3FRCA

Tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
201
Chain Sequence
IVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione S-transferase
publication title Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
rcsb
source organism Plasmodium falciparum
total genus 69
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3frcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3frcA01
3TJJA 1A2MA 4EUYA 3TKSE 4G19A 2CA8A 3IXRA 2QGVA 3CBUA 4TR1A 4PQIA 2PVQA 1YEXA 2GQMA 1U6TA 3KMOA 4O7HA 3ZZXA 1EP8A 1S3AA 2K18A 4Q5RA 5DCHA 4ACSA 4OO4A 4DSSB 1A24A 3U5RE 3VWXA 2GQLA 4ZIJA 3LXZA 2HQTA 3F6FA 3VLNA 2WGRA 1XWAA 4K7NA 5ECRB 3F4RA 1ML6A 2A4VA 3M9KA 3LGCA 5HR1A 2FCHA 1GSYA 1XXUA 1ZYQB 2YJHA 5JCWA 1NHYA 5CAXA 5G31A 4ECCA 3BD2A 3PPUA 2E7PA 2MMOA 4EC0A 1J9BA 2RIIA 2WFCA 3PGTA 4TR1B 1XBSA 4V2LA 3ZFBA 3HZ8A 4JRRA 1U3IA 4MZBA 4JEDA 2FA8A 3HJOA 2H71A 4HEA2 3PR8A 1XWCA 2JU5A 4XS4A 2VCWA 4D73B 3IOSA 1BYEA 4GSNA 2CZ2A 2DBCA 4XIHA 2R37A 1XOBA 4E8EA 2H1AA 1V57A 1BX9A 1HYUA 1PN9A 3J7Yb 2CAIA 3L9SA 4JE1A 4KW6A 3I69A 1SK2A 1XZOA 4L0WA 2BTOT 4IP6A 5DJLA 4L8EA 2DJ1A 3P7XA 4IELA 1K0BA 1YDKA 3LEFA 2VAFA 1YEPA 1XWGA 2FWFA 1XOAA 4IQ1A 3CYNA 4QL9A 4EVMA 1LJRA 2AJQB 1UVZA 4NV5A 1KBNA 2B1KA 3UMAA 3VURA 2MMNA 2JZRA 1TK8B 3DD3A 3PINA 2G2QA 3ZFLA 2IFQA 4OD7A 3UARA 4F9ZA 2I3YA 4NXIA 2RM5A 3VPQA 4DSQA 4MJBA 3IA1A 2TRXA 2AYTA 5D93A 1XW9A 2NVLA 3RAZA 4FQUA 5B6NA 4MP4A 1Z3EA 3FZ9A 2EIOA 1K0DA 1H75A 5GAPD 2GDRA 1SYXA 5B6MA 2WS2A 3NIVA 4GQCA 1GTUA 1F3AA 4L5LA 5J5NA 4BL7A 1FVKA 4OO5A 4YAPA 3N5OA 1EP7A 1AXDA 3WT1A 2H74A 4OFTA 5ECHB 2O7KA 2B3SA 1EEJA 4KH7A 3C71A 9GSSA 4HJ2A 5EVOA 3D0ZA 3EINA 2R6KA 1FB6A 4Z7XA 5CP1A 3FEUA 2C80A 1GSDA 1EGRA 2ON5A 3MAKA 1M2BA 4CHSA 1MTCA 1WOUA 1ZOFA 3TKPA 2H30A 5ECMB 3HZ4A 1XWBA 2WJUA 3WYWA 4EDZA 1AQXA 5J4UA 3VFIA 5ID2A 5J9CA 3FY7A 2C0GA 2PWJA 4J56E 5B8BA 1XVQA 4N10A 6GSSA 1MEKA 2LTKA 2HI7A 5KN2A 3KGKA 1S3DA 4HU7A 4Q5FA 2I4AA 4RUVA 3F4SA 3UVHA 3RHBA 1SKWB 3GSTA 3UBKA 4XRAA 1JZDA 1O81A 1O8XA 4X43A 2REMA 1XFLA 4X1UA 1R5AA 2PU9C 3BCIA 4XS6A 2IMKA 1QK8A 1AW9A 1PL2A 5J41A 2OBIA 4MPGA 2BJXA 2HSMA 3O3TA 3E0UA 1ZMAA 2NDOA 4ILFA 3SWLA 2H1GA 1TTZA 4ID0A 3LQ7A 4N0VA 4DEJA 1E2YA 5AIVA 5KN3A 2WDUA 3M8NA 3QR6A 3DVXA 1I5GA 2ZNMA 1T4YA 4KDYA 2XBIA 4ZL9A 3D6IA 1A23A 3UOMA 4I2UA 4MZWA 2YV9A 14GSA 1TRSA 3K8NA 2LRCA 3BJ5A 4GLTA 1V9WA 2DJKA 3UVTA 2OE1A 5HFGA 3N9JA 5DJMA 4NAXA 4TKYA 2MMAA 4K9ZA 4GRFA 1GSFA 1WWJA 2LUSA 2LV3A 1USBA 2F9SA 1VRSD 1I9DA 3DXBA 2YCDA 5C00A 2JZSA 5JWQB 3TDGA 3TCOA 3TJKA 4G10A 4OFMA 4GF0A 2YOIA 3Q19A 1VF2A 4GTUA 3I6AA 2YZUA 1YJ6A 1JZOA 2H6XA 4OWYA 2L57A 2OBKA 5ECPB 1FG4A 1EZKA 4GWRA 4HOJA 3A2XA 2VOCA 1GUKA 3RBTA 1AC1A 1M9AA 1M9BA 3CSJA 2J23A 4ZB8A 1HNBA 5LCZA 1S3CA 1Z6MA 1DE1A 1UN2A 2X99A 5ECOB 4HUAA 2L5LA 1A8YA 3UL3A 1T1VA 2P31A 4IN0A 3BOAA 3HHVA 4JBBA 2LJKA 1ON4A 4GQFA 4GSSA 4ECJA 11GSA 3GL5A 3H4KA 1AAZA 3P2AA 1K3YA 2JACA 2M80A 2FY6A 3KMNA 1C72A 1MDKA 4IJIA 3ZMLA 2C3QA 5INYA 3GSSA 4BVYB 4KGIA 2GT5A 1R26A 5G5FA 1RW1A 3KM6A 1QFNA 1ZCPA 1F37A 3ED3A 1W89A 4V2NA 3ZREA 2VO4A 3DIEA 3GRXA 2LRTA 5BMUA 3FKFA 5LNKe 1GTBA 4FYCA 2C0FA 5JCGA 2X8CA 1BEDA 1KEBA 1SD9A 4NPBA 2CAQA 3H93A 2K6VA 2R4VA 2VUPA 3GKXA 1X5EA 4EO3A 4KE3A 1G0TA 4MJCA 1GH2A 3ME7A 4ECBA 1OYJA 5IMAA 3Q6OA 4ZILA 1ERTA 2WCIA 1K3LA 2B5YA 3GMFA 19GSA 5GSSA 5ELAA 2OACA 1F2EA 2R2JA 3KCMA 1SKSB 4L0UA 3C1SA 1JZRA 1OC9A 2Z9SA 2H1BA 4PNGA 3APOA 3ZVJA 5DALA 1YF1A 4PUAA 2AV4A 4YAVA 5DVBA 2WB9A 1ERUA 1SK0A 2I1UA 2IIYA 4GCIA 3QFBC 1AUCA 2ALBA 4NWYA 3HJMA 5DAKB 1WE0A 5HR0A 4YQMA 3LXTA 4MH2A 5A4VA 3MSZA 5CRDA 3ZIVA 1EV4A 2O89A 3F3QA 5H5SA 4PTSA 4QL7A 2H66A 4WXTA 4KF9A 1IYHA 1QXHA 5J3RA 4OCEA 4FYBA 3NOFA 1PQNA 2C3NA 17GSA 1THXA 3E9JB 1TW9A 1PKZA 4OFNA 4ECIA 2F8AA 2V41A 3HDCA 1PKWA 1WRYA 4IHUA 5ECLB 4DSRA 3CTFA 4PGTA 2B7JA 2PGTA 2E2GA 3D22A 2HE3A 4V1Ag 2JADA 1GSQA 2E0QA 4IS0A 1F6MC 4IBPA 2ON7A 5KEJA 4ISDA 2FLSA 2N5BA 4D73A 2H76A 1HNCA 3UIWA 5F05A 3CRUA 2OA7A 3DRNA 5ABRA 1X9SB 3WT2A 4KCEA 3H8QA 1YKCA 2GLRA 1ZYEA 1YF0A 3F3RA 5CRWA 3HVVA 5IMZA 4P3YB 1GL8A 5JWRB 3Q74A 5IPHA 4FH8A 5KN1A 1EOGA 2CZ3A 3A2WA 2PVOC 1X9WB 4WETA 3ZYWA 1F9MA 2VM2A 3QD9A 2DC5A 4YH2A 5HFKA 4TXVA 4BVXA 4JR6A 2HT9A 2VCVA 4X0XA 1G6WA 3VI5A 1WP0A 3EC3A 4PNFA 2K8VA 5F07A 3GIXA 4OCFA 2ZCTA 1WIKA 2VL3A 2LEGA 3TRXA 1XW6A 5ECQB 4MABA 2KUCA 1TK5B 3G7YA 1GTIA 1QUWA 1SYRA 3HD5A 2DJJA 4IVFA 2GT6A 1KTEA 4MPFA 4KCAA 4I6XA 1R7HA 1SU9A 2LRNA 1GSUA 1Z9HA 1YY7A 3GTUB 4BVXB 3O6TA 4WBJA 1TRWA 4GSTA 2K8SA 3SBCA 8GSSA 4TR3A 1SL2B 2GS3A 2YANA 5G1LA 1PX6A 4KDXA 3GX8A 3FR9A 4WKWA 3TJBA 2CVDA 4H86A 1GRXA 1BG5A 6GSWA 1M0UA 3H1NA 1R4WA 2V2GA 2BMXA 1JLWA 5CNWA 4HJMA 1ZGNA 4BA7A 5IM9A 4WEYA 1V40A 1K0MA 3KP8A 4KA0A 5D9XA 2NBSA 1GUMA 1K0NA 2IN3A 2XPEA 3GA4A 3M3MA 1ACVA 5G5EA 3QDNA 2C4JA 3GNJA 1QGVA 1VF4A 1FB0A 1TOFA 1U3AA 1YKAA 2V32A 1N2AA 3LYKA 4LMVA 4XHMA 2LJAA 2R5GA 3R3EA 2C0DA 4JZQA 1Z5YE 3V1WA 2YWNA 4WBRD 4RQRA 3CSHA 2P5QA 2H8LA 1GTAA 1MDJA 2GZPA 1GLPA 3IBHA 2X8HA 1A2LA 2GSSA 4DVCA 4K7IA 5G2ZA 2IL3A 2I81A 3ZMKA 3M1GA 3A2VA 2FUG2 3QAWA 5AN1A 4POKA 2O8VB 1SD8A 1YZXA 5IOXA 2DJ3A 4MZCA 2DJ2A 2FWGA 2B5EA 1Z6NA 1AIUA 2H0GA 3TOTA 3W8SA 2M72A 3ERWA 3TGZA 1PL1A 1FW1A 1X0RA 2OE0A 2R3XA 4N30A 1LU4A 2XPDA 4O92A 3VPTA 3LSZA 3WGEA 2LNTA 2B6MA 2DSAA 1HQOA 3IHQA 1K0AA 3L9VA 3ZRDA 6GSUA 5IMCA 1UA5A 3DWVA 5AGYA 4V1Ap 1W4VA 4IP1A 4TVEA 4TR4A 2V6OA 2VL2C 2K9FA 1J0FA 3KH7A 4BWQA 2KOKA 1FVJA 4N11A 5ECKB 2GTUA 2YWIA 4ZBDA 2HZEB 3CXGA 1Q98A 1VF1A 3APSA 5EPFA 4K0GA 3IDVA 3KZQA 5L71A 3CSIA 1B8XA 1FOVA 1TRUA 2GZZA 1T7PB 3HYPA 2NPBA 2ES7A 3KIJA 2F8FA 1SENA 5FWGA 2VIMA 4NMUA 1THOA 2H0IA 2V1MA 2VLVA 2HNLA 1GUHA 4AGSA 2IMIA 2J9HA 3BBYA 3D4TA 2HYXA 1VF3A 1NM3A 4I8BA 2FGXA 4K2DA 1TU7A 1V58A 3G9BA 3MWHA 3DKSA 2JL4A 1Q4JA 2A2RA 4EF0A 3TB2A 2O85A 2E2MA 5CRGA 1SJZA 1T3BA 2VL9A 3FHKA 3EWLA 2H73A 3KD0A 5CO3A 1WPIA 3IAM2 10GSA 1V98A 4LMWA 2VL2A 4HI7A 4BVYA 1FHEA 4F03A 4KSMA 3GL3A 2L59A 1GP1A 3GYKA 1K0OA 1IYIA 1T8EB 1FO5A 1M99A 2HFDA 3CMIA 1GSSA 4I5QA 1RK4A 5ECIB 4K0NA 3OR5A 4POMA 4RI6A 1TXXA 3A5WA 5HR2A 4Q5NA 4PX1A 3NZNA 4AJ6A 3FZ5A 4NHZA 3ZITA 3CTGA 1OKTA 2L6DA 1G6YA 1CQHA 4K8MA 2PBJA 4CDOA 4NHWA 3WGXA 4XS1A 3VWVA 5F0GA 3HJPA 3GFKA 2RUEA 4JU5A 5JWOB 2P0GA 3JCML 3H79A 3MDKA 2YN1A 2IPAA 1MD4A 2QSIA 3TKRA 4WF5A 3DEXA 1AQWA 3KTLA 2YZHA 4WF4A 5LD0A 3VWUA 1JZWA 1X9MB 1J08A 1OE7A 1OAZA 1ZL9A 4MMMA 2IMEA 1B48A 1ERVA 1SK1A 3AY8A 2VCQA 4MDCA 4G2EA 4GXZA 5DBQA 3UEMA 1NHOA 1X5CA 4KX4A 2KP2A 3GH9A 4AF2A 1TP9A 4E8HA 4KDUA 3D5JA 1M2DA 2KP1A 4YQUA 3ZL5A 3IK9A 4MH3A 4MCUA 5DAKA 1QMVA 3EMPA 3HVXA 4KSOA 1OC3A 3GHAA 3UJ1A 1SL0B 5KN0A 2GSRA 2N5FA 1Z7PA 1EV9A 1TI1A 2C8UA 4ZBAA 2FNOA 4FIWA 3L78A 2PN8A 3F8UA 1K0CA 3HVSA 1BJXA 3D4MA 1G7EA 3EU4A 1B9XC 1XCCA 2HZFA 4MJEA 5H5QA 5HR3A 3RPPA 1EGOA 4AJ8A 4ML6A 2HRKB 1U88A 3EVIA 1NSWA 22GSA 2LNSA 4KAEA 4LL4B 2HRNA 4F0BA 2TIRA 1SJ6A 2YV7A 2RUFA 6GSVA 2VM1A 2KHPA 5DQYA 1O85A 3O76A 12GSA 6GSTA 2M46A 2WZ9A 3ZLPA 2XC2A 4ZB9A 2UZ8A 5IOWA 3ME8A 3US3A 3HKRA 2HRAA 1QQ2A 2B7KA 2JSYA 2GQKA 3KTBA 2F51A 1OE8A 4WR5A 4IGJA 3TOUA 2CQ9A 1XVWA 3IR4A 2GGTA 2V6KA 1A8LA 4J2FA 2GVPA 2HSHA 3UBLA 2YWMA 4F2IA 2DJ0A 3HA9A 1VGLA 1T4ZA 2AUVA 4TXOB 1O6JA 4MF6A 2H70A 3TUEA 3LJRA 2WULA 3MNGA 2QKEA 4RI7A 1OKDA 2AB6A 2PUKC 1PGTA 1A0FA 1SJIA 1GWCA 4HDEA 4I2TA 3M0FA 3KP9A 4PQHA 4ML1A 3RHCA 1N8JA 1OVNA 4XRDA 2B5XA 1XPVA 2EC4A 1PMTA 3R2QA 3D21A 5J9BA 1ERWA 4KB3A 5F8BA 1JLVA 5IIZA 5HFIA 3GTUA 5D8IA 1FAAA 5GAND 3J7Yk 2A2SA 1A2JA 2RM6A 1EOHA 5IPGA 2D2ZA 1ABAA 2FD3A 5HQPA 3QFAC 2YPMA 4I97A 2RLIA 2VCZA 1M7TA 3EMXA 5B7CA 5IO0A 4KNDA 1TU8A 3C73A 4IJ3A 3GN3A 4L5OA 2LS5A 2H01A 2H75A 2LQOA 4HQSA 1MD3A 1NW2A 1T00A 1ZZYA 3GUSA 1HNAA 3P8WA 4JR4A 3QMXA 3QOUA 2HSNB 3FZ4A 1O8WA 2ZUPA 2YP6A 5A4WA 3KEBA 3KXOA 1B4QA 2CX3A 1WJKA 4Q5QA 2WRTA 3ERGA 4K7OA 1TK0B 4XS4B 2OJLA 3U6VA 3HXSA 4TR0A 4TRXA 2FHEA 3QCPA 2PPTA 4HZ4A 3GH6A 2H6YA 3C1RA 3F9UA 4EE0A 2CV4A 2C0EA 5ECSA 1PX7A 5A4UA 3EURA 2H72A 2F3MA 3ZVJD 1TRVA 4BWSA 4HU9A 2C3TA 5D9TA 2AHEA 2L4QA 3EE2A 2VD1A 2EIRA 3EYTA 1URMA 2GSTA 5H5RA 2IMFA 2JSZA 1B4PA 2X64A 1AQVA 2MYGA 2YJ7A 3L0HA 4MF5A 3ERFA 2IFQB 4LL1B 2I9HA 1B9YC 5ELGA 2GZYA 3BCKA 2TRCP 4K1FA 1SKRB 4KUNA 3APQA 2H1DA 2FWEA 7GSSA 3VK9A 1DSBA 5IMVA 3FR6A 3QPMA 3ISOA 5B8AA 2HZEA 4NV2A 2CVKA 3G7IA 1TJDA 4EL1A 3C7MA 3FZAA 3IE3A 3KH9A 2DLXA 1SL1B 4IW9A 2CVBA 1BAYA 5FT3A 4BL7B 5COHA 3E3EA 2YWOA 3IK7A 1JFUA 5DDLA 3FYGA 2MBTA 5IO2A 2MBSA 1E6BA 2KLXA 4ZL7A 1LBKA 4ZB6A 3VWWA 1XW5A 2CX4A 2MZCA 5ECNB 2DIZA 16GSA 2XBQA 5C04A 3TJFA 4O5RA 2VLTA 3HCZA 1YQ1A 4MLYA 3GKMA 2IMDA 4PQ1A 3IPZA 4PUFC 5ID2B 3C8EA 5EL8A 4G0LA 2O87A 2OKAA 3WD6A 2PERA 1PA3A 5D96A 3W8JA 3GV1A 4XCSA 5CYYA 4TOPA 3TJGA 4ZXGA 1GNWA 4ULXA 3KJYA 2DMLA 1Z7RA 1PRXA 1GSEA 4N0ZA 3Q18A 5E4WA 1TDIA 2OE3A 4ZBBA 2H19A 6GSXA 3FW2A 4V2MA 3LYPA 1ST9A 3LORA 2HSMB 2XHFA 1EEMA 5CREA 1M2AA 3TKQA 4MJAA 1F3BA 3PH9A 3IRAA 5E59A 1XWKA 1R5PA 4WR4A 3QAVA 4MF7A 2VLUA 20GSA 2FWHA 4HQZA 5IMFA 3S9FA 4AJ7A 1X5DA 1DE2A 5GZZB 4HS1A 1O7UA 3F4TA 1A0RP 2HRFA 3L4NA 5IQYA 3G7JA 4MA9A 2L5OA 1XIYA 4O32A 2L4CA 3GURA 2VCXA 3F63A 2FA4A 2HLSA 2CT6A 2VD0A 5D73A 5AISA 1V2AA 13GSA 2DIYA 3L9UA 2QC7A 5F06A 3FK8A 1GULA 3RDWA 4USSA 1PD21 4EDYA 1ILOA 3DYRA 2JZTA 5AIXA 4EXJA 5DQSA 5G1KA 1MDIA 3W6GA 2LQQA 2H0HA 2P5RA 2HSYA 4ZL8A 2N5AA 1G7OA 6GSYA 2VCTA 4YQVA 3M9JA 3IAS2 3CRTA 1DUGA 2HXKA 1DBYA 3FR3A 1TKDB 3DGQA 3ZTLA 5DCGA 1OC8A 5FHIA 4POLA 4RQXA 1K3OA 1WMJA 1TI3A 3GX0A 2G0FA 4PXOA 1GNEA 2AAWA 1CQGA 4J57E 1U87A 4FO5A 4HZ2A 4QQ7A 2IJYA 1BQ7A 3IV4A 1KNGA 5IMDA 2HRKA 5D9WA 2PMTA 3QAGA 3TRPA 3GKNA 4K6XA 4G0KA 2IWTA 5A5KA 4POBA 4XTSA 3TKSC 1RQMA 4BPYA 2EIQA 2DMMA 2LKUA 2GSQA 1EWXA 4G9HA 4IKHA 3LFLA 3ZIJA 3RPNA 3F6DA 3VI7A 4F82A 4IQAA 4OMVA 3LWAA 1Y25A 3A3TA 3F0IA 3TRQA 5CRHA 4G0IA 4CW9A 3P90A 5EY6A 2X8GA 3LG6A 3IC8A 3HY2A 5G30A 5GSTA 3WGDA 2B1LA 3I43A 2C1YA 4TXOA 18GSA 2MMZA 4TW5A 2YNXA 2NTOA 5D9VA 1JHBA 4LLRA 5JCUA 2LJRA 4MK3A 1HD2A 4DSSA 1UC7A 3EU3A 3IC4A 1Y6EA 3FRCA 3DVWA 4LA1A 3I9V2 4F0CA 4PURA 3TKSA 5ENUA 3DMLA 2H6ZA 1GLQA 4EKZA 4FYUA 1H4OA 2OADA 3UAPA 1OC9B 4TN8A 1PSQA 2LSTA 5DALB 2L6CA 3GKKA 1O73A
