3FRCA

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
201
Chain Sequence
IVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 69
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3frcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3frcA01
2O87A 5IM9A 4NV5A 4MK3A 2VIMA 4V1Ap 2JSYA 3EVIA 1K0MA 1FVKA 2LNSA 7GSSA 3G9BA 4HEA2 1GTUA 4TR0A 5HR3A 1KBNA 1JZDA 2E2GA 2YWMA 4GQCA 5ECMB 4LLRA 2IMEA 4IP6A 1ZCPA 3BJ5A 3VWWA 3FZ5A 3SBCA 1GUHA 4NAXA 3G7IA 2VUPA 4F82A 4FO5A 19GSA 1S3CA 4MZWA 1K0OA 3LJRA 4MPFA 5ECRB 2VL2A 2LTKA 2MYGA 3H79A 4BA7A 1ILOA 2C1YA 2FGXA 3F4RA 1O8XA 3APQA 4BVXB 3O76A 1I9DA 2HQTA 5CNWA 1B8XA 4PQIA 1WWJA 1H4OA 4V2MA 5HR0A 20GSA 2V6KA 4QQ7A 3D6IA 3QR6A 1GTAA 2JZSA 3EMXA 1PL2A 3WT2A 3IK9A 3GX8A 4K6XA 4G0KA 3TJJA 3IV4A 5G30A 2R5GA 3QAVA 4EXJA 1FOVA 5CP1A 3LG6A 1M0UA 2XPDA 1F37A 4WETA 5J5NA 3GA4A 4JU5A 3UL3A 1WMJA 4IVFA 4G2EA 1WE0A 4NPBA 2WULA 4AJ8A 4OD7A 1XVQA 2B5YA 2P31A 3VPTA 4FQUA 4WXTA 3HJPA 1GUMA 1Y25A 2XBQA 6GSXA 1X9SB 4HI7A 4I5QA 2AJQB 2HZEB 1AXDA 5C04A 3KP8A 1TKDB 2PERA 5IOWA 5D9XA 1B4PA 2X8GA 3UBLA 2KP2A 3WT1A 3GMFA 2DIYA 5J9BA 4GXZA 4ULXA 3M1GA 2B6MA 1WOUA 1OKTA 5KN1A 4D73A 4OO5A 2DJ1A 4V2NA 3QFBC 3O3TA 2H6ZA 4K0GA 2GT5A 3ZFLA 1FAAA 1WJKA 4FYCA 2TRCP 2I9HA 1NHYA 4RUVA 1YKCA 5ECLB 3SWLA 2CQ9A 3FKFA 2KUCA 2HSMB 1SKWB 1BQ7A 1RK4A 2OKAA 3P8WA 2GS3A 1HNAA 3M3MA 3D4MA 1Z3EA 2E7PA 2HRAA 3ZYWA 2MMNA 5J41A 4PURA 2IIYA 1TU8A 2X99A 1M9AA 1LBKA 4GF0A 5ECQB 3KMOA 4HJ2A 4Q5RA 5DQSA 3EYTA 3GIXA 5ABRA 5BMUA 5CRHA 4MP4A 4ZILA 1PKZA 3P7XA 1NSWA 4BL7A 2A4VA 4IS0A 3L4NA 3TGZA 3ZVJA 2NDOA 1ERWA 4NWYA 2VCTA 1BAYA 5ECIB 5G2ZA 1GLQA 1XWBA 2X64A 1V58A 2I1UA 4G10A 4YH2A 6GSVA 4I8BA 4POKA 3QFAC 4NXIA 1EEJA 4AJ7A 2JU5A 2DJJA 1OAZA 2HYXA 1ACVA 4KDUA 2IN3A 3L9SA 2VL9A 3FR6A 4N11A 2RLIA 1R5AA 1QFNA 3PPUA 1GSUA 1PQNA 2V1MA 2EIOA 3ZZXA 3GSTA 1ZZYA 2AV4A 1Z7PA 3FR3A 3ZFBA 2TRXA 2B5XA 2I4AA 3QOUA 2GZPA 3IR4A 3FK8A 1GNEA 1FB6A 2ZUPA 1OE7A 4X43A 2H30A 1GSQA 3C1RA 2PVOC 4X1UA 2A2SA 1OKDA 4ZBDA 2YZHA 3TKSE 4I2UA 1AQWA 5ECPB 1FO5A 1Z6NA 2C8UA 1WIKA 2LRTA 3M0FA 5G31A 5IOXA 5B6NA 5ECKB 1X5EA 3UVTA 1QMVA 4IJ3A 2KLXA 1YF0A 1HNCA 1XZOA 4Q5QA 3KZQA 2LRNA 3ISOA 1SL2B 4GLTA 3F4SA 5AN1A 3LFLA 1XOAA 1RW1A 1A24A 1MTCA 1EOHA 2D2ZA 4ZB8A 1QGVA 2REMA 3VI7A 1G6YA 4IQ1A 4KB3A 4OFMA 3GNJA 4NHWA 2PGTA 8GSSA 5DQYA 1GSFA 2BJXA 3TOTA 3IBHA 2CVBA 5CRDA 5F05A 2GVPA 4ISDA 2MMZA 2IMIA 1AUCA 2VCZA 4DEJA 3US3A 1VRSD 3EU4A 2P0GA 5DALA 2H1AA 1ZYQB 4ZIJA 2P5QA 4Z7XA 2JADA 1TK8B 4GRFA 2C0GA 4L0WA 3P2AA 4CDOA 4IQAA 2RUEA 3HVSA 2PPTA 2UZ8A 2V6OA 5D73A 1UVZA 1QQ2A 4TVEA 1K3YA 2AB6A 2CVKA 3LQ7A 1O6JA 4ML6A 5EVOA 4XS6A 2H6YA 4TR1B 3WGEA 1TRWA 3TJFA 1X0RA 1MDKA 4L5LA 3AY8A 2GSSA 3L0HA 2GQLA 1VF4A 3KXOA 1UC7A 4MF7A 1GP1A 3CYNA 2V41A 2F9SA 3E3EA 2GDRA 1XWCA 4LMVA 2PWJA 2H66A 3VURA 4P3YB 5GAPD 2G0FA 3HZ8A 1TRSA 4PNFA 4E8HA 3Q18A 1X5DA 4JR6A 1PL1A 3C8EA 1ERVA 2IPAA 2C3TA 4KSMA 2I3YA 4F03A 1HQOA 1TXXA 2B7KA 1CQHA 3CMIA 3QAGA 3UVHA 2VLVA 1GSDA 3F6DA 3ERGA 3KGKA 3MSZA 3PR8A 4K8MA 1OYJA 1KTEA 1UA5A 1U6TA 2LUSA 4KDYA 3EINA 6GSUA 1K0NA 3ME7A 5DJMA 1U87A 4BVXA 4YQUA 3BBYA 3ED3A 1O73A 1AIUA 4MABA 4ECJA 3V1WA 5HFKA 3LGCA 2HNLA 2L57A 3U6VA 1GWCA 2HRNA 3TRXA 1JZWA 2WCIA 4TW5A 3FHKA 3TRPA 2HZFA 3I9V2 3GHAA 4TXOB 4DSRA 4JBBA 4KDXA 3NIVA 1SJZA 4DSQA 2H8LA 1JLVA 1O7UA 1OC3A 2LJRA 5F8BA 5ELAA 1T4ZA 1B9XC 2LQQA 2H01A 2R37A 1ZL9A 1PMTA 2CA8A 1F2EA 2C0EA 2VD0A 5B7CA 1YY7A 2H1BA 2DLXA 1H75A 4KUNA 3IA1A 5A4UA 3HKRA 2XBIA 1AQVA 2R2JA 4HQZA 4E8EA 1F9MA 5CO3A 2GSTA 5HFIA 2JACA 4ZL8A 3FW2A 2WS2A 1S3DA 3IAM2 2YJHA 5IO2A 4QL7A 2HZEA 4IELA 1ERTA 4TR3A 2IWTA 1ML6A 2GQKA 1V57A 1LU4A 2LSTA 3HD5A 2P5RA 5AIXA 2GT6A 2VCXA 2IMKA 1TK0B 3TOUA 2RM6A 4PGTA 3CSHA 1TI1A 2IMDA 2PBJA 1R4WA 3I6AA 4OCEA 3TUEA 5E59A 3M8NA 1SD8A 2HE3A 3EU3A 1YQ1A 1RQMA 2M46A 4ZXGA 1QXHA 4WEYA 1MEKA 6GSTA 4KH7A 4KX4A 5HR1A 5GSSA 1GSYA 5B8BA 3ERFA 3ZIJA 5IMCA 2HSMA 4FH8A 5DVBA 3F0IA 4XIHA 4WF4A 2ON7A 3C71A 2JZRA 1X9WB 2YOIA 3CXGA 2DJ0A 3D4TA 4KCEA 3TKSC 1K0CA 2OE0A 1TRUA 2GTUA 3F8UA 2WFCA 3HJMA 3PGTA 4F0CA 4MLYA 4K0NA 5D9TA 2K6VA 5L71A 3TB2A 2WRTA 4I6XA 5DDLA 4IP1A 4PUFC 10GSA 3HCZA 4FYBA 4PNGA 1AC1A 3QMXA 4OCFA 3A3TA 3ZIVA 1CQGA 4YQMA 5D96A 4MPGA 3FRCA 4AGSA 4WR5A 1AW9A 1EP8A 4XTSA 1Y6EA 1EP7A 1XVWA 3APOA 1XOBA 1TU7A 3D0ZA 1PRXA 4HU9A 1FHEA 4G19A 3DIEA 5IQYA 2ES7A 4MDCA 1NM3A 5JCGA 1ZYEA 4H86A 1T8EB 5JCWA 1THXA 1VF2A 3HYPA 1K3OA 3WGDA 2HXKA 4ACSA 3L9VA 1WRYA 2HFDA 4PTSA 2FWHA 3TJBA 1XIYA 4ML1A 3A2VA 4IN0A 5EL8A 4HU7A 2H75A 2HRFA 3DMLA 3VWXA 1TK5B 1O8WA 1XBSA 1O85A 4ZL7A 1MDJA 2FUG2 2L6DA 3F6FA 3UEMA 1TP9A 2L6CA 3I69A 1KEBA 4TN8A 3VFIA 2FHEA 1FB0A 4KNDA 4OFNA 4EO3A 3IE3A 3A2XA 3F63A 5HQPA 1N8JA 1B4QA 2PMTA 1Z7RA 2QC7A 5EPFA 2DIZA 3O6TA 4KW6A 3H93A 5A4VA 4XS4B 2C80A 1GTBA 3ZTLA 2N5BA 2FD3A 4PXOA 4MH2A 5DJLA 5G5FA 5D8IA 4ID0A 2FLSA 3KJYA 5CYYA 2YWNA 1J9BA 3IC8A 4ZB9A 2H1GA 3QCPA 2WGRA 3BD2A 1THOA 1V40A 3N9JA 2M80A 3GL3A 1EGOA 3G7JA 4IKHA 4MZCA 3LSZA 5EY6A 4LL4B 3PH9A 3KIJA 3J7Yb 2IFQB 1ZMAA 1X9MB 1Q4JA 2O89A 3FZAA 2OBIA 4HOJA 2L4QA 4IGJA 4N0ZA 4EDYA 1XFLA 4YAVA 2DSAA 1IYHA 3A5WA 4O7HA 4WBRD 3RPPA 2YN1A 2DJ2A 4BWQA 1EV4A 5B8AA 1S3AA 2O7KA 2VM1A 4MJCA 1T7PB 2O8VB 3GKMA 2LQOA 4IW9A 1XCCA 3NZNA 1DUGA 3W8SA 4POBA 1R26A 4D73B 2L59A 1JZOA 1GULA 3UOMA 5CAXA 4EUYA 1M99A 4MH3A 5CRGA 4G0LA 4IJIA 4CHSA 4KF9A 3ZMLA 3H4KA 3QD9A 4TR1A 16GSA 2VLUA 1T3BA 5D9VA 1OC9B 4FIWA 12GSA 1TRVA 3DGQA 3HZ4A 2HRKA 3D22A 3VI5A 4MMMA 3IRAA 2AAWA 1BX9A 1FW1A 1OE8A 3D5JA 3KH7A 1BEDA 1XW9A 2FNOA 2FWGA 4USSA 1ON4A 4N10A 1C72A 5IPHA 3C73A 5ID2B 2X8HA 1M7TA 2V2GA 4RQXA 4TRXA 2CZ2A 9GSSA 2B3SA 2GGTA 3ME8A 1YKAA 2C0FA 3CSJA 5H5QA 2M72A 2VOCA 5DCGA 4EL1A 3UAPA 2MBSA 2C3QA 5ENUA 4CW9A 4J2FA 1EGRA 3Q19A 1M2DA 3F9UA 3UARA 3KM6A 3EWLA 4LMWA 4JRRA 2VL2C 5JCUA 4O92A 3GFKA 3NOFA 4K9ZA 3EE2A 1ZOFA 4EC0A 5ECOB 2C3NA 1BG5A 4LL1B 1SKRB 2H0HA 1QUWA 1SENA 1A2JA 3Q74A 4ECBA 4L8EA 2MMOA 2YV7A 1TDIA 2VL3A 1ST9A 5J9CA 2PUKC 3DEXA 5KN2A 2OA7A 2CV4A 4TXOA 1T00A 2B1KA 1Z9HA 3C7MA 2GSQA 4HS1A 3LXZA 5ECSA 3CSIA 4PQ1A 1PX6A 3IK7A 3IOSA 2LKUA 1F3BA 14GSA 3JCML 3M9JA 2GQMA 5AGYA 1G7OA 4I2TA 3K8NA 1SL1B 2OACA 4JZQA 4WKWA 5JWRB 3QDNA 1BJXA 2FA4A 3UJ1A 4XHMA 2OADA 3GTUB 1E2YA 5LNKe 5IMVA 4POMA 1GTIA 1EWXA 3RAZA 2GSRA 1SJ6A 2N5FA 1PX7A 1SYRA 4ZBBA 1USBA 5F07A 3J7Yk 2K9FA 1YJ6A 1PA3A 4WF5A 1ERUA 1J08A 2FA8A 4POLA 1MD4A 3RBTA 1GNWA 4WBJA 2H73A 4KSOA 1EV9A 18GSA 2WB9A 2YV9A 4K7IA 1URMA 2KP1A 2FWEA 4HDEA 1GLPA 5B6MA 3BCIA 1XWKA 3S9FA 1IYIA 4ECIA 1Z6MA 1NW2A 1SK0A 4GTUA 5ECNB 3DWVA 3UMAA 1GUKA 3GYKA 3CTGA 2ON5A 4L0UA 3I43A 2YJ7A 2NTOA 2FCHA 2HSNB 3LYKA 2MZCA 5INYA 3TJKA 2K8VA 2XHFA 3LWAA 5AIVA 3HVVA 1TOFA 2Z9SA 3HJOA 1T1VA 3L9UA 2AYTA 5F06A 5KN0A 4HZ4A 2QSIA 3R3EA 2VM2A 4KGIA 1J0FA 3CTFA 5IIZA 1F6MC 4XS1A 4RQRA 3QAWA 4Q5NA 2DJ3A 1MDIA 3CBUA 1DSBA 1YEPA 2GZYA 1A0FA 4ZL9A 2K8SA 2R4VA 2XC2A 3HY2A 3TRQA 2K18A 5AISA 4DVCA 4BVYB 1YDKA 2DMMA 4NV2A 2VO4A 4K1FA 4EDZA 3GH9A 3MDKA 3FY7A 5COHA 4L5OA 4EVMA 5D9WA 2E0QA 2RM5A 4KA0A 4F2IA 4YQVA 1U88A 3GKNA 5HFGA 2BTOT 2YWIA 2MMAA 2TIRA 2YANA 3EMPA 4RI7A 2KHPA 4AF2A 4GSSA 2H74A 1X5CA 3MNGA 1Q98A 1JHBA 3D21A 4XCSA 4GSNA 3DVWA 4HUAA 3FYGA 4PX1A 2RIIA 4LA1A 5DAKB 2CX4A 1E6BA 4GQFA 4HZ2A 2IMFA 4HJMA 3VK9A 1A8LA 3KCMA 2LS5A 2DC5A 4J57E 5A4WA 3DKSA 2H19A 3KP9A 3KEBA 3RDWA 2ZNMA 2YZUA 1G7EA 5LCZA 4ILFA 4V1Ag 11GSA 2IL3A 4K2DA 2C4JA 3FZ9A 2EIRA 4DSSB 1T4YA 2CVDA 2H76A 1ZGNA 1HNBA 1PKWA 3WYWA 3LXTA 4MZBA 4XS4A 5A5KA 2J9HA 4YAPA 1A0RP 4BPYA 4NHZA 3DD3A 2H71A 3DYRA 6GSYA 2L5OA 1BYEA 2C0DA 3FEUA 3DRNA 4J56E 2JSZA 5IMFA 5DBQA 1G6WA 22GSA 5IMDA 1EEMA 1V9WA 1WPIA 1FVJA 2IFQA 2LV3A 1YF1A 3GL5A 1K0AA 4XRAA 5H5SA 3TKQA 4K7NA 5D93A 4EKZA 4OO4A 3G7YA 17GSA 1PD21 5FHIA 5J4UA 2CX3A 4MJAA 3KD0A 3HHVA 4RI6A 1JFUA 4TKYA 1Z5YE 4G9HA 4F9ZA 1K0DA 4BWSA 2HSYA 4WR4A 1GSEA 2PU9C 5CREA 2NBSA 2GLRA 4O5RA 1DE1A 2YCDA 4KE3A 3GKXA 2VCWA 3EC3A 2KOKA 5FT3A 1M9BA 3KH9A 3OR5A 1A23A 3W8JA 13GSA 3GH6A 2JZTA 3E9JB 2CAIA 5GZZB 1XW6A 1VF3A 1OC9A 1WP0A 5H5RA 4Q5FA 2NPBA 1OVNA 4OMVA 4PQHA 2A2RA 2YP6A 1SK1A 2B5EA 3BCKA 1A2MA 1XXUA 5IMZA 4MA9A 2F8AA 2H0GA 4GCIA 3IDVA 1SU9A 3IPZA 2VCQA 2IJYA 1XWGA 5ID2A 1VF1A 1SKSB 5KN3A 2L5LA 2H1DA 3GSSA 2F51A 2O85A 1JZRA 2CZ3A 3A2WA 3H1NA 5CRWA 3RPNA 3UBKA 3ZREA 3L78A 1K3LA 1W4VA 2PN8A 3KTBA 5F0GA 2QGVA 2DBCA 4O32A 5G5EA 1XPVA 5HR2A 2CAQA 1M2AA 3Q6OA 4TR4A 5GAND 5DCHA 4FYUA 2YPMA 5J3RA 1R5PA 4ECCA 2CT6A 1GRXA 6GSWA 3RHCA 2ALBA 1U3AA 3KMNA 2E2MA 6GSSA 3HXSA 3WGXA 4MF6A 1I5GA 1SD9A 3IHQA 1PSQA 3WD6A 3ZLPA 2BMXA 3TDGA 4QL9A 3ZITA 2B7JA 5C00A 1KNGA 2DMLA 1A2LA 3RHBA 2WJUA 3ZMKA 3LEFA 3HDCA 2L4CA 1YZXA 3QPMA 1UN2A 5JWQB 5IPGA 3LORA 3DVXA 4N0VA 3F4TA 4X0XA 2MBTA 4KAEA 3GTUA 3GX0A 4KCAA 3ZRDA 3IAS2 4GWRA 2J23A 4MCUA 3TKSA 2LRCA 2DJKA 5JWOB 2HLSA 1VGLA 3ZL5A 3IXRA 5IO0A 2QKEA 4AJ6A 2H70A 1SJIA 2HI7A 3CRTA 5GSTA 4TXVA 2G2QA 4NMUA 3VWVA 2OE3A 4BL7B 1U3IA 4MJBA 3P90A 3MAKA 2JL4A 2XPEA 2I81A 5ECHB 3C1SA 3EURA 3LYPA 2LJAA 4OFTA 2RUFA 3VPQA 2H72A 2OE1A 3GN3A 4V2LA 1M2BA 3TKPA 4JEDA 3E0UA 4I97A 3GV1A 1FG4A 3U5RE 3APSA 1B9YC 3H8QA 4MF5A 2V32A 2FWFA 1W89A 4F0BA 2H6XA 3DXBA 2AUVA 1SL0B 5G1LA 2WZ9A 2FY6A 1TTZA 5IMAA 3VWUA 4HQSA 4XRDA 3HVXA 1OC8A 4IBPA 2WDUA 3PINA 2VD1A 2OBKA 2NVLA 1TI3A 2YWOA 2F8FA 2HT9A 2VLTA 1B48A 1AAZA 1O81A 2F3MA 2ZCTA 3MWHA 1DE2A 3IC4A 4N30A 3TKRA 2EIQA 4IHUA 3FZ4A 4EE0A 2OJLA 2EC4A 4BVYA 1PGTA 2HRKB 5FWGA 4GSTA 4G0IA 2X8CA 3GKKA 1G0TA 3BOAA 2VAFA 1TW9A 1V2AA 4JR4A 1N2AA 4K7OA 3FR9A 2R6KA 1TJDA 1AQXA 3GURA 1HYUA 1GL8A 1EOGA 2GZZA 3KTLA 2PVQA 2LNTA 1HD2A 1K0BA 2YNXA 1PN9A 4TOPA 1R7HA 4MJEA 1JLWA 3CRUA 1NHOA 1A8YA 3GRXA 4EF0A 3TCOA 5KEJA 3F3QA 4ZB6A 5DAKA 2LEGA 2LJKA 3ERWA 3W6GA 2H0IA 5G1KA 1V98A 4OWYA 1YEXA 4PUAA 2B1LA 5DALB 1EZKA 2HSHA 3TJGA 3GUSA 3R2QA 2AHEA 1GH2A 3ZVJD 5E4WA 1LJRA 3F3RA 2R3XA 5ELGA 2VCVA 1SYXA 1QK8A 1F3AA 3M9KA 1GSSA 4JE1A 1SK2A 4DSSA 1ABAA 1DBYA 4ZBAA 3VLNA 5LD0A 3N5OA 2N5AA 3UIWA 3HA9A 1MD3A 1XWAA 1XW5A
