5D73A

Structure of wuchereria bancrofti pi-class glutathione s-transferase
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
207
structure length
207
Chain Sequence
b'SYKLTYFPIRGLAEPIRLVLVDQGIKFTDDRINASDWPSMKSHFHFGQLPCLYDGDHQIVQSGAILRHLARKHNLNGGNELETTHIDMFCEGVRDLHTKYTKMIYQAYDTEKDSYIKDILPVELAKFEKLLATRDDGKNFILGEKISYVDFVLFEELDIHQILDPHCLDKFPLLKAYHQRMEDRPGLKEYCKQRNRAKIPVNGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title STRUCTURE OF WUCHERERIA BANCROFTI PI-CLASS GLUTATHIONE S-TRANSFERASE
rcsb
source organism Wuchereria bancrofti
molecule tags Transferase
total genus 73
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5d73A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5d73A01
2I3YA 2CX4A 2PN8A 3H1NA 3Q74A 1PSQA 1X9MB 4LL4B 3GTUA 3LJRA 3MNGA 1A23A 1GP1A 1JFUA 4MP4A 5ECSA 3GUSA 1EGOA 2VCWA 3L4NA 4XS6A 4YAPA 5ECLB 1SK1A 4MABA 1DSBA 5EL8A 3UIWA 1GSQA 4ZILA 1SKRB 2VM2A 4USSA 4G19A 4IVFA 5CAXA 1X5CA 2E0QA 4PXOA 4GQCA 2C80A 1GLPA 4BL7A 1YKAA 2OE1A 2RM6A 1GULA 1USBA 4I5QA 1M99A 3TKPA 3KJYA 4V2NA 2GZYA 5CRDA 1VRSD 3C1SA 5A4VA 3C71A 4ACSA 3FW2A 4NV2A 1CQGA 2GZZA 3E9JB 3TJBA 2ON5A 2WB9A 1SYRA 5HFKA 2OA7A 1RK4A 4AF2A 4JBBA 2DJ2A 1F3BA 5CREA 5JCWA 4ZBBA 2M46A 4QL7A 2YV7A 2V6OA 1T3BA 5B8BA 2HRKA 2LQQA 3F0IA 2H71A 2C0FA 4GSNA 1E6BA 4OD7A 2VL3A 3TJFA 2MMNA 3A2XA 2KOKA 4TR4A 2AHEA 3FZ9A 3F4TA 1TK0B 2LS5A 1K3LA 4MZWA 4K7IA 4AJ8A 4MF6A 5D93A 1J9BA 4TR0A 1MDJA 2DBCA 1BEDA 1PX6A 2ALBA 2IPAA 3ERFA 4YQUA 5L71A 2IFQB 5IOWA 1M2AA 3CXGA 4WBJA 1AQXA 5A4UA 1X0RA 2C4JA 1U87A 5KN2A 2O85A 3US3A 3UL3A 4NXIA 3H4KA 2HRAA 4TRXA 3A2WA 1FW1A 4BVYA 2PU9C 1EZKA 1TI3A 5H5RA 2M80A 3DIEA 4HJMA 4Z7XA 4Q5FA 3GN3A 3VWWA 4L8EA 4JR4A 4EKZA 1N2AA 4F2IA 1G6WA 3EMXA 1JZDA 3CRUA 5KEJA 4HJ2A 3VFIA 4ECJA 2N5BA 1ZMAA 1JZOA 2LSTA 2LRCA 4ECCA 2FHEA 3GMFA 3LEFA 18GSA 5DCGA 4HQZA 5F0GA 2PMTA 1K3YA 4KDXA 2HFDA 1WOUA 3ZYWA 2TIRA 3SWLA 1PKWA 1HQOA 4MF5A 3ERGA 2DLXA 3BBYA 2F3MA 2VCXA 4LL1B 4GLTA 1GNWA 2V6KA 3DXBA 3IOSA 2WULA 2V1MA 4ZB8A 2P5RA 2AB6A 4AGSA 5JWOB 20GSA 3ZL5A 5CRHA 2H66A 4WR4A 1QMVA 2NBSA 4PX1A 1NW2A 3RHBA 2AJQB 1TOFA 3QFBC 4TN8A 1YDKA 3LXTA 2ZNMA 4DSSB 4IHUA 1LBKA 2L5OA 1W89A 1SD8A 2LRTA 1YEPA 3WD6A 1S3DA 4KSMA 1GLQA 5E4WA 1SJ6A 2K18A 2MBSA 5J41A 4YQVA 4LMVA 4N0VA 4EUYA 2LJRA 3KH9A 4F9ZA 2DJJA 2B3SA 3DVWA 2H30A 3DYRA 3N5OA 4IW9A 4RUVA 1TP9A 3TJJA 5ID2A 2MZCA 5J3RA 4HEA2 1NHYA 2L4QA 2X8HA 11GSA 1ERUA 3IDVA 1O81A 3TRQA 5DJLA 4MPFA 2HQTA 5FT3A 3CMIA 1KNGA 4V2LA 3KD0A 2V2GA 4KGIA 1JLWA 4BWSA 3M1GA 5IMVA 5ECRB 4BA7A 1BG5A 2YNXA 3ME7A 3QMXA 5ECNB 2IIYA 3UEMA 2TRXA 2YV9A 3FR3A 3N9JA 4KCEA 1XBSA 4ZBDA 1SYXA 3GTUB 1AW9A 4YQMA 2VCQA 1SK2A 3MWHA 1GWCA 2HZEA 4K0GA 3D4TA 4WR5A 1U88A 2PVOC 2AUVA 2DJ3A 1SKSB 3DGQA 2OADA 2H74A 4OFMA 3IC4A 2REMA 1GTUA 1TXXA 5DBQA 4TVEA 2C3NA 1PA3A 1ERVA 6GSYA 3ZVJD 3GX0A 3D6IA 2VO4A 2FLSA 3EC3A 4OO5A 1SL0B 3F6DA 3ISOA 3FR9A 2X99A 2MYGA 1TRSA 2L6CA 1S3AA 3RAZA 5B6MA 3GV1A 4BL7B 1QGVA 2GT6A 4KNDA 1W4VA 4DSQA 1G6YA 3ZTLA 1ZZYA 3DEXA 3M9KA 3FZ4A 4GSSA 2V32A 3IV4A 4HS1A 2GVPA 1THXA 3K8NA 2XC2A 1SL1B 1U3AA 1PX7A 6GSWA 1EV9A 3IR4A 3G7JA 4ID0A 5CO3A 4TOPA 2R2JA 2F8FA 1WPIA 3CSJA 3I69A 3FZAA 2HRKB 4ZB9A 4I97A 1JLVA 5DQSA 2HRNA 2JACA 4EO3A 1URMA 1GSDA 4F03A 5HR1A 2PWJA 2A4VA 2QSIA 2OBKA 1GSEA 1AIUA 4WF4A 2GQKA 3LYPA 2VCVA 4TR1B 19GSA 2NDOA 5IPHA 1ML6A 3H93A 2IJYA 1PN9A 4KH7A 1DE2A 5IO2A 3TRPA 3S9FA 1GTAA 1Z6NA 4TW5A 4MA9A 3L78A 3BCKA 4ZB6A 2C3QA 2OKAA 4RI7A 5HR3A 1HYUA 3QCPA 4NAXA 2L57A 1XVQA 2LKUA 2I81A 3UVHA 2E7PA 2VIMA 3GKKA 1GUHA 1PQNA 4KB3A 3GSTA 4MDCA 3FEUA 4D73B 1BQ7A 1DBYA 3HCZA 4RQRA 3IPZA 1RQMA 2HZFA 2VM1A 5G31A 4XS4A 2CVDA 3F8UA 4BPYA 3M0FA 4K8MA 2HI7A 2CVKA 3GKNA 1R4WA 4OO4A 1KTEA 1H75A 2DIZA 4KCAA 3TKSC 1UVZA 2VL9A 2LNTA 3EU4A 4PNGA 5DALA 3VK9A 3ZMLA 1WP0A 4MH2A 4TR3A 2HYXA 3BD2A 1ZGNA 3L0HA 4IQAA 1C72A 1MDKA 3ZFLA 1A24A 4N30A 1A0FA 2H1BA 3G7IA 4HI7A 3M8NA 1Q4JA 3HZ8A 3FR6A 3ZITA 3KMOA 2GSSA 3Q19A 5AIVA 2F51A 2DJKA 2XPDA 2JZRA 1JZWA 3HJMA 1U6TA 4WETA 3GIXA 2P5QA 1Q98A 2L5LA 4GF0A 2K8SA 5AIXA 5B7CA 2GSRA 1TKDB 2EIRA 4HDEA 4OCFA 3ZFBA 3HXSA 3VI5A 3GH6A 4J56E 2HT9A 4K1FA 1FG4A 1M9BA 5J9CA 1ST9A 2K8VA 5H5SA 4MMMA 1MDIA 2D2ZA 1PD21 3IC8A 5FWGA 5HFGA 5ID2B 4MZBA 2H8LA 2O87A 1O8XA 2VL2C 4I6XA 3F63A 2IL3A 1TRVA 2I9HA 4HU7A 4JEDA 4PNFA 3ZREA 2ON7A 1UN2A 4I2UA 1TW9A 2RUEA 5F07A 4XRDA 4K7NA 3ZVJA 2B7JA 2H6YA 1YQ1A 1XWAA 3FKFA 4PUAA 2WGRA 4J57E 1O7UA 1RW1A 5ABRA 3QD9A 1XOAA 1PL1A 4N0ZA 2HSYA 5IO0A 3G7YA 5INYA 4NPBA 4K9ZA 1GNEA 4IGJA 4IELA 3TDGA 2H19A 2KLXA 4KX4A 4HZ4A 3GYKA 2DMMA 3R2QA 1THOA 2DIYA 4ECBA 1SD9A 2KP2A 1FAAA 1TDIA 1FOVA 3ZIVA 4BVXA 2C0EA 5LCZA 5DDLA 2CZ2A 1F6MC 1XCCA 2E2MA 6GSTA 3C7MA 1F3AA 1OC8A 2F9SA 2KUCA 2HSMA 3GNJA 3CBUA 3HVSA 1SL2B 3APOA 7GSSA 5GSSA 3KXOA 4O5RA 2IN3A 1K3OA 4GXZA 3GL3A 4HQSA 1TRWA 3F6FA 2C1YA 3UBLA 2Z9SA 1GUMA 9GSSA 3VPQA 3TUEA 2R6KA 3APQA 4E8EA 3ZLPA 1ERTA 1TRUA 4ULXA 4LMWA 4V1Ag 2JZTA 4L0WA 4ISDA 2YOIA 4HU9A 3UMAA 4TXOA 4DEJA 3GKXA 3D21A 2G2QA 1A0RP 5GZZB 5ECHB 4POKA 1BJXA 3KH7A 4HZ2A 4EE0A 1M2DA 3GH9A 1XWBA 5G5EA 1K0AA 5J4UA 5IQYA 2H70A 1GTIA 4KDYA 3UJ1A 5IOXA 4NMUA 2BMXA 1WWJA 2B5EA 1ZYQB 1AUCA 3O76A 2LJKA 1E2YA 1HNAA 6GSSA 4MH3A 3MSZA 1O73A 3CTFA 3HD5A 1X9WB 4KSOA 3IK7A 1U3IA 3V1WA 3L9VA 1WE0A 2O8VB 1FVJA 3TJKA 4XHMA 8GSSA 1XXUA 3LWAA 1O85A 2MMOA 5H5QA 4IP6A 1JHBA 3RHCA 1H4OA 2LEGA 1X5EA 3WT2A 3GRXA 2H01A 1ZOFA 4JR6A 2CQ9A 3M9JA 2BJXA 1XFLA 1V40A 3HYPA 3FY7A 2O7KA 2WRTA 1GH2A 2WDUA 3L9UA 1FB0A 1GTBA 2VUPA 3PR8A 3H8QA 3GURA 4ML1A 2X8GA 1ZL9A 1R26A 5G30A 4EDYA 3DRNA 2DC5A 1V58A 4FYCA 2FGXA 2H6XA 3PH9A 2P31A 1AXDA 1O8WA 5B6NA 5JCUA 3D5JA 5DALB 4PTSA 1PKZA 1EOHA 4ZL7A 1ABAA 1GRXA 5AISA 3RPNA 4CDOA 1YZXA 3DD3A 4FQUA 2GDRA 3DMLA 22GSA 1EP8A 3A5WA 4LA1A 2YZHA 3HKRA 5DVBA 1K0BA 4PURA 2CX3A 2R4VA 1T1VA 1M7TA 2YJ7A 4POLA 3I6AA 1V98A 2GQLA 2YWOA 3DKSA 5D9VA 5ECIB 3IAM2 1R7HA 3EURA 3HZ4A 2WJUA 3UBKA 2NTOA 5G5FA 1SENA 3I43A 1A2MA 1X5DA 5EVOA 3BJ5A 2N5AA 2YJHA 4JU5A 3RDWA 4AJ6A 5J5NA 2JU5A 5GAPD 6GSUA 4IP1A 2WS2A 3EE2A 2GQMA 2HRFA 4H86A 17GSA 1UC7A 5DAKA 3WGEA 1DE1A 4BWQA 4GCIA 1EOGA 4IQ1A 1YJ6A 1K0MA 2MMZA 4NWYA 1Y25A 2OJLA 2H1DA 4ILFA 1PL2A 4Q5NA 5BMUA 2H0GA 10GSA 5B8AA 1V9WA 2RM5A 3MDKA 1XW6A 4G0LA 3CTGA 1Z7PA 3QAGA 3WGXA 4G9HA 1B9XC 3GA4A 2O89A 4G0IA 3Q6OA 2AV4A 4IJ3A 1QK8A 4EDZA 2R37A 2LTKA 5F06A 5HR2A 5E59A 1KEBA 2BTOT 1T00A 4O92A 1Z5YE 2GS3A 3BCIA 4PGTA 3TKSE 6GSVA 6GSXA 2LV3A 4J2FA 3TGZA 3VWVA 4KAEA 5GSTA 2G0FA 1WMJA 4YH2A 4BVXB 2CVBA 4MJEA 2XBQA 4N11A 3U6VA 4WF5A 3J7Yk 2V41A 3GFKA 3FRCA 1OC3A 1IYIA 4L5LA 1BX9A 4AJ7A 4KA0A 2HSMB 5D9XA 4HOJA 1A8YA 3AY8A 3I9V2 3IA1A 1G7OA 4O7HA 3RBTA 4WXTA 4IS0A 2OACA 2H1GA 2RLIA 3TOTA 2R3XA 2JZSA 2B5YA 4BVYB 4ZXGA 3ED3A 4DVCA 2C8UA 1NM3A 4IKHA 1NSWA 2J9HA 3P90A 3PINA 4OMVA 3FK8A 3GX8A 5AGYA 1IYHA 4TXOB 3IRAA 5D9WA 4X0XA 1GSFA 1F9MA 3KP8A 2DJ0A 2FWEA 3J7Yb 5ELGA 4PQ1A 2EIQA 4GSTA 3LGCA 5D9TA 3SBCA 2M72A 2L4CA 1YKCA 3LYKA 4XCSA 1ZCPA 2YWIA 4EF0A 5F05A 1DUGA 3VWXA 3CSIA 3P7XA 1F37A 1PRXA 4POMA 2B6MA 2H6ZA 2VOCA 4WEYA 4IN0A 5KN1A 3TB2A 2FA4A 5G1KA 2LJAA 5F8BA 2AYTA 3C73A 2VAFA 2GT5A 2AAWA 5IPGA 5HFIA 3IHQA 1QXHA 4K6XA 4EVMA 1EP7A 4RQXA 1PMTA 2YN1A 1K0OA 1ILOA 2C0DA 4F82A 1XWCA 4ZIJA 2QKEA 3PGTA 4V1Ap 2X8CA 1SJZA 3DVXA 3NIVA 2TRCP 4TKYA 4MJAA 3Q18A 2PGTA 4N10A 1OYJA 2LRNA 4MZCA 2OBIA 3W8SA 1OE8A 2IMIA 4HUAA 5JCGA 2GSTA 3EINA 2FWFA 3HDCA 2PPTA 4JRRA 2HSHA 1F2EA 5A4WA 1AC1A 1GSSA 3D4MA 4MJBA 5DCHA 2DSAA 2DJ1A 1O6JA 1TK5B 4GQFA 3L9SA 4XIHA 5IMDA 2KP1A 2ZUPA 3F4RA 2PBJA 1A2LA 5LD0A 4F0BA 1BYEA 4ZL8A 4QQ7A 3IAS2 1NHOA 5ENUA 1EV4A 5ECMB 4Q5RA 4P3YB 4ML6A 1YF1A 2E2GA 1Z6MA 3IE3A 2HXKA 4EL1A 4G0KA 3A2VA 5G1LA 4LLRA 3LXZA 2CZ3A 5COHA 3HJOA 2HZEB 4K2DA 4KE3A 4KUNA 5D8IA 3GHAA 4XS1A 3JCML 2YANA 3E0UA 1V2AA 2MBTA 4X1UA 3G9BA 3ZIJA 4FYUA 2H72A 1I9DA 4FYBA 4MCUA 2K9FA 3F4SA 3NZNA 5DAKB 2CT6A 2I4AA 1K0DA 1OC9A 2FUG2 1VF1A 1TK8B 3P2AA 2H0IA 4EXJA 2FNOA 3IBHA 5AN1A 1XWKA 4RI6A 4MLYA 1T7PB 1VF3A 3TJGA 3UVTA 1ACVA 2JSZA 5DQYA 1A2JA 1S3CA 4XTSA 5DJMA 3VPTA 4FO5A 1HNCA 3M3MA 1VF2A 1TI1A 1MD4A 2WZ9A 1OAZA 2NPBA 4TR1A 4JZQA 1EEMA 1OVNA 3C8EA 1B4QA 2PUKC 3W8JA 2J23A 5IM9A 4OFTA 1Z3EA 13GSA 5JWRB 2CAIA 2H73A 2KHPA 2DMLA 3A3TA 2H0HA 3LQ7A 3MAKA 1OKDA 3ZMKA 3TKRA 1M2BA 2YCDA 4D73A 3EYTA 2L59A 1SK0A 2IMFA 4WBRD 4PQIA 4ZBAA 5IMZA 2A2RA 2YWMA 4KW6A 1V57A 4K7OA 1VF4A 3PPUA 1ERWA 2H76A 1LU4A 2YPMA 3HHVA 1SJIA 1XW9A 2LUSA 5ECPB 2FY6A 2PVQA 1MD3A 1GUKA 5D73A 4F0CA 3EVIA 1B48A 3F3QA 3TOUA 3HJPA 4G2EA 1A8LA 2N5FA 1Z9HA 5CNWA 2QGVA 4XS4B 2QC7A 5CP1A 1GSYA 4MK3A 2EC4A 4PQHA 1T4ZA 5D96A 1TU7A 4V2MA 2JADA 1WRYA 5FHIA 3LFLA 4MJCA 5CYYA 4G10A 1M0UA 5LNKe 3CSHA 3TKQA 4OCEA 4L0UA 2YWNA 4XRAA 2C0GA 3R3EA 4FIWA 5CRGA 3QOUA 1XPVA 1Z7RA 2PERA 4DSRA 3IK9A 4NHWA 5IIZA 2FA8A 2FWGA 3QDNA 3ZZXA 2OE0A 2WCIA 1G7EA 16GSA 5GAND 1SKWB 2FD3A 2L6DA 1WJKA 4YAVA 3P8WA 2IWTA 1CQHA 5C04A 1XW5A 4X43A 4EC0A 4L5OA 1K0CA 3QR6A 1JZRA 3WGDA 3BOAA 2VCTA 1XVWA 1BAYA 2OE3A 2LNSA 3KTLA 3WYWA 5KN0A 3TKSA 4IBPA 2ZCTA 5HR0A 2VD0A 5CRWA 1FHEA 5ECKB 3KM6A 4GRFA 3NOFA 4OWYA 1QFNA 3F3RA 1TJDA 2NVLA 1OKTA 1J0FA 3QPMA 2CA8A 5ECOB 3W6GA 2UZ8A 4JE1A 3O3TA 2GLRA 5G2ZA 1FB6A 2C3TA 3FYGA 2P0GA 5C00A 1TU8A 3GSSA 2R5GA 1FO5A 1EWXA 5A5KA 3IXRA 1HD2A 3ERWA 1HNBA 1G0TA 3WT1A 1XIYA 4MF7A 1XZOA 2A2SA 3VLNA 1AAZA 1T4YA 1KBNA 5JWQB 3UOMA 1Y6EA 5EY6A 1ON4A 2WFCA 2CV4A 1GSUA 1AQWA 3CRTA 4K0NA 3HVVA 1I5GA 1MTCA 2RIIA 1EGRA 2JSYA 3GL5A 14GSA 3E3EA 3KP9A 1R5AA 3KIJA 4O32A 2RUFA 5HQPA 2GGTA 2YP6A 1B8XA 1K0NA 2IFQA 3LORA 3OR5A 5KN3A 1X9SB 2MMAA 4POBA 3KZQA 2VL2A 1PGTA 3FZ5A 1AQVA 3VWUA 1OC9B 3HVXA 1XOBA 3KTBA 12GSA 3TRXA 1J08A 2HNLA 1EEJA 4MPGA 2YZUA 2VLUA 1YF0A 3QFAC 3ME8A 3RPPA 3LG6A 1QUWA 1FVKA 2VLVA 3UARA 4I2TA 3F9UA 1QQ2A 3VURA 2GZPA 4GWRA 4IJIA 3APSA 2B1LA 2B1KA 5ELAA 3KMNA 2HSNB 1WIKA 1XWGA 1GL8A 1MEKA 5IMAA 1N8JA 2EIOA 3HY2A 4Q5QA 2IMDA 1M9AA 3ZRDA 3EU3A 3QAVA 3KCMA 4ZL9A 3O6TA 4KF9A 3H79A 3D0ZA 1YEXA 1UA5A 4E8HA 2JL4A 1R5PA 4GTUA 2VCZA 2XHFA 4PUFC 3KEBA 2X64A 2XPEA 1VGLA 2VLTA 4I8BA 2HLSA 2XBIA 3EMPA 2HE3A 2IMKA 3D22A 1B9YC 5IMCA 3KGKA 2GTUA 2ES7A 4DSSA 2K6VA 1B4PA 1YY7A 4OFNA 4FH8A 1LJRA 2I1UA 3LSZA 4KDUA 4WKWA 2FCHA 2B7KA 3C1RA 2H75A 1SU9A 3DWVA 5IMFA 3HA9A 2B5XA 3FHKA 4TXVA 4NV5A 3GKMA 2GSQA 5J9BA 5ECQB 1ZYEA 4CHSA 2LQOA 2IMEA 2CAQA 1TTZA 3VI7A 3TCOA 3EWLA 3CYNA 4CW9A 2F8AA 2FWHA 2VD1A 2H1AA 3QAWA 5EPFA 4NHZA 1OE7A 4ECIA 3U5RE 4QL9A 1T8EB 3UAPA