chains in the Genus database with same CATH superfamily
3TJJA 1A2MA 2WW3A 4EUYA 3TKSE 4G19A 2CA8A 3IXRA 2QGVA 3CBUA 4TR1A 4PQIA 2PVQA 1YEXA 2GQMA 1U6TA 3KMOA 4O7HA 3ZZXA 1EP8A 1S3AA 2K18A 4Q5RA 5DCHA 4ACSA 4OO4A 4DSSB 1A24A 3U5RE 3VWXA 2GQLA 4ZIJA 3LXZA 2HQTA 3F6FA 3VLNA 2WGRA 4O5UA 1XWAA 4K7NA 5ECRB 3F4RA 1ZYNA 1ML6A 2A4VA 3M9KA 3LGCA 5HR1A 2FCHA 1GSYA 1XXUA 1ZYQB 2YJHA 5JCWA 1NHYA 5CAXA 5G31A 4ECCA 3BD2A 3PPUA 2E7PA 2MMOA 4EC0A 1J9BA 2RIIA 2WFCA 3PGTA 4TR1B 1XBSA 4V2LA 3ZFBA 3HZ8A 4JRRA 1U3IA 2X4AA 4MZBA 4JEDA 2FA8A 3HJOA 2H71A 4HEA2 3PR8A 1XWCA 2JU5A 4XS4A 2VCWA 4D73B 3IOSA 1BYEA 4GSNA 2CZ2A 2DBCA 5KOWA 4XIHA 2R37A 1XOBA 4E8EA 2H1AA 1V57A 1BX9A 1HYUA 1PN9A 4AKIA 3J7Yb 2CAIA 3L9SA 4JE1A 4KW6A 1SVMA 3I69A 1SK2A 1XZOA 4BIKA 4L0WA 2BTOT 4IP6A 5DJLA 4L8EA 2DJ1A 3P7XA 4IELA 1K0BA 1YDKA 4EIQA 1FOHA 3LEFA 4FXYP 2VAFA 1YEPA 1XWGA 2FWFA 1XOAA 4IQ1A 3CQFA 3CYNA 4QL9A 4EVMA 1LJRA 2AJQB 1UVZA 4NV5A 1KBNA 2B1KA 3UMAA 3VURA 2MMNA 2JZRA 1TK8B 2R0GA 3DD3A 3PINA 2G2QA 3ZFLA 2WVZA 2IFQA 4OD7A 3UARA 4F9ZA 2I3YA 4NXIA 2EFDA 2RM5A 3VPQA 4DSQA 2H1LA 4MJBA 3IA1A 2TRXA 2AYTA 5D93A 1XW9A 1XG8A 2NVLA 3RAZA 4FQUA 5B6NA 4MP4A 1Z3EA 3FZ9A 2EIOA 1K0DA 1H75A 5GAPD 2GDRA 1SYXA 5B6MA 2WS2A 3NIVA 4GQCA 1GTUA 1F3AA 4L5LA 5J5NA 4BL7A 1FVKA 4OO5A 4YAPA 3N5OA 1EP7A 1AXDA 3WT1A 2H74A 4OFTA 5ECHB 2O7KA 2B3SA 1EEJA 4KH7A 3C71A 9GSSA 4HJ2A 5EVOA 3D0ZA 3EINA 2R6KA 1FB6A 4Z7XA 5CP1A 3FEUA 2C80A 1GSDA 1EGRA 2ON5A 3MAKA 1M2BA 4CHSA 1MTCA 1WOUA 1ZOFA 3TKPA 2H30A 5ECMB 3HZ4A 1XWBA 2WZSA 2WJUA 3WYWA 4EDZA 1AQXA 5J4UA 3VFIA 5ID2A 5J9CA 3FY7A 2C0GA 2PWJA 4J56E 5B8BA 1XVQA 4N10A 1SVLA 6GSSA 1MEKA 2LTKA 2HI7A 5KN2A 3KGKA 1S3DA 4HU7A 4Q5FA 2I4AA 4RUVA 3F4SA 3UVHA 3RHBA 1SKWB 3GSTA 3UBKA 4XRAA 1JZDA 1O81A 1O8XA 4X43A 2REMA 1XFLA 4X1UA 1R5AA 2PU9C 3BCIA 4XS6A 2IMKA 1QK8A 1AW9A 1PL2A 5J41A 2OBIA 4MPGA 2BJXA 2HSMA 3O3TA 3E0UA 1ZMAA 2O5VA 2NDOA 4ILFA 3SWLA 2H1GA 1TTZA 4ID0A 3LQ7A 4Z2RA 4N0VA 4DEJA 3EPTA 1E2YA 5AIVA 5KN3A 2WDUA 3M8NA 3QR6A 3DVXA 1I5GA 2ZNMA 1T4YA 4KDYA 2XBIA 4ZL9A 3D6IA 1A23A 3UOMA 4I2UA 4MZWA 2YV9A 14GSA 1TRSA 3K8NA 2LRCA 3BJ5A 4GLTA 1V9WA 2DJKA 3UVTA 2OE1A 5HFGA 3N9JA 5DJMA 4NAXA 4TKYA 2MMAA 4K9ZA 4GRFA 1GSFA 1WWJA 2LUSA 2LV3A 1USBA 2F9SA 1VRSD 1I9DA 3DXBA 2YCDA 5C00A 2JZSA 5JWQB 3TDGA 3TU3B 3TCOA 3TJKA 4G10A 4OFMA 2R0CA 4X4JA 4GF0A 2YOIA 3Q19A 1VF2A 4GTUA 3I6AA 3LW9A 2YZUA 1YJ6A 1JZOA 2H6XA 4OWYA 2L57A 2OBKA 4PHZC 5ECPB 1FG4A 1EZKA 4GWRA 4HOJA 3A2XA 2VOCA 1GUKA 3RBTA 1AC1A 1M9AA 1M9BA 3CSJA 2J23A 4ZB8A 1HNBA 5LCZA 1S3CA 1Z6MA 1DE1A 1UN2A 5BRTA 2X99A 5ECOB 4HUAA 2L5LA 2WW2A 1A8YA 3UL3A 1T1VA 2P31A 3BOAA 3HHVA 4IN0A 4JBBA 2LJKA 1ON4A 4GQFA 4GSSA 4ECJA 11GSA 3GL5A 3H4KA 1AAZA 3P2AA 1K3YA 2JACA 2M80A 2FY6A 3KMNA 1C72A 1MDKA 4IJIA 2QA1A 3ZMLA 2C3QA 5INYA 3GSSA 4BVYB 4KGIA 2GT5A 1R26A 5G5FA 1RW1A 3KM6A 1QFNA 1ZCPA 1F37A 3ED3A 1W89A 4V2NA 4EIPA 3ZREA 2VO4A 3DIEA 3GRXA 2LRTA 5BMUA 3FKFA 5LNKe 1GTBA 4FYCA 2C0FA 3CWGA 5JCGA 2X8CA 1BEDA 1KEBA 1SD9A 4NPBA 2CAQA 4W66A 3H93A 2K6VA 2R4VA 2VUPA 3GKXA 1X5EA 4EO3A 4KE3A 1G0TA 4MJCA 1GH2A 3ME7A 4ECBA 1OYJA 5A1NA 5IMAA 3Q6OA 4ZILA 1ERTA 2WCIA 1M3JA 1K3LA 2B5YA 3GMFA 19GSA 5GSSA 5ELAA 4AKXB 2OACA 1F2EA 2R2JA 3KCMA 1SKSB 4L0UA 3C1SA 1JZRA 1OC9A 2Z9SA 2H1BA 4PNGA 3APOA 3ZVJA 5DALA 1YF1A 4PUAA 2AV4A 4YAVA 5DVBA 2WB9A 1ERUA 1SK0A 2I1UA 2IIYA 4GCIA 3QFBC 1AUCA 4CY8A 2ALBA 4NWYA 3HJMA 5DAKB 1YEWC 1WE0A 5HR0A 4YQMA 3LXTA 4MH2A 5A4VA 3MSZA 5CRDA 3ZIVA 1EV4A 2O89A 3F3QA 5H5SA 4PTSA 4QL7A 4PI2C 2H66A 4WXTA 4KF9A 1IYHA 1QXHA 5J3RA 4OCEA 4FYBA 3NOFA 1PN0A 1PQNA 2C3NA 17GSA 1THXA 3E9JB 1TW9A 1PKZA 4OFNA 4ECIA 2F8AA 2V41A 3HDCA 1PKWA 1WRYA 4IHUA 5ECLB 4DSRA 3CTFA 4PGTA 2B7JA 2PGTA 2E2GA 3D22A 2HE3A 4V1Ag 2JADA 1M3IA 1GSQA 5J47A 2E0QA 4IS0A 1F6MC 4IBPA 2ON7A 5KEJA 4ISDA 2FLSA 2N5BA 4D73A 2H76A 1HNCA 3UIWA 5F05A 3CRUA 2OA7A 3DRNA 5ABRA 1X9SB 3WT2A 4KCEA 3H8QA 1YKCA 2GLRA 1ZYEA 1YF0A 3F3RA 5CRWA 3HVVA 5IMZA 4P3YB 1GL8A 5JWRB 3Q74A 5IPHA 1S4BP 4FH8A 5KN1A 1EOGA 2CZ3A 3MIXA 3A2WA 2PVOC 1X9WB 4WETA 3ZYWA 1F9MA 2VM2A 3QD9A 2DC5A 4YH2A 5HFKA 4TXVA 4BVXA 4JR6A 2HT9A 2VCVA 4X0XA 1G6WA 3VI5A 1WP0A 3EC3A 4PNFA 2K8VA 5F07A 3GIXA 4OCFA 2ZCTA 1WIKA 2VL3A 2LEGA 3TRXA 1XW6A 5ECQB 4MABA 2KUCA 1TK5B 3G7YA 1GTIA 1QUWA 2VKZG 1SYRA 3HD5A 2DJJA 4IVFA 2GT6A 1KTEA 4MPFA 4KCAA 4I6XA 1R7HA 1SU9A 2LRNA 1GSUA 1Z9HA 1YY7A 3GTUB 4BVXB 3O6TA 4WBJA 1TRWA 4GSTA 2K8SA 3SBCA 8GSSA 4K5SA 4TR3A 1SL2B 2GS3A 2YANA 1BF5A 5G1LA 1PX6A 4KDXA 3GX8A 3FR9A 4WKWA 3TJBA 2CVDA 4H86A 1GRXA 1BG5A 6GSWA 1M0UA 3H1NA 1R4WA 2V2GA 2BMXA 1JLWA 5CNWA 4HJMA 1ZGNA 4BA7A 5IM9A 4WEYA 1V40A 1K0MA 3KP8A 4KA0A 5D9XA 2NBSA 1GUMA 1K0NA 2IN3A 5A5HB 2XPEA 3GA4A 3M3MA 1ACVA 5G5EA 3QDNA 2C4JA 3GNJA 1QGVA 1VF4A 1FB0A 1TOFA 1U3AA 1YKAA 2V32A 1N2AA 3LYKA 4LMVA 4XHMA 2LJAA 2R5GA 3R3EA 2C0DA 4JZQA 1Z5YE 3V1WA 2YWNA 4WBRD 4RQRA 3CSHA 3RGBC 2H8LA 2P5QA 1GTAA 1MDJA 2GZPA 1GLPA 3IBHA 2X8HA 1A2LA 2GSSA 4DVCA 4K7IA 5G2ZA 2IL3A 2I81A 3ZMKA 3M1GA 3A2VA 2FUG2 3QAWA 5AN1A 4POKA 2O8VB 1SD8A 1YZXA 5IOXA 2DJ3A 4MZCA 2DJ2A 2FWGA 2B5EA 1Z6NA 1AIUA 2H0GA 3TOTA 3W8SA 2M72A 3ERWA 3TGZA 1PL1A 1FW1A 1X0RA 2OE0A 2R3XA 4N30A 1LU4A 2XPDA 4O92A 3VPTA 3LSZA 3WGEA 2LNTA 2B6MA 2DSAA 1HQOA 3IHQA 1K0AA 3L9VA 3ZRDA 6GSUA 5IMCA 1UA5A 3DWVA 5AGYA 4V1Ap 1W4VA 4IP1A 4TVEA 4TR4A 2V6OA 2VL2C 5KOXA 2K9FA 1J0FA 3KH7A 4BWQA 2KOKA 1FVJA 4N11A 5ECKB 2GTUA 2YWIA 4ZBDA 2HZEB 3CXGA 1Q98A 1VF1A 3APSA 5EPFA 4K0GA 3IDVA 3KZQA 5L71A 3CSIA 1B8XA 1FOVA 1TRUA 2GZZA 1T7PB 3HYPA 2NPBA 2ES7A 3KIJA 5J4VA 2F8FA 1SENA 5FWGA 2VIMA 4NMUA 1THOA 2H0IA 2V1MA 2VLVA 2HNLA 1GUHA 4AGSA 2IMIA 2J9HA 3BBYA 3D4TA 2HYXA 1VF3A 1NM3A 4I8BA 2FGXA 2O36A 4K2DA 1TU7A 1V58A 3G9BA 3MWHA 3DKSA 2JL4A 1Q4JA 2A2RA 4EF0A 3TB2A 2O85A 2E2MA 1N25A 5CRGA 1SJZA 1T3BA 2VL9A 3FHKA 3EWLA 2H73A 3KD0A 5CO3A 1WPIA 3IAM2 10GSA 1V98A 4LMWA 2VL2A 4HI7A 4BVYA 1FHEA 4F03A 4KSMA 3GL3A 2L59A 4AKGA 1GP1A 3GYKA 4HSCX 1K0OA 1IYIA 1T8EB 1FO5A 1M99A 2HFDA 3CMIA 1GSSA 4I5QA 1RK4A 5ECIB 4K0NA 3OR5A 4POMA 4RI6A 1TXXA 3A5WA 5HR2A 4Q5NA 4PX1A 3NZNA 1SVOA 4AJ6A 3FZ5A 4NHZA 3ZITA 3CTGA 1OKTA 2L6DA 1G6YA 1CQHA 4K8MA 2PBJA 4CDOA 4NHWA 3WGXA 4XS1A 3VWVA 5F0GA 3HJPA 3GFKA 2RUEA 4JU5A 5JWOB 2P0GA 3JCML 2X49A 3H79A 3MDKA 2YN1A 2IPAA 1MD4A 2QSIA 3TKRA 4WF5A 3DEXA 1AQWA 3KTLA 2YZHA 4WF4A 2O3EA 5LD0A 3VWUA 1JZWA 1X9MB 1J08A 1OE7A 1OAZA 1ZL9A 4MMMA 2IMEA 1B48A 1ERVA 1SK1A 3AY8A 2VCQA 4MDCA 4G2EA 4GXZA 5DBQA 3UEMA 1NHOA 1X5CA 4KX4A 2KP2A 3GH9A 4GDFA 4AF2A 1TP9A 4E8HA 4KDUA 3D5JA 1M2DA 2KP1A 4YQUA 3ZL5A 3IK9A 4MH3A 4MCUA 5DAKA 1QMVA 3EMPA 2A2PA 3HVXA 4KSOA 1OC3A 3GHAA 3UJ1A 1SL0B 5KN0A 2GSRA 2N5FA 1Z7PA 1EV9A 1TI1A 2C8UA 4ZBAA 2FNOA 4FIWA 3L78A 2PN8A 3F8UA 1K0CA 3HVSA 1BJXA 3D4MA 1G7EA 3EU4A 1B9XC 1XCCA 2HZFA 4MJEA 5H5QA 5HR3A 3RPPA 2UV8G 1EGOA 4AJ8A 4ML6A 2HRKB 1U88A 3EVIA 2WW0A 1NSWA 22GSA 2LNSA 4KAEA 4LL4B 2HRNA 4F0BA 2TIRA 1SJ6A 2YV7A 1I1IP 2RUFA 6GSVA 2VM1A 2KHPA 5DQYA 1O85A 3O76A 12GSA 6GSTA 2M46A 2WZ9A 3ZLPA 2XC2A 3A5IA 4ZB9A 2UZ8A 5IOWA 3ME8A 3US3A 3HKRA 2HRAA 1QQ2A 2B7KA 2JSYA 2GQKA 3KTBA 2F51A 1OE8A 4WR5A 4IGJA 3TOUA 2CQ9A 1XVWA 2WVXB 3IR4A 2GGTA 2V6KA 1A8LA 4J2FA 2GVPA 2HSHA 3UBLA 2YWMA 4F2IA 2DJ0A 3HA9A 1VGLA 1T4ZA 2AUVA 4TXOB 4ICYA 1O6JA 4MF6A 2H70A 3TUEA 3LJRA 2WULA 3MNGA 4N3ZA 4CY6A 2QKEA 4RI7A 1OKDA 2AB6A 2PUKC 1PGTA 1A0FA 1SJIA 1GWCA 4HDEA 4I2TA 3M0FA 3KP9A 4PQHA 4ML1A 3RHCA 4YKGA 1N8JA 1OVNA 4XRDA 2B5XA 1XPVA 2EC4A 1PMTA 3R2QA 3D21A 5J9BA 1ERWA 4KB3A 5F8BA 1JLVA 4Z2TA 5IIZA 5HFIA 3GTUA 5D8IA 1FAAA 5GAND 1Y1UA 3J7Yk 2A2SA 1A2JA 2RM6A 1EOHA 5IPGA 2D2ZA 2HSNA 1ABAA 2FD3A 5HQPA 3QFAC 2YPMA 4I97A 2RLIA 2VCZA 1M7TA 3EMXA 5B7CA 1PFOA 5IO0A 4KNDA 1TU8A 3C73A 4IJ3A 3GN3A 4L5OA 2LS5A 2H01A 2H75A 2LQOA 4HQSA 1MD3A 1NW2A 1T00A 1ZZYA 3GUSA 1HNAA 3P8WA 5A5HA 4JR4A 3QMXA 3QOUA 2HSNB 3FZ4A 1O8WA 2ZUPA 2YP6A 2EFEA 5A4WA 3KEBA 3KXOA 1B4QA 4O5QA 2CX3A 1WJKA 4Q5QA 2WRTA 3ERGA 4K7OA 2OT3A 1TK0B 4XS4B 2OJLA 3U6VA 3HXSA 4TR0A 4TRXA 2FHEA 3QCPA 2PPTA 4HZ4A 3GH6A 2H6YA 4YKFA 3C1RA 3F9UA 4EE0A 2CV4A 1BG1A 2C0EA 3HVNA 5ECSA 1PX7A 5A4UA 1TXUA 3EURA 2H72A 2F3MA 3ZVJD 1TRVA 4BWSA 4HU9A 2C3TA 5D9TA 2AHEA 2L4QA 3EE2A 2VD1A 4K5RA 2EIRA 4A5PA 3EYTA 1URMA 2GSTA 5H5RA 2IMFA 2JSZA 1B4PA 2X64A 1AQVA 2MYGA 2YJ7A 3L0HA 4MF5A 3ERFA 2IFQB 4LL1B 2I9HA 1B9YC 3FMWA 5ELGA 2GZYA 3BCKA 2TRCP 4K1FA 1YVLA 1SKRB 4KUNA 3APQA 2H1DA 2FWEA 7GSSA 3VK9A 1DSBA 5IMVA 3FR6A 3QPMA 3ISOA 5B8AA 2HZEA 4NV2A 2CVKA 3G7IA 1TJDA 4EL1A 3C7MA 3FZAA 3IE3A 3KH9A 2DLXA 1SL1B 4IW9A 2CVBA 1BAYA 5FT3A 4BL7B 5COHA 3E3EA 2YWOA 3IK7A 1JFUA 5DDLA 3FYGA 2MBTA 5IO2A 2MBSA 1ZYPA 1E6BA 2KLXA 4ZL7A 1LBKA 4ZB6A 3VWWA 1XW5A 2CX4A 2MZCA 5ECNB 2DIZA 16GSA 2XBQA 5C04A 3TJFA 4O5RA 4AI6A 2VLTA 3HCZA 1YQ1A 4MLYA 3GKMA 2IMDA 4PQ1A 3IPZA 4PUFC 5ID2B 2A4HA 3C8EA 5EL8A 4G0LA 2O87A 3MYDA 2OKAA 3WD6A 2PERA 1PA3A 5D96A 3W8JA 3GV1A 4XCSA 5CYYA 2WW1A 4TOPA 3TJGA 4ZXGA 1GNWA 4ULXA 3KJYA 2DMLA 1Z7RA 1PRXA 1GSEA 4N0ZA 3Q18A 5E4WA 2EFCA 2EFHA 1TDIA 3CHXC 2OE3A 4ZBBA 2H19A 6GSXA 4K2XA 3FW2A 4V2MA 3LYPA 3IHGA 1ST9A 3LORA 2HSMB 2XHFA 1EEMA 5CREA 1M2AA 3TKQA 4MJAA 1F3BA 3PH9A 3IRAA 5E59A 1XWKA 1R5PA 4WR4A 3QAVA 4MF7A 2VLUA 20GSA 2FWHA 4HQZA 5IMFA 3S9FA 4AJ7A 1X5DA 1DE2A 5GZZB 2DKIA 4HS1A 1O7UA 3F4TA 1A0RP 2HRFA 3L4NA 1S3RA 5IQYA 3G7JA 4MA9A 2L5OA 1XIYA 4O32A 2L4CA 3GURA 2VCXA 3F63A 2FA4A 4Z2UA 2HLSA 2CT6A 3HMJG 2R0PA 2VD0A 5D73A 5AISA 1V2AA 4MNNA 13GSA 2DIYA 3L9UA 2QC7A 5F06A 3FK8A 1GULA 3RDWA 4USSA 1PD21 4EDYA 1ILOA 3DYRA 2JZTA 5AIXA 4EXJA 5DQSA 5G1KA 1MDIA 4PI0C 3W6GA 2LQQA 2H0HA 2P5RA 2DKHA 2HSYA 2N5AA 4ZL8A 1G7OA 6GSYA 2VCTA 4YQVA 3M9JA 2WVYA 3IAS2 3CRTA 1DUGA 2HXKA 1DBYA 3FR3A 1TKDB 3DGQA 3ZTLA 5DCGA 1OC8A 5FHIA 4POLA 4RQXA 5A34A 1K3OA 1WMJA 1TI3A 3GX0A 2G0FA 4PXOA 1GNEA 2AAWA 1CQGA 4J57E 1U87A 4FO5A 4HZ2A 4QQ7A 2IJYA 1BQ7A 3IV4A 1KNGA 5IMDA 2HRKA 5D9WA 2PMTA 3QAGA 3TRPA 2QA2A 3GKNA 4K6XA 4G0KA 2IWTA 5A5KA 4POBA 4XTSA 4AKHA 3TKSC 1RQMA 4BPYA 2EIQA 2DMMA 2LKUA 2GSQA 1EWXA 4G9HA 4IKHA 3LFLA 3ZIJA 3RPNA 3RFRC 3F6DA 3VI7A 4F82A 4IQAA 5A34B 4OMVA 3LWAA 1Y25A 3A3TA 3F0IA 3TRQA 5CRHA 4G0IA 2WVXA 4CW9A 3P90A 5EY6A 2X8GA 3LG6A 3IC8A 3HY2A 5G30A 5GSTA 3WGDA 2B1LA 3I43A 2C1YA 4TXOA 5BMUB 18GSA 2MMZA 4TW5A 2YNXA 2NTOA 5D9VA 1JHBA 4ZB7A 4LLRA 5JCUA 2LJRA 4MK3A 1HD2A 4DSSA 1UC7A 3EU3A 3IC4A 1Y6EA 3FRCA 3DVWA 4LA1A 5A1NB 4F0CA 3I9V2 4PURA 3TKSA 5ENUA 3DMLA 2H6ZA 1GLQA 4G01A 5J40A 4EKZA 4FYUA 1H4OA 2OADA 4QMKA 4E68A 3UAPA 1OC9B 4TN8A 1PSQA 2LSTA 5DALB 2L6CA 5J4YA 3GKKA 1O73A