chains in the Genus database with same CATH superfamily
2O87A 5IM9A 4NV5A 4MK3A 2VIMA 4CY6A 4V1Ap 2JSYA 3EVIA 1K0MA 1FVKA 2LNSA 7GSSA 3G9BA 4HEA2 1GTUA 4TR0A 5HR3A 1KBNA 1JZDA 2E2GA 2YWMA 4GQCA 5ECMB 4LLRA 2IMEA 4IP6A 1ZCPA 3BJ5A 3VWWA 3FZ5A 3SBCA 1GUHA 4NAXA 3G7IA 4BIKA 2VUPA 4F82A 4FO5A 19GSA 1S3CA 4MZWA 1K0OA 3LJRA 4MPFA 1YVLA 5ECRB 2VL2A 2LTKA 2MYGA 1BF5A 3H79A 4BA7A 1ILOA 2C1YA 2FGXA 3F4RA 1O8XA 3APQA 4BVXB 3O76A 1I9DA 2HQTA 5CNWA 1B8XA 4PQIA 1WWJA 1H4OA 4V2MA 5HR0A 20GSA 2V6KA 3CQFA 4QQ7A 4G01A 3D6IA 3QR6A 1GTAA 2JZSA 3EMXA 1PL2A 3WT2A 3IK9A 3GX8A 4K6XA 4G0KA 3TJJA 3IV4A 5G30A 2R5GA 3QAVA 4EXJA 1FOVA 5CP1A 3LG6A 1M0UA 2XPDA 1F37A 4WETA 5J5NA 3GA4A 4JU5A 3UL3A 1WMJA 4IVFA 4G2EA 4Z2UA 1WE0A 4NPBA 2WULA 4AJ8A 4OD7A 1XVQA 2B5YA 2P31A 3VPTA 4FQUA 4WXTA 3HJPA 1GUMA 1Y25A 2XBQA 6GSXA 1X9SB 4HI7A 4I5QA 2AJQB 2HZEB 1AXDA 5C04A 3KP8A 1TKDB 2PERA 5IOWA 5D9XA 1B4PA 3A5IA 2X8GA 3UBLA 2KP2A 3WT1A 3GMFA 2DIYA 5J9BA 4GXZA 4ULXA 3M1GA 2B6MA 1WOUA 1OKTA 5KN1A 4D73A 4OO5A 2DJ1A 4V2NA 5A1NB 3O3TA 3QFBC 2H6ZA 4K0GA 2GT5A 3EPTA 3ZFLA 1FAAA 1WJKA 4FYCA 2TRCP 2I9HA 1NHYA 4RUVA 1YKCA 5ECLB 3SWLA 2CQ9A 3FKFA 2DKHA 2KUCA 2HSMB 1SKWB 1BQ7A 1RK4A 2OKAA 3P8WA 2GS3A 1HNAA 2OT3A 3M3MA 3D4MA 1Z3EA 2E7PA 2HRAA 3ZYWA 2MMNA 5J41A 4PURA 2IIYA 1TU8A 2X99A 1M9AA 1LBKA 4GF0A 5ECQB 3KMOA 4HJ2A 4Q5RA 5DQSA 3EYTA 3GIXA 5ABRA 5BMUA 5CRHA 4MP4A 4ZILA 3FMWA 1PKZA 3P7XA 1NSWA 4BL7A 2R0GA 2A4VA 4IS0A 3L4NA 3TGZA 4X4JA 3ZVJA 2NDOA 1ERWA 4NWYA 2VCTA 1BAYA 5ECIB 5G2ZA 1GLQA 1XWBA 2X64A 1V58A 2I1UA 4G10A 4YH2A 6GSVA 4I8BA 4POKA 3QFAC 4NXIA 1EEJA 4AJ7A 2JU5A 2DJJA 1OAZA 2HYXA 1ACVA 4KDUA 2IN3A 3L9SA 2VL9A 3FR6A 4N11A 2RLIA 1R5AA 1QFNA 3PPUA 1GSUA 1PQNA 2V1MA 2WVXB 2EIOA 3ZZXA 3GSTA 1ZZYA 2AV4A 2EFDA 1Z7PA 3FR3A 4W66A 3ZFBA 2TRXA 2B5XA 2I4AA 3QOUA 2GZPA 3IR4A 3FK8A 1GNEA 1FB6A 2ZUPA 1OE7A 4X43A 2H30A 1GSQA 3C1RA 2PVOC 4X1UA 2A2SA 1OKDA 4ZBDA 2YZHA 3TKSE 4I2UA 1AQWA 5ECPB 1FO5A 1Z6NA 2C8UA 1WIKA 2LRTA 3M0FA 5G31A 5IOXA 5B6NA 5ECKB 1X5EA 3UVTA 1QMVA 4IJ3A 2KLXA 1YF0A 1HNCA 1XZOA 4Q5QA 3KZQA 2LRNA 3ISOA 1SL2B 4GLTA 3F4SA 5BRTA 4HSCX 5AN1A 3LFLA 1XOAA 1RW1A 1A24A 1MTCA 1EOHA 2D2ZA 4ZB8A 1QGVA 2REMA 3VI7A 1G6YA 4IQ1A 4KB3A 4OFMA 1FOHA 3GNJA 4NHWA 2PGTA 8GSSA 5DQYA 1GSFA 2BJXA 3TOTA 3IBHA 2CVBA 5CRDA 5F05A 2GVPA 4ISDA 2MMZA 2IMIA 1AUCA 2VCZA 4DEJA 3US3A 1VRSD 3EU4A 2P0GA 2HSNA 5DALA 1ZYPA 2H1AA 1ZYQB 4ZIJA 2P5QA 4Z7XA 2JADA 1TK8B 4GRFA 2C0GA 4L0WA 4AI6A 3P2AA 4CDOA 4IQAA 2RUEA 3HVSA 2PPTA 2UZ8A 2V6OA 5D73A 1UVZA 1QQ2A 4TVEA 1ZYNA 1K3YA 2UV8G 2AB6A 2CVKA 3LQ7A 1O6JA 4ML6A 5EVOA 4XS6A 2H6YA 4TR1B 2O3EA 3WGEA 1TRWA 3TJFA 1X0RA 1MDKA 2QA2A 4L5LA 3AY8A 2GSSA 3L0HA 2GQLA 5A34B 1VF4A 3KXOA 1UC7A 4MF7A 1GP1A 3CYNA 2V41A 2F9SA 3E3EA 2GDRA 1XWCA 4LMVA 3CHXC 2PWJA 2H66A 3VURA 4P3YB 5GAPD 2G0FA 3HZ8A 1TRSA 4PNFA 4E8HA 3Q18A 1X5DA 4JR6A 1PL1A 3C8EA 1ERVA 2IPAA 2C3TA 4KSMA 2I3YA 4PI2C 4F03A 1HQOA 1TXXA 2B7KA 1CQHA 3CMIA 3QAGA 3UVHA 2VLVA 1GSDA 3F6DA 3ERGA 3KGKA 3MSZA 3PR8A 2WW3A 4K8MA 1OYJA 1KTEA 1UA5A 1U6TA 2LUSA 4KDYA 3EINA 4N3ZA 6GSUA 1K0NA 3ME7A 5DJMA 1U87A 4BVXA 1M3IA 4YQUA 3BBYA 3ED3A 2R0CA 1O73A 1AIUA 4MABA 4ECJA 3HMJG 3V1WA 1S3RA 5HFKA 3LGCA 2HNLA 2L57A 4O5UA 3U6VA 1GWCA 2HRNA 3TRXA 1JZWA 2WCIA 4TW5A 3FHKA 3TRPA 2HZFA 3I9V2 3GHAA 4TXOB 4DSRA 4JBBA 4KDXA 3NIVA 1SJZA 4DSQA 2H8LA 2X4AA 1JLVA 1O7UA 1OC3A 2LJRA 5F8BA 5ELAA 1T4ZA 1B9XC 2LQQA 2H01A 2R37A 1ZL9A 1PMTA 2CA8A 1F2EA 2C0EA 2VD0A 5B7CA 5J40A 1YY7A 2H1BA 2DLXA 1H75A 4KUNA 3IA1A 5A4UA 3HKRA 2XBIA 1AQVA 2R2JA 4HQZA 4E8EA 1F9MA 5CO3A 2GSTA 2WW0A 5HFIA 2JACA 4ZL8A 3FW2A 2WS2A 1S3DA 3IAM2 2YJHA 5IO2A 4QL7A 2HZEA 4IELA 1ERTA 4TR3A 2IWTA 1ML6A 2GQKA 1V57A 1LU4A 2LSTA 3HD5A 2P5RA 5AIXA 2GT6A 2VCXA 2IMKA 1TK0B 3TOUA 2RM6A 4PGTA 3CSHA 1TI1A 2IMDA 2PBJA 1R4WA 3I6AA 4OCEA 3TUEA 5E59A 3M8NA 1SD8A 5A1NA 2HE3A 3EU3A 1YQ1A 1RQMA 2M46A 4ZXGA 1QXHA 4WEYA 1MEKA 6GSTA 4KH7A 4KX4A 5HR1A 5GSSA 1GSYA 5B8BA 3ERFA 3ZIJA 5KOXA 5IMCA 2HSMA 4FH8A 5DVBA 3F0IA 4XIHA 4WF4A 4CY8A 2ON7A 3C71A 2JZRA 5J4VA 1X9WB 4K5RA 2YOIA 3CXGA 2DJ0A 3D4TA 4KCEA 3TKSC 1K0CA 2OE0A 1TRUA 1XG8A 2GTUA 3F8UA 4E68A 2WFCA 3HJMA 3PGTA 4F0CA 4MLYA 4K0NA 5D9TA 2K6VA 5L71A 3TB2A 2WRTA 4I6XA 5DDLA 4IP1A 4PUFC 10GSA 3HCZA 4FYBA 4PNGA 1AC1A 3QMXA 4OCFA 3A3TA 3ZIVA 1CQGA 4YQMA 5D96A 4MPGA 3FRCA 4AGSA 4WR5A 1AW9A 1EP8A 5A5HB 4XTSA 1Y6EA 1EP7A 1XVWA 3APOA 1XOBA 1TU7A 3D0ZA 1PRXA 4HU9A 1FHEA 4G19A 3DIEA 5IQYA 2ES7A 3HVNA 4MDCA 1NM3A 5JCGA 1ZYEA 4H86A 1T8EB 5JCWA 1THXA 3LW9A 1VF2A 3HYPA 1K3OA 3WGDA 2HXKA 4ACSA 4YKFA 3L9VA 1WRYA 2HFDA 4PTSA 2FWHA 2DKIA 3TJBA 1XIYA 4ML1A 3A2VA 4IN0A 5EL8A 4HU7A 2H75A 2HRFA 3DMLA 3VWXA 1TK5B 3IHGA 1O8WA 1XBSA 1O85A 4ZL7A 1MDJA 2FUG2 4K5SA 2L6DA 3F6FA 3UEMA 1TP9A 2L6CA 3I69A 1KEBA 4TN8A 3VFIA 2FHEA 1FB0A 4KNDA 4OFNA 4EO3A 3IE3A 3A2XA 3F63A 5HQPA 1N8JA 1B4QA 2PMTA 1Z7RA 2QC7A 1M3JA 5EPFA 2DIZA 3O6TA 4KW6A 3H93A 5A4VA 4XS4B 2C80A 1GTBA 3ZTLA 2N5BA 2FD3A 4PXOA 4MH2A 5DJLA 5G5FA 5D8IA 4ID0A 2FLSA 3KJYA 5CYYA 2YWNA 1J9BA 3IC8A 4ZB9A 2H1GA 3QCPA 2WGRA 3BD2A 1THOA 1V40A 3N9JA 2WVYA 2M80A 3GL3A 1EGOA 3G7JA 4IKHA 4MZCA 3LSZA 5EY6A 4LL4B 3PH9A 3KIJA 3J7Yb 2IFQB 1ZMAA 1X9MB 1Q4JA 2O89A 3FZAA 2OBIA 4QMKA 4HOJA 2L4QA 4IGJA 1YEWC 4N0ZA 4EDYA 1XFLA 4YAVA 2DSAA 1IYHA 3A5WA 4O7HA 4WBRD 3RPPA 2YN1A 2DJ2A 4BWQA 1EV4A 5B8AA 1S3AA 2VKZG 2O7KA 2VM1A 4MJCA 1T7PB 2O8VB 3GKMA 2LQOA 4IW9A 2WW2A 1XCCA 3NZNA 1DUGA 3W8SA 4POBA 1R26A 4D73B 2L59A 1JZOA 1GULA 3UOMA 5CAXA 4EUYA 1M99A 4MH3A 5CRGA 4G0LA 4IJIA 4CHSA 4KF9A 3ZMLA 1N25A 3H4KA 3QD9A 4TR1A 16GSA 2VLUA 1T3BA 5D9VA 5KOWA 1OC9B 1Y1UA 4FIWA 12GSA 5A34A 1TRVA 3DGQA 3HZ4A 2HRKA 3D22A 3VI5A 4MMMA 3IRAA 2AAWA 1BX9A 1FW1A 1OE8A 3D5JA 3KH7A 1BEDA 1XW9A 2FNOA 2FWGA 4USSA 1ON4A 4N10A 1C72A 5IPHA 3C73A 5ID2B 4MNNA 3MYDA 4PHZC 2X8HA 1M7TA 2V2GA 4RQXA 4TRXA 2CZ2A 9GSSA 2B3SA 2GGTA 3ME8A 1YKAA 2C0FA 3CSJA 5H5QA 2M72A 2VOCA 5DCGA 4EL1A 3UAPA 2MBSA 2C3QA 5ENUA 4CW9A 4J2FA 1EGRA 3Q19A 1M2DA 3F9UA 3UARA 3KM6A 3EWLA 4LMWA 4JRRA 2VL2C 5JCUA 4O92A 3GFKA 3NOFA 4AKGA 4K9ZA 3EE2A 1ZOFA 4EC0A 5ECOB 2C3NA 1BG5A 4LL1B 1SKRB 1PFOA 2H0HA 1QUWA 1SENA 1A2JA 3Q74A 4ECBA 4L8EA 2MMOA 2YV7A 1TDIA 2VL3A 1ST9A 5J9CA 2PUKC 3DEXA 5KN2A 2OA7A 2CV4A 4TXOA 1T00A 2B1KA 2EFCA 1Z9HA 3C7MA 2GSQA 4HS1A 3LXZA 5ECSA 3CSIA 4PQ1A 1PX6A 3IK7A 3IOSA 2LKUA 1F3BA 14GSA 3JCML 3M9JA 2GQMA 5AGYA 1G7OA 4I2TA 3K8NA 1SL1B 2OACA 4JZQA 4WKWA 5JWRB 3QDNA 1BJXA 2FA4A 3UJ1A 4XHMA 2OADA 3GTUB 1E2YA 5LNKe 5IMVA 4POMA 1GTIA 1EWXA 3RAZA 2GSRA 1SJ6A 2N5FA 1PX7A 1SYRA 4ZBBA 1USBA 5F07A 3J7Yk 2K9FA 1YJ6A 1PA3A 4WF5A 1ERUA 1J08A 2FA8A 2QA1A 4POLA 1MD4A 3RBTA 1GNWA 5J4YA 4WBJA 2H73A 4KSOA 1EV9A 18GSA 2WB9A 2YV9A 4K7IA 1URMA 2KP1A 2FWEA 4HDEA 1GLPA 4AKXB 5B6MA 3BCIA 1XWKA 3TU3B 3S9FA 1IYIA 4ECIA 1Z6MA 1NW2A 1SK0A 4GTUA 5ECNB 3DWVA 3UMAA 1GUKA 3GYKA 3CTGA 2ON5A 4L0UA 3I43A 2YJ7A 2NTOA 2FCHA 2HSNB 3LYKA 2MZCA 5INYA 3TJKA 2K8VA 2XHFA 3LWAA 5AIVA 3HVVA 1TOFA 2Z9SA 3HJOA 1T1VA 3L9UA 2AYTA 5F06A 5KN0A 4HZ4A 2QSIA 3R3EA 2VM2A 4KGIA 1J0FA 3CTFA 5IIZA 1F6MC 3RFRC 4XS1A 4RQRA 3QAWA 4Q5NA 2DJ3A 1MDIA 3CBUA 1DSBA 1YEPA 2GZYA 1A0FA 4ZL9A 2K8SA 2R4VA 2XC2A 3HY2A 3TRQA 2K18A 5AISA 4DVCA 4BVYB 1YDKA 2DMMA 4NV2A 2VO4A 4K1FA 4EDZA 3GH9A 3MDKA 3FY7A 5COHA 4L5OA 5A5HA 4EVMA 5D9WA 2E0QA 2RM5A 4KA0A 4F2IA 4YQVA 1U88A 3GKNA 5HFGA 2BTOT 2H1LA 2YWIA 2MMAA 2TIRA 4FXYP 2YANA 3EMPA 4RI7A 2KHPA 4AF2A 4GSSA 4YKGA 2H74A 1X5CA 3MNGA 1Q98A 1JHBA 3D21A 4XCSA 4GSNA 3DVWA 4HUAA 3FYGA 4PX1A 2RIIA 4LA1A 5DAKB 2CX4A 1E6BA 4GQFA 4HZ2A 4A5PA 2IMFA 4HJMA 3VK9A 1A8LA 3KCMA 2LS5A 2DC5A 4J57E 5A4WA 3DKSA 2H19A 3KP9A 3KEBA 3RDWA 2WZSA 2ZNMA 2YZUA 1G7EA 5LCZA 4ILFA 4V1Ag 11GSA 2IL3A 4K2DA 2C4JA 3FZ9A 2EIRA 4DSSB 1T4YA 2CVDA 2H76A 1ZGNA 2A2PA 1HNBA 1PKWA 3WYWA 3LXTA 4MZBA 4XS4A 5A5KA 2J9HA 4YAPA 1A0RP 4BPYA 4NHZA 3DD3A 4AKHA 1BG1A 2H71A 3DYRA 6GSYA 2L5OA 1BYEA 2C0DA 3FEUA 3DRNA 4J56E 2JSZA 5IMFA 5DBQA 1G6WA 22GSA 5IMDA 1EEMA 1V9WA 1WPIA 1FVJA 2IFQA 2LV3A 1YF1A 3GL5A 1K0AA 4XRAA 5H5SA 3TKQA 4K7NA 5D93A 4EKZA 4OO4A 3G7YA 17GSA 1PD21 5FHIA 1S4BP 2EFHA 5J4UA 2CX3A 4MJAA 3KD0A 3HHVA 4RI6A 1JFUA 4TKYA 2WVXA 2WVZA 4G9HA 1Z5YE 2R0PA 4F9ZA 1K0DA 4BWSA 2HSYA 4WR4A 1GSEA 2PU9C 5CREA 2NBSA 2GLRA 4O5RA 1DE1A 2YCDA 4KE3A 3GKXA 2VCWA 3EC3A 2KOKA 5FT3A 2O5VA 2WW1A 1M9BA 3KH9A 3OR5A 1A23A 1SVMA 3W8JA 13GSA 3GH6A 2JZTA 3E9JB 2CAIA 5GZZB 1XW6A 1VF3A 1OC9A 1WP0A 5H5RA 4Q5FA 2NPBA 1OVNA 4OMVA 4PQHA 2A2RA 2YP6A 1SK1A 2B5EA 3BCKA 1A2MA 1XXUA 5IMZA 4MA9A 2F8AA 2H0GA 4GCIA 3IDVA 1SU9A 3IPZA 2VCQA 2IJYA 1XWGA 5ID2A 1VF1A 1SKSB 5KN3A 2L5LA 2H1DA 3GSSA 2F51A 2O85A 1JZRA 2CZ3A 3A2WA 3H1NA 5CRWA 3RPNA 3UBKA 3ZREA 3L78A 4Z2RA 1K3LA 1W4VA 2PN8A 3KTBA 5F0GA 2QGVA 2DBCA 4O32A 5G5EA 1XPVA 5HR2A 2CAQA 1M2AA 3Q6OA 4TR4A 5GAND 5DCHA 4FYUA 2YPMA 5J3RA 1R5PA 4ECCA 2A4HA 2CT6A 1GRXA 6GSWA 3MIXA 3RHCA 2ALBA 1U3AA 3KMNA 2E2MA 6GSSA 3HXSA 3WGXA 1SVOA 4MF6A 1I5GA 1SD9A 3IHQA 1PSQA 5J47A 3WD6A 3ZLPA 2BMXA 3TDGA 4QL9A 3ZITA 2B7JA 5C00A 1KNGA 2DMLA 1A2LA 4EIQA 3RHBA 2WJUA 3ZMKA 3LEFA 3HDCA 2L4CA 1YZXA 3QPMA 1UN2A 5JWQB 5IPGA 3LORA 3DVXA 3F4TA 4N0VA 4X0XA 2EFEA 3RGBC 2MBTA 4PI0C 4KAEA 3CWGA 3GTUA 3GX0A 4KCAA 3ZRDA 3IAS2 4GWRA 4GDFA 2J23A 4MCUA 3TKSA 2LRCA 2DJKA 5JWOB 2HLSA 1VGLA 3ZL5A 3IXRA 5IO0A 2QKEA 4AJ6A 2H70A 1SJIA 5BMUB 2HI7A 3CRTA 5GSTA 4TXVA 2G2QA 4NMUA 3VWVA 2OE3A 4BL7B 1U3IA 4MJBA 3P90A 3MAKA 2JL4A 4ICYA 2XPEA 2I81A 4ZB7A 5ECHB 3C1SA 3EURA 3LYPA 2LJAA 4OFTA 2RUFA 3VPQA 2H72A 2OE1A 3GN3A 4V2LA 1M2BA 3TKPA 4JEDA 3E0UA 4I97A 3GV1A 1FG4A 3U5RE 3APSA 1B9YC 3H8QA 4MF5A 2X49A 1TXUA 2V32A 2FWFA 1W89A 4F0BA 2H6XA 4O5QA 1PN0A 3DXBA 2AUVA 4EIPA 1SL0B 5G1LA 2WZ9A 2FY6A 1TTZA 5IMAA 3VWUA 4HQSA 4XRDA 3HVXA 1OC8A 4IBPA 2WDUA 3PINA 2VD1A 2OBKA 2NVLA 1TI3A 2YWOA 2F8FA 2HT9A 2VLTA 1B48A 1AAZA 1O81A 2F3MA 2ZCTA 3MWHA 1DE2A 3IC4A 4N30A 3TKRA 2EIQA 4IHUA 3FZ4A 4EE0A 2OJLA 2EC4A 4BVYA 1PGTA 4AKIA 2HRKB 1I1IP 5FWGA 4GSTA 4G0IA 2X8CA 3GKKA 1G0TA 3BOAA 2VAFA 1TW9A 1V2AA 4JR4A 1N2AA 4K7OA 3FR9A 2R6KA 1TJDA 1AQXA 3GURA 1HYUA 1GL8A 1EOGA 2GZZA 3KTLA 2PVQA 2LNTA 1HD2A 1K0BA 2YNXA 1PN9A 4TOPA 1R7HA 4MJEA 1JLWA 3CRUA 1NHOA 1A8YA 3GRXA 4EF0A 3TCOA 5KEJA 3F3QA 4ZB6A 5DAKA 2LEGA 2LJKA 3ERWA 3W6GA 2H0IA 5G1KA 1V98A 4OWYA 1YEXA 4PUAA 2B1LA 5DALB 1EZKA 2HSHA 3TJGA 3GUSA 3R2QA 2AHEA 1GH2A 3ZVJD 5E4WA 1LJRA 3F3RA 2R3XA 5ELGA 2VCVA 1SYXA 1QK8A 1F3AA 3M9KA 1GSSA 4Z2TA 4JE1A 1SK2A 4DSSA 1ABAA 1DBYA 4ZBAA 3VLNA 5LD0A 3N5OA 2N5AA 4K2XA 3UIWA 1SVLA 2O36A 3HA9A 1MD3A 1XWAA 1XW5A
