FZ5A 4JEDA 1X0RA 1EV9A 4NXIA 1G6YA 2HYXA 5J9CA 1PMTA 3LYPA 5IPGA 3GRXA 3TDGA 1G7EA 2PBJA 2K9FA
chains in the Genus database with same CATH superfamily
2IN3A 3ISOA 5KN1A 3BBYA 3APQA 3HA9A 4XHMA 4O5RA 2L4QA 1I9DA 2OT3A 2WVZA 2H30A 3M9KA 2VCWA 1X5DA 3DD3A 5B8AA 4PQIA 2N5BA 1EZKA 3VFIA 2O8VB 2C3NA 1DE1A 5CRGA 2AJQB 4TR1A 3VWVA 1I1IP 3WGXA 1OVNA 2MMZA 4G9HA 4KH7A 1VRSD 1C72A 5LCZA 1ZL9A 1GH2A 3ME7A 5AIXA 4TN8A 2LJAA 1GLQA 1OC8A 2GSRA 2R6KA 4LA1A 2C8UA 2LUSA 1NHYA 4IELA 2OJLA 4F03A 5A5KA 5JCWA 4BA7A 2O3EA 3VURA 4TXVA 4WBJA 5D96A 3IC4A 3CTGA 3FEUA 4EUYA 3ZRDA 4KX4A 4TR1B 1GUHA 5HFKA 1MTCA 4ZB8A 2O85A 1TOFA 3C71A 1MEKA 4TKYA 4MPGA 3F4RA 1UC7A 4ZIJA 2RM5A 2VCZA 1WMJA 2B5XA 1GSEA 1SJIA 2M46A 3F6FA 3VWUA 3DYRA 2WRTA 4H86A 2ZNMA 2TIRA 3TKSA 3TJGA 3KP8A 2GQKA 5KOXA 1AIUA 3HJOA 1WP0A 4W66A 4I97A 1O7UA 4FYCA 2CZ2A 3GL5A 3KMOA 1EWXA 1PX7A 2G0FA 4BL7A 2B7JA 3ZREA 4KF9A 5CRDA 2L5OA 3EPTA 2JU5A 2JSZA 2ON5A 1SENA 2ES7A 1EP7A 4YQUA 4OFMA 2GZPA 2LQOA 2B1KA 4YH2A 4I5QA 2I81A 3R2QA 6GSUA 1G7OA 1LU4A 4XCSA 4QL7A 2AB6A 1TRSA 5L71A 4OO4A 4O32A 1SK0A 1M0UA 4MMMA 4BVXA 1FAAA 2DJ2A 2H6YA 2WULA 3IK9A 2M72A 3IA1A 5F05A 3FK8A 1BG5A 4XS4A 11GSA 1O85A 3L0HA 1AC1A 1SD9A 2DMLA 1XVWA 1R26A 1K3OA 5ENUA 2DSAA 1ZYPA 4YKGA 1AQXA 3TJKA 3HY2A 3ERGA 3ZL5A 4BL7B 4NAXA 1YZXA 3DMLA 5CRHA 4X43A 2VL2C 2JL4A 3GKMA 2VIMA 4MP4A 2CV4A 3UMAA 4K7OA 1YQ1A 4ACSA 1ZOFA 1TU8A 1PKZA 2HT9A 5GZZB 4GTUA 1MD4A 4WR4A 3UJ1A 4BVXB 1T1VA 1BAYA 1A8YA 1KEBA 5EVOA 3L9VA 1XPVA 4XS4B 3KH7A 3LSZA 1ERWA 5DBQA 5JWQB 5J41A 5JCUA 2FCHA 2MBSA 1U3IA 3DGQA 4MJCA 4I6XA 4EO3A 2UZ8A 5J40A 2OE3A 4MZWA 3W8JA 2MYGA 1EP8A 4AI6A 4EDZA 4Z2TA 4PXOA 1H75A 4P3YB 1M9AA 2F51A 1GULA 2WJUA 4X4JA 4FYBA 1K0NA 4PI2C 3OR5A 1XVQA 2YNXA 1ILOA 2DJ0A 2V2GA 1ZYNA 4HQZA 17GSA 4BVYA 4V1Ag 3V1WA 5DCHA 2R4VA 1HD2A 2L5LA 2R0PA 1PGTA 4OWYA 2IPAA 2YANA 4O5UA 4K5SA 2OA7A 4J2FA 2XPEA 1NSWA 4BPYA 1R4WA 5J4VA 3VPTA 2WW0A 2EFDA 3CSJA 14GSA 1RK4A 1EGOA 2L57A 3FKFA 3IHGA 4NPBA 1WE0A 2B1LA 4EE0A 4NV2A 3TB2A 5D73A 4AJ8A 4IKHA 1OAZA 2IL3A 2VD1A 2YV9A 4XRAA 1SVLA 1EOHA 2FGXA 4BWQA 3GH6A 5A4UA 2BJXA 3ME8A 4BVYB 1WWJA 5F8BA 2L59A 1Y6EA 4JR4A 3TKRA 3ZFBA 1AQWA 1FOVA 3PR8A 1JZDA 5KEJA 3QAGA 4IQAA 5IMCA 3D6IA 2LTKA 3FHKA 4IJIA 2WW1A 5HR0A 2XC2A 3LXZA 3ZIVA 5IO0A 3M3MA 3IAS2 5F0GA 4JZQA 1SL0B 2F3MA 1M7TA 3MNGA 4K2DA 3LW9A 4ECBA 3P8WA 1U87A 4RI6A 3E3EA 3L9SA 1OE8A 4ZB9A 2EC4A 2F8AA 2AUVA 4ECJA 4IS0A 4JBBA 2A2SA 4PNGA 3HMJG 4G01A 1E6BA 2B5EA 4MABA 2R2JA 3Q19A 2HXKA 4F9ZA 3ZITA 5CAXA 4MA9A 2R0CA 2H76A 2O5VA 4GSTA 3GX8A 1MD3A 3Q18A 3IBHA 1Z7RA 5GAND 2X99A 5LNKe 2LS5A 4G19A 1TI3A 2BTOT 2VD0A 3HJPA 2GTUA 5J3RA 3C1SA 3MDKA 4YAPA 2B7KA 3EU4A 4HSCX 1TK0B 4KE3A 2KLXA 2LV3A 3TJFA 5E59A 1M9BA 1S4BP 7GSSA 5D8IA 4RQRA 5A5HA 4IVFA 1JZOA 3ZLPA 1PL1A 4RI7A 1A2LA 4HS1A 3HD5A 5IIZA 1CQGA 2DJ1A 4AGSA 1K0OA 1IYHA 4TRXA 1BJXA 3A2WA 2I4AA 3DKSA 1PX6A 4GF0A 2M80A 2CX3A 2I9HA 2ZUPA 1QQ2A 3A5WA 3QR6A 2ZCTA 1OC3A 1B4PA 1F37A 1YKCA 1PSQA 1ZGNA 5EL8A 1KNGA 3MYDA 1XCCA 4K9ZA 1TK5B 6GSTA 1YVLA 1TP9A 3FR6A 2PWJA 3D4MA 5H5SA 1N8JA 3N5OA 3ZMLA 2HRFA 3ED3A 1GWCA 2WW2A 2YJHA 5A5HB 2QC7A 3P7XA 2X4AA 2CT6A 1BYEA 3IE3A 5AISA 1ACVA 2KP1A 2RIIA 3C8EA 3CSHA 2A4VA 3GHAA 3O6TA 5J4UA 5E4WA 4Q5QA 4FXYP 1GSSA 4WF4A 4ECCA 3D22A 3DEXA 3VK9A 5IQYA 2YOIA 1K0DA 2WDUA 1DUGA 1V2AA 5C00A 4TW5A 4ICYA 3APSA 4N3ZA 1M2BA 2LKUA 4FQUA 2IMIA 3EURA 4WBRD 1A0FA 2N5FA 3M1GA 1YF0A 1GTAA 1SVMA 1ZYEA 3RAZA 1GUKA 5FT3A 6GSYA 2HSNA 3N9JA 2V6OA 4OD7A 1NW2A 5CYYA 1EV4A 18GSA 4PHZC 3TOUA 2GSSA 4ILFA 3TRXA 1SU9A 2IMEA 5A4VA 5AIVA 6GSVA 3KXOA 2LEGA 1J0FA 2VKZG 2EIOA 4G0LA 3LXTA 3UAPA 3KZQA 1GL8A 1USBA 3W8SA 4XS1A 1QK8A 4MH3A 2H0GA 1FB0A 2JACA 3QFAC 2YWOA 5INYA 3TKQA 4PGTA 2GGTA 5GSSA 5JCGA 4DSSA 3BJ5A 3VI5A 4EIQA 1A2MA 1O8XA 4PUAA 2HZFA 3ZTLA 4KDUA 2HSNB 2YCDA 1O73A 3GIXA 4FO5A 3CQFA 1SKWB 2WVYA 1SJZA 2KOKA 3LYKA 2D2ZA 22GSA 3TUEA 2PN8A 2GS3A 5LD0A 5J5NA 4NHWA 2VLUA 3IAM2 1T4YA 3GKKA 4Z2UA 4MJEA 1FO5A 2LRTA 2VLTA 4MLYA 1XXUA 4WEYA 2H1GA 2HI7A 5AGYA 3Q74A 4G10A 2VCXA 4D73A 2V6KA 2X8HA 2HE3A 4I2TA 4DSSB 3CRTA 1K0CA 4EF0A 4L5OA 1YY7A 4AKXB 5CREA 4POBA 4O7HA 1Z3EA 3C73A 3TU3B 1XIYA 2H0IA 4AKIA 3RPNA 2H71A 2GSTA 3AY8A 4KA0A 5COHA 4HOJA 1MDJA 2A2PA 1K0AA 4AKGA 3WYWA 3FMWA 5IMZA 3JCML 2FWGA 4IQ1A 1XWAA 4PNFA 1YEXA 3G7JA 1URMA 5IO2A 4HZ2A 1XW6A 4D73B 4F82A 1XW5A 1UVZA 2H74A 5DJMA 1O8WA 1GTIA 4EIPA 3KMNA 2KUCA 2X49A 3HVNA 5DQSA 1B9XC 1PKWA 3F8UA 3TKSC 2HRNA 2Z9SA 3S9FA 2BMXA 3QCPA 4IJ3A 2QGVA 1PD21 3F3RA 1M3IA 5IOWA 3HVSA 3H93A 2E7PA 3D4TA 4KUNA 2L6DA 1K3YA 2R5GA 2DJJA 2WZ9A 1XWBA 2YZHA 3CXGA 2EIQA 5IMFA 4XIHA 2CAQA 1YJ6A 19GSA 2JZRA 1AXDA 3F6DA 2X8GA 3KM6A 4XS6A 3BCKA 3FZ4A 5ECRB 1QXHA 2AHEA 1TJDA 3M8NA 2PUKC 2IMKA 2WW3A 3U5RE 1XG8A 4KCEA 3ERWA 4N30A 1SL1B 2DLXA 1X5EA 3HVVA 2HSHA 2FWEA 5KN0A 3KTLA 4WF5A 2WFCA 3H8QA 1FG4A 2HLSA 2KP2A 5F07A 1MDKA 2WS2A 3VLNA 3IPZA 3TJBA 1GTUA 2DJKA 1M2DA 2J9HA 2REMA 3EINA 3FR9A 1QMVA 1TW9A 2FNOA 4O92A 3VPQA 4MZBA 5ECLB 4N11A 4HZ4A 4MZCA 4OCEA 2OE1A 4MH2A 4WETA 4POMA 2HSYA 2DKIA 5IOXA 1XOAA 4EC0A 2P31A 4N10A 1TRWA 4F0CA 1GUMA 3GH9A 5IMDA 1PQNA 2DJ3A 3EC3A 2GVPA 1THOA 5ECHB 5DDLA 1F6MC 4JR6A 2VAFA 2VUPA 1I5GA 2ON7A 1ML6A 4IN0A 4FIWA 1JLVA 3F4SA 3EYTA 4Q5NA 2QKEA 5HR2A 1HNBA 4PQHA 1WRYA 1XFLA 1T4ZA 1AW9A 2N5AA 3UVTA 5ECSA 5D9TA 2DIYA 3A5IA 3WGDA 4LL4B 5JWOB 4FYUA 5IMVA 1VF4A 1V98A 3L4NA 2OACA 2F9SA 4KSMA 2LJKA 2CVDA 4ID0A 1SJ6A 4V2MA 4GLTA 1B9YC 4ML6A 1KTEA 4KDXA 2YJ7A 5D93A 5HFIA 3DIEA 1S3DA 4LL1B 3E0UA 2H01A 1M2AA 2VLVA 2I1UA 1U3AA 3P90A 1Y25A 2H70A 4KCAA 1VF3A 4JE1A 5ABRA 5CNWA 5EPFA 1Z9HA 3DWVA 3I6AA 3QAWA 2NTOA 5DAKA 4HQSA 2E2MA 1EGRA 4GCIA 4L0WA 2IMDA 4WXTA 4HU7A 5KN2A 5HFGA 1Q4JA 3F3QA 3UARA 2RUFA 3WD6A 13GSA 2VO4A 1U88A 4MDCA 1EOGA 4O5QA 1A8LA 3LEFA 3UOMA 1EEJA 2YP6A 4MJBA 4DSQA 2QSIA 4GQFA 3UL3A 2LRCA 1FOHA 2KHPA 4IGJA 5JWRB 4K0GA 3NZNA 3TRPA 4ZB6A 5DAKB 4YKFA 2HQTA 1THXA 5J9BA 1TXXA 1PRXA 2XPDA 1E2YA 3EVIA 3QFBC 2XBIA 4G2EA 2MMAA 2L6CA 2H6XA 2VCTA 3P2AA 2GQLA 1UN2A 1CQHA 3GNJA 3RGBC 2V32A 5H5RA 2HNLA 1JZRA 3CYNA 2EFCA 1TXUA 4ZBDA 4ULXA 4PTSA 1J9BA 1HNCA 4N0ZA 4L5LA 10GSA 2K8SA 2TRXA 5HQPA 2LRNA 1T00A 1ZYQB 3TJJA 4F2IA 1DBYA 4GSNA 3GFKA 2J23A 4JU5A 4V2NA 3O76A 1XWKA 2NVLA 1TTZA 2VCQA 2P5RA 5G31A 3CWGA 2YPMA 3HKRA 1SKRB 3FRCA 2NPBA 2TRCP 1F9MA 4I8BA 2JSYA 1B4QA 4K7IA 2GDRA 1GNEA 2LNTA 3L78A 1OKTA 3R3EA 2GT5A 1A24A 2H73A 2CA8A 3MIXA 3GN3A 3KP9A 2X64A 1XOBA 4ZL7A 1N2AA 2K8VA 1S3CA 5DJLA 2MMNA 3RHCA 3ERFA 4MPFA 2VM1A 3NOFA 4KNDA 4ZBAA 2AYTA 3A3TA 5GSTA 5D9XA 4ZBBA 2H1AA 2A2RA 2HRAA 1JZWA 3KD0A 2OKAA 5B6MA 2C3QA 3MWHA 1G6WA 3GL3A 3LWAA 4KSOA 5C04A 20GSA 2YN1A 3G7YA 1A2JA 3HZ8A 1LBKA 3I69A 1GTBA 3DVXA 1SD8A 3EWLA 4ISDA 2YZUA 2CVKA 5KN3A 5H5QA 4N0VA 1BX9A 3NIVA 2MBTA 3GSSA 4XRDA 5DQYA 3LG6A 3KGKA 3PINA 2H19A 1X9SB 3GSTA 12GSA 4PURA 3G7IA 1KBNA 2FA4A 5CO3A 1X9WB 2F8FA 5D9WA 1DE2A 2FWHA 2LJRA 4KW6A 1TKDB 2IJYA 4MJAA 3BOAA 1GSQA 4LMVA 4CY8A 2DKHA 3HJMA 4YQVA 3GMFA 3CMIA 4EKZA 2I3YA 1MDIA 3H4KA 4CY6A 2DIZA 2JADA 2B3SA 1FVKA 5FWGA 1SYXA 1PA3A 5IM9A 1HNAA 5ECPB 1N25A 2HRKA 4Q5RA 1V40A 2ALBA 1YKAA 4EL1A 4USSA 5HR1A 4GRFA 2WVXA 3HYPA 2H66A 4HEA2 4MF5A 2C0DA 3ZVJD 3VWXA 3IOSA 3M0FA 5A1NA 1EEMA 4F0BA 5J4YA 4TXOA 2JZSA 1TDIA 1XW9A 4ZL8A 5HR3A 5B7CA 3Q6OA 9GSSA 3I43A 1AUCA 5B8BA 4MF6A 4LMWA 3WGEA 3FZAA 4K0NA 5EY6A 2EFHA 2NBSA 2RLIA 4K7NA 1TK8B 4GQCA 1VF2A 2H0HA 5A34A 3O3TA 3L9UA 4HU9A 1AQVA 2HRKB 1BQ7A 4EDYA 4OO5A 3ZFLA 3FR3A 3TKSE 3LQ7A 2WVXB 2YWIA 2B6MA 2FY6A 3IV4A 3RBTA 4GSSA 3HXSA 4AF2A 3LFLA 3F0IA 3APOA 5A1NB 2PMTA 4E68A 4Z7XA 5G2ZA 4K6XA 1K3LA 5G1KA 4TXOB 3U6VA 3IC8A 2RM6A 3HVXA 3A2XA 3FY7A 3DVWA 4MNNA 1GSYA 3QPMA 4POKA 1B8XA 2XBQA 2H1LA 3CSIA 3M9JA 5G5EA 3ZVJA 5A34B 3TOTA 2C3TA 16GSA 4X0XA 1GNWA 5ELGA 3IRAA 3GKNA 1ERUA 1JHBA 2H6ZA 4EXJA 3MAKA 3A2VA 2VL2A 1ZMAA 5A4WA 1YEWC 2O7KA 3BCIA 2H1BA 2RUEA 1FHEA 3KH9A 4ZL9A 5IPHA 1GP1A 3D0ZA 1A0RP 1WIKA 2AV4A 4IHUA 2WZSA 3TGZA 3KIJA 2YWNA 3UBLA 5KOWA 1ST9A 3TKPA 4BIKA 5DCGA 1PN9A 3IK7A 3G9BA 1X5CA 4QQ7A 4WKWA 1QGVA 5FHIA 2L4CA 2QA2A 3D5JA 2WCIA 3DRNA 1V9WA 2K6VA 3EMXA 3J7Yk 1IYIA 4KB3A 2CX4A 1GSDA 3ZMKA 4POLA 3GUSA 2WGRA 3HCZA 3RHBA 4MK3A 1TU7A 4E8EA 4OCFA 5F06A 4DEJA 4IBPA 2EIRA 3CTFA 4AJ7A 3CRUA 1Z7PA 1WJKA 5G30A 1T3BA 1PFOA 2CQ9A 1TI1A 4RQXA 1XWGA 1QUWA 3IDVA 4CHSA 2PVOC 4G0KA 1Z5YE 2IWTA 