4I97A

The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
207
structure length
207
Chain Sequence
b'ADLYYLPGSSPCRSVIMVAKAIGLELNKKLLDLSTGEHLKPEFVKINPQHTIPTLVDNGFALWESRAILVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPELYKKMEAAVEFLNTFLEGQTYAAGDSLTIADIALLATMSSFEVAGYDFSKYENVNKWYANAKKVTPGWDENWAGCQEFKKYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELTA CLASS 1 GLUTATHIONE S-TRANSFERASE
publication title Evolution of herbivory by adaption in an ancient detoxification pathway
rcsb
source organism Scaptomyza nigrita
molecule tags Transferase
total genus 76
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4i97A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i97A01
3RPPA 2VO4A 1W89A 2Z9SA 1SD8A 1TXXA 3FW2A 3J7Yk 3LJRA 1XVQA 3HJOA 4V1Ap 2HYXA 4MCUA 3ZMLA 4AGSA 1GTAA 2VD1A 2MZCA 1YF1A 2DJ2A 1SKWB 17GSA 2HSYA 3HJPA 5IO0A 1X0RA 3Q18A 3F3RA 4TR3A 4NHWA 1XWKA 3GH6A 4FYUA 3ZFLA 3WGEA 1FW1A 2AV4A 1A24A 1TW9A 2L4QA 2LQQA 3C7MA 5KN0A 1TJDA 3H93A 4K0GA 3GKXA 3H79A 4LMWA 3L4NA 14GSA 2RM6A 3EU3A 5IM9A 6GSWA 2PBJA 1CQGA 5IPHA 3FZ5A 2DBCA 3D0ZA 4OD7A 3HHVA 2VL2A 2JL4A 4HU7A 4HS1A 2R2JA 2V41A 1U6TA 2K8VA 1T4ZA 2P5QA 1NM3A 1XOBA 4TKYA 1ZCPA 1YDKA 4KE3A 1U87A 1SK2A 3HKRA 3MNGA 2DJJA 5GAPD 1MD4A 5BMUA 3F9UA 4HU9A 1SKSB 4TW5A 3VLNA 3CBUA 5E59A 1WRYA 2F9SA 2GS3A 4NWYA 1B4QA 2O7KA 1K0BA 4I2UA 1XVWA 1AXDA 1K0MA 2DIYA 5IQYA 3W8JA 3FZ4A 4E8HA 1BJXA 2LRCA 2X64A 2JZRA 3CTFA 2BTOT 4BVXA 2WGRA 2C0GA 4PQ1A 5ELGA 4DSSA 1G6YA 2LTKA 5E4WA 4KDXA 1S3CA 3MWHA 1SK0A 2HT9A 4NV2A 3TUEA 2WDUA 3TB2A 3IE3A 3GL5A 1ST9A 3KTBA 5IIZA 4MJBA 1ZOFA 3TKSE 5ELAA 4BVXB 1J0FA 2VCTA 2FGXA 2F3MA 4IJIA 3M3MA 3HVXA 4DSSB 1M7TA 2CVBA 1M2AA 1GNWA 3L9VA 1SKRB 1O7UA 4Q5FA 2HZEA 4F9ZA 6GSSA 1XWAA 5CREA 5D9XA 2TIRA 1A2LA 3GN3A 3EVIA 3FYGA 1EEJA 4EL1A 4GRFA 5A4WA 4XIHA 3PPUA 3KH7A 5HFGA 4RI6A 4WF4A 2H19A 3OR5A 2HRKA 2WJUA 5GSSA 2B3SA 2C3NA 1F3AA 3DVWA 2HZEB 3F4SA 2K18A 4YAVA 5LCZA 1R26A 2H70A 4LA1A 3KH9A 5DVBA 2EIOA 1DE1A 2B7KA 4N11A 2XBQA 4HEA2 4XCSA 1AIUA 2F8FA 1TK8B 3D6IA 2VL2C 2HRKB 4WF5A 3VWVA 1U3AA 5DCGA 3GRXA 1GSFA 1GH2A 3F63A 1V98A 1C72A 4WEYA 2HXKA 5F05A 1EP8A 3IDVA 5IMDA 4NMUA 3IK9A 4MLYA 3F0IA 2VCQA 3I9V2 2GZYA 2B5EA 4CHSA 1QQ2A 2LQOA 1Q4JA 2KLXA 1SL2B 2N5BA 3IAM2 1PL2A 3Q74A 5JCWA 2O89A 1SYRA 4AF2A 2IJYA 3TJKA 3R2QA 4OCFA 4IS0A 2LKUA 1I5GA 4JR6A 1GSUA 4MJAA 4F03A 2H30A 1O8WA 3QPMA 4Z7XA 1XOAA 1OAZA 2L5OA 5CRHA 2H0GA 3TCOA 1NHYA 4JR4A 4TR1B 3APSA 5AIVA 4DVCA 4EDYA 4KA0A 1MDKA 1TRSA 4PNFA 3KIJA 4NPBA 1YEXA 2TRXA 1YZXA 5B8BA 3TOUA 1XWCA 2VCVA 3QMXA 1QUWA 3HYPA 2LJKA 4MH3A 3DVXA 2TRCP 2C0DA 1WIKA 5D73A 3GKMA 1M99A 2FWEA 1EZKA 3MDKA 2HE3A 3F6FA 3ERFA 1U88A 3D4MA 4NAXA 2C8UA 4IJ3A 3UVTA 2M72A 4MDCA 3KEBA 2IPAA 5DQYA 2HRFA 2R6KA 2H73A 3A2VA 1YY7A 2YJ7A 4ZXGA 3BJ5A 3US3A 4OO4A 1ERVA 3DIEA 3QDNA 3GL3A 1SYXA 1IYHA 1GTUA 2DMMA 3LORA 3TKRA 1B9YC 1ML6A 2I1UA 1S3AA 5DAKB 2K8SA 1YQ1A 