5D73A

Structure of wuchereria bancrofti pi-class glutathione s-transferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
207
structure length
207
Chain Sequence
SYKLTYFPIRGLAEPIRLVLVDQGIKFTDDRINASDWPSMKSHFHFGQLPCLYDGDHQIVQSGAILRHLARKHNLNGGNELETTHIDMFCEGVRDLHTKYTKMIYQAYDTEKDSYIKDILPVELAKFEKLLATRDDGKNFILGEKISYVDFVLFEELDIHQILDPHCLDKFPLLKAYHQRMEDRPGLKEYCKQRNRAKIPVNGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title STRUCTURE OF WUCHERERIA BANCROFTI PI-CLASS GLUTATHIONE S-TRANSFERASE
rcsb
source organism Wuchereria bancrofti
total genus 73
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5d73A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5d73A01
4EDYA 1MTCA 2WDUA 3DXBA 3TCOA 1FB6A 1OAZA 4I5QA 4D73B 3P7XA 1EOGA 3HVXA 4IBPA 2G0FA 4HU7A 1GULA 1T00A 2IN3A 4F0CA 3RPPA 3CXGA 1W89A 4X1UA 4OWYA 1TXXA 3Q18A 1Y6EA 3UVTA 3DVXA 1O81A 4BWSA 4KSOA 2P0GA 4IQAA 4F9ZA 2IPAA 1ERWA 2PWJA 4K6XA 1AIUA 3H4KA 3UARA 1V57A 3GRXA 1B4QA 3QAWA 1V9WA 3GKXA 5E59A 2CVBA 5J9BA 20GSA 3VI7A 1NM3A 3DIEA 3KH9A 1YKCA 1GP1A 1Z9HA 3ISOA 14GSA 2DJ3A 3C7MA 1TDIA 1YF1A 3PINA 3D0ZA 3RDWA 5GSSA 3PH9A 4HJ2A 1J08A 1GLQA 1ACVA 1GTIA 3D22A 5IO0A 1A8LA 2WZ9A 2H6XA 17GSA 1FVJA 3C1SA 1QQ2A 5DAKA 4BVYB 3F4RA 1Y25A 2IFQB 3APQA 5ID2B 2VM2A 2HYXA 2LQQA 1EGRA 1F37A 5ECPB 3H93A 3MWHA 1X5DA 2OKAA 1JLWA 1T4YA 2DIYA 3E0UA 1S3DA 3IBHA 3EWLA 1Z6NA 4GXZA 2LRNA 2J9HA 3F3RA 3KIJA 3FR3A 4X0XA 4I6XA 4PXOA 1AW9A 3QPMA 5B6MA 2CX4A 2C0FA 1A0FA 1OC9B 2A2RA 4KSMA 1GTUA 4MABA 2E0QA 4ECCA 4YQMA 1SD8A 4IW9A 4FIWA 2NDOA 1OKDA 5G30A 5D9XA 2H1DA 2K9FA 3TDGA 5G5EA 3L78A 4GWRA 4NWYA 1AC1A 5DALB 1FO5A 3TKSC 2DSAA 3N5OA 3UIWA 2QKEA 5ECNB 3LYPA 2GSQA 4QL7A 3IR4A 4HS1A 2GZPA 3ZL5A 2VCVA 3F63A 3CSJA 1ZYEA 2YWMA 4YAVA 4ACSA 3KP8A 3CBUA 2H75A 1GSFA 5CRGA 3IXRA 3GMFA 2B5EA 4ZBBA 3IK7A 2JU5A 1JHBA 9GSSA 4MP4A 1SJIA 1QMVA 2F9SA 1MD3A 2FWGA 4F03A 4XRAA 3N9JA 4V2NA 1VRSD 2YWOA 1SL2B 3ZLPA 4NV5A 4GRFA 3GTUB 2V1MA 3ME8A 3U6VA 3GL3A 4JRRA 4ECBA 2E7PA 5D9WA 1OC8A 1Z6MA 2CZ3A 4TXOB 4XS4A 1M2DA 1SKWB 5A4WA 1OC3A 2F8FA 5COHA 3RHCA 4L5LA 3F4SA 2PGTA 2FD3A 2YANA 1A2LA 4KDUA 4BVXA 3L9UA 4K7NA 4QQ7A 4BA7A 2LRCA 2XBQA 1O6JA 3IRAA 4G0KA 1FAAA 2YN1A 1GL8A 4G9HA 2HRNA 5JWQB 3LFLA 1K0MA 3TKSE 3TJJA 5D96A 1BG5A 1WWJA 5ECOB 2H6YA 3IDVA 4EUYA 2PU9C 2LS5A 1XOBA 3GHAA 2GS3A 1YKAA 2X8CA 2EC4A 2VL9A 3TOTA 3I43A 1CQHA 1AAZA 1RK4A 4FH8A 2ALBA 4LL4B 4ID0A 1PRXA 1T7PB 2F51A 1PKZA 4KCAA 3GYKA 5GAND 3QCPA 4BWQA 3HY2A 4IQ1A 2N5BA 1HNCA 4USSA 3D4MA 1GWCA 2OA7A 5AISA 5DQSA 1EGOA 4JEDA 4EVMA 3US3A 1A0RP 3Q6OA 1Z3EA 2VLUA 2X64A 1X9WB 5CRWA 2R6KA 2JSZA 1USBA 5GAPD 2GDRA 2P5QA 3APSA 2V32A 4FYUA 4IJIA 1SL0B 5D9TA 3GFKA 4K0NA 3ZVJD 1SYXA 1Z7RA 2FA4A 1B8XA 2PMTA 4OFNA 5A4VA 2YZUA 2C3NA 2YCDA 4D73A 1SKRB 2LUSA 5BMUA 1G6YA 13GSA 3VWWA 3L9SA 2J23A 3G7JA 2HSYA 5C04A 4MJBA 3GN3A 1SJZA 6GSXA 3RPNA 4MF5A 5EVOA 1S3CA 1AUCA 1T1VA 2RIIA 6GSUA 1EP8A 2B3SA 2I3YA 3M3MA 2NBSA 2CT6A 4JBBA 5IO2A 3KMNA 2AYTA 5EPFA 4TN8A 5CRDA 3A2VA 1TU7A 1WE0A 5JWOB 1TJDA 1TU8A 1FHEA 2M72A 3VWXA 4MDCA 4DSSB 1E2YA 2CX3A 4ULXA 2LNTA 2CAQA 2M80A 5KEJA 4EKZA 2N5AA 2LNSA 1JLVA 4KNDA 4MF6A 1CQGA 5H5QA 3F3QA 5CP1A 5ELGA 2AV4A 2KUCA 4BVYA 3IOSA 4YH2A 1XIYA 3ZFLA 4XTSA 3MSZA 3RBTA 4MCUA 1F2EA 3M8NA 2H30A 1KEBA 2IMEA 1TOFA 5DCHA 4G0IA 4K8MA 5FT3A 1N2AA 3F9UA 1KTEA 2H0HA 2OE0A 2B1LA 5DJLA 1OE7A 2CAIA 2QGVA 1AQVA 2GGTA 3A2XA 4MJCA 4WF4A 1XWCA 2HSMA 1U3AA 1M7TA 1ZCPA 1ILOA 2PUKC 5A4UA 3S9FA 2GQMA 3M1GA 5DALA 1G7EA 2C4JA 1M0UA 4RUVA 2P31A 4AJ7A 4DEJA 4GQCA 4ECJA 3UBKA 2O89A 2WGRA 5HR2A 2C0EA 4NV2A 1GNEA 5HR3A 1FOVA 1YEPA 3TKSA 1H75A 2OACA 3UJ1A 3A3TA 3IV4A 2H0IA 1O8WA 3Q74A 2VL2C 6GSVA 2L4CA 3P90A 5IMDA 5IOWA 1XOAA 4NAXA 4ML1A 3QFBC 1TRUA 4FO5A 4OD7A 3IE3A 1GUHA 3O3TA 3TRPA 2X8HA 2HRKA 1NW2A 4YAPA 1NHOA 4ML6A 1WPIA 4TXVA 1VF1A 5A5KA 4I8BA 19GSA 2VAFA 3ERGA 1AQWA 6GSSA 3P8WA 2VD0A 1ZYQB 2YOIA 1BYEA 2FGXA 5AN1A 2D2ZA 2CVKA 2FLSA 4KW6A 4IKHA 1XFLA 4KX4A 2XHFA 1WOUA 1PL1A 2A2SA 1J0FA 3UMAA 2GTUA 3LG6A 1T3BA 2BMXA 4TXOA 3HZ4A 2HQTA 7GSSA 4PUFC 2IMDA 4O5RA 1GNWA 3APOA 1K0AA 4Q5RA 2QSIA 3TUEA 5ECMB 2HNLA 3GKKA 2R4VA 4PGTA 4GCIA 2R37A 2PN8A 1EEMA 5G2ZA 3GA4A 3KCMA 4PQIA 2O87A 4JZQA 3D6IA 4LMWA 3E3EA 3ZIVA 2K18A 4LMVA 1C72A 4OCEA 2EIQA 4ISDA 3GL5A 1OVNA 3LWAA 5HFIA 1SYRA 1Z7PA 2GSRA 4IVFA 3FY7A 1XCCA 4KB3A 4YQVA 4EF0A 3GX0A 2TRXA 3GUSA 4HQSA 1GLPA 4XS1A 3BOAA 2H74A 1KBNA 1K3YA 3JCML 3UOMA 4ZXGA 1T4ZA 1WRYA 4KGIA 2GVPA 5JCWA 4V1Ag 5IMAA 2B6MA 1RQMA 5B8BA 1GH2A 1BX9A 1YZXA 1XPVA 4KAEA 3FZ5A 1Q4JA 2VUPA 4O7HA 4HZ2A 1LU4A 4GSSA 2LV3A 3FK8A 2R2JA 5ECIB 3W8JA 2HLSA 2MYGA 4MZWA 4HOJA 1K3LA 5D93A 2AAWA 3UVHA 2V41A 1QFNA 2LEGA 3HVVA 2IL3A 3PR8A 3ZTLA 2MBSA 5F07A 2A4VA 1GSYA 3IHQA 1FVKA 4TR1A 3IK9A 1A8YA 2KHPA 4EXJA 2B1KA 5ENUA 2VOCA 4NHZA 2YP6A 3FRCA 2L5LA 3IAS2 3TRQA 2H71A 2HSNB 5J3RA 3EMXA 4G2EA 3VK9A 1TK0B 10GSA 3ED3A 2VD1A 1U87A 1Z5YE 3FKFA 2NTOA 18GSA 4DSSA 5F05A 1I9DA 1PGTA 2YNXA 1YY7A 1OYJA 2HSHA 3LJRA 2DC5A 3FR6A 3DVWA 2F3MA 2RM6A 4KE3A 4KUNA 4TRXA 5ECKB 4LLRA 2V2GA 3VFIA 1YEXA 1V58A 1R4WA 3F6FA 4MPGA 1MDKA 3NOFA 2E2MA 2FY6A 1JZOA 1F9MA 4E8HA 3KXOA 1XXUA 2FUG2 4BL7B 2DJ0A 4EC0A 1QUWA 3GURA 1RW1A 3ZZXA 1THXA 3KP9A 2EIRA 4KDYA 2B5YA 22GSA 2WS2A 2H76A 1LJRA 2L59A 2FWFA 4WXTA 1IYHA 1XWAA 1BAYA 2IMIA 4XHMA 2ZUPA 3BCIA 4JE1A 2R3XA 5JCUA 3TKQA 4N30A 3HXSA 3BD2A 6GSWA 3LEFA 5CRHA 3EVIA 1B9YC 5CAXA 3DD3A 1G7OA 3WGEA 3R2QA 3DMLA 2H01A 1B4PA 1EP7A 3C1RA 3KJYA 1XW9A 5D9VA 2ZCTA 5IMZA 1DSBA 1M99A 3HA9A 2HZEB 4KH7A 1OE8A 3LQ7A 2CV4A 2TRCP 2YV7A 1TI3A 2KLXA 2YZHA 2DBCA 2TIRA 2VL2A 5B7CA 2CQ9A 3M9KA 1EV4A 2XPEA 5INYA 4GF0A 1X9MB 1ZGNA 1E6BA 1ERUA 5G5FA 2C3TA 1GSQA 1LBKA 2OBIA 4WBJA 4AGSA 1TP9A 2C0GA 5HFKA 4OO5A 3KTBA 3D4TA 2GT6A 3I6AA 2M46A 3TKRA 3FHKA 2HRAA 4LL1B 4EE0A 1K0NA 5H5RA 5DQYA 4CDOA 5GZZB 4IP1A 1SL1B 2KP1A 2Z9SA 1V2AA 4N0VA 4WETA 3TRXA 3LGCA 4HEA2 3EINA 2AUVA 4RQRA 4TR0A 2L4QA 4XS6A 3TB2A 1PN9A 1QGVA 4HQZA 4K0GA 3CMIA 2OE1A 5IPHA 12GSA 2JL4A 3F8UA 2I81A 3J7Yk 1YQ1A 16GSA 5DJMA 1K3OA 4PTSA 4TOPA 3KTLA 4PNFA 4G0LA 4XCSA 4XIHA 3NIVA 2GQLA 4TW5A 5CO3A 2LJRA 2C3QA 4RI6A 2ON5A 1SK2A 2L6DA 2PPTA 1K0DA 5G1LA 1OKTA 2C8UA 3HZ8A 4MZCA 2H1AA 5JWRB 4OCFA 1SJ6A 2IFQA 5ID2A 1ZL9A 2VLVA 2FHEA 3GX8A 4OFTA 2PVOC 3HCZA 5C00A 4POLA 3IC4A 3VPQA 5ABRA 2P5RA 2FWEA 2HRFA 4K1FA 1U88A 2DLXA 1PKWA 4POKA 1ERTA 3IPZA 2C1YA 3ZMKA 1EZKA 2NPBA 1OC9A 3QAVA 2GT5A 3TOUA 5HR0A 3GKMA 3GH6A 3MNGA 3G7YA 2DJKA 1ON4A 1PL2A 3O6TA 4IJ3A 4GTUA 3TKPA 3RAZA 3KEBA 4V2LA 3D5JA 3HDCA 3KGKA 2B5XA 1TKDB 4YQUA 2VCTA 3FEUA 4MJAA 3GIXA 2E2GA 4TKYA 1TTZA 3VPTA 1PX6A 4ZB9A 2XC2A 4WR4A 4BVXB 3FW2A 1UA5A 2RUFA 4MLYA 2BTOT 5L71A 2LSTA 3LXZA 1VF2A 2L6CA 2MMZA 2AHEA 3F6DA 3EYTA 5ECQB 3HHVA 3WGDA 2KOKA 3O76A 1PD21 3KM6A 3Q19A 2X99A 3QD9A 1EOHA 3VURA 5LCZA 4N11A 4H86A 1R26A 3MAKA 1PQNA 1WMJA 4IS0A 1F3BA 3GTUA 1GSUA 1YF0A 3H79A 4J56E 3IC8A 3FZ4A 5ECRB 1X5CA 1H4OA 2O85A 1TRVA 3EURA 4MF7A 2WCIA 2DJ2A 2H72A 4XRDA 1ZOFA 3EU4A 1O8XA 1WIKA 3EMPA 4P3YB 1XWKA 1ML6A 2H73A 11GSA 1UN2A 1EEJA 1XVWA 3ZITA 2AJQB 1DE2A 4N10A 4AJ6A 4MJEA 4KCEA 2HZEA 2REMA 5EL8A 1XWGA 2GLRA 3ERFA 4NPBA 1K0OA 5J5NA 4HI7A 3NZNA 4PX1A 1DE1A 1QK8A 1J9BA 2H66A 1GSDA 2DMMA 1W4VA 3GSTA 2JSYA 2LRTA 4O32A 5IQYA 1R5PA 3TGZA 4JU5A 4Q5NA 3UBLA 2K8VA 2HFDA 1HD2A 1FB0A 3TJGA 3M0FA 1B9XC 2HT9A 4X43A 2RM5A 3C8EA 5F06A 4I2UA 5H5SA 2WULA 4NHWA 3PGTA 5AGYA 3EC3A 2MBTA 3GH9A 5IOXA 4ZBDA 4AJ8A 2FWHA 1M2AA 2OE3A 2VLTA 4ZIJA 4ZB6A 4WBRD 2H70A 2C80A 4RI7A 2GSSA 1SK0A 2X8GA 3A5WA 2YPMA 4MH3A 3HYPA 3VI5A 3KD0A 5AIVA 1A23A 4HUAA 4TR4A 4GLTA 1O73A 5KN2A 4JR4A 4HZ4A 3L0HA 5IM9A 2H1GA 5ELAA 2B7KA 2YWNA 1PSQA 2O8VB 2XBIA 2PBJA 4PURA 5FHIA 4ECIA 4EL1A 3UL3A 3V1WA 3QAGA 1TI1A 1BQ7A 3QMXA 1MDIA 2YV9A 2OJLA 3FYGA 4G19A 1UC7A 5IMVA 5D8IA 6GSTA 2K6VA 4F82A 2WJUA 2GQKA 5G1KA 3GNJA 2IWTA 2HSMB 4K7IA 2G2QA 3DRNA 2VCQA 3WT2A 5F8BA 1JFUA 4J57E 3ME7A 4K2DA 4GSTA 2XPDA 3A2WA 2FCHA 1O85A 3L9VA 1ZMAA 2DJ1A 3WT1A 1WP0A 3HVSA 4PQHA 2H8LA 4Q5FA 1K0BA 1A2JA 4ZBAA 3VLNA 4FQUA 5J41A 4IELA 2GZYA 5G31A 4V1Ap 3UAPA 1IYIA 2PERA 4FYBA 4L0WA 1Q98A 4L5OA 3ERWA 1JZDA 1TW9A 1SU9A 3D21A 3EE2A 2OADA 2L5OA 2VL3A 2HRKB 5GSTA 4ZL7A 5IIZA 2N5FA 3FR9A 3ZMLA 3DGQA 3L4NA 1WJKA 4ILFA 2KP2A 3HD5A 5EY6A 2YJ7A 2FNOA 2JADA 3M9JA 3MDKA 2F8AA 1A24A 4K7OA 5ECLB 4N0ZA 5ECHB 1JZWA 1F6MC 1GUMA 4ZL8A 5HFGA 1PMTA 4MH2A 4DSQA 2L57A 1THOA 2CA8A 1MD4A 4GQFA 2VO4A 1M2BA 2LJAA 1TRWA 3U5RE 5IMCA 4QL9A 1GUKA 4HU9A 3IA1A 1VF3A 2K8SA 3QR6A 3HJOA 5JCGA 4IN0A 1XWBA 5D73A 1A2MA 2IMFA 2OBKA 3CRTA 1ZZYA 1R5AA 5CNWA 2PVQA 2ES7A 1G0TA 2RUEA 5HQPA 1X9SB 5HR1A 2JZTA 2QC7A 3CYNA 8GSSA 4O92A 5IPGA 5J4UA 4LA1A 2IJYA 1TK8B 2ON7A 2V6KA 1PA3A 3SBCA 3ZIJA 5ECSA 2AB6A 1N8JA 2JZRA 4ZB8A 4OMVA 2LQOA 2DMLA 3C71A 4OFMA 1FG4A 1VGLA 5F0GA 5KN0A 4I97A 4IP6A 4PQ1A 3VWUA 4MMMA 2NVLA 1G6WA 2LTKA 3ZYWA 1YDKA 1XW5A 2HE3A 4OO4A 3LSZA 3HJMA 4IGJA 1GTAA 1GSEA 3OR5A 3GV1A 2CZ2A 1S3AA 3BJ5A 2C0DA 4MZBA 3G7IA 4EDZA 5DAKB 3GKNA 4ZILA 4WF5A 2WFCA 4DSRA 4PUAA 5E4WA 1GTBA 1DUGA 1AXDA 3FZ9A 3FZAA 1SK1A 3DEXA 4IHUA 3UEMA 4CW9A 4TR1B 2B7JA 3CTFA 3KMOA 4K9ZA 3LYKA 3E9JB 3EU3A 2BJXA 1NSWA 1M9AA 1BEDA 3CRUA 1T8EB 3BBYA 1ST9A 1V40A 2R5GA 4HJMA 4WEYA 3PPUA 3H1NA 4POMA 2HZFA 1VF4A 3HKRA 1U6TA 4L8EA 2VCZA 3H8QA 1XZOA 1UVZA 4POBA 5DCGA 4CHSA 3LXTA 2DIZA 5LNKe 4Z7XA 3I69A 1EV9A 1HNAA 4KDXA 1BJXA 1U3IA 3F4TA 3ZVJA 2WB9A 4J2FA 3VWVA 4L0UA 5DBQA 2YWIA 1MDJA 3ZRDA 5B6NA 1FW1A 1SD9A 6GSYA 2MZCA 4MA9A 2H0GA 1HQOA 3TJBA 2ZNMA 1TK5B 3KH7A 5CREA 4I2TA 2GSTA 1ERVA 3HJPA 1QXHA 2CVDA 3LORA 3WGXA 4RQXA 1XVQA 1YJ6A 2WRTA 1AQXA 5KN1A 4FYCA 2VCWA 3RHBA 1TRSA 2MMOA 3K8NA 5DVBA 2HXKA 3QOUA 2IIYA 2I4AA 3I9V2 2LKUA 2EIOA 5CYYA 1XW6A 2IMKA 2DJJA 3R3EA 1SKSB 1V98A 4KF9A 5FWGA 1K0CA 3DWVA 3ZREA 4XS4B 1O7UA 2H1BA 5IMFA 1URMA 3QDNA 1GSSA 4MPFA 4F0BA 3KZQA 1MEKA 1R7HA 2H6ZA 3QFAC 1EWXA 1DBYA 3IAM2 2YJHA 4KA0A 3TJFA 3GSSA 4Q5QA 2GZZA 5KN3A 1HNBA 3CSIA 1HYUA 3C73A 2HI7A 3TJKA 4JR6A 2MMAA 4BL7A 2I1UA 2LJKA 4MK3A 4TVEA 4E8EA 4BPYA 3J7Yb 1KNGA 4PNGA 3W8SA 1X5EA 3P2AA 2JACA 5DDLA 4DVCA 3F0IA 2VCXA 1ABAA 2MMNA 2UZ8A 3SWLA 4G10A 3WYWA 1F3AA 5LD0A 3DYRA 4WR5A 4TR3A 2RLIA 3CTGA 5AIXA 4EO3A 2JZSA 4HDEA 3W6GA 3CSHA 4F2IA 4V2MA 1B48A 1SENA 1X0RA 1JZRA 1PX7A 4WKWA 3ZFBA 2VM1A 3BCKA 3DKSA 2O7KA 2H19A 1NHYA 3AY8A 4NMUA 4AF2A 4ZL9A 5J9CA 2VIMA 4GSNA 2V6OA 1XBSA 1GRXA 4NXIA 1M9BA 5B8AA 3WD6A 2FA8A 2I9HA 1I5GA 3G9BA