chains in the Genus database with same CATH topology
3TJJA 1A2MA 4EUYA 3TKSE 4G19A 2CA8A 3IXRA 2QGVA 3CBUA 4TR1A 4PQIA 2PVQA 1YEXA 2GQMA 1U6TA 3KMOA 4O7HA 3ZZXA 1EP8A 1S3AA 2K18A 4Q5RA 5DCHA 4ACSA 4OO4A 4DSSB 1A24A 3U5RE 3VWXA 2GQLA 4ZIJA 3LXZA 2HQTA 3F6FA 3VLNA 2WGRA 4O5UA 1XWAA 4K7NA 5ECRB 3F4RA 1ZYNA 1ML6A 2A4VA 3M9KA 3LGCA 5HR1A 2FCHA 1GSYA 1XXUA 1ZYQB 2YJHA 5JCWA 1NHYA 5CAXA 5G31A 4ECCA 3BD2A 3PPUA 2E7PA 2MMOA 4EC0A 1J9BA 2RIIA 2WFCA 3PGTA 4TR1B 1XBSA 4V2LA 3ZFBA 3HZ8A 4JRRA 1U3IA 2X4AA 4MZBA 4JEDA 2FA8A 3HJOA 2H71A 4HEA2 3PR8A 1XWCA 2JU5A 4XS4A 2VCWA 4D73B 3IOSA 1BYEA 4GSNA 2CZ2A 2DBCA 5KOWA 4XIHA 2R37A 1XOBA 4E8EA 2H1AA 1V57A 1BX9A 1HYUA 1PN9A 4AKIA 3J7Yb 2CAIA 3L9SA 4JE1A 4KW6A 1SVMA 3I69A 1SK2A 1XZOA 4L0WA 2BTOT 4IP6A 5DJLA 4L8EA 2DJ1A 3P7XA 4IELA 1K0BA 1YDKA 4EIQA 1FOHA 3LEFA 2VAFA 1YEPA 1XWGA 2FWFA 1XOAA 4IQ1A 3CYNA 4QL9A 4EVMA 1LJRA 2AJQB 1UVZA 4NV5A 1KBNA 2B1KA 3UMAA 3VURA 2MMNA 2JZRA 1TK8B 2R0GA 3DD3A 3PINA 2G2QA 3ZFLA 2IFQA 4OD7A 3UARA 4F9ZA 2I3YA 4NXIA 2EFDA 2RM5A 3VPQA 4DSQA 2H1LA 4MJBA 3IA1A 2TRXA 2AYTA 5D93A 1XW9A 2NVLA 3RAZA 4FQUA 5B6NA 4MP4A 1Z3EA 3FZ9A 2EIOA 1K0DA 1H75A 5GAPD 2GDRA 1SYXA 5B6MA 2WS2A 3NIVA 4GQCA 1GTUA 1F3AA 4L5LA 5J5NA 4BL7A 1FVKA 4OO5A 4YAPA 3N5OA 1EP7A 1AXDA 3WT1A 2H74A 4OFTA 5ECHB 2O7KA 2B3SA 1EEJA 4KH7A 3C71A 9GSSA 4HJ2A 5EVOA 3D0ZA 3EINA 2R6KA 1FB6A 4Z7XA 5CP1A 3FEUA 2C80A 1GSDA 1EGRA 2ON5A 3MAKA 1M2BA 4CHSA 1MTCA 1WOUA 1ZOFA 3TKPA 2H30A 5ECMB 3HZ4A 1XWBA 2WJUA 3WYWA 4EDZA 1AQXA 5J4UA 3VFIA 5ID2A 5J9CA 3FY7A 2C0GA 2PWJA 4J56E 5B8BA 1XVQA 4N10A 1SVLA 6GSSA 1MEKA 2LTKA 2HI7A 5KN2A 3KGKA 1S3DA 4HU7A 4Q5FA 2I4AA 4RUVA 3F4SA 3UVHA 3RHBA 1SKWB 3GSTA 3UBKA 4XRAA 1JZDA 1O81A 1O8XA 4X43A 2REMA 1XFLA 4X1UA 1R5AA 2PU9C 3BCIA 4XS6A 2IMKA 1QK8A 1AW9A 1PL2A 5J41A 2OBIA 4MPGA 2BJXA 2HSMA 3O3TA 3E0UA 1ZMAA 2O5VA 2NDOA 4ILFA 3SWLA 2H1GA 1TTZA 4ID0A 3LQ7A 4Z2RA 4N0VA 4DEJA 3EPTA 1E2YA 5AIVA 5KN3A 2WDUA 3M8NA 3QR6A 3DVXA 1I5GA 2ZNMA 1T4YA 4KDYA 2XBIA 4ZL9A 3D6IA 1A23A 3UOMA 4I2UA 4MZWA 2YV9A 14GSA 1TRSA 3K8NA 2LRCA 3BJ5A 4GLTA 1V9WA 2DJKA 3UVTA 2OE1A 5HFGA 3N9JA 5DJMA 4NAXA 4TKYA 2MMAA 4K9ZA 4GRFA 1GSFA 1WWJA 2LUSA 2LV3A 1USBA 2F9SA 1VRSD 1I9DA 3DXBA 2YCDA 5C00A 2JZSA 5JWQB 3TDGA 3TU3B 3TCOA 3TJKA 4G10A 4OFMA 2R0CA 4X4JA 4GF0A 2YOIA 3Q19A 1VF2A 4GTUA 3I6AA 3LW9A 2YZUA 1YJ6A 1JZOA 2H6XA 4OWYA 2L57A 2OBKA 5ECPB 1FG4A 1EZKA 4GWRA 4HOJA 3A2XA 2VOCA 1GUKA 3RBTA 1AC1A 1M9AA 1M9BA 3CSJA 2J23A 4ZB8A 1HNBA 5LCZA 1S3CA 1Z6MA 1DE1A 1UN2A 5BRTA 2X99A 5ECOB 4HUAA 2L5LA 1A8YA 3UL3A 1T1VA 2P31A 3BOAA 3HHVA 4IN0A 4JBBA 2LJKA 1ON4A 4GQFA 4GSSA 4ECJA 11GSA 3GL5A 3H4KA 1AAZA 3P2AA 1K3YA 2JACA 2M80A 2FY6A 3KMNA 1C72A 1MDKA 4IJIA 2QA1A 3ZMLA 2C3QA 5INYA 3GSSA 4BVYB 4KGIA 2GT5A 1R26A 5G5FA 1RW1A 3KM6A 1QFNA 1ZCPA 1F37A 3ED3A 1W89A 4V2NA 4EIPA 3ZREA 2VO4A 3DIEA 3GRXA 2LRTA 5BMUA 3FKFA 5LNKe 1GTBA 4FYCA 2C0FA 3CWGA 5JCGA 2X8CA 1BEDA 1KEBA 1SD9A 4NPBA 2CAQA 4W66A 3H93A 2K6VA 2R4VA 2VUPA 3GKXA 1X5EA 4EO3A 4KE3A 1G0TA 4MJCA 1GH2A 3ME7A 4ECBA 1OYJA 5A1NA 5IMAA 3Q6OA 4ZILA 1ERTA 2WCIA 1K3LA 2B5YA 3GMFA 19GSA 5GSSA 5ELAA 4AKXB 2OACA 1F2EA 2R2JA 3KCMA 1SKSB 4L0UA 3C1SA 1JZRA 1OC9A 2Z9SA 2H1BA 4PNGA 3APOA 3ZVJA 5DALA 1YF1A 4PUAA 2AV4A 4YAVA 5DVBA 2WB9A 1ERUA 1SK0A 2I1UA 2IIYA 4GCIA 3QFBC 1AUCA 4CY8A 2ALBA 4NWYA 3HJMA 5DAKB 1WE0A 5HR0A 4YQMA 3LXTA 4MH2A 5A4VA 3MSZA 5CRDA 3ZIVA 1EV4A 2O89A 3F3QA 5H5SA 4PTSA 4QL7A 2H66A 4WXTA 4KF9A 1IYHA 1QXHA 5J3RA 4OCEA 4FYBA 3NOFA 1PN0A 1PQNA 2C3NA 17GSA 1THXA 3E9JB 1TW9A 1PKZA 4OFNA 4ECIA 2F8AA 2V41A 3HDCA 1PKWA 1WRYA 4IHUA 5ECLB 4DSRA 3CTFA 4PGTA 2B7JA 2PGTA 2E2GA 3D22A 2HE3A 4V1Ag 2JADA 1GSQA 5J47A 2E0QA 4IS0A 1F6MC 4IBPA 2ON7A 5KEJA 4ISDA 2FLSA 2N5BA 4D73A 2H76A 1HNCA 3UIWA 5F05A 3CRUA 2OA7A 3DRNA 5ABRA 1X9SB 3WT2A 4KCEA 3H8QA 1YKCA 2GLRA 1ZYEA 1YF0A 3F3RA 5CRWA 3HVVA 5IMZA 4P3YB 1GL8A 5JWRB 3Q74A 5IPHA 4FH8A 5KN1A 1EOGA 2CZ3A 3MIXA 3A2WA 2PVOC 1X9WB 4WETA 3ZYWA 1F9MA 2VM2A 3QD9A 2DC5A 4YH2A 5HFKA 4TXVA 4BVXA 4JR6A 2HT9A 2VCVA 4X0XA 1G6WA 3VI5A 1WP0A 3EC3A 4PNFA 2K8VA 5F07A 3GIXA 4OCFA 2ZCTA 1WIKA 2VL3A 2LEGA 3TRXA 1XW6A 5ECQB 4MABA 2KUCA 1TK5B 3G7YA 1GTIA 1QUWA 2VKZG 1SYRA 3HD5A 2DJJA 4IVFA 2GT6A 1KTEA 4MPFA 4KCAA 4I6XA 1R7HA 1SU9A 2LRNA 1GSUA 1Z9HA 1YY7A 3GTUB 4BVXB 3O6TA 4WBJA 1TRWA 4GSTA 2K8SA 3SBCA 8GSSA 4K5SA 4TR3A 1SL2B 2GS3A 2YANA 1BF5A 5G1LA 1PX6A 4KDXA 3GX8A 3FR9A 4WKWA 3TJBA 2CVDA 4H86A 1GRXA 1BG5A 6GSWA 1M0UA 3H1NA 1R4WA 2V2GA 2BMXA 1JLWA 5CNWA 4HJMA 1ZGNA 4BA7A 5IM9A 4WEYA 1V40A 1K0MA 3KP8A 4KA0A 5D9XA 2NBSA 1GUMA 1K0NA 2IN3A 5A5HB 2XPEA 3GA4A 3M3MA 1ACVA 5G5EA 3QDNA 2C4JA 3GNJA 1QGVA 1VF4A 1FB0A 1TOFA 1U3AA 1YKAA 2V32A 1N2AA 3LYKA 4LMVA 4XHMA 2LJAA 2R5GA 3R3EA 2C0DA 4JZQA 1Z5YE 3V1WA 2YWNA 4WBRD 4RQRA 3CSHA 2P5QA 2H8LA 1GTAA 1MDJA 2GZPA 1GLPA 3IBHA 2X8HA 1A2LA 2GSSA 4DVCA 4K7IA 5G2ZA 2IL3A 2I81A 3ZMKA 3M1GA 3A2VA 2FUG2 3QAWA 5AN1A 4POKA 2O8VB 1SD8A 1YZXA 5IOXA 2DJ3A 4MZCA 2DJ2A 2FWGA 2B5EA 1Z6NA 1AIUA 2H0GA 3TOTA 3W8SA 2M72A 3ERWA 3TGZA 1PL1A 1FW1A 1X0RA 2OE0A 2R3XA 4N30A 1LU4A 2XPDA 4O92A 3VPTA 3LSZA 3WGEA 2LNTA 2B6MA 2DSAA 1HQOA 3IHQA 1K0AA 3L9VA 3ZRDA 6GSUA 5IMCA 1UA5A 3DWVA 5AGYA 4V1Ap 1W4VA 4IP1A 4TVEA 4TR4A 2V6OA 2VL2C 5KOXA 2K9FA 1J0FA 3KH7A 4BWQA 2KOKA 1FVJA 4N11A 5ECKB 2GTUA 2YWIA 4ZBDA 2HZEB 3CXGA 1Q98A 1VF1A 3APSA 5EPFA 4K0GA 3IDVA 3KZQA 5L71A 3CSIA 1B8XA 1FOVA 1TRUA 2GZZA 1T7PB 3HYPA 2NPBA 2ES7A 3KIJA 5J4VA 2F8FA 1SENA 5FWGA 2VIMA 4NMUA 1THOA 2H0IA 2V1MA 2VLVA 2HNLA 1GUHA 4AGSA 2IMIA 2J9HA 3BBYA 3D4TA 2HYXA 1VF3A 1NM3A 4I8BA 2FGXA 4K2DA 1TU7A 1V58A 3G9BA 3MWHA 3DKSA 2JL4A 1Q4JA 2A2RA 4EF0A 3TB2A 2O85A 2E2MA 1N25A 5CRGA 1SJZA 1T3BA 2VL9A 3FHKA 3EWLA 2H73A 3KD0A 5CO3A 1WPIA 3IAM2 10GSA 1V98A 4LMWA 2VL2A 4HI7A 4BVYA 1FHEA 4F03A 4KSMA 3GL3A 2L59A 4AKGA 1GP1A 3GYKA 1K0OA 1IYIA 1T8EB 1FO5A 1M99A 2HFDA 3CMIA 1GSSA 4I5QA 1RK4A 5ECIB 4K0NA 3OR5A 4POMA 4RI6A 1TXXA 3A5WA 5HR2A 4Q5NA 4PX1A 3NZNA 1SVOA 4AJ6A 3FZ5A 4NHZA 3ZITA 3CTGA 1OKTA 2L6DA 1G6YA 1CQHA 4K8MA 2PBJA 4CDOA 4NHWA 3WGXA 4XS1A 3VWVA 5F0GA 3HJPA 3GFKA 2RUEA 4JU5A 5JWOB 2P0GA 3JCML 2X49A 3H79A 3MDKA 2YN1A 2IPAA 1MD4A 2QSIA 3TKRA 4WF5A 3DEXA 1AQWA 3KTLA 2YZHA 4WF4A 5LD0A 3VWUA 1JZWA 1X9MB 1J08A 1OE7A 1OAZA 1ZL9A 4MMMA 2IMEA 1B48A 1ERVA 1SK1A 3AY8A 2VCQA 4MDCA 4G2EA 4GXZA 5DBQA 3UEMA 1NHOA 1X5CA 4KX4A 2KP2A 3GH9A 4GDFA 4AF2A 1TP9A 4E8HA 4KDUA 3D5JA 1M2DA 2KP1A 4YQUA 3ZL5A 3IK9A 4MH3A 4MCUA 5DAKA 1QMVA 3EMPA 2A2PA 3HVXA 4KSOA 1OC3A 3GHAA 3UJ1A 1SL0B 5KN0A 2GSRA 2N5FA 1Z7PA 1EV9A 1TI1A 2C8UA 4ZBAA 2FNOA 4FIWA 3L78A 2PN8A 3F8UA 1K0CA 3HVSA 1BJXA 3D4MA 1G7EA 3EU4A 1B9XC 1XCCA 2HZFA 4MJEA 5H5QA 5HR3A 3RPPA 2UV8G 1EGOA 4AJ8A 4ML6A 2HRKB 1U88A 3EVIA 1NSWA 22GSA 2LNSA 4KAEA 4LL4B 2HRNA 4F0BA 2TIRA 1SJ6A 2YV7A 2RUFA 6GSVA 2VM1A 2KHPA 5DQYA 1O85A 3O76A 12GSA 6GSTA 2M46A 2WZ9A 3ZLPA 2XC2A 3A5IA 4ZB9A 2UZ8A 5IOWA 3ME8A 3US3A 3HKRA 2HRAA 1QQ2A 2B7KA 2JSYA 2GQKA 3KTBA 2F51A 1OE8A 4WR5A 4IGJA 3TOUA 2CQ9A 1XVWA 3IR4A 2GGTA 2V6KA 1A8LA 4J2FA 2GVPA 2HSHA 3UBLA 2YWMA 4F2IA 2DJ0A 3HA9A 1VGLA 1T4ZA 2AUVA 4TXOB 4ICYA 1O6JA 4MF6A 2H70A 3TUEA 3LJRA 2WULA 3MNGA 4N3ZA 4CY6A 2QKEA 4RI7A 1OKDA 2AB6A 2PUKC 1PGTA 1A0FA 1SJIA 1GWCA 4HDEA 4I2TA 3M0FA 3KP9A 4PQHA 4ML1A 3RHCA 4YKGA 1N8JA 1OVNA 4XRDA 2B5XA 1XPVA 2EC4A 1PMTA 3R2QA 3D21A 5J9BA 1ERWA 4KB3A 5F8BA 1JLVA 4Z2TA 5IIZA 5HFIA 3GTUA 5D8IA 1FAAA 5GAND 1Y1UA 3J7Yk 2A2SA 1A2JA 2RM6A 1EOHA 5IPGA 2D2ZA 2HSNA 1ABAA 2FD3A 5HQPA 3QFAC 2YPMA 4I97A 2RLIA 2VCZA 1M7TA 3EMXA 5B7CA 5IO0A 4KNDA 1TU8A 3C73A 4IJ3A 3GN3A 4L5OA 2LS5A 2H01A 2H75A 2LQOA 4HQSA 1MD3A 1NW2A 1T00A 1ZZYA 3GUSA 1HNAA 3P8WA 5A5HA 4JR4A 3QMXA 3QOUA 2HSNB 3FZ4A 1O8WA 2ZUPA 2YP6A 2EFEA 5A4WA 3KEBA 3KXOA 1B4QA 4O5QA 2CX3A 1WJKA 4Q5QA 2WRTA 3ERGA 4K7OA 2OT3A 1TK0B 4XS4B 2OJLA 3U6VA 3HXSA 4TR0A 4TRXA 2FHEA 3QCPA 2PPTA 4HZ4A 3GH6A 2H6YA 4YKFA 3C1RA 3F9UA 4EE0A 2CV4A 1BG1A 2C0EA 5ECSA 1PX7A 5A4UA 1TXUA 3EURA 2H72A 2F3MA 3ZVJD 1TRVA 4BWSA 4HU9A 2C3TA 5D9TA 2AHEA 2L4QA 3EE2A 2VD1A 4K5RA 2EIRA 4A5PA 3EYTA 1URMA 2GSTA 5H5RA 2IMFA 2JSZA 1B4PA 2X64A 1AQVA 2MYGA 2YJ7A 3L0HA 4MF5A 3ERFA 2IFQB 4LL1B 2I9HA 1B9YC 