1NHOA 3N5OA 1LU4A 1K0DA 2J23A 1Y25A 4I97A 2YV9A 5LNKe 2PWJA 3DWVA 3H8QA 1X9WB 1PD21 2KP1A 4OFNA 1WPIA 3WD6A 3CRTA 2PUKC 5CRDA 4IQAA 1Z5YE 2YJHA 1EP7A 2B6MA 3IA1A 2C3QA 1JHBA 3TOTA 4FO5A 4ECBA 3IXRA 4QQ7A 1QGVA 2YWOA 1ZMAA 3IV4A 2OE0A 1N2AA 4ZBBA 4KB3A 2YCDA 1EOGA 1AQWA 4CDOA 5COHA 3HY2A 1M2DA 3TKQA 2B5XA 2EIRA 4X0XA 4ZB8A 5AN1A 1G7OA 2H76A 4LL4B 3D22A 3G7JA 3G7YA 2N5AA 3K8NA 1KTEA 1GWCA 2L59A 3TJGA 4GQFA 4V1Ag 2I3YA 1YKAA 1PKZA 2AJQB 2CAQA 3BD2A 4I6XA 2H0HA 1W4VA 4O92A 3U6VA 1F6MC 1M9AA 3GMFA 22GSA 2MBSA 4GLTA 3H4KA 2HLSA 1AQVA 3R3EA 4PUFC 3UARA 3A5WA 1VF2A 5HR1A 3CXGA 4L5LA 1ABAA 3ZL5A 4GTUA 1GTBA 4KAEA 3C73A 1GSQA 2RUEA 1THXA 3IAS2 1M9BA 3GTUB 3C71A 12GSA 3A2WA 4AJ6A 3RBTA 2DJKA 4K7IA 3LYKA 2O8VB 1XWGA 3NOFA 3VPTA 1F37A 1M0UA 2LUSA 3HZ8A 2BMXA 2CX4A 1KNGA 1S3DA 4FIWA 1WP0A 2LJRA 3HDCA 1OE8A 1FB6A 1J08A 5F8BA 1KEBA 1YF0A 2LSTA 4TN8A 1BAYA 4I8BA 3FY7A 2LNTA 2REMA 5GZZB 1O8XA 4ZL8A 2ES7A 2L6CA 19GSA 1VF3A 3D5JA 2RM5A 2DIZA 4RQXA 4ECCA 4MK3A 4EDZA 3IBHA 2DJ1A 2CT6A 2YWMA 3UBKA 4ZILA 4MZBA 3EWLA 1Q98A 3VI5A 3O6TA 4J56E 4LL1B 1JLVA 4MZCA 1MDIA 2HNLA 2HRAA 1J9BA 4ULXA 4TXOA 1V9WA 3LXZA 2OBKA 2B1KA 2ON7A 2CVKA 1T7PB 3VPQA 4NXIA 1H4OA 3CSJA 4ECJA 2VCZA 2O85A 3I43A 3P90A 4IELA 5EL8A 1TTZA 3GIXA 3ZFBA 3EC3A 4X43A 1UC7A 2WB9A 2MMAA 4XS6A 3QAGA 3P2AA 1BG5A 4HDEA 4TXOB 3ZTLA 2V2GA 3GURA 4KSMA 4G0KA 3ME7A 5ECIB 5CRGA 2MMNA 2LRNA 2VLTA 1GTIA 3M8NA 2L6DA 4DSQA 2RIIA 4I2TA 4XRAA 1A0FA 3CYNA 1K0CA 5DJMA 1B48A 3BOAA 3APQA 1H75A 2YV7A 3UEMA 4ILFA 3L0HA 2V32A 5IOXA 4IVFA 4EC0A 2WS2A 1PQNA 4HJMA 2GT5A 1F2EA 1SU9A 4JZQA 1JZWA 4V2LA 4G0IA 1GSSA 3NIVA 4KDUA 3DYRA 4KNDA 3APOA 1HNAA 2CV4A 4IW9A 2HRNA 3VWUA 3IRAA 5G1LA 3WT1A 4MMMA 2GSQA 2AUVA 2V1MA 5B7CA 3LYPA 1XWBA 2IMFA 1Z6NA 3GSSA 1GLPA 2E2MA 3TJBA 1XZOA 2OADA 4XHMA 4Q5NA 5DALA 3LXTA 2PMTA 4KSOA 1RK4A 3P7XA 4RUVA 1TI1A 2L57A 2H71A 6GSUA 4D73A 3FR9A 4PGTA 2CQ9A 1HD2A 1ZGNA 3GX8A 2CX3A 4PURA 5IMFA 2GQKA 2H75A 2I81A 1KBNA 3RPNA 5DALB 1THOA 3ISOA 5C04A 4E8EA 2OKAA 4D73B 5ECOB 4YQVA 1RQMA 2QKEA 2OE1A 2FWHA 1SD9A 10GSA 3ZLPA 1OVNA 4IP1A 5G30A 2AB6A 1TKDB 5D9TA 2L4CA 3KP9A 1SL1B 3QD9A 2C0FA 1SL0B 1GULA 5G31A 2P31A 4OO5A 2AHEA 2YZHA 1O81A 4BL7A 5ECLB 3DRNA 2H8LA 1I9DA 2C0EA 4BA7A 1OKTA 5D8IA 1TOFA 1FVKA 1YKCA 5F07A 1TK0B 1A0RP 4POBA 1ON4A 4LMVA 16GSA 2GDRA 4BPYA 4BL7B 2WCIA 3HXSA 3J7Yb 2BJXA 1BEDA 3ZMKA 2MBTA 4KW6A 1XPVA 1PA3A 3WGXA 3N9JA 3UAPA 5H5RA 1PL1A 2P5RA 4MPFA 2XC2A 2IWTA 4MH2A 3PINA 2H0IA 1UVZA 3L9SA 3O3TA 5EPFA 3VURA 4G0LA 2YOIA 5D93A 4YAPA 3F6DA 1TU8A 5CO3A 5IO2A 1FAAA 3CSHA 3IC4A 2GGTA 1T4YA 4Q5QA 4V2NA 4ZBDA 1X9MB 2QC7A 2PVOC 3DD3A 3BCKA 5L71A 4EE0A 3JCML 3M0FA 5J3RA 2X8HA 1FHEA 1XFLA 3QAVA 1V2AA 3VWXA 1BYEA 4O5RA 1RW1A 5C00A 2H01A 2GSTA 4MJEA 4TXVA 4F2IA 5KN2A 4EVMA 2RUFA 1HNBA 5HFKA 3SWLA 1O73A 1URMA 2XBIA 2A2SA 4K6XA 4J57E 2GSSA 3VI7A 4RQRA 4POKA 4ISDA 3KP8A 1DE2A 4XS1A 5HR3A 1EOHA 4XRDA 4HOJA 3S9FA 3Q19A 