chains in the Genus database with same CATH superfamily
4EDYA 1MTCA 2WDUA 3DXBA 3TCOA 1ZYNA 1FB6A 2WW2A 1OAZA 4I5QA 4D73B 3P7XA 1EOGA 3HVXA 4IBPA 2G0FA 2WW0A 4HU7A 1GULA 1T00A 2IN3A 4F0CA 3RPPA 3CXGA 1W89A 5A1NB 4X1UA 4OWYA 1TXXA 3Q18A 1Y6EA 3UVTA 3DVXA 1O81A 4BWSA 4KSOA 2P0GA 4IQAA 4F9ZA 2IPAA 1ERWA 2PWJA 4K6XA 1ZYPA 1AIUA 1BG1A 3H4KA 3UARA 1V57A 3GRXA 1B4QA 3QAWA 1V9WA 3GKXA 5E59A 2CVBA 5J9BA 20GSA 3VI7A 1NM3A 3DIEA 1YKCA 4AKXB 1GP1A 3KH9A 5J47A 1Z9HA 3ISOA 14GSA 2DJ3A 3C7MA 1TDIA 1YF1A 3PINA 3D0ZA 3RDWA 5GSSA 3PH9A 4HJ2A 1J08A 1GLQA 1ACVA 1GTIA 3D22A 5IO0A 1A8LA 2WZ9A 4GDFA 2H6XA 17GSA 1FVJA 3C1SA 1QQ2A 5DAKA 4BVYB 3F4RA 1Y25A 2IFQB 3APQA 5ID2B 2VM2A 2HYXA 2LQQA 1EGRA 1F37A 5ECPB 3H93A 3MWHA 1X5DA 2OKAA 1JLWA 1T4YA 2DIYA 3E0UA 1S3DA 3IBHA 3EWLA 1Z6NA 4GXZA 2LRNA 2J9HA 3F3RA 3KIJA 3FR3A 4X0XA 4I6XA 4PXOA 1AW9A 3QPMA 5B6MA 2CX4A 2C0FA 1A0FA 1OC9B 2A2RA 4KSMA 1GTUA 4MABA 2E0QA 4ECCA 4YQMA 1SD8A 4IW9A 4FIWA 2NDOA 1OKDA 5G30A 5D9XA 2H1DA 2K9FA 3TDGA 1I1IP 2EFCA 5G5EA 3L78A 2X4AA 4GWRA 4NWYA 1AC1A 5DALB 1FO5A 3TKSC 2DSAA 3N5OA 3UIWA 2QKEA 5ECNB 3LYPA 2GSQA 4X4JA 4QL7A 3IR4A 4HS1A 2GZPA 3ZL5A 2VCVA 4AKHA 3F63A 3CSJA 1ZYEA 2VKZG 2YWMA 4YAVA 4ACSA 4Z2TA 3KP8A 3CBUA 2H75A 1GSFA 5CRGA 3IXRA 3GMFA 2B5EA 4ZBBA 3IK7A 2JU5A 1JHBA 9GSSA 4MP4A 1SJIA 1QMVA 2F9SA 4PHZC 1MD3A 2FWGA 4F03A 4XRAA 3N9JA 4V2NA 1VRSD 2YWOA 1SL2B 3ZLPA 4NV5A 4GRFA 3GTUB 2R0CA 2V1MA 3ME8A 3U6VA 5A5HB 3GL3A 4JRRA 4ECBA 2E7PA 5D9WA 1OC8A 1Z6MA 2CZ3A 4TXOB 4XS4A 1M2DA 1SKWB 5A4WA 1OC3A 2F8FA 5COHA 3EPTA 3RHCA 4L5LA 3F4SA 2PGTA 2FD3A 2YANA 1A2LA 4KDUA 4BVXA 3L9UA 4K7NA 4QQ7A 4BA7A 2LRCA 2XBQA 1O6JA 3IRAA 4G0KA 1FAAA 2YN1A 1GL8A 3LW9A 4G9HA 2HRNA 5JWQB 3LFLA 1K0MA 3TKSE 3CWGA 3TJJA 5D96A 1BG5A 1WWJA 5ECOB 2H6YA 3IDVA 3HMJG 4EUYA 2PU9C 2LS5A 1XOBA 3GHAA 2GS3A 1YKAA 2X8CA 2EC4A 2VL9A 3TOTA 2A4HA 3I43A 1CQHA 1AAZA 1RK4A 4FH8A 2ALBA 4LL4B 4ID0A 1PRXA 1T7PB 2F51A 1PKZA 4KCAA 3GYKA 5GAND 3QCPA 4BWQA 3HY2A 4IQ1A 2N5BA 1HNCA 4USSA 3D4MA 4PI0C 1GWCA 2OA7A 5AISA 5DQSA 1EGOA 4JEDA 4EVMA 3US3A 1A0RP 3Q6OA 4HSCX 1Z3EA 2VLUA 2X64A 1X9WB 5CRWA 2R6KA 2R0PA 2JSZA 1USBA 5GAPD 2GDRA 2P5QA 3APSA 2V32A 4FYUA 4IJIA 1S4BP 1SL0B 5D9TA 3GFKA 4K0NA 3ZVJD 1SYXA 1Z7RA 2FA4A 1B8XA 2PMTA 4OFNA 5A4VA 2YZUA 2C3NA 2YCDA 4K5RA 4D73A 1SKRB 2LUSA 5BMUA 1G6YA 13GSA 3VWWA 4E68A 3L9SA 2J23A 3G7JA 2HSYA 1SVMA 5A1NA 5C04A 4MJBA 3GN3A 1SJZA 6GSXA 3RPNA 2WVYA 4MF5A 5EVOA 1S3CA 1AUCA 1T1VA 2RIIA 6GSUA 1EP8A 2B3SA 2I3YA 3M3MA 2NBSA 2CT6A 4JBBA 5IO2A 3KMNA 2AYTA 5EPFA 4TN8A 5CRDA 3A2VA 1TU7A 1WE0A 5JWOB 1TJDA 1TU8A 1FHEA 2M72A 3VWXA 4MDCA 4DSSB 1E2YA 2CX3A 4ULXA 2LNTA 2O36A 2CAQA 2M80A 5KEJA 4EKZA 2N5AA 2LNSA 1JLVA 4KNDA 4MF6A 1CQGA 4O5UA 5H5QA 3F3QA 5CP1A 1XG8A 5ELGA 2AV4A 2KUCA 4BVYA 3IOSA 4YH2A 1XIYA 3ZFLA 4XTSA 3MSZA 3RBTA 4MCUA 1F2EA 3M8NA 2H30A 1KEBA 2IMEA 1TOFA 5DCHA 4N3ZA 4G0IA 4K8MA 5FT3A 1N2AA 3F9UA 1KTEA 2H0HA 2OE0A 2B1LA 5DJLA 1OE7A 2CAIA 2QGVA 1AQVA 4A5PA 2GGTA 3A2XA 4MJCA 4Z2UA 4WF4A 1XWCA 2HSMA 1U3AA 1M7TA 1ZCPA 1ILOA 2PUKC 5A4UA 3S9FA 2GQMA 3M1GA 5DALA 1G7EA 2C4JA 1M0UA 4RUVA 2P31A 4AJ7A 3MIXA 4DEJA 4GQCA 4ECJA 3UBKA 2O89A 2WGRA 5HR2A 2C0EA 4NV2A 1GNEA 5HR3A 1FOVA 1YEPA 3TKSA 1H75A 4AKGA 2OACA 3UJ1A 3A3TA 3IV4A 2H0IA 1O8WA 3Q74A 2VL2C 6GSVA 2L4CA 3P90A 5IMDA 5IOWA 1XOAA 4NAXA 4ML1A 3QFBC 1TRUA 4FO5A 4OD7A 3IE3A 1GUHA 3O3TA 3TRPA 2X8HA 2HRKA 1NW2A 4YAPA 1NHOA 4ML6A 1M3JA 1WPIA 4TXVA 1VF1A 5A5KA 4I8BA 19GSA 2VAFA 3ERGA 1AQWA 6GSSA 3P8WA 2VD0A 1PN0A 1ZYQB 2YOIA 1BYEA 2WVXB 2FGXA 5AN1A 2D2ZA 2CVKA 2FLSA 4KW6A 4IKHA 1XFLA 2WW1A 4KX4A 2XHFA 1WOUA 1PL1A 1YEWC 2A2SA 1J0FA 2EFEA 3UMAA 2GTUA 3LG6A 1T3BA 2BMXA 4TXOA 3HZ4A 2HQTA 7GSSA 4PUFC 2IMDA 4O5RA 1GNWA 3APOA 1K0AA 4Q5RA 2QSIA 3TUEA 5ECMB 2HNLA 3GKKA 1BF5A 2R4VA 4PGTA 4GCIA 2R37A 2PN8A 1EEMA 5G2ZA 3GA4A 3KCMA 4PQIA 2O87A 4JZQA 3D6IA 4LMWA 3E3EA 3ZIVA 2K18A 4LMVA 1C72A 4OCEA 4YKGA 3HVNA 2EIQA 4ISDA 3GL5A 1OVNA 3LWAA 5HFIA 3CQFA 1SYRA 1Z7PA 3A5IA 2GSRA 4IVFA 3FY7A 1XCCA 4KB3A 4YQVA 4EF0A 3GX0A 2TRXA 3GUSA 4HQSA 1GLPA 4XS1A 3BOAA 2H74A 1KBNA 1K3YA 3JCML 3UOMA 4ZXGA 1T4ZA 1WRYA 4KGIA 2GVPA 5JCWA 4V1Ag 5IMAA 2B6MA 1RQMA 5B8BA 1GH2A 1BX9A 1YZXA 1XPVA 4AKIA 4KAEA 3FZ5A 1Q4JA 2VUPA 4O7HA 4HZ2A 1LU4A 4GSSA 2LV3A 3FK8A 2R2JA 5ECIB 3W8JA 2HLSA 2MYGA 4MZWA 4HOJA 1K3LA 5BRTA 5D93A 2AAWA 2UV8G 3UVHA 2V41A 1QFNA 2LEGA 3HVVA 2IL3A 3PR8A 3ZTLA 2MBSA 4FXYP 5F07A 2A4VA 4K5SA 1GSYA 3IHQA 1FVKA 4TR1A 3IK9A 1A8YA 2KHPA 4EXJA 2B1KA 5ENUA 2VOCA 4NHZA 2YP6A 3FRCA 2L5LA 3IAS2 3TRQA 2H71A 4CY6A 2HSNB 5J3RA 3EMXA 4G2EA 3VK9A 1TK0B 10GSA 3ED3A 2VD1A 1U87A 1Z5YE 3FKFA 2NTOA 18GSA 4DSSA 5F05A 1I9DA 1PGTA 2YNXA 1YY7A 1OYJA 2HSHA 3LJRA 2DC5A 3FR6A 3DVWA 2F3MA 2RM6A 4KE3A 4KUNA 4TRXA 5ECKB 4LLRA 2V2GA 3VFIA 1YEXA 1V58A 1R4WA 4EIQA 3F6FA 1PFOA 4MPGA 1MDKA 5A34A 3NOFA 2E2MA 2QA2A 2FY6A 1JZOA 1F9MA 4E8HA 3KXOA 1XXUA 2FUG2 4BL7B 2DJ0A 4EC0A 1QUWA 3GURA 1RW1A 3ZZXA 1THXA 3KP9A 2EIRA 4KDYA 2B5YA 22GSA 2WS2A 5J40A 2H76A 1LJRA 2L59A 2FWFA 3RGBC 4WXTA 1IYHA 4EIPA 1XWAA 1BAYA 2IMIA 4XHMA 2ZUPA 3BCIA 4JE1A 2R3XA 5JCUA 3TKQA 4N30A 3HXSA 3BD2A 6GSWA 3LEFA 5CRHA 3EVIA 1B9YC 5CAXA 3DD3A 1G7OA 3WGEA 3R2QA 3DMLA 2H01A 1B4PA 1EP7A 3C1RA 3KJYA 1XW9A 5D9VA 2ZCTA 5IMZA 1DSBA 1M99A 3HA9A 2HZEB 4KH7A 1OE8A 5J4VA 4ZB7A 3LQ7A 4BIKA 2CV4A 2TRCP 2YV7A 1TI3A 2KLXA 2YZHA 2DBCA 2TIRA 2VL2A 5B7CA 2CQ9A 3M9KA 1EV4A 2XPEA 5INYA 4GF0A 1X9MB 1ZGNA 1E6BA 1ERUA 5G5FA 2C3TA 1GSQA 4ICYA 1LBKA 2OBIA 4WBJA 4AGSA 1TP9A 2C0GA 5HFKA 4OO5A 3KTBA 3D4TA 2GT6A 3I6AA 3MYDA 2M46A 3TKRA 3FHKA 2HRAA 4LL1B 4EE0A 1K0NA 5H5RA 5DQYA 4CDOA 5GZZB 4IP1A 1SL1B 2KP1A 2Z9SA 1V2AA 4N0VA 1TXUA 4WETA 5KOWA 3TRXA 3LGCA 4HEA2 3EINA 2AUVA 4RQRA 4TR0A 2L4QA 4XS6A 3TB2A 1PN9A 1QGVA 4HQZA 4K0GA 3CMIA 2OE1A 5IPHA 12GSA 1FOHA 2JL4A 3F8UA 2I81A 3J7Yk 1YQ1A 16GSA 5DJMA 1K3OA 4PTSA 4TOPA 3KTLA 4PNFA 4G0LA 4XCSA 4XIHA 3NIVA 2GQLA 4TW5A 5CO3A 2LJRA 2C3QA 4RI6A 2ON5A 1SK2A 2L6DA 2PPTA 1K0DA 5G1LA 1OKTA 3TU3B 2C8UA 3HZ8A 4MZCA 2H1AA 5JWRB 4OCFA 1SJ6A 2IFQA 5ID2A 1ZL9A 2VLVA 2FHEA 3GX8A 4OFTA 2PVOC 3HCZA 5C00A 4POLA 3IC4A 3VPQA 5ABRA 2P5RA 2FWEA 2WW3A 2HRFA 4K1FA 1U88A 2DLXA 1PKWA 4POKA 1ERTA 3IPZA 2C1YA 3ZMKA 1EZKA 2HSNA 2NPBA 1OC9A 3QAVA 2GT5A 5J4YA 3TOUA 5HR0A 3GKMA 3GH6A 3MNGA 3G7YA 2DJKA 1ON4A 1PL2A 3O6TA 4IJ3A 4GTUA 3TKPA 3RAZA 3KEBA 4V2LA 3D5JA 3HDCA 3KGKA 2B5XA 1TKDB 1N25A 4YQUA 2VCTA 3FEUA 4MJAA 3GIXA 2E2GA 4TKYA 1TTZA 3VPTA 1PX6A 4ZB9A 2XC2A 4WR4A 4BVXB 3FW2A 1UA5A 2RUFA 4MLYA 2BTOT 5L71A 2LSTA 3LXZA 1VF2A 2L6CA 4QMKA 2MMZA 2AHEA 3F6DA 3EYTA 5ECQB 3HHVA 3WGDA 2KOKA 2QA1A 3O76A 1PD21 3KM6A 3Q19A 2X99A 3QD9A 1EOHA 3VURA 5LCZA 4N11A 4H86A 2O5VA 1R26A 3MAKA 1PQNA 1WMJA 4IS0A 1F3BA 3GTUA 5A5HA 1GSUA 1YF0A 3H79A 4J56E 3IC8A 3FZ4A 1Y1UA 5ECRB 1X5CA 1H4OA 2O85A 1TRVA 3EURA 4MF7A 2WCIA 2DJ2A 2H72A 4XRDA 1ZOFA 3EU4A 1O8XA 1WIKA 3EMPA 4P3YB 1XWKA 1ML6A 1SVLA 2H73A 11GSA 1UN2A 1EEJA 1XVWA 3ZITA 2AJQB 1DE2A 4N10A 4AJ6A 4MJEA 4KCEA 2HZEA 4G01A 2DKHA 2REMA 5EL8A 1XWGA 2GLRA 3ERFA 4NPBA 1K0OA 5J5NA 4W66A 4HI7A 3NZNA 4PX1A 2X49A 1DE1A 5BMUB 1QK8A 1J9BA 2H66A 1GSDA 2DMMA 1W4VA 3GSTA 2JSYA 2LRTA 4O32A 5IQYA 1R5PA 3TGZA 4JU5A 4Q5NA 3UBLA 2EFDA 2K8VA 2HFDA 4PI2C 1HD2A 1FB0A 3TJGA 3M0FA 1B9XC 2HT9A 4X43A 2RM5A 3C8EA 5F06A 4I2UA 5H5SA 2WULA 4NHWA 3PGTA 5AGYA 3EC3A 2MBTA 3GH9A 2A2PA 5IOXA 4ZBDA 4AJ8A 2FWHA 1M2AA 2OE3A 2VLTA 4ZIJA 4ZB6A 4WBRD 2H70A 2C80A 4RI7A 2GSSA 1SK0A 2X8GA 3A5WA 2YPMA 4MH3A 3HYPA 3VI5A 3KD0A 5AIVA 1A23A 4HUAA 4TR4A 4GLTA 1O73A 5KN2A 4JR4A 4HZ4A 3L0HA 5IM9A 2H1GA 5ELAA 2B7KA 2YWNA 1PSQA 2O8VB 2XBIA 2PBJA 4PURA 5FHIA 4ECIA 4YKFA 1SVOA 4EL1A 3UL3A 3V1WA 3QAGA 1TI1A 1BQ7A 3QMXA 1MDIA 2YV9A 4MNNA 2OJLA 3FYGA 4G19A 1UC7A 5IMVA 5D8IA 6GSTA 2K6VA 4F82A 2WJUA 2GQKA 5G1KA 3GNJA 2H1LA 2IWTA 2HSMB 4K7IA 2G2QA 3DRNA 2VCQA 4O5QA 3WT2A 5F8BA 1JFUA 4J57E 3ME7A 4K2DA 4GSTA 2XPDA 3A2WA 2FCHA 1O85A 3L9VA 1ZMAA 2DJ1A 3WT1A 1WP0A 3HVSA 4PQHA 2H8LA 4Q5FA 1K0BA 1A2JA 4ZBAA 3VLNA 4FQUA 5J41A 4IELA 2GZYA 5G31A 4V1Ap 3UAPA 1IYIA 2PERA 4FYBA 4L0WA 1Q98A 4L5OA 3ERWA 1JZDA 1TW9A 1SU9A 3D21A 3EE2A 2OADA 2L5OA 2VL3A 2HRKB 5GSTA 4ZL7A 5IIZA 2N5FA 3FR9A 3ZMLA 3DGQA 3L4NA 1WJKA 4ILFA 2KP2A 3HD5A 5EY6A 2YJ7A 2FNOA 2JADA 3M9JA 3MDKA 2F8AA 1A24A 1S3RA 4K7OA 5ECLB 4N0ZA 5ECHB 1JZWA 1F6MC 1GUMA 4ZL8A 5HFGA 1PMTA 4MH2A 4DSQA 2L57A 1THOA 2CA8A 1MD4A 4GQFA 2VO4A 1M2BA 2LJAA 1TRWA 3U5RE 5IMCA 4QL9A 1GUKA 4HU9A 3IA1A 1VF3A 2K8SA 3QR6A 3HJOA 5JCGA 4IN0A 1XWBA 5D73A 1A2MA 2IMFA 2OBKA 2OT3A 3CRTA 1ZZYA 1R5AA 5CNWA 2PVQA 2ES7A 1G0TA 2RUEA 5HQPA 1X9SB 5HR1A 2JZTA 3IHGA 2QC7A 3CYNA 8GSSA 4O92A 5IPGA 5J4UA 5KOXA 4LA1A 2IJYA 1TK8B 2ON7A 2V6KA 1PA3A 3SBCA 3ZIJA 5ECSA 2AB6A 1N8JA 2JZRA 4ZB8A 4OMVA 2LQOA 2DMLA 2WVXA 3C71A 4OFMA 1FG4A 1VGLA 5F0GA 5KN0A 1YVLA 4I97A 4IP6A 4PQ1A 3VWUA 4MMMA 2NVLA 1G6WA 2LTKA 3ZYWA 