5D73A

Structure of wuchereria bancrofti pi-class glutathione s-transferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
207
structure length
207
Chain Sequence
SYKLTYFPIRGLAEPIRLVLVDQGIKFTDDRINASDWPSMKSHFHFGQLPCLYDGDHQIVQSGAILRHLARKHNLNGGNELETTHIDMFCEGVRDLHTKYTKMIYQAYDTEKDSYIKDILPVELAKFEKLLATRDDGKNFILGEKISYVDFVLFEELDIHQILDPHCLDKFPLLKAYHQRMEDRPGLKEYCKQRNRAKIPVNGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title STRUCTURE OF WUCHERERIA BANCROFTI PI-CLASS GLUTATHIONE S-TRANSFERASE
rcsb
source organism Wuchereria bancrofti
molecule tags Transferase
total genus 73
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5d73A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5d73A01
4USSA 5IMFA 2GZYA 5DQSA 3KCMA 1SK1A 4OFTA 1B9YC 3R3EA 3IDVA 3QD9A 5DCHA 4TXVA 3LEFA 5JWRB 1K3YA 1J08A 3UBLA 5ECQB 2UZ8A 5IMAA 1SKSB 2AJQB 4PGTA 2C3NA 4AJ7A 3DGQA 5ECRB 2LJKA 4J2FA 4ZB8A 1YZXA 2E2MA 5B7CA 4J57E 1AIUA 3ZYWA 3D4TA 1SL1B 2C0EA 3IRAA 1TU8A 4F03A 2YP6A 2OACA 3V1WA 1GH2A 4XRAA 3EINA 4EC0A 4FYUA 4GQCA 1M2DA 1GUHA 4IJIA 5GSTA 4MJBA 3L0HA 1X9SB 4KH7A 4MH3A 4TR1A 11GSA 5FT3A 2GS3A 3HJOA 3ISOA 1GLQA 10GSA 4L8EA 3GH9A 1B48A 2OE1A 3M8NA 3F6FA 1XW6A 1OE8A 4MP4A 1WP0A 3GKXA 3CRUA 4WBRD 2ALBA 1OC3A 5EPFA 2GZZA 2C0FA 1KEBA 3F4TA 3GKKA 4ISDA 2X99A 4L5LA 3KD0A 3ME7A 1G7OA 4ZL8A 1M99A 3CBUA 1HNCA 2DLXA 3RAZA 1USBA 3N5OA 4FYCA 4KAEA 4ZXGA 3DYRA 4YQMA 5ID2B 4GQFA 1X5DA 4WF4A 3EU3A 3D6IA 3IV4A 2PVOC 1WOUA 2WCIA 3VI7A 2WS2A 2ON7A 1IYHA 4I8BA 4PX1A 4DSQA 1U3AA 2LV3A 2G2QA 3LGCA 4G19A 2CVKA 2VCXA 1DE1A 3HHVA 4KX4A 2GVPA 1W4VA 1X9WB 2N5AA 2HLSA 1GSSA 4HU7A 3H93A 2H8LA 3I69A 2CAQA 2VL9A 2XHFA 2GSQA 2X8GA 1GSEA 2YOIA 2C3QA 3UBKA 3EMXA 1AQVA 3D21A 4K7IA 4O32A 3ZVJA 3TKQA 1SL2B 3F3QA 3BCIA 1T1VA 3HJMA 4XS4B 5J41A 2MMOA 4ULXA 5JWOB 1V40A 1A0FA 3J7Yk 1TP9A 2H01A 3WGXA 4OO5A 2GSTA 3QDNA 3KTBA 4ECBA 4MH2A 2XBQA 1F6MC 3FYGA 1EWXA 1GLPA 5A5KA 3DVXA 2OA7A 2V2GA 1PX6A 2WGRA 2BMXA 3EU4A 1EOGA 4HJMA 1M2BA 16GSA 4QQ7A 4HUAA 4OFMA 1BQ7A 5J4UA 3D22A 1LJRA 2OE0A 4EE0A 3ZTLA 2L57A 4NHWA 1XZOA 1OKDA 3TB2A 3FZ5A 2OADA 2L5OA 1MDKA 4PURA 4MJCA 5IOXA 4GSNA 2A4VA 4ML6A 4BL7A 4MF6A 4ZILA 3ZMLA 4TKYA 3TUEA 5B8AA 4HU9A 3Q74A 2Z9SA 6GSSA 1QFNA 3KP9A 3N9JA 3F4RA 3VWXA 3QMXA 3OR5A 3NZNA 4KSMA 1AXDA 2F8AA 5DJMA 4ILFA 5G30A 4DVCA 1FO5A 2PMTA 2YN1A 3GN3A 4L5OA 2V41A 2FLSA 5F06A 3GX8A 1K0MA 2DSAA 1FG4A 3ZFLA 2FGXA 4JEDA 3GL5A 2PBJA 4RQXA 1VF1A 1SD8A 3KH7A 1F3AA 5FWGA 3DRNA 2VO4A 1K0NA 1EEJA 3KZQA 2ZCTA 4KDXA 5DALA 3ERWA 4IP1A 4MJEA 4N11A 2H70A 3L9UA 2KP1A 1YF0A 3GTUB 2EIRA 3VPQA 3H4KA 4G10A 2O85A 1QK8A 2IL3A 3GIXA 1B8XA 2R5GA 5HR0A 3IE3A 4LL4B 1UVZA 1GTUA 2GSRA 3E9JB 4XHMA 5HQPA 1XWBA 3P7XA 4XS1A 3DXBA 4I5QA 5E59A 4WR5A 2VCWA 4OCFA 2K18A 2FWFA 1HNAA 1C72A 2IMKA 5DAKA 5BMUA 3M9KA 1R4WA 2CVBA 4WR4A 3UARA 2RIIA 5D93A 1FVJA 1GWCA 1B9XC 1F37A 3BD2A 5ECHB 1NHOA 3CTFA 5EVOA 2DBCA 2O87A 5D9WA 3L78A 1B4QA 3L4NA 1ZYQB 1BYEA 2LRCA 3DWVA 2REMA 3L9SA 1AQWA 4KGIA 3HVSA 1GTIA 3KEBA 1TRWA 3MAKA 1EP8A 4Q5FA 5KN1A 4YH2A 3HD5A 3QOUA 3EE2A 2NDOA 2H1DA 3IHQA 4V2MA 2MMZA 4PQIA 3KJYA 2HE3A 2PU9C 4MABA 3ZIJA 3DKSA 4RQRA 2CVDA 2QGVA 3Q18A 2HZEB 2H76A 3G7JA 2LS5A 4K0NA 3VWVA 2H71A 5AIXA 1PQNA 3GKMA 4GCIA 2OKAA 4Z7XA 3MNGA 5A4VA 3F0IA 3BJ5A 2GLRA 2RM6A 1TRSA 4E8EA 2G0FA 1HYUA 4IQAA 2HRKB 5G5FA 3HJPA 5D9XA 4LLRA 4DSSA 4O7HA 1SJIA 1GRXA 3LWAA 1AAZA 4OWYA 2PGTA 1FVKA 1A2MA 3HKRA 1B4PA 1GL8A 5G2ZA 1EV4A 2GT6A 3QFAC 2DMMA 1X9MB 8GSSA 5CRWA 2QSIA 2I4AA 2BTOT 1ZOFA 4QL7A 2KP2A 4KCAA 3KIJA 2YWNA 2H1AA 2LTKA 1M2AA 4L0WA 3NOFA 4OFNA 4KW6A 5JCWA 2CZ2A 4IQ1A 3F63A 2P5QA 3GV1A 2XBIA 3SBCA 5C04A 1OC9A 3IR4A 2FA4A 1YQ1A 4KCEA 2IFQB 1URMA 2O8VB 2H1BA 2ES7A 1ZGNA 4JZQA 1ERUA 1ST9A 4H86A 4POMA 2JZRA 4IHUA 3TKSC 2N5BA 4YQUA 2WJUA 3GSTA 3GA4A 4POKA 4DSRA 5CAXA 1XWAA 1YF1A 19GSA 4XS6A 1O73A 2O7KA 4ECJA 4KDUA 1Z6NA 4BVXB 4K7OA 4TXOA 4F82A 3HCZA 3A3TA 4G0KA 2HYXA 3QAVA 4OMVA 6GSVA 1R7HA 4Q5RA 2IN3A 2L5LA 6GSYA 13GSA 5GAND 1O85A 4TOPA 2K8SA 4MCUA 2VL3A 2E0QA 1T4ZA 1RQMA 1TRVA 5LD0A 2FWHA 2YWIA 5DCGA 3DMLA 3QAWA 4K0GA 4HOJA 1YKAA 4IGJA 1PKWA 1Z7PA 4EXJA 4KSOA 2DJKA 2VLUA 3FR6A 2LNTA 2L4QA 4PQ1A 6GSWA 1V2AA 1ZL9A 3GSSA 3TKPA 1EP7A 2HNLA 4XIHA 1Z9HA 1T00A 2E7PA 1I9DA 2VM1A 1G7EA 5FHIA 3GMFA 1BAYA 5CNWA 1GUKA 2V32A 2FCHA 3IA1A 1MD4A 3IAS2 1AQXA 4ACSA 1T3BA 3HVXA 3G7IA 1EV9A 3HVVA 4MF7A 4GRFA 5G5EA 3CSHA 2VL2A 2GQMA 2LJAA 3H1NA 3US3A 2CX4A 1FB6A 5KN2A 2IIYA 3F3RA 3TKSA 3KMNA 3UVHA 1O8WA 2B1KA 4MA9A 2NBSA 1JZOA 3TOUA 5J5NA 4BWQA 2KOKA 1RW1A 1NSWA 1ZYEA 1SKWB 3FZAA 1ZCPA 2B7JA 4V2NA 3TOTA 3GYKA 5D9VA 4N30A 2YPMA 1XWGA 5EL8A 4I2TA 3H79A 3VWUA 5A4UA 3IAM2 4ZL7A 2ZUPA 3GHAA 2D2ZA 1KNGA 5ENUA 4MPFA 2IJYA 1ZZYA 2DC5A 2F3MA 4KF9A 1M7TA 1YY7A 1VF2A 2AUVA 1K3OA 4OD7A 4WKWA 2LRTA 4V1Ag 4J56E 1QXHA 1YKCA 7GSSA 5INYA 3GNJA 2H0GA 3APOA 3WT2A 4Q5NA 3WGEA 1XW5A 5CO3A 2JADA 4EO3A 5CREA 2H6YA 4K9ZA 2HI7A 2OBIA 1NM3A 4ZBAA 2KHPA 1MD3A 2B7KA 2RUFA 1PRXA 4CHSA 2YV9A 3EC3A 1K0CA 1TI3A 5B8BA 3LXTA 2WULA 2A2SA 3GX0A 5D9TA 1SENA 4EL1A 5A4WA 2DIYA 3TJBA 4BVYB 2B3SA 4I6XA 2YWMA 1FB0A 5DAKB 5F0GA 3ZL5A 2F51A 3IBHA 1VRSD 2GTUA 1GSQA 4BPYA 1OC8A 2GSSA 1E6BA 5ELAA 3CTGA 4HQSA 4WBJA 1EZKA 1TU7A 1GSFA 3QAGA 4EF0A 2I9HA 1TJDA 4ECIA 2DJ3A 4G0IA 3M0FA 3TRPA 1U87A 4KUNA 4K6XA 5IIZA 4GXZA 4LMWA 5ECMB 2R4VA 1ERVA 1O8XA 1J9BA 2CAIA 5GZZB 4MZCA 1T4YA 3PR8A 1ACVA 2YZHA 4XCSA 5DQYA 1SK2A 2PVQA 1WPIA 2H1GA 4WF5A 1A2JA 3IPZA 2HSMB 3W8SA 2KLXA 2HRAA 1JLVA 5DVBA 2YZUA 1SU9A 1SL0B 2NTOA 3D5JA 2K8VA 2ON5A 5JWQB 2YV7A 4MMMA 4X1UA 5G1LA 2VCTA 4BWSA 2P5RA 3TRXA 3LFLA 2PWJA 2C1YA 4DSSB 4TW5A 1JLWA 4AF2A 1V57A 5HR2A 3WT1A 1TXXA 5LNKe 2VLTA 2FWEA 4JU5A 3FW2A 3RDWA 3A2WA 2LKUA 2R37A 5EY6A 4IKHA 4FH8A 1SYXA 5ID2A 2C4JA 1GP1A 4ZB9A 1FHEA 3TKSE 3F6DA 1AUCA 3TJGA 5AIVA 1M9BA 2GDRA 1YJ6A 1EGRA 1LBKA 1Y25A 5IPHA 1U3IA 5HFGA 4LL1B 5H5RA 4JRRA 4IJ3A 1OC9B 4MDCA 4MLYA 3Q19A 2FUG2 4HI7A 1T8EB 3ZLPA 1PX7A 4K2DA 2LUSA 2NVLA 2M46A 4XS4A 4TRXA 1XWCA 4GWRA 5HFKA 1JHBA 4ID0A 3SWLA 3WD6A 4TXOB 2AV4A 1H4OA 1S3CA 2O89A 1Z5YE 5GAPD 1BJXA 2VCVA 4OCEA 4IS0A 4IN0A 2PPTA 3IC4A 4ZL9A 4OO4A 1V9WA 1XCCA 1OKTA 2HZFA 4LA1A 5D8IA 1WMJA 3TJFA 5DDLA 4HZ4A 3LXZA 2H0IA 4DEJA 3VWWA 1WRYA 1Q4JA 4YAPA 2CX3A 3ERFA 3FRCA 3CMIA 4FYBA 3S9FA 2WFCA 3GKNA 3L9VA 2I81A 1UC7A 3PH9A 2HSNB 1NHYA 2DJ2A 2EIOA 2FWGA 2H75A 4QL9A 2DJ1A 3FKFA 4EUYA 1X5CA 2L4CA 5D96A 5F8BA 1JZRA 1SJ6A 1QQ2A 1DUGA 1JZWA 2MMAA 4NWYA 20GSA 4L0UA 2XPEA 4TR1B 3J7Yb 1TRUA 1A8LA 3BBYA 2HFDA 4AJ8A 3TCOA 4P3YB 1XOAA 4MZBA 1YDKA 3PPUA 5G31A 4NXIA 1T7PB 3M1GA 3F4SA 1X0RA 14GSA 3P90A 2AAWA 3UEMA 4PNFA 4XTSA 4MF5A 3UMAA 1GSDA 1O6JA 4NHZA 3H8QA 4HJ2A 2M72A 4PXOA 4ECCA 3VI5A 3D0ZA 1M0UA 3I43A 5ECPB 4HDEA 4MPGA 1YEXA 1BG5A 4JR4A 2GZPA 3IC8A 4YAVA 2JU5A 4D73A 5CRHA 1DE2A 2L6CA 3C73A 3ZFBA 4LMVA 3E0UA 4POLA 1TKDB 1QMVA 5ECOB 2VLVA 1F9MA 5E4WA 1PKZA 2AHEA 3APSA 3WYWA 3LSZA 3RPPA 2TRCP 1OAZA 2VD1A 3CSJA 1SJZA 1BX9A 5KEJA 1KTEA 4FO5A 5KN0A 3ERGA 2J23A 3FY7A 1PGTA 3ME8A 3FR3A 1I5GA 1GNWA 1SK0A 2YWOA 1ON4A 1CQHA 2J9HA 4K1FA 4TN8A 3O76A 1LU4A 3UJ1A 3AY8A 5F05A 2H19A 3DIEA 4KDYA 1FW1A 3UAPA 3QR6A 5H5QA 1G6YA 4ZIJA 2YANA 1EGOA 4NV5A 5J9BA 3QFBC 2A2RA 1A24A 1HD2A 4IVFA 1O81A 1JFUA 4ZB6A 1WWJA 5ECKB 3TGZA 2HZEA 3C1RA 3GRXA 4X0XA 2MBTA 1M9AA 2LNSA 1PMTA 5IMVA 2CT6A 4JR6A 5ECNB 2IMFA 3WGDA 4N0VA 3IOSA 1K0DA 4BL7B 2I3YA 1FOVA 2H0HA 2JACA 2KUCA 2MBSA 2IWTA 3MWHA 3D4MA 4MK3A 2HRKA 5IPGA 2H6ZA 3JCML 5F07A 1A23A 3A2XA 5IMZA 4BA7A 2C3TA 2FNOA 2WRTA 1TI1A 3GL3A 3LQ7A 2TRXA 3EYTA 1ILOA 2DJJA 4PTSA 1RK4A 2VD0A 3RHBA 2FY6A 3VPTA 4JBBA 2CQ9A 2VM2A 3CRTA 1XW9A 3LYPA 2VCZA 4HZ2A 4F9ZA 1K0BA 2VCQA 3IK7A 2VOCA 3UOMA 1SD9A 3FHKA 2R6KA 3EVIA 3UVTA 3UL3A 1NW2A 3RPNA 3EMPA 1TK8B 4ZBBA 2YJ7A 9GSSA 3LG6A 2EIQA 2V6OA 1K0OA 2H66A 1GTBA 3LORA 2WB9A 4TVEA 5DALB 2FA8A 1UA5A 2B6MA 1THXA 2IFQA 3HDCA 4G2EA 1ML6A 3R2QA 4EKZA 2JSZA 4EVMA 4FQUA 1VGLA 4HEA2 1GUMA 4AJ6A 3MDKA 2R2JA 2GT5A 1WJKA 2HRFA 3Q6OA 4IP6A 5ECLB 4CW9A 4EDZA 3UIWA 4BVXA 1F2EA 3ZMKA 3HA9A 4I97A 2WZ9A 1PSQA 1OE7A 3ED3A 2HXKA 2V6KA 1GNEA 2GQKA 2C0DA 5KN3A 4NMUA 4RI6A 1JZDA 1XPVA 3KH9A 3QCPA 5IQYA 5B6MA 4N0ZA 1DSBA 1G0TA 1AC1A 3GFKA 3HXSA 3O6TA 1O7UA 2LQOA 1PL1A 1J0FA 4ZBDA 1A0RP 1UN2A 1ERWA 4GSSA 2VUPA 1MEKA 2LQQA 3KMOA 3TJJA 1XWKA 1X5EA 2EC4A 2X8HA 2MYGA 1Z6MA 3GH6A 3LYKA 2H72A 2AB6A 5IO2A 3IXRA 5AISA 2MZCA 6GSTA 5H5SA 4Q5QA 2B5XA 3K8NA 1WE0A 12GSA 2ZNMA 1Z3EA 3FZ9A 3F8UA 5IOWA 1SKRB 2IPAA 2HSYA 4IELA 4RI7A 2LJRA 2F9SA 2P31A 4FIWA 1THOA 3ZIVA 2YCDA 1N2AA 3G7YA 4KA0A 2CA8A 4IW9A 3DVWA 4NV2A 3C1SA 4JE1A 5C00A 2QKEA 6GSUA 3I9V2 3KTLA 4GLTA 5IMCA 2JSYA 5G1KA 4NPBA 5IO0A 2JZTA 3ZVJD 1S3DA 2WDUA 4X43A 2OE3A 1XVQA 1DBYA 1V98A 1TW9A 3M9JA 1GSYA 2HSHA 5J9CA 2BJXA 2H30A 4YQVA 4KB3A 1U88A 4WETA 5DBQA 2LRNA 2L6DA 1PN9A 2JZSA 2C0GA 2DMLA 2CZ3A 1MTCA 4EDYA 3VFIA 1YEPA 3VK9A 2RLIA 2K6VA 1XXUA 1HNBA 3PINA 4K8MA 1QUWA 18GSA 1PL2A 3G9BA 5D73A 3RBTA 2HT9A 2V1MA 2LEGA 3P8WA 3MSZA 3E3EA 1A2LA 2E2GA 2PUKC 5ECIB 2X8CA 4AGSA 2C8UA 1K3LA 1A8YA 3PGTA 17GSA 4D73B 3KXOA 5IMDA 1ZMAA 5LCZA 2YJHA 3GURA 1GTAA 3P2AA 2HRNA 3DEXA 4F2IA 1U6TA 5COHA 3HZ8A 4MZWA 3BOAA 3W8JA 3KGKA 3U6VA 1SYRA 3C8EA 3KP8A 1QGVA 4F0CA 3CXGA 5GSSA 2DIZA 4GTUA 1ERTA 1TK0B 3RHCA 2XPDA 1OYJA 1PD21 1E2YA 3LJRA 3A2VA 4BVYA 1XBSA 2OJLA 3FK8A 4TR0A 5CRDA 2CV4A 4KNDA 4TR4A 4PNGA 1S3AA 22GSA 4WEYA 4GSTA 4PUAA 2RM5A 4E8HA 1TDIA 2L59A 4G0LA 1AW9A 3ZREA 5ABRA 2IMDA 3KM6A 3M3MA 5ELGA 1XIYA 3I6AA 4HQZA 4G9HA 3HYPA 3BCKA 1VF4A 6GSXA 1H75A 1MDJA 3F9UA 5CRGA 5HFIA 3TJKA 4XRDA 4ML1A 1VF3A 3ZRDA 4IBPA 3EWLA 2MMNA 3FZ4A 3FEUA 3W6GA 2IMIA 3ZITA 2H74A 2HSMA 5L71A 5IM9A 1TOFA 1Q98A 1R5AA 2FD3A 2JL4A 1W89A 1PA3A 1Z7RA 5ECSA 3HZ4A 5J3RA 1XOBA 2FHEA 5CYYA 2B5EA 2GGTA 1CQGA 1V58A 3O3TA 5JCUA 4RUVA 5AN1A 5HR1A 5JCGA 4KE3A 2P0GA 3APQA 1KBNA 3DD3A 2QC7A 4O92A 3CYNA 2RUEA 4HS1A 2B5YA 3IK9A 3A5WA 3QPMA 2PERA 1OVNA 3C71A 4O5RA 1F3BA 2K9FA 3GUSA 3ZZXA 1R26A 2H73A 3GTUA 2M80A 2NPBA 1WIKA 1XFLA 2VIMA 4I2UA 1BEDA 1ABAA 2F8FA 2DJ0A 4GF0A 1N8JA 1IYIA 5HR3A 5CP1A 1GSUA 1MDIA 4K7NA 2IMEA 1Y6EA 3CSIA 2XC2A 4CDOA 3TDGA 2B1LA 2R3XA 2AYTA 2C80A 4F0BA 5DJLA 2H6XA 2GQLA 2TIRA 4MJAA 3NIVA 2PN8A 3VURA 2VL2C 4WXTA 2X64A 1G6WA 5AGYA 1K0AA 2YNXA 1EEMA 4NAXA 3FR9A 3HY2A 3C7MA 3TKRA 3TRQA 2LSTA 2OBKA 4POBA 3U5RE 4PUFC 2I1UA 3VLNA 1XVWA 4TR3A 4V2LA 4N10A 4V1Ap 1EOHA 1HQOA 1FAAA 4PQHA 1TK5B 2VAFA 2N5FA 1R5PA 1GULA 1TTZA 5B6NA 2HQTA 3EURA