1TRUA 2JADA 3CTGA 4MP4A 4V2MA 3H1NA 4JBBA 2GLRA 2V6KA 3FR3A 1FOVA 1UA5A 5CNWA 3ZREA 3LG6A 1T8EB 2CZ3A 1GSEA 2NTOA 2ZNMA 3F3QA 3I6AA 4PNGA 3SBCA 5IMAA 4MJCA 1QMVA 2FUG2 4TVEA 4IP6A 1MEKA 3KCMA 1MDJA 1Z9HA 5DDLA 5G5FA 4BWQA 3E3EA 5HR0A 5INYA 4K0NA 2FA4A 3TKSA 1B8XA 4DSRA 3HVVA 4YQMA 1X5EA 4ML1A 2IL3A 1GUKA 2K6VA 3RDWA 3HD5A 4Q5RA 5IOWA 2IFQA 5G5EA 4OMVA 20GSA 1ERUA 5EY6A 3DEXA 1EGOA 2XPEA 3KTLA 3ZYWA 1FO5A 2YWIA 2FA8A 1EV9A 6GSVA 1G7EA 3Q6OA 1TI3A 3A3TA 2WFCA 3IOSA 1XXUA 5FWGA 2RLIA 4ID0A 1X5CA 4ZB6A 1A8YA 4YQUA 2PGTA 1YEPA 1ACVA 2CAIA 2JZSA 2IFQB 3FRCA 3G7IA 5B6MA 4WBRD 4ZIJA 3ZVJA 2G0FA 3KGKA 2VD0A 3KMOA 2JU5A 3FZAA 2PU9C 1ZYEA 1O6JA 2C1YA 2ON5A 3C1SA 2H74A 4PQHA 2PVQA 5HFIA 5ECNB 4IBPA 1X9SB 3TRQA 1XCCA 3PH9A 2MMOA 1NSWA 1TRWA 1ILOA 5GSTA 4HZ4A 1T3BA 2FLSA 4KGIA 4PXOA 5JWOB 13GSA 2HSMA 1WJKA 4QL9A 3QAWA 1B9XC 2YN1A 1WOUA 3DKSA 5ECHB 4ECIA 1BQ7A 3VFIA 5DQSA 2F8AA 4IGJA 3BCIA 1YJ6A 4GQCA 3TKPA 3EYTA 3M9KA 4XS4A 3IK7A 2QSIA 2B1LA 4FYBA 3EU4A 3LWAA 2G2QA 11GSA 3E0UA 1TU7A 4WXTA 2AAWA 3W6GA 4CW9A 1GUMA 3DGQA 2VCXA 2JSYA 4POLA 3GUSA 4TR4A 1HNCA 2YP6A 2VL9A 3CMIA 5DJLA 1K0NA 4G2EA 1Y6EA 1GLQA 2ALBA 5IPGA 3CSIA 2WRTA 1ERTA 1TRVA 1JLWA 2VLUA 1E6BA 4XS4B 4MF5A 3ED3A 3GYKA 5AIXA 3KMNA 3U5RE 4KH7A 4EUYA 2N5FA 2GQMA 1USBA 1V40A 2DJ0A 1DSBA 2J9HA 4PUAA 3TGZA 3FR6A 1T00A 1R5PA 3FKFA 5LD0A 2R4VA 4KCEA 4WKWA 1V58A 1MD3A 1LBKA 2LJAA 4POMA 5J9CA 2VLVA 2IMDA 5KN3A 2OA7A 1Z7PA 2ZUPA 5ECQB 1N8JA 4MF7A 1F9MA 1LJRA 1VRSD 1FVJA 2XHFA 4MA9A 1SJIA 18GSA 2DJ3A 4OCEA 1DBYA 2H1BA 3A2XA 1F3BA 3EMPA 5G1KA 5ECKB 3O76A 2HQTA 2ZCTA 4AJ7A 4N10A 2VM2A 1XW5A 3RAZA 2I9HA 2PPTA 3DMLA 1WMJA 1SENA 1NW2A 1GUHA 5EVOA 4G19A 2VAFA 4TOPA 6GSTA 1PSQA 1ZZYA 4K1FA 4K7NA 2CZ2A 1VF1A 3F4RA 3FHKA 1MTCA 1OKDA 1OC8A 4HQSA 3KXOA 3GKNA 1WE0A 1PKWA 4ZL7A 1DUGA 5JWRB 2KUCA 3IC8A 5KEJA 2YZUA 4NHZA 2D2ZA 3D21A 2IMIA 2H6YA 2GT6A 2HZFA 3PGTA 1JFUA 2P0GA 5CP1A 2QGVA 2NPBA 3RHBA 3ZVJD 5ECRB 5J4UA 5DCHA 4WR5A 1GSDA 4FQUA 1UN2A 4GSTA 1K0AA 5D9VA 2NDOA 1ZYQB 2OACA 4ZB9A 3G9BA 2KOKA 3QOUA 4IN0A 5B6NA 4O32A 2HFDA 1EWXA 1TK5B 3QFAC 3RHCA 4ACSA 3UJ1A 3LSZA 4EF0A 1PN9A 3EINA 3C8EA 2WULA 1JZOA 1XBSA 5KN1A 4K9ZA 1ZL9A 5J9BA 2M80A 3ZZXA 2H6XA 4BWSA 3EMXA 4AJ8A 5J5NA 5ECPB 1OE7A 4IQ1A 4J2FA 1R7HA 3IPZA 3V1WA 1FB0A 3FZ9A 3WYWA 5A4VA 1M2BA 3CRUA 3GX0A 4N0VA 3HJMA 2GVPA 4HUAA 1WWJA 3GNJA 2XPDA 1K3YA 2HSHA 1QK8A 2FNOA 3M1GA 4GXZA 3UIWA 1G0TA 2PERA 2KHPA 2GZPA 1XW9A 2CVDA 4WR4A 3KD0A 1K0OA 3PR8A 9GSSA 3KM6A 1GP1A 2GZZA 4USSA 7GSSA 1QFNA 2LS5A 2YWNA 1HQOA 3HVSA 4L0UA 3L9UA 3NZNA 2A2RA 5CRWA 4KDYA 4MABA 5JCUA 1A2JA 4PQIA 1B4PA 4JEDA 2E2GA 4FH8A 3VWWA 2GTUA 2X8CA 1PX6A 5H5QA 2OJLA 4HZ2A 4KCAA 2HSNB 5ECSA 2KP2A 2L5LA 3TJJA 1JZDA 5ECMB 2FWGA 2E7PA 3WT2A 3QR6A 3HA9A 1U3IA 2IMKA 3KZQA 1A2MA 5DBQA 4N30A 3EE2A 8GSSA 4F82A 3LFLA 4OFMA 1XW6A 1JZRA 4OFTA 3W8SA 5CYYA 1GL8A 3UOMA 3IR4A 2H6ZA 2EC4A 3GHAA 3BBYA 4HJ2A 5F0GA 3ZIJA 4TR1A 