6GSVA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLSHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
total genus 82
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gsvA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gsvA01
5HR0A 4QL7A 2ZUPA 3ZIVA 3EMXA 1GTUA 2GSTA 4PQ1A 3MAKA 3KP9A 1B4PA 2OE1A 1EV4A 2BTOT 1X9MB 3IXRA 2JSYA 3KH7A 4IN0A 2OADA 3APSA 3ZRDA 1N2AA 2H6XA 2H73A 2H0HA 4G0LA 5H5RA 4GLTA 4OFTA 4ML1A 1K0MA 2YV7A 3UJ1A 4PNFA 4BWQA 1GL8A 3FZAA 3K8NA 1T8EB 2GTUA 3PINA 3W8JA 1EEMA 2LSTA 2HZEB 3RPNA 2OJLA 1AQWA 3HVVA 1GTBA 3IK7A 3KM6A 4E8EA 1ERUA 1G0TA 4HQSA 1F37A 1M2BA 10GSA 3TKQA 3ME8A 4JRRA 1I9DA 1GLQA 5KN2A 3L78A 3ERGA 2FNOA 4NPBA 1O73A 2G2QA 2OBKA 4IJ3A 5G5FA 4I6XA 5D9TA 2H19A 1PMTA 1GSQA 3CRUA 3HJPA 2LNSA 1TP9A 4IS0A 3O76A 1TXXA 4K0GA 2AAWA 2K9FA 1TI1A 3TJFA 4BVYB 2I4AA 2QSIA 1S3AA 2LJKA 3A2WA 3BCKA 1GSEA 1V9WA 6GSVA 3WT2A 2C3QA 4EUYA 5GZZB 1AW9A 1YEPA 5ECPB 3DIEA 2Z9SA 3DKSA 3TRXA 1BG5A 1X5EA 2OACA 1KBNA 4ZL8A 4LMVA 4KH7A 2IJYA 4MMMA 3BOAA 3UBLA 3P7XA 2IIYA 4RI6A 4G0IA 1ZGNA 2HSMB 5DALA 5IMVA 3F3RA 5F07A 2PWJA 5CNWA 1NM3A 3IRAA 5GAND 2H70A 2TRXA 2B1KA 3GKKA 6GSSA 4XIHA 1O8XA 2AJQB 2CX4A 4RQRA 2UZ8A 1QGVA 3PPUA 1AUCA 4PURA 1GP1A 4GSSA 2F51A 2LJRA 3VLNA 3HZ8A 4PGTA 2VM2A 1GNEA 2VCXA 4KW6A 4NWYA 3D21A 4YQMA 1OKDA 1X9WB 2B5EA 2L5LA 1WJKA 2YV9A 5B6NA 1MTCA 3I9V2 3F6FA 12GSA 1F2EA 2YOIA 5E4WA 2GDRA 3TRPA 1GNWA 3MNGA 2O7KA 20GSA 3GUSA 5J9BA 3KP8A 2N5AA 4WF4A 1JZWA 3M9JA 5JWOB 5DAKA 2R3XA 2QC7A 3GHAA 4MPGA 3RPPA 1PX6A 2GSQA 5DQYA 1A23A 3EMPA 1VF4A 1GUMA 5DJLA 1LBKA 4MJBA 2IMKA 3ZREA 3WGEA 2H1DA 4G2EA 3D6IA 3LXZA 2V32A 2MBSA 3FRCA 1OC8A 2VOCA 4OCEA 4TW5A 1XWBA 3UARA 2A4VA 4ULXA 3LSZA 2E2MA 3IOSA 4TR1A 2X99A 3HDCA 3CYNA 1X5DA 5IOWA 4KSOA 3EYTA 3FKFA 1THXA 3ZTLA 3C73A 2H01A 2HXKA 3R2QA 1WMJA 4QL9A 3LEFA 3LGCA 1URMA 3FZ5A 3Q74A 4MA9A 5IOXA 1NSWA 1M2DA 3BJ5A 5IO0A 5C04A 4RI7A 1J9BA 3J7Yk 1AIUA 2J9HA 1V40A 3GL3A 3UAPA 4J56E 1OC9B 1RK4A 3WYWA 5C00A 1TU7A 4DSSA 3QFAC 3N5OA 1BX9A 3TJBA 3PGTA 4WF5A 2L6CA 5AN1A 4ECCA 3CTFA 2LQOA 3GKNA 3EINA 1B48A 3HYPA 5FHIA 4XRAA 1XPVA 1EWXA 1Z6MA 5ECOB 5JCUA 1YEXA 3KD0A 1AQXA 4MZCA 3M8NA 2O89A 4KDXA 2LRCA 5CRWA 4N11A 3D4TA 4KA0A 2H0GA 1JFUA 5DALB 3H79A 1Z3EA 1K3OA 2YN1A 4EDYA 4TRXA 2FWFA 4G9HA 4KB3A 1WOUA 1TK8B 3I43A 2WS2A 2IFQA 3F4TA 4OFMA 5B7CA 3CRTA 3WGXA 1A2JA 4IHUA 5KEJA 1PX7A 5GAPD 3VK9A 2H8LA 3PH9A 5HFGA 1PSQA 1YZXA 2FWEA 1SD9A 4MCUA 1TOFA 1SK0A 1PKZA 4TVEA 1U87A 1TKDB 1FHEA 4V2LA 3CSJA 3O3TA 1VF1A 1A0RP 4V2NA 3LWAA 3VPTA 3F0IA 3DYRA 1TK5B 2FWGA 4GCIA 1GRXA 4YQUA 5B6MA 3M0FA 3VFIA 2EIRA 4JEDA 4PUFC 2BJXA 4O5RA 1TW9A 5DBQA 2LRNA 1XFLA 4ACSA 1K0NA 1G7EA 1HNAA 1MD3A 5DAKB 4YQVA 18GSA 1B4QA 4HOJA 2DSAA 3VI5A 4HJ2A 3HXSA 4ID0A 1XXUA 1SD8A 1GTIA 5ECHB 3LJRA 1HYUA 5CAXA 1Z7PA 1IYHA 2PVQA 2XBIA 2C0FA 2VCTA 2CT6A 4ZL7A 2P0GA 3G7YA 4TR1B 2N5FA 2EIQA 3R3EA 3ERFA 2NTOA 5KN3A 3GMFA 1K0OA 3GYKA 4WEYA 3EU3A 2FHEA 1K0DA 3QDNA 4FYUA 2R4VA 4HI7A 1ERVA 4F0BA 5ECKB 3LQ7A 2B7KA 5IIZA 4IGJA 4DVCA 4EF0A 4WBRD 1EGOA 2YP6A 4WR4A 3QCPA 1MEKA 3EU4A 2WRTA 3I6AA 5A4UA 2PU9C 3TKRA 4KGIA 1XWCA 2LQQA 4P3YB 1Z7RA 5AISA 5DJMA 1OYJA 4ISDA 4F03A 1T1VA 2VCQA 4MF5A 1TRSA 4O7HA 3GX0A 1SKRB 1EEJA 5IMAA 4HUAA 4ZB6A 4G19A 2DMLA 1K3LA 4GTUA 2M80A 3W6GA 4POLA 1GSDA 2YWNA 5CP1A 3UVHA 2C8UA 1MDKA 3ME7A 4TR0A 3GTUA 17GSA 1F3AA 4HQZA 3DRNA 4MJAA 2B3SA 2V6KA 3BCIA 4BL7A 2PMTA 1CQHA 2O87A 2DBCA 4EXJA 2NVLA 1M99A 2FA8A 2IFQB 1QMVA 2PUKC 5INYA 3KEBA 2HLSA 4N0VA 3M1GA 5AGYA 2C3NA 4IBPA 5IM9A 4MK3A 3QAGA 5EL8A 4MLYA 2L6DA 3TUEA 2H0IA 2GLRA 3ZMLA 1JLWA 2KP1A 3ISOA 3NIVA 2GQMA 3TB2A 4LL4B 4JR6A 4I2TA 1GTAA 5LD0A 2DIYA 3L9SA 3CMIA 3OR5A 3WD6A 1SL2B 4XS1A 2GS3A 3KTLA 5G5EA 4GXZA 2AUVA 5IPGA 4ZXGA 2WZ9A 2I3YA 3D4MA 5ECLB 5DDLA 5HFIA 2I9HA 2WCIA 3FR9A 3G7IA 2HI7A 2K8VA 3GA4A 3I69A 1A2MA 2FLSA 2AB6A 3TRQA 3ZFBA 2HRAA 1XW5A 2WDUA 3L9UA 2K18A 2L4QA 4MF7A 1HQOA 1EOGA 2CVDA 2MMNA 2X8HA 4JZQA 1XIYA 1TDIA 4TKYA 5J4UA 9GSSA 3FY7A 4NHZA 2IN3A 2H1GA 1M9AA 2EIOA 5ID2A 4HS1A 4WXTA 1B8XA 3GSTA 1OAZA 5EVOA 3ZITA 1Q4JA 3FZ9A 4K6XA 3LFLA 2H72A 1GSFA 4O92A 4MH3A 1OC9A 2G0FA 1XZOA 3V1WA 1K0AA 1XWGA 2MBTA 1A0FA 1ZL9A 2R6KA 1ZYQB 2HNLA 4AGSA 5DCHA 5IO2A 4DSQA 3TJGA 3CSIA 2VLUA 2REMA 5A4VA 2J23A 1ML6A 2CQ9A 2YZUA 1VF3A 4MDCA 1U88A 2IL3A 1B9XC 1BJXA 4WBJA 1WIKA 1SYRA 2AHEA 1SK1A 2FCHA 4F0CA 2RIIA 1THOA 3VPQA 4Z7XA 3PR8A 5F8BA 3HD5A 2DJ1A 1S3DA 1ON4A 4F2IA 1U3IA 2M46A 3GTUB 3QFBC 4HU9A 2GSSA 4ZIJA 5IQYA 1AAZA 2EC4A 1H75A 2WGRA 4BL7B 4K9ZA 1PL1A 3KGKA 3RHCA 1A2LA 1V98A 4CHSA 2HZFA 2KLXA 3O6TA 4G10A 1QQ2A 1MD4A 2PPTA 4K2DA 4MZBA 5BMUA 2C3TA 5LNKe 2PN8A 1V2AA 2XPDA 1J08A 4N10A 2O8VB 4ZBDA 3WT1A 2VD0A 2C0DA 2ZCTA 2L59A 3IAS2 1EV9A 3EC3A 5E59A 3ZL5A 1GWCA 5KN0A 2GT6A 1XW6A 1FO5A 1QFNA 2F3MA 4ZILA 3UOMA 3LORA 2LKUA 1O8WA 3L9VA 5HFKA 2V41A 3UEMA 1O6JA 1EZKA 4J57E 3GX8A 3TOTA 2E7PA 3HVXA 1XVWA 2PBJA 2LTKA 3DEXA 5ECNB 3F9UA 5A5KA 3A2VA 2RLIA 3H93A 2MYGA 2YJHA 5ELAA 1O81A 3MDKA 2LS5A 3NZNA 3TKSE 2IMIA 3FK8A 2V6OA 3M3MA 4XTSA 3IK9A 4MPFA 3MWHA 3GKXA 2H66A 4K7IA 1YJ6A 3E9JB 1XWAA 2VL9A 3F8UA 1M7TA 3KIJA 5CRDA 1AXDA 2B5XA 4CW9A 1WP0A 5ID2B 3BD2A 3VI7A 3J7Yb 4ML6A 3ZYWA 2VD1A 4XRDA 3ZVJA 5HR3A 2VO4A 5B8BA 1GLPA 3EWLA 2DC5A 4KCEA 3FR6A 5CYYA 4N30A 4LL1B 3UL3A 4L5LA 2CAQA 1M9BA 5J41A 3L0HA 2X8CA 1LU4A 5DQSA 2YANA 1W89A 4HZ4A 4OMVA 1ZOFA 5IMFA 4MP4A 2ALBA 4KAEA 3GH9A 5EPFA 3KZQA 4MH2A 1OE8A 1DBYA 2K6VA 2CV4A 3KH9A 1B9YC 1O7UA 2M72A 3VWVA 2GQLA 5ECMB 5HR1A 1OKTA 2FA4A 2TRCP 1EOHA 3IE3A 3VWWA 2NBSA 1YF0A 2OKAA 2YPMA 4GQCA 2HRKA 2ON5A 1GUKA 1SENA 3WGDA 4GSNA 1SU9A 4IP6A 2YWMA 5B8AA 3KMOA 5D9VA 4POKA 3FEUA 4OFNA 2GZPA 1NHOA 3UBKA 4BVXA 3GRXA 2X64A 2LEGA 4L5OA 1PD21 4MABA 4IVFA 2F8FA 2X8GA 1U6TA 4PQHA 2OE0A 4QQ7A 2DLXA 1IYIA 3F63A 2H75A 1ABAA 4OO4A 2GT5A 2JZTA 2L57A 2XHFA 1AQVA 1ERTA 4X0XA 2JU5A 1HNCA 4EO3A 2R37A 1GH2A 2O85A 3GNJA 6GSTA 1QK8A 2HFDA 4ECBA 5F0GA 1GUHA 5LCZA 5G1KA 4DSRA 3BBYA 4Q5FA 4PNGA 1W4VA 1PRXA 5CRGA 6GSWA 2H1BA 2GQKA 3TOUA 1T3BA 3VWUA 1JZRA 1JZDA 2A2RA 1YY7A 4NAXA 2I81A 2DJ0A 3HZ4A 2IMFA 1ZZYA 1UN2A 3APQA 1MDIA 1M0UA 1I5GA 2FD3A 1UA5A 3IV4A 2F9SA 1SYXA 2IMEA 1KEBA 1PN9A 1FAAA 3ZLPA 3Q19A 1G6WA 4JU5A 2C80A 3D5JA 3D22A 4MJCA 1G7OA 1WPIA 1Z9HA 4FYBA 2MMZA 1KNGA 1FW1A 1F9MA 1T00A 2VL2A 1YDKA 3FZ4A 1Z6NA 3HJMA 4V1Ap 4KNDA 3CBUA 2H74A 3A3TA 2PGTA 3QMXA 4TXOB 1Y25A 4ECIA 1XVQA 4TR3A 4XS6A 3FW2A 3A2XA 3FHKA 1K0BA 3HCZA 2CX3A 1PKWA 3IPZA 5GSSA 1TJDA 4LMWA 1PL2A 4XS4A 1DE1A 2GGTA 1RW1A 1F6MC 3DWVA 3TDGA 4IQ1A 5J9CA 3C1SA 1E6BA 4V1Ag 2AYTA 3QPMA 5J3RA 2C0EA 4E8HA 3GKMA 2RUEA 1YF1A 5A4WA 3IC4A 3A5WA 1NHYA 2XBQA 2HRKB 3C7MA 1ZCPA 3E3EA 3US3A 4H86A 4Q5NA 3N9JA 3U6VA 4BVXB 4JR4A 3DD3A 2H6ZA 2ZNMA 1SJIA 4IJIA 1ST9A 1M2AA 4IP1A 2BMXA 3W8SA 2JADA 4OWYA 2JSZA 4IW9A 2OA7A 7GSSA 4OO5A 1V58A 1XCCA 2P31A 3DVWA 1JHBA 5H5SA 1AC1A 3GSSA 4EVMA 4WR5A 1Y6EA 3KMNA 2B6MA 1XOAA 2JZRA 1EGRA 1YKAA 3KTBA 2VLVA 2DMMA 3HY2A 5COHA 1G6YA 3DXBA 5CREA 4J2FA 3JCML 1BAYA 2CZ2A 2QGVA 2PERA 3L4NA 3UVTA 4I5QA 1BEDA 4OCFA 5D9WA 1ILOA 2WJUA 1N8JA 1XOBA 5ECQB 5ECRB 2B1LA 2PVOC 4ZBAA 2DJKA 1A8LA 2WFCA 5JCWA 1OVNA 1CQGA 6GSUA 1EP7A 4AJ6A 3HKRA 4OD7A 3E0UA 1TTZA 5HQPA 3G9BA 5D8IA 4I8BA 2WULA 4L0UA 1XW9A 3IHQA 4FIWA 3IDVA 2RM5A 4EDZA 1HNBA 3U5RE 3Q6OA 4PQIA 2R5GA 1FOVA 4KDUA 4ECJA 4PXOA 1LJRA 4YAPA 2VCVA 3ZIJA 4X1UA 3IA1A 3HHVA 2MZCA 5ELGA 2V2GA 1R5AA 2DJJA 3F3QA 3KCMA 4KE3A 5EY6A 4HDEA 3UMAA 1WRYA 4F9ZA 1FVJA 4TXVA 1T4YA 1GSYA 3ERWA 1JZOA 3APOA 3ZMKA 2H76A 3CTGA 4IQAA 4GSTA 4XS4B 4DEJA 22GSA 2CVBA 2CVKA 4PTSA 2CA8A 4MZWA 1FG4A 4GF0A 2KHPA 3HVSA 3GL5A 1UVZA 4D73A 1R5PA 2HE3A 3FR3A 5HR2A 4XCSA 1TK0B 2FY6A 2VL3A 1R7HA 2CAIA 2VCZA 4JE1A 2GVPA 5CRHA 2H30A 4EKZA 3FYGA 3C1RA 2KOKA 2VUPA 3KJYA 3H4KA 4N0ZA 1VRSD 4AF2A 3LG6A 2FWHA 4K0NA 4ZL9A 5G30A 3GH6A 4YH2A 4POBA 2E0QA 2YJ7A 2IPAA 4TN8A 3TKSA 3QR6A 2JACA 4KUNA 1BQ7A 1R26A 2C1YA 3LYKA 3ZVJD 1Z5YE 3P90A 3LXTA 4G0KA 5GSTA 3QD9A 1H4OA 11GSA 4FO5A 1ACVA 4NV2A 2LRTA 1ZYEA 1JLVA 4K7NA 3TJJA 2I1UA 2N5BA 4F82A 4EE0A 1X0RA 4BPYA 4GQFA 1GULA 2IMDA 2DIZA 3F4RA 3TKSC 1SJZA 4HZ2A 3H1NA 4ZB8A 4KX4A 4WKWA 4JBBA 1GSSA 2VM1A 2TIRA 1YQ1A 1SJ6A 4BWSA 3RHBA 4PX1A 3SWLA 1O85A 2RUFA 3VWXA 2F8AA 2YZHA 3CXGA 2LUSA 1RQMA 2DJ2A 5ENUA 1Q98A 3TCOA 1GSUA 1XBSA 4LA1A 3LYPA 5DCGA 5IMCA 3P8WA 3TGZA 3C71A 4EC0A 2VLTA 5IMDA 3DGQA 2DJ3A 1SL0B 3IBHA 2L4CA 5DVBA 1VGLA 5ABRA 2LV3A 3QAWA 1FVKA 1UC7A 1C72A 2FUG2 4POMA 4TXOA 3RAZA 1TRWA 1X5CA 3NOFA 3UIWA 2MMAA 1SKSB 4LLRA 1T4ZA 2B5YA 2H71A 4USSA 4NHWA 1X9SB 4ZB9A 4AJ7A 4MF6A 8GSSA 1YKCA 1OC3A 3GURA 1R4WA 4TR4A 4K1FA 4NXIA 2CZ3A 5G31A 4YAVA 2OE3A 4AJ8A 5KN1A 2KUCA 4GRFA 2GSRA 2YWIA 3AY8A 2A2SA 6GSYA 2HSNB 2H1AA 1KTEA 3VURA 1TRUA 4D73B 3GV1A 2V1MA 5G1LA 1MDJA 2YWOA 3TJKA 3QOUA 2HT9A 1F3BA 5D73A 4K8MA 1T7PB 4I2UA 2OBIA 3EURA 3GFKA 4ZBBA 2WB9A 4HEA2 3SBCA 2VAFA 1SK2A 3HJOA 1HD2A 4KF9A 3DVXA 3F4SA 1BYEA 5CO3A 5JWQB 3EVIA 5G2ZA 6GSXA 2NPBA 3CSHA 1PQNA 3EE2A 5F05A 2AV4A 2K8SA 5ECIB 5D9XA 1QXHA 5IPHA 4GWRA 3IC8A 2XC2A 4FH8A 4IELA 4IKHA 3TKPA 1PGTA 1TI3A 2HZEA 2L5OA 2XPEA 5JCGA 5J5NA 2HYXA 2P5QA 2FGXA 1A24A 3C8EA 3D0ZA 1DSBA 5AIXA 1J0FA 1EP8A 2E2GA 4NMUA 3Q18A 4FYCA 3DMLA 3S9FA 2GZYA 2HSHA 1WE0A 4L0WA 3G7JA 2IWTA 3GIXA 4NV5A 2LNTA 3P2AA 4RUVA 4I97A 2LJAA 2ON7A 1FB0A 1NW2A 2VCWA 3ED3A 4TOPA 4K7OA 4CDOA 3H8QA 1SL1B 1K3YA 3RBTA 2YNXA 2HSYA 1ERWA 1USBA 2KP2A 4BVYA 2HRNA 2HRFA 1TRVA 1PA3A 4WETA 2R2JA 5AIVA 2C4JA 4ILFA 5F06A 5FT3A 2HQTA 3F6DA 1QUWA 4MJEA 1E2YA 4O32A 2RM6A 2NDOA 1SKWB 4RQXA 4KCAA 16GSA 5H5QA 4Q5QA 2VL2C 1VF2A 4EL1A 4L8EA 4Q5RA 5L71A 1K0CA 1V57A 1S3CA 4DSSB 5FWGA 2H6YA 3IR4A 13GSA 4FQUA 3IAM2 1DUGA 3QAVA 4V2MA 4HJMA 4HU7A 14GSA 3M9KA 2HSMA 2QKEA 2B7JA 1A8YA 3HA9A 3MSZA 4PUAA 1XWKA 3KXOA 2YCDA 2MMOA 1U3AA 19GSA 2GZZA 3ZFLA 5D93A 2JL4A 2VIMA 1WWJA 4BA7A 1TU8A 5IMZA 3GN3A 4KSMA 3RDWA 3ZZXA 2C0GA 1ZMAA 5JWRB 5D96A 4X43A 4XHMA 2JZSA 1DE2A 2P5RA 2D2ZA 5ECSA 4KDYA 2ES7A 1OE7A 1FB6A