chains in the Genus database with same CATH superfamily
2I3YA 2CX4A 2PN8A 3H1NA 2X49A 3Q74A 1PSQA 1X9MB 4LL4B 3GTUA 3LJRA 3MNGA 1A23A 1GP1A 1YVLA 4N3ZA 3MYDA 1JFUA 4MP4A 5ECSA 3GUSA 2QA1A 1EGOA 2VCWA 3L4NA 4XS6A 4YAPA 5ECLB 1SK1A 4MABA 1DSBA 5EL8A 3UIWA 1GSQA 4ZILA 1SKRB 2VM2A 4USSA 4G19A 4IVFA 5CAXA 1X5CA 2E0QA 4PXOA 5A1NA 4GQCA 2C80A 1GLPA 4BL7A 1YKAA 2OE1A 2RM6A 1GULA 1USBA 4I5QA 4AKIA 1M99A 3TKPA 3KJYA 4V2NA 2GZYA 5CRDA 1VRSD 3C1SA 5A4VA 3C71A 4ACSA 3FW2A 4NV2A 1CQGA 4ZB7A 2GZZA 3E9JB 3TJBA 2ON5A 2WB9A 1SYRA 4EIQA 5HFKA 2OA7A 1RK4A 4AF2A 4JBBA 2DJ2A 1F3BA 5CREA 5JCWA 4ZBBA 2M46A 4QL7A 2YV7A 2V6OA 1T3BA 5B8BA 2HRKA 2LQQA 3F0IA 2H71A 2C0FA 4GSNA 1E6BA 4OD7A 2VL3A 3TJFA 2MMNA 3A2XA 2KOKA 4TR4A 2AHEA 3FZ9A 3F4TA 1TK0B 2LS5A 1K3LA 4MZWA 4K7IA 4AJ8A 4MF6A 5D93A 1J9BA 4TR0A 1MDJA 2DBCA 1BEDA 1PX6A 2ALBA 2IPAA 3ERFA 4YQUA 5L71A 2IFQB 5IOWA 1I1IP 1M2AA 3CXGA 4WBJA 1AQXA 5A4UA 1X0RA 2C4JA 1U87A 5KN2A 2O85A 3US3A 3UL3A 4NXIA 3H4KA 2HRAA 4TRXA 3A2WA 1FW1A 4BVYA 2PU9C 1EZKA 1TI3A 5H5RA 2M80A 3DIEA 4HJMA 4Z7XA 4Q5FA 3GN3A 3VWWA 4L8EA 4JR4A 4EKZA 1N2AA 4F2IA 1G6WA 3EMXA 1JZDA 3CRUA 4Z2RA 5KEJA 4HJ2A 3VFIA 4ECJA 2N5BA 1ZMAA 1JZOA 2LSTA 2LRCA 4ECCA 2FHEA 3GMFA 3LEFA 18GSA 5DCGA 4HQZA 5F0GA 2PMTA 1K3YA 4KDXA 2HFDA 1WOUA 3ZYWA 2TIRA 3SWLA 1PKWA 1HQOA 4MF5A 3ERGA 2DLXA 3BBYA 2F3MA 2VCXA 4LL1B 4GLTA 1GNWA 2V6KA 3DXBA 3IOSA 2WULA 2V1MA 4ZB8A 2P5RA 2AB6A 4AGSA 5JWOB 20GSA 3ZL5A 5CRHA 2H66A 4WR4A 1QMVA 2NBSA 4PX1A 1NW2A 4HSCX 3RHBA 2AJQB 1TOFA 2WW0A 3QFBC 4TN8A 1YDKA 3LXTA 2ZNMA 4ICYA 4DSSB 4IHUA 2WW2A 1LBKA 2L5OA 4MNNA 1W89A 1SD8A 2LRTA 1YEPA 3WD6A 1S3DA 4KSMA 1GLQA 5E4WA 1SJ6A 2K18A 2MBSA 5J41A 4YQVA 4LMVA 5A34B 4N0VA 4EUYA 2LJRA 3KH9A 4F9ZA 2DJJA 2B3SA 2WVZA 3DVWA 2H30A 3DYRA 4Z2TA 3N5OA 4IW9A 4RUVA 1TP9A 3TJJA 5ID2A 2MZCA 5J3RA 4HEA2 1NHYA 2L4QA 2X8HA 4CY8A 11GSA 1ERUA 3IDVA 1O81A 3TRQA 5DJLA 4MPFA 2HQTA 5FT3A 2DKIA 3CMIA 1KNGA 4V2LA 3KD0A 2V2GA 2R0PA 4KGIA 1BF5A 1JLWA 4BWSA 3M1GA 5IMVA 5ECRB 4BA7A 1BG5A 2YNXA 3ME7A 3IHGA 3QMXA 5ECNB 2IIYA 3UEMA 2TRXA 2YV9A 3FR3A 3N9JA 4KCEA 1XBSA 4ZBDA 1SYXA 3GTUB 1AW9A 4YQMA 2VCQA 1SK2A 3MWHA 1GWCA 2HZEA 4K0GA 3D4TA 4WR5A 1U88A 2PVOC 2AUVA 2DJ3A 1SKSB 3DGQA 2OADA 2H74A 4OFMA 3IC4A 2REMA 1GTUA 1TXXA 4FXYP 5DBQA 4TVEA 2C3NA 1PA3A 1ERVA 6GSYA 3ZVJD 3GX0A 3D6IA 2VO4A 2FLSA 3EC3A 3CWGA 4OO5A 1SL0B 3CHXC 3F6DA 1PFOA 3ISOA 3FR9A 2X99A 2MYGA 1TRSA 2L6CA 1S3AA 3RAZA 5A1NB 2DKHA 3TU3B 5B6MA 3GV1A 4BL7B 1QGVA 2GT6A 4KNDA 1W4VA 4DSQA 1G6YA 3ZTLA 1ZZYA 3DEXA 3M9KA 3FZ4A 4GSSA 2V32A 3IV4A 4HS1A 2GVPA 1THXA 3K8NA 2XC2A 1SL1B 1U3AA 1PX7A 6GSWA 1EV9A 3IR4A 3G7JA 4ID0A 5CO3A 4TOPA 2R2JA 2F8FA 1WPIA 3CSJA 3I69A 3FZAA 2HRKB 4ZB9A 4AI6A 4I97A 1JLVA 5DQSA 2HRNA 2JACA 4EO3A 1URMA 1GSDA 4F03A 5HR1A 2PWJA 2A4VA 2QSIA 2OBKA 1GSEA 1AIUA 4WF4A 2GQKA 3LYPA 2VCVA 4TR1B 19GSA 2NDOA 5IPHA 1ML6A 3H93A 2IJYA 2O3EA 1PN9A 4KH7A 1DE2A 5IO2A 3TRPA 3S9FA 1GTAA 1Z6NA 4TW5A 4MA9A 3L78A 3BCKA 4ZB6A 2C3QA 2OKAA 4RI7A 5HR3A 1HYUA 3QCPA 4NAXA 2L57A 1XVQA 2LKUA 2I81A 3UVHA 2E7PA 2VIMA 3GKKA 1GUHA 1PQNA 4KB3A 3GSTA 4MDCA 3FEUA 4D73B 1BQ7A 1DBYA 3HCZA 4RQRA 3IPZA 1RQMA 2HZFA 2VM1A 5G31A 4XS4A 2CVDA 3F8UA 4BPYA 3M0FA 4K8MA 2HI7A 2CVKA 3GKNA 1R4WA 4OO4A 1KTEA 1H75A 2DIZA 4KCAA 3TKSC 1UVZA 2VL9A 2LNTA 3EU4A 4PNGA 5DALA 3VK9A 3ZMLA 1WP0A 4MH2A 4TR3A 2HYXA 2VKZG 3BD2A 1ZGNA 3L0HA 4EIPA 4IQAA 1C72A 1MDKA 3ZFLA 1A24A 4N30A 1A0FA 2H1BA 3G7IA 4HI7A 3M8NA 1Q4JA 3HZ8A 3FR6A 3ZITA 2A4HA 3KMOA 2GSSA 3Q19A 5AIVA 2F51A 2DJKA 2XPDA 2JZRA 1JZWA 3HJMA 1U6TA 4WETA 3GIXA 2P5QA 1Q98A 2L5LA 4GF0A 2K8SA 5AIXA 4Z2UA 5B7CA 2GSRA 4AKHA 1TKDB 2EIRA 4HDEA 4OCFA 1FOHA 3ZFBA 3HXSA 3VI5A 3GH6A 4J56E 2HT9A 4K1FA 1FG4A 1M9BA 5J9CA 2A2PA 1ST9A 2K8VA 5H5SA 4MMMA 1MDIA 2D2ZA 1PD21 3IC8A 5FWGA 5HFGA 5ID2B 4MZBA 2H8LA 2O87A 4K5SA 1O8XA 3EPTA 2VL2C 4I6XA 3F63A 2IL3A 1TRVA 3CQFA 2I9HA 4HU7A 4JEDA 4PNFA 3ZREA 2ON7A 1UN2A 4I2UA 1TW9A 2RUEA 5F07A 4XRDA 4K7NA 3ZVJA 2B7JA 2H6YA 1YQ1A 1XWAA 3FKFA 4PUAA 2WGRA 4J57E 1O7UA 1RW1A 5ABRA 3QD9A 1XOAA 1PL1A 4N0ZA 2HSYA 5IO0A 3G7YA 5INYA 4NPBA 2R0GA 4K9ZA 1GNEA 4IGJA 4IELA 3TDGA 2H19A 2KLXA 4KX4A 4HZ4A 4PI2C 3GYKA 2DMMA 3R2QA 4K2XA 1THOA 2DIYA 4ECBA 1SD9A 2KP2A 1FAAA 1TDIA 1FOVA 3ZIVA 4BVXA 2C0EA 5LCZA 5DDLA 1SVOA 2CZ2A 4G01A 1F6MC 1XCCA 2E2MA 6GSTA 3C7MA 1F3AA 1OC8A 2F9SA 2KUCA 2HSMA 3GNJA 3CBUA 3HVSA 1SL2B 3APOA 7GSSA 5GSSA 3KXOA 4O5RA 2IN3A 1K3OA 4GXZA 3GL3A 4HQSA 1TRWA 3F6FA 2C1YA 3UBLA 2Z9SA 1GUMA 9GSSA 3VPQA 3TUEA 2R6KA 3APQA 4E8EA 4AKXB 3ZLPA 1ERTA 4GDFA 1TRUA 4ULXA 4LMWA 4V1Ag 2JZTA 4W66A 4L0WA 4ISDA 2YOIA 4HU9A 2WW3A 3UMAA 4TXOA 4DEJA 3GKXA 3D21A 2G2QA 1A0RP 5GZZB 5ECHB 4POKA 1BJXA 3KH7A 4HZ2A 4EE0A 1M2DA 3GH9A 1XWBA 5G5EA 1K0AA 5J4UA 5IQYA 2H70A 1GTIA 4KDYA 3UJ1A 5IOXA 4NMUA 2BMXA 1WWJA 2B5EA 1ZYQB 1AUCA 3O76A 2LJKA 1E2YA 1HNAA 6GSSA 4MH3A 3MSZA 1O73A 3CTFA 3HD5A 1ZYNA 1X9WB 5BRTA 4KSOA 3IK7A 1U3IA 3V1WA 3L9VA 1WE0A 2O8VB 1FVJA 3TJKA 4XHMA 8GSSA 4A5PA 1XXUA 3LWAA 1O85A 2MMOA 5H5QA 4IP6A 1JHBA 3RHCA 1H4OA 2LEGA 1X5EA 3WT2A 3GRXA 2H01A 1ZOFA 4JR6A 2CQ9A 1ZYPA 1Y1UA 3M9JA 2BJXA 1XFLA 1V40A 3HYPA 3FY7A 2O7KA 2WRTA 1GH2A 2WDUA 3L9UA 1FB0A 1GTBA 2VUPA 3PR8A 3H8QA 3GURA 4ML1A 1S3RA 2X8GA 1ZL9A 1R26A 5G30A 4EDYA 3DRNA 2DC5A 2WVXA 2X4AA 2WW1A 1V58A 4PHZC 4FYCA 2FGXA 2H6XA 3PH9A 2P31A 1AXDA 1O8WA 5B6NA 5JCUA 3D5JA 5DALB 4PTSA 1PKZA 1EOHA 4ZL7A 1ABAA 1GRXA 5AISA 3RPNA 4CDOA 1YZXA 3DD3A 4FQUA 2GDRA 3DMLA 22GSA 4O5UA 1EP8A 3A5WA 4LA1A 2YZHA 3HKRA 5DVBA 1K0BA 4PURA 2CX3A 2R4VA 1T1VA 1M7TA 2YJ7A 4POLA 3I6AA 1V98A 2GQLA 2YWOA 2UV8G 3DKSA 5D9VA 5ECIB 3IAM2 1R7HA 3EURA 3HZ4A 2WJUA 3UBKA 2NTOA 5G5FA 1SENA 3I43A 2O36A 1A2MA 1X5DA 5EVOA 3BJ5A 2N5AA 2YJHA 1XG8A 4JU5A 3RDWA 4AJ6A 5J5NA 2JU5A 4K5RA 5GAPD 6GSUA 4IP1A 2WS2A 3EE2A 2GQMA 2HRFA 4H86A 17GSA 1UC7A 5DAKA 4O5QA 3WGEA 1DE1A 4BWQA 4GCIA 1EOGA 2EFDA 4IQ1A 1YJ6A 1K0MA 2MMZA 4NWYA 1Y25A 2OJLA 1PN0A 2H1DA 4ILFA 1PL2A 4Q5NA 5BMUA 2H0GA 10GSA 5B8AA 1V9WA 2RM5A 3MDKA 1XW6A 4G0LA 3CTGA 1Z7PA 3QAGA 3WGXA 4G9HA 1B9XC 3GA4A 2O89A 4G0IA 3Q6OA 2AV4A 4IJ3A 1QK8A 4EDZA 2R37A 2LTKA 5F06A 5HR2A 5E59A 1KEBA 2BTOT 1T00A 5A5HA 4O92A 2QA2A 1Z5YE 2GS3A 3BCIA 4PGTA 3TKSE 6GSVA 6GSXA 2LV3A 4J2FA 3TGZA 3VWVA 4KAEA 5GSTA 4CY6A 2G0FA 4PI0C 1WMJA 4YH2A 4BVXB 2CVBA 4MJEA 1SVLA 2XBQA 4N11A 3U6VA 4WF5A 3J7Yk 2V41A 3GFKA 1M3IA 3FRCA 1OC3A 1IYIA 4L5LA 1BX9A 4AJ7A 4KA0A 2HSMB 5D9XA 4HOJA 1A8YA 3AY8A 3I9V2 2OT3A 3IA1A 1G7OA 4O7HA 3RBTA 4WXTA 4IS0A 2OACA 2H1GA 2RLIA 3TOTA 2R3XA 2JZSA 2B5YA 4BVYB 4ZXGA 3ED3A 4DVCA 2C8UA 1NM3A 4IKHA 1NSWA 2J9HA 3P90A 3PINA 4OMVA 3FK8A 3GX8A 5AGYA 1IYHA 4TXOB 3LW9A 3IRAA 5D9WA 4X0XA 1GSFA 1F9MA 3KP8A 2DJ0A 2FWEA 3J7Yb 5ELGA 4PQ1A 2EIQA 4GSTA 3LGCA 5D9TA 3SBCA 2M72A 2L4CA 1YKCA 3LYKA 4XCSA 1ZCPA 2YWIA 4EF0A 5F05A 2EFEA 1DUGA 3VWXA 3CSIA 3P7XA 1F37A 1PRXA 4POMA 2B6MA 2H6ZA 2VOCA 4WEYA 4IN0A 5KN1A 3TB2A 2FA4A 5G1KA 2LJAA 5F8BA 2AYTA 3C73A 4AKGA 2VAFA 2GT5A 2AAWA 5IPGA 5HFIA 3IHQA 1QXHA 4K6XA 4EVMA 1EP7A 4RQXA 1PMTA 2YN1A 1K0OA 2WVXB 1ILOA 2C0DA 4F82A 1XWCA 4ZIJA 2QKEA 3PGTA 4V1Ap 1S4BP 2X8CA 1SJZA 3DVXA 3NIVA 2TRCP 4TKYA 4MJAA 3Q18A 2PGTA 4N10A 1OYJA 2LRNA 4MZCA 2OBIA 3W8SA 1OE8A 2IMIA 4HUAA 5JCGA 2GSTA 3EINA 2FWFA 3HDCA 5J40A 2PPTA 4JRRA 2HSHA 5J4VA 1F2EA 5A4WA 1AC1A 1GSSA 3D4MA 4MJBA 5DCHA 2DSAA 2DJ1A 1O6JA 1TK5B 4YKGA 4GQFA 3L9SA 4XIHA 5IMDA 2KP1A 2ZUPA 3F4RA 2PBJA 1A2LA 5LD0A 4F0BA 1BYEA 4ZL8A 4QQ7A 3IAS2 1BG1A 1NHOA 5ENUA 1EV4A 5ECMB 4Q5RA 4P3YB 3MIXA 4ML6A 1YF1A 4X4JA 2E2GA 1Z6MA 3IE3A 2HXKA 4EL1A 4G0KA 3A2VA 5J4YA 5G1LA 4LLRA 3LXZA 2CZ3A 5COHA 3HJOA 2HZEB 4K2DA 4KE3A 4KUNA 5D8IA 4QMKA 3GHAA 4XS1A 3JCML 2YANA 3E0UA 1V2AA 2MBTA 4X1UA 3G9BA 3ZIJA 4FYUA 2H72A 1I9DA 4FYBA 4MCUA 2K9FA 3F4SA 3NZNA 4E68A 5DAKB 2CT6A 2I4AA 1K0DA 2EFCA 1OC9A 2FUG2 1VF1A 1TK8B 3P2AA 2H0IA 4EXJA 2FNOA 3IBHA 5AN1A 1XWKA 5BMUB 4RI6A 4MLYA 1T7PB 1VF3A 3TJGA 3UVTA 1ACVA 2JSZA 5DQYA 1A2JA 1S3CA 4XTSA 5DJMA 3VPTA 4FO5A 1HNCA 3M3MA 1VF2A 1TI1A 1MD4A 2WZ9A 1OAZA 2NPBA 4TR1A 4JZQA 5A5HB 1EEMA 2HSNA 1OVNA 3C8EA 1B4QA 2PUKC 3W8JA 2J23A 5IM9A 4OFTA 1Z3EA 13GSA 5JWRB 2O5VA 2CAIA 4YKFA 2H73A 2KHPA 2DMLA 3A3TA 2H0HA 3LQ7A 3MAKA 1OKDA 3ZMKA 3TKRA 1M2BA 2YCDA 4D73A 3EYTA 2L59A 1SK0A 4BIKA 2IMFA 4WBRD 4PQIA 4ZBAA 5IMZA 2A2RA 2YWMA 1TXUA 4KW6A 1V57A 4K7OA 1VF4A 3PPUA 1ERWA 2H76A 2H1LA 1LU4A 2YPMA 3HHVA 1SJIA 1XW9A 2LUSA 5ECPB 2FY6A 3RGBC 2PVQA 1MD3A 1GUKA 5D73A 4F0CA 3EVIA 1B48A 3F3QA 3TOUA 3HJPA 4G2EA 1A8LA 2N5FA 1Z9HA 5CNWA 2QGVA 4XS4B 2QC7A 5CP1A 1GSYA 4MK3A 2EC4A 4PQHA 5KOWA 1T4ZA 5D96A 1TU7A 4V2MA 5J47A 2JADA 1WRYA 5FHIA 3LFLA 4MJCA 5CYYA 4G10A 1M0UA 5LNKe 3CSHA 3TKQA 4OCEA 4L0UA 2YWNA 4XRAA 2C0GA 3R3EA 4FIWA 5CRGA 3QOUA 1XPVA 1Z7RA 2PERA 3HVNA 4DSRA 3IK9A 4NHWA 5IIZA 2FA8A 2FWGA 3QDNA 3ZZXA 2OE0A 2WCIA 1G7EA 16GSA 5GAND 1SKWB 