3FRCA

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
201
Chain Sequence
b'IVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 69
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3frcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3frcA01
2EIQA 3ZFLA 2I1UA 2V6OA 3KMOA 4WBJA 5D9VA 2PN8A 4POBA 5AIVA 2H1GA 1JZRA 2LJKA 1EP7A 2V6KA 1QUWA 2YV9A 4MMMA 2C4JA 4HUAA 6GSUA 4QL9A 3IC4A 5INYA 2L57A 4HQZA 5IOXA 2LNSA 1SD8A 4L8EA 1IYHA 3VPQA 1J08A 2HRAA 1AAZA 3GUSA 1OC9A 1SJ6A 2KOKA 3ERWA 2YPMA 4GLTA 3TKPA 3DKSA 4ECJA 1IYIA 4TXVA 4OCEA 4ZBAA 1M2BA 1TP9A 5D9TA 4NV2A 1OVNA 4MJAA 4PGTA 11GSA 2GZYA 2H72A 1NW2A 2H0HA 3F6DA 2OA7A 4ZL8A 1SL2B 3DVWA 3LYKA 3HD5A 2LQQA 4ILFA 1V9WA 2B3SA 3EC3A 4POMA 4BA7A 1SJIA 3ZYWA 1Q98A 2Z9SA 3LSZA 4ZBDA 1F6MC 2R3XA 5IQYA 1WWJA 3APSA 1SU9A 3EURA 4K1FA 3QD9A 3RBTA 3QAVA 1XPVA 1EOGA 3EWLA 3OR5A 3GSTA 5J9BA 2OJLA 2HRKA 1PMTA 1RQMA 1Z9HA 2E7PA 4PNGA 3GMFA 2F51A 4ZB8A 4K8MA 5COHA 1K0CA 2X8GA 5D9XA 5FT3A 2VM1A 3IRAA 1JZWA 3S9FA 1E6BA 1O73A 2B6MA 3P2AA 4NMUA 2IFQB 4MJEA 5EL8A 1GLQA 3CSIA 1R26A 3DRNA 2A2SA 3I69A 4PTSA 3KH7A 4Q5QA 2OACA 3PINA 4IJIA 1BG5A 2GDRA 1QMVA 2IN3A 4MCUA 4L0UA 4EDYA 4TR1B 1HQOA 1Z5YE 1J9BA 3W6GA 3WGEA 1SYRA 4XS6A 4I8BA 1TU8A 4TVEA 1NM3A 2VCXA 1GLPA 3QDNA 4QL7A 4HEA2 1EEJA 3ME8A 3LJRA 3UVHA 3HKRA 2H1BA 4HDEA 5IO2A 5ECMB 1THOA 3FZ5A 5GAND 3C1SA 2VCWA 4BPYA 4KSOA 1PX7A 2B1KA 2H30A 1O85A 4IS0A 5ECIB 4LL4B 2L5OA 4KH7A 3O6TA 2O85A 4FYCA 2VCQA 4K7IA 3CTGA 4LA1A 4EC0A 2O89A 2LKUA 4IBPA 3QOUA 2RIIA 3ZIVA 5HR1A 3FR9A 2YWMA 2XPEA 1PA3A 4KCEA 3KP9A 2L4CA 3M0FA 2CVKA 2PU9C 4YQVA 3Q18A 4FYBA 2NVLA 5JWQB 3CSJA 2JACA 1XWBA 1A8YA 2F8AA 2IL3A 2H66A 2VCTA 4FQUA 4QQ7A 3UIWA 5FHIA 1XOBA 3VFIA 3FHKA 1TRSA 1YKCA 3GX0A 2JL4A 4PQIA 2YWOA 3VI7A 3ZVJD 3BBYA 3FK8A 1A23A 3APQA 4HI7A 2VD1A 1HNBA 5A4VA 1GSQA 3GH9A 2OE1A 3TDGA 2VL9A 4RI7A 2MMOA 1R7HA 2LQOA 5ECOB 1ACVA 2WRTA 4Q5RA 3W8SA 4BVYA 2M72A 4E8HA 1GNWA 2FWHA 4MZWA 3EVIA 1TK5B 3E0UA 5B6MA 4X0XA 1GSYA 4BVXB 1FO5A 1TJDA 3ISOA 2WGRA 1EWXA 1B4QA 2HZEB 1YJ6A 2E2MA 4N10A 1B48A 2GQKA 3FZ4A 1NHOA 3FYGA 3FZAA 2H01A 3MNGA 2P5QA 2HSMB 4N11A 2AV4A 2C8UA 3U6VA 3GA4A 5LD0A 3HJOA 1B4PA 4V1Ag 4AJ8A 4ZB6A 1Z3EA 3IC8A 2O87A 2ZUPA 3RPPA 2ALBA 5ABRA 4YQUA 5DJLA 3DMLA 2CX3A 2L6DA 5DBQA 3P7XA 5H5RA 3LXTA 1B9YC 4KB3A 3SWLA 5ID2B 3VK9A 4ECBA 1TK8B 2LJAA 3PGTA 3LEFA 3U5RE 4F82A 2FGXA 1AXDA 1BAYA 3WYWA 2H74A 3C71A 3ZL5A 2CZ3A 1O8XA 2E0QA 2CT6A 4Q5FA 3GH6A 1XW9A 4MH3A 3Q74A 3WGDA 4TXOB 4F03A 2LNTA 1KEBA 5F05A 2AHEA 4YQMA 5F06A 1ZYQB 2HXKA 4DEJA 3KD0A 5DVBA 4CW9A 3KGKA 4V1Ap 3TKSA 2AAWA 4XHMA 2B5YA 2EIRA 1SKRB 2PPTA 1XVQA 1VF1A 5A4UA 1WIKA 5JWRB 2WFCA 5IMDA 4EXJA 1O6JA 2GZPA 1G0TA 3H1NA 1K3LA 1HD2A 5EY6A 2FNOA 1UVZA 2YZHA 3A2VA 2VOCA 5H5SA 1Q4JA 2AYTA 3K8NA 3CRUA 3N5OA 5HFKA 2YJ7A 4RI6A 3F4RA 2GT5A 4TR3A 2MBSA 4KDUA 3J7Yb 4V2MA 1OE8A 4F0BA 3GIXA 4AJ6A 3E3EA 1ST9A 4GSSA 1OYJA 1V57A 2DMLA 1FHEA 4GSTA 5KN3A 1X9WB 4FIWA 1TXXA 1I5GA 4I2TA 5JCGA 4KE3A 2CV4A 3TKRA 5DQSA 1X0RA 3TRXA 2VLTA 2VIMA 4PX1A 3F3RA 4L0WA 2MBTA 4GWRA 2YWNA 4MZCA 2X64A 4DVCA 3IE3A 3PR8A 1JLWA 5J9CA 2IPAA 2H1AA 4JR4A 2FWEA 1XBSA 3EU3A 2IJYA 5G5FA 3CBUA 1GTIA 2M80A 2TIRA 1OC9B 1GUKA 1EOHA 4OFNA 1YQ1A 5GSTA 1PGTA 4WF4A 4BL7A 2I4AA 2HSHA 3HXSA 2YNXA 1GL8A 2H71A 3D21A 1O81A 2NPBA 4POLA 5CYYA 3IR4A 1EP8A 5AN1A 3GX8A 4PUFC 4FO5A 1YF0A 3KTLA 2E2GA 2O7KA 1ILOA 3F4TA 6GSVA 3KEBA 4ZL9A 3GTUA 2VLUA 1JZDA 1WP0A 3MSZA 4MF5A 4H86A 3TJBA 4HJMA 14GSA 3UL3A 1EGOA 3TKQA 2LRCA 2EC4A 1NHYA 3D4TA 4I97A 1M9AA 1THXA 1U88A 5GSSA 3IAS2 2EIOA 3KH9A 5ECHB 1MEKA 2V41A 4KA0A 2HRKB 2GZZA 4HS1A 2RUFA 6GSXA 1UA5A 1YEXA 5IMCA 4OO4A 4DSSA 3HVVA 6GSTA 16GSA 4EDZA 2DMMA 1JLVA 4E8EA 4NV5A 1NSWA 2B7JA 5IO0A 1TRUA 4IP1A 1BEDA 2P5RA 4CDOA 2LUSA 2G0FA 5CO3A 3FR3A 4ULXA 2HFDA 3HA9A 3UEMA 1QFNA 1WPIA 1X5EA 1TDIA 3KIJA 3L78A 2FLSA 1EV9A 2CZ2A 5IMFA 5ELAA 3VURA 4KNDA 3VWVA 3IA1A 4JU5A 1N8JA 3UOMA 1BQ7A 2HSYA 4Z7XA 1BYEA 3EMPA 2VCVA 5CRDA 1XIYA 5DALA 4X43A 1RK4A 2LSTA 2FHEA 4GRFA 3ME7A 1VGLA 3FY7A 4TW5A 1C72A 3Q6OA 1K3YA 2GQMA 2HQTA 2PVQA 1YDKA 3QAWA 2XHFA 5B8BA 1M7TA 1H75A 2N5FA 2TRXA 1M2DA 5HQPA 1EGRA 4TN8A 1T8EB 4IQAA 2C1YA 5LCZA 2ZNMA 2K18A 1VRSD 5HFGA 2HLSA 4GF0A 4ZB9A 5HFIA 1K0BA 1GWCA 4XTSA 3KZQA 2MMNA 1T1VA 4JR6A 4J56E 4PQHA 5IMVA 1VF4A 3LYPA 2H1DA 2RM5A 3ZRDA 4MK3A 2DJ1A 3BD2A 5E4WA 4GSNA 4IELA 1GSFA 3F8UA 3G7JA 2F8FA 4MF7A 2H6XA 1DE2A 1XZOA 2FD3A 5A5KA 1K0MA 2FA8A 4V2LA 3GURA 2NBSA 1F3BA 3FR6A 1FG4A 3LG6A 3HZ8A 1A0RP 5CRWA 3VWUA 1OKDA 3ZIJA 5GAPD 4ECCA 5C04A 1PX6A 1VF3A 3MDKA 2YANA 1TRWA 2L5LA 3UBLA 4HZ2A 4NWYA 1Z6MA 1OC3A 9GSSA 1FB0A 1J0FA 2KLXA 4KX4A 4FH8A 2DJ0A 1T4ZA 1TK0B 2DIYA 3DWVA 5F0GA 4HU7A 3WT1A 2WULA 5C00A 3GKMA 4BVYB 4MF6A 12GSA 4F0CA 4MP4A 3TB2A 1YY7A 2R2JA 1MDIA 2YCDA 3WD6A 1T7PB 1TI3A 1GSUA 1K0DA 5EPFA 1FVKA 1X5CA 1ERUA 4KDYA 2JZTA 2RM6A 4NPBA 1USBA 5DCGA 2LTKA 1SJZA 1GSSA 5B6NA 1MD4A 2VAFA 4JRRA 2VL2A 2WCIA 5ECLB 3TOUA 3KCMA 3O76A 4PXOA 1X9SB 1CQGA 1PL2A 5ECNB 5KN0A 5AIXA 3MAKA 1GH2A 1ZZYA 3D6IA 4MDCA 1JZOA 3ERFA 4MPGA 2RUEA 4K6XA 4L5LA 1XW5A 4RQRA 3ZFBA 2B1LA 3TJGA 1ERWA 5GZZB 4IHUA 4WF5A 2B5EA 4G0KA 4EE0A 2K9FA 2H6ZA 1MDJA 1K0AA 3E9JB 5HR2A 4MPFA 5IPGA 4WEYA 1OC8A 2HT9A 2X99A 2YV7A 4HU9A 3G9BA 3A2WA 3DD3A 3KM6A 3I43A 2M46A 5CAXA 1AQXA 6GSWA 1ZYEA 1F3AA 4HZ4A 2IMFA 3HJPA 1AQVA 3NZNA 1TOFA 3FEUA 1WMJA 2PUKC 5JCUA 2DIZA 2YN1A 4ZILA 4HOJA 4D73A 3H79A 1ZL9A 1TKDB 2R37A 5J41A 3NIVA 4ZXGA 4G9HA 3C73A 4I6XA 4ML6A 4EF0A 1X9MB 4NHWA 3BJ5A 4ZIJA 1SK2A 1OE7A 1JFUA 18GSA 1TU7A 2G2QA 2R4VA 1OKTA 4PNFA 4IW9A 1Z7PA 4Q5NA 2C0EA 2H8LA 1A2JA 1XWCA 2R5GA 2BMXA 3IHQA 2GLRA 2VO4A 1GRXA 1SL0B 2PWJA 1N2AA 1GUHA 2NTOA 2REMA 2H73A 3EMXA 3KP8A 2DJJA 3DGQA 4IN0A 4FYUA 1PN9A 3L4NA 3L9UA 2VUPA 2C3NA 4X1UA 1AUCA 4OD7A 1UN2A 1GSDA 4OCFA 2QC7A 3GYKA 5HR0A 1Z6NA 3FKFA 5A4WA 4BL7B 2AB6A 4MH2A 5E59A 1ERTA 4XS1A 1EEMA 2PVOC 5CREA 2HRFA 1BJXA 4NXIA 4ZBBA 4JBBA 1S3AA 2WJUA 1XWKA 1O8WA 1KBNA 4POKA 3PPUA 4AGSA 2O8VB 4MJBA 2XC2A 3JCML 2GVPA 4NHZA 1DSBA 2P31A 4J57E 3GTUB 2AUVA 3IXRA 4PUAA 3VWXA 3WGXA 3M9KA 13GSA 2CQ9A 2OKAA 4YH2A 3G7YA 4YAPA 1GULA 3TKSC 1GSEA 1V2AA 3C8EA 3RAZA 2L59A 4TR0A 3LXZA 3I6AA 2JADA 2DSAA 2IIYA 1WJKA 3IV4A 1U3IA 3EYTA 4XRDA 4LMVA 4OFMA 1ZOFA 2V1MA 4GTUA 4O5RA 4AF2A 4DSSB 2FCHA 3IBHA 4LMWA 3L9SA 2OE0A 1PL1A 2FY6A 3HVXA 4F9ZA 3D5JA 3GV1A 3DYRA 1S3DA 5J3RA 2LV3A 3F63A 2CA8A 3FZ9A 3QR6A 4K0NA 1GP1A 5D73A 5DAKA 3LWAA 4IP6A 1A24A 3ZLPA 1HNAA 4RQXA 4MZBA 5DCHA 3CRTA 4XRAA 4XS4A 2ON5A 3M9JA 1GUMA 3N9JA 4G10A 1AQWA 1E2YA 2A2RA 1YKAA 4WR5A 4IQ1A 1Y25A 2HZFA 3P90A 3F9UA 6GSYA 1F37A 1OAZA 5DALB 3F0IA 4IJ3A 2MMZA 4JE1A 2PBJA 2DJ3A 2V2GA 2QGVA 5B8AA 6GSSA 1A0FA 3IPZA 3UMAA 4PQ1A 4OO5A 4LLRA 3LFLA 1XFLA 1ML6A 1T3BA 1B9XC 3D4MA 5D8IA 2XBQA 4G2EA 5KN2A 3DEXA 7GSSA 5ECPB 3TGZA 1SL1B 2JU5A 5ECSA 3RHCA 3PH9A 2PGTA 4K2DA 1AIUA 1PRXA 5F8BA 2H0IA 1W4VA 2H19A 3M3MA 1XWGA 4GQCA 3DXBA 2GSSA 2PERA 3UVTA 2P0GA 2J23A 1U6TA 1WOUA 1BX9A 4OFTA 17GSA 2JZRA 3KXOA 8GSSA 3GKKA 4G0IA 5L71A 4WBRD 2C3QA 1XWAA 10GSA 2YWIA 2VL3A 1UC7A 2YJHA 5ECKB 1LJRA 1RW1A 5CP1A 4NAXA 20GSA 2ZCTA 3KJYA 1G7OA 3D22A 2JSYA 2CAIA 1SYXA 1Z7RA 5ECQB 3IDVA 3W8JA 1DBYA 1HYUA 2GGTA 3UBKA 3GFKA 2HE3A 4GXZA 5IIZA 3VI5A 2VCZA 2D2ZA 3R2QA 4OWYA 4V2NA 5HR3A 1W89A 2HRNA 3M1GA 4O7HA 2YP6A 2GS3A 1H4OA 3QMXA 2X8HA 2FWGA 2K8SA 1PQNA 5CRHA 3IOSA 3ERGA 2RLIA 5D9WA 2LRNA 4GQFA 4K7NA 2VM2A 2V32A 3H8QA 4HQSA 1VF2A 3ZITA 1SK0A 2H75A 4G19A 3G7IA 4HJ2A 1A2MA 2OBIA 5CRGA 1DUGA 5B7CA 3KMNA 1FB6A 2HI7A 3HHVA 2HSNB 5ECRB 2DLXA 1TW9A 2FUG2 2H70A 3BCKA 4DSQA 2QSIA 2GSTA 2HNLA 4JEDA 1F2EA 1M9BA 1GTAA 1PD21 4KGIA 3A3TA 3P8WA 2YZUA 4N0VA 3QAGA 1SD9A 1F9MA 2DBCA 5J4UA 1PSQA 3M8NA 2CX4A 3CSHA 4JZQA 5IPHA 2AJQB 2FWFA 2L4QA 2CAQA 2I81A 3DVXA 2MYGA 2H6YA 5G31A 2XBIA 5FWGA 4ML1A 4LL1B 3GN3A 4L5OA 4WKWA 3TUEA 1CQHA 3TOTA 22GSA 2B5XA 5BMUA 4I2UA 1G7EA 4K9ZA 4BWQA 1MTCA 2IMIA 1WRYA 1SKSB 1LBKA 1A8LA 4ACSA 3TJJA 3CYNA 3VWWA 2I9HA 3C7MA 3WT2A 1TTZA 2IFQA 4BWSA 1GNEA 3RPNA 4IKHA 1HNCA 4EL1A 2WB9A 2K8VA 1PKZA 1V58A 3F3QA 4N0ZA 3GHAA 3LGCA 3UARA 1EV4A 2JZSA 4TR1A 1ERVA 1TI1A 3A5WA 2H76A 4D73B 5LNKe 3ZZXA 1DE1A 3LORA 1G6YA 3MWHA 3F6FA 1EZKA 3ZTLA 5IM9A 2K6VA 2WS2A 3TKSE 5AGYA 1SK1A 5G1LA 5J5NA 5G1KA 1QGVA 2IMEA 4PURA 5CNWA 1GTUA 1R5PA 3UJ1A 4N30A 3GL3A 2GTUA 1QXHA 2LS5A 4MLYA 3BCIA 3FRCA 2KHPA 3RDWA 3DIEA 2WZ9A 4I5QA 4MJCA 4TKYA 4MA9A 1B8XA 2VL2C 4J2FA 2C3TA 2MMAA 4O92A 2H0GA 5G2ZA 1K0OA 1KNGA 2KUCA 3EINA 4EO3A 5D96A 1ZGNA 3CTFA 3QFBC 2JSZA 2XPDA 1JHBA 4IGJA 1M0UA 3Q19A 4ID0A 3AY8A 1FOVA 1K0NA 2C0GA 4XCSA 3CXGA 3BOAA 4K7OA 3VLNA 1V40A 3HCZA 1AW9A 5DJMA 3EU4A 4WETA 2IWTA 3GRXA 2UZ8A 2VLVA 1SENA 1XCCA 1XW6A 4ZL7A 1K3OA 3RHBA 4EKZA 4AJ7A 4WR4A 4YAVA 5F07A 4EVMA 3O3TA 1SKWB 2DJKA 3I9V2 1ZCPA 4KW6A 4TOPA 1V98A 5G5EA 2NDOA 3IAM2 3ZVJA 1PKWA 3GSSA 4RUVA 1A2LA 1FW1A 3F4SA 3SBCA 5DDLA 1XXUA 3TRQA 5ENUA 3LQ7A 3US3A 3KTBA 3L9VA 1QQ2A 1M2AA 3NOFA 3APOA 2ON7A 2BJXA 2GT6A 1KTEA 4TR4A 3GKXA 1T4YA 2YOIA 2DC5A 4BVXA 5IMAA 2OADA 2C0DA 1YF1A 2HZEA 3HDCA 3VPTA 2TRCP 2HSMA 5ELGA 3ZREA 2LJRA 1S3CA 3V1WA 1QK8A 3ZMLA 2C0FA 5KN1A 2B7KA 1ZMAA 2KP1A 2L6CA 3CMIA 1XVWA 4OMVA 4XIHA 5DAKB 1R5AA 2OE3A 5KEJA 3TCOA 4EUYA 1I9DA 1G6WA 2LEGA 4XS4B 4DSRA 2GQLA 4MABA 2I3YA 3HYPA 2R6KA 2GSQA 3IK7A 3GL5A 4F2IA 4TRXA 3QFAC 1U3AA 5AISA 1MD3A 3QCPA 5ID2A 5DQYA 2J9HA 1U87A 1T00A 2IMKA 3H93A 3A2XA 3TJFA 3TRPA 4ECIA 1ABAA 1LU4A 3QPMA 4P3YB 5IOWA 3IK9A 3ZMKA 3HZ4A 1YZXA 2VD0A 3HY2A 3R3EA 2GSRA 3EE2A 4TXOA 3J7Yk 2CVBA 2ES7A 1YEPA 4KF9A 2F3MA 5G30A 5D93A 3H4KA 2HYXA 1WE0A 1MDKA 5EVOA 1X5DA 2MZCA 4O32A 2OBKA 2A4VA 4GCIA 4ISDA 1URMA 2CVDA 4KSMA 3ED3A 5JCWA 2FA4A 1XOAA 4WXTA 1TRVA 3C1RA 1AC1A 4KUNA 3HVSA 2IMDA 2WDUA 2N5AA 4KCAA 2PMTA 2KP2A 2N5BA 3FW2A 5JWOB 4CHSA 1FVJA 1GTBA 3GNJA 4K0GA 5IMZA 1Y6EA 4KDXA 3D0ZA 3L0HA 2QKEA 3HJMA 1O7UA 1R4WA 4G0LA 3UAPA 1FAAA 2F9SA 3GKNA 19GSA 1ON4A 1M99A 2BTOT 2X8CA 4IVFA 2DJ2A 2C80A 2LRTA 4KAEA 4USSA 5H5QA 3TJKA