5HR2A 4FYCA 2X99A 2E0QA 4XTSA 2O87A 2M46A 4ML6A 2H1DA 3GSTA 1OC3A 2LEGA 2R37A 5ABRA 1G6WA 3LGCA 1VGLA 4EO3A 3GV1A 1PRXA 2C80A 1R4WA 2OBIA 2DSAA 4IHUA 4G9HA 5GAND 5FHIA 2JACA 3TRPA 1FG4A 1GRXA 4PTSA 1HYUA 3ME8A 3GFKA 1PGTA 3VK9A 4DEJA 5IMVA 2MYGA 3P8WA 1A23A 4F0CA 5G2ZA 3GA4A 1TP9A 3D4TA 2YANA 3I69A 1SK1A 4P3YB 3GH9A 2VCWA 3ERWA 2JSZA 5D9WA 3LEFA 4L0WA 1QXHA 2PN8A 4G10A 4GCIA 3C1RA 3UMAA 1GSYA 3ZITA 4PX1A 3TJFA 3TDGA 2F51A 5JWQB 2WZ9A 4WBJA 5FT3A 2R5GA 1VF4A 2VM1A 5AISA 1XIYA 3M9JA 4BVYA 4TR0A 4F0BA 1A8LA 3ERGA 4EXJA 3QCPA 4JU5A 2A4VA 4GSSA 1CQHA 3UVHA 2OE3A 1SJ6A 5DAKA 4NV5A 5JCGA 4K7OA 1E2YA 3QFBC 2MMZA 3HZ4A 4HI7A 3WGDA 2IMEA 4HQZA 5AGYA 5J41A 4RI7A 4BVYB 2FD3A 2AYTA 4MPGA 2NBSA 1Z6MA 1V57A 1K3LA 5A4UA 4I5QA 1TDIA 2JZTA 2K9FA 2V6OA 4WETA 4GWRA 4IKHA 4L8EA 2I4AA 4K8MA 4GF0A 4YH2A 1K3OA 3DXBA 2VUPA 1IYIA 3HCZA 6GSYA 5H5SA 2H66A 1EGRA 3MAKA 2FWFA 3L78A 1SJZA 1AC1A 5A5KA 1Z3EA 5IMCA 3AY8A 2FCHA 4OWYA 1AAZA 1EV4A 1ERWA 2R3XA 4ZBAA 3F4TA 2H72A 2GSRA 1AUCA 4TRXA 3F8UA 4H86A 1GNEA 1EEMA 3E9JB 2GQLA 3LQ7A 2FY6A 3EURA 5F06A 1R5AA 1O85A 5CAXA 2YPMA 3UL3A 3ZRDA 2DC5A 5ENUA 2B7JA 3IHQA 2EIQA 2VIMA 1T1VA 5ID2A 5D96A 2C4JA 5IMZA 2FHEA 4K2DA 3MSZA 2IN3A 1BX9A 1PX7A 3GTUA 4KX4A 2IIYA 4KUNA 4ZL9A 4EKZA 4QL7A 1OC9A 4N0ZA 2B5YA 2HSMB 2H1GA 2LV3A 3TKSC 2DMLA 2VL3A 2VOCA 4JRRA 3GKKA 3UBLA 5ID2B 1AQXA 6GSXA 2H1AA 2HI7A 2X8GA 2UZ8A 4MF6A 4LLRA 1Z7RA 4X1UA 5B8AA 1OC9B 3FK8A 4KF9A 4O7HA 2NVLA 4MZWA 1AW9A 4L5OA 3KJYA 1X5DA 2C3TA 2CA8A 3FEUA 5HQPA 2LNSA 4JE1A 4GSNA 1OYJA 3TRXA 2LRTA 2YNXA 1PMTA 3ZIVA 2DLXA
chains in the Genus database with same CATH superfamily
3RPPA 2VO4A 1W89A 2Z9SA 1SD8A 1TXXA 3FW2A 3J7Yk 3LJRA 1XVQA 3HJOA 4V1Ap 2HYXA 4MCUA 3ZMLA 4AGSA 1GTAA 2VD1A 2MZCA 1YF1A 2DJ2A 1SKWB 17GSA 2HSYA 3HJPA 5IO0A 1X0RA 3Q18A 3F3RA 4TR3A 4NHWA 1XWKA 3GH6A 4FYUA 4K5SA 3ZFLA 3WGEA 1FW1A 2AV4A 1A24A 1TW9A 2L4QA 2LQQA 4YKFA 3C7MA 5KN0A 1TJDA 3H93A 4K0GA 3GKXA 3H79A 4LMWA 4CY6A 3L4NA 4A5PA 14GSA 2RM6A 3EU3A 5IM9A 6GSWA 2PBJA 3EPTA 5IPHA 1CQGA 3FZ5A 2DBCA 3D0ZA 4OD7A 3HHVA 2VL2A 2JL4A 4HU7A 4HS1A 2R2JA 2V41A 1U6TA 2K8VA 1T4ZA 2P5QA 1NM3A 1XOBA 4TKYA 1ZCPA 1YDKA 4KE3A 1U87A 1SK2A 3HKRA 3MNGA 2DJJA 5GAPD 1MD4A 5BMUA 3F9UA 4HU9A 1SKSB 4TW5A 3VLNA 3CBUA 5E59A 1WRYA 2F9SA 2GS3A 4NWYA 1B4QA 4PI0C 2O7KA 1K0BA 4I2UA 1XVWA 1AXDA 1K0MA 2DIYA 5IQYA 5J4YA 3FZ4A 3W8JA 4E8HA 1BJXA 2LRCA 2X64A 2JZRA 3CTFA 2BTOT 4BVXA 2WGRA 2C0GA 5BMUB 4PQ1A 5ELGA 4DSSA 1G6YA 2LTKA 5E4WA 4KDXA 1S3CA 3MWHA 1SK0A 2HT9A 4NV2A 3TUEA 2WDUA 3TB2A 3IE3A 3GL5A 1ST9A 3KTBA 5IIZA 4MJBA 1ZOFA 3TKSE 5ELAA 4BVXB 1J0FA 2VCTA 2FGXA 2F3MA 4IJIA 3M3MA 3HVXA 4DSSB 1M7TA 2CVBA 1M2AA 1GNWA 3L9VA 1SKRB 1O7UA 4Q5FA 2HZEA 4F9ZA 6GSSA 1XWAA 5CREA 5D9XA 2TIRA 1A2LA 3GN3A 3EVIA 3FYGA 2A4HA 1EEJA 4EL1A 4GRFA 5A4WA 4XIHA 2R0PA 3PPUA 3KH7A 5HFGA 4RI6A 4WF4A 2H19A 3OR5A 2HRKA 2WJUA 5GSSA 5J40A 2B3SA 2C3NA 1F3AA 3DVWA 2HZEB 3F4SA 2K18A 