2FD3A 2L6DA 1WJKA 4YAVA 1SVMA 3P8WA 2IWTA 1CQHA 5C04A 1XW5A 4X43A 4EC0A 4L5OA 1K0CA 3QR6A 1N25A 1JZRA 3WGDA 3A5IA 3BOAA 2VCTA 1XVWA 1BAYA 2OE3A 2LNSA 3KTLA 3WYWA 5KN0A 3TKSA 2WVYA 4IBPA 2ZCTA 5HR0A 2VD0A 5CRWA 1FHEA 5ECKB 3KM6A 4GRFA 3NOFA 4OWYA 1QFNA 3F3RA 1TJDA 2NVLA 1OKTA 1J0FA 3QPMA 2R0CA 2CA8A 5ECOB 3W6GA 2UZ8A 4JE1A 3O3TA 2GLRA 5G2ZA 1FB6A 2C3TA 3FYGA 2P0GA 5C00A 1TU8A 3GSSA 2R5GA 3FMWA 1FO5A 1EWXA 5A5KA 3IXRA 1HD2A 3ERWA 1HNBA 1G0TA 3WT1A 1XIYA 4MF7A 1XZOA 2A2SA 3VLNA 3HMJG 1AAZA 1T4YA 1KBNA 5JWQB 3UOMA 1Y6EA 5EY6A 1ON4A 2WFCA 2CV4A 1GSUA 1AQWA 3CRTA 4K0NA 3HVVA 1I5GA 1MTCA 2RIIA 1EGRA 2JSYA 3GL5A 14GSA 3E3EA 3KP9A 1R5AA 3KIJA 4O32A 2RUFA 5HQPA 2GGTA 2YP6A 1B8XA 1K0NA 2IFQA 3LORA 3OR5A 5KN3A 1X9SB 2MMAA 4POBA 3KZQA 2VL2A 1PGTA 3FZ5A 1AQVA 3VWUA 1OC9B 3HVXA 1XOBA 3KTBA 12GSA 3TRXA 1J08A 2HNLA 1EEJA 4MPGA 2YZUA 2VLUA 1YF0A 3QFAC 3ME8A 3RPPA 3LG6A 3RFRC 1QUWA 1FVKA 2VLVA 1YEWC 3UARA 4I2TA 3F9UA 1QQ2A 3VURA 2GZPA 4GWRA 4IJIA 3APSA 2B1LA 2B1KA 5ELAA 3KMNA 2HSNB 1WIKA 1XWGA 1GL8A 1MEKA 5IMAA 1N8JA 2EIOA 3HY2A 4Q5QA 2IMDA 1M9AA 3ZRDA 3EU3A 3QAVA 3KCMA 4ZL9A 3O6TA 4KF9A 3H79A 3D0ZA 1YEXA 1UA5A 2WZSA 1M3JA 4E8HA 2JL4A 1R5PA 4GTUA 2VCZA 2XHFA 4PUFC 3KEBA 2X64A 2XPEA 1VGLA 2EFHA 2VLTA 4I8BA 2HLSA 2XBIA 3EMPA 2HE3A 2IMKA 3D22A 1B9YC 5IMCA 3KGKA 2GTUA 2ES7A 4DSSA 2K6VA 1B4PA 1YY7A 4OFNA 4FH8A 1LJRA 2I1UA 3LSZA 4KDUA 4WKWA 2FCHA 2B7KA 3C1RA 2H75A 1SU9A 3DWVA 5IMFA 3HA9A 5KOXA 5A34A 2B5XA 3FHKA 4TXVA 4NV5A 3GKMA 2GSQA 5J9BA 5ECQB 1ZYEA 4CHSA 2LQOA 2IMEA 2CAQA 1TTZA 3VI7A 3TCOA 3EWLA 3CYNA 4CW9A 2F8AA 2FWHA 2VD1A 2H1AA 3QAWA 5EPFA 4NHZA 1OE7A 4ECIA 3U5RE 4QL9A 1T8EB 3UAPA
chains in the Genus database with same CATH topology
2I3YA 2CX4A 2PN8A 3H1NA 2X49A 3Q74A 1PSQA 1X9MB 4LL4B 3GTUA 3LJRA 3MNGA 1A23A 1GP1A 1YVLA 4N3ZA 3MYDA 1JFUA 4MP4A 5ECSA 3GUSA 2QA1A 1EGOA 2VCWA 3L4NA 4XS6A 4YAPA 5ECLB 1SK1A 4MABA 1DSBA 5EL8A 3UIWA 1GSQA 4ZILA 1SKRB 2VM2A 4USSA 4G19A 4IVFA 5CAXA 1X5CA 2E0QA 4PXOA 5A1NA 4GQCA 2C80A 1GLPA 4BL7A 1YKAA 2OE1A 2RM6A 1GULA 1USBA 4I5QA 4AKIA 1M99A 3TKPA 3KJYA 4V2NA 2GZYA 5CRDA 1VRSD 3C1SA 5A4VA 3C71A 4ACSA 3FW2A 4NV2A 1CQGA 4ZB7A 2GZZA 3E9JB 3TJBA 2ON5A 2WB9A 1SYRA 4EIQA 5HFKA 2OA7A 1RK4A 4AF2A 4JBBA 2DJ2A 1F3BA 5CREA 5JCWA 4ZBBA 2M46A 4QL7A 2YV7A 2V6OA 1T3BA 5B8BA 2HRKA 2LQQA 3F0IA 2H71A 2C0FA 4GSNA 1E6BA 4OD7A 2VL3A 3TJFA 2MMNA 3A2XA 2KOKA 4TR4A 2AHEA 3FZ9A 3F4TA 1TK0B 2LS5A 1K3LA 4MZWA 4K7IA 4AJ8A 4MF6A 5D93A 1J9BA 4TR0A 1MDJA 2DBCA 1BEDA 1PX6A 2ALBA 2IPAA 3ERFA 4YQUA 5L71A 2IFQB 5IOWA 1M2AA 3CXGA 4WBJA 1AQXA 5A4UA 1X0RA 2C4JA 1U87A 5KN2A 2O85A 3US3A 3UL3A 4NXIA 3H4KA 2HRAA 4TRXA 3A2WA 1FW1A 4BVYA 2PU9C 1EZKA 1TI3A 5H5RA 2M80A 3DIEA 4HJMA 4Z7XA 4Q5FA 3GN3A 3VWWA 4L8EA 4JR4A 4EKZA 1N2AA 4F2IA 1G6WA 3EMXA 1JZDA 3CRUA 4Z2RA 5KEJA 4HJ2A 3VFIA 4ECJA 2N5BA 1ZMAA 1JZOA 2LSTA 2LRCA 4ECCA 2FHEA 3GMFA 3LEFA 18GSA 5DCGA 4HQZA 5F0GA 2PMTA 1K3YA 4KDXA 2HFDA 1WOUA 3ZYWA 2TIRA 3SWLA 1PKWA 1HQOA 4MF5A 3ERGA 2DLXA 3BBYA 2F3MA 2VCXA 4LL1B 4GLTA 1GNWA 2V6KA 3DXBA 3IOSA 2WULA 2V1MA 4ZB8A 2P5RA 2AB6A 4AGSA 5JWOB 20GSA 3ZL5A 5CRHA 2H66A 4WR4A 1QMVA 2NBSA 4PX1A 1NW2A 3RHBA 2AJQB 1TOFA 3QFBC 4TN8A 1YDKA 3LXTA 2ZNMA 4ICYA 4DSSB 4IHUA 1LBKA 2L5OA 4MNNA 1W89A 1SD8A 2LRTA 1YEPA 3WD6A 1S3DA 4KSMA 1GLQA 5E4WA 1SJ6A 2K18A 2MBSA 5J41A 4YQVA 4LMVA 5A34B 4N0VA 4EUYA 2LJRA 3KH9A 4F9ZA 2DJJA 2B3SA 3DVWA 2H30A 3DYRA 4Z2TA 3N5OA 4IW9A 4RUVA 1TP9A 3TJJA 5ID2A 2MZCA 5J3RA 4HEA2 1NHYA 2L4QA 2X8HA 4CY8A 11GSA 1ERUA 3IDVA 1O81A 3TRQA 5DJLA 4MPFA 2HQTA 5FT3A 2DKIA 3CMIA 1KNGA 4V2LA 3KD0A 2V2GA 2R0PA 4KGIA 1BF5A 1JLWA 4BWSA 3M1GA 5IMVA 5ECRB 4BA7A 1BG5A 2YNXA 3ME7A 3IHGA 3QMXA 5ECNB 2IIYA 3UEMA 2TRXA 2YV9A 3FR3A 3N9JA 4KCEA 1XBSA 4ZBDA 1SYXA 3GTUB 1AW9A 4YQMA 2VCQA 1SK2A 3MWHA 1GWCA 2HZEA 4K0GA 3D4TA 4WR5A 1U88A 2PVOC 2AUVA 2DJ3A 1SKSB 3DGQA 2OADA 2H74A 4OFMA 3IC4A 2REMA 1GTUA 1TXXA 5DBQA 4TVEA 2C3NA 1PA3A 1ERVA 6GSYA 3ZVJD 3GX0A 3D6IA 2VO4A 2FLSA 3EC3A 3CWGA 4OO5A 1SL0B 3F6DA 3ISOA 3FR9A 2X99A 2MYGA 1TRSA 2L6CA 1S3AA 3RAZA 5A1NB 2DKHA 3TU3B 5B6MA 3GV1A 4BL7B 1QGVA 2GT6A 4KNDA 1W4VA 4DSQA 1G6YA 3ZTLA 1ZZYA 3DEXA 3M9KA 3FZ4A 4GSSA 2V32A 3IV4A 4HS1A 2GVPA 1THXA 3K8NA 2XC2A 1SL1B 1U3AA 1PX7A 6GSWA 1EV9A 3IR4A 3G7JA 4ID0A 5CO3A 4TOPA 2R2JA 2F8FA 1WPIA 3CSJA 3I69A 3FZAA 2HRKB 4ZB9A 4AI6A 4I97A 1JLVA 5DQSA 2HRNA 2JACA 4EO3A 1URMA 1GSDA 4F03A 5HR1A 2PWJA 2A4VA 2QSIA 2OBKA 1GSEA 1AIUA 4WF4A 2GQKA 3LYPA 2VCVA 4TR1B 19GSA 2NDOA 5IPHA 1ML6A 3H93A 2IJYA 1PN9A 4KH7A 1DE2A 5IO2A 3TRPA 3S9FA 1GTAA 1Z6NA 4TW5A 4MA9A 3L78A 3BCKA 4ZB6A 2C3QA 2OKAA 4RI7A 5HR3A 1HYUA 3QCPA 4NAXA 2L57A 1XVQA 2LKUA 2I81A 3UVHA 2E7PA 2VIMA 3GKKA 1GUHA 1PQNA 4KB3A 3GSTA 4MDCA 3FEUA 4D73B 1BQ7A 1DBYA 3HCZA 4RQRA 3IPZA 1RQMA 2HZFA 2VM1A 5G31A 4XS4A 2CVDA 3F8UA 4BPYA 3M0FA 4K8MA 2HI7A 2CVKA 3GKNA 1R4WA 4OO4A 1KTEA 1H75A 2DIZA 4KCAA 3TKSC 1UVZA 2VL9A 2LNTA 3EU4A 4PNGA 5DALA 3VK9A 3ZMLA 1WP0A 4MH2A 4TR3A 2HYXA 2VKZG 3BD2A 1ZGNA 3L0HA 4EIPA 4IQAA 1C72A 1MDKA 3ZFLA 1A24A 4N30A 1A0FA 2H1BA 3G7IA 4HI7A 3M8NA 1Q4JA 3HZ8A 3FR6A 3ZITA 2A4HA 3KMOA 2GSSA 3Q19A 5AIVA 2F51A 2DJKA 2XPDA 2JZRA 1JZWA 3HJMA 1U6TA 4WETA 3GIXA 2P5QA 1Q98A 2L5LA 4GF0A 2K8SA 5AIXA 4Z2UA 5B7CA 2GSRA 4AKHA 1TKDB 2EIRA 4HDEA 4OCFA 1FOHA 3ZFBA 3HXSA 3VI5A 3GH6A 4J56E 2HT9A 4K1FA 1FG4A 1M9BA 5J9CA 2A2PA 1ST9A 2K8VA 5H5SA 4MMMA 1MDIA 2D2ZA 1PD21 3IC8A 5FWGA 5HFGA 5ID2B 4MZBA 2H8LA 2O87A 4K5SA 1O8XA 3EPTA 2VL2C 4I6XA 3F63A 2IL3A 1TRVA 2I9HA 4HU7A 4JEDA 4PNFA 3ZREA 2ON7A 1UN2A 4I2UA 1TW9A 2RUEA 5F07A 4XRDA 4K7NA 3ZVJA 2B7JA 2H6YA 1YQ1A 1XWAA 3FKFA 4PUAA 2WGRA 4J57E 1O7UA 1RW1A 5ABRA 3QD9A 1XOAA 1PL1A 4N0ZA 2HSYA 5IO0A 3G7YA 5INYA 4NPBA 2R0GA 4K9ZA 1GNEA 4IGJA 4IELA 3TDGA 2H19A 2KLXA 4KX4A 4HZ4A 3GYKA 2DMMA 3R2QA 4K2XA 1THOA 2DIYA 4ECBA 1SD9A 2KP2A 1FAAA 1TDIA 1FOVA 3ZIVA 4BVXA 2C0EA 5LCZA 5DDLA 1SVOA 2CZ2A 4G01A 1F6MC 1XCCA 2E2MA 6GSTA 3C7MA 1F3AA 1OC8A 2F9SA 2KUCA 2HSMA 3GNJA 3CBUA 3HVSA 1SL2B 3APOA 7GSSA 5GSSA 3KXOA 4O5RA 2IN3A 1K3OA 4GXZA 3GL3A 4HQSA 1TRWA 3F6FA 2C1YA 3UBLA 2Z9SA 1GUMA 9GSSA 3VPQA 3TUEA 2R6KA 3APQA 4E8EA 4AKXB 3ZLPA 1ERTA 4GDFA 1TRUA 4ULXA 4LMWA 4V1Ag 2JZTA 4W66A 4L0WA 4ISDA 2YOIA 4HU9A 3UMAA 4TXOA 4DEJA 3GKXA 3D21A 2G2QA 1A0RP 5GZZB 5ECHB 4POKA 1BJXA 3KH7A 4HZ2A 4EE0A 1M2DA 3GH9A 1XWBA 5G5EA 1K0AA 5J4UA 5IQYA 2H70A 1GTIA 4KDYA 3UJ1A 5IOXA 4NMUA 2BMXA 1WWJA 2B5EA 1ZYQB 1AUCA 3O76A 2LJKA 1E2YA 1HNAA 6GSSA 4MH3A 3MSZA 1O73A 3CTFA 3HD5A 1ZYNA 1X9WB 5BRTA 4KSOA 3IK7A 1U3IA 3V1WA 3L9VA 1WE0A 2O8VB 1FVJA 3TJKA 4XHMA 8GSSA 4A5PA 1XXUA 3LWAA 1O85A 2MMOA 5H5QA 4IP6A 1JHBA 3RHCA 1H4OA 2LEGA 1X5EA 3WT2A 3GRXA 2H01A 1ZOFA 4JR6A 2CQ9A 1ZYPA 1Y1UA 3M9JA 2BJXA 1XFLA 1V40A 3HYPA 3FY7A 2O7KA 2WRTA 1GH2A 2WDUA 3L9UA 1FB0A 1GTBA 2VUPA 3PR8A 3H8QA 3GURA 4ML1A 2X8GA 1ZL9A 1R26A 5G30A 4EDYA 3DRNA 2DC5A 2X4AA 1V58A 4FYCA 2FGXA 2H6XA 3PH9A 2P31A 1AXDA 1O8WA 5B6NA 5JCUA 3D5JA 5DALB 4PTSA 1PKZA 1EOHA 4ZL7A 1ABAA 1GRXA 5AISA 3RPNA 4CDOA 1YZXA 3DD3A 4FQUA 2GDRA 3DMLA 22GSA 4O5UA 1EP8A 3A5WA 4LA1A 2YZHA 3HKRA 5DVBA 1K0BA 4PURA 2CX3A 2R4VA 1T1VA 1M7TA 2YJ7A 4POLA 3I6AA 1V98A 2GQLA 2YWOA 2UV8G 3DKSA 5D9VA 5ECIB 3IAM2 1R7HA 3EURA 3HZ4A 2WJUA 3UBKA 2NTOA 5G5FA 1SENA 3I43A 1A2MA 1X5DA 5EVOA 3BJ5A 2N5AA 2YJHA 4JU5A 3RDWA 4AJ6A 5J5NA 2JU5A 4K5RA 5GAPD 6GSUA 4IP1A 2WS2A 3EE2A 2GQMA 2HRFA 4H86A 17GSA 1UC7A 5DAKA 4O5QA 3WGEA 1DE1A 4BWQA 4GCIA 1EOGA 2EFDA 4IQ1A 1YJ6A 1K0MA 2MMZA 4NWYA 1Y25A 2OJLA 1PN0A 2H1DA 4ILFA 1PL2A 4Q5NA 5BMUA 2H0GA 10GSA 5B8AA 1V9WA 2RM5A 3MDKA 1XW6A 4G0LA 3CTGA 1Z7PA 3QAGA 3WGXA 4G9HA 1B9XC 3GA4A 2O89A 4G0IA 3Q6OA 2AV4A 4IJ3A 1QK8A 4EDZA 2R37A 2LTKA 5F06A 5HR2A 5E59A 1KEBA 2BTOT 1T00A 5A5HA 4O92A 2QA2A 1Z5YE 2GS3A 3BCIA 4PGTA 3TKSE 6GSVA 6GSXA 2LV3A 4J2FA 3TGZA 3VWVA 4KAEA 5GSTA 4CY6A 2G0FA 1WMJA 4YH2A 4BVXB 2CVBA 4MJEA 1SVLA 2XBQA 4N11A 3U6VA 4WF5A 3J7Yk 2V41A 3GFKA 3FRCA 1OC3A 1IYIA 4L5LA 1BX9A 4AJ7A 4KA0A 2HSMB 5D9XA 4HOJA 1A8YA 3AY8A 3I9V2 2OT3A 3IA1A 1G7OA 4O7HA 3RBTA 4WXTA 4IS0A 2OACA 2H1GA 2RLIA 3TOTA 2R3XA 2JZSA 2B5YA 4BVYB 4ZXGA 3ED3A 4DVCA 2C8UA 1NM3A 4IKHA 1NSWA 2J9HA 3P90A 3PINA 4OMVA 3FK8A 3GX8A 5AGYA 1IYHA 4TXOB 3LW9A 3IRAA 5D9WA 4X0XA 1GSFA 1F9MA 3KP8A 2DJ0A 2FWEA 3J7Yb 5ELGA 4PQ1A 2EIQA 4GSTA 3LGCA 5D9TA 3SBCA 2M72A 2L4CA 1YKCA 3LYKA 4XCSA 1ZCPA 2YWIA 4EF0A 5F05A 2EFEA 1DUGA 3VWXA 3CSIA 3P7XA 1F37A 1PRXA 4POMA 2B6MA 2H6ZA 2VOCA 4WEYA 4IN0A 5KN1A 3TB2A 2FA4A 5G1KA 2LJAA 5F8BA 2AYTA 3C73A 4AKGA 2VAFA 2GT5A 2AAWA 5IPGA 5HFIA 3IHQA 1QXHA 4K6XA 4EVMA 1EP7A 4RQXA 1PMTA 2YN1A 1K0OA 1ILOA 2C0DA 4F82A 1XWCA 4ZIJA 2QKEA 3PGTA 4V1Ap 2X8CA 1SJZA 3DVXA 3NIVA 2TRCP 4TKYA 4MJAA 3Q18A 2PGTA 4N10A 1OYJA 2LRNA 4MZCA 2OBIA 3W8SA 1OE8A 2IMIA 4HUAA 5JCGA 2GSTA 3EINA 2FWFA 3HDCA 5J40A 2PPTA 4JRRA 2HSHA 5J4VA 1F2EA 5A4WA 1AC1A 1GSSA 3D4MA 4MJBA 5DCHA 2DSAA 2DJ1A 1O6JA 1TK5B 4YKGA 4GQFA 3L9SA 4XIHA 5IMDA 2KP1A 2ZUPA 3F4RA 2PBJA 1A2LA 5LD0A 4F0BA 1BYEA 4ZL8A 4QQ7A 3IAS2 1BG1A 1NHOA 5ENUA 1EV4A 5ECMB 4Q5RA 4P3YB 3MIXA 4ML6A 1YF1A 4X4JA 2E2GA 1Z6MA 3IE3A 2HXKA 4EL1A 4G0KA 3A2VA 5J4YA 5G1LA 4LLRA 3LXZA 2CZ3A 5COHA 3HJOA 2HZEB 4K2DA 4KE3A 4KUNA 5D8IA 4QMKA 3GHAA 4XS1A 3JCML 2YANA 3E0UA 1V2AA 2MBTA 4X1UA 3G9BA 3ZIJA 4FYUA 2H72A 1I9DA 4FYBA 4MCUA 2K9FA 3F4SA 3NZNA 4E68A 5DAKB 2CT6A 2I4AA 1K0DA 2EFCA 1OC9A 2FUG2 1VF1A 1TK8B 3P2AA 2H0IA 4EXJA 2FNOA 3IBHA 5AN1A 1XWKA 5BMUB 4RI6A 4MLYA 1T7PB 1VF3A 3TJGA 3UVTA 1ACVA 2JSZA 5DQYA 1A2JA 1S3CA 4XTSA 5DJMA 3VPTA 4FO5A 1HNCA 3M3MA 1VF2A 1TI1A 1MD4A 2WZ9A 1OAZA 2NPBA 4TR1A 4JZQA 5A5HB 1EEMA 2HSNA 1OVNA 3C8EA 1B4QA 2PUKC 3W8JA 2J23A 5IM9A 4OFTA 