4HDEA 3IR4A 2O36A 1XBSA 4QMKA 2PPTA 2PERA 4RUVA 2XHFA 1TRUA 3GX0A 4X1UA 1BEDA 4L0UA 1FB6A 5ECQB 1TRVA 3QMXA 2PGTA 4OMVA 3UVHA 4JRRA 4TR4A 2LSTA 1G0TA 4OFTA 2EFEA 3H79A 2FD3A 1X9MB 5ECKB 2IFQA 3UBKA 4K2XA 1SVOA 4DVCA 4K8MA 3GKXA 1Z6NA 4AJ6A 5G1LA 4ECIA 2LQQA 5ELAA 3GV1A 2V1MA 1F3BA 4ZXGA 3IXRA 4BWSA 4TR0A 6GSWA 1JLWA 3K8NA 4HJ2A 1PN0A 2WB9A 1VF1A 3QAVA 3RPPA 2CZ3A 5IMAA 2O89A 3GA4A 4K5RA 4LLRA 1H4OA 1V58A 4MCUA 3TCOA 2MMOA 4Z2RA 4IW9A 2C80A 5GAPD 5ECNB 5DALA 1SK2A 1M3JA 3VWWA 2H8LA 1YEPA 4E8HA 2IFQB 3C1RA 3HHVA 2FA8A 4V2LA 4FH8A 3HDCA 2FLSA 1JFUA 2GSQA 6GSXA 1ABAA 2V41A 3CBUA 1W89A 4GWRA 1HQOA 3QDNA 1SK1A 1LJRA 4K1FA 1ERTA 4KGIA 5CRWA 3SBCA 3W6GA 3F9UA 1XZOA 1BG1A 2P0GA 2VL3A 2PU9C 2LNSA 2C1YA 1ON4A 1NM3A 2C0FA 2FWFA 3I9V2 2CVBA 1GSFA 4YQMA 4HI7A 3SWLA 3C7MA 2VOCA 4QL9A 1F3AA 4CW9A 1BF5A 5DALB 1WOUA 1RW1A 3RDWA 4PX1A 1PL2A 2OBIA 4HJMA 3LGCA 2IMFA 4V1Ap 1OYJA 4I2UA 3US3A 1K0MA 5AN1A 4ML1A 3UEMA 2GZZA 4KAEA 4J57E 4NV5A 1Y1UA 2OE0A 3IHQA 2R37A 2DBCA 1ERVA 1T8EB 4DSRA 5CP1A 2P5QA 2R0GA 1V57A 3PH9A 3RFRC 2HSMA 2HFDA 3FW2A 2DC5A 4G0IA 1U6TA 4GDFA 3GURA 2VM2A 4MF7A 1WPIA 4NWYA 3H1NA 2HZEA 3KJYA 3QD9A 4WR5A 1Q98A 1A23A 3ZIJA 2O87A 3MSZA 1GRXA 5G5FA 1S3RA 2X8CA 1AAZA 1OC9A 2CAIA 4XTSA 3KCMA 2E2GA 2NDOA 4PUFC 3F63A 2A4HA 3KTBA 2OBKA 1YDKA 2AAWA 1FVJA 3EMPA 2GZYA 2B5YA 5BMUA 3GTUA 2UV8G 2H72A 4YAVA 5DVBA 4HUAA 3J7Yb 4PI0C 2DMMA 2VCVA 1XWCA 3DXBA 2HSMB 5ID2A 1FW1A 2E0QA 3GYKA 2QA1A 3PGTA 4ZB7A 2YWMA 3WT1A 2JZTA 3FZ9A 1R7HA 1OE7A 6GSSA 1QFNA 3D21A 3QOUA 2YV7A 4TR3A 2MZCA 4GXZA 2HZEB 1SL2B 1HYUA 8GSSA 4AKHA 1SKSB 5ECIB 2GT6A 1OC9B 3E9JB 4TOPA 2K18A 3EE2A 3LJRA 3PPUA 1ZCPA 3F4TA 2C4JA 1O6JA 2H75A 3WT2A 5BMUB 4EVMA 3GTUB 2FHEA 3BD2A 1UA5A 1M99A 2GQMA 1YF1A 1Z6MA 5J47A 2C0EA 1S3AA 2G2QA 1T7PB 1GSUA 5B6NA 1OKDA 3FYGA 4Q5FA 2C0GA 5ID2B 4TVEA 1VGLA 1ZZYA 1K0BA 4IP6A 4A5PA 4J56E 1W4VA 2H1DA 4IP1A 1J08A 1F2EA 4PQ1A 1R5PA 3HZ4A 4L8EA 2IIYA 2PVQA 4NMUA 1GLPA 1O81A 1SYRA 3ZYWA 2FUG2 2VL9A 1NHOA 5ECOB 3CHXC 4NHZA 2R3XA 1R5AA 1RQMA 3KEBA 2GLRA 5D9VA 4OFNA 3VI7A 5BRTA 3UIWA 1DSBA 3TRQA 4ZILA 3LORA 2OADA 4CDOA 5ECMB 4KDYA 3EU3A 3ZZXA 1B48A 3FZ5A 4JEDA 1X0RA 1EV9A 4NXIA 1G6YA 2HYXA 5J9CA 1PMTA 3LYPA 5IPGA 3GRXA 3TDGA 1G7EA 2PBJA 2K9FA
chains in the Genus database with same CATH topology
2IN3A 3ISOA 5KN1A 3BBYA 3APQA 3HA9A 4XHMA 4O5RA 2L4QA 1I9DA 2OT3A 2H30A 3M9KA 2VCWA 1X5DA 3DD3A 5B8AA 4PQIA 2N5BA 1EZKA 3VFIA 2O8VB 2C3NA 1DE1A 5CRGA 2AJQB 4TR1A 3VWVA 3WGXA 1OVNA 2MMZA 4G9HA 4KH7A 1VRSD 1C72A 5LCZA 1ZL9A 1GH2A 3ME7A 5AIXA 4TN8A 2LJAA 1GLQA 1OC8A 2GSRA 2R6KA 4LA1A 2C8UA 2LUSA 1NHYA 4IELA 2OJLA 4F03A 5A5KA 5JCWA 4BA7A 3VURA 4TXVA 4WBJA 5D96A 3IC4A 3CTGA 3FEUA 4EUYA 3ZRDA 4KX4A 4TR1B 1GUHA 5HFKA 1MTCA 4ZB8A 2O85A 1TOFA 3C71A 1MEKA 4TKYA 4MPGA 3F4RA 1UC7A 4ZIJA 2RM5A 2VCZA 1WMJA 2B5XA 1GSEA 1SJIA 2M46A 3F6FA 3VWUA 3DYRA 2WRTA 4H86A 2ZNMA 2TIRA 3TKSA 3TJGA 3KP8A 2GQKA 5KOXA 1AIUA 3HJOA 1WP0A 4W66A 4I97A 1O7UA 4FYCA 2CZ2A 3GL5A 3KMOA 1EWXA 1PX7A 2G0FA 4BL7A 2B7JA 3ZREA 4KF9A 5CRDA 2L5OA 3EPTA 2JU5A 2JSZA 2ON5A 1SENA 2ES7A 1EP7A 4YQUA 4OFMA 2GZPA 2LQOA 2B1KA 4YH2A 4I5QA 2I81A 3R2QA 6GSUA 1G7OA 1LU4A 4XCSA 4QL7A 2AB6A 1TRSA 5L71A 4OO4A 4O32A 1SK0A 1M0UA 4MMMA 4BVXA 1FAAA 2DJ2A 2H6YA 2WULA 3IK9A 2M72A 3IA1A 5F05A 3FK8A 1BG5A 4XS4A 11GSA 1O85A 3L0HA 1AC1A 1SD9A 2DMLA 1XVWA 1R26A 1K3OA 5ENUA 2DSAA 1ZYPA 4YKGA 1AQXA 3TJKA 3HY2A 3ERGA 3ZL5A 4BL7B 4NAXA 1YZXA 3DMLA 5CRHA 4X43A 2VL2C 2JL4A 3GKMA 2VIMA 4MP4A 2CV4A 3UMAA 4K7OA 1YQ1A 4ACSA 1ZOFA 1TU8A 1PKZA 2HT9A 5GZZB 4GTUA 1MD4A 4WR4A 3UJ1A 4BVXB 1T1VA 1BAYA 1A8YA 1KEBA 5EVOA 3L9VA 1XPVA 4XS4B 3KH7A 3LSZA 1ERWA 5DBQA 5JWQB 5J41A 5JCUA 2FCHA 2MBSA 1U3IA 3DGQA 4MJCA 4I6XA 4EO3A 2UZ8A 5J40A 2OE3A 4MZWA 3W8JA 2MYGA 1EP8A 4AI6A 4EDZA 4Z2TA 4PXOA 1H75A 4P3YB 1M9AA 2F51A 1GULA 2WJUA 4X4JA 4FYBA 1K0NA 3OR5A 1XVQA 2YNXA 1ILOA 2DJ0A 2V2GA 1ZYNA 4HQZA 17GSA 4BVYA 4V1Ag 3V1WA 5DCHA 2R4VA 1HD2A 2L5LA 2R0PA 1PGTA 4OWYA 2IPAA 2YANA 4O5UA 4K5SA 2OA7A 4J2FA 2XPEA 1NSWA 4BPYA 1R4WA 5J4VA 3VPTA 2EFDA 3CSJA 14GSA 1RK4A 1EGOA 2L57A 3FKFA 3IHGA 4NPBA 1WE0A 2B1LA 4EE0A 4NV2A 3TB2A 5D73A 4AJ8A 4IKHA 1OAZA 2IL3A 2VD1A 2YV9A 4XRAA 1SVLA 1EOHA 2FGXA 4BWQA 3GH6A 5A4UA 2BJXA 3ME8A 4BVYB 1WWJA 5F8BA 2L59A 1Y6EA 4JR4A 3TKRA 3ZFBA 1AQWA 1FOVA 3PR8A 1JZDA 5KEJA 3QAGA 4IQAA 5IMCA 3D6IA 2LTKA 3FHKA 4IJIA 5HR0A 2XC2A 3LXZA 3ZIVA 5IO0A 3M3MA 3IAS2 5F0GA 4JZQA 1SL0B 2F3MA 1M7TA 3MNGA 4K2DA 3LW9A 4ECBA 3P8WA 1U87A 4RI6A 3E3EA 3L9SA 1OE8A 4ZB9A 2EC4A 2F8AA 2AUVA 4ECJA 4IS0A 4JBBA 2A2SA 4PNGA 3HMJG 4G01A 1E6BA 2B5EA 4MABA 2R2JA 3Q19A 2HXKA 4F9ZA 3ZITA 5CAXA 4MA9A 2R0CA 2H76A 2O5VA 4GSTA 3GX8A 1MD3A 3Q18A 3IBHA 1Z7RA 5GAND 2X99A 5LNKe 2LS5A 4G19A 1TI3A 2BTOT 2VD0A 3HJPA 2GTUA 5J3RA 3C1SA 3MDKA 4YAPA 2B7KA 3EU4A 1TK0B 4KE3A 2KLXA 2LV3A 3TJFA 5E59A 1M9BA 7GSSA 5D8IA 4RQRA 5A5HA 4IVFA 1JZOA 3ZLPA 1PL1A 4RI7A 1A2LA 4HS1A 3HD5A 5IIZA 1CQGA 2DJ1A 4AGSA 1K0OA 1IYHA 4TRXA 1BJXA 3A2WA 2I4AA 3DKSA 1PX6A 4GF0A 2M80A 2CX3A 2I9HA 2ZUPA 1QQ2A 3A5WA 3QR6A 2ZCTA 1OC3A 1B4PA 1F37A 1YKCA 1PSQA 1ZGNA 5EL8A 1KNGA 3MYDA 1XCCA 4K9ZA 1TK5B 6GSTA 1YVLA 1TP9A 3FR6A 2PWJA 3D4MA 5H5SA 1N8JA 3N5OA 3ZMLA 2HRFA 3ED3A 1GWCA 2YJHA 5A5HB 2QC7A 3P7XA 2X4AA 2CT6A 1BYEA 3IE3A 5AISA 1ACVA 2KP1A 2RIIA 3C8EA 3CSHA 2A4VA 3GHAA 3O6TA 5J4UA 5E4WA 4Q5QA 1GSSA 4WF4A 4ECCA 3D22A 3DEXA 3VK9A 5IQYA 2YOIA 1K0DA 2WDUA 1DUGA 1V2AA 5C00A 4TW5A 4ICYA 3APSA 4N3ZA 1M2BA 2LKUA 4FQUA 2IMIA 3EURA 4WBRD 1A0FA 2N5FA 3M1GA 1YF0A 1GTAA 1SVMA 1ZYEA 3RAZA 1GUKA 5FT3A 6GSYA 2HSNA 3N9JA 2V6OA 4OD7A 1NW2A 5CYYA 1EV4A 18GSA 3TOUA 2GSSA 4ILFA 3TRXA 1SU9A 2IMEA 5A4VA 5AIVA 6GSVA 3KXOA 2LEGA 1J0FA 2VKZG 2EIOA 4G0LA 3LXTA 3UAPA 3KZQA 1GL8A 1USBA 3W8SA 4XS1A 1QK8A 4MH3A 2H0GA 1FB0A 2JACA 3QFAC 2YWOA 5INYA 3TKQA 4PGTA 2GGTA 5GSSA 5JCGA 4DSSA 3BJ5A 3VI5A 4EIQA 1A2MA 1O8XA 4PUAA 2HZFA 3ZTLA 4KDUA 2HSNB 2YCDA 1O73A 3GIXA 4FO5A 1SKWB 1SJZA 2KOKA 3LYKA 2D2ZA 22GSA 3TUEA 2PN8A 2GS3A 5LD0A 5J5NA 4NHWA 2VLUA 3IAM2 1T4YA 3GKKA 4Z2UA 4MJEA 1FO5A 2LRTA 2VLTA 4MLYA 1XXUA 4WEYA 2H1GA 2HI7A 5AGYA 3Q74A 4G10A 2VCXA 4D73A 2V6KA 2X8HA 2HE3A 4I2TA 4DSSB 3CRTA 1K0CA 4EF0A 4L5OA 1YY7A 4AKXB 5CREA 4POBA 4O7HA 1Z3EA 3C73A 3TU3B 1XIYA 2H0IA 4AKIA 3RPNA 2H71A 2GSTA 3AY8A 4KA0A 5COHA 4HOJA 1MDJA 2A2PA 1K0AA 4AKGA 3WYWA 3FMWA 5IMZA 3JCML 2FWGA 4IQ1A 1XWAA 4PNFA 1YEXA 3G7JA 1URMA 5IO2A 4HZ2A 1XW6A 4D73B 4F82A 1XW5A 1UVZA 2H74A 5DJMA 1O8WA 1GTIA 4EIPA 3KMNA 2KUCA 2X49A 5DQSA 1B9XC 1PKWA 3F8UA 3TKSC 2HRNA 2Z9SA 3S9FA 2BMXA 3QCPA 4IJ3A 2QGVA 1PD21 3F3RA 5IOWA 3HVSA 3H93A 2E7PA 3D4TA 4KUNA 2L6DA 1K3YA 2R5GA 2DJJA 2WZ9A 1XWBA 2YZHA 3CXGA 2EIQA 5IMFA 4XIHA 2CAQA 1YJ6A 19GSA 2JZRA 1AXDA 3F6DA 2X8GA 3KM6A 4XS6A 3BCKA 3FZ4A 5ECRB 1QXHA 2AHEA 1TJDA 3M8NA 2PUKC 2IMKA 3U5RE 4KCEA 4N30A 3ERWA 1SL1B 2DLXA 1X5EA 3HVVA 2HSHA 2FWEA 5KN0A 3KTLA 4WF5A 2WFCA 3H8QA 1FG4A 2HLSA 2KP2A 5F07A 1MDKA 2WS2A 3VLNA 3IPZA 3TJBA 1GTUA 2DJKA 1M2DA 2J9HA 2REMA 3EINA 3FR9A 1QMVA 1TW9A 2FNOA 4O92A 3VPQA 4MZBA 5ECLB 4N11A 4HZ4A 4MZCA 4OCEA 2OE1A 4MH2A 4WETA 4POMA 2HSYA 2DKIA 5IOXA 1XOAA 4EC0A 2P31A 4N10A 1TRWA 4F0CA 1GUMA 3GH9A 5IMDA 1PQNA 2DJ3A 3EC3A 2GVPA 1THOA 5ECHB 5DDLA 1F6MC 4JR6A 2VAFA 2VUPA 1I5GA 2ON7A 1ML6A 4IN0A 4FIWA 1JLVA 3F4SA 3EYTA 4Q5NA 2QKEA 5HR2A 1HNBA 4PQHA 1WRYA 1XFLA 1T4ZA 1AW9A 2N5AA 3UVTA 5ECSA 5D9TA 2DIYA 3A5IA 3WGDA 4LL4B 5JWOB 4FYUA 5IMVA 1VF4A 1V98A 3L4NA 2OACA 2F9SA 4KSMA 2LJKA 2CVDA 4ID0A 1SJ6A 4V2MA 4GLTA 1B9YC 4ML6A 1KTEA 4KDXA 2YJ7A 5D93A 5HFIA 3DIEA 1S3DA 4LL1B 3E0UA 2H01A 1M2AA 2VLVA 2I1UA 1U3AA 3P90A 1Y25A 2H70A 4KCAA 1VF3A 4JE1A 5ABRA 5CNWA 5EPFA 1Z9HA 3DWVA 3I6AA 3QAWA 2NTOA 5DAKA 4HQSA 2E2MA 1EGRA 4GCIA 4L0WA 2IMDA 4WXTA 4HU7A 5KN2A 5HFGA 1Q4JA 3F3QA 3UARA 2RUFA 3WD6A 13GSA 2VO4A 1U88A 4MDCA 1EOGA 4O5QA 1A8LA 3LEFA 3UOMA 1EEJA 2YP6A 4MJBA 4DSQA 2QSIA 4GQFA 3UL3A 2LRCA 1FOHA 2KHPA 4IGJA 5JWRB 4K0GA 3NZNA 3TRPA 4ZB6A 5DAKB 4YKFA 2HQTA 1THXA 5J9BA 1TXXA 1PRXA 2XPDA 1E2YA 3EVIA 3QFBC 2XBIA 4G2EA 2MMAA 2L6CA 2H6XA 2VCTA 3P2AA 2GQLA 1UN2A 1CQHA 3GNJA 2V32A 5H5RA 2HNLA 1JZRA 3CYNA 2EFCA 1TXUA 4ZBDA 4ULXA 4PTSA 1J9BA 1HNCA 4N0ZA 4L5LA 10GSA 2K8SA 2TRXA 5HQPA 2LRNA 1T00A 1ZYQB 3TJJA 4F2IA 1DBYA 4GSNA 3GFKA 2J23A 4JU5A 4V2NA 3O76A 1XWKA 2NVLA 1TTZA 2VCQA 2P5RA 5G31A 3CWGA 2YPMA 3HKRA 1SKRB 