3FMWA 5ELGA 2GZYA 3BCKA 2TRCP 4K1FA 1YVLA 1SKRB 4KUNA 3APQA 2H1DA 2FWEA 7GSSA 3VK9A 1DSBA 5IMVA 3FR6A 3QPMA 3ISOA 5B8AA 2HZEA 4NV2A 2CVKA 3G7IA 1TJDA 4EL1A 3C7MA 3FZAA 3IE3A 3KH9A 2DLXA 1SL1B 4IW9A 2CVBA 1BAYA 5FT3A 4BL7B 5COHA 3E3EA 2YWOA 3IK7A 1JFUA 5DDLA 3FYGA 2MBTA 5IO2A 2MBSA 1ZYPA 1E6BA 2KLXA 4ZL7A 1LBKA 4ZB6A 3VWWA 1XW5A 2CX4A 2MZCA 5ECNB 2DIZA 16GSA 2XBQA 5C04A 3TJFA 4O5RA 4AI6A 2VLTA 3HCZA 1YQ1A 4MLYA 3GKMA 2IMDA 4PQ1A 3IPZA 4PUFC 5ID2B 2A4HA 3C8EA 5EL8A 4G0LA 2O87A 3MYDA 2OKAA 3WD6A 2PERA 1PA3A 5D96A 3W8JA 3GV1A 4XCSA 5CYYA 4TOPA 3TJGA 4ZXGA 1GNWA 4ULXA 3KJYA 2DMLA 1Z7RA 1PRXA 1GSEA 4N0ZA 3Q18A 5E4WA 2EFCA 2EFHA 1TDIA 2OE3A 4ZBBA 2H19A 6GSXA 4K2XA 3FW2A 4V2MA 3LYPA 3IHGA 1ST9A 3LORA 2HSMB 2XHFA 1EEMA 5CREA 1M2AA 3TKQA 4MJAA 1F3BA 3PH9A 3IRAA 5E59A 1XWKA 1R5PA 4WR4A 3QAVA 4MF7A 2VLUA 20GSA 2FWHA 4HQZA 5IMFA 3S9FA 4AJ7A 1X5DA 1DE2A 5GZZB 2DKIA 4HS1A 1O7UA 3F4TA 1A0RP 2HRFA 3L4NA 5IQYA 3G7JA 4MA9A 2L5OA 1XIYA 4O32A 2L4CA 3GURA 2VCXA 3F63A 2FA4A 4Z2UA 2HLSA 2CT6A 3HMJG 2R0PA 2VD0A 5D73A 5AISA 1V2AA 4MNNA 13GSA 2DIYA 3L9UA 2QC7A 5F06A 3FK8A 1GULA 3RDWA 4USSA 1PD21 4EDYA 1ILOA 3DYRA 2JZTA 5AIXA 4EXJA 5DQSA 5G1KA 1MDIA 3W6GA 2LQQA 2H0HA 2P5RA 2DKHA 2HSYA 2N5AA 4ZL8A 1G7OA 6GSYA 2VCTA 4YQVA 3M9JA 3IAS2 3CRTA 1DUGA 2HXKA 1DBYA 3FR3A 1TKDB 3DGQA 3ZTLA 5DCGA 1OC8A 5FHIA 4POLA 4RQXA 5A34A 1K3OA 1WMJA 1TI3A 3GX0A 2G0FA 4PXOA 1GNEA 2AAWA 1CQGA 4J57E 1U87A 4FO5A 4HZ2A 4QQ7A 2IJYA 1BQ7A 3IV4A 1KNGA 5IMDA 2HRKA 5D9WA 2PMTA 3QAGA 3TRPA 2QA2A 3GKNA 4K6XA 4G0KA 2IWTA 5A5KA 4POBA 4XTSA 4AKHA 3TKSC 1RQMA 4BPYA 2EIQA 2DMMA 2LKUA 2GSQA 1EWXA 4G9HA 4IKHA 3LFLA 3ZIJA 3RPNA 3F6DA 3VI7A 4F82A 4IQAA 5A34B 4OMVA 3LWAA 1Y25A 3A3TA 3F0IA 3TRQA 5CRHA 4G0IA 4CW9A 3P90A 5EY6A 2X8GA 3LG6A 3IC8A 3HY2A 5G30A 5GSTA 3WGDA 2B1LA 3I43A 2C1YA 4TXOA 5BMUB 18GSA 2MMZA 4TW5A 2YNXA 2NTOA 5D9VA 1JHBA 4ZB7A 4LLRA 5JCUA 2LJRA 4MK3A 1HD2A 4DSSA 1UC7A 3EU3A 3IC4A 1Y6EA 3FRCA 3DVWA 4LA1A 5A1NB 4F0CA 3I9V2 4PURA 3TKSA 5ENUA 3DMLA 2H6ZA 1GLQA 4G01A 5J40A 4EKZA 4FYUA 1H4OA 2OADA 4QMKA 4E68A 3UAPA 1OC9B 4TN8A 1PSQA 2LSTA 5DALB 2L6CA 5J4YA 3GKKA 1O73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJJ A;  1A2M A;  4EUY A;  3TKS E;  4G19 A;  2CA8 A;  3IXR A;  2QGV A;  3CBU A;  4TR1 A;  4PQI A;  2PVQ A;  1YEX A;  2GQM A;  1U6T A;  3KMO A;  4O7H A;  3ZZX A;  1EP8 A;  1S3A A;  2K18 A;  4Q5R A;  5DCH A;  4ACS A;  4OO4 A;  4DSS B;  1A24 A;  3U5R E;  3VWX A;  2GQL A;  4ZIJ A;  3LXZ A;  2HQT A;  3F6F A;  3VLN A;  2WGR A;  1XWA A;  4K7N A;  5ECR B;  3F4R A;  1ML6 A;  2A4V A;  3M9K A;  3LGC A;  5HR1 A;  2FCH A;  1GSY A;  1XXU A;  1ZYQ B;  2YJH A;  5JCW A;  1NHY A;  5CAX A;  5G31 A;  4ECC A;  3BD2 A;  3PPU A;  2E7P A;  2MMO A;  4EC0 A;  1J9B A;  2RII A;  2WFC A;  3PGT A;  4TR1 B;  1XBS A;  4V2L A;  3ZFB A;  3HZ8 A;  4JRR A;  1U3I A;  4MZB A;  4JED A;  2FA8 A;  3HJO A;  2H71 A;  4HEA 2;  3PR8 A;  1XWC A;  2JU5 A;  4XS4 A;  2VCW A;  4D73 B;  3IOS A;  1BYE A;  4GSN A;  2CZ2 A;  2DBC A;  4XIH A;  2R37 A;  1XOB A;  4E8E A;  2H1A A;  1V57 A;  1BX9 A;  1HYU A;  1PN9 A;  3J7Y b;  2CAI A;  3L9S A;  4JE1 A;  4KW6 A;  3I69 A;  1SK2 A;  1XZO A;  4L0W A;  2BTO T;  4IP6 A;  5DJL A;  4L8E A;  2DJ1 A;  3P7X A;  4IEL A;  1K0B A;  1YDK A;  3LEF A;  2VAF A;  1YEP A;  1XWG A;  2FWF A;  1XOA A;  4IQ1 A;  3CYN A;  4QL9 A;  4EVM A;  1LJR A;  2AJQ B;  1UVZ A;  4NV5 A;  1KBN A;  2B1K A;  3UMA A;  3VUR A;  2MMN A;  2JZR A;  1TK8 B;  3DD3 A;  3PIN A;  2G2Q A;  3ZFL A;  2IFQ A;  4OD7 A;  3UAR A;  4F9Z A;  2I3Y A;  4NXI A;  2RM5 A;  3VPQ A;  4DSQ A;  4MJB A;  3IA1 A;  2TRX A;  2AYT A;  5D93 A;  1XW9 A;  2NVL A;  3RAZ A;  4FQU A;  5B6N A;  4MP4 A;  1Z3E A;  3FZ9 A;  2EIO A;  1K0D A;  1H75 A;  5GAP D;  2GDR A;  1SYX A;  5B6M A;  2WS2 A;  3NIV A;  4GQC A;  1GTU A;  1F3A A;  4L5L A;  5J5N A;  4BL7 A;  1FVK A;  4OO5 A;  4YAP A;  3N5O A;  1EP7 A;  1AXD A;  3WT1 A;  2H74 A;  4OFT A;  5ECH B;  2O7K A;  2B3S A;  1EEJ A;  4KH7 A;  3C71 A;  9GSS A;  4HJ2 A;  5EVO A;  3D0Z A;  3EIN A;  2R6K A;  1FB6 A;  4Z7X A;  5CP1 A;  3FEU A;  2C80 A;  1GSD A;  1EGR A;  2ON5 A;  3MAK A;  1M2B A;  4CHS A;  1MTC A;  1WOU A;  1ZOF A;  3TKP A;  2H30 A;  5ECM B;  3HZ4 A;  1XWB A;  2WJU A;  3WYW A;  4EDZ A;  1AQX A;  5J4U A;  3VFI A;  5ID2 A;  5J9C A;  3FY7 A;  2C0G A;  2PWJ A;  4J56 E;  5B8B A;  1XVQ A;  4N10 A;  6GSS A;  1MEK A;  2LTK A;  2HI7 A;  5KN2 A;  3KGK A;  1S3D A;  4HU7 A;  4Q5F A;  2I4A A;  4RUV A;  3F4S A;  3UVH A;  3RHB A;  1SKW B;  3GST A;  3UBK A;  4XRA A;  1JZD A;  1O81 A;  1O8X A;  4X43 A;  2REM A;  1XFL A;  4X1U A;  1R5A A;  2PU9 C;  3BCI A;  4XS6 A;  2IMK A;  1QK8 A;  1AW9 A;  1PL2 A;  5J41 A;  2OBI A;  4MPG A;  2BJX A;  2HSM A;  3O3T A;  3E0U A;  1ZMA A;  2NDO A;  4ILF A;  3SWL A;  2H1G A;  1TTZ A;  4ID0 A;  3LQ7 A;  4N0V A;  4DEJ A;  1E2Y A;  5AIV A;  5KN3 A;  2WDU A;  3M8N A;  3QR6 A;  3DVX A;  1I5G A;  2ZNM A;  1T4Y A;  4KDY A;  2XBI A;  4ZL9 A;  3D6I A;  1A23 A;  3UOM A;  4I2U A;  4MZW A;  2YV9 A;  14GS A;  1TRS A;  3K8N A;  2LRC A;  3BJ5 A;  4GLT A;  1V9W A;  2DJK A;  3UVT A;  2OE1 A;  5HFG A;  3N9J A;  5DJM A;  4NAX A;  4TKY A;  2MMA A;  4K9Z A;  4GRF A;  1GSF A;  1WWJ A;  2LUS A;  2LV3 A;  1USB A;  2F9S A;  1VRS D;  1I9D A;  3DXB A;  2YCD A;  5C00 A;  2JZS A;  5JWQ B;  3TDG A;  3TCO A;  3TJK A;  4G10 A;  4OFM A;  4GF0 A;  2YOI A;  3Q19 A;  1VF2 A;  4GTU A;  3I6A A;  2YZU A;  1YJ6 A;  1JZO A;  2H6X A;  4OWY A;  2L57 A;  2OBK A;  5ECP B;  1FG4 A;  1EZK A;  4GWR A;  4HOJ A;  3A2X A;  2VOC A;  1GUK A;  3RBT A;  1AC1 A;  1M9A A;  1M9B A;  3CSJ A;  2J23 A;  4ZB8 A;  1HNB A;  5LCZ A;  1S3C A;  1Z6M A;  1DE1 A;  1UN2 A;  2X99 A;  5ECO B;  4HUA A;  2L5L A;  1A8Y A;  3UL3 A;  1T1V A;  2P31 A;  4IN0 A;  3BOA A;  3HHV A;  4JBB A;  2LJK A;  1ON4 A;  4GQF A;  4GSS A;  4ECJ A;  11GS A;  3GL5 A;  3H4K A;  1AAZ A;  3P2A A;  1K3Y A;  2JAC A;  2M80 A;  2FY6 A;  3KMN A;  1C72 A;  1MDK A;  4IJI A;  3ZML A;  2C3Q A;  5INY A;  3GSS A;  4BVY B;  4KGI A;  2GT5 A;  1R26 A;  5G5F A;  1RW1 A;  3KM6 A;  1QFN A;  1ZCP A;  1F37 A;  3ED3 A;  1W89 A;  4V2N A;  3ZRE A;  2VO4 A;  3DIE A;  3GRX A;  2LRT A;  5BMU A;  3FKF A;  5LNK e;  1GTB A;  4FYC A;  2C0F A;  5JCG A;  2X8C A;  1BED A;  1KEB A;  1SD9 A;  4NPB A;  2CAQ A;  3H93 A;  2K6V A;  2R4V A;  2VUP A;  3GKX A;  1X5E A;  4EO3 A;  4KE3 A;  1G0T A;  4MJC A;  1GH2 A;  3ME7 A;  4ECB A;  1OYJ A;  5IMA A;  3Q6O A;  4ZIL A;  1ERT A;  2WCI A;  1K3L A;  2B5Y A;  3GMF A;  19GS A;  5GSS A;  5ELA A;  2OAC A;  1F2E A;  2R2J A;  3KCM A;  1SKS B;  4L0U A;  3C1S A;  1JZR A;  1OC9 A;  2Z9S A;  2H1B A;  4PNG A;  3APO A;  3ZVJ A;  5DAL A;  1YF1 A;  4PUA A;  2AV4 A;  4YAV A;  5DVB A;  2WB9 A;  1ERU A;  1SK0 A;  2I1U A;  2IIY A;  4GCI A;  3QFB C;  1AUC A;  2ALB A;  4NWY A;  3HJM A;  5DAK B;  1WE0 A;  5HR0 A;  4YQM A;  3LXT A;  4MH2 A;  5A4V A;  3MSZ A;  5CRD A;  3ZIV A;  1EV4 A;  2O89 A;  3F3Q A;  5H5S A;  4PTS A;  4QL7 A;  2H66 A;  4WXT A;  4KF9 A;  1IYH A;  1QXH A;  5J3R A;  4OCE A;  4FYB A;  3NOF A;  1PQN A;  2C3N A;  17GS A;  1THX A;  3E9J B;  1TW9 A;  1PKZ A;  4OFN A;  4ECI A;  2F8A A;  2V41 A;  3HDC A;  1PKW A;  1WRY A;  4IHU A;  5ECL B;  4DSR A;  3CTF A;  4PGT A;  2B7J A;  2PGT A;  2E2G A;  3D22 A;  2HE3 A;  4V1A g;  2JAD A;  1GSQ A;  2E0Q A;  4IS0 A;  1F6M C;  4IBP A;  2ON7 A;  5KEJ A;  4ISD A;  2FLS A;  2N5B A;  4D73 A;  2H76 A;  1HNC A;  3UIW A;  5F05 A;  3CRU A;  2OA7 A;  3DRN A;  5ABR A;  1X9S B;  3WT2 A;  4KCE A;  3H8Q A;  1YKC A;  2GLR A;  1ZYE A;  1YF0 A;  3F3R A;  5CRW A;  3HVV A;  5IMZ A;  4P3Y B;  1GL8 A;  5JWR B;  3Q74 A;  5IPH A;  4FH8 A;  5KN1 A;  1EOG A;  2CZ3 A;  3A2W A;  2PVO C;  1X9W B;  4WET A;  3ZYW A;  1F9M A;  2VM2 A;  3QD9 A;  2DC5 A;  4YH2 A;  5HFK A;  4TXV A;  4BVX A;  4JR6 A;  2HT9 A;  2VCV A;  4X0X A;  1G6W A;  3VI5 A;  1WP0 A;  3EC3 A;  4PNF A;  2K8V A;  5F07 A;  3GIX A;  4OCF A;  2ZCT A;  1WIK A;  2VL3 A;  2LEG A;  3TRX A;  1XW6 A;  5ECQ B;  4MAB A;  2KUC A;  1TK5 B;  3G7Y A;  1GTI A;  1QUW A;  1SYR A;  3HD5 A;  2DJJ A;  4IVF A;  2GT6 A;  1KTE A;  4MPF A;  4KCA A;  4I6X A;  1R7H A;  1SU9 A;  2LRN A;  1GSU A;  1Z9H A;  1YY7 A;  3GTU B;  4BVX B;  3O6T A;  4WBJ A;  1TRW A;  4GST A;  2K8S A;  3SBC A;  8GSS A;  4TR3 A;  1SL2 B;  2GS3 A;  2YAN A;  5G1L A;  1PX6 A;  4KDX A;  3GX8 A;  3FR9 A;  4WKW A;  3TJB A;  2CVD A;  4H86 A;  1GRX A;  1BG5 A;  6GSW A;  1M0U A;  3H1N A;  1R4W A;  2V2G A;  2BMX A;  1JLW A;  5CNW A;  4HJM A;  1ZGN A;  4BA7 A;  5IM9 A;  4WEY A;  1V40 A;  1K0M A;  3KP8 A;  4KA0 A;  5D9X A;  2NBS A;  1GUM A;  1K0N A;  2IN3 A;  2XPE A;  3GA4 A;  3M3M A;  1ACV A;  5G5E A;  3QDN A;  2C4J A;  3GNJ A;  1QGV A;  1VF4 A;  1FB0 A;  1TOF A;  1U3A A;  1YKA A;  2V32 A;  1N2A A;  3LYK A;  4LMV A;  4XHM A;  2LJA A;  2R5G A;  3R3E A;  2C0D A;  4JZQ A;  1Z5Y E;  3V1W A;  2YWN A;  4WBR D;  4RQR A;  3CSH A;  2P5Q A;  2H8L A;  1GTA A;  1MDJ A;  2GZP A;  1GLP A;  3IBH A;  2X8H A;  1A2L A;  2GSS A;  4DVC A;  4K7I A;  5G2Z A;  2IL3 A;  2I81 A;  3ZMK A;  3M1G A;  3A2V A;  2FUG 2;  3QAW A;  5AN1 A;  4POK A;  2O8V B;  1SD8 A;  1YZX A;  5IOX A;  2DJ3 A;  4MZC A;  2DJ2 A;  2FWG A;  2B5E A;  1Z6N A;  1AIU A;  2H0G A;  3TOT A;  3W8S A;  2M72 A;  3ERW A;  3TGZ A;  1PL1 A;  1FW1 A;  1X0R A;  2OE0 A;  2R3X A;  4N30 A;  1LU4 A;  2XPD A;  4O92 A;  3VPT A;  3LSZ A;  3WGE A;  2LNT A;  2B6M A;  2DSA A;  1HQO A;  3IHQ A;  1K0A A;  3L9V A;  3ZRD A;  6GSU A;  5IMC A;  1UA5 A;  3DWV A;  5AGY A;  