chains in the Genus database with same CATH superfamily
4USSA 5IMFA 2GZYA 5DQSA 3KCMA 1SK1A 4OFTA 1B9YC 3R3EA 3IDVA 3QD9A 5DCHA 4TXVA 3LEFA 5JWRB 1K3YA 1J08A 3UBLA 5ECQB 3LW9A 2UZ8A 5IMAA 1SKSB 2AJQB 4PGTA 2C3NA 4AJ7A 3DGQA 5ECRB 2LJKA 4J2FA 4ZB8A 1YZXA 2E2MA 5B7CA 4J57E 1AIUA 3ZYWA 3D4TA 1SL1B 2C0EA 3IRAA 2HSNA 1TU8A 4F03A 2YP6A 2OACA 3V1WA 1GH2A 4XRAA 3EINA 4EC0A 1Y1UA 4FYUA 4GQCA 1M2DA 4K5RA 1GUHA 4IJIA 5GSTA 4MJBA 2DKHA 3L0HA 1X9SB 4KH7A 4MH3A 4TR1A 11GSA 2WW1A 5FT3A 2GS3A 3HJOA 3ISOA 1GLQA 10GSA 4L8EA 3GH9A 1B48A 2OE1A 4A5PA 3F6FA 3M8NA 1XW6A 1OE8A 4MP4A 1WP0A 3GKXA 3CRUA 4WBRD 2ALBA 1OC3A 5EPFA 2GZZA 2C0FA 1KEBA 3F4TA 3GKKA 4ISDA 2X99A 4L5LA 3KD0A 3ME7A 1G7OA 4ZL8A 1M99A 3CBUA 1HNCA 2DLXA 3RAZA 1USBA 3N5OA 4FYCA 4KAEA 4ZXGA 3DYRA 4YQMA 5ID2B 4GQFA 1X5DA 4WF4A 3EU3A 3D6IA 3IV4A 2PVOC 1WOUA 2WCIA 3VI7A 2WS2A 2ON7A 1IYHA 4I8BA 4PX1A 4DSQA 1U3AA 2LV3A 2G2QA 2WVXA 3LGCA 4G19A 2CVKA 2VCXA 1DE1A 3HHVA 4KX4A 2GVPA 1W4VA 1X9WB 2N5AA 2HLSA 1GSSA 4HU7A 3H93A 2H8LA 3I69A 2CAQA 2VL9A 2XHFA 2GSQA 2X8GA 1GSEA 2YOIA 2WW0A 2C3QA 3UBKA 3EMXA 1AQVA 3D21A 4K7IA 4O32A 3ZVJA 3TKQA 1SL2B 3F3QA 3BCIA 1T1VA 3HJMA 4XS4B 5J41A 2MMOA 4ULXA 5JWOB 1V40A 3CQFA 1A0FA 3J7Yk 1TP9A 2H01A 3WGXA 1SVLA 4OO5A 2GSTA 3QDNA 3KTBA 4ECBA 4MH2A 2XBQA 1F6MC 3FYGA 1EWXA 1GLPA 5A5KA 3DVXA 2OA7A 2V2GA 1PX6A 2WGRA 2BMXA 3EU4A 1EOGA 4HJMA 1M2BA 16GSA 4QQ7A 3CHXC 4HUAA 4OFMA 1BQ7A 5J4UA 3D22A 1LJRA 2OE0A 4EE0A 3ZTLA 2L57A 4NHWA 1XZOA 1OKDA 3TB2A 3FZ5A 2OADA 1ZYPA 2L5OA 1MDKA 4PURA 4MJCA 5IOXA 4GSNA 2A4VA 4ML6A 4BL7A 4MF6A 4ZILA 2EFHA 3ZMLA 4TKYA 3TUEA 5B8AA 4HU9A 3Q74A 1SVOA 2Z9SA 6GSSA 2R0GA 1QFNA 3KP9A 1I1IP 3N9JA 3F4RA 3VWXA 3QMXA 3OR5A 3NZNA 4KSMA 1AXDA 2F8AA 5DJMA 4ILFA 5G30A 4DVCA 1FO5A 2PMTA 2YN1A 3GN3A 4L5OA 2V41A 2FLSA 5F06A 3GX8A 1ZYNA 1K0MA 2DSAA 1FG4A 3ZFLA 2FGXA 4JEDA 3GL5A 2PBJA 4RQXA 1VF1A 1SD8A 1F3AA 5FWGA 3KH7A 3A5IA 3DRNA 2VO4A 1K0NA 1EEJA 3KZQA 2ZCTA 4KDXA 5DALA 3ERWA 4IP1A 4MJEA 4N11A 2H70A 3L9UA 2KP1A 1YF0A 3GTUB 2EIRA 3VPQA 3H4KA 4G10A 2O85A 1QK8A 2IL3A 3GIXA 3HMJG 1B8XA 2R5GA 5HR0A 3IE3A 2R0PA 4LL4B 1UVZA 1GTUA 2GSRA 4Z2RA 3E9JB 4XHMA 5HQPA 1XWBA 3P7XA 4XS1A 3DXBA 4I5QA 5E59A 4WR5A 2VCWA 4OCFA 2K18A 2FWFA 4QMKA 1HNAA 1C72A 2IMKA 5DAKA 5BMUA 3M9KA 1R4WA 2CVBA 4WR4A 3UARA 2RIIA 5D93A 1FVJA 1GWCA 1B9XC 1F37A 3BD2A 5ECHB 1NHOA 3CTFA 5EVOA 2DBCA 2O87A 5D9WA 3L78A 1B4QA 3L4NA 1ZYQB 1BYEA 2LRCA 3DWVA 2REMA 3L9SA 1AQWA 4KGIA 3HVSA 1GTIA 3KEBA 1TRWA 3MAKA 1EP8A 4Q5FA 5KN1A 4YH2A 3HD5A 3QOUA 3EE2A 2NDOA 2O36A 2H1DA 3IHQA 4HSCX 2MMZA 4V2MA 4PQIA 3KJYA 2HE3A 2PU9C 4MABA 3ZIJA 3DKSA 4RQRA 2CVDA 2QGVA 5A34B 3Q18A 2HZEB 2H76A 3G7JA 2LS5A 4K0NA 3VWVA 2H71A 5AIXA 1PQNA 3GKMA 4GCIA 2OKAA 4Z7XA 3MNGA 5A4VA 3F0IA 3BJ5A 2GLRA 2RM6A 1TRSA 4E8EA 2G0FA 1HYUA 4IQAA 2HRKB 5G5FA 3HJPA 5D9XA 4LLRA 4DSSA 4O7HA 1SJIA 1GRXA 3LWAA 1AAZA 4OWYA 2PGTA 1FVKA 1A2MA 3HKRA 1BF5A 1B4PA 1S4BP 1GL8A 5G2ZA 1EV4A 2GT6A 3QFAC 2DMMA 1X9MB 8GSSA 5CRWA 2QSIA 2O5VA 2I4AA 2BTOT 1ZOFA 4QL7A 2QA1A 1XG8A 2KP2A 4KCAA 3KIJA 2YWNA 2H1AA 2LTKA 1M2AA 4L0WA 3NOFA 4OFNA 4KW6A 5JCWA 2CZ2A 4IQ1A 3F63A 2P5QA 3GV1A 2XBIA 3HVNA 3SBCA 5C04A 1OC9A 3IR4A 2FA4A 1YQ1A 4KCEA 2IFQB 1URMA 4AKXB 2O8VB 2H1BA 2ES7A 1ZGNA 4JZQA 1ERUA 1ST9A 4H86A 4POMA 2JZRA 4IHUA 2WVXB 3TKSC 2N5BA 3EPTA 4YQUA 2WJUA 3GSTA 3GA4A 4POKA 4DSRA 5CAXA 1XWAA 1YF1A 19GSA 4XS6A 1O73A 2O7KA 4ECJA 4KDUA 1Z6NA 4BVXB 4K7OA 4TXOA 4F82A 3HCZA 3A3TA 4G0KA 2HYXA 3QAVA 4OMVA 6GSVA 1R7HA 4Q5RA 2IN3A 2L5LA 6GSYA 13GSA 5GAND 1O85A 4TOPA 2K8SA 4MCUA 2VL3A 2E0QA 1T4ZA 1RQMA 1TRVA 5LD0A 2FWHA 2YWIA 5DCGA 3DMLA 3QAWA 4K0GA 4HOJA 1YKAA 4IGJA 1PKWA 1M3IA 1Z7PA 4EXJA 4KSOA 5A1NB 2DJKA 2VLUA 3FR6A 2LNTA 2L4QA 4PQ1A 6GSWA 1V2AA 1ZL9A 3GSSA 3TKPA 1EP7A 2HNLA 4XIHA 1Z9HA 1T00A 2E7PA 1I9DA 2VM1A 1G7EA 5FHIA 3GMFA 1BAYA 5CNWA 1GUKA 2V32A 2FCHA 3IA1A 1MD4A 3IAS2 1AQXA 4ACSA 1T3BA 3HVXA 3G7IA 1EV9A 3HVVA 4MF7A 4GRFA 5G5EA 3CSHA 2VL2A 2GQMA 2LJAA 3H1NA 3US3A 2CX4A 1FB6A 5KN2A 2IIYA 3F3RA 3TKSA 3KMNA 3UVHA 1O8WA 2B1KA 4MA9A 2NBSA 1JZOA 3TOUA 5J5NA 4BWQA 2KOKA 1RW1A 1NSWA 1ZYEA 1SKWB 3FZAA 1ZCPA 2B7JA 4V2NA 3TOTA 3GYKA 5D9VA 4N30A 2YPMA 1XWGA 5EL8A 4I2TA 3H79A 3VWUA 5A4UA 3IAM2 4ZL7A 2ZUPA 3GHAA 2D2ZA 4EIPA 1KNGA 5ENUA 4MPFA 2IJYA 1ZZYA 2DC5A 2F3MA 4KF9A 1M7TA 1YY7A 1VF2A 2AUVA 1K3OA 4Z2UA 4O5QA 4OD7A 4WKWA 2LRTA 4V1Ag 1QXHA 4J56E 1YKCA 7GSSA 5INYA 2EFCA 3GNJA 2H0GA 3APOA 3WT2A 4Q5NA 3WGEA 1XW5A 5CO3A 2JADA 4EO3A 5CREA 2H6YA 4K9ZA 2HI7A 2OBIA 1NM3A 4ZBAA 2KHPA 1MD3A 2B7KA 2RUFA 1PRXA 4CHSA 2YV9A 3EC3A 1K0CA 1TI3A 5B8BA 3LXTA 2WULA 2A2SA 3GX0A 5D9TA 5J47A 1SENA 4EL1A 5A4WA 2DIYA 3TJBA 4BVYB 2B3SA 4I6XA 2YWMA 1FB0A 5DAKB 5BMUB 5F0GA 3ZL5A 2F51A 3IBHA 1VRSD 5J4VA 4K2XA 2GTUA 1GSQA 4BPYA 1OC8A 2GSSA 1E6BA 5ELAA 3CTGA 4HQSA 4WBJA 1EZKA 2H1LA 1TU7A 1GSFA 3QAGA 4EF0A 2I9HA 5A5HA 1TJDA 4ECIA 2DJ3A 4G0IA 3M0FA 3TRPA 1U87A 4KUNA 4K6XA 5IIZA 4GXZA 4LMWA 5ECMB 2R4VA 1ERVA 4EIQA 1O8XA 1J9BA 2CAIA 5GZZB 4MZCA 1T4YA 3PR8A 1ACVA 2YZHA 4XCSA 5DQYA 1SK2A 2PVQA 1WPIA 2H1GA 4WF5A 1A2JA 3IPZA 2HSMB 3W8SA 2KLXA 2HRAA 1JLVA 5DVBA 2YZUA 1SU9A 1SL0B 4GDFA 2NTOA 5J4YA 3D5JA 2K8VA 2ON5A 5JWQB 2YV7A 4MMMA 4X1UA 5G1LA 2VCTA 4BWSA 2P5RA 3TRXA 3LFLA 2PWJA 2C1YA 4DSSB 4TW5A 1JLWA 2X49A 4AF2A 1S3RA 1V57A 5HR2A 1TXXA 3WT1A 2VLTA 5LNKe 2FWEA 4JU5A 3FW2A 3RDWA 3A2WA 2LKUA 2R37A 5EY6A 4IKHA 4FH8A 1SYXA 5ID2A 2C4JA 1GP1A 4ZB9A 1FHEA 3TKSE 3F6DA 1AUCA 4E68A 3TJGA 5AIVA 1M9BA 2GDRA 1YJ6A 4AKHA 2EFDA 1EGRA 1LBKA 1Y25A 5IPHA 1U3IA 5HFGA 4LL1B 5H5RA 4JRRA 4IJ3A 1OC9B 4MDCA 4MLYA 1BG1A 3Q19A 2FUG2 4HI7A 1T8EB 3ZLPA 1PX7A 4K2DA 2LUSA 2NVLA 2M46A 4XS4A 4TRXA 1XWCA 4GWRA 5HFKA 1JHBA 4ID0A 4CY6A 3SWLA 3WD6A 4TXOB 2AV4A 1H4OA 1S3CA 2O89A 1Z5YE 5GAPD 1BJXA 5KOXA 2VCVA 4OCEA 4IS0A 4IN0A 5BRTA 2PPTA 3IC4A 1N25A 4ZL9A 4OO4A 1V9WA 1XCCA 1OKTA 2HZFA 4LA1A 5D8IA 1WMJA 3TJFA 5DDLA 4HZ4A 3LXZA 2H0IA 4DEJA 3VWWA 1WRYA 1Q4JA 4YAPA 2CX3A 3ERFA 3FRCA 3CMIA 4FYBA 3S9FA 2WFCA 4AI6A 3GKNA 3L9VA 2I81A 1UC7A 3PH9A 2HSNB 1NHYA 2DJ2A 2EIOA 2FWGA 2H75A 4QL9A 2DJ1A 3FKFA 4EUYA 1X5CA 2L4CA 5D96A 5F8BA 1JZRA 1SJ6A 1QQ2A 1DUGA 1JZWA 2MMAA 4NWYA 20GSA 4L0UA 2XPEA 4TR1B 3J7Yb 1TRUA 1A8LA 3BBYA 2HFDA 4AJ8A 3TCOA 4P3YB 1XOAA 4MZBA 1YDKA 3PPUA 5G31A 4NXIA 1T7PB 3M1GA 3F4SA 1X0RA 14GSA 3P90A 2AAWA 3UEMA 4PNFA 4XTSA 4MF5A 3UMAA 1GSDA 1TXUA 1O6JA 2WZSA 4NHZA 3H8QA 4HJ2A 2M72A 4PXOA 4ECCA 3VI5A 3D0ZA 1M0UA 1YEWC 3I43A 5ECPB 4HDEA 4MPGA 1YEXA 1BG5A 4JR4A 2GZPA 3IC8A 4YAVA 2JU5A 4D73A 5CRHA 1DE2A 2UV8G 2L6CA 3C73A 3RFRC 3ZFBA 4LMVA 3E0UA 4POLA 1TKDB 1QMVA 5ECOB 2VLVA 1F9MA 5E4WA 1PKZA 2AHEA 3APSA 3WYWA 1SVMA 3LSZA 3RPPA 2TRCP 1OAZA 2VD1A 3CSJA 1SJZA 1PFOA 1BX9A 4CY8A 5KEJA 1KTEA 4FO5A 5KN0A 3ERGA 2J23A 3FY7A 1PGTA 3ME8A 3FR3A 1I5GA 1GNWA 1SK0A 2YWOA 1ON4A 1CQHA 2J9HA 4K1FA 4TN8A 3O76A 1LU4A 3UJ1A 3AY8A 3DIEA 4W66A 5F05A 2H19A 4KDYA 1FW1A 3UAPA 3QR6A 5H5QA 1G6YA 4ZIJA 2YANA 1EGOA 4NV5A 5J9BA 3QFBC 2A2RA 1A24A 1HD2A 4IVFA 1O81A 1JFUA 4ZB6A 5A34A 1WWJA 2OT3A 5ECKB 3TGZA 2HZEA 3C1RA 3GRXA 4X0XA 2MBTA 1M9AA 2LNSA 1PMTA 5IMVA 2CT6A 4MNNA 4JR6A 5ECNB 5A5HB 2IMFA 3WGDA 4N0VA 3IOSA 1K0DA 4BL7B 2I3YA 1FOVA 2H0HA 2JACA 2KUCA 2MBSA 2IWTA 3MWHA 4FXYP 3D4MA 4MK3A 2HRKA 5IPGA 2H6ZA 3JCML 5F07A 1A23A 3A2XA 5IMZA 4BA7A 2C3TA 2FNOA 2WRTA 1TI1A 3GL3A 3LQ7A 2TRXA 4N3ZA 3EYTA 1ILOA 2DJJA 4PTSA 1RK4A 2VD0A 3RHBA 2FY6A 3VPTA 4JBBA 2EFEA 2CQ9A 2VM2A 3CRTA 1XW9A 3LYPA 2VCZA 4HZ2A 5J40A 4F9ZA 1K0BA 1YVLA 2VCQA 3IK7A 4ZB7A 2VOCA 3UOMA 1SD9A 3FHKA 2R6KA 4G01A 3EVIA 4ICYA 3UVTA 3UL3A 1NW2A 3RPNA 3EMPA 1TK8B 4ZBBA 4O5UA 2YJ7A 1FOHA 9GSSA 3LG6A 2EIQA 2V6OA 1K0OA 2H66A 1GTBA 3LORA 2WB9A 4TVEA 5DALB 2FA8A 1UA5A 2B6MA 1THXA 2IFQA 3TU3B 3HDCA 4G2EA 1ML6A 3R2QA 4EKZA 4PI0C 2JSZA 5KOWA 4EVMA 4FQUA 1VGLA 4HEA2 1GUMA 4AJ6A 3MDKA 2R2JA 2GT5A 1WJKA 2HRFA 3Q6OA 4IP6A 5ECLB 4CW9A 4EDZA 3UIWA 4BVXA 1F2EA 3ZMKA 3HA9A 4I97A 2WZ9A 1PSQA 1OE7A 3ED3A 2HXKA 2V6KA 1GNEA 2GQKA 2C0DA 5KN3A 4NMUA 4RI6A 1JZDA 1XPVA 3KH9A 3QCPA 5IQYA 5B6MA 4N0ZA 1DSBA 1G0TA 1AC1A 3GFKA 3HXSA 3O6TA 1O7UA 2LQOA 2O3EA 1PL1A 1J0FA 4ZBDA 1A0RP 1UN2A 5A1NA 1ERWA 4GSSA 2VUPA 1MEKA 2LQQA 3KMOA 3TJJA 1XWKA 1X5EA 2EC4A 2X8HA 2MYGA 1Z6MA 3GH6A 3LYKA 2H72A 2AB6A 5IO2A 3IXRA 5AISA 2MZCA 6GSTA 5H5SA 4Q5QA 2B5XA 3K8NA 1WE0A 12GSA 2ZNMA 1Z3EA 3FZ9A 3F8UA 5IOWA 1SKRB 2IPAA 2HSYA 4IELA 4RI7A 2LJRA 2F9SA 2P31A 4FIWA 1THOA 3ZIVA 2YCDA 1N2AA 3G7YA 4KA0A 3MYDA 2CA8A 4IW9A 3DVWA 4NV2A 3C1SA 4JE1A 5C00A 2QKEA 6GSUA 3I9V2 3KTLA 4GLTA 5IMCA 2JSYA 5G1KA 4NPBA 5IO0A 2JZTA 3ZVJD 3FMWA 1S3DA 2WDUA 4X43A 2OE3A 1XVQA 1DBYA 1V98A 1TW9A 3M9JA 1GSYA 2HSHA 5J9CA 2BJXA 2H30A 4YQVA 4KB3A 1U88A 4WETA 5DBQA 2LRNA 2L6DA 1PN9A 2JZSA 2C0GA 2DMLA 2CZ3A 1MTCA 4EDYA 3VFIA 1YEPA 3VK9A 2WW3A 2RLIA 2K6VA 1XXUA 1HNBA 3PINA 4K8MA 1QUWA 3MIXA 18GSA 4PI2C 1PL2A 