3FRCA 2NPBA 2TRCP 1F9MA 4I8BA 2JSYA 1B4QA 4K7IA 2GDRA 1GNEA 2LNTA 3L78A 1OKTA 3R3EA 2GT5A 1A24A 2H73A 2CA8A 3MIXA 3GN3A 3KP9A 2X64A 1XOBA 4ZL7A 1N2AA 2K8VA 1S3CA 5DJLA 2MMNA 3RHCA 3ERFA 4MPFA 2VM1A 3NOFA 4KNDA 4ZBAA 2AYTA 3A3TA 5GSTA 5D9XA 4ZBBA 2H1AA 2A2RA 2HRAA 1JZWA 3KD0A 2OKAA 5B6MA 2C3QA 3MWHA 1G6WA 3GL3A 3LWAA 4KSOA 5C04A 20GSA 2YN1A 3G7YA 1A2JA 3HZ8A 1LBKA 3I69A 1GTBA 3DVXA 1SD8A 3EWLA 4ISDA 2YZUA 2CVKA 5KN3A 5H5QA 4N0VA 1BX9A 3NIVA 2MBTA 3GSSA 4XRDA 5DQYA 3LG6A 3KGKA 3PINA 2H19A 1X9SB 3GSTA 12GSA 4PURA 3G7IA 1KBNA 2FA4A 5CO3A 1X9WB 2F8FA 5D9WA 1DE2A 2FWHA 2LJRA 4KW6A 1TKDB 2IJYA 4MJAA 3BOAA 1GSQA 4LMVA 4CY8A 2DKHA 3HJMA 4YQVA 3GMFA 3CMIA 4EKZA 2I3YA 1MDIA 3H4KA 4CY6A 2DIZA 2JADA 2B3SA 1FVKA 5FWGA 1SYXA 1PA3A 5IM9A 1HNAA 5ECPB 1N25A 2HRKA 4Q5RA 1V40A 2ALBA 1YKAA 4EL1A 4USSA 5HR1A 4GRFA 3HYPA 2H66A 4HEA2 4MF5A 2C0DA 3ZVJD 3VWXA 3IOSA 3M0FA 5A1NA 1EEMA 4F0BA 5J4YA 4TXOA 2JZSA 1TDIA 1XW9A 4ZL8A 5HR3A 5B7CA 3Q6OA 9GSSA 3I43A 1AUCA 5B8BA 4MF6A 4LMWA 3WGEA 3FZAA 4K0NA 5EY6A 2EFHA 2NBSA 2RLIA 4K7NA 1TK8B 4GQCA 1VF2A 2H0HA 5A34A 3O3TA 3L9UA 4HU9A 1AQVA 2HRKB 1BQ7A 4EDYA 4OO5A 3ZFLA 3FR3A 3TKSE 3LQ7A 2YWIA 2B6MA 2FY6A 3IV4A 3RBTA 4GSSA 3HXSA 4AF2A 3LFLA 3F0IA 3APOA 5A1NB 2PMTA 4E68A 4Z7XA 5G2ZA 4K6XA 1K3LA 5G1KA 4TXOB 3U6VA 3IC8A 2RM6A 3HVXA 3A2XA 3FY7A 3DVWA 4MNNA 1GSYA 3QPMA 4POKA 1B8XA 2XBQA 2H1LA 3CSIA 3M9JA 5G5EA 3ZVJA 5A34B 3TOTA 2C3TA 16GSA 4X0XA 1GNWA 5ELGA 3IRAA 3GKNA 1ERUA 1JHBA 2H6ZA 4EXJA 3MAKA 3A2VA 2VL2A 1ZMAA 5A4WA 2O7KA 3BCIA 2H1BA 2RUEA 1FHEA 3KH9A 4ZL9A 5IPHA 1GP1A 3D0ZA 1A0RP 1WIKA 2AV4A 4IHUA 3TGZA 3KIJA 2YWNA 3UBLA 5KOWA 1ST9A 3TKPA 5DCGA 1PN9A 3IK7A 3G9BA 1X5CA 4QQ7A 4WKWA 1QGVA 5FHIA 2L4CA 2QA2A 3D5JA 2WCIA 3DRNA 1V9WA 2K6VA 3EMXA 3J7Yk 1IYIA 4KB3A 2CX4A 1GSDA 3ZMKA 4POLA 3GUSA 2WGRA 3HCZA 3RHBA 4MK3A 1TU7A 4E8EA 4OCFA 5F06A 4DEJA 4IBPA 2EIRA 3CTFA 4AJ7A 3CRUA 1Z7PA 1WJKA 5G30A 1T3BA 2CQ9A 1TI1A 4RQXA 1XWGA 1QUWA 3IDVA 4CHSA 2PVOC 4G0KA 1Z5YE 2IWTA 4HDEA 3IR4A 1XBSA 4QMKA 2PPTA 2PERA 4RUVA 2XHFA 1TRUA 3GX0A 4X1UA 1BEDA 4L0UA 1FB6A 5ECQB 1TRVA 3QMXA 2PGTA 4OMVA 3UVHA 4JRRA 4TR4A 2LSTA 1G0TA 4OFTA 2EFEA 3H79A 2FD3A 1X9MB 5ECKB 2IFQA 3UBKA 4K2XA 1SVOA 4DVCA 4K8MA 3GKXA 1Z6NA 4AJ6A 5G1LA 4ECIA 2LQQA 5ELAA 3GV1A 2V1MA 1F3BA 4ZXGA 3IXRA 4BWSA 4TR0A 6GSWA 1JLWA 3K8NA 4HJ2A 1PN0A 2WB9A 1VF1A 3QAVA 3RPPA 2CZ3A 5IMAA 2O89A 3GA4A 4K5RA 4LLRA 1H4OA 1V58A 4MCUA 3TCOA 2MMOA 4Z2RA 4IW9A 2C80A 5GAPD 5ECNB 5DALA 1SK2A 3VWWA 2H8LA 1YEPA 4E8HA 2IFQB 3C1RA 3HHVA 2FA8A 4V2LA 4FH8A 3HDCA 2FLSA 1JFUA 2GSQA 6GSXA 1ABAA 2V41A 3CBUA 1W89A 4GWRA 1HQOA 3QDNA 1SK1A 1LJRA 4K1FA 1ERTA 4KGIA 5CRWA 3SBCA 3W6GA 3F9UA 1XZOA 1BG1A 2P0GA 2VL3A 2PU9C 2LNSA 2C1YA 1ON4A 1NM3A 2C0FA 2FWFA 3I9V2 2CVBA 1GSFA 4YQMA 4HI7A 3SWLA 3C7MA 2VOCA 4QL9A 1F3AA 4CW9A 1BF5A 5DALB 1WOUA 1RW1A 3RDWA 4PX1A 1PL2A 2OBIA 4HJMA 3LGCA 2IMFA 4V1Ap 1OYJA 4I2UA 3US3A 1K0MA 5AN1A 4ML1A 3UEMA 2GZZA 4KAEA 4J57E 4NV5A 1Y1UA 2OE0A 3IHQA 2R37A 2DBCA 1ERVA 1T8EB 4DSRA 5CP1A 2P5QA 2R0GA 1V57A 3PH9A 2HSMA 2HFDA 3FW2A 2DC5A 4G0IA 1U6TA 4GDFA 3GURA 2VM2A 4MF7A 1WPIA 4NWYA 3H1NA 2HZEA 3KJYA 3QD9A 4WR5A 1Q98A 1A23A 3ZIJA 2O87A 3MSZA 1GRXA 5G5FA 2X8CA 1AAZA 1OC9A 2CAIA 4XTSA 3KCMA 2E2GA 2NDOA 4PUFC 3F63A 2A4HA 3KTBA 2OBKA 1YDKA 2AAWA 1FVJA 3EMPA 2GZYA 2B5YA 5BMUA 3GTUA 2UV8G 2H72A 4YAVA 5DVBA 4HUAA 3J7Yb 2DMMA 2VCVA 1XWCA 3DXBA 2HSMB 5ID2A 1FW1A 2E0QA 3GYKA 2QA1A 3PGTA 4ZB7A 2YWMA 3WT1A 2JZTA 3FZ9A 1R7HA 1OE7A 6GSSA 1QFNA 3D21A 3QOUA 2YV7A 4TR3A 2MZCA 4GXZA 2HZEB 1SL2B 1HYUA 8GSSA 4AKHA 1SKSB 5ECIB 2GT6A 1OC9B 3E9JB 4TOPA 2K18A 3EE2A 3LJRA 3PPUA 1ZCPA 3F4TA 2C4JA 1O6JA 2H75A 3WT2A 5BMUB 4EVMA 3GTUB 2FHEA 3BD2A 1UA5A 1M99A 2GQMA 1YF1A 1Z6MA 5J47A 2C0EA 1S3AA 2G2QA 1T7PB 1GSUA 5B6NA 1OKDA 3FYGA 4Q5FA 2C0GA 5ID2B 4TVEA 1VGLA 1ZZYA 1K0BA 4IP6A 4A5PA 4J56E 1W4VA 2H1DA 4IP1A 1J08A 1F2EA 4PQ1A 1R5PA 3HZ4A 4L8EA 2IIYA 2PVQA 4NMUA 1GLPA 1O81A 1SYRA 3ZYWA 2FUG2 2VL9A 1NHOA 5ECOB 4NHZA 2R3XA 1R5AA 1RQMA 3KEBA 2GLRA 5D9VA 4OFNA 3VI7A 5BRTA 3UIWA 1DSBA 3TRQA 4ZILA 3LORA 2OADA 4CDOA 5ECMB 4KDYA 3EU3A 3ZZXA 1B48A 3FZ5A 4JEDA 1X0RA 1EV9A 4NXIA 1G6YA 2HYXA 5J9CA 1PMTA 3LYPA 5IPGA 3GRXA 3TDGA 1G7EA 2PBJA 2K9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IN3 A;  3ISO A;  5KN1 A;  3BBY A;  3APQ A;  3HA9 A;  4XHM A;  4O5R A;  2L4Q A;  1I9D A;  2H30 A;  3M9K A;  2VCW A;  1X5D A;  3DD3 A;  5B8A A;  4PQI A;  2N5B A;  1EZK A;  3VFI A;  2O8V B;  2C3N A;  1DE1 A;  5CRG A;  2AJQ B;  4TR1 A;  3VWV A;  3WGX A;  1OVN A;  2MMZ A;  4G9H A;  4KH7 A;  1VRS D;  1C72 A;  5LCZ A;  1ZL9 A;  1GH2 A;  3ME7 A;  5AIX A;  4TN8 A;  2LJA A;  1GLQ A;  1OC8 A;  2GSR A;  2R6K A;  4LA1 A;  2C8U A;  2LUS A;  1NHY A;  4IEL A;  2OJL A;  4F03 A;  5A5K A;  5JCW A;  4BA7 A;  3VUR A;  4TXV A;  4WBJ A;  5D96 A;  3IC4 A;  3CTG A;  3FEU A;  4EUY A;  3ZRD A;  4KX4 A;  4TR1 B;  1GUH A;  5HFK A;  1MTC A;  4ZB8 A;  2O85 A;  1TOF A;  3C71 A;  1MEK A;  4TKY A;  4MPG A;  3F4R A;  1UC7 A;  4ZIJ A;  2RM5 A;  2VCZ A;  1WMJ A;  2B5X A;  1GSE A;  1SJI A;  2M46 A;  3F6F A;  3VWU A;  3DYR A;  2WRT A;  4H86 A;  2ZNM A;  2TIR A;  3TKS A;  3TJG A;  3KP8 A;  2GQK A;  1AIU A;  3HJO A;  1WP0 A;  1O7U A;  4I97 A;  4FYC A;  2CZ2 A;  3GL5 A;  3KMO A;  1EWX A;  1PX7 A;  2G0F A;  4BL7 A;  2B7J A;  3ZRE A;  4KF9 A;  5CRD A;  2L5O A;  2JU5 A;  2JSZ A;  2ON5 A;  1SEN A;  2ES7 A;  1EP7 A;  4YQU A;  4OFM A;  2GZP A;  2LQO A;  2B1K A;  4YH2 A;  4I5Q A;  2I81 A;  3R2Q A;  6GSU A;  1G7O A;  1LU4 A;  4XCS A;  4QL7 A;  2AB6 A;  1TRS A;  5L71 A;  4OO4 A;  4O32 A;  1SK0 A;  1M0U A;  4MMM A;  4BVX A;  1FAA A;  2DJ2 A;  2H6Y A;  2WUL A;  3IK9 A;  2M72 A;  3IA1 A;  5F05 A;  3FK8 A;  1BG5 A;  4XS4 A;  11GS A;  1O85 A;  3L0H A;  1AC1 A;  1SD9 A;  2DML A;  1XVW A;  1R26 A;  1K3O A;  5ENU A;  2DSA A;  1AQX A;  3TJK A;  3HY2 A;  3ERG A;  3ZL5 A;  4BL7 B;  4NAX A;  1YZX A;  3DML A;  5CRH A;  4X43 A;  2VL2 C;  2JL4 A;  3GKM A;  2VIM A;  4MP4 A;  2CV4 A;  3UMA A;  4K7O A;  1YQ1 A;  4ACS A;  1ZOF A;  1TU8 A;  1PKZ A;  2HT9 A;  5GZZ B;  4GTU A;  1MD4 A;  4WR4 A;  3UJ1 A;  4BVX B;  1T1V A;  1BAY A;  1A8Y A;  1KEB A;  5EVO A;  3L9V A;  1XPV A;  4XS4 B;  3KH7 A;  3LSZ A;  1ERW A;  5DBQ A;  5JWQ B;  5J41 A;  5JCU A;  2FCH A;  2MBS A;  1U3I A;  3DGQ A;  4MJC A;  4I6X A;  4EO3 A;  2UZ8 A;  2OE3 A;  4MZW A;  3W8J A;  2MYG A;  1EP8 A;  4EDZ A;  4PXO A;  1H75 A;  4P3Y B;  1M9A A;  2F51 A;  1GUL A;  2WJU A;  4FYB A;  1K0N A;  3OR5 A;  1XVQ A;  2YNX A;  1ILO A;  2DJ0 A;  2V2G A;  4HQZ A;  17GS A;  4BVY A;  4V1A g;  3V1W A;  5DCH A;  2R4V A;  1HD2 A;  2L5L A;  1PGT A;  4OWY A;  2IPA A;  2YAN A;  2OA7 A;  4J2F A;  2XPE A;  1NSW A;  4BPY A;  1R4W A;  3VPT A;  3CSJ A;  14GS A;  1RK4 A;  1EGO A;  2L57 A;  3FKF A;  4NPB A;  1WE0 A;  2B1L A;  4EE0 A;  4NV2 A;  3TB2 A;  5D73 A;  4AJ8 A;  4IKH A;  1OAZ A;  2IL3 A;  2VD1 A;  2YV9 A;  4XRA A;  1EOH A;  2FGX A;  4BWQ A;  3GH6 A;  5A4U A;  2BJX A;  3ME8 A;  4BVY B;  1WWJ A;  5F8B A;  2L59 A;  1Y6E A;  4JR4 A;  3TKR A;  3ZFB A;  1AQW A;  1FOV A;  3PR8 A;  1JZD A;  5KEJ A;  3QAG A;  4IQA A;  5IMC A;  3D6I A;  2LTK A;  3FHK A;  4IJI A;  5HR0 A;  2XC2 A;  3LXZ A;  3ZIV A;  5IO0 A;  3M3M A;  3IAS 2;  5F0G A;  4JZQ A;  1SL0 B;  2F3M A;  1M7T A;  3MNG A;  4K2D A;  4ECB A;  3P8W A;  1U87 A;  4RI6 A;  3E3E A;  3L9S A;  1OE8 A;  4ZB9 A;  2EC4 A;  2F8A A;  2AUV A;  4ECJ A;  4IS0 A;  4JBB A;  2A2S A;  4PNG A;  1E6B A;  2B5E A;  4MAB A;  2R2J A;  3Q19 A;  2HXK A;  4F9Z A;  3ZIT A;  5CAX A;  4MA9 A;  2H76 A;  4GST A;  3GX8 A;  1MD3 A;  3Q18 A;  3IBH A;  1Z7R A;  5GAN D;  2X99 A;  5LNK e;  2LS5 A;  4G19 A;  1TI3 A;  2BTO T;  2VD0 A;  3HJP A;  2GTU A;  5J3R A;  3C1S A;  3MDK A;  4YAP A;  2B7K A;  3EU4 A;  1TK0 B;  4KE3 A;  2KLX A;  2LV3 A;  3TJF A;  5E59 A;  1M9B A;  7GSS A;  5D8I A;  4RQR A;  4IVF A;  1JZO A;  3ZLP A;  1PL1 A;  4RI7 A;  1A2L A;  4HS1 A;  3HD5 A;  5IIZ A;  1CQG A;  2DJ1 A;  4AGS A;  1K0O A;  1IYH A;  4TRX A;  1BJX A;  3A2W A;  2I4A A;  3DKS A;  1PX6 A;  4GF0 A;  2M80 A;  2CX3 A;  2I9H A;  2ZUP A;  1QQ2 A;  3A5W A;  3QR6 A;  2ZCT A;  1OC3 A;  1B4P A;  1F37 A;  1YKC A;  1PSQ A;  1ZGN A;  5EL8 A;  1KNG A;  1XCC A;  4K9Z A;  1TK5 B;  6GST A;  2PWJ A;  1TP9 A;  3FR6 A;  3D4M A;  5H5S