4V1A p;  1W4V A;  4IP1 A;  4TVE A;  4TR4 A;  2V6O A;  2VL2 C;  2K9F A;  1J0F A;  3KH7 A;  4BWQ A;  2KOK A;  1FVJ A;  4N11 A;  5ECK B;  2GTU A;  2YWI A;  4ZBD A;  2HZE B;  3CXG A;  1Q98 A;  1VF1 A;  3APS A;  5EPF A;  4K0G A;  3IDV A;  3KZQ A;  5L71 A;  3CSI A;  1B8X A;  1FOV A;  1TRU A;  2GZZ A;  1T7P B;  3HYP A;  2NPB A;  2ES7 A;  3KIJ A;  2F8F A;  1SEN A;  5FWG A;  2VIM A;  4NMU A;  1THO A;  2H0I A;  2V1M A;  2VLV A;  2HNL A;  1GUH A;  4AGS A;  2IMI A;  2J9H A;  3BBY A;  3D4T A;  2HYX A;  1VF3 A;  1NM3 A;  4I8B A;  2FGX A;  4K2D A;  1TU7 A;  1V58 A;  3G9B A;  3MWH A;  3DKS A;  2JL4 A;  1Q4J A;  2A2R A;  4EF0 A;  3TB2 A;  2O85 A;  2E2M A;  5CRG A;  1SJZ A;  1T3B A;  2VL9 A;  3FHK A;  3EWL A;  2H73 A;  3KD0 A;  5CO3 A;  1WPI A;  3IAM 2;  10GS A;  1V98 A;  4LMW A;  2VL2 A;  4HI7 A;  4BVY A;  1FHE A;  4F03 A;  4KSM A;  3GL3 A;  2L59 A;  1GP1 A;  3GYK A;  1K0O A;  1IYI A;  1T8E B;  1FO5 A;  1M99 A;  2HFD A;  3CMI A;  1GSS A;  4I5Q A;  1RK4 A;  5ECI B;  4K0N A;  3OR5 A;  4POM A;  4RI6 A;  1TXX A;  3A5W A;  5HR2 A;  4Q5N A;  4PX1 A;  3NZN A;  4AJ6 A;  3FZ5 A;  4NHZ A;  3ZIT A;  3CTG A;  1OKT A;  2L6D A;  1G6Y A;  1CQH A;  4K8M A;  2PBJ A;  4CDO A;  4NHW A;  3WGX A;  4XS1 A;  3VWV A;  5F0G A;  3HJP A;  3GFK A;  2RUE A;  4JU5 A;  5JWO B;  2P0G A;  3JCM L;  3H79 A;  3MDK A;  2YN1 A;  2IPA A;  1MD4 A;  2QSI A;  3TKR A;  4WF5 A;  3DEX A;  1AQW A;  3KTL A;  2YZH A;  4WF4 A;  5LD0 A;  3VWU A;  1JZW A;  1X9M B;  1J08 A;  1OE7 A;  1OAZ A;  1ZL9 A;  4MMM A;  2IME A;  1B48 A;  1ERV A;  1SK1 A;  3AY8 A;  2VCQ A;  4MDC A;  4G2E A;  4GXZ A;  5DBQ A;  3UEM A;  1NHO A;  1X5C A;  4KX4 A;  2KP2 A;  3GH9 A;  4AF2 A;  1TP9 A;  4E8H A;  4KDU A;  3D5J A;  1M2D A;  2KP1 A;  4YQU A;  3ZL5 A;  3IK9 A;  4MH3 A;  4MCU A;  5DAK A;  1QMV A;  3EMP A;  3HVX A;  4KSO A;  1OC3 A;  3GHA A;  3UJ1 A;  1SL0 B;  5KN0 A;  2GSR A;  2N5F A;  1Z7P A;  1EV9 A;  1TI1 A;  2C8U A;  4ZBA A;  2FNO A;  4FIW A;  3L78 A;  2PN8 A;  3F8U A;  1K0C A;  3HVS A;  1BJX A;  3D4M A;  1G7E A;  3EU4 A;  1B9X C;  1XCC A;  2HZF A;  4MJE A;  5H5Q A;  5HR3 A;  3RPP A;  1EGO A;  4AJ8 A;  4ML6 A;  2HRK B;  1U88 A;  3EVI A;  1NSW A;  22GS A;  2LNS A;  4KAE A;  4LL4 B;  2HRN A;  4F0B A;  2TIR A;  1SJ6 A;  2YV7 A;  2RUF A;  6GSV A;  2VM1 A;  2KHP A;  5DQY A;  1O85 A;  3O76 A;  12GS A;  6GST A;  2M46 A;  2WZ9 A;  3ZLP A;  2XC2 A;  4ZB9 A;  2UZ8 A;  5IOW A;  3ME8 A;  3US3 A;  3HKR A;  2HRA A;  1QQ2 A;  2B7K A;  2JSY A;  2GQK A;  3KTB A;  2F51 A;  1OE8 A;  4WR5 A;  4IGJ A;  3TOU A;  2CQ9 A;  1XVW A;  3IR4 A;  2GGT A;  2V6K A;  1A8L A;  4J2F A;  2GVP A;  2HSH A;  3UBL A;  2YWM A;  4F2I A;  2DJ0 A;  3HA9 A;  1VGL A;  1T4Z A;  2AUV A;  4TXO B;  1O6J A;  4MF6 A;  2H70 A;  3TUE A;  3LJR A;  2WUL A;  3MNG A;  2QKE A;  4RI7 A;  1OKD A;  2AB6 A;  2PUK C;  1PGT A;  1A0F A;  1SJI A;  1GWC A;  4HDE A;  4I2T A;  3M0F A;  3KP9 A;  4PQH A;  4ML1 A;  3RHC A;  1N8J A;  1OVN A;  4XRD A;  2B5X A;  1XPV A;  2EC4 A;  1PMT A;  3R2Q A;  3D21 A;  5J9B A;  1ERW A;  4KB3 A;  5F8B A;  1JLV A;  5IIZ A;  5HFI A;  3GTU A;  5D8I A;  1FAA A;  5GAN D;  3J7Y k;  2A2S A;  1A2J A;  2RM6 A;  1EOH A;  5IPG A;  2D2Z A;  1ABA A;  2FD3 A;  5HQP A;  3QFA C;  2YPM A;  4I97 A;  2RLI A;  2VCZ A;  1M7T A;  3EMX A;  5B7C A;  5IO0 A;  4KND A;  1TU8 A;  3C73 A;  4IJ3 A;  3GN3 A;  4L5O A;  2LS5 A;  2H01 A;  2H75 A;  2LQO A;  4HQS A;  1MD3 A;  1NW2 A;  1T00 A;  1ZZY A;  3GUS A;  1HNA A;  3P8W A;  4JR4 A;  3QMX A;  3QOU A;  2HSN B;  3FZ4 A;  1O8W A;  2ZUP A;  2YP6 A;  5A4W A;  3KEB A;  3KXO A;  1B4Q A;  2CX3 A;  1WJK A;  4Q5Q A;  2WRT A;  3ERG A;  4K7O A;  1TK0 B;  4XS4 B;  2OJL A;  3U6V A;  3HXS A;  4TR0 A;  4TRX A;  2FHE A;  3QCP A;  2PPT A;  4HZ4 A;  3GH6 A;  2H6Y A;  3C1R A;  3F9U A;  4EE0 A;  2CV4 A;  2C0E A;  5ECS A;  1PX7 A;  5A4U A;  3EUR A;  2H72 A;  2F3M A;  3ZVJ D;  1TRV A;  4BWS A;  4HU9 A;  2C3T A;  5D9T A;  2AHE A;  2L4Q A;  3EE2 A;  2VD1 A;  2EIR A;  3EYT A;  1URM A;  2GST A;  5H5R A;  2IMF A;  2JSZ A;  1B4P A;  2X64 A;  1AQV A;  2MYG A;  2YJ7 A;  3L0H A;  4MF5 A;  3ERF A;  2IFQ B;  4LL1 B;  2I9H A;  1B9Y C;  5ELG A;  2GZY A;  3BCK A;  2TRC P;  4K1F A;  1SKR B;  4KUN A;  3APQ A;  2H1D A;  2FWE A;  7GSS A;  3VK9 A;  1DSB A;  5IMV A;  3FR6 A;  3QPM A;  3ISO A;  5B8A A;  2HZE A;  4NV2 A;  2CVK A;  3G7I A;  1TJD A;  4EL1 A;  3C7M A;  3FZA A;  3IE3 A;  3KH9 A;  2DLX A;  1SL1 B;  4IW9 A;  2CVB A;  1BAY A;  5FT3 A;  4BL7 B;  5COH A;  3E3E A;  2YWO A;  3IK7 A;  1JFU A;  5DDL A;  3FYG A;  2MBT A;  5IO2 A;  2MBS A;  1E6B A;  2KLX A;  4ZL7 A;  1LBK A;  4ZB6 A;  3VWW A;  1XW5 A;  2CX4 A;  2MZC A;  5ECN B;  2DIZ A;  16GS A;  2XBQ A;  5C04 A;  3TJF A;  4O5R A;  2VLT A;  3HCZ A;  1YQ1 A;  4MLY A;  3GKM A;  2IMD A;  4PQ1 A;  3IPZ A;  4PUF C;  5ID2 B;  3C8E A;  5EL8 A;  4G0L A;  2O87 A;  2OKA A;  3WD6 A;  2PER A;  1PA3 A;  5D96 A;  3W8J A;  3GV1 A;  4XCS A;  5CYY A;  4TOP A;  3TJG A;  4ZXG A;  1GNW A;  4ULX A;  3KJY A;  2DML A;  1Z7R A;  1PRX A;  1GSE A;  4N0Z A;  3Q18 A;  5E4W A;  1TDI A;  2OE3 A;  4ZBB A;  2H19 A;  6GSX A;  3FW2 A;  4V2M A;  3LYP A;  1ST9 A;  3LOR A;  2HSM B;  2XHF A;  1EEM A;  5CRE A;  1M2A A;  3TKQ A;  4MJA A;  1F3B A;  3PH9 A;  3IRA A;  5E59 A;  1XWK A;  1R5P A;  4WR4 A;  3QAV A;  4MF7 A;  2VLU A;  20GS A;  2FWH A;  4HQZ A;  5IMF A;  3S9F A;  4AJ7 A;  1X5D A;  1DE2 A;  5GZZ B;  4HS1 A;  1O7U A;  3F4T A;  1A0R P;  2HRF A;  3L4N A;  5IQY A;  3G7J A;  4MA9 A;  2L5O A;  1XIY A;  4O32 A;  2L4C A;  3GUR A;  2VCX A;  3F63 A;  2FA4 A;  2HLS A;  2CT6 A;  2VD0 A;  5D73 A;  5AIS A;  1V2A A;  13GS A;  2DIY A;  3L9U A;  2QC7 A;  5F06 A;  3FK8 A;  1GUL A;  3RDW A;  4USS A;  1PD2 1;  4EDY A;  1ILO A;  3DYR A;  2JZT A;  5AIX A;  4EXJ A;  5DQS A;  5G1K A;  1MDI A;  3W6G A;  2LQQ A;  2H0H A;  2P5R A;  2HSY A;  4ZL8 A;  2N5A A;  1G7O A;  6GSY A;  2VCT A;  4YQV A;  3M9J A;  3IAS 2;  3CRT A;  1DUG A;  2HXK A;  1DBY A;  3FR3 A;  1TKD B;  3DGQ A;  3ZTL A;  5DCG A;  1OC8 A;  5FHI A;  4POL A;  4RQX A;  1K3O A;  1WMJ A;  1TI3 A;  3GX0 A;  2G0F A;  4PXO A;  1GNE A;  2AAW A;  1CQG A;  4J57 E;  1U87 A;  4FO5 A;  4HZ2 A;  4QQ7 A;  2IJY A;  1BQ7 A;  3IV4 A;  1KNG A;  5IMD A;  2HRK A;  5D9W A;  2PMT A;  3QAG A;  3TRP A;  3GKN A;  4K6X A;  4G0K A;  2IWT A;  5A5K A;  4POB A;  4XTS A;  3TKS C;  1RQM A;  4BPY A;  2EIQ A;  2DMM A;  2LKU A;  2GSQ A;  1EWX A;  4G9H A;  4IKH A;  3LFL A;  3ZIJ A;  3RPN A;  3F6D A;  3VI7 A;  4F82 A;  4IQA A;  4OMV A;  3LWA A;  1Y25 A;  3A3T A;  3F0I A;  3TRQ A;  5CRH A;  4G0I A;  4CW9 A;  3P90 A;  5EY6 A;  2X8G A;  3LG6 A;  3IC8 A;  3HY2 A;  5G30 A;  5GST A;  3WGD A;  2B1L A;  3I43 A;  2C1Y A;  4TXO A;  18GS A;  2MMZ A;  4TW5 A;  2YNX A;  2NTO A;  5D9V A;  1JHB A;  4LLR A;  5JCU A;  2LJR A;  4MK3 A;  1HD2 A;  4DSS A;  1UC7 A;  3EU3 A;  3IC4 A;  1Y6E A;  3FRC A;  3DVW A;  4LA1 A;  3I9V 2;  4F0C A;  4PUR A;  3TKS A;  5ENU A;  3DML A;  2H6Z A;  1GLQ A;  4EKZ A;  4FYU A;  1H4O A;  2OAD A;  3UAP A;  1OC9 B;  4TN8 A;  1PSQ A;  2LST A;  5DAL B;  2L6C A;  3GKK A;  1O73 A; 
#chains in the Genus database with same CATH topology
 3TJJ A;  1A2M A;  2WW3 A;  4EUY A;  3TKS E;  4G19 A;  2CA8 A;  3IXR A;  2QGV A;  3CBU A;  4TR1 A;  4PQI A;  2PVQ A;  1YEX A;  2GQM A;  1U6T A;  3KMO A;  4O7H A;  3ZZX A;  1EP8 A;  1S3A A;  2K18 A;  4Q5R A;  5DCH A;  4ACS A;  4OO4 A;  4DSS B;  1A24 A;  3U5R E;  3VWX A;  2GQL A;  4ZIJ A;  3LXZ A;  2HQT A;  3F6F A;  3VLN A;  2WGR A;  4O5U A;  1XWA A;  4K7N A;  5ECR B;  3F4R A;  1ZYN A;  1ML6 A;  2A4V A;  3M9K A;  3LGC A;  5HR1 A;  2FCH A;  1GSY A;  1XXU A;  1ZYQ B;  2YJH A;  5JCW A;  1NHY A;  5CAX A;  5G31 A;  4ECC A;  3BD2 A;  3PPU A;  2E7P A;  2MMO A;  4EC0 A;  1J9B A;  2RII A;  2WFC A;  3PGT A;  4TR1 B;  1XBS A;  4V2L A;  3ZFB A;  3HZ8 A;  4JRR A;  1U3I A;  2X4A A;  4MZB A;  4JED A;  2FA8 A;  3HJO A;  2H71 A;  4HEA 2;  3PR8 A;  1XWC A;  2JU5 A;  4XS4 A;  2VCW A;  4D73 B;  3IOS A;  1BYE A;  4GSN A;  2CZ2 A;  2DBC A;  5KOW A;  4XIH A;  2R37 A;  1XOB A;  4E8E A;  2H1A A;  1V57 A;  1BX9 A;  1HYU A;  1PN9 A;  4AKI A;  3J7Y b;  2CAI A;  3L9S A;  4JE1 A;  4KW6 A;  1SVM A;  3I69 A;  1SK2 A;  1XZO A;  4BIK A;  4L0W A;  2BTO T;  4IP6 A;  5DJL A;  4L8E A;  2DJ1 A;  3P7X A;  4IEL A;  1K0B A;  1YDK A;  4EIQ A;  1FOH A;  3LEF A;  4FXY P;  2VAF A;  1YEP A;  1XWG A;  2FWF A;  1XOA A;  4IQ1 A;  3CQF A;  3CYN A;  4QL9 A;  4EVM A;  1LJR A;  2AJQ B;  1UVZ A;  4NV5 A;  1KBN A;  2B1K A;  3UMA A;  3VUR A;  2MMN A;  2JZR A;  1TK8 B;  2R0G A;  3DD3 A;  3PIN A;  2G2Q A;  3ZFL A;  2WVZ A;  2IFQ A;  4OD7 A;  3UAR A;  4F9Z A;  2I3Y A;  4NXI A;  2EFD A;  2RM5 A;  3VPQ A;  4DSQ A;  2H1L A;  4MJB A;  3IA1 A;  2TRX A;  2AYT A;  5D93 A;  1XW9 A;  1XG8 A;  2NVL A;  3RAZ A;  4FQU A;  5B6N A;  4MP4 A;  1Z3E A;  3FZ9 A;  2EIO A;  1K0D A;  1H75 A;  5GAP D;  2GDR A;  1SYX A;  5B6M A;  2WS2 A;  3NIV A;  4GQC A;  1GTU A;  1F3A A;  4L5L A;  5J5N A;  4BL7 A;  1FVK A;  4OO5 A;  4YAP A;  3N5O A;  1EP7 A;  1AXD A;  3WT1 A;  2H74 A;  4OFT A;  5ECH B;  2O7K A;  2B3S A;  1EEJ A;  4KH7 A;  3C71 A;  9GSS A;  4HJ2 A;  5EVO A;  3D0Z A;  3EIN A;  2R6K A;  1FB6 A;  4Z7X A;  5CP1 A;  3FEU A;  2C80 A;  1GSD A;  1EGR A;  2ON5 A;  3MAK A;  1M2B A;  4CHS A;  1MTC A;  1WOU A;  1ZOF A;  3TKP A;  2H30 A;  5ECM B;  3HZ4 A;  1XWB A;  2WZS A;  2WJU A;  3WYW A;  4EDZ A;  1AQX A;  5J4U A;  3VFI A;  5ID2 A;  5J9C A;  3FY7 A;  2C0G A;  2PWJ A;  4J56 E;  5B8B A;  1XVQ A;  4N10 A;  