3G9BA 5D73A 3RBTA 2VKZG 2HT9A 2A2PA 2V1MA 2LEGA 3P8WA 3MSZA 3E3EA 1A2LA 2A4HA 2E2GA 2PUKC 5ECIB 2X8CA 4AGSA 2QA2A 2C8UA 1K3LA 1A8YA 17GSA 3PGTA 4D73B 3KXOA 5IMDA 1ZMAA 5LCZA 2YJHA 3GURA 1GTAA 3P2AA 2HRNA 3DEXA 4F2IA 1U6TA 4BIKA 5COHA 3HZ8A 4MZWA 3BOAA 3W8JA 1PN0A 3KGKA 3U6VA 1SYRA 3C8EA 3KP8A 1QGVA 3RGBC 4F0CA 3CXGA 5GSSA 2DIZA 4GTUA 1ERTA 1TK0B 3RHCA 2XPDA 1OYJA 1PD21 1E2YA 3LJRA 3A2VA 4BVYA 1XBSA 2OJLA 3FK8A 4TR0A 5CRDA 2CV4A 2WVYA 4KNDA 4TR4A 4PNGA 1S3AA 22GSA 4WEYA 4GSTA 4PUAA 2RM5A 1M3JA 4E8HA 1TDIA 2L59A 4G0LA 1AW9A 3ZREA 5ABRA 2IMDA 3KM6A 4AKIA 3M3MA 5ELGA 1XIYA 2R0CA 3I6AA 3CWGA 4HQZA 4G9HA 3HYPA 3BCKA 1VF4A 6GSXA 1H75A 1MDJA 3F9UA 5CRGA 5HFIA 3TJKA 4XRDA 4ML1A 1VF3A 3ZRDA 4IBPA 3EWLA 2MMNA 3FZ4A 3FEUA 3W6GA 2IMIA 3ZITA 2H74A 4YKFA 2HSMA 5L71A 5IM9A 1TOFA 1Q98A 1R5AA 2FD3A 2JL4A 2WW2A 1W89A 1PA3A 1Z7RA 5ECSA 3HZ4A 5J3RA 1XOBA 2FHEA 5CYYA 2B5EA 2GGTA 1CQGA 1V58A 3O3TA 5JCUA 4RUVA 5AN1A 5HR1A 5JCGA 4KE3A 2P0GA 3APQA 1KBNA 3DD3A 2QC7A 4O92A 3CYNA 2RUEA 4HS1A 2B5YA 3IK9A 3A5WA 3QPMA 4K5SA 2PERA 1OVNA 3C71A 4O5RA 1F3BA 2K9FA 2X4AA 3GUSA 3ZZXA 1R26A 2H73A 3GTUA 2M80A 2NPBA 4AKGA 1WIKA 1XFLA 2WVZA 2VIMA 4I2UA 1BEDA 1ABAA 2F8FA 2DJ0A 4GF0A 1N8JA 1IYIA 5HR3A 5CP1A 1GSUA 1MDIA 4K7NA 2IMEA 2DKIA 1Y6EA 3CSIA 2XC2A 4CDOA 3TDGA 2B1LA 2R3XA 2AYTA 2C80A 4F0BA 5DJLA 2H6XA 2GQLA 2TIRA 4MJAA 3IHGA 3NIVA 2PN8A 3VURA 2VL2C 4WXTA 2X64A 1G6WA 5AGYA 1K0AA 2YNXA 1EEMA 4NAXA 3FR9A 3HY2A 3C7MA 3TKRA 3TRQA 2LSTA 2OBKA 4POBA 4Z2TA 3U5RE 4PUFC 2I1UA 3VLNA 1XVWA 4TR3A 4V2LA 4PHZC 4N10A 4V1Ap 1EOHA 1HQOA 1FAAA 4YKGA 4PQHA 4X4JA 1TK5B 2VAFA 2N5FA 1R5PA 1GULA 1TTZA 5B6NA 2HQTA 3EURA
chains in the Genus database with same CATH topology
4USSA 5IMFA 2GZYA 5DQSA 3KCMA 1SK1A 4OFTA 1B9YC 3R3EA 3IDVA 3QD9A 5DCHA 4TXVA 3LEFA 5JWRB 1K3YA 1J08A 3UBLA 5ECQB 3LW9A 2UZ8A 5IMAA 1SKSB 2AJQB 4PGTA 2C3NA 4AJ7A 3DGQA 5ECRB 2LJKA 4J2FA 4ZB8A 1YZXA 2E2MA 5B7CA 4J57E 1AIUA 3ZYWA 3D4TA 1SL1B 2C0EA 3IRAA 2HSNA 1TU8A 4F03A 2YP6A 2OACA 3V1WA 1GH2A 4XRAA 3EINA 4EC0A 1Y1UA 4FYUA 4GQCA 1M2DA 4K5RA 1GUHA 4IJIA 5GSTA 4MJBA 2DKHA 3L0HA 1X9SB 4KH7A 4MH3A 4TR1A 11GSA 5FT3A 2GS3A 3HJOA 3ISOA 1GLQA 10GSA 4L8EA 3GH9A 1B48A 2OE1A 4A5PA 3M8NA 3F6FA 1XW6A 1OE8A 4MP4A 1WP0A 3GKXA 3CRUA 4WBRD 2ALBA 1OC3A 5EPFA 2GZZA 2C0FA 1KEBA 3F4TA 3GKKA 4ISDA 2X99A 4L5LA 3KD0A 3ME7A 1G7OA 4ZL8A 1M99A 3CBUA 1HNCA 2DLXA 3RAZA 1USBA 3N5OA 4FYCA 4KAEA 4ZXGA 3DYRA 4YQMA 5ID2B 4GQFA 1X5DA 4WF4A 3EU3A 3D6IA 3IV4A 2PVOC 1WOUA 2WCIA 3VI7A 2WS2A 2ON7A 1IYHA 4I8BA 4PX1A 4DSQA 1U3AA 2LV3A 2G2QA 3LGCA 4G19A 2CVKA 2VCXA 1DE1A 3HHVA 4KX4A 2GVPA 1W4VA 1X9WB 2N5AA 2HLSA 1GSSA 4HU7A 3H93A 2H8LA 3I69A 2CAQA 2VL9A 2XHFA 2GSQA 2X8GA 1GSEA 2YOIA 2C3QA 3UBKA 3EMXA 1AQVA 3D21A 4K7IA 4O32A 3ZVJA 3TKQA 1SL2B 3F3QA 3BCIA 1T1VA 3HJMA 4XS4B 5J41A 2MMOA 4ULXA 5JWOB 1V40A 1A0FA 3J7Yk 1TP9A 2H01A 3WGXA 1SVLA 4OO5A 2GSTA 3QDNA 3KTBA 4ECBA 4MH2A 2XBQA 1F6MC 3FYGA 1EWXA 1GLPA 5A5KA 3DVXA 2OA7A 2V2GA 1PX6A 2WGRA 2BMXA 3EU4A 1EOGA 4HJMA 1M2BA 16GSA 4QQ7A 4HUAA 4OFMA 1BQ7A 5J4UA 3D22A 1LJRA 2OE0A 4EE0A 3ZTLA 2L57A 4NHWA 1XZOA 1OKDA 3TB2A 3FZ5A 2OADA 1ZYPA 2L5OA 1MDKA 4PURA 4MJCA 5IOXA 4GSNA 2A4VA 4ML6A 4BL7A 4MF6A 4ZILA 2EFHA 3ZMLA 4TKYA 3TUEA 5B8AA 4HU9A 3Q74A 1SVOA 2Z9SA 6GSSA 2R0GA 1QFNA 3KP9A 3N9JA 3F4RA 3VWXA 3QMXA 3OR5A 3NZNA 4KSMA 1AXDA 2F8AA 5DJMA 4ILFA 5G30A 4DVCA 1FO5A 2PMTA 2YN1A 3GN3A 4L5OA 2V41A 2FLSA 5F06A 3GX8A 1ZYNA 1K0MA 2DSAA 1FG4A 3ZFLA 2FGXA 4JEDA 3GL5A 2PBJA 4RQXA 1VF1A 1SD8A 3KH7A 1F3AA 5FWGA 3A5IA 3DRNA 2VO4A 1K0NA 1EEJA 3KZQA 2ZCTA 4KDXA 5DALA 3ERWA 4IP1A 4MJEA 4N11A 2H70A 3L9UA 2KP1A 1YF0A 3GTUB 2EIRA 3VPQA 3H4KA 4G10A 2O85A 1QK8A 2IL3A 3GIXA 3HMJG 1B8XA 2R5GA 5HR0A 3IE3A 2R0PA 4LL4B 1UVZA 1GTUA 2GSRA 4Z2RA 3E9JB 4XHMA 5HQPA 1XWBA 3P7XA 4XS1A 3DXBA 4I5QA 5E59A 4WR5A 2VCWA 4OCFA 2K18A 2FWFA 4QMKA 1HNAA 1C72A 2IMKA 5DAKA 5BMUA 3M9KA 1R4WA 2CVBA 4WR4A 3UARA 2RIIA 5D93A 1FVJA 1GWCA 1B9XC 1F37A 3BD2A 5ECHB 1NHOA 3CTFA 5EVOA 2DBCA 2O87A 5D9WA 3L78A 1B4QA 3L4NA 1ZYQB 1BYEA 2LRCA 3DWVA 2REMA 3L9SA 1AQWA 4KGIA 3HVSA 1GTIA 3KEBA 1TRWA 3MAKA 1EP8A 4Q5FA 5KN1A 4YH2A 3HD5A 3QOUA 3EE2A 2NDOA 2H1DA 3IHQA 4V2MA 2MMZA 4PQIA 3KJYA 2HE3A 2PU9C 4MABA 3ZIJA 3DKSA 4RQRA 2CVDA 2QGVA 5A34B 3Q18A 2HZEB 2H76A 3G7JA 2LS5A 4K0NA 3VWVA 2H71A 5AIXA 1PQNA 3GKMA 4GCIA 2OKAA 4Z7XA 3MNGA 5A4VA 3F0IA 3BJ5A 2GLRA 2RM6A 1TRSA 4E8EA 2G0FA 1HYUA 4IQAA 2HRKB 5G5FA 3HJPA 5D9XA 4LLRA 4DSSA 4O7HA 1SJIA 1GRXA 3LWAA 1AAZA 4OWYA 2PGTA 1FVKA 1A2MA 3HKRA 1BF5A 1B4PA 1GL8A 5G2ZA 1EV4A 2GT6A 3QFAC 2DMMA 1X9MB 8GSSA 5CRWA 2QSIA 2O5VA 2I4AA 2BTOT 1ZOFA 4QL7A 2QA1A 2KP2A 4KCAA 3KIJA 2YWNA 2H1AA 2LTKA 1M2AA 4L0WA 3NOFA 4OFNA 4KW6A 5JCWA 2CZ2A 4IQ1A 3F63A 2P5QA 3GV1A 2XBIA 3SBCA 5C04A 1OC9A 3IR4A 2FA4A 1YQ1A 4KCEA 2IFQB 1URMA 4AKXB 2O8VB 2H1BA 2ES7A 1ZGNA 4JZQA 1ERUA 1ST9A 4H86A 4POMA 2JZRA 4IHUA 3TKSC 2N5BA 3EPTA 4YQUA 2WJUA 3GSTA 3GA4A 4POKA 4DSRA 5CAXA 1XWAA 1YF1A 19GSA 4XS6A 1O73A 2O7KA 4ECJA 4KDUA 1Z6NA 4BVXB 4K7OA 4TXOA 4F82A 3HCZA 3A3TA 4G0KA 2HYXA 3QAVA 4OMVA 6GSVA 1R7HA 4Q5RA 2IN3A 2L5LA 6GSYA 13GSA 5GAND 1O85A 4TOPA 2K8SA 4MCUA 2VL3A 2E0QA 1T4ZA 1RQMA 1TRVA 5LD0A 2FWHA 2YWIA 5DCGA 3DMLA 3QAWA 4K0GA 4HOJA 1YKAA 4IGJA 1PKWA 1Z7PA 4EXJA 4KSOA 5A1NB 2DJKA 2VLUA 3FR6A 2LNTA 2L4QA 4PQ1A 6GSWA 1V2AA 1ZL9A 3GSSA 3TKPA 1EP7A 2HNLA 4XIHA 1Z9HA 1T00A 2E7PA 1I9DA 2VM1A 1G7EA 5FHIA 3GMFA 1BAYA 5CNWA 1GUKA 2V32A 2FCHA 3IA1A 1MD4A 3IAS2 1AQXA 4ACSA 1T3BA 3HVXA 3G7IA 1EV9A 3HVVA 4MF7A 4GRFA 5G5EA 3CSHA 2VL2A 2GQMA 2LJAA 3H1NA 3US3A 2CX4A 1FB6A 5KN2A 2IIYA 3F3RA 3TKSA 3KMNA 3UVHA 1O8WA 2B1KA 4MA9A 2NBSA 1JZOA 3TOUA 5J5NA 4BWQA 2KOKA 1RW1A 1NSWA 1ZYEA 1SKWB 3FZAA 1ZCPA 2B7JA 4V2NA 3TOTA 3GYKA 5D9VA 4N30A 2YPMA 1XWGA 5EL8A 4I2TA 3H79A 3VWUA 5A4UA 3IAM2 4ZL7A 2ZUPA 3GHAA 2D2ZA 4EIPA 1KNGA 5ENUA 4MPFA 2IJYA 1ZZYA 2DC5A 2F3MA 4KF9A 1M7TA 1YY7A 1VF2A 2AUVA 1K3OA 4Z2UA 4O5QA 4OD7A 4WKWA 2LRTA 4V1Ag 1QXHA 4J56E 1YKCA 7GSSA 5INYA 2EFCA 3GNJA 2H0GA 3APOA 3WT2A 4Q5NA 3WGEA 1XW5A 5CO3A 2JADA 4EO3A 5CREA 2H6YA 4K9ZA 2HI7A 2OBIA 1NM3A 4ZBAA 2KHPA 1MD3A 2B7KA 2RUFA 1PRXA 4CHSA 2YV9A 3EC3A 1K0CA 1TI3A 5B8BA 3LXTA 2WULA 2A2SA 3GX0A 5D9TA 5J47A 1SENA 4EL1A 5A4WA 2DIYA 3TJBA 4BVYB 2B3SA 4I6XA 2YWMA 1FB0A 5DAKB 5BMUB 5F0GA 3ZL5A 2F51A 3IBHA 1VRSD 5J4VA 4K2XA 2GTUA 1GSQA 4BPYA 1OC8A 2GSSA 1E6BA 5ELAA 3CTGA 4HQSA 4WBJA 1EZKA 2H1LA 1TU7A 1GSFA 3QAGA 4EF0A 2I9HA 5A5HA 1TJDA 4ECIA 2DJ3A 4G0IA 3M0FA 3TRPA 1U87A 4KUNA 4K6XA 5IIZA 4GXZA 4LMWA 5ECMB 2R4VA 1ERVA 4EIQA 1O8XA 1J9BA 2CAIA 5GZZB 4MZCA 1T4YA 3PR8A 1ACVA 2YZHA 4XCSA 5DQYA 1SK2A 2PVQA 1WPIA 2H1GA 4WF5A 1A2JA 3IPZA 2HSMB 3W8SA 2KLXA 2HRAA 1JLVA 5DVBA 2YZUA 1SU9A 1SL0B 4GDFA 2NTOA 5J4YA 3D5JA 2K8VA 2ON5A 5JWQB 2YV7A 4MMMA 4X1UA 5G1LA 2VCTA 4BWSA 2P5RA 3TRXA 3LFLA 2PWJA 2C1YA 4DSSB 4TW5A 1JLWA 2X49A 4AF2A 1V57A 5HR2A 3WT1A 1TXXA 5LNKe 2VLTA 2FWEA 4JU5A 3FW2A 3RDWA 3A2WA 2LKUA 2R37A 5EY6A 4IKHA 4FH8A 1SYXA 5ID2A 2C4JA 1GP1A 4ZB9A 1FHEA 3TKSE 3F6DA 1AUCA 4E68A 3TJGA 5AIVA 1M9BA 2GDRA 1YJ6A 4AKHA 2EFDA 1EGRA 1LBKA 1Y25A 5IPHA 1U3IA 5HFGA 4LL1B 5H5RA 4JRRA 4IJ3A 1OC9B 4MDCA 4MLYA 1BG1A 3Q19A 2FUG2 4HI7A 1T8EB 3ZLPA 1PX7A 4K2DA 2LUSA 2NVLA 2M46A 4XS4A 4TRXA 1XWCA 4GWRA 5HFKA 1JHBA 4ID0A 4CY6A 3SWLA 3WD6A 4TXOB 2AV4A 1H4OA 1S3CA 2O89A 1Z5YE 5GAPD 1BJXA 5KOXA 2VCVA 4OCEA 4IS0A 4IN0A 5BRTA 2PPTA 3IC4A 1N25A 4ZL9A 4OO4A 1V9WA 1XCCA 1OKTA 2HZFA 4LA1A 5D8IA 1WMJA 3TJFA 5DDLA 4HZ4A 3LXZA 2H0IA 4DEJA 3VWWA 1WRYA 1Q4JA 4YAPA 2CX3A 3ERFA 3FRCA 3CMIA 4FYBA 3S9FA 2WFCA 4AI6A 3GKNA 3L9VA 2I81A 1UC7A 3PH9A 2HSNB 1NHYA 2DJ2A 2EIOA 2FWGA 2H75A 4QL9A 2DJ1A 3FKFA 4EUYA 1X5CA 2L4CA 5D96A 5F8BA 1JZRA 1SJ6A 1QQ2A 1DUGA 1JZWA 2MMAA 4NWYA 20GSA 4L0UA 2XPEA 4TR1B 3J7Yb 1TRUA 1A8LA 3BBYA 2HFDA 4AJ8A 3TCOA 4P3YB 1XOAA 4MZBA 1YDKA 3PPUA 5G31A 4NXIA 1T7PB 3M1GA 3F4SA 1X0RA 14GSA 3P90A 2AAWA 3UEMA 4PNFA 4XTSA 4MF5A 3UMAA 1GSDA 1TXUA 1O6JA 4NHZA 3H8QA 4HJ2A 2M72A 4PXOA 4ECCA 3VI5A 3D0ZA 1M0UA 3I43A 5ECPB 4HDEA 4MPGA 1YEXA 1BG5A 4JR4A 2GZPA 3IC8A 4YAVA 2JU5A 4D73A 5CRHA 1DE2A 2UV8G 2L6CA 3C73A 3ZFBA 4LMVA 3E0UA 4POLA 1TKDB 1QMVA 5ECOB 2VLVA 1F9MA 5E4WA 1PKZA 2AHEA 3APSA 3WYWA 1SVMA 3LSZA 3RPPA 2TRCP 1OAZA 2VD1A 3CSJA 1SJZA 1BX9A 4CY8A 5KEJA 1KTEA 4FO5A 5KN0A 3ERGA 2J23A 3FY7A 1PGTA 3ME8A 3FR3A 1I5GA 1GNWA 1SK0A 2YWOA 1ON4A 1CQHA 2J9HA 4K1FA 4TN8A 3O76A 1LU4A 3UJ1A 3AY8A 3DIEA 4W66A 5F05A 2H19A 4KDYA 1FW1A 3UAPA 3QR6A 5H5QA 1G6YA 4ZIJA 2YANA 1EGOA 4NV5A 5J9BA 3QFBC 2A2RA 1A24A 1HD2A 4IVFA 1O81A 1JFUA 4ZB6A 5A34A 1WWJA 2OT3A 5ECKB 3TGZA 2HZEA 3C1RA 3GRXA 4X0XA 2MBTA 1M9AA 2LNSA 1PMTA 5IMVA 2CT6A 4MNNA 4JR6A 5ECNB 5A5HB 2IMFA 3WGDA 4N0VA 3IOSA 1K0DA 4BL7B 2I3YA 1FOVA 2H0HA 2JACA 2KUCA 2MBSA 2IWTA 3MWHA 3D4MA 4MK3A 2HRKA 5IPGA 2H6ZA 3JCML 5F07A 1A23A 3A2XA 5IMZA 4BA7A 2C3TA 2FNOA 2WRTA 1TI1A 3GL3A 3LQ7A 2TRXA 4N3ZA 3EYTA 1ILOA 2DJJA 4PTSA 1RK4A 2VD0A 3RHBA 2FY6A 3VPTA 4JBBA 2EFEA 2CQ9A 2VM2A 3CRTA 1XW9A 3LYPA 2VCZA 4HZ2A 5J40A 4F9ZA 1K0BA 1YVLA 2VCQA 3IK7A 4ZB7A 2VOCA 3UOMA 1SD9A 3FHKA 2R6KA 4G01A 3EVIA 4ICYA 3UVTA 3UL3A 1NW2A 3RPNA 3EMPA 1TK8B 4ZBBA 4O5UA 2YJ7A 1FOHA 9GSSA 3LG6A 2EIQA 2V6OA 1K0OA 2H66A 1GTBA 3LORA 2WB9A 4TVEA 5DALB 2FA8A 1UA5A 2B6MA 1THXA 2IFQA 3TU3B 3HDCA 4G2EA 1ML6A 3R2QA 4EKZA 2JSZA 5KOWA 4EVMA 4FQUA 1VGLA 4HEA2 1GUMA 4AJ6A 3MDKA 2R2JA 2GT5A 1WJKA 2HRFA 3Q6OA 4IP6A 5ECLB 4CW9A 4EDZA 3UIWA 4BVXA 1F2EA 3ZMKA 3HA9A 4I97A 2WZ9A 1PSQA 1OE7A 3ED3A 2HXKA 2V6KA 1GNEA 2GQKA 2C0DA 5KN3A 4NMUA 4RI6A 1JZDA 1XPVA 3KH9A 3QCPA 5IQYA 5B6MA 4N0ZA 1DSBA 1G0TA 1AC1A 3GFKA 3HXSA 3O6TA 1O7UA 2LQOA 1PL1A 1J0FA 