chains in the Genus database with same CATH superfamily
5HR0A 4QL7A 2ZUPA 3ZIVA 3EMXA 1GTUA 2GSTA 4PQ1A 3MYDA 4K5RA 3MAKA 3KP9A 1B4PA 2OE1A 1EV4A 2BTOT 1X9MB 3IXRA 1ZYNA 2JSYA 2R0CA 3KH7A 4IN0A 2OADA 3APSA 3ZRDA 1N2AA 2H6XA 2H73A 2H0HA 4G0LA 5H5RA 4GLTA 4OFTA 4ML1A 1K0MA 2YV7A 3UJ1A 4PNFA 4BWQA 1GL8A 3FZAA 3K8NA 1T8EB 3A5IA 2GTUA 3PINA 3W8JA 1EEMA 2LSTA 2HZEB 3RPNA 2OJLA 5A5HA 1AQWA 3HVVA 1GTBA 3IK7A 3KM6A 4E8EA 1ERUA 1G0TA 4HQSA 1F37A 1M2BA 10GSA 4A5PA 3TKQA 3ME8A 4JRRA 4O5QA 3HVNA 1I9DA 1GLQA 5KN2A 3L78A 3ERGA 2FNOA 4NPBA 1O73A 2G2QA 2OBKA 4IJ3A 5G5FA 4I6XA 5D9TA 2H19A 1PMTA 1GSQA 3CRUA 3HJPA 2LNSA 1TP9A 4IS0A 3O76A 5J47A 1TXXA 4K0GA 2AAWA 2K9FA 1TI1A 3TJFA 4BVYB 2I4AA 2QSIA 1S3AA 2LJKA 3A2WA 3BCKA 1GSEA 1V9WA 6GSVA 3WT2A 2C3QA 3CQFA 4EUYA 5GZZB 1AW9A 1YEPA 5ECPB 3DIEA 2Z9SA 3DKSA 3TRXA 1BG5A 1X5EA 2OACA 1KBNA 3MIXA 4ZL8A 4LMVA 4KH7A 2IJYA 4MMMA 3BOAA 3UBLA 3P7XA 2IIYA 4RI6A 4G0IA 3RGBC 1ZGNA 2HSMB 5DALA 5IMVA 1N25A 3F3RA 5F07A 2PWJA 5CNWA 1NM3A 3IRAA 5GAND 2H70A 2TRXA 2B1KA 3GKKA 6GSSA 4XIHA 1O8XA 2AJQB 2CX4A 4RQRA 2UZ8A 1QGVA 3PPUA 1AUCA 4PURA 1GP1A 4GSSA 2F51A 2LJRA 3VLNA 3HZ8A 4PGTA 2VM2A 1GNEA 2VCXA 4KW6A 4NWYA 3D21A 4YQMA 1OKDA 4ZB7A 1X9WB 2B5EA 2L5LA 1WJKA 2YV9A 5B6NA 1MTCA 3I9V2 3F6FA 12GSA 1F2EA 2YOIA 5E4WA 2GDRA 3TRPA 1GNWA 3MNGA 2O7KA 20GSA 3GUSA 5J9BA 3KP8A 2N5AA 4E68A 4WF4A 1JZWA 3M9JA 5JWOB 5DAKA 2R3XA 2QC7A 3GHAA 4MPGA 3RPPA 1PX6A 2GSQA 5DQYA 1A23A 3IHGA 3EMPA 1VF4A 1GUMA 5DJLA 1LBKA 4MJBA 2IMKA 3ZREA 3WGEA 2H1DA 4G2EA 3D6IA 3LXZA 2V32A 5A5HB 5A34A 2MBSA 3FRCA 1OC8A 2VOCA 4OCEA 4TW5A 1XWBA 3UARA 2A4VA 4ULXA 3LSZA 2E2MA 3IOSA 4TR1A 2X99A 3HDCA 4AKXB 3CYNA 1X5DA 5IOWA 4KSOA 3EYTA 3FKFA 5KOXA 1THXA 3ZTLA 3C73A 2H01A 2HXKA 1M3JA 1FOHA 3R2QA 1WMJA 4QL9A 3LEFA 3LGCA 1URMA 2VKZG 3FZ5A 3Q74A 4MA9A 5IOXA 1NSWA 4PHZC 1M2DA 3BJ5A 5IO0A 5C04A 4RI7A 1J9BA 3J7Yk 1AIUA 2J9HA 1V40A 3GL3A 3UAPA 4J56E 1OC9B 1RK4A 3WYWA 5C00A 1TU7A 4DSSA 3QFAC 3N5OA 1BX9A 3TJBA 3PGTA 4WF5A 2L6CA 5AN1A 4ECCA 3CTFA 2LQOA 3GKNA 3RFRC 3EINA 1B48A 3HYPA 2H1LA 5FHIA 4XRAA 1XPVA 1EWXA 1Z6MA 5ECOB 5JCUA 1YEXA 3KD0A 4Z2RA 1AQXA 4MZCA 3M8NA 2O89A 4KDXA 2LRCA 5CRWA 4EIQA 4N11A 5BRTA 3D4TA 4KA0A 2H0GA 1JFUA 5DALB 3H79A 1Z3EA 1K3OA 2YN1A 4EDYA 4TRXA 2FWFA 4G9HA 4KB3A 1WOUA 1TK8B 3I43A 2WS2A 2IFQA 3F4TA 4OFMA 5B7CA 3CRTA 3WGXA 1A2JA 1S4BP 4IHUA 5KEJA 1PX7A 5GAPD 3VK9A 2H8LA 3PH9A 5HFGA 1PSQA 1YZXA 2FWEA 1SD9A 4MCUA 1TOFA 1SK0A 1PKZA 4TVEA 1U87A 1TKDB 1FHEA 4V2LA 3CSJA 3O3TA 1VF1A 1A0RP 4V2NA 2QA1A 3LWAA 3VPTA 3F0IA 3DYRA 1TK5B 2FWGA 4GCIA 1GRXA 5KOWA 4YQUA 2A2PA 5B6MA 3M0FA 3VFIA 2EIRA 4JEDA 4PUFC 2BJXA 4O5RA 1TW9A 5DBQA 2LRNA 1XFLA 4ACSA 1K0NA 1G7EA 1HNAA 1MD3A 5DAKB 4YQVA 18GSA 1B4QA 4HOJA 2DSAA 3VI5A 1ZYPA 4HJ2A 3HXSA 4ID0A 1XXUA 2EFDA 1SD8A 1GTIA 5ECHB 3LJRA 1HYUA 5A34B 5CAXA 1Z7PA 1IYHA 2PVQA 2XBIA 2C0FA 2VCTA 2CT6A 4ZL7A 2P0GA 3G7YA 4TR1B 2N5FA 2EIQA 3R3EA 3ERFA 1YEWC 2NTOA 5KN3A 3GMFA 1K0OA 3GYKA 4WEYA 3EU3A 2FHEA 1K0DA 3QDNA 4FYUA 2R4VA 4HI7A 1ERVA 4F0BA 1M3IA 5ECKB 3LQ7A 2B7KA 5IIZA 3TU3B 4IGJA 4K2XA 4DVCA 4EF0A 4K5SA 4WBRD 1EGOA 2YP6A 4WR4A 3QCPA 1MEKA 3EU4A 2WRTA 3I6AA 5A4UA 2PU9C 3TKRA 4KGIA 1XWCA 2LQQA 4P3YB 1Z7RA 5AISA 5DJMA 1OYJA 4ISDA 4F03A 1T1VA 2VCQA 4MF5A 1TRSA 4O7HA 3CHXC 3GX0A 4YKFA 1SKRB 1EEJA 5IMAA 4HUAA 4ZB6A 2O3EA 4G19A 2DMLA 1K3LA 4GTUA 2M80A 3W6GA 4POLA 1GSDA 2YWNA 5CP1A 3UVHA 2C8UA 1MDKA 3ME7A 4TR0A 3GTUA 17GSA 1F3AA 4HQZA 3DRNA 4MJAA 2B3SA 2V6KA 3BCIA 4BL7A 2PMTA 1CQHA 2O87A 2DBCA 4EXJA 2NVLA 1M99A 2FA8A 2IFQB 1QMVA 2PUKC 5INYA 3KEBA 2HLSA 2R0PA 4N0VA 3M1GA 4AI6A 5AGYA 2C3NA 4IBPA 5IM9A 4MK3A 3QAGA 5J4VA 5EL8A 4MLYA 2L6DA 3TUEA 1TXUA 2H0IA 2GLRA 3ZMLA 1JLWA 2KP1A 3ISOA 3NIVA 2GQMA 3TB2A 4LL4B 4JR6A 4I2TA 1GTAA 5LD0A 2DIYA 3L9SA 3CMIA 3OR5A 3WD6A 1SL2B 4AKGA 4XS1A 2WW2A 2GS3A 3KTLA 5G5EA 4GXZA 2AUVA 5IPGA 4ZXGA 2WZ9A 2I3YA 3D4MA 5ECLB 5DDLA 5HFIA 2I9HA 2WCIA 3FR9A 3G7IA 2HI7A 2K8VA 3GA4A 3I69A 1A2MA 2FLSA 2AB6A 3TRQA 3ZFBA 2HRAA 1XW5A 2WDUA 3L9UA 2K18A 2L4QA 4MF7A 1HQOA 1EOGA 2CVDA 2MMNA 2X8HA 4JZQA 1XIYA 1TDIA 4TKYA 5J4UA 9GSSA 3FY7A 4NHZA 2IN3A 2H1GA 1M9AA 2EIOA 5ID2A 4HS1A 4WXTA 1B8XA 3GSTA 1OAZA 5EVOA 3ZITA 1Q4JA 3FZ9A 4K6XA 3LFLA 2H72A 1GSFA 4O92A 4MH3A 1OC9A 2G0FA 1XZOA 3V1WA 1K0AA 1XWGA 2MBTA 1A0FA 1ZL9A 2R6KA 1ZYQB 2HNLA 4AGSA 5DCHA 5IO2A 4DSQA 3TJGA 3CSIA 2VLUA 2REMA 1SVLA 5A4VA 2J23A 1ML6A 2WVXA 2CQ9A 2YZUA 1VF3A 4MDCA 1U88A 2IL3A 1B9XC 1BJXA 4WBJA 1WIKA 1SYRA 2AHEA 1SK1A 2FCHA 4ICYA 4F0CA 2RIIA 1THOA 3VPQA 4Z7XA 3PR8A 5F8BA 3HD5A 2DJ1A 1S3DA 1ON4A 4F2IA 1U3IA 2M46A 3GTUB 3QFBC 4HU9A 2GSSA 4ZIJA 5IQYA 1AAZA 2EC4A 1H75A 2WGRA 4BL7B 4K9ZA 1PL1A 3KGKA 3RHCA 1A2LA 1V98A 4CHSA 2HZFA 2KLXA 3O6TA 4G10A 1QQ2A 1MD4A 2PPTA 4K2DA 4MZBA 5BMUA 2C3TA 5LNKe 2PN8A 2WW3A 1V2AA 2XPDA 1J08A 4N10A 2O8VB 4ZBDA 3WT1A 2VD0A 2C0DA 2ZCTA 2L59A 3IAS2 1EV9A 3EC3A 5E59A 3ZL5A 1GWCA 5KN0A 2GT6A 1XW6A 2X4AA 1FO5A 1QFNA 2F3MA 4ZILA 3UOMA 3LORA 2LKUA 1O8WA 3L9VA 5HFKA 2V41A 3UEMA 1O6JA 1EZKA 4J57E 3GX8A 3TOTA 2E7PA 3HVXA 1XVWA 2PBJA 2LTKA 3DEXA 5ECNB 3F9UA 5A5KA 3A2VA 2RLIA 3H93A 2MYGA 2YJHA 5ELAA 1O81A 3MDKA 2LS5A 3NZNA 3TKSE 2IMIA 3FK8A 2V6OA 3M3MA 4XTSA 3IK9A 4MPFA 3MWHA 3GKXA 2H66A 4K7IA 1YJ6A 3E9JB 1XWAA 2VL9A 3F8UA 1M7TA 3KIJA 5CRDA 1AXDA 2B5XA 4CW9A 1WP0A 2QA2A 5ID2B 3CWGA 3BD2A 3VI7A 3J7Yb 4ML6A 3ZYWA 2VD1A 4XRDA 3ZVJA 5HR3A 2VO4A 4PI0C 5B8BA 1GLPA 3EWLA 2DC5A 4KCEA 2UV8G 4HSCX 3FR6A 5CYYA 4N30A 4LL1B 3UL3A 4L5LA 3LW9A 2CAQA 1M9BA 1BG1A 5J41A 3L0HA 4GDFA 2X8CA 1LU4A 5DQSA 2YANA 1W89A 4G01A 4HZ4A 4OMVA 1ZOFA 5IMFA 2WVYA 4MP4A 2ALBA 4KAEA 3HMJG 3GH9A 2WVXB 5EPFA 3KZQA 4MH2A 1OE8A 1DBYA 2K6VA 2CV4A 3KH9A 1B9YC 1S3RA 1O7UA 2M72A 3VWVA 2GQLA 5ECMB 5HR1A 1OKTA 2FA4A 2TRCP 1EOHA 3IE3A 3VWWA 2NBSA 2WZSA 1YF0A 2OKAA 2YPMA 4GQCA 2HRKA 2ON5A 1GUKA 1SENA 3WGDA 4GSNA 1SU9A 4IP6A 2YWMA 5B8AA 3KMOA 5D9VA 4POKA 3FEUA 4OFNA 2GZPA 1NHOA 3UBKA 4BVXA 3GRXA 2X64A 2LEGA 4L5OA 1PD21 4MABA 4IVFA 2F8FA 2X8GA 1U6TA 4PQHA 2OE0A 4QQ7A 2DLXA 1IYIA 3F63A 2H75A 1ABAA 4OO4A 2GT5A 2JZTA 2L57A 2XHFA 4Z2TA 1AQVA 1ERTA 4X0XA 2JU5A 1HNCA 5BMUB 4EO3A 2R37A 1GH2A 2O85A 3GNJA 6GSTA 1QK8A 1YVLA 2HFDA 4ECBA 5F0GA 1GUHA 5LCZA 5G1KA 4DSRA 3BBYA 4Q5FA 4PNGA 1W4VA 1PRXA 5CRGA 6GSWA 2H1BA 2GQKA 3TOUA 1T3BA 3VWUA 1JZRA 1Y1UA 1JZDA 2A2RA 1YY7A 4NAXA 2I81A 2DJ0A 3HZ4A 2IMFA 1ZZYA 1UN2A 3APQA 1MDIA 1M0UA 1I5GA 2FD3A 1UA5A 3IV4A 2F9SA 1SYXA 2IMEA 4FXYP 1KEBA 4O5UA 1PN9A 1FAAA 3ZLPA 3Q19A 1G6WA 4JU5A 2C80A 3D5JA 3D22A 4MJCA 1G7OA 1WPIA 1Z9HA 4FYBA 2X49A 2MMZA 1KNGA 1FW1A 1F9MA 1T00A 2VL2A 1YDKA 3FZ4A 1Z6NA 3HJMA 4V1Ap 4KNDA 3CBUA 2H74A 3A3TA 2PGTA 3QMXA 4TXOB 1Y25A 4ECIA 1XVQA 4TR3A 4XS6A 3FW2A 3A2XA 3FHKA 1K0BA 3HCZA 2CX3A 2OT3A 1PKWA 3IPZA 5GSSA 1TJDA 4MNNA 4LMWA 1PL2A 4XS4A 1DE1A 2GGTA 1RW1A 1F6MC 3DWVA 3TDGA 4IQ1A 5J9CA 3C1SA 1E6BA 4V1Ag 2AYTA 3QPMA 5J3RA 2C0EA 4E8HA 3GKMA 2RUEA 1SVMA 1YF1A 5A4WA 3IC4A 3A5WA 1NHYA 2XBQA 2HRKB 3C7MA 1ZCPA 3E3EA 3US3A 4H86A 5A1NB 4Q5NA 4BIKA 3N9JA 3U6VA 2A4HA 4BVXB 4JR4A 3DD3A 2H6ZA 2ZNMA 1SJIA 4IJIA 1ST9A 1M2AA 4IP1A 2BMXA 3W8SA 2JADA 4OWYA 2JSZA 4IW9A 2OA7A 7GSSA 4OO5A 1V58A 1XCCA 2P31A 3DVWA 1JHBA 5H5SA 1AC1A 3GSSA 4EVMA 4WR5A 1Y6EA 3KMNA 2B6MA 1XOAA 2JZRA 1EGRA 1YKAA 3KTBA 2VLVA 2DMMA 3HY2A 5COHA 4QMKA 1G6YA 3DXBA 5CREA 4J2FA 3JCML 1BAYA 2CZ2A 2QGVA 3FMWA 2PERA 3L4NA 3UVTA 4I5QA 1BEDA 4OCFA 2DKHA 5D9WA 1ILOA 2WJUA 1N8JA 1XOBA 5ECQB 5ECRB 2B1LA 2PVOC 4ZBAA 2DJKA 1A8LA 2WFCA 5JCWA 1OVNA 2O5VA 1CQGA 6GSUA 1EP7A 4AJ6A 3HKRA 4OD7A 3E0UA 1TTZA 5HQPA 3G9BA 5D8IA 4I8BA 2WULA 4L0UA 1XW9A 3IHQA 4FIWA 3IDVA 2RM5A 4EDZA 1HNBA 3U5RE 3Q6OA 4PQIA 2R5GA 1FOVA 4KDUA 4ECJA 4PXOA 1LJRA 4YAPA 2VCVA 3ZIJA 4X1UA 3IA1A 3HHVA 2MZCA 5ELGA 2V2GA 1R5AA 2DJJA 3F3QA 3KCMA 4KE3A 5EY6A 4HDEA 3UMAA 1WRYA 4F9ZA 1FVJA 4TXVA 1T4YA 1GSYA 3ERWA 1JZOA 3APOA 3ZMKA 2H76A 3CTGA 4IQAA 4N3ZA 4GSTA 4XS4B 4DEJA 22GSA 2CVBA 2CVKA 4PTSA 2CA8A 4MZWA 1FG4A 4GF0A 2KHPA 2HSNA 3HVSA 2WVZA 3GL5A 1UVZA 4D73A 1R5PA 2HE3A 3FR3A 5HR2A 4XCSA 1TK0B 2FY6A 2VL3A 1R7HA 2CAIA 4EIPA 2VCZA 4JE1A 2GVPA 5CRHA 2H30A 4EKZA 3FYGA 3C1RA 2KOKA 5J40A 2VUPA 3KJYA 3H4KA 4N0ZA 1VRSD 4AF2A 3LG6A 2FWHA 4K0NA 4ZL9A 5G30A 3GH6A 4YH2A 4POBA 2E0QA 2YJ7A 2IPAA 4TN8A 3TKSA 3QR6A 2JACA 4KUNA 1BQ7A 1R26A 1XG8A 2C1YA 3LYKA 3ZVJD 1Z5YE 3P90A 3LXTA 4G0KA 5GSTA 3QD9A 2WW0A 1H4OA 11GSA 4FO5A 1ACVA 4NV2A 2LRTA 1ZYEA 1JLVA 4K7NA 3TJJA 2I1UA 2N5BA 4F82A 4EE0A 1X0RA 4BPYA 4GQFA 1GULA 2IMDA 2DIZA 3EPTA 3F4RA 3TKSC 1SJZA 4HZ2A 3H1NA 4ZB8A 4KX4A 4WKWA 4JBBA 4W66A 1GSSA 2VM1A 2TIRA 1YQ1A 1SJ6A 4BWSA 3RHBA 4PX1A 3SWLA 1O85A 2RUFA 3VWXA 2F8AA 2YZHA 3CXGA 2LUSA 1RQMA 2DKIA 2DJ2A 2O36A 5ENUA 1Q98A 3TCOA 1GSUA 1XBSA 4LA1A 3LYPA 5DCGA 5IMCA 4YKGA 3P8WA 3TGZA 3C71A 4EC0A 2VLTA 5IMDA 3DGQA 2DJ3A 1SL0B 3IBHA 2L4CA 5DVBA 1VGLA 5ABRA 2LV3A 3QAWA 1FVKA 1UC7A 1C72A 2FUG2 4POMA 4TXOA 3RAZA 1TRWA 1X5CA 3NOFA 3UIWA 2MMAA 1SKSB 4LLRA 1T4ZA 2B5YA 2H71A 4USSA 4NHWA 1X9SB 4PI2C 4ZB9A 4AJ7A 4MF6A 4AKHA 8GSSA 1YKCA 1OC3A 3GURA 1R4WA 4TR4A 4K1FA 4NXIA 2CZ3A 5G31A 4YAVA 2OE3A 4AJ8A 4CY6A 1PFOA 5KN1A 2KUCA 4GRFA 2GSRA 2YWIA 3AY8A 5A1NA 2A2SA 6GSYA 2HSNB 2H1AA 1KTEA 3VURA 1TRUA 4D73B 3GV1A 2V1MA 5G1LA 1MDJA 2YWOA 3TJKA 3QOUA 2HT9A 1F3BA 5D73A 1SVOA 4K8MA 1T7PB 4I2UA 2OBIA 3EURA 3GFKA 4ZBBA 2WB9A 4HEA2 3SBCA 2VAFA 1SK2A 3HJOA 1HD2A 4KF9A 3DVXA 3F4SA 1BYEA 5CO3A 5JWQB 3EVIA 5G2ZA 6GSXA 2NPBA 3CSHA 1PQNA 1BF5A 3EE2A 5F05A 2AV4A 2K8SA 5ECIB 5D9XA 1QXHA 5IPHA 4GWRA 3IC8A 2XC2A 4FH8A 4IELA 4IKHA 3TKPA 1PGTA 1TI3A 2HZEA 2L5OA 2XPEA 5JCGA 5J5NA 2HYXA 2P5QA 2FGXA 1A24A 3C8EA 3D0ZA 1DSBA 5AIXA 1J0FA 1EP8A 2E2GA 4AKIA 4NMUA 3Q18A 4FYCA 3DMLA 3S9FA 2GZYA 2HSHA 1WE0A 2WW1A 4L0WA 2EFCA 3G7JA 2IWTA 3GIXA 4NV5A 2LNTA 3P2AA 4RUVA 4I97A 2LJAA 2ON7A 1FB0A 1NW2A 2VCWA 3ED3A 4TOPA 4K7OA 4CDOA 3H8QA 1SL1B 1K3YA 3RBTA 2YNXA 2HSYA 1ERWA 1USBA 2KP2A 4BVYA 2HRNA 2HRFA 1TRVA 1PA3A 4WETA 2R2JA 5AIVA 2C4JA 4ILFA 5F06A 5FT3A 2HQTA 3F6DA 1QUWA 4MJEA 1E2YA 4O32A 2RM6A 2NDOA 1SKWB 1I1IP 4RQXA 4KCAA 16GSA 2EFHA 5H5QA 4Q5QA 2VL2C 1VF2A 2EFEA 4EL1A 4L8EA 4Z2UA 4Q5RA 5L71A 1K0CA 1V57A 1S3CA 4DSSB 5FWGA 2H6YA 3IR4A 2R0GA 13GSA 1PN0A 4FQUA 3IAM2 1DUGA 3QAVA 5J4YA 4V2MA 14GSA 3M9KA 2HSMA 2QKEA 2B7JA 4HJMA 4HU7A 4CY8A 4X4JA 1A8YA 3HA9A 3MSZA 4PUAA 1XWKA 3KXOA 2YCDA 2MMOA 1U3AA 19GSA 2GZZA 3ZFLA 5D93A 2JL4A 2VIMA 1WWJA 4BA7A 1TU8A 5IMZA 3GN3A 4KSMA 3RDWA 3ZZXA 2C0GA 1ZMAA 5JWRB 5D96A 4X43A 4XHMA 2JZSA 1DE2A 2P5RA 2D2ZA 5ECSA 4KDYA 2ES7A 1OE7A 1FB6A