chains in the Genus database with same CATH topology
2O87A 5IM9A 4NV5A 4MK3A 2VIMA 4CY6A 4V1Ap 2JSYA 3EVIA 1K0MA 1FVKA 2LNSA 7GSSA 3G9BA 4HEA2 1GTUA 4TR0A 5HR3A 1KBNA 1JZDA 2E2GA 2YWMA 4GQCA 5ECMB 4LLRA 2IMEA 4IP6A 1ZCPA 3BJ5A 3VWWA 3FZ5A 3SBCA 1GUHA 4NAXA 3G7IA 2VUPA 4F82A 4FO5A 19GSA 1S3CA 4MZWA 1K0OA 3LJRA 4MPFA 1YVLA 5ECRB 2VL2A 2LTKA 2MYGA 1BF5A 3H79A 4BA7A 1ILOA 2C1YA 2FGXA 3F4RA 1O8XA 3APQA 4BVXB 3O76A 1I9DA 2HQTA 5CNWA 1B8XA 4PQIA 1WWJA 1H4OA 4V2MA 5HR0A 20GSA 2V6KA 4QQ7A 4G01A 3D6IA 3QR6A 1GTAA 2JZSA 3EMXA 1PL2A 3WT2A 3IK9A 3GX8A 4K6XA 4G0KA 3TJJA 3IV4A 5G30A 2R5GA 3QAVA 4EXJA 1FOVA 5CP1A 3LG6A 1M0UA 2XPDA 1F37A 4WETA 5J5NA 3GA4A 4JU5A 3UL3A 1WMJA 4IVFA 4G2EA 4Z2UA 1WE0A 4NPBA 2WULA 4AJ8A 4OD7A 1XVQA 2B5YA 2P31A 3VPTA 4FQUA 4WXTA 3HJPA 1GUMA 1Y25A 2XBQA 6GSXA 1X9SB 4HI7A 4I5QA 2AJQB 2HZEB 1AXDA 5C04A 3KP8A 1TKDB 2PERA 5IOWA 5D9XA 1B4PA 3A5IA 2X8GA 3UBLA 2KP2A 3WT1A 3GMFA 2DIYA 5J9BA 4GXZA 4ULXA 3M1GA 2B6MA 1WOUA 1OKTA 5KN1A 4D73A 4OO5A 2DJ1A 4V2NA 5A1NB 3O3TA 3QFBC 2H6ZA 4K0GA 2GT5A 3EPTA 3ZFLA 1FAAA 1WJKA 4FYCA 2TRCP 2I9HA 1NHYA 4RUVA 1YKCA 5ECLB 3SWLA 2CQ9A 3FKFA 2DKHA 2KUCA 2HSMB 1SKWB 1BQ7A 1RK4A 2OKAA 3P8WA 2GS3A 1HNAA 2OT3A 3M3MA 3D4MA 1Z3EA 2E7PA 2HRAA 3ZYWA 2MMNA 5J41A 4PURA 2IIYA 1TU8A 2X99A 1M9AA 1LBKA 4GF0A 5ECQB 3KMOA 4HJ2A 4Q5RA 5DQSA 3EYTA 3GIXA 5ABRA 5BMUA 5CRHA 4MP4A 4ZILA 3FMWA 1PKZA 3P7XA 1NSWA 4BL7A 2R0GA 2A4VA 4IS0A 3L4NA 3TGZA 4X4JA 3ZVJA 2NDOA 1ERWA 4NWYA 2VCTA 1BAYA 5ECIB 5G2ZA 1GLQA 1XWBA 2X64A 1V58A 2I1UA 4G10A 4YH2A 6GSVA 4I8BA 4POKA 3QFAC 4NXIA 1EEJA 4AJ7A 2JU5A 2DJJA 1OAZA 2HYXA 1ACVA 4KDUA 2IN3A 3L9SA 2VL9A 3FR6A 4N11A 2RLIA 1R5AA 1QFNA 3PPUA 1GSUA 1PQNA 2V1MA 2EIOA 3ZZXA 3GSTA 1ZZYA 2AV4A 2EFDA 1Z7PA 3FR3A 4W66A 3ZFBA 2TRXA 2B5XA 2I4AA 3QOUA 2GZPA 3IR4A 3FK8A 1GNEA 1FB6A 2ZUPA 1OE7A 4X43A 2H30A 1GSQA 3C1RA 2PVOC 4X1UA 2A2SA 1OKDA 4ZBDA 2YZHA 3TKSE 4I2UA 1AQWA 5ECPB 1FO5A 1Z6NA 2C8UA 1WIKA 2LRTA 3M0FA 5G31A 5IOXA 5B6NA 5ECKB 1X5EA 3UVTA 1QMVA 4IJ3A 2KLXA 1YF0A 1HNCA 1XZOA 4Q5QA 3KZQA 2LRNA 3ISOA 1SL2B 4GLTA 3F4SA 5BRTA 5AN1A 3LFLA 1XOAA 1RW1A 1A24A 1MTCA 1EOHA 2D2ZA 4ZB8A 1QGVA 2REMA 3VI7A 1G6YA 4IQ1A 4KB3A 4OFMA 1FOHA 3GNJA 4NHWA 2PGTA 8GSSA 5DQYA 1GSFA 2BJXA 3TOTA 3IBHA 2CVBA 5CRDA 5F05A 2GVPA 4ISDA 2MMZA 2IMIA 1AUCA 2VCZA 4DEJA 3US3A 1VRSD 3EU4A 2P0GA 2HSNA 5DALA 1ZYPA 2H1AA 1ZYQB 4ZIJA 2P5QA 4Z7XA 2JADA 1TK8B 4GRFA 2C0GA 4L0WA 4AI6A 3P2AA 4CDOA 4IQAA 2RUEA 3HVSA 2PPTA 2UZ8A 2V6OA 5D73A 1UVZA 1QQ2A 4TVEA 1ZYNA 1K3YA 2UV8G 2AB6A 2CVKA 3LQ7A 1O6JA 4ML6A 5EVOA 4XS6A 2H6YA 4TR1B 3WGEA 1TRWA 3TJFA 1X0RA 1MDKA 2QA2A 4L5LA 3AY8A 2GSSA 3L0HA 2GQLA 5A34B 1VF4A 3KXOA 1UC7A 4MF7A 1GP1A 3CYNA 2V41A 2F9SA 3E3EA 2GDRA 1XWCA 4LMVA 2PWJA 2H66A 3VURA 4P3YB 5GAPD 2G0FA 3HZ8A 1TRSA 4PNFA 4E8HA 3Q18A 1X5DA 4JR6A 1PL1A 3C8EA 1ERVA 2IPAA 2C3TA 4KSMA 2I3YA 4F03A 1HQOA 1TXXA 2B7KA 1CQHA 3CMIA 3QAGA 3UVHA 2VLVA 1GSDA 3F6DA 3ERGA 3KGKA 3MSZA 3PR8A 4K8MA 1OYJA 1KTEA 1UA5A 1U6TA 2LUSA 4KDYA 3EINA 4N3ZA 6GSUA 1K0NA 3ME7A 5DJMA 1U87A 4BVXA 4YQUA 3BBYA 3ED3A 2R0CA 1O73A 1AIUA 4MABA 4ECJA 3HMJG 3V1WA 5HFKA 3LGCA 2HNLA 2L57A 4O5UA 3U6VA 1GWCA 2HRNA 3TRXA 1JZWA 2WCIA 4TW5A 3FHKA 3TRPA 2HZFA 3I9V2 3GHAA 4TXOB 4DSRA 4JBBA 4KDXA 3NIVA 1SJZA 4DSQA 2H8LA 2X4AA 1JLVA 1O7UA 1OC3A 2LJRA 5F8BA 5ELAA 1T4ZA 1B9XC 2LQQA 2H01A 2R37A 1ZL9A 1PMTA 2CA8A 1F2EA 2C0EA 2VD0A 5B7CA 5J40A 1YY7A 2H1BA 2DLXA 1H75A 4KUNA 3IA1A 5A4UA 3HKRA 2XBIA 1AQVA 2R2JA 4HQZA 4E8EA 1F9MA 5CO3A 2GSTA 5HFIA 2JACA 4ZL8A 3FW2A 2WS2A 1S3DA 3IAM2 2YJHA 5IO2A 4QL7A 2HZEA 4IELA 1ERTA 4TR3A 2IWTA 1ML6A 2GQKA 1V57A 1LU4A 2LSTA 3HD5A 2P5RA 5AIXA 2GT6A 2VCXA 2IMKA 1TK0B 3TOUA 2RM6A 4PGTA 3CSHA 1TI1A 2IMDA 2PBJA 1R4WA 3I6AA 4OCEA 3TUEA 5E59A 3M8NA 1SD8A 5A1NA 2HE3A 3EU3A 1YQ1A 1RQMA 2M46A 4ZXGA 1QXHA 4WEYA 1MEKA 6GSTA 4KH7A 4KX4A 5HR1A 5GSSA 1GSYA 5B8BA 3ERFA 3ZIJA 5KOXA 5IMCA 2HSMA 4FH8A 5DVBA 3F0IA 4XIHA 4WF4A 4CY8A 2ON7A 3C71A 2JZRA 5J4VA 1X9WB 4K5RA 2YOIA 3CXGA 2DJ0A 3D4TA 4KCEA 3TKSC 1K0CA 2OE0A 1TRUA 2GTUA 3F8UA 4E68A 2WFCA 3HJMA 3PGTA 4F0CA 4MLYA 4K0NA 5D9TA 2K6VA 5L71A 3TB2A 2WRTA 4I6XA 5DDLA 4IP1A 4PUFC 10GSA 3HCZA 4FYBA 4PNGA 1AC1A 3QMXA 4OCFA 3A3TA 3ZIVA 1CQGA 4YQMA 5D96A 4MPGA 3FRCA 4AGSA 4WR5A 1AW9A 1EP8A 5A5HB 4XTSA 1Y6EA 1EP7A 1XVWA 3APOA 1XOBA 1TU7A 3D0ZA 1PRXA 4HU9A 1FHEA 4G19A 3DIEA 5IQYA 2ES7A 4MDCA 1NM3A 5JCGA 1ZYEA 4H86A 1T8EB 5JCWA 1THXA 3LW9A 1VF2A 3HYPA 1K3OA 3WGDA 2HXKA 4ACSA 4YKFA 3L9VA 1WRYA 2HFDA 4PTSA 2FWHA 2DKIA 3TJBA 1XIYA 4ML1A 3A2VA 4IN0A 5EL8A 4HU7A 2H75A 2HRFA 3DMLA 3VWXA 1TK5B 3IHGA 1O8WA 1XBSA 1O85A 4ZL7A 1MDJA 2FUG2 4K5SA 2L6DA 3F6FA 3UEMA 1TP9A 2L6CA 3I69A 1KEBA 4TN8A 3VFIA 2FHEA 1FB0A 4KNDA 4OFNA 4EO3A 3IE3A 3A2XA 3F63A 5HQPA 1N8JA 1B4QA 2PMTA 1Z7RA 2QC7A 5EPFA 2DIZA 3O6TA 4KW6A 3H93A 5A4VA 4XS4B 2C80A 1GTBA 3ZTLA 2N5BA 2FD3A 4PXOA 4MH2A 5DJLA 5G5FA 5D8IA 4ID0A 2FLSA 3KJYA 5CYYA 2YWNA 1J9BA 3IC8A 4ZB9A 2H1GA 3QCPA 2WGRA 3BD2A 1THOA 1V40A 3N9JA 2M80A 3GL3A 1EGOA 3G7JA 4IKHA 4MZCA 3LSZA 5EY6A 4LL4B 3PH9A 3KIJA 3J7Yb 2IFQB 1ZMAA 1X9MB 1Q4JA 2O89A 3FZAA 2OBIA 4QMKA 4HOJA 2L4QA 4IGJA 4N0ZA 4EDYA 1XFLA 4YAVA 2DSAA 1IYHA 3A5WA 4O7HA 4WBRD 3RPPA 2YN1A 2DJ2A 4BWQA 1EV4A 5B8AA 1S3AA 2VKZG 2O7KA 2VM1A 4MJCA 1T7PB 2O8VB 3GKMA 2LQOA 4IW9A 1XCCA 3NZNA 1DUGA 3W8SA 4POBA 1R26A 4D73B 2L59A 1JZOA 1GULA 3UOMA 5CAXA 4EUYA 1M99A 4MH3A 5CRGA 4G0LA 4IJIA 4CHSA 4KF9A 3ZMLA 1N25A 3H4KA 3QD9A 4TR1A 16GSA 2VLUA 1T3BA 5D9VA 5KOWA 1OC9B 1Y1UA 4FIWA 12GSA 5A34A 1TRVA 3DGQA 3HZ4A 2HRKA 3D22A 3VI5A 4MMMA 3IRAA 2AAWA 1BX9A 1FW1A 1OE8A 3D5JA 3KH7A 1BEDA 1XW9A 2FNOA 2FWGA 4USSA 1ON4A 4N10A 1C72A 5IPHA 3C73A 5ID2B 4MNNA 3MYDA 2X8HA 1M7TA 2V2GA 4RQXA 4TRXA 2CZ2A 9GSSA 2B3SA 2GGTA 3ME8A 1YKAA 2C0FA 3CSJA 5H5QA 2M72A 2VOCA 5DCGA 4EL1A 3UAPA 2MBSA 2C3QA 5ENUA 4CW9A 4J2FA 1EGRA 3Q19A 1M2DA 3F9UA 3UARA 3KM6A 3EWLA 4LMWA 4JRRA 2VL2C 5JCUA 4O92A 3GFKA 3NOFA 4AKGA 4K9ZA 3EE2A 1ZOFA 4EC0A 5ECOB 2C3NA 1BG5A 4LL1B 1SKRB 2H0HA 1QUWA 1SENA 1A2JA 3Q74A 4ECBA 4L8EA 2MMOA 2YV7A 1TDIA 2VL3A 1ST9A 5J9CA 2PUKC 3DEXA 5KN2A 2OA7A 2CV4A 4TXOA 1T00A 2B1KA 2EFCA 1Z9HA 3C7MA 2GSQA 4HS1A 3LXZA 5ECSA 3CSIA 4PQ1A 1PX6A 3IK7A 3IOSA 2LKUA 1F3BA 14GSA 3JCML 3M9JA 2GQMA 5AGYA 1G7OA 4I2TA 3K8NA 1SL1B 2OACA 4JZQA 4WKWA 5JWRB 3QDNA 1BJXA 2FA4A 3UJ1A 4XHMA 2OADA 3GTUB 1E2YA 5LNKe 5IMVA 4POMA 1GTIA 1EWXA 3RAZA 2GSRA 1SJ6A 2N5FA 1PX7A 1SYRA 4ZBBA 1USBA 5F07A 3J7Yk 2K9FA 1YJ6A 1PA3A 4WF5A 1ERUA 1J08A 2FA8A 2QA1A 4POLA 1MD4A 3RBTA 1GNWA 5J4YA 4WBJA 2H73A 4KSOA 1EV9A 18GSA 2WB9A 2YV9A 4K7IA 1URMA 2KP1A 2FWEA 4HDEA 1GLPA 4AKXB 5B6MA 3BCIA 1XWKA 3TU3B 3S9FA 1IYIA 4ECIA 1Z6MA 1NW2A 1SK0A 4GTUA 5ECNB 3DWVA 3UMAA 1GUKA 3GYKA 3CTGA 2ON5A 4L0UA 3I43A 2YJ7A 2NTOA 2FCHA 2HSNB 3LYKA 2MZCA 5INYA 3TJKA 2K8VA 2XHFA 3LWAA 5AIVA 3HVVA 1TOFA 2Z9SA 3HJOA 1T1VA 3L9UA 2AYTA 5F06A 5KN0A 4HZ4A 2QSIA 3R3EA 2VM2A 4KGIA 1J0FA 3CTFA 5IIZA 1F6MC 4XS1A 4RQRA 3QAWA 4Q5NA 2DJ3A 1MDIA 3CBUA 1DSBA 1YEPA 2GZYA 1A0FA 4ZL9A 2K8SA 2R4VA 2XC2A 3HY2A 3TRQA 2K18A 5AISA 4DVCA 4BVYB 1YDKA 2DMMA 4NV2A 2VO4A 4K1FA 4EDZA 3GH9A 3MDKA 3FY7A 5COHA 4L5OA 5A5HA 4EVMA 5D9WA 2E0QA 2RM5A 4KA0A 4F2IA 4YQVA 1U88A 3GKNA 5HFGA 2BTOT 2H1LA 2YWIA 2MMAA 2TIRA 2YANA 3EMPA 4RI7A 2KHPA 4AF2A 4GSSA 4YKGA 2H74A 1X5CA 3MNGA 1Q98A 1JHBA 3D21A 4XCSA 4GSNA 3DVWA 4HUAA 3FYGA 4PX1A 2RIIA 4LA1A 5DAKB 2CX4A 1E6BA 4GQFA 4HZ2A 4A5PA 2IMFA 4HJMA 3VK9A 1A8LA 3KCMA 2LS5A 2DC5A 4J57E 5A4WA 3DKSA 2H19A 3KP9A 3KEBA 3RDWA 2ZNMA 2YZUA 1G7EA 5LCZA 4ILFA 4V1Ag 11GSA 2IL3A 4K2DA 2C4JA 3FZ9A 2EIRA 4DSSB 1T4YA 2CVDA 2H76A 1ZGNA 2A2PA 1HNBA 1PKWA 3WYWA 3LXTA 4MZBA 4XS4A 5A5KA 2J9HA 4YAPA 1A0RP 4BPYA 4NHZA 3DD3A 4AKHA 1BG1A 2H71A 3DYRA 6GSYA 2L5OA 1BYEA 2C0DA 3FEUA 3DRNA 4J56E 2JSZA 5IMFA 5DBQA 1G6WA 22GSA 5IMDA 1EEMA 1V9WA 1WPIA 1FVJA 2IFQA 2LV3A 1YF1A 3GL5A 1K0AA 4XRAA 5H5SA 3TKQA 4K7NA 5D93A 4EKZA 4OO4A 3G7YA 17GSA 1PD21 5FHIA 2EFHA 5J4UA 2CX3A 4MJAA 3KD0A 3HHVA 4RI6A 1JFUA 4TKYA 1Z5YE 4G9HA 2R0PA 4F9ZA 1K0DA 4BWSA 2HSYA 4WR4A 1GSEA 2PU9C 5CREA 2NBSA 2GLRA 4O5RA 1DE1A 2YCDA 4KE3A 3GKXA 2VCWA 3EC3A 2KOKA 5FT3A 2O5VA 1M9BA 3KH9A 3OR5A 1A23A 1SVMA 3W8JA 13GSA 3GH6A 2JZTA 3E9JB 2CAIA 5GZZB 1XW6A 1VF3A 1OC9A 1WP0A 5H5RA 4Q5FA 2NPBA 