4ZBDA 1A0RP 1UN2A 5A1NA 1ERWA 4GSSA 2VUPA 1MEKA 2LQQA 3KMOA 3TJJA 1XWKA 1X5EA 2EC4A 2X8HA 2MYGA 1Z6MA 3GH6A 3LYKA 2H72A 2AB6A 5IO2A 3IXRA 5AISA 2MZCA 6GSTA 5H5SA 4Q5QA 2B5XA 3K8NA 1WE0A 12GSA 2ZNMA 1Z3EA 3FZ9A 3F8UA 5IOWA 1SKRB 2IPAA 2HSYA 4IELA 4RI7A 2LJRA 2F9SA 2P31A 4FIWA 1THOA 3ZIVA 2YCDA 1N2AA 3G7YA 4KA0A 3MYDA 2CA8A 4IW9A 3DVWA 4NV2A 3C1SA 4JE1A 5C00A 2QKEA 6GSUA 3I9V2 3KTLA 4GLTA 5IMCA 2JSYA 5G1KA 4NPBA 5IO0A 2JZTA 3ZVJD 3FMWA 1S3DA 2WDUA 4X43A 2OE3A 1XVQA 1DBYA 1V98A 1TW9A 3M9JA 1GSYA 2HSHA 5J9CA 2BJXA 2H30A 4YQVA 4KB3A 1U88A 4WETA 5DBQA 2LRNA 2L6DA 1PN9A 2JZSA 2C0GA 2DMLA 2CZ3A 1MTCA 4EDYA 3VFIA 1YEPA 3VK9A 2RLIA 2K6VA 1XXUA 1HNBA 3PINA 4K8MA 1QUWA 3MIXA 18GSA 1PL2A 3G9BA 5D73A 3RBTA 2VKZG 2HT9A 2A2PA 2V1MA 2LEGA 3P8WA 3MSZA 3E3EA 1A2LA 2A4HA 2E2GA 2PUKC 5ECIB 2X8CA 4AGSA 2QA2A 2C8UA 1K3LA 1A8YA 17GSA 3PGTA 4D73B 3KXOA 5IMDA 1ZMAA 5LCZA 2YJHA 3GURA 1GTAA 3P2AA 2HRNA 3DEXA 4F2IA 1U6TA 5COHA 3HZ8A 4MZWA 3BOAA 3W8JA 1PN0A 3KGKA 3U6VA 1SYRA 3C8EA 3KP8A 1QGVA 4F0CA 3CXGA 5GSSA 2DIZA 4GTUA 1ERTA 1TK0B 3RHCA 2XPDA 1OYJA 1PD21 1E2YA 3LJRA 3A2VA 4BVYA 1XBSA 2OJLA 3FK8A 4TR0A 5CRDA 2CV4A 4KNDA 4TR4A 4PNGA 1S3AA 22GSA 4WEYA 4GSTA 4PUAA 2RM5A 4E8HA 1TDIA 2L59A 4G0LA 1AW9A 3ZREA 5ABRA 2IMDA 3KM6A 4AKIA 3M3MA 5ELGA 1XIYA 2R0CA 3I6AA 3CWGA 4HQZA 4G9HA 3HYPA 3BCKA 1VF4A 6GSXA 1H75A 1MDJA 3F9UA 5CRGA 5HFIA 3TJKA 4XRDA 4ML1A 1VF3A 3ZRDA 4IBPA 3EWLA 2MMNA 3FZ4A 3FEUA 3W6GA 2IMIA 3ZITA 2H74A 4YKFA 2HSMA 5L71A 5IM9A 1TOFA 1Q98A 1R5AA 2FD3A 2JL4A 1W89A 1PA3A 1Z7RA 5ECSA 3HZ4A 5J3RA 1XOBA 2FHEA 5CYYA 2B5EA 2GGTA 1CQGA 1V58A 3O3TA 5JCUA 4RUVA 5AN1A 5HR1A 5JCGA 4KE3A 2P0GA 3APQA 1KBNA 3DD3A 2QC7A 4O92A 3CYNA 2RUEA 4HS1A 2B5YA 3IK9A 3A5WA 3QPMA 4K5SA 2PERA 1OVNA 3C71A 4O5RA 1F3BA 2K9FA 2X4AA 3GUSA 3ZZXA 1R26A 2H73A 3GTUA 2M80A 2NPBA 4AKGA 1WIKA 1XFLA 2VIMA 4I2UA 1BEDA 1ABAA 2F8FA 2DJ0A 4GF0A 1N8JA 1IYIA 5HR3A 5CP1A 1GSUA 1MDIA 4K7NA 2IMEA 2DKIA 1Y6EA 3CSIA 2XC2A 4CDOA 3TDGA 2B1LA 2R3XA 2AYTA 2C80A 4F0BA 5DJLA 2H6XA 2GQLA 2TIRA 4MJAA 3IHGA 3NIVA 2PN8A 3VURA 2VL2C 4WXTA 2X64A 1G6WA 5AGYA 1K0AA 2YNXA 1EEMA 4NAXA 3FR9A 3HY2A 3C7MA 3TKRA 3TRQA 2LSTA 2OBKA 4POBA 4Z2TA 3U5RE 4PUFC 2I1UA 3VLNA 1XVWA 4TR3A 4V2LA 4N10A 4V1Ap 1EOHA 1HQOA 1FAAA 4YKGA 4PQHA 4X4JA 1TK5B 2VAFA 2N5FA 1R5PA 1GULA 1TTZA 5B6NA 2HQTA 3EURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USS A;  5IMF A;  2GZY A;  5DQS A;  3KCM A;  1SK1 A;  4OFT A;  1B9Y C;  3R3E A;  3IDV A;  3QD9 A;  5DCH A;  4TXV A;  3LEF A;  5JWR B;  1K3Y A;  1J08 A;  3UBL A;  5ECQ B;  2UZ8 A;  5IMA A;  1SKS B;  2AJQ B;  4PGT A;  2C3N A;  4AJ7 A;  3DGQ A;  5ECR B;  2LJK A;  4J2F A;  4ZB8 A;  1YZX A;  2E2M A;  5B7C A;  4J57 E;  1AIU A;  3ZYW A;  3D4T A;  1SL1 B;  2C0E A;  3IRA A;  1TU8 A;  4F03 A;  2YP6 A;  2OAC A;  3V1W A;  1GH2 A;  4XRA A;  3EIN A;  4EC0 A;  4FYU A;  4GQC A;  1M2D A;  1GUH A;  4IJI A;  5GST A;  4MJB A;  3L0H A;  1X9S B;  4KH7 A;  4MH3 A;  4TR1 A;  11GS A;  5FT3 A;  2GS3 A;  3HJO A;  3ISO A;  1GLQ A;  10GS A;  4L8E A;  3GH9 A;  1B48 A;  2OE1 A;  3M8N A;  3F6F A;  1XW6 A;  1OE8 A;  4MP4 A;  1WP0 A;  3GKX A;  3CRU A;  4WBR D;  2ALB A;  1OC3 A;  5EPF A;  2GZZ A;  2C0F A;  1KEB A;  3F4T A;  3GKK A;  4ISD A;  2X99 A;  4L5L A;  3KD0 A;  3ME7 A;  1G7O A;  4ZL8 A;  1M99 A;  3CBU A;  1HNC A;  2DLX A;  3RAZ A;  1USB A;  3N5O A;  4FYC A;  4KAE A;  4ZXG A;  3DYR A;  4YQM A;  5ID2 B;  4GQF A;  1X5D A;  4WF4 A;  3EU3 A;  3D6I A;  3IV4 A;  2PVO C;  1WOU A;  2WCI A;  3VI7 A;  2WS2 A;  2ON7 A;  1IYH A;  4I8B A;  4PX1 A;  4DSQ A;  1U3A A;  2LV3 A;  2G2Q A;  3LGC A;  4G19 A;  2CVK A;  2VCX A;  1DE1 A;  3HHV A;  4KX4 A;  2GVP A;  1W4V A;  1X9W B;  2N5A A;  2HLS A;  1GSS A;  4HU7 A;  3H93 A;  2H8L A;  3I69 A;  2CAQ A;  2VL9 A;  2XHF A;  2GSQ A;  2X8G A;  1GSE A;  2YOI A;  2C3Q A;  3UBK A;  3EMX A;  1AQV A;  3D21 A;  4K7I A;  4O32 A;  3ZVJ A;  3TKQ A;  1SL2 B;  3F3Q A;  3BCI A;  1T1V A;  3HJM A;  4XS4 B;  5J41 A;  2MMO A;  4ULX A;  5JWO B;  1V40 A;  1A0F A;  3J7Y k;  1TP9 A;  2H01 A;  3WGX A;  4OO5 A;  2GST A;  3QDN A;  3KTB A;  4ECB A;  4MH2 A;  2XBQ A;  1F6M C;  3FYG A;  1EWX A;  1GLP A;  5A5K A;  3DVX A;  2OA7 A;  2V2G A;  1PX6 A;  2WGR A;  2BMX A;  3EU4 A;  1EOG A;  4HJM A;  1M2B A;  16GS A;  4QQ7 A;  4HUA A;  4OFM A;  1BQ7 A;  5J4U A;  3D22 A;  1LJR A;  2OE0 A;  4EE0 A;  3ZTL A;  2L57 A;  4NHW A;  1XZO A;  1OKD A;  3TB2 A;  3FZ5 A;  2OAD A;  2L5O A;  1MDK A;  4PUR A;  4MJC A;  5IOX A;  4GSN A;  2A4V A;  4ML6 A;  4BL7 A;  4MF6 A;  4ZIL A;  3ZML A;  4TKY A;  3TUE A;  5B8A A;  4HU9 A;  3Q74 A;  2Z9S A;  6GSS A;  1QFN A;  3KP9 A;  3N9J A;  3F4R A;  3VWX A;  3QMX A;  3OR5 A;  3NZN A;  4KSM A;  1AXD A;  2F8A A;  5DJM A;  4ILF A;  5G30 A;  4DVC A;  1FO5 A;  2PMT A;  2YN1 A;  3GN3 A;  4L5O A;  2V41 A;  2FLS A;  5F06 A;  3GX8 A;  1K0M A;  2DSA A;  1FG4 A;  3ZFL A;  2FGX A;  4JED A;  3GL5 A;  2PBJ A;  4RQX A;  1VF1 A;  1SD8 A;  3KH7 A;  1F3A A;  5FWG A;  3DRN A;  2VO4 A;  1K0N A;  1EEJ A;  3KZQ A;  2ZCT A;  4KDX A;  5DAL A;  3ERW A;  4IP1 A;  4MJE A;  4N11 A;  2H70 A;  3L9U A;  2KP1 A;  1YF0 A;  3GTU B;  2EIR A;  3VPQ A;  3H4K A;  4G10 A;  2O85 A;  1QK8 A;  2IL3 A;  3GIX A;  1B8X A;  2R5G A;  5HR0 A;  3IE3 A;  4LL4 B;  1UVZ A;  1GTU A;  2GSR A;  3E9J B;  4XHM A;  5HQP A;  1XWB A;  3P7X A;  4XS1 A;  3DXB A;  4I5Q A;  5E59 A;  4WR5 A;  2VCW A;  4OCF A;  2K18 A;  2FWF A;  1HNA A;  1C72 A;  2IMK A;  5DAK A;  5BMU A;  3M9K A;  1R4W A;  2CVB A;  4WR4 A;  3UAR A;  2RII A;  5D93 A;  1FVJ A;  1GWC A;  1B9X C;  1F37 A;  3BD2 A;  5ECH B;  1NHO A;  3CTF A;  5EVO A;  2DBC A;  2O87 A;  5D9W A;  3L78 A;  1B4Q A;  3L4N A;  1ZYQ B;  1BYE A;  2LRC A;  3DWV A;  2REM A;  3L9S A;  1AQW A;  4KGI A;  3HVS A;  1GTI A;  3KEB A;  1TRW A;  3MAK A;  1EP8 A;  4Q5F A;  5KN1 A;  4YH2 A;  3HD5 A;  3QOU A;  3EE2 A;  2NDO A;  2H1D A;  3IHQ A;  4V2M A;  2MMZ A;  4PQI A;  3KJY A;  2HE3 A;  2PU9 C;  4MAB A;  3ZIJ A;  3DKS A;  4RQR A;  2CVD A;  2QGV A;  3Q18 A;  2HZE B;  2H76 A;  3G7J A;  2LS5 A;  4K0N A;  3VWV A;  2H71 A;  5AIX A;  1PQN A;  3GKM A;  4GCI A;  2OKA A;  4Z7X A;  3MNG A;  5A4V A;  3F0I A;  3BJ5 A;  2GLR A;  2RM6 A;  1TRS A;  4E8E A;  2G0F A;  1HYU A;  4IQA A;  2HRK B;  5G5F A;  3HJP A;  5D9X A;  4LLR A;  4DSS A;  4O7H A;  1SJI A;  1GRX A;  3LWA A;  1AAZ A;  4OWY A;  2PGT A;  1FVK A;  1A2M A;  3HKR A;  1B4P A;  1GL8 A;  5G2Z A;  1EV4 A;  2GT6 A;  3QFA C;  2DMM A;  1X9M B;  8GSS A;  5CRW A;  2QSI A;  2I4A A;  2BTO T;  1ZOF A;  4QL7 A;  2KP2 A;  4KCA A;  3KIJ A;  2YWN A;  2H1A A;  2LTK A;  1M2A A;  4L0W A;  3NOF A;  4OFN A;  4KW6 A;  5JCW A;  2CZ2 A;  4IQ1 A;  3F63 A;  2P5Q A;  3GV1 A;  2XBI A;  3SBC A;  5C04 A;  1OC9 A;  3IR4 A;  2FA4 A;  1YQ1 A;  4KCE A;  2IFQ B;  1URM A;  2O8V B;  2H1B A;  2ES7 A;  1ZGN A;  4JZQ A;  1ERU A;  1ST9 A;  4H86 A;  4POM A;  2JZR A;  4IHU A;  3TKS C;  2N5B A;  4YQU A;  2WJU A;  3GST A;  3GA4 A;  4POK A;  4DSR A;  5CAX A;  1XWA A;  1YF1 A;  19GS A;  4XS6 A;  1O73 A;  2O7K A;  4ECJ A;  4KDU A;  1Z6N A;  4BVX B;  4K7O A;  4TXO A;  4F82 A;  3HCZ A;  3A3T A;  4G0K A;  2HYX A;  3QAV A;  4OMV A;  6GSV A;  1R7H A;  4Q5R A;  2IN3 A;  2L5L A;  6GSY A;  13GS A;  5GAN D;  1O85 A;  4TOP A;  2K8S A;  4MCU A;  2VL3 A;  2E0Q A;  1T4Z A;  1RQM A;  1TRV A;  5LD0 A;  2FWH A;  2YWI A;  5DCG A;  3DML A;  3QAW A;  4K0G A;  4HOJ A;  1YKA A;  4IGJ A;  1PKW A;  1Z7P A;  4EXJ A;  4KSO A;  2DJK A;  2VLU A;  3FR6 A;  2LNT A;  2L4Q A;  4PQ1 A;  6GSW A;  1V2A A;  1ZL9 A;  3GSS A;  3TKP A;  1EP7 A;  2HNL A;  4XIH A;  1Z9H A;  1T00 A;  2E7P A;  1I9D A;  2VM1 A;  1G7E A;  5FHI A;  3GMF A;  1BAY A;  5CNW A;  1GUK A;  2V32 A;  2FCH A;  3IA1 A;  1MD4 A;  3IAS 2;  1AQX A;  4ACS A;  1T3B A;  3HVX A;  3G7I A;  1EV9 A;  3HVV A;  4MF7 A;  4GRF A;  5G5E A;  3CSH A;  2VL2 A;  2GQM A;  2LJA A;  3H1N A;  3US3 A;  2CX4 A;  1FB6 A;  5KN2 A;  2IIY A;  3F3R A;  3TKS A;  3KMN A;  3UVH A;  1O8W A;  2B1K A;  4MA9 A;  2NBS A;  1JZO A;  3TOU A;  5J5N A;  4BWQ A;  2KOK A;  1RW1 A;  1NSW A;  1ZYE A;  1SKW B;  3FZA A;  1ZCP A;  2B7J A;  4V2N A;  3TOT A;  3GYK A;  5D9V A;  4N30 A;  2YPM A;  1XWG A;  5EL8 A;  4I2T A;  3H79 A;  3VWU A;  5A4U A;  3IAM 2;  4ZL7 A;  2ZUP A;  3GHA A;  2D2Z A;  1KNG A;  5ENU A;  4MPF A;  2IJY A;  1ZZY A;  2DC5 A;  2F3M A;  4KF9 A;  1M7T A;  1YY7 A;  1VF2 A;  2AUV A;  1K3O A;  4OD7 A;  4WKW A;  2LRT A;  4V1A g;  4J56 E;  1QXH A;  1YKC A;  7GSS A;  5INY A;  3GNJ A;  2H0G A;  3APO A;  3WT2 A;  4Q5N A;  3WGE A;  1XW5 A;  5CO3 A;  2JAD A;  4EO3 A;  5CRE A;  2H6Y A;  4K9Z A;  2HI7 A;  2OBI A;  1NM3 A;  4ZBA A;  2KHP A;  1MD3 A;  2B7K A;  2RUF A;  1PRX A;  4CHS A;  2YV9 A;  3EC3 A;  1K0C A;  1TI3 A;  5B8B A;  3LXT A;  2WUL A;  2A2S A;  3GX0 A;  5D9T A;  1SEN A;  4EL1 A;  5A4W A;  2DIY A;  3TJB A;  4BVY B;  2B3S A;  4I6X A;  2YWM A;  1FB0 A;  5DAK B;  5F0G A;  3ZL5 A;  2F51 A;  3IBH A;  1VRS D;  2GTU A;  1GSQ A;  4BPY A;  1OC8 A;  2GSS A;  1E6B A;  5ELA A;  3CTG A;  4HQS A;  4WBJ A;  1EZK A;  1TU7 A;  1GSF A;  3QAG A;  4EF0 A;  2I9H A;  1TJD A;  4ECI A;  2DJ3 A;  4G0I A;  3M0F A;  3TRP A;  1U87 A;  4KUN A;  4K6X A;  5IIZ A;  4GXZ A;  4LMW A;  5ECM B;  2R4V A;  1ERV A;  1O8X A;  1J9B A;  2CAI A;  5GZZ B;  4MZC A;  1T4Y A;  3PR8 A;  1ACV A;  2YZH A;  4XCS A;  5DQY A;  1SK2 A;  2PVQ A;  1WPI A;  2H1G A;  4WF5 A;  1A2J A;  3IPZ A;  2HSM B;  3W8S A;  2KLX A;  2HRA A;  1JLV A;  5DVB A;  2YZU A;  1SU9 A;  1SL0 B;  2NTO A;  3D5J A;  2K8V A;  2ON5 A;  5JWQ B;  2YV7 A;  4MMM A;  4X1U