1YDKA 1XW5A 2HE3A 4OO4A 3LSZA 3HJMA 4IGJA 1GTAA 1GSEA 3OR5A 3GV1A 2CZ2A 1S3AA 3BJ5A 3FMWA 2C0DA 4MZBA 3G7IA 4EDZA 5DAKB 3GKNA 4ZILA 4WF5A 2WFCA 4DSRA 4PUAA 5E4WA 1GTBA 1DUGA 1AXDA 3FZ9A 3FZAA 2EFHA 1SK1A 3DEXA 4IHUA 3UEMA 4CW9A 4Z2RA 4TR1B 2B7JA 3CTFA 3KMOA 4K9ZA 3LYKA 3E9JB 3EU3A 2BJXA 1NSWA 1M9AA 4CY8A 1BEDA 3CRUA 1T8EB 3BBYA 1ST9A 1V40A 2R5GA 4HJMA 4WEYA 3PPUA 3H1NA 4POMA 2HZFA 3CHXC 1VF4A 3HKRA 1U6TA 4L8EA 2VCZA 3H8QA 1XZOA 1UVZA 4POBA 5DCGA 4CHSA 3LXTA 2DIZA 5LNKe 4Z7XA 3I69A 1EV9A 1HNAA 4KDXA 1BJXA 1U3IA 3F4TA 3ZVJA 2WB9A 4J2FA 3VWVA 4L0UA 5DBQA 2YWIA 1MDJA 3ZRDA 5B6NA 1FW1A 1SD9A 6GSYA 2MZCA 4MA9A 2H0GA 1HQOA 3TJBA 2ZNMA 1TK5B 3KH7A 5CREA 2GSTA 4I2TA 1ERVA 3HJPA 1QXHA 2CVDA 3LORA 3WGXA 4RQXA 1XVQA 1YJ6A 2WRTA 1AQXA 5A34B 5KN1A 4FYCA 2DKIA 2VCWA 3RHBA 1TRSA 2MMOA 3K8NA 5DVBA 2HXKA 3QOUA 2IIYA 2I4AA 3I9V2 2LKUA 2EIOA 5CYYA 1XW6A 2IMKA 2DJJA 3R3EA 1SKSB 1V98A 4KF9A 5FWGA 1K0CA 3DWVA 3ZREA 4XS4B 1O7UA 2H1BA 5IMFA 1URMA 3QDNA 1GSSA 4MPFA 4F0BA 3KZQA 1MEKA 1R7HA 2H6ZA 3QFAC 1EWXA 1DBYA 3IAM2 2YJHA 4KA0A 3TJFA 3GSSA 4Q5QA 2GZZA 5KN3A 1HNBA 3CSIA 1HYUA 3C73A 2HI7A 3TJKA 4JR6A 2MMAA 4BL7A 2I1UA 2R0GA 2LJKA 4MK3A 4TVEA 4E8EA 4BPYA 3J7Yb 1KNGA 1M3IA 4PNGA 3W8SA 1X5EA 3P2AA 2O3EA 2JACA 5DDLA 4DVCA 3F0IA 2VCXA 1ABAA 4K2XA 2MMNA 2UZ8A 3SWLA 4G10A 3WYWA 1F3AA 5LD0A 3DYRA 2WZSA 4WR5A 4TR3A 2RLIA 3CTGA 5AIXA 4EO3A 2JZSA 4HDEA 3W6GA 3CSHA 4F2IA 4V2MA 1B48A 1SENA 1X0RA 1JZRA 1PX7A 4WKWA 3ZFBA 2VM1A 3BCKA 3DKSA 2O7KA 2WVZA 2H19A 1NHYA 3AY8A 4NMUA 3RFRC 4AF2A 4ZL9A 5J9CA 2VIMA 4GSNA 2V6OA 4AI6A 1XBSA 1GRXA 4NXIA 1M9BA 5B8AA 3WD6A 2FA8A 2I9HA 1I5GA 3G9BA
chains in the Genus database with same CATH topology
4EDYA 1MTCA 2WDUA 3DXBA 3TCOA 1ZYNA 1FB6A 1OAZA 4I5QA 4D73B 3P7XA 1EOGA 3HVXA 4IBPA 2G0FA 4HU7A 1GULA 1T00A 2IN3A 4F0CA 3RPPA 3CXGA 1W89A 5A1NB 4X1UA 4OWYA 1TXXA 3Q18A 1Y6EA 3UVTA 3DVXA 1O81A 4BWSA 4KSOA 2P0GA 4IQAA 4F9ZA 2IPAA 1ERWA 2PWJA 4K6XA 1ZYPA 1AIUA 1BG1A 3H4KA 3UARA 1V57A 3GRXA 1B4QA 3QAWA 1V9WA 3GKXA 5E59A 2CVBA 5J9BA 20GSA 3VI7A 1NM3A 3DIEA 3KH9A 1YKCA 4AKXB 1GP1A 5J47A 1Z9HA 3ISOA 14GSA 2DJ3A 3C7MA 1TDIA 1YF1A 3PINA 3D0ZA 3RDWA 5GSSA 3PH9A 4HJ2A 1J08A 1GLQA 1ACVA 1GTIA 3D22A 5IO0A 1A8LA 2WZ9A 4GDFA 2H6XA 17GSA 1FVJA 3C1SA 1QQ2A 5DAKA 4BVYB 3F4RA 1Y25A 2IFQB 3APQA 5ID2B 2VM2A 2HYXA 2LQQA 1EGRA 1F37A 5ECPB 3H93A 3MWHA 1X5DA 2OKAA 1JLWA 1T4YA 2DIYA 3E0UA 1S3DA 3IBHA 3EWLA 1Z6NA 4GXZA 2LRNA 2J9HA 3F3RA 3KIJA 3FR3A 4X0XA 4I6XA 4PXOA 1AW9A 3QPMA 5B6MA 2CX4A 2C0FA 1A0FA 1OC9B 2A2RA 4KSMA 1GTUA 4MABA 2E0QA 4ECCA 4YQMA 1SD8A 4IW9A 4FIWA 2NDOA 1OKDA 5G30A 5D9XA 2H1DA 2K9FA 3TDGA 5G5EA 2EFCA 3L78A 2X4AA 4GWRA 4NWYA 1AC1A 5DALB 1FO5A 3TKSC 2DSAA 3N5OA 3UIWA 2QKEA 5ECNB 3LYPA 2GSQA 4X4JA 4QL7A 3IR4A 4HS1A 2GZPA 3ZL5A 2VCVA 4AKHA 3F63A 3CSJA 1ZYEA 2VKZG 2YWMA 4YAVA 4ACSA 4Z2TA 3KP8A 3CBUA 2H75A 1GSFA 5CRGA 3IXRA 3GMFA 2B5EA 4ZBBA 3IK7A 2JU5A 1JHBA 9GSSA 4MP4A 1SJIA 1QMVA 2F9SA 1MD3A 2FWGA 4F03A 4XRAA 3N9JA 4V2NA 1VRSD 2YWOA 1SL2B 3ZLPA 4NV5A 4GRFA 3GTUB 2R0CA 2V1MA 3ME8A 3U6VA 5A5HB 3GL3A 4JRRA 4ECBA 2E7PA 5D9WA 1OC8A 1Z6MA 2CZ3A 4TXOB 4XS4A 1M2DA 1SKWB 5A4WA 1OC3A 2F8FA 5COHA 3EPTA 3RHCA 4L5LA 3F4SA 2PGTA 2FD3A 2YANA 1A2LA 4KDUA 4BVXA 3L9UA 4K7NA 4QQ7A 4BA7A 2LRCA 2XBQA 1O6JA 3IRAA 4G0KA 1FAAA 2YN1A 1GL8A 3LW9A 4G9HA 2HRNA 5JWQB 3LFLA 1K0MA 3TKSE 3CWGA 3TJJA 5D96A 1BG5A 1WWJA 5ECOB 2H6YA 3IDVA 3HMJG 4EUYA 2PU9C 2LS5A 1XOBA 3GHAA 2GS3A 1YKAA 2X8CA 2EC4A 2VL9A 3TOTA 2A4HA 3I43A 1CQHA 1AAZA 1RK4A 4FH8A 2ALBA 4LL4B 4ID0A 1PRXA 1T7PB 2F51A 1PKZA 4KCAA 3GYKA 5GAND 3QCPA 4BWQA 3HY2A 4IQ1A 2N5BA 1HNCA 4USSA 3D4MA 1GWCA 2OA7A 5AISA 5DQSA 1EGOA 4JEDA 4EVMA 3US3A 1A0RP 3Q6OA 1Z3EA 2VLUA 2X64A 1X9WB 5CRWA 2R6KA 2R0PA 2JSZA 1USBA 5GAPD 2GDRA 2P5QA 3APSA 2V32A 4FYUA 4IJIA 1SL0B 5D9TA 3GFKA 4K0NA 3ZVJD 1SYXA 1Z7RA 2FA4A 1B8XA 2PMTA 4OFNA 5A4VA 2YZUA 2C3NA 2YCDA 4K5RA 4D73A 1SKRB 2LUSA 5BMUA 1G6YA 13GSA 3VWWA 4E68A 3L9SA 2J23A 3G7JA 2HSYA 1SVMA 5A1NA 5C04A 4MJBA 3GN3A 1SJZA 6GSXA 3RPNA 4MF5A 5EVOA 1S3CA 1AUCA 1T1VA 2RIIA 6GSUA 1EP8A 2B3SA 2I3YA 3M3MA 2NBSA 2CT6A 4JBBA 5IO2A 3KMNA 2AYTA 5EPFA 4TN8A 5CRDA 3A2VA 1TU7A 1WE0A 5JWOB 1TJDA 1TU8A 1FHEA 2M72A 3VWXA 4MDCA 4DSSB 1E2YA 2CX3A 4ULXA 2LNTA 2CAQA 2M80A 5KEJA 4EKZA 2N5AA 2LNSA 1JLVA 4KNDA 4MF6A 1CQGA 4O5UA 5H5QA 3F3QA 5CP1A 5ELGA 2AV4A 2KUCA 4BVYA 3IOSA 4YH2A 1XIYA 3ZFLA 4XTSA 3MSZA 3RBTA 4MCUA 1F2EA 3M8NA 2H30A 1KEBA 2IMEA 1TOFA 5DCHA 4N3ZA 4G0IA 4K8MA 5FT3A 1N2AA 3F9UA 1KTEA 2H0HA 2OE0A 2B1LA 5DJLA 1OE7A 2CAIA 2QGVA 1AQVA 4A5PA 2GGTA 3A2XA 4MJCA 4Z2UA 4WF4A 1XWCA 2HSMA 1U3AA 1M7TA 1ZCPA 1ILOA 2PUKC 5A4UA 3S9FA 2GQMA 3M1GA 5DALA 1G7EA 2C4JA 1M0UA 4RUVA 2P31A 4AJ7A 3MIXA 4DEJA 4GQCA 4ECJA 3UBKA 2O89A 2WGRA 5HR2A 2C0EA 4NV2A 1GNEA 5HR3A 1FOVA 1YEPA 3TKSA 1H75A 4AKGA 2OACA 3UJ1A 3A3TA 3IV4A 2H0IA 1O8WA 3Q74A 2VL2C 6GSVA 2L4CA 3P90A 5IMDA 5IOWA 1XOAA 4NAXA 4ML1A 3QFBC 1TRUA 4FO5A 4OD7A 3IE3A 1GUHA 3O3TA 3TRPA 2X8HA 2HRKA 1NW2A 4YAPA 1NHOA 4ML6A 1WPIA 4TXVA 1VF1A 5A5KA 4I8BA 19GSA 2VAFA 3ERGA 1AQWA 6GSSA 3P8WA 2VD0A 1PN0A 1ZYQB 2YOIA 1BYEA 2FGXA 5AN1A 2D2ZA 2CVKA 2FLSA 4KW6A 4IKHA 1XFLA 4KX4A 2XHFA 1WOUA 1PL1A 2A2SA 1J0FA 2EFEA 3UMAA 2GTUA 3LG6A 1T3BA 2BMXA 4TXOA 3HZ4A 2HQTA 7GSSA 4PUFC 2IMDA 4O5RA 1GNWA 3APOA 1K0AA 4Q5RA 2QSIA 3TUEA 5ECMB 2HNLA 3GKKA 1BF5A 2R4VA 4PGTA 4GCIA 2R37A 2PN8A 1EEMA 5G2ZA 3GA4A 3KCMA 4PQIA 2O87A 4JZQA 3D6IA 4LMWA 3E3EA 3ZIVA 2K18A 4LMVA 1C72A 4OCEA 4YKGA 2EIQA 4ISDA 3GL5A 1OVNA 3LWAA 5HFIA 1SYRA 1Z7PA 3A5IA 2GSRA 4IVFA 3FY7A 1XCCA 4KB3A 4YQVA 4EF0A 3GX0A 2TRXA 3GUSA 4HQSA 1GLPA 4XS1A 3BOAA 2H74A 1KBNA 1K3YA 3JCML 3UOMA 4ZXGA 1T4ZA 1WRYA 4KGIA 2GVPA 5JCWA 4V1Ag 5IMAA 2B6MA 1RQMA 5B8BA 1GH2A 1BX9A 1YZXA 1XPVA 4AKIA 4KAEA 3FZ5A 1Q4JA 2VUPA 4O7HA 4HZ2A 1LU4A 4GSSA 2LV3A 3FK8A 2R2JA 5ECIB 3W8JA 2HLSA 2MYGA 4MZWA 4HOJA 1K3LA 5BRTA 5D93A 2AAWA 2UV8G 3UVHA 2V41A 1QFNA 2LEGA 3HVVA 2IL3A 3PR8A 3ZTLA 2MBSA 5F07A 2A4VA 4K5SA 1GSYA 3IHQA 1FVKA 4TR1A 3IK9A 1A8YA 2KHPA 4EXJA 2B1KA 5ENUA 2VOCA 4NHZA 2YP6A 3FRCA 2L5LA 3IAS2 3TRQA 2H71A 4CY6A 2HSNB 5J3RA 3EMXA 4G2EA 3VK9A 1TK0B 10GSA 3ED3A 2VD1A 1U87A 1Z5YE 3FKFA 2NTOA 18GSA 4DSSA 5F05A 1I9DA 1PGTA 2YNXA 1YY7A 1OYJA 2HSHA 3LJRA 2DC5A 3FR6A 3DVWA 2F3MA 2RM6A 4KE3A 4KUNA 4TRXA 5ECKB 4LLRA 2V2GA 3VFIA 1YEXA 1V58A 1R4WA 4EIQA 3F6FA 4MPGA 1MDKA 5A34A 3NOFA 2E2MA 2QA2A 2FY6A 1JZOA 1F9MA 4E8HA 3KXOA 1XXUA 2FUG2 4BL7B 2DJ0A 4EC0A 1QUWA 3GURA 1RW1A 3ZZXA 1THXA 3KP9A 2EIRA 4KDYA 2B5YA 22GSA 2WS2A 5J40A 2H76A 1LJRA 2L59A 2FWFA 4WXTA 1IYHA 4EIPA 1XWAA 1BAYA 2IMIA 4XHMA 2ZUPA 3BCIA 4JE1A 2R3XA 5JCUA 3TKQA 4N30A 3HXSA 3BD2A 6GSWA 3LEFA 5CRHA 3EVIA 1B9YC 5CAXA 3DD3A 1G7OA 3WGEA 3R2QA 3DMLA 2H01A 1B4PA 1EP7A 3C1RA 3KJYA 1XW9A 5D9VA 2ZCTA 5IMZA 1DSBA 1M99A 3HA9A 2HZEB 4KH7A 1OE8A 5J4VA 4ZB7A 3LQ7A 2CV4A 2TRCP 2YV7A 1TI3A 2KLXA 2YZHA 2DBCA 2TIRA 2VL2A 5B7CA 2CQ9A 3M9KA 1EV4A 2XPEA 5INYA 4GF0A 1X9MB 1ZGNA 1E6BA 1ERUA 5G5FA 2C3TA 1GSQA 4ICYA 1LBKA 2OBIA 4WBJA 4AGSA 1TP9A 2C0GA 5HFKA 4OO5A 3KTBA 3D4TA 2GT6A 3I6AA 3MYDA 2M46A 3TKRA 3FHKA 2HRAA 4LL1B 4EE0A 1K0NA 5H5RA 5DQYA 4CDOA 5GZZB 4IP1A 1SL1B 2KP1A 2Z9SA 1V2AA 4N0VA 1TXUA 4WETA 5KOWA 3TRXA 3LGCA 4HEA2 3EINA 2AUVA 4RQRA 4TR0A 2L4QA 4XS6A 3TB2A 1PN9A 1QGVA 4HQZA 4K0GA 3CMIA 2OE1A 5IPHA 12GSA 1FOHA 2JL4A 3F8UA 2I81A 3J7Yk 1YQ1A 16GSA 5DJMA 1K3OA 4PTSA 4TOPA 3KTLA 4PNFA 4G0LA 4XCSA 4XIHA 3NIVA 2GQLA 4TW5A 5CO3A 2LJRA 2C3QA 4RI6A 2ON5A 1SK2A 2L6DA 2PPTA 1K0DA 5G1LA 1OKTA 3TU3B 2C8UA 3HZ8A 4MZCA 2H1AA 5JWRB 4OCFA 1SJ6A 2IFQA 5ID2A 1ZL9A 2VLVA 2FHEA 3GX8A 4OFTA 2PVOC 3HCZA 5C00A 4POLA 3IC4A 3VPQA 5ABRA 2P5RA 2FWEA 2HRFA 4K1FA 1U88A 2DLXA 1PKWA 4POKA 1ERTA 3IPZA 2C1YA 3ZMKA 1EZKA 2HSNA 2NPBA 1OC9A 3QAVA 2GT5A 5J4YA 3TOUA 5HR0A 3GKMA 3GH6A 3MNGA 3G7YA 2DJKA 1ON4A 1PL2A 3O6TA 4IJ3A 4GTUA 3TKPA 3RAZA 3KEBA 4V2LA 3D5JA 3HDCA 3KGKA 2B5XA 1TKDB 1N25A 4YQUA 2VCTA 3FEUA 4MJAA 3GIXA 2E2GA 4TKYA 1TTZA 3VPTA 1PX6A 4ZB9A 2XC2A 4WR4A 4BVXB 3FW2A 1UA5A 2RUFA 4MLYA 2BTOT 5L71A 2LSTA 3LXZA 1VF2A 2L6CA 4QMKA 2MMZA 2AHEA 3F6DA 3EYTA 5ECQB 3HHVA 3WGDA 2KOKA 2QA1A 3O76A 1PD21 3KM6A 3Q19A 2X99A 3QD9A 1EOHA 3VURA 5LCZA 4N11A 4H86A 2O5VA 1R26A 3MAKA 1PQNA 1WMJA 4IS0A 1F3BA 3GTUA 5A5HA 1GSUA 1YF0A 3H79A 4J56E 3IC8A 3FZ4A 1Y1UA 5ECRB 1X5CA 1H4OA 2O85A 1TRVA 3EURA 4MF7A 2WCIA 2DJ2A 2H72A 4XRDA 1ZOFA 3EU4A 1O8XA 1WIKA 3EMPA 4P3YB 1XWKA 1ML6A 1SVLA 2H73A 11GSA 1UN2A 1EEJA 1XVWA 3ZITA 2AJQB 1DE2A 4N10A 4AJ6A 4MJEA 4KCEA 2HZEA 4G01A 2DKHA 2REMA 5EL8A 1XWGA 2GLRA 3ERFA 4NPBA 1K0OA 5J5NA 4W66A 4HI7A 3NZNA 4PX1A 2X49A 1DE1A 5BMUB 1QK8A 1J9BA 2H66A 1GSDA 2DMMA 1W4VA 3GSTA 2JSYA 2LRTA 4O32A 5IQYA 1R5PA 3TGZA 4JU5A 4Q5NA 3UBLA 2EFDA 2K8VA 2HFDA 1HD2A 1FB0A 3TJGA 3M0FA 1B9XC 2HT9A 4X43A 2RM5A 3C8EA 5F06A 4I2UA 5H5SA 2WULA 4NHWA 3PGTA 5AGYA 3EC3A 2MBTA 3GH9A 2A2PA 5IOXA 4ZBDA 4AJ8A 2FWHA 1M2AA 2OE3A 2VLTA 4ZIJA 4ZB6A 4WBRD 2H70A 2C80A 4RI7A 2GSSA 1SK0A 2X8GA 3A5WA 2YPMA 4MH3A 3HYPA 3VI5A 3KD0A 5AIVA 1A23A 4HUAA 4TR4A 4GLTA 1O73A 5KN2A 4JR4A 4HZ4A 3L0HA 5IM9A 2H1GA 5ELAA 2B7KA 2YWNA 1PSQA 2O8VB 2XBIA 2PBJA 4PURA 5FHIA 4ECIA 4YKFA 1SVOA 4EL1A 3UL3A 3V1WA 3QAGA 1TI1A 1BQ7A 3QMXA 1MDIA 2YV9A 4MNNA 2OJLA 3FYGA 4G19A 1UC7A 5IMVA 5D8IA 6GSTA 2K6VA 4F82A 2WJUA 2GQKA 5G1KA 3GNJA 2H1LA 2IWTA 2HSMB 4K7IA 2G2QA 3DRNA 2VCQA 4O5QA 3WT2A 5F8BA 1JFUA 4J57E 3ME7A 4K2DA 4GSTA 2XPDA 3A2WA 2FCHA 1O85A 3L9VA 1ZMAA 2DJ1A 3WT1A 1WP0A 3HVSA 4PQHA 2H8LA 4Q5FA 1K0BA 1A2JA 4ZBAA 3VLNA 4FQUA 5J41A 4IELA 2GZYA 5G31A 4V1Ap 3UAPA 1IYIA 2PERA 4FYBA 4L0WA 1Q98A 4L5OA 3ERWA 1JZDA 1TW9A 1SU9A 3D21A 3EE2A 2OADA 2L5OA 