A;  1N8J A;  3N5O A;  3ZML A;  2HRF A;  3ED3 A;  1GWC A;  2YJH A;  2QC7 A;  3P7X A;  2CT6 A;  1BYE A;  3IE3 A;  5AIS A;  1ACV A;  2KP1 A;  2RII A;  3C8E A;  3CSH A;  2A4V A;  3GHA A;  3O6T A;  5J4U A;  5E4W A;  4Q5Q A;  1GSS A;  4WF4 A;  4ECC A;  3D22 A;  3DEX A;  3VK9 A;  5IQY A;  2YOI A;  1K0D A;  2WDU A;  1DUG A;  1V2A A;  5C00 A;  4TW5 A;  3APS A;  1M2B A;  2LKU A;  4FQU A;  2IMI A;  3EUR A;  4WBR D;  1A0F A;  2N5F A;  3M1G A;  1YF0 A;  1GTA A;  1ZYE A;  3RAZ A;  1GUK A;  5FT3 A;  6GSY A;  4OD7 A;  3N9J A;  2V6O A;  1NW2 A;  5CYY A;  1EV4 A;  18GS A;  3TOU A;  2GSS A;  4ILF A;  3TRX A;  1SU9 A;  2IME A;  5A4V A;  5AIV A;  6GSV A;  3KXO A;  2LEG A;  1J0F A;  2EIO A;  4G0L A;  3LXT A;  3UAP A;  3KZQ A;  1GL8 A;  1USB A;  3W8S A;  4XS1 A;  1QK8 A;  4MH3 A;  2H0G A;  1FB0 A;  2JAC A;  3QFA C;  2YWO A;  5INY A;  3TKQ A;  4PGT A;  2GGT A;  5GSS A;  5JCG A;  4DSS A;  3BJ5 A;  3VI5 A;  1A2M A;  1O8X A;  4PUA A;  2HZF A;  3ZTL A;  4KDU A;  2HSN B;  2YCD A;  1O73 A;  3GIX A;  4FO5 A;  1SKW B;  1SJZ A;  2KOK A;  3LYK A;  2D2Z A;  22GS A;  3TUE A;  2PN8 A;  2GS3 A;  5LD0 A;  5J5N A;  4NHW A;  2VLU A;  3IAM 2;  1T4Y A;  3GKK A;  4MJE A;  1FO5 A;  2LRT A;  2VLT A;  4MLY A;  1XXU A;  4WEY A;  2H1G A;  2HI7 A;  5AGY A;  3Q74 A;  4G10 A;  2VCX A;  4D73 A;  2V6K A;  2X8H A;  2HE3 A;  4I2T A;  4DSS B;  3CRT A;  1K0C A;  4EF0 A;  4L5O A;  1YY7 A;  5CRE A;  4POB A;  4O7H A;  1Z3E A;  3C73 A;  1XIY A;  2H0I A;  3RPN A;  2H71 A;  2GST A;  3AY8 A;  4KA0 A;  5COH A;  4HOJ A;  1MDJ A;  1K0A A;  3WYW A;  5IMZ A;  3JCM L;  2FWG A;  4IQ1 A;  1XWA A;  4PNF A;  1YEX A;  3G7J A;  1URM A;  5IO2 A;  4HZ2 A;  1XW6 A;  4D73 B;  4F82 A;  1XW5 A;  1UVZ A;  2H74 A;  5DJM A;  1O8W A;  1GTI A;  3KMN A;  2KUC A;  5DQS A;  1B9X C;  1PKW A;  3F8U A;  3TKS C;  2HRN A;  2Z9S A;  3S9F A;  2BMX A;  3QCP A;  4IJ3 A;  2QGV A;  1PD2 1;  3F3R A;  5IOW A;  3HVS A;  3H93 A;  2E7P A;  3D4T A;  4KUN A;  2L6D A;  1K3Y A;  2R5G A;  2DJJ A;  2WZ9 A;  1XWB A;  2YZH A;  3CXG A;  2EIQ A;  5IMF A;  4XIH A;  2CAQ A;  1YJ6 A;  19GS A;  2JZR A;  1AXD A;  3F6D A;  2X8G A;  3KM6 A;  4XS6 A;  3BCK A;  3FZ4 A;  5ECR B;  1QXH A;  2AHE A;  1TJD A;  3M8N A;  2PUK C;  2IMK A;  3U5R E;  4KCE A;  4N30 A;  3ERW A;  1SL1 B;  2DLX A;  1X5E A;  3HVV A;  2HSH A;  2FWE A;  5KN0 A;  3KTL A;  4WF5 A;  2WFC A;  3H8Q A;  1FG4 A;  2HLS A;  2KP2 A;  5F07 A;  1MDK A;  2WS2 A;  3VLN A;  3IPZ A;  3TJB A;  1GTU A;  2DJK A;  1M2D A;  2J9H A;  2REM A;  3EIN A;  3FR9 A;  1QMV A;  1TW9 A;  2FNO A;  4O92 A;  3VPQ A;  4MZB A;  5ECL B;  4N11 A;  4HZ4 A;  4MZC A;  4OCE A;  2OE1 A;  4MH2 A;  4WET A;  4POM A;  2HSY A;  5IOX A;  1XOA A;  4EC0 A;  2P31 A;  4N10 A;  1TRW A;  4F0C A;  1GUM A;  3GH9 A;  5IMD A;  1PQN A;  2DJ3 A;  3EC3 A;  2GVP A;  1THO A;  5ECH B;  5DDL A;  1F6M C;  4JR6 A;  2VAF A;  2VUP A;  1I5G A;  2ON7 A;  1ML6 A;  4IN0 A;  4FIW A;  1JLV A;  3F4S A;  3EYT A;  4Q5N A;  2QKE A;  5HR2 A;  1HNB A;  4PQH A;  1WRY A;  1XFL A;  1T4Z A;  1AW9 A;  2N5A A;  3UVT A;  5ECS A;  5D9T A;  2DIY A;  3WGD A;  4LL4 B;  5JWO B;  4FYU A;  5IMV A;  1VF4 A;  1V98 A;  3L4N A;  2OAC A;  2F9S A;  4KSM A;  2LJK A;  2CVD A;  4ID0 A;  1SJ6 A;  4V2M A;  4GLT A;  1B9Y C;  4ML6 A;  1KTE A;  4KDX A;  2YJ7 A;  5D93 A;  5HFI A;  3DIE A;  1S3D A;  4LL1 B;  3E0U A;  2H01 A;  1M2A A;  2VLV A;  2I1U A;  1U3A A;  3P90 A;  1Y25 A;  2H70 A;  4KCA A;  1VF3 A;  4JE1 A;  5ABR A;  5CNW A;  5EPF A;  1Z9H A;  3DWV A;  3I6A A;  3QAW A;  2NTO A;  5DAK A;  4HQS A;  2E2M A;  1EGR A;  4GCI A;  4L0W A;  2IMD A;  4WXT A;  4HU7 A;  5KN2 A;  5HFG A;  1Q4J A;  3F3Q A;  3UAR A;  2RUF A;  3WD6 A;  13GS A;  2VO4 A;  1U88 A;  4MDC A;  1EOG A;  1A8L A;  3LEF A;  3UOM A;  1EEJ A;  2YP6 A;  4MJB A;  4DSQ A;  2QSI A;  4GQF A;  3UL3 A;  2LRC A;  2KHP A;  4IGJ A;  5JWR B;  4K0G A;  3NZN A;  3TRP A;  4ZB6 A;  5DAK B;  2HQT A;  1THX A;  5J9B A;  1TXX A;  1PRX A;  2XPD A;  1E2Y A;  3EVI A;  3QFB C;  2XBI A;  4G2E A;  2MMA A;  2L6C A;  2H6X A;  2VCT A;  3P2A A;  2GQL A;  1UN2 A;  1CQH A;  3GNJ A;  2V32 A;  5H5R A;  2HNL A;  1JZR A;  3CYN A;  4ZBD A;  4ULX A;  4PTS A;  1J9B A;  1HNC A;  4N0Z A;  4L5L A;  10GS A;  2K8S A;  2TRX A;  5HQP A;  2LRN A;  1T00 A;  1ZYQ B;  3TJJ A;  4F2I A;  1DBY A;  4GSN A;  3GFK A;  2J23 A;  4JU5 A;  4V2N A;  3O76 A;  1XWK A;  2NVL A;  1TTZ A;  2VCQ A;  2P5R A;  5G31 A;  2YPM A;  3HKR A;  1SKR B;  3FRC A;  2NPB A;  2TRC P;  1F9M A;  4I8B A;  2JSY A;  1B4Q A;  4K7I A;  2GDR A;  1GNE A;  2LNT A;  3L78 A;  1OKT A;  3R3E A;  2GT5 A;  1A24 A;  2H73 A;  2CA8 A;  3GN3 A;  3KP9 A;  2X64 A;  1XOB A;  4ZL7 A;  1N2A A;  2K8V A;  1S3C A;  5DJL A;  2MMN A;  3RHC A;  3ERF A;  4MPF A;  2VM1 A;  3NOF A;  4KND A;  4ZBA A;  2AYT A;  3A3T A;  5GST A;  5D9X A;  4ZBB A;  2H1A A;  2A2R A;  2HRA A;  1JZW A;  3KD0 A;  2OKA A;  5B6M A;  2C3Q A;  3MWH A;  1G6W A;  3GL3 A;  3LWA A;  4KSO A;  5C04 A;  20GS A;  2YN1 A;  3G7Y A;  1A2J A;  1LBK A;  3HZ8 A;  3I69 A;  1GTB A;  3DVX A;  1SD8 A;  3EWL A;  4ISD A;  2YZU A;  2CVK A;  5KN3 A;  5H5Q A;  4N0V A;  1BX9 A;  3NIV A;  2MBT A;  3GSS A;  4XRD A;  5DQY A;  3LG6 A;  3KGK A;  3PIN A;  2H19 A;  1X9S B;  3GST A;  12GS A;  4PUR A;  3G7I A;  1KBN A;  2FA4 A;  5CO3 A;  1X9W B;  2F8F A;  5D9W A;  1DE2 A;  2FWH A;  2LJR A;  4KW6 A;  1TKD B;  2IJY A;  4MJA A;  3BOA A;  1GSQ A;  4LMV A;  3HJM A;  4YQV A;  3GMF A;  3CMI A;  4EKZ A;  2I3Y A;  1MDI A;  3H4K A;  2DIZ A;  2JAD A;  2B3S A;  1FVK A;  5FWG A;  1SYX A;  1PA3 A;  5IM9 A;  1HNA A;  5ECP B;  2HRK A;  4Q5R A;  1V40 A;  2ALB A;  1YKA A;  4EL1 A;  4USS A;  5HR1 A;  4GRF A;  3HYP A;  2H66 A;  4HEA 2;  4MF5 A;  2C0D A;  3ZVJ D;  3VWX A;  3IOS A;  3M0F A;  4F0B A;  1EEM A;  4TXO A;  2JZS A;  1TDI A;  1XW9 A;  4ZL8 A;  5HR3 A;  3Q6O A;  5B7C A;  9GSS A;  3I43 A;  1AUC A;  5B8B A;  4MF6 A;  4LMW A;  3WGE A;  3FZA A;  4K0N A;  5EY6 A;  2NBS A;  2RLI A;  4K7N A;  1TK8 B;  4GQC A;  1VF2 A;  2H0H A;  3O3T A;  3L9U A;  4HU9 A;  1AQV A;  2HRK B;  1BQ7 A;  4EDY A;  4OO5 A;  3ZFL A;  3FR3 A;  3TKS E;  3LQ7 A;  2YWI A;  2B6M A;  2FY6 A;  3IV4 A;  3RBT A;  4GSS A;  3HXS A;  4AF2 A;  3LFL A;  3F0I A;  3APO A;  2PMT A;  4Z7X A;  5G2Z A;  4K6X A;  1K3L A;  5G1K A;  4TXO B;  3U6V A;  3IC8 A;  2RM6 A;  3HVX A;  3A2X A;  3FY7 A;  3DVW A;  1GSY A;  3QPM A;  4POK A;  1B8X A;  2XBQ A;  3CSI A;  3M9J A;  5G5E A;  3ZVJ A;  3TOT A;  2C3T A;  16GS A;  4X0X A;  1GNW A;  5ELG A;  3IRA A;  3GKN A;  1ERU A;  1JHB A;  2H6Z A;  4EXJ A;  3MAK A;  3A2V A;  2VL2 A;  1ZMA A;  5A4W A;  2O7K A;  3BCI A;  2H1B A;  2RUE A;  1FHE A;  3KH9 A;  4ZL9 A;  5IPH A;  1GP1 A;  3D0Z A;  1A0R P;  1WIK A;  2AV4 A;  4IHU A;  3TGZ A;  3KIJ A;  2YWN A;  3UBL A;  1ST9 A;  3TKP A;  5DCG A;  1PN9 A;  3IK7 A;  3G9B A;  1X5C A;  4QQ7 A;  4WKW A;  1QGV A;  5FHI A;  2L4C A;  3D5J A;  2WCI A;  3DRN A;  1V9W A;  2K6V A;  3EMX A;  3J7Y k;  1IYI A;  4KB3 A;  2CX4 A;  1GSD A;  3ZMK A;  4POL A;  3GUS A;  2WGR A;  3HCZ A;  3RHB A;  4MK3 A;  1TU7 A;  4E8E A;  4OCF A;  5F06 A;  4DEJ A;  4IBP A;  2EIR A;  3CTF A;  4AJ7 A;  3CRU A;  1Z7P A;  1WJK A;  5G30 A;  1T3B A;  2CQ9 A;  1TI1 A;  4RQX A;  1XWG A;  1QUW A;  3IDV A;  4CHS A;  2PVO C;  4HDE A;  4G0K A;  1Z5Y E;  2IWT A;  3IR4 A;  1XBS A;  2PPT A;  2PER A;  4RUV A;  2XHF A;  1TRU A;  3GX0 A;  4X1U A;  1BED A;  4L0U A;  1FB6 A;  5ECQ B;  1TRV A;  3QMX A;  2PGT A;  4OMV A;  3UVH A;  4JRR A;  4TR4 A;  2LST A;  1G0T A;  4OFT A;  3H79 A;  2FD3 A;  1X9M B;  5ECK B;  2IFQ A;  3UBK A;  4DVC A;  4K8M A;  3GKX A;  1Z6N A;  4AJ6 A;  5G1L A;  4ECI A;  2LQQ A;  5ELA A;  3GV1 A;  2V1M A;  1F3B A;  4ZXG A;  3IXR A;  4BWS A;  4TR0 A;  6GSW A;  1JLW A;  3K8N A;  4HJ2 A;  2WB9 A;  1VF1 A;  3QAV A;  3RPP A;  2CZ3 A;  5IMA A;  2O89 A;  3GA4 A;  4LLR A;  1H4O A;  1V58 A;  4MCU A;  3TCO A;  2MMO A;  4IW9 A;  2C80 A;  5GAP D;  5ECN B;  5DAL A;  1SK2 A;  3VWW A;  2H8L A;  1YEP A;  4E8H A;  2IFQ B;  3C1R A;  3HHV A;  2FA8 A;  4V2L A;  4FH8 A;  3HDC A;  2FLS A;  1JFU A;  2GSQ A;  6GSX A;  1ABA A;  2V41 A;  3CBU A;  1W89 A;  4GWR A;  1HQO A;  3QDN A;  1SK1 A;  1LJR A;  4K1F A;  1ERT A;  4KGI A;  5CRW A;  3SBC A;  3W6G A;  3F9U A;  1XZO A;  2P0G A;  2VL3 A;  