1SVL A;  6GSS A;  1MEK A;  2LTK A;  2HI7 A;  5KN2 A;  3KGK A;  1S3D A;  4HU7 A;  4Q5F A;  2I4A A;  4RUV A;  3F4S A;  3UVH A;  3RHB A;  1SKW B;  3GST A;  3UBK A;  4XRA A;  1JZD A;  1O81 A;  1O8X A;  4X43 A;  2REM A;  1XFL A;  4X1U A;  1R5A A;  2PU9 C;  3BCI A;  4XS6 A;  2IMK A;  1QK8 A;  1AW9 A;  1PL2 A;  5J41 A;  2OBI A;  4MPG A;  2BJX A;  2HSM A;  3O3T A;  3E0U A;  1ZMA A;  2O5V A;  2NDO A;  4ILF A;  3SWL A;  2H1G A;  1TTZ A;  4ID0 A;  3LQ7 A;  4Z2R A;  4N0V A;  4DEJ A;  3EPT A;  1E2Y A;  5AIV A;  5KN3 A;  2WDU A;  3M8N A;  3QR6 A;  3DVX A;  1I5G A;  2ZNM A;  1T4Y A;  4KDY A;  2XBI A;  4ZL9 A;  3D6I A;  1A23 A;  3UOM A;  4I2U A;  4MZW A;  2YV9 A;  14GS A;  1TRS A;  3K8N A;  2LRC A;  3BJ5 A;  4GLT A;  1V9W A;  2DJK A;  3UVT A;  2OE1 A;  5HFG A;  3N9J A;  5DJM A;  4NAX A;  4TKY A;  2MMA A;  4K9Z A;  4GRF A;  1GSF A;  1WWJ A;  2LUS A;  2LV3 A;  1USB A;  2F9S A;  1VRS D;  1I9D A;  3DXB A;  2YCD A;  5C00 A;  2JZS A;  5JWQ B;  3TDG A;  3TU3 B;  3TCO A;  3TJK A;  4G10 A;  4OFM A;  2R0C A;  4X4J A;  4GF0 A;  2YOI A;  3Q19 A;  1VF2 A;  4GTU A;  3I6A A;  3LW9 A;  2YZU A;  1YJ6 A;  1JZO A;  2H6X A;  4OWY A;  2L57 A;  2OBK A;  4PHZ C;  5ECP B;  1FG4 A;  1EZK A;  4GWR A;  4HOJ A;  3A2X A;  2VOC A;  1GUK A;  3RBT A;  1AC1 A;  1M9A A;  1M9B A;  3CSJ A;  2J23 A;  4ZB8 A;  1HNB A;  5LCZ A;  1S3C A;  1Z6M A;  1DE1 A;  1UN2 A;  5BRT A;  2X99 A;  5ECO B;  4HUA A;  2L5L A;  2WW2 A;  1A8Y A;  3UL3 A;  1T1V A;  2P31 A;  3BOA A;  3HHV A;  4IN0 A;  4JBB A;  2LJK A;  1ON4 A;  4GQF A;  4GSS A;  4ECJ A;  11GS A;  3GL5 A;  3H4K A;  1AAZ A;  3P2A A;  1K3Y A;  2JAC A;  2M80 A;  2FY6 A;  3KMN A;  1C72 A;  1MDK A;  4IJI A;  2QA1 A;  3ZML A;  2C3Q A;  5INY A;  3GSS A;  4BVY B;  4KGI A;  2GT5 A;  1R26 A;  5G5F A;  1RW1 A;  3KM6 A;  1QFN A;  1ZCP A;  1F37 A;  3ED3 A;  1W89 A;  4V2N A;  4EIP A;  3ZRE A;  2VO4 A;  3DIE A;  3GRX A;  2LRT A;  5BMU A;  3FKF A;  5LNK e;  1GTB A;  4FYC A;  2C0F A;  3CWG A;  5JCG A;  2X8C A;  1BED A;  1KEB A;  1SD9 A;  4NPB A;  2CAQ A;  4W66 A;  3H93 A;  2K6V A;  2R4V A;  2VUP A;  3GKX A;  1X5E A;  4EO3 A;  4KE3 A;  1G0T A;  4MJC A;  1GH2 A;  3ME7 A;  4ECB A;  1OYJ A;  5A1N A;  5IMA A;  3Q6O A;  4ZIL A;  1ERT A;  2WCI A;  1M3J A;  1K3L A;  2B5Y A;  3GMF A;  19GS A;  5GSS A;  5ELA A;  4AKX B;  2OAC A;  1F2E A;  2R2J A;  3KCM A;  1SKS B;  4L0U A;  3C1S A;  1JZR A;  1OC9 A;  2Z9S A;  2H1B A;  4PNG A;  3APO A;  3ZVJ A;  5DAL A;  1YF1 A;  4PUA A;  2AV4 A;  4YAV A;  5DVB A;  2WB9 A;  1ERU A;  1SK0 A;  2I1U A;  2IIY A;  4GCI A;  3QFB C;  1AUC A;  4CY8 A;  2ALB A;  4NWY A;  3HJM A;  5DAK B;  1YEW C;  1WE0 A;  5HR0 A;  4YQM A;  3LXT A;  4MH2 A;  5A4V A;  3MSZ A;  5CRD A;  3ZIV A;  1EV4 A;  2O89 A;  3F3Q A;  5H5S A;  4PTS A;  4QL7 A;  4PI2 C;  2H66 A;  4WXT A;  4KF9 A;  1IYH A;  1QXH A;  5J3R A;  4OCE A;  4FYB A;  3NOF A;  1PN0 A;  1PQN A;  2C3N A;  17GS A;  1THX A;  3E9J B;  1TW9 A;  1PKZ A;  4OFN A;  4ECI A;  2F8A A;  2V41 A;  3HDC A;  1PKW A;  1WRY A;  4IHU A;  5ECL B;  4DSR A;  3CTF A;  4PGT A;  2B7J A;  2PGT A;  2E2G A;  3D22 A;  2HE3 A;  4V1A g;  2JAD A;  1M3I A;  1GSQ A;  5J47 A;  2E0Q A;  4IS0 A;  1F6M C;  4IBP A;  2ON7 A;  5KEJ A;  4ISD A;  2FLS A;  2N5B A;  4D73 A;  2H76 A;  1HNC A;  3UIW A;  5F05 A;  3CRU A;  2OA7 A;  3DRN A;  5ABR A;  1X9S B;  3WT2 A;  4KCE A;  3H8Q A;  1YKC A;  2GLR A;  1ZYE A;  1YF0 A;  3F3R A;  5CRW A;  3HVV A;  5IMZ A;  4P3Y B;  1GL8 A;  5JWR B;  3Q74 A;  5IPH A;  1S4B P;  4FH8 A;  5KN1 A;  1EOG A;  2CZ3 A;  3MIX A;  3A2W A;  2PVO C;  1X9W B;  4WET A;  3ZYW A;  1F9M A;  2VM2 A;  3QD9 A;  2DC5 A;  4YH2 A;  5HFK A;  4TXV A;  4BVX A;  4JR6 A;  2HT9 A;  2VCV A;  4X0X A;  1G6W A;  3VI5 A;  1WP0 A;  3EC3 A;  4PNF A;  2K8V A;  5F07 A;  3GIX A;  4OCF A;  2ZCT A;  1WIK A;  2VL3 A;  2LEG A;  3TRX A;  1XW6 A;  5ECQ B;  4MAB A;  2KUC A;  1TK5 B;  3G7Y A;  1GTI A;  1QUW A;  2VKZ G;  1SYR A;  3HD5 A;  2DJJ A;  4IVF A;  2GT6 A;  1KTE A;  4MPF A;  4KCA A;  4I6X A;  1R7H A;  1SU9 A;  2LRN A;  1GSU A;  1Z9H A;  1YY7 A;  3GTU B;  4BVX B;  3O6T A;  4WBJ A;  1TRW A;  4GST A;  2K8S A;  3SBC A;  8GSS A;  4K5S A;  4TR3 A;  1SL2 B;  2GS3 A;  2YAN A;  1BF5 A;  5G1L A;  1PX6 A;  4KDX A;  3GX8 A;  3FR9 A;  4WKW A;  3TJB A;  2CVD A;  4H86 A;  1GRX A;  1BG5 A;  6GSW A;  1M0U A;  3H1N A;  1R4W A;  2V2G A;  2BMX A;  1JLW A;  5CNW A;  4HJM A;  1ZGN A;  4BA7 A;  5IM9 A;  4WEY A;  1V40 A;  1K0M A;  3KP8 A;  4KA0 A;  5D9X A;  2NBS A;  1GUM A;  1K0N A;  2IN3 A;  5A5H B;  2XPE A;  3GA4 A;  3M3M A;  1ACV A;  5G5E A;  3QDN A;  2C4J A;  3GNJ A;  1QGV A;  1VF4 A;  1FB0 A;  1TOF A;  1U3A A;  1YKA A;  2V32 A;  1N2A A;  3LYK A;  4LMV A;  4XHM A;  2LJA A;  2R5G A;  3R3E A;  2C0D A;  4JZQ A;  1Z5Y E;  3V1W A;  2YWN A;  4WBR D;  4RQR A;  3CSH A;  3RGB C;  2H8L A;  2P5Q A;  1GTA A;  1MDJ A;  2GZP A;  1GLP A;  3IBH A;  2X8H A;  1A2L A;  2GSS A;  4DVC A;  4K7I A;  5G2Z A;  2IL3 A;  2I81 A;  3ZMK A;  3M1G A;  3A2V A;  2FUG 2;  3QAW A;  5AN1 A;  4POK A;  2O8V B;  1SD8 A;  1YZX A;  5IOX A;  2DJ3 A;  4MZC A;  2DJ2 A;  2FWG A;  2B5E A;  1Z6N A;  1AIU A;  2H0G A;  3TOT A;  3W8S A;  2M72 A;  3ERW A;  3TGZ A;  1PL1 A;  1FW1 A;  1X0R A;  2OE0 A;  2R3X A;  4N30 A;  1LU4 A;  2XPD A;  4O92 A;  3VPT A;  3LSZ A;  3WGE A;  2LNT A;  2B6M A;  2DSA A;  1HQO A;  3IHQ A;  1K0A A;  3L9V A;  3ZRD A;  6GSU A;  5IMC A;  1UA5 A;  3DWV A;  5AGY A;  4V1A p;  1W4V A;  4IP1 A;  4TVE A;  4TR4 A;  2V6O A;  2VL2 C;  5KOX A;  2K9F A;  1J0F A;  3KH7 A;  4BWQ A;  2KOK A;  1FVJ A;  4N11 A;  5ECK B;  2GTU A;  2YWI A;  4ZBD A;  2HZE B;  3CXG A;  1Q98 A;  1VF1 A;  3APS A;  5EPF A;  4K0G A;  3IDV A;  3KZQ A;  5L71 A;  3CSI A;  1B8X A;  1FOV A;  1TRU A;  2GZZ A;  1T7P B;  3HYP A;  2NPB A;  2ES7 A;  3KIJ A;  5J4V A;  2F8F A;  1SEN A;  5FWG A;  2VIM A;  4NMU A;  1THO A;  2H0I A;  2V1M A;  2VLV A;  2HNL A;  1GUH A;  4AGS A;  2IMI A;  2J9H A;  3BBY A;  3D4T A;  2HYX A;  1VF3 A;  1NM3 A;  4I8B A;  2FGX A;  2O36 A;  4K2D A;  1TU7 A;  1V58 A;  3G9B A;  3MWH A;  3DKS A;  2JL4 A;  1Q4J A;  2A2R A;  4EF0 A;  3TB2 A;  2O85 A;  2E2M A;  1N25 A;  5CRG A;  1SJZ A;  1T3B A;  2VL9 A;  3FHK A;  3EWL A;  2H73 A;  3KD0 A;  5CO3 A;  1WPI A;  3IAM 2;  10GS A;  1V98 A;  4LMW A;  2VL2 A;  4HI7 A;  4BVY A;  1FHE A;  4F03 A;  4KSM A;  3GL3 A;  2L59 A;  4AKG A;  1GP1 A;  3GYK A;  4HSC X;  1K0O A;  1IYI A;  1T8E B;  1FO5 A;  1M99 A;  2HFD A;  3CMI A;  1GSS A;  4I5Q A;  1RK4 A;  5ECI B;  4K0N A;  3OR5 A;  4POM A;  4RI6 A;  1TXX A;  3A5W A;  5HR2 A;  4Q5N A;  4PX1 A;  3NZN A;  1SVO A;  4AJ6 A;  3FZ5 A;  4NHZ A;  3ZIT A;  3CTG A;  1OKT A;  2L6D A;  1G6Y A;  1CQH A;  4K8M A;  2PBJ A;  4CDO A;  4NHW A;  3WGX A;  4XS1 A;  3VWV A;  5F0G A;  3HJP A;  3GFK A;  2RUE A;  4JU5 A;  5JWO B;  2P0G A;  3JCM L;  2X49 A;  3H79 A;  3MDK A;  2YN1 A;  2IPA A;  1MD4 A;  2QSI A;  3TKR A;  4WF5 A;  3DEX A;  1AQW A;  3KTL A;  2YZH A;  4WF4 A;  2O3E A;  5LD0 A;  3VWU A;  1JZW A;  1X9M B;  1J08 A;  1OE7 A;  1OAZ A;  1ZL9 A;  4MMM A;  2IME A;  1B48 A;  1ERV A;  1SK1 A;  3AY8 A;  2VCQ A;  4MDC A;  4G2E A;  4GXZ A;  5DBQ A;  3UEM A;  1NHO A;  1X5C A;  4KX4 A;  2KP2 A;  3GH9 A;  4GDF A;  4AF2 A;  1TP9 A;  4E8H A;  4KDU A;  3D5J A;  1M2D A;  2KP1 A;  4YQU A;  3ZL5 A;  3IK9 A;  4MH3 A;  4MCU A;  5DAK A;  1QMV A;  3EMP A;  2A2P A;  3HVX A;  4KSO A;  1OC3 A;  3GHA A;  3UJ1 A;  1SL0 B;  5KN0 A;  2GSR A;  2N5F A;  1Z7P A;  1EV9 A;  1TI1 A;  2C8U A;  4ZBA A;  2FNO A;  4FIW A;  3L78 A;  2PN8 A;  3F8U A;  1K0C A;  3HVS A;  1BJX A;  3D4M A;  1G7E A;  3EU4 A;  1B9X C;  1XCC A;  2HZF A;  4MJE A;  5H5Q A;  5HR3 A;  3RPP A;  2UV8 G;  1EGO A;  4AJ8 A;  4ML6 A;  2HRK B;  1U88 A;  3EVI A;  2WW0 A;  1NSW A;  22GS A;  2LNS A;  4KAE A;  4LL4 B;  2HRN A;  4F0B A;  2TIR A;  1SJ6 A;  2YV7 A;  1I1I P;  2RUF A;  6GSV A;  2VM1 A;  2KHP A;  5DQY A;  1O85 A;  3O76 A;  12GS A;  6GST A;  2M46 A;  2WZ9 A;  3ZLP A;  2XC2 A;  3A5I A;  4ZB9 A;  2UZ8 A;  5IOW A;  3ME8 A;  3US3 A;  3HKR A;  2HRA A;  1QQ2 A;  2B7K A;  2JSY A;  2GQK A;  3KTB A;  2F51 A;  1OE8 A;  4WR5 A;  4IGJ A;  3TOU A;  2CQ9 A;  1XVW A;  2WVX B;  3IR4 A;  2GGT A;  2V6K A;  1A8L A;  4J2F A;  2GVP A;  2HSH A;  3UBL A;  2YWM A;  4F2I A;  2DJ0 A;  3HA9 A;  1VGL A;  1T4Z A;  2AUV A;  4TXO B;  4ICY A;  1O6J A;  4MF6 A;  2H70 A;  3TUE A;  3LJR A;  2WUL A;  3MNG A;  4N3Z A;  4CY6 A;  2QKE A;  4RI7 A;  1OKD A;  2AB6 A;  2PUK C;  1PGT A;  1A0F A;  1SJI A;  1GWC A;  4HDE A;  4I2T A;  3M0F A;  3KP9 A;  4PQH A;  4ML1 A;  3RHC A;  4YKG A;  1N8J A;  1OVN A;  4XRD A;  2B5X A;  1XPV A;  2EC4 A;  1PMT A;  3R2Q A;  3D21 A;  5J9B A;  1ERW A;  4KB3 A;  5F8B A;  1JLV A;  4Z2T A;  5IIZ A;  5HFI A;  3GTU A;  5D8I A;  1FAA A;  5GAN D;  1Y1U A;  3J7Y k;  2A2S A;  1A2J A;  2RM6 A;  1EOH A;  5IPG A;  2D2Z A;  2HSN A;  1ABA A;  2FD3 A;  5HQP A;  3QFA C;  2YPM A;  4I97 A;  2RLI A;  2VCZ A;  1M7T A;  3EMX A;  5B7C A;  1PFO A;  5IO0 A;  4KND A;  1TU8 A;  3C73 A;  4IJ3 A;  3GN3 A;  4L5O A;  2LS5 A;  2H01 A;  2H75 A;  2LQO A;  4HQS A;  1MD3 A;  1NW2 A;  1T00 A;  1ZZY A;  3GUS A;  1HNA A;  3P8W A;  5A5H A;  4JR4 A;  3QMX A;  3QOU A;  2HSN B;  3FZ4 A;  1O8W A;  2ZUP A;  2YP6 A;  2EFE A;  5A4W A;  3KEB A;  3KXO A;  1B4Q A;  4O5Q A;  2CX3 A;  1WJK A;  4Q5Q A;  2WRT A;  3ERG A;  4K7O A;  2OT3 A;  1TK0 B;  4XS4 B;  2OJL A;  3U6V A;  3HXS A;  4TR0 A;  4TRX A;  2FHE A;  3QCP A;  2PPT A;  4HZ4 A;  3GH6 A;  2H6Y A;  4YKF A;  3C1R A;  3F9U A;  4EE0 A;  2CV4 