2VL3A 2HRKB 5GSTA 4ZL7A 5IIZA 2N5FA 3FR9A 3ZMLA 3DGQA 3L4NA 1WJKA 4ILFA 2KP2A 3HD5A 5EY6A 2YJ7A 2FNOA 2JADA 3M9JA 3MDKA 2F8AA 1A24A 4K7OA 5ECLB 4N0ZA 5ECHB 1JZWA 1F6MC 1GUMA 4ZL8A 5HFGA 1PMTA 4MH2A 4DSQA 2L57A 1THOA 2CA8A 1MD4A 4GQFA 2VO4A 1M2BA 2LJAA 1TRWA 3U5RE 5IMCA 4QL9A 1GUKA 4HU9A 3IA1A 1VF3A 2K8SA 3QR6A 3HJOA 5JCGA 4IN0A 1XWBA 5D73A 1A2MA 2IMFA 2OBKA 2OT3A 3CRTA 1ZZYA 1R5AA 5CNWA 2PVQA 2ES7A 1G0TA 2RUEA 5HQPA 1X9SB 5HR1A 2JZTA 3IHGA 2QC7A 3CYNA 8GSSA 4O92A 5IPGA 5J4UA 5KOXA 4LA1A 2IJYA 1TK8B 2ON7A 2V6KA 1PA3A 3SBCA 3ZIJA 5ECSA 2AB6A 1N8JA 2JZRA 4ZB8A 4OMVA 2LQOA 2DMLA 3C71A 4OFMA 1FG4A 1VGLA 5F0GA 5KN0A 1YVLA 4I97A 4IP6A 4PQ1A 3VWUA 4MMMA 2NVLA 1G6WA 2LTKA 3ZYWA 1YDKA 1XW5A 2HE3A 4OO4A 3LSZA 3HJMA 4IGJA 1GTAA 1GSEA 3OR5A 3GV1A 2CZ2A 1S3AA 3BJ5A 3FMWA 2C0DA 4MZBA 3G7IA 4EDZA 5DAKB 3GKNA 4ZILA 4WF5A 2WFCA 4DSRA 4PUAA 5E4WA 1GTBA 1DUGA 1AXDA 3FZ9A 3FZAA 2EFHA 1SK1A 3DEXA 4IHUA 3UEMA 4CW9A 4Z2RA 4TR1B 2B7JA 3CTFA 3KMOA 4K9ZA 3LYKA 3E9JB 3EU3A 2BJXA 1NSWA 1M9AA 4CY8A 1BEDA 3CRUA 1T8EB 3BBYA 1ST9A 1V40A 2R5GA 4HJMA 4WEYA 3PPUA 3H1NA 4POMA 2HZFA 1VF4A 3HKRA 1U6TA 4L8EA 2VCZA 3H8QA 1XZOA 1UVZA 4POBA 5DCGA 4CHSA 3LXTA 2DIZA 5LNKe 4Z7XA 3I69A 1EV9A 1HNAA 4KDXA 1BJXA 1U3IA 3F4TA 3ZVJA 2WB9A 4J2FA 3VWVA 4L0UA 5DBQA 2YWIA 1MDJA 3ZRDA 5B6NA 1FW1A 1SD9A 6GSYA 2MZCA 4MA9A 2H0GA 1HQOA 3TJBA 2ZNMA 1TK5B 3KH7A 5CREA 2GSTA 4I2TA 1ERVA 3HJPA 1QXHA 2CVDA 3LORA 3WGXA 4RQXA 1XVQA 1YJ6A 2WRTA 1AQXA 5A34B 5KN1A 4FYCA 2DKIA 2VCWA 3RHBA 1TRSA 2MMOA 3K8NA 5DVBA 2HXKA 3QOUA 2IIYA 2I4AA 3I9V2 2LKUA 2EIOA 5CYYA 1XW6A 2IMKA 2DJJA 3R3EA 1SKSB 1V98A 4KF9A 5FWGA 1K0CA 3DWVA 3ZREA 4XS4B 1O7UA 2H1BA 5IMFA 1URMA 3QDNA 1GSSA 4MPFA 4F0BA 3KZQA 1MEKA 1R7HA 2H6ZA 3QFAC 1EWXA 1DBYA 3IAM2 2YJHA 4KA0A 3TJFA 3GSSA 4Q5QA 2GZZA 5KN3A 1HNBA 3CSIA 1HYUA 3C73A 2HI7A 3TJKA 4JR6A 2MMAA 4BL7A 2I1UA 2R0GA 2LJKA 4MK3A 4TVEA 4E8EA 4BPYA 3J7Yb 1KNGA 4PNGA 3W8SA 1X5EA 3P2AA 2JACA 5DDLA 4DVCA 3F0IA 2VCXA 1ABAA 4K2XA 2MMNA 2UZ8A 3SWLA 4G10A 3WYWA 1F3AA 5LD0A 3DYRA 4WR5A 4TR3A 2RLIA 3CTGA 5AIXA 4EO3A 2JZSA 4HDEA 3W6GA 3CSHA 4F2IA 4V2MA 1B48A 1SENA 1X0RA 1JZRA 1PX7A 4WKWA 3ZFBA 2VM1A 3BCKA 3DKSA 2O7KA 2H19A 1NHYA 3AY8A 4NMUA 4AF2A 4ZL9A 5J9CA 2VIMA 4GSNA 2V6OA 4AI6A 1XBSA 1GRXA 4NXIA 1M9BA 5B8AA 3WD6A 2FA8A 2I9HA 1I5GA 3G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDY A;  1MTC A;  2WDU A;  3DXB A;  3TCO A;  1FB6 A;  1OAZ A;  4I5Q A;  4D73 B;  3P7X A;  1EOG A;  3HVX A;  4IBP A;  2G0F A;  4HU7 A;  1GUL A;  1T00 A;  2IN3 A;  4F0C A;  3RPP A;  3CXG A;  1W89 A;  4X1U A;  4OWY A;  1TXX A;  3Q18 A;  1Y6E A;  3UVT A;  3DVX A;  1O81 A;  4BWS A;  4KSO A;  2P0G A;  4IQA A;  4F9Z A;  2IPA A;  1ERW A;  2PWJ A;  4K6X A;  1AIU A;  3H4K A;  3UAR A;  1V57 A;  3GRX A;  1B4Q A;  3QAW A;  1V9W A;  3GKX A;  5E59 A;  2CVB A;  5J9B A;  20GS A;  3VI7 A;  1NM3 A;  3DIE A;  3KH9 A;  1YKC A;  1GP1 A;  1Z9H A;  3ISO A;  14GS A;  2DJ3 A;  3C7M A;  1TDI A;  1YF1 A;  3PIN A;  3D0Z A;  3RDW A;  5GSS A;  3PH9 A;  4HJ2 A;  1J08 A;  1GLQ A;  1ACV A;  1GTI A;  3D22 A;  5IO0 A;  1A8L A;  2WZ9 A;  2H6X A;  17GS A;  1FVJ A;  3C1S A;  1QQ2 A;  5DAK A;  4BVY B;  3F4R A;  1Y25 A;  2IFQ B;  3APQ A;  5ID2 B;  2VM2 A;  2HYX A;  2LQQ A;  1EGR A;  1F37 A;  5ECP B;  3H93 A;  3MWH A;  1X5D A;  2OKA A;  1JLW A;  1T4Y A;  2DIY A;  3E0U A;  1S3D A;  3IBH A;  3EWL A;  1Z6N A;  4GXZ A;  2LRN A;  2J9H A;  3F3R A;  3KIJ A;  3FR3 A;  4X0X A;  4I6X A;  4PXO A;  1AW9 A;  3QPM A;  5B6M A;  2CX4 A;  2C0F A;  1A0F A;  1OC9 B;  2A2R A;  4KSM A;  1GTU A;  4MAB A;  2E0Q A;  4ECC A;  4YQM A;  1SD8 A;  4IW9 A;  4FIW A;  2NDO A;  1OKD A;  5G30 A;  5D9X A;  2H1D A;  2K9F A;  3TDG A;  5G5E A;  3L78 A;  4GWR A;  4NWY A;  1AC1 A;  5DAL B;  1FO5 A;  3TKS C;  2DSA A;  3N5O A;  3UIW A;  2QKE A;  5ECN B;  3LYP A;  2GSQ A;  4QL7 A;  3IR4 A;  4HS1 A;  2GZP A;  3ZL5 A;  2VCV A;  3F63 A;  3CSJ A;  1ZYE A;  2YWM A;  4YAV A;  4ACS A;  3KP8 A;  3CBU A;  2H75 A;  1GSF A;  5CRG A;  3IXR A;  3GMF A;  2B5E A;  4ZBB A;  3IK7 A;  2JU5 A;  1JHB A;  9GSS A;  4MP4 A;  1SJI A;  1QMV A;  2F9S A;  1MD3 A;  2FWG A;  4F03 A;  4XRA A;  3N9J A;  4V2N A;  1VRS D;  2YWO A;  1SL2 B;  3ZLP A;  4NV5 A;  4GRF A;  3GTU B;  2V1M A;  3ME8 A;  3U6V A;  3GL3 A;  4JRR A;  4ECB A;  2E7P A;  5D9W A;  1OC8 A;  1Z6M A;  2CZ3 A;  4TXO B;  4XS4 A;  1M2D A;  1SKW B;  5A4W A;  1OC3 A;  2F8F A;  5COH A;  3RHC A;  4L5L A;  3F4S A;  2PGT A;  2FD3 A;  2YAN A;  1A2L A;  4KDU A;  4BVX A;  3L9U A;  4K7N A;  4QQ7 A;  4BA7 A;  2LRC A;  2XBQ A;  1O6J A;  3IRA A;  4G0K A;  1FAA A;  2YN1 A;  1GL8 A;  4G9H A;  2HRN A;  5JWQ B;  3LFL A;  1K0M A;  3TKS E;  3TJJ A;  5D96 A;  1BG5 A;  1WWJ A;  5ECO B;  2H6Y A;  3IDV A;  4EUY A;  2PU9 C;  2LS5 A;  1XOB A;  3GHA A;  2GS3 A;  1YKA A;  2X8C A;  2EC4 A;  2VL9 A;  3TOT A;  3I43 A;  1CQH A;  1AAZ A;  1RK4 A;  4FH8 A;  2ALB A;  4LL4 B;  4ID0 A;  1PRX A;  1T7P B;  2F51 A;  1PKZ A;  4KCA A;  3GYK A;  5GAN D;  3QCP A;  4BWQ A;  3HY2 A;  4IQ1 A;  2N5B A;  1HNC A;  4USS A;  3D4M A;  1GWC A;  2OA7 A;  5AIS A;  5DQS A;  1EGO A;  4JED A;  4EVM A;  3US3 A;  1A0R P;  3Q6O A;  1Z3E A;  2VLU A;  2X64 A;  1X9W B;  5CRW A;  2R6K A;  2JSZ A;  1USB A;  5GAP D;  2GDR A;  2P5Q A;  3APS A;  2V32 A;  4FYU A;  4IJI A;  1SL0 B;  5D9T A;  3GFK A;  4K0N A;  3ZVJ D;  1SYX A;  1Z7R A;  2FA4 A;  1B8X A;  2PMT A;  4OFN A;  5A4V A;  2YZU A;  2C3N A;  2YCD A;  4D73 A;  1SKR B;  2LUS A;  5BMU A;  1G6Y A;  13GS A;  3VWW A;  3L9S A;  2J23 A;  3G7J A;  2HSY A;  5C04 A;  4MJB A;  3GN3 A;  1SJZ A;  6GSX A;  3RPN A;  4MF5 A;  5EVO A;  1S3C A;  1AUC A;  1T1V A;  2RII A;  6GSU A;  1EP8 A;  2B3S A;  2I3Y A;  3M3M A;  2NBS A;  2CT6 A;  4JBB A;  5IO2 A;  3KMN A;  2AYT A;  5EPF A;  4TN8 A;  5CRD A;  3A2V A;  1TU7 A;  1WE0 A;  5JWO B;  1TJD A;  1TU8 A;  1FHE A;  2M72 A;  3VWX A;  4MDC A;  4DSS B;  1E2Y A;  2CX3 A;  4ULX A;  2LNT A;  2CAQ A;  2M80 A;  5KEJ A;  4EKZ A;  2N5A A;  2LNS A;  1JLV A;  4KND A;  4MF6 A;  1CQG A;  5H5Q A;  3F3Q A;  5CP1 A;  5ELG A;  2AV4 A;  2KUC A;  4BVY A;  3IOS A;  4YH2 A;  1XIY A;  3ZFL A;  4XTS A;  3MSZ A;  3RBT A;  4MCU A;  1F2E A;  3M8N A;  2H30 A;  1KEB A;  2IME A;  1TOF A;  5DCH A;  4G0I A;  4K8M A;  5FT3 A;  1N2A A;  3F9U A;  1KTE A;  2H0H A;  2OE0 A;  2B1L A;  5DJL A;  1OE7 A;  2CAI A;  2QGV A;  1AQV A;  2GGT A;  3A2X A;  4MJC A;  4WF4 A;  1XWC A;  2HSM A;  1U3A A;  1M7T A;  1ZCP A;  1ILO A;  2PUK C;  5A4U A;  3S9F A;  2GQM A;  3M1G A;  5DAL A;  1G7E A;  2C4J A;  1M0U A;  4RUV A;  2P31 A;  4AJ7 A;  4DEJ A;  4GQC A;  4ECJ A;  3UBK A;  2O89 A;  2WGR A;  5HR2 A;  2C0E A;  4NV2 A;  1GNE A;  5HR3 A;  1FOV A;  1YEP A;  3TKS A;  1H75 A;  2OAC A;  3UJ1 A;  3A3T A;  3IV4 A;  2H0I A;  1O8W A;  3Q74 A;  2VL2 C;  6GSV A;  2L4C A;  3P90 A;  5IMD A;  5IOW A;  1XOA A;  4NAX A;  4ML1 A;  3QFB C;  1TRU A;  4FO5 A;  4OD7 A;  3IE3 A;  1GUH A;  3O3T A;  3TRP A;  2X8H A;  2HRK A;  1NW2 A;  4YAP A;  1NHO A;  4ML6 A;  1WPI A;  4TXV A;  1VF1 A;  5A5K A;  4I8B A;  19GS A;  2VAF A;  3ERG A;  1AQW A;  6GSS A;  3P8W A;  2VD0 A;  1ZYQ B;  2YOI A;  1BYE A;  2FGX A;  5AN1 A;  2D2Z A;  2CVK A;  2FLS A;  4KW6 A;  4IKH A;  1XFL A;  4KX4 A;  2XHF A;  1WOU A;  1PL1 A;  2A2S A;  1J0F A;  3UMA A;  2GTU A;  3LG6 A;  1T3B A;  2BMX A;  4TXO A;  3HZ4 A;  2HQT A;  7GSS A;  4PUF C;  2IMD A;  4O5R A;  1GNW A;  3APO A;  1K0A A;  4Q5R A;  2QSI A;  3TUE A;  5ECM B;  2HNL A;  3GKK A;  2R4V A;  4PGT A;  4GCI A;  2R37 A;  2PN8 A;  1EEM A;  5G2Z A;  3GA4 A;  3KCM A;  4PQI A;  2O87 A;  4JZQ A;  3D6I A;  4LMW A;  3E3E A;  3ZIV A;  2K18 A;  4LMV A;  1C72 A;  4OCE A;  2EIQ A;  4ISD A;  3GL5 A;  1OVN A;  3LWA A;  5HFI A;  1SYR A;  1Z7P A;  2GSR A;  4IVF A;  3FY7 A;  1XCC A;  4KB3 A;  4YQV A;  4EF0 A;  3GX0 A;  2TRX A;  3GUS A;  4HQS A;  1GLP A;  4XS1 A;  3BOA A;  2H74 A;  1KBN A;  1K3Y A;  3JCM L;  3UOM A;  4ZXG A;  1T4Z A;  1WRY A;  4KGI A;  2GVP A;  5JCW A;  4V1A g;  5IMA A;  2B6M A;  1RQM A;  5B8B A;  1GH2 A;  1BX9 A;  1YZX A;  1XPV A;  4KAE A;  3FZ5 A;  1Q4J A;  2VUP A;  4O7H A;  4HZ2 A;  1LU4 A;  4GSS A;  2LV3 A;  3FK8 A;  2R2J A;  5ECI B;  3W8J A;  2HLS A;  2MYG A;  4MZW A;  4HOJ A;  1K3L A;  5D93 A;  2AAW A;  3UVH A;  2V41 A;  1QFN A;  2LEG A;  3HVV A;  2IL3 A;  3PR8 A;  3ZTL A;  2MBS A;  5F07 A;  2A4V A;  1GSY A;  3IHQ A;  1FVK A;  4TR1 A;  3IK9 A;  1A8Y A;  2KHP A;  4EXJ A;  2B1K A;  5ENU A;  2VOC A;  4NHZ A;  2YP6 A;  3FRC A;  2L5L A;  3IAS 2;  3TRQ A;  2H71 A;  2HSN B;  5J3R A;  3EMX A;  4G2E A;  3VK9 A;  1TK0 B;  10GS A;  3ED3 A;  2VD1 A;  1U87 A;  1Z5Y E;  3FKF A;  2NTO A;  18GS A;  4DSS A;  5F05 A;  1I9D A;  1PGT A;  2YNX A;  1YY7 A;  1OYJ A;  2HSH A;  3LJR A;  2DC5 A;  3FR6 A;  3DVW A;  2F3M A;  2RM6 A;  4KE3 A;  4KUN A;  4TRX A;  5ECK B;  4LLR A;  2V2G A;  3VFI A;  1YEX A;  1V58 A;  1R4W A;  3F6F A;  4MPG A;  1MDK A;  3NOF A;  2E2M A;  2FY6 A;  1JZO A;  1F9M A;  4E8H A;  3KXO A;  1XXU A;  2FUG 2;  4BL7 B;  2DJ0 A;  4EC0 A;  1QUW A;  3GUR A;  1RW1 A;  3ZZX A;  1THX A;  3KP9 A;  2EIR A;  4KDY A;  2B5Y A;  22GS A;  2WS2 A;  2H76 A;  1LJR A;  2L59 A;  2FWF A;  4WXT A;  1IYH A;  1XWA A;  1BAY A;  2IMI A;  4XHM A;  2ZUP A;  3BCI A;  4JE1 A;  2R3X A;  5JCU A;  3TKQ A;  4N30 A;  3HXS A;  3BD2 A;  6GSW A;  3LEF A;  5CRH A;  3EVI A;  1B9Y C;  5CAX A;  3DD3 A;  1G7O A;  3WGE A;  3R2Q A;  3DML A;  2H01 A;  1B4P A;  1EP7 A;  3C1R A;  3KJY A;  1XW9 A;  5D9V A;  2ZCT A;  5IMZ A;  1DSB A;  1M99 A;  3HA9 A;  2HZE B;  4KH7 A;  1OE8 A;  3LQ7 A;  