2PU9 C;  2LNS A;  2C1Y A;  1ON4 A;  1NM3 A;  2C0F A;  2FWF A;  3I9V 2;  2CVB A;  1GSF A;  4YQM A;  4HI7 A;  3SWL A;  3C7M A;  2VOC A;  4QL9 A;  1F3A A;  4CW9 A;  5DAL B;  1WOU A;  1RW1 A;  3RDW A;  4PX1 A;  1PL2 A;  2OBI A;  4HJM A;  3LGC A;  2IMF A;  4V1A p;  1OYJ A;  4I2U A;  3US3 A;  1K0M A;  5AN1 A;  4ML1 A;  3UEM A;  2GZZ A;  4KAE A;  4J57 E;  4NV5 A;  2OE0 A;  3IHQ A;  2R37 A;  2DBC A;  1ERV A;  1T8E B;  4DSR A;  5CP1 A;  2P5Q A;  1V57 A;  3PH9 A;  2HSM A;  2HFD A;  3FW2 A;  2DC5 A;  4G0I A;  1U6T A;  3GUR A;  2VM2 A;  4MF7 A;  1WPI A;  4NWY A;  3H1N A;  2HZE A;  3KJY A;  3QD9 A;  4WR5 A;  1Q98 A;  1A23 A;  3ZIJ A;  2O87 A;  3MSZ A;  1GRX A;  5G5F A;  2X8C A;  1AAZ A;  1OC9 A;  2CAI A;  4XTS A;  3KCM A;  2E2G A;  2NDO A;  4PUF C;  3F63 A;  3KTB A;  2OBK A;  1YDK A;  2AAW A;  1FVJ A;  3EMP A;  2GZY A;  2B5Y A;  5BMU A;  3GTU A;  2H72 A;  4YAV A;  5DVB A;  4HUA A;  3J7Y b;  2DMM A;  2VCV A;  1XWC A;  3DXB A;  2HSM B;  5ID2 A;  1FW1 A;  2E0Q A;  3GYK A;  3PGT A;  2YWM A;  3WT1 A;  2JZT A;  3FZ9 A;  1R7H A;  1OE7 A;  6GSS A;  1QFN A;  3D21 A;  3QOU A;  2YV7 A;  4TR3 A;  2MZC A;  4GXZ A;  2HZE B;  1SL2 B;  1HYU A;  8GSS A;  1SKS B;  5ECI B;  2GT6 A;  1OC9 B;  3E9J B;  4TOP A;  2K18 A;  3EE2 A;  3LJR A;  3PPU A;  1ZCP A;  3F4T A;  2C4J A;  1O6J A;  2H75 A;  3WT2 A;  4EVM A;  3GTU B;  2FHE A;  3BD2 A;  1UA5 A;  1M99 A;  2GQM A;  1YF1 A;  1Z6M A;  2C0E A;  1S3A A;  2G2Q A;  1T7P B;  1GSU A;  5B6N A;  1OKD A;  3FYG A;  4Q5F A;  2C0G A;  5ID2 B;  4TVE A;  1VGL A;  1ZZY A;  1K0B A;  4IP6 A;  4J56 E;  1W4V A;  2H1D A;  4IP1 A;  1J08 A;  1F2E A;  4PQ1 A;  1R5P A;  3HZ4 A;  4L8E A;  2IIY A;  2PVQ A;  4NMU A;  1GLP A;  1O81 A;  1SYR A;  3ZYW A;  2FUG 2;  2VL9 A;  1NHO A;  5ECO B;  4NHZ A;  2R3X A;  1R5A A;  1RQM A;  3KEB A;  2GLR A;  5D9V A;  4OFN A;  3VI7 A;  3UIW A;  1DSB A;  3TRQ A;  4ZIL A;  3LOR A;  2OAD A;  4CDO A;  5ECM B;  4KDY A;  3EU3 A;  3ZZX A;  1B48 A;  3FZ5 A;  4JED A;  1X0R A;  1EV9 A;  4NXI A;  1G6Y A;  2HYX A;  5J9C A;  1PMT A;  3LYP A;  5IPG A;  3GRX A;  3TDG A;  1G7E A;  2PBJ A;  2K9F A; 
#chains in the Genus database with same CATH topology
 2IN3 A;  3ISO A;  5KN1 A;  3BBY A;  3APQ A;  3HA9 A;  4XHM A;  4O5R A;  2L4Q A;  1I9D A;  2OT3 A;  2WVZ A;  2H30 A;  3M9K A;  2VCW A;  1X5D A;  3DD3 A;  5B8A A;  4PQI A;  2N5B A;  1EZK A;  3VFI A;  2O8V B;  2C3N A;  1DE1 A;  5CRG A;  2AJQ B;  4TR1 A;  3VWV A;  1I1I P;  3WGX A;  1OVN A;  2MMZ A;  4G9H A;  4KH7 A;  1VRS D;  1C72 A;  5LCZ A;  1ZL9 A;  1GH2 A;  3ME7 A;  5AIX A;  4TN8 A;  2LJA A;  1GLQ A;  1OC8 A;  2GSR A;  2R6K A;  4LA1 A;  2C8U A;  2LUS A;  1NHY A;  4IEL A;  2OJL A;  4F03 A;  5A5K A;  5JCW A;  4BA7 A;  2O3E A;  3VUR A;  4TXV A;  4WBJ A;  5D96 A;  3IC4 A;  3CTG A;  3FEU A;  4EUY A;  3ZRD A;  4KX4 A;  4TR1 B;  1GUH A;  5HFK A;  1MTC A;  4ZB8 A;  2O85 A;  1TOF A;  3C71 A;  1MEK A;  4TKY A;  4MPG A;  3F4R A;  1UC7 A;  4ZIJ A;  2RM5 A;  2VCZ A;  1WMJ A;  2B5X A;  1GSE A;  1SJI A;  2M46 A;  3F6F A;  3VWU A;  3DYR A;  2WRT A;  4H86 A;  2ZNM A;  2TIR A;  3TKS A;  3TJG A;  3KP8 A;  2GQK A;  5KOX A;  1AIU A;  3HJO A;  1WP0 A;  4W66 A;  4I97 A;  1O7U A;  4FYC A;  2CZ2 A;  3GL5 A;  3KMO A;  1EWX A;  1PX7 A;  2G0F A;  4BL7 A;  2B7J A;  3ZRE A;  4KF9 A;  5CRD A;  2L5O A;  3EPT A;  2JU5 A;  2JSZ A;  2ON5 A;  1SEN A;  2ES7 A;  1EP7 A;  4YQU A;  4OFM A;  2GZP A;  2LQO A;  2B1K A;  4YH2 A;  4I5Q A;  2I81 A;  3R2Q A;  6GSU A;  1G7O A;  1LU4 A;  4XCS A;  4QL7 A;  2AB6 A;  1TRS A;  5L71 A;  4OO4 A;  4O32 A;  1SK0 A;  1M0U A;  4MMM A;  4BVX A;  1FAA A;  2DJ2 A;  2H6Y A;  2WUL A;  3IK9 A;  2M72 A;  3IA1 A;  5F05 A;  3FK8 A;  1BG5 A;  4XS4 A;  11GS A;  1O85 A;  3L0H A;  1AC1 A;  1SD9 A;  2DML A;  1XVW A;  1R26 A;  1K3O A;  5ENU A;  2DSA A;  1ZYP A;  4YKG A;  1AQX A;  3TJK A;  3HY2 A;  3ERG A;  3ZL5 A;  4BL7 B;  4NAX A;  1YZX A;  3DML A;  5CRH A;  4X43 A;  2VL2 C;  2JL4 A;  3GKM A;  2VIM A;  4MP4 A;  2CV4 A;  3UMA A;  4K7O A;  1YQ1 A;  4ACS A;  1ZOF A;  1TU8 A;  1PKZ A;  2HT9 A;  5GZZ B;  4GTU A;  1MD4 A;  4WR4 A;  3UJ1 A;  4BVX B;  1T1V A;  1BAY A;  1A8Y A;  1KEB A;  5EVO A;  3L9V A;  1XPV A;  4XS4 B;  3KH7 A;  3LSZ A;  1ERW A;  5DBQ A;  5JWQ B;  5J41 A;  5JCU A;  2FCH A;  2MBS A;  1U3I A;  3DGQ A;  4MJC A;  4I6X A;  4EO3 A;  2UZ8 A;  5J40 A;  2OE3 A;  4MZW A;  3W8J A;  2MYG A;  1EP8 A;  4AI6 A;  4EDZ A;  4Z2T A;  4PXO A;  1H75 A;  4P3Y B;  1M9A A;  2F51 A;  1GUL A;  2WJU A;  4X4J A;  4FYB A;  1K0N A;  4PI2 C;  3OR5 A;  1XVQ A;  2YNX A;  1ILO A;  2DJ0 A;  2V2G A;  1ZYN A;  4HQZ A;  17GS A;  4BVY A;  4V1A g;  3V1W A;  5DCH A;  2R4V A;  1HD2 A;  2L5L A;  2R0P A;  1PGT A;  4OWY A;  2IPA A;  2YAN A;  4O5U A;  4K5S A;  2OA7 A;  4J2F A;  2XPE A;  1NSW A;  4BPY A;  1R4W A;  5J4V A;  3VPT A;  2WW0 A;  2EFD A;  3CSJ A;  14GS A;  1RK4 A;  1EGO A;  2L57 A;  3FKF A;  3IHG A;  4NPB A;  1WE0 A;  2B1L A;  4EE0 A;  4NV2 A;  3TB2 A;  5D73 A;  4AJ8 A;  4IKH A;  1OAZ A;  2IL3 A;  2VD1 A;  2YV9 A;  4XRA A;  1SVL A;  1EOH A;  2FGX A;  4BWQ A;  3GH6 A;  5A4U A;  2BJX A;  3ME8 A;  4BVY B;  1WWJ A;  5F8B A;  2L59 A;  1Y6E A;  4JR4 A;  3TKR A;  3ZFB A;  1AQW A;  1FOV A;  3PR8 A;  1JZD A;  5KEJ A;  3QAG A;  4IQA A;  5IMC A;  3D6I A;  2LTK A;  3FHK A;  4IJI A;  2WW1 A;  5HR0 A;  2XC2 A;  3LXZ A;  3ZIV A;  5IO0 A;  3M3M A;  3IAS 2;  5F0G A;  4JZQ A;  1SL0 B;  2F3M A;  1M7T A;  3MNG A;  4K2D A;  3LW9 A;  4ECB A;  3P8W A;  1U87 A;  4RI6 A;  3E3E A;  3L9S A;  1OE8 A;  4ZB9 A;  2EC4 A;  2F8A A;  2AUV A;  4ECJ A;  4IS0 A;  4JBB A;  2A2S A;  4PNG A;  3HMJ G;  4G01 A;  1E6B A;  2B5E A;  4MAB A;  2R2J A;  3Q19 A;  2HXK A;  4F9Z A;  3ZIT A;  5CAX A;  4MA9 A;  2R0C A;  2H76 A;  2O5V A;  4GST A;  3GX8 A;  1MD3 A;  3Q18 A;  3IBH A;  1Z7R A;  5GAN D;  2X99 A;  5LNK e;  2LS5 A;  4G19 A;  1TI3 A;  2BTO T;  2VD0 A;  3HJP A;  2GTU A;  5J3R A;  3C1S A;  3MDK A;  4YAP A;  2B7K A;  3EU4 A;  4HSC X;  1TK0 B;  4KE3 A;  2KLX A;  2LV3 A;  3TJF A;  5E59 A;  1M9B A;  1S4B P;  7GSS A;  5D8I A;  4RQR A;  5A5H A;  4IVF A;  1JZO A;  3ZLP A;  1PL1 A;  4RI7 A;  1A2L A;  4HS1 A;  3HD5 A;  5IIZ A;  1CQG A;  2DJ1 A;  4AGS A;  1K0O A;  1IYH A;  4TRX A;  1BJX A;  3A2W A;  2I4A A;  3DKS A;  1PX6 A;  4GF0 A;  2M80 A;  2CX3 A;  2I9H A;  2ZUP A;  1QQ2 A;  3A5W A;  3QR6 A;  2ZCT A;  1OC3 A;  1B4P A;  1F37 A;  1YKC A;  1PSQ A;  1ZGN A;  5EL8 A;  1KNG A;  3MYD A;  1XCC A;  4K9Z A;  1TK5 B;  6GST A;  1YVL A;  1TP9 A;  3FR6 A;  2PWJ A;  3D4M A;  5H5S A;  1N8J A;  3N5O A;  3ZML A;  2HRF A;  3ED3 A;  1GWC A;  2WW2 A;  2YJH A;  5A5H B;  2QC7 A;  3P7X A;  2X4A A;  2CT6 A;  1BYE A;  3IE3 A;  5AIS A;  1ACV A;  2KP1 A;  2RII A;  3C8E A;  3CSH A;  2A4V A;  3GHA A;  3O6T A;  5J4U A;  5E4W A;  4Q5Q A;  4FXY P;  1GSS A;  4WF4 A;  4ECC A;  3D22 A;  3DEX A;  3VK9 A;  5IQY A;  2YOI A;  1K0D A;  2WDU A;  1DUG A;  1V2A A;  5C00 A;  4TW5 A;  4ICY A;  3APS A;  4N3Z A;  1M2B A;  2LKU A;  4FQU A;  2IMI A;  3EUR A;  4WBR D;  1A0F A;  2N5F A;  3M1G A;  1YF0 A;  1GTA A;  1SVM A;  1ZYE A;  3RAZ A;  1GUK A;  5FT3 A;  6GSY A;  2HSN A;  3N9J A;  2V6O A;  4OD7 A;  1NW2 A;  5CYY A;  1EV4 A;  18GS A;  4PHZ C;  3TOU A;  2GSS A;  4ILF A;  3TRX A;  1SU9 A;  2IME A;  5A4V A;  5AIV A;  6GSV A;  3KXO A;  2LEG A;  1J0F A;  2VKZ G;  2EIO A;  4G0L A;  3LXT A;  3UAP A;  3KZQ A;  1GL8 A;  1USB A;  3W8S A;  4XS1 A;  1QK8 A;  4MH3 A;  2H0G A;  1FB0 A;  2JAC A;  3QFA C;  2YWO A;  5INY A;  3TKQ A;  4PGT A;  2GGT A;  5GSS A;  5JCG A;  4DSS A;  3BJ5 A;  3VI5 A;  4EIQ A;  1A2M A;  1O8X A;  4PUA A;  2HZF A;  3ZTL A;  4KDU A;  2HSN B;  2YCD A;  1O73 A;  3GIX A;  4FO5 A;  3CQF A;  1SKW B;  2WVY A;  1SJZ A;  2KOK A;  3LYK A;  2D2Z A;  22GS A;  3TUE A;  2PN8 A;  2GS3 A;  5LD0 A;  5J5N A;  4NHW A;  2VLU A;  3IAM 2;  1T4Y A;  3GKK A;  4Z2U A;  4MJE A;  1FO5 A;  2LRT A;  2VLT A;  4MLY A;  1XXU A;  4WEY A;  2H1G A;  2HI7 A;  5AGY A;  3Q74 A;  4G10 A;  2VCX A;  4D73 A;  2V6K A;  2X8H A;  2HE3 A;  4I2T A;  4DSS B;  3CRT A;  1K0C A;  4EF0 A;  4L5O A;  1YY7 A;  4AKX B;  5CRE A;  4POB A;  4O7H A;  1Z3E A;  3C73 A;  3TU3 B;  1XIY A;  2H0I A;  4AKI A;  3RPN A;  2H71 A;  2GST A;  3AY8 A;  4KA0 A;  5COH A;  4HOJ A;  1MDJ A;  2A2P A;  1K0A A;  4AKG