4YAVA 5LCZA 1R26A 2H70A 4LA1A 3KH9A 5DVBA 2EIOA 1DE1A 2B7KA 4N11A 4Z2UA 2XBQA 4HEA2 4FXYP 4XCSA 1AIUA 2F8FA 1TK8B 3D6IA 2VL2C 2HRKB 4WF5A 3VWVA 1U3AA 5DCGA 3GRXA 1GSFA 1GH2A 3F63A 1V98A 2QA2A 1C72A 4WEYA 2HXKA 5F05A 1EP8A 3IDVA 5IMDA 4NMUA 3IK9A 4MLYA 1Y1UA 3F0IA 2VCQA 3I9V2 2GZYA 2B5EA 4CHSA 1QQ2A 2LQOA 1Q4JA 1M3JA 2KLXA 1SL2B 2N5BA 3IAM2 1PL2A 3Q74A 5JCWA 2O89A 1SYRA 4AF2A 2IJYA 3TJKA 3R2QA 4K5RA 4OCFA 4IS0A 2LKUA 1I5GA 4JR6A 1GSUA 2EFCA 4MJAA 4F03A 2H30A 1O8WA 3QPMA 4Z7XA 1XOAA 1OAZA 2L5OA 5CRHA 2H0GA 3TCOA 1NHYA 4JR4A 4TR1B 3APSA 5AIVA 4DVCA 4EDYA 4KA0A 1MDKA 1TRSA 4PNFA 3KIJA 4NPBA 1YEXA 2TRXA 1YZXA 5B8BA 3TOUA 1XWCA 2VCVA 3QMXA 1QUWA 3HYPA 2LJKA 3CHXC 4MH3A 3DVXA 2TRCP 2C0DA 1WIKA 5D73A 3GKMA 1M99A 2FWEA 1EZKA 3MDKA 2HE3A 3F6FA 3ERFA 1U88A 3D4MA 4NAXA 2C8UA 4IJ3A 3UVTA 2M72A 4MDCA 3KEBA 2IPAA 5DQYA 2HRFA 2R6KA 2H73A 3A2VA 1YY7A 2YJ7A 4ZXGA 3BJ5A 3US3A 4OO4A 1ERVA 3DIEA 3QDNA 3GL3A 1SYXA 1IYHA 4BIKA 1GTUA 2UV8G 2DMMA 3LORA 3TKRA 1B9YC 1S3RA 1ML6A 2I1UA 2X49A 1S3AA 5DAKB 2K8SA 1YQ1A 1NHOA 3N5OA 1LU4A 1K0DA 2J23A 1Y25A 4I97A 2YV9A 5LNKe 2PWJA 3DWVA 3H8QA 1X9WB 4AKHA 1PD21 2KP1A 4OFNA 1WPIA 3WD6A 3CRTA 2PUKC 5CRDA 4IQAA 1Z5YE 2YJHA 1EP7A 2B6MA 3IA1A 2C3QA 1JHBA 3TOTA 4FO5A 4ECBA 3IXRA 4QQ7A 1QGVA 2YWOA 1ZMAA 3IV4A 2OE0A 1N2AA 4ZBBA 4KB3A 2YCDA 1EOGA 1AQWA 4CDOA 5COHA 3HY2A 1M2DA 3TKQA 2B5XA 2EIRA 4X0XA 4ZB8A 5AN1A 1G7OA 2H76A 4LL4B 2OT3A 3D22A 3G7JA 3G7YA 2N5AA 3K8NA 1KTEA 1GWCA 2L59A 3TJGA 4GQFA 4V1Ag 2I3YA 1YKAA 1PKZA 2AJQB 2CAQA 3BD2A 4I6XA 2H0HA 1W4VA 4O92A 3U6VA 1F6MC 1M9AA 3GMFA 22GSA 2MBSA 4GLTA 3H4KA 1TXUA 2HLSA 1AQVA 3R3EA 4PUFC 3UARA 3A5WA 1VF2A 1XG8A 5HR1A 3CXGA 4L5LA 1ABAA 3CQFA 3ZL5A 4GTUA 1GTBA 4KAEA 3C73A 1GSQA 2RUEA 1THXA 3IAS2 1M9BA 3GTUB 3C71A 12GSA 2X4AA 3A2WA 4AJ6A 3RBTA 2DJKA 4K7IA 3LYKA 2O8VB 1XWGA 3NOFA 4Z2TA 3VPTA 1F37A 1M0UA 1S4BP 2LUSA 3HZ8A 2BMXA 2CX4A 1KNGA 1S3DA 4FIWA 4ZB7A 1WP0A 2LJRA 3HDCA 4MNNA 1OE8A 1FB6A 1J08A 5F8BA 1KEBA 1YF0A 2LSTA 4TN8A 1BAYA 4I8BA 3FY7A 2LNTA 2REMA 5GZZB 1O8XA 3RFRC 4ZL8A 2ES7A 2L6CA 19GSA 1VF3A 3D5JA 2RM5A 1YEWC 2DIZA 4RQXA 4ECCA 4MK3A 4EDZA 3IBHA 2DJ1A 2CT6A 2YWMA 3UBKA 4ZILA 4MZBA 3EWLA 1Q98A 3VI5A 3O6TA 4J56E 2VKZG 4LL1B 1JLVA 4MZCA 4O5QA 1MDIA 2HNLA 2WVYA 2HRAA 1J9BA 4ULXA 4TXOA 1V9WA 3LXZA 2QA1A 2OBKA 4HSCX 2B1KA 2ON7A 2CVKA 1T7PB 3VPQA 4NXIA 1H4OA 3CSJA 4ECJA 2VCZA 2O85A 4AKGA 3I43A 3P90A 4IELA 5EL8A 1TTZA 3GIXA 3ZFBA 3EC3A 4X43A 1UC7A 2WB9A 2MMAA 4XS6A 2WW3A 3QAGA 3P2AA 1BG5A 4HDEA 4TXOB 3ZTLA 2V2GA 3GURA 4KSMA 4G0KA 5ECIB 3ME7A 5CRGA 2MMNA 2LRNA 2VLTA 1GTIA 3M8NA 2L6DA 4DSQA 2RIIA 4I2TA 4XRAA 1A0FA 3CYNA 1K0CA 5DJMA 1B48A 3BOAA 3APQA 1H75A 2YV7A 5A5HA 3UEMA 4YKGA 4ILFA 3L0HA 2V32A 5IOXA 4IVFA 4EC0A 2WS2A 1PQNA 4HJMA 2GT5A 1F2EA 1SU9A 4JZQA 1JZWA 4V2LA 4G0IA 1ZYPA 1GSSA 3NIVA 4KDUA 3DYRA 4KNDA 2O5VA 3APOA 4E68A 1HNAA 2CV4A 4IW9A 5A5HB 2HRNA 3VWUA 3IRAA 5G1LA 3WT1A 4MMMA 2GSQA 