2CV4 A;  2TRC P;  2YV7 A;  1TI3 A;  2KLX A;  2YZH A;  2DBC A;  2TIR A;  2VL2 A;  5B7C A;  2CQ9 A;  3M9K A;  1EV4 A;  2XPE A;  5INY A;  4GF0 A;  1X9M B;  1ZGN A;  1E6B A;  1ERU A;  5G5F A;  2C3T A;  1GSQ A;  1LBK A;  2OBI A;  4WBJ A;  4AGS A;  1TP9 A;  2C0G A;  5HFK A;  4OO5 A;  3KTB A;  3D4T A;  2GT6 A;  3I6A A;  2M46 A;  3TKR A;  3FHK A;  2HRA A;  4LL1 B;  4EE0 A;  1K0N A;  5H5R A;  5DQY A;  4CDO A;  5GZZ B;  4IP1 A;  1SL1 B;  2KP1 A;  2Z9S A;  1V2A A;  4N0V A;  4WET A;  3TRX A;  3LGC A;  4HEA 2;  3EIN A;  2AUV A;  4RQR A;  4TR0 A;  2L4Q A;  4XS6 A;  3TB2 A;  1PN9 A;  1QGV A;  4HQZ A;  4K0G A;  3CMI A;  2OE1 A;  5IPH A;  12GS A;  2JL4 A;  3F8U A;  2I81 A;  3J7Y k;  1YQ1 A;  16GS A;  5DJM A;  1K3O A;  4PTS A;  4TOP A;  3KTL A;  4PNF A;  4G0L A;  4XCS A;  4XIH A;  3NIV A;  2GQL A;  4TW5 A;  5CO3 A;  2LJR A;  2C3Q A;  4RI6 A;  2ON5 A;  1SK2 A;  2L6D A;  2PPT A;  1K0D A;  5G1L A;  1OKT A;  2C8U A;  3HZ8 A;  4MZC A;  2H1A A;  5JWR B;  4OCF A;  1SJ6 A;  2IFQ A;  5ID2 A;  1ZL9 A;  2VLV A;  2FHE A;  3GX8 A;  4OFT A;  2PVO C;  3HCZ A;  5C00 A;  4POL A;  3IC4 A;  3VPQ A;  5ABR A;  2P5R A;  2FWE A;  2HRF A;  4K1F A;  1U88 A;  2DLX A;  1PKW A;  4POK A;  1ERT A;  3IPZ A;  2C1Y A;  3ZMK A;  1EZK A;  2NPB A;  1OC9 A;  3QAV A;  2GT5 A;  3TOU A;  5HR0 A;  3GKM A;  3GH6 A;  3MNG A;  3G7Y A;  2DJK A;  1ON4 A;  1PL2 A;  3O6T A;  4IJ3 A;  4GTU A;  3TKP A;  3RAZ A;  3KEB A;  4V2L A;  3D5J A;  3HDC A;  3KGK A;  2B5X A;  1TKD B;  4YQU A;  2VCT A;  3FEU A;  4MJA A;  3GIX A;  2E2G A;  4TKY A;  1TTZ A;  3VPT A;  1PX6 A;  4ZB9 A;  2XC2 A;  4WR4 A;  4BVX B;  3FW2 A;  1UA5 A;  2RUF A;  4MLY A;  2BTO T;  5L71 A;  2LST A;  3LXZ A;  1VF2 A;  2L6C A;  2MMZ A;  2AHE A;  3F6D A;  3EYT A;  5ECQ B;  3HHV A;  3WGD A;  2KOK A;  3O76 A;  1PD2 1;  3KM6 A;  3Q19 A;  2X99 A;  3QD9 A;  1EOH A;  3VUR A;  5LCZ A;  4N11 A;  4H86 A;  1R26 A;  3MAK A;  1PQN A;  1WMJ A;  4IS0 A;  1F3B A;  3GTU A;  1GSU A;  1YF0 A;  3H79 A;  4J56 E;  3IC8 A;  3FZ4 A;  5ECR B;  1X5C A;  1H4O A;  2O85 A;  1TRV A;  3EUR A;  4MF7 A;  2WCI A;  2DJ2 A;  2H72 A;  4XRD A;  1ZOF A;  3EU4 A;  1O8X A;  1WIK A;  3EMP A;  4P3Y B;  1XWK A;  1ML6 A;  2H73 A;  11GS A;  1UN2 A;  1EEJ A;  1XVW A;  3ZIT A;  2AJQ B;  1DE2 A;  4N10 A;  4AJ6 A;  4MJE A;  4KCE A;  2HZE A;  2REM A;  5EL8 A;  1XWG A;  2GLR A;  3ERF A;  4NPB A;  1K0O A;  5J5N A;  4HI7 A;  3NZN A;  4PX1 A;  1DE1 A;  1QK8 A;  1J9B A;  2H66 A;  1GSD A;  2DMM A;  1W4V A;  3GST A;  2JSY A;  2LRT A;  4O32 A;  5IQY A;  1R5P A;  3TGZ A;  4JU5 A;  4Q5N A;  3UBL A;  2K8V A;  2HFD A;  1HD2 A;  1FB0 A;  3TJG A;  3M0F A;  1B9X C;  2HT9 A;  4X43 A;  2RM5 A;  3C8E A;  5F06 A;  4I2U A;  5H5S A;  2WUL A;  4NHW A;  3PGT A;  5AGY A;  3EC3 A;  2MBT A;  3GH9 A;  5IOX A;  4ZBD A;  4AJ8 A;  2FWH A;  1M2A A;  2OE3 A;  2VLT A;  4ZIJ A;  4ZB6 A;  4WBR D;  2H70 A;  2C80 A;  4RI7 A;  2GSS A;  1SK0 A;  2X8G A;  3A5W A;  2YPM A;  4MH3 A;  3HYP A;  3VI5 A;  3KD0 A;  5AIV A;  1A23 A;  4HUA A;  4TR4 A;  4GLT A;  1O73 A;  5KN2 A;  4JR4 A;  4HZ4 A;  3L0H A;  5IM9 A;  2H1G A;  5ELA A;  2B7K A;  2YWN A;  1PSQ A;  2O8V B;  2XBI A;  2PBJ A;  4PUR A;  5FHI A;  4ECI A;  4EL1 A;  3UL3 A;  3V1W A;  3QAG A;  1TI1 A;  1BQ7 A;  3QMX A;  1MDI A;  2YV9 A;  2OJL A;  3FYG A;  4G19 A;  1UC7 A;  5IMV A;  5D8I A;  6GST A;  2K6V A;  4F82 A;  2WJU A;  2GQK A;  5G1K A;  3GNJ A;  2IWT A;  2HSM B;  4K7I A;  2G2Q A;  3DRN A;  2VCQ A;  3WT2 A;  5F8B A;  1JFU A;  4J57 E;  3ME7 A;  4K2D A;  4GST A;  2XPD A;  3A2W A;  2FCH A;  1O85 A;  3L9V A;  1ZMA A;  2DJ1 A;  3WT1 A;  1WP0 A;  3HVS A;  4PQH A;  2H8L A;  4Q5F A;  1K0B A;  1A2J A;  4ZBA A;  3VLN A;  4FQU A;  5J41 A;  4IEL A;  2GZY A;  5G31 A;  4V1A p;  3UAP A;  1IYI A;  2PER A;  4FYB A;  4L0W A;  1Q98 A;  4L5O A;  3ERW A;  1JZD A;  1TW9 A;  1SU9 A;  3D21 A;  3EE2 A;  2OAD A;  2L5O A;  2VL3 A;  2HRK B;  5GST A;  4ZL7 A;  5IIZ A;  2N5F A;  3FR9 A;  3ZML A;  3DGQ A;  3L4N A;  1WJK A;  4ILF A;  2KP2 A;  3HD5 A;  5EY6 A;  2YJ7 A;  2FNO A;  2JAD A;  3M9J A;  3MDK A;  2F8A A;  1A24 A;  4K7O A;  5ECL B;  4N0Z A;  5ECH B;  1JZW A;  1F6M C;  1GUM A;  4ZL8 A;  5HFG A;  1PMT A;  4MH2 A;  4DSQ A;  2L57 A;  1THO A;  2CA8 A;  1MD4 A;  4GQF A;  2VO4 A;  1M2B A;  2LJA A;  1TRW A;  3U5R E;  5IMC A;  4QL9 A;  1GUK A;  4HU9 A;  3IA1 A;  1VF3 A;  2K8S A;  3QR6 A;  3HJO A;  5JCG A;  4IN0 A;  1XWB A;  5D73 A;  1A2M A;  2IMF A;  2OBK A;  3CRT A;  1ZZY A;  1R5A A;  5CNW A;  2PVQ A;  2ES7 A;  1G0T A;  2RUE A;  5HQP A;  1X9S B;  5HR1 A;  2JZT A;  2QC7 A;  3CYN A;  8GSS A;  4O92 A;  5IPG A;  5J4U A;  4LA1 A;  2IJY A;  1TK8 B;  2ON7 A;  2V6K A;  1PA3 A;  3SBC A;  3ZIJ A;  5ECS A;  2AB6 A;  1N8J A;  2JZR A;  4ZB8 A;  4OMV A;  2LQO A;  2DML A;  3C71 A;  4OFM A;  1FG4 A;  1VGL A;  5F0G A;  5KN0 A;  4I97 A;  4IP6 A;  4PQ1 A;  3VWU A;  4MMM A;  2NVL A;  1G6W A;  2LTK A;  3ZYW A;  1YDK A;  1XW5 A;  2HE3 A;  4OO4 A;  3LSZ A;  3HJM A;  4IGJ A;  1GTA A;  1GSE A;  3OR5 A;  3GV1 A;  2CZ2 A;  1S3A A;  3BJ5 A;  2C0D A;  4MZB A;  3G7I A;  4EDZ A;  5DAK B;  3GKN A;  4ZIL A;  4WF5 A;  2WFC A;  4DSR A;  4PUA A;  5E4W A;  1GTB A;  1DUG A;  1AXD A;  3FZ9 A;  3FZA A;  1SK1 A;  3DEX A;  4IHU A;  3UEM A;  4CW9 A;  4TR1 B;  2B7J A;  3CTF A;  3KMO A;  4K9Z A;  3LYK A;  3E9J B;  3EU3 A;  2BJX A;  1NSW A;  1M9A A;  1BED A;  3CRU A;  1T8E B;  3BBY A;  1ST9 A;  1V40 A;  2R5G A;  4HJM A;  4WEY A;  3PPU A;  3H1N A;  4POM A;  2HZF A;  1VF4 A;  3HKR A;  1U6T A;  4L8E A;  2VCZ A;  3H8Q A;  1XZO A;  1UVZ A;  4POB A;  5DCG A;  4CHS A;  3LXT A;  2DIZ A;  5LNK e;  4Z7X A;  3I69 A;  1EV9 A;  1HNA A;  4KDX A;  1BJX A;  1U3I A;  3F4T A;  3ZVJ A;  2WB9 A;  4J2F A;  3VWV A;  4L0U A;  5DBQ A;  2YWI A;  1MDJ A;  3ZRD A;  5B6N A;  1FW1 A;  1SD9 A;  6GSY A;  2MZC A;  4MA9 A;  2H0G A;  1HQO A;  3TJB A;  2ZNM A;  1TK5 B;  3KH7 A;  5CRE A;  4I2T A;  2GST A;  1ERV A;  3HJP A;  1QXH A;  2CVD A;  3LOR A;  3WGX A;  4RQX A;  1XVQ A;  1YJ6 A;  2WRT A;  1AQX A;  5KN1 A;  4FYC A;  2VCW A;  3RHB A;  1TRS A;  2MMO A;  3K8N A;  5DVB A;  2HXK A;  3QOU A;  2IIY A;  2I4A A;  3I9V 2;  2LKU A;  2EIO A;  5CYY A;  1XW6 A;  2IMK A;  2DJJ A;  3R3E A;  1SKS B;  1V98 A;  4KF9 A;  5FWG A;  1K0C A;  3DWV A;  3ZRE A;  4XS4 B;  1O7U A;  2H1B A;  5IMF A;  1URM A;  3QDN A;  1GSS A;  4MPF A;  4F0B A;  3KZQ A;  1MEK A;  1R7H A;  2H6Z A;  3QFA C;  1EWX A;  1DBY A;  3IAM 2;  2YJH A;  4KA0 A;  3TJF A;  3GSS A;  4Q5Q A;  2GZZ A;  5KN3 A;  1HNB A;  3CSI A;  1HYU A;  3C73 A;  2HI7 A;  3TJK A;  4JR6 A;  2MMA A;  4BL7 A;  2I1U A;  2LJK A;  4MK3 A;  4TVE A;  4E8E A;  4BPY A;  3J7Y b;  1KNG A;  4PNG A;  3W8S A;  1X5E A;  3P2A A;  2JAC A;  5DDL A;  4DVC A;  3F0I A;  2VCX A;  1ABA A;  2MMN A;  2UZ8 A;  3SWL A;  4G10 A;  3WYW A;  1F3A A;  5LD0 A;  3DYR A;  4WR5 A;  4TR3 A;  2RLI A;  3CTG A;  5AIX A;  4EO3 A;  2JZS A;  4HDE A;  3W6G A;  3CSH A;  4F2I A;  4V2M A;  1B48 A;  1SEN A;  1X0R A;  1JZR A;  1PX7 A;  4WKW A;  3ZFB A;  2VM1 A;  3BCK A;  3DKS A;  2O7K A;  2H19 A;  1NHY A;  3AY8 A;  4NMU A;  4AF2 A;  4ZL9 A;  5J9C A;  2VIM A;  4GSN A;  2V6O A;  1XBS A;  1GRX A;  4NXI A;  1M9B A;  5B8A A;  3WD6 A;  2FA8 A;  2I9H A;  1I5G A;  3G9B A; 
#chains in the Genus database with same CATH topology
 4EDY A;  1MTC A;  2WDU A;  3DXB A;  3TCO A;  1ZYN A;  1FB6 A;  2WW2 A;  1OAZ A;  4I5Q A;  4D73 B;  3P7X A;  1EOG A;  3HVX A;  4IBP A;  2G0F A;  2WW0 A;  4HU7 A;  1GUL A;  1T00 A;  2IN3 A;  4F0C A;  3RPP A;  3CXG A;  1W89 A;  5A1N B;  4X1U A;  4OWY A;  1TXX A;  3Q18 A;  1Y6E A;  3UVT A;  3DVX A;  1O81 A;  4BWS A;  4KSO A;  2P0G A;  4IQA A;  4F9Z A;  2IPA A;  1ERW A;  2PWJ A;  4K6X A;  1ZYP A;  1AIU A;  1BG1 A;  3H4K A;  3UAR A;  1V57 A;  3GRX A;  1B4Q A;  3QAW A;  1V9W A;  3GKX A;  5E59 A;  2CVB A;  5J9B A;  20GS A;  3VI7 A;  1NM3 A;  3DIE A;  1YKC A;  4AKX B;  1GP1 A;  3KH9 A;  5J47 A;  1Z9H A;  3ISO A;  14GS A;  2DJ3 A;  3C7M A;  1TDI A;  1YF1 A;  3PIN A;  3D0Z A;  3RDW A;  5GSS A;  3PH9 A;  4HJ2 A;  1J08 A;  1GLQ A;  1ACV A;  1GTI A;  3D22 A;  5IO0 A;  1A8L A;  2WZ9 A;  4GDF A;  2H6X A;  17GS A;  1FVJ A;  3C1S A;  1QQ2 A;  5DAK A;  4BVY B;  3F4R A;  1Y25 A;  2IFQ B;  3APQ A;  5ID2 B;  2VM2 A;  2HYX A;  2LQQ A;  1EGR A;  1F37 A;  5ECP B;  3H93 A;  3MWH A;  1X5D A;  2OKA A;  1JLW A;  1T4Y A;  2DIY A;  3E0U A;  1S3D A;  3IBH A;  3EWL A;  1Z6N A;  4GXZ A;  2LRN A;  2J9H A;  3F3R A;  3KIJ A;  3FR3 A;  4X0X A;  4I6X A;  4PXO A;  1AW9 A;  3QPM A;  5B6M A;  2CX4 A;  2C0F A;  1A0F A;  1OC9 B;  2A2R A;  4KSM A;  1GTU A;  4MAB A;  2E0Q A;  4ECC A;  4YQM A;  1SD8 A;  4IW9 A;  4FIW A;  2NDO A;  1OKD A;  5G30 A;  5D9X A;  2H1D A;  2K9F A;  3TDG A;  1I1I P;  2EFC A;  5G5E A;  3L78 A;  2X4A A;  4GWR A;  4NWY A;  1AC1 A;  5DAL B;  1FO5 A;  3TKS C;  2DSA A;  3N5O A;  3UIW A;  2QKE A;  5ECN B;  3LYP A;  2GSQ A;  4X4J A;  4QL7 A;  3IR4 A;  4HS1 A;  2GZP A;  3ZL5 A;  2VCV A;  4AKH A;  3F63 A;  3CSJ A;  1ZYE A;  2VKZ G;  2YWM A;  4YAV A;  4ACS A;  4Z2T A;  3KP8 A;  3CBU A;  2H75 A;  1GSF A;  5CRG A;  3IXR A;  3GMF A;  2B5E A;  4ZBB A;  3IK7 A;  2JU5 A;  1JHB A;  9GSS A;  4MP4 A;  1SJI A;  1QMV A;  2F9S A;  4PHZ C;  1MD3 A;  2FWG A;  4F03 A;  4XRA A;  3N9J A;  4V2N A;  1VRS D;  2YWO A;  1SL2 B;  3ZLP A;  4NV5 A;  4GRF A;  3GTU B;  2R0C A;  2V1M A;  3ME8 A;  3U6V A;  5A5H B;  3GL3 A;  4JRR A;  4ECB A;  2E7P A;  5D9W A;  1OC8 A;  1Z6M A;  2CZ3 A;  4TXO B;  4XS4 A;  1M2D A;  1SKW B;  5A4W A;  1OC3 A;  2F8F A;  5COH A;  3EPT A;  3RHC A;  