1OVNA 4OMVA 4PQHA 2A2RA 2YP6A 1SK1A 2B5EA 3BCKA 1A2MA 1XXUA 5IMZA 4MA9A 2F8AA 2H0GA 4GCIA 3IDVA 1SU9A 3IPZA 2VCQA 2IJYA 1XWGA 5ID2A 1VF1A 1SKSB 5KN3A 2L5LA 2H1DA 3GSSA 2F51A 2O85A 1JZRA 2CZ3A 3A2WA 3H1NA 5CRWA 3RPNA 3UBKA 3ZREA 3L78A 4Z2RA 1K3LA 1W4VA 2PN8A 3KTBA 5F0GA 2QGVA 2DBCA 4O32A 5G5EA 1XPVA 5HR2A 2CAQA 1M2AA 3Q6OA 4TR4A 5GAND 5DCHA 4FYUA 2YPMA 5J3RA 1R5PA 4ECCA 2A4HA 2CT6A 1GRXA 6GSWA 3MIXA 3RHCA 2ALBA 1U3AA 3KMNA 2E2MA 6GSSA 3HXSA 3WGXA 1SVOA 4MF6A 1I5GA 1SD9A 3IHQA 1PSQA 5J47A 3WD6A 3ZLPA 2BMXA 3TDGA 4QL9A 3ZITA 2B7JA 5C00A 1KNGA 2DMLA 1A2LA 4EIQA 3RHBA 2WJUA 3ZMKA 3LEFA 3HDCA 2L4CA 1YZXA 3QPMA 1UN2A 5JWQB 5IPGA 3LORA 3DVXA 3F4TA 4N0VA 4X0XA 2EFEA 2MBTA 4KAEA 3CWGA 3GTUA 3GX0A 4KCAA 3ZRDA 3IAS2 4GWRA 4GDFA 2J23A 4MCUA 3TKSA 2LRCA 2DJKA 5JWOB 2HLSA 1VGLA 3ZL5A 3IXRA 5IO0A 2QKEA 4AJ6A 2H70A 1SJIA 5BMUB 2HI7A 3CRTA 5GSTA 4TXVA 2G2QA 4NMUA 3VWVA 2OE3A 4BL7B 1U3IA 4MJBA 3P90A 3MAKA 2JL4A 4ICYA 2XPEA 2I81A 4ZB7A 5ECHB 3C1SA 3EURA 3LYPA 2LJAA 4OFTA 2RUFA 3VPQA 2H72A 2OE1A 3GN3A 4V2LA 1M2BA 3TKPA 4JEDA 3E0UA 4I97A 3GV1A 1FG4A 3U5RE 3APSA 1B9YC 3H8QA 4MF5A 2X49A 1TXUA 2V32A 2FWFA 1W89A 4F0BA 2H6XA 4O5QA 1PN0A 3DXBA 2AUVA 4EIPA 1SL0B 5G1LA 2WZ9A 2FY6A 1TTZA 5IMAA 3VWUA 4HQSA 4XRDA 3HVXA 1OC8A 4IBPA 2WDUA 3PINA 2VD1A 2OBKA 2NVLA 1TI3A 2YWOA 2F8FA 2HT9A 2VLTA 1B48A 1AAZA 1O81A 2F3MA 2ZCTA 3MWHA 1DE2A 3IC4A 4N30A 3TKRA 2EIQA 4IHUA 3FZ4A 4EE0A 2OJLA 2EC4A 4BVYA 1PGTA 4AKIA 2HRKB 5FWGA 4GSTA 4G0IA 2X8CA 3GKKA 1G0TA 3BOAA 2VAFA 1TW9A 1V2AA 4JR4A 1N2AA 4K7OA 3FR9A 2R6KA 1TJDA 1AQXA 3GURA 1HYUA 1GL8A 1EOGA 2GZZA 3KTLA 2PVQA 2LNTA 1HD2A 1K0BA 2YNXA 1PN9A 4TOPA 1R7HA 4MJEA 1JLWA 3CRUA 1NHOA 1A8YA 3GRXA 4EF0A 3TCOA 5KEJA 3F3QA 4ZB6A 5DAKA 2LEGA 2LJKA 3ERWA 3W6GA 2H0IA 5G1KA 1V98A 4OWYA 1YEXA 4PUAA 2B1LA 5DALB 1EZKA 2HSHA 3TJGA 3GUSA 3R2QA 2AHEA 1GH2A 3ZVJD 5E4WA 1LJRA 3F3RA 2R3XA 5ELGA 2VCVA 1SYXA 1QK8A 1F3AA 3M9KA 1GSSA 4Z2TA 4JE1A 1SK2A 4DSSA 1ABAA 1DBYA 4ZBAA 3VLNA 5LD0A 3N5OA 2N5AA 4K2XA 3UIWA 1SVLA 3HA9A 1MD3A 1XWAA 1XW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O87 A;  5IM9 A;  4NV5 A;  4MK3 A;  2VIM A;  4V1A p;  2JSY A;  3EVI A;  1K0M A;  1FVK A;  2LNS A;  7GSS A;  3G9B A;  4HEA 2;  1GTU A;  4TR0 A;  5HR3 A;  1KBN A;  1JZD A;  2E2G A;  2YWM A;  4GQC A;  5ECM B;  4LLR A;  2IME A;  4IP6 A;  1ZCP A;  3BJ5 A;  3VWW A;  3FZ5 A;  3SBC A;  1GUH A;  4NAX A;  3G7I A;  2VUP A;  4F82 A;  4FO5 A;  19GS A;  1S3C A;  4MZW A;  1K0O A;  3LJR A;  4MPF A;  5ECR B;  2VL2 A;  2LTK A;  2MYG A;  3H79 A;  4BA7 A;  1ILO A;  2C1Y A;  2FGX A;  3F4R A;  1O8X A;  3APQ A;  4BVX B;  3O76 A;  1I9D A;  2HQT A;  5CNW A;  1B8X A;  4PQI A;  1WWJ A;  1H4O A;  4V2M A;  5HR0 A;  20GS A;  2V6K A;  4QQ7 A;  3D6I A;  3QR6 A;  1GTA A;  2JZS A;  3EMX A;  1PL2 A;  3WT2 A;  3IK9 A;  3GX8 A;  4K6X A;  4G0K A;  3TJJ A;  3IV4 A;  5G30 A;  2R5G A;  3QAV A;  4EXJ A;  1FOV A;  5CP1 A;  3LG6 A;  1M0U A;  2XPD A;  1F37 A;  4WET A;  5J5N A;  3GA4 A;  4JU5 A;  3UL3 A;  1WMJ A;  4IVF A;  4G2E A;  1WE0 A;  4NPB A;  2WUL A;  4AJ8 A;  4OD7 A;  1XVQ A;  2B5Y A;  2P31 A;  3VPT A;  4FQU A;  4WXT A;  3HJP A;  1GUM A;  1Y25 A;  2XBQ A;  6GSX A;  1X9S B;  4HI7 A;  4I5Q A;  2AJQ B;  2HZE B;  1AXD A;  5C04 A;  3KP8 A;  1TKD B;  2PER A;  5IOW A;  5D9X A;  1B4P A;  2X8G A;  3UBL A;  2KP2 A;  3WT1 A;  3GMF A;  2DIY A;  5J9B A;  4GXZ A;  4ULX A;  3M1G A;  2B6M A;  1WOU A;  1OKT A;  5KN1 A;  4D73 A;  4OO5 A;  2DJ1 A;  4V2N A;  3QFB C;  3O3T A;  2H6Z A;  4K0G A;  2GT5 A;  3ZFL A;  1FAA A;  1WJK A;  4FYC A;  2TRC P;  2I9H A;  1NHY A;  4RUV A;  1YKC A;  5ECL B;  3SWL A;  2CQ9 A;  3FKF A;  2KUC A;  2HSM B;  1SKW B;  1BQ7 A;  1RK4 A;  2OKA A;  3P8W A;  2GS3 A;  1HNA A;  3M3M A;  3D4M A;  1Z3E A;  2E7P A;  2HRA A;  3ZYW A;  2MMN A;  5J41 A;  4PUR A;  2IIY A;  1TU8 A;  2X99 A;  1M9A A;  1LBK A;  4GF0 A;  5ECQ B;  3KMO A;  4HJ2 A;  4Q5R A;  5DQS A;  3EYT A;  3GIX A;  5ABR A;  5BMU A;  5CRH A;  4MP4 A;  4ZIL A;  1PKZ A;  3P7X A;  1NSW A;  4BL7 A;  2A4V A;  4IS0 A;  3L4N A;  3TGZ A;  3ZVJ A;  2NDO A;  1ERW A;  4NWY A;  2VCT A;  1BAY A;  5ECI B;  5G2Z A;  1GLQ A;  1XWB A;  2X64 A;  1V58 A;  2I1U A;  4G10 A;  4YH2 A;  6GSV A;  4I8B A;  4POK A;  3QFA C;  4NXI A;  1EEJ A;  4AJ7 A;  2JU5 A;  2DJJ A;  1OAZ A;  2HYX A;  1ACV A;  4KDU A;  2IN3 A;  3L9S A;  2VL9 A;  3FR6 A;  4N11 A;  2RLI A;  1R5A A;  1QFN A;  3PPU A;  1GSU A;  1PQN A;  2V1M A;  2EIO A;  3ZZX A;  3GST A;  1ZZY A;  2AV4 A;  1Z7P A;  3FR3 A;  3ZFB A;  2TRX A;  2B5X A;  2I4A A;  3QOU A;  2GZP A;  3IR4 A;  3FK8 A;  1GNE A;  1FB6 A;  2ZUP A;  1OE7 A;  4X43 A;  2H30 A;  1GSQ A;  3C1R A;  2PVO C;  4X1U A;  2A2S A;  1OKD A;  4ZBD A;  2YZH A;  3TKS E;  4I2U A;  1AQW A;  5ECP B;  1FO5 A;  1Z6N A;  2C8U A;  1WIK A;  2LRT A;  3M0F A;  5G31 A;  5IOX A;  5B6N A;  5ECK B;  1X5E A;  3UVT A;  1QMV A;  4IJ3 A;  2KLX A;  1YF0 A;  1HNC A;  1XZO A;  4Q5Q A;  3KZQ A;  2LRN A;  3ISO A;  1SL2 B;  4GLT A;  3F4S A;  5AN1 A;  3LFL A;  1XOA A;  1RW1 A;  1A24 A;  1MTC A;  1EOH A;  2D2Z A;  4ZB8 A;  1QGV A;  2REM A;  3VI7 A;  1G6Y A;  4IQ1 A;  4KB3 A;  4OFM A;  3GNJ A;  4NHW A;  2PGT A;  8GSS A;  5DQY A;  1GSF A;  2BJX A;  3TOT A;  3IBH A;  2CVB A;  5CRD A;  5F05 A;  2GVP A;  4ISD A;  2MMZ A;  2IMI A;  1AUC A;  2VCZ A;  4DEJ A;  3US3 A;  1VRS D;  3EU4 A;  2P0G A;  5DAL A;  2H1A A;  1ZYQ B;  4ZIJ A;  2P5Q A;  4Z7X A;  2JAD A;  1TK8 B;  4GRF A;  2C0G A;  4L0W A;  3P2A A;  4CDO A;  4IQA A;  2RUE A;  3HVS A;  2PPT A;  2UZ8 A;  2V6O A;  5D73 A;  1UVZ A;  1QQ2 A;  4TVE A;  1K3Y A;  2AB6 A;  2CVK A;  3LQ7 A;  1O6J A;  4ML6 A;  5EVO A;  4XS6 A;  2H6Y A;  4TR1 B;  3WGE A;  1TRW A;  3TJF A;  1X0R A;  1MDK A;  4L5L A;  3AY8 A;  2GSS A;  3L0H A;  2GQL A;  1VF4 A;  3KXO A;  1UC7 A;  4MF7 A;  1GP1 A;  3CYN A;  2V41 A;  2F9S A;  3E3E A;  2GDR A;  1XWC A;  4LMV A;  2PWJ A;  2H66 A;  3VUR A;  4P3Y B;  5GAP D;  2G0F A;  3HZ8 A;  1TRS A;  4PNF A;  4E8H A;  3Q18 A;  1X5D A;  4JR6 A;  1PL1 A;  3C8E A;  1ERV A;  2IPA A;  2C3T A;  4KSM A;  2I3Y A;  4F03 A;  1HQO A;  1TXX A;  2B7K A;  1CQH A;  3CMI A;  3QAG A;  3UVH A;  2VLV A;  1GSD A;  3F6D A;  3ERG A;  3KGK A;  3MSZ A;  3PR8 A;  4K8M A;  1OYJ A;  1KTE A;  1UA5 A;  1U6T A;  2LUS A;  4KDY A;  3EIN A;  6GSU A;  1K0N A;  3ME7 A;  5DJM A;  1U87 A;  4BVX A;  4YQU A;  3BBY A;  3ED3 A;  1O73 A;  1AIU A;  4MAB A;  4ECJ A;  3V1W A;  5HFK A;  3LGC A;  2HNL A;  2L57 A;  3U6V A;  1GWC A;  2HRN A;  3TRX A;  1JZW A;  2WCI A;  4TW5 A;  3FHK A;  3TRP A;  2HZF A;  3I9V 2;  3GHA A;  4TXO B;  4DSR A;  4JBB A;  4KDX A;  3NIV A;  1SJZ A;  4DSQ A;  2H8L A;  1JLV A;  1O7U A;  1OC3 A;  2LJR A;  5F8B A;  5ELA A;  1T4Z A;  1B9X C;  2LQQ A;  2H01 A;  2R37 A;  1ZL9 A;  1PMT A;  2CA8 A;  1F2E A;  2C0E A;  2VD0 A;  5B7C A;  1YY7 A;  2H1B A;  2DLX A;  1H75 A;  4KUN A;  3IA1 A;  5A4U A;  3HKR A;  2XBI A;  1AQV A;  2R2J A;  4HQZ A;  4E8E A;  1F9M A;  5CO3 A;  2GST A;  5HFI A;  2JAC A;  4ZL8 A;  3FW2 A;  2WS2 A;  1S3D A;  3IAM 2;  2YJH A;  5IO2 A;  4QL7 A;  2HZE A;  4IEL A;  1ERT A;  4TR3 A;  2IWT A;  1ML6 A;  2GQK A;  1V57 A;  1LU4 A;  2LST A;  3HD5 A;  2P5R A;  5AIX A;  2GT6 A;  2VCX A;  2IMK A;  1TK0 B;  3TOU A;  2RM6 A;  4PGT A;  3CSH A;  1TI1 A;  2IMD A;  2PBJ A;  1R4W A;  3I6A A;  4OCE A;  3TUE A;  5E59 A;  3M8N A;  1SD8 A;  2HE3 A;  3EU3 A;  1YQ1 A;  1RQM A;  2M46 A;  4ZXG A;  1QXH A;  4WEY A;  1MEK A;  6GST A;  4KH7 A;  4KX4 A;  5HR1 A;  5GSS A;  1GSY A;  5B8B A;  3ERF A;  3ZIJ A;  5IMC A;  2HSM A;  4FH8 A;  5DVB A;  3F0I A;  4XIH A;  4WF4 A;  2ON7 A;  3C71 A;  2JZR A;  1X9W B;  2YOI A;  3CXG A;  2DJ0 A;  3D4T A;  4KCE A;  3TKS C;  1K0C A;  2OE0 A;  1TRU A;  2GTU A;  3F8U A;  2WFC A;  3HJM A;  3PGT A;  4F0C A;  4MLY A;  4K0N A;  5D9T A;  2K6V A;  5L71 A;  3TB2 A;  2WRT A;  4I6X A;  5DDL A;  4IP1 A;  4PUF C;  10GS A;  3HCZ A;  4FYB A;  4PNG A;  1AC1 A;  3QMX A;  4OCF A;  3A3T A;  3ZIV A;  1CQG A;  4YQM A;  5D96 A;  4MPG A;  3FRC A;  4AGS A;  4WR5 A;  1AW9 A;  1EP8 A;  4XTS A;  1Y6E A;  1EP7 A;  1XVW A;  3APO A;  1XOB A;  1TU7 A;  3D0Z A;  1PRX A;  4HU9 A;  1FHE A;  4G19 A;  3DIE A;  5IQY A;  2ES7 A;  4MDC A;  1NM3 A;  5JCG A;  1ZYE A;  4H86 A;  1T8E B;  5JCW A;  1THX A;  1VF2 A;  3HYP A;  1K3O A;  3WGD A;  2HXK A;  4ACS A;  3L9V A;  1WRY A;  2HFD A;  4PTS A;  2FWH A;  3TJB A;  1XIY A;  4ML1 A;  3A2V A;  4IN0 A;  5EL8 A;  4HU7 A;  2H75 A;  2HRF A;  3DML A;  3VWX A;  1TK5 B;  1O8W A;  1XBS A;  1O85 A;  4ZL7 A;  1MDJ A;  2FUG 2;  2L6D A;  3F6F A;  3UEM A;  1TP9 A;  2L6C A;  3I69 A;  1KEB A;  4TN8 A;  3VFI A;  2FHE A;  1FB0 A;  4KND A;  4OFN A;  4EO3 A;  3IE3 A;  3A2X A;  3F63 A;  5HQP A;  1N8J A;  1B4Q A;  2PMT A;  1Z7R A;  2QC7 A;  5EPF A;  2DIZ A;  3O6T A;  4KW6 A;  3H93 A;  5A4V A;  4XS4 B;  2C80 A;  1GTB A;  3ZTL A;  2N5B A;  2FD3 A;  4PXO A;  4MH2 A;  5DJL A;  5G5F A;  5D8I A;  4ID0 A;  2FLS A;  3KJY A;  5CYY A;  2YWN A;  1J9B A;  3IC8 A;  4ZB9 A;  2H1G A;  3QCP A;  2WGR A;  3BD2 A;  1THO A;  1V40 A;  3N9J A;  2M80 A;  3GL3 A;  1EGO A;  3G7J A;  4IKH A;  4MZC A;  3LSZ A;  5EY6 A;  4LL4 B;  3PH9 A;  3KIJ A;  3J7Y b;  2IFQ B;  1ZMA A;  1X9M B;  1Q4J A;  2O89 A;  3FZA A;  2OBI A;  4HOJ A;  2L4Q A;  4IGJ A;  4N0Z A;  4EDY A;  1XFL A;  4YAV A;  2DSA A;  1IYH A;  3A5W A;  4O7H A;  4WBR D;  3RPP A;  2YN1 A;  2DJ2 A;  4BWQ A;  1EV4 A;  5B8A A;  1S3A A;  2O7K A;  2VM1 A;  4MJC A;  1T7P B;  2O8V B;  3GKM A;  2LQO A;  4IW9 A;  1XCC A;  3NZN A;  