1Z3EA 13GSA 5JWRB 2O5VA 2CAIA 4YKFA 2H73A 2KHPA 2DMLA 3A3TA 2H0HA 3LQ7A 3MAKA 1OKDA 3ZMKA 3TKRA 1M2BA 2YCDA 4D73A 3EYTA 2L59A 1SK0A 2IMFA 4WBRD 4PQIA 4ZBAA 5IMZA 2A2RA 2YWMA 1TXUA 4KW6A 1V57A 4K7OA 1VF4A 3PPUA 1ERWA 2H76A 2H1LA 1LU4A 2YPMA 3HHVA 1SJIA 1XW9A 2LUSA 5ECPB 2FY6A 2PVQA 1MD3A 1GUKA 5D73A 4F0CA 3EVIA 1B48A 3F3QA 3TOUA 3HJPA 4G2EA 1A8LA 2N5FA 1Z9HA 5CNWA 2QGVA 4XS4B 2QC7A 5CP1A 1GSYA 4MK3A 2EC4A 4PQHA 5KOWA 1T4ZA 5D96A 1TU7A 4V2MA 5J47A 2JADA 1WRYA 5FHIA 3LFLA 4MJCA 5CYYA 4G10A 1M0UA 5LNKe 3CSHA 3TKQA 4OCEA 4L0UA 2YWNA 4XRAA 2C0GA 3R3EA 4FIWA 5CRGA 3QOUA 1XPVA 1Z7RA 2PERA 4DSRA 3IK9A 4NHWA 5IIZA 2FA8A 2FWGA 3QDNA 3ZZXA 2OE0A 2WCIA 1G7EA 16GSA 5GAND 1SKWB 2FD3A 2L6DA 1WJKA 4YAVA 1SVMA 3P8WA 2IWTA 1CQHA 5C04A 1XW5A 4X43A 4EC0A 4L5OA 1K0CA 3QR6A 1N25A 1JZRA 3WGDA 3A5IA 3BOAA 2VCTA 1XVWA 1BAYA 2OE3A 2LNSA 3KTLA 3WYWA 5KN0A 3TKSA 4IBPA 2ZCTA 5HR0A 2VD0A 5CRWA 1FHEA 5ECKB 3KM6A 4GRFA 3NOFA 4OWYA 1QFNA 3F3RA 1TJDA 2NVLA 1OKTA 1J0FA 3QPMA 2R0CA 2CA8A 5ECOB 3W6GA 2UZ8A 4JE1A 3O3TA 2GLRA 5G2ZA 1FB6A 2C3TA 3FYGA 2P0GA 5C00A 1TU8A 3GSSA 2R5GA 3FMWA 1FO5A 1EWXA 5A5KA 3IXRA 1HD2A 3ERWA 1HNBA 1G0TA 3WT1A 1XIYA 4MF7A 1XZOA 2A2SA 3VLNA 3HMJG 1AAZA 1T4YA 1KBNA 5JWQB 3UOMA 1Y6EA 5EY6A 1ON4A 2WFCA 2CV4A 1GSUA 1AQWA 3CRTA 4K0NA 3HVVA 1I5GA 1MTCA 2RIIA 1EGRA 2JSYA 3GL5A 14GSA 3E3EA 3KP9A 1R5AA 3KIJA 4O32A 2RUFA 5HQPA 2GGTA 2YP6A 1B8XA 1K0NA 2IFQA 3LORA 3OR5A 5KN3A 1X9SB 2MMAA 4POBA 3KZQA 2VL2A 1PGTA 3FZ5A 1AQVA 3VWUA 1OC9B 3HVXA 1XOBA 3KTBA 12GSA 3TRXA 1J08A 2HNLA 1EEJA 4MPGA 2YZUA 2VLUA 1YF0A 3QFAC 3ME8A 3RPPA 3LG6A 1QUWA 1FVKA 2VLVA 3UARA 4I2TA 3F9UA 1QQ2A 3VURA 2GZPA 4GWRA 4IJIA 3APSA 2B1LA 2B1KA 5ELAA 3KMNA 2HSNB 1WIKA 1XWGA 1GL8A 1MEKA 5IMAA 1N8JA 2EIOA 3HY2A 4Q5QA 2IMDA 1M9AA 3ZRDA 3EU3A 3QAVA 3KCMA 4ZL9A 3O6TA 4KF9A 3H79A 3D0ZA 1YEXA 1UA5A 4E8HA 2JL4A 1R5PA 4GTUA 2VCZA 2XHFA 4PUFC 3KEBA 2X64A 2XPEA 1VGLA 2EFHA 2VLTA 4I8BA 2HLSA 2XBIA 3EMPA 2HE3A 2IMKA 3D22A 1B9YC 5IMCA 3KGKA 2GTUA 2ES7A 4DSSA 2K6VA 1B4PA 1YY7A 4OFNA 4FH8A 1LJRA 2I1UA 3LSZA 4KDUA 4WKWA 2FCHA 2B7KA 3C1RA 2H75A 1SU9A 3DWVA 5IMFA 3HA9A 5KOXA 5A34A 2B5XA 3FHKA 4TXVA 4NV5A 3GKMA 2GSQA 5J9BA 5ECQB 1ZYEA 4CHSA 2LQOA 2IMEA 2CAQA 1TTZA 3VI7A 3TCOA 3EWLA 3CYNA 4CW9A 2F8AA 2FWHA 2VD1A 2H1AA 3QAWA 5EPFA 4NHZA 1OE7A 4ECIA 3U5RE 4QL9A 1T8EB 3UAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3Y A;  2CX4 A;  2PN8 A;  3H1N A;  3Q74 A;  1PSQ A;  1X9M B;  4LL4 B;  3GTU A;  3LJR A;  3MNG A;  1A23 A;  1GP1 A;  1JFU A;  4MP4 A;  5ECS A;  3GUS A;  1EGO A;  2VCW A;  3L4N A;  4XS6 A;  4YAP A;  5ECL B;  1SK1 A;  4MAB A;  1DSB A;  5EL8 A;  3UIW A;  1GSQ A;  4ZIL A;  1SKR B;  2VM2 A;  4USS A;  4G19 A;  4IVF A;  5CAX A;  1X5C A;  2E0Q A;  4PXO A;  4GQC A;  2C80 A;  1GLP A;  4BL7 A;  1YKA A;  2OE1 A;  2RM6 A;  1GUL A;  1USB A;  4I5Q A;  1M99 A;  3TKP A;  3KJY A;  4V2N A;  2GZY A;  5CRD A;  1VRS D;  3C1S A;  5A4V A;  3C71 A;  4ACS A;  3FW2 A;  4NV2 A;  1CQG A;  2GZZ A;  3E9J B;  3TJB A;  2ON5 A;  2WB9 A;  1SYR A;  5HFK A;  2OA7 A;  1RK4 A;  4AF2 A;  4JBB A;  2DJ2 A;  1F3B A;  5CRE A;  5JCW A;  4ZBB A;  2M46 A;  4QL7 A;  2YV7 A;  2V6O A;  1T3B A;  5B8B A;  2HRK A;  2LQQ A;  3F0I A;  2H71 A;  2C0F A;  4GSN A;  1E6B A;  4OD7 A;  2VL3 A;  3TJF A;  2MMN A;  3A2X A;  2KOK A;  4TR4 A;  2AHE A;  3FZ9 A;  3F4T A;  1TK0 B;  2LS5 A;  1K3L A;  4MZW A;  4K7I A;  4AJ8 A;  4MF6 A;  5D93 A;  1J9B A;  4TR0 A;  1MDJ A;  2DBC A;  1BED A;  1PX6 A;  2ALB A;  2IPA A;  3ERF A;  4YQU A;  5L71 A;  2IFQ B;  5IOW A;  1M2A A;  3CXG A;  4WBJ A;  1AQX A;  5A4U A;  1X0R A;  2C4J A;  1U87 A;  5KN2 A;  2O85 A;  3US3 A;  3UL3 A;  4NXI A;  3H4K A;  2HRA A;  4TRX A;  3A2W A;  1FW1 A;  4BVY A;  2PU9 C;  1EZK A;  1TI3 A;  5H5R A;  2M80 A;  3DIE A;  4HJM A;  4Z7X A;  4Q5F A;  3GN3 A;  3VWW A;  4L8E A;  4JR4 A;  4EKZ A;  1N2A A;  4F2I A;  1G6W A;  3EMX A;  1JZD A;  3CRU A;  5KEJ A;  4HJ2 A;  3VFI A;  4ECJ A;  2N5B A;  1ZMA A;  1JZO A;  2LST A;  2LRC A;  4ECC A;  2FHE A;  3GMF A;  3LEF A;  18GS A;  5DCG A;  4HQZ A;  5F0G A;  2PMT A;  1K3Y A;  4KDX A;  2HFD A;  1WOU A;  3ZYW A;  2TIR A;  3SWL A;  1PKW A;  1HQO A;  4MF5 A;  3ERG A;  2DLX A;  3BBY A;  2F3M A;  2VCX A;  4LL1 B;  4GLT A;  1GNW A;  2V6K A;  3DXB A;  3IOS A;  2WUL A;  2V1M A;  4ZB8 A;  2P5R A;  2AB6 A;  4AGS A;  5JWO B;  20GS A;  3ZL5 A;  5CRH A;  2H66 A;  4WR4 A;  1QMV A;  2NBS A;  4PX1 A;  1NW2 A;  3RHB A;  2AJQ B;  1TOF A;  3QFB C;  4TN8 A;  1YDK A;  3LXT A;  2ZNM A;  4DSS B;  4IHU A;  1LBK A;  2L5O A;  1W89 A;  1SD8 A;  2LRT A;  1YEP A;  3WD6 A;  1S3D A;  4KSM A;  1GLQ A;  5E4W A;  1SJ6 A;  2K18 A;  2MBS A;  5J41 A;  4YQV A;  4LMV A;  4N0V A;  4EUY A;  2LJR A;  3KH9 A;  4F9Z A;  2DJJ A;  2B3S A;  3DVW A;  2H30 A;  3DYR A;  3N5O A;  4IW9 A;  4RUV A;  1TP9 A;  3TJJ A;  5ID2 A;  2MZC A;  5J3R A;  4HEA 2;  1NHY A;  2L4Q A;  2X8H A;  11GS A;  1ERU A;  3IDV A;  1O81 A;  3TRQ A;  5DJL A;  4MPF A;  2HQT A;  5FT3 A;  3CMI A;  1KNG A;  4V2L A;  3KD0 A;  2V2G A;  4KGI A;  1JLW A;  4BWS A;  3M1G A;  5IMV A;  5ECR B;  4BA7 A;  1BG5 A;  2YNX A;  3ME7 A;  3QMX A;  5ECN B;  2IIY A;  3UEM A;  2TRX A;  2YV9 A;  3FR3 A;  3N9J A;  4KCE A;  1XBS A;  4ZBD A;  1SYX A;  3GTU B;  1AW9 A;  4YQM A;  2VCQ A;  1SK2 A;  3MWH A;  1GWC A;  2HZE A;  4K0G A;  3D4T A;  4WR5 A;  1U88 A;  2PVO C;  2AUV A;  2DJ3 A;  1SKS B;  3DGQ A;  2OAD A;  2H74 A;  4OFM A;  3IC4 A;  2REM A;  1GTU A;  1TXX A;  5DBQ A;  4TVE A;  2C3N A;  1PA3 A;  1ERV A;  6GSY A;  3ZVJ D;  3GX0 A;  3D6I A;  2VO4 A;  2FLS A;  3EC3 A;  4OO5 A;  1SL0 B;  3F6D A;  3ISO A;  3FR9 A;  2X99 A;  2MYG A;  1TRS A;  2L6C A;  1S3A A;  3RAZ A;  5B6M A;  3GV1 A;  4BL7 B;  1QGV A;  2GT6 A;  4KND A;  1W4V A;  4DSQ A;  1G6Y A;  3ZTL A;  1ZZY A;  3DEX A;  3M9K A;  3FZ4 A;  4GSS A;  2V32 A;  3IV4 A;  4HS1 A;  2GVP A;  1THX A;  3K8N A;  2XC2 A;  1SL1 B;  1U3A A;  1PX7 A;  6GSW A;  1EV9 A;  3IR4 A;  3G7J A;  4ID0 A;  5CO3 A;  4TOP A;  2R2J A;  2F8F A;  1WPI A;  3CSJ A;  3I69 A;  3FZA A;  2HRK B;  4ZB9 A;  4I97 A;  1JLV A;  5DQS A;  2HRN A;  2JAC A;  4EO3 A;  1URM A;  1GSD A;  4F03 A;  5HR1 A;  2PWJ A;  2A4V A;  2QSI A;  2OBK A;  1GSE A;  1AIU A;  4WF4 A;  2GQK A;  3LYP A;  2VCV A;  4TR1 B;  19GS A;  2NDO A;  5IPH A;  1ML6 A;  3H93 A;  2IJY A;  1PN9 A;  4KH7 A;  1DE2 A;  5IO2 A;  3TRP A;  3S9F A;  1GTA A;  1Z6N A;  4TW5 A;  4MA9 A;  3L78 A;  3BCK A;  4ZB6 A;  2C3Q A;  2OKA A;  4RI7 A;  5HR3 A;  1HYU A;  3QCP A;  4NAX A;  2L57 A;  1XVQ A;  2LKU A;  2I81 A;  3UVH A;  2E7P A;  2VIM A;  3GKK A;  1GUH A;  1PQN A;  4KB3 A;  3GST A;  4MDC A;  3FEU A;  4D73 B;  1BQ7 A;  1DBY A;  3HCZ A;  4RQR A;  3IPZ A;  1RQM A;  2HZF A;  2VM1 A;  5G31 A;  4XS4 A;  2CVD A;  3F8U A;  4BPY A;  3M0F A;  4K8M A;  2HI7 A;  2CVK A;  3GKN A;  1R4W A;  4OO4 A;  1KTE A;  1H75 A;  2DIZ A;  4KCA A;  3TKS C;  1UVZ A;  2VL9 A;  2LNT A;  3EU4 A;  4PNG A;  5DAL A;  3VK9 A;  3ZML A;  1WP0 A;  4MH2 A;  4TR3 A;  2HYX A;  3BD2 A;  1ZGN A;  3L0H A;  4IQA A;  1C72 A;  1MDK A;  3ZFL A;  1A24 A;  4N30 A;  1A0F A;  2H1B A;  3G7I A;  4HI7 A;  3M8N A;  1Q4J A;  3HZ8 A;  3FR6 A;  3ZIT A;  3KMO A;  2GSS A;  3Q19 A;  5AIV A;  2F51 A;  2DJK A;  2XPD A;  2JZR A;  1JZW A;  3HJM A;  1U6T A;  4WET A;  3GIX A;  2P5Q A;  1Q98 A;  2L5L A;  4GF0 A;  2K8S A;  5AIX A;  5B7C A;  2GSR A;  1TKD B;  2EIR A;  4HDE A;  4OCF A;  3ZFB A;  3HXS A;  3VI5 A;  3GH6 A;  4J56 E;  2HT9 A;  4K1F A;  1FG4 A;  1M9B A;  5J9C A;  1ST9 A;  2K8V A;  5H5S A;  4MMM A;  1MDI A;  2D2Z A;  1PD2 1;  3IC8 A;  5FWG A;  5HFG A;  5ID2 B;  4MZB A;  2H8L A;  2O87 A;  1O8X A;  2VL2 C;  4I6X A;  3F63 A;  2IL3 A;  1TRV A;  2I9H A;  4HU7 A;  4JED A;  4PNF A;  3ZRE A;  2ON7 A;  1UN2 A;  4I2U A;  1TW9 A;  2RUE A;  5F07 A;  4XRD A;  4K7N A;  3ZVJ A;  2B7J A;  2H6Y A;  1YQ1 A;  1XWA A;  3FKF A;  4PUA A;  2WGR A;  4J57 E;  1O7U A;  1RW1 A;  5ABR A;  3QD9 A;  1XOA A;  1PL1 A;  4N0Z A;  2HSY A;  5IO0 A;  3G7Y A;  5INY A;  4NPB A;  4K9Z A;  1GNE A;  4IGJ A;  4IEL A;  3TDG A;  2H19 A;  2KLX A;  4KX4 A;  4HZ4 A;  3GYK A;  2DMM A;  3R2Q A;  1THO A;  2DIY A;  4ECB A;  1SD9 A;  2KP2 A;  1FAA A;  1TDI A;  1FOV A;  3ZIV A;  4BVX A;  2C0E A;  5LCZ A;  5DDL A;  2CZ2 A;  1F6M C;  1XCC A;  2E2M A;  6GST A;  3C7M A;  1F3A A;  1OC8 A;  2F9S A;  2KUC A;  2HSM A;  3GNJ A;  3CBU A;  3HVS A;  1SL2 B;  3APO A;  7GSS A;  5GSS A;  3KXO A;  4O5R A;  2IN3 A;  1K3O A;  4GXZ A;  3GL3 A;  4HQS A;  1TRW A;  3F6F A;  2C1Y A;  3UBL A;  2Z9S A;  1GUM A;  9GSS A;  3VPQ A;  3TUE A;  2R6K A;  3APQ A;  4E8E A;  3ZLP A;  1ERT A;  1TRU A;  4ULX A;  4LMW A;  4V1A g;  2JZT A;  4L0W A;  4ISD A;  2YOI A;  4HU9 A;  3UMA A;  4TXO A;  4DEJ A;  3GKX A;  3D21 A;  2G2Q A;  1A0R P;  5GZZ B;  5ECH B;  4POK A;  1BJX A;  3KH7 A;  4HZ2 A;  4EE0 A;  1M2D A;  3GH9 A;  1XWB A;  5G5E A;  1K0A A;  5J4U A;  5IQY A;  2H70 A;  1GTI A;  4KDY A;  3UJ1 A;  5IOX A;  4NMU A;  2BMX A;  1WWJ A;  2B5E A;  1ZYQ B;  1AUC A;  3O76 A;  2LJK A;  1E2Y A;  1HNA A;  6GSS A;  4MH3 A;  3MSZ A;  1O73 A;  3CTF A;  3HD5 A;  1X9W B;  4KSO A;  3IK7 A;  1U3I A;  3V1W A;  3L9V A;  1WE0 A;  2O8V B;  1FVJ A;  3TJK A;  4XHM A;  8GSS A;  1XXU A;  3LWA A;  1O85 A;  2MMO A;  5H5Q A;  4IP6 A;  1JHB A;  3RHC A;  1H4O A;  2LEG A;  1X5E A;  3WT2 A;  3GRX A;  2H01 A;  1ZOF A;  4JR6 A;  2CQ9 A;  3M9J A;  2BJX A;  1XFL A;  1V40 A;  3HYP A;  3FY7 A;  2O7K A;  2WRT A;  1GH2 A;  2WDU A;  3L9U A;  1FB0 A;  1GTB A;  2VUP A;  3PR8 A;  3H8Q A;  3GUR A;  4ML1 A;  2X8G A;  1ZL9 A;  1R26 A;  5G30 