2AUVA 2V1MA 5B7CA 3LYPA 1XWBA 2R0CA 2IMFA 1Z6NA 3GSSA 1GLPA 2E2MA 3TJBA 1XZOA 2OADA 4XHMA 4Q5NA 5DALA 3LXTA 2PMTA 4KSOA 1RK4A 3P7XA 4RUVA 1TI1A 2L57A 2H71A 6GSUA 4D73A 3FR9A 4PGTA 4AKXB 2CQ9A 1HD2A 1ZGNA 3GX8A 2CX3A 4PURA 5IMFA 2GQKA 2H75A 2I81A 1KBNA 3RPNA 2WVXA 5DALB 1THOA 3ISOA 5C04A 3HMJG 4E8EA 2OKAA 4D73B 5ECOB 4YQVA 1RQMA 2QKEA 2OE1A 4AI6A 2FWHA 1SD9A 2R0GA 10GSA 3ZLPA 1OVNA 4IP1A 5G30A 2AB6A 1TKDB 5D9TA 2L4CA 3KP9A 1SL1B 5A34A 3QD9A 2C0FA 2WVXB 1SL0B 1GULA 5G31A 2P31A 4OO5A 2AHEA 2YZHA 1O81A 4BL7A 5ECLB 4K2XA 3DRNA 2H8LA 1I9DA 2C0EA 4BA7A 1OKTA 5D8IA 5KOWA 1TOFA 1FVKA 1YKCA 5F07A 1TK0B 5A34B 5J4VA 1A0RP 4POBA 1ON4A 4LMVA 16GSA 2GDRA 4BPYA 4BL7B 2WCIA 3HXSA 3J7Yb 2BJXA 1BEDA 3ZMKA 2MBTA 4KW6A 1XPVA 1PA3A 3WGXA 3N9JA 3UAPA 5H5RA 1PL1A 2P5RA 4MPFA 2XC2A 2IWTA 4MH2A 3PINA 4AKIA 2H0IA 1UVZA 3L9SA 3O3TA 5EPFA 3VURA 4G0LA 2YOIA 5D93A 4YAPA 3F6DA 1TU8A 5CO3A 5IO2A 1I1IP 1FAAA 2A2PA 3CSHA 3IC4A 2GGTA 1T4YA 4Q5QA 4V2NA 4ZBDA 1X9MB 2QC7A 2PVOC 3DD3A 3BCKA 5L71A 4EE0A 3JCML 3M0FA 2WW0A 5J3RA 2X8HA 1FHEA 1XFLA 3QAVA 1V2AA 3VWXA 1BYEA 4O5RA 1RW1A 5C00A 2H01A 2GSTA 4MJEA 4TXVA 4F2IA 5KN2A 4EVMA 2RUFA 1HNBA 5HFKA 3SWLA 1O73A 2EFDA 1URMA 2XBIA 2A2SA 4K6XA 4J57E 2GSSA 3VI7A 4RQRA 4POKA 4ISDA 3KP8A 1DE2A 4XS1A 5HR3A 1EOHA 4XRDA 4HOJA 3S9FA 3Q19A 1TRUA 2JADA 3CTGA 4MP4A 4V2MA 3H1NA 4JBBA 2GLRA 2V6KA 3FR3A 1FOVA 1UA5A 5CNWA 3ZREA 3LG6A 1T8EB 2CZ3A 1GSEA 2NTOA 2ZNMA 3F3QA 3I6AA 4PNGA 3SBCA 5IMAA 4MJCA 1QMVA 2FUG2 4TVEA 4IP6A 1MEKA 3KCMA 1MDJA 1Z9HA 5DDLA 5G5FA 4BWQA 3E3EA 5HR0A 5INYA 4K0NA 2FA4A 3TKSA 1B8XA 4DSRA 3HVVA 4YQMA 1X5EA 4ML1A 2IL3A 1GUKA 2K6VA 3RDWA 3HD5A 4Q5RA 5IOWA 2IFQA 5G5EA 4OMVA 20GSA 1ERUA 5EY6A 3DEXA 1EGOA 2XPEA 3KTLA 3ZYWA 1FO5A 2YWIA 2FA8A 1EV9A 6GSVA 1G7EA 3Q6OA 1TI3A 3A3TA 2WFCA 3IOSA 1XXUA 5FWGA 2RLIA 4ID0A 1X5CA 4ZB6A 1A8YA 4YQUA 2PGTA 1YEPA 1ACVA 2CAIA 2JZSA 2IFQB 3FRCA 3G7IA 5B6MA 4WBRD 4ZIJA 3ZVJA 2G0FA 2WW2A 3KGKA 2VD0A 3KMOA 2JU5A 3FZAA 2PU9C 1ZYEA 1O6JA 2C1YA 2ON5A 3C1SA 2H74A 4PQHA 4Z2RA 2PVQA 5HFIA 5ECNB 4IBPA 1YVLA 1X9SB 3TRQA 1XCCA 3PH9A 2MMOA 1NSWA 1TRWA 1ILOA 5GSTA 4HZ4A 1T3BA 2FLSA 4KGIA 4PXOA 5JWOB 13GSA 2HSMA 1WJKA 4QL9A 3QAWA 1B9XC 2YN1A 1WOUA 3DKSA 5ECHB 4ECIA 1BQ7A 3VFIA 5DQSA 2F8AA 4IGJA 3BCIA 1YJ6A 4GQCA 3TKPA 3EYTA 3M9KA 4XS4A 3IK7A 3RGBC 2QSIA 2B1LA 4FYBA 3EU4A 3LWAA 2G2QA 11GSA 3E0UA 1TU7A 4WXTA 2AAWA 3W6GA 4CW9A 1GUMA 3DGQA 2VCXA 4PHZC 2JSYA 4POLA 3GUSA 4TR4A 1HNCA 2YP6A 2VL9A 3CMIA 5DJLA 4GDFA 1K0NA 4G2EA 1Y6EA 1GLQA 2ALBA 1BF5A 5IPGA 1PFOA 3CSIA 2WRTA 1ERTA 1TRVA 1JLWA 2VLUA 1E6BA 4XS4B 4W66A 4MF5A 3ED3A 3GYKA 5AIXA 3KMNA 3U5RE 4KH7A 4EUYA 2N5FA 2GQMA 4EIPA 1USBA 1V40A 2DJ0A 1DSBA 2J9HA 4PUAA 4N3ZA 3TGZA 3FR6A 1T00A 1R5PA 4G01A 3FKFA 5LD0A 2R4VA 4KCEA 4WKWA 1V58A 1MD3A 1LBKA 2LJAA 4POMA 5J9CA 2VLVA 2IMDA 5KN3A 2OA7A 1Z7PA 2ZUPA 5ECQB 1N8JA 4MF7A 1F9MA 1LJRA 1VRSD 1FVJA 2XHFA 4MA9A 1SJIA 18GSA 2DJ3A 4OCEA 