1DUG A;  3W8S A;  4POB A;  1R26 A;  4D73 B;  2L59 A;  1JZO A;  1GUL A;  3UOM A;  5CAX A;  4EUY A;  1M99 A;  4MH3 A;  5CRG A;  4G0L A;  4IJI A;  4CHS A;  4KF9 A;  3ZML A;  3H4K A;  3QD9 A;  4TR1 A;  16GS A;  2VLU A;  1T3B A;  5D9V A;  1OC9 B;  4FIW A;  12GS A;  1TRV A;  3DGQ A;  3HZ4 A;  2HRK A;  3D22 A;  3VI5 A;  4MMM A;  3IRA A;  2AAW A;  1BX9 A;  1FW1 A;  1OE8 A;  3D5J A;  3KH7 A;  1BED A;  1XW9 A;  2FNO A;  2FWG A;  4USS A;  1ON4 A;  4N10 A;  1C72 A;  5IPH A;  3C73 A;  5ID2 B;  2X8H A;  1M7T A;  2V2G A;  4RQX A;  4TRX A;  2CZ2 A;  9GSS A;  2B3S A;  2GGT A;  3ME8 A;  1YKA A;  2C0F A;  3CSJ A;  5H5Q A;  2M72 A;  2VOC A;  5DCG A;  4EL1 A;  3UAP A;  2MBS A;  2C3Q A;  5ENU A;  4CW9 A;  4J2F A;  1EGR A;  3Q19 A;  1M2D A;  3F9U A;  3UAR A;  3KM6 A;  3EWL A;  4LMW A;  4JRR A;  2VL2 C;  5JCU A;  4O92 A;  3GFK A;  3NOF A;  4K9Z A;  3EE2 A;  1ZOF A;  4EC0 A;  5ECO B;  2C3N A;  1BG5 A;  4LL1 B;  1SKR B;  2H0H A;  1QUW A;  1SEN A;  1A2J A;  3Q74 A;  4ECB A;  4L8E A;  2MMO A;  2YV7 A;  1TDI A;  2VL3 A;  1ST9 A;  5J9C A;  2PUK C;  3DEX A;  5KN2 A;  2OA7 A;  2CV4 A;  4TXO A;  1T00 A;  2B1K A;  1Z9H A;  3C7M A;  2GSQ A;  4HS1 A;  3LXZ A;  5ECS A;  3CSI A;  4PQ1 A;  1PX6 A;  3IK7 A;  3IOS A;  2LKU A;  1F3B A;  14GS A;  3JCM L;  3M9J A;  2GQM A;  5AGY A;  1G7O A;  4I2T A;  3K8N A;  1SL1 B;  2OAC A;  4JZQ A;  4WKW A;  5JWR B;  3QDN A;  1BJX A;  2FA4 A;  3UJ1 A;  4XHM A;  2OAD A;  3GTU B;  1E2Y A;  5LNK e;  5IMV A;  4POM A;  1GTI A;  1EWX A;  3RAZ A;  2GSR A;  1SJ6 A;  2N5F A;  1PX7 A;  1SYR A;  4ZBB A;  1USB A;  5F07 A;  3J7Y k;  2K9F A;  1YJ6 A;  1PA3 A;  4WF5 A;  1ERU A;  1J08 A;  2FA8 A;  4POL A;  1MD4 A;  3RBT A;  1GNW A;  4WBJ A;  2H73 A;  4KSO A;  1EV9 A;  18GS A;  2WB9 A;  2YV9 A;  4K7I A;  1URM A;  2KP1 A;  2FWE A;  4HDE A;  1GLP A;  5B6M A;  3BCI A;  1XWK A;  3S9F A;  1IYI A;  4ECI A;  1Z6M A;  1NW2 A;  1SK0 A;  4GTU A;  5ECN B;  3DWV A;  3UMA A;  1GUK A;  3GYK A;  3CTG A;  2ON5 A;  4L0U A;  3I43 A;  2YJ7 A;  2NTO A;  2FCH A;  2HSN B;  3LYK A;  2MZC A;  5INY A;  3TJK A;  2K8V A;  2XHF A;  3LWA A;  5AIV A;  3HVV A;  1TOF A;  2Z9S A;  3HJO A;  1T1V A;  3L9U A;  2AYT A;  5F06 A;  5KN0 A;  4HZ4 A;  2QSI A;  3R3E A;  2VM2 A;  4KGI A;  1J0F A;  3CTF A;  5IIZ A;  1F6M C;  4XS1 A;  4RQR A;  3QAW A;  4Q5N A;  2DJ3 A;  1MDI A;  3CBU A;  1DSB A;  1YEP A;  2GZY A;  1A0F A;  4ZL9 A;  2K8S A;  2R4V A;  2XC2 A;  3HY2 A;  3TRQ A;  2K18 A;  5AIS A;  4DVC A;  4BVY B;  1YDK A;  2DMM A;  4NV2 A;  2VO4 A;  4K1F A;  4EDZ A;  3GH9 A;  3MDK A;  3FY7 A;  5COH A;  4L5O A;  4EVM A;  5D9W A;  2E0Q A;  2RM5 A;  4KA0 A;  4F2I A;  4YQV A;  1U88 A;  3GKN A;  5HFG A;  2BTO T;  2YWI A;  2MMA A;  2TIR A;  2YAN A;  3EMP A;  4RI7 A;  2KHP A;  4AF2 A;  4GSS A;  2H74 A;  1X5C A;  3MNG A;  1Q98 A;  1JHB A;  3D21 A;  4XCS A;  4GSN A;  3DVW A;  4HUA A;  3FYG A;  4PX1 A;  2RII A;  4LA1 A;  5DAK B;  2CX4 A;  1E6B A;  4GQF A;  4HZ2 A;  2IMF A;  4HJM A;  3VK9 A;  1A8L A;  3KCM A;  2LS5 A;  2DC5 A;  4J57 E;  5A4W A;  3DKS A;  2H19 A;  3KP9 A;  3KEB A;  3RDW A;  2ZNM A;  2YZU A;  1G7E A;  5LCZ A;  4ILF A;  4V1A g;  11GS A;  2IL3 A;  4K2D A;  2C4J A;  3FZ9 A;  2EIR A;  4DSS B;  1T4Y A;  2CVD A;  2H76 A;  1ZGN A;  1HNB A;  1PKW A;  3WYW A;  3LXT A;  4MZB A;  4XS4 A;  5A5K A;  2J9H A;  4YAP A;  1A0R P;  4BPY A;  4NHZ A;  3DD3 A;  2H71 A;  3DYR A;  6GSY A;  2L5O A;  1BYE A;  2C0D A;  3FEU A;  3DRN A;  4J56 E;  2JSZ A;  5IMF A;  5DBQ A;  1G6W A;  22GS A;  5IMD A;  1EEM A;  1V9W A;  1WPI A;  1FVJ A;  2IFQ A;  2LV3 A;  1YF1 A;  3GL5 A;  1K0A A;  4XRA A;  5H5S A;  3TKQ A;  4K7N A;  5D93 A;  4EKZ A;  4OO4 A;  3G7Y A;  17GS A;  1PD2 1;  5FHI A;  5J4U A;  2CX3 A;  4MJA A;  3KD0 A;  3HHV A;  4RI6 A;  1JFU A;  4TKY A;  1Z5Y E;  4G9H A;  4F9Z A;  1K0D A;  4BWS A;  2HSY A;  4WR4 A;  1GSE A;  2PU9 C;  5CRE A;  2NBS A;  2GLR A;  4O5R A;  1DE1 A;  2YCD A;  4KE3 A;  3GKX A;  2VCW A;  3EC3 A;  2KOK A;  5FT3 A;  1M9B A;  3KH9 A;  3OR5 A;  1A23 A;  3W8J A;  13GS A;  3GH6 A;  2JZT A;  3E9J B;  2CAI A;  5GZZ B;  1XW6 A;  1VF3 A;  1OC9 A;  1WP0 A;  5H5R A;  4Q5F A;  2NPB A;  1OVN A;  4OMV A;  4PQH A;  2A2R A;  2YP6 A;  1SK1 A;  2B5E A;  3BCK A;  1A2M A;  1XXU A;  5IMZ A;  4MA9 A;  2F8A A;  2H0G A;  4GCI A;  3IDV A;  1SU9 A;  3IPZ A;  2VCQ A;  2IJY A;  1XWG A;  5ID2 A;  1VF1 A;  1SKS B;  5KN3 A;  2L5L A;  2H1D A;  3GSS A;  2F51 A;  2O85 A;  1JZR A;  2CZ3 A;  3A2W A;  3H1N A;  5CRW A;  3RPN A;  3UBK A;  3ZRE A;  3L78 A;  1K3L A;  1W4V A;  2PN8 A;  3KTB A;  5F0G A;  2QGV A;  2DBC A;  4O32 A;  5G5E A;  1XPV A;  5HR2 A;  2CAQ A;  1M2A A;  3Q6O A;  4TR4 A;  5GAN D;  5DCH A;  4FYU A;  2YPM A;  5J3R A;  1R5P A;  4ECC A;  2CT6 A;  1GRX A;  6GSW A;  3RHC A;  2ALB A;  1U3A A;  3KMN A;  2E2M A;  6GSS A;  3HXS A;  3WGX A;  4MF6 A;  1I5G A;  1SD9 A;  3IHQ A;  1PSQ A;  3WD6 A;  3ZLP A;  2BMX A;  3TDG A;  4QL9 A;  3ZIT A;  2B7J A;  5C00 A;  1KNG A;  2DML A;  1A2L A;  3RHB A;  2WJU A;  3ZMK A;  3LEF A;  3HDC A;  2L4C A;  1YZX A;  3QPM A;  1UN2 A;  5JWQ B;  5IPG A;  3LOR A;  3DVX A;  4N0V A;  3F4T A;  4X0X A;  2MBT A;  4KAE A;  3GTU A;  3GX0 A;  4KCA A;  3ZRD A;  3IAS 2;  4GWR A;  2J23 A;  4MCU A;  3TKS A;  2LRC A;  2DJK A;  5JWO B;  2HLS A;  1VGL A;  3ZL5 A;  3IXR A;  5IO0 A;  2QKE A;  4AJ6 A;  2H70 A;  1SJI A;  2HI7 A;  3CRT A;  5GST A;  4TXV A;  2G2Q A;  4NMU A;  3VWV A;  2OE3 A;  4BL7 B;  1U3I A;  4MJB A;  3P90 A;  3MAK A;  2JL4 A;  2XPE A;  2I81 A;  5ECH B;  3C1S A;  3EUR A;  3LYP A;  2LJA A;  4OFT A;  2RUF A;  3VPQ A;  2H72 A;  2OE1 A;  3GN3 A;  4V2L A;  1M2B A;  3TKP A;  4JED A;  3E0U A;  4I97 A;  3GV1 A;  1FG4 A;  3U5R E;  3APS A;  1B9Y C;  3H8Q A;  4MF5 A;  2V32 A;  2FWF A;  1W89 A;  4F0B A;  2H6X A;  3DXB A;  2AUV A;  1SL0 B;  5G1L A;  2WZ9 A;  2FY6 A;  1TTZ A;  5IMA A;  3VWU A;  4HQS A;  4XRD A;  3HVX A;  1OC8 A;  4IBP A;  2WDU A;  3PIN A;  2VD1 A;  2OBK A;  2NVL A;  1TI3 A;  2YWO A;  2F8F A;  2HT9 A;  2VLT A;  1B48 A;  1AAZ A;  1O81 A;  2F3M A;  2ZCT A;  3MWH A;  1DE2 A;  3IC4 A;  4N30 A;  3TKR A;  2EIQ A;  4IHU A;  3FZ4 A;  4EE0 A;  2OJL A;  2EC4 A;  4BVY A;  1PGT A;  2HRK B;  5FWG A;  4GST A;  4G0I A;  2X8C A;  3GKK A;  1G0T A;  3BOA A;  2VAF A;  1TW9 A;  1V2A A;  4JR4 A;  1N2A A;  4K7O A;  3FR9 A;  2R6K A;  1TJD A;  1AQX A;  3GUR A;  1HYU A;  1GL8 A;  1EOG A;  2GZZ A;  3KTL A;  2PVQ A;  2LNT A;  1HD2 A;  1K0B A;  2YNX A;  1PN9 A;  4TOP A;  1R7H A;  4MJE A;  1JLW A;  3CRU A;  1NHO A;  1A8Y A;  3GRX A;  4EF0 A;  3TCO A;  5KEJ A;  3F3Q A;  4ZB6 A;  5DAK A;  2LEG A;  2LJK A;  3ERW A;  3W6G A;  2H0I A;  5G1K A;  1V98 A;  4OWY A;  1YEX A;  4PUA A;  2B1L A;  5DAL B;  1EZK A;  2HSH A;  3TJG A;  3GUS A;  3R2Q A;  2AHE A;  1GH2 A;  3ZVJ D;  5E4W A;  1LJR A;  3F3R A;  2R3X A;  5ELG A;  2VCV A;  1SYX A;  1QK8 A;  1F3A A;  3M9K A;  1GSS A;  4JE1 A;  1SK2 A;  4DSS A;  1ABA A;  1DBY A;  4ZBA A;  3VLN A;  5LD0 A;  3N5O A;  2N5A A;  3UIW A;  3HA9 A;  1MD3 A;  1XWA A;  1XW5 A; 
#chains in the Genus database with same CATH topology
 2O87 A;  5IM9 A;  4NV5 A;  4MK3 A;  2VIM A;  4CY6 A;  4V1A p;  2JSY A;  3EVI A;  1K0M A;  1FVK A;  2LNS A;  7GSS A;  3G9B A;  4HEA 2;  1GTU A;  4TR0 A;  5HR3 A;  1KBN A;  1JZD A;  2E2G A;  2YWM A;  4GQC A;  5ECM B;  4LLR A;  2IME A;  4IP6 A;  1ZCP A;  3BJ5 A;  3VWW A;  3FZ5 A;  3SBC A;  1GUH A;  4NAX A;  3G7I A;  4BIK A;  2VUP A;  4F82 A;  4FO5 A;  19GS A;  1S3C A;  4MZW A;  1K0O A;  3LJR A;  4MPF A;  1YVL A;  5ECR B;  2VL2 A;  2LTK A;  2MYG A;  1BF5 A;  3H79 A;  4BA7 A;  1ILO A;  2C1Y A;  2FGX A;  3F4R A;  1O8X A;  3APQ A;  4BVX B;  3O76 A;  1I9D A;  2HQT A;  5CNW A;  1B8X A;  4PQI A;  1WWJ A;  1H4O A;  4V2M A;  5HR0 A;  20GS A;  2V6K A;  3CQF A;  4QQ7 A;  4G01 A;  3D6I A;  3QR6 A;  1GTA A;  2JZS A;  3EMX A;  1PL2 A;  3WT2 A;  3IK9 A;  3GX8 A;  4K6X A;  4G0K A;  3TJJ A;  3IV4 A;  5G30 A;  2R5G A;  3QAV A;  4EXJ A;  1FOV A;  5CP1 A;  3LG6 A;  1M0U A;  2XPD A;  1F37 A;  4WET A;  5J5N A;  3GA4 A;  4JU5 A;  3UL3 A;  1WMJ A;  4IVF A;  4G2E A;  4Z2U A;  1WE0 A;  4NPB A;  2WUL A;  4AJ8 A;  4OD7 A;  1XVQ A;  2B5Y A;  2P31 A;  3VPT A;  4FQU A;  4WXT A;  3HJP A;  1GUM A;  1Y25 A;  2XBQ A;  6GSX A;  1X9S B;  4HI7 A;  4I5Q A;  2AJQ B;  2HZE B;  1AXD A;  5C04 A;  3KP8 A;  1TKD B;  2PER A;  5IOW A;  5D9X A;  1B4P A;  3A5I A;  2X8G A;  3UBL A;  2KP2 A;  3WT1 A;  3GMF A;  2DIY A;  5J9B A;  4GXZ A;  4ULX A;  3M1G A;  2B6M A;  1WOU A;  1OKT A;  5KN1 A;  4D73 A;  4OO5 A;  2DJ1 A;  4V2N A;  5A1N B;  3O3T A;  3QFB C;  2H6Z A;  4K0G A;  2GT5 A;  3EPT A;  3ZFL A;  1FAA A;  1WJK A;  4FYC A;  2TRC P;  2I9H A;  1NHY A;  4RUV A;  1YKC A;  5ECL B;  3SWL A;  2CQ9 A;  3FKF A;  2DKH A;  2KUC A;  2HSM B;  1SKW B;  1BQ7 A;  1RK4 A;  2OKA A;  3P8W A;  2GS3 A;  1HNA A;  2OT3 A;  3M3M A;  3D4M A;  1Z3E A;  2E7P A;  2HRA A;  3ZYW A;  2MMN A;  5J41 A;  4PUR A;  2IIY A;  1TU8 A;  2X99 A;  1M9A A;  1LBK A;  4GF0 A;  5ECQ B;  3KMO A;  4HJ2 A;  4Q5R A;  5DQS A;  3EYT A;  3GIX A;  5ABR A;  5BMU A;  5CRH A;  4MP4 A;  4ZIL A;  3FMW A;  1PKZ A;  3P7X A;  1NSW A;  4BL7 A;  2R0G A;  2A4V A;  4IS0 A;  3L4N A;  3TGZ A;  4X4J A;  3ZVJ A;  2NDO A;  1ERW A;  4NWY A;  2VCT A;  1BAY A;  5ECI B;  5G2Z A;  1GLQ A;  1XWB A;  2X64 A;  1V58 A;  2I1U A;  4G10 A;  4YH2 A;  6GSV A;  4I8B A;  4POK A;  3QFA C;  4NXI A;  1EEJ A;  4AJ7 A;  2JU5 A;  2DJJ A;  1OAZ A;  2HYX A;  1ACV A;  4KDU A;  2IN3 A;  3L9S A;  2VL9 A;  3FR6 A;  