A;  4EDY A;  3DRN A;  2DC5 A;  1V58 A;  4FYC A;  2FGX A;  2H6X A;  3PH9 A;  2P31 A;  1AXD A;  1O8W A;  5B6N A;  5JCU A;  3D5J A;  5DAL B;  4PTS A;  1PKZ A;  1EOH A;  4ZL7 A;  1ABA A;  1GRX A;  5AIS A;  3RPN A;  4CDO A;  1YZX A;  3DD3 A;  4FQU A;  2GDR A;  3DML A;  22GS A;  1EP8 A;  3A5W A;  4LA1 A;  2YZH A;  3HKR A;  5DVB A;  1K0B A;  4PUR A;  2CX3 A;  2R4V A;  1T1V A;  1M7T A;  2YJ7 A;  4POL A;  3I6A A;  1V98 A;  2GQL A;  2YWO A;  3DKS A;  5D9V A;  5ECI B;  3IAM 2;  1R7H A;  3EUR A;  3HZ4 A;  2WJU A;  3UBK A;  2NTO A;  5G5F A;  1SEN A;  3I43 A;  1A2M A;  1X5D A;  5EVO A;  3BJ5 A;  2N5A A;  2YJH A;  4JU5 A;  3RDW A;  4AJ6 A;  5J5N A;  2JU5 A;  5GAP D;  6GSU A;  4IP1 A;  2WS2 A;  3EE2 A;  2GQM A;  2HRF A;  4H86 A;  17GS A;  1UC7 A;  5DAK A;  3WGE A;  1DE1 A;  4BWQ A;  4GCI A;  1EOG A;  4IQ1 A;  1YJ6 A;  1K0M A;  2MMZ A;  4NWY A;  1Y25 A;  2OJL A;  2H1D A;  4ILF A;  1PL2 A;  4Q5N A;  5BMU A;  2H0G A;  10GS A;  5B8A A;  1V9W A;  2RM5 A;  3MDK A;  1XW6 A;  4G0L A;  3CTG A;  1Z7P A;  3QAG A;  3WGX A;  4G9H A;  1B9X C;  3GA4 A;  2O89 A;  4G0I A;  3Q6O A;  2AV4 A;  4IJ3 A;  1QK8 A;  4EDZ A;  2R37 A;  2LTK A;  5F06 A;  5HR2 A;  5E59 A;  1KEB A;  2BTO T;  1T00 A;  4O92 A;  1Z5Y E;  2GS3 A;  3BCI A;  4PGT A;  3TKS E;  6GSV A;  6GSX A;  2LV3 A;  4J2F A;  3TGZ A;  3VWV A;  4KAE A;  5GST A;  2G0F A;  1WMJ A;  4YH2 A;  4BVX B;  2CVB A;  4MJE A;  2XBQ A;  4N11 A;  3U6V A;  4WF5 A;  3J7Y k;  2V41 A;  3GFK A;  3FRC A;  1OC3 A;  1IYI A;  4L5L A;  1BX9 A;  4AJ7 A;  4KA0 A;  2HSM B;  5D9X A;  4HOJ A;  1A8Y A;  3AY8 A;  3I9V 2;  3IA1 A;  1G7O A;  4O7H A;  3RBT A;  4WXT A;  4IS0 A;  2OAC A;  2H1G A;  2RLI A;  3TOT A;  2R3X A;  2JZS A;  2B5Y A;  4BVY B;  4ZXG A;  3ED3 A;  4DVC A;  2C8U A;  1NM3 A;  4IKH A;  1NSW A;  2J9H A;  3P90 A;  3PIN A;  4OMV A;  3FK8 A;  3GX8 A;  5AGY A;  1IYH A;  4TXO B;  3IRA A;  5D9W A;  4X0X A;  1GSF A;  1F9M A;  3KP8 A;  2DJ0 A;  2FWE A;  3J7Y b;  5ELG A;  4PQ1 A;  2EIQ A;  4GST A;  3LGC A;  5D9T A;  3SBC A;  2M72 A;  2L4C A;  1YKC A;  3LYK A;  4XCS A;  1ZCP A;  2YWI A;  4EF0 A;  5F05 A;  1DUG A;  3VWX A;  3CSI A;  3P7X A;  1F37 A;  1PRX A;  4POM A;  2B6M A;  2H6Z A;  2VOC A;  4WEY A;  4IN0 A;  5KN1 A;  3TB2 A;  2FA4 A;  5G1K A;  2LJA A;  5F8B A;  2AYT A;  3C73 A;  2VAF A;  2GT5 A;  2AAW A;  5IPG A;  5HFI A;  3IHQ A;  1QXH A;  4K6X A;  4EVM A;  1EP7 A;  4RQX A;  1PMT A;  2YN1 A;  1K0O A;  1ILO A;  2C0D A;  4F82 A;  1XWC A;  4ZIJ A;  2QKE A;  3PGT A;  4V1A p;  2X8C A;  1SJZ A;  3DVX A;  3NIV A;  2TRC P;  4TKY A;  4MJA A;  3Q18 A;  2PGT A;  4N10 A;  1OYJ A;  2LRN A;  4MZC A;  2OBI A;  3W8S A;  1OE8 A;  2IMI A;  4HUA A;  5JCG A;  2GST A;  3EIN A;  2FWF A;  3HDC A;  2PPT A;  4JRR A;  2HSH A;  1F2E A;  5A4W A;  1AC1 A;  1GSS A;  3D4M A;  4MJB A;  5DCH A;  2DSA A;  2DJ1 A;  1O6J A;  1TK5 B;  4GQF A;  3L9S A;  4XIH A;  5IMD A;  2KP1 A;  2ZUP A;  3F4R A;  2PBJ A;  1A2L A;  5LD0 A;  4F0B A;  1BYE A;  4ZL8 A;  4QQ7 A;  3IAS 2;  1NHO A;  5ENU A;  1EV4 A;  5ECM B;  4Q5R A;  4P3Y B;  4ML6 A;  1YF1 A;  2E2G A;  1Z6M A;  3IE3 A;  2HXK A;  4EL1 A;  4G0K A;  3A2V A;  5G1L A;  4LLR A;  3LXZ A;  2CZ3 A;  5COH A;  3HJO A;  2HZE B;  4K2D A;  4KE3 A;  4KUN A;  5D8I A;  3GHA A;  4XS1 A;  3JCM L;  2YAN A;  3E0U A;  1V2A A;  2MBT A;  4X1U A;  3G9B A;  3ZIJ A;  4FYU A;  2H72 A;  1I9D A;  4FYB A;  4MCU A;  2K9F A;  3F4S A;  3NZN A;  5DAK B;  2CT6 A;  2I4A A;  1K0D A;  1OC9 A;  2FUG 2;  1VF1 A;  1TK8 B;  3P2A A;  2H0I A;  4EXJ A;  2FNO A;  3IBH A;  5AN1 A;  1XWK A;  4RI6 A;  4MLY A;  1T7P B;  1VF3 A;  3TJG A;  3UVT A;  1ACV A;  2JSZ A;  5DQY A;  1A2J A;  1S3C A;  4XTS A;  5DJM A;  3VPT A;  4FO5 A;  1HNC A;  3M3M A;  1VF2 A;  1TI1 A;  1MD4 A;  2WZ9 A;  1OAZ A;  2NPB A;  4TR1 A;  4JZQ A;  1EEM A;  1OVN A;  3C8E A;  1B4Q A;  2PUK C;  3W8J A;  2J23 A;  5IM9 A;  4OFT A;  1Z3E A;  13GS A;  5JWR B;  2CAI A;  2H73 A;  2KHP A;  2DML A;  3A3T A;  2H0H A;  3LQ7 A;  3MAK A;  1OKD A;  3ZMK A;  3TKR A;  1M2B A;  2YCD A;  4D73 A;  3EYT A;  2L59 A;  1SK0 A;  2IMF A;  4WBR D;  4PQI A;  4ZBA A;  5IMZ A;  2A2R A;  2YWM A;  4KW6 A;  1V57 A;  4K7O A;  1VF4 A;  3PPU A;  1ERW A;  2H76 A;  1LU4 A;  2YPM A;  3HHV A;  1SJI A;  1XW9 A;  2LUS A;  5ECP B;  2FY6 A;  2PVQ A;  1MD3 A;  1GUK A;  5D73 A;  4F0C A;  3EVI A;  1B48 A;  3F3Q A;  3TOU A;  3HJP A;  4G2E A;  1A8L A;  2N5F A;  1Z9H A;  5CNW A;  2QGV A;  4XS4 B;  2QC7 A;  5CP1 A;  1GSY A;  4MK3 A;  2EC4 A;  4PQH A;  1T4Z A;  5D96 A;  1TU7 A;  4V2M A;  2JAD A;  1WRY A;  5FHI A;  3LFL A;  4MJC A;  5CYY A;  4G10 A;  1M0U A;  5LNK e;  3CSH A;  3TKQ A;  4OCE A;  4L0U A;  2YWN A;  4XRA A;  2C0G A;  3R3E A;  4FIW A;  5CRG A;  3QOU A;  1XPV A;  1Z7R A;  2PER A;  4DSR A;  3IK9 A;  4NHW A;  5IIZ A;  2FA8 A;  2FWG A;  3QDN A;  3ZZX A;  2OE0 A;  2WCI A;  1G7E A;  16GS A;  5GAN D;  1SKW B;  2FD3 A;  2L6D A;  1WJK A;  4YAV A;  3P8W A;  2IWT A;  1CQH A;  5C04 A;  1XW5 A;  4X43 A;  4EC0 A;  4L5O A;  1K0C A;  3QR6 A;  1JZR A;  3WGD A;  3BOA A;  2VCT A;  1XVW A;  1BAY A;  2OE3 A;  2LNS A;  3KTL A;  3WYW A;  5KN0 A;  3TKS A;  4IBP A;  2ZCT A;  5HR0 A;  2VD0 A;  5CRW A;  1FHE A;  5ECK B;  3KM6 A;  4GRF A;  3NOF A;  4OWY A;  1QFN A;  3F3R A;  1TJD A;  2NVL A;  1OKT A;  1J0F A;  3QPM A;  2CA8 A;  5ECO B;  3W6G A;  2UZ8 A;  4JE1 A;  3O3T A;  2GLR A;  5G2Z A;  1FB6 A;  2C3T A;  3FYG A;  2P0G A;  5C00 A;  1TU8 A;  3GSS A;  2R5G A;  1FO5 A;  1EWX A;  5A5K A;  3IXR A;  1HD2 A;  3ERW A;  1HNB A;  1G0T A;  3WT1 A;  1XIY A;  4MF7 A;  1XZO A;  2A2S A;  3VLN A;  1AAZ A;  1T4Y A;  1KBN A;  5JWQ B;  3UOM A;  1Y6E A;  5EY6 A;  1ON4 A;  2WFC A;  2CV4 A;  1GSU A;  1AQW A;  3CRT A;  4K0N A;  3HVV A;  1I5G A;  1MTC A;  2RII A;  1EGR A;  2JSY A;  3GL5 A;  14GS A;  3E3E A;  3KP9 A;  1R5A A;  3KIJ A;  4O32 A;  2RUF A;  5HQP A;  2GGT A;  2YP6 A;  1B8X A;  1K0N A;  2IFQ A;  3LOR A;  3OR5 A;  5KN3 A;  1X9S B;  2MMA A;  4POB A;  3KZQ A;  2VL2 A;  1PGT A;  3FZ5 A;  1AQV A;  3VWU A;  1OC9 B;  3HVX A;  1XOB A;  3KTB A;  12GS A;  3TRX A;  1J08 A;  2HNL A;  1EEJ A;  4MPG A;  2YZU A;  2VLU A;  1YF0 A;  3QFA C;  3ME8 A;  3RPP A;  3LG6 A;  1QUW A;  1FVK A;  2VLV A;  3UAR A;  4I2T A;  3F9U A;  1QQ2 A;  3VUR A;  2GZP A;  4GWR A;  4IJI A;  3APS A;  2B1L A;  2B1K A;  5ELA A;  3KMN A;  2HSN B;  1WIK A;  1XWG A;  1GL8 A;  1MEK A;  5IMA A;  1N8J A;  2EIO A;  3HY2 A;  4Q5Q A;  2IMD A;  1M9A A;  3ZRD A;  3EU3 A;  3QAV A;  3KCM A;  4ZL9 A;  3O6T A;  4KF9 A;  3H79 A;  3D0Z A;  1YEX A;  1UA5 A;  4E8H A;  2JL4 A;  1R5P A;  4GTU A;  2VCZ A;  2XHF A;  4PUF C;  3KEB A;  2X64 A;  2XPE A;  1VGL A;  2VLT A;  4I8B A;  2HLS A;  2XBI A;  3EMP A;  2HE3 A;  2IMK A;  3D22 A;  1B9Y C;  5IMC A;  3KGK A;  2GTU A;  2ES7 A;  4DSS A;  2K6V A;  1B4P A;  1YY7 A;  4OFN A;  4FH8 A;  1LJR A;  2I1U A;  3LSZ A;  4KDU A;  4WKW A;  2FCH A;  2B7K A;  3C1R A;  2H75 A;  1SU9 A;  3DWV A;  5IMF A;  3HA9 A;  2B5X A;  3FHK A;  4TXV A;  4NV5 A;  3GKM A;  2GSQ A;  5J9B A;  5ECQ B;  1ZYE A;  4CHS A;  2LQO A;  2IME A;  2CAQ A;  1TTZ A;  3VI7 A;  3TCO A;  3EWL A;  3CYN A;  4CW9 A;  2F8A A;  2FWH A;  2VD1 A;  2H1A A;  3QAW A;  5EPF A;  4NHZ A;  1OE7 A;  4ECI A;  3U5R E;  4QL9 A;  1T8E B;  3UAP A; 
#chains in the Genus database with same CATH topology
 2I3Y A;  2CX4 A;  2PN8 A;  3H1N A;  2X49 A;  3Q74 A;  1PSQ A;  1X9M B;  4LL4 B;  3GTU A;  3LJR A;  3MNG A;  1A23 A;  1GP1 A;  1YVL A;  4N3Z A;  3MYD A;  1JFU A;  4MP4 A;  5ECS A;  3GUS A;  2QA1 A;  1EGO A;  2VCW A;  3L4N A;  4XS6 A;  4YAP A;  5ECL B;  1SK1 A;  4MAB A;  1DSB A;  5EL8 A;  3UIW A;  1GSQ A;  4ZIL A;  1SKR B;  2VM2 A;  4USS A;  4G19 A;  4IVF A;  5CAX A;  1X5C A;  2E0Q A;  4PXO A;  5A1N A;  4GQC A;  2C80 A;  1GLP A;  4BL7 A;  1YKA A;  2OE1 A;  2RM6 A;  1GUL A;  1USB A;  4I5Q A;  4AKI A;  1M99 A;  3TKP A;  3KJY A;  4V2N A;  2GZY A;  5CRD A;  1VRS D;  3C1S A;  5A4V A;  3C71 A;  4ACS A;  3FW2 A;  4NV2 A;  1CQG A;  4ZB7 A;  2GZZ A;  3E9J B;  3TJB A;  2ON5 A;  2WB9 A;  1SYR A;  4EIQ A;  5HFK A;  2OA7 A;  1RK4 A;  4AF2 A;  4JBB A;  2DJ2 A;  1F3B A;  5CRE A;  5JCW A;  4ZBB A;  2M46 A;  4QL7 A;  2YV7 A;  2V6O A;  1T3B A;  5B8B A;  2HRK A;  2LQQ A;  3F0I A;  2H71 A;  2C0F A;  4GSN A;  1E6B A;  4OD7 A;  2VL3 A;  3TJF A;  2MMN A;  3A2X A;  2KOK A;  4TR4 A;  2AHE A;  3FZ9 A;  3F4T A;  1TK0 B;  2LS5 A;  1K3L A;  4MZW A;  4K7I A;  4AJ8 A;  4MF6 A;  5D93 A;  1J9B A;  4TR0 A;  1MDJ A;  2DBC A;  1BED A;  1PX6 A;  2ALB A;  2IPA A;  3ERF A;  4YQU A;  5L71 A;  2IFQ B;  5IOW A;  1I1I P;  1M2A A;  3CXG A;  4WBJ A;  1AQX A;  5A4U A;  1X0R A;  2C4J A;  1U87 A;  5KN2 A;  2O85 A;  3US3 A;  3UL3 A;  4NXI A;  3H4K A;  2HRA A;  4TRX A;  3A2W A;  1FW1 A;  4BVY A;  2PU9 C;  1EZK A;  1TI3 A;  5H5R A;  2M80 A;  3DIE A;  4HJM A;  4Z7X A;  4Q5F A;  3GN3 A;  3VWW A;  4L8E A;  4JR4 A;  4EKZ A;  1N2A A;  4F2I A;  1G6W A;  3EMX A;  1JZD A;  3CRU A;  4Z2R A;  5KEJ A;  4HJ2 A;  3VFI A;  4ECJ A;  2N5B A;  1ZMA A;  1JZO A;  2LST A;  2LRC A;  4ECC A;  2FHE A;  3GMF A;  3LEF A;  18GS A;  5DCG A;  4HQZ A;  5F0G A;  2PMT A;  1K3Y A;  4KDX A;  2HFD A;  1WOU A;  3ZYW A;  2TIR A;  3SWL A;  1PKW A;  1HQO A;  4MF5 A;  3ERG A;  2DLX A;  3BBY A;  2F3M A;  2VCX A;  4LL1 B;  4GLT A;  1GNW A;  2V6K A;  3DXB A;  3IOS A;  2WUL A;  2V1M A;  4ZB8 A;  2P5R A;  2AB6 A;  4AGS A;  5JWO B;  20GS A;  3ZL5 A;  5CRH A;  2H66 A;  4WR4 A;  1QMV A;  2NBS A;  4PX1 A;  1NW2 A;  4HSC X;  3RHB A;  2AJQ B;  1TOF A;  2WW0 A;  3QFB C;  4TN8 A;  1YDK A;  3LXT A;  2ZNM