chains in the Genus database with same CATH topology
5HR0A 4QL7A 2ZUPA 3ZIVA 3EMXA 1GTUA 2GSTA 4PQ1A 3MYDA 4K5RA 3MAKA 3KP9A 1B4PA 2OE1A 1EV4A 2BTOT 1X9MB 3IXRA 1ZYNA 2JSYA 2R0CA 3KH7A 4IN0A 2OADA 3APSA 3ZRDA 1N2AA 2H6XA 2H73A 2H0HA 4G0LA 5H5RA 4GLTA 4OFTA 4ML1A 1K0MA 2YV7A 3UJ1A 4PNFA 4BWQA 1GL8A 3FZAA 3K8NA 1T8EB 3A5IA 2GTUA 3PINA 3W8JA 1EEMA 2LSTA 2HZEB 3RPNA 2OJLA 5A5HA 1AQWA 3HVVA 1GTBA 3IK7A 3KM6A 4E8EA 1ERUA 1G0TA 4HQSA 1F37A 1M2BA 10GSA 4A5PA 3TKQA 3ME8A 4JRRA 4O5QA 1I9DA 1GLQA 5KN2A 3L78A 3ERGA 2FNOA 4NPBA 1O73A 2G2QA 2OBKA 4IJ3A 5G5FA 4I6XA 5D9TA 2H19A 1PMTA 1GSQA 3CRUA 3HJPA 2LNSA 1TP9A 4IS0A 3O76A 5J47A 1TXXA 4K0GA 2AAWA 2K9FA 1TI1A 3TJFA 4BVYB 2I4AA 2QSIA 1S3AA 2LJKA 3A2WA 3BCKA 1GSEA 1V9WA 6GSVA 3WT2A 2C3QA 4EUYA 5GZZB 1AW9A 1YEPA 5ECPB 3DIEA 2Z9SA 3DKSA 3TRXA 1BG5A 1X5EA 2OACA 1KBNA 3MIXA 4ZL8A 4LMVA 4KH7A 2IJYA 4MMMA 3BOAA 3UBLA 3P7XA 2IIYA 4RI6A 4G0IA 1ZGNA 2HSMB 5DALA 5IMVA 1N25A 3F3RA 5F07A 2PWJA 5CNWA 1NM3A 3IRAA 5GAND 2H70A 2TRXA 2B1KA 3GKKA 6GSSA 4XIHA 1O8XA 2AJQB 2CX4A 4RQRA 2UZ8A 1QGVA 3PPUA 1AUCA 4PURA 1GP1A 4GSSA 2F51A 2LJRA 3VLNA 3HZ8A 4PGTA 2VM2A 1GNEA 2VCXA 4KW6A 4NWYA 3D21A 4YQMA 1OKDA 4ZB7A 1X9WB 2B5EA 2L5LA 1WJKA 2YV9A 5B6NA 1MTCA 3I9V2 3F6FA 12GSA 1F2EA 2YOIA 5E4WA 2GDRA 3TRPA 1GNWA 3MNGA 2O7KA 20GSA 3GUSA 5J9BA 3KP8A 2N5AA 4E68A 4WF4A 1JZWA 3M9JA 5JWOB 5DAKA 2R3XA 2QC7A 3GHAA 4MPGA 3RPPA 1PX6A 2GSQA 5DQYA 1A23A 3IHGA 3EMPA 1VF4A 1GUMA 5DJLA 1LBKA 4MJBA 2IMKA 3ZREA 3WGEA 2H1DA 4G2EA 3D6IA 3LXZA 2V32A 5A5HB 5A34A 2MBSA 3FRCA 1OC8A 2VOCA 4OCEA 4TW5A 1XWBA 3UARA 2A4VA 4ULXA 3LSZA 2E2MA 3IOSA 4TR1A 2X99A 3HDCA 4AKXB 3CYNA 1X5DA 5IOWA 4KSOA 3EYTA 3FKFA 5KOXA 1THXA 3ZTLA 3C73A 2H01A 2HXKA 1FOHA 3R2QA 1WMJA 4QL9A 3LEFA 3LGCA 1URMA 2VKZG 3FZ5A 3Q74A 4MA9A 5IOXA 1NSWA 1M2DA 3BJ5A 5IO0A 5C04A 4RI7A 1J9BA 3J7Yk 1AIUA 2J9HA 1V40A 3GL3A 3UAPA 4J56E 1OC9B 1RK4A 3WYWA 5C00A 1TU7A 4DSSA 3QFAC 3N5OA 1BX9A 3TJBA 3PGTA 4WF5A 2L6CA 5AN1A 4ECCA 3CTFA 2LQOA 3GKNA 3EINA 1B48A 3HYPA 2H1LA 5FHIA 4XRAA 1XPVA 1EWXA 1Z6MA 5ECOB 5JCUA 1YEXA 3KD0A 4Z2RA 1AQXA 4MZCA 3M8NA 2O89A 4KDXA 2LRCA 5CRWA 4EIQA 4N11A 5BRTA 3D4TA 4KA0A 2H0GA 1JFUA 5DALB 3H79A 1Z3EA 1K3OA 2YN1A 4EDYA 4TRXA 2FWFA 4G9HA 4KB3A 1WOUA 1TK8B 3I43A 2WS2A 2IFQA 3F4TA 4OFMA 5B7CA 3CRTA 3WGXA 1A2JA 4IHUA 5KEJA 1PX7A 5GAPD 3VK9A 2H8LA 3PH9A 5HFGA 1PSQA 1YZXA 2FWEA 1SD9A 4MCUA 1TOFA 1SK0A 1PKZA 4TVEA 1U87A 1TKDB 1FHEA 4V2LA 3CSJA 3O3TA 1VF1A 1A0RP 4V2NA 2QA1A 3LWAA 3VPTA 3F0IA 3DYRA 1TK5B 2FWGA 4GCIA 1GRXA 5KOWA 4YQUA 2A2PA 5B6MA 3M0FA 3VFIA 2EIRA 4JEDA 4PUFC 2BJXA 4O5RA 1TW9A 5DBQA 2LRNA 1XFLA 4ACSA 1K0NA 1G7EA 1HNAA 1MD3A 5DAKB 4YQVA 18GSA 1B4QA 4HOJA 2DSAA 3VI5A 1ZYPA 4HJ2A 3HXSA 4ID0A 1XXUA 2EFDA 1SD8A 1GTIA 5ECHB 3LJRA 1HYUA 5A34B 5CAXA 1Z7PA 1IYHA 2PVQA 2XBIA 2C0FA 2VCTA 2CT6A 4ZL7A 2P0GA 3G7YA 4TR1B 2N5FA 2EIQA 3R3EA 3ERFA 2NTOA 5KN3A 3GMFA 1K0OA 3GYKA 4WEYA 3EU3A 2FHEA 1K0DA 3QDNA 4FYUA 2R4VA 4HI7A 1ERVA 4F0BA 5ECKB 3LQ7A 2B7KA 5IIZA 3TU3B 4IGJA 4K2XA 4DVCA 4EF0A 4K5SA 4WBRD 1EGOA 2YP6A 4WR4A 3QCPA 1MEKA 3EU4A 2WRTA 3I6AA 5A4UA 2PU9C 3TKRA 4KGIA 1XWCA 2LQQA 4P3YB 1Z7RA 5AISA 5DJMA 1OYJA 4ISDA 4F03A 1T1VA 2VCQA 4MF5A 1TRSA 4O7HA 3GX0A 4YKFA 1SKRB 1EEJA 5IMAA 4HUAA 4ZB6A 4G19A 2DMLA 1K3LA 4GTUA 2M80A 3W6GA 4POLA 1GSDA 2YWNA 5CP1A 3UVHA 2C8UA 1MDKA 3ME7A 4TR0A 3GTUA 17GSA 1F3AA 4HQZA 3DRNA 4MJAA 2B3SA 2V6KA 3BCIA 4BL7A 2PMTA 1CQHA 2O87A 2DBCA 4EXJA 2NVLA 1M99A 2FA8A 2IFQB 1QMVA 2PUKC 5INYA 3KEBA 2HLSA 2R0PA 4N0VA 3M1GA 4AI6A 5AGYA 2C3NA 4IBPA 5IM9A 4MK3A 3QAGA 5J4VA 5EL8A 4MLYA 2L6DA 3TUEA 1TXUA 2H0IA 2GLRA 3ZMLA 1JLWA 2KP1A 3ISOA 3NIVA 2GQMA 3TB2A 4LL4B 4JR6A 4I2TA 1GTAA 5LD0A 2DIYA 3L9SA 3CMIA 3OR5A 3WD6A 1SL2B 4AKGA 4XS1A 2GS3A 3KTLA 5G5EA 4GXZA 2AUVA 5IPGA 4ZXGA 2WZ9A 2I3YA 3D4MA 5ECLB 5DDLA 5HFIA 2I9HA 2WCIA 3FR9A 3G7IA 2HI7A 2K8VA 3GA4A 3I69A 1A2MA 2FLSA 2AB6A 3TRQA 3ZFBA 2HRAA 1XW5A 2WDUA 3L9UA 2K18A 2L4QA 4MF7A 1HQOA 1EOGA 2CVDA 2MMNA 2X8HA 4JZQA 1XIYA 1TDIA 4TKYA 5J4UA 9GSSA 3FY7A 4NHZA 2IN3A 2H1GA 1M9AA 2EIOA 5ID2A 4HS1A 4WXTA 1B8XA 3GSTA 1OAZA 5EVOA 3ZITA 1Q4JA 3FZ9A 4K6XA 3LFLA 2H72A 1GSFA 4O92A 4MH3A 1OC9A 2G0FA 1XZOA 3V1WA 1K0AA 1XWGA 2MBTA 1A0FA 1ZL9A 2R6KA 1ZYQB 2HNLA 4AGSA 5DCHA 5IO2A 4DSQA 3TJGA 3CSIA 2VLUA 2REMA 1SVLA 5A4VA 2J23A 1ML6A 2CQ9A 2YZUA 1VF3A 4MDCA 1U88A 2IL3A 1B9XC 1BJXA 4WBJA 1WIKA 1SYRA 2AHEA 1SK1A 2FCHA 4ICYA 4F0CA 2RIIA 1THOA 3VPQA 4Z7XA 3PR8A 5F8BA 3HD5A 2DJ1A 1S3DA 1ON4A 4F2IA 1U3IA 2M46A 3GTUB 3QFBC 4HU9A 2GSSA 4ZIJA 5IQYA 1AAZA 2EC4A 1H75A 2WGRA 4BL7B 4K9ZA 1PL1A 3KGKA 3RHCA 1A2LA 1V98A 4CHSA 2HZFA 2KLXA 3O6TA 4G10A 1QQ2A 1MD4A 2PPTA 4K2DA 4MZBA 5BMUA 2C3TA 5LNKe 2PN8A 1V2AA 2XPDA 1J08A 4N10A 2O8VB 4ZBDA 3WT1A 2VD0A 2C0DA 2ZCTA 2L59A 3IAS2 1EV9A 3EC3A 5E59A 3ZL5A 1GWCA 5KN0A 2GT6A 1XW6A 2X4AA 1FO5A 1QFNA 2F3MA 4ZILA 3UOMA 3LORA 2LKUA 1O8WA 3L9VA 5HFKA 2V41A 3UEMA 1O6JA 1EZKA 4J57E 3GX8A 3TOTA 2E7PA 3HVXA 1XVWA 2PBJA 2LTKA 3DEXA 5ECNB 3F9UA 5A5KA 3A2VA 2RLIA 3H93A 2MYGA 2YJHA 5ELAA 1O81A 3MDKA 2LS5A 3NZNA 3TKSE 2IMIA 3FK8A 2V6OA 3M3MA 4XTSA 3IK9A 4MPFA 3MWHA 3GKXA 2H66A 4K7IA 1YJ6A 3E9JB 1XWAA 2VL9A 3F8UA 1M7TA 3KIJA 5CRDA 1AXDA 2B5XA 4CW9A 1WP0A 2QA2A 5ID2B 3CWGA 3BD2A 3VI7A 3J7Yb 4ML6A 3ZYWA 2VD1A 4XRDA 3ZVJA 5HR3A 2VO4A 5B8BA 1GLPA 3EWLA 2DC5A 4KCEA 2UV8G 3FR6A 5CYYA 4N30A 4LL1B 3UL3A 4L5LA 3LW9A 2CAQA 1M9BA 1BG1A 5J41A 3L0HA 4GDFA 2X8CA 1LU4A 5DQSA 2YANA 1W89A 4G01A 4HZ4A 4OMVA 1ZOFA 5IMFA 4MP4A 2ALBA 4KAEA 3HMJG 3GH9A 5EPFA 3KZQA 4MH2A 1OE8A 1DBYA 2K6VA 2CV4A 3KH9A 1B9YC 1O7UA 2M72A 3VWVA 2GQLA 5ECMB 5HR1A 1OKTA 2FA4A 2TRCP 1EOHA 3IE3A 3VWWA 2NBSA 1YF0A 2OKAA 2YPMA 4GQCA 2HRKA 2ON5A 1GUKA 1SENA 3WGDA 4GSNA 1SU9A 4IP6A 2YWMA 5B8AA 3KMOA 5D9VA 4POKA 3FEUA 4OFNA 2GZPA 1NHOA 3UBKA 4BVXA 3GRXA 2X64A 2LEGA 4L5OA 1PD21 4MABA 4IVFA 2F8FA 2X8GA 1U6TA 4PQHA 2OE0A 4QQ7A 2DLXA 1IYIA 3F63A 2H75A 1ABAA 4OO4A 2GT5A 2JZTA 2L57A 2XHFA 4Z2TA 1AQVA 1ERTA 4X0XA 2JU5A 1HNCA 5BMUB 4EO3A 2R37A 1GH2A 2O85A 3GNJA 6GSTA 1QK8A 1YVLA 2HFDA 4ECBA 5F0GA 1GUHA 5LCZA 5G1KA 4DSRA 3BBYA 4Q5FA 4PNGA 1W4VA 1PRXA 5CRGA 6GSWA 2H1BA 2GQKA 3TOUA 1T3BA 3VWUA 1JZRA 1Y1UA 1JZDA 2A2RA 1YY7A 4NAXA 2I81A 2DJ0A 3HZ4A 2IMFA 1ZZYA 1UN2A 3APQA 1MDIA 1M0UA 1I5GA 2FD3A 1UA5A 3IV4A 2F9SA 1SYXA 2IMEA 1KEBA 4O5UA 1PN9A 1FAAA 3ZLPA 3Q19A 1G6WA 4JU5A 2C80A 3D5JA 3D22A 4MJCA 1G7OA 1WPIA 1Z9HA 4FYBA 2X49A 2MMZA 1KNGA 1FW1A 1F9MA 1T00A 2VL2A 1YDKA 3FZ4A 1Z6NA 3HJMA 4V1Ap 4KNDA 3CBUA 2H74A 3A3TA 2PGTA 3QMXA 4TXOB 1Y25A 4ECIA 1XVQA 4TR3A 4XS6A 3FW2A 3A2XA 3FHKA 1K0BA 3HCZA 2CX3A 2OT3A 1PKWA 3IPZA 5GSSA 1TJDA 4MNNA 4LMWA 1PL2A 4XS4A 1DE1A 2GGTA 1RW1A 1F6MC 3DWVA 3TDGA 4IQ1A 5J9CA 3C1SA 1E6BA 4V1Ag 2AYTA 3QPMA 5J3RA 2C0EA 4E8HA 3GKMA 2RUEA 1SVMA 1YF1A 5A4WA 3IC4A 3A5WA 1NHYA 2XBQA 2HRKB 3C7MA 1ZCPA 3E3EA 3US3A 4H86A 5A1NB 4Q5NA 3N9JA 3U6VA 2A4HA 4BVXB 4JR4A 3DD3A 2H6ZA 2ZNMA 1SJIA 4IJIA 1ST9A 1M2AA 4IP1A 2BMXA 3W8SA 2JADA 4OWYA 2JSZA 4IW9A 2OA7A 7GSSA 4OO5A 1V58A 1XCCA 2P31A 3DVWA 1JHBA 5H5SA 1AC1A 3GSSA 4EVMA 4WR5A 1Y6EA 3KMNA 2B6MA 1XOAA 2JZRA 1EGRA 1YKAA 3KTBA 2VLVA 2DMMA 3HY2A 5COHA 4QMKA 1G6YA 3DXBA 5CREA 4J2FA 3JCML 1BAYA 2CZ2A 2QGVA 3FMWA 2PERA 3L4NA 3UVTA 4I5QA 1BEDA 4OCFA 2DKHA 5D9WA 1ILOA 2WJUA 1N8JA 1XOBA 5ECQB 5ECRB 2B1LA 2PVOC 4ZBAA 2DJKA 1A8LA 2WFCA 5JCWA 1OVNA 2O5VA 1CQGA 6GSUA 1EP7A 4AJ6A 3HKRA 4OD7A 3E0UA 1TTZA 5HQPA 3G9BA 5D8IA 4I8BA 2WULA 4L0UA 1XW9A 3IHQA 4FIWA 3IDVA 2RM5A 4EDZA 1HNBA 3U5RE 3Q6OA 4PQIA 2R5GA 1FOVA 4KDUA 4ECJA 4PXOA 1LJRA 4YAPA 2VCVA 3ZIJA 4X1UA 3IA1A 3HHVA 2MZCA 5ELGA 2V2GA 1R5AA 2DJJA 3F3QA 3KCMA 4KE3A 5EY6A 4HDEA 3UMAA 1WRYA 4F9ZA 1FVJA 4TXVA 1T4YA 1GSYA 3ERWA 1JZOA 3APOA 3ZMKA 2H76A 3CTGA 4IQAA 4N3ZA 4GSTA 4XS4B 4DEJA 22GSA 2CVBA 2CVKA 4PTSA 2CA8A 4MZWA 1FG4A 4GF0A 2KHPA 2HSNA 3HVSA 3GL5A 1UVZA 4D73A 1R5PA 2HE3A 3FR3A 5HR2A 4XCSA 1TK0B 2FY6A 2VL3A 1R7HA 2CAIA 4EIPA 2VCZA 4JE1A 2GVPA 5CRHA 2H30A 4EKZA 3FYGA 3C1RA 2KOKA 5J40A 2VUPA 3KJYA 3H4KA 4N0ZA 1VRSD 4AF2A 3LG6A 2FWHA 4K0NA 4ZL9A 5G30A 3GH6A 4YH2A 4POBA 2E0QA 2YJ7A 2IPAA 4TN8A 3TKSA 3QR6A 2JACA 4KUNA 1BQ7A 1R26A 2C1YA 3LYKA 3ZVJD 1Z5YE 3P90A 3LXTA 4G0KA 5GSTA 3QD9A 1H4OA 11GSA 4FO5A 1ACVA 4NV2A 2LRTA 1ZYEA 1JLVA 4K7NA 3TJJA 2I1UA 