4L5L A;  3F4S A;  2PGT A;  2FD3 A;  2YAN A;  1A2L A;  4KDU A;  4BVX A;  3L9U A;  4K7N A;  4QQ7 A;  4BA7 A;  2LRC A;  2XBQ A;  1O6J A;  3IRA A;  4G0K A;  1FAA A;  2YN1 A;  1GL8 A;  3LW9 A;  4G9H A;  2HRN A;  5JWQ B;  3LFL A;  1K0M A;  3TKS E;  3CWG A;  3TJJ A;  5D96 A;  1BG5 A;  1WWJ A;  5ECO B;  2H6Y A;  3IDV A;  3HMJ G;  4EUY A;  2PU9 C;  2LS5 A;  1XOB A;  3GHA A;  2GS3 A;  1YKA A;  2X8C A;  2EC4 A;  2VL9 A;  3TOT A;  2A4H A;  3I43 A;  1CQH A;  1AAZ A;  1RK4 A;  4FH8 A;  2ALB A;  4LL4 B;  4ID0 A;  1PRX A;  1T7P B;  2F51 A;  1PKZ A;  4KCA A;  3GYK A;  5GAN D;  3QCP A;  4BWQ A;  3HY2 A;  4IQ1 A;  2N5B A;  1HNC A;  4USS A;  3D4M A;  4PI0 C;  1GWC A;  2OA7 A;  5AIS A;  5DQS A;  1EGO A;  4JED A;  4EVM A;  3US3 A;  1A0R P;  3Q6O A;  4HSC X;  1Z3E A;  2VLU A;  2X64 A;  1X9W B;  5CRW A;  2R6K A;  2R0P A;  2JSZ A;  1USB A;  5GAP D;  2GDR A;  2P5Q A;  3APS A;  2V32 A;  4FYU A;  4IJI A;  1S4B P;  1SL0 B;  5D9T A;  3GFK A;  4K0N A;  3ZVJ D;  1SYX A;  1Z7R A;  2FA4 A;  1B8X A;  2PMT A;  4OFN A;  5A4V A;  2YZU A;  2C3N A;  2YCD A;  4K5R A;  4D73 A;  1SKR B;  2LUS A;  5BMU A;  1G6Y A;  13GS A;  3VWW A;  4E68 A;  3L9S A;  2J23 A;  3G7J A;  2HSY A;  1SVM A;  5A1N A;  5C04 A;  4MJB A;  3GN3 A;  1SJZ A;  6GSX A;  3RPN A;  2WVY A;  4MF5 A;  5EVO A;  1S3C A;  1AUC A;  1T1V A;  2RII A;  6GSU A;  1EP8 A;  2B3S A;  2I3Y A;  3M3M A;  2NBS A;  2CT6 A;  4JBB A;  5IO2 A;  3KMN A;  2AYT A;  5EPF A;  4TN8 A;  5CRD A;  3A2V A;  1TU7 A;  1WE0 A;  5JWO B;  1TJD A;  1TU8 A;  1FHE A;  2M72 A;  3VWX A;  4MDC A;  4DSS B;  1E2Y A;  2CX3 A;  4ULX A;  2LNT A;  2O36 A;  2CAQ A;  2M80 A;  5KEJ A;  4EKZ A;  2N5A A;  2LNS A;  1JLV A;  4KND A;  4MF6 A;  1CQG A;  4O5U A;  5H5Q A;  3F3Q A;  5CP1 A;  1XG8 A;  5ELG A;  2AV4 A;  2KUC A;  4BVY A;  3IOS A;  4YH2 A;  1XIY A;  3ZFL A;  4XTS A;  3MSZ A;  3RBT A;  4MCU A;  1F2E A;  3M8N A;  2H30 A;  1KEB A;  2IME A;  1TOF A;  5DCH A;  4N3Z A;  4G0I A;  4K8M A;  5FT3 A;  1N2A A;  3F9U A;  1KTE A;  2H0H A;  2OE0 A;  2B1L A;  5DJL A;  1OE7 A;  2CAI A;  2QGV A;  1AQV A;  4A5P A;  2GGT A;  3A2X A;  4MJC A;  4Z2U A;  4WF4 A;  1XWC A;  2HSM A;  1U3A A;  1M7T A;  1ZCP A;  1ILO A;  2PUK C;  5A4U A;  3S9F A;  2GQM A;  3M1G A;  5DAL A;  1G7E A;  2C4J A;  1M0U A;  4RUV A;  2P31 A;  4AJ7 A;  3MIX A;  4DEJ A;  4GQC A;  4ECJ A;  3UBK A;  2O89 A;  2WGR A;  5HR2 A;  2C0E A;  4NV2 A;  1GNE A;  5HR3 A;  1FOV A;  1YEP A;  3TKS A;  1H75 A;  4AKG A;  2OAC A;  3UJ1 A;  3A3T A;  3IV4 A;  2H0I A;  1O8W A;  3Q74 A;  2VL2 C;  6GSV A;  2L4C A;  3P90 A;  5IMD A;  5IOW A;  1XOA A;  4NAX A;  4ML1 A;  3QFB C;  1TRU A;  4FO5 A;  4OD7 A;  3IE3 A;  1GUH A;  3O3T A;  3TRP A;  2X8H A;  2HRK A;  1NW2 A;  4YAP A;  1NHO A;  4ML6 A;  1M3J A;  1WPI A;  4TXV A;  1VF1 A;  5A5K A;  4I8B A;  19GS A;  2VAF A;  3ERG A;  1AQW A;  6GSS A;  3P8W A;  2VD0 A;  1PN0 A;  1ZYQ B;  2YOI A;  1BYE A;  2WVX B;  2FGX A;  5AN1 A;  2D2Z A;  2CVK A;  2FLS A;  4KW6 A;  4IKH A;  1XFL A;  2WW1 A;  4KX4 A;  2XHF A;  1WOU A;  1PL1 A;  1YEW C;  2A2S A;  1J0F A;  2EFE A;  3UMA A;  2GTU A;  3LG6 A;  1T3B A;  2BMX A;  4TXO A;  3HZ4 A;  2HQT A;  7GSS A;  4PUF C;  2IMD A;  4O5R A;  1GNW A;  3APO A;  1K0A A;  4Q5R A;  2QSI A;  3TUE A;  5ECM B;  2HNL A;  3GKK A;  1BF5 A;  2R4V A;  4PGT A;  4GCI A;  2R37 A;  2PN8 A;  1EEM A;  5G2Z A;  3GA4 A;  3KCM A;  4PQI A;  2O87 A;  4JZQ A;  3D6I A;  4LMW A;  3E3E A;  3ZIV A;  2K18 A;  4LMV A;  1C72 A;  4OCE A;  4YKG A;  3HVN A;  2EIQ A;  4ISD A;  3GL5 A;  1OVN A;  3LWA A;  5HFI A;  3CQF A;  1SYR A;  1Z7P A;  3A5I A;  2GSR A;  4IVF A;  3FY7 A;  1XCC A;  4KB3 A;  4YQV A;  4EF0 A;  3GX0 A;  2TRX A;  3GUS A;  4HQS A;  1GLP A;  4XS1 A;  3BOA A;  2H74 A;  1KBN A;  1K3Y A;  3JCM L;  3UOM A;  4ZXG A;  1T4Z A;  1WRY A;  4KGI A;  2GVP A;  5JCW A;  4V1A g;  5IMA A;  2B6M A;  1RQM A;  5B8B A;  1GH2 A;  1BX9 A;  1YZX A;  1XPV A;  4AKI A;  4KAE A;  3FZ5 A;  1Q4J A;  2VUP A;  4O7H A;  4HZ2 A;  1LU4 A;  4GSS A;  2LV3 A;  3FK8 A;  2R2J A;  5ECI B;  3W8J A;  2HLS A;  2MYG A;  4MZW A;  4HOJ A;  1K3L A;  5BRT A;  5D93 A;  2AAW A;  2UV8 G;  3UVH A;  2V41 A;  1QFN A;  2LEG A;  3HVV A;  2IL3 A;  3PR8 A;  3ZTL A;  2MBS A;  4FXY P;  5F07 A;  2A4V A;  4K5S A;  1GSY A;  3IHQ A;  1FVK A;  4TR1 A;  3IK9 A;  1A8Y A;  2KHP A;  4EXJ A;  2B1K A;  5ENU A;  2VOC A;  4NHZ A;  2YP6 A;  3FRC A;  2L5L A;  3IAS 2;  3TRQ A;  2H71 A;  4CY6 A;  2HSN B;  5J3R A;  3EMX A;  4G2E A;  3VK9 A;  1TK0 B;  10GS A;  3ED3 A;  2VD1 A;  1U87 A;  1Z5Y E;  3FKF A;  2NTO A;  18GS A;  4DSS A;  5F05 A;  1I9D A;  1PGT A;  2YNX A;  1YY7 A;  1OYJ A;  2HSH A;  3LJR A;  2DC5 A;  3FR6 A;  3DVW A;  2F3M A;  2RM6 A;  4KE3 A;  4KUN A;  4TRX A;  5ECK B;  4LLR A;  2V2G A;  3VFI A;  1YEX A;  1V58 A;  1R4W A;  4EIQ A;  3F6F A;  1PFO A;  4MPG A;  1MDK A;  5A34 A;  3NOF A;  2E2M A;  2QA2 A;  2FY6 A;  1JZO A;  1F9M A;  4E8H A;  3KXO A;  1XXU A;  2FUG 2;  4BL7 B;  2DJ0 A;  4EC0 A;  1QUW A;  3GUR A;  1RW1 A;  3ZZX A;  1THX A;  3KP9 A;  2EIR A;  4KDY A;  2B5Y A;  22GS A;  2WS2 A;  5J40 A;  2H76 A;  1LJR A;  2L59 A;  2FWF A;  3RGB C;  4WXT A;  1IYH A;  4EIP A;  1XWA A;  1BAY A;  2IMI A;  4XHM A;  2ZUP A;  3BCI A;  4JE1 A;  2R3X A;  5JCU A;  3TKQ A;  4N30 A;  3HXS A;  3BD2 A;  6GSW A;  3LEF A;  5CRH A;  3EVI A;  1B9Y C;  5CAX A;  3DD3 A;  1G7O A;  3WGE A;  3R2Q A;  3DML A;  2H01 A;  1B4P A;  1EP7 A;  3C1R A;  3KJY A;  1XW9 A;  5D9V A;  2ZCT A;  5IMZ A;  1DSB A;  1M99 A;  3HA9 A;  2HZE B;  4KH7 A;  1OE8 A;  5J4V A;  4ZB7 A;  3LQ7 A;  4BIK A;  2CV4 A;  2TRC P;  2YV7 A;  1TI3 A;  2KLX A;  2YZH A;  2DBC A;  2TIR A;  2VL2 A;  5B7C A;  2CQ9 A;  3M9K A;  1EV4 A;  2XPE A;  5INY A;  4GF0 A;  1X9M B;  1ZGN A;  1E6B A;  1ERU A;  5G5F A;  2C3T A;  1GSQ A;  4ICY A;  1LBK A;  2OBI A;  4WBJ A;  4AGS A;  1TP9 A;  2C0G A;  5HFK A;  4OO5 A;  3KTB A;  3D4T A;  2GT6 A;  3I6A A;  3MYD A;  2M46 A;  3TKR A;  3FHK A;  2HRA A;  4LL1 B;  4EE0 A;  1K0N A;  5H5R A;  5DQY A;  4CDO A;  5GZZ B;  4IP1 A;  1SL1 B;  2KP1 A;  2Z9S A;  1V2A A;  4N0V A;  1TXU A;  4WET A;  5KOW A;  3TRX A;  3LGC A;  4HEA 2;  3EIN A;  2AUV A;  4RQR A;  4TR0 A;  2L4Q A;  4XS6 A;  3TB2 A;  1PN9 A;  1QGV A;  4HQZ A;  4K0G A;  3CMI A;  2OE1 A;  5IPH A;  12GS A;  1FOH A;  2JL4 A;  3F8U A;  2I81 A;  3J7Y k;  1YQ1 A;  16GS A;  5DJM A;  1K3O A;  4PTS A;  4TOP A;  3KTL A;  4PNF A;  4G0L A;  4XCS A;  4XIH A;  3NIV A;  2GQL A;  4TW5 A;  5CO3 A;  2LJR A;  2C3Q A;  4RI6 A;  2ON5 A;  1SK2 A;  2L6D A;  2PPT A;  1K0D A;  5G1L A;  1OKT A;  3TU3 B;  2C8U A;  3HZ8 A;  4MZC A;  2H1A A;  5JWR B;  4OCF A;  1SJ6 A;  2IFQ A;  5ID2 A;  1ZL9 A;  2VLV A;  2FHE A;  3GX8 A;  4OFT A;  2PVO C;  3HCZ A;  5C00 A;  4POL A;  3IC4 A;  3VPQ A;  5ABR A;  2P5R A;  2FWE A;  2WW3 A;  2HRF A;  4K1F A;  1U88 A;  2DLX A;  1PKW A;  4POK A;  1ERT A;  3IPZ A;  2C1Y A;  3ZMK A;  1EZK A;  2HSN A;  2NPB A;  1OC9 A;  3QAV A;  2GT5 A;  5J4Y A;  3TOU A;  5HR0 A;  3GKM A;  3GH6 A;  3MNG A;  3G7Y A;  2DJK A;  1ON4 A;  1PL2 A;  3O6T A;  4IJ3 A;  4GTU A;  3TKP A;  3RAZ A;  3KEB A;  4V2L A;  3D5J A;  3HDC A;  3KGK A;  2B5X A;  1TKD B;  1N25 A;  4YQU A;  2VCT A;  3FEU A;  4MJA A;  3GIX A;  2E2G A;  4TKY A;  1TTZ A;  3VPT A;  1PX6 A;  4ZB9 A;  2XC2 A;  4WR4 A;  4BVX B;  3FW2 A;  1UA5 A;  2RUF A;  4MLY A;  2BTO T;  5L71 A;  2LST A;  3LXZ A;  1VF2 A;  2L6C A;  4QMK A;  2MMZ A;  2AHE A;  3F6D A;  3EYT A;  5ECQ B;  3HHV A;  3WGD A;  2KOK A;  2QA1 A;  3O76 A;  1PD2 1;  3KM6 A;  3Q19 A;  2X99 A;  3QD9 A;  1EOH A;  3VUR A;  5LCZ A;  4N11 A;  4H86 A;  2O5V A;  1R26 A;  3MAK A;  1PQN A;  1WMJ A;  4IS0 A;  1F3B A;  3GTU A;  5A5H A;  1GSU A;  1YF0 A;  3H79 A;  4J56 E;  3IC8 A;  3FZ4 A;  1Y1U A;  5ECR B;  1X5C A;  1H4O A;  2O85 A;  1TRV A;  3EUR A;  4MF7 A;  2WCI A;  2DJ2 A;  2H72 A;  4XRD A;  1ZOF A;  3EU4 A;  1O8X A;  1WIK A;  3EMP A;  4P3Y B;  1XWK A;  1ML6 A;  1SVL A;  2H73 A;  11GS A;  1UN2 A;  1EEJ A;  1XVW A;  3ZIT A;  2AJQ B;  1DE2 A;  4N10 A;  4AJ6 A;  4MJE A;  4KCE A;  2HZE A;  4G01 A;  2DKH A;  2REM A;  5EL8 A;  1XWG A;  2GLR A;  3ERF A;  4NPB A;  1K0O A;  5J5N A;  4W66 A;  4HI7 A;  3NZN A;  4PX1 A;  2X49 A;  1DE1 A;  5BMU B;  1QK8 A;  1J9B A;  2H66 A;  1GSD A;  2DMM A;  1W4V A;  3GST A;  2JSY A;  2LRT A;  4O32 A;  5IQY A;  1R5P A;  3TGZ A;  4JU5 A;  4Q5N A;  3UBL A;  2EFD A;  2K8V A;  2HFD A;  4PI2 C;  1HD2 A;  1FB0 A;  3TJG A;  3M0F A;  1B9X C;  2HT9 A;  4X43 A;  2RM5 A;  3C8E A;  5F06 A;  4I2U A;  5H5S A;  2WUL A;  4NHW A;  3PGT A;  5AGY A;  3EC3 A;  2MBT A;  3GH9 A;  2A2P A;  5IOX A;  4ZBD A;  4AJ8 A;  2FWH A;  1M2A A;  2OE3 A;  2VLT A;  4ZIJ A;  4ZB6 A;  4WBR D;  2H70 A;  2C80 A;  4RI7 A;  2GSS A;  1SK0 A;  2X8G A;  3A5W A;  2YPM A;  4MH3 A;  3HYP A;  3VI5 A;  3KD0 A;  5AIV A;  1A23 A;  4HUA A;  4TR4 A;  4GLT A;  1O73 A;  5KN2 A;  4JR4 A;  4HZ4 A;  3L0H A;  5IM9 A;  2H1G A;  5ELA A;  2B7K A;  2YWN A;  1PSQ A;  2O8V B;  2XBI A;  2PBJ A;  4PUR A;  5FHI A;  4ECI A;  4YKF A;  1SVO A;  4EL1 A;  3UL3 A;  3V1W A;  3QAG A;  1TI1 A;  1BQ7 A;  3QMX A;  1MDI A;  2YV9 A;  4MNN A;  2OJL A;  3FYG A;  4G19 A;  1UC7 A;  5IMV A;  5D8I A;  6GST A;  2K6V A;  4F82 A;  2WJU A;  2GQK A;  5G1K A;  3GNJ A;  2H1L A;  2IWT A;  2HSM B;  4K7I A;  2G2Q A;  3DRN A;  2VCQ A;  4O5Q A;  3WT2 A;  5F8B A;  1JFU A;  4J57 E;  3ME7 A;  4K2D A;  4GST A;  2XPD A;  3A2W A;  2FCH A;  1O85 A;  3L9V A;  1ZMA A;  2DJ1 A;  3WT1 A;  1WP0 A;  3HVS A;  4PQH A;  2H8L A;  4Q5F A;  1K0B A;  1A2J A;  4ZBA A;  3VLN A;  4FQU