A;  5G1L A;  2VCT A;  4BWS A;  2P5R A;  3TRX A;  3LFL A;  2PWJ A;  2C1Y A;  4DSS B;  4TW5 A;  1JLW A;  4AF2 A;  1V57 A;  5HR2 A;  3WT1 A;  1TXX A;  5LNK e;  2VLT A;  2FWE A;  4JU5 A;  3FW2 A;  3RDW A;  3A2W A;  2LKU A;  2R37 A;  5EY6 A;  4IKH A;  4FH8 A;  1SYX A;  5ID2 A;  2C4J A;  1GP1 A;  4ZB9 A;  1FHE A;  3TKS E;  3F6D A;  1AUC A;  3TJG A;  5AIV A;  1M9B A;  2GDR A;  1YJ6 A;  1EGR A;  1LBK A;  1Y25 A;  5IPH A;  1U3I A;  5HFG A;  4LL1 B;  5H5R A;  4JRR A;  4IJ3 A;  1OC9 B;  4MDC A;  4MLY A;  3Q19 A;  2FUG 2;  4HI7 A;  1T8E B;  3ZLP A;  1PX7 A;  4K2D A;  2LUS A;  2NVL A;  2M46 A;  4XS4 A;  4TRX A;  1XWC A;  4GWR A;  5HFK A;  1JHB A;  4ID0 A;  3SWL A;  3WD6 A;  4TXO B;  2AV4 A;  1H4O A;  1S3C A;  2O89 A;  1Z5Y E;  5GAP D;  1BJX A;  2VCV A;  4OCE A;  4IS0 A;  4IN0 A;  2PPT A;  3IC4 A;  4ZL9 A;  4OO4 A;  1V9W A;  1XCC A;  1OKT A;  2HZF A;  4LA1 A;  5D8I A;  1WMJ A;  3TJF A;  5DDL A;  4HZ4 A;  3LXZ A;  2H0I A;  4DEJ A;  3VWW A;  1WRY A;  1Q4J A;  4YAP A;  2CX3 A;  3ERF A;  3FRC A;  3CMI A;  4FYB A;  3S9F A;  2WFC A;  3GKN A;  3L9V A;  2I81 A;  1UC7 A;  3PH9 A;  2HSN B;  1NHY A;  2DJ2 A;  2EIO A;  2FWG A;  2H75 A;  4QL9 A;  2DJ1 A;  3FKF A;  4EUY A;  1X5C A;  2L4C A;  5D96 A;  5F8B A;  1JZR A;  1SJ6 A;  1QQ2 A;  1DUG A;  1JZW A;  2MMA A;  4NWY A;  20GS A;  4L0U A;  2XPE A;  4TR1 B;  3J7Y b;  1TRU A;  1A8L A;  3BBY A;  2HFD A;  4AJ8 A;  3TCO A;  4P3Y B;  1XOA A;  4MZB A;  1YDK A;  3PPU A;  5G31 A;  4NXI A;  1T7P B;  3M1G A;  3F4S A;  1X0R A;  14GS A;  3P90 A;  2AAW A;  3UEM A;  4PNF A;  4XTS A;  4MF5 A;  3UMA A;  1GSD A;  1O6J A;  4NHZ A;  3H8Q A;  4HJ2 A;  2M72 A;  4PXO A;  4ECC A;  3VI5 A;  3D0Z A;  1M0U A;  3I43 A;  5ECP B;  4HDE A;  4MPG A;  1YEX A;  1BG5 A;  4JR4 A;  2GZP A;  3IC8 A;  4YAV A;  2JU5 A;  4D73 A;  5CRH A;  1DE2 A;  2L6C A;  3C73 A;  3ZFB A;  4LMV A;  3E0U A;  4POL A;  1TKD B;  1QMV A;  5ECO B;  2VLV A;  1F9M A;  5E4W A;  1PKZ A;  2AHE A;  3APS A;  3WYW A;  3LSZ A;  3RPP A;  2TRC P;  1OAZ A;  2VD1 A;  3CSJ A;  1SJZ A;  1BX9 A;  5KEJ A;  1KTE A;  4FO5 A;  5KN0 A;  3ERG A;  2J23 A;  3FY7 A;  1PGT A;  3ME8 A;  3FR3 A;  1I5G A;  1GNW A;  1SK0 A;  2YWO A;  1ON4 A;  1CQH A;  2J9H A;  4K1F A;  4TN8 A;  3O76 A;  1LU4 A;  3UJ1 A;  3AY8 A;  5F05 A;  2H19 A;  3DIE A;  4KDY A;  1FW1 A;  3UAP A;  3QR6 A;  5H5Q A;  1G6Y A;  4ZIJ A;  2YAN A;  1EGO A;  4NV5 A;  5J9B A;  3QFB C;  2A2R A;  1A24 A;  1HD2 A;  4IVF A;  1O81 A;  1JFU A;  4ZB6 A;  1WWJ A;  5ECK B;  3TGZ A;  2HZE A;  3C1R A;  3GRX A;  4X0X A;  2MBT A;  1M9A A;  2LNS A;  1PMT A;  5IMV A;  2CT6 A;  4JR6 A;  5ECN B;  2IMF A;  3WGD A;  4N0V A;  3IOS A;  1K0D A;  4BL7 B;  2I3Y A;  1FOV A;  2H0H A;  2JAC A;  2KUC A;  2MBS A;  2IWT A;  3MWH A;  3D4M A;  4MK3 A;  2HRK A;  5IPG A;  2H6Z A;  3JCM L;  5F07 A;  1A23 A;  3A2X A;  5IMZ A;  4BA7 A;  2C3T A;  2FNO A;  2WRT A;  1TI1 A;  3GL3 A;  3LQ7 A;  2TRX A;  3EYT A;  1ILO A;  2DJJ A;  4PTS A;  1RK4 A;  2VD0 A;  3RHB A;  2FY6 A;  3VPT A;  4JBB A;  2CQ9 A;  2VM2 A;  3CRT A;  1XW9 A;  3LYP A;  2VCZ A;  4HZ2 A;  4F9Z A;  1K0B A;  2VCQ A;  3IK7 A;  2VOC A;  3UOM A;  1SD9 A;  3FHK A;  2R6K A;  3EVI A;  3UVT A;  3UL3 A;  1NW2 A;  3RPN A;  3EMP A;  1TK8 B;  4ZBB A;  2YJ7 A;  9GSS A;  3LG6 A;  2EIQ A;  2V6O A;  1K0O A;  2H66 A;  1GTB A;  3LOR A;  2WB9 A;  4TVE A;  5DAL B;  2FA8 A;  1UA5 A;  2B6M A;  1THX A;  2IFQ A;  3HDC A;  4G2E A;  1ML6 A;  3R2Q A;  4EKZ A;  2JSZ A;  4EVM A;  4FQU A;  1VGL A;  4HEA 2;  1GUM A;  4AJ6 A;  3MDK A;  2R2J A;  2GT5 A;  1WJK A;  2HRF A;  3Q6O A;  4IP6 A;  5ECL B;  4CW9 A;  4EDZ A;  3UIW A;  4BVX A;  1F2E A;  3ZMK A;  3HA9 A;  4I97 A;  2WZ9 A;  1PSQ A;  1OE7 A;  3ED3 A;  2HXK A;  2V6K A;  1GNE A;  2GQK A;  2C0D A;  5KN3 A;  4NMU A;  4RI6 A;  1JZD A;  1XPV A;  3KH9 A;  3QCP A;  5IQY A;  5B6M A;  4N0Z A;  1DSB A;  1G0T A;  1AC1 A;  3GFK A;  3HXS A;  3O6T A;  1O7U A;  2LQO A;  1PL1 A;  1J0F A;  4ZBD A;  1A0R P;  1UN2 A;  1ERW A;  4GSS A;  2VUP A;  1MEK A;  2LQQ A;  3KMO A;  3TJJ A;  1XWK A;  1X5E A;  2EC4 A;  2X8H A;  2MYG A;  1Z6M A;  3GH6 A;  3LYK A;  2H72 A;  2AB6 A;  5IO2 A;  3IXR A;  5AIS A;  2MZC A;  6GST A;  5H5S A;  4Q5Q A;  2B5X A;  3K8N A;  1WE0 A;  12GS A;  2ZNM A;  1Z3E A;  3FZ9 A;  3F8U A;  5IOW A;  1SKR B;  2IPA A;  2HSY A;  4IEL A;  4RI7 A;  2LJR A;  2F9S A;  2P31 A;  4FIW A;  1THO A;  3ZIV A;  2YCD A;  1N2A A;  3G7Y A;  4KA0 A;  2CA8 A;  4IW9 A;  3DVW A;  4NV2 A;  3C1S A;  4JE1 A;  5C00 A;  2QKE A;  6GSU A;  3I9V 2;  3KTL A;  4GLT A;  5IMC A;  2JSY A;  5G1K A;  4NPB A;  5IO0 A;  2JZT A;  3ZVJ D;  1S3D A;  2WDU A;  4X43 A;  2OE3 A;  1XVQ A;  1DBY A;  1V98 A;  1TW9 A;  3M9J A;  1GSY A;  2HSH A;  5J9C A;  2BJX A;  2H30 A;  4YQV A;  4KB3 A;  1U88 A;  4WET A;  5DBQ A;  2LRN A;  2L6D A;  1PN9 A;  2JZS A;  2C0G A;  2DML A;  2CZ3 A;  1MTC A;  4EDY A;  3VFI A;  1YEP A;  3VK9 A;  2RLI A;  2K6V A;  1XXU A;  1HNB A;  3PIN A;  4K8M A;  1QUW A;  18GS A;  1PL2 A;  3G9B A;  5D73 A;  3RBT A;  2HT9 A;  2V1M A;  2LEG A;  3P8W A;  3MSZ A;  3E3E A;  1A2L A;  2E2G A;  2PUK C;  5ECI B;  2X8C A;  4AGS A;  2C8U A;  1K3L A;  1A8Y A;  3PGT A;  17GS A;  4D73 B;  3KXO A;  5IMD A;  1ZMA A;  5LCZ A;  2YJH A;  3GUR A;  1GTA A;  3P2A A;  2HRN A;  3DEX A;  4F2I A;  1U6T A;  5COH A;  3HZ8 A;  4MZW A;  3BOA A;  3W8J A;  3KGK A;  3U6V A;  1SYR A;  3C8E A;  3KP8 A;  1QGV A;  4F0C A;  3CXG A;  5GSS A;  2DIZ A;  4GTU A;  1ERT A;  1TK0 B;  3RHC A;  2XPD A;  1OYJ A;  1PD2 1;  1E2Y A;  3LJR A;  3A2V A;  4BVY A;  1XBS A;  2OJL A;  3FK8 A;  4TR0 A;  5CRD A;  2CV4 A;  4KND A;  4TR4 A;  4PNG A;  1S3A A;  22GS A;  4WEY A;  4GST A;  4PUA A;  2RM5 A;  4E8H A;  1TDI A;  2L59 A;  4G0L A;  1AW9 A;  3ZRE A;  5ABR A;  2IMD A;  3KM6 A;  3M3M A;  5ELG A;  1XIY A;  3I6A A;  4HQZ A;  4G9H A;  3HYP A;  3BCK A;  1VF4 A;  6GSX A;  1H75 A;  1MDJ A;  3F9U A;  5CRG A;  5HFI A;  3TJK A;  4XRD A;  4ML1 A;  1VF3 A;  3ZRD A;  4IBP A;  3EWL A;  2MMN A;  3FZ4 A;  3FEU A;  3W6G A;  2IMI A;  3ZIT A;  2H74 A;  2HSM A;  5L71 A;  5IM9 A;  1TOF A;  1Q98 A;  1R5A A;  2FD3 A;  2JL4 A;  1W89 A;  1PA3 A;  1Z7R A;  5ECS A;  3HZ4 A;  5J3R A;  1XOB A;  2FHE A;  5CYY A;  2B5E A;  2GGT A;  1CQG A;  1V58 A;  3O3T A;  5JCU A;  4RUV A;  5AN1 A;  5HR1 A;  5JCG A;  4KE3 A;  2P0G A;  3APQ A;  1KBN A;  3DD3 A;  2QC7 A;  4O92 A;  3CYN A;  2RUE A;  4HS1 A;  2B5Y A;  3IK9 A;  3A5W A;  3QPM A;  2PER A;  1OVN A;  3C71 A;  4O5R A;  1F3B A;  2K9F A;  3GUS A;  3ZZX A;  1R26 A;  2H73 A;  3GTU A;  2M80 A;  2NPB A;  1WIK A;  1XFL A;  2VIM A;  4I2U A;  1BED A;  1ABA A;  2F8F A;  2DJ0 A;  4GF0 A;  1N8J A;  1IYI A;  5HR3 A;  5CP1 A;  1GSU A;  1MDI A;  4K7N A;  2IME A;  1Y6E A;  3CSI A;  2XC2 A;  4CDO A;  3TDG A;  2B1L A;  2R3X A;  2AYT A;  2C80 A;  4F0B A;  5DJL A;  2H6X A;  2GQL A;  2TIR A;  4MJA A;  3NIV A;  2PN8 A;  3VUR A;  2VL2 C;  4WXT A;  2X64 A;  1G6W A;  5AGY A;  1K0A A;  2YNX A;  1EEM A;  4NAX A;  3FR9 A;  3HY2 A;  3C7M A;  3TKR A;  3TRQ A;  2LST A;  2OBK A;  4POB A;  3U5R E;  4PUF C;  2I1U A;  3VLN A;  1XVW A;  4TR3 A;  4V2L A;  4N10 A;  4V1A p;  1EOH A;  1HQO A;  1FAA A;  4PQH A;  1TK5 B;  2VAF A;  2N5F A;  1R5P A;  1GUL A;  1TTZ A;  5B6N A;  2HQT A;  3EUR A; 
#chains in the Genus database with same CATH topology
 4USS A;  5IMF A;  2GZY A;  5DQS A;  3KCM A;  1SK1 A;  4OFT A;  1B9Y C;  3R3E A;  3IDV A;  3QD9 A;  5DCH A;  4TXV A;  3LEF A;  5JWR B;  1K3Y A;  1J08 A;  3UBL A;  5ECQ B;  3LW9 A;  2UZ8 A;  5IMA A;  1SKS B;  2AJQ B;  4PGT A;  2C3N A;  4AJ7 A;  3DGQ A;  5ECR B;  2LJK A;  4J2F A;  4ZB8 A;  1YZX A;  2E2M A;  5B7C A;  4J57 E;  1AIU A;  3ZYW A;  3D4T A;  1SL1 B;  2C0E A;  3IRA A;  2HSN A;  1TU8 A;  4F03 A;  2YP6 A;  2OAC A;  3V1W A;  1GH2 A;  4XRA A;  3EIN A;  4EC0 A;  1Y1U A;  4FYU A;  4GQC A;  1M2D A;  4K5R A;  1GUH A;  4IJI A;  5GST A;  4MJB A;  2DKH A;  3L0H A;  1X9S B;  4KH7 A;  4MH3 A;  4TR1 A;  11GS A;  2WW1 A;  5FT3 A;  2GS3 A;  3HJO A;  3ISO A;  1GLQ A;  10GS A;  4L8E A;  3GH9 A;  1B48 A;  2OE1 A;  4A5P A;  3F6F A;  3M8N A;  1XW6 A;  1OE8 A;  4MP4 A;  1WP0 A;  3GKX A;  3CRU A;  4WBR D;  2ALB A;  1OC3 A;  5EPF A;  2GZZ A;  2C0F A;  1KEB A;  3F4T A;  3GKK A;  4ISD A;  2X99 A;  4L5L A;  3KD0 A;  3ME7 A;  1G7O A;  4ZL8 A;  1M99 A;  3CBU A;  1HNC A;  2DLX A;  3RAZ A;  1USB A;  3N5O A;  4FYC A;  4KAE A;  4ZXG A;  3DYR A;  4YQM A;  5ID2 B;  4GQF A;  1X5D A;  4WF4 A;  3EU3 A;  3D6I A;  3IV4 A;  2PVO C;  1WOU A;  2WCI A;  3VI7 A;  2WS2 A;  2ON7 A;  1IYH A;  4I8B A;  4PX1 A;  4DSQ A;  1U3A A;  2LV3 A;  2G2Q A;  2WVX A;  3LGC A;  4G19 A;  2CVK A;  2VCX A;  1DE1 A;  3HHV A;  4KX4 A;  2GVP A;  1W4V A;  1X9W B;  2N5A A;  2HLS A;  1GSS A;  4HU7 A;  3H93 A;  2H8L A;  3I69 A;  2CAQ A;  2VL9 A;  2XHF A;  2GSQ A;  2X8G A;  1GSE A;  2YOI A;  2WW0 A;  2C3Q A;  3UBK A;  3EMX A;  1AQV A;  3D21 A;  4K7I A;  4O32 A;  3ZVJ A;  3TKQ A;  1SL2 B;  3F3Q A;  3BCI A;  1T1V A;  3HJM A;  4XS4 B;  5J41 A;  2MMO A;  4ULX A;  5JWO B;  1V40 A;  3CQF A;  1A0F A;  3J7Y k;  1TP9 A;  2H01 A;  3WGX A;  1SVL A;  4OO5 A;  2GST A;  3QDN A;  3KTB A;  4ECB A;  4MH2 A;  2XBQ A;  1F6M C;  3FYG A;  1EWX A;  1GLP A;  5A5K A;  3DVX A;  2OA7 A;  2V2G A;  1PX6 A;  2WGR A;  2BMX A;  3EU4 A;  1EOG A;  4HJM A;  1M2B A;  16GS A;  4QQ7 A;  3CHX C;  4HUA A;  4OFM A;  1BQ7 A;  5J4U A;  3D22 A;  1LJR A;  2OE0 A;  4EE0 A;  3ZTL A;  2L57 A;  4NHW A;  1XZO A;  1OKD A;  3TB2 A;  3FZ5 A;  2OAD A;  1ZYP A;  2L5O A;  1MDK A;  4PUR A;  4MJC A;  5IOX A;  4GSN A;  2A4V