2N5BA 4F82A 4EE0A 1X0RA 4BPYA 4GQFA 1GULA 2IMDA 2DIZA 3EPTA 3F4RA 3TKSC 1SJZA 4HZ2A 3H1NA 4ZB8A 4KX4A 4WKWA 4JBBA 4W66A 1GSSA 2VM1A 2TIRA 1YQ1A 1SJ6A 4BWSA 3RHBA 4PX1A 3SWLA 1O85A 2RUFA 3VWXA 2F8AA 2YZHA 3CXGA 2LUSA 1RQMA 2DKIA 2DJ2A 5ENUA 1Q98A 3TCOA 1GSUA 1XBSA 4LA1A 3LYPA 5DCGA 5IMCA 4YKGA 3P8WA 3TGZA 3C71A 4EC0A 2VLTA 5IMDA 3DGQA 2DJ3A 1SL0B 3IBHA 2L4CA 5DVBA 1VGLA 5ABRA 2LV3A 3QAWA 1FVKA 1UC7A 1C72A 2FUG2 4POMA 4TXOA 3RAZA 1TRWA 1X5CA 3NOFA 3UIWA 2MMAA 1SKSB 4LLRA 1T4ZA 2B5YA 2H71A 4USSA 4NHWA 1X9SB 4ZB9A 4AJ7A 4MF6A 4AKHA 8GSSA 1YKCA 1OC3A 3GURA 1R4WA 4TR4A 4K1FA 4NXIA 2CZ3A 5G31A 4YAVA 2OE3A 4AJ8A 4CY6A 5KN1A 2KUCA 4GRFA 2GSRA 2YWIA 3AY8A 5A1NA 2A2SA 6GSYA 2HSNB 2H1AA 1KTEA 3VURA 1TRUA 4D73B 3GV1A 2V1MA 5G1LA 1MDJA 2YWOA 3TJKA 3QOUA 2HT9A 1F3BA 5D73A 1SVOA 4K8MA 1T7PB 4I2UA 2OBIA 3EURA 3GFKA 4ZBBA 2WB9A 4HEA2 3SBCA 2VAFA 1SK2A 3HJOA 1HD2A 4KF9A 3DVXA 3F4SA 1BYEA 5CO3A 5JWQB 3EVIA 5G2ZA 6GSXA 2NPBA 3CSHA 1PQNA 1BF5A 3EE2A 5F05A 2AV4A 2K8SA 5ECIB 5D9XA 1QXHA 5IPHA 4GWRA 3IC8A 2XC2A 4FH8A 4IELA 4IKHA 3TKPA 1PGTA 1TI3A 2HZEA 2L5OA 2XPEA 5JCGA 5J5NA 2HYXA 2P5QA 2FGXA 1A24A 3C8EA 3D0ZA 1DSBA 5AIXA 1J0FA 1EP8A 2E2GA 4AKIA 4NMUA 3Q18A 4FYCA 3DMLA 3S9FA 2GZYA 2HSHA 1WE0A 4L0WA 2EFCA 3G7JA 2IWTA 3GIXA 4NV5A 2LNTA 3P2AA 4RUVA 4I97A 2LJAA 2ON7A 1FB0A 1NW2A 2VCWA 3ED3A 4TOPA 4K7OA 4CDOA 3H8QA 1SL1B 1K3YA 3RBTA 2YNXA 2HSYA 1ERWA 1USBA 2KP2A 4BVYA 2HRNA 2HRFA 1TRVA 1PA3A 4WETA 2R2JA 5AIVA 2C4JA 4ILFA 5F06A 5FT3A 2HQTA 3F6DA 1QUWA 4MJEA 1E2YA 4O32A 2RM6A 2NDOA 1SKWB 4RQXA 4KCAA 16GSA 2EFHA 5H5QA 4Q5QA 2VL2C 1VF2A 2EFEA 4EL1A 4L8EA 4Z2UA 4Q5RA 5L71A 1K0CA 1V57A 1S3CA 4DSSB 5FWGA 2H6YA 3IR4A 2R0GA 13GSA 1PN0A 4FQUA 3IAM2 1DUGA 3QAVA 5J4YA 4V2MA 14GSA 3M9KA 2HSMA 2QKEA 2B7JA 4HJMA 4HU7A 4CY8A 4X4JA 1A8YA 3HA9A 3MSZA 4PUAA 1XWKA 3KXOA 2YCDA 2MMOA 1U3AA 19GSA 2GZZA 3ZFLA 5D93A 2JL4A 2VIMA 1WWJA 4BA7A 1TU8A 5IMZA 3GN3A 4KSMA 3RDWA 3ZZXA 2C0GA 1ZMAA 5JWRB 5D96A 4X43A 4XHMA 2JZSA 1DE2A 2P5RA 2D2ZA 5ECSA 4KDYA 2ES7A 1OE7A 1FB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HR0 A;  4QL7 A;  2ZUP A;  3ZIV A;  3EMX A;  1GTU A;  2GST A;  4PQ1 A;  3MAK A;  3KP9 A;  1B4P A;  2OE1 A;  1EV4 A;  2BTO T;  1X9M B;  3IXR A;  2JSY A;  3KH7 A;  4IN0 A;  2OAD A;  3APS A;  3ZRD A;  1N2A A;  2H6X A;  2H73 A;  2H0H A;  4G0L A;  5H5R A;  4GLT A;  4OFT A;  4ML1 A;  1K0M A;  2YV7 A;  3UJ1 A;  4PNF A;  4BWQ A;  1GL8 A;  3FZA A;  3K8N A;  1T8E B;  2GTU A;  3PIN A;  3W8J A;  1EEM A;  2LST A;  2HZE B;  3RPN A;  2OJL A;  1AQW A;  3HVV A;  1GTB A;  3IK7 A;  3KM6 A;  4E8E A;  1ERU A;  1G0T A;  4HQS A;  1F37 A;  1M2B A;  10GS A;  3TKQ A;  3ME8 A;  4JRR A;  1I9D A;  1GLQ A;  5KN2 A;  3L78 A;  3ERG A;  2FNO A;  4NPB A;  1O73 A;  2G2Q A;  2OBK A;  4IJ3 A;  5G5F A;  4I6X A;  5D9T A;  2H19 A;  1PMT A;  1GSQ A;  3CRU A;  3HJP A;  2LNS A;  1TP9 A;  4IS0 A;  3O76 A;  1TXX A;  4K0G A;  2AAW A;  2K9F A;  1TI1 A;  3TJF A;  4BVY B;  2I4A A;  2QSI A;  1S3A A;  2LJK A;  3A2W A;  3BCK A;  1GSE A;  1V9W A;  6GSV A;  3WT2 A;  2C3Q A;  4EUY A;  5GZZ B;  1AW9 A;  1YEP A;  5ECP B;  3DIE A;  2Z9S A;  3DKS A;  3TRX A;  1BG5 A;  1X5E A;  2OAC A;  1KBN A;  4ZL8 A;  4LMV A;  4KH7 A;  2IJY A;  4MMM A;  3BOA A;  3UBL A;  3P7X A;  2IIY A;  4RI6 A;  4G0I A;  1ZGN A;  2HSM B;  5DAL A;  5IMV A;  3F3R A;  5F07 A;  2PWJ A;  5CNW A;  1NM3 A;  3IRA A;  5GAN D;  2H70 A;  2TRX A;  2B1K A;  3GKK A;  6GSS A;  4XIH A;  1O8X A;  2AJQ B;  2CX4 A;  4RQR A;  2UZ8 A;  1QGV A;  3PPU A;  1AUC A;  4PUR A;  1GP1 A;  4GSS A;  2F51 A;  2LJR A;  3VLN A;  3HZ8 A;  4PGT A;  2VM2 A;  1GNE A;  2VCX A;  4KW6 A;  4NWY A;  3D21 A;  4YQM A;  1OKD A;  1X9W B;  2B5E A;  2L5L A;  1WJK A;  2YV9 A;  5B6N A;  1MTC A;  3I9V 2;  3F6F A;  12GS A;  1F2E A;  2YOI A;  5E4W A;  2GDR A;  3TRP A;  1GNW A;  3MNG A;  2O7K A;  20GS A;  3GUS A;  5J9B A;  3KP8 A;  2N5A A;  4WF4 A;  1JZW A;  3M9J A;  5JWO B;  5DAK A;  2R3X A;  2QC7 A;  3GHA A;  4MPG A;  3RPP A;  1PX6 A;  2GSQ A;  5DQY A;  1A23 A;  3EMP A;  1VF4 A;  1GUM A;  5DJL A;  1LBK A;  4MJB A;  2IMK A;  3ZRE A;  3WGE A;  2H1D A;  4G2E A;  3D6I A;  3LXZ A;  2V32 A;  2MBS A;  3FRC A;  1OC8 A;  2VOC A;  4OCE A;  4TW5 A;  1XWB A;  3UAR A;  2A4V A;  4ULX A;  3LSZ A;  2E2M A;  3IOS A;  4TR1 A;  2X99 A;  3HDC A;  3CYN A;  1X5D A;  5IOW A;  4KSO A;  3EYT A;  3FKF A;  1THX A;  3ZTL A;  3C73 A;  2H01 A;  2HXK A;  3R2Q A;  1WMJ A;  4QL9 A;  3LEF A;  3LGC A;  1URM A;  3FZ5 A;  3Q74 A;  4MA9 A;  5IOX A;  1NSW A;  1M2D A;  3BJ5 A;  5IO0 A;  5C04 A;  4RI7 A;  1J9B A;  3J7Y k;  1AIU A;  2J9H A;  1V40 A;  3GL3 A;  3UAP A;  4J56 E;  1OC9 B;  1RK4 A;  3WYW A;  5C00 A;  1TU7 A;  4DSS A;  3QFA C;  3N5O A;  1BX9 A;  3TJB A;  3PGT A;  4WF5 A;  2L6C A;  5AN1 A;  4ECC A;  3CTF A;  2LQO A;  3GKN A;  3EIN A;  1B48 A;  3HYP A;  5FHI A;  4XRA A;  1XPV A;  1EWX A;  1Z6M A;  5ECO B;  5JCU A;  1YEX A;  3KD0 A;  1AQX A;  4MZC A;  3M8N A;  2O89 A;  4KDX A;  2LRC A;  5CRW A;  4N11 A;  3D4T A;  4KA0 A;  2H0G A;  1JFU A;  5DAL B;  3H79 A;  1Z3E A;  1K3O A;  2YN1 A;  4EDY A;  4TRX A;  2FWF A;  4G9H A;  4KB3 A;  1WOU A;  1TK8 B;  3I43 A;  2WS2 A;  2IFQ A;  3F4T A;  4OFM A;  5B7C A;  3CRT A;  3WGX A;  1A2J A;  4IHU A;  5KEJ A;  1PX7 A;  5GAP D;  3VK9 A;  2H8L A;  3PH9 A;  5HFG A;  1PSQ A;  1YZX A;  2FWE A;  1SD9 A;  4MCU A;  1TOF A;  1SK0 A;  1PKZ A;  4TVE A;  1U87 A;  1TKD B;  1FHE A;  4V2L A;  3CSJ A;  3O3T A;  1VF1 A;  1A0R P;  4V2N A;  3LWA A;  3VPT A;  3F0I A;  3DYR A;  1TK5 B;  2FWG A;  4GCI A;  1GRX A;  4YQU A;  5B6M A;  3M0F A;  3VFI A;  2EIR A;  4JED A;  4PUF C;  2BJX A;  4O5R A;  1TW9 A;  5DBQ A;  2LRN A;  1XFL A;  4ACS A;  1K0N A;  1G7E A;  1HNA A;  1MD3 A;  5DAK B;  4YQV A;  18GS A;  1B4Q A;  4HOJ A;  2DSA A;  3VI5 A;  4HJ2 A;  3HXS A;  4ID0 A;  1XXU A;  1SD8 A;  1GTI A;  5ECH B;  3LJR A;  1HYU A;  5CAX A;  1Z7P A;  1IYH A;  2PVQ A;  2XBI A;  2C0F A;  2VCT A;  2CT6 A;  4ZL7 A;  2P0G A;  3G7Y A;  4TR1 B;  2N5F A;  2EIQ A;  3R3E A;  3ERF A;  2NTO A;  5KN3 A;  3GMF A;  1K0O A;  3GYK A;  4WEY A;  3EU3 A;  2FHE A;  1K0D A;  3QDN A;  4FYU A;  2R4V A;  4HI7 A;  1ERV A;  4F0B A;  5ECK B;  3LQ7 A;  2B7K A;  5IIZ A;  4IGJ A;  4DVC A;  4EF0 A;  4WBR D;  1EGO A;  2YP6 A;  4WR4 A;  3QCP A;  1MEK A;  3EU4 A;  2WRT A;  3I6A A;  5A4U A;  2PU9 C;  3TKR A;  4KGI A;  1XWC A;  2LQQ A;  4P3Y B;  1Z7R A;  5AIS A;  5DJM A;  1OYJ A;  4ISD A;  4F03 A;  1T1V A;  2VCQ A;  4MF5 A;  1TRS A;  4O7H A;  3GX0 A;  1SKR B;  1EEJ A;  5IMA A;  4HUA A;  4ZB6 A;  4G19 A;  2DML A;  1K3L A;  4GTU A;  2M80 A;  3W6G A;  4POL A;  1GSD A;  2YWN A;  5CP1 A;  3UVH A;  2C8U A;  1MDK A;  3ME7 A;  4TR0 A;  3GTU A;  17GS A;  1F3A A;  4HQZ A;  3DRN A;  4MJA A;  2B3S A;  2V6K A;  3BCI A;  4BL7 A;  2PMT A;  1CQH A;  2O87 A;  2DBC A;  4EXJ A;  2NVL A;  1M99 A;  2FA8 A;  2IFQ B;  1QMV A;  2PUK C;  5INY A;  3KEB A;  2HLS A;  4N0V A;  3M1G A;  5AGY A;  2C3N A;  4IBP A;  5IM9 A;  4MK3 A;  3QAG A;  5EL8 A;  4MLY A;  2L6D A;  3TUE A;  2H0I A;  2GLR A;  3ZML A;  1JLW A;  2KP1 A;  3ISO A;  3NIV A;  2GQM A;  3TB2 A;  4LL4 B;  4JR6 A;  4I2T A;  1GTA A;  5LD0 A;  2DIY A;  3L9S A;  3CMI A;  3OR5 A;  3WD6 A;  1SL2 B;  4XS1 A;  2GS3 A;  3KTL A;  5G5E A;  4GXZ A;  2AUV A;  5IPG A;  4ZXG A;  2WZ9 A;  2I3Y A;  3D4M A;  5ECL B;  5DDL A;  5HFI A;  2I9H A;  2WCI A;  3FR9 A;  3G7I A;  2HI7 A;  2K8V A;  3GA4 A;  3I69 A;  1A2M A;  2FLS A;  2AB6 A;  3TRQ A;  3ZFB A;  2HRA A;  1XW5 A;  2WDU A;  3L9U A;  2K18 A;  2L4Q A;  4MF7 A;  1HQO A;  1EOG A;  2CVD A;  2MMN A;  2X8H A;  4JZQ A;  1XIY A;  1TDI A;  4TKY A;  5J4U A;  9GSS A;  3FY7 A;  4NHZ A;  2IN3 A;  2H1G A;  1M9A A;  2EIO A;  5ID2 A;  4HS1 A;  4WXT A;  1B8X A;  3GST A;  1OAZ A;  5EVO A;  3ZIT A;  1Q4J A;  3FZ9 A;  4K6X A;  3LFL A;  2H72 A;  1GSF A;  4O92 A;  4MH3 A;  1OC9 A;  2G0F A;  1XZO A;  3V1W A;  1K0A A;  1XWG A;  2MBT A;  1A0F A;  1ZL9 A;  2R6K A;  1ZYQ B;  2HNL A;  4AGS A;  5DCH A;  5IO2 A;  4DSQ A;  3TJG A;  3CSI A;  2VLU A;  2REM A;  5A4V A;  2J23 A;  1ML6 A;  2CQ9 A;  2YZU A;  1VF3 A;  4MDC A;  1U88 A;  2IL3 A;  1B9X C;  1BJX A;  4WBJ A;  1WIK A;  1SYR A;  2AHE A;  1SK1 A;  2FCH A;  4F0C A;  2RII A;  1THO A;  3VPQ A;  4Z7X A;  3PR8 A;  5F8B A;  3HD5 A;  2DJ1 A;  1S3D A;  1ON4 A;  4F2I A;  1U3I A;  2M46 A;  3GTU B;  3QFB C;  4HU9 A;  2GSS A;  4ZIJ A;  5IQY A;  1AAZ A;  2EC4 A;  1H75 A;  2WGR A;  4BL7 B;  4K9Z A;  1PL1 A;  3KGK A;  3RHC A;  1A2L A;  1V98 A;  4CHS A;  2HZF A;  2KLX A;  3O6T A;  4G10 A;  1QQ2 A;  1MD4 A;  2PPT A;  4K2D A;  4MZB A;  5BMU A;  2C3T A;  5LNK e;  2PN8 A;  1V2A A;  2XPD A;  1J08 A;  4N10 A;  2O8V B;  4ZBD A;  3WT1 A;  2VD0 A;  2C0D A;  2ZCT A;  2L59 A;  3IAS 2;  1EV9 A;  3EC3 A;  5E59 A;  3ZL5 A;  1GWC A;  5KN0 A;  2GT6 A;  1XW6 A;  1FO5 A;  1QFN A;  2F3M A;  4ZIL A;  3UOM A;  3LOR A;  2LKU A;  1O8W A;  3L9V A;  5HFK A;  2V41 A;  3UEM A;  1O6J A;  1EZK A;  4J57 E;  3GX8 A;  3TOT A;  2E7P A;  3HVX A;  1XVW A;  2PBJ A;  2LTK A;  3DEX A;  5ECN B;  3F9U A;  5A5K A;  3A2V A;  2RLI A;  3H93 A;  2MYG A;  2YJH A;  5ELA A;  1O81 A;  3MDK A;  2LS5 A;  3NZN A;  3TKS E;  2IMI A;  3FK8 A;  2V6O A;  3M3M A;  4XTS A;  3IK9 A;  4MPF A;  3MWH A;  3GKX A;  2H66 A;  4K7I A;  1YJ6 A;  3E9J B;  1XWA A;  2VL9 A;  3F8U A;  1M7T A;  3KIJ A;  5CRD A;  1AXD A;  2B5X A;  4CW9 A;  1WP0 A;  5ID2 B;  3BD2 A;  3VI7 A;  3J7Y b;  4ML6 A;  3ZYW A;  2VD1 A;  4XRD A;  3ZVJ A;  5HR3 A;  2VO4 A;  5B8B A;  1GLP