chains in the Genus database with same CATH superfamily
2EIQA 3ZFLA 2I1UA 2V6OA 3KMOA 4WBJA 5D9VA 2PN8A 4POBA 5AIVA 2H1GA 1JZRA 2LJKA 1EP7A 2V6KA 1QUWA 2YV9A 4MMMA 2C4JA 4HUAA 6GSUA 4QL9A 3IC4A 5INYA 2L57A 4HQZA 4YKGA 5IOXA 2LNSA 1SD8A 4L8EA 1IYHA 3VPQA 1J08A 2HRAA 1AAZA 3GUSA 1OC9A 1SJ6A 2KOKA 3ERWA 2YPMA 4GLTA 3TKPA 3DKSA 4ECJA 1IYIA 4TXVA 4OCEA 4ZBAA 1M2BA 1TP9A 5D9TA 4NV2A 1OVNA 4MJAA 4PGTA 11GSA 2GZYA 2H72A 1NW2A 2H0HA 3F6DA 2OA7A 4ZL8A 1SL2B 3DVWA 3LYKA 3HD5A 2LQQA 4ILFA 1V9WA 2B3SA 3EC3A 4EIPA 4POMA 4BA7A 1SJIA 3ZYWA 1Q98A 4MNNA 2Z9SA 3LSZA 4ZBDA 1F6MC 2R3XA 5IQYA 1WWJA 1M3JA 3APSA 1SU9A 3EURA 4K1FA 3QD9A 3RBTA 3QAVA 1XPVA 1EOGA 3EWLA 3OR5A 3GSTA 5J9BA 2OJLA 5BMUB 2HRKA 4G01A 1PMTA 1RQMA 1Z9HA 2E7PA 4PNGA 3GMFA 2F51A 4ZB8A 4K8MA 5COHA 1K0CA 2X8GA 5D9XA 5FT3A 2VM1A 3IRAA 1JZWA 3S9FA 1E6BA 1O73A 2B6MA 3P2AA 4NMUA 2IFQB 4MJEA 5EL8A 1GLQA 3CSIA 1R26A 3DRNA 2A2SA 3I69A 4PTSA 3KH7A 4Q5QA 2OACA 3PINA 4IJIA 1BG5A 2WW1A 2GDRA 1QMVA 2IN3A 4MCUA 4L0UA 4EDYA 4TR1B 1HQOA 2WVXB 1Z5YE 1J9BA 3W6GA 3WGEA 1SYRA 4XS6A 4I8BA 1TU8A 4TVEA 1NM3A 2VCXA 1GLPA 2QA2A 3QDNA 4QL7A 4HEA2 1EEJA 3ME8A 3LJRA 3UVHA 1YEWC 3HKRA 2H1BA 4HDEA 5IO2A 5ECMB 1THOA 3FZ5A 5GAND 4AKXB 4N3ZA 2EFCA 3C1SA 2VCWA 3CWGA 4BPYA 4KSOA 1PX7A 2B1KA 2H30A 1O85A 4IS0A 5ECIB 4LL4B 2L5OA 4KH7A 3O6TA 2O85A 4FYCA 2VCQA 4K7IA 3CTGA 4LA1A 4EC0A 2O89A 2LKUA 4IBPA 3QOUA 2RIIA 3ZIVA 5HR1A 3FR9A 2YWMA 2XPEA 1PA3A 4KCEA 3KP9A 2L4CA 2QA1A 3M0FA 2CVKA 2PU9C 4YQVA 3Q18A 4FYBA 2NVLA 5JWQB 3CSJA 4K5RA 3MIXA 2JACA 1XWBA 1A8YA 2F8AA 2IL3A 2H66A 2VCTA 4FQUA 4QQ7A 3UIWA 5FHIA 1XOBA 3VFIA 3FHKA 1TRSA 1YKCA 3GX0A 2JL4A 4PQIA 2YWOA 5A34A 3VI7A 3ZVJD 3BBYA 3FK8A 1A23A 3APQA 4HI7A 2VD1A 1HNBA 5A4VA 1GSQA 3GH9A 2OE1A 3TDGA 2VL9A 4RI7A 2MMOA 1R7HA 2LQOA 5ECOB 1ACVA 2WRTA 4Q5RA 3W8SA 4BVYA 2M72A 4E8HA 1GNWA 2FWHA 4MZWA 4Z2UA 3EVIA 1TK5B 3E0UA 5B6MA 4X0XA 1GSYA 4BVXB 1FO5A 1TJDA 3ISOA 2WGRA 1EWXA 1B4QA 3MYDA 2HZEB 1YJ6A 2E2MA 4N10A 1B48A 2GQKA 3FZ4A 1BG1A 1NHOA 3FYGA 3FZAA 2H01A 3MNGA 2P5QA 2HSMB 4N11A 2AV4A 2C8UA 3U6VA 3GA4A 5LD0A 3HJOA 1B4PA 4V1Ag 4AJ8A 5A1NA 4ZB6A 1Z3EA 3IC8A 2O87A 2ZUPA 3RPPA 4AKHA 2ALBA 5ABRA 4YQUA 5DJLA 3DMLA 2O3EA 2CX3A 2L6DA 5DBQA 3P7XA 5H5RA 3LXTA 1B9YC 2WW3A 4KB3A 3SWLA 5ID2B 3VK9A 4ECBA 1TK8B 1PN0A 2LJAA 3PGTA 3LEFA 3U5RE 4F82A 2FGXA 1AXDA 1BAYA 3WYWA 2H74A 3C71A 3ZL5A 2CZ3A 1O8XA 2E0QA 2CT6A 4Q5FA 3GH6A 1XW9A 1S3RA 1FOHA 4MH3A 3Q74A 3WGDA 4TXOB 4F03A 2LNTA 1KEBA 5F05A 2AHEA 4YQMA 5F06A 1ZYQB 2HXKA 4DEJA 3KD0A 5DVBA 4CW9A 3KGKA 4V1Ap 3TKSA 2AAWA 4XHMA 2B5YA 2EIRA 1SKRB 2PPTA 1XVQA 1VF1A 5A4UA 1WIKA 5JWRB 2WFCA 5IMDA 4EXJA 1O6JA 2GZPA 1G0TA 3H1NA 1K3LA 1HD2A 5EY6A 2FNOA 5KOWA 1UVZA 2YZHA 3A2VA 2VOCA 5H5SA 1Q4JA 2AYTA 3K8NA 3CRUA 3N5OA 5HFKA 2YJ7A 4RI6A 3F4RA 2GT5A 4TR3A 2MBSA 4KDUA 3J7Yb 4V2MA 1OE8A 4F0BA 3GIXA 4AJ6A 3E3EA 1ST9A 4GSSA 1OYJA 1V57A 2DMLA 1FHEA 4GSTA 5KN3A 1X9WB 4FIWA 1TXXA 1I5GA 2WW0A 4I2TA 5JCGA 4KE3A 2CV4A 3TKRA 5DQSA 1X0RA 3TRXA 2VLTA 2VIMA 4PX1A 3F3RA 4L0WA 2MBTA 4GWRA 2YWNA 4MZCA 2X64A 4DVCA 3IE3A 3PR8A 1JLWA 5J9CA 2IPAA 2H1AA 4JR4A 3TU3B 2FWEA 1XBSA 3EU3A 2IJYA 5G5FA 4EIQA 3CBUA 1GTIA 2M80A 2TIRA 1OC9B 1GUKA 1EOHA 4OFNA 1YQ1A 5GSTA 1PGTA 4WF4A 4BL7A 2I4AA 2HSHA 3HXSA 2YNXA 1GL8A 2H71A 3D21A 1O81A 2NPBA 2O5VA 4POLA 5CYYA 3IR4A 1EP8A 5AN1A 3GX8A 4PUFC 4FO5A 1YF0A 3KTLA 2E2GA 2O7KA 1ILOA 3F4TA 6GSVA 3KEBA 4ZL9A 3GTUA 2VLUA 1JZDA 1WP0A 3MSZA 4MF5A 4H86A 3TJBA 3LW9A 4HJMA 14GSA 3UL3A 1EGOA 3TKQA 2LRCA 2EC4A 1NHYA 3D4TA 4I97A 1M9AA 1THXA 1U88A 5GSSA 3IAS2 2EIOA 3KH9A 5ECHB 1MEKA 2V41A 2EFEA 2HRKB 4KA0A 2GZZA 4HS1A 2RUFA 6GSXA 1UA5A 1YEXA 5IMCA 4OO4A 4DSSA 3HVVA 6GSTA 16GSA 4EDZA 2DMMA 1JLVA 4E8EA 4NV5A 1NSWA 2B7JA 5IO0A 1TRUA 4IP1A 1BEDA 2P5RA 4CDOA 4E68A 2LUSA 2G0FA 5CO3A 3FR3A 4ULXA 2HFDA 1PFOA 3HA9A 3UEMA 1QFNA 1WPIA 1X5EA 1TDIA 3KIJA 3L78A 2FLSA 1EV9A 3RFRC 2CZ2A 5IMFA 5ELAA 3VURA 4KNDA 3VWVA 4AKGA 3IA1A 4JU5A 1N8JA 3UOMA 1BQ7A 2HSYA 4Z7XA 1BYEA 3EMPA 2VCVA 5CRDA 1XIYA 5DALA 4X43A 1RK4A 2LSTA 2FHEA 4GRFA 3ME7A 1VGLA 1SVLA 3FY7A 4TW5A 1C72A 3Q6OA 1K3YA 2GQMA 2HQTA 2PVQA 1YDKA 3QAWA 2XHFA 5B8BA 1M7TA 1H75A 2N5FA 2TRXA 4K2XA 1M2DA 5HQPA 1EGRA 4TN8A 1T8EB 4IQAA 2C1YA 5LCZA 2ZNMA 2K18A 1VRSD 5HFGA 2HLSA 4GF0A 4ZB9A 5HFIA 4A5PA 4Z2RA 1K0BA 1GWCA 4XTSA 3KZQA 2MMNA 1T1VA 4JR6A 4J56E 4PQHA 5IMVA 1VF4A 3LYPA 2H1DA 2RM5A 3ZRDA 4MK3A 2DJ1A 3BD2A 5E4WA 4GSNA 4IELA 1GSFA 3F8UA 3G7JA 2F8FA 4MF7A 2H6XA 1DE2A 1XZOA 2FD3A 5A5KA 1K0MA 2FA8A 4V2LA 3GURA 2NBSA 1F3BA 3FR6A 1FG4A 3LG6A 3HZ8A 1A0RP 5CRWA 3VWUA 1OKDA 3ZIJA 5GAPD 4ECCA 5C04A 1PX6A 1VF3A 3MDKA 2YANA 1TRWA 2L5LA 3UBLA 4HZ2A 4NWYA 1Z6MA 1OC3A 9GSSA 1FB0A 1TXUA 1J0FA 2KLXA 4KX4A 4FH8A 2DJ0A 1T4ZA 1TK0B 2DIYA 3DWVA 5F0GA 4HU7A 3WT1A 2WULA 5C00A 3GKMA 4BVYB 4HSCX 4MF6A 12GSA 4Z2TA 4F0CA 4MP4A 3TB2A 1YY7A 2R2JA 1MDIA 2YCDA 3WD6A 1T7PB 1ZYPA 2HSNA 1TI3A 1GSUA 1K0DA 5EPFA 4ICYA 1FVKA 1X5CA 1ERUA 4KDYA 2JZTA 2RM6A 4NPBA 1USBA 5DCGA 2LTKA 2WW2A 1SJZA 1GSSA 5B6NA 1MD4A 2VAFA 4JRRA 2VL2A 2WCIA 5ECLB 3TOUA 3KCMA 3O76A 4PXOA 1X9SB 1CQGA 1PL2A 5ECNB 5KN0A 5AIXA 4PHZC 3MAKA 1GH2A 1ZZYA 3D6IA 4MDCA 1JZOA 3ERFA 4MPGA 2A4HA 2RUEA 4K6XA 4L5LA 1XW5A 4RQRA 3ZFBA 2B1LA 3TJGA 1ERWA 5GZZB 4IHUA 4WF5A 3CQFA 2B5EA 4G0KA 4EE0A 2K9FA 2H6ZA 1MDJA 1K0AA 3E9JB 5HR2A 4MPFA 5IPGA 4WEYA 2VKZG 1OC8A 2HT9A 2X99A 2YV7A 2DKIA 2X49A 4HU9A 3G9BA 3A2WA 3DD3A 3KM6A 3I43A 2M46A 5CAXA 1AQXA 1M3IA 6GSWA 1ZYEA 1F3AA 4HZ4A 2IMFA 3HJPA 1AQVA 3NZNA 1TOFA 3FEUA 1WMJA 2PUKC 5JCUA 2DIZA 2YN1A 4ZILA 4HOJA 4D73A 3H79A 1ZL9A 1TKDB 2R37A 5J41A 3NIVA 4ZXGA 4G9HA 3C73A 4I6XA 4ML6A 4EF0A 1X9MB 4NHWA 3BJ5A 4ZIJA 1SK2A 1OE7A 1JFUA 18GSA 1TU7A 2G2QA 4K5SA 2R4VA 1OKTA 4PNFA 4IW9A 1Z7PA 4BIKA 4Q5NA 2C0EA 2H8LA 1A2JA 1XWCA 2R5GA 5KOXA 2BMXA 3IHQA 2GLRA 2VO4A 1GRXA 4GDFA 1SL0B 2PWJA 1N2AA 1GUHA 2NTOA 2REMA 2H73A 2R0PA 3EMXA 3KP8A 2DJJA 3DGQA 4IN0A 4FYUA 1PN9A 3L4NA 3L9UA 2VUPA 2C3NA 2WVZA 4X1UA 1AUCA 4OD7A 1UN2A 1GSDA 4OCFA 2QC7A 3GYKA 5HR0A 1Z6NA 3FKFA 5A4WA 4BL7B 3RGBC 2AB6A 4MH2A 5E59A 1ERTA 4XS1A 1EEMA 2PVOC 5CREA 2HRFA 1BJXA 4NXIA 4ZBBA 4JBBA 1S3AA 2WJUA 1XWKA 1O8WA 1KBNA 4POKA 3PPUA 4AGSA 2O8VB 4MJBA 2XC2A 3JCML 2GVPA 4NHZA 1DSBA 2P31A 4J57E 3GTUB 2AUVA 4QMKA 3IXRA 4PUAA 3VWXA 3WGXA 3M9KA 13GSA 2CQ9A 2OKAA 4YH2A 3G7YA 4YAPA 1GULA 3TKSC 1GSEA 1V2AA 3C8EA 3RAZA 2L59A 4TR0A 3LXZA 3I6AA 2JADA 2DSAA 2IIYA 1WJKA 3IV4A 4CY8A 1U3IA 3EYTA 4XRDA 4LMVA 4OFMA 1ZOFA 2V1MA 4GTUA 4O5RA 4AF2A 4ZB7A 4DSSB 2FCHA 3IBHA 4LMWA 3L9SA 2OE0A 1PL1A 2FY6A 3HVXA 4F9ZA 3D5JA 3GV1A 3DYRA 1S3DA 5J3RA 2LV3A 3F63A 2CA8A 3FZ9A 3A5IA 3QR6A 4K0NA 1GP1A 5D73A 5DAKA 3LWAA 4IP6A 1A24A 3ZLPA 1HNAA 4RQXA 4MZBA 5DCHA 3CRTA 4XRAA 4XS4A 2ON5A 3M9JA 1GUMA 3N9JA 4G10A 1AQWA 1E2YA 2A2RA 4O5QA 1YKAA 4WR5A 4IQ1A 1Y25A 2HZFA 3P90A 3F9UA 5J40A 6GSYA 1F37A 1OAZA 5DALB 3F0IA 4IJ3A 2MMZA 4JE1A 2PBJA 2DJ3A 2V2GA 2QGVA 5B8AA 4W66A 6GSSA 1A0FA 3IPZA 1N25A 3UMAA 4PQ1A 4OO5A 4LLRA 3LFLA 1XFLA 1ML6A 1T3BA 1B9XC 3D4MA 5D8IA 2XBQA 4G2EA 5KN2A 2A2PA 3DEXA 7GSSA 5ECPB 3TGZA 1SL1B 2JU5A 5ECSA 3RHCA 3PH9A 2PGTA 4K2DA 1AIUA 1PRXA 5F8BA 2H0IA 1W4VA 2H19A 3M3MA 1XWGA 4GQCA 3DXBA 2GSSA 2PERA 3UVTA 2P0GA 2J23A 1U6TA 1WOUA 1BX9A 4OFTA 17GSA 2JZRA 3KXOA 8GSSA 5A5HA 3GKKA 4G0IA 5L71A 4WBRD 2C3QA 1XWAA 10GSA 2YWIA 2VL3A 1UC7A 2YJHA 5ECKB 1LJRA 1RW1A 5CP1A 1Y1UA 4NAXA 20GSA 2ZCTA 3KJYA 1G7OA 3D22A 2JSYA 2CAIA 1S4BP 2R0CA 1SYXA 1Z7RA 5ECQB 3IDVA 3W8JA 1DBYA 1HYUA 2GGTA 3UBKA 3GFKA 2HE3A 4GXZA 5IIZA 3VI5A 2VCZA 2D2ZA 3R2QA 4OWYA 4V2NA 5HR3A 3IHGA 1W89A 2HRNA 3M1GA 4O7HA 2YP6A 4YKFA 2GS3A 1H4OA 3QMXA 2X8HA 2FWGA 2K8SA 1PQNA 5CRHA 3IOSA 3ERGA 2RLIA 5D9WA 2LRNA 4GQFA 4K7NA 2VM2A 2V32A 3H8QA 4HQSA 1VF2A 3ZITA 1SK0A 2H75A 3G7IA 4G19A 3CHXC 4HJ2A 2OBIA 1A2MA 5CRGA 1DUGA 5B7CA 3KMNA 1FB6A 2HI7A 3HHVA 2HSNB 5ECRB 2DLXA 1TW9A 2FUG2 2H70A 3BCKA 4DSQA 2QSIA 2GSTA 2HNLA 4JEDA 1YVLA 1F2EA 1M9BA 1GTAA 1PD21 4KGIA 2X4AA 3A3TA 3P8WA 2YZUA 4N0VA 3QAGA 1SD9A 1F9MA 2EFHA 4O5UA 2DBCA 1XG8A 5J4UA 1PSQA 3M8NA 2CX4A 3CSHA 4JZQA 5IPHA 2AJQB 2FWFA 4CY6A 2L4QA 5A34B 2CAQA 2I81A 3DVXA 2MYGA 2H6YA 5J4YA 3HVNA 5G31A 2XBIA 5FWGA 4ML1A 4LL1B 3GN3A 4L5OA 4WKWA 3TUEA 1CQHA 3TOTA 22GSA 2H1LA 2B5XA 5BMUA 4I2UA 2DKHA 1G7EA 4K9ZA 4BWQA 1MTCA 2IMIA 1ZYNA 1WRYA 1SVMA 1SKSB 1LBKA 1A8LA 4ACSA 3TJJA 3CYNA 3VWWA 2O36A 2I9HA 3C7MA 3WT2A 1TTZA 2IFQA 4BWSA 1GNEA 3RPNA 4IKHA 1HNCA 4EL1A 2WB9A 2K8VA 1PKZA 1V58A 3F3QA 4N0ZA 3GHAA 3LGCA 3UARA 1EV4A 2JZSA 4TR1A 5A1NB 1ERVA 2WVXA 1TI1A 3A5WA 2H76A 4FXYP 4D73B 5LNKe 3ZZXA 1DE1A 3LORA 1G6YA 3MWHA 3F6FA 1EZKA 3ZTLA 5IM9A 2K6VA 2WS2A 3TKSE 5AGYA 1SK1A 5G1LA 5J5NA 5G1KA 1QGVA 2IMEA 4PURA 5CNWA 1GTUA 1R5PA 3EPTA 3UJ1A 4N30A 3GL3A 2GTUA 1QXHA 5BRTA 3FMWA 2LS5A 4MLYA 3BCIA 3FRCA 2KHPA 3RDWA 3DIEA 2WZ9A 4I5QA 4MJCA 4TKYA 4MA9A 1B8XA 2VL2C 4J2FA 2C3TA 2MMAA 4O92A 2H0GA 5G2ZA 1K0OA 1KNGA 2KUCA 3EINA 4EO3A 5D96A 1ZGNA 3CTFA 3QFBC 2JSZA 2XPDA 1JHBA 4IGJA 4PI0C 1M0UA 3Q19A 3HMJG 4ID0A 3AY8A 1FOVA 5J4VA 1K0NA 2C0GA 4XCSA 3CXGA 3BOAA 4K7OA 3VLNA 1V40A 3HCZA 1AW9A 5DJMA 3EU4A 4WETA 2IWTA 3GRXA 2UZ8A 2VLVA 1SENA 1XCCA 1XW6A 1SVOA 4ZL7A 1K3OA 3RHBA 4EKZA 4AJ7A 4WR4A 4YAVA 5F07A 4EVMA 3O3TA 1SKWB 2DJKA 3I9V2 1ZCPA 4KW6A 4TOPA 1V98A 5G5EA 2NDOA 3IAM2 3ZVJA 1PKWA 3GSSA 4RUVA 1A2LA 1FW1A 3F4SA 3SBCA 2EFDA 5DDLA 1XXUA 3TRQA 5ENUA 3LQ7A 3US3A 3KTBA 3L9VA 1QQ2A 1M2AA 3NOFA 3APOA 2ON7A 2BJXA 1I1IP 2GT6A 1KTEA 4TR4A 2UV8G 3GKXA 1T4YA 2YOIA 2DC5A 2WZSA 4BVXA 5IMAA 2OADA 2C0DA 1YF1A 2HZEA 3HDCA 2WVYA 3VPTA 2TRCP 2HSMA 5ELGA 3ZREA 2LJRA 1S3CA 3V1WA 1QK8A 3ZMLA 2C0FA 5KN1A 2B7KA 1ZMAA 2KP1A 2L6CA 3CMIA 1XVWA 4OMVA 4XIHA 5DAKB 1R5AA 2OE3A 5KEJA 3TCOA 4EUYA 5J47A 1I9DA 1G6WA 2LEGA 4XS4B 2OT3A 4AKIA 4DSRA 2GQLA 4MABA 2R0GA 2I3YA 3HYPA 2R6KA 2GSQA 4PI2C 3IK7A 3GL5A 4F2IA 4TRXA 3QFAC 1U3AA 5AISA 1MD3A 3QCPA 5ID2A 5DQYA 2J9HA 1U87A 1T00A 2IMKA 3H93A 3A2XA 3TJFA 3TRPA 4ECIA 1ABAA 1LU4A 3QPMA 4P3YB 5IOWA 3IK9A 3ZMKA 3HZ4A 4X4JA 1YZXA 2VD0A 3HY2A 3R3EA 2GSRA 3EE2A 4TXOA 3J7Yk 2CVBA 2ES7A 1YEPA 4KF9A 2F3MA 5G30A 5D93A 3H4KA 4AI6A 2HYXA 1BF5A 1WE0A 1MDKA 5EVOA 1X5DA 2MZCA 4O32A 2OBKA 2A4VA 4GCIA 4ISDA 1URMA 2CVDA 4KSMA 3ED3A 5JCWA 2FA4A 1XOAA 4WXTA 1TRVA 3C1RA 1AC1A 4KUNA 3HVSA 2IMDA 2WDUA 2N5AA 5A5HB 4KCAA 2PMTA 2KP2A 2N5BA 3FW2A 5JWOB 4CHSA 1FVJA 1GTBA 3GNJA 4K0GA 5IMZA 1Y6EA 4KDXA 3D0ZA 3L0HA 2QKEA 3HJMA 1O7UA 1R4WA 4G0LA 3UAPA 1FAAA 2F9SA 3GKNA 19GSA 1ON4A 1M99A 2BTOT 2X8CA 4IVFA 2DJ2A 2C80A 2LRTA 4KAEA 4USSA 5H5QA 3TJKA