4N11 A;  2RLI A;  1R5A A;  1QFN A;  3PPU A;  1GSU A;  1PQN A;  2V1M A;  2WVX B;  2EIO A;  3ZZX A;  3GST A;  1ZZY A;  2AV4 A;  2EFD A;  1Z7P A;  3FR3 A;  4W66 A;  3ZFB A;  2TRX A;  2B5X A;  2I4A A;  3QOU A;  2GZP A;  3IR4 A;  3FK8 A;  1GNE A;  1FB6 A;  2ZUP A;  1OE7 A;  4X43 A;  2H30 A;  1GSQ A;  3C1R A;  2PVO C;  4X1U A;  2A2S A;  1OKD A;  4ZBD A;  2YZH A;  3TKS E;  4I2U A;  1AQW A;  5ECP B;  1FO5 A;  1Z6N A;  2C8U A;  1WIK A;  2LRT A;  3M0F A;  5G31 A;  5IOX A;  5B6N A;  5ECK B;  1X5E A;  3UVT A;  1QMV A;  4IJ3 A;  2KLX A;  1YF0 A;  1HNC A;  1XZO A;  4Q5Q A;  3KZQ A;  2LRN A;  3ISO A;  1SL2 B;  4GLT A;  3F4S A;  5BRT A;  4HSC X;  5AN1 A;  3LFL A;  1XOA A;  1RW1 A;  1A24 A;  1MTC A;  1EOH A;  2D2Z A;  4ZB8 A;  1QGV A;  2REM A;  3VI7 A;  1G6Y A;  4IQ1 A;  4KB3 A;  4OFM A;  1FOH A;  3GNJ A;  4NHW A;  2PGT A;  8GSS A;  5DQY A;  1GSF A;  2BJX A;  3TOT A;  3IBH A;  2CVB A;  5CRD A;  5F05 A;  2GVP A;  4ISD A;  2MMZ A;  2IMI A;  1AUC A;  2VCZ A;  4DEJ A;  3US3 A;  1VRS D;  3EU4 A;  2P0G A;  2HSN A;  5DAL A;  1ZYP A;  2H1A A;  1ZYQ B;  4ZIJ A;  2P5Q A;  4Z7X A;  2JAD A;  1TK8 B;  4GRF A;  2C0G A;  4L0W A;  4AI6 A;  3P2A A;  4CDO A;  4IQA A;  2RUE A;  3HVS A;  2PPT A;  2UZ8 A;  2V6O A;  5D73 A;  1UVZ A;  1QQ2 A;  4TVE A;  1ZYN A;  1K3Y A;  2UV8 G;  2AB6 A;  2CVK A;  3LQ7 A;  1O6J A;  4ML6 A;  5EVO A;  4XS6 A;  2H6Y A;  4TR1 B;  2O3E A;  3WGE A;  1TRW A;  3TJF A;  1X0R A;  1MDK A;  2QA2 A;  4L5L A;  3AY8 A;  2GSS A;  3L0H A;  2GQL A;  5A34 B;  1VF4 A;  3KXO A;  1UC7 A;  4MF7 A;  1GP1 A;  3CYN A;  2V41 A;  2F9S A;  3E3E A;  2GDR A;  1XWC A;  4LMV A;  3CHX C;  2PWJ A;  2H66 A;  3VUR A;  4P3Y B;  5GAP D;  2G0F A;  3HZ8 A;  1TRS A;  4PNF A;  4E8H A;  3Q18 A;  1X5D A;  4JR6 A;  1PL1 A;  3C8E A;  1ERV A;  2IPA A;  2C3T A;  4KSM A;  2I3Y A;  4PI2 C;  4F03 A;  1HQO A;  1TXX A;  2B7K A;  1CQH A;  3CMI A;  3QAG A;  3UVH A;  2VLV A;  1GSD A;  3F6D A;  3ERG A;  3KGK A;  3MSZ A;  3PR8 A;  2WW3 A;  4K8M A;  1OYJ A;  1KTE A;  1UA5 A;  1U6T A;  2LUS A;  4KDY A;  3EIN A;  4N3Z A;  6GSU A;  1K0N A;  3ME7 A;  5DJM A;  1U87 A;  4BVX A;  1M3I A;  4YQU A;  3BBY A;  3ED3 A;  2R0C A;  1O73 A;  1AIU A;  4MAB A;  4ECJ A;  3HMJ G;  3V1W A;  1S3R A;  5HFK A;  3LGC A;  2HNL A;  2L57 A;  4O5U A;  3U6V A;  1GWC A;  2HRN A;  3TRX A;  1JZW A;  2WCI A;  4TW5 A;  3FHK A;  3TRP A;  2HZF A;  3I9V 2;  3GHA A;  4TXO B;  4DSR A;  4JBB A;  4KDX A;  3NIV A;  1SJZ A;  4DSQ A;  2H8L A;  2X4A A;  1JLV A;  1O7U A;  1OC3 A;  2LJR A;  5F8B A;  5ELA A;  1T4Z A;  1B9X C;  2LQQ A;  2H01 A;  2R37 A;  1ZL9 A;  1PMT A;  2CA8 A;  1F2E A;  2C0E A;  2VD0 A;  5B7C A;  5J40 A;  1YY7 A;  2H1B A;  2DLX A;  1H75 A;  4KUN A;  3IA1 A;  5A4U A;  3HKR A;  2XBI A;  1AQV A;  2R2J A;  4HQZ A;  4E8E A;  1F9M A;  5CO3 A;  2GST A;  2WW0 A;  5HFI A;  2JAC A;  4ZL8 A;  3FW2 A;  2WS2 A;  1S3D A;  3IAM 2;  2YJH A;  5IO2 A;  4QL7 A;  2HZE A;  4IEL A;  1ERT A;  4TR3 A;  2IWT A;  1ML6 A;  2GQK A;  1V57 A;  1LU4 A;  2LST A;  3HD5 A;  2P5R A;  5AIX A;  2GT6 A;  2VCX A;  2IMK A;  1TK0 B;  3TOU A;  2RM6 A;  4PGT A;  3CSH A;  1TI1 A;  2IMD A;  2PBJ A;  1R4W A;  3I6A A;  4OCE A;  3TUE A;  5E59 A;  3M8N A;  1SD8 A;  5A1N A;  2HE3 A;  3EU3 A;  1YQ1 A;  1RQM A;  2M46 A;  4ZXG A;  1QXH A;  4WEY A;  1MEK A;  6GST A;  4KH7 A;  4KX4 A;  5HR1 A;  5GSS A;  1GSY A;  5B8B A;  3ERF A;  3ZIJ A;  5KOX A;  5IMC A;  2HSM A;  4FH8 A;  5DVB A;  3F0I A;  4XIH A;  4WF4 A;  4CY8 A;  2ON7 A;  3C71 A;  2JZR A;  5J4V A;  1X9W B;  4K5R A;  2YOI A;  3CXG A;  2DJ0 A;  3D4T A;  4KCE A;  3TKS C;  1K0C A;  2OE0 A;  1TRU A;  1XG8 A;  2GTU A;  3F8U A;  4E68 A;  2WFC A;  3HJM A;  3PGT A;  4F0C A;  4MLY A;  4K0N A;  5D9T A;  2K6V A;  5L71 A;  3TB2 A;  2WRT A;  4I6X A;  5DDL A;  4IP1 A;  4PUF C;  10GS A;  3HCZ A;  4FYB A;  4PNG A;  1AC1 A;  3QMX A;  4OCF A;  3A3T A;  3ZIV A;  1CQG A;  4YQM A;  5D96 A;  4MPG A;  3FRC A;  4AGS A;  4WR5 A;  1AW9 A;  1EP8 A;  5A5H B;  4XTS A;  1Y6E A;  1EP7 A;  1XVW A;  3APO A;  1XOB A;  1TU7 A;  3D0Z A;  1PRX A;  4HU9 A;  1FHE A;  4G19 A;  3DIE A;  5IQY A;  2ES7 A;  3HVN A;  4MDC A;  1NM3 A;  5JCG A;  1ZYE A;  4H86 A;  1T8E B;  5JCW A;  1THX A;  3LW9 A;  1VF2 A;  3HYP A;  1K3O A;  3WGD A;  2HXK A;  4ACS A;  4YKF A;  3L9V A;  1WRY A;  2HFD A;  4PTS A;  2FWH A;  2DKI A;  3TJB A;  1XIY A;  4ML1 A;  3A2V A;  4IN0 A;  5EL8 A;  4HU7 A;  2H75 A;  2HRF A;  3DML A;  3VWX A;  1TK5 B;  3IHG A;  1O8W A;  1XBS A;  1O85 A;  4ZL7 A;  1MDJ A;  2FUG 2;  4K5S A;  2L6D A;  3F6F A;  3UEM A;  1TP9 A;  2L6C A;  3I69 A;  1KEB A;  4TN8 A;  3VFI A;  2FHE A;  1FB0 A;  4KND A;  4OFN A;  4EO3 A;  3IE3 A;  3A2X A;  3F63 A;  5HQP A;  1N8J A;  1B4Q A;  2PMT A;  1Z7R A;  2QC7 A;  1M3J A;  5EPF A;  2DIZ A;  3O6T A;  4KW6 A;  3H93 A;  5A4V A;  4XS4 B;  2C80 A;  1GTB A;  3ZTL A;  2N5B A;  2FD3 A;  4PXO A;  4MH2 A;  5DJL A;  5G5F A;  5D8I A;  4ID0 A;  2FLS A;  3KJY A;  5CYY A;  2YWN A;  1J9B A;  3IC8 A;  4ZB9 A;  2H1G A;  3QCP A;  2WGR A;  3BD2 A;  1THO A;  1V40 A;  3N9J A;  2WVY A;  2M80 A;  3GL3 A;  1EGO A;  3G7J A;  4IKH A;  4MZC A;  3LSZ A;  5EY6 A;  4LL4 B;  3PH9 A;  3KIJ A;  3J7Y b;  2IFQ B;  1ZMA A;  1X9M B;  1Q4J A;  2O89 A;  3FZA A;  2OBI A;  4QMK A;  4HOJ A;  2L4Q A;  4IGJ A;  1YEW C;  4N0Z A;  4EDY A;  1XFL A;  4YAV A;  2DSA A;  1IYH A;  3A5W A;  4O7H A;  4WBR D;  3RPP A;  2YN1 A;  2DJ2 A;  4BWQ A;  1EV4 A;  5B8A A;  1S3A A;  2VKZ G;  2O7K A;  2VM1 A;  4MJC A;  1T7P B;  2O8V B;  3GKM A;  2LQO A;  4IW9 A;  2WW2 A;  1XCC A;  3NZN A;  1DUG A;  3W8S A;  4POB A;  1R26 A;  4D73 B;  2L59 A;  1JZO A;  1GUL A;  3UOM A;  5CAX A;  4EUY A;  1M99 A;  4MH3 A;  5CRG A;  4G0L A;  4IJI A;  4CHS A;  4KF9 A;  3ZML A;  1N25 A;  3H4K A;  3QD9 A;  4TR1 A;  16GS A;  2VLU A;  1T3B A;  5D9V A;  5KOW A;  1OC9 B;  1Y1U A;  4FIW A;  12GS A;  5A34 A;  1TRV A;  3DGQ A;  3HZ4 A;  2HRK A;  3D22 A;  3VI5 A;  4MMM A;  3IRA A;  2AAW A;  1BX9 A;  1FW1 A;  1OE8 A;  3D5J A;  3KH7 A;  1BED A;  1XW9 A;  2FNO A;  2FWG A;  4USS A;  1ON4 A;  4N10 A;  1C72 A;  5IPH A;  3C73 A;  5ID2 B;  4MNN A;  3MYD A;  4PHZ C;  2X8H A;  1M7T A;  2V2G A;  4RQX A;  4TRX A;  2CZ2 A;  9GSS A;  2B3S A;  2GGT A;  3ME8 A;  1YKA A;  2C0F A;  3CSJ A;  5H5Q A;  2M72 A;  2VOC A;  5DCG A;  4EL1 A;  3UAP A;  2MBS A;  2C3Q A;  5ENU A;  4CW9 A;  4J2F A;  1EGR A;  3Q19 A;  1M2D A;  3F9U A;  3UAR A;  3KM6 A;  3EWL A;  4LMW A;  4JRR A;  2VL2 C;  5JCU A;  4O92 A;  3GFK A;  3NOF A;  4AKG A;  4K9Z A;  3EE2 A;  1ZOF A;  4EC0 A;  5ECO B;  2C3N A;  1BG5 A;  4LL1 B;  1SKR B;  1PFO A;  2H0H A;  1QUW A;  1SEN A;  1A2J A;  3Q74 A;  4ECB A;  4L8E A;  2MMO A;  2YV7 A;  1TDI A;  2VL3 A;  1ST9 A;  5J9C A;  2PUK C;  3DEX A;  5KN2 A;  2OA7 A;  2CV4 A;  4TXO A;  1T00 A;  2B1K A;  2EFC A;  1Z9H A;  3C7M A;  2GSQ A;  4HS1 A;  3LXZ A;  5ECS A;  3CSI A;  4PQ1 A;  1PX6 A;  3IK7 A;  3IOS A;  2LKU A;  1F3B A;  14GS A;  3JCM L;  3M9J A;  2GQM A;  5AGY A;  1G7O A;  4I2T A;  3K8N A;  1SL1 B;  2OAC A;  4JZQ A;  4WKW A;  5JWR B;  3QDN A;  1BJX A;  2FA4 A;  3UJ1 A;  4XHM A;  2OAD A;  3GTU B;  1E2Y A;  5LNK e;  5IMV A;  4POM A;  1GTI A;  1EWX A;  3RAZ A;  2GSR A;  1SJ6 A;  2N5F A;  1PX7 A;  1SYR A;  4ZBB A;  1USB A;  5F07 A;  3J7Y k;  2K9F A;  1YJ6 A;  1PA3 A;  4WF5 A;  1ERU A;  1J08 A;  2FA8 A;  2QA1 A;  4POL A;  1MD4 A;  3RBT A;  1GNW A;  5J4Y A;  4WBJ A;  2H73 A;  4KSO A;  1EV9 A;  18GS A;  2WB9 A;  2YV9 A;  4K7I A;  1URM A;  2KP1 A;  2FWE A;  4HDE A;  1GLP A;  4AKX B;  5B6M A;  3BCI A;  1XWK A;  3TU3 B;  3S9F A;  1IYI A;  4ECI A;  1Z6M A;  1NW2 A;  1SK0 A;  4GTU A;  5ECN B;  3DWV A;  3UMA A;  1GUK A;  3GYK A;  3CTG A;  2ON5 A;  4L0U A;  3I43 A;  2YJ7 A;  2NTO A;  2FCH A;  2HSN B;  3LYK A;  2MZC A;  5INY A;  3TJK A;  2K8V A;  2XHF A;  3LWA A;  5AIV A;  3HVV A;  1TOF A;  2Z9S A;  3HJO A;  1T1V A;  3L9U A;  2AYT A;  5F06 A;  5KN0 A;  4HZ4 A;  2QSI A;  3R3E A;  2VM2 A;  4KGI A;  1J0F A;  3CTF A;  5IIZ A;  1F6M C;  3RFR C;  4XS1 A;  4RQR A;  3QAW A;  4Q5N A;  2DJ3 A;  1MDI A;  3CBU A;  1DSB A;  1YEP A;  2GZY A;  1A0F A;  4ZL9 A;  2K8S A;  2R4V A;  2XC2 A;  3HY2 A;  3TRQ A;  2K18 A;  5AIS A;  4DVC A;  4BVY B;  1YDK A;  2DMM A;  4NV2 A;  2VO4 A;  4K1F A;  4EDZ A;  3GH9 A;  3MDK A;  3FY7 A;  5COH A;  4L5O A;  5A5H A;  4EVM A;  5D9W A;  2E0Q A;  2RM5 A;  4KA0 A;  4F2I A;  4YQV A;  1U88 A;  3GKN A;  5HFG A;  2BTO T;  2H1L A;  2YWI A;  2MMA A;  2TIR A;  4FXY P;  2YAN A;  3EMP A;  4RI7 A;  2KHP A;  4AF2 A;  4GSS A;  4YKG A;  2H74 A;  1X5C A;  3MNG A;  1Q98 A;  1JHB A;  3D21 A;  4XCS A;  4GSN A;  3DVW A;  4HUA A;  3FYG A;  4PX1 A;  2RII A;  4LA1 A;  5DAK B;  2CX4 A;  1E6B A;  4GQF A;  4HZ2 A;  4A5P A;  2IMF A;  4HJM A;  3VK9 A;  1A8L A;  3KCM A;  2LS5 A;  2DC5 A;  4J57 E;  5A4W A;  3DKS A;  2H19 A;  3KP9 A;  3KEB A;  3RDW A;  2WZS A;  2ZNM A;  2YZU A;  1G7E A;  5LCZ A;  4ILF A;  4V1A g;  11GS A;  2IL3 A;  4K2D A;  2C4J A;  3FZ9 A;  2EIR A;  4DSS B;  1T4Y A;  2CVD A;  2H76 A;  1ZGN A;  2A2P A;  1HNB A;  1PKW A;  3WYW A;  3LXT A;  4MZB A;  4XS4 A;  5A5K A;  2J9H A;  4YAP A;  1A0R P;  4BPY A;  4NHZ A;  3DD3 A;  4AKH A;  1BG1 A;  2H71 A;  3DYR A;  6GSY A;  2L5O A;  1BYE A;  2C0D A;  3FEU A;  3DRN A;  4J56 E;  2JSZ A;  5IMF A;  5DBQ A;  1G6W A;  22GS A;  5IMD A;  1EEM A;  1V9W A;  1WPI A;  1FVJ A;  2IFQ A;  2LV3 A;  1YF1 A;  3GL5 A;  1K0A A;  4XRA A;  5H5S A;  3TKQ A;  4K7N A;  5D93 A;  4EKZ A;  4OO4 A;  3G7Y A;  17GS A;  1PD2 1;  5FHI