A;  3EWL A;  2DC5 A;  4KCE A;  3FR6 A;  5CYY A;  4N30 A;  4LL1 B;  3UL3 A;  4L5L A;  2CAQ A;  1M9B A;  5J41 A;  3L0H A;  2X8C A;  1LU4 A;  5DQS A;  2YAN A;  1W89 A;  4HZ4 A;  4OMV A;  1ZOF A;  5IMF A;  4MP4 A;  2ALB A;  4KAE A;  3GH9 A;  5EPF A;  3KZQ A;  4MH2 A;  1OE8 A;  1DBY A;  2K6V A;  2CV4 A;  3KH9 A;  1B9Y C;  1O7U A;  2M72 A;  3VWV A;  2GQL A;  5ECM B;  5HR1 A;  1OKT A;  2FA4 A;  2TRC P;  1EOH A;  3IE3 A;  3VWW A;  2NBS A;  1YF0 A;  2OKA A;  2YPM A;  4GQC A;  2HRK A;  2ON5 A;  1GUK A;  1SEN A;  3WGD A;  4GSN A;  1SU9 A;  4IP6 A;  2YWM A;  5B8A A;  3KMO A;  5D9V A;  4POK A;  3FEU A;  4OFN A;  2GZP A;  1NHO A;  3UBK A;  4BVX A;  3GRX A;  2X64 A;  2LEG A;  4L5O A;  1PD2 1;  4MAB A;  4IVF A;  2F8F A;  2X8G A;  1U6T A;  4PQH A;  2OE0 A;  4QQ7 A;  2DLX A;  1IYI A;  3F63 A;  2H75 A;  1ABA A;  4OO4 A;  2GT5 A;  2JZT A;  2L57 A;  2XHF A;  1AQV A;  1ERT A;  4X0X A;  2JU5 A;  1HNC A;  4EO3 A;  2R37 A;  1GH2 A;  2O85 A;  3GNJ A;  6GST A;  1QK8 A;  2HFD A;  4ECB A;  5F0G A;  1GUH A;  5LCZ A;  5G1K A;  4DSR A;  3BBY A;  4Q5F A;  4PNG A;  1W4V A;  1PRX A;  5CRG A;  6GSW A;  2H1B A;  2GQK A;  3TOU A;  1T3B A;  3VWU A;  1JZR A;  1JZD A;  2A2R A;  1YY7 A;  4NAX A;  2I81 A;  2DJ0 A;  3HZ4 A;  2IMF A;  1ZZY A;  1UN2 A;  3APQ A;  1MDI A;  1M0U A;  1I5G A;  2FD3 A;  1UA5 A;  3IV4 A;  2F9S A;  1SYX A;  2IME A;  1KEB A;  1PN9 A;  1FAA A;  3ZLP A;  3Q19 A;  1G6W A;  4JU5 A;  2C80 A;  3D5J A;  3D22 A;  4MJC A;  1G7O A;  1WPI A;  1Z9H A;  4FYB A;  2MMZ A;  1KNG A;  1FW1 A;  1F9M A;  1T00 A;  2VL2 A;  1YDK A;  3FZ4 A;  1Z6N A;  3HJM A;  4V1A p;  4KND A;  3CBU A;  2H74 A;  3A3T A;  2PGT A;  3QMX A;  4TXO B;  1Y25 A;  4ECI A;  1XVQ A;  4TR3 A;  4XS6 A;  3FW2 A;  3A2X A;  3FHK A;  1K0B A;  3HCZ A;  2CX3 A;  1PKW A;  3IPZ A;  5GSS A;  1TJD A;  4LMW A;  1PL2 A;  4XS4 A;  1DE1 A;  2GGT A;  1RW1 A;  1F6M C;  3DWV A;  3TDG A;  4IQ1 A;  5J9C A;  3C1S A;  1E6B A;  4V1A g;  2AYT A;  3QPM A;  5J3R A;  2C0E A;  4E8H A;  3GKM A;  2RUE A;  1YF1 A;  5A4W A;  3IC4 A;  3A5W A;  1NHY A;  2XBQ A;  2HRK B;  3C7M A;  1ZCP A;  3E3E A;  3US3 A;  4H86 A;  4Q5N A;  3N9J A;  3U6V A;  4BVX B;  4JR4 A;  3DD3 A;  2H6Z A;  2ZNM A;  1SJI A;  4IJI A;  1ST9 A;  1M2A A;  4IP1 A;  2BMX A;  3W8S A;  2JAD A;  4OWY A;  2JSZ A;  4IW9 A;  2OA7 A;  7GSS A;  4OO5 A;  1V58 A;  1XCC A;  2P31 A;  3DVW A;  1JHB A;  5H5S A;  1AC1 A;  3GSS A;  4EVM A;  4WR5 A;  1Y6E A;  3KMN A;  2B6M A;  1XOA A;  2JZR A;  1EGR A;  1YKA A;  3KTB A;  2VLV A;  2DMM A;  3HY2 A;  5COH A;  1G6Y A;  3DXB A;  5CRE A;  4J2F A;  3JCM L;  1BAY A;  2CZ2 A;  2QGV A;  2PER A;  3L4N A;  3UVT A;  4I5Q A;  1BED A;  4OCF A;  5D9W A;  1ILO A;  2WJU A;  1N8J A;  1XOB A;  5ECQ B;  5ECR B;  2B1L A;  2PVO C;  4ZBA A;  2DJK A;  1A8L A;  2WFC A;  5JCW A;  1OVN A;  1CQG A;  6GSU A;  1EP7 A;  4AJ6 A;  3HKR A;  4OD7 A;  3E0U A;  1TTZ A;  5HQP A;  3G9B A;  5D8I A;  4I8B A;  2WUL A;  4L0U A;  1XW9 A;  3IHQ A;  4FIW A;  3IDV A;  2RM5 A;  4EDZ A;  1HNB A;  3U5R E;  3Q6O A;  4PQI A;  2R5G A;  1FOV A;  4KDU A;  4ECJ A;  4PXO A;  1LJR A;  4YAP A;  2VCV A;  3ZIJ A;  4X1U A;  3IA1 A;  3HHV A;  2MZC A;  5ELG A;  2V2G A;  1R5A A;  2DJJ A;  3F3Q A;  3KCM A;  4KE3 A;  5EY6 A;  4HDE A;  3UMA A;  1WRY A;  4F9Z A;  1FVJ A;  4TXV A;  1T4Y A;  1GSY A;  3ERW A;  1JZO A;  3APO A;  3ZMK A;  2H76 A;  3CTG A;  4IQA A;  4GST A;  4XS4 B;  4DEJ A;  22GS A;  2CVB A;  2CVK A;  4PTS A;  2CA8 A;  4MZW A;  1FG4 A;  4GF0 A;  2KHP A;  3HVS A;  3GL5 A;  1UVZ A;  4D73 A;  1R5P A;  2HE3 A;  3FR3 A;  5HR2 A;  4XCS A;  1TK0 B;  2FY6 A;  2VL3 A;  1R7H A;  2CAI A;  2VCZ A;  4JE1 A;  2GVP A;  5CRH A;  2H30 A;  4EKZ A;  3FYG A;  3C1R A;  2KOK A;  2VUP A;  3KJY A;  3H4K A;  4N0Z A;  1VRS D;  4AF2 A;  3LG6 A;  2FWH A;  4K0N A;  4ZL9 A;  5G30 A;  3GH6 A;  4YH2 A;  4POB A;  2E0Q A;  2YJ7 A;  2IPA A;  4TN8 A;  3TKS A;  3QR6 A;  2JAC A;  4KUN A;  1BQ7 A;  1R26 A;  2C1Y A;  3LYK A;  3ZVJ D;  1Z5Y E;  3P90 A;  3LXT A;  4G0K A;  5GST A;  3QD9 A;  1H4O A;  11GS A;  4FO5 A;  1ACV A;  4NV2 A;  2LRT A;  1ZYE A;  1JLV A;  4K7N A;  3TJJ A;  2I1U A;  2N5B A;  4F82 A;  4EE0 A;  1X0R A;  4BPY A;  4GQF A;  1GUL A;  2IMD A;  2DIZ A;  3F4R A;  3TKS C;  1SJZ A;  4HZ2 A;  3H1N A;  4ZB8 A;  4KX4 A;  4WKW A;  4JBB A;  1GSS A;  2VM1 A;  2TIR A;  1YQ1 A;  1SJ6 A;  4BWS A;  3RHB A;  4PX1 A;  3SWL A;  1O85 A;  2RUF A;  3VWX A;  2F8A A;  2YZH A;  3CXG A;  2LUS A;  1RQM A;  2DJ2 A;  5ENU A;  1Q98 A;  3TCO A;  1GSU A;  1XBS A;  4LA1 A;  3LYP A;  5DCG A;  5IMC A;  3P8W A;  3TGZ A;  3C71 A;  4EC0 A;  2VLT A;  5IMD A;  3DGQ A;  2DJ3 A;  1SL0 B;  3IBH A;  2L4C A;  5DVB A;  1VGL A;  5ABR A;  2LV3 A;  3QAW A;  1FVK A;  1UC7 A;  1C72 A;  2FUG 2;  4POM A;  4TXO A;  3RAZ A;  1TRW A;  1X5C A;  3NOF A;  3UIW A;  2MMA A;  1SKS B;  4LLR A;  1T4Z A;  2B5Y A;  2H71 A;  4USS A;  4NHW A;  1X9S B;  4ZB9 A;  4AJ7 A;  4MF6 A;  8GSS A;  1YKC A;  1OC3 A;  3GUR A;  1R4W A;  4TR4 A;  4K1F A;  4NXI A;  2CZ3 A;  5G31 A;  4YAV A;  2OE3 A;  4AJ8 A;  5KN1 A;  2KUC A;  4GRF A;  2GSR A;  2YWI A;  3AY8 A;  2A2S A;  6GSY A;  2HSN B;  2H1A A;  1KTE A;  3VUR A;  1TRU A;  4D73 B;  3GV1 A;  2V1M A;  5G1L A;  1MDJ A;  2YWO A;  3TJK A;  3QOU A;  2HT9 A;  1F3B A;  5D73 A;  4K8M A;  1T7P B;  4I2U A;  2OBI A;  3EUR A;  3GFK A;  4ZBB A;  2WB9 A;  4HEA 2;  3SBC A;  2VAF A;  1SK2 A;  3HJO A;  1HD2 A;  4KF9 A;  3DVX A;  3F4S A;  1BYE A;  5CO3 A;  5JWQ B;  3EVI A;  5G2Z A;  6GSX A;  2NPB A;  3CSH A;  1PQN A;  3EE2 A;  5F05 A;  2AV4 A;  2K8S A;  5ECI B;  5D9X A;  1QXH A;  5IPH A;  4GWR A;  3IC8 A;  2XC2 A;  4FH8 A;  4IEL A;  4IKH A;  3TKP A;  1PGT A;  1TI3 A;  2HZE A;  2L5O A;  2XPE A;  5JCG A;  5J5N A;  2HYX A;  2P5Q A;  2FGX A;  1A24 A;  3C8E A;  3D0Z A;  1DSB A;  5AIX A;  1J0F A;  1EP8 A;  2E2G A;  4NMU A;  3Q18 A;  4FYC A;  3DML A;  3S9F A;  2GZY A;  2HSH A;  1WE0 A;  4L0W A;  3G7J A;  2IWT A;  3GIX A;  4NV5 A;  2LNT A;  3P2A A;  4RUV A;  4I97 A;  2LJA A;  2ON7 A;  1FB0 A;  1NW2 A;  2VCW A;  3ED3 A;  4TOP A;  4K7O A;  4CDO A;  3H8Q A;  1SL1 B;  1K3Y A;  3RBT A;  2YNX A;  2HSY A;  1ERW A;  1USB A;  2KP2 A;  4BVY A;  2HRN A;  2HRF A;  1TRV A;  1PA3 A;  4WET A;  2R2J A;  5AIV A;  2C4J A;  4ILF A;  5F06 A;  5FT3 A;  2HQT A;  3F6D A;  1QUW A;  4MJE A;  1E2Y A;  4O32 A;  2RM6 A;  2NDO A;  1SKW B;  4RQX A;  4KCA A;  16GS A;  5H5Q A;  4Q5Q A;  2VL2 C;  1VF2 A;  4EL1 A;  4L8E A;  4Q5R A;  5L71 A;  1K0C A;  1V57 A;  1S3C A;  4DSS B;  5FWG A;  2H6Y A;  3IR4 A;  13GS A;  4FQU A;  3IAM 2;  1DUG A;  3QAV A;  4V2M A;  4HJM A;  4HU7 A;  14GS A;  3M9K A;  2HSM A;  2QKE A;  2B7J A;  1A8Y A;  3HA9 A;  3MSZ A;  4PUA A;  1XWK A;  3KXO A;  2YCD A;  2MMO A;  1U3A A;  19GS A;  2GZZ A;  3ZFL A;  5D93 A;  2JL4 A;  2VIM A;  1WWJ A;  4BA7 A;  1TU8 A;  5IMZ A;  3GN3 A;  4KSM A;  3RDW A;  3ZZX A;  2C0G A;  1ZMA A;  5JWR B;  5D96 A;  4X43 A;  4XHM A;  2JZS A;  1DE2 A;  2P5R A;  2D2Z A;  5ECS A;  4KDY A;  2ES7 A;  1OE7 A;  1FB6 A; 
#chains in the Genus database with same CATH topology
 5HR0 A;  4QL7 A;  2ZUP A;  3ZIV A;  3EMX A;  1GTU A;  2GST A;  4PQ1 A;  3MYD A;  4K5R A;  3MAK A;  3KP9 A;  1B4P A;  2OE1 A;  1EV4 A;  2BTO T;  1X9M B;  3IXR A;  1ZYN A;  2JSY A;  2R0C A;  3KH7 A;  4IN0 A;  2OAD A;  3APS A;  3ZRD A;  1N2A A;  2H6X A;  2H73 A;  2H0H A;  4G0L A;  5H5R A;  4GLT A;  4OFT A;  4ML1 A;  1K0M A;  2YV7 A;  3UJ1 A;  4PNF A;  4BWQ A;  1GL8 A;  3FZA A;  3K8N A;  1T8E B;  3A5I A;  2GTU A;  3PIN A;  3W8J A;  1EEM A;  2LST A;  2HZE B;  3RPN A;  2OJL A;  5A5H A;  1AQW A;  3HVV A;  1GTB A;  3IK7 A;  3KM6 A;  4E8E A;  1ERU A;  1G0T A;  4HQS A;  1F37 A;  1M2B A;  10GS A;  4A5P A;  3TKQ A;  3ME8 A;  4JRR A;  4O5Q A;  3HVN A;  1I9D A;  1GLQ A;  5KN2 A;  3L78 A;  3ERG A;  2FNO A;  4NPB A;  1O73 A;  2G2Q A;  2OBK A;  4IJ3 A;  5G5F A;  4I6X A;  5D9T A;  2H19 A;  1PMT A;  1GSQ A;  3CRU A;  3HJP A;  2LNS A;  1TP9 A;  4IS0 A;  3O76 A;  5J47 A;  1TXX A;  4K0G A;  2AAW A;  2K9F A;  1TI1 A;  3TJF A;  4BVY B;  2I4A A;  2QSI A;  1S3A A;  2LJK A;  3A2W A;  3BCK A;  1GSE A;  1V9W A;  6GSV A;  3WT2 A;  2C3Q A;  3CQF A;  4EUY A;  5GZZ B;  1AW9 A;  1YEP A;  5ECP B;  3DIE A;  2Z9S A;  3DKS A;  3TRX A;  1BG5 A;  1X5E A;  2OAC A;  1KBN A;  3MIX A;  4ZL8 A;  4LMV A;  4KH7 A;  2IJY A;  4MMM A;  3BOA A;  3UBL A;  3P7X A;  2IIY A;  4RI6 A;  4G0I A;  3RGB C;  1ZGN A;  2HSM B;  5DAL A;  5IMV A;  1N25 A;  3F3R A;  5F07 A;  2PWJ A;  5CNW A;  1NM3 A;  3IRA A;  5GAN D;  2H70 A;  2TRX A;  2B1K A;  3GKK A;  6GSS A;  4XIH A;  1O8X A;  2AJQ B;  2CX4 A;  4RQR A;  2UZ8 A;  1QGV A;  3PPU A;  1AUC A;  4PUR A;  1GP1 A;  4GSS A;  2F51 A;  2LJR A;  3VLN A;  3HZ8 A;  4PGT A;  2VM2 A;  1GNE A;  2VCX A;  4KW6 A;  4NWY A;  3D21 A;  4YQM A;  1OKD A;  4ZB7 A;  1X9W B;  2B5E A;  2L5L A;  1WJK A;  2YV9 A;  5B6N A;  1MTC A;  3I9V 2;  3F6F A;  12GS A;  1F2E A;  2YOI A;  5E4W A;  2GDR A;  3TRP A;  1GNW A;  3MNG A;  2O7K A;  20GS A;  3GUS A;  5J9B A;  3KP8 A;  2N5A A;  4E68 A;  4WF4 A;  1JZW A;  3M9J A;  5JWO B;  5DAK A;  2R3X A;  2QC7 A;  3GHA A;  4MPG A;  3RPP A;  1PX6 A;  2GSQ A;  5DQY A;  1A23 A;  3IHG A;  3EMP A;  1VF4 A;  1GUM A;  5DJL A;  1LBK A;  4MJB A;  2IMK A;  3ZRE A;  3WGE A;  2H1D A;  4G2E A;  3D6I A;  3LXZ A;  2V32 A;  5A5H B;  5A34 A;  2MBS A;  3FRC A;  1OC8 A;  2VOC A;  4OCE A;  4TW5 A;  1XWB A;  3UAR A;  2A4V A;  4ULX A;  3LSZ A;  2E2M A;  3IOS A;  4TR1 A;  2X99 A;  3HDC A;  4AKX B;  3CYN