chains in the Genus database with same CATH topology
2EIQA 3ZFLA 2I1UA 2V6OA 3KMOA 4WBJA 5D9VA 2PN8A 4POBA 5AIVA 2H1GA 1JZRA 2LJKA 1EP7A 2V6KA 1QUWA 2YV9A 4MMMA 2C4JA 4HUAA 6GSUA 4QL9A 3IC4A 5INYA 2L57A 4HQZA 4YKGA 5IOXA 2LNSA 1SD8A 4L8EA 1IYHA 3VPQA 1J08A 2HRAA 1AAZA 3GUSA 1OC9A 1SJ6A 2KOKA 3ERWA 2YPMA 4GLTA 3TKPA 3DKSA 4ECJA 1IYIA 4TXVA 4OCEA 4ZBAA 1M2BA 1TP9A 5D9TA 4NV2A 1OVNA 4MJAA 4PGTA 11GSA 2GZYA 2H72A 1NW2A 2H0HA 3F6DA 2OA7A 4ZL8A 1SL2B 3DVWA 3LYKA 3HD5A 2LQQA 4ILFA 1V9WA 2B3SA 3EC3A 4EIPA 4POMA 4BA7A 1SJIA 3ZYWA 1Q98A 4MNNA 2Z9SA 3LSZA 4ZBDA 1F6MC 2R3XA 5IQYA 1WWJA 3APSA 1SU9A 3EURA 4K1FA 3QD9A 3RBTA 3QAVA 1XPVA 1EOGA 3EWLA 3OR5A 3GSTA 5J9BA 2OJLA 5BMUB 2HRKA 4G01A 1PMTA 1RQMA 1Z9HA 2E7PA 4PNGA 3GMFA 2F51A 4ZB8A 4K8MA 5COHA 1K0CA 2X8GA 5D9XA 5FT3A 2VM1A 3IRAA 1JZWA 3S9FA 1E6BA 1O73A 2B6MA 3P2AA 4NMUA 2IFQB 4MJEA 5EL8A 1GLQA 3CSIA 1R26A 3DRNA 2A2SA 3I69A 4PTSA 3KH7A 4Q5QA 2OACA 3PINA 4IJIA 1BG5A 2GDRA 1QMVA 2IN3A 4MCUA 4L0UA 4EDYA 4TR1B 1HQOA 1Z5YE 1J9BA 3W6GA 3WGEA 1SYRA 4XS6A 4I8BA 1TU8A 4TVEA 1NM3A 2VCXA 1GLPA 2QA2A 3QDNA 4QL7A 4HEA2 1EEJA 3ME8A 3LJRA 3UVHA 3HKRA 2H1BA 4HDEA 5IO2A 5ECMB 1THOA 3FZ5A 5GAND 4AKXB 4N3ZA 2EFCA 3C1SA 2VCWA 3CWGA 4BPYA 4KSOA 1PX7A 2B1KA 2H30A 1O85A 4IS0A 5ECIB 4LL4B 2L5OA 4KH7A 3O6TA 2O85A 4FYCA 2VCQA 4K7IA 3CTGA 4LA1A 4EC0A 2O89A 2LKUA 4IBPA 3QOUA 2RIIA 3ZIVA 5HR1A 3FR9A 2YWMA 2XPEA 1PA3A 4KCEA 3KP9A 2L4CA 2QA1A 3M0FA 2CVKA 2PU9C 4YQVA 3Q18A 4FYBA 2NVLA 5JWQB 3CSJA 4K5RA 3MIXA 2JACA 1XWBA 1A8YA 2F8AA 2IL3A 2H66A 2VCTA 4FQUA 4QQ7A 3UIWA 5FHIA 1XOBA 3VFIA 3FHKA 1TRSA 1YKCA 3GX0A 2JL4A 4PQIA 2YWOA 5A34A 3VI7A 3ZVJD 3BBYA 3FK8A 1A23A 3APQA 4HI7A 2VD1A 1HNBA 5A4VA 1GSQA 3GH9A 2OE1A 3TDGA 2VL9A 4RI7A 2MMOA 1R7HA 2LQOA 5ECOB 1ACVA 2WRTA 4Q5RA 3W8SA 4BVYA 2M72A 4E8HA 1GNWA 2FWHA 4MZWA 4Z2UA 3EVIA 1TK5B 3E0UA 5B6MA 4X0XA 1GSYA 4BVXB 1FO5A 1TJDA 3ISOA 2WGRA 1EWXA 1B4QA 3MYDA 2HZEB 1YJ6A 2E2MA 4N10A 1B48A 2GQKA 3FZ4A 1BG1A 1NHOA 3FYGA 3FZAA 2H01A 3MNGA 2P5QA 2HSMB 4N11A 2AV4A 2C8UA 3U6VA 3GA4A 5LD0A 3HJOA 1B4PA 4V1Ag 4AJ8A 5A1NA 4ZB6A 1Z3EA 3IC8A 2O87A 2ZUPA 3RPPA 4AKHA 2ALBA 5ABRA 4YQUA 5DJLA 3DMLA 2CX3A 2L6DA 5DBQA 3P7XA 5H5RA 3LXTA 1B9YC 4KB3A 3SWLA 5ID2B 3VK9A 4ECBA 1TK8B 1PN0A 2LJAA 3PGTA 3LEFA 3U5RE 4F82A 2FGXA 1AXDA 1BAYA 3WYWA 2H74A 3C71A 3ZL5A 2CZ3A 1O8XA 2E0QA 2CT6A 4Q5FA 3GH6A 1XW9A 1FOHA 4MH3A 3Q74A 3WGDA 4TXOB 4F03A 2LNTA 1KEBA 5F05A 2AHEA 4YQMA 5F06A 1ZYQB 2HXKA 4DEJA 3KD0A 5DVBA 4CW9A 3KGKA 4V1Ap 3TKSA 2AAWA 4XHMA 2B5YA 2EIRA 1SKRB 2PPTA 1XVQA 1VF1A 5A4UA 1WIKA 5JWRB 2WFCA 5IMDA 4EXJA 1O6JA 2GZPA 1G0TA 3H1NA 1K3LA 1HD2A 5EY6A 2FNOA 5KOWA 1UVZA 2YZHA 3A2VA 2VOCA 5H5SA 1Q4JA 2AYTA 3K8NA 3CRUA 3N5OA 5HFKA 2YJ7A 4RI6A 3F4RA 2GT5A 4TR3A 2MBSA 4KDUA 3J7Yb 4V2MA 1OE8A 4F0BA 3GIXA 4AJ6A 3E3EA 1ST9A 4GSSA 1OYJA 1V57A 2DMLA 1FHEA 4GSTA 5KN3A 1X9WB 4FIWA 1TXXA 1I5GA 4I2TA 5JCGA 4KE3A 2CV4A 3TKRA 5DQSA 1X0RA 3TRXA 2VLTA 2VIMA 4PX1A 3F3RA 4L0WA 2MBTA 4GWRA 2YWNA 4MZCA 2X64A 4DVCA 3IE3A 3PR8A 1JLWA 5J9CA 2IPAA 2H1AA 4JR4A 3TU3B 2FWEA 1XBSA 3EU3A 2IJYA 5G5FA 4EIQA 3CBUA 1GTIA 2M80A 2TIRA 1OC9B 1GUKA 1EOHA 4OFNA 1YQ1A 5GSTA 1PGTA 4WF4A 4BL7A 2I4AA 2HSHA 3HXSA 2YNXA 1GL8A 2H71A 3D21A 1O81A 2NPBA 2O5VA 4POLA 5CYYA 3IR4A 1EP8A 5AN1A 3GX8A 4PUFC 4FO5A 1YF0A 3KTLA 2E2GA 2O7KA 1ILOA 3F4TA 6GSVA 3KEBA 4ZL9A 3GTUA 2VLUA 1JZDA 1WP0A 3MSZA 4MF5A 4H86A 3TJBA 3LW9A 4HJMA 14GSA 3UL3A 1EGOA 3TKQA 2LRCA 2EC4A 1NHYA 3D4TA 4I97A 1M9AA 1THXA 1U88A 5GSSA 3IAS2 2EIOA 3KH9A 5ECHB 1MEKA 2V41A 2EFEA 2HRKB 4KA0A 2GZZA 4HS1A 2RUFA 6GSXA 1UA5A 1YEXA 5IMCA 4OO4A 4DSSA 3HVVA 6GSTA 16GSA 4EDZA 2DMMA 1JLVA 4E8EA 4NV5A 1NSWA 2B7JA 5IO0A 1TRUA 4IP1A 1BEDA 2P5RA 4CDOA 4E68A 2LUSA 2G0FA 5CO3A 3FR3A 4ULXA 2HFDA 3HA9A 3UEMA 1QFNA 1WPIA 1X5EA 1TDIA 3KIJA 3L78A 2FLSA 1EV9A 2CZ2A 5IMFA 5ELAA 3VURA 4KNDA 3VWVA 4AKGA 3IA1A 4JU5A 1N8JA 3UOMA 1BQ7A 2HSYA 4Z7XA 1BYEA 3EMPA 2VCVA 5CRDA 1XIYA 5DALA 4X43A 1RK4A 2LSTA 2FHEA 4GRFA 3ME7A 1VGLA 1SVLA 3FY7A 4TW5A 1C72A 3Q6OA 1K3YA 2GQMA 2HQTA 2PVQA 1YDKA 3QAWA 2XHFA 5B8BA 1M7TA 1H75A 2N5FA 2TRXA 4K2XA 1M2DA 5HQPA 1EGRA 4TN8A 1T8EB 4IQAA 2C1YA 5LCZA 2ZNMA 2K18A 1VRSD 5HFGA 2HLSA 4GF0A 4ZB9A 5HFIA 4A5PA 4Z2RA 1K0BA 1GWCA 4XTSA 3KZQA 2MMNA 1T1VA 4JR6A 4J56E 4PQHA 5IMVA 1VF4A 3LYPA 2H1DA 2RM5A 3ZRDA 4MK3A 2DJ1A 3BD2A 5E4WA 4GSNA 4IELA 1GSFA 3F8UA 3G7JA 2F8FA 4MF7A 2H6XA 1DE2A 1XZOA 2FD3A 5A5KA 1K0MA 2FA8A 4V2LA 3GURA 2NBSA 1F3BA 3FR6A 1FG4A 3LG6A 3HZ8A 1A0RP 5CRWA 3VWUA 1OKDA 3ZIJA 5GAPD 4ECCA 5C04A 1PX6A 1VF3A 3MDKA 2YANA 1TRWA 2L5LA 3UBLA 4HZ2A 4NWYA 1Z6MA 1OC3A 9GSSA 1FB0A 1TXUA 1J0FA 2KLXA 4KX4A 4FH8A 2DJ0A 1T4ZA 1TK0B 2DIYA 3DWVA 5F0GA 4HU7A 3WT1A 2WULA 5C00A 3GKMA 4BVYB 4MF6A 12GSA 4Z2TA 4F0CA 4MP4A 3TB2A 1YY7A 2R2JA 1MDIA 2YCDA 3WD6A 1T7PB 1ZYPA 2HSNA 1TI3A 1GSUA 1K0DA 5EPFA 4ICYA 1FVKA 1X5CA 1ERUA 4KDYA 2JZTA 2RM6A 4NPBA 1USBA 5DCGA 2LTKA 1SJZA 1GSSA 5B6NA 1MD4A 2VAFA 4JRRA 2VL2A 2WCIA 5ECLB 3TOUA 3KCMA 3O76A 4PXOA 1X9SB 1CQGA 1PL2A 5ECNB 5KN0A 5AIXA 3MAKA 1GH2A 1ZZYA 3D6IA 4MDCA 1JZOA 3ERFA 4MPGA 2A4HA 2RUEA 4K6XA 4L5LA 1XW5A 4RQRA 3ZFBA 2B1LA 3TJGA 1ERWA 5GZZB 4IHUA 4WF5A 2B5EA 4G0KA 4EE0A 2K9FA 2H6ZA 1MDJA 1K0AA 3E9JB 5HR2A 4MPFA 5IPGA 4WEYA 2VKZG 1OC8A 2HT9A 2X99A 2YV7A 2DKIA 2X49A 4HU9A 3G9BA 3A2WA 3DD3A 3KM6A 3I43A 2M46A 5CAXA 1AQXA 6GSWA 1ZYEA 1F3AA 4HZ4A 2IMFA 3HJPA 1AQVA 3NZNA 1TOFA 3FEUA 1WMJA 2PUKC 5JCUA 2DIZA 2YN1A 4ZILA 4HOJA 4D73A 3H79A 1ZL9A 1TKDB 2R37A 5J41A 3NIVA 4ZXGA 4G9HA 3C73A 4I6XA 4ML6A 4EF0A 1X9MB 4NHWA 3BJ5A 4ZIJA 1SK2A 1OE7A 1JFUA 18GSA 1TU7A 2G2QA 4K5SA 2R4VA 1OKTA 4PNFA 4IW9A 1Z7PA 4Q5NA 2C0EA 2H8LA 1A2JA 1XWCA 2R5GA 5KOXA 2BMXA 3IHQA 2GLRA 2VO4A 1GRXA 4GDFA 1SL0B 2PWJA 1N2AA 1GUHA 2NTOA 2REMA 2H73A 2R0PA 3EMXA 3KP8A 2DJJA 3DGQA 4IN0A 4FYUA 1PN9A 3L4NA 3L9UA 2VUPA 2C3NA 4X1UA 1AUCA 4OD7A 1UN2A 1GSDA 4OCFA 2QC7A 3GYKA 5HR0A 1Z6NA 3FKFA 5A4WA 4BL7B 2AB6A 4MH2A 5E59A 1ERTA 4XS1A 1EEMA 2PVOC 5CREA 2HRFA 1BJXA 4NXIA 4ZBBA 4JBBA 1S3AA 2WJUA 1XWKA 1O8WA 1KBNA 4POKA 3PPUA 4AGSA 2O8VB 4MJBA 2XC2A 3JCML 2GVPA 4NHZA 1DSBA 2P31A 4J57E 3GTUB 2AUVA 4QMKA 3IXRA 4PUAA 3VWXA 3WGXA 3M9KA 13GSA 2CQ9A 2OKAA 4YH2A 3G7YA 4YAPA 1GULA 3TKSC 1GSEA 1V2AA 3C8EA 3RAZA 2L59A 4TR0A 3LXZA 3I6AA 2JADA 2DSAA 2IIYA 1WJKA 3IV4A 4CY8A 1U3IA 3EYTA 4XRDA 4LMVA 4OFMA 1ZOFA 2V1MA 4GTUA 4O5RA 4AF2A 4ZB7A 4DSSB 2FCHA 3IBHA 4LMWA 3L9SA 2OE0A 1PL1A 2FY6A 3HVXA 4F9ZA 3D5JA 3GV1A 3DYRA 1S3DA 5J3RA 2LV3A 3F63A 2CA8A 3FZ9A 3A5IA 3QR6A 4K0NA 1GP1A 5D73A 5DAKA 3LWAA 4IP6A 1A24A 3ZLPA 1HNAA 4RQXA 4MZBA 5DCHA 3CRTA 4XRAA 4XS4A 2ON5A 3M9JA 1GUMA 3N9JA 4G10A 1AQWA 1E2YA 2A2RA 4O5QA 1YKAA 4WR5A 4IQ1A 1Y25A 2HZFA 3P90A 3F9UA 5J40A 6GSYA 1F37A 1OAZA 5DALB 3F0IA 4IJ3A 2MMZA 4JE1A 2PBJA 2DJ3A 2V2GA 2QGVA 5B8AA 4W66A 6GSSA 1A0FA 3IPZA 1N25A 3UMAA 4PQ1A 4OO5A 4LLRA 3LFLA 1XFLA 1ML6A 1T3BA 1B9XC 3D4MA 5D8IA 2XBQA 4G2EA 5KN2A 2A2PA 3DEXA 7GSSA 5ECPB 3TGZA 1SL1B 2JU5A 5ECSA 3RHCA 3PH9A 2PGTA 4K2DA 1AIUA 1PRXA 5F8BA 2H0IA 1W4VA 2H19A 3M3MA 1XWGA 4GQCA 3DXBA 2GSSA 2PERA 3UVTA 2P0GA 2J23A 1U6TA 1WOUA 1BX9A 4OFTA 17GSA 2JZRA 3KXOA 8GSSA 5A5HA 3GKKA 4G0IA 5L71A 4WBRD 2C3QA 1XWAA 10GSA 2YWIA 2VL3A 1UC7A 2YJHA 5ECKB 1LJRA 1RW1A 5CP1A 1Y1UA 4NAXA 20GSA 2ZCTA 3KJYA 1G7OA 3D22A 2JSYA 2CAIA 2R0CA 1SYXA 1Z7RA 5ECQB 3IDVA 3W8JA 1DBYA 1HYUA 2GGTA 3UBKA 3GFKA 2HE3A 4GXZA 5IIZA 3VI5A 2VCZA 2D2ZA 3R2QA 4OWYA 4V2NA 5HR3A 3IHGA 1W89A 2HRNA 3M1GA 4O7HA 2YP6A 4YKFA 2GS3A 1H4OA 3QMXA 2X8HA 2FWGA 2K8SA 1PQNA 5CRHA 3IOSA 3ERGA 2RLIA 5D9WA 2LRNA 4GQFA 4K7NA 2VM2A 2V32A 3H8QA 4HQSA 1VF2A 3ZITA 1SK0A 2H75A 3G7IA 4G19A 4HJ2A 1A2MA 2OBIA 5CRGA 1DUGA 5B7CA 3KMNA 1FB6A 2HI7A 3HHVA 2HSNB 5ECRB 2DLXA 1TW9A 2FUG2 2H70A 3BCKA 4DSQA 2QSIA 2GSTA 2HNLA 4JEDA 1YVLA 1F2EA 1M9BA 1GTAA 1PD21 4KGIA 2X4AA 3A3TA 3P8WA 2YZUA 4N0VA 3QAGA 1SD9A 1F9MA 2EFHA 4O5UA 2DBCA 5J4UA 1PSQA 3M8NA 2CX4A 3CSHA 4JZQA 5IPHA 2AJQB 2FWFA 4CY6A 2L4QA 5A34B 2CAQA 2I81A 3DVXA 2MYGA 2H6YA 5J4YA 5G31A 2XBIA 5FWGA 4ML1A 4LL1B 3GN3A 4L5OA 4WKWA 3TUEA 1CQHA 3TOTA 22GSA 2H1LA 2B5XA 5BMUA 4I2UA 2DKHA 1G7EA 4K9ZA 4BWQA 1MTCA 2IMIA 1ZYNA 1WRYA 1SVMA 1SKSB 1LBKA 1A8LA 4ACSA 3TJJA 3CYNA 3VWWA 2I9HA 3C7MA 3WT2A 1TTZA 2IFQA 4BWSA 1GNEA 3RPNA 4IKHA 