A;  1S4B P;  2EFH A;  5J4U A;  2CX3 A;  4MJA A;  3KD0 A;  3HHV A;  4RI6 A;  1JFU A;  4TKY A;  2WVX A;  2WVZ A;  4G9H A;  1Z5Y E;  2R0P A;  4F9Z A;  1K0D A;  4BWS A;  2HSY A;  4WR4 A;  1GSE A;  2PU9 C;  5CRE A;  2NBS A;  2GLR A;  4O5R A;  1DE1 A;  2YCD A;  4KE3 A;  3GKX A;  2VCW A;  3EC3 A;  2KOK A;  5FT3 A;  2O5V A;  2WW1 A;  1M9B A;  3KH9 A;  3OR5 A;  1A23 A;  1SVM A;  3W8J A;  13GS A;  3GH6 A;  2JZT A;  3E9J B;  2CAI A;  5GZZ B;  1XW6 A;  1VF3 A;  1OC9 A;  1WP0 A;  5H5R A;  4Q5F A;  2NPB A;  1OVN A;  4OMV A;  4PQH A;  2A2R A;  2YP6 A;  1SK1 A;  2B5E A;  3BCK A;  1A2M A;  1XXU A;  5IMZ A;  4MA9 A;  2F8A A;  2H0G A;  4GCI A;  3IDV A;  1SU9 A;  3IPZ A;  2VCQ A;  2IJY A;  1XWG A;  5ID2 A;  1VF1 A;  1SKS B;  5KN3 A;  2L5L A;  2H1D A;  3GSS A;  2F51 A;  2O85 A;  1JZR A;  2CZ3 A;  3A2W A;  3H1N A;  5CRW A;  3RPN A;  3UBK A;  3ZRE A;  3L78 A;  4Z2R A;  1K3L A;  1W4V A;  2PN8 A;  3KTB A;  5F0G A;  2QGV A;  2DBC A;  4O32 A;  5G5E A;  1XPV A;  5HR2 A;  2CAQ A;  1M2A A;  3Q6O A;  4TR4 A;  5GAN D;  5DCH A;  4FYU A;  2YPM A;  5J3R A;  1R5P A;  4ECC A;  2A4H A;  2CT6 A;  1GRX A;  6GSW A;  3MIX A;  3RHC A;  2ALB A;  1U3A A;  3KMN A;  2E2M A;  6GSS A;  3HXS A;  3WGX A;  1SVO A;  4MF6 A;  1I5G A;  1SD9 A;  3IHQ A;  1PSQ A;  5J47 A;  3WD6 A;  3ZLP A;  2BMX A;  3TDG A;  4QL9 A;  3ZIT A;  2B7J A;  5C00 A;  1KNG A;  2DML A;  1A2L A;  4EIQ A;  3RHB A;  2WJU A;  3ZMK A;  3LEF A;  3HDC A;  2L4C A;  1YZX A;  3QPM A;  1UN2 A;  5JWQ B;  5IPG A;  3LOR A;  3DVX A;  3F4T A;  4N0V A;  4X0X A;  2EFE A;  3RGB C;  2MBT A;  4PI0 C;  4KAE A;  3CWG A;  3GTU A;  3GX0 A;  4KCA A;  3ZRD A;  3IAS 2;  4GWR A;  4GDF A;  2J23 A;  4MCU A;  3TKS A;  2LRC A;  2DJK A;  5JWO B;  2HLS A;  1VGL A;  3ZL5 A;  3IXR A;  5IO0 A;  2QKE A;  4AJ6 A;  2H70 A;  1SJI A;  5BMU B;  2HI7 A;  3CRT A;  5GST A;  4TXV A;  2G2Q A;  4NMU A;  3VWV A;  2OE3 A;  4BL7 B;  1U3I A;  4MJB A;  3P90 A;  3MAK A;  2JL4 A;  4ICY A;  2XPE A;  2I81 A;  4ZB7 A;  5ECH B;  3C1S A;  3EUR A;  3LYP A;  2LJA A;  4OFT A;  2RUF A;  3VPQ A;  2H72 A;  2OE1 A;  3GN3 A;  4V2L A;  1M2B A;  3TKP A;  4JED A;  3E0U A;  4I97 A;  3GV1 A;  1FG4 A;  3U5R E;  3APS A;  1B9Y C;  3H8Q A;  4MF5 A;  2X49 A;  1TXU A;  2V32 A;  2FWF A;  1W89 A;  4F0B A;  2H6X A;  4O5Q A;  1PN0 A;  3DXB A;  2AUV A;  4EIP A;  1SL0 B;  5G1L A;  2WZ9 A;  2FY6 A;  1TTZ A;  5IMA A;  3VWU A;  4HQS A;  4XRD A;  3HVX A;  1OC8 A;  4IBP A;  2WDU A;  3PIN A;  2VD1 A;  2OBK A;  2NVL A;  1TI3 A;  2YWO A;  2F8F A;  2HT9 A;  2VLT A;  1B48 A;  1AAZ A;  1O81 A;  2F3M A;  2ZCT A;  3MWH A;  1DE2 A;  3IC4 A;  4N30 A;  3TKR A;  2EIQ A;  4IHU A;  3FZ4 A;  4EE0 A;  2OJL A;  2EC4 A;  4BVY A;  1PGT A;  4AKI A;  2HRK B;  1I1I P;  5FWG A;  4GST A;  4G0I A;  2X8C A;  3GKK A;  1G0T A;  3BOA A;  2VAF A;  1TW9 A;  1V2A A;  4JR4 A;  1N2A A;  4K7O A;  3FR9 A;  2R6K A;  1TJD A;  1AQX A;  3GUR A;  1HYU A;  1GL8 A;  1EOG A;  2GZZ A;  3KTL A;  2PVQ A;  2LNT A;  1HD2 A;  1K0B A;  2YNX A;  1PN9 A;  4TOP A;  1R7H A;  4MJE A;  1JLW A;  3CRU A;  1NHO A;  1A8Y A;  3GRX A;  4EF0 A;  3TCO A;  5KEJ A;  3F3Q A;  4ZB6 A;  5DAK A;  2LEG A;  2LJK A;  3ERW A;  3W6G A;  2H0I A;  5G1K A;  1V98 A;  4OWY A;  1YEX A;  4PUA A;  2B1L A;  5DAL B;  1EZK A;  2HSH A;  3TJG A;  3GUS A;  3R2Q A;  2AHE A;  1GH2 A;  3ZVJ D;  5E4W A;  1LJR A;  3F3R A;  2R3X A;  5ELG A;  2VCV A;  1SYX A;  1QK8 A;  1F3A A;  3M9K A;  1GSS A;  4Z2T A;  4JE1 A;  1SK2 A;  4DSS A;  1ABA A;  1DBY A;  4ZBA A;  3VLN A;  5LD0 A;  3N5O A;  2N5A A;  4K2X A;  3UIW A;  1SVL A;  2O36 A;  3HA9 A;  1MD3 A;  1XWA A;  1XW5 A; 
#chains in the Genus database with same CATH homology
 2O87 A;  5IM9 A;  4NV5 A;  4MK3 A;  2VIM A;  4CY6 A;  4V1A p;  2JSY A;  3EVI A;  1K0M A;  1FVK A;  2LNS A;  7GSS A;  3G9B A;  4HEA 2;  1GTU A;  4TR0 A;  5HR3 A;  1KBN A;  1JZD A;  2E2G A;  2YWM A;  4GQC A;  5ECM B;  4LLR A;  2IME A;  4IP6 A;  1ZCP A;  3BJ5 A;  3VWW A;  3FZ5 A;  3SBC A;  1GUH A;  4NAX A;  3G7I A;  2VUP A;  4F82 A;  4FO5 A;  19GS A;  1S3C A;  4MZW A;  1K0O A;  3LJR A;  4MPF A;  1YVL A;  5ECR B;  2VL2 A;  2LTK A;  2MYG A;  1BF5 A;  3H79 A;  4BA7 A;  1ILO A;  2C1Y A;  2FGX A;  3F4R A;  1O8X A;  3APQ A;  4BVX B;  3O76 A;  1I9D A;  2HQT A;  5CNW A;  1B8X A;  4PQI A;  1WWJ A;  1H4O A;  4V2M A;  5HR0 A;  20GS A;  2V6K A;  4QQ7 A;  4G01 A;  3D6I A;  3QR6 A;  1GTA A;  2JZS A;  3EMX A;  1PL2 A;  3WT2 A;  3IK9 A;  3GX8 A;  4K6X A;  4G0K A;  3TJJ A;  3IV4 A;  5G30 A;  2R5G A;  3QAV A;  4EXJ A;  1FOV A;  5CP1 A;  3LG6 A;  1M0U A;  2XPD A;  1F37 A;  4WET A;  5J5N A;  3GA4 A;  4JU5 A;  3UL3 A;  1WMJ A;  4IVF A;  4G2E A;  4Z2U A;  1WE0 A;  4NPB A;  2WUL A;  4AJ8 A;  4OD7 A;  1XVQ A;  2B5Y A;  2P31 A;  3VPT A;  4FQU A;  4WXT A;  3HJP A;  1GUM A;  1Y25 A;  2XBQ A;  6GSX A;  1X9S B;  4HI7 A;  4I5Q A;  2AJQ B;  2HZE B;  1AXD A;  5C04 A;  3KP8 A;  1TKD B;  2PER A;  5IOW A;  5D9X A;  1B4P A;  3A5I A;  2X8G A;  3UBL A;  2KP2 A;  3WT1 A;  3GMF A;  2DIY A;  5J9B A;  4GXZ A;  4ULX A;  3M1G A;  2B6M A;  1WOU A;  1OKT A;  5KN1 A;  4D73 A;  4OO5 A;  2DJ1 A;  4V2N A;  5A1N B;  3O3T A;  3QFB C;  2H6Z A;  4K0G A;  2GT5 A;  3EPT A;  3ZFL A;  1FAA A;  1WJK A;  4FYC A;  2TRC P;  2I9H A;  1NHY A;  4RUV A;  1YKC A;  5ECL B;  3SWL A;  2CQ9 A;  3FKF A;  2DKH A;  2KUC A;  2HSM B;  1SKW B;  1BQ7 A;  1RK4 A;  2OKA A;  3P8W A;  2GS3 A;  1HNA A;  2OT3 A;  3M3M A;  3D4M A;  1Z3E A;  2E7P A;  2HRA A;  3ZYW A;  2MMN A;  5J41 A;  4PUR A;  2IIY A;  1TU8 A;  2X99 A;  1M9A A;  1LBK A;  4GF0 A;  5ECQ B;  3KMO A;  4HJ2 A;  4Q5R A;  5DQS A;  3EYT A;  3GIX A;  5ABR A;  5BMU A;  5CRH A;  4MP4 A;  4ZIL A;  3FMW A;  1PKZ A;  3P7X A;  1NSW A;  4BL7 A;  2R0G A;  2A4V A;  4IS0 A;  3L4N A;  3TGZ A;  4X4J A;  3ZVJ A;  2NDO A;  1ERW A;  4NWY A;  2VCT A;  1BAY A;  5ECI B;  5G2Z A;  1GLQ A;  1XWB A;  2X64 A;  1V58 A;  2I1U A;  4G10 A;  4YH2 A;  6GSV A;  4I8B A;  4POK A;  3QFA C;  4NXI A;  1EEJ A;  4AJ7 A;  2JU5 A;  2DJJ A;  1OAZ A;  2HYX A;  1ACV A;  4KDU A;  2IN3 A;  3L9S A;  2VL9 A;  3FR6 A;  4N11 A;  2RLI A;  1R5A A;  1QFN A;  3PPU A;  1GSU A;  1PQN A;  2V1M A;  2EIO A;  3ZZX A;  3GST A;  1ZZY A;  2AV4 A;  2EFD A;  1Z7P A;  3FR3 A;  4W66 A;  3ZFB A;  2TRX A;  2B5X A;  2I4A A;  3QOU A;  2GZP A;  3IR4 A;  3FK8 A;  1GNE A;  1FB6 A;  2ZUP A;  1OE7 A;  4X43 A;  2H30 A;  1GSQ A;  3C1R A;  2PVO C;  4X1U A;  2A2S A;  1OKD A;  4ZBD A;  2YZH A;  3TKS E;  4I2U A;  1AQW A;  5ECP B;  1FO5 A;  1Z6N A;  2C8U A;  1WIK A;  2LRT A;  3M0F A;  5G31 A;  5IOX A;  5B6N A;  5ECK B;  1X5E A;  3UVT A;  1QMV A;  4IJ3 A;  2KLX A;  1YF0 A;  1HNC A;  1XZO A;  4Q5Q A;  3KZQ A;  2LRN A;  3ISO A;  1SL2 B;  4GLT A;  3F4S A;  5BRT A;  5AN1 A;  3LFL A;  1XOA A;  1RW1 A;  1A24 A;  1MTC A;  1EOH A;  2D2Z A;  4ZB8 A;  1QGV A;  2REM A;  3VI7 A;  1G6Y A;  4IQ1 A;  4KB3 A;  4OFM A;  1FOH A;  3GNJ A;  4NHW A;  2PGT A;  8GSS A;  5DQY A;  1GSF A;  2BJX A;  3TOT A;  3IBH A;  2CVB A;  5CRD A;  5F05 A;  2GVP A;  4ISD A;  2MMZ A;  2IMI A;  1AUC A;  2VCZ A;  4DEJ A;  3US3 A;  1VRS D;  3EU4 A;  2P0G A;  2HSN A;  5DAL A;  1ZYP A;  2H1A A;  1ZYQ B;  4ZIJ A;  2P5Q A;  4Z7X A;  2JAD A;  1TK8 B;  4GRF A;  2C0G A;  4L0W A;  4AI6 A;  3P2A A;  4CDO A;  4IQA A;  2RUE A;  3HVS A;  2PPT A;  2UZ8 A;  2V6O A;  5D73 A;  1UVZ A;  1QQ2 A;  4TVE A;  1ZYN A;  1K3Y A;  2UV8 G;  2AB6 A;  2CVK A;  3LQ7 A;  1O6J A;  4ML6 A;  5EVO A;  4XS6 A;  2H6Y A;  4TR1 B;  3WGE A;  1TRW A;  3TJF A;  1X0R A;  1MDK A;  2QA2 A;  4L5L A;  3AY8 A;  2GSS A;  3L0H A;  2GQL A;  5A34 B;  1VF4 A;  3KXO A;  1UC7 A;  4MF7 A;  1GP1 A;  3CYN A;  2V41 A;  2F9S A;  3E3E A;  2GDR A;  1XWC A;  4LMV A;  2PWJ A;  2H66 A;  3VUR A;  4P3Y B;  5GAP D;  2G0F A;  3HZ8 A;  1TRS A;  4PNF A;  4E8H A;  3Q18 A;  1X5D A;  4JR6 A;  1PL1 A;  3C8E A;  1ERV A;  2IPA A;  2C3T A;  4KSM A;  2I3Y A;  4F03 A;  1HQO A;  1TXX A;  2B7K A;  1CQH A;  3CMI A;  3QAG A;  3UVH A;  2VLV A;  1GSD A;  3F6D A;  3ERG A;  3KGK A;  3MSZ A;  3PR8 A;  4K8M A;  1OYJ A;  1KTE A;  1UA5 A;  1U6T A;  2LUS A;  4KDY A;  3EIN A;  4N3Z A;  6GSU A;  1K0N A;  3ME7 A;  5DJM A;  1U87 A;  4BVX A;  4YQU A;  3BBY A;  3ED3 A;  2R0C A;  1O73 A;  1AIU A;  4MAB A;  4ECJ A;  3HMJ G;  3V1W A;  5HFK A;  3LGC A;  2HNL A;  2L57 A;  4O5U A;  3U6V A;  1GWC A;  2HRN A;  3TRX A;  1JZW A;  2WCI A;  4TW5 A;  3FHK A;  3TRP A;  2HZF A;  3I9V 2;  3GHA A;  4TXO B;  4DSR A;  4JBB A;  4KDX A;  3NIV A;  1SJZ A;  4DSQ A;  2H8L A;  2X4A A;  1JLV A;  1O7U A;  1OC3 A;  2LJR A;  5F8B A;  5ELA A;  1T4Z A;  1B9X C;  2LQQ A;  2H01 A;  2R37 A;  1ZL9 A;  1PMT A;  2CA8 A;  1F2E A;  2C0E A;  2VD0 A;  5B7C A;  5J40 A;  1YY7 A;  2H1B A;  2DLX A;  1H75 A;  4KUN A;  3IA1 A;  5A4U A;  3HKR A;  2XBI A;  1AQV A;  2R2J A;  4HQZ A;  4E8E A;  1F9M A;  5CO3 A;  2GST A;  5HFI A;  2JAC A;  4ZL8 A;  3FW2 A;  2WS2 A;  1S3D A;  3IAM 2;  2YJH A;  5IO2 A;  4QL7 A;  2HZE A;  4IEL A;  1ERT A;  4TR3 A;  2IWT A;  1ML6 A;  2GQK A;  1V57 A;  1LU4 A;  2LST A;  3HD5 A;  2P5R A;  5AIX A;  2GT6 A;  2VCX A;  2IMK A;  1TK0 B;  3TOU A;  2RM6 A;  4PGT A;  3CSH A;  1TI1 A;  2IMD A;  2PBJ A;  1R4W A;  3I6A A;  4OCE A;  3TUE A;  5E59 A;  3M8N A;  1SD8 A;  5A1N A;  2HE3 A;  3EU3 A;  1YQ1 A;  1RQM A;  2M46 A;  4ZXG A;  1QXH A;  4WEY A;  1MEK A;  6GST A;  4KH7 A;  4KX4 A;  5HR1 A;  5GSS A;  1GSY A;  5B8B A;  3ERF A;  3ZIJ A;  5KOX A;  5IMC A;  2HSM A;  4FH8 A;  5DVB A;  3F0I A;  4XIH A;  4WF4 A;  4CY8 A;  2ON7 A;  3C71 