A;  4ML6 A;  4BL7 A;  4MF6 A;  4ZIL A;  2EFH A;  3ZML A;  4TKY A;  3TUE A;  5B8A A;  4HU9 A;  3Q74 A;  1SVO A;  2Z9S A;  6GSS A;  2R0G A;  1QFN A;  3KP9 A;  1I1I P;  3N9J A;  3F4R A;  3VWX A;  3QMX A;  3OR5 A;  3NZN A;  4KSM A;  1AXD A;  2F8A A;  5DJM A;  4ILF A;  5G30 A;  4DVC A;  1FO5 A;  2PMT A;  2YN1 A;  3GN3 A;  4L5O A;  2V41 A;  2FLS A;  5F06 A;  3GX8 A;  1ZYN A;  1K0M A;  2DSA A;  1FG4 A;  3ZFL A;  2FGX A;  4JED A;  3GL5 A;  2PBJ A;  4RQX A;  1VF1 A;  1SD8 A;  1F3A A;  5FWG A;  3KH7 A;  3A5I A;  3DRN A;  2VO4 A;  1K0N A;  1EEJ A;  3KZQ A;  2ZCT A;  4KDX A;  5DAL A;  3ERW A;  4IP1 A;  4MJE A;  4N11 A;  2H70 A;  3L9U A;  2KP1 A;  1YF0 A;  3GTU B;  2EIR A;  3VPQ A;  3H4K A;  4G10 A;  2O85 A;  1QK8 A;  2IL3 A;  3GIX A;  3HMJ G;  1B8X A;  2R5G A;  5HR0 A;  3IE3 A;  2R0P A;  4LL4 B;  1UVZ A;  1GTU A;  2GSR A;  4Z2R A;  3E9J B;  4XHM A;  5HQP A;  1XWB A;  3P7X A;  4XS1 A;  3DXB A;  4I5Q A;  5E59 A;  4WR5 A;  2VCW A;  4OCF A;  2K18 A;  2FWF A;  4QMK A;  1HNA A;  1C72 A;  2IMK A;  5DAK A;  5BMU A;  3M9K A;  1R4W A;  2CVB A;  4WR4 A;  3UAR A;  2RII A;  5D93 A;  1FVJ A;  1GWC A;  1B9X C;  1F37 A;  3BD2 A;  5ECH B;  1NHO A;  3CTF A;  5EVO A;  2DBC A;  2O87 A;  5D9W A;  3L78 A;  1B4Q A;  3L4N A;  1ZYQ B;  1BYE A;  2LRC A;  3DWV A;  2REM A;  3L9S A;  1AQW A;  4KGI A;  3HVS A;  1GTI A;  3KEB A;  1TRW A;  3MAK A;  1EP8 A;  4Q5F A;  5KN1 A;  4YH2 A;  3HD5 A;  3QOU A;  3EE2 A;  2NDO A;  2O36 A;  2H1D A;  3IHQ A;  4HSC X;  2MMZ A;  4V2M A;  4PQI A;  3KJY A;  2HE3 A;  2PU9 C;  4MAB A;  3ZIJ A;  3DKS A;  4RQR A;  2CVD A;  2QGV A;  5A34 B;  3Q18 A;  2HZE B;  2H76 A;  3G7J A;  2LS5 A;  4K0N A;  3VWV A;  2H71 A;  5AIX A;  1PQN A;  3GKM A;  4GCI A;  2OKA A;  4Z7X A;  3MNG A;  5A4V A;  3F0I A;  3BJ5 A;  2GLR A;  2RM6 A;  1TRS A;  4E8E A;  2G0F A;  1HYU A;  4IQA A;  2HRK B;  5G5F A;  3HJP A;  5D9X A;  4LLR A;  4DSS A;  4O7H A;  1SJI A;  1GRX A;  3LWA A;  1AAZ A;  4OWY A;  2PGT A;  1FVK A;  1A2M A;  3HKR A;  1BF5 A;  1B4P A;  1S4B P;  1GL8 A;  5G2Z A;  1EV4 A;  2GT6 A;  3QFA C;  2DMM A;  1X9M B;  8GSS A;  5CRW A;  2QSI A;  2O5V A;  2I4A A;  2BTO T;  1ZOF A;  4QL7 A;  2QA1 A;  1XG8 A;  2KP2 A;  4KCA A;  3KIJ A;  2YWN A;  2H1A A;  2LTK A;  1M2A A;  4L0W A;  3NOF A;  4OFN A;  4KW6 A;  5JCW A;  2CZ2 A;  4IQ1 A;  3F63 A;  2P5Q A;  3GV1 A;  2XBI A;  3HVN A;  3SBC A;  5C04 A;  1OC9 A;  3IR4 A;  2FA4 A;  1YQ1 A;  4KCE A;  2IFQ B;  1URM A;  4AKX B;  2O8V B;  2H1B A;  2ES7 A;  1ZGN A;  4JZQ A;  1ERU A;  1ST9 A;  4H86 A;  4POM A;  2JZR A;  4IHU A;  2WVX B;  3TKS C;  2N5B A;  3EPT A;  4YQU A;  2WJU A;  3GST A;  3GA4 A;  4POK A;  4DSR A;  5CAX A;  1XWA A;  1YF1 A;  19GS A;  4XS6 A;  1O73 A;  2O7K A;  4ECJ A;  4KDU A;  1Z6N A;  4BVX B;  4K7O A;  4TXO A;  4F82 A;  3HCZ A;  3A3T A;  4G0K A;  2HYX A;  3QAV A;  4OMV A;  6GSV A;  1R7H A;  4Q5R A;  2IN3 A;  2L5L A;  6GSY A;  13GS A;  5GAN D;  1O85 A;  4TOP A;  2K8S A;  4MCU A;  2VL3 A;  2E0Q A;  1T4Z A;  1RQM A;  1TRV A;  5LD0 A;  2FWH A;  2YWI A;  5DCG A;  3DML A;  3QAW A;  4K0G A;  4HOJ A;  1YKA A;  4IGJ A;  1PKW A;  1M3I A;  1Z7P A;  4EXJ A;  4KSO A;  5A1N B;  2DJK A;  2VLU A;  3FR6 A;  2LNT A;  2L4Q A;  4PQ1 A;  6GSW A;  1V2A A;  1ZL9 A;  3GSS A;  3TKP A;  1EP7 A;  2HNL A;  4XIH A;  1Z9H A;  1T00 A;  2E7P A;  1I9D A;  2VM1 A;  1G7E A;  5FHI A;  3GMF A;  1BAY A;  5CNW A;  1GUK A;  2V32 A;  2FCH A;  3IA1 A;  1MD4 A;  3IAS 2;  1AQX A;  4ACS A;  1T3B A;  3HVX A;  3G7I A;  1EV9 A;  3HVV A;  4MF7 A;  4GRF A;  5G5E A;  3CSH A;  2VL2 A;  2GQM A;  2LJA A;  3H1N A;  3US3 A;  2CX4 A;  1FB6 A;  5KN2 A;  2IIY A;  3F3R A;  3TKS A;  3KMN A;  3UVH A;  1O8W A;  2B1K A;  4MA9 A;  2NBS A;  1JZO A;  3TOU A;  5J5N A;  4BWQ A;  2KOK A;  1RW1 A;  1NSW A;  1ZYE A;  1SKW B;  3FZA A;  1ZCP A;  2B7J A;  4V2N A;  3TOT A;  3GYK A;  5D9V A;  4N30 A;  2YPM A;  1XWG A;  5EL8 A;  4I2T A;  3H79 A;  3VWU A;  5A4U A;  3IAM 2;  4ZL7 A;  2ZUP A;  3GHA A;  2D2Z A;  4EIP A;  1KNG A;  5ENU A;  4MPF A;  2IJY A;  1ZZY A;  2DC5 A;  2F3M A;  4KF9 A;  1M7T A;  1YY7 A;  1VF2 A;  2AUV A;  1K3O A;  4Z2U A;  4O5Q A;  4OD7 A;  4WKW A;  2LRT A;  4V1A g;  1QXH A;  4J56 E;  1YKC A;  7GSS A;  5INY A;  2EFC A;  3GNJ A;  2H0G A;  3APO A;  3WT2 A;  4Q5N A;  3WGE A;  1XW5 A;  5CO3 A;  2JAD A;  4EO3 A;  5CRE A;  2H6Y A;  4K9Z A;  2HI7 A;  2OBI A;  1NM3 A;  4ZBA A;  2KHP A;  1MD3 A;  2B7K A;  2RUF A;  1PRX A;  4CHS A;  2YV9 A;  3EC3 A;  1K0C A;  1TI3 A;  5B8B A;  3LXT A;  2WUL A;  2A2S A;  3GX0 A;  5D9T A;  5J47 A;  1SEN A;  4EL1 A;  5A4W A;  2DIY A;  3TJB A;  4BVY B;  2B3S A;  4I6X A;  2YWM A;  1FB0 A;  5DAK B;  5BMU B;  5F0G A;  3ZL5 A;  2F51 A;  3IBH A;  1VRS D;  5J4V A;  4K2X A;  2GTU A;  1GSQ A;  4BPY A;  1OC8 A;  2GSS A;  1E6B A;  5ELA A;  3CTG A;  4HQS A;  4WBJ A;  1EZK A;  2H1L A;  1TU7 A;  1GSF A;  3QAG A;  4EF0 A;  2I9H A;  5A5H A;  1TJD A;  4ECI A;  2DJ3 A;  4G0I A;  3M0F A;  3TRP A;  1U87 A;  4KUN A;  4K6X A;  5IIZ A;  4GXZ A;  4LMW A;  5ECM B;  2R4V A;  1ERV A;  4EIQ A;  1O8X A;  1J9B A;  2CAI A;  5GZZ B;  4MZC A;  1T4Y A;  3PR8 A;  1ACV A;  2YZH A;  4XCS A;  5DQY A;  1SK2 A;  2PVQ A;  1WPI A;  2H1G A;  4WF5 A;  1A2J A;  3IPZ A;  2HSM B;  3W8S A;  2KLX A;  2HRA A;  1JLV A;  5DVB A;  2YZU A;  1SU9 A;  1SL0 B;  4GDF A;  2NTO A;  5J4Y A;  3D5J A;  2K8V A;  2ON5 A;  5JWQ B;  2YV7 A;  4MMM A;  4X1U A;  5G1L A;  2VCT A;  4BWS A;  2P5R A;  3TRX A;  3LFL A;  2PWJ A;  2C1Y A;  4DSS B;  4TW5 A;  1JLW A;  2X49 A;  4AF2 A;  1S3R A;  1V57 A;  5HR2 A;  1TXX A;  3WT1 A;  2VLT A;  5LNK e;  2FWE A;  4JU5 A;  3FW2 A;  3RDW A;  3A2W A;  2LKU A;  2R37 A;  5EY6 A;  4IKH A;  4FH8 A;  1SYX A;  5ID2 A;  2C4J A;  1GP1 A;  4ZB9 A;  1FHE A;  3TKS E;  3F6D A;  1AUC A;  4E68 A;  3TJG A;  5AIV A;  1M9B A;  2GDR A;  1YJ6 A;  4AKH A;  2EFD A;  1EGR A;  1LBK A;  1Y25 A;  5IPH A;  1U3I A;  5HFG A;  4LL1 B;  5H5R A;  4JRR A;  4IJ3 A;  1OC9 B;  4MDC A;  4MLY A;  1BG1 A;  3Q19 A;  2FUG 2;  4HI7 A;  1T8E B;  3ZLP A;  1PX7 A;  4K2D A;  2LUS A;  2NVL A;  2M46 A;  4XS4 A;  4TRX A;  1XWC A;  4GWR A;  5HFK A;  1JHB A;  4ID0 A;  4CY6 A;  3SWL A;  3WD6 A;  4TXO B;  2AV4 A;  1H4O A;  1S3C A;  2O89 A;  1Z5Y E;  5GAP D;  1BJX A;  5KOX A;  2VCV A;  4OCE A;  4IS0 A;  4IN0 A;  5BRT A;  2PPT A;  3IC4 A;  1N25 A;  4ZL9 A;  4OO4 A;  1V9W A;  1XCC A;  1OKT A;  2HZF A;  4LA1 A;  5D8I A;  1WMJ A;  3TJF A;  5DDL A;  4HZ4 A;  3LXZ A;  2H0I A;  4DEJ A;  3VWW A;  1WRY A;  1Q4J A;  4YAP A;  2CX3 A;  3ERF A;  3FRC A;  3CMI A;  4FYB A;  3S9F A;  2WFC A;  4AI6 A;  3GKN A;  3L9V A;  2I81 A;  1UC7 A;  3PH9 A;  2HSN B;  1NHY A;  2DJ2 A;  2EIO A;  2FWG A;  2H75 A;  4QL9 A;  2DJ1 A;  3FKF A;  4EUY A;  1X5C A;  2L4C A;  5D96 A;  5F8B A;  1JZR A;  1SJ6 A;  1QQ2 A;  1DUG A;  1JZW A;  2MMA A;  4NWY A;  20GS A;  4L0U A;  2XPE A;  4TR1 B;  3J7Y b;  1TRU A;  1A8L A;  3BBY A;  2HFD A;  4AJ8 A;  3TCO A;  4P3Y B;  1XOA A;  4MZB A;  1YDK A;  3PPU A;  5G31 A;  4NXI A;  1T7P B;  3M1G A;  3F4S A;  1X0R A;  14GS A;  3P90 A;  2AAW A;  3UEM A;  4PNF A;  4XTS A;  4MF5 A;  3UMA A;  1GSD A;  1TXU A;  1O6J A;  2WZS A;  4NHZ A;  3H8Q A;  4HJ2 A;  2M72 A;  4PXO A;  4ECC A;  3VI5 A;  3D0Z A;  1M0U A;  1YEW C;  3I43 A;  5ECP B;  4HDE A;  4MPG A;  1YEX A;  1BG5 A;  4JR4 A;  2GZP A;  3IC8 A;  4YAV A;  2JU5 A;  4D73 A;  5CRH A;  1DE2 A;  2UV8 G;  2L6C A;  3C73 A;  3RFR C;  3ZFB A;  4LMV A;  3E0U A;  4POL A;  1TKD B;  1QMV A;  5ECO B;  2VLV A;  1F9M A;  5E4W A;  1PKZ A;  2AHE A;  3APS A;  3WYW A;  1SVM A;  3LSZ A;  3RPP A;  2TRC P;  1OAZ A;  2VD1 A;  3CSJ A;  1SJZ A;  1PFO A;  1BX9 A;  4CY8 A;  5KEJ A;  1KTE A;  4FO5 A;  5KN0 A;  3ERG A;  2J23 A;  3FY7 A;  1PGT A;  3ME8 A;  3FR3 A;  1I5G A;  1GNW A;  1SK0 A;  2YWO A;  1ON4 A;  1CQH A;  2J9H A;  4K1F A;  4TN8 A;  3O76 A;  1LU4 A;  3UJ1 A;  3AY8 A;  3DIE A;  4W66 A;  5F05 A;  2H19 A;  4KDY A;  1FW1 A;  3UAP A;  3QR6 A;  5H5Q A;  1G6Y A;  4ZIJ A;  2YAN A;  1EGO A;  4NV5 A;  5J9B A;  3QFB C;  2A2R A;  1A24 A;  1HD2 A;  4IVF A;  1O81 A;  1JFU A;  4ZB6 A;  5A34 A;  1WWJ A;  2OT3 A;  5ECK B;  3TGZ A;  2HZE A;  3C1R A;  3GRX A;  4X0X A;  2MBT A;  1M9A A;  2LNS A;  1PMT A;  5IMV A;  2CT6 A;  4MNN A;  4JR6 A;  5ECN B;  5A5H B;  2IMF A;  3WGD A;  4N0V A;  3IOS A;  1K0D A;  4BL7 B;  2I3Y A;  1FOV A;  2H0H A;  2JAC A;  2KUC A;  2MBS A;  2IWT A;  3MWH A;  4FXY P;  3D4M A;  4MK3 A;  2HRK A;  5IPG A;  2H6Z A;  3JCM L;  5F07 A;  1A23 A;  3A2X A;  5IMZ A;  4BA7 A;  2C3T A;  2FNO A;  2WRT A;  1TI1 A;  3GL3 A;  3LQ7 A;  2TRX A;  4N3Z A;  3EYT A;  1ILO A;  2DJJ A;  4PTS A;  1RK4 A;  2VD0 A;  3RHB A;  2FY6 A;  3VPT A;  4JBB A;  2EFE A;  2CQ9 A;  2VM2 A;  3CRT A;  1XW9 A;  3LYP A;  2VCZ A;  4HZ2 A;  5J40 A;  4F9Z A;  1K0B A;  1YVL A;  2VCQ A;  3IK7 A;  4ZB7 A;  2VOC A;  3UOM A;  1SD9 A;  3FHK A;  2R6K A;  4G01 A;  3EVI A;  4ICY A;  3UVT A;  3UL3 A;  1NW2 A;  3RPN A;  3EMP A;  1TK8 B;  4ZBB A;  4O5U A;  2YJ7 A;  1FOH A;  9GSS A;  3LG6 A;  2EIQ A;  2V6O A;  1K0O A;  2H66 A;  1GTB A;  3LOR A;  2WB9 A;  4TVE A;  5DAL B;  2FA8 A;  1UA5 A;  2B6M A;  1THX A;  2IFQ A;  3TU3 B;  3HDC A;  4G2E A;  1ML6 A;  3R2Q A;  4EKZ A;  4PI0 C;  2JSZ A;  5KOW A;  4EVM A;  4FQU A;  1VGL A;  4HEA 2;  1GUM A;  4AJ6 A;  3MDK A;  2R2J A;  2GT5 A;  1WJK A;  2HRF A;  3Q6O A;  4IP6 A;  5ECL B;  4CW9 A;  4EDZ A;  3UIW A;  4BVX A;  1F2E A;  3ZMK A;  3HA9 A;  4I97 A;  2WZ9 A;  1PSQ A;  1OE7 A;  3ED3 A;  2HXK A;  2V6K A;  1GNE A;  2GQK A;  2C0D A;  5KN3 A;  4NMU A;  4RI6 A;  1JZD A;  