1HNCA 4EL1A 2WB9A 2K8VA 1PKZA 1V58A 3F3QA 4N0ZA 3GHAA 3LGCA 3UARA 1EV4A 2JZSA 4TR1A 5A1NB 1ERVA 1TI1A 3A5WA 2H76A 4D73B 5LNKe 3ZZXA 1DE1A 3LORA 1G6YA 3MWHA 3F6FA 1EZKA 3ZTLA 5IM9A 2K6VA 2WS2A 3TKSE 5AGYA 1SK1A 5G1LA 5J5NA 5G1KA 1QGVA 2IMEA 4PURA 5CNWA 1GTUA 1R5PA 3EPTA 3UJ1A 4N30A 3GL3A 2GTUA 1QXHA 5BRTA 3FMWA 2LS5A 4MLYA 3BCIA 3FRCA 2KHPA 3RDWA 3DIEA 2WZ9A 4I5QA 4MJCA 4TKYA 4MA9A 1B8XA 2VL2C 4J2FA 2C3TA 2MMAA 4O92A 2H0GA 5G2ZA 1K0OA 1KNGA 2KUCA 3EINA 4EO3A 5D96A 1ZGNA 3CTFA 3QFBC 2JSZA 2XPDA 1JHBA 4IGJA 1M0UA 3Q19A 3HMJG 4ID0A 3AY8A 1FOVA 5J4VA 1K0NA 2C0GA 4XCSA 3CXGA 3BOAA 4K7OA 3VLNA 1V40A 3HCZA 1AW9A 5DJMA 3EU4A 4WETA 2IWTA 3GRXA 2UZ8A 2VLVA 1SENA 1XCCA 1XW6A 1SVOA 4ZL7A 1K3OA 3RHBA 4EKZA 4AJ7A 4WR4A 4YAVA 5F07A 4EVMA 3O3TA 1SKWB 2DJKA 3I9V2 1ZCPA 4KW6A 4TOPA 1V98A 5G5EA 2NDOA 3IAM2 3ZVJA 1PKWA 3GSSA 4RUVA 1A2LA 1FW1A 3F4SA 3SBCA 2EFDA 5DDLA 1XXUA 3TRQA 5ENUA 3LQ7A 3US3A 3KTBA 3L9VA 1QQ2A 1M2AA 3NOFA 3APOA 2ON7A 2BJXA 2GT6A 1KTEA 4TR4A 2UV8G 3GKXA 1T4YA 2YOIA 2DC5A 4BVXA 5IMAA 2OADA 2C0DA 1YF1A 2HZEA 3HDCA 3VPTA 2TRCP 2HSMA 5ELGA 3ZREA 2LJRA 1S3CA 3V1WA 1QK8A 3ZMLA 2C0FA 5KN1A 2B7KA 1ZMAA 2KP1A 2L6CA 3CMIA 1XVWA 4OMVA 4XIHA 5DAKB 1R5AA 2OE3A 5KEJA 3TCOA 4EUYA 5J47A 1I9DA 1G6WA 2LEGA 4XS4B 2OT3A 4AKIA 4DSRA 2GQLA 4MABA 2R0GA 2I3YA 3HYPA 2R6KA 2GSQA 3IK7A 3GL5A 4F2IA 4TRXA 3QFAC 1U3AA 5AISA 1MD3A 3QCPA 5ID2A 5DQYA 2J9HA 1U87A 1T00A 2IMKA 3H93A 3A2XA 3TJFA 3TRPA 4ECIA 1ABAA 1LU4A 3QPMA 4P3YB 5IOWA 3IK9A 3ZMKA 3HZ4A 4X4JA 1YZXA 2VD0A 3HY2A 3R3EA 2GSRA 3EE2A 4TXOA 3J7Yk 2CVBA 2ES7A 1YEPA 4KF9A 2F3MA 5G30A 5D93A 3H4KA 4AI6A 2HYXA 1BF5A 1WE0A 1MDKA 5EVOA 1X5DA 2MZCA 4O32A 2OBKA 2A4VA 4GCIA 4ISDA 1URMA 2CVDA 4KSMA 3ED3A 5JCWA 2FA4A 1XOAA 4WXTA 1TRVA 3C1RA 1AC1A 4KUNA 3HVSA 2IMDA 2WDUA 2N5AA 5A5HB 4KCAA 2PMTA 2KP2A 2N5BA 3FW2A 5JWOB 4CHSA 1FVJA 1GTBA 3GNJA 4K0GA 5IMZA 1Y6EA 4KDXA 3D0ZA 3L0HA 2QKEA 3HJMA 1O7UA 1R4WA 4G0LA 3UAPA 1FAAA 2F9SA 3GKNA 19GSA 1ON4A 1M99A 2BTOT 2X8CA 4IVFA 2DJ2A 2C80A 2LRTA 4KAEA 4USSA 5H5QA 3TJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIQ A;  3ZFL A;  2I1U A;  2V6O A;  3KMO A;  4WBJ A;  5D9V A;  2PN8 A;  4POB A;  5AIV A;  2H1G A;  1JZR A;  2LJK A;  1EP7 A;  2V6K A;  1QUW A;  2YV9 A;  4MMM A;  2C4J A;  4HUA A;  6GSU A;  4QL9 A;  3IC4 A;  5INY A;  2L57 A;  4HQZ A;  5IOX A;  2LNS A;  1SD8 A;  4L8E A;  1IYH A;  3VPQ A;  1J08 A;  2HRA A;  1AAZ A;  3GUS A;  1OC9 A;  1SJ6 A;  2KOK A;  3ERW A;  2YPM A;  4GLT A;  3TKP A;  3DKS A;  4ECJ A;  1IYI A;  4TXV A;  4OCE A;  4ZBA A;  1M2B A;  1TP9 A;  5D9T A;  4NV2 A;  1OVN A;  4MJA A;  4PGT A;  11GS A;  2GZY A;  2H72 A;  1NW2 A;  2H0H A;  3F6D A;  2OA7 A;  4ZL8 A;  1SL2 B;  3DVW A;  3LYK A;  3HD5 A;  2LQQ A;  4ILF A;  1V9W A;  2B3S A;  3EC3 A;  4POM A;  4BA7 A;  1SJI A;  3ZYW A;  1Q98 A;  2Z9S A;  3LSZ A;  4ZBD A;  1F6M C;  2R3X A;  5IQY A;  1WWJ A;  3APS A;  1SU9 A;  3EUR A;  4K1F A;  3QD9 A;  3RBT A;  3QAV A;  1XPV A;  1EOG A;  3EWL A;  3OR5 A;  3GST A;  5J9B A;  2OJL A;  2HRK A;  1PMT A;  1RQM A;  1Z9H A;  2E7P A;  4PNG A;  3GMF A;  2F51 A;  4ZB8 A;  4K8M A;  5COH A;  1K0C A;  2X8G A;  5D9X A;  5FT3 A;  2VM1 A;  3IRA A;  1JZW A;  3S9F A;  1E6B A;  1O73 A;  2B6M A;  3P2A A;  4NMU A;  2IFQ B;  4MJE A;  5EL8 A;  1GLQ A;  3CSI A;  1R26 A;  3DRN A;  2A2S A;  3I69 A;  4PTS A;  3KH7 A;  4Q5Q A;  2OAC A;  3PIN A;  4IJI A;  1BG5 A;  2GDR A;  1QMV A;  2IN3 A;  4MCU A;  4L0U A;  4EDY A;  4TR1 B;  1HQO A;  1Z5Y E;  1J9B A;  3W6G A;  3WGE A;  1SYR A;  4XS6 A;  4I8B A;  1TU8 A;  4TVE A;  1NM3 A;  2VCX A;  1GLP A;  3QDN A;  4QL7 A;  4HEA 2;  1EEJ A;  3ME8 A;  3LJR A;  3UVH A;  3HKR A;  2H1B A;  4HDE A;  5IO2 A;  5ECM B;  1THO A;  3FZ5 A;  5GAN D;  3C1S A;  2VCW A;  4BPY A;  4KSO A;  1PX7 A;  2B1K A;  2H30 A;  1O85 A;  4IS0 A;  5ECI B;  4LL4 B;  2L5O A;  4KH7 A;  3O6T A;  2O85 A;  4FYC A;  2VCQ A;  4K7I A;  3CTG A;  4LA1 A;  4EC0 A;  2O89 A;  2LKU A;  4IBP A;  3QOU A;  2RII A;  3ZIV A;  5HR1 A;  3FR9 A;  2YWM A;  2XPE A;  1PA3 A;  4KCE A;  3KP9 A;  2L4C A;  3M0F A;  2CVK A;  2PU9 C;  4YQV A;  3Q18 A;  4FYB A;  2NVL A;  5JWQ B;  3CSJ A;  2JAC A;  1XWB A;  1A8Y A;  2F8A A;  2IL3 A;  2H66 A;  2VCT A;  4FQU A;  4QQ7 A;  3UIW A;  5FHI A;  1XOB A;  3VFI A;  3FHK A;  1TRS A;  1YKC A;  3GX0 A;  2JL4 A;  4PQI A;  2YWO A;  3VI7 A;  3ZVJ D;  3BBY A;  3FK8 A;  1A23 A;  3APQ A;  4HI7 A;  2VD1 A;  1HNB A;  5A4V A;  1GSQ A;  3GH9 A;  2OE1 A;  3TDG A;  2VL9 A;  4RI7 A;  2MMO A;  1R7H A;  2LQO A;  5ECO B;  1ACV A;  2WRT A;  4Q5R A;  3W8S A;  4BVY A;  2M72 A;  4E8H A;  1GNW A;  2FWH A;  4MZW A;  3EVI A;  1TK5 B;  3E0U A;  5B6M A;  4X0X A;  1GSY A;  4BVX B;  1FO5 A;  1TJD A;  3ISO A;  2WGR A;  1EWX A;  1B4Q A;  2HZE B;  1YJ6 A;  2E2M A;  4N10 A;  1B48 A;  2GQK A;  3FZ4 A;  1NHO A;  3FYG A;  3FZA A;  2H01 A;  3MNG A;  2P5Q A;  2HSM B;  4N11 A;  2AV4 A;  2C8U A;  3U6V A;  3GA4 A;  5LD0 A;  3HJO A;  1B4P A;  4V1A g;  4AJ8 A;  4ZB6 A;  1Z3E A;  3IC8 A;  2O87 A;  2ZUP A;  3RPP A;  2ALB A;  5ABR A;  4YQU A;  5DJL A;  3DML A;  2CX3 A;  2L6D A;  5DBQ A;  3P7X A;  5H5R A;  3LXT A;  1B9Y C;  4KB3 A;  3SWL A;  5ID2 B;  3VK9 A;  4ECB A;  1TK8 B;  2LJA A;  3PGT A;  3LEF A;  3U5R E;  4F82 A;  2FGX A;  1AXD A;  1BAY A;  3WYW A;  2H74 A;  3C71 A;  3ZL5 A;  2CZ3 A;  1O8X A;  2E0Q A;  2CT6 A;  4Q5F A;  3GH6 A;  1XW9 A;  4MH3 A;  3Q74 A;  3WGD A;  4TXO B;  4F03 A;  2LNT A;  1KEB A;  5F05 A;  2AHE A;  4YQM A;  5F06 A;  1ZYQ B;  2HXK A;  4DEJ A;  3KD0 A;  5DVB A;  4CW9 A;  3KGK A;  4V1A p;  3TKS A;  2AAW A;  4XHM A;  2B5Y A;  2EIR A;  1SKR B;  2PPT A;  1XVQ A;  1VF1 A;  5A4U A;  1WIK A;  5JWR B;  2WFC A;  5IMD A;  4EXJ A;  1O6J A;  2GZP A;  1G0T A;  3H1N A;  1K3L A;  1HD2 A;  5EY6 A;  2FNO A;  1UVZ A;  2YZH A;  3A2V A;  2VOC A;  5H5S A;  1Q4J A;  2AYT A;  3K8N A;  3CRU A;  3N5O A;  5HFK A;  2YJ7 A;  4RI6 A;  3F4R A;  2GT5 A;  4TR3 A;  2MBS A;  4KDU A;  3J7Y b;  4V2M A;  1OE8 A;  4F0B A;  3GIX A;  4AJ6 A;  3E3E A;  1ST9 A;  4GSS A;  1OYJ A;  1V57 A;  2DML A;  1FHE A;  4GST A;  5KN3 A;  1X9W B;  4FIW A;  1TXX A;  1I5G A;  4I2T A;  5JCG A;  4KE3 A;  2CV4 A;  3TKR A;  5DQS A;  1X0R A;  3TRX A;  2VLT A;  2VIM A;  4PX1 A;  3F3R A;  4L0W A;  2MBT A;  4GWR A;  2YWN A;  4MZC A;  2X64 A;  4DVC A;  3IE3 A;  3PR8 A;  1JLW A;  5J9C A;  2IPA A;  2H1A A;  4JR4 A;  2FWE A;  1XBS A;  3EU3 A;  2IJY A;  5G5F A;  3CBU A;  1GTI A;  2M80 A;  2TIR A;  1OC9 B;  1GUK A;  1EOH A;  4OFN A;  1YQ1 A;  5GST A;  1PGT A;  4WF4 A;  4BL7 A;  2I4A A;  2HSH A;  3HXS A;  2YNX A;  1GL8 A;  2H71 A;  3D21 A;  1O81 A;  2NPB A;  4POL A;  5CYY A;  3IR4 A;  1EP8 A;  5AN1 A;  3GX8 A;  4PUF C;  4FO5 A;  1YF0 A;  3KTL A;  2E2G A;  2O7K A;  1ILO A;  3F4T A;  6GSV A;  3KEB A;  4ZL9 A;  3GTU A;  2VLU A;  1JZD A;  1WP0 A;  3MSZ A;  4MF5 A;  4H86 A;  3TJB A;  4HJM A;  14GS A;  3UL3 A;  1EGO A;  3TKQ A;  2LRC A;  2EC4 A;  1NHY A;  3D4T A;  4I97 A;  1M9A A;  1THX A;  1U88 A;  5GSS A;  3IAS 2;  2EIO A;  3KH9 A;  5ECH B;  1MEK A;  2V41 A;  4KA0 A;  2HRK B;  2GZZ A;  4HS1 A;  2RUF A;  6GSX A;  1UA5 A;  1YEX A;  5IMC A;  4OO4 A;  4DSS A;  3HVV A;  6GST A;  16GS A;  4EDZ A;  2DMM A;  1JLV A;  4E8E A;  4NV5 A;  1NSW A;  2B7J A;  5IO0 A;  1TRU A;  4IP1 A;  1BED A;  2P5R A;  4CDO A;  2LUS A;  2G0F A;  5CO3 A;  3FR3 A;  4ULX A;  2HFD A;  3HA9 A;  3UEM A;  1QFN A;  1WPI A;  1X5E A;  1TDI A;  3KIJ A;  3L78 A;  2FLS A;  1EV9 A;  2CZ2 A;  5IMF A;  5ELA A;  3VUR A;  4KND A;  3VWV A;  3IA1 A;  4JU5 A;  1N8J A;  3UOM A;  1BQ7 A;  2HSY A;  4Z7X A;  1BYE A;  3EMP A;  2VCV A;  5CRD A;  1XIY A;  5DAL A;  4X43 A;  1RK4 A;  2LST A;  2FHE A;  4GRF A;  3ME7 A;  1VGL A;  3FY7 A;  4TW5 A;  1C72 A;  3Q6O A;  1K3Y A;  2GQM A;  2HQT A;  2PVQ A;  1YDK A;  3QAW A;  2XHF A;  5B8B A;  1M7T A;  1H75 A;  2N5F A;  2TRX A;  1M2D A;  5HQP A;  1EGR A;  4TN8 A;  1T8E B;  4IQA A;  2C1Y A;  5LCZ A;  2ZNM A;  2K18 A;  1VRS D;  5HFG A;  2HLS A;  4GF0 A;  4ZB9 A;  5HFI A;  1K0B A;  1GWC A;  4XTS A;  3KZQ A;  2MMN A;  1T1V A;  4JR6 A;  4J56 E;  4PQH A;  5IMV A;  1VF4 A;  3LYP A;  2H1D A;  2RM5 A;  3ZRD A;  4MK3 A;  2DJ1 A;  3BD2 A;  5E4W A;  4GSN A;  4IEL A;  1GSF A;  3F8U A;  3G7J A;  2F8F A;  4MF7 A;  2H6X A;  1DE2 A;  1XZO A;  2FD3 A;  5A5K A;  1K0M A;  2FA8 A;  4V2L A;  3GUR A;  2NBS A;  1F3B A;  3FR6 A;  1FG4 A;  3LG6 A;  3HZ8 A;  1A0R P;  5CRW A;  3VWU A;  1OKD A;  3ZIJ A;  5GAP D;  4ECC A;  5C04 A;  1PX6 A;  1VF3 A;  3MDK A;  2YAN A;  1TRW A;  2L5L A;  3UBL A;  4HZ2 A;  4NWY A;  1Z6M A;  1OC3 A;  9GSS A;  1FB0 A;  1J0F A;  2KLX A;  4KX4 A;  4FH8 A;  2DJ0 A;  1T4Z A;  1TK0 B;  2DIY A;  3DWV A;  5F0G A;  4HU7 A;  3WT1 A;  2WUL A;  5C00 A;  3GKM A;  4BVY B;  4MF6 A;  12GS A;  4F0C A;  4MP4 A;  3TB2 A;  1YY7 A;  2R2J A;  1MDI A;  2YCD A;  3WD6 A;  1T7P B;  1TI3 A;  1GSU A;  1K0D A;  5EPF A;  1FVK A;  1X5C A;  1ERU A;  4KDY A;  2JZT A;  2RM6 A;  4NPB A;  1USB A;  5DCG A;  2LTK A;  1SJZ A;  1GSS A;  5B6N A;  1MD4 A;  2VAF A;  4JRR A;  2VL2 A;  2WCI A;  5ECL B;  3TOU A;  3KCM A;  3O76 A;  4PXO A;  1X9S B;  1CQG A;  1PL2 A;  5ECN B;  5KN0 A;  5AIX A;  3MAK A;  1GH2 A;  1ZZY A;  3D6I A;  4MDC A;  1JZO A;  3ERF A;  4MPG A;  2RUE A;  4K6X A;  4L5L A;  1XW5 A;  4RQR A;  3ZFB A;  2B1L A;  3TJG A;  1ERW A;  5GZZ B;  4IHU A;  4WF5 A;  2B5E A;  4G0K A;  4EE0 A;  2K9F A;  2H6Z A;  1MDJ A;  1K0A A;  3E9J B;  5HR2 A;  4MPF A;  5IPG A;  4WEY A;  1OC8 A;  2HT9 A;  2X99 A;  2YV7 A;  4HU9 A;  