A;  5J41 A;  4IEL A;  2GZY A;  5G31 A;  4V1A p;  3UAP A;  1IYI A;  2PER A;  4FYB A;  4L0W A;  1Q98 A;  4L5O A;  3ERW A;  1JZD A;  1TW9 A;  1SU9 A;  3D21 A;  3EE2 A;  2OAD A;  2L5O A;  2VL3 A;  2HRK B;  5GST A;  4ZL7 A;  5IIZ A;  2N5F A;  3FR9 A;  3ZML A;  3DGQ A;  3L4N A;  1WJK A;  4ILF A;  2KP2 A;  3HD5 A;  5EY6 A;  2YJ7 A;  2FNO A;  2JAD A;  3M9J A;  3MDK A;  2F8A A;  1A24 A;  1S3R A;  4K7O A;  5ECL B;  4N0Z A;  5ECH B;  1JZW A;  1F6M C;  1GUM A;  4ZL8 A;  5HFG A;  1PMT A;  4MH2 A;  4DSQ A;  2L57 A;  1THO A;  2CA8 A;  1MD4 A;  4GQF A;  2VO4 A;  1M2B A;  2LJA A;  1TRW A;  3U5R E;  5IMC A;  4QL9 A;  1GUK A;  4HU9 A;  3IA1 A;  1VF3 A;  2K8S A;  3QR6 A;  3HJO A;  5JCG A;  4IN0 A;  1XWB A;  5D73 A;  1A2M A;  2IMF A;  2OBK A;  2OT3 A;  3CRT A;  1ZZY A;  1R5A A;  5CNW A;  2PVQ A;  2ES7 A;  1G0T A;  2RUE A;  5HQP A;  1X9S B;  5HR1 A;  2JZT A;  3IHG A;  2QC7 A;  3CYN A;  8GSS A;  4O92 A;  5IPG A;  5J4U A;  5KOX A;  4LA1 A;  2IJY A;  1TK8 B;  2ON7 A;  2V6K A;  1PA3 A;  3SBC A;  3ZIJ A;  5ECS A;  2AB6 A;  1N8J A;  2JZR A;  4ZB8 A;  4OMV A;  2LQO A;  2DML A;  2WVX A;  3C71 A;  4OFM A;  1FG4 A;  1VGL A;  5F0G A;  5KN0 A;  1YVL A;  4I97 A;  4IP6 A;  4PQ1 A;  3VWU A;  4MMM A;  2NVL A;  1G6W A;  2LTK A;  3ZYW A;  1YDK A;  1XW5 A;  2HE3 A;  4OO4 A;  3LSZ A;  3HJM A;  4IGJ A;  1GTA A;  1GSE A;  3OR5 A;  3GV1 A;  2CZ2 A;  1S3A A;  3BJ5 A;  3FMW A;  2C0D A;  4MZB A;  3G7I A;  4EDZ A;  5DAK B;  3GKN A;  4ZIL A;  4WF5 A;  2WFC A;  4DSR A;  4PUA A;  5E4W A;  1GTB A;  1DUG A;  1AXD A;  3FZ9 A;  3FZA A;  2EFH A;  1SK1 A;  3DEX A;  4IHU A;  3UEM A;  4CW9 A;  4Z2R A;  4TR1 B;  2B7J A;  3CTF A;  3KMO A;  4K9Z A;  3LYK A;  3E9J B;  3EU3 A;  2BJX A;  1NSW A;  1M9A A;  4CY8 A;  1BED A;  3CRU A;  1T8E B;  3BBY A;  1ST9 A;  1V40 A;  2R5G A;  4HJM A;  4WEY A;  3PPU A;  3H1N A;  4POM A;  2HZF A;  3CHX C;  1VF4 A;  3HKR A;  1U6T A;  4L8E A;  2VCZ A;  3H8Q A;  1XZO A;  1UVZ A;  4POB A;  5DCG A;  4CHS A;  3LXT A;  2DIZ A;  5LNK e;  4Z7X A;  3I69 A;  1EV9 A;  1HNA A;  4KDX A;  1BJX A;  1U3I A;  3F4T A;  3ZVJ A;  2WB9 A;  4J2F A;  3VWV A;  4L0U A;  5DBQ A;  2YWI A;  1MDJ A;  3ZRD A;  5B6N A;  1FW1 A;  1SD9 A;  6GSY A;  2MZC A;  4MA9 A;  2H0G A;  1HQO A;  3TJB A;  2ZNM A;  1TK5 B;  3KH7 A;  5CRE A;  2GST A;  4I2T A;  1ERV A;  3HJP A;  1QXH A;  2CVD A;  3LOR A;  3WGX A;  4RQX A;  1XVQ A;  1YJ6 A;  2WRT A;  1AQX A;  5A34 B;  5KN1 A;  4FYC A;  2DKI A;  2VCW A;  3RHB A;  1TRS A;  2MMO A;  3K8N A;  5DVB A;  2HXK A;  3QOU A;  2IIY A;  2I4A A;  3I9V 2;  2LKU A;  2EIO A;  5CYY A;  1XW6 A;  2IMK A;  2DJJ A;  3R3E A;  1SKS B;  1V98 A;  4KF9 A;  5FWG A;  1K0C A;  3DWV A;  3ZRE A;  4XS4 B;  1O7U A;  2H1B A;  5IMF A;  1URM A;  3QDN A;  1GSS A;  4MPF A;  4F0B A;  3KZQ A;  1MEK A;  1R7H A;  2H6Z A;  3QFA C;  1EWX A;  1DBY A;  3IAM 2;  2YJH A;  4KA0 A;  3TJF A;  3GSS A;  4Q5Q A;  2GZZ A;  5KN3 A;  1HNB A;  3CSI A;  1HYU A;  3C73 A;  2HI7 A;  3TJK A;  4JR6 A;  2MMA A;  4BL7 A;  2I1U A;  2R0G A;  2LJK A;  4MK3 A;  4TVE A;  4E8E A;  4BPY A;  3J7Y b;  1KNG A;  1M3I A;  4PNG A;  3W8S A;  1X5E A;  3P2A A;  2O3E A;  2JAC A;  5DDL A;  4DVC A;  3F0I A;  2VCX A;  1ABA A;  4K2X A;  2MMN A;  2UZ8 A;  3SWL A;  4G10 A;  3WYW A;  1F3A A;  5LD0 A;  3DYR A;  2WZS A;  4WR5 A;  4TR3 A;  2RLI A;  3CTG A;  5AIX A;  4EO3 A;  2JZS A;  4HDE A;  3W6G A;  3CSH A;  4F2I A;  4V2M A;  1B48 A;  1SEN A;  1X0R A;  1JZR A;  1PX7 A;  4WKW A;  3ZFB A;  2VM1 A;  3BCK A;  3DKS A;  2O7K A;  2WVZ A;  2H19 A;  1NHY A;  3AY8 A;  4NMU A;  3RFR C;  4AF2 A;  4ZL9 A;  5J9C A;  2VIM A;  4GSN A;  2V6O A;  4AI6 A;  1XBS A;  1GRX A;  4NXI A;  1M9B A;  5B8A A;  3WD6 A;  2FA8 A;  2I9H A;  1I5G A;  3G9B A; 
#chains in the Genus database with same CATH homology
 4EDY A;  1MTC A;  2WDU A;  3DXB A;  3TCO A;  1ZYN A;  1FB6 A;  1OAZ A;  4I5Q A;  4D73 B;  3P7X A;  1EOG A;  3HVX A;  4IBP A;  2G0F A;  4HU7 A;  1GUL A;  1T00 A;  2IN3 A;  4F0C A;  3RPP A;  3CXG A;  1W89 A;  5A1N B;  4X1U A;  4OWY A;  1TXX A;  3Q18 A;  1Y6E A;  3UVT A;  3DVX A;  1O81 A;  4BWS A;  4KSO A;  2P0G A;  4IQA A;  4F9Z A;  2IPA A;  1ERW A;  2PWJ A;  4K6X A;  1ZYP A;  1AIU A;  1BG1 A;  3H4K A;  3UAR A;  1V57 A;  3GRX A;  1B4Q A;  3QAW A;  1V9W A;  3GKX A;  5E59 A;  2CVB A;  5J9B A;  20GS A;  3VI7 A;  1NM3 A;  3DIE A;  3KH9 A;  1YKC A;  4AKX B;  1GP1 A;  5J47 A;  1Z9H A;  3ISO A;  14GS A;  2DJ3 A;  3C7M A;  1TDI A;  1YF1 A;  3PIN A;  3D0Z A;  3RDW A;  5GSS A;  3PH9 A;  4HJ2 A;  1J08 A;  1GLQ A;  1ACV A;  1GTI A;  3D22 A;  5IO0 A;  1A8L A;  2WZ9 A;  4GDF A;  2H6X A;  17GS A;  1FVJ A;  3C1S A;  1QQ2 A;  5DAK A;  4BVY B;  3F4R A;  1Y25 A;  2IFQ B;  3APQ A;  5ID2 B;  2VM2 A;  2HYX A;  2LQQ A;  1EGR A;  1F37 A;  5ECP B;  3H93 A;  3MWH A;  1X5D A;  2OKA A;  1JLW A;  1T4Y A;  2DIY A;  3E0U A;  1S3D A;  3IBH A;  3EWL A;  1Z6N A;  4GXZ A;  2LRN A;  2J9H A;  3F3R A;  3KIJ A;  3FR3 A;  4X0X A;  4I6X A;  4PXO A;  1AW9 A;  3QPM A;  5B6M A;  2CX4 A;  2C0F A;  1A0F A;  1OC9 B;  2A2R A;  4KSM A;  1GTU A;  4MAB A;  2E0Q A;  4ECC A;  4YQM A;  1SD8 A;  4IW9 A;  4FIW A;  2NDO A;  1OKD A;  5G30 A;  5D9X A;  2H1D A;  2K9F A;  3TDG A;  5G5E A;  2EFC A;  3L78 A;  2X4A A;  4GWR A;  4NWY A;  1AC1 A;  5DAL B;  1FO5 A;  3TKS C;  2DSA A;  3N5O A;  3UIW A;  2QKE A;  5ECN B;  3LYP A;  2GSQ A;  4X4J A;  4QL7 A;  3IR4 A;  4HS1 A;  2GZP A;  3ZL5 A;  2VCV A;  4AKH A;  3F63 A;  3CSJ A;  1ZYE A;  2VKZ G;  2YWM A;  4YAV A;  4ACS A;  4Z2T A;  3KP8 A;  3CBU A;  2H75 A;  1GSF A;  5CRG A;  3IXR A;  3GMF A;  2B5E A;  4ZBB A;  3IK7 A;  2JU5 A;  1JHB A;  9GSS A;  4MP4 A;  1SJI A;  1QMV A;  2F9S A;  1MD3 A;  2FWG A;  4F03 A;  4XRA A;  3N9J A;  4V2N A;  1VRS D;  2YWO A;  1SL2 B;  3ZLP A;  4NV5 A;  4GRF A;  3GTU B;  2R0C A;  2V1M A;  3ME8 A;  3U6V A;  5A5H B;  3GL3 A;  4JRR A;  4ECB A;  2E7P A;  5D9W A;  1OC8 A;  1Z6M A;  2CZ3 A;  4TXO B;  4XS4 A;  1M2D A;  1SKW B;  5A4W A;  1OC3 A;  2F8F A;  5COH A;  3EPT A;  3RHC A;  4L5L A;  3F4S A;  2PGT A;  2FD3 A;  2YAN A;  1A2L A;  4KDU A;  4BVX A;  3L9U A;  4K7N A;  4QQ7 A;  4BA7 A;  2LRC A;  2XBQ A;  1O6J A;  3IRA A;  4G0K A;  1FAA A;  2YN1 A;  1GL8 A;  3LW9 A;  4G9H A;  2HRN A;  5JWQ B;  3LFL A;  1K0M A;  3TKS E;  3CWG A;  3TJJ A;  5D96 A;  1BG5 A;  1WWJ A;  5ECO B;  2H6Y A;  3IDV A;  3HMJ G;  4EUY A;  2PU9 C;  2LS5 A;  1XOB A;  3GHA A;  2GS3 A;  1YKA A;  2X8C A;  2EC4 A;  2VL9 A;  3TOT A;  2A4H A;  3I43 A;  1CQH A;  1AAZ A;  1RK4 A;  4FH8 A;  2ALB A;  4LL4 B;  4ID0 A;  1PRX A;  1T7P B;  2F51 A;  1PKZ A;  4KCA A;  3GYK A;  5GAN D;  3QCP A;  4BWQ A;  3HY2 A;  4IQ1 A;  2N5B A;  1HNC A;  4USS A;  3D4M A;  1GWC A;  2OA7 A;  5AIS A;  5DQS A;  1EGO A;  4JED A;  4EVM A;  3US3 A;  1A0R P;  3Q6O A;  1Z3E A;  2VLU A;  2X64 A;  1X9W B;  5CRW A;  2R6K A;  2R0P A;  2JSZ A;  1USB A;  5GAP D;  2GDR A;  2P5Q A;  3APS A;  2V32 A;  4FYU A;  4IJI A;  1SL0 B;  5D9T A;  3GFK A;  4K0N A;  3ZVJ D;  1SYX A;  1Z7R A;  2FA4 A;  1B8X A;  2PMT A;  4OFN A;  5A4V A;  2YZU A;  2C3N A;  2YCD A;  4K5R A;  4D73 A;  1SKR B;  2LUS A;  5BMU A;  1G6Y A;  13GS A;  3VWW A;  4E68 A;  3L9S A;  2J23 A;  3G7J A;  2HSY A;  1SVM A;  5A1N A;  5C04 A;  4MJB A;  3GN3 A;  1SJZ A;  6GSX A;  3RPN A;  4MF5 A;  5EVO A;  1S3C A;  1AUC A;  1T1V A;  2RII A;  6GSU A;  1EP8 A;  2B3S A;  2I3Y A;  3M3M A;  2NBS A;  2CT6 A;  4JBB A;  5IO2 A;  3KMN A;  2AYT A;  5EPF A;  4TN8 A;  5CRD A;  3A2V A;  1TU7 A;  1WE0 A;  5JWO B;  1TJD A;  1TU8 A;  1FHE A;  2M72 A;  3VWX A;  4MDC A;  4DSS B;  1E2Y A;  2CX3 A;  4ULX A;  2LNT A;  2CAQ A;  2M80 A;  5KEJ A;  4EKZ A;  2N5A A;  2LNS A;  1JLV A;  4KND A;  4MF6 A;  1CQG A;  4O5U A;  5H5Q A;  3F3Q A;  5CP1 A;  5ELG A;  2AV4 A;  2KUC A;  4BVY A;  3IOS A;  4YH2 A;  1XIY A;  3ZFL A;  4XTS A;  3MSZ A;  3RBT A;  4MCU A;  1F2E A;  3M8N A;  2H30 A;  1KEB A;  2IME A;  1TOF A;  5DCH A;  4N3Z A;  4G0I A;  4K8M A;  5FT3 A;  1N2A A;  3F9U A;  1KTE A;  2H0H A;  2OE0 A;  2B1L A;  5DJL A;  1OE7 A;  2CAI A;  2QGV A;  1AQV A;  4A5P A;  2GGT A;  3A2X A;  4MJC A;  4Z2U A;  4WF4 A;  1XWC A;  2HSM A;  1U3A A;  1M7T A;  1ZCP A;  1ILO A;  2PUK C;  5A4U A;  3S9F A;  2GQM A;  3M1G A;  5DAL A;  1G7E A;  2C4J A;  1M0U A;  4RUV A;  2P31 A;  4AJ7 A;  3MIX A;  4DEJ A;  4GQC A;  4ECJ A;  3UBK A;  2O89 A;  2WGR A;  5HR2 A;  2C0E A;  4NV2 A;  1GNE A;  5HR3 A;  1FOV A;  1YEP A;  3TKS A;  1H75 A;  4AKG A;  2OAC A;  3UJ1 A;  3A3T A;  3IV4 A;  2H0I A;  1O8W A;  3Q74 A;  2VL2 C;  6GSV A;  2L4C A;  3P90 A;  5IMD A;  5IOW A;  1XOA A;  4NAX A;  4ML1 A;  3QFB C;  1TRU A;  4FO5 A;  4OD7 A;  3IE3 A;  1GUH A;  3O3T A;  3TRP A;  2X8H A;  2HRK A;  1NW2 A;  4YAP A;  1NHO A;  4ML6 A;  1WPI A;  4TXV A;  1VF1 A;  5A5K A;  4I8B A;  19GS A;  2VAF A;  3ERG A;  1AQW A;  6GSS A;  3P8W A;  2VD0 A;  1PN0 A;  1ZYQ B;  2YOI A;  1BYE A;  2FGX A;  5AN1 A;  2D2Z A;  2CVK A;  2FLS A;  4KW6 A;  4IKH A;  1XFL A;  4KX4 A;  2XHF A;  1WOU A;  1PL1 A;  2A2S A;  1J0F A;  2EFE A;  3UMA A;  2GTU A;  3LG6 A;  1T3B A;  2BMX A;  4TXO A;  3HZ4 A;  2HQT A;  7GSS A;  4PUF C;  2IMD A;  4O5R A;  1GNW A;  3APO A;  1K0A A;  4Q5R A;  2QSI A;  3TUE A;  5ECM B;  2HNL A;  3GKK A;  1BF5 A;  2R4V A;  4PGT A;  4GCI A;  2R37 A;  2PN8 A;  1EEM A;  5G2Z A;  3GA4 A;  3KCM A;  4PQI A;  2O87 A;  4JZQ A;  3D6I A;  4LMW A;  3E3E A;  3ZIV A;  2K18 A;  4LMV A;  1C72 A;  4OCE A;  4YKG A;  2EIQ A;  4ISD A;  3GL5 A;  1OVN A;  3LWA A;  5HFI A;  1SYR A;  1Z7P A;  3A5I A;  2GSR A;  4IVF A;  3FY7 A;  1XCC A;  4KB3 A;  4YQV