A;  3WYW A;  3FMW A;  5IMZ A;  3JCM L;  2FWG A;  4IQ1 A;  1XWA A;  4PNF A;  1YEX A;  3G7J A;  1URM A;  5IO2 A;  4HZ2 A;  1XW6 A;  4D73 B;  4F82 A;  1XW5 A;  1UVZ A;  2H74 A;  5DJM A;  1O8W A;  1GTI A;  4EIP A;  3KMN A;  2KUC A;  2X49 A;  3HVN A;  5DQS A;  1B9X C;  1PKW A;  3F8U A;  3TKS C;  2HRN A;  2Z9S A;  3S9F A;  2BMX A;  3QCP A;  4IJ3 A;  2QGV A;  1PD2 1;  3F3R A;  1M3I A;  5IOW A;  3HVS A;  3H93 A;  2E7P A;  3D4T A;  4KUN A;  2L6D A;  1K3Y A;  2R5G A;  2DJJ A;  2WZ9 A;  1XWB A;  2YZH A;  3CXG A;  2EIQ A;  5IMF A;  4XIH A;  2CAQ A;  1YJ6 A;  19GS A;  2JZR A;  1AXD A;  3F6D A;  2X8G A;  3KM6 A;  4XS6 A;  3BCK A;  3FZ4 A;  5ECR B;  1QXH A;  2AHE A;  1TJD A;  3M8N A;  2PUK C;  2IMK A;  2WW3 A;  3U5R E;  1XG8 A;  4KCE A;  3ERW A;  4N30 A;  1SL1 B;  2DLX A;  1X5E A;  3HVV A;  2HSH A;  2FWE A;  5KN0 A;  3KTL A;  4WF5 A;  2WFC A;  3H8Q A;  1FG4 A;  2HLS A;  2KP2 A;  5F07 A;  1MDK A;  2WS2 A;  3VLN A;  3IPZ A;  3TJB A;  1GTU A;  2DJK A;  1M2D A;  2J9H A;  2REM A;  3EIN A;  3FR9 A;  1QMV A;  1TW9 A;  2FNO A;  4O92 A;  3VPQ A;  4MZB A;  5ECL B;  4N11 A;  4HZ4 A;  4MZC A;  4OCE A;  2OE1 A;  4MH2 A;  4WET A;  4POM A;  2HSY A;  2DKI A;  5IOX A;  1XOA A;  4EC0 A;  2P31 A;  4N10 A;  1TRW A;  4F0C A;  1GUM A;  3GH9 A;  5IMD A;  1PQN A;  2DJ3 A;  3EC3 A;  2GVP A;  1THO A;  5ECH B;  5DDL A;  1F6M C;  4JR6 A;  2VAF A;  2VUP A;  1I5G A;  2ON7 A;  1ML6 A;  4IN0 A;  4FIW A;  1JLV A;  3F4S A;  3EYT A;  4Q5N A;  2QKE A;  5HR2 A;  1HNB A;  4PQH A;  1WRY A;  1XFL A;  1T4Z A;  1AW9 A;  2N5A A;  3UVT A;  5ECS A;  5D9T A;  2DIY A;  3A5I A;  3WGD A;  4LL4 B;  5JWO B;  4FYU A;  5IMV A;  1VF4 A;  1V98 A;  3L4N A;  2OAC A;  2F9S A;  4KSM A;  2LJK A;  2CVD A;  4ID0 A;  1SJ6 A;  4V2M A;  4GLT A;  1B9Y C;  4ML6 A;  1KTE A;  4KDX A;  2YJ7 A;  5D93 A;  5HFI A;  3DIE A;  1S3D A;  4LL1 B;  3E0U A;  2H01 A;  1M2A A;  2VLV A;  2I1U A;  1U3A A;  3P90 A;  1Y25 A;  2H70 A;  4KCA A;  1VF3 A;  4JE1 A;  5ABR A;  5CNW A;  5EPF A;  1Z9H A;  3DWV A;  3I6A A;  3QAW A;  2NTO A;  5DAK A;  4HQS A;  2E2M A;  1EGR A;  4GCI A;  4L0W A;  2IMD A;  4WXT A;  4HU7 A;  5KN2 A;  5HFG A;  1Q4J A;  3F3Q A;  3UAR A;  2RUF A;  3WD6 A;  13GS A;  2VO4 A;  1U88 A;  4MDC A;  1EOG A;  4O5Q A;  1A8L A;  3LEF A;  3UOM A;  1EEJ A;  2YP6 A;  4MJB A;  4DSQ A;  2QSI A;  4GQF A;  3UL3 A;  2LRC A;  1FOH A;  2KHP A;  4IGJ A;  5JWR B;  4K0G A;  3NZN A;  3TRP A;  4ZB6 A;  5DAK B;  4YKF A;  2HQT A;  1THX A;  5J9B A;  1TXX A;  1PRX A;  2XPD A;  1E2Y A;  3EVI A;  3QFB C;  2XBI A;  4G2E A;  2MMA A;  2L6C A;  2H6X A;  2VCT A;  3P2A A;  2GQL A;  1UN2 A;  1CQH A;  3GNJ A;  3RGB C;  2V32 A;  5H5R A;  2HNL A;  1JZR A;  3CYN A;  2EFC A;  1TXU A;  4ZBD A;  4ULX A;  4PTS A;  1J9B A;  1HNC A;  4N0Z A;  4L5L A;  10GS A;  2K8S A;  2TRX A;  5HQP A;  2LRN A;  1T00 A;  1ZYQ B;  3TJJ A;  4F2I A;  1DBY A;  4GSN A;  3GFK A;  2J23 A;  4JU5 A;  4V2N A;  3O76 A;  1XWK A;  2NVL A;  1TTZ A;  2VCQ A;  2P5R A;  5G31 A;  3CWG A;  2YPM A;  3HKR A;  1SKR B;  3FRC A;  2NPB A;  2TRC P;  1F9M A;  4I8B A;  2JSY A;  1B4Q A;  4K7I A;  2GDR A;  1GNE A;  2LNT A;  3L78 A;  1OKT A;  3R3E A;  2GT5 A;  1A24 A;  2H73 A;  2CA8 A;  3MIX A;  3GN3 A;  3KP9 A;  2X64 A;  1XOB A;  4ZL7 A;  1N2A A;  2K8V A;  1S3C A;  5DJL A;  2MMN A;  3RHC A;  3ERF A;  4MPF A;  2VM1 A;  3NOF A;  4KND A;  4ZBA A;  2AYT A;  3A3T A;  5GST A;  5D9X A;  4ZBB A;  2H1A A;  2A2R A;  2HRA A;  1JZW A;  3KD0 A;  2OKA A;  5B6M A;  2C3Q A;  3MWH A;  1G6W A;  3GL3 A;  3LWA A;  4KSO A;  5C04 A;  20GS A;  2YN1 A;  3G7Y A;  1A2J A;  3HZ8 A;  1LBK A;  3I69 A;  1GTB A;  3DVX A;  1SD8 A;  3EWL A;  4ISD A;  2YZU A;  2CVK A;  5KN3 A;  5H5Q A;  4N0V A;  1BX9 A;  3NIV A;  2MBT A;  3GSS A;  4XRD A;  5DQY A;  3LG6 A;  3KGK A;  3PIN A;  2H19 A;  1X9S B;  3GST A;  12GS A;  4PUR A;  3G7I A;  1KBN A;  2FA4 A;  5CO3 A;  1X9W B;  2F8F A;  5D9W A;  1DE2 A;  2FWH A;  2LJR A;  4KW6 A;  1TKD B;  2IJY A;  4MJA A;  3BOA A;  1GSQ A;  4LMV A;  4CY8 A;  2DKH A;  3HJM A;  4YQV A;  3GMF A;  3CMI A;  4EKZ A;  2I3Y A;  1MDI A;  3H4K A;  4CY6 A;  2DIZ A;  2JAD A;  2B3S A;  1FVK A;  5FWG A;  1SYX A;  1PA3 A;  5IM9 A;  1HNA A;  5ECP B;  1N25 A;  2HRK A;  4Q5R A;  1V40 A;  2ALB A;  1YKA A;  4EL1 A;  4USS A;  5HR1 A;  4GRF A;  2WVX A;  3HYP A;  2H66 A;  4HEA 2;  4MF5 A;  2C0D A;  3ZVJ D;  3VWX A;  3IOS A;  3M0F A;  5A1N A;  1EEM A;  4F0B A;  5J4Y A;  4TXO A;  2JZS A;  1TDI A;  1XW9 A;  4ZL8 A;  5HR3 A;  5B7C A;  3Q6O A;  9GSS A;  3I43 A;  1AUC A;  5B8B A;  4MF6 A;  4LMW A;  3WGE A;  3FZA A;  4K0N A;  5EY6 A;  2EFH A;  2NBS A;  2RLI A;  4K7N A;  1TK8 B;  4GQC A;  1VF2 A;  2H0H A;  5A34 A;  3O3T A;  3L9U A;  4HU9 A;  1AQV A;  2HRK B;  1BQ7 A;  4EDY A;  4OO5 A;  3ZFL A;  3FR3 A;  3TKS E;  3LQ7 A;  2WVX B;  2YWI A;  2B6M A;  2FY6 A;  3IV4 A;  3RBT A;  4GSS A;  3HXS A;  4AF2 A;  3LFL A;  3F0I A;  3APO A;  5A1N B;  2PMT A;  4E68 A;  4Z7X A;  5G2Z A;  4K6X A;  1K3L A;  5G1K A;  4TXO B;  3U6V A;  3IC8 A;  2RM6 A;  3HVX A;  3A2X A;  3FY7 A;  3DVW A;  4MNN A;  1GSY A;  3QPM A;  4POK A;  1B8X A;  2XBQ A;  2H1L A;  3CSI A;  3M9J A;  5G5E A;  3ZVJ A;  5A34 B;  3TOT A;  2C3T A;  16GS A;  4X0X A;  1GNW A;  5ELG A;  3IRA A;  3GKN A;  1ERU A;  1JHB A;  2H6Z A;  4EXJ A;  3MAK A;  3A2V A;  2VL2 A;  1ZMA A;  5A4W A;  1YEW C;  2O7K A;  3BCI A;  2H1B A;  2RUE A;  1FHE A;  3KH9 A;  4ZL9 A;  5IPH A;  1GP1 A;  3D0Z A;  1A0R P;  1WIK A;  2AV4 A;  4IHU A;  2WZS A;  3TGZ A;  3KIJ A;  2YWN A;  3UBL A;  5KOW A;  1ST9 A;  3TKP A;  4BIK A;  5DCG A;  1PN9 A;  3IK7 A;  3G9B A;  1X5C A;  4QQ7 A;  4WKW A;  1QGV A;  5FHI A;  2L4C A;  2QA2 A;  3D5J A;  2WCI A;  3DRN A;  1V9W A;  2K6V A;  3EMX A;  3J7Y k;  1IYI A;  4KB3 A;  2CX4 A;  1GSD A;  3ZMK A;  4POL A;  3GUS A;  2WGR A;  3HCZ A;  3RHB A;  4MK3 A;  1TU7 A;  4E8E A;  4OCF A;  5F06 A;  4DEJ A;  4IBP A;  2EIR A;  3CTF A;  4AJ7 A;  3CRU A;  1Z7P A;  1WJK A;  5G30 A;  1T3B A;  1PFO A;  2CQ9 A;  1TI1 A;  4RQX A;  1XWG A;  1QUW A;  3IDV A;  4CHS A;  2PVO C;  4G0K A;  1Z5Y E;  2IWT A;  4HDE A;  3IR4 A;  2O36 A;  1XBS A;  4QMK A;  2PPT A;  2PER A;  4RUV A;  2XHF A;  1TRU A;  3GX0 A;  4X1U A;  1BED A;  4L0U A;  1FB6 A;  5ECQ B;  1TRV A;  3QMX A;  2PGT A;  4OMV A;  3UVH A;  4JRR A;  4TR4 A;  2LST A;  1G0T A;  4OFT A;  2EFE A;  3H79 A;  2FD3 A;  1X9M B;  5ECK B;  2IFQ A;  3UBK A;  4K2X A;  1SVO A;  4DVC A;  4K8M A;  3GKX A;  1Z6N A;  4AJ6 A;  5G1L A;  4ECI A;  2LQQ A;  5ELA A;  3GV1 A;  2V1M A;  1F3B A;  4ZXG A;  3IXR A;  4BWS A;  4TR0 A;  6GSW A;  1JLW A;  3K8N A;  4HJ2 A;  1PN0 A;  2WB9 A;  1VF1 A;  3QAV A;  3RPP A;  2CZ3 A;  5IMA A;  2O89 A;  3GA4 A;  4K5R A;  4LLR A;  1H4O A;  1V58 A;  4MCU A;  3TCO A;  2MMO A;  4Z2R A;  4IW9 A;  2C80 A;  5GAP D;  5ECN B;  5DAL A;  1SK2 A;  1M3J A;  3VWW A;  2H8L A;  1YEP A;  4E8H A;  2IFQ B;  3C1R A;  3HHV A;  2FA8 A;  4V2L A;  4FH8 A;  3HDC A;  2FLS A;  1JFU A;  2GSQ A;  6GSX A;  1ABA A;  2V41 A;  3CBU A;  1W89 A;  4GWR A;  1HQO A;  3QDN A;  1SK1 A;  1LJR A;  4K1F A;  1ERT A;  4KGI A;  5CRW A;  3SBC A;  3W6G A;  3F9U A;  1XZO A;  1BG1 A;  2P0G A;  2VL3 A;  2PU9 C;  2LNS A;  2C1Y A;  1ON4 A;  1NM3 A;  2C0F A;  2FWF A;  3I9V 2;  2CVB A;  1GSF A;  4YQM A;  4HI7 A;  3SWL A;  3C7M A;  2VOC A;  4QL9 A;  1F3A A;  4CW9 A;  1BF5 A;  5DAL B;  1WOU A;  1RW1 A;  3RDW A;  4PX1 A;  1PL2 A;  2OBI A;  4HJM A;  3LGC A;  2IMF A;  4V1A p;  1OYJ A;  4I2U A;  3US3 A;  1K0M A;  5AN1 A;  4ML1 A;  3UEM A;  2GZZ A;  4KAE A;  4J57 E;  4NV5 A;  1Y1U A;  2OE0 A;  3IHQ A;  2R37 A;  2DBC A;  1ERV A;  1T8E B;  4DSR A;  5CP1 A;  2P5Q A;  2R0G A;  1V57 A;  3PH9 A;  3RFR C;  2HSM A;  2HFD A;  3FW2 A;  2DC5 A;  4G0I A;  1U6T A;  4GDF A;  3GUR A;  2VM2 A;  4MF7 A;  1WPI A;  4NWY A;  3H1N A;  2HZE A;  3KJY A;  3QD9 A;  4WR5 A;  1Q98 A;  1A23 A;  3ZIJ A;  2O87 A;  3MSZ A;  1GRX A;  5G5F A;  1S3R A;  2X8C A;  1AAZ A;  1OC9 A;  2CAI A;  4XTS A;  3KCM A;  2E2G A;  2NDO A;  4PUF C;  3F63 A;  2A4H A;  3KTB A;  2OBK A;  1YDK A;  2AAW A;  1FVJ A;  3EMP A;  2GZY A;  2B5Y A;  5BMU A;  3GTU A;  2UV8 G;  2H72 A;  4YAV A;  5DVB A;  4HUA A;  3J7Y b;  4PI0 C;  2DMM A;  2VCV A;  1XWC A;  3DXB A;  2HSM B;  5ID2 A;  1FW1 A;  2E0Q A;  3GYK A;  2QA1 A;  3PGT A;  4ZB7 A;  2YWM A;  3WT1 A;  2JZT A;  3FZ9 A;  1R7H A;  1OE7 A;  6GSS A;  1QFN A;  3D21 A;  3QOU A;  2YV7 A;  4TR3 A;  2MZC A;  4GXZ A;  2HZE B;  1SL2 B;  1HYU A;  8GSS A;  4AKH A;  1SKS B;  5ECI B;  2GT6 A;  1OC9 B;  3E9J B;  4TOP A;  2K18 A;  3EE2 A;  3LJR A;  3PPU A;  1ZCP A;  3F4T A;  2C4J A;  1O6J A;  2H75 A;  3WT2 A;  5BMU B;  4EVM A;  3GTU B;  2FHE A;  3BD2 A;  1UA5 A;  1M99 A;  2GQM A;  1YF1 A;  1Z6M A;  5J47 A;  2C0E A;  1S3A A;  2G2Q A;  1T7P B;  1GSU A;  5B6N A;  1OKD A;  3FYG A;  4Q5F A;  2C0G A;  5ID2 B;  4TVE A;  1VGL A;  1ZZY A;  1K0B A;  4IP6 A;  4A5P A;  4J56 E;  1W4V A;  2H1D A;  4IP1 A;  1J08 A;  1F2E A;  4PQ1 A;  1R5P A;  3HZ4 A;  4L8E A;  2IIY A;  2PVQ A;  4NMU A;  1GLP A;  1O81 A;  1SYR A;  3ZYW A;  2FUG 2;  2VL9 A;  1NHO A;  5ECO B;  3CHX C;  4NHZ A;  2R3X A;  1R5A A;  1RQM A;  3KEB A;  2GLR A;  5D9V A;  4OFN A;  3VI7 A;  5BRT A;  3UIW A;  1DSB A;  3TRQ A;  4ZIL A;  3LOR A;  2OAD A;  4CDO A;  5ECM B;  4KDY A;  3EU3 A;  3ZZX A;  1B48 A;  3FZ5 A;  4JED A;  1X0R A;  1EV9 A;  4NXI A;  1G6Y A;  2HYX A;  5J9C A;  1PMT A;  3LYP A;  5IPG A;  3GRX A;  3TDG A;  1G7E A;  2PBJ A;  2K9F A; 