A;  1X5D A;  5IOW A;  4KSO A;  3EYT A;  3FKF A;  5KOX A;  1THX A;  3ZTL A;  3C73 A;  2H01 A;  2HXK A;  1M3J A;  1FOH A;  3R2Q A;  1WMJ A;  4QL9 A;  3LEF A;  3LGC A;  1URM A;  2VKZ G;  3FZ5 A;  3Q74 A;  4MA9 A;  5IOX A;  1NSW A;  4PHZ C;  1M2D A;  3BJ5 A;  5IO0 A;  5C04 A;  4RI7 A;  1J9B A;  3J7Y k;  1AIU A;  2J9H A;  1V40 A;  3GL3 A;  3UAP A;  4J56 E;  1OC9 B;  1RK4 A;  3WYW A;  5C00 A;  1TU7 A;  4DSS A;  3QFA C;  3N5O A;  1BX9 A;  3TJB A;  3PGT A;  4WF5 A;  2L6C A;  5AN1 A;  4ECC A;  3CTF A;  2LQO A;  3GKN A;  3RFR C;  3EIN A;  1B48 A;  3HYP A;  2H1L A;  5FHI A;  4XRA A;  1XPV A;  1EWX A;  1Z6M A;  5ECO B;  5JCU A;  1YEX A;  3KD0 A;  4Z2R A;  1AQX A;  4MZC A;  3M8N A;  2O89 A;  4KDX A;  2LRC A;  5CRW A;  4EIQ A;  4N11 A;  5BRT A;  3D4T A;  4KA0 A;  2H0G A;  1JFU A;  5DAL B;  3H79 A;  1Z3E A;  1K3O A;  2YN1 A;  4EDY A;  4TRX A;  2FWF A;  4G9H A;  4KB3 A;  1WOU A;  1TK8 B;  3I43 A;  2WS2 A;  2IFQ A;  3F4T A;  4OFM A;  5B7C A;  3CRT A;  3WGX A;  1A2J A;  1S4B P;  4IHU A;  5KEJ A;  1PX7 A;  5GAP D;  3VK9 A;  2H8L A;  3PH9 A;  5HFG A;  1PSQ A;  1YZX A;  2FWE A;  1SD9 A;  4MCU A;  1TOF A;  1SK0 A;  1PKZ A;  4TVE A;  1U87 A;  1TKD B;  1FHE A;  4V2L A;  3CSJ A;  3O3T A;  1VF1 A;  1A0R P;  4V2N A;  2QA1 A;  3LWA A;  3VPT A;  3F0I A;  3DYR A;  1TK5 B;  2FWG A;  4GCI A;  1GRX A;  5KOW A;  4YQU A;  2A2P A;  5B6M A;  3M0F A;  3VFI A;  2EIR A;  4JED A;  4PUF C;  2BJX A;  4O5R A;  1TW9 A;  5DBQ A;  2LRN A;  1XFL A;  4ACS A;  1K0N A;  1G7E A;  1HNA A;  1MD3 A;  5DAK B;  4YQV A;  18GS A;  1B4Q A;  4HOJ A;  2DSA A;  3VI5 A;  1ZYP A;  4HJ2 A;  3HXS A;  4ID0 A;  1XXU A;  2EFD A;  1SD8 A;  1GTI A;  5ECH B;  3LJR A;  1HYU A;  5A34 B;  5CAX A;  1Z7P A;  1IYH A;  2PVQ A;  2XBI A;  2C0F A;  2VCT A;  2CT6 A;  4ZL7 A;  2P0G A;  3G7Y A;  4TR1 B;  2N5F A;  2EIQ A;  3R3E A;  3ERF A;  1YEW C;  2NTO A;  5KN3 A;  3GMF A;  1K0O A;  3GYK A;  4WEY A;  3EU3 A;  2FHE A;  1K0D A;  3QDN A;  4FYU A;  2R4V A;  4HI7 A;  1ERV A;  4F0B A;  1M3I A;  5ECK B;  3LQ7 A;  2B7K A;  5IIZ A;  3TU3 B;  4IGJ A;  4K2X A;  4DVC A;  4EF0 A;  4K5S A;  4WBR D;  1EGO A;  2YP6 A;  4WR4 A;  3QCP A;  1MEK A;  3EU4 A;  2WRT A;  3I6A A;  5A4U A;  2PU9 C;  3TKR A;  4KGI A;  1XWC A;  2LQQ A;  4P3Y B;  1Z7R A;  5AIS A;  5DJM A;  1OYJ A;  4ISD A;  4F03 A;  1T1V A;  2VCQ A;  4MF5 A;  1TRS A;  4O7H A;  3CHX C;  3GX0 A;  4YKF A;  1SKR B;  1EEJ A;  5IMA A;  4HUA A;  4ZB6 A;  2O3E A;  4G19 A;  2DML A;  1K3L A;  4GTU A;  2M80 A;  3W6G A;  4POL A;  1GSD A;  2YWN A;  5CP1 A;  3UVH A;  2C8U A;  1MDK A;  3ME7 A;  4TR0 A;  3GTU A;  17GS A;  1F3A A;  4HQZ A;  3DRN A;  4MJA A;  2B3S A;  2V6K A;  3BCI A;  4BL7 A;  2PMT A;  1CQH A;  2O87 A;  2DBC A;  4EXJ A;  2NVL A;  1M99 A;  2FA8 A;  2IFQ B;  1QMV A;  2PUK C;  5INY A;  3KEB A;  2HLS A;  2R0P A;  4N0V A;  3M1G A;  4AI6 A;  5AGY A;  2C3N A;  4IBP A;  5IM9 A;  4MK3 A;  3QAG A;  5J4V A;  5EL8 A;  4MLY A;  2L6D A;  3TUE A;  1TXU A;  2H0I A;  2GLR A;  3ZML A;  1JLW A;  2KP1 A;  3ISO A;  3NIV A;  2GQM A;  3TB2 A;  4LL4 B;  4JR6 A;  4I2T A;  1GTA A;  5LD0 A;  2DIY A;  3L9S A;  3CMI A;  3OR5 A;  3WD6 A;  1SL2 B;  4AKG A;  4XS1 A;  2WW2 A;  2GS3 A;  3KTL A;  5G5E A;  4GXZ A;  2AUV A;  5IPG A;  4ZXG A;  2WZ9 A;  2I3Y A;  3D4M A;  5ECL B;  5DDL A;  5HFI A;  2I9H A;  2WCI A;  3FR9 A;  3G7I A;  2HI7 A;  2K8V A;  3GA4 A;  3I69 A;  1A2M A;  2FLS A;  2AB6 A;  3TRQ A;  3ZFB A;  2HRA A;  1XW5 A;  2WDU A;  3L9U A;  2K18 A;  2L4Q A;  4MF7 A;  1HQO A;  1EOG A;  2CVD A;  2MMN A;  2X8H A;  4JZQ A;  1XIY A;  1TDI A;  4TKY A;  5J4U A;  9GSS A;  3FY7 A;  4NHZ A;  2IN3 A;  2H1G A;  1M9A A;  2EIO A;  5ID2 A;  4HS1 A;  4WXT A;  1B8X A;  3GST A;  1OAZ A;  5EVO A;  3ZIT A;  1Q4J A;  3FZ9 A;  4K6X A;  3LFL A;  2H72 A;  1GSF A;  4O92 A;  4MH3 A;  1OC9 A;  2G0F A;  1XZO A;  3V1W A;  1K0A A;  1XWG A;  2MBT A;  1A0F A;  1ZL9 A;  2R6K A;  1ZYQ B;  2HNL A;  4AGS A;  5DCH A;  5IO2 A;  4DSQ A;  3TJG A;  3CSI A;  2VLU A;  2REM A;  1SVL A;  5A4V A;  2J23 A;  1ML6 A;  2WVX A;  2CQ9 A;  2YZU A;  1VF3 A;  4MDC A;  1U88 A;  2IL3 A;  1B9X C;  1BJX A;  4WBJ A;  1WIK A;  1SYR A;  2AHE A;  1SK1 A;  2FCH A;  4ICY A;  4F0C A;  2RII A;  1THO A;  3VPQ A;  4Z7X A;  3PR8 A;  5F8B A;  3HD5 A;  2DJ1 A;  1S3D A;  1ON4 A;  4F2I A;  1U3I A;  2M46 A;  3GTU B;  3QFB C;  4HU9 A;  2GSS A;  4ZIJ A;  5IQY A;  1AAZ A;  2EC4 A;  1H75 A;  2WGR A;  4BL7 B;  4K9Z A;  1PL1 A;  3KGK A;  3RHC A;  1A2L A;  1V98 A;  4CHS A;  2HZF A;  2KLX A;  3O6T A;  4G10 A;  1QQ2 A;  1MD4 A;  2PPT A;  4K2D A;  4MZB A;  5BMU A;  2C3T A;  5LNK e;  2PN8 A;  2WW3 A;  1V2A A;  2XPD A;  1J08 A;  4N10 A;  2O8V B;  4ZBD A;  3WT1 A;  2VD0 A;  2C0D A;  2ZCT A;  2L59 A;  3IAS 2;  1EV9 A;  3EC3 A;  5E59 A;  3ZL5 A;  1GWC A;  5KN0 A;  2GT6 A;  1XW6 A;  2X4A A;  1FO5 A;  1QFN A;  2F3M A;  4ZIL A;  3UOM A;  3LOR A;  2LKU A;  1O8W A;  3L9V A;  5HFK A;  2V41 A;  3UEM A;  1O6J A;  1EZK A;  4J57 E;  3GX8 A;  3TOT A;  2E7P A;  3HVX A;  1XVW A;  2PBJ A;  2LTK A;  3DEX A;  5ECN B;  3F9U A;  5A5K A;  3A2V A;  2RLI A;  3H93 A;  2MYG A;  2YJH A;  5ELA A;  1O81 A;  3MDK A;  2LS5 A;  3NZN A;  3TKS E;  2IMI A;  3FK8 A;  2V6O A;  3M3M A;  4XTS A;  3IK9 A;  4MPF A;  3MWH A;  3GKX A;  2H66 A;  4K7I A;  1YJ6 A;  3E9J B;  1XWA A;  2VL9 A;  3F8U A;  1M7T A;  3KIJ A;  5CRD A;  1AXD A;  2B5X A;  4CW9 A;  1WP0 A;  2QA2 A;  5ID2 B;  3CWG A;  3BD2 A;  3VI7 A;  3J7Y b;  4ML6 A;  3ZYW A;  2VD1 A;  4XRD A;  3ZVJ A;  5HR3 A;  2VO4 A;  4PI0 C;  5B8B A;  1GLP A;  3EWL A;  2DC5 A;  4KCE A;  2UV8 G;  4HSC X;  3FR6 A;  5CYY A;  4N30 A;  4LL1 B;  3UL3 A;  4L5L A;  3LW9 A;  2CAQ A;  1M9B A;  1BG1 A;  5J41 A;  3L0H A;  4GDF A;  2X8C A;  1LU4 A;  5DQS A;  2YAN A;  1W89 A;  4G01 A;  4HZ4 A;  4OMV A;  1ZOF A;  5IMF A;  2WVY A;  4MP4 A;  2ALB A;  4KAE A;  3HMJ G;  3GH9 A;  2WVX B;  5EPF A;  3KZQ A;  4MH2 A;  1OE8 A;  1DBY A;  2K6V A;  2CV4 A;  3KH9 A;  1B9Y C;  1S3R A;  1O7U A;  2M72 A;  3VWV A;  2GQL A;  5ECM B;  5HR1 A;  1OKT A;  2FA4 A;  2TRC P;  1EOH A;  3IE3 A;  3VWW A;  2NBS A;  2WZS A;  1YF0 A;  2OKA A;  2YPM A;  4GQC A;  2HRK A;  2ON5 A;  1GUK A;  1SEN A;  3WGD A;  4GSN A;  1SU9 A;  4IP6 A;  2YWM A;  5B8A A;  3KMO A;  5D9V A;  4POK A;  3FEU A;  4OFN A;  2GZP A;  1NHO A;  3UBK A;  4BVX A;  3GRX A;  2X64 A;  2LEG A;  4L5O A;  1PD2 1;  4MAB A;  4IVF A;  2F8F A;  2X8G A;  1U6T A;  4PQH A;  2OE0 A;  4QQ7 A;  2DLX A;  1IYI A;  3F63 A;  2H75 A;  1ABA A;  4OO4 A;  2GT5 A;  2JZT A;  2L57 A;  2XHF A;  4Z2T A;  1AQV A;  1ERT A;  4X0X A;  2JU5 A;  1HNC A;  5BMU B;  4EO3 A;  2R37 A;  1GH2 A;  2O85 A;  3GNJ A;  6GST A;  1QK8 A;  1YVL A;  2HFD A;  4ECB A;  5F0G A;  1GUH A;  5LCZ A;  5G1K A;  4DSR A;  3BBY A;  4Q5F A;  4PNG A;  1W4V A;  1PRX A;  5CRG A;  6GSW A;  2H1B A;  2GQK A;  3TOU A;  1T3B A;  3VWU A;  1JZR A;  1Y1U A;  1JZD A;  2A2R A;  1YY7 A;  4NAX A;  2I81 A;  2DJ0 A;  3HZ4 A;  2IMF A;  1ZZY A;  1UN2 A;  3APQ A;  1MDI A;  1M0U A;  1I5G A;  2FD3 A;  1UA5 A;  3IV4 A;  2F9S A;  1SYX A;  2IME A;  4FXY P;  1KEB A;  4O5U A;  1PN9 A;  1FAA A;  3ZLP A;  3Q19 A;  1G6W A;  4JU5 A;  2C80 A;  3D5J A;  3D22 A;  4MJC A;  1G7O A;  1WPI A;  1Z9H A;  4FYB A;  2X49 A;  2MMZ A;  1KNG A;  1FW1 A;  1F9M A;  1T00 A;  2VL2 A;  1YDK A;  3FZ4 A;  1Z6N A;  3HJM A;  4V1A p;  4KND A;  3CBU A;  2H74 A;  3A3T A;  2PGT A;  3QMX A;  4TXO B;  1Y25 A;  4ECI A;  1XVQ A;  4TR3 A;  4XS6 A;  3FW2 A;  3A2X A;  3FHK A;  1K0B A;  3HCZ A;  2CX3 A;  2OT3 A;  1PKW A;  3IPZ A;  5GSS A;  1TJD A;  4MNN A;  4LMW A;  1PL2 A;  4XS4 A;  1DE1 A;  2GGT A;  1RW1 A;  1F6M C;  3DWV A;  3TDG A;  4IQ1 A;  5J9C A;  3C1S A;  1E6B A;  4V1A g;  2AYT A;  3QPM A;  5J3R A;  2C0E A;  4E8H A;  3GKM A;  2RUE A;  1SVM A;  1YF1 A;  5A4W A;  3IC4 A;  3A5W A;  1NHY A;  2XBQ A;  2HRK B;  3C7M A;  1ZCP A;  3E3E A;  3US3 A;  4H86 A;  5A1N B;  4Q5N A;  4BIK A;  3N9J A;  3U6V A;  2A4H A;  4BVX B;  4JR4 A;  3DD3 A;  2H6Z A;  2ZNM A;  1SJI A;  4IJI A;  1ST9 A;  1M2A A;  4IP1 A;  2BMX A;  3W8S A;  2JAD A;  4OWY A;  2JSZ A;  4IW9 A;  2OA7 A;  7GSS A;  4OO5 A;  1V58 A;  1XCC A;  2P31 A;  3DVW A;  1JHB A;  5H5S A;  1AC1 A;  3GSS A;  4EVM A;  4WR5 A;  1Y6E A;  3KMN A;  2B6M A;  1XOA A;  2JZR A;  1EGR A;  1YKA A;  3KTB A;  2VLV A;  2DMM A;  3HY2 A;  5COH A;  4QMK A;  1G6Y A;  3DXB A;  5CRE A;  4J2F A;  3JCM L;  1BAY A;  2CZ2 A;  2QGV A;  3FMW A;  2PER A;  3L4N A;  3UVT A;  4I5Q A;  1BED A;  4OCF A;  2DKH A;  5D9W A;  1ILO A;  2WJU A;  1N8J A;  1XOB A;  5ECQ B;  5ECR B;  2B1L A;  2PVO C;  4ZBA A;  2DJK A;  1A8L A;  2WFC A;  5JCW A;  1OVN A;  2O5V A;  1CQG A;  6GSU A;  1EP7 A;  4AJ6 A;  3HKR A;  4OD7 A;  3E0U A;  1TTZ A;  5HQP A;  3G9B A;  5D8I A;  4I8B A;  2WUL A;  4L0U A;  1XW9 A;  3IHQ A;  4FIW A;  3IDV A;  2RM5 A;  4EDZ A;  1HNB A;  3U5R E;  3Q6O A;  4PQI A;  2R5G A;  1FOV A;  4KDU A;  4ECJ A;  4PXO A;  1LJR A;  4YAP A;  2VCV A;  3ZIJ A;  4X1U A;  3IA1 A;  3HHV A;  2MZC A;  5ELG A;  2V2G A;  1R5A A;  2DJJ A;  3F3Q A;  3KCM A;  4KE3 A;  5EY6 A;  4HDE A;  3UMA A;  1WRY A;  4F9Z A;  1FVJ A;  4TXV A;  1T4Y A;  1GSY A;  3ERW A;  1JZO A;  3APO A;  3ZMK A;  2H76 A;  3CTG A;  4IQA A;  4N3Z A;  4GST A;  4XS4 B;  4DEJ A;  22GS A;  2CVB A;  2CVK A;  4PTS A;  2CA8 A;  4MZW A;  1FG4 A;  4GF0 A;  2KHP A;  2HSN A;  3HVS A;  2WVZ A;  3GL5 A;  1UVZ A;  4D73 A;  1R5P A;  2HE3 A;  3FR3 A;  5HR2 A;  4XCS A;  1TK0 B;  2FY6 A;  2VL3 A;  1R7H A;  2CAI A;  4EIP A;  2VCZ A;  4JE1 A;  2GVP A;  5CRH A;  2H30 A;  4EKZ A;  3FYG A;  3C1R A;  2KOK A;  5J40 A;  2VUP A;  3KJY A;  3H4K A;  4N0Z A;  1VRS D;  4AF2 A;  3LG6 A;  2FWH A;  4K0N A;  4ZL9 A;  5G30 A;  3GH6 A;  4YH2 A;  4POB A;  2E0Q A;  2YJ7 A;  2IPA A;  4TN8 A;  3TKS A;  3QR6 A;  2JAC A;  4KUN A;  1BQ7 A;  1R26 A;  1XG8 A;  2C1Y A;  3LYK A;  3ZVJ D;  1Z5Y E;  3P90 A;  3LXT A;  4G0K A;  5GST A;  3QD9 A;  2WW0 A;  1H4O A;  11GS A;  4FO5 A;  1ACV A;  4NV2 A;  2LRT A;  1ZYE A;  1JLV A;  4K7N A;  3TJJ A;  2I1U A;  2N5B A;  4F82 A;  4EE0 A;  1X0R A;  4BPY A;  4GQF A;  1GUL A;  2IMD A;  2DIZ A;  3EPT A;  3F4R A;  3TKS C;  1SJZ A;  4HZ2 A;  3H1N A;  4ZB8 A;  4KX4 A;  4WKW A;  4JBB A;  4W66 A;  1GSS A;  2VM1 A;  2TIR A;  1YQ1 A;  1SJ6 A;  4BWS A;  3RHB A;  4PX1 A;  3SWL A;  1O85 A;  2RUF A;  3VWX A;  2F8A A;  2YZH A;  3CXG A;  2LUS A;  1RQM A;  2DKI A;  2DJ2 A;  2O36 A;  5ENU A;  1Q98 A;  3TCO A;  1GSU A;  1XBS A;  4LA1 A;  3LYP A;  5DCG A;  5IMC A;  4YKG A;  3P8W A;  3TGZ A;  3C71 A;  4EC0 A;  2VLT A;  5IMD A;  3DGQ A;  2DJ3 A;  1SL0 B;  3IBH A;  2L4C A;  5DVB A;  1VGL A;  5ABR A;  2LV3 A;  3QAW A;  1FVK A;  1UC7 A;  1C72 A;  2FUG 2;  4POM A;  4TXO A;  3RAZ A;  1TRW A;  1X5C A;  3NOF A;  3UIW A;  2MMA A;  1SKS B;  4LLR A;  1T4Z A;  2B5Y A;  2H71 A;  4USS A;  4NHW A;  1X9S B;  4PI2 C;  4ZB9 A;  4AJ7 A;  4MF6 A;  4AKH A;  8GSS A;  1YKC A;  1OC3 A;  3GUR A;  1R4W A;  4TR4 A;  4K1F A;  4NXI A;  2CZ3 A;  5G31 A;  4YAV A;  2OE3 A;  4AJ8 A;  4CY6 A;  1PFO A;  5KN1 A;  2KUC A;  4GRF A;  2GSR A;  2YWI A;  3AY8 A;  5A1N A;  2A2S A;  6GSY A;  2HSN B;  2H1A A;  1KTE A;  3VUR A;  1TRU A;  4D73 B;  3GV1 A;  2V1M A;  5G1L A;  1MDJ A;  2YWO A;  3TJK A;  3QOU A;  2HT9 A;  1F3B A;  5D73 A;  1SVO A;  4K8M A;  1T7P B;  4I2U A;  2OBI A;  3EUR A;  3GFK A;  4ZBB A;  2WB9 A;  4HEA 2;  3SBC A;  2VAF A;  1SK2 A;  3HJO A;  1HD2 A;  4KF9 A;  3DVX A;  3F4S A;  1BYE A;  5CO3 A;  5JWQ B;  3EVI A;  5G2Z A;  6GSX A;  2NPB A;  3CSH A;  1PQN A;  1BF5 A;  3EE2 A;  5F05 A;  2AV4 A;  2K8S A;  5ECI B;  5D9X A;  1QXH A;  5IPH A;  4GWR A;  3IC8 A;  2XC2 A;  4FH8 A;  4IEL A;  4IKH A;  3TKP A;  1PGT A;  1TI3 A;  2HZE A;  2L5O A;  2XPE A;  5JCG A;  5J5N A;  2HYX A;  2P5Q A;  2FGX A;  1A24 A;  3C8E A;  3D0Z A;  1DSB A;  5AIX A;  1J0F A;  1EP8 A;  2E2G A;  4AKI A;  4NMU A;  3Q18 A;  4FYC A;  3DML A;  3S9F A;  2GZY A;  2HSH A;  1WE0 A;  2WW1 A;  4L0W A;  2EFC A;  3G7J A;  2IWT A;  3GIX A;  4NV5 A;  2LNT A;  3P2A A;  4RUV A;  4I97 A;  2LJA A;  2ON7 A;  1FB0 A;  1NW2 A;  2VCW A;  3ED3 A;  4TOP A;  4K7O A;  4CDO A;  3H8Q A;  1SL1 B;  1K3Y A;  3RBT A;  2YNX A;  2HSY A;  1ERW A;  1USB A;  2KP2 A;  4BVY A;  2HRN A;  2HRF A;  1TRV A;  1PA3 A;  4WET A;  2R2J A;  5AIV A;  2C4J A;  4ILF A;  5F06 A;  5FT3 A;  2HQT A;  3F6D A;  1QUW A;  4MJE A;  1E2Y A;  4O32 A;  2RM6 A;  2NDO A;  1SKW B;  1I1I P;  4RQX A;  4KCA A;  16GS A;  2EFH A;  5H5Q A;  4Q5Q A;  2VL2 C;  1VF2 A;  2EFE A;  4EL1 A;  4L8E A;  4Z2U A;  4Q5R A;  5L71 A;  1K0C A;  1V57 A;  1S3C A;  4DSS B;  5FWG A;  2H6Y A;  3IR4 A;  2R0G A;  13GS A;  1PN0 A;  4FQU A;  3IAM 2;  1DUG A;  3QAV A;  5J4Y A;  4V2M A;  14GS A;  3M9K A;  2HSM A;  2QKE A;  2B7J A;  4HJM A;  4HU7 A;  4CY8 A;  4X4J A;  1A8Y A;  3HA9 A;  3MSZ A;  4PUA A;  1XWK A;  3KXO A;  2YCD A;  2MMO A;  1U3A A;  19GS A;  2GZZ A;  3ZFL A;  5D93 A;  2JL4 A;  2VIM A;  1WWJ A;  4BA7 A;  1TU8 A;  5IMZ A;  3GN3 A;  4KSM A;  3RDW A;  3ZZX A;  2C0G A;  1ZMA A;  5JWR B;  5D96 A;  4X43 A;  4XHM A;  2JZS A;  1DE2 A;  2P5R A;  2D2Z A;  5ECS A;  4KDY A;  2ES7 A;  1OE7 A;  1FB6 A; 
#chains in the Genus database with same CATH homology
 5HR0 A;  4QL7 A;  2ZUP A;  3ZIV A;  3EMX A;  1GTU A;  2GST A;  4PQ1 A;  3MYD A;  4K5R A;  3MAK A;  3KP9 A;  1B4P A;  2OE1 A;  1EV4 A;  2BTO T;  1X9M B;  3IXR A;  1ZYN A;  2JSY A;  2R0C A;  3KH7 A;  4IN0 A;  2OAD A;  3APS A;  3ZRD A;  1N2A A;  2H6X A;  2H73 A;  2H0H A;  4G0L A;  5H5R A;  4GLT A;  4OFT A;  4ML1 A;  1K0M A;  2YV7 A;  3UJ1 A;  4PNF A;  4BWQ A;  1GL8 A;  3FZA A;  3K8N A;  1T8E B;  3A5I A;  2GTU A;  3PIN A;  3W8J A;  1EEM A;  2LST A;  2HZE B;  3RPN A;  2OJL A;  5A5H A;  1AQW A;  3HVV A;  1GTB A;  3IK7 A;  3KM6 A;  4E8E A;  1ERU A;  1G0T A;  4HQS A;  1F37 A;  1M2B A;  10GS A;  4A5P A;  3TKQ A;  3ME8 A;  4JRR A;  4O5Q A;  1I9D A;  1GLQ A;  5KN2 A;  3L78 A;  3ERG A;  2FNO A;  4NPB A;  1O73 A;  2G2Q A;  2OBK A;  4IJ3 A;  5G5F A;  4I6X A;  5D9T A;  2H19 A;  1PMT A;  1GSQ A;  3CRU A;  3HJP A;  2LNS A;  1TP9 A;  4IS0 A;  3O76 A;  5J47 A;  1TXX A;  4K0G A;  2AAW A;  2K9F A;  1TI1 A;  3TJF A;  4BVY B;  2I4A A;  2QSI A;  1S3A A;  2LJK A;  3A2W A;  3BCK A;  1GSE A;  1V9W A;  6GSV A;  3WT2 A;  2C3Q A;  4EUY A;  5GZZ B;  1AW9 A;  1YEP A;  5ECP B;  3DIE A;  2Z9S A;  3DKS A;  3TRX A;  1BG5 A;  1X5E A;  2OAC A;  1KBN A;  3MIX A;  4ZL8 A;  4LMV A;  4KH7 A;  2IJY A;  4MMM A;  3BOA A;  3UBL A;  3P7X A;  2IIY A;  4RI6 A;  4G0I A;  1ZGN A;  2HSM B;  5DAL A;  5IMV A;  1N25 A;  3F3R A;  5F07 A;  2PWJ A;  5CNW A;  1NM3 A;  3IRA A;  5GAN D;  2H70 A;  2TRX A;  2B1K A;  3GKK A;  6GSS A;  4XIH A;  1O8X A;  2AJQ B;  2CX4 A;  4RQR A;  2UZ8 A;  1QGV A;  3PPU A;  1AUC A;  4PUR A;  1GP1 A;  4GSS A;  2F51 A;  2LJR A;  3VLN A;  3HZ8 A;  4PGT A;  2VM2 A;  1GNE A;  2VCX A;  4KW6 A;  4NWY A;  3D21 A;  4YQM A;  1OKD A;  4ZB7 A;  1X9W B;  2B5E A;  2L5L A;  1WJK A;  2YV9 A;  5B6N A;  1MTC A;  3I9V 2;  3F6F A;  12GS A;  1F2E A;  2YOI A;  5E4W A;  2GDR A;  3TRP A;  1GNW A;  3MNG A;  2O7K A;  20GS A;  3GUS A;  5J9B A;  3KP8 A;  2N5A A;  4E68 A;  4WF4 A;  1JZW A;  3M9J A;  5JWO B;  5DAK A;  2R3X A;  2QC7 A;  3GHA A;  4MPG A;  3RPP A;  1PX6 A;  2GSQ A;  5DQY A;  1A23 A;  3IHG A;  3EMP A;  1VF4 A;  1GUM A;  5DJL A;  1LBK A;  4MJB A;  2IMK A;  3ZRE A;  3WGE A;  2H1D A;  4G2E A;  3D6I A;  3LXZ A;  2V32 A;  5A5H B;  5A34 A;  2MBS A;  3FRC A;  1OC8 A;  2VOC A;  4OCE A;  4TW5 A;  1XWB A;  3UAR A;  2A4V A;  4ULX A;  3LSZ A;  2E2M A;  3IOS A;  4TR1 A;  2X99 A;  3HDC A;  4AKX B;  3CYN A;  1X5D A;  5IOW A;  4KSO A;  3EYT A;  3FKF A;  5KOX A;  1THX A;  3ZTL A;  3C73 A;  2H01 A;  2HXK A;  1FOH A;  3R2Q A;  1WMJ A;  4QL9 A;  3LEF A;  3LGC A;  1URM A;  2VKZ G;  3FZ5 A;  3Q74 A;  4MA9 A;  5IOX A;  1NSW A;  1M2D A;  3BJ5 A;  5IO0 A;  5C04 A;  4RI7 A;  1J9B A;  3J7Y k;  1AIU A;  2J9H A;  1V40 A;  3GL3 A;  3UAP A;  4J56 E;  1OC9 B;  1RK4 A;  3WYW A;  5C00 A;  1TU7 A;  4DSS A;  3QFA C;  3N5O A;  1BX9 A;  3TJB A;  3PGT A;  4WF5 A;  2L6C A;  5AN1 A;  4ECC A;  3CTF A;  2LQO A;  3GKN A;  3EIN A;  1B48 A;  3HYP A;  2H1L A;  5FHI A;  4XRA A;  1XPV A;  1EWX A;  1Z6M A;  5ECO B;  5JCU A;  1YEX A;  3KD0 A;  4Z2R A;  1AQX A;  4MZC A;  3M8N A;  2O89 A;  4KDX A;  2LRC A;  5CRW A;  4EIQ A;  4N11 A;  5BRT A;  3D4T A;  4KA0 A;  2H0G A;  1JFU A;  5DAL B;  3H79 A;  1Z3E A;  1K3O A;  2YN1 A;  4EDY A;  4TRX A;  2FWF A;  4G9H A;  4KB3 A;  1WOU A;  1TK8 B;  3I43 A;  2WS2 A;  2IFQ A;  3F4T A;  4OFM A;  5B7C A;  3CRT A;  3WGX A;  1A2J A;  4IHU A;  5KEJ A;  1PX7 A;  5GAP D;  3VK9 A;  2H8L A;  3PH9 A;  5HFG A;  1PSQ A;  1YZX A;  2FWE A;  1SD9 A;  4MCU A;  1TOF A;  1SK0 A;  1PKZ A;  4TVE A;  1U87 A;  1TKD B;  1FHE A;  4V2L A;  3CSJ A;  3O3T A;  1VF1 A;  1A0R P;  4V2N A;  2QA1 A;  3LWA A;  3VPT A;  3F0I A;  3DYR A;  1TK5 B;  2FWG A;  4GCI A;  1GRX A;  5KOW A;  4YQU A;  2A2P A;  5B6M A;  3M0F A;  3VFI A;  2EIR A;  4JED A;  4PUF C;  2BJX A;  4O5R A;  1TW9 A;  5DBQ A;  2LRN A;  1XFL A;  4ACS A;  1K0N A;  1G7E A;  1HNA A;  1MD3 A;  5DAK B;  4YQV A;  18GS A;  1B4Q A;  4HOJ A;  2DSA A;  3VI5 A;  1ZYP A;  4HJ2 A;  3HXS A;  4ID0 A;  1XXU A;  2EFD A;  1SD8 A;  1GTI A;  5ECH B;  3LJR A;  1HYU A;  5A34 B;  5CAX A;  1Z7P A;  1IYH A;  2PVQ A;  2XBI A;  2C0F A;  2VCT A;  2CT6 A;  4ZL7 A;  2P0G A;  3G7Y A;  4TR1 B;  2N5F A;  2EIQ A;  3R3E A;  3ERF A;  2NTO A;  5KN3 A;  3GMF A;  1K0O A;  3GYK A;  4WEY A;  3EU3 A;  2FHE A;  1K0D A;  3QDN A;  4FYU A;  2R4V A;  4HI7 A;  1ERV A;  4F0B A;  5ECK B;  3LQ7 A;  2B7K A;  5IIZ A;  3TU3 B;  4IGJ A;  4K2X A;  4DVC A;  4EF0 A;  4K5S A;  4WBR D;  1EGO A;  2YP6 A;  4WR4 A;  3QCP A;  1MEK A;  3EU4 A;  2WRT A;  3I6A A;  5A4U A;  2PU9 C;  3TKR A;  4KGI A;  1XWC A;  2LQQ A;  4P3Y B;  1Z7R A;  5AIS A;  5DJM A;  1OYJ A;  4ISD A;  4F03 A;  1T1V A;  2VCQ A;  4MF5 A;  1TRS A;  4O7H A;  3GX0 A;  4YKF A;  1SKR B;  1EEJ A;  5IMA A;  4HUA A;  4ZB6 A;  4G19 A;  2DML A;  1K3L A;  4GTU A;  2M80 A;  3W6G A;  4POL A;  1GSD A;  2YWN A;  5CP1 A;  3UVH A;  2C8U A;  1MDK A;  3ME7 A;  4TR0 A;  3GTU A;  17GS A;  1F3A A;  4HQZ A;  3DRN A;  4MJA A;  2B3S A;  2V6K A;  3BCI A;  4BL7 A;  2PMT A;  1CQH A;  2O87 A;  2DBC A;  4EXJ A;  2NVL A;  1M99 A;  2FA8 A;  2IFQ B;  1QMV A;  2PUK C;  5INY A;  3KEB A;  2HLS A;  2R0P A;  4N0V A;  3M1G A;  4AI6 A;  5AGY A;  2C3N A;  4IBP A;  5IM9 A;  4MK3 A;  3QAG A;  5J4V A;  5EL8 A;  4MLY A;  2L6D A;  3TUE A;  1TXU A;  2H0I A;  2GLR A;  3ZML A;  1JLW A;  2KP1 A;  3ISO A;  3NIV A;  2GQM A;  3TB2 A;  4LL4 B;  4JR6 A;  4I2T A;  1GTA A;  5LD0 A;  2DIY A;  3L9S A;  3CMI A;  3OR5 A;  3WD6 A;  1SL2 B;  4AKG A;  4XS1 A;  2GS3 A;  3KTL A;  5G5E A;  4GXZ A;  2AUV A;  5IPG A;  4ZXG A;  2WZ9 A;  2I3Y A;  3D4M A;  5ECL B;  5DDL A;  5HFI A;  2I9H A;  2WCI A;  3FR9 A;  3G7I A;  2HI7 A;  2K8V A;  3GA4 A;  3I69 A;  1A2M A;  2FLS A;  2AB6 A;  3TRQ A;  3ZFB A;  2HRA A;  1XW5 A;  2WDU A;  3L9U A;  2K18 A;  2L4Q A;  4MF7 