A;  4ICY A;  4DSS B;  4IHU A;  2WW2 A;  1LBK A;  2L5O A;  4MNN A;  1W89 A;  1SD8 A;  2LRT A;  1YEP A;  3WD6 A;  1S3D A;  4KSM A;  1GLQ A;  5E4W A;  1SJ6 A;  2K18 A;  2MBS A;  5J41 A;  4YQV A;  4LMV A;  5A34 B;  4N0V A;  4EUY A;  2LJR A;  3KH9 A;  4F9Z A;  2DJJ A;  2B3S A;  2WVZ A;  3DVW A;  2H30 A;  3DYR A;  4Z2T A;  3N5O A;  4IW9 A;  4RUV A;  1TP9 A;  3TJJ A;  5ID2 A;  2MZC A;  5J3R A;  4HEA 2;  1NHY A;  2L4Q A;  2X8H A;  4CY8 A;  11GS A;  1ERU A;  3IDV A;  1O81 A;  3TRQ A;  5DJL A;  4MPF A;  2HQT A;  5FT3 A;  2DKI A;  3CMI A;  1KNG A;  4V2L A;  3KD0 A;  2V2G A;  2R0P A;  4KGI A;  1BF5 A;  1JLW A;  4BWS A;  3M1G A;  5IMV A;  5ECR B;  4BA7 A;  1BG5 A;  2YNX A;  3ME7 A;  3IHG A;  3QMX A;  5ECN B;  2IIY A;  3UEM A;  2TRX A;  2YV9 A;  3FR3 A;  3N9J A;  4KCE A;  1XBS A;  4ZBD A;  1SYX A;  3GTU B;  1AW9 A;  4YQM A;  2VCQ A;  1SK2 A;  3MWH A;  1GWC A;  2HZE A;  4K0G A;  3D4T A;  4WR5 A;  1U88 A;  2PVO C;  2AUV A;  2DJ3 A;  1SKS B;  3DGQ A;  2OAD A;  2H74 A;  4OFM A;  3IC4 A;  2REM A;  1GTU A;  1TXX A;  4FXY P;  5DBQ A;  4TVE A;  2C3N A;  1PA3 A;  1ERV A;  6GSY A;  3ZVJ D;  3GX0 A;  3D6I A;  2VO4 A;  2FLS A;  3EC3 A;  3CWG A;  4OO5 A;  1SL0 B;  3CHX C;  3F6D A;  1PFO A;  3ISO A;  3FR9 A;  2X99 A;  2MYG A;  1TRS A;  2L6C A;  1S3A A;  3RAZ A;  5A1N B;  2DKH A;  3TU3 B;  5B6M A;  3GV1 A;  4BL7 B;  1QGV A;  2GT6 A;  4KND A;  1W4V A;  4DSQ A;  1G6Y A;  3ZTL A;  1ZZY A;  3DEX A;  3M9K A;  3FZ4 A;  4GSS A;  2V32 A;  3IV4 A;  4HS1 A;  2GVP A;  1THX A;  3K8N A;  2XC2 A;  1SL1 B;  1U3A A;  1PX7 A;  6GSW A;  1EV9 A;  3IR4 A;  3G7J A;  4ID0 A;  5CO3 A;  4TOP A;  2R2J A;  2F8F A;  1WPI A;  3CSJ A;  3I69 A;  3FZA A;  2HRK B;  4ZB9 A;  4AI6 A;  4I97 A;  1JLV A;  5DQS A;  2HRN A;  2JAC A;  4EO3 A;  1URM A;  1GSD A;  4F03 A;  5HR1 A;  2PWJ A;  2A4V A;  2QSI A;  2OBK A;  1GSE A;  1AIU A;  4WF4 A;  2GQK A;  3LYP A;  2VCV A;  4TR1 B;  19GS A;  2NDO A;  5IPH A;  1ML6 A;  3H93 A;  2IJY A;  2O3E A;  1PN9 A;  4KH7 A;  1DE2 A;  5IO2 A;  3TRP A;  3S9F A;  1GTA A;  1Z6N A;  4TW5 A;  4MA9 A;  3L78 A;  3BCK A;  4ZB6 A;  2C3Q A;  2OKA A;  4RI7 A;  5HR3 A;  1HYU A;  3QCP A;  4NAX A;  2L57 A;  1XVQ A;  2LKU A;  2I81 A;  3UVH A;  2E7P A;  2VIM A;  3GKK A;  1GUH A;  1PQN A;  4KB3 A;  3GST A;  4MDC A;  3FEU A;  4D73 B;  1BQ7 A;  1DBY A;  3HCZ A;  4RQR A;  3IPZ A;  1RQM A;  2HZF A;  2VM1 A;  5G31 A;  4XS4 A;  2CVD A;  3F8U A;  4BPY A;  3M0F A;  4K8M A;  2HI7 A;  2CVK A;  3GKN A;  1R4W A;  4OO4 A;  1KTE A;  1H75 A;  2DIZ A;  4KCA A;  3TKS C;  1UVZ A;  2VL9 A;  2LNT A;  3EU4 A;  4PNG A;  5DAL A;  3VK9 A;  3ZML A;  1WP0 A;  4MH2 A;  4TR3 A;  2HYX A;  2VKZ G;  3BD2 A;  1ZGN A;  3L0H A;  4EIP A;  4IQA A;  1C72 A;  1MDK A;  3ZFL A;  1A24 A;  4N30 A;  1A0F A;  2H1B A;  3G7I A;  4HI7 A;  3M8N A;  1Q4J A;  3HZ8 A;  3FR6 A;  3ZIT A;  2A4H A;  3KMO A;  2GSS A;  3Q19 A;  5AIV A;  2F51 A;  2DJK A;  2XPD A;  2JZR A;  1JZW A;  3HJM A;  1U6T A;  4WET A;  3GIX A;  2P5Q A;  1Q98 A;  2L5L A;  4GF0 A;  2K8S A;  5AIX A;  4Z2U A;  5B7C A;  2GSR A;  4AKH A;  1TKD B;  2EIR A;  4HDE A;  4OCF A;  1FOH A;  3ZFB A;  3HXS A;  3VI5 A;  3GH6 A;  4J56 E;  2HT9 A;  4K1F A;  1FG4 A;  1M9B A;  5J9C A;  2A2P A;  1ST9 A;  2K8V A;  5H5S A;  4MMM A;  1MDI A;  2D2Z A;  1PD2 1;  3IC8 A;  5FWG A;  5HFG A;  5ID2 B;  4MZB A;  2H8L A;  2O87 A;  4K5S A;  1O8X A;  3EPT A;  2VL2 C;  4I6X A;  3F63 A;  2IL3 A;  1TRV A;  3CQF A;  2I9H A;  4HU7 A;  4JED A;  4PNF A;  3ZRE A;  2ON7 A;  1UN2 A;  4I2U A;  1TW9 A;  2RUE A;  5F07 A;  4XRD A;  4K7N A;  3ZVJ A;  2B7J A;  2H6Y A;  1YQ1 A;  1XWA A;  3FKF A;  4PUA A;  2WGR A;  4J57 E;  1O7U A;  1RW1 A;  5ABR A;  3QD9 A;  1XOA A;  1PL1 A;  4N0Z A;  2HSY A;  5IO0 A;  3G7Y A;  5INY A;  4NPB A;  2R0G A;  4K9Z A;  1GNE A;  4IGJ A;  4IEL A;  3TDG A;  2H19 A;  2KLX A;  4KX4 A;  4HZ4 A;  4PI2 C;  3GYK A;  2DMM A;  3R2Q A;  4K2X A;  1THO A;  2DIY A;  4ECB A;  1SD9 A;  2KP2 A;  1FAA A;  1TDI A;  1FOV A;  3ZIV A;  4BVX A;  2C0E A;  5LCZ A;  5DDL A;  1SVO A;  2CZ2 A;  4G01 A;  1F6M C;  1XCC A;  2E2M A;  6GST A;  3C7M A;  1F3A A;  1OC8 A;  2F9S A;  2KUC A;  2HSM A;  3GNJ A;  3CBU A;  3HVS A;  1SL2 B;  3APO A;  7GSS A;  5GSS A;  3KXO A;  4O5R A;  2IN3 A;  1K3O A;  4GXZ A;  3GL3 A;  4HQS A;  1TRW A;  3F6F A;  2C1Y A;  3UBL A;  2Z9S A;  1GUM A;  9GSS A;  3VPQ A;  3TUE A;  2R6K A;  3APQ A;  4E8E A;  4AKX B;  3ZLP A;  1ERT A;  4GDF A;  1TRU A;  4ULX A;  4LMW A;  4V1A g;  2JZT A;  4W66 A;  4L0W A;  4ISD A;  2YOI A;  4HU9 A;  2WW3 A;  3UMA A;  4TXO A;  4DEJ A;  3GKX A;  3D21 A;  2G2Q A;  1A0R P;  5GZZ B;  5ECH B;  4POK A;  1BJX A;  3KH7 A;  4HZ2 A;  4EE0 A;  1M2D A;  3GH9 A;  1XWB A;  5G5E A;  1K0A A;  5J4U A;  5IQY A;  2H70 A;  1GTI A;  4KDY A;  3UJ1 A;  5IOX A;  4NMU A;  2BMX A;  1WWJ A;  2B5E A;  1ZYQ B;  1AUC A;  3O76 A;  2LJK A;  1E2Y A;  1HNA A;  6GSS A;  4MH3 A;  3MSZ A;  1O73 A;  3CTF A;  3HD5 A;  1ZYN A;  1X9W B;  5BRT A;  4KSO A;  3IK7 A;  1U3I A;  3V1W A;  3L9V A;  1WE0 A;  2O8V B;  1FVJ A;  3TJK A;  4XHM A;  8GSS A;  4A5P A;  1XXU A;  3LWA A;  1O85 A;  2MMO A;  5H5Q A;  4IP6 A;  1JHB A;  3RHC A;  1H4O A;  2LEG A;  1X5E A;  3WT2 A;  3GRX A;  2H01 A;  1ZOF A;  4JR6 A;  2CQ9 A;  1ZYP A;  1Y1U A;  3M9J A;  2BJX A;  1XFL A;  1V40 A;  3HYP A;  3FY7 A;  2O7K A;  2WRT A;  1GH2 A;  2WDU A;  3L9U A;  1FB0 A;  1GTB A;  2VUP A;  3PR8 A;  3H8Q A;  3GUR A;  4ML1 A;  1S3R A;  2X8G A;  1ZL9 A;  1R26 A;  5G30 A;  4EDY A;  3DRN A;  2DC5 A;  2WVX A;  2X4A A;  2WW1 A;  1V58 A;  4PHZ C;  4FYC A;  2FGX A;  2H6X A;  3PH9 A;  2P31 A;  1AXD A;  1O8W A;  5B6N A;  5JCU A;  3D5J A;  5DAL B;  4PTS A;  1PKZ A;  1EOH A;  4ZL7 A;  1ABA A;  1GRX A;  5AIS A;  3RPN A;  4CDO A;  1YZX A;  3DD3 A;  4FQU A;  2GDR A;  3DML A;  22GS A;  4O5U A;  1EP8 A;  3A5W A;  4LA1 A;  2YZH A;  3HKR A;  5DVB A;  1K0B A;  4PUR A;  2CX3 A;  2R4V A;  1T1V A;  1M7T A;  2YJ7 A;  4POL A;  3I6A A;  1V98 A;  2GQL A;  2YWO A;  2UV8 G;  3DKS A;  5D9V A;  5ECI B;  3IAM 2;  1R7H A;  3EUR A;  3HZ4 A;  2WJU A;  3UBK A;  2NTO A;  5G5F A;  1SEN A;  3I43 A;  2O36 A;  1A2M A;  1X5D A;  5EVO A;  3BJ5 A;  2N5A A;  2YJH A;  1XG8 A;  4JU5 A;  3RDW A;  4AJ6 A;  5J5N A;  2JU5 A;  4K5R A;  5GAP D;  6GSU A;  4IP1 A;  2WS2 A;  3EE2 A;  2GQM A;  2HRF A;  4H86 A;  17GS A;  1UC7 A;  5DAK A;  4O5Q A;  3WGE A;  1DE1 A;  4BWQ A;  4GCI A;  1EOG A;  2EFD A;  4IQ1 A;  1YJ6 A;  1K0M A;  2MMZ A;  4NWY A;  1Y25 A;  2OJL A;  1PN0 A;  2H1D A;  4ILF A;  1PL2 A;  4Q5N A;  5BMU A;  2H0G A;  10GS A;  5B8A A;  1V9W A;  2RM5 A;  3MDK A;  1XW6 A;  4G0L A;  3CTG A;  1Z7P A;  3QAG A;  3WGX A;  4G9H A;  1B9X C;  3GA4 A;  2O89 A;  4G0I A;  3Q6O A;  2AV4 A;  4IJ3 A;  1QK8 A;  4EDZ A;  2R37 A;  2LTK A;  5F06 A;  5HR2 A;  5E59 A;  1KEB A;  2BTO T;  1T00 A;  5A5H A;  4O92 A;  2QA2 A;  1Z5Y E;  2GS3 A;  3BCI A;  4PGT A;  3TKS E;  6GSV A;  6GSX A;  2LV3 A;  4J2F A;  3TGZ A;  3VWV A;  4KAE A;  5GST A;  4CY6 A;  2G0F A;  4PI0 C;  1WMJ A;  4YH2 A;  4BVX B;  2CVB A;  4MJE A;  1SVL A;  2XBQ A;  4N11 A;  3U6V A;  4WF5 A;  3J7Y k;  2V41 A;  3GFK A;  1M3I A;  3FRC A;  1OC3 A;  1IYI A;  4L5L A;  1BX9 A;  4AJ7 A;  4KA0 A;  2HSM B;  5D9X A;  4HOJ A;  1A8Y A;  3AY8 A;  3I9V 2;  2OT3 A;  3IA1 A;  1G7O A;  4O7H A;  3RBT A;  4WXT A;  4IS0 A;  2OAC A;  2H1G A;  2RLI A;  3TOT A;  2R3X A;  2JZS A;  2B5Y A;  4BVY B;  4ZXG A;  3ED3 A;  4DVC A;  2C8U A;  1NM3 A;  4IKH A;  1NSW A;  2J9H A;  3P90 A;  3PIN A;  4OMV A;  3FK8 A;  3GX8 A;  5AGY A;  1IYH A;  4TXO B;  3LW9 A;  3IRA A;  5D9W A;  4X0X A;  1GSF A;  1F9M A;  3KP8 A;  2DJ0 A;  2FWE A;  3J7Y b;  5ELG A;  4PQ1 A;  2EIQ A;  4GST A;  3LGC A;  5D9T A;  3SBC A;  2M72 A;  2L4C A;  1YKC A;  3LYK A;  4XCS A;  1ZCP A;  2YWI A;  4EF0 A;  5F05 A;  2EFE A;  1DUG A;  3VWX A;  3CSI A;  3P7X A;  1F37 A;  1PRX A;  4POM A;  2B6M A;  2H6Z A;  2VOC A;  4WEY A;  4IN0 A;  5KN1 A;  3TB2 A;  2FA4 A;  5G1K A;  2LJA A;  5F8B A;  2AYT A;  3C73 A;  4AKG A;  2VAF A;  2GT5 A;  2AAW A;  5IPG A;  5HFI A;  3IHQ A;  1QXH A;  4K6X A;  4EVM A;  1EP7 A;  4RQX A;  1PMT A;  2YN1 A;  1K0O A;  2WVX B;  1ILO A;  2C0D A;  4F82 A;  1XWC A;  4ZIJ A;  2QKE A;  3PGT A;  4V1A p;  1S4B P;  2X8C A;  1SJZ A;  3DVX A;  3NIV A;  2TRC P;  4TKY A;  4MJA A;  3Q18 A;  2PGT A;  4N10 A;  1OYJ A;  2LRN A;  4MZC A;  2OBI A;  3W8S A;  1OE8 A;  2IMI A;  4HUA A;  5JCG A;  2GST A;  3EIN A;  2FWF A;  3HDC A;  5J40 A;  2PPT A;  4JRR A;  2HSH A;  5J4V A;  1F2E A;  5A4W A;  1AC1 A;  1GSS A;  3D4M A;  4MJB A;  5DCH A;  2DSA A;  2DJ1 A;  1O6J A;  1TK5 B;  4YKG A;  4GQF A;  3L9S A;  4XIH A;  5IMD A;  2KP1 A;  2ZUP A;  3F4R A;  2PBJ A;  1A2L A;  5LD0 A;  4F0B A;  1BYE A;  4ZL8 A;  4QQ7 A;  3IAS 2;  1BG1 A;  1NHO A;  5ENU A;  1EV4 A;  5ECM B;  4Q5R A;  4P3Y B;  3MIX A;  4ML6 A;  1YF1 A;  4X4J A;  2E2G A;  1Z6M A;  3IE3 A;  2HXK A;  4EL1 A;  4G0K A;  3A2V A;  5J4Y A;  5G1L A;  4LLR A;  3LXZ A;  2CZ3 A;  5COH A;  3HJO A;  2HZE B;  4K2D A;  4KE3 A;  4KUN A;  5D8I A;  4QMK A;  3GHA A;  4XS1 A;  3JCM L;  2YAN A;  3E0U A;  1V2A A;  2MBT A;  4X1U A;  3G9B A;  3ZIJ A;  4FYU A;  2H72 A;  1I9D A;  4FYB A;  4MCU A;  2K9F A;  3F4S A;  3NZN A;  4E68 A;  5DAK B;  2CT6 A;  2I4A A;  1K0D A;  2EFC A;  1OC9 A;  2FUG 2;  1VF1 A;  1TK8 B;  3P2A A;  2H0I A;  4EXJ A;  2FNO A;  3IBH A;  5AN1 A;  1XWK A;  5BMU B;  4RI6 A;  4MLY A;  1T7P B;  1VF3 A;  3TJG A;  3UVT A;  1ACV A;  2JSZ A;  5DQY A;  1A2J A;  1S3C A;  4XTS A;  5DJM A;  3VPT A;  4FO5 A;  1HNC A;  3M3M A;  1VF2 A;  1TI1 A;  1MD4 A;  2WZ9 A;  1OAZ A;  2NPB A;  4TR1 A;  4JZQ A;  5A5H B;  1EEM A;  2HSN A;  1OVN A;  3C8E A;  1B4Q A;  2PUK C;  3W8J A;  2J23 A;  5IM9 A;  4OFT A;  1Z3E A;  13GS A;  5JWR B;  2O5V A;  2CAI A;  4YKF A;  2H73 A;  2KHP A;  2DML A;  3A3T A;  2H0H A;  3LQ7 A;  3MAK A;  1OKD A;  3ZMK A;  3TKR A;  1M2B A;  2YCD A;  4D73 A;  3EYT A;  2L59 A;  1SK0 A;  4BIK A;  2IMF A;  4WBR D;  4PQI A;  4ZBA A;  5IMZ A;  2A2R A;  2YWM A;  1TXU A;  4KW6 A;  1V57 A;  4K7O A;  1VF4 A;  3PPU A;  1ERW A;  2H76 A;  2H1L A;  1LU4 A;  2YPM A;  3HHV A;  1SJI A;  1XW9 A;  2LUS A;  5ECP B;  2FY6 A;  3RGB C;  2PVQ A;  1MD3 A;  1GUK A;  5D73 A;  4F0C A;  3EVI A;  1B48 A;  3F3Q A;  3TOU A;  3HJP A;  4G2E A;  1A8L A;  2N5F A;  1Z9H A;  5CNW A;  2QGV A;  4XS4 B;  2QC7 A;  5CP1 A;  1GSY A;  4MK3 A;  2EC4 A;  4PQH A;  5KOW A;  1T4Z A;  5D96 A;  1TU7 A;  4V2M A;  5J47 A;  2JAD A;  1WRY A;  5FHI A;  3LFL A;  4MJC A;  5CYY A;  4G10 A;  1M0U A;  5LNK e;  3CSH A;  3TKQ A;  4OCE A;  4L0U A;  2YWN A;  4XRA A;  2C0G A;  3R3E A;  4FIW A;  5CRG A;  3QOU A;  1XPV A;  1Z7R A;  2PER A;  3HVN A;  4DSR A;  3IK9 A;  4NHW A;  5IIZ A;  2FA8 A;  2FWG A;  3QDN A;  3ZZX A;  2OE0 A;  2WCI A;  1G7E A;  16GS A;  5GAN D;  1SKW B;  2FD3 A;  2L6D A;  1WJK A;  4YAV A;  1SVM A;  3P8W A;  2IWT A;  1CQH A;  5C04 A;  1XW5 A;  4X43 A;  4EC0 A;  4L5O A;  1K0C A;  3QR6 A;  1N25 A;  1JZR A;  3WGD A;  3A5I A;  3BOA A;  2VCT A;  1XVW A;  1BAY A;  2OE3 A;  2LNS A;  3KTL A;  3WYW A;  5KN0 A;  3TKS A;  2WVY A;  4IBP A;  2ZCT A;  5HR0 A;  2VD0 A;  5CRW A;  1FHE A;  5ECK B;  3KM6 A;  4GRF A;  3NOF A;  4OWY A;  1QFN A;  3F3R A;  1TJD A;  2NVL A;  1OKT A;  1J0F A;  3QPM A;  2R0C A;  2CA8 A;  5ECO B;  3W6G A;  2UZ8 A;  4JE1 A;  3O3T A;  2GLR A;  5G2Z A;  1FB6 A;  2C3T A;  3FYG A;  2P0G A;  5C00 A;  1TU8 A;  3GSS A;  2R5G A;  3FMW A;  1FO5 A;  1EWX A;  5A5K A;  3IXR A;  1HD2 A;  3ERW A;  1HNB A;  1G0T A;  3WT1 A;  1XIY A;  4MF7 A;  1XZO A;  2A2S A;  3VLN A;  3HMJ G;  1AAZ A;  1T4Y A;  1KBN A;  5JWQ B;  3UOM A;  1Y6E A;  5EY6 A;  1ON4 A;  2WFC A;  2CV4 A;  1GSU A;  1AQW A;  3CRT A;  4K0N A;  3HVV A;  1I5G A;  1MTC A;  2RII A;  1EGR A;  2JSY A;  3GL5 A;  14GS A;  3E3E A;  3KP9 A;  1R5A A;  3KIJ A;  4O32 A;  2RUF A;  5HQP A;  2GGT A;  2YP6 A;  1B8X A;  1K0N A;  2IFQ A;  3LOR A;  3OR5 A;  5KN3 A;  1X9S B;  2MMA A;  4POB A;  3KZQ A;  2VL2 A;  1PGT A;  3FZ5 A;  1AQV A;  3VWU A;  1OC9 B;  3HVX A;  1XOB A;  3KTB A;  12GS A;  3TRX A;  1J08 A;  2HNL A;  1EEJ A;  4MPG A;  2YZU A;  2VLU A;  1YF0 A;  3QFA C;  3ME8 A;  3RPP A;  3LG6 A;  3RFR C;  1QUW A;  1FVK A;  2VLV A;  1YEW C;  3UAR A;  4I2T A;  3F9U A;  1QQ2 A;  3VUR A;  2GZP A;  4GWR A;  4IJI A;  3APS A;  2B1L A;  2B1K A;  5ELA A;  3KMN A;  2HSN B;  1WIK A;  1XWG A;  1GL8 A;  1MEK A;  5IMA A;  1N8J A;  2EIO A;  3HY2 A;  4Q5Q A;  2IMD A;  1M9A A;  3ZRD A;  3EU3 A;  3QAV A;  3KCM A;  4ZL9 A;  3O6T A;  4KF9 A;  3H79 A;  3D0Z A;  1YEX A;  1UA5 A;  2WZS A;  1M3J A;  4E8H A;  2JL4 A;  1R5P A;  4GTU A;  2VCZ A;  2XHF A;  4PUF C;  3KEB A;  2X64 A;  2XPE A;  1VGL A;  2EFH A;  2VLT A;  4I8B A;  2HLS A;  2XBI A;  3EMP A;  2HE3 A;  2IMK A;  3D22 A;  1B9Y C;  5IMC A;  3KGK A;  2GTU A;  2ES7 A;  4DSS A;  2K6V A;  1B4P A;  1YY7 A;  4OFN A;  4FH8 A;  1LJR A;  2I1U A;  3LSZ A;  4KDU A;  4WKW A;  2FCH A;  2B7K A;  3C1R A;  2H75 A;  1SU9 A;  3DWV A;  5IMF A;  3HA9 A;  5KOX A;  5A34 A;  2B5X A;  3FHK A;  4TXV A;  4NV5 A;  3GKM A;  2GSQ A;  5J9B A;  5ECQ B;  1ZYE A;  4CHS A;  2LQO A;  2IME A;  2CAQ A;  1TTZ A;  3VI7 A;  3TCO A;  3EWL A;  3CYN A;  4CW9 A;  2F8A A;  2FWH A;  2VD1 A;  2H1A A;  3QAW A;  5EPF A;  4NHZ A;  1OE7 A;  4ECI A;  3U5R E;  4QL9 A;  1T8E B;  3UAP A; 
#chains in the Genus database with same CATH homology
 2I3Y A;  2CX4 A;  2PN8 A;  3H1N A;  2X49 A;  3Q74 A;  1PSQ A;  1X9M B;  4LL4 B;  3GTU A;  3LJR A;  3MNG A;  1A23 A;  1GP1 A;  1YVL A;  4N3Z A;  3MYD A;  1JFU A;  4MP4 A;  5ECS A;  3GUS A;  2QA1 A;  1EGO A;  2VCW A;  3L4N A;  4XS6 A;  4YAP A;  5ECL B;  1SK1 A;  4MAB A;  1DSB A;  5EL8 A;  3UIW A;  1GSQ A;  4ZIL A;  1SKR B;  2VM2 A;  4USS A;  4G19 A;  4IVF A;  5CAX A;  1X5C A;  2E0Q A;  4PXO A;  5A1N A;  4GQC A;  2C80 A;  1GLP A;  4BL7 A;  1YKA A;  2OE1 A;  2RM6 A;  1GUL A;  1USB A;  4I5Q A;  4AKI A;  1M99 A;  3TKP A;  3KJY A;  4V2N A;  2GZY A;  5CRD A;  1VRS D;  3C1S A;  5A4V A;  3C71 A;  4ACS A;  3FW2 A;  4NV2 A;  1CQG A;  4ZB7 A;  2GZZ A;  3E9J B;  3TJB A;  2ON5 A;  2WB9 A;  1SYR A;  4EIQ A;  5HFK A;  2OA7 A;  1RK4 A;  4AF2 A;  4JBB A;  2DJ2 A;  1F3B A;  5CRE A;  5JCW A;  4ZBB A;  2M46 A;  4QL7 A;  2YV7 A;  2V6O A;  1T3B A;  5B8B A;  2HRK A;  2LQQ A;  3F0I A;  2H71 A;  2C0F A;  4GSN A;  1E6B A;  4OD7 A;  2VL3 A;  3TJF A;  2MMN A;  3A2X A;  2KOK A;  4TR4 A;  2AHE A;  3FZ9 A;  3F4T A;  1TK0 B;  2LS5 A;  1K3L A;  4MZW A;  4K7I A;  4AJ8 A;  4MF6 A;  5D93 A;  1J9B A;  4TR0 A;  1MDJ A;  2DBC A;  1BED A;  1PX6 A;  2ALB A;  2IPA A;  3ERF A;  4YQU A;  5L71 A;  2IFQ B;  5IOW A;  1M2A A;  3CXG A;  4WBJ A;  1AQX A;  5A4U A;  1X0R A;  2C4J A;  1U87 A;  5KN2 A;  2O85 A;  3US3 A;  3UL3 A;  4NXI A;  3H4K A;  2HRA A;  4TRX A;  3A2W A;  1FW1 A;  4BVY A;  2PU9 C;  1EZK A;  1TI3 A;  5H5R A;  2M80 A;  3DIE A;  4HJM A;  4Z7X A;  4Q5F A;  3GN3 A;  3VWW A;  4L8E A;  4JR4 A;  4EKZ A;  1N2A A;  4F2I A;  1G6W A;  3EMX A;  1JZD A;  3CRU A;  4Z2R A;  5KEJ A;  4HJ2 A;  3VFI A;  4ECJ A;  2N5B A;  1ZMA A;  1JZO A;  2LST A;  2LRC A;  4ECC A;  2FHE A;  3GMF A;  3LEF A;  18GS A;  5DCG A;  4HQZ A;  5F0G A;  2PMT A;  1K3Y A;  4KDX A;  2HFD A;  1WOU A;  3ZYW A;  2TIR A;  3SWL A;  1PKW A;  1HQO A;  4MF5 A;  3ERG A;  2DLX A;  3BBY A;  2F3M A;  2VCX A;  4LL1 B;  4GLT A;  1GNW A;  2V6K A;  3DXB A;  3IOS A;  2WUL A;  2V1M A;  4ZB8 A;  2P5R A;  2AB6 A;  4AGS A;  5JWO B;  20GS A;  3ZL5 A;  5CRH A;  2H66 A;  4WR4 A;  1QMV A;  2NBS A;  4PX1 A;  1NW2 A;  3RHB A;  2AJQ B;  1TOF A;  3QFB C;  4TN8 A;  1YDK A;  3LXT A;  2ZNM A;  4ICY A;  4DSS B;  4IHU A;  1LBK A;  2L5O A;  4MNN A;  1W89 A;  1SD8 A;  2LRT A;  1YEP A;  3WD6 A;  1S3D A;  4KSM A;  1GLQ A;  5E4W A;  1SJ6 A;  2K18 A;  2MBS A;  5J41 A;  4YQV A;  4LMV A;  5A34 B;  4N0V A;  4EUY A;  2LJR A;  3KH9 A;  4F9Z A;  2DJJ A;  2B3S A;  3DVW A;  2H30 A;  3DYR A;  4Z2T A;  3N5O A;  4IW9 A;  4RUV A;  1TP9 A;  3TJJ A;  5ID2 A;  2MZC A;  5J3R A;  4HEA 2;  1NHY A;  2L4Q A;  2X8H A;  4CY8 A;  11GS A;  1ERU A;  3IDV A;  1O81 A;  3TRQ A;  5DJL A;  4MPF A;  2HQT A;  5FT3 A;  2DKI A;  3CMI A;  1KNG A;  4V2L A;  3KD0 A;  2V2G A;  2R0P A;  4KGI A;  1BF5 A;  1JLW A;  4BWS A;  3M1G A;  5IMV A;  5ECR B;  4BA7 A;  1BG5 A;  2YNX A;  3ME7 A;  3IHG A;  3QMX A;  5ECN B;  2IIY A;  3UEM A;  2TRX A;  2YV9 A;  3FR3 A;  3N9J A;  4KCE A;  1XBS A;  4ZBD A;  1SYX A;  3GTU B;  1AW9 A;  4YQM A;  2VCQ A;  1SK2 A;  3MWH A;  1GWC A;  2HZE A;  4K0G A;  3D4T A;  4WR5 A;  1U88 A;  2PVO C;  2AUV A;  2DJ3 A;  1SKS B;  3DGQ A;  2OAD A;  2H74 A;  4OFM A;  3IC4 A;  2REM A;  1GTU A;  1TXX A;  5DBQ A;  4TVE A;  2C3N A;  1PA3 A;  1ERV A;  6GSY A;  3ZVJ D;  3GX0 A;  3D6I A;  2VO4 A;  2FLS A;  3EC3 A;  3CWG A;  4OO5 A;  1SL0 B;  3F6D A;  3ISO A;  3FR9 A;  2X99 A;  2MYG A;  1TRS A;  2L6C A;  1S3A A;  3RAZ A;  5A1N B;  2DKH A;  3TU3 B;  5B6M A;  3GV1 A;  4BL7 B;  1QGV A;  2GT6 A;  4KND A;  1W4V A;  4DSQ A;  1G6Y A;  3ZTL A;  1ZZY A;  3DEX A;  3M9K A;  3FZ4 A;  4GSS A;  2V32 A;  3IV4 A;  4HS1 A;  2GVP A;  1THX A;  3K8N A;  2XC2 A;  1SL1 B;  1U3A A;  1PX7 A;  6GSW A;  1EV9 A;  3IR4 A;  3G7J A;  4ID0 A;  5CO3 A;  4TOP A;  2R2J A;  2F8F A;  1WPI A;  3CSJ A;  3I69 A;  3FZA A;  2HRK B;  4ZB9 A;  4AI6 A;  4I97 A;  1JLV A;  5DQS A;  2HRN A;  2JAC A;  4EO3 A;  1URM A;  1GSD A;  4F03 A;  5HR1 A;  2PWJ A;  2A4V A;  2QSI A;  2OBK A;  1GSE A;  1AIU A;  4WF4 A;  2GQK A;  3LYP A;  2VCV A;  4TR1 B;  19GS A;  2NDO A;  5IPH A;  1ML6 A;  3H93 A;  2IJY A;  1PN9 A;  4KH7 A;  1DE2 A;  5IO2 A;  3TRP A;  3S9F A;  1GTA A;  1Z6N A;  4TW5 A;  4MA9 A;  3L78 A;  3BCK A;  4ZB6 A;  2C3Q A;  2OKA A;  4RI7 A;  5HR3 A;  1HYU A;  3QCP A;  4NAX A;  2L57 A;  1XVQ A;  2LKU A;  2I81 A;  3UVH A;  2E7P A;  2VIM A;  3GKK A;  1GUH A;  1PQN A;  4KB3 A;  3GST A;  4MDC A;  3FEU A;  4D73 B;  1BQ7 A;  1DBY A;  3HCZ A;  4RQR A;  3IPZ A;  1RQM A;  2HZF A;  2VM1 A;  5G31 A;  4XS4 A;  2CVD A;  3F8U A;  4BPY A;  3M0F A;  4K8M A;  2HI7 A;  2CVK A;  3GKN A;  1R4W A;  4OO4 A;  1KTE A;  1H75 A;  2DIZ A;  4KCA A;  3TKS C;  1UVZ A;  2VL9 A;  2LNT A;  3EU4 A;  4PNG A;  5DAL A;  3VK9 A;  3ZML A;  1WP0 A;  4MH2 A;  4TR3 A;  2HYX A;  2VKZ G;  3BD2 A;  1ZGN A;  3L0H A;  4EIP A;  4IQA A;  1C72 A;  1MDK A;  3ZFL A;  1A24 A;  4N30 A;  1A0F A;  2H1B A;  3G7I A;  4HI7 A;  3M8N A;  1Q4J A;  3HZ8 A;  3FR6 A;  3ZIT A;  2A4H A;  3KMO A;  2GSS A;  3Q19 A;  5AIV A;  2F51 A;  2DJK A;  2XPD A;  2JZR A;  1JZW A;  3HJM A;  1U6T A;  4WET A;  3GIX A;  2P5Q A;  1Q98 A;  2L5L A;  4GF0 A;  2K8S A;  5AIX A;  4Z2U A;  5B7C A;  2GSR A;  4AKH A;  1TKD B;  2EIR A;  4HDE A;  4OCF A;  1FOH A;  3ZFB A;  3HXS A;  3VI5 A;  3GH6 A;  4J56 E;  2HT9 A;  4K1F A;  1FG4 A;  1M9B A;  5J9C A;  2A2P A;  1ST9 A;  2K8V A;  5H5S A;  4MMM A;  1MDI A;  2D2Z A;  1PD2 1;  3IC8 A;  5FWG A;  5HFG A;  5ID2 B;  4MZB A;  2H8L A;  2O87 A;  4K5S A;  1O8X A;  3EPT A;  2VL2 C;  4I6X A;  3F63 A;  2IL3 A;  1TRV A;  2I9H A;  4HU7 A;  4JED A;  4PNF A;  3ZRE A;  2ON7 A;  1UN2 A;  4I2U A;  1TW9 A;  2RUE A;  5F07 A;  4XRD A;  4K7N A;  3ZVJ A;  2B7J A;  2H6Y A;  