1XPV A;  3KH9 A;  3QCP A;  5IQY A;  5B6M A;  4N0Z A;  1DSB A;  1G0T A;  1AC1 A;  3GFK A;  3HXS A;  3O6T A;  1O7U A;  2LQO A;  2O3E A;  1PL1 A;  1J0F A;  4ZBD A;  1A0R P;  1UN2 A;  5A1N A;  1ERW A;  4GSS A;  2VUP A;  1MEK A;  2LQQ A;  3KMO A;  3TJJ A;  1XWK A;  1X5E A;  2EC4 A;  2X8H A;  2MYG A;  1Z6M A;  3GH6 A;  3LYK A;  2H72 A;  2AB6 A;  5IO2 A;  3IXR A;  5AIS A;  2MZC A;  6GST A;  5H5S A;  4Q5Q A;  2B5X A;  3K8N A;  1WE0 A;  12GS A;  2ZNM A;  1Z3E A;  3FZ9 A;  3F8U A;  5IOW A;  1SKR B;  2IPA A;  2HSY A;  4IEL A;  4RI7 A;  2LJR A;  2F9S A;  2P31 A;  4FIW A;  1THO A;  3ZIV A;  2YCD A;  1N2A A;  3G7Y A;  4KA0 A;  3MYD A;  2CA8 A;  4IW9 A;  3DVW A;  4NV2 A;  3C1S A;  4JE1 A;  5C00 A;  2QKE A;  6GSU A;  3I9V 2;  3KTL A;  4GLT A;  5IMC A;  2JSY A;  5G1K A;  4NPB A;  5IO0 A;  2JZT A;  3ZVJ D;  3FMW A;  1S3D A;  2WDU A;  4X43 A;  2OE3 A;  1XVQ A;  1DBY A;  1V98 A;  1TW9 A;  3M9J A;  1GSY A;  2HSH A;  5J9C A;  2BJX A;  2H30 A;  4YQV A;  4KB3 A;  1U88 A;  4WET A;  5DBQ A;  2LRN A;  2L6D A;  1PN9 A;  2JZS A;  2C0G A;  2DML A;  2CZ3 A;  1MTC A;  4EDY A;  3VFI A;  1YEP A;  3VK9 A;  2WW3 A;  2RLI A;  2K6V A;  1XXU A;  1HNB A;  3PIN A;  4K8M A;  1QUW A;  3MIX A;  18GS A;  4PI2 C;  1PL2 A;  3G9B A;  5D73 A;  3RBT A;  2VKZ G;  2HT9 A;  2A2P A;  2V1M A;  2LEG A;  3P8W A;  3MSZ A;  3E3E A;  1A2L A;  2A4H A;  2E2G A;  2PUK C;  5ECI B;  2X8C A;  4AGS A;  2QA2 A;  2C8U A;  1K3L A;  1A8Y A;  17GS A;  3PGT A;  4D73 B;  3KXO A;  5IMD A;  1ZMA A;  5LCZ A;  2YJH A;  3GUR A;  1GTA A;  3P2A A;  2HRN A;  3DEX A;  4F2I A;  1U6T A;  4BIK A;  5COH A;  3HZ8 A;  4MZW A;  3BOA A;  3W8J A;  1PN0 A;  3KGK A;  3U6V A;  1SYR A;  3C8E A;  3KP8 A;  1QGV A;  3RGB C;  4F0C A;  3CXG A;  5GSS A;  2DIZ A;  4GTU A;  1ERT A;  1TK0 B;  3RHC A;  2XPD A;  1OYJ A;  1PD2 1;  1E2Y A;  3LJR A;  3A2V A;  4BVY A;  1XBS A;  2OJL A;  3FK8 A;  4TR0 A;  5CRD A;  2CV4 A;  2WVY A;  4KND A;  4TR4 A;  4PNG A;  1S3A A;  22GS A;  4WEY A;  4GST A;  4PUA A;  2RM5 A;  1M3J A;  4E8H A;  1TDI A;  2L59 A;  4G0L A;  1AW9 A;  3ZRE A;  5ABR A;  2IMD A;  3KM6 A;  4AKI A;  3M3M A;  5ELG A;  1XIY A;  2R0C A;  3I6A A;  3CWG A;  4HQZ A;  4G9H A;  3HYP A;  3BCK A;  1VF4 A;  6GSX A;  1H75 A;  1MDJ A;  3F9U A;  5CRG A;  5HFI A;  3TJK A;  4XRD A;  4ML1 A;  1VF3 A;  3ZRD A;  4IBP A;  3EWL A;  2MMN A;  3FZ4 A;  3FEU A;  3W6G A;  2IMI A;  3ZIT A;  2H74 A;  4YKF A;  2HSM A;  5L71 A;  5IM9 A;  1TOF A;  1Q98 A;  1R5A A;  2FD3 A;  2JL4 A;  2WW2 A;  1W89 A;  1PA3 A;  1Z7R A;  5ECS A;  3HZ4 A;  5J3R A;  1XOB A;  2FHE A;  5CYY A;  2B5E A;  2GGT A;  1CQG A;  1V58 A;  3O3T A;  5JCU A;  4RUV A;  5AN1 A;  5HR1 A;  5JCG A;  4KE3 A;  2P0G A;  3APQ A;  1KBN A;  3DD3 A;  2QC7 A;  4O92 A;  3CYN A;  2RUE A;  4HS1 A;  2B5Y A;  3IK9 A;  3A5W A;  3QPM A;  4K5S A;  2PER A;  1OVN A;  3C71 A;  4O5R A;  1F3B A;  2K9F A;  2X4A A;  3GUS A;  3ZZX A;  1R26 A;  2H73 A;  3GTU A;  2M80 A;  2NPB A;  4AKG A;  1WIK A;  1XFL A;  2WVZ A;  2VIM A;  4I2U A;  1BED A;  1ABA A;  2F8F A;  2DJ0 A;  4GF0 A;  1N8J A;  1IYI A;  5HR3 A;  5CP1 A;  1GSU A;  1MDI A;  4K7N A;  2IME A;  2DKI A;  1Y6E A;  3CSI A;  2XC2 A;  4CDO A;  3TDG A;  2B1L A;  2R3X A;  2AYT A;  2C80 A;  4F0B A;  5DJL A;  2H6X A;  2GQL A;  2TIR A;  4MJA A;  3IHG A;  3NIV A;  2PN8 A;  3VUR A;  2VL2 C;  4WXT A;  2X64 A;  1G6W A;  5AGY A;  1K0A A;  2YNX A;  1EEM A;  4NAX A;  3FR9 A;  3HY2 A;  3C7M A;  3TKR A;  3TRQ A;  2LST A;  2OBK A;  4POB A;  4Z2T A;  3U5R E;  4PUF C;  2I1U A;  3VLN A;  1XVW A;  4TR3 A;  4V2L A;  4PHZ C;  4N10 A;  4V1A p;  1EOH A;  1HQO A;  1FAA A;  4YKG A;  4PQH A;  4X4J A;  1TK5 B;  2VAF A;  2N5F A;  1R5P A;  1GUL A;  1TTZ A;  5B6N A;  2HQT A;  3EUR A; 
#chains in the Genus database with same CATH homology
 4USS A;  5IMF A;  2GZY A;  5DQS A;  3KCM A;  1SK1 A;  4OFT A;  1B9Y C;  3R3E A;  3IDV A;  3QD9 A;  5DCH A;  4TXV A;  3LEF A;  5JWR B;  1K3Y A;  1J08 A;  3UBL A;  5ECQ B;  3LW9 A;  2UZ8 A;  5IMA A;  1SKS B;  2AJQ B;  4PGT A;  2C3N A;  4AJ7 A;  3DGQ A;  5ECR B;  2LJK A;  4J2F A;  4ZB8 A;  1YZX A;  2E2M A;  5B7C A;  4J57 E;  1AIU A;  3ZYW A;  3D4T A;  1SL1 B;  2C0E A;  3IRA A;  2HSN A;  1TU8 A;  4F03 A;  2YP6 A;  2OAC A;  3V1W A;  1GH2 A;  4XRA A;  3EIN A;  4EC0 A;  1Y1U A;  4FYU A;  4GQC A;  1M2D A;  4K5R A;  1GUH A;  4IJI A;  5GST A;  4MJB A;  2DKH A;  3L0H A;  1X9S B;  4KH7 A;  4MH3 A;  4TR1 A;  11GS A;  5FT3 A;  2GS3 A;  3HJO A;  3ISO A;  1GLQ A;  10GS A;  4L8E A;  3GH9 A;  1B48 A;  2OE1 A;  4A5P A;  3M8N A;  3F6F A;  1XW6 A;  1OE8 A;  4MP4 A;  1WP0 A;  3GKX A;  3CRU A;  4WBR D;  2ALB A;  1OC3 A;  5EPF A;  2GZZ A;  2C0F A;  1KEB A;  3F4T A;  3GKK A;  4ISD A;  2X99 A;  4L5L A;  3KD0 A;  3ME7 A;  1G7O A;  4ZL8 A;  1M99 A;  3CBU A;  1HNC A;  2DLX A;  3RAZ A;  1USB A;  3N5O A;  4FYC A;  4KAE A;  4ZXG A;  3DYR A;  4YQM A;  5ID2 B;  4GQF A;  1X5D A;  4WF4 A;  3EU3 A;  3D6I A;  3IV4 A;  2PVO C;  1WOU A;  2WCI A;  3VI7 A;  2WS2 A;  2ON7 A;  1IYH A;  4I8B A;  4PX1 A;  4DSQ A;  1U3A A;  2LV3 A;  2G2Q A;  3LGC A;  4G19 A;  2CVK A;  2VCX A;  1DE1 A;  3HHV A;  4KX4 A;  2GVP A;  1W4V A;  1X9W B;  2N5A A;  2HLS A;  1GSS A;  4HU7 A;  3H93 A;  2H8L A;  3I69 A;  2CAQ A;  2VL9 A;  2XHF A;  2GSQ A;  2X8G A;  1GSE A;  2YOI A;  2C3Q A;  3UBK A;  3EMX A;  1AQV A;  3D21 A;  4K7I A;  4O32 A;  3ZVJ A;  3TKQ A;  1SL2 B;  3F3Q A;  3BCI A;  1T1V A;  3HJM A;  4XS4 B;  5J41 A;  2MMO A;  4ULX A;  5JWO B;  1V40 A;  1A0F A;  3J7Y k;  1TP9 A;  2H01 A;  3WGX A;  1SVL A;  4OO5 A;  2GST A;  3QDN A;  3KTB A;  4ECB A;  4MH2 A;  2XBQ A;  1F6M C;  3FYG A;  1EWX A;  1GLP A;  5A5K A;  3DVX A;  2OA7 A;  2V2G A;  1PX6 A;  2WGR A;  2BMX A;  3EU4 A;  1EOG A;  4HJM A;  1M2B A;  16GS A;  4QQ7 A;  4HUA A;  4OFM A;  1BQ7 A;  5J4U A;  3D22 A;  1LJR A;  2OE0 A;  4EE0 A;  3ZTL A;  2L57 A;  4NHW A;  1XZO A;  1OKD A;  3TB2 A;  3FZ5 A;  2OAD A;  1ZYP A;  2L5O A;  1MDK A;  4PUR A;  4MJC A;  5IOX A;  4GSN A;  2A4V A;  4ML6 A;  4BL7 A;  4MF6 A;  4ZIL A;  2EFH A;  3ZML A;  4TKY A;  3TUE A;  5B8A A;  4HU9 A;  3Q74 A;  1SVO A;  2Z9S A;  6GSS A;  2R0G A;  1QFN A;  3KP9 A;  3N9J A;  3F4R A;  3VWX A;  3QMX A;  3OR5 A;  3NZN A;  4KSM A;  1AXD A;  2F8A A;  5DJM A;  4ILF A;  5G30 A;  4DVC A;  1FO5 A;  2PMT A;  2YN1 A;  3GN3 A;  4L5O A;  2V41 A;  2FLS A;  5F06 A;  3GX8 A;  1ZYN A;  1K0M A;  2DSA A;  1FG4 A;  3ZFL A;  2FGX A;  4JED A;  3GL5 A;  2PBJ A;  4RQX A;  1VF1 A;  1SD8 A;  3KH7 A;  1F3A A;  5FWG A;  3A5I A;  3DRN A;  2VO4 A;  1K0N A;  1EEJ A;  3KZQ A;  2ZCT A;  4KDX A;  5DAL A;  3ERW A;  4IP1 A;  4MJE A;  4N11 A;  2H70 A;  3L9U A;  2KP1 A;  1YF0 A;  3GTU B;  2EIR A;  3VPQ A;  3H4K A;  4G10 A;  2O85 A;  1QK8 A;  2IL3 A;  3GIX A;  3HMJ G;  1B8X A;  2R5G A;  5HR0 A;  3IE3 A;  2R0P A;  4LL4 B;  1UVZ A;  1GTU A;  2GSR A;  4Z2R A;  3E9J B;  4XHM A;  5HQP A;  1XWB A;  3P7X A;  4XS1 A;  3DXB A;  4I5Q A;  5E59 A;  4WR5 A;  2VCW A;  4OCF A;  2K18 A;  2FWF A;  4QMK A;  1HNA A;  1C72 A;  2IMK A;  5DAK A;  5BMU A;  3M9K A;  1R4W A;  2CVB A;  4WR4 A;  3UAR A;  2RII A;  5D93 A;  1FVJ A;  1GWC A;  1B9X C;  1F37 A;  3BD2 A;  5ECH B;  1NHO A;  3CTF A;  5EVO A;  2DBC A;  2O87 A;  5D9W A;  3L78 A;  1B4Q A;  3L4N A;  1ZYQ B;  1BYE A;  2LRC A;  3DWV A;  2REM A;  3L9S A;  1AQW A;  4KGI A;  3HVS A;  1GTI A;  3KEB A;  1TRW A;  3MAK A;  1EP8 A;  4Q5F A;  5KN1 A;  4YH2 A;  3HD5 A;  3QOU A;  3EE2 A;  2NDO A;  2H1D A;  3IHQ A;  4V2M A;  2MMZ A;  4PQI A;  3KJY A;  2HE3 A;  2PU9 C;  4MAB A;  3ZIJ A;  3DKS A;  4RQR A;  2CVD A;  2QGV A;  5A34 B;  3Q18 A;  2HZE B;  2H76 A;  3G7J A;  2LS5 A;  4K0N A;  3VWV A;  2H71 A;  5AIX A;  1PQN A;  3GKM A;  4GCI A;  2OKA A;  4Z7X A;  3MNG A;  5A4V A;  3F0I A;  3BJ5 A;  2GLR A;  2RM6 A;  1TRS A;  4E8E A;  2G0F A;  1HYU A;  4IQA A;  2HRK B;  5G5F A;  3HJP A;  5D9X A;  4LLR A;  4DSS A;  4O7H A;  1SJI A;  1GRX A;  3LWA A;  1AAZ A;  4OWY A;  2PGT A;  1FVK A;  1A2M A;  3HKR A;  1BF5 A;  1B4P A;  1GL8 A;  5G2Z A;  1EV4 A;  2GT6 A;  3QFA C;  2DMM A;  1X9M B;  8GSS A;  5CRW A;  2QSI A;  2O5V A;  2I4A A;  2BTO T;  1ZOF A;  4QL7 A;  2QA1 A;  2KP2 A;  4KCA A;  3KIJ A;  2YWN A;  2H1A A;  2LTK A;  1M2A A;  4L0W A;  3NOF A;  4OFN A;  4KW6 A;  5JCW A;  2CZ2 A;  4IQ1 A;  3F63 A;  2P5Q A;  3GV1 A;  2XBI A;  3SBC A;  5C04 A;  1OC9 A;  3IR4 A;  2FA4 A;  1YQ1 A;  4KCE A;  2IFQ B;  1URM A;  4AKX B;  2O8V B;  2H1B A;  2ES7 A;  1ZGN A;  4JZQ A;  1ERU A;  1ST9 A;  4H86 A;  4POM A;  2JZR A;  4IHU A;  3TKS C;  2N5B A;  3EPT A;  4YQU A;  2WJU A;  3GST A;  3GA4 A;  4POK A;  4DSR A;  5CAX A;  1XWA A;  1YF1 A;  19GS A;  4XS6 A;  1O73 A;  2O7K A;  4ECJ A;  4KDU A;  1Z6N A;  4BVX B;  4K7O A;  4TXO A;  4F82 A;  3HCZ A;  3A3T A;  4G0K A;  2HYX A;  3QAV A;  4OMV A;  6GSV A;  1R7H A;  4Q5R A;  2IN3 A;  2L5L A;  6GSY A;  13GS A;  5GAN D;  1O85 A;  4TOP A;  2K8S A;  4MCU A;  2VL3 A;  2E0Q A;  1T4Z A;  1RQM A;  1TRV A;  5LD0 A;  2FWH A;  2YWI A;  5DCG A;  3DML A;  3QAW A;  4K0G A;  4HOJ A;  1YKA A;  4IGJ A;  1PKW A;  1Z7P A;  4EXJ A;  4KSO A;  5A1N B;  2DJK A;  2VLU A;  3FR6 A;  2LNT A;  2L4Q A;  4PQ1 A;  6GSW A;  1V2A A;  1ZL9 A;  3GSS A;  3TKP A;  1EP7 A;  2HNL A;  4XIH A;  1Z9H A;  1T00 A;  2E7P A;  1I9D A;  2VM1 A;  1G7E A;  5FHI A;  3GMF A;  1BAY A;  5CNW A;  1GUK A;  2V32 A;  2FCH A;  3IA1 A;  1MD4 A;  3IAS 2;  1AQX A;  4ACS A;  1T3B A;  3HVX A;  3G7I A;  1EV9 A;  3HVV A;  4MF7 A;  4GRF A;  5G5E A;  3CSH A;  2VL2 A;  2GQM A;  2LJA A;  3H1N A;  3US3 A;  2CX4 A;  1FB6 A;  5KN2 A;  