3G9B A;  3A2W A;  3DD3 A;  3KM6 A;  3I43 A;  2M46 A;  5CAX A;  1AQX A;  6GSW A;  1ZYE A;  1F3A A;  4HZ4 A;  2IMF A;  3HJP A;  1AQV A;  3NZN A;  1TOF A;  3FEU A;  1WMJ A;  2PUK C;  5JCU A;  2DIZ A;  2YN1 A;  4ZIL A;  4HOJ A;  4D73 A;  3H79 A;  1ZL9 A;  1TKD B;  2R37 A;  5J41 A;  3NIV A;  4ZXG A;  4G9H A;  3C73 A;  4I6X A;  4ML6 A;  4EF0 A;  1X9M B;  4NHW A;  3BJ5 A;  4ZIJ A;  1SK2 A;  1OE7 A;  1JFU A;  18GS A;  1TU7 A;  2G2Q A;  2R4V A;  1OKT A;  4PNF A;  4IW9 A;  1Z7P A;  4Q5N A;  2C0E A;  2H8L A;  1A2J A;  1XWC A;  2R5G A;  2BMX A;  3IHQ A;  2GLR A;  2VO4 A;  1GRX A;  1SL0 B;  2PWJ A;  1N2A A;  1GUH A;  2NTO A;  2REM A;  2H73 A;  3EMX A;  3KP8 A;  2DJJ A;  3DGQ A;  4IN0 A;  4FYU A;  1PN9 A;  3L4N A;  3L9U A;  2VUP A;  2C3N A;  4X1U A;  1AUC A;  4OD7 A;  1UN2 A;  1GSD A;  4OCF A;  2QC7 A;  3GYK A;  5HR0 A;  1Z6N A;  3FKF A;  5A4W A;  4BL7 B;  2AB6 A;  4MH2 A;  5E59 A;  1ERT A;  4XS1 A;  1EEM A;  2PVO C;  5CRE A;  2HRF A;  1BJX A;  4NXI A;  4ZBB A;  4JBB A;  1S3A A;  2WJU A;  1XWK A;  1O8W A;  1KBN A;  4POK A;  3PPU A;  4AGS A;  2O8V B;  4MJB A;  2XC2 A;  3JCM L;  2GVP A;  4NHZ A;  1DSB A;  2P31 A;  4J57 E;  3GTU B;  2AUV A;  3IXR A;  4PUA A;  3VWX A;  3WGX A;  3M9K A;  13GS A;  2CQ9 A;  2OKA A;  4YH2 A;  3G7Y A;  4YAP A;  1GUL A;  3TKS C;  1GSE A;  1V2A A;  3C8E A;  3RAZ A;  2L59 A;  4TR0 A;  3LXZ A;  3I6A A;  2JAD A;  2DSA A;  2IIY A;  1WJK A;  3IV4 A;  1U3I A;  3EYT A;  4XRD A;  4LMV A;  4OFM A;  1ZOF A;  2V1M A;  4GTU A;  4O5R A;  4AF2 A;  4DSS B;  2FCH A;  3IBH A;  4LMW A;  3L9S A;  2OE0 A;  1PL1 A;  2FY6 A;  3HVX A;  4F9Z A;  3D5J A;  3GV1 A;  3DYR A;  1S3D A;  5J3R A;  2LV3 A;  3F63 A;  2CA8 A;  3FZ9 A;  3QR6 A;  4K0N A;  1GP1 A;  5D73 A;  5DAK A;  3LWA A;  4IP6 A;  1A24 A;  3ZLP A;  1HNA A;  4RQX A;  4MZB A;  5DCH A;  3CRT A;  4XRA A;  4XS4 A;  2ON5 A;  3M9J A;  1GUM A;  3N9J A;  4G10 A;  1AQW A;  1E2Y A;  2A2R A;  1YKA A;  4WR5 A;  4IQ1 A;  1Y25 A;  2HZF A;  3P90 A;  3F9U A;  6GSY A;  1F37 A;  1OAZ A;  5DAL B;  3F0I A;  4IJ3 A;  2MMZ A;  4JE1 A;  2PBJ A;  2DJ3 A;  2V2G A;  2QGV A;  5B8A A;  6GSS A;  1A0F A;  3IPZ A;  3UMA A;  4PQ1 A;  4OO5 A;  4LLR A;  3LFL A;  1XFL A;  1ML6 A;  1T3B A;  1B9X C;  3D4M A;  5D8I A;  2XBQ A;  4G2E A;  5KN2 A;  3DEX A;  7GSS A;  5ECP B;  3TGZ A;  1SL1 B;  2JU5 A;  5ECS A;  3RHC A;  3PH9 A;  2PGT A;  4K2D A;  1AIU A;  1PRX A;  5F8B A;  2H0I A;  1W4V A;  2H19 A;  3M3M A;  1XWG A;  4GQC A;  3DXB A;  2GSS A;  2PER A;  3UVT A;  2P0G A;  2J23 A;  1U6T A;  1WOU A;  1BX9 A;  4OFT A;  17GS A;  2JZR A;  3KXO A;  8GSS A;  3GKK A;  4G0I A;  5L71 A;  4WBR D;  2C3Q A;  1XWA A;  10GS A;  2YWI A;  2VL3 A;  1UC7 A;  2YJH A;  5ECK B;  1LJR A;  1RW1 A;  5CP1 A;  4NAX A;  20GS A;  2ZCT A;  3KJY A;  1G7O A;  3D22 A;  2JSY A;  2CAI A;  1SYX A;  1Z7R A;  5ECQ B;  3IDV A;  3W8J A;  1DBY A;  1HYU A;  2GGT A;  3UBK A;  3GFK A;  2HE3 A;  4GXZ A;  5IIZ A;  3VI5 A;  2VCZ A;  2D2Z A;  3R2Q A;  4OWY A;  4V2N A;  5HR3 A;  1W89 A;  2HRN A;  3M1G A;  4O7H A;  2YP6 A;  2GS3 A;  1H4O A;  3QMX A;  2X8H A;  2FWG A;  2K8S A;  1PQN A;  5CRH A;  3IOS A;  3ERG A;  2RLI A;  5D9W A;  2LRN A;  4GQF A;  4K7N A;  2VM2 A;  2V32 A;  3H8Q A;  4HQS A;  1VF2 A;  3ZIT A;  1SK0 A;  2H75 A;  4G19 A;  3G7I A;  4HJ2 A;  1A2M A;  2OBI A;  5CRG A;  1DUG A;  5B7C A;  3KMN A;  1FB6 A;  2HI7 A;  3HHV A;  2HSN B;  5ECR B;  2DLX A;  1TW9 A;  2FUG 2;  2H70 A;  3BCK A;  4DSQ A;  2QSI A;  2GST A;  2HNL A;  4JED A;  1F2E A;  1M9B A;  1GTA A;  1PD2 1;  4KGI A;  3A3T A;  3P8W A;  2YZU A;  4N0V A;  3QAG A;  1SD9 A;  1F9M A;  2DBC A;  5J4U A;  1PSQ A;  3M8N A;  2CX4 A;  3CSH A;  4JZQ A;  5IPH A;  2AJQ B;  2FWF A;  2L4Q A;  2CAQ A;  2I81 A;  3DVX A;  2MYG A;  2H6Y A;  5G31 A;  2XBI A;  5FWG A;  4ML1 A;  4LL1 B;  3GN3 A;  4L5O A;  4WKW A;  3TUE A;  1CQH A;  3TOT A;  22GS A;  2B5X A;  5BMU A;  4I2U A;  1G7E A;  4K9Z A;  4BWQ A;  1MTC A;  2IMI A;  1WRY A;  1SKS B;  1LBK A;  1A8L A;  4ACS A;  3TJJ A;  3CYN A;  3VWW A;  2I9H A;  3C7M A;  3WT2 A;  1TTZ A;  2IFQ A;  4BWS A;  1GNE A;  3RPN A;  4IKH A;  1HNC A;  4EL1 A;  2WB9 A;  2K8V A;  1PKZ A;  1V58 A;  3F3Q A;  4N0Z A;  3GHA A;  3LGC A;  3UAR A;  1EV4 A;  2JZS A;  4TR1 A;  1ERV A;  1TI1 A;  3A5W A;  2H76 A;  4D73 B;  5LNK e;  3ZZX A;  1DE1 A;  3LOR A;  1G6Y A;  3MWH A;  3F6F A;  1EZK A;  3ZTL A;  5IM9 A;  2K6V A;  2WS2 A;  3TKS E;  5AGY A;  1SK1 A;  5G1L A;  5J5N A;  5G1K A;  1QGV A;  2IME A;  4PUR A;  5CNW A;  1GTU A;  1R5P A;  3UJ1 A;  4N30 A;  3GL3 A;  2GTU A;  1QXH A;  2LS5 A;  4MLY A;  3BCI A;  3FRC A;  2KHP A;  3RDW A;  3DIE A;  2WZ9 A;  4I5Q A;  4MJC A;  4TKY A;  4MA9 A;  1B8X A;  2VL2 C;  4J2F A;  2C3T A;  2MMA A;  4O92 A;  2H0G A;  5G2Z A;  1K0O A;  1KNG A;  2KUC A;  3EIN A;  4EO3 A;  5D96 A;  1ZGN A;  3CTF A;  3QFB C;  2JSZ A;  2XPD A;  1JHB A;  4IGJ A;  1M0U A;  3Q19 A;  4ID0 A;  3AY8 A;  1FOV A;  1K0N A;  2C0G A;  4XCS A;  3CXG A;  3BOA A;  4K7O A;  3VLN A;  1V40 A;  3HCZ A;  1AW9 A;  5DJM A;  3EU4 A;  4WET A;  2IWT A;  3GRX A;  2UZ8 A;  2VLV A;  1SEN A;  1XCC A;  1XW6 A;  4ZL7 A;  1K3O A;  3RHB A;  4EKZ A;  4AJ7 A;  4WR4 A;  4YAV A;  5F07 A;  4EVM A;  3O3T A;  1SKW B;  2DJK A;  3I9V 2;  1ZCP A;  4KW6 A;  4TOP A;  1V98 A;  5G5E A;  2NDO A;  3IAM 2;  3ZVJ A;  1PKW A;  3GSS A;  4RUV A;  1A2L A;  1FW1 A;  3F4S A;  3SBC A;  5DDL A;  1XXU A;  3TRQ A;  5ENU A;  3LQ7 A;  3US3 A;  3KTB A;  3L9V A;  1QQ2 A;  1M2A A;  3NOF A;  3APO A;  2ON7 A;  2BJX A;  2GT6 A;  1KTE A;  4TR4 A;  3GKX A;  1T4Y A;  2YOI A;  2DC5 A;  4BVX A;  5IMA A;  2OAD A;  2C0D A;  1YF1 A;  2HZE A;  3HDC A;  3VPT A;  2TRC P;  2HSM A;  5ELG A;  3ZRE A;  2LJR A;  1S3C A;  3V1W A;  1QK8 A;  3ZML A;  2C0F A;  5KN1 A;  2B7K A;  1ZMA A;  2KP1 A;  2L6C A;  3CMI A;  1XVW A;  4OMV A;  4XIH A;  5DAK B;  1R5A A;  2OE3 A;  5KEJ A;  3TCO A;  4EUY A;  1I9D A;  1G6W A;  2LEG A;  4XS4 B;  4DSR A;  2GQL A;  4MAB A;  2I3Y A;  3HYP A;  2R6K A;  2GSQ A;  3IK7 A;  3GL5 A;  4F2I A;  4TRX A;  3QFA C;  1U3A A;  5AIS A;  1MD3 A;  3QCP A;  5ID2 A;  5DQY A;  2J9H A;  1U87 A;  1T00 A;  2IMK A;  3H93 A;  3A2X A;  3TJF A;  3TRP A;  4ECI A;  1ABA A;  1LU4 A;  3QPM A;  4P3Y B;  5IOW A;  3IK9 A;  3ZMK A;  3HZ4 A;  1YZX A;  2VD0 A;  3HY2 A;  3R3E A;  2GSR A;  3EE2 A;  4TXO A;  3J7Y k;  2CVB A;  2ES7 A;  1YEP A;  4KF9 A;  2F3M A;  5G30 A;  5D93 A;  3H4K A;  2HYX A;  1WE0 A;  1MDK A;  5EVO A;  1X5D A;  2MZC A;  4O32 A;  2OBK A;  2A4V A;  4GCI A;  4ISD A;  1URM A;  2CVD A;  4KSM A;  3ED3 A;  5JCW A;  2FA4 A;  1XOA A;  4WXT A;  1TRV A;  3C1R A;  1AC1 A;  4KUN A;  3HVS A;  2IMD A;  2WDU A;  2N5A A;  4KCA A;  2PMT A;  2KP2 A;  2N5B A;  3FW2 A;  5JWO B;  4CHS A;  1FVJ A;  1GTB A;  3GNJ A;  4K0G A;  5IMZ A;  1Y6E A;  4KDX A;  3D0Z A;  3L0H A;  2QKE A;  3HJM A;  1O7U A;  1R4W A;  4G0L A;  3UAP A;  1FAA A;  2F9S A;  3GKN A;  19GS A;  1ON4 A;  1M99 A;  2BTO T;  2X8C A;  4IVF A;  2DJ2 A;  2C80 A;  2LRT A;  4KAE A;  4USS A;  5H5Q A;  3TJK A; 
#chains in the Genus database with same CATH topology
 2EIQ A;  3ZFL A;  2I1U A;  2V6O A;  3KMO A;  4WBJ A;  5D9V A;  2PN8 A;  4POB A;  5AIV A;  2H1G A;  1JZR A;  2LJK A;  1EP7 A;  2V6K A;  1QUW A;  2YV9 A;  4MMM A;  2C4J A;  4HUA A;  6GSU A;  4QL9 A;  3IC4 A;  5INY A;  2L57 A;  4HQZ A;  4YKG A;  5IOX A;  2LNS A;  1SD8 A;  4L8E A;  1IYH A;  3VPQ A;  1J08 A;  2HRA A;  1AAZ A;  3GUS A;  1OC9 A;  1SJ6 A;  2KOK A;  3ERW A;  2YPM A;  4GLT A;  3TKP A;  3DKS A;  4ECJ A;  1IYI A;  4TXV A;  4OCE A;  4ZBA A;  1M2B A;  1TP9 A;  5D9T A;  4NV2 A;  1OVN A;  4MJA A;  4PGT A;  11GS A;  2GZY A;  2H72 A;  1NW2 A;  2H0H A;  3F6D A;  2OA7 A;  4ZL8 A;  1SL2 B;  3DVW A;  3LYK A;  3HD5 A;  2LQQ A;  4ILF A;  1V9W A;  2B3S A;  3EC3 A;  4EIP A;  4POM A;  4BA7 A;  1SJI A;  3ZYW A;  1Q98 A;  4MNN A;  2Z9S A;  3LSZ A;  4ZBD A;  1F6M C;  2R3X A;  5IQY A;  1WWJ A;  1M3J A;  3APS A;  1SU9 A;  3EUR A;  4K1F A;  3QD9 A;  3RBT A;  3QAV A;  1XPV A;  1EOG A;  3EWL A;  3OR5 A;  3GST A;  5J9B A;  2OJL A;  5BMU B;  2HRK A;  4G01 A;  1PMT A;  1RQM A;  1Z9H A;  2E7P A;  4PNG A;  3GMF A;  2F51 A;  4ZB8 A;  4K8M A;  5COH A;  1K0C A;  2X8G A;  5D9X A;  5FT3 A;  2VM1 A;  3IRA A;  1JZW A;  3S9F A;  1E6B A;  1O73 A;  2B6M A;  3P2A A;  4NMU A;  2IFQ B;  4MJE A;  5EL8 A;  1GLQ A;  3CSI A;  1R26 A;  3DRN A;  2A2S A;  3I69 A;  4PTS A;  3KH7 A;  4Q5Q A;  2OAC A;  3PIN A;  4IJI A;  1BG5 A;  2WW1 A;  2GDR A;  1QMV A;  2IN3 A;  4MCU A;  4L0U A;  4EDY A;  4TR1 B;  1HQO A;  2WVX B;  1Z5Y E;  1J9B A;  3W6G A;  3WGE A;  1SYR A;  4XS6 A;  4I8B A;  1TU8 A;  4TVE A;  1NM3 A;  2VCX A;  1GLP A;  2QA2 A;  3QDN A;  4QL7 A;  4HEA 2;  1EEJ A;  3ME8 A;  3LJR A;  3UVH A;  1YEW C;  3HKR A;  2H1B A;  4HDE A;  5IO2 A;  5ECM B;  1THO A;  3FZ5 A;  5GAN D;  4AKX B;  4N3Z A;  2EFC A;  3C1S A;  2VCW A;  3CWG A;  4BPY A;  4KSO A;  1PX7 A;  2B1K A;  2H30 A;  1O85 A;  4IS0 A;  5ECI B;  4LL4 B;  2L5O A;  4KH7 A;  3O6T A;  2O85 A;  4FYC A;  2VCQ A;  4K7I A;  3CTG A;  4LA1 A;  4EC0 A;  2O89 A;  2LKU A;  4IBP A;  3QOU A;  2RII A;  3ZIV A;  5HR1 A;  3FR9 A;  2YWM A;  2XPE A;  1PA3 A;  4KCE A;  3KP9 A;  2L4C A;  2QA1 A;  3M0F A;  2CVK A;  2PU9 C;  4YQV A;  3Q18 A;  4FYB A;  2NVL A;  5JWQ B;  3CSJ A;  4K5R A;  3MIX A;  2JAC A;  1XWB A;  1A8Y A;  2F8A A;  2IL3 A;  2H66 A;  2VCT A;  4FQU A;  4QQ7 A;  3UIW A;  5FHI A;  1XOB A;  3VFI A;  3FHK A;  1TRS A;  1YKC A;  3GX0 A;  2JL4 A;  4PQI A;  2YWO A;  5A34 A;  