1DBYA 2H1BA 5BRTA 3A2XA 1F3BA 3EMPA 5G1KA 5ECKB 3O76A 2HQTA 2ZCTA 4AJ7A 4N10A 2VM2A 1XW5A 3RAZA 2I9HA 2PPTA 3LW9A 3DMLA 1WMJA 1SENA 1NW2A 1GUHA 5EVOA 4G19A 2VAFA 4TOPA 6GSTA 1PSQA 1ZZYA 4K1FA 4K7NA 2CZ2A 1VF1A 3F4RA 3FHKA 1MTCA 1OKDA 1OC8A 4HQSA 3KXOA 3GKNA 1WE0A 1PKWA 4ZL7A 1DUGA 5JWRB 2KUCA 3IC8A 5KEJA 2YZUA 4NHZA 2D2ZA 3D21A 2IMIA 2H6YA 2GT6A 2HZFA 3PGTA 1JFUA 2P0GA 5CP1A 2QGVA 2NPBA 3RHBA 3ZVJD 5ECRB 5J4UA 1SVLA 5DCHA 4WR5A 1GSDA 4FQUA 1UN2A 4GSTA 4PI2C 1K0AA 5D9VA 2NDOA 1ZYQB 2OACA 4ZB9A 3G9BA 2KOKA 3QOUA 4IN0A 5B6NA 4O32A 2HFDA 1EWXA 1TK5B 3QFAC 3RHCA 4ACSA 3UJ1A 3LSZA 4EF0A 1PN9A 3EINA 3C8EA 2WULA 1JZOA 4ICYA 1XBSA 5KN1A 4K9ZA 1ZL9A 5J9BA 2M80A 3ZZXA 2H6XA 4BWSA 3EMXA 4AJ8A 5J5NA 5ECPB 1OE7A 4IQ1A 4J2FA 1R7HA 3IPZA 3V1WA 3IHGA 1FB0A 3FZ9A 3WYWA 5A4VA 1M2BA 3CRUA 3GX0A 4N0VA 3HJMA 2GVPA 4HUAA 1WWJA 3GNJA 2XPDA 1N25A 1K3YA 2HSHA 1QK8A 2FNOA 3M1GA 4GXZA 3UIWA 1G0TA 2PERA 2KHPA 2GZPA 1XW9A 2CVDA 4WR4A 3KD0A 1K0OA 3PR8A 9GSSA 3KM6A 1GP1A 2HSNA 4USSA 2GZZA 4CY8A 7GSSA 1QFNA 2LS5A 2YWNA 1HQOA 3HVSA 4L0UA 3L9UA 3NZNA 2A2RA 5CRWA 4KDYA 4MABA 5JCUA 4QMKA 1A2JA 4PQIA 1B4PA 4JEDA 2E2GA 4FH8A 3VWWA 2GTUA 2X8CA 1PX6A 5H5QA 2OJLA 3A5IA 4HZ2A 4KCAA 2HSNB 5ECSA 2KP2A 2L5LA 3TJJA 1JZDA 5ECMB 2FWGA 2E7PA 3WT2A 3QR6A 3MIXA 3HA9A 1U3IA 2IMKA 3KZQA 1A2MA 5DBQA 4N30A 3EE2A 8GSSA 4F82A 3LFLA 4OFMA 1XW6A 1JZRA 4OFTA 3W8SA 5CYYA 1GL8A 3UOMA 3IR4A 2H6ZA 2EC4A 3GHAA 3BBYA 1BG1A 4HJ2A 5F0GA 2DKIA 3ZIJA 4TR1A 5HR2A 4FYCA 2X99A 2E0QA 4XTSA 2O87A 2M46A 4ML6A 2H1DA 1SVOA 3GSTA 1OC3A 2LEGA 2R37A 5ABRA 1G6WA 3LGCA 1VGLA 4EO3A 2H1LA 3GV1A 1PRXA 2C80A 1R4WA 2WZSA 2OBIA 2DSAA 4IHUA 4G9HA 5GAND 5FHIA 2JACA 3TRPA 4X4JA 1FG4A 1GRXA 4PTSA 1HYUA 3ME8A 3GFKA 1PGTA 3VK9A 4DEJA 5IMVA 1M3IA 2MYGA 3P8WA 1A23A 4F0CA 2O36A 5G2ZA 3GA4A 1TP9A 3D4TA 2YANA 3I69A 1SK1A 4P3YB 2DKHA 3GH9A 2VCWA 3ERWA 2JSZA 3HVNA 5D9WA 3LEFA 4L0WA 3CWGA 1QXHA 2PN8A 4G10A 4GCIA 3C1RA 3UMAA 1GSYA 3ZITA 4PX1A 3TJFA 3TDGA 2F51A 5JWQB 2WZ9A 4WBJA 5FT3A 2R5GA 1VF4A 5J47A 2VM1A 5AISA 1XIYA 3M9JA 4BVYA 4TR0A 4F0BA 1A8LA 3ERGA 4EXJA 3QCPA 4JU5A 2A4VA 4GSSA 1CQHA 3UVHA 1FOHA 2OE3A 1SJ6A 5DAKA 4NV5A 5JCGA 4K7OA 1E2YA 3QFBC 2MMZA 3HZ4A 4HI7A 3WGDA 2IMEA 4HQZA 5AGYA 5J41A 4RI7A 4BVYB 4O5UA 2FD3A 2AYTA 4MPGA 2NBSA 1Z6MA 1V57A 1K3LA 5A4UA 4I5QA 1TDIA 2JZTA 2K9FA 2V6OA 4WETA 4GWRA 4IKHA 4L8EA 2I4AA 4K8MA 4GF0A 4YH2A 1K3OA 3DXBA 2VUPA 1IYIA 3HCZA 6GSYA 5H5SA 2H66A 1SVMA 1EGRA 2EFEA 3MAKA 2FWFA 3L78A 1SJZA 1AC1A 5A5KA 1Z3EA 5IMCA 3AY8A 2FCHA 4OWYA 1AAZA 1EV4A 1ERWA 2R3XA 4ZBAA 5KOXA 4EIQA 3F4TA 2H72A 2GSRA 1AUCA 1ZYNA 4TRXA 3F8UA 4H86A 1GNEA 1EEMA 3E9JB 2GQLA 3LQ7A 2FY6A 3EURA 5F06A 1R5AA 1O85A 3MYDA 5CAXA 2EFHA 2WW1A 2YPMA 3UL3A 3ZRDA 2DC5A 5ENUA 2B7JA 3IHQA 2EIQA 2VIMA 1T1VA 5ID2A 3FMWA 5D96A 2C4JA 5IMZA 2FHEA 4K2DA 3MSZA 2IN3A 1BX9A 5A1NA 1PX7A 3GTUA 4KX4A 2IIYA 4KUNA 4ZL9A 4EKZA 4QL7A 1OC9A 4N0ZA 2B5YA 2HSMB 2WVZA 2H1GA 2LV3A 3TKSC 2DMLA 2VL3A 2VOCA 4JRRA 3GKKA 3UBLA 5ID2B 1AQXA 6GSXA 2H1AA 1PN0A 2HI7A 2X8GA 2UZ8A 5A1NB 4MF6A 3TU3B 4LLRA 1Z7RA 4X1UA 5B8AA 1OC9B 3FK8A 4KF9A 4O7HA 2NVLA 4MZWA 1AW9A 2O3EA 4L5OA 3KJYA 1X5DA 2C3TA 2CA8A 3FEUA 5HQPA 2LNSA 4JE1A 4GSNA 1OYJA 3TRXA 2LRTA 2YNXA 1PMTA 3ZIVA 2DLXA