A;  1BG1 A;  2C0E A;  3HVN A;  5ECS A;  1PX7 A;  5A4U A;  1TXU A;  3EUR A;  2H72 A;  2F3M A;  3ZVJ D;  1TRV A;  4BWS A;  4HU9 A;  2C3T A;  5D9T A;  2AHE A;  2L4Q A;  3EE2 A;  2VD1 A;  4K5R A;  2EIR A;  4A5P A;  3EYT A;  1URM A;  2GST A;  5H5R A;  2IMF A;  2JSZ A;  1B4P A;  2X64 A;  1AQV A;  2MYG A;  2YJ7 A;  3L0H A;  4MF5 A;  3ERF A;  2IFQ B;  4LL1 B;  2I9H A;  1B9Y C;  3FMW A;  5ELG A;  2GZY A;  3BCK A;  2TRC P;  4K1F A;  1YVL A;  1SKR B;  4KUN A;  3APQ A;  2H1D A;  2FWE A;  7GSS A;  3VK9 A;  1DSB A;  5IMV A;  3FR6 A;  3QPM A;  3ISO A;  5B8A A;  2HZE A;  4NV2 A;  2CVK A;  3G7I A;  1TJD A;  4EL1 A;  3C7M A;  3FZA A;  3IE3 A;  3KH9 A;  2DLX A;  1SL1 B;  4IW9 A;  2CVB A;  1BAY A;  5FT3 A;  4BL7 B;  5COH A;  3E3E A;  2YWO A;  3IK7 A;  1JFU A;  5DDL A;  3FYG A;  2MBT A;  5IO2 A;  2MBS A;  1ZYP A;  1E6B A;  2KLX A;  4ZL7 A;  1LBK A;  4ZB6 A;  3VWW A;  1XW5 A;  2CX4 A;  2MZC A;  5ECN B;  2DIZ A;  16GS A;  2XBQ A;  5C04 A;  3TJF A;  4O5R A;  4AI6 A;  2VLT A;  3HCZ A;  1YQ1 A;  4MLY A;  3GKM A;  2IMD A;  4PQ1 A;  3IPZ A;  4PUF C;  5ID2 B;  2A4H A;  3C8E A;  5EL8 A;  4G0L A;  2O87 A;  3MYD A;  2OKA A;  3WD6 A;  2PER A;  1PA3 A;  5D96 A;  3W8J A;  3GV1 A;  4XCS A;  5CYY A;  2WW1 A;  4TOP A;  3TJG A;  4ZXG A;  1GNW A;  4ULX A;  3KJY A;  2DML A;  1Z7R A;  1PRX A;  1GSE A;  4N0Z A;  3Q18 A;  5E4W A;  2EFC A;  2EFH A;  1TDI A;  3CHX C;  2OE3 A;  4ZBB A;  2H19 A;  6GSX A;  4K2X A;  3FW2 A;  4V2M A;  3LYP A;  3IHG A;  1ST9 A;  3LOR A;  2HSM B;  2XHF A;  1EEM A;  5CRE A;  1M2A A;  3TKQ A;  4MJA A;  1F3B A;  3PH9 A;  3IRA A;  5E59 A;  1XWK A;  1R5P A;  4WR4 A;  3QAV A;  4MF7 A;  2VLU A;  20GS A;  2FWH A;  4HQZ A;  5IMF A;  3S9F A;  4AJ7 A;  1X5D A;  1DE2 A;  5GZZ B;  2DKI A;  4HS1 A;  1O7U A;  3F4T A;  1A0R P;  2HRF A;  3L4N A;  1S3R A;  5IQY A;  3G7J A;  4MA9 A;  2L5O A;  1XIY A;  4O32 A;  2L4C A;  3GUR A;  2VCX A;  3F63 A;  2FA4 A;  4Z2U A;  2HLS A;  2CT6 A;  3HMJ G;  2R0P A;  2VD0 A;  5D73 A;  5AIS A;  1V2A A;  4MNN A;  13GS A;  2DIY A;  3L9U A;  2QC7 A;  5F06 A;  3FK8 A;  1GUL A;  3RDW A;  4USS A;  1PD2 1;  4EDY A;  1ILO A;  3DYR A;  2JZT A;  5AIX A;  4EXJ A;  5DQS A;  5G1K A;  1MDI A;  4PI0 C;  3W6G A;  2LQQ A;  2H0H A;  2P5R A;  2DKH A;  2HSY A;  2N5A A;  4ZL8 A;  1G7O A;  6GSY A;  2VCT A;  4YQV A;  3M9J A;  2WVY A;  3IAS 2;  3CRT A;  1DUG A;  2HXK A;  1DBY A;  3FR3 A;  1TKD B;  3DGQ A;  3ZTL A;  5DCG A;  1OC8 A;  5FHI A;  4POL A;  4RQX A;  5A34 A;  1K3O A;  1WMJ A;  1TI3 A;  3GX0 A;  2G0F A;  4PXO A;  1GNE A;  2AAW A;  1CQG A;  4J57 E;  1U87 A;  4FO5 A;  4HZ2 A;  4QQ7 A;  2IJY A;  1BQ7 A;  3IV4 A;  1KNG A;  5IMD A;  2HRK A;  5D9W A;  2PMT A;  3QAG A;  3TRP A;  2QA2 A;  3GKN A;  4K6X A;  4G0K A;  2IWT A;  5A5K A;  4POB A;  4XTS A;  4AKH A;  3TKS C;  1RQM A;  4BPY A;  2EIQ A;  2DMM A;  2LKU A;  2GSQ A;  1EWX A;  4G9H A;  4IKH A;  3LFL A;  3ZIJ A;  3RPN A;  3RFR C;  3F6D A;  3VI7 A;  4F82 A;  4IQA A;  5A34 B;  4OMV A;  3LWA A;  1Y25 A;  3A3T A;  3F0I A;  3TRQ A;  5CRH A;  4G0I A;  2WVX A;  4CW9 A;  3P90 A;  5EY6 A;  2X8G A;  3LG6 A;  3IC8 A;  3HY2 A;  5G30 A;  5GST A;  3WGD A;  2B1L A;  3I43 A;  2C1Y A;  4TXO A;  5BMU B;  18GS A;  2MMZ A;  4TW5 A;  2YNX A;  2NTO A;  5D9V A;  1JHB A;  4ZB7 A;  4LLR A;  5JCU A;  2LJR A;  4MK3 A;  1HD2 A;  4DSS A;  1UC7 A;  3EU3 A;  3IC4 A;  1Y6E A;  3FRC A;  3DVW A;  4LA1 A;  5A1N B;  4F0C A;  3I9V 2;  4PUR A;  3TKS A;  5ENU A;  3DML A;  2H6Z A;  1GLQ A;  4G01 A;  5J40 A;  4EKZ A;  4FYU A;  1H4O A;  2OAD A;  4QMK A;  4E68 A;  3UAP A;  1OC9 B;  4TN8 A;  1PSQ A;  2LST A;  5DAL B;  2L6C A;  5J4Y A;  3GKK A;  1O73 A; 
#chains in the Genus database with same CATH homology
 3TJJ A;  1A2M A;  4EUY A;  3TKS E;  4G19 A;  2CA8 A;  3IXR A;  2QGV A;  3CBU A;  4TR1 A;  4PQI A;  2PVQ A;  1YEX A;  2GQM A;  1U6T A;  3KMO A;  4O7H A;  3ZZX A;  1EP8 A;  1S3A A;  2K18 A;  4Q5R A;  5DCH A;  4ACS A;  4OO4 A;  4DSS B;  1A24 A;  3U5R E;  3VWX A;  2GQL A;  4ZIJ A;  3LXZ A;  2HQT A;  3F6F A;  3VLN A;  2WGR A;  4O5U A;  1XWA A;  4K7N A;  5ECR B;  3F4R A;  1ZYN A;  1ML6 A;  2A4V A;  3M9K A;  3LGC A;  5HR1 A;  2FCH A;  1GSY A;  1XXU A;  1ZYQ B;  2YJH A;  5JCW A;  1NHY A;  5CAX A;  5G31 A;  4ECC A;  3BD2 A;  3PPU A;  2E7P A;  2MMO A;  4EC0 A;  1J9B A;  2RII A;  2WFC A;  3PGT A;  4TR1 B;  1XBS A;  4V2L A;  3ZFB A;  3HZ8 A;  4JRR A;  1U3I A;  2X4A A;  4MZB A;  4JED A;  2FA8 A;  3HJO A;  2H71 A;  4HEA 2;  3PR8 A;  1XWC A;  2JU5 A;  4XS4 A;  2VCW A;  4D73 B;  3IOS A;  1BYE A;  4GSN A;  2CZ2 A;  2DBC A;  5KOW A;  4XIH A;  2R37 A;  1XOB A;  4E8E A;  2H1A A;  1V57 A;  1BX9 A;  1HYU A;  1PN9 A;  4AKI A;  3J7Y b;  2CAI A;  3L9S A;  4JE1 A;  4KW6 A;  1SVM A;  3I69 A;  1SK2 A;  1XZO A;  4L0W A;  2BTO T;  4IP6 A;  5DJL A;  4L8E A;  2DJ1 A;  3P7X A;  4IEL A;  1K0B A;  1YDK A;  4EIQ A;  1FOH A;  3LEF A;  2VAF A;  1YEP A;  1XWG A;  2FWF A;  1XOA A;  4IQ1 A;  3CYN A;  4QL9 A;  4EVM A;  1LJR A;  2AJQ B;  1UVZ A;  4NV5 A;  1KBN A;  2B1K A;  3UMA A;  3VUR A;  2MMN A;  2JZR A;  1TK8 B;  2R0G A;  3DD3 A;  3PIN A;  2G2Q A;  3ZFL A;  2IFQ A;  4OD7 A;  3UAR A;  4F9Z A;  2I3Y A;  4NXI A;  2EFD A;  2RM5 A;  3VPQ A;  4DSQ A;  2H1L A;  4MJB A;  3IA1 A;  2TRX A;  2AYT A;  5D93 A;  1XW9 A;  2NVL A;  3RAZ A;  4FQU A;  5B6N A;  4MP4 A;  1Z3E A;  3FZ9 A;  2EIO A;  1K0D A;  1H75 A;  5GAP D;  2GDR A;  1SYX A;  5B6M A;  2WS2 A;  3NIV A;  4GQC A;  1GTU A;  1F3A A;  4L5L A;  5J5N A;  4BL7 A;  1FVK A;  4OO5 A;  4YAP A;  3N5O A;  1EP7 A;  1AXD A;  3WT1 A;  2H74 A;  4OFT A;  5ECH B;  2O7K A;  2B3S A;  1EEJ A;  4KH7 A;  3C71 A;  9GSS A;  4HJ2 A;  5EVO A;  3D0Z A;  3EIN A;  2R6K A;  1FB6 A;  4Z7X A;  5CP1 A;  3FEU A;  2C80 A;  1GSD A;  1EGR A;  2ON5 A;  3MAK A;  1M2B A;  4CHS A;  1MTC A;  1WOU A;  1ZOF A;  3TKP A;  2H30 A;  5ECM B;  3HZ4 A;  1XWB A;  2WJU A;  3WYW A;  4EDZ A;  1AQX A;  5J4U A;  3VFI A;  5ID2 A;  5J9C A;  3FY7 A;  2C0G A;  2PWJ A;  4J56 E;  5B8B A;  1XVQ A;  4N10 A;  1SVL A;  6GSS A;  1MEK A;  2LTK A;  2HI7 A;  5KN2 A;  3KGK A;  1S3D A;  4HU7 A;  4Q5F A;  2I4A A;  4RUV A;  3F4S A;  3UVH A;  3RHB A;  1SKW B;  3GST A;  3UBK A;  4XRA A;  1JZD A;  1O81 A;  1O8X A;  4X43 A;  2REM A;  1XFL A;  4X1U A;  1R5A A;  2PU9 C;  3BCI A;  4XS6 A;  2IMK A;  1QK8 A;  1AW9 A;  1PL2 A;  5J41 A;  2OBI A;  4MPG A;  2BJX A;  2HSM A;  3O3T A;  3E0U A;  1ZMA A;  2O5V A;  2NDO A;  4ILF A;  3SWL A;  2H1G A;  1TTZ A;  4ID0 A;  3LQ7 A;  4Z2R A;  4N0V A;  4DEJ A;  3EPT A;  1E2Y A;  5AIV A;  5KN3 A;  2WDU A;  3M8N A;  3QR6 A;  3DVX A;  1I5G A;  2ZNM A;  1T4Y A;  4KDY A;  2XBI A;  4ZL9 A;  3D6I A;  1A23 A;  3UOM A;  4I2U A;  4MZW A;  2YV9 A;  14GS A;  1TRS A;  3K8N A;  2LRC A;  3BJ5 A;  4GLT A;  1V9W A;  2DJK A;  3UVT A;  2OE1 A;  5HFG A;  3N9J A;  5DJM A;  4NAX A;  4TKY A;  2MMA A;  4K9Z A;  4GRF A;  1GSF A;  1WWJ A;  2LUS A;  2LV3 A;  1USB A;  2F9S A;  1VRS D;  1I9D A;  3DXB A;  2YCD A;  5C00 A;  2JZS A;  5JWQ B;  3TDG A;  3TU3 B;  3TCO A;  3TJK A;  4G10 A;  4OFM A;  2R0C A;  4X4J A;  4GF0 A;  2YOI A;  3Q19 A;  1VF2 A;  4GTU A;  3I6A A;  3LW9 A;  2YZU A;  1YJ6 A;  1JZO A;  2H6X A;  4OWY A;  2L57 A;  2OBK A;  5ECP B;  1FG4 A;  1EZK A;  4GWR A;  4HOJ A;  3A2X A;  2VOC A;  1GUK A;  3RBT A;  1AC1 A;  1M9A A;  1M9B A;  3CSJ A;  2J23 A;  4ZB8 A;  1HNB A;  5LCZ A;  1S3C A;  1Z6M A;  1DE1 A;  1UN2 A;  5BRT A;  2X99 A;  5ECO B;  4HUA A;  2L5L A;  1A8Y A;  3UL3 A;  1T1V A;  2P31 A;  3BOA A;  3HHV A;  4IN0 A;  4JBB A;  2LJK A;  1ON4 A;  4GQF A;  4GSS A;  4ECJ A;  11GS A;  3GL5 A;  3H4K A;  1AAZ A;  3P2A A;  1K3Y A;  2JAC A;  2M80 A;  2FY6 A;  3KMN A;  1C72 A;  1MDK A;  4IJI A;  2QA1 A;  3ZML A;  2C3Q A;  5INY A;  3GSS A;  4BVY B;  4KGI A;  2GT5 A;  1R26 A;  5G5F A;  1RW1 A;  3KM6 A;  1QFN A;  1ZCP A;  1F37 A;  3ED3 A;  1W89 A;  4V2N A;  4EIP A;  3ZRE A;  2VO4 A;  3DIE A;  3GRX A;  2LRT A;  5BMU A;  3FKF A;  5LNK e;  1GTB A;  4FYC A;  2C0F A;  3CWG A;  5JCG A;  2X8C A;  1BED A;  1KEB A;  1SD9 A;  4NPB A;  2CAQ A;  4W66 A;  3H93 A;  2K6V A;  2R4V A;  2VUP A;  3GKX A;  1X5E A;  4EO3 A;  4KE3 A;  1G0T A;  4MJC A;  1GH2 A;  3ME7 A;  4ECB A;  1OYJ A;  5A1N A;  5IMA A;  3Q6O A;  4ZIL A;  1ERT A;  2WCI A;  1K3L A;  2B5Y A;  3GMF A;  19GS A;  5GSS A;  5ELA A;  4AKX B;  2OAC A;  1F2E A;  2R2J A;  3KCM A;  1SKS B;  4L0U A;  3C1S A;  1JZR A;  1OC9 A;  2Z9S A;  2H1B A;  4PNG A;  3APO A;  3ZVJ A;  5DAL A;  1YF1 A;  4PUA A;  2AV4 A;  4YAV A;  5DVB A;  2WB9 A;  1ERU A;  1SK0 A;  2I1U A;  2IIY A;  4GCI A;  3QFB C;  1AUC A;  4CY8 A;  2ALB A;  4NWY A;  3HJM A;  5DAK B;  1WE0 A;  5HR0 A;  4YQM A;  3LXT A;  4MH2 A;  5A4V A;  3MSZ A;  5CRD A;  3ZIV A;  1EV4 A;  2O89 A;  3F3Q A;  5H5S A;  4PTS A;  4QL7 A;  2H66 A;  4WXT A;  4KF9 A;  1IYH A;  1QXH A;  5J3R A;  4OCE A;  4FYB A;  3NOF A;  1PN0 A;  1PQN A;  2C3N A;  17GS A;  1THX A;  3E9J B;  1TW9 A;  1PKZ A;  4OFN A;  4ECI A;  2F8A A;  2V41 A;  3HDC A;  1PKW A;  1WRY A;  4IHU A;  5ECL B;  4DSR A;  3CTF A;  4PGT A;  2B7J A;  2PGT A;  2E2G A;  3D22 A;  2HE3 A;  4V1A g;  2JAD A;  1GSQ A;  5J47 A;  2E0Q A;  4IS0 A;  1F6M C;  4IBP A;  2ON7 A;  5KEJ A;  4ISD A;  2FLS A;  2N5B A;  4D73 A;  2H76 A;  1HNC A;  3UIW A;  5F05 A;  3CRU A;  2OA7 A;  3DRN A;  5ABR A;  1X9S B;  3WT2 A;  4KCE A;  3H8Q A;  1YKC A;  2GLR A;  1ZYE A;  1YF0 A;  3F3R A;  5CRW A;  3HVV A;  5IMZ A;  4P3Y B;  1GL8 A;  5JWR B;  3Q74 A;  5IPH A;  4FH8 A;  5KN1 A;  1EOG A;  2CZ3 A;  3MIX A;  3A2W A;  2PVO