3VI7 A;  3ZVJ D;  3BBY A;  3FK8 A;  1A23 A;  3APQ A;  4HI7 A;  2VD1 A;  1HNB A;  5A4V A;  1GSQ A;  3GH9 A;  2OE1 A;  3TDG A;  2VL9 A;  4RI7 A;  2MMO A;  1R7H A;  2LQO A;  5ECO B;  1ACV A;  2WRT A;  4Q5R A;  3W8S A;  4BVY A;  2M72 A;  4E8H A;  1GNW A;  2FWH A;  4MZW A;  4Z2U A;  3EVI A;  1TK5 B;  3E0U A;  5B6M A;  4X0X A;  1GSY A;  4BVX B;  1FO5 A;  1TJD A;  3ISO A;  2WGR A;  1EWX A;  1B4Q A;  3MYD A;  2HZE B;  1YJ6 A;  2E2M A;  4N10 A;  1B48 A;  2GQK A;  3FZ4 A;  1BG1 A;  1NHO A;  3FYG A;  3FZA A;  2H01 A;  3MNG A;  2P5Q A;  2HSM B;  4N11 A;  2AV4 A;  2C8U A;  3U6V A;  3GA4 A;  5LD0 A;  3HJO A;  1B4P A;  4V1A g;  4AJ8 A;  5A1N A;  4ZB6 A;  1Z3E A;  3IC8 A;  2O87 A;  2ZUP A;  3RPP A;  4AKH A;  2ALB A;  5ABR A;  4YQU A;  5DJL A;  3DML A;  2O3E A;  2CX3 A;  2L6D A;  5DBQ A;  3P7X A;  5H5R A;  3LXT A;  1B9Y C;  2WW3 A;  4KB3 A;  3SWL A;  5ID2 B;  3VK9 A;  4ECB A;  1TK8 B;  1PN0 A;  2LJA A;  3PGT A;  3LEF A;  3U5R E;  4F82 A;  2FGX A;  1AXD A;  1BAY A;  3WYW A;  2H74 A;  3C71 A;  3ZL5 A;  2CZ3 A;  1O8X A;  2E0Q A;  2CT6 A;  4Q5F A;  3GH6 A;  1XW9 A;  1S3R A;  1FOH A;  4MH3 A;  3Q74 A;  3WGD A;  4TXO B;  4F03 A;  2LNT A;  1KEB A;  5F05 A;  2AHE A;  4YQM A;  5F06 A;  1ZYQ B;  2HXK A;  4DEJ A;  3KD0 A;  5DVB A;  4CW9 A;  3KGK A;  4V1A p;  3TKS A;  2AAW A;  4XHM A;  2B5Y A;  2EIR A;  1SKR B;  2PPT A;  1XVQ A;  1VF1 A;  5A4U A;  1WIK A;  5JWR B;  2WFC A;  5IMD A;  4EXJ A;  1O6J A;  2GZP A;  1G0T A;  3H1N A;  1K3L A;  1HD2 A;  5EY6 A;  2FNO A;  5KOW A;  1UVZ A;  2YZH A;  3A2V A;  2VOC A;  5H5S A;  1Q4J A;  2AYT A;  3K8N A;  3CRU A;  3N5O A;  5HFK A;  2YJ7 A;  4RI6 A;  3F4R A;  2GT5 A;  4TR3 A;  2MBS A;  4KDU A;  3J7Y b;  4V2M A;  1OE8 A;  4F0B A;  3GIX A;  4AJ6 A;  3E3E A;  1ST9 A;  4GSS A;  1OYJ A;  1V57 A;  2DML A;  1FHE A;  4GST A;  5KN3 A;  1X9W B;  4FIW A;  1TXX A;  1I5G A;  2WW0 A;  4I2T A;  5JCG A;  4KE3 A;  2CV4 A;  3TKR A;  5DQS A;  1X0R A;  3TRX A;  2VLT A;  2VIM A;  4PX1 A;  3F3R A;  4L0W A;  2MBT A;  4GWR A;  2YWN A;  4MZC A;  2X64 A;  4DVC A;  3IE3 A;  3PR8 A;  1JLW A;  5J9C A;  2IPA A;  2H1A A;  4JR4 A;  3TU3 B;  2FWE A;  1XBS A;  3EU3 A;  2IJY A;  5G5F A;  4EIQ A;  3CBU A;  1GTI A;  2M80 A;  2TIR A;  1OC9 B;  1GUK A;  1EOH A;  4OFN A;  1YQ1 A;  5GST A;  1PGT A;  4WF4 A;  4BL7 A;  2I4A A;  2HSH A;  3HXS A;  2YNX A;  1GL8 A;  2H71 A;  3D21 A;  1O81 A;  2NPB A;  2O5V A;  4POL A;  5CYY A;  3IR4 A;  1EP8 A;  5AN1 A;  3GX8 A;  4PUF C;  4FO5 A;  1YF0 A;  3KTL A;  2E2G A;  2O7K A;  1ILO A;  3F4T A;  6GSV A;  3KEB A;  4ZL9 A;  3GTU A;  2VLU A;  1JZD A;  1WP0 A;  3MSZ A;  4MF5 A;  4H86 A;  3TJB A;  3LW9 A;  4HJM A;  14GS A;  3UL3 A;  1EGO A;  3TKQ A;  2LRC A;  2EC4 A;  1NHY A;  3D4T A;  4I97 A;  1M9A A;  1THX A;  1U88 A;  5GSS A;  3IAS 2;  2EIO A;  3KH9 A;  5ECH B;  1MEK A;  2V41 A;  2EFE A;  2HRK B;  4KA0 A;  2GZZ A;  4HS1 A;  2RUF A;  6GSX A;  1UA5 A;  1YEX A;  5IMC A;  4OO4 A;  4DSS A;  3HVV A;  6GST A;  16GS A;  4EDZ A;  2DMM A;  1JLV A;  4E8E A;  4NV5 A;  1NSW A;  2B7J A;  5IO0 A;  1TRU A;  4IP1 A;  1BED A;  2P5R A;  4CDO A;  4E68 A;  2LUS A;  2G0F A;  5CO3 A;  3FR3 A;  4ULX A;  2HFD A;  1PFO A;  3HA9 A;  3UEM A;  1QFN A;  1WPI A;  1X5E A;  1TDI A;  3KIJ A;  3L78 A;  2FLS A;  1EV9 A;  3RFR C;  2CZ2 A;  5IMF A;  5ELA A;  3VUR A;  4KND A;  3VWV A;  4AKG A;  3IA1 A;  4JU5 A;  1N8J A;  3UOM A;  1BQ7 A;  2HSY A;  4Z7X A;  1BYE A;  3EMP A;  2VCV A;  5CRD A;  1XIY A;  5DAL A;  4X43 A;  1RK4 A;  2LST A;  2FHE A;  4GRF A;  3ME7 A;  1VGL A;  1SVL A;  3FY7 A;  4TW5 A;  1C72 A;  3Q6O A;  1K3Y A;  2GQM A;  2HQT A;  2PVQ A;  1YDK A;  3QAW A;  2XHF A;  5B8B A;  1M7T A;  1H75 A;  2N5F A;  2TRX A;  4K2X A;  1M2D A;  5HQP A;  1EGR A;  4TN8 A;  1T8E B;  4IQA A;  2C1Y A;  5LCZ A;  2ZNM A;  2K18 A;  1VRS D;  5HFG A;  2HLS A;  4GF0 A;  4ZB9 A;  5HFI A;  4A5P A;  4Z2R A;  1K0B A;  1GWC A;  4XTS A;  3KZQ A;  2MMN A;  1T1V A;  4JR6 A;  4J56 E;  4PQH A;  5IMV A;  1VF4 A;  3LYP A;  2H1D A;  2RM5 A;  3ZRD A;  4MK3 A;  2DJ1 A;  3BD2 A;  5E4W A;  4GSN A;  4IEL A;  1GSF A;  3F8U A;  3G7J A;  2F8F A;  4MF7 A;  2H6X A;  1DE2 A;  1XZO A;  2FD3 A;  5A5K A;  1K0M A;  2FA8 A;  4V2L A;  3GUR A;  2NBS A;  1F3B A;  3FR6 A;  1FG4 A;  3LG6 A;  3HZ8 A;  1A0R P;  5CRW A;  3VWU A;  1OKD A;  3ZIJ A;  5GAP D;  4ECC A;  5C04 A;  1PX6 A;  1VF3 A;  3MDK A;  2YAN A;  1TRW A;  2L5L A;  3UBL A;  4HZ2 A;  4NWY A;  1Z6M A;  1OC3 A;  9GSS A;  1FB0 A;  1TXU A;  1J0F A;  2KLX A;  4KX4 A;  4FH8 A;  2DJ0 A;  1T4Z A;  1TK0 B;  2DIY A;  3DWV A;  5F0G A;  4HU7 A;  3WT1 A;  2WUL A;  5C00 A;  3GKM A;  4BVY B;  4HSC X;  4MF6 A;  12GS A;  4Z2T A;  4F0C A;  4MP4 A;  3TB2 A;  1YY7 A;  2R2J A;  1MDI A;  2YCD A;  3WD6 A;  1T7P B;  1ZYP A;  2HSN A;  1TI3 A;  1GSU A;  1K0D A;  5EPF A;  4ICY A;  1FVK A;  1X5C A;  1ERU A;  4KDY A;  2JZT A;  2RM6 A;  4NPB A;  1USB A;  5DCG A;  2LTK A;  2WW2 A;  1SJZ A;  1GSS A;  5B6N A;  1MD4 A;  2VAF A;  4JRR A;  2VL2 A;  2WCI A;  5ECL B;  3TOU A;  3KCM A;  3O76 A;  4PXO A;  1X9S B;  1CQG A;  1PL2 A;  5ECN B;  5KN0 A;  5AIX A;  4PHZ C;  3MAK A;  1GH2 A;  1ZZY A;  3D6I A;  4MDC A;  1JZO A;  3ERF A;  4MPG A;  2A4H A;  2RUE A;  4K6X A;  4L5L A;  1XW5 A;  4RQR A;  3ZFB A;  2B1L A;  3TJG A;  1ERW A;  5GZZ B;  4IHU A;  4WF5 A;  3CQF A;  2B5E A;  4G0K A;  4EE0 A;  2K9F A;  2H6Z A;  1MDJ A;  1K0A A;  3E9J B;  5HR2 A;  4MPF A;  5IPG A;  4WEY A;  2VKZ G;  1OC8 A;  2HT9 A;  2X99 A;  2YV7 A;  2DKI A;  2X49 A;  4HU9 A;  3G9B A;  3A2W A;  3DD3 A;  3KM6 A;  3I43 A;  2M46 A;  5CAX A;  1AQX A;  1M3I A;  6GSW A;  1ZYE A;  1F3A A;  4HZ4 A;  2IMF A;  3HJP A;  1AQV A;  3NZN A;  1TOF A;  3FEU A;  1WMJ A;  2PUK C;  5JCU A;  2DIZ A;  2YN1 A;  4ZIL A;  4HOJ A;  4D73 A;  3H79 A;  1ZL9 A;  1TKD B;  2R37 A;  5J41 A;  3NIV A;  4ZXG A;  4G9H A;  3C73 A;  4I6X A;  4ML6 A;  4EF0 A;  1X9M B;  4NHW A;  3BJ5 A;  4ZIJ A;  1SK2 A;  1OE7 A;  1JFU A;  18GS A;  1TU7 A;  2G2Q A;  4K5S A;  2R4V A;  1OKT A;  4PNF A;  4IW9 A;  1Z7P A;  4BIK A;  4Q5N A;  2C0E A;  2H8L A;  1A2J A;  1XWC A;  2R5G A;  5KOX A;  2BMX A;  3IHQ A;  2GLR A;  2VO4 A;  1GRX A;  4GDF A;  1SL0 B;  2PWJ A;  1N2A A;  1GUH A;  2NTO A;  2REM A;  2H73 A;  2R0P A;  3EMX A;  3KP8 A;  2DJJ A;  3DGQ A;  4IN0 A;  4FYU A;  1PN9 A;  3L4N A;  3L9U A;  2VUP A;  2C3N A;  2WVZ A;  4X1U A;  1AUC A;  4OD7 A;  1UN2 A;  1GSD A;  4OCF A;  2QC7 A;  3GYK A;  5HR0 A;  1Z6N A;  3FKF A;  5A4W A;  4BL7 B;  3RGB C;  2AB6 A;  4MH2 A;  5E59 A;  1ERT A;  4XS1 A;  1EEM A;  2PVO C;  5CRE A;  2HRF A;  1BJX A;  4NXI A;  4ZBB A;  4JBB A;  1S3A A;  2WJU A;  1XWK A;  1O8W A;  1KBN A;  4POK A;  3PPU A;  4AGS A;  2O8V B;  4MJB A;  2XC2 A;  3JCM L;  2GVP A;  4NHZ A;  1DSB A;  2P31 A;  4J57 E;  3GTU B;  2AUV A;  4QMK A;  3IXR A;  4PUA A;  3VWX A;  3WGX A;  3M9K A;  13GS A;  2CQ9 A;  2OKA A;  4YH2 A;  3G7Y A;  4YAP A;  1GUL A;  3TKS C;  1GSE A;  1V2A A;  3C8E A;  3RAZ A;  2L59 A;  4TR0 A;  3LXZ A;  3I6A A;  2JAD A;  2DSA A;  2IIY A;  1WJK A;  3IV4 A;  4CY8 A;  1U3I A;  3EYT A;  4XRD A;  4LMV A;  4OFM A;  1ZOF A;  2V1M A;  4GTU A;  4O5R A;  4AF2 A;  4ZB7 A;  4DSS B;  2FCH A;  3IBH A;  4LMW A;  3L9S A;  2OE0 A;  1PL1 A;  2FY6 A;  3HVX A;  4F9Z A;  3D5J A;  3GV1 A;  3DYR A;  1S3D A;  5J3R A;  2LV3 A;  3F63 A;  2CA8 A;  3FZ9 A;  3A5I A;  3QR6 A;  4K0N A;  1GP1 A;  5D73 A;  5DAK A;  3LWA A;  4IP6 A;  1A24 A;  3ZLP A;  1HNA A;  4RQX A;  4MZB A;  5DCH A;  3CRT A;  4XRA A;  4XS4 A;  2ON5 A;  3M9J A;  1GUM A;  3N9J A;  4G10 A;  1AQW A;  1E2Y A;  2A2R A;  4O5Q A;  1YKA A;  4WR5 A;  4IQ1 A;  1Y25 A;  2HZF A;  3P90 A;  3F9U A;  5J40 A;  6GSY A;  1F37 A;  1OAZ A;  5DAL B;  3F0I A;  4IJ3 A;  2MMZ A;  4JE1 A;  2PBJ A;  2DJ3 A;  2V2G A;  2QGV A;  5B8A A;  4W66 A;  6GSS A;  1A0F A;  3IPZ A;  1N25 A;  3UMA A;  4PQ1 A;  4OO5 A;  4LLR A;  3LFL A;  1XFL A;  1ML6 A;  1T3B A;  1B9X C;  3D4M A;  5D8I A;  2XBQ A;  4G2E A;  5KN2 A;  2A2P A;  3DEX A;  7GSS A;  5ECP B;  3TGZ A;  1SL1 B;  2JU5 A;  5ECS A;  3RHC A;  3PH9 A;  2PGT A;  4K2D A;  1AIU A;  1PRX A;  5F8B A;  2H0I A;  1W4V A;  2H19 A;  3M3M A;  1XWG A;  4GQC A;  3DXB A;  2GSS A;  2PER A;  3UVT A;  2P0G A;  2J23 A;  1U6T A;  1WOU A;  1BX9 A;  4OFT A;  17GS A;  2JZR A;  3KXO A;  8GSS A;  5A5H A;  3GKK A;  4G0I A;  5L71 A;  4WBR D;  2C3Q A;  1XWA A;  10GS A;  2YWI A;  2VL3 A;  1UC7 A;  2YJH A;  5ECK B;  1LJR A;  1RW1 A;  5CP1 A;  1Y1U A;  4NAX A;  20GS A;  2ZCT A;  3KJY A;  1G7O A;  3D22 A;  2JSY A;  2CAI A;  1S4B P;  2R0C A;  1SYX A;  1Z7R A;  5ECQ B;  3IDV A;  3W8J A;  1DBY A;  1HYU A;  2GGT A;  3UBK A;  3GFK A;  2HE3 A;  4GXZ A;  5IIZ A;  3VI5 A;  2VCZ A;  2D2Z A;  3R2Q A;  4OWY A;  4V2N A;  5HR3 A;  3IHG A;  1W89 A;  2HRN A;  3M1G A;  4O7H A;  2YP6 A;  4YKF A;  2GS3 A;  1H4O A;  3QMX A;  2X8H A;  2FWG A;  2K8S A;  1PQN A;  5CRH A;  3IOS A;  3ERG A;  2RLI A;  5D9W A;  2LRN A;  4GQF A;  4K7N A;  2VM2 A;  2V32 A;  3H8Q A;  4HQS A;  1VF2 A;  3ZIT A;  1SK0 A;  2H75 A;  3G7I A;  4G19 A;  3CHX C;  4HJ2 A;  2OBI A;  1A2M A;  5CRG A;  1DUG A;  5B7C A;  3KMN A;  1FB6 A;  2HI7 A;  3HHV A;  2HSN B;  5ECR B;  2DLX A;  1TW9 A;  2FUG 2;  2H70 A;  3BCK A;  4DSQ A;  2QSI A;  2GST A;  2HNL A;  4JED A;  1YVL A;  1F2E A;  1M9B A;  1GTA A;  1PD2 1;  4KGI A;  2X4A A;  3A3T A;  3P8W A;  2YZU A;  4N0V A;  3QAG A;  1SD9 A;  1F9M A;  2EFH A;  4O5U A;  2DBC A;  1XG8 A;  5J4U A;  1PSQ A;  3M8N A;  2CX4 A;  3CSH A;  4JZQ A;  5IPH A;  2AJQ B;  2FWF