A;  4EF0 A;  3GX0 A;  2TRX A;  3GUS A;  4HQS A;  1GLP A;  4XS1 A;  3BOA A;  2H74 A;  1KBN A;  1K3Y A;  3JCM L;  3UOM A;  4ZXG A;  1T4Z A;  1WRY A;  4KGI A;  2GVP A;  5JCW A;  4V1A g;  5IMA A;  2B6M A;  1RQM A;  5B8B A;  1GH2 A;  1BX9 A;  1YZX A;  1XPV A;  4AKI A;  4KAE A;  3FZ5 A;  1Q4J A;  2VUP A;  4O7H A;  4HZ2 A;  1LU4 A;  4GSS A;  2LV3 A;  3FK8 A;  2R2J A;  5ECI B;  3W8J A;  2HLS A;  2MYG A;  4MZW A;  4HOJ A;  1K3L A;  5BRT A;  5D93 A;  2AAW A;  2UV8 G;  3UVH A;  2V41 A;  1QFN A;  2LEG A;  3HVV A;  2IL3 A;  3PR8 A;  3ZTL A;  2MBS A;  5F07 A;  2A4V A;  4K5S A;  1GSY A;  3IHQ A;  1FVK A;  4TR1 A;  3IK9 A;  1A8Y A;  2KHP A;  4EXJ A;  2B1K A;  5ENU A;  2VOC A;  4NHZ A;  2YP6 A;  3FRC A;  2L5L A;  3IAS 2;  3TRQ A;  2H71 A;  4CY6 A;  2HSN B;  5J3R A;  3EMX A;  4G2E A;  3VK9 A;  1TK0 B;  10GS A;  3ED3 A;  2VD1 A;  1U87 A;  1Z5Y E;  3FKF A;  2NTO A;  18GS A;  4DSS A;  5F05 A;  1I9D A;  1PGT A;  2YNX A;  1YY7 A;  1OYJ A;  2HSH A;  3LJR A;  2DC5 A;  3FR6 A;  3DVW A;  2F3M A;  2RM6 A;  4KE3 A;  4KUN A;  4TRX A;  5ECK B;  4LLR A;  2V2G A;  3VFI A;  1YEX A;  1V58 A;  1R4W A;  4EIQ A;  3F6F A;  4MPG A;  1MDK A;  5A34 A;  3NOF A;  2E2M A;  2QA2 A;  2FY6 A;  1JZO A;  1F9M A;  4E8H A;  3KXO A;  1XXU A;  2FUG 2;  4BL7 B;  2DJ0 A;  4EC0 A;  1QUW A;  3GUR A;  1RW1 A;  3ZZX A;  1THX A;  3KP9 A;  2EIR A;  4KDY A;  2B5Y A;  22GS A;  2WS2 A;  5J40 A;  2H76 A;  1LJR A;  2L59 A;  2FWF A;  4WXT A;  1IYH A;  4EIP A;  1XWA A;  1BAY A;  2IMI A;  4XHM A;  2ZUP A;  3BCI A;  4JE1 A;  2R3X A;  5JCU A;  3TKQ A;  4N30 A;  3HXS A;  3BD2 A;  6GSW A;  3LEF A;  5CRH A;  3EVI A;  1B9Y C;  5CAX A;  3DD3 A;  1G7O A;  3WGE A;  3R2Q A;  3DML A;  2H01 A;  1B4P A;  1EP7 A;  3C1R A;  3KJY A;  1XW9 A;  5D9V A;  2ZCT A;  5IMZ A;  1DSB A;  1M99 A;  3HA9 A;  2HZE B;  4KH7 A;  1OE8 A;  5J4V A;  4ZB7 A;  3LQ7 A;  2CV4 A;  2TRC P;  2YV7 A;  1TI3 A;  2KLX A;  2YZH A;  2DBC A;  2TIR A;  2VL2 A;  5B7C A;  2CQ9 A;  3M9K A;  1EV4 A;  2XPE A;  5INY A;  4GF0 A;  1X9M B;  1ZGN A;  1E6B A;  1ERU A;  5G5F A;  2C3T A;  1GSQ A;  4ICY A;  1LBK A;  2OBI A;  4WBJ A;  4AGS A;  1TP9 A;  2C0G A;  5HFK A;  4OO5 A;  3KTB A;  3D4T A;  2GT6 A;  3I6A A;  3MYD A;  2M46 A;  3TKR A;  3FHK A;  2HRA A;  4LL1 B;  4EE0 A;  1K0N A;  5H5R A;  5DQY A;  4CDO A;  5GZZ B;  4IP1 A;  1SL1 B;  2KP1 A;  2Z9S A;  1V2A A;  4N0V A;  1TXU A;  4WET A;  5KOW A;  3TRX A;  3LGC A;  4HEA 2;  3EIN A;  2AUV A;  4RQR A;  4TR0 A;  2L4Q A;  4XS6 A;  3TB2 A;  1PN9 A;  1QGV A;  4HQZ A;  4K0G A;  3CMI A;  2OE1 A;  5IPH A;  12GS A;  1FOH A;  2JL4 A;  3F8U A;  2I81 A;  3J7Y k;  1YQ1 A;  16GS A;  5DJM A;  1K3O A;  4PTS A;  4TOP A;  3KTL A;  4PNF A;  4G0L A;  4XCS A;  4XIH A;  3NIV A;  2GQL A;  4TW5 A;  5CO3 A;  2LJR A;  2C3Q A;  4RI6 A;  2ON5 A;  1SK2 A;  2L6D A;  2PPT A;  1K0D A;  5G1L A;  1OKT A;  3TU3 B;  2C8U A;  3HZ8 A;  4MZC A;  2H1A A;  5JWR B;  4OCF A;  1SJ6 A;  2IFQ A;  5ID2 A;  1ZL9 A;  2VLV A;  2FHE A;  3GX8 A;  4OFT A;  2PVO C;  3HCZ A;  5C00 A;  4POL A;  3IC4 A;  3VPQ A;  5ABR A;  2P5R A;  2FWE A;  2HRF A;  4K1F A;  1U88 A;  2DLX A;  1PKW A;  4POK A;  1ERT A;  3IPZ A;  2C1Y A;  3ZMK A;  1EZK A;  2HSN A;  2NPB A;  1OC9 A;  3QAV A;  2GT5 A;  5J4Y A;  3TOU A;  5HR0 A;  3GKM A;  3GH6 A;  3MNG A;  3G7Y A;  2DJK A;  1ON4 A;  1PL2 A;  3O6T A;  4IJ3 A;  4GTU A;  3TKP A;  3RAZ A;  3KEB A;  4V2L A;  3D5J A;  3HDC A;  3KGK A;  2B5X A;  1TKD B;  1N25 A;  4YQU A;  2VCT A;  3FEU A;  4MJA A;  3GIX A;  2E2G A;  4TKY A;  1TTZ A;  3VPT A;  1PX6 A;  4ZB9 A;  2XC2 A;  4WR4 A;  4BVX B;  3FW2 A;  1UA5 A;  2RUF A;  4MLY A;  2BTO T;  5L71 A;  2LST A;  3LXZ A;  1VF2 A;  2L6C A;  4QMK A;  2MMZ A;  2AHE A;  3F6D A;  3EYT A;  5ECQ B;  3HHV A;  3WGD A;  2KOK A;  2QA1 A;  3O76 A;  1PD2 1;  3KM6 A;  3Q19 A;  2X99 A;  3QD9 A;  1EOH A;  3VUR A;  5LCZ A;  4N11 A;  4H86 A;  2O5V A;  1R26 A;  3MAK A;  1PQN A;  1WMJ A;  4IS0 A;  1F3B A;  3GTU A;  5A5H A;  1GSU A;  1YF0 A;  3H79 A;  4J56 E;  3IC8 A;  3FZ4 A;  1Y1U A;  5ECR B;  1X5C A;  1H4O A;  2O85 A;  1TRV A;  3EUR A;  4MF7 A;  2WCI A;  2DJ2 A;  2H72 A;  4XRD A;  1ZOF A;  3EU4 A;  1O8X A;  1WIK A;  3EMP A;  4P3Y B;  1XWK A;  1ML6 A;  1SVL A;  2H73 A;  11GS A;  1UN2 A;  1EEJ A;  1XVW A;  3ZIT A;  2AJQ B;  1DE2 A;  4N10 A;  4AJ6 A;  4MJE A;  4KCE A;  2HZE A;  4G01 A;  2DKH A;  2REM A;  5EL8 A;  1XWG A;  2GLR A;  3ERF A;  4NPB A;  1K0O A;  5J5N A;  4W66 A;  4HI7 A;  3NZN A;  4PX1 A;  2X49 A;  1DE1 A;  5BMU B;  1QK8 A;  1J9B A;  2H66 A;  1GSD A;  2DMM A;  1W4V A;  3GST A;  2JSY A;  2LRT A;  4O32 A;  5IQY A;  1R5P A;  3TGZ A;  4JU5 A;  4Q5N A;  3UBL A;  2EFD A;  2K8V A;  2HFD A;  1HD2 A;  1FB0 A;  3TJG A;  3M0F A;  1B9X C;  2HT9 A;  4X43 A;  2RM5 A;  3C8E A;  5F06 A;  4I2U A;  5H5S A;  2WUL A;  4NHW A;  3PGT A;  5AGY A;  3EC3 A;  2MBT A;  3GH9 A;  2A2P A;  5IOX A;  4ZBD A;  4AJ8 A;  2FWH A;  1M2A A;  2OE3 A;  2VLT A;  4ZIJ A;  4ZB6 A;  4WBR D;  2H70 A;  2C80 A;  4RI7 A;  2GSS A;  1SK0 A;  2X8G A;  3A5W A;  2YPM A;  4MH3 A;  3HYP A;  3VI5 A;  3KD0 A;  5AIV A;  1A23 A;  4HUA A;  4TR4 A;  4GLT A;  1O73 A;  5KN2 A;  4JR4 A;  4HZ4 A;  3L0H A;  5IM9 A;  2H1G A;  5ELA A;  2B7K A;  2YWN A;  1PSQ A;  2O8V B;  2XBI A;  2PBJ A;  4PUR A;  5FHI A;  4ECI A;  4YKF A;  1SVO A;  4EL1 A;  3UL3 A;  3V1W A;  3QAG A;  1TI1 A;  1BQ7 A;  3QMX A;  1MDI A;  2YV9 A;  4MNN A;  2OJL A;  3FYG A;  4G19 A;  1UC7 A;  5IMV A;  5D8I A;  6GST A;  2K6V A;  4F82 A;  2WJU A;  2GQK A;  5G1K A;  3GNJ A;  2H1L A;  2IWT A;  2HSM B;  4K7I A;  2G2Q A;  3DRN A;  2VCQ A;  4O5Q A;  3WT2 A;  5F8B A;  1JFU A;  4J57 E;  3ME7 A;  4K2D A;  4GST A;  2XPD A;  3A2W A;  2FCH A;  1O85 A;  3L9V A;  1ZMA A;  2DJ1 A;  3WT1 A;  1WP0 A;  3HVS A;  4PQH A;  2H8L A;  4Q5F A;  1K0B A;  1A2J A;  4ZBA A;  3VLN A;  4FQU A;  5J41 A;  4IEL A;  2GZY A;  5G31 A;  4V1A p;  3UAP A;  1IYI A;  2PER A;  4FYB A;  4L0W A;  1Q98 A;  4L5O A;  3ERW A;  1JZD A;  1TW9 A;  1SU9 A;  3D21 A;  3EE2 A;  2OAD A;  2L5O A;  2VL3 A;  2HRK B;  5GST A;  4ZL7 A;  5IIZ A;  2N5F A;  3FR9 A;  3ZML A;  3DGQ A;  3L4N A;  1WJK A;  4ILF A;  2KP2 A;  3HD5 A;  5EY6 A;  2YJ7 A;  2FNO A;  2JAD A;  3M9J A;  3MDK A;  2F8A A;  1A24 A;  4K7O A;  5ECL B;  4N0Z A;  5ECH B;  1JZW A;  1F6M C;  1GUM A;  4ZL8 A;  5HFG A;  1PMT A;  4MH2 A;  4DSQ A;  2L57 A;  1THO A;  2CA8 A;  1MD4 A;  4GQF A;  2VO4 A;  1M2B A;  2LJA A;  1TRW A;  3U5R E;  5IMC A;  4QL9 A;  1GUK A;  4HU9 A;  3IA1 A;  1VF3 A;  2K8S A;  3QR6 A;  3HJO A;  5JCG A;  4IN0 A;  1XWB A;  5D73 A;  1A2M A;  2IMF A;  2OBK A;  2OT3 A;  3CRT A;  1ZZY A;  1R5A A;  5CNW A;  2PVQ A;  2ES7 A;  1G0T A;  2RUE A;  5HQP A;  1X9S B;  5HR1 A;  2JZT A;  3IHG A;  2QC7 A;  3CYN A;  8GSS A;  4O92 A;  5IPG A;  5J4U A;  5KOX A;  4LA1 A;  2IJY A;  1TK8 B;  2ON7 A;  2V6K A;  1PA3 A;  3SBC A;  3ZIJ A;  5ECS A;  2AB6 A;  1N8J A;  2JZR A;  4ZB8 A;  4OMV A;  2LQO A;  2DML A;  3C71 A;  4OFM A;  1FG4 A;  1VGL A;  5F0G A;  5KN0 A;  1YVL A;  4I97 A;  4IP6 A;  4PQ1 A;  3VWU A;  4MMM A;  2NVL A;  1G6W A;  2LTK A;  3ZYW A;  1YDK A;  1XW5 A;  2HE3 A;  4OO4 A;  3LSZ A;  3HJM A;  4IGJ A;  1GTA A;  1GSE A;  3OR5 A;  3GV1 A;  2CZ2 A;  1S3A A;  3BJ5 A;  3FMW A;  2C0D A;  4MZB A;  3G7I A;  4EDZ A;  5DAK B;  3GKN A;  4ZIL A;  4WF5 A;  2WFC A;  4DSR A;  4PUA A;  5E4W A;  1GTB A;  1DUG A;  1AXD A;  3FZ9 A;  3FZA A;  2EFH A;  1SK1 A;  3DEX A;  4IHU A;  3UEM A;  4CW9 A;  4Z2R A;  4TR1 B;  2B7J A;  3CTF A;  3KMO A;  4K9Z A;  3LYK A;  3E9J B;  3EU3 A;  2BJX A;  1NSW A;  1M9A A;  4CY8 A;  1BED A;  3CRU A;  1T8E B;  3BBY A;  1ST9 A;  1V40 A;  2R5G A;  4HJM A;  4WEY A;  3PPU A;  3H1N A;  4POM A;  2HZF A;  1VF4 A;  3HKR A;  1U6T A;  4L8E A;  2VCZ A;  3H8Q A;  1XZO A;  1UVZ A;  4POB A;  5DCG A;  4CHS A;  3LXT A;  2DIZ A;  5LNK e;  4Z7X A;  3I69 A;  1EV9 A;  1HNA A;  4KDX A;  1BJX A;  1U3I A;  3F4T A;  3ZVJ A;  2WB9 A;  4J2F A;  3VWV A;  4L0U A;  5DBQ A;  2YWI A;  1MDJ A;  3ZRD A;  5B6N A;  1FW1 A;  1SD9 A;  6GSY A;  2MZC A;  4MA9 A;  2H0G A;  1HQO A;  3TJB A;  2ZNM A;  1TK5 B;  3KH7 A;  5CRE A;  2GST A;  4I2T A;  1ERV A;  3HJP A;  1QXH A;  2CVD A;  3LOR A;  3WGX A;  4RQX A;  1XVQ A;  1YJ6 A;  2WRT A;  1AQX A;  5A34 B;  5KN1 A;  4FYC A;  2DKI A;  2VCW A;  3RHB A;  1TRS A;  2MMO A;  3K8N A;  5DVB A;  2HXK A;  3QOU A;  2IIY A;  2I4A A;  3I9V 2;  2LKU A;  2EIO A;  5CYY A;  1XW6 A;  2IMK A;  2DJJ A;  3R3E A;  1SKS B;  1V98 A;  4KF9 A;  5FWG A;  1K0C A;  3DWV A;  3ZRE A;  4XS4 B;  1O7U A;  2H1B A;  5IMF A;  1URM A;  3QDN A;  1GSS A;  4MPF A;  4F0B A;  3KZQ A;  1MEK A;  1R7H A;  2H6Z A;  3QFA C;  1EWX A;  1DBY A;  3IAM 2;  2YJH A;  4KA0 A;  3TJF A;  3GSS A;  4Q5Q A;  2GZZ A;  5KN3 A;  1HNB A;  3CSI A;  1HYU A;  3C73 A;  2HI7 A;  3TJK A;  4JR6 A;  2MMA A;  4BL7 A;  2I1U A;  2R0G A;  2LJK A;  4MK3 A;  4TVE A;  4E8E A;  4BPY A;  3J7Y b;  1KNG A;  4PNG A;  3W8S A;  1X5E A;  3P2A A;  2JAC A;  5DDL A;  4DVC A;  3F0I A;  2VCX A;  1ABA A;  4K2X A;  2MMN A;  2UZ8 A;  3SWL A;  4G10 A;  3WYW A;  1F3A A;  5LD0 A;  3DYR A;  4WR5 A;  4TR3 A;  2RLI A;  3CTG A;  5AIX A;  4EO3 A;  2JZS A;  4HDE A;  3W6G A;  3CSH A;  4F2I A;  4V2M A;  1B48 A;  1SEN A;  1X0R A;  1JZR A;  1PX7 A;  4WKW A;  3ZFB A;  2VM1 A;  3BCK A;  3DKS A;  2O7K A;  2H19 A;  1NHY A;  3AY8 A;  4NMU A;  4AF2 A;  4ZL9 A;  5J9C A;  2VIM A;  4GSN A;  2V6O A;  4AI6 A;  1XBS A;  1GRX A;  4NXI A;  1M9B A;  5B8A A;  3WD6 A;  2FA8 A;  2I9H A;  1I5G A;  3G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...