2IIY A;  3F3R A;  3TKS A;  3KMN A;  3UVH A;  1O8W A;  2B1K A;  4MA9 A;  2NBS A;  1JZO A;  3TOU A;  5J5N A;  4BWQ A;  2KOK A;  1RW1 A;  1NSW A;  1ZYE A;  1SKW B;  3FZA A;  1ZCP A;  2B7J A;  4V2N A;  3TOT A;  3GYK A;  5D9V A;  4N30 A;  2YPM A;  1XWG A;  5EL8 A;  4I2T A;  3H79 A;  3VWU A;  5A4U A;  3IAM 2;  4ZL7 A;  2ZUP A;  3GHA A;  2D2Z A;  4EIP A;  1KNG A;  5ENU A;  4MPF A;  2IJY A;  1ZZY A;  2DC5 A;  2F3M A;  4KF9 A;  1M7T A;  1YY7 A;  1VF2 A;  2AUV A;  1K3O A;  4Z2U A;  4O5Q A;  4OD7 A;  4WKW A;  2LRT A;  4V1A g;  1QXH A;  4J56 E;  1YKC A;  7GSS A;  5INY A;  2EFC A;  3GNJ A;  2H0G A;  3APO A;  3WT2 A;  4Q5N A;  3WGE A;  1XW5 A;  5CO3 A;  2JAD A;  4EO3 A;  5CRE A;  2H6Y A;  4K9Z A;  2HI7 A;  2OBI A;  1NM3 A;  4ZBA A;  2KHP A;  1MD3 A;  2B7K A;  2RUF A;  1PRX A;  4CHS A;  2YV9 A;  3EC3 A;  1K0C A;  1TI3 A;  5B8B A;  3LXT A;  2WUL A;  2A2S A;  3GX0 A;  5D9T A;  5J47 A;  1SEN A;  4EL1 A;  5A4W A;  2DIY A;  3TJB A;  4BVY B;  2B3S A;  4I6X A;  2YWM A;  1FB0 A;  5DAK B;  5BMU B;  5F0G A;  3ZL5 A;  2F51 A;  3IBH A;  1VRS D;  5J4V A;  4K2X A;  2GTU A;  1GSQ A;  4BPY A;  1OC8 A;  2GSS A;  1E6B A;  5ELA A;  3CTG A;  4HQS A;  4WBJ A;  1EZK A;  2H1L A;  1TU7 A;  1GSF A;  3QAG A;  4EF0 A;  2I9H A;  5A5H A;  1TJD A;  4ECI A;  2DJ3 A;  4G0I A;  3M0F A;  3TRP A;  1U87 A;  4KUN A;  4K6X A;  5IIZ A;  4GXZ A;  4LMW A;  5ECM B;  2R4V A;  1ERV A;  4EIQ A;  1O8X A;  1J9B A;  2CAI A;  5GZZ B;  4MZC A;  1T4Y A;  3PR8 A;  1ACV A;  2YZH A;  4XCS A;  5DQY A;  1SK2 A;  2PVQ A;  1WPI A;  2H1G A;  4WF5 A;  1A2J A;  3IPZ A;  2HSM B;  3W8S A;  2KLX A;  2HRA A;  1JLV A;  5DVB A;  2YZU A;  1SU9 A;  1SL0 B;  4GDF A;  2NTO A;  5J4Y A;  3D5J A;  2K8V A;  2ON5 A;  5JWQ B;  2YV7 A;  4MMM A;  4X1U A;  5G1L A;  2VCT A;  4BWS A;  2P5R A;  3TRX A;  3LFL A;  2PWJ A;  2C1Y A;  4DSS B;  4TW5 A;  1JLW A;  2X49 A;  4AF2 A;  1V57 A;  5HR2 A;  3WT1 A;  1TXX A;  5LNK e;  2VLT A;  2FWE A;  4JU5 A;  3FW2 A;  3RDW A;  3A2W A;  2LKU A;  2R37 A;  5EY6 A;  4IKH A;  4FH8 A;  1SYX A;  5ID2 A;  2C4J A;  1GP1 A;  4ZB9 A;  1FHE A;  3TKS E;  3F6D A;  1AUC A;  4E68 A;  3TJG A;  5AIV A;  1M9B A;  2GDR A;  1YJ6 A;  4AKH A;  2EFD A;  1EGR A;  1LBK A;  1Y25 A;  5IPH A;  1U3I A;  5HFG A;  4LL1 B;  5H5R A;  4JRR A;  4IJ3 A;  1OC9 B;  4MDC A;  4MLY A;  1BG1 A;  3Q19 A;  2FUG 2;  4HI7 A;  1T8E B;  3ZLP A;  1PX7 A;  4K2D A;  2LUS A;  2NVL A;  2M46 A;  4XS4 A;  4TRX A;  1XWC A;  4GWR A;  5HFK A;  1JHB A;  4ID0 A;  4CY6 A;  3SWL A;  3WD6 A;  4TXO B;  2AV4 A;  1H4O A;  1S3C A;  2O89 A;  1Z5Y E;  5GAP D;  1BJX A;  5KOX A;  2VCV A;  4OCE A;  4IS0 A;  4IN0 A;  5BRT A;  2PPT A;  3IC4 A;  1N25 A;  4ZL9 A;  4OO4 A;  1V9W A;  1XCC A;  1OKT A;  2HZF A;  4LA1 A;  5D8I A;  1WMJ A;  3TJF A;  5DDL A;  4HZ4 A;  3LXZ A;  2H0I A;  4DEJ A;  3VWW A;  1WRY A;  1Q4J A;  4YAP A;  2CX3 A;  3ERF A;  3FRC A;  3CMI A;  4FYB A;  3S9F A;  2WFC A;  4AI6 A;  3GKN A;  3L9V A;  2I81 A;  1UC7 A;  3PH9 A;  2HSN B;  1NHY A;  2DJ2 A;  2EIO A;  2FWG A;  2H75 A;  4QL9 A;  2DJ1 A;  3FKF A;  4EUY A;  1X5C A;  2L4C A;  5D96 A;  5F8B A;  1JZR A;  1SJ6 A;  1QQ2 A;  1DUG A;  1JZW A;  2MMA A;  4NWY A;  20GS A;  4L0U A;  2XPE A;  4TR1 B;  3J7Y b;  1TRU A;  1A8L A;  3BBY A;  2HFD A;  4AJ8 A;  3TCO A;  4P3Y B;  1XOA A;  4MZB A;  1YDK A;  3PPU A;  5G31 A;  4NXI A;  1T7P B;  3M1G A;  3F4S A;  1X0R A;  14GS A;  3P90 A;  2AAW A;  3UEM A;  4PNF A;  4XTS A;  4MF5 A;  3UMA A;  1GSD A;  1TXU A;  1O6J A;  4NHZ A;  3H8Q A;  4HJ2 A;  2M72 A;  4PXO A;  4ECC A;  3VI5 A;  3D0Z A;  1M0U A;  3I43 A;  5ECP B;  4HDE A;  4MPG A;  1YEX A;  1BG5 A;  4JR4 A;  2GZP A;  3IC8 A;  4YAV A;  2JU5 A;  4D73 A;  5CRH A;  1DE2 A;  2UV8 G;  2L6C A;  3C73 A;  3ZFB A;  4LMV A;  3E0U A;  4POL A;  1TKD B;  1QMV A;  5ECO B;  2VLV A;  1F9M A;  5E4W A;  1PKZ A;  2AHE A;  3APS A;  3WYW A;  1SVM A;  3LSZ A;  3RPP A;  2TRC P;  1OAZ A;  2VD1 A;  3CSJ A;  1SJZ A;  1BX9 A;  4CY8 A;  5KEJ A;  1KTE A;  4FO5 A;  5KN0 A;  3ERG A;  2J23 A;  3FY7 A;  1PGT A;  3ME8 A;  3FR3 A;  1I5G A;  1GNW A;  1SK0 A;  2YWO A;  1ON4 A;  1CQH A;  2J9H A;  4K1F A;  4TN8 A;  3O76 A;  1LU4 A;  3UJ1 A;  3AY8 A;  3DIE A;  4W66 A;  5F05 A;  2H19 A;  4KDY A;  1FW1 A;  3UAP A;  3QR6 A;  5H5Q A;  1G6Y A;  4ZIJ A;  2YAN A;  1EGO A;  4NV5 A;  5J9B A;  3QFB C;  2A2R A;  1A24 A;  1HD2 A;  4IVF A;  1O81 A;  1JFU A;  4ZB6 A;  5A34 A;  1WWJ A;  2OT3 A;  5ECK B;  3TGZ A;  2HZE A;  3C1R A;  3GRX A;  4X0X A;  2MBT A;  1M9A A;  2LNS A;  1PMT A;  5IMV A;  2CT6 A;  4MNN A;  4JR6 A;  5ECN B;  5A5H B;  2IMF A;  3WGD A;  4N0V A;  3IOS A;  1K0D A;  4BL7 B;  2I3Y A;  1FOV A;  2H0H A;  2JAC A;  2KUC A;  2MBS A;  2IWT A;  3MWH A;  3D4M A;  4MK3 A;  2HRK A;  5IPG A;  2H6Z A;  3JCM L;  5F07 A;  1A23 A;  3A2X A;  5IMZ A;  4BA7 A;  2C3T A;  2FNO A;  2WRT A;  1TI1 A;  3GL3 A;  3LQ7 A;  2TRX A;  4N3Z A;  3EYT A;  1ILO A;  2DJJ A;  4PTS A;  1RK4 A;  2VD0 A;  3RHB A;  2FY6 A;  3VPT A;  4JBB A;  2EFE A;  2CQ9 A;  2VM2 A;  3CRT A;  1XW9 A;  3LYP A;  2VCZ A;  4HZ2 A;  5J40 A;  4F9Z A;  1K0B A;  1YVL A;  2VCQ A;  3IK7 A;  4ZB7 A;  2VOC A;  3UOM A;  1SD9 A;  3FHK A;  2R6K A;  4G01 A;  3EVI A;  4ICY A;  3UVT A;  3UL3 A;  1NW2 A;  3RPN A;  3EMP A;  1TK8 B;  4ZBB A;  4O5U A;  2YJ7 A;  1FOH A;  9GSS A;  3LG6 A;  2EIQ A;  2V6O A;  1K0O A;  2H66 A;  1GTB A;  3LOR A;  2WB9 A;  4TVE A;  5DAL B;  2FA8 A;  1UA5 A;  2B6M A;  1THX A;  2IFQ A;  3TU3 B;  3HDC A;  4G2E A;  1ML6 A;  3R2Q A;  4EKZ A;  2JSZ A;  5KOW A;  4EVM A;  4FQU A;  1VGL A;  4HEA 2;  1GUM A;  4AJ6 A;  3MDK A;  2R2J A;  2GT5 A;  1WJK A;  2HRF A;  3Q6O A;  4IP6 A;  5ECL B;  4CW9 A;  4EDZ A;  3UIW A;  4BVX A;  1F2E A;  3ZMK A;  3HA9 A;  4I97 A;  2WZ9 A;  1PSQ A;  1OE7 A;  3ED3 A;  2HXK A;  2V6K A;  1GNE A;  2GQK A;  2C0D A;  5KN3 A;  4NMU A;  4RI6 A;  1JZD A;  1XPV A;  3KH9 A;  3QCP A;  5IQY A;  5B6M A;  4N0Z A;  1DSB A;  1G0T A;  1AC1 A;  3GFK A;  3HXS A;  3O6T A;  1O7U A;  2LQO A;  1PL1 A;  1J0F A;  4ZBD A;  1A0R P;  1UN2 A;  5A1N A;  1ERW A;  4GSS A;  2VUP A;  1MEK A;  2LQQ A;  3KMO A;  3TJJ A;  1XWK A;  1X5E A;  2EC4 A;  2X8H A;  2MYG A;  1Z6M A;  3GH6 A;  3LYK A;  2H72 A;  2AB6 A;  5IO2 A;  3IXR A;  5AIS A;  2MZC A;  6GST A;  5H5S A;  4Q5Q A;  2B5X A;  3K8N A;  1WE0 A;  12GS A;  2ZNM A;  1Z3E A;  3FZ9 A;  3F8U A;  5IOW A;  1SKR B;  2IPA A;  2HSY A;  4IEL A;  4RI7 A;  2LJR A;  2F9S A;  2P31 A;  4FIW A;  1THO A;  3ZIV A;  2YCD A;  1N2A A;  3G7Y A;  4KA0 A;  3MYD A;  2CA8 A;  4IW9 A;  3DVW A;  4NV2 A;  3C1S A;  4JE1 A;  5C00 A;  2QKE A;  6GSU A;  3I9V 2;  3KTL A;  4GLT A;  5IMC A;  2JSY A;  5G1K A;  4NPB A;  5IO0 A;  2JZT A;  3ZVJ D;  3FMW A;  1S3D A;  2WDU A;  4X43 A;  2OE3 A;  1XVQ A;  1DBY A;  1V98 A;  1TW9 A;  3M9J A;  1GSY A;  2HSH A;  5J9C A;  2BJX A;  2H30 A;  4YQV A;  4KB3 A;  1U88 A;  4WET A;  5DBQ A;  2LRN A;  2L6D A;  1PN9 A;  2JZS A;  2C0G A;  2DML A;  2CZ3 A;  1MTC A;  4EDY A;  3VFI A;  1YEP A;  3VK9 A;  2RLI A;  2K6V A;  1XXU A;  1HNB A;  3PIN A;  4K8M A;  1QUW A;  3MIX A;  18GS A;  1PL2 A;  3G9B A;  5D73 A;  3RBT A;  2VKZ G;  2HT9 A;  2A2P A;  2V1M A;  2LEG A;  3P8W A;  3MSZ A;  3E3E A;  1A2L A;  2A4H A;  2E2G A;  2PUK C;  5ECI B;  2X8C A;  4AGS A;  2QA2 A;  2C8U A;  1K3L A;  1A8Y A;  17GS A;  3PGT A;  4D73 B;  3KXO A;  5IMD A;  1ZMA A;  5LCZ A;  2YJH A;  3GUR A;  1GTA A;  3P2A A;  2HRN A;  3DEX A;  4F2I A;  1U6T A;  5COH A;  3HZ8 A;  4MZW A;  3BOA A;  3W8J A;  1PN0 A;  3KGK A;  3U6V A;  1SYR A;  3C8E A;  3KP8 A;  1QGV A;  4F0C A;  3CXG A;  5GSS A;  2DIZ A;  4GTU A;  1ERT A;  1TK0 B;  3RHC A;  2XPD A;  1OYJ A;  1PD2 1;  1E2Y A;  3LJR A;  3A2V A;  4BVY A;  1XBS A;  2OJL A;  3FK8 A;  4TR0 A;  5CRD A;  2CV4 A;  4KND A;  4TR4 A;  4PNG A;  1S3A A;  22GS A;  4WEY A;  4GST A;  4PUA A;  2RM5 A;  4E8H A;  1TDI A;  2L59 A;  4G0L A;  1AW9 A;  3ZRE A;  5ABR A;  2IMD A;  3KM6 A;  4AKI A;  3M3M A;  5ELG A;  1XIY A;  2R0C A;  3I6A A;  3CWG A;  4HQZ A;  4G9H A;  3HYP A;  3BCK A;  1VF4 A;  6GSX A;  1H75 A;  1MDJ A;  3F9U A;  5CRG A;  5HFI A;  3TJK A;  4XRD A;  4ML1 A;  1VF3 A;  3ZRD A;  4IBP A;  3EWL A;  2MMN A;  3FZ4 A;  3FEU A;  3W6G A;  2IMI A;  3ZIT A;  2H74 A;  4YKF A;  2HSM A;  5L71 A;  5IM9 A;  1TOF A;  1Q98 A;  1R5A A;  2FD3 A;  2JL4 A;  1W89 A;  1PA3 A;  1Z7R A;  5ECS A;  3HZ4 A;  5J3R A;  1XOB A;  2FHE A;  5CYY A;  2B5E A;  2GGT A;  1CQG A;  1V58 A;  3O3T A;  5JCU A;  4RUV A;  5AN1 A;  5HR1 A;  5JCG A;  4KE3 A;  2P0G A;  3APQ A;  1KBN A;  3DD3 A;  2QC7 A;  4O92 A;  3CYN A;  2RUE A;  4HS1 A;  2B5Y A;  3IK9 A;  3A5W A;  3QPM A;  4K5S A;  2PER A;  1OVN A;  3C71 A;  4O5R A;  1F3B A;  2K9F A;  2X4A A;  3GUS A;  3ZZX A;  1R26 A;  2H73 A;  3GTU A;  2M80 A;  2NPB A;  4AKG A;  1WIK A;  1XFL A;  2VIM A;  4I2U A;  1BED A;  1ABA A;  2F8F A;  2DJ0 A;  4GF0 A;  1N8J A;  1IYI A;  5HR3 A;  5CP1 A;  1GSU A;  1MDI A;  4K7N A;  2IME A;  2DKI A;  1Y6E A;  3CSI A;  2XC2 A;  4CDO A;  3TDG A;  2B1L A;  2R3X A;  2AYT A;  2C80 A;  4F0B A;  5DJL A;  2H6X A;  2GQL A;  2TIR A;  4MJA A;  3IHG A;  3NIV A;  2PN8 A;  3VUR A;  2VL2 C;  4WXT A;  2X64 A;  1G6W A;  5AGY A;  1K0A A;  2YNX A;  1EEM A;  4NAX A;  3FR9 A;  3HY2 A;  3C7M A;  3TKR A;  3TRQ A;  2LST A;  2OBK A;  4POB A;  4Z2T A;  3U5R E;  4PUF C;  2I1U A;  3VLN A;  1XVW A;  4TR3 A;  4V2L A;  4N10 A;  4V1A p;  1EOH A;  1HQO A;  1FAA A;  4YKG A;  4PQH A;  4X4J A;  1TK5 B;  2VAF A;  2N5F A;  1R5P A;  1GUL A;  1TTZ A;  5B6N A;  2HQT A;  3EUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...