A;  1HQO A;  1EOG A;  2CVD A;  2MMN A;  2X8H A;  4JZQ A;  1XIY A;  1TDI A;  4TKY A;  5J4U A;  9GSS A;  3FY7 A;  4NHZ A;  2IN3 A;  2H1G A;  1M9A A;  2EIO A;  5ID2 A;  4HS1 A;  4WXT A;  1B8X A;  3GST A;  1OAZ A;  5EVO A;  3ZIT A;  1Q4J A;  3FZ9 A;  4K6X A;  3LFL A;  2H72 A;  1GSF A;  4O92 A;  4MH3 A;  1OC9 A;  2G0F A;  1XZO A;  3V1W A;  1K0A A;  1XWG A;  2MBT A;  1A0F A;  1ZL9 A;  2R6K A;  1ZYQ B;  2HNL A;  4AGS A;  5DCH A;  5IO2 A;  4DSQ A;  3TJG A;  3CSI A;  2VLU A;  2REM A;  1SVL A;  5A4V A;  2J23 A;  1ML6 A;  2CQ9 A;  2YZU A;  1VF3 A;  4MDC A;  1U88 A;  2IL3 A;  1B9X C;  1BJX A;  4WBJ A;  1WIK A;  1SYR A;  2AHE A;  1SK1 A;  2FCH A;  4ICY A;  4F0C A;  2RII A;  1THO A;  3VPQ A;  4Z7X A;  3PR8 A;  5F8B A;  3HD5 A;  2DJ1 A;  1S3D A;  1ON4 A;  4F2I A;  1U3I A;  2M46 A;  3GTU B;  3QFB C;  4HU9 A;  2GSS A;  4ZIJ A;  5IQY A;  1AAZ A;  2EC4 A;  1H75 A;  2WGR A;  4BL7 B;  4K9Z A;  1PL1 A;  3KGK A;  3RHC A;  1A2L A;  1V98 A;  4CHS A;  2HZF A;  2KLX A;  3O6T A;  4G10 A;  1QQ2 A;  1MD4 A;  2PPT A;  4K2D A;  4MZB A;  5BMU A;  2C3T A;  5LNK e;  2PN8 A;  1V2A A;  2XPD A;  1J08 A;  4N10 A;  2O8V B;  4ZBD A;  3WT1 A;  2VD0 A;  2C0D A;  2ZCT A;  2L59 A;  3IAS 2;  1EV9 A;  3EC3 A;  5E59 A;  3ZL5 A;  1GWC A;  5KN0 A;  2GT6 A;  1XW6 A;  2X4A A;  1FO5 A;  1QFN A;  2F3M A;  4ZIL A;  3UOM A;  3LOR A;  2LKU A;  1O8W A;  3L9V A;  5HFK A;  2V41 A;  3UEM A;  1O6J A;  1EZK A;  4J57 E;  3GX8 A;  3TOT A;  2E7P A;  3HVX A;  1XVW A;  2PBJ A;  2LTK A;  3DEX A;  5ECN B;  3F9U A;  5A5K A;  3A2V A;  2RLI A;  3H93 A;  2MYG A;  2YJH A;  5ELA A;  1O81 A;  3MDK A;  2LS5 A;  3NZN A;  3TKS E;  2IMI A;  3FK8 A;  2V6O A;  3M3M A;  4XTS A;  3IK9 A;  4MPF A;  3MWH A;  3GKX A;  2H66 A;  4K7I A;  1YJ6 A;  3E9J B;  1XWA A;  2VL9 A;  3F8U A;  1M7T A;  3KIJ A;  5CRD A;  1AXD A;  2B5X A;  4CW9 A;  1WP0 A;  2QA2 A;  5ID2 B;  3CWG A;  3BD2 A;  3VI7 A;  3J7Y b;  4ML6 A;  3ZYW A;  2VD1 A;  4XRD A;  3ZVJ A;  5HR3 A;  2VO4 A;  5B8B A;  1GLP A;  3EWL A;  2DC5 A;  4KCE A;  2UV8 G;  3FR6 A;  5CYY A;  4N30 A;  4LL1 B;  3UL3 A;  4L5L A;  3LW9 A;  2CAQ A;  1M9B A;  1BG1 A;  5J41 A;  3L0H A;  4GDF A;  2X8C A;  1LU4 A;  5DQS A;  2YAN A;  1W89 A;  4G01 A;  4HZ4 A;  4OMV A;  1ZOF A;  5IMF A;  4MP4 A;  2ALB A;  4KAE A;  3HMJ G;  3GH9 A;  5EPF A;  3KZQ A;  4MH2 A;  1OE8 A;  1DBY A;  2K6V A;  2CV4 A;  3KH9 A;  1B9Y C;  1O7U A;  2M72 A;  3VWV A;  2GQL A;  5ECM B;  5HR1 A;  1OKT A;  2FA4 A;  2TRC P;  1EOH A;  3IE3 A;  3VWW A;  2NBS A;  1YF0 A;  2OKA A;  2YPM A;  4GQC A;  2HRK A;  2ON5 A;  1GUK A;  1SEN A;  3WGD A;  4GSN A;  1SU9 A;  4IP6 A;  2YWM A;  5B8A A;  3KMO A;  5D9V A;  4POK A;  3FEU A;  4OFN A;  2GZP A;  1NHO A;  3UBK A;  4BVX A;  3GRX A;  2X64 A;  2LEG A;  4L5O A;  1PD2 1;  4MAB A;  4IVF A;  2F8F A;  2X8G A;  1U6T A;  4PQH A;  2OE0 A;  4QQ7 A;  2DLX A;  1IYI A;  3F63 A;  2H75 A;  1ABA A;  4OO4 A;  2GT5 A;  2JZT A;  2L57 A;  2XHF A;  4Z2T A;  1AQV A;  1ERT A;  4X0X A;  2JU5 A;  1HNC A;  5BMU B;  4EO3 A;  2R37 A;  1GH2 A;  2O85 A;  3GNJ A;  6GST A;  1QK8 A;  1YVL A;  2HFD A;  4ECB A;  5F0G A;  1GUH A;  5LCZ A;  5G1K A;  4DSR A;  3BBY A;  4Q5F A;  4PNG A;  1W4V A;  1PRX A;  5CRG A;  6GSW A;  2H1B A;  2GQK A;  3TOU A;  1T3B A;  3VWU A;  1JZR A;  1Y1U A;  1JZD A;  2A2R A;  1YY7 A;  4NAX A;  2I81 A;  2DJ0 A;  3HZ4 A;  2IMF A;  1ZZY A;  1UN2 A;  3APQ A;  1MDI A;  1M0U A;  1I5G A;  2FD3 A;  1UA5 A;  3IV4 A;  2F9S A;  1SYX A;  2IME A;  1KEB A;  4O5U A;  1PN9 A;  1FAA A;  3ZLP A;  3Q19 A;  1G6W A;  4JU5 A;  2C80 A;  3D5J A;  3D22 A;  4MJC A;  1G7O A;  1WPI A;  1Z9H A;  4FYB A;  2X49 A;  2MMZ A;  1KNG A;  1FW1 A;  1F9M A;  1T00 A;  2VL2 A;  1YDK A;  3FZ4 A;  1Z6N A;  3HJM A;  4V1A p;  4KND A;  3CBU A;  2H74 A;  3A3T A;  2PGT A;  3QMX A;  4TXO B;  1Y25 A;  4ECI A;  1XVQ A;  4TR3 A;  4XS6 A;  3FW2 A;  3A2X A;  3FHK A;  1K0B A;  3HCZ A;  2CX3 A;  2OT3 A;  1PKW A;  3IPZ A;  5GSS A;  1TJD A;  4MNN A;  4LMW A;  1PL2 A;  4XS4 A;  1DE1 A;  2GGT A;  1RW1 A;  1F6M C;  3DWV A;  3TDG A;  4IQ1 A;  5J9C A;  3C1S A;  1E6B A;  4V1A g;  2AYT A;  3QPM A;  5J3R A;  2C0E A;  4E8H A;  3GKM A;  2RUE A;  1SVM A;  1YF1 A;  5A4W A;  3IC4 A;  3A5W A;  1NHY A;  2XBQ A;  2HRK B;  3C7M A;  1ZCP A;  3E3E A;  3US3 A;  4H86 A;  5A1N B;  4Q5N A;  3N9J A;  3U6V A;  2A4H A;  4BVX B;  4JR4 A;  3DD3 A;  2H6Z A;  2ZNM A;  1SJI A;  4IJI A;  1ST9 A;  1M2A A;  4IP1 A;  2BMX A;  3W8S A;  2JAD A;  4OWY A;  2JSZ A;  4IW9 A;  2OA7 A;  7GSS A;  4OO5 A;  1V58 A;  1XCC A;  2P31 A;  3DVW A;  1JHB A;  5H5S A;  1AC1 A;  3GSS A;  4EVM A;  4WR5 A;  1Y6E A;  3KMN A;  2B6M A;  1XOA A;  2JZR A;  1EGR A;  1YKA A;  3KTB A;  2VLV A;  2DMM A;  3HY2 A;  5COH A;  4QMK A;  1G6Y A;  3DXB A;  5CRE A;  4J2F A;  3JCM L;  1BAY A;  2CZ2 A;  2QGV A;  3FMW A;  2PER A;  3L4N A;  3UVT A;  4I5Q A;  1BED A;  4OCF A;  2DKH A;  5D9W A;  1ILO A;  2WJU A;  1N8J A;  1XOB A;  5ECQ B;  5ECR B;  2B1L A;  2PVO C;  4ZBA A;  2DJK A;  1A8L A;  2WFC A;  5JCW A;  1OVN A;  2O5V A;  1CQG A;  6GSU A;  1EP7 A;  4AJ6 A;  3HKR A;  4OD7 A;  3E0U A;  1TTZ A;  5HQP A;  3G9B A;  5D8I A;  4I8B A;  2WUL A;  4L0U A;  1XW9 A;  3IHQ A;  4FIW A;  3IDV A;  2RM5 A;  4EDZ A;  1HNB A;  3U5R E;  3Q6O A;  4PQI A;  2R5G A;  1FOV A;  4KDU A;  4ECJ A;  4PXO A;  1LJR A;  4YAP A;  2VCV A;  3ZIJ A;  4X1U A;  3IA1 A;  3HHV A;  2MZC A;  5ELG A;  2V2G A;  1R5A A;  2DJJ A;  3F3Q A;  3KCM A;  4KE3 A;  5EY6 A;  4HDE A;  3UMA A;  1WRY A;  4F9Z A;  1FVJ A;  4TXV A;  1T4Y A;  1GSY A;  3ERW A;  1JZO A;  3APO A;  3ZMK A;  2H76 A;  3CTG A;  4IQA A;  4N3Z A;  4GST A;  4XS4 B;  4DEJ A;  22GS A;  2CVB A;  2CVK A;  4PTS A;  2CA8 A;  4MZW A;  1FG4 A;  4GF0 A;  2KHP A;  2HSN A;  3HVS A;  3GL5 A;  1UVZ A;  4D73 A;  1R5P A;  2HE3 A;  3FR3 A;  5HR2 A;  4XCS A;  1TK0 B;  2FY6 A;  2VL3 A;  1R7H A;  2CAI A;  4EIP A;  2VCZ A;  4JE1 A;  2GVP A;  5CRH A;  2H30 A;  4EKZ A;  3FYG A;  3C1R A;  2KOK A;  5J40 A;  2VUP A;  3KJY A;  3H4K A;  4N0Z A;  1VRS D;  4AF2 A;  3LG6 A;  2FWH A;  4K0N A;  4ZL9 A;  5G30 A;  3GH6 A;  4YH2 A;  4POB A;  2E0Q A;  2YJ7 A;  2IPA A;  4TN8 A;  3TKS A;  3QR6 A;  2JAC A;  4KUN A;  1BQ7 A;  1R26 A;  2C1Y A;  3LYK A;  3ZVJ D;  1Z5Y E;  3P90 A;  3LXT A;  4G0K A;  5GST A;  3QD9 A;  1H4O A;  11GS A;  4FO5 A;  1ACV A;  4NV2 A;  2LRT A;  1ZYE A;  1JLV A;  4K7N A;  3TJJ A;  2I1U A;  2N5B A;  4F82 A;  4EE0 A;  1X0R A;  4BPY A;  4GQF A;  1GUL A;  2IMD A;  2DIZ A;  3EPT A;  3F4R A;  3TKS C;  1SJZ A;  4HZ2 A;  3H1N A;  4ZB8 A;  4KX4 A;  4WKW A;  4JBB A;  4W66 A;  1GSS A;  2VM1 A;  2TIR A;  1YQ1 A;  1SJ6 A;  4BWS A;  3RHB A;  4PX1 A;  3SWL A;  1O85 A;  2RUF A;  3VWX A;  2F8A A;  2YZH A;  3CXG A;  2LUS A;  1RQM A;  2DKI A;  2DJ2 A;  5ENU A;  1Q98 A;  3TCO A;  1GSU A;  1XBS A;  4LA1 A;  3LYP A;  5DCG A;  5IMC A;  4YKG A;  3P8W A;  3TGZ A;  3C71 A;  4EC0 A;  2VLT A;  5IMD A;  3DGQ A;  2DJ3 A;  1SL0 B;  3IBH A;  2L4C A;  5DVB A;  1VGL A;  5ABR A;  2LV3 A;  3QAW A;  1FVK A;  1UC7 A;  1C72 A;  2FUG 2;  4POM A;  4TXO A;  3RAZ A;  1TRW A;  1X5C A;  3NOF A;  3UIW A;  2MMA A;  1SKS B;  4LLR A;  1T4Z A;  2B5Y A;  2H71 A;  4USS A;  4NHW A;  1X9S B;  4ZB9 A;  4AJ7 A;  4MF6 A;  4AKH A;  8GSS A;  1YKC A;  1OC3 A;  3GUR A;  1R4W A;  4TR4 A;  4K1F A;  4NXI A;  2CZ3 A;  5G31 A;  4YAV A;  2OE3 A;  4AJ8 A;  4CY6 A;  5KN1 A;  2KUC A;  4GRF A;  2GSR A;  2YWI A;  3AY8 A;  5A1N A;  2A2S A;  6GSY A;  2HSN B;  2H1A A;  1KTE A;  3VUR A;  1TRU A;  4D73 B;  3GV1 A;  2V1M A;  5G1L A;  1MDJ A;  2YWO A;  3TJK A;  3QOU A;  2HT9 A;  1F3B A;  5D73 A;  1SVO A;  4K8M A;  1T7P B;  4I2U A;  2OBI A;  3EUR A;  3GFK A;  4ZBB A;  2WB9 A;  4HEA 2;  3SBC A;  2VAF A;  1SK2 A;  3HJO A;  1HD2 A;  4KF9 A;  3DVX A;  3F4S A;  1BYE A;  5CO3 A;  5JWQ B;  3EVI A;  5G2Z A;  6GSX A;  2NPB A;  3CSH A;  1PQN A;  1BF5 A;  3EE2 A;  5F05 A;  2AV4 A;  2K8S A;  5ECI B;  5D9X A;  1QXH A;  5IPH A;  4GWR A;  3IC8 A;  2XC2 A;  4FH8 A;  4IEL A;  4IKH A;  3TKP A;  1PGT A;  1TI3 A;  2HZE A;  2L5O A;  2XPE A;  5JCG A;  5J5N A;  2HYX A;  2P5Q A;  2FGX A;  1A24 A;  3C8E A;  3D0Z A;  1DSB A;  5AIX A;  1J0F A;  1EP8 A;  2E2G A;  4AKI A;  4NMU A;  3Q18 A;  4FYC A;  3DML A;  3S9F A;  2GZY A;  2HSH A;  1WE0 A;  4L0W A;  2EFC A;  3G7J A;  2IWT A;  3GIX A;  4NV5 A;  2LNT A;  3P2A A;  4RUV A;  4I97 A;  2LJA A;  2ON7 A;  1FB0 A;  1NW2 A;  2VCW A;  3ED3 A;  4TOP A;  4K7O A;  4CDO A;  3H8Q A;  1SL1 B;  1K3Y A;  3RBT A;  2YNX A;  2HSY A;  1ERW A;  1USB A;  2KP2 A;  4BVY A;  2HRN A;  2HRF A;  1TRV A;  1PA3 A;  4WET A;  2R2J A;  5AIV A;  2C4J A;  4ILF A;  5F06 A;  5FT3 A;  2HQT A;  3F6D A;  1QUW A;  4MJE A;  1E2Y A;  4O32 A;  2RM6 A;  2NDO A;  1SKW B;  4RQX A;  4KCA A;  16GS A;  2EFH A;  5H5Q A;  4Q5Q A;  2VL2 C;  1VF2 A;  2EFE A;  4EL1 A;  4L8E A;  4Z2U A;  4Q5R A;  5L71 A;  1K0C A;  1V57 A;  1S3C A;  4DSS B;  5FWG A;  2H6Y A;  3IR4 A;  2R0G A;  13GS A;  1PN0 A;  4FQU A;  3IAM 2;  1DUG A;  3QAV A;  5J4Y A;  4V2M A;  14GS A;  3M9K A;  2HSM A;  2QKE A;  2B7J A;  4HJM A;  4HU7 A;  4CY8 A;  4X4J A;  1A8Y A;  3HA9 A;  3MSZ A;  4PUA A;  1XWK A;  3KXO A;  2YCD A;  2MMO A;  1U3A A;  19GS A;  2GZZ A;  3ZFL A;  5D93 A;  2JL4 A;  2VIM A;  1WWJ A;  4BA7 A;  1TU8 A;  5IMZ A;  3GN3 A;  4KSM A;  3RDW A;  3ZZX A;  2C0G A;  1ZMA A;  5JWR B;  5D96 A;  4X43 A;  4XHM A;  2JZS A;  1DE2 A;  2P5R A;  2D2Z A;  5ECS A;  4KDY A;  2ES7 A;  1OE7 A;  1FB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...