A;  4CY6 A;  2L4Q A;  5A34 B;  2CAQ A;  2I81 A;  3DVX A;  2MYG A;  2H6Y A;  5J4Y A;  3HVN A;  5G31 A;  2XBI A;  5FWG A;  4ML1 A;  4LL1 B;  3GN3 A;  4L5O A;  4WKW A;  3TUE A;  1CQH A;  3TOT A;  22GS A;  2H1L A;  2B5X A;  5BMU A;  4I2U A;  2DKH A;  1G7E A;  4K9Z A;  4BWQ A;  1MTC A;  2IMI A;  1ZYN A;  1WRY A;  1SVM A;  1SKS B;  1LBK A;  1A8L A;  4ACS A;  3TJJ A;  3CYN A;  3VWW A;  2O36 A;  2I9H A;  3C7M A;  3WT2 A;  1TTZ A;  2IFQ A;  4BWS A;  1GNE A;  3RPN A;  4IKH A;  1HNC A;  4EL1 A;  2WB9 A;  2K8V A;  1PKZ A;  1V58 A;  3F3Q A;  4N0Z A;  3GHA A;  3LGC A;  3UAR A;  1EV4 A;  2JZS A;  4TR1 A;  5A1N B;  1ERV A;  2WVX A;  1TI1 A;  3A5W A;  2H76 A;  4FXY P;  4D73 B;  5LNK e;  3ZZX A;  1DE1 A;  3LOR A;  1G6Y A;  3MWH A;  3F6F A;  1EZK A;  3ZTL A;  5IM9 A;  2K6V A;  2WS2 A;  3TKS E;  5AGY A;  1SK1 A;  5G1L A;  5J5N A;  5G1K A;  1QGV A;  2IME A;  4PUR A;  5CNW A;  1GTU A;  1R5P A;  3EPT A;  3UJ1 A;  4N30 A;  3GL3 A;  2GTU A;  1QXH A;  5BRT A;  3FMW A;  2LS5 A;  4MLY A;  3BCI A;  3FRC A;  2KHP A;  3RDW A;  3DIE A;  2WZ9 A;  4I5Q A;  4MJC A;  4TKY A;  4MA9 A;  1B8X A;  2VL2 C;  4J2F A;  2C3T A;  2MMA A;  4O92 A;  2H0G A;  5G2Z A;  1K0O A;  1KNG A;  2KUC A;  3EIN A;  4EO3 A;  5D96 A;  1ZGN A;  3CTF A;  3QFB C;  2JSZ A;  2XPD A;  1JHB A;  4IGJ A;  4PI0 C;  1M0U A;  3Q19 A;  3HMJ G;  4ID0 A;  3AY8 A;  1FOV A;  5J4V A;  1K0N A;  2C0G A;  4XCS A;  3CXG A;  3BOA A;  4K7O A;  3VLN A;  1V40 A;  3HCZ A;  1AW9 A;  5DJM A;  3EU4 A;  4WET A;  2IWT A;  3GRX A;  2UZ8 A;  2VLV A;  1SEN A;  1XCC A;  1XW6 A;  1SVO A;  4ZL7 A;  1K3O A;  3RHB A;  4EKZ A;  4AJ7 A;  4WR4 A;  4YAV A;  5F07 A;  4EVM A;  3O3T A;  1SKW B;  2DJK A;  3I9V 2;  1ZCP A;  4KW6 A;  4TOP A;  1V98 A;  5G5E A;  2NDO A;  3IAM 2;  3ZVJ A;  1PKW A;  3GSS A;  4RUV A;  1A2L A;  1FW1 A;  3F4S A;  3SBC A;  2EFD A;  5DDL A;  1XXU A;  3TRQ A;  5ENU A;  3LQ7 A;  3US3 A;  3KTB A;  3L9V A;  1QQ2 A;  1M2A A;  3NOF A;  3APO A;  2ON7 A;  2BJX A;  1I1I P;  2GT6 A;  1KTE A;  4TR4 A;  2UV8 G;  3GKX A;  1T4Y A;  2YOI A;  2DC5 A;  2WZS A;  4BVX A;  5IMA A;  2OAD A;  2C0D A;  1YF1 A;  2HZE A;  3HDC A;  2WVY A;  3VPT A;  2TRC P;  2HSM A;  5ELG A;  3ZRE A;  2LJR A;  1S3C A;  3V1W A;  1QK8 A;  3ZML A;  2C0F A;  5KN1 A;  2B7K A;  1ZMA A;  2KP1 A;  2L6C A;  3CMI A;  1XVW A;  4OMV A;  4XIH A;  5DAK B;  1R5A A;  2OE3 A;  5KEJ A;  3TCO A;  4EUY A;  5J47 A;  1I9D A;  1G6W A;  2LEG A;  4XS4 B;  2OT3 A;  4AKI A;  4DSR A;  2GQL A;  4MAB A;  2R0G A;  2I3Y A;  3HYP A;  2R6K A;  2GSQ A;  4PI2 C;  3IK7 A;  3GL5 A;  4F2I A;  4TRX A;  3QFA C;  1U3A A;  5AIS A;  1MD3 A;  3QCP A;  5ID2 A;  5DQY A;  2J9H A;  1U87 A;  1T00 A;  2IMK A;  3H93 A;  3A2X A;  3TJF A;  3TRP A;  4ECI A;  1ABA A;  1LU4 A;  3QPM A;  4P3Y B;  5IOW A;  3IK9 A;  3ZMK A;  3HZ4 A;  4X4J A;  1YZX A;  2VD0 A;  3HY2 A;  3R3E A;  2GSR A;  3EE2 A;  4TXO A;  3J7Y k;  2CVB A;  2ES7 A;  1YEP A;  4KF9 A;  2F3M A;  5G30 A;  5D93 A;  3H4K A;  4AI6 A;  2HYX A;  1BF5 A;  1WE0 A;  1MDK A;  5EVO A;  1X5D A;  2MZC A;  4O32 A;  2OBK A;  2A4V A;  4GCI A;  4ISD A;  1URM A;  2CVD A;  4KSM A;  3ED3 A;  5JCW A;  2FA4 A;  1XOA A;  4WXT A;  1TRV A;  3C1R A;  1AC1 A;  4KUN A;  3HVS A;  2IMD A;  2WDU A;  2N5A A;  5A5H B;  4KCA A;  2PMT A;  2KP2 A;  2N5B A;  3FW2 A;  5JWO B;  4CHS A;  1FVJ A;  1GTB A;  3GNJ A;  4K0G A;  5IMZ A;  1Y6E A;  4KDX A;  3D0Z A;  3L0H A;  2QKE A;  3HJM A;  1O7U A;  1R4W A;  4G0L A;  3UAP A;  1FAA A;  2F9S A;  3GKN A;  19GS A;  1ON4 A;  1M99 A;  2BTO T;  2X8C A;  4IVF A;  2DJ2 A;  2C80 A;  2LRT A;  4KAE A;  4USS A;  5H5Q A;  3TJK A; 
#chains in the Genus database with same CATH homology
 2EIQ A;  3ZFL A;  2I1U A;  2V6O A;  3KMO A;  4WBJ A;  5D9V A;  2PN8 A;  4POB A;  5AIV A;  2H1G A;  1JZR A;  2LJK A;  1EP7 A;  2V6K A;  1QUW A;  2YV9 A;  4MMM A;  2C4J A;  4HUA A;  6GSU A;  4QL9 A;  3IC4 A;  5INY A;  2L57 A;  4HQZ A;  4YKG A;  5IOX A;  2LNS A;  1SD8 A;  4L8E A;  1IYH A;  3VPQ A;  1J08 A;  2HRA A;  1AAZ A;  3GUS A;  1OC9 A;  1SJ6 A;  2KOK A;  3ERW A;  2YPM A;  4GLT A;  3TKP A;  3DKS A;  4ECJ A;  1IYI A;  4TXV A;  4OCE A;  4ZBA A;  1M2B A;  1TP9 A;  5D9T A;  4NV2 A;  1OVN A;  4MJA A;  4PGT A;  11GS A;  2GZY A;  2H72 A;  1NW2 A;  2H0H A;  3F6D A;  2OA7 A;  4ZL8 A;  1SL2 B;  3DVW A;  3LYK A;  3HD5 A;  2LQQ A;  4ILF A;  1V9W A;  2B3S A;  3EC3 A;  4EIP A;  4POM A;  4BA7 A;  1SJI A;  3ZYW A;  1Q98 A;  4MNN A;  2Z9S A;  3LSZ A;  4ZBD A;  1F6M C;  2R3X A;  5IQY A;  1WWJ A;  3APS A;  1SU9 A;  3EUR A;  4K1F A;  3QD9 A;  3RBT A;  3QAV A;  1XPV A;  1EOG A;  3EWL A;  3OR5 A;  3GST A;  5J9B A;  2OJL A;  5BMU B;  2HRK A;  4G01 A;  1PMT A;  1RQM A;  1Z9H A;  2E7P A;  4PNG A;  3GMF A;  2F51 A;  4ZB8 A;  4K8M A;  5COH A;  1K0C A;  2X8G A;  5D9X A;  5FT3 A;  2VM1 A;  3IRA A;  1JZW A;  3S9F A;  1E6B A;  1O73 A;  2B6M A;  3P2A A;  4NMU A;  2IFQ B;  4MJE A;  5EL8 A;  1GLQ A;  3CSI A;  1R26 A;  3DRN A;  2A2S A;  3I69 A;  4PTS A;  3KH7 A;  4Q5Q A;  2OAC A;  3PIN A;  4IJI A;  1BG5 A;  2GDR A;  1QMV A;  2IN3 A;  4MCU A;  4L0U A;  4EDY A;  4TR1 B;  1HQO A;  1Z5Y E;  1J9B A;  3W6G A;  3WGE A;  1SYR A;  4XS6 A;  4I8B A;  1TU8 A;  4TVE A;  1NM3 A;  2VCX A;  1GLP A;  2QA2 A;  3QDN A;  4QL7 A;  4HEA 2;  1EEJ A;  3ME8 A;  3LJR A;  3UVH A;  3HKR A;  2H1B A;  4HDE A;  5IO2 A;  5ECM B;  1THO A;  3FZ5 A;  5GAN D;  4AKX B;  4N3Z A;  2EFC A;  3C1S A;  2VCW A;  3CWG A;  4BPY A;  4KSO A;  1PX7 A;  2B1K A;  2H30 A;  1O85 A;  4IS0 A;  5ECI B;  4LL4 B;  2L5O A;  4KH7 A;  3O6T A;  2O85 A;  4FYC A;  2VCQ A;  4K7I A;  3CTG A;  4LA1 A;  4EC0 A;  2O89 A;  2LKU A;  4IBP A;  3QOU A;  2RII A;  3ZIV A;  5HR1 A;  3FR9 A;  2YWM A;  2XPE A;  1PA3 A;  4KCE A;  3KP9 A;  2L4C A;  2QA1 A;  3M0F A;  2CVK A;  2PU9 C;  4YQV A;  3Q18 A;  4FYB A;  2NVL A;  5JWQ B;  3CSJ A;  4K5R A;  3MIX A;  2JAC A;  1XWB A;  1A8Y A;  2F8A A;  2IL3 A;  2H66 A;  2VCT A;  4FQU A;  4QQ7 A;  3UIW A;  5FHI A;  1XOB A;  3VFI A;  3FHK A;  1TRS A;  1YKC A;  3GX0 A;  2JL4 A;  4PQI A;  2YWO A;  5A34 A;  3VI7 A;  3ZVJ D;  3BBY A;  3FK8 A;  1A23 A;  3APQ A;  4HI7 A;  2VD1 A;  1HNB A;  5A4V A;  1GSQ A;  3GH9 A;  2OE1 A;  3TDG A;  2VL9 A;  4RI7 A;  2MMO A;  1R7H A;  2LQO A;  5ECO B;  1ACV A;  2WRT A;  4Q5R A;  3W8S A;  4BVY A;  2M72 A;  4E8H A;  1GNW A;  2FWH A;  4MZW A;  4Z2U A;  3EVI A;  1TK5 B;  3E0U A;  5B6M A;  4X0X A;  1GSY A;  4BVX B;  1FO5 A;  1TJD A;  3ISO A;  2WGR A;  1EWX A;  1B4Q A;  3MYD A;  2HZE B;  1YJ6 A;  2E2M A;  4N10 A;  1B48 A;  2GQK A;  3FZ4 A;  1BG1 A;  1NHO A;  3FYG A;  3FZA A;  2H01 A;  3MNG A;  2P5Q A;  2HSM B;  4N11 A;  2AV4 A;  2C8U A;  3U6V A;  3GA4 A;  5LD0 A;  3HJO A;  1B4P A;  4V1A g;  4AJ8 A;  5A1N A;  4ZB6 A;  1Z3E A;  3IC8 A;  2O87 A;  2ZUP A;  3RPP A;  4AKH A;  2ALB A;  5ABR A;  4YQU A;  5DJL A;  3DML A;  2CX3 A;  2L6D A;  5DBQ A;  3P7X A;  5H5R A;  3LXT A;  1B9Y C;  4KB3 A;  3SWL A;  5ID2 B;  3VK9 A;  4ECB A;  1TK8 B;  1PN0 A;  2LJA A;  3PGT A;  3LEF A;  3U5R E;  4F82 A;  2FGX A;  1AXD A;  1BAY A;  3WYW A;  2H74 A;  3C71 A;  3ZL5 A;  2CZ3 A;  1O8X A;  2E0Q A;  2CT6 A;  4Q5F A;  3GH6 A;  1XW9 A;  1FOH A;  4MH3 A;  3Q74 A;  3WGD A;  4TXO B;  4F03 A;  2LNT A;  1KEB A;  5F05 A;  2AHE A;  4YQM A;  5F06 A;  1ZYQ B;  2HXK A;  4DEJ A;  3KD0 A;  5DVB A;  4CW9 A;  3KGK A;  4V1A p;  3TKS A;  2AAW A;  4XHM A;  2B5Y A;  2EIR A;  1SKR B;  2PPT A;  1XVQ A;  1VF1 A;  5A4U A;  1WIK A;  5JWR B;  2WFC A;  5IMD A;  4EXJ A;  1O6J A;  2GZP A;  1G0T A;  3H1N A;  1K3L A;  1HD2 A;  5EY6 A;  2FNO A;  5KOW A;  1UVZ A;  2YZH A;  3A2V A;  2VOC A;  5H5S A;  1Q4J A;  2AYT A;  3K8N A;  3CRU A;  3N5O A;  5HFK A;  2YJ7 A;  4RI6 A;  3F4R A;  2GT5 A;  4TR3 A;  2MBS A;  4KDU A;  3J7Y b;  4V2M A;  1OE8 A;  4F0B A;  3GIX A;  4AJ6 A;  3E3E A;  1ST9 A;  4GSS A;  1OYJ A;  1V57 A;  2DML A;  1FHE A;  4GST A;  5KN3 A;  1X9W B;  4FIW A;  1TXX A;  1I5G A;  4I2T A;  5JCG A;  4KE3 A;  2CV4 A;  3TKR A;  5DQS A;  1X0R A;  3TRX A;  2VLT A;  2VIM A;  4PX1 A;  3F3R A;  4L0W A;  2MBT A;  4GWR A;  2YWN A;  4MZC A;  2X64 A;  4DVC A;  3IE3 A;  3PR8 A;  1JLW A;  5J9C A;  2IPA A;  2H1A A;  4JR4 A;  3TU3 B;  2FWE A;  1XBS A;  3EU3 A;  2IJY A;  5G5F A;  4EIQ A;  3CBU A;  1GTI A;  2M80 A;  2TIR A;  1OC9 B;  1GUK A;  1EOH A;  4OFN A;  1YQ1 A;  5GST A;  1PGT A;  4WF4 A;  4BL7 A;  2I4A A;  2HSH A;  3HXS A;  2YNX A;  1GL8 A;  2H71 A;  3D21 A;  1O81 A;  2NPB A;  2O5V A;  4POL A;  5CYY A;  3IR4 A;  1EP8 A;  5AN1 A;  3GX8 A;  4PUF C;  4FO5 A;  1YF0 A;  3KTL A;  2E2G A;  2O7K A;  1ILO A;  3F4T A;  6GSV A;  3KEB A;  4ZL9 A;  3GTU A;  2VLU A;  1JZD A;  1WP0 A;  3MSZ A;  4MF5 A;  4H86 A;  3TJB A;  3LW9 A;  4HJM A;  14GS A;  3UL3 A;  1EGO A;  3TKQ A;  2LRC A;  2EC4 A;  1NHY A;  3D4T A;  4I97 A;  1M9A A;  1THX A;  1U88 A;  5GSS A;  3IAS 2;  2EIO A;  3KH9 A;  5ECH B;  1MEK A;  2V41 A;  2EFE A;  2HRK B;  4KA0 A;  2GZZ A;  4HS1 A;  2RUF A;  6GSX A;  1UA5 A;  1YEX A;  5IMC A;  4OO4 A;  4DSS A;  3HVV A;  6GST A;  16GS A;  4EDZ A;  2DMM A;  1JLV A;  4E8E A;  4NV5 A;  1NSW A;  2B7J A;  5IO0 A;  1TRU A;  4IP1 A;  1BED A;  2P5R A;  4CDO A;  4E68 A;  2LUS A;  2G0F A;  5CO3 A;  3FR3 A;  4ULX A;  2HFD A;  3HA9 A;  3UEM A;  1QFN A;  1WPI A;  1X5E A;  1TDI A;  3KIJ A;  3L78 A;  2FLS A;  1EV9 A;  2CZ2 A;  5IMF A;  5ELA A;  3VUR A;  4KND A;  3VWV A;  4AKG A;  3IA1 A;  4JU5 A;  1N8J A;  3UOM A;  1BQ7 A;  2HSY A;  4Z7X A;  1BYE A;  3EMP A;  2VCV A;  5CRD A;  1XIY A;  5DAL A;  4X43 