1YQ1 A;  1XWA A;  3FKF A;  4PUA A;  2WGR A;  4J57 E;  1O7U A;  1RW1 A;  5ABR A;  3QD9 A;  1XOA A;  1PL1 A;  4N0Z A;  2HSY A;  5IO0 A;  3G7Y A;  5INY A;  4NPB A;  2R0G A;  4K9Z A;  1GNE A;  4IGJ A;  4IEL A;  3TDG A;  2H19 A;  2KLX A;  4KX4 A;  4HZ4 A;  3GYK A;  2DMM A;  3R2Q A;  4K2X A;  1THO A;  2DIY A;  4ECB A;  1SD9 A;  2KP2 A;  1FAA A;  1TDI A;  1FOV A;  3ZIV A;  4BVX A;  2C0E A;  5LCZ A;  5DDL A;  1SVO A;  2CZ2 A;  4G01 A;  1F6M C;  1XCC A;  2E2M A;  6GST A;  3C7M A;  1F3A A;  1OC8 A;  2F9S A;  2KUC A;  2HSM A;  3GNJ A;  3CBU A;  3HVS A;  1SL2 B;  3APO A;  7GSS A;  5GSS A;  3KXO A;  4O5R A;  2IN3 A;  1K3O A;  4GXZ A;  3GL3 A;  4HQS A;  1TRW A;  3F6F A;  2C1Y A;  3UBL A;  2Z9S A;  1GUM A;  9GSS A;  3VPQ A;  3TUE A;  2R6K A;  3APQ A;  4E8E A;  4AKX B;  3ZLP A;  1ERT A;  4GDF A;  1TRU A;  4ULX A;  4LMW A;  4V1A g;  2JZT A;  4W66 A;  4L0W A;  4ISD A;  2YOI A;  4HU9 A;  3UMA A;  4TXO A;  4DEJ A;  3GKX A;  3D21 A;  2G2Q A;  1A0R P;  5GZZ B;  5ECH B;  4POK A;  1BJX A;  3KH7 A;  4HZ2 A;  4EE0 A;  1M2D A;  3GH9 A;  1XWB A;  5G5E A;  1K0A A;  5J4U A;  5IQY A;  2H70 A;  1GTI A;  4KDY A;  3UJ1 A;  5IOX A;  4NMU A;  2BMX A;  1WWJ A;  2B5E A;  1ZYQ B;  1AUC A;  3O76 A;  2LJK A;  1E2Y A;  1HNA A;  6GSS A;  4MH3 A;  3MSZ A;  1O73 A;  3CTF A;  3HD5 A;  1ZYN A;  1X9W B;  5BRT A;  4KSO A;  3IK7 A;  1U3I A;  3V1W A;  3L9V A;  1WE0 A;  2O8V B;  1FVJ A;  3TJK A;  4XHM A;  8GSS A;  4A5P A;  1XXU A;  3LWA A;  1O85 A;  2MMO A;  5H5Q A;  4IP6 A;  1JHB A;  3RHC A;  1H4O A;  2LEG A;  1X5E A;  3WT2 A;  3GRX A;  2H01 A;  1ZOF A;  4JR6 A;  2CQ9 A;  1ZYP A;  1Y1U A;  3M9J A;  2BJX A;  1XFL A;  1V40 A;  3HYP A;  3FY7 A;  2O7K A;  2WRT A;  1GH2 A;  2WDU A;  3L9U A;  1FB0 A;  1GTB A;  2VUP A;  3PR8 A;  3H8Q A;  3GUR A;  4ML1 A;  2X8G A;  1ZL9 A;  1R26 A;  5G30 A;  4EDY A;  3DRN A;  2DC5 A;  2X4A A;  1V58 A;  4FYC A;  2FGX A;  2H6X A;  3PH9 A;  2P31 A;  1AXD A;  1O8W A;  5B6N A;  5JCU A;  3D5J A;  5DAL B;  4PTS A;  1PKZ A;  1EOH A;  4ZL7 A;  1ABA A;  1GRX A;  5AIS A;  3RPN A;  4CDO A;  1YZX A;  3DD3 A;  4FQU A;  2GDR A;  3DML A;  22GS A;  4O5U A;  1EP8 A;  3A5W A;  4LA1 A;  2YZH A;  3HKR A;  5DVB A;  1K0B A;  4PUR A;  2CX3 A;  2R4V A;  1T1V A;  1M7T A;  2YJ7 A;  4POL A;  3I6A A;  1V98 A;  2GQL A;  2YWO A;  2UV8 G;  3DKS A;  5D9V A;  5ECI B;  3IAM 2;  1R7H A;  3EUR A;  3HZ4 A;  2WJU A;  3UBK A;  2NTO A;  5G5F A;  1SEN A;  3I43 A;  1A2M A;  1X5D A;  5EVO A;  3BJ5 A;  2N5A A;  2YJH A;  4JU5 A;  3RDW A;  4AJ6 A;  5J5N A;  2JU5 A;  4K5R A;  5GAP D;  6GSU A;  4IP1 A;  2WS2 A;  3EE2 A;  2GQM A;  2HRF A;  4H86 A;  17GS A;  1UC7 A;  5DAK A;  4O5Q A;  3WGE A;  1DE1 A;  4BWQ A;  4GCI A;  1EOG A;  2EFD A;  4IQ1 A;  1YJ6 A;  1K0M A;  2MMZ A;  4NWY A;  1Y25 A;  2OJL A;  1PN0 A;  2H1D A;  4ILF A;  1PL2 A;  4Q5N A;  5BMU A;  2H0G A;  10GS A;  5B8A A;  1V9W A;  2RM5 A;  3MDK A;  1XW6 A;  4G0L A;  3CTG A;  1Z7P A;  3QAG A;  3WGX A;  4G9H A;  1B9X C;  3GA4 A;  2O89 A;  4G0I A;  3Q6O A;  2AV4 A;  4IJ3 A;  1QK8 A;  4EDZ A;  2R37 A;  2LTK A;  5F06 A;  5HR2 A;  5E59 A;  1KEB A;  2BTO T;  1T00 A;  5A5H A;  4O92 A;  2QA2 A;  1Z5Y E;  2GS3 A;  3BCI A;  4PGT A;  3TKS E;  6GSV A;  6GSX A;  2LV3 A;  4J2F A;  3TGZ A;  3VWV A;  4KAE A;  5GST A;  4CY6 A;  2G0F A;  1WMJ A;  4YH2 A;  4BVX B;  2CVB A;  4MJE A;  1SVL A;  2XBQ A;  4N11 A;  3U6V A;  4WF5 A;  3J7Y k;  2V41 A;  3GFK A;  3FRC A;  1OC3 A;  1IYI A;  4L5L A;  1BX9 A;  4AJ7 A;  4KA0 A;  2HSM B;  5D9X A;  4HOJ A;  1A8Y A;  3AY8 A;  3I9V 2;  2OT3 A;  3IA1 A;  1G7O A;  4O7H A;  3RBT A;  4WXT A;  4IS0 A;  2OAC A;  2H1G A;  2RLI A;  3TOT A;  2R3X A;  2JZS A;  2B5Y A;  4BVY B;  4ZXG A;  3ED3 A;  4DVC A;  2C8U A;  1NM3 A;  4IKH A;  1NSW A;  2J9H A;  3P90 A;  3PIN A;  4OMV A;  3FK8 A;  3GX8 A;  5AGY A;  1IYH A;  4TXO B;  3LW9 A;  3IRA A;  5D9W A;  4X0X A;  1GSF A;  1F9M A;  3KP8 A;  2DJ0 A;  2FWE A;  3J7Y b;  5ELG A;  4PQ1 A;  2EIQ A;  4GST A;  3LGC A;  5D9T A;  3SBC A;  2M72 A;  2L4C A;  1YKC A;  3LYK A;  4XCS A;  1ZCP A;  2YWI A;  4EF0 A;  5F05 A;  2EFE A;  1DUG A;  3VWX A;  3CSI A;  3P7X A;  1F37 A;  1PRX A;  4POM A;  2B6M A;  2H6Z A;  2VOC A;  4WEY A;  4IN0 A;  5KN1 A;  3TB2 A;  2FA4 A;  5G1K A;  2LJA A;  5F8B A;  2AYT A;  3C73 A;  4AKG A;  2VAF A;  2GT5 A;  2AAW A;  5IPG A;  5HFI A;  3IHQ A;  1QXH A;  4K6X A;  4EVM A;  1EP7 A;  4RQX A;  1PMT A;  2YN1 A;  1K0O A;  1ILO A;  2C0D A;  4F82 A;  1XWC A;  4ZIJ A;  2QKE A;  3PGT A;  4V1A p;  2X8C A;  1SJZ A;  3DVX A;  3NIV A;  2TRC P;  4TKY A;  4MJA A;  3Q18 A;  2PGT A;  4N10 A;  1OYJ A;  2LRN A;  4MZC A;  2OBI A;  3W8S A;  1OE8 A;  2IMI A;  4HUA A;  5JCG A;  2GST A;  3EIN A;  2FWF A;  3HDC A;  5J40 A;  2PPT A;  4JRR A;  2HSH A;  5J4V A;  1F2E A;  5A4W A;  1AC1 A;  1GSS A;  3D4M A;  4MJB A;  5DCH A;  2DSA A;  2DJ1 A;  1O6J A;  1TK5 B;  4YKG A;  4GQF A;  3L9S A;  4XIH A;  5IMD A;  2KP1 A;  2ZUP A;  3F4R A;  2PBJ A;  1A2L A;  5LD0 A;  4F0B A;  1BYE A;  4ZL8 A;  4QQ7 A;  3IAS 2;  1BG1 A;  1NHO A;  5ENU A;  1EV4 A;  5ECM B;  4Q5R A;  4P3Y B;  3MIX A;  4ML6 A;  1YF1 A;  4X4J A;  2E2G A;  1Z6M A;  3IE3 A;  2HXK A;  4EL1 A;  4G0K A;  3A2V A;  5J4Y A;  5G1L A;  4LLR A;  3LXZ A;  2CZ3 A;  5COH A;  3HJO A;  2HZE B;  4K2D A;  4KE3 A;  4KUN A;  5D8I A;  4QMK A;  3GHA A;  4XS1 A;  3JCM L;  2YAN A;  3E0U A;  1V2A A;  2MBT A;  4X1U A;  3G9B A;  3ZIJ A;  4FYU A;  2H72 A;  1I9D A;  4FYB A;  4MCU A;  2K9F A;  3F4S A;  3NZN A;  4E68 A;  5DAK B;  2CT6 A;  2I4A A;  1K0D A;  2EFC A;  1OC9 A;  2FUG 2;  1VF1 A;  1TK8 B;  3P2A A;  2H0I A;  4EXJ A;  2FNO A;  3IBH A;  5AN1 A;  1XWK A;  5BMU B;  4RI6 A;  4MLY A;  1T7P B;  1VF3 A;  3TJG A;  3UVT A;  1ACV A;  2JSZ A;  5DQY A;  1A2J A;  1S3C A;  4XTS A;  5DJM A;  3VPT A;  4FO5 A;  1HNC A;  3M3M A;  1VF2 A;  1TI1 A;  1MD4 A;  2WZ9 A;  1OAZ A;  2NPB A;  4TR1 A;  4JZQ A;  5A5H B;  1EEM A;  2HSN A;  1OVN A;  3C8E A;  1B4Q A;  2PUK C;  3W8J A;  2J23 A;  5IM9 A;  4OFT A;  1Z3E A;  13GS A;  5JWR B;  2O5V A;  2CAI A;  4YKF A;  2H73 A;  2KHP A;  2DML A;  3A3T A;  2H0H A;  3LQ7 A;  3MAK A;  1OKD A;  3ZMK A;  3TKR A;  1M2B A;  2YCD A;  4D73 A;  3EYT A;  2L59 A;  1SK0 A;  2IMF A;  4WBR D;  4PQI A;  4ZBA A;  5IMZ A;  2A2R A;  2YWM A;  1TXU A;  4KW6 A;  1V57 A;  4K7O A;  1VF4 A;  3PPU A;  1ERW A;  2H76 A;  2H1L A;  1LU4 A;  2YPM A;  3HHV A;  1SJI A;  1XW9 A;  2LUS A;  5ECP B;  2FY6 A;  2PVQ A;  1MD3 A;  1GUK A;  5D73 A;  4F0C A;  3EVI A;  1B48 A;  3F3Q A;  3TOU A;  3HJP A;  4G2E A;  1A8L A;  2N5F A;  1Z9H A;  5CNW A;  2QGV A;  4XS4 B;  2QC7 A;  5CP1 A;  1GSY A;  4MK3 A;  2EC4 A;  4PQH A;  5KOW A;  1T4Z A;  5D96 A;  1TU7 A;  4V2M A;  5J47 A;  2JAD A;  1WRY A;  5FHI A;  3LFL A;  4MJC A;  5CYY A;  4G10 A;  1M0U A;  5LNK e;  3CSH A;  3TKQ A;  4OCE A;  4L0U A;  2YWN A;  4XRA A;  2C0G A;  3R3E A;  4FIW A;  5CRG A;  3QOU A;  1XPV A;  1Z7R A;  2PER A;  4DSR A;  3IK9 A;  4NHW A;  5IIZ A;  2FA8 A;  2FWG A;  3QDN A;  3ZZX A;  2OE0 A;  2WCI A;  1G7E A;  16GS A;  5GAN D;  1SKW B;  2FD3 A;  2L6D A;  1WJK A;  4YAV A;  1SVM A;  3P8W A;  2IWT A;  1CQH A;  5C04 A;  1XW5 A;  4X43 A;  4EC0 A;  4L5O A;  1K0C A;  3QR6 A;  1N25 A;  1JZR A;  3WGD A;  3A5I A;  3BOA A;  2VCT A;  1XVW A;  1BAY A;  2OE3 A;  2LNS A;  3KTL A;  3WYW A;  5KN0 A;  3TKS A;  4IBP A;  2ZCT A;  5HR0 A;  2VD0 A;  5CRW A;  1FHE A;  5ECK B;  3KM6 A;  4GRF A;  3NOF A;  4OWY A;  1QFN A;  3F3R A;  1TJD A;  2NVL A;  1OKT A;  1J0F A;  3QPM A;  2R0C A;  2CA8 A;  5ECO B;  3W6G A;  2UZ8 A;  4JE1 A;  3O3T A;  2GLR A;  5G2Z A;  1FB6 A;  2C3T A;  3FYG A;  2P0G A;  5C00 A;  1TU8 A;  3GSS A;  2R5G A;  3FMW A;  1FO5 A;  1EWX A;  5A5K A;  3IXR A;  1HD2 A;  3ERW A;  1HNB A;  1G0T A;  3WT1 A;  1XIY A;  4MF7 A;  1XZO A;  2A2S A;  3VLN A;  3HMJ G;  1AAZ A;  1T4Y A;  1KBN A;  5JWQ B;  3UOM A;  1Y6E A;  5EY6 A;  1ON4 A;  2WFC A;  2CV4 A;  1GSU A;  1AQW A;  3CRT A;  4K0N A;  3HVV A;  1I5G A;  1MTC A;  2RII A;  1EGR A;  2JSY A;  3GL5 A;  14GS A;  3E3E A;  3KP9 A;  1R5A A;  3KIJ A;  4O32 A;  2RUF A;  5HQP A;  2GGT A;  2YP6 A;  1B8X A;  1K0N A;  2IFQ A;  3LOR A;  3OR5 A;  5KN3 A;  1X9S B;  2MMA A;  4POB A;  3KZQ A;  2VL2 A;  1PGT A;  3FZ5 A;  1AQV A;  3VWU A;  1OC9 B;  3HVX A;  1XOB A;  3KTB A;  12GS A;  3TRX A;  1J08 A;  2HNL A;  1EEJ A;  4MPG A;  2YZU A;  2VLU A;  1YF0 A;  3QFA C;  3ME8 A;  3RPP A;  3LG6 A;  1QUW A;  1FVK A;  2VLV A;  3UAR A;  4I2T A;  3F9U A;  1QQ2 A;  3VUR A;  2GZP A;  4GWR A;  4IJI A;  3APS A;  2B1L A;  2B1K A;  5ELA A;  3KMN A;  2HSN B;  1WIK A;  1XWG A;  1GL8 A;  1MEK A;  5IMA A;  1N8J A;  2EIO A;  3HY2 A;  4Q5Q A;  2IMD A;  1M9A A;  3ZRD A;  3EU3 A;  3QAV A;  3KCM A;  4ZL9 A;  3O6T A;  4KF9 A;  3H79 A;  3D0Z A;  1YEX A;  1UA5 A;  4E8H A;  2JL4 A;  1R5P A;  4GTU A;  2VCZ A;  2XHF A;  4PUF C;  3KEB A;  2X64 A;  2XPE A;  1VGL A;  2EFH A;  2VLT A;  4I8B A;  2HLS A;  2XBI A;  3EMP A;  2HE3 A;  2IMK A;  3D22 A;  1B9Y C;  5IMC A;  3KGK A;  2GTU A;  2ES7 A;  4DSS A;  2K6V A;  1B4P A;  1YY7 A;  4OFN A;  4FH8 A;  1LJR A;  2I1U A;  3LSZ A;  4KDU A;  4WKW A;  2FCH A;  2B7K A;  3C1R A;  2H75 A;  1SU9 A;  3DWV A;  5IMF A;  3HA9 A;  5KOX A;  5A34 A;  2B5X A;  3FHK A;  4TXV A;  4NV5 A;  3GKM A;  2GSQ A;  5J9B A;  5ECQ B;  1ZYE A;  4CHS A;  2LQO A;  2IME A;  2CAQ A;  1TTZ A;  3VI7 A;  3TCO A;  3EWL A;  3CYN A;  4CW9 A;  2F8A A;  2FWH A;  2VD1 A;  2H1A A;  3QAW A;  5EPF A;  4NHZ A;  1OE7 A;  4ECI A;  3U5R E;  4QL9 A;  1T8E B;  3UAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...