#chains in the Genus database with same CATH homology
 2IN3 A;  3ISO A;  5KN1 A;  3BBY A;  3APQ A;  3HA9 A;  4XHM A;  4O5R A;  2L4Q A;  1I9D A;  2OT3 A;  2H30 A;  3M9K A;  2VCW A;  1X5D A;  3DD3 A;  5B8A A;  4PQI A;  2N5B A;  1EZK A;  3VFI A;  2O8V B;  2C3N A;  1DE1 A;  5CRG A;  2AJQ B;  4TR1 A;  3VWV A;  3WGX A;  1OVN A;  2MMZ A;  4G9H A;  4KH7 A;  1VRS D;  1C72 A;  5LCZ A;  1ZL9 A;  1GH2 A;  3ME7 A;  5AIX A;  4TN8 A;  2LJA A;  1GLQ A;  1OC8 A;  2GSR A;  2R6K A;  4LA1 A;  2C8U A;  2LUS A;  1NHY A;  4IEL A;  2OJL A;  4F03 A;  5A5K A;  5JCW A;  4BA7 A;  3VUR A;  4TXV A;  4WBJ A;  5D96 A;  3IC4 A;  3CTG A;  3FEU A;  4EUY A;  3ZRD A;  4KX4 A;  4TR1 B;  1GUH A;  5HFK A;  1MTC A;  4ZB8 A;  2O85 A;  1TOF A;  3C71 A;  1MEK A;  4TKY A;  4MPG A;  3F4R A;  1UC7 A;  4ZIJ A;  2RM5 A;  2VCZ A;  1WMJ A;  2B5X A;  1GSE A;  1SJI A;  2M46 A;  3F6F A;  3VWU A;  3DYR A;  2WRT A;  4H86 A;  2ZNM A;  2TIR A;  3TKS A;  3TJG A;  3KP8 A;  2GQK A;  5KOX A;  1AIU A;  3HJO A;  1WP0 A;  4W66 A;  4I97 A;  1O7U A;  4FYC A;  2CZ2 A;  3GL5 A;  3KMO A;  1EWX A;  1PX7 A;  2G0F A;  4BL7 A;  2B7J A;  3ZRE A;  4KF9 A;  5CRD A;  2L5O A;  3EPT A;  2JU5 A;  2JSZ A;  2ON5 A;  1SEN A;  2ES7 A;  1EP7 A;  4YQU A;  4OFM A;  2GZP A;  2LQO A;  2B1K A;  4YH2 A;  4I5Q A;  2I81 A;  3R2Q A;  6GSU A;  1G7O A;  1LU4 A;  4XCS A;  4QL7 A;  2AB6 A;  1TRS A;  5L71 A;  4OO4 A;  4O32 A;  1SK0 A;  1M0U A;  4MMM A;  4BVX A;  1FAA A;  2DJ2 A;  2H6Y A;  2WUL A;  3IK9 A;  2M72 A;  3IA1 A;  5F05 A;  3FK8 A;  1BG5 A;  4XS4 A;  11GS A;  1O85 A;  3L0H A;  1AC1 A;  1SD9 A;  2DML A;  1XVW A;  1R26 A;  1K3O A;  5ENU A;  2DSA A;  1ZYP A;  4YKG A;  1AQX A;  3TJK A;  3HY2 A;  3ERG A;  3ZL5 A;  4BL7 B;  4NAX A;  1YZX A;  3DML A;  5CRH A;  4X43 A;  2VL2 C;  2JL4 A;  3GKM A;  2VIM A;  4MP4 A;  2CV4 A;  3UMA A;  4K7O A;  1YQ1 A;  4ACS A;  1ZOF A;  1TU8 A;  1PKZ A;  2HT9 A;  5GZZ B;  4GTU A;  1MD4 A;  4WR4 A;  3UJ1 A;  4BVX B;  1T1V A;  1BAY A;  1A8Y A;  1KEB A;  5EVO A;  3L9V A;  1XPV A;  4XS4 B;  3KH7 A;  3LSZ A;  1ERW A;  5DBQ A;  5JWQ B;  5J41 A;  5JCU A;  2FCH A;  2MBS A;  1U3I A;  3DGQ A;  4MJC A;  4I6X A;  4EO3 A;  2UZ8 A;  5J40 A;  2OE3 A;  4MZW A;  3W8J A;  2MYG A;  1EP8 A;  4AI6 A;  4EDZ A;  4Z2T A;  4PXO A;  1H75 A;  4P3Y B;  1M9A A;  2F51 A;  1GUL A;  2WJU A;  4X4J A;  4FYB A;  1K0N A;  3OR5 A;  1XVQ A;  2YNX A;  1ILO A;  2DJ0 A;  2V2G A;  1ZYN A;  4HQZ A;  17GS A;  4BVY A;  4V1A g;  3V1W A;  5DCH A;  2R4V A;  1HD2 A;  2L5L A;  2R0P A;  1PGT A;  4OWY A;  2IPA A;  2YAN A;  4O5U A;  4K5S A;  2OA7 A;  4J2F A;  2XPE A;  1NSW A;  4BPY A;  1R4W A;  5J4V A;  3VPT A;  2EFD A;  3CSJ A;  14GS A;  1RK4 A;  1EGO A;  2L57 A;  3FKF A;  3IHG A;  4NPB A;  1WE0 A;  2B1L A;  4EE0 A;  4NV2 A;  3TB2 A;  5D73 A;  4AJ8 A;  4IKH A;  1OAZ A;  2IL3 A;  2VD1 A;  2YV9 A;  4XRA A;  1SVL A;  1EOH A;  2FGX A;  4BWQ A;  3GH6 A;  5A4U A;  2BJX A;  3ME8 A;  4BVY B;  1WWJ A;  5F8B A;  2L59 A;  1Y6E A;  4JR4 A;  3TKR A;  3ZFB A;  1AQW A;  1FOV A;  3PR8 A;  1JZD A;  5KEJ A;  3QAG A;  4IQA A;  5IMC A;  3D6I A;  2LTK A;  3FHK A;  4IJI A;  5HR0 A;  2XC2 A;  3LXZ A;  3ZIV A;  5IO0 A;  3M3M A;  3IAS 2;  5F0G A;  4JZQ A;  1SL0 B;  2F3M A;  1M7T A;  3MNG A;  4K2D A;  3LW9 A;  4ECB A;  3P8W A;  1U87 A;  4RI6 A;  3E3E A;  3L9S A;  1OE8 A;  4ZB9 A;  2EC4 A;  2F8A A;  2AUV A;  4ECJ A;  4IS0 A;  4JBB A;  2A2S A;  4PNG A;  3HMJ G;  4G01 A;  1E6B A;  2B5E A;  4MAB A;  2R2J A;  3Q19 A;  2HXK A;  4F9Z A;  3ZIT A;  5CAX A;  4MA9 A;  2R0C A;  2H76 A;  2O5V A;  4GST A;  3GX8 A;  1MD3 A;  3Q18 A;  3IBH A;  1Z7R A;  5GAN D;  2X99 A;  5LNK e;  2LS5 A;  4G19 A;  1TI3 A;  2BTO T;  2VD0 A;  3HJP A;  2GTU A;  5J3R A;  3C1S A;  3MDK A;  4YAP A;  2B7K A;  3EU4 A;  1TK0 B;  4KE3 A;  2KLX A;  2LV3 A;  3TJF A;  5E59 A;  1M9B A;  7GSS A;  5D8I A;  4RQR A;  5A5H A;  4IVF A;  1JZO A;  3ZLP A;  1PL1 A;  4RI7 A;  1A2L A;  4HS1 A;  3HD5 A;  5IIZ A;  1CQG A;  2DJ1 A;  4AGS A;  1K0O A;  1IYH A;  4TRX A;  1BJX A;  3A2W A;  2I4A A;  3DKS A;  1PX6 A;  4GF0 A;  2M80 A;  2CX3 A;  2I9H A;  2ZUP A;  1QQ2 A;  3A5W A;  3QR6 A;  2ZCT A;  1OC3 A;  1B4P A;  1F37 A;  1YKC A;  1PSQ A;  1ZGN A;  5EL8 A;  1KNG A;  3MYD A;  1XCC A;  4K9Z A;  1TK5 B;  6GST A;  1YVL A;  1TP9 A;  3FR6 A;  2PWJ A;  3D4M A;  5H5S A;  1N8J A;  3N5O A;  3ZML A;  2HRF A;  3ED3 A;  1GWC A;  2YJH A;  5A5H B;  2QC7 A;  3P7X A;  2X4A A;  2CT6 A;  1BYE A;  3IE3 A;  5AIS A;  1ACV A;  2KP1 A;  2RII A;  3C8E A;  3CSH A;  2A4V A;  3GHA A;  3O6T A;  5J4U A;  5E4W A;  4Q5Q A;  1GSS A;  4WF4 A;  4ECC A;  3D22 A;  3DEX A;  3VK9 A;  5IQY A;  2YOI A;  1K0D A;  2WDU A;  1DUG A;  1V2A A;  5C00 A;  4TW5 A;  4ICY A;  3APS A;  4N3Z A;  1M2B A;  2LKU A;  4FQU A;  2IMI A;  3EUR A;  4WBR D;  1A0F A;  2N5F A;  3M1G A;  1YF0 A;  1GTA A;  1SVM A;  1ZYE A;  3RAZ A;  1GUK A;  5FT3 A;  6GSY A;  2HSN A;  3N9J A;  2V6O A;  4OD7 A;  1NW2 A;  5CYY A;  1EV4 A;  18GS A;  3TOU A;  2GSS A;  4ILF A;  3TRX A;  1SU9 A;  2IME A;  5A4V A;  5AIV A;  6GSV A;  3KXO A;  2LEG A;  1J0F A;  2VKZ G;  2EIO A;  4G0L A;  3LXT A;  3UAP A;  3KZQ A;  1GL8 A;  1USB A;  3W8S A;  4XS1 A;  1QK8 A;  4MH3 A;  2H0G A;  1FB0 A;  2JAC A;  3QFA C;  2YWO A;  5INY A;  3TKQ A;  4PGT A;  2GGT A;  5GSS A;  5JCG A;  4DSS A;  3BJ5 A;  3VI5 A;  4EIQ A;  1A2M A;  1O8X A;  4PUA A;  2HZF A;  3ZTL A;  4KDU A;  2HSN B;  2YCD A;  1O73 A;  3GIX A;  4FO5 A;  1SKW B;  1SJZ A;  2KOK A;  3LYK A;  2D2Z A;  22GS A;  3TUE A;  2PN8 A;  2GS3 A;  5LD0 A;  5J5N A;  4NHW A;  2VLU A;  3IAM 2;  1T4Y A;  3GKK A;  4Z2U A;  4MJE A;  1FO5 A;  2LRT A;  2VLT A;  4MLY A;  1XXU A;  4WEY A;  2H1G A;  2HI7 A;  5AGY A;  3Q74 A;  4G10 A;  2VCX A;  4D73 A;  2V6K A;  2X8H A;  2HE3 A;  4I2T A;  4DSS B;  3CRT A;  1K0C A;  4EF0 A;  4L5O A;  1YY7 A;  4AKX B;  5CRE A;  4POB A;  4O7H A;  1Z3E A;  3C73 A;  3TU3 B;  1XIY A;  2H0I A;  4AKI A;  3RPN A;  2H71 A;  2GST A;  3AY8 A;  4KA0 A;  5COH A;  4HOJ A;  1MDJ A;  2A2P A;  1K0A A;  4AKG A;  3WYW A;  3FMW A;  5IMZ A;  3JCM L;  2FWG A;  4IQ1 A;  1XWA A;  4PNF A;  1YEX A;  3G7J A;  1URM A;  5IO2 A;  4HZ2 A;  1XW6 A;  4D73 B;  4F82 A;  1XW5 A;  1UVZ A;  2H74 A;  5DJM A;  1O8W A;  1GTI A;  4EIP A;  3KMN A;  2KUC A;  2X49 A;  5DQS A;  1B9X C;  1PKW A;  3F8U A;  3TKS C;  2HRN A;  2Z9S A;  3S9F A;  2BMX A;  3QCP A;  4IJ3 A;  2QGV A;  1PD2 1;  3F3R A;  5IOW A;  3HVS A;  3H93 A;  2E7P A;  3D4T A;  4KUN A;  2L6D A;  1K3Y A;  2R5G A;  2DJJ A;  2WZ9 A;  1XWB A;  2YZH A;  3CXG A;  2EIQ A;  5IMF A;  4XIH A;  2CAQ A;  1YJ6 A;  19GS A;  2JZR A;  1AXD A;  3F6D A;  2X8G A;  3KM6 A;  4XS6 A;  3BCK A;  3FZ4 A;  5ECR B;  1QXH A;  2AHE A;  1TJD A;  3M8N A;  2PUK C;  2IMK A;  3U5R E;  4KCE A;  4N30 A;  3ERW A;  1SL1 B;  2DLX A;  1X5E A;  3HVV A;  2HSH A;  2FWE A;  5KN0 A;  3KTL A;  4WF5 A;  2WFC A;  3H8Q A;  1FG4 A;  2HLS A;  2KP2 A;  5F07 A;  1MDK A;  2WS2 A;  3VLN A;  3IPZ A;  3TJB A;  1GTU A;  2DJK A;  1M2D A;  2J9H A;  2REM A;  3EIN A;  3FR9 A;  1QMV A;  1TW9 A;  2FNO A;  4O92 A;  3VPQ A;  4MZB A;  5ECL B;  