C;  1X9W B;  4WET A;  3ZYW A;  1F9M A;  2VM2 A;  3QD9 A;  2DC5 A;  4YH2 A;  5HFK A;  4TXV A;  4BVX A;  4JR6 A;  2HT9 A;  2VCV A;  4X0X A;  1G6W A;  3VI5 A;  1WP0 A;  3EC3 A;  4PNF A;  2K8V A;  5F07 A;  3GIX A;  4OCF A;  2ZCT A;  1WIK A;  2VL3 A;  2LEG A;  3TRX A;  1XW6 A;  5ECQ B;  4MAB A;  2KUC A;  1TK5 B;  3G7Y A;  1GTI A;  1QUW A;  2VKZ G;  1SYR A;  3HD5 A;  2DJJ A;  4IVF A;  2GT6 A;  1KTE A;  4MPF A;  4KCA A;  4I6X A;  1R7H A;  1SU9 A;  2LRN A;  1GSU A;  1Z9H A;  1YY7 A;  3GTU B;  4BVX B;  3O6T A;  4WBJ A;  1TRW A;  4GST A;  2K8S A;  3SBC A;  8GSS A;  4K5S A;  4TR3 A;  1SL2 B;  2GS3 A;  2YAN A;  1BF5 A;  5G1L A;  1PX6 A;  4KDX A;  3GX8 A;  3FR9 A;  4WKW A;  3TJB A;  2CVD A;  4H86 A;  1GRX A;  1BG5 A;  6GSW A;  1M0U A;  3H1N A;  1R4W A;  2V2G A;  2BMX A;  1JLW A;  5CNW A;  4HJM A;  1ZGN A;  4BA7 A;  5IM9 A;  4WEY A;  1V40 A;  1K0M A;  3KP8 A;  4KA0 A;  5D9X A;  2NBS A;  1GUM A;  1K0N A;  2IN3 A;  5A5H B;  2XPE A;  3GA4 A;  3M3M A;  1ACV A;  5G5E A;  3QDN A;  2C4J A;  3GNJ A;  1QGV A;  1VF4 A;  1FB0 A;  1TOF A;  1U3A A;  1YKA A;  2V32 A;  1N2A A;  3LYK A;  4LMV A;  4XHM A;  2LJA A;  2R5G A;  3R3E A;  2C0D A;  4JZQ A;  1Z5Y E;  3V1W A;  2YWN A;  4WBR D;  4RQR A;  3CSH A;  2P5Q A;  2H8L A;  1GTA A;  1MDJ A;  2GZP A;  1GLP A;  3IBH A;  2X8H A;  1A2L A;  2GSS A;  4DVC A;  4K7I A;  5G2Z A;  2IL3 A;  2I81 A;  3ZMK A;  3M1G A;  3A2V A;  2FUG 2;  3QAW A;  5AN1 A;  4POK A;  2O8V B;  1SD8 A;  1YZX A;  5IOX A;  2DJ3 A;  4MZC A;  2DJ2 A;  2FWG A;  2B5E A;  1Z6N A;  1AIU A;  2H0G A;  3TOT A;  3W8S A;  2M72 A;  3ERW A;  3TGZ A;  1PL1 A;  1FW1 A;  1X0R A;  2OE0 A;  2R3X A;  4N30 A;  1LU4 A;  2XPD A;  4O92 A;  3VPT A;  3LSZ A;  3WGE A;  2LNT A;  2B6M A;  2DSA A;  1HQO A;  3IHQ A;  1K0A A;  3L9V A;  3ZRD A;  6GSU A;  5IMC A;  1UA5 A;  3DWV A;  5AGY A;  4V1A p;  1W4V A;  4IP1 A;  4TVE A;  4TR4 A;  2V6O A;  2VL2 C;  5KOX A;  2K9F A;  1J0F A;  3KH7 A;  4BWQ A;  2KOK A;  1FVJ A;  4N11 A;  5ECK B;  2GTU A;  2YWI A;  4ZBD A;  2HZE B;  3CXG A;  1Q98 A;  1VF1 A;  3APS A;  5EPF A;  4K0G A;  3IDV A;  3KZQ A;  5L71 A;  3CSI A;  1B8X A;  1FOV A;  1TRU A;  2GZZ A;  1T7P B;  3HYP A;  2NPB A;  2ES7 A;  3KIJ A;  5J4V A;  2F8F A;  1SEN A;  5FWG A;  2VIM A;  4NMU A;  1THO A;  2H0I A;  2V1M A;  2VLV A;  2HNL A;  1GUH A;  4AGS A;  2IMI A;  2J9H A;  3BBY A;  3D4T A;  2HYX A;  1VF3 A;  1NM3 A;  4I8B A;  2FGX A;  4K2D A;  1TU7 A;  1V58 A;  3G9B A;  3MWH A;  3DKS A;  2JL4 A;  1Q4J A;  2A2R A;  4EF0 A;  3TB2 A;  2O85 A;  2E2M A;  1N25 A;  5CRG A;  1SJZ A;  1T3B A;  2VL9 A;  3FHK A;  3EWL A;  2H73 A;  3KD0 A;  5CO3 A;  1WPI A;  3IAM 2;  10GS A;  1V98 A;  4LMW A;  2VL2 A;  4HI7 A;  4BVY A;  1FHE A;  4F03 A;  4KSM A;  3GL3 A;  2L59 A;  4AKG A;  1GP1 A;  3GYK A;  1K0O A;  1IYI A;  1T8E B;  1FO5 A;  1M99 A;  2HFD A;  3CMI A;  1GSS A;  4I5Q A;  1RK4 A;  5ECI B;  4K0N A;  3OR5 A;  4POM A;  4RI6 A;  1TXX A;  3A5W A;  5HR2 A;  4Q5N A;  4PX1 A;  3NZN A;  1SVO A;  4AJ6 A;  3FZ5 A;  4NHZ A;  3ZIT A;  3CTG A;  1OKT A;  2L6D A;  1G6Y A;  1CQH A;  4K8M A;  2PBJ A;  4CDO A;  4NHW A;  3WGX A;  4XS1 A;  3VWV A;  5F0G A;  3HJP A;  3GFK A;  2RUE A;  4JU5 A;  5JWO B;  2P0G A;  3JCM L;  2X49 A;  3H79 A;  3MDK A;  2YN1 A;  2IPA A;  1MD4 A;  2QSI A;  3TKR A;  4WF5 A;  3DEX A;  1AQW A;  3KTL A;  2YZH A;  4WF4 A;  5LD0 A;  3VWU A;  1JZW A;  1X9M B;  1J08 A;  1OE7 A;  1OAZ A;  1ZL9 A;  4MMM A;  2IME A;  1B48 A;  1ERV A;  1SK1 A;  3AY8 A;  2VCQ A;  4MDC A;  4G2E A;  4GXZ A;  5DBQ A;  3UEM A;  1NHO A;  1X5C A;  4KX4 A;  2KP2 A;  3GH9 A;  4GDF A;  4AF2 A;  1TP9 A;  4E8H A;  4KDU A;  3D5J A;  1M2D A;  2KP1 A;  4YQU A;  3ZL5 A;  3IK9 A;  4MH3 A;  4MCU A;  5DAK A;  1QMV A;  3EMP A;  2A2P A;  3HVX A;  4KSO A;  1OC3 A;  3GHA A;  3UJ1 A;  1SL0 B;  5KN0 A;  2GSR A;  2N5F A;  1Z7P A;  1EV9 A;  1TI1 A;  2C8U A;  4ZBA A;  2FNO A;  4FIW A;  3L78 A;  2PN8 A;  3F8U A;  1K0C A;  3HVS A;  1BJX A;  3D4M A;  1G7E A;  3EU4 A;  1B9X C;  1XCC A;  2HZF A;  4MJE A;  5H5Q A;  5HR3 A;  3RPP A;  2UV8 G;  1EGO A;  4AJ8 A;  4ML6 A;  2HRK B;  1U88 A;  3EVI A;  1NSW A;  22GS A;  2LNS A;  4KAE A;  4LL4 B;  2HRN A;  4F0B A;  2TIR A;  1SJ6 A;  2YV7 A;  2RUF A;  6GSV A;  2VM1 A;  2KHP A;  5DQY A;  1O85 A;  3O76 A;  12GS A;  6GST A;  2M46 A;  2WZ9 A;  3ZLP A;  2XC2 A;  3A5I A;  4ZB9 A;  2UZ8 A;  5IOW A;  3ME8 A;  3US3 A;  3HKR A;  2HRA A;  1QQ2 A;  2B7K A;  2JSY A;  2GQK A;  3KTB A;  2F51 A;  1OE8 A;  4WR5 A;  4IGJ A;  3TOU A;  2CQ9 A;  1XVW A;  3IR4 A;  2GGT A;  2V6K A;  1A8L A;  4J2F A;  2GVP A;  2HSH A;  3UBL A;  2YWM A;  4F2I A;  2DJ0 A;  3HA9 A;  1VGL A;  1T4Z A;  2AUV A;  4TXO B;  4ICY A;  1O6J A;  4MF6 A;  2H70 A;  3TUE A;  3LJR A;  2WUL A;  3MNG A;  4N3Z A;  4CY6 A;  2QKE A;  4RI7 A;  1OKD A;  2AB6 A;  2PUK C;  1PGT A;  1A0F A;  1SJI A;  1GWC A;  4HDE A;  4I2T A;  3M0F A;  3KP9 A;  4PQH A;  4ML1 A;  3RHC A;  4YKG A;  1N8J A;  1OVN A;  4XRD A;  2B5X A;  1XPV A;  2EC4 A;  1PMT A;  3R2Q A;  3D21 A;  5J9B A;  1ERW A;  4KB3 A;  5F8B A;  1JLV A;  4Z2T A;  5IIZ A;  5HFI A;  3GTU A;  5D8I A;  1FAA A;  5GAN D;  1Y1U A;  3J7Y k;  2A2S A;  1A2J A;  2RM6 A;  1EOH A;  5IPG A;  2D2Z A;  2HSN A;  1ABA A;  2FD3 A;  5HQP A;  3QFA C;  2YPM A;  4I97 A;  2RLI A;  2VCZ A;  1M7T A;  3EMX A;  5B7C A;  5IO0 A;  4KND A;  1TU8 A;  3C73 A;  4IJ3 A;  3GN3 A;  4L5O A;  2LS5 A;  2H01 A;  2H75 A;  2LQO A;  4HQS A;  1MD3 A;  1NW2 A;  1T00 A;  1ZZY A;  3GUS A;  1HNA A;  3P8W A;  5A5H A;  4JR4 A;  3QMX A;  3QOU A;  2HSN B;  3FZ4 A;  1O8W A;  2ZUP A;  2YP6 A;  2EFE A;  5A4W A;  3KEB A;  3KXO A;  1B4Q A;  4O5Q A;  2CX3 A;  1WJK A;  4Q5Q A;  2WRT A;  3ERG A;  4K7O A;  2OT3 A;  1TK0 B;  4XS4 B;  2OJL A;  3U6V A;  3HXS A;  4TR0 A;  4TRX A;  2FHE A;  3QCP A;  2PPT A;  4HZ4 A;  3GH6 A;  2H6Y A;  4YKF A;  3C1R A;  3F9U A;  4EE0 A;  2CV4 A;  1BG1 A;  2C0E A;  5ECS A;  1PX7 A;  5A4U A;  1TXU A;  3EUR A;  2H72 A;  2F3M A;  3ZVJ D;  1TRV A;  4BWS A;  4HU9 A;  2C3T A;  5D9T A;  2AHE A;  2L4Q A;  3EE2 A;  2VD1 A;  4K5R A;  2EIR A;  4A5P A;  3EYT A;  1URM A;  2GST A;  5H5R A;  2IMF A;  2JSZ A;  1B4P A;  2X64 A;  1AQV A;  2MYG A;  2YJ7 A;  3L0H A;  4MF5 A;  3ERF A;  2IFQ B;  4LL1 B;  2I9H A;  1B9Y C;  3FMW A;  5ELG A;  2GZY A;  3BCK A;  2TRC P;  4K1F A;  1YVL A;  1SKR B;  4KUN A;  3APQ A;  2H1D A;  2FWE A;  7GSS A;  3VK9 A;  1DSB A;  5IMV A;  3FR6 A;  3QPM A;  3ISO A;  5B8A A;  2HZE A;  4NV2 A;  2CVK A;  3G7I A;  1TJD A;  4EL1 A;  3C7M A;  3FZA A;  3IE3 A;  3KH9 A;  2DLX A;  1SL1 B;  4IW9 A;  2CVB A;  1BAY A;  5FT3 A;  4BL7 B;  5COH A;  3E3E A;  2YWO A;  3IK7 A;  1JFU A;  5DDL A;  3FYG A;  2MBT A;  5IO2 A;  2MBS A;  1ZYP A;  1E6B A;  2KLX A;  4ZL7 A;  1LBK A;  4ZB6 A;  3VWW A;  1XW5 A;  2CX4 A;  2MZC A;  5ECN B;  2DIZ A;  16GS A;  2XBQ A;  5C04 A;  3TJF A;  4O5R A;  4AI6 A;  2VLT A;  3HCZ A;  1YQ1 A;  4MLY A;  3GKM A;  2IMD A;  4PQ1 A;  3IPZ A;  4PUF C;  5ID2 B;  2A4H A;  3C8E A;  5EL8 A;  4G0L A;  2O87 A;  3MYD A;  2OKA A;  3WD6 A;  2PER A;  1PA3 A;  5D96 A;  3W8J A;  3GV1 A;  4XCS A;  5CYY A;  4TOP A;  3TJG A;  4ZXG A;  1GNW A;  4ULX A;  3KJY A;  2DML A;  1Z7R A;  1PRX A;  1GSE A;  4N0Z A;  3Q18 A;  5E4W A;  2EFC A;  2EFH A;  1TDI A;  2OE3 A;  4ZBB A;  2H19 A;  6GSX A;  4K2X A;  3FW2 A;  4V2M A;  3LYP A;  3IHG A;  1ST9 A;  3LOR A;  2HSM B;  2XHF A;  1EEM A;  5CRE A;  1M2A A;  3TKQ A;  4MJA A;  1F3B A;  3PH9 A;  3IRA A;  5E59 A;  1XWK A;  1R5P A;  4WR4 A;  3QAV A;  4MF7 A;  2VLU A;  20GS A;  2FWH A;  4HQZ A;  5IMF A;  3S9F A;  4AJ7 A;  1X5D A;  1DE2 A;  5GZZ B;  2DKI A;  4HS1 A;  1O7U A;  3F4T A;  1A0R P;  2HRF A;  3L4N A;  5IQY A;  3G7J A;  4MA9 A;  2L5O A;  1XIY A;  4O32 A;  2L4C A;  3GUR A;  2VCX A;  3F63 A;  2FA4 A;  4Z2U A;  2HLS A;  2CT6 A;  3HMJ G;  2R0P A;  2VD0 A;  5D73 A;  5AIS A;  1V2A A;  4MNN A;  13GS A;  2DIY A;  3L9U A;  2QC7 A;  5F06 A;  3FK8 A;  1GUL A;  3RDW A;  4USS A;  1PD2 1;  4EDY A;  1ILO A;  3DYR A;  2JZT A;  5AIX A;  4EXJ A;  5DQS A;  5G1K A;  1MDI A;  3W6G A;  2LQQ A;  2H0H A;  2P5R A;  2DKH A;  2HSY A;  2N5A A;  4ZL8 A;  1G7O A;  6GSY A;  2VCT A;  4YQV A;  3M9J A;  3IAS 2;  3CRT A;  1DUG A;  2HXK A;  1DBY A;  3FR3 A;  1TKD B;  3DGQ A;  3ZTL A;  5DCG A;  1OC8 A;  5FHI A;  4POL A;  4RQX A;  5A34 A;  1K3O A;  1WMJ A;  1TI3 A;  3GX0 A;  2G0F A;  4PXO A;  1GNE A;  2AAW A;  1CQG A;  4J57 E;  1U87 A;  4FO5 A;  4HZ2 A;  4QQ7 A;  2IJY A;  1BQ7 A;  3IV4 A;  1KNG A;  5IMD A;  2HRK A;  5D9W A;  2PMT A;  3QAG A;  3TRP A;  2QA2 A;  3GKN A;  4K6X A;  4G0K A;  2IWT A;  5A5K A;  4POB A;  4XTS A;  4AKH A;  3TKS C;  1RQM A;  4BPY A;  2EIQ A;  2DMM A;  2LKU A;  2GSQ A;  1EWX A;  4G9H A;  4IKH A;  3LFL A;  3ZIJ A;  3RPN A;  3F6D A;  3VI7 A;  4F82 A;  4IQA A;  5A34 B;  4OMV A;  3LWA A;  1Y25 A;  3A3T A;  3F0I A;  3TRQ A;  5CRH A;  4G0I A;  4CW9 A;  3P90 A;  5EY6 A;  2X8G A;  3LG6 A;  3IC8 A;  3HY2 A;  5G30 A;  5GST A;  3WGD A;  2B1L A;  3I43 A;  2C1Y A;  4TXO A;  5BMU B;  18GS A;  2MMZ A;  4TW5 A;  2YNX A;  2NTO A;  5D9V A;  1JHB A;  4ZB7 A;  4LLR A;  5JCU A;  2LJR A;  4MK3 A;  1HD2 A;  4DSS A;  1UC7 A;  3EU3 A;  3IC4 A;  1Y6E A;  3FRC A;  3DVW A;  4LA1 A;  5A1N B;  4F0C A;  3I9V 2;  4PUR A;  3TKS A;  5ENU A;  3DML A;  2H6Z A;  1GLQ A;  4G01 A;  5J40 A;  4EKZ A;  4FYU A;  1H4O A;  2OAD A;  4QMK A;  4E68 A;  3UAP A;  1OC9 B;  4TN8 A;  1PSQ A;  2LST A;  5DAL B;  2L6C A;  5J4Y A;  3GKK A;  1O73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...