A;  1RK4 A;  2LST A;  2FHE A;  4GRF A;  3ME7 A;  1VGL A;  1SVL A;  3FY7 A;  4TW5 A;  1C72 A;  3Q6O A;  1K3Y A;  2GQM A;  2HQT A;  2PVQ A;  1YDK A;  3QAW A;  2XHF A;  5B8B A;  1M7T A;  1H75 A;  2N5F A;  2TRX A;  4K2X A;  1M2D A;  5HQP A;  1EGR A;  4TN8 A;  1T8E B;  4IQA A;  2C1Y A;  5LCZ A;  2ZNM A;  2K18 A;  1VRS D;  5HFG A;  2HLS A;  4GF0 A;  4ZB9 A;  5HFI A;  4A5P A;  4Z2R A;  1K0B A;  1GWC A;  4XTS A;  3KZQ A;  2MMN A;  1T1V A;  4JR6 A;  4J56 E;  4PQH A;  5IMV A;  1VF4 A;  3LYP A;  2H1D A;  2RM5 A;  3ZRD A;  4MK3 A;  2DJ1 A;  3BD2 A;  5E4W A;  4GSN A;  4IEL A;  1GSF A;  3F8U A;  3G7J A;  2F8F A;  4MF7 A;  2H6X A;  1DE2 A;  1XZO A;  2FD3 A;  5A5K A;  1K0M A;  2FA8 A;  4V2L A;  3GUR A;  2NBS A;  1F3B A;  3FR6 A;  1FG4 A;  3LG6 A;  3HZ8 A;  1A0R P;  5CRW A;  3VWU A;  1OKD A;  3ZIJ A;  5GAP D;  4ECC A;  5C04 A;  1PX6 A;  1VF3 A;  3MDK A;  2YAN A;  1TRW A;  2L5L A;  3UBL A;  4HZ2 A;  4NWY A;  1Z6M A;  1OC3 A;  9GSS A;  1FB0 A;  1TXU A;  1J0F A;  2KLX A;  4KX4 A;  4FH8 A;  2DJ0 A;  1T4Z A;  1TK0 B;  2DIY A;  3DWV A;  5F0G A;  4HU7 A;  3WT1 A;  2WUL A;  5C00 A;  3GKM A;  4BVY B;  4MF6 A;  12GS A;  4Z2T A;  4F0C A;  4MP4 A;  3TB2 A;  1YY7 A;  2R2J A;  1MDI A;  2YCD A;  3WD6 A;  1T7P B;  1ZYP A;  2HSN A;  1TI3 A;  1GSU A;  1K0D A;  5EPF A;  4ICY A;  1FVK A;  1X5C A;  1ERU A;  4KDY A;  2JZT A;  2RM6 A;  4NPB A;  1USB A;  5DCG A;  2LTK A;  1SJZ A;  1GSS A;  5B6N A;  1MD4 A;  2VAF A;  4JRR A;  2VL2 A;  2WCI A;  5ECL B;  3TOU A;  3KCM A;  3O76 A;  4PXO A;  1X9S B;  1CQG A;  1PL2 A;  5ECN B;  5KN0 A;  5AIX A;  3MAK A;  1GH2 A;  1ZZY A;  3D6I A;  4MDC A;  1JZO A;  3ERF A;  4MPG A;  2A4H A;  2RUE A;  4K6X A;  4L5L A;  1XW5 A;  4RQR A;  3ZFB A;  2B1L A;  3TJG A;  1ERW A;  5GZZ B;  4IHU A;  4WF5 A;  2B5E A;  4G0K A;  4EE0 A;  2K9F A;  2H6Z A;  1MDJ A;  1K0A A;  3E9J B;  5HR2 A;  4MPF A;  5IPG A;  4WEY A;  2VKZ G;  1OC8 A;  2HT9 A;  2X99 A;  2YV7 A;  2DKI A;  2X49 A;  4HU9 A;  3G9B A;  3A2W A;  3DD3 A;  3KM6 A;  3I43 A;  2M46 A;  5CAX A;  1AQX A;  6GSW A;  1ZYE A;  1F3A A;  4HZ4 A;  2IMF A;  3HJP A;  1AQV A;  3NZN A;  1TOF A;  3FEU A;  1WMJ A;  2PUK C;  5JCU A;  2DIZ A;  2YN1 A;  4ZIL A;  4HOJ A;  4D73 A;  3H79 A;  1ZL9 A;  1TKD B;  2R37 A;  5J41 A;  3NIV A;  4ZXG A;  4G9H A;  3C73 A;  4I6X A;  4ML6 A;  4EF0 A;  1X9M B;  4NHW A;  3BJ5 A;  4ZIJ A;  1SK2 A;  1OE7 A;  1JFU A;  18GS A;  1TU7 A;  2G2Q A;  4K5S A;  2R4V A;  1OKT A;  4PNF A;  4IW9 A;  1Z7P A;  4Q5N A;  2C0E A;  2H8L A;  1A2J A;  1XWC A;  2R5G A;  5KOX A;  2BMX A;  3IHQ A;  2GLR A;  2VO4 A;  1GRX A;  4GDF A;  1SL0 B;  2PWJ A;  1N2A A;  1GUH A;  2NTO A;  2REM A;  2H73 A;  2R0P A;  3EMX A;  3KP8 A;  2DJJ A;  3DGQ A;  4IN0 A;  4FYU A;  1PN9 A;  3L4N A;  3L9U A;  2VUP A;  2C3N A;  4X1U A;  1AUC A;  4OD7 A;  1UN2 A;  1GSD A;  4OCF A;  2QC7 A;  3GYK A;  5HR0 A;  1Z6N A;  3FKF A;  5A4W A;  4BL7 B;  2AB6 A;  4MH2 A;  5E59 A;  1ERT A;  4XS1 A;  1EEM A;  2PVO C;  5CRE A;  2HRF A;  1BJX A;  4NXI A;  4ZBB A;  4JBB A;  1S3A A;  2WJU A;  1XWK A;  1O8W A;  1KBN A;  4POK A;  3PPU A;  4AGS A;  2O8V B;  4MJB A;  2XC2 A;  3JCM L;  2GVP A;  4NHZ A;  1DSB A;  2P31 A;  4J57 E;  3GTU B;  2AUV A;  4QMK A;  3IXR A;  4PUA A;  3VWX A;  3WGX A;  3M9K A;  13GS A;  2CQ9 A;  2OKA A;  4YH2 A;  3G7Y A;  4YAP A;  1GUL A;  3TKS C;  1GSE A;  1V2A A;  3C8E A;  3RAZ A;  2L59 A;  4TR0 A;  3LXZ A;  3I6A A;  2JAD A;  2DSA A;  2IIY A;  1WJK A;  3IV4 A;  4CY8 A;  1U3I A;  3EYT A;  4XRD A;  4LMV A;  4OFM A;  1ZOF A;  2V1M A;  4GTU A;  4O5R A;  4AF2 A;  4ZB7 A;  4DSS B;  2FCH A;  3IBH A;  4LMW A;  3L9S A;  2OE0 A;  1PL1 A;  2FY6 A;  3HVX A;  4F9Z A;  3D5J A;  3GV1 A;  3DYR A;  1S3D A;  5J3R A;  2LV3 A;  3F63 A;  2CA8 A;  3FZ9 A;  3A5I A;  3QR6 A;  4K0N A;  1GP1 A;  5D73 A;  5DAK A;  3LWA A;  4IP6 A;  1A24 A;  3ZLP A;  1HNA A;  4RQX A;  4MZB A;  5DCH A;  3CRT A;  4XRA A;  4XS4 A;  2ON5 A;  3M9J A;  1GUM A;  3N9J A;  4G10 A;  1AQW A;  1E2Y A;  2A2R A;  4O5Q A;  1YKA A;  4WR5 A;  4IQ1 A;  1Y25 A;  2HZF A;  3P90 A;  3F9U A;  5J40 A;  6GSY A;  1F37 A;  1OAZ A;  5DAL B;  3F0I A;  4IJ3 A;  2MMZ A;  4JE1 A;  2PBJ A;  2DJ3 A;  2V2G A;  2QGV A;  5B8A A;  4W66 A;  6GSS A;  1A0F A;  3IPZ A;  1N25 A;  3UMA A;  4PQ1 A;  4OO5 A;  4LLR A;  3LFL A;  1XFL A;  1ML6 A;  1T3B A;  1B9X C;  3D4M A;  5D8I A;  2XBQ A;  4G2E A;  5KN2 A;  2A2P A;  3DEX A;  7GSS A;  5ECP B;  3TGZ A;  1SL1 B;  2JU5 A;  5ECS A;  3RHC A;  3PH9 A;  2PGT A;  4K2D A;  1AIU A;  1PRX A;  5F8B A;  2H0I A;  1W4V A;  2H19 A;  3M3M A;  1XWG A;  4GQC A;  3DXB A;  2GSS A;  2PER A;  3UVT A;  2P0G A;  2J23 A;  1U6T A;  1WOU A;  1BX9 A;  4OFT A;  17GS A;  2JZR A;  3KXO A;  8GSS A;  5A5H A;  3GKK A;  4G0I A;  5L71 A;  4WBR D;  2C3Q A;  1XWA A;  10GS A;  2YWI A;  2VL3 A;  1UC7 A;  2YJH A;  5ECK B;  1LJR A;  1RW1 A;  5CP1 A;  1Y1U A;  4NAX A;  20GS A;  2ZCT A;  3KJY A;  1G7O A;  3D22 A;  2JSY A;  2CAI A;  2R0C A;  1SYX A;  1Z7R A;  5ECQ B;  3IDV A;  3W8J A;  1DBY A;  1HYU A;  2GGT A;  3UBK A;  3GFK A;  2HE3 A;  4GXZ A;  5IIZ A;  3VI5 A;  2VCZ A;  2D2Z A;  3R2Q A;  4OWY A;  4V2N A;  5HR3 A;  3IHG A;  1W89 A;  2HRN A;  3M1G A;  4O7H A;  2YP6 A;  4YKF A;  2GS3 A;  1H4O A;  3QMX A;  2X8H A;  2FWG A;  2K8S A;  1PQN A;  5CRH A;  3IOS A;  3ERG A;  2RLI A;  5D9W A;  2LRN A;  4GQF A;  4K7N A;  2VM2 A;  2V32 A;  3H8Q A;  4HQS A;  1VF2 A;  3ZIT A;  1SK0 A;  2H75 A;  3G7I A;  4G19 A;  4HJ2 A;  1A2M A;  2OBI A;  5CRG A;  1DUG A;  5B7C A;  3KMN A;  1FB6 A;  2HI7 A;  3HHV A;  2HSN B;  5ECR B;  2DLX A;  1TW9 A;  2FUG 2;  2H70 A;  3BCK A;  4DSQ A;  2QSI A;  2GST A;  2HNL A;  4JED A;  1YVL A;  1F2E A;  1M9B A;  1GTA A;  1PD2 1;  4KGI A;  2X4A A;  3A3T A;  3P8W A;  2YZU A;  4N0V A;  3QAG A;  1SD9 A;  1F9M A;  2EFH A;  4O5U A;  2DBC A;  5J4U A;  1PSQ A;  3M8N A;  2CX4 A;  3CSH A;  4JZQ A;  5IPH A;  2AJQ B;  2FWF A;  4CY6 A;  2L4Q A;  5A34 B;  2CAQ A;  2I81 A;  3DVX A;  2MYG A;  2H6Y A;  5J4Y A;  5G31 A;  2XBI A;  5FWG A;  4ML1 A;  4LL1 B;  3GN3 A;  4L5O A;  4WKW A;  3TUE A;  1CQH A;  3TOT A;  22GS A;  2H1L A;  2B5X A;  5BMU A;  4I2U A;  2DKH A;  1G7E A;  4K9Z A;  4BWQ A;  1MTC A;  2IMI A;  1ZYN A;  1WRY A;  1SVM A;  1SKS B;  1LBK A;  1A8L A;  4ACS A;  3TJJ A;  3CYN A;  3VWW A;  2I9H A;  3C7M A;  3WT2 A;  1TTZ A;  2IFQ A;  4BWS A;  1GNE A;  3RPN A;  4IKH A;  1HNC A;  4EL1 A;  2WB9 A;  2K8V A;  1PKZ A;  1V58 A;  3F3Q A;  4N0Z A;  3GHA A;  3LGC A;  3UAR A;  1EV4 A;  2JZS A;  4TR1 A;  5A1N B;  1ERV A;  1TI1 A;  3A5W A;  2H76 A;  4D73 B;  5LNK e;  3ZZX A;  1DE1 A;  3LOR A;  1G6Y A;  3MWH A;  3F6F A;  1EZK A;  3ZTL A;  5IM9 A;  2K6V A;  2WS2 A;  3TKS E;  5AGY A;  1SK1 A;  5G1L A;  5J5N A;  5G1K A;  1QGV A;  2IME A;  4PUR A;  5CNW A;  1GTU A;  1R5P A;  3EPT A;  3UJ1 A;  4N30 A;  3GL3 A;  2GTU A;  1QXH A;  5BRT A;  3FMW A;  2LS5 A;  4MLY A;  3BCI A;  3FRC A;  2KHP A;  3RDW A;  3DIE A;  2WZ9 A;  4I5Q A;  4MJC A;  4TKY A;  4MA9 A;  1B8X A;  2VL2 C;  4J2F A;  2C3T A;  2MMA A;  4O92 A;  2H0G A;  5G2Z A;  1K0O A;  1KNG A;  2KUC A;  3EIN A;  4EO3 A;  5D96 A;  1ZGN A;  3CTF A;  3QFB C;  2JSZ A;  2XPD A;  1JHB A;  4IGJ A;  1M0U A;  3Q19 A;  3HMJ G;  4ID0 A;  3AY8 A;  1FOV A;  5J4V A;  1K0N A;  2C0G A;  4XCS A;  3CXG A;  3BOA A;  4K7O A;  3VLN A;  1V40 A;  3HCZ A;  1AW9 A;  5DJM A;  3EU4 A;  4WET A;  2IWT A;  3GRX A;  2UZ8 A;  2VLV A;  1SEN A;  1XCC A;  1XW6 A;  1SVO A;  4ZL7 A;  1K3O A;  3RHB A;  4EKZ A;  4AJ7 A;  4WR4 A;  4YAV A;  5F07 A;  4EVM A;  3O3T A;  1SKW B;  2DJK A;  3I9V 2;  1ZCP A;  4KW6 A;  4TOP A;  1V98 A;  5G5E A;  2NDO A;  3IAM 2;  3ZVJ A;  1PKW A;  3GSS A;  4RUV A;  1A2L A;  1FW1 A;  3F4S A;  3SBC A;  2EFD A;  5DDL A;  1XXU A;  3TRQ A;  5ENU A;  3LQ7 A;  3US3 A;  3KTB A;  3L9V A;  1QQ2 A;  1M2A A;  3NOF A;  3APO A;  2ON7 A;  2BJX A;  2GT6 A;  1KTE A;  4TR4 A;  2UV8 G;  3GKX A;  1T4Y A;  2YOI A;  2DC5 A;  4BVX A;  5IMA A;  2OAD A;  2C0D A;  1YF1 A;  2HZE A;  3HDC A;  3VPT A;  2TRC P;  2HSM A;  5ELG A;  3ZRE A;  2LJR A;  1S3C A;  3V1W A;  1QK8 A;  3ZML A;  2C0F A;  5KN1 A;  2B7K A;  1ZMA A;  2KP1 A;  2L6C A;  3CMI A;  1XVW A;  4OMV A;  4XIH A;  5DAK B;  1R5A A;  2OE3 A;  5KEJ A;  3TCO A;  4EUY A;  5J47 A;  1I9D A;  1G6W A;  2LEG A;  4XS4 B;  2OT3 A;  4AKI A;  4DSR A;  2GQL A;  4MAB A;  2R0G A;  2I3Y A;  3HYP A;  2R6K A;  2GSQ A;  3IK7 A;  3GL5 A;  4F2I A;  4TRX A;  3QFA C;  1U3A A;  5AIS A;  1MD3 A;  3QCP A;  5ID2 A;  5DQY A;  2J9H A;  1U87 A;  1T00 A;  2IMK A;  3H93 A;  3A2X A;  3TJF A;  3TRP A;  4ECI A;  1ABA A;  1LU4 A;  3QPM A;  4P3Y B;  5IOW A;  3IK9 A;  3ZMK A;  3HZ4 A;  4X4J A;  1YZX A;  2VD0 A;  3HY2 A;  3R3E A;  2GSR A;  3EE2 A;  4TXO A;  3J7Y k;  2CVB A;  2ES7 A;  1YEP A;  4KF9 A;  2F3M A;  5G30 A;  5D93 A;  3H4K A;  4AI6 A;  2HYX A;  1BF5 A;  1WE0 A;  1MDK A;  5EVO A;  1X5D A;  2MZC A;  4O32 A;  2OBK A;  2A4V A;  4GCI A;  4ISD A;  1URM A;  2CVD A;  4KSM A;  3ED3 A;  5JCW A;  2FA4 A;  1XOA A;  4WXT A;  1TRV A;  3C1R A;  1AC1 A;  4KUN A;  3HVS A;  2IMD A;  2WDU A;  2N5A A;  5A5H B;  4KCA A;  2PMT A;  2KP2 A;  2N5B A;  3FW2 A;  5JWO B;  4CHS A;  1FVJ A;  1GTB A;  3GNJ A;  4K0G A;  5IMZ A;  1Y6E A;  4KDX A;  3D0Z A;  3L0H A;  2QKE A;  3HJM A;  1O7U A;  1R4W A;  4G0L A;  3UAP A;  1FAA A;  2F9S A;  3GKN A;  19GS A;  1ON4 A;  1M99 A;  2BTO T;  2X8C A;  4IVF A;  2DJ2 A;  2C80 A;  2LRT A;  4KAE A;  4USS A;  5H5Q A;  3TJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...