4N11 A;  4HZ4 A;  4MZC A;  4OCE A;  2OE1 A;  4MH2 A;  4WET A;  4POM A;  2HSY A;  2DKI A;  5IOX A;  1XOA A;  4EC0 A;  2P31 A;  4N10 A;  1TRW A;  4F0C A;  1GUM A;  3GH9 A;  5IMD A;  1PQN A;  2DJ3 A;  3EC3 A;  2GVP A;  1THO A;  5ECH B;  5DDL A;  1F6M C;  4JR6 A;  2VAF A;  2VUP A;  1I5G A;  2ON7 A;  1ML6 A;  4IN0 A;  4FIW A;  1JLV A;  3F4S A;  3EYT A;  4Q5N A;  2QKE A;  5HR2 A;  1HNB A;  4PQH A;  1WRY A;  1XFL A;  1T4Z A;  1AW9 A;  2N5A A;  3UVT A;  5ECS A;  5D9T A;  2DIY A;  3A5I A;  3WGD A;  4LL4 B;  5JWO B;  4FYU A;  5IMV A;  1VF4 A;  1V98 A;  3L4N A;  2OAC A;  2F9S A;  4KSM A;  2LJK A;  2CVD A;  4ID0 A;  1SJ6 A;  4V2M A;  4GLT A;  1B9Y C;  4ML6 A;  1KTE A;  4KDX A;  2YJ7 A;  5D93 A;  5HFI A;  3DIE A;  1S3D A;  4LL1 B;  3E0U A;  2H01 A;  1M2A A;  2VLV A;  2I1U A;  1U3A A;  3P90 A;  1Y25 A;  2H70 A;  4KCA A;  1VF3 A;  4JE1 A;  5ABR A;  5CNW A;  5EPF A;  1Z9H A;  3DWV A;  3I6A A;  3QAW A;  2NTO A;  5DAK A;  4HQS A;  2E2M A;  1EGR A;  4GCI A;  4L0W A;  2IMD A;  4WXT A;  4HU7 A;  5KN2 A;  5HFG A;  1Q4J A;  3F3Q A;  3UAR A;  2RUF A;  3WD6 A;  13GS A;  2VO4 A;  1U88 A;  4MDC A;  1EOG A;  4O5Q A;  1A8L A;  3LEF A;  3UOM A;  1EEJ A;  2YP6 A;  4MJB A;  4DSQ A;  2QSI A;  4GQF A;  3UL3 A;  2LRC A;  1FOH A;  2KHP A;  4IGJ A;  5JWR B;  4K0G A;  3NZN A;  3TRP A;  4ZB6 A;  5DAK B;  4YKF A;  2HQT A;  1THX A;  5J9B A;  1TXX A;  1PRX A;  2XPD A;  1E2Y A;  3EVI A;  3QFB C;  2XBI A;  4G2E A;  2MMA A;  2L6C A;  2H6X A;  2VCT A;  3P2A A;  2GQL A;  1UN2 A;  1CQH A;  3GNJ A;  2V32 A;  5H5R A;  2HNL A;  1JZR A;  3CYN A;  2EFC A;  1TXU A;  4ZBD A;  4ULX A;  4PTS A;  1J9B A;  1HNC A;  4N0Z A;  4L5L A;  10GS A;  2K8S A;  2TRX A;  5HQP A;  2LRN A;  1T00 A;  1ZYQ B;  3TJJ A;  4F2I A;  1DBY A;  4GSN A;  3GFK A;  2J23 A;  4JU5 A;  4V2N A;  3O76 A;  1XWK A;  2NVL A;  1TTZ A;  2VCQ A;  2P5R A;  5G31 A;  3CWG A;  2YPM A;  3HKR A;  1SKR B;  3FRC A;  2NPB A;  2TRC P;  1F9M A;  4I8B A;  2JSY A;  1B4Q A;  4K7I A;  2GDR A;  1GNE A;  2LNT A;  3L78 A;  1OKT A;  3R3E A;  2GT5 A;  1A24 A;  2H73 A;  2CA8 A;  3MIX A;  3GN3 A;  3KP9 A;  2X64 A;  1XOB A;  4ZL7 A;  1N2A A;  2K8V A;  1S3C A;  5DJL A;  2MMN A;  3RHC A;  3ERF A;  4MPF A;  2VM1 A;  3NOF A;  4KND A;  4ZBA A;  2AYT A;  3A3T A;  5GST A;  5D9X A;  4ZBB A;  2H1A A;  2A2R A;  2HRA A;  1JZW A;  3KD0 A;  2OKA A;  5B6M A;  2C3Q A;  3MWH A;  1G6W A;  3GL3 A;  3LWA A;  4KSO A;  5C04 A;  20GS A;  2YN1 A;  3G7Y A;  1A2J A;  3HZ8 A;  1LBK A;  3I69 A;  1GTB A;  3DVX A;  1SD8 A;  3EWL A;  4ISD A;  2YZU A;  2CVK A;  5KN3 A;  5H5Q A;  4N0V A;  1BX9 A;  3NIV A;  2MBT A;  3GSS A;  4XRD A;  5DQY A;  3LG6 A;  3KGK A;  3PIN A;  2H19 A;  1X9S B;  3GST A;  12GS A;  4PUR A;  3G7I A;  1KBN A;  2FA4 A;  5CO3 A;  1X9W B;  2F8F A;  5D9W A;  1DE2 A;  2FWH A;  2LJR A;  4KW6 A;  1TKD B;  2IJY A;  4MJA A;  3BOA A;  1GSQ A;  4LMV A;  4CY8 A;  2DKH A;  3HJM A;  4YQV A;  3GMF A;  3CMI A;  4EKZ A;  2I3Y A;  1MDI A;  3H4K A;  4CY6 A;  2DIZ A;  2JAD A;  2B3S A;  1FVK A;  5FWG A;  1SYX A;  1PA3 A;  5IM9 A;  1HNA A;  5ECP B;  1N25 A;  2HRK A;  4Q5R A;  1V40 A;  2ALB A;  1YKA A;  4EL1 A;  4USS A;  5HR1 A;  4GRF A;  3HYP A;  2H66 A;  4HEA 2;  4MF5 A;  2C0D A;  3ZVJ D;  3VWX A;  3IOS A;  3M0F A;  5A1N A;  1EEM A;  4F0B A;  5J4Y A;  4TXO A;  2JZS A;  1TDI A;  1XW9 A;  4ZL8 A;  5HR3 A;  5B7C A;  3Q6O A;  9GSS A;  3I43 A;  1AUC A;  5B8B A;  4MF6 A;  4LMW A;  3WGE A;  3FZA A;  4K0N A;  5EY6 A;  2EFH A;  2NBS A;  2RLI A;  4K7N A;  1TK8 B;  4GQC A;  1VF2 A;  2H0H A;  5A34 A;  3O3T A;  3L9U A;  4HU9 A;  1AQV A;  2HRK B;  1BQ7 A;  4EDY A;  4OO5 A;  3ZFL A;  3FR3 A;  3TKS E;  3LQ7 A;  2YWI A;  2B6M A;  2FY6 A;  3IV4 A;  3RBT A;  4GSS A;  3HXS A;  4AF2 A;  3LFL A;  3F0I A;  3APO A;  5A1N B;  2PMT A;  4E68 A;  4Z7X A;  5G2Z A;  4K6X A;  1K3L A;  5G1K A;  4TXO B;  3U6V A;  3IC8 A;  2RM6 A;  3HVX A;  3A2X A;  3FY7 A;  3DVW A;  4MNN A;  1GSY A;  3QPM A;  4POK A;  1B8X A;  2XBQ A;  2H1L A;  3CSI A;  3M9J A;  5G5E A;  3ZVJ A;  5A34 B;  3TOT A;  2C3T A;  16GS A;  4X0X A;  1GNW A;  5ELG A;  3IRA A;  3GKN A;  1ERU A;  1JHB A;  2H6Z A;  4EXJ A;  3MAK A;  3A2V A;  2VL2 A;  1ZMA A;  5A4W A;  2O7K A;  3BCI A;  2H1B A;  2RUE A;  1FHE A;  3KH9 A;  4ZL9 A;  5IPH A;  1GP1 A;  3D0Z A;  1A0R P;  1WIK A;  2AV4 A;  4IHU A;  3TGZ A;  3KIJ A;  2YWN A;  3UBL A;  5KOW A;  1ST9 A;  3TKP A;  5DCG A;  1PN9 A;  3IK7 A;  3G9B A;  1X5C A;  4QQ7 A;  4WKW A;  1QGV A;  5FHI A;  2L4C A;  2QA2 A;  3D5J A;  2WCI A;  3DRN A;  1V9W A;  2K6V A;  3EMX A;  3J7Y k;  1IYI A;  4KB3 A;  2CX4 A;  1GSD A;  3ZMK A;  4POL A;  3GUS A;  2WGR A;  3HCZ A;  3RHB A;  4MK3 A;  1TU7 A;  4E8E A;  4OCF A;  5F06 A;  4DEJ A;  4IBP A;  2EIR A;  3CTF A;  4AJ7 A;  3CRU A;  1Z7P A;  1WJK A;  5G30 A;  1T3B A;  2CQ9 A;  1TI1 A;  4RQX A;  1XWG A;  1QUW A;  3IDV A;  4CHS A;  2PVO C;  4G0K A;  1Z5Y E;  2IWT A;  4HDE A;  3IR4 A;  1XBS A;  4QMK A;  2PPT A;  2PER A;  4RUV A;  2XHF A;  1TRU A;  3GX0 A;  4X1U A;  1BED A;  4L0U A;  1FB6 A;  5ECQ B;  1TRV A;  3QMX A;  2PGT A;  4OMV A;  3UVH A;  4JRR A;  4TR4 A;  2LST A;  1G0T A;  4OFT A;  2EFE A;  3H79 A;  2FD3 A;  1X9M B;  5ECK B;  2IFQ A;  3UBK A;  4K2X A;  1SVO A;  4DVC A;  4K8M A;  3GKX A;  1Z6N A;  4AJ6 A;  5G1L A;  4ECI A;  2LQQ A;  5ELA A;  3GV1 A;  2V1M A;  1F3B A;  4ZXG A;  3IXR A;  4BWS A;  4TR0 A;  6GSW A;  1JLW A;  3K8N A;  4HJ2 A;  1PN0 A;  2WB9 A;  1VF1 A;  3QAV A;  3RPP A;  2CZ3 A;  5IMA A;  2O89 A;  3GA4 A;  4K5R A;  4LLR A;  1H4O A;  1V58 A;  4MCU A;  3TCO A;  2MMO A;  4Z2R A;  4IW9 A;  2C80 A;  5GAP D;  5ECN B;  5DAL A;  1SK2 A;  3VWW A;  2H8L A;  1YEP A;  4E8H A;  2IFQ B;  3C1R A;  3HHV A;  2FA8 A;  4V2L A;  4FH8 A;  3HDC A;  2FLS A;  1JFU A;  2GSQ A;  6GSX A;  1ABA A;  2V41 A;  3CBU A;  1W89 A;  4GWR A;  1HQO A;  3QDN A;  1SK1 A;  1LJR A;  4K1F A;  1ERT A;  4KGI A;  5CRW A;  3SBC A;  3W6G A;  3F9U A;  1XZO A;  1BG1 A;  2P0G A;  2VL3 A;  2PU9 C;  2LNS A;  2C1Y A;  1ON4 A;  1NM3 A;  2C0F A;  2FWF A;  3I9V 2;  2CVB A;  1GSF A;  4YQM A;  4HI7 A;  3SWL A;  3C7M A;  2VOC A;  4QL9 A;  1F3A A;  4CW9 A;  1BF5 A;  5DAL B;  1WOU A;  1RW1 A;  3RDW A;  4PX1 A;  1PL2 A;  2OBI A;  4HJM A;  3LGC A;  2IMF A;  4V1A p;  1OYJ A;  4I2U A;  3US3 A;  1K0M A;  5AN1 A;  4ML1 A;  3UEM A;  2GZZ A;  4KAE A;  4J57 E;  4NV5 A;  1Y1U A;  2OE0 A;  3IHQ A;  2R37 A;  2DBC A;  1ERV A;  1T8E B;  4DSR A;  5CP1 A;  2P5Q A;  2R0G A;  1V57 A;  3PH9 A;  2HSM A;  2HFD A;  3FW2 A;  2DC5 A;  4G0I A;  1U6T A;  4GDF A;  3GUR A;  2VM2 A;  4MF7 A;  1WPI A;  4NWY A;  3H1N A;  2HZE A;  3KJY A;  3QD9 A;  4WR5 A;  1Q98 A;  1A23 A;  3ZIJ A;  2O87 A;  3MSZ A;  1GRX A;  5G5F A;  2X8C A;  1AAZ A;  1OC9 A;  2CAI A;  4XTS A;  3KCM A;  2E2G A;  2NDO A;  4PUF C;  3F63 A;  2A4H A;  3KTB A;  2OBK A;  1YDK A;  2AAW A;  1FVJ A;  3EMP A;  2GZY A;  2B5Y A;  5BMU A;  3GTU A;  2UV8 G;  2H72 A;  4YAV A;  5DVB A;  4HUA A;  3J7Y b;  2DMM A;  2VCV A;  1XWC A;  3DXB A;  2HSM B;  5ID2 A;  1FW1 A;  2E0Q A;  3GYK A;  2QA1 A;  3PGT A;  4ZB7 A;  2YWM A;  3WT1 A;  2JZT A;  3FZ9 A;  1R7H A;  1OE7 A;  6GSS A;  1QFN A;  3D21 A;  3QOU A;  2YV7 A;  4TR3 A;  2MZC A;  4GXZ A;  2HZE B;  1SL2 B;  1HYU A;  8GSS A;  4AKH A;  1SKS B;  5ECI B;  2GT6 A;  1OC9 B;  3E9J B;  4TOP A;  2K18 A;  3EE2 A;  3LJR A;  3PPU A;  1ZCP A;  3F4T A;  2C4J A;  1O6J A;  2H75 A;  3WT2 A;  5BMU B;  4EVM A;  3GTU B;  2FHE A;  3BD2 A;  1UA5 A;  1M99 A;  2GQM A;  1YF1 A;  1Z6M A;  5J47 A;  2C0E A;  1S3A A;  2G2Q A;  1T7P B;  1GSU A;  5B6N A;  1OKD A;  3FYG A;  4Q5F A;  2C0G A;  5ID2 B;  4TVE A;  1VGL A;  1ZZY A;  1K0B A;  4IP6 A;  4A5P A;  4J56 E;  1W4V A;  2H1D A;  4IP1 A;  1J08 A;  1F2E A;  4PQ1 A;  1R5P A;  3HZ4 A;  4L8E A;  2IIY A;  2PVQ A;  4NMU A;  1GLP A;  1O81 A;  1SYR A;  3ZYW A;  2FUG 2;  2VL9 A;  1NHO A;  5ECO B;  4NHZ A;  2R3X A;  1R5A A;  1RQM A;  3KEB A;  2GLR A;  5D9V A;  4OFN A;  3VI7 A;  5BRT A;  3UIW A;  1DSB A;  3TRQ A;  4ZIL A;  3LOR A;  2OAD A;  4CDO A;  5ECM B;  4KDY A;  3EU3 A;  3ZZX A;  1B48 A;  3FZ5 A;  4JED A;  1X0R A;  1EV9 A;  4NXI A;  1G6Y A;  2HYX A;  5J9C A;  1PMT A;  3LYP A;  5IPG A;  3GRX A;  3TDG A;  1G7E A;  2PBJ A;  2K9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...