A;  2JZR A;  5J4V A;  1X9W B;  4K5R A;  2YOI A;  3CXG A;  2DJ0 A;  3D4T A;  4KCE A;  3TKS C;  1K0C A;  2OE0 A;  1TRU A;  2GTU A;  3F8U A;  4E68 A;  2WFC A;  3HJM A;  3PGT A;  4F0C A;  4MLY A;  4K0N A;  5D9T A;  2K6V A;  5L71 A;  3TB2 A;  2WRT A;  4I6X A;  5DDL A;  4IP1 A;  4PUF C;  10GS A;  3HCZ A;  4FYB A;  4PNG A;  1AC1 A;  3QMX A;  4OCF A;  3A3T A;  3ZIV A;  1CQG A;  4YQM A;  5D96 A;  4MPG A;  3FRC A;  4AGS A;  4WR5 A;  1AW9 A;  1EP8 A;  5A5H B;  4XTS A;  1Y6E A;  1EP7 A;  1XVW A;  3APO A;  1XOB A;  1TU7 A;  3D0Z A;  1PRX A;  4HU9 A;  1FHE A;  4G19 A;  3DIE A;  5IQY A;  2ES7 A;  4MDC A;  1NM3 A;  5JCG A;  1ZYE A;  4H86 A;  1T8E B;  5JCW A;  1THX A;  3LW9 A;  1VF2 A;  3HYP A;  1K3O A;  3WGD A;  2HXK A;  4ACS A;  4YKF A;  3L9V A;  1WRY A;  2HFD A;  4PTS A;  2FWH A;  2DKI A;  3TJB A;  1XIY A;  4ML1 A;  3A2V A;  4IN0 A;  5EL8 A;  4HU7 A;  2H75 A;  2HRF A;  3DML A;  3VWX A;  1TK5 B;  3IHG A;  1O8W A;  1XBS A;  1O85 A;  4ZL7 A;  1MDJ A;  2FUG 2;  4K5S A;  2L6D A;  3F6F A;  3UEM A;  1TP9 A;  2L6C A;  3I69 A;  1KEB A;  4TN8 A;  3VFI A;  2FHE A;  1FB0 A;  4KND A;  4OFN A;  4EO3 A;  3IE3 A;  3A2X A;  3F63 A;  5HQP A;  1N8J A;  1B4Q A;  2PMT A;  1Z7R A;  2QC7 A;  5EPF A;  2DIZ A;  3O6T A;  4KW6 A;  3H93 A;  5A4V A;  4XS4 B;  2C80 A;  1GTB A;  3ZTL A;  2N5B A;  2FD3 A;  4PXO A;  4MH2 A;  5DJL A;  5G5F A;  5D8I A;  4ID0 A;  2FLS A;  3KJY A;  5CYY A;  2YWN A;  1J9B A;  3IC8 A;  4ZB9 A;  2H1G A;  3QCP A;  2WGR A;  3BD2 A;  1THO A;  1V40 A;  3N9J A;  2M80 A;  3GL3 A;  1EGO A;  3G7J A;  4IKH A;  4MZC A;  3LSZ A;  5EY6 A;  4LL4 B;  3PH9 A;  3KIJ A;  3J7Y b;  2IFQ B;  1ZMA A;  1X9M B;  1Q4J A;  2O89 A;  3FZA A;  2OBI A;  4QMK A;  4HOJ A;  2L4Q A;  4IGJ A;  4N0Z A;  4EDY A;  1XFL A;  4YAV A;  2DSA A;  1IYH A;  3A5W A;  4O7H A;  4WBR D;  3RPP A;  2YN1 A;  2DJ2 A;  4BWQ A;  1EV4 A;  5B8A A;  1S3A A;  2VKZ G;  2O7K A;  2VM1 A;  4MJC A;  1T7P B;  2O8V B;  3GKM A;  2LQO A;  4IW9 A;  1XCC A;  3NZN A;  1DUG A;  3W8S A;  4POB A;  1R26 A;  4D73 B;  2L59 A;  1JZO A;  1GUL A;  3UOM A;  5CAX A;  4EUY A;  1M99 A;  4MH3 A;  5CRG A;  4G0L A;  4IJI A;  4CHS A;  4KF9 A;  3ZML A;  1N25 A;  3H4K A;  3QD9 A;  4TR1 A;  16GS A;  2VLU A;  1T3B A;  5D9V A;  5KOW A;  1OC9 B;  1Y1U A;  4FIW A;  12GS A;  5A34 A;  1TRV A;  3DGQ A;  3HZ4 A;  2HRK A;  3D22 A;  3VI5 A;  4MMM A;  3IRA A;  2AAW A;  1BX9 A;  1FW1 A;  1OE8 A;  3D5J A;  3KH7 A;  1BED A;  1XW9 A;  2FNO A;  2FWG A;  4USS A;  1ON4 A;  4N10 A;  1C72 A;  5IPH A;  3C73 A;  5ID2 B;  4MNN A;  3MYD A;  2X8H A;  1M7T A;  2V2G A;  4RQX A;  4TRX A;  2CZ2 A;  9GSS A;  2B3S A;  2GGT A;  3ME8 A;  1YKA A;  2C0F A;  3CSJ A;  5H5Q A;  2M72 A;  2VOC A;  5DCG A;  4EL1 A;  3UAP A;  2MBS A;  2C3Q A;  5ENU A;  4CW9 A;  4J2F A;  1EGR A;  3Q19 A;  1M2D A;  3F9U A;  3UAR A;  3KM6 A;  3EWL A;  4LMW A;  4JRR A;  2VL2 C;  5JCU A;  4O92 A;  3GFK A;  3NOF A;  4AKG A;  4K9Z A;  3EE2 A;  1ZOF A;  4EC0 A;  5ECO B;  2C3N A;  1BG5 A;  4LL1 B;  1SKR B;  2H0H A;  1QUW A;  1SEN A;  1A2J A;  3Q74 A;  4ECB A;  4L8E A;  2MMO A;  2YV7 A;  1TDI A;  2VL3 A;  1ST9 A;  5J9C A;  2PUK C;  3DEX A;  5KN2 A;  2OA7 A;  2CV4 A;  4TXO A;  1T00 A;  2B1K A;  2EFC A;  1Z9H A;  3C7M A;  2GSQ A;  4HS1 A;  3LXZ A;  5ECS A;  3CSI A;  4PQ1 A;  1PX6 A;  3IK7 A;  3IOS A;  2LKU A;  1F3B A;  14GS A;  3JCM L;  3M9J A;  2GQM A;  5AGY A;  1G7O A;  4I2T A;  3K8N A;  1SL1 B;  2OAC A;  4JZQ A;  4WKW A;  5JWR B;  3QDN A;  1BJX A;  2FA4 A;  3UJ1 A;  4XHM A;  2OAD A;  3GTU B;  1E2Y A;  5LNK e;  5IMV A;  4POM A;  1GTI A;  1EWX A;  3RAZ A;  2GSR A;  1SJ6 A;  2N5F A;  1PX7 A;  1SYR A;  4ZBB A;  1USB A;  5F07 A;  3J7Y k;  2K9F A;  1YJ6 A;  1PA3 A;  4WF5 A;  1ERU A;  1J08 A;  2FA8 A;  2QA1 A;  4POL A;  1MD4 A;  3RBT A;  1GNW A;  5J4Y A;  4WBJ A;  2H73 A;  4KSO A;  1EV9 A;  18GS A;  2WB9 A;  2YV9 A;  4K7I A;  1URM A;  2KP1 A;  2FWE A;  4HDE A;  1GLP A;  4AKX B;  5B6M A;  3BCI A;  1XWK A;  3TU3 B;  3S9F A;  1IYI A;  4ECI A;  1Z6M A;  1NW2 A;  1SK0 A;  4GTU A;  5ECN B;  3DWV A;  3UMA A;  1GUK A;  3GYK A;  3CTG A;  2ON5 A;  4L0U A;  3I43 A;  2YJ7 A;  2NTO A;  2FCH A;  2HSN B;  3LYK A;  2MZC A;  5INY A;  3TJK A;  2K8V A;  2XHF A;  3LWA A;  5AIV A;  3HVV A;  1TOF A;  2Z9S A;  3HJO A;  1T1V A;  3L9U A;  2AYT A;  5F06 A;  5KN0 A;  4HZ4 A;  2QSI A;  3R3E A;  2VM2 A;  4KGI A;  1J0F A;  3CTF A;  5IIZ A;  1F6M C;  4XS1 A;  4RQR A;  3QAW A;  4Q5N A;  2DJ3 A;  1MDI A;  3CBU A;  1DSB A;  1YEP A;  2GZY A;  1A0F A;  4ZL9 A;  2K8S A;  2R4V A;  2XC2 A;  3HY2 A;  3TRQ A;  2K18 A;  5AIS A;  4DVC A;  4BVY B;  1YDK A;  2DMM A;  4NV2 A;  2VO4 A;  4K1F A;  4EDZ A;  3GH9 A;  3MDK A;  3FY7 A;  5COH A;  4L5O A;  5A5H A;  4EVM A;  5D9W A;  2E0Q A;  2RM5 A;  4KA0 A;  4F2I A;  4YQV A;  1U88 A;  3GKN A;  5HFG A;  2BTO T;  2H1L A;  2YWI A;  2MMA A;  2TIR A;  2YAN A;  3EMP A;  4RI7 A;  2KHP A;  4AF2 A;  4GSS A;  4YKG A;  2H74 A;  1X5C A;  3MNG A;  1Q98 A;  1JHB A;  3D21 A;  4XCS A;  4GSN A;  3DVW A;  4HUA A;  3FYG A;  4PX1 A;  2RII A;  4LA1 A;  5DAK B;  2CX4 A;  1E6B A;  4GQF A;  4HZ2 A;  4A5P A;  2IMF A;  4HJM A;  3VK9 A;  1A8L A;  3KCM A;  2LS5 A;  2DC5 A;  4J57 E;  5A4W A;  3DKS A;  2H19 A;  3KP9 A;  3KEB A;  3RDW A;  2ZNM A;  2YZU A;  1G7E A;  5LCZ A;  4ILF A;  4V1A g;  11GS A;  2IL3 A;  4K2D A;  2C4J A;  3FZ9 A;  2EIR A;  4DSS B;  1T4Y A;  2CVD A;  2H76 A;  1ZGN A;  2A2P A;  1HNB A;  1PKW A;  3WYW A;  3LXT A;  4MZB A;  4XS4 A;  5A5K A;  2J9H A;  4YAP A;  1A0R P;  4BPY A;  4NHZ A;  3DD3 A;  4AKH A;  1BG1 A;  2H71 A;  3DYR A;  6GSY A;  2L5O A;  1BYE A;  2C0D A;  3FEU A;  3DRN A;  4J56 E;  2JSZ A;  5IMF A;  5DBQ A;  1G6W A;  22GS A;  5IMD A;  1EEM A;  1V9W A;  1WPI A;  1FVJ A;  2IFQ A;  2LV3 A;  1YF1 A;  3GL5 A;  1K0A A;  4XRA A;  5H5S A;  3TKQ A;  4K7N A;  5D93 A;  4EKZ A;  4OO4 A;  3G7Y A;  17GS A;  1PD2 1;  5FHI A;  2EFH A;  5J4U A;  2CX3 A;  4MJA A;  3KD0 A;  3HHV A;  4RI6 A;  1JFU A;  4TKY A;  1Z5Y E;  4G9H A;  2R0P A;  4F9Z A;  1K0D A;  4BWS A;  2HSY A;  4WR4 A;  1GSE A;  2PU9 C;  5CRE A;  2NBS A;  2GLR A;  4O5R A;  1DE1 A;  2YCD A;  4KE3 A;  3GKX A;  2VCW A;  3EC3 A;  2KOK A;  5FT3 A;  2O5V A;  1M9B A;  3KH9 A;  3OR5 A;  1A23 A;  1SVM A;  3W8J A;  13GS A;  3GH6 A;  2JZT A;  3E9J B;  2CAI A;  5GZZ B;  1XW6 A;  1VF3 A;  1OC9 A;  1WP0 A;  5H5R A;  4Q5F A;  2NPB A;  1OVN A;  4OMV A;  4PQH A;  2A2R A;  2YP6 A;  1SK1 A;  2B5E A;  3BCK A;  1A2M A;  1XXU A;  5IMZ A;  4MA9 A;  2F8A A;  2H0G A;  4GCI A;  3IDV A;  1SU9 A;  3IPZ A;  2VCQ A;  2IJY A;  1XWG A;  5ID2 A;  1VF1 A;  1SKS B;  5KN3 A;  2L5L A;  2H1D A;  3GSS A;  2F51 A;  2O85 A;  1JZR A;  2CZ3 A;  3A2W A;  3H1N A;  5CRW A;  3RPN A;  3UBK A;  3ZRE A;  3L78 A;  4Z2R A;  1K3L A;  1W4V A;  2PN8 A;  3KTB A;  5F0G A;  2QGV A;  2DBC A;  4O32 A;  5G5E A;  1XPV A;  5HR2 A;  2CAQ A;  1M2A A;  3Q6O A;  4TR4 A;  5GAN D;  5DCH A;  4FYU A;  2YPM A;  5J3R A;  1R5P A;  4ECC A;  2A4H A;  2CT6 A;  1GRX A;  6GSW A;  3MIX A;  3RHC A;  2ALB A;  1U3A A;  3KMN A;  2E2M A;  6GSS A;  3HXS A;  3WGX A;  1SVO A;  4MF6 A;  1I5G A;  1SD9 A;  3IHQ A;  1PSQ A;  5J47 A;  3WD6 A;  3ZLP A;  2BMX A;  3TDG A;  4QL9 A;  3ZIT A;  2B7J A;  5C00 A;  1KNG A;  2DML A;  1A2L A;  4EIQ A;  3RHB A;  2WJU A;  3ZMK A;  3LEF A;  3HDC A;  2L4C A;  1YZX A;  3QPM A;  1UN2 A;  5JWQ B;  5IPG A;  3LOR A;  3DVX A;  3F4T A;  4N0V A;  4X0X A;  2EFE A;  2MBT A;  4KAE A;  3CWG A;  3GTU A;  3GX0 A;  4KCA A;  3ZRD A;  3IAS 2;  4GWR A;  4GDF A;  2J23 A;  4MCU A;  3TKS A;  2LRC A;  2DJK A;  5JWO B;  2HLS A;  1VGL A;  3ZL5 A;  3IXR A;  5IO0 A;  2QKE A;  4AJ6 A;  2H70 A;  1SJI A;  5BMU B;  2HI7 A;  3CRT A;  5GST A;  4TXV A;  2G2Q A;  4NMU A;  3VWV A;  2OE3 A;  4BL7 B;  1U3I A;  4MJB A;  3P90 A;  3MAK A;  2JL4 A;  4ICY A;  2XPE A;  2I81 A;  4ZB7 A;  5ECH B;  3C1S A;  3EUR A;  3LYP A;  2LJA A;  4OFT A;  2RUF A;  3VPQ A;  2H72 A;  2OE1 A;  3GN3 A;  4V2L A;  1M2B A;  3TKP A;  4JED A;  3E0U A;  4I97 A;  3GV1 A;  1FG4 A;  3U5R E;  3APS A;  1B9Y C;  3H8Q A;  4MF5 A;  2X49 A;  1TXU A;  2V32 A;  2FWF A;  1W89 A;  4F0B A;  2H6X A;  4O5Q A;  1PN0 A;  3DXB A;  2AUV A;  4EIP A;  1SL0 B;  5G1L A;  2WZ9 A;  2FY6 A;  1TTZ A;  5IMA A;  3VWU A;  4HQS A;  4XRD A;  3HVX A;  1OC8 A;  4IBP A;  2WDU A;  3PIN A;  2VD1 A;  2OBK A;  2NVL A;  1TI3 A;  2YWO A;  2F8F A;  2HT9 A;  2VLT A;  1B48 A;  1AAZ A;  1O81 A;  2F3M A;  2ZCT A;  3MWH A;  1DE2 A;  3IC4 A;  4N30 A;  3TKR A;  2EIQ A;  4IHU A;  3FZ4 A;  4EE0 A;  2OJL A;  2EC4 A;  4BVY A;  1PGT A;  4AKI A;  2HRK B;  5FWG A;  4GST A;  4G0I A;  2X8C A;  3GKK A;  1G0T A;  3BOA A;  2VAF A;  1TW9 A;  1V2A A;  4JR4 A;  1N2A A;  4K7O A;  3FR9 A;  2R6K A;  1TJD A;  1AQX A;  3GUR A;  1HYU A;  1GL8 A;  1EOG A;  2GZZ A;  3KTL A;  2PVQ A;  2LNT A;  1HD2 A;  1K0B A;  2YNX A;  1PN9 A;  4TOP A;  1R7H A;  4MJE A;  1JLW A;  3CRU A;  1NHO A;  1A8Y A;  3GRX A;  4EF0 A;  3TCO A;  5KEJ A;  3F3Q A;  4ZB6 A;  5DAK A;  2LEG A;  2LJK A;  3ERW A;  3W6G A;  2H0I A;  5G1K A;  1V98 A;  4OWY A;  1YEX A;  4PUA A;  2B1L A;  5DAL B;  1EZK A;  2HSH A;  3TJG A;  3GUS A;  3R2Q A;  2AHE A;  1GH2 A;  3ZVJ D;  5E4W A;  1LJR A;  3F3R A;  2R3X A;  5ELG A;  2VCV A;  1SYX A;  1QK8 A;  1F3A A;  3M9K A;  1GSS A;  4Z2T A;  4JE1 A;  1SK2 A;  4DSS A;  1ABA A;  1DBY A;  4ZBA A;  3VLN A;  5LD0 A;  3N5O A;  2N5A A;  4K2X A;  3UIW A;  1SVL A;  3HA9 A;  1MD3 A;  1XWA A;  1XW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...