chains in the Genus database with same CATH topology
3RPPA 2VO4A 1W89A 2Z9SA 1SD8A 1TXXA 3FW2A 3J7Yk 3LJRA 1XVQA 3HJOA 4V1Ap 2HYXA 4MCUA 3ZMLA 4AGSA 1GTAA 2VD1A 2MZCA 1YF1A 2DJ2A 1SKWB 17GSA 2HSYA 3HJPA 5IO0A 1X0RA 3Q18A 3F3RA 4TR3A 4NHWA 1XWKA 3GH6A 4FYUA 4K5SA 3ZFLA 3WGEA 1FW1A 2AV4A 1A24A 1TW9A 2L4QA 2LQQA 4YKFA 3C7MA 5KN0A 1TJDA 3H93A 4K0GA 3GKXA 3H79A 4LMWA 4CY6A 3L4NA 4A5PA 14GSA 2RM6A 3EU3A 5IM9A 6GSWA 2PBJA 3EPTA 5IPHA 1CQGA 3FZ5A 2DBCA 3D0ZA 4OD7A 3HHVA 2VL2A 2JL4A 4HU7A 4HS1A 2R2JA 2V41A 1U6TA 2K8VA 1T4ZA 2P5QA 1NM3A 1XOBA 4TKYA 1ZCPA 1YDKA 4KE3A 1U87A 1SK2A 3HKRA 3MNGA 2DJJA 5GAPD 1MD4A 5BMUA 3F9UA 4HU9A 1SKSB 4TW5A 3VLNA 3CBUA 5E59A 1WRYA 2F9SA 2GS3A 4NWYA 1B4QA 2O7KA 1K0BA 4I2UA 1XVWA 1AXDA 1K0MA 2DIYA 5IQYA 5J4YA 3FZ4A 3W8JA 4E8HA 1BJXA 2LRCA 2X64A 2JZRA 3CTFA 2BTOT 4BVXA 2WGRA 2C0GA 5BMUB 4PQ1A 5ELGA 4DSSA 1G6YA 2LTKA 5E4WA 4KDXA 1S3CA 3MWHA 1SK0A 2HT9A 4NV2A 3TUEA 2WDUA 3TB2A 3IE3A 3GL5A 1ST9A 3KTBA 5IIZA 4MJBA 1ZOFA 3TKSE 5ELAA 4BVXB 1J0FA 2VCTA 2FGXA 2F3MA 4IJIA 3M3MA 3HVXA 4DSSB 1M7TA 2CVBA 1M2AA 1GNWA 3L9VA 1SKRB 1O7UA 4Q5FA 2HZEA 4F9ZA 6GSSA 1XWAA 5CREA 5D9XA 2TIRA 1A2LA 3GN3A 3EVIA 3FYGA 2A4HA 1EEJA 4EL1A 4GRFA 5A4WA 4XIHA 2R0PA 3PPUA 3KH7A 5HFGA 4RI6A 4WF4A 2H19A 3OR5A 2HRKA 2WJUA 5GSSA 5J40A 2B3SA 2C3NA 1F3AA 3DVWA 2HZEB 3F4SA 2K18A 4YAVA 5LCZA 1R26A 2H70A 4LA1A 3KH9A 5DVBA 2EIOA 1DE1A 2B7KA 4N11A 4Z2UA 2XBQA 4HEA2 4XCSA 1AIUA 2F8FA 1TK8B 3D6IA 2VL2C 2HRKB 4WF5A 3VWVA 1U3AA 5DCGA 3GRXA 1GSFA 1GH2A 3F63A 1V98A 2QA2A 1C72A 4WEYA 2HXKA 5F05A 1EP8A 3IDVA 5IMDA 4NMUA 3IK9A 4MLYA 1Y1UA 3F0IA 2VCQA 3I9V2 2GZYA 2B5EA 4CHSA 1QQ2A 2LQOA 1Q4JA 2KLXA 1SL2B 2N5BA 3IAM2 1PL2A 3Q74A 5JCWA 2O89A 1SYRA 4AF2A 2IJYA 3TJKA 3R2QA 4K5RA 4OCFA 4IS0A 2LKUA 1I5GA 4JR6A 1GSUA 2EFCA 4MJAA 4F03A 2H30A 1O8WA 3QPMA 4Z7XA 1XOAA 1OAZA 2L5OA 5CRHA 2H0GA 3TCOA 1NHYA 4JR4A 4TR1B 3APSA 5AIVA 4DVCA 4EDYA 4KA0A 1MDKA 1TRSA 4PNFA 3KIJA 4NPBA 1YEXA 2TRXA 1YZXA 5B8BA 3TOUA 1XWCA 2VCVA 3QMXA 1QUWA 3HYPA 2LJKA 4MH3A 3DVXA 2TRCP 2C0DA 1WIKA 5D73A 3GKMA 1M99A 2FWEA 1EZKA 3MDKA 2HE3A 3F6FA 3ERFA 1U88A 3D4MA 4NAXA 2C8UA 4IJ3A 3UVTA 2M72A 4MDCA 3KEBA 2IPAA 5DQYA 2HRFA 2R6KA 2H73A 3A2VA 1YY7A 2YJ7A 4ZXGA 3BJ5A 3US3A 4OO4A 1ERVA 3DIEA 3QDNA 3GL3A 1SYXA 1IYHA 1GTUA 2UV8G 2DMMA 3LORA 3TKRA 1B9YC 1ML6A 2I1UA 2X49A 1S3AA 5DAKB 2K8SA 1YQ1A 1NHOA 3N5OA 1LU4A 1K0DA 2J23A 1Y25A 4I97A 2YV9A 5LNKe 2PWJA 3DWVA 3H8QA 1X9WB 4AKHA 1PD21 2KP1A 4OFNA 1WPIA 3WD6A 3CRTA 2PUKC 5CRDA 4IQAA 1Z5YE 2YJHA 1EP7A 2B6MA 3IA1A 2C3QA 1JHBA 3TOTA 4FO5A 4ECBA 3IXRA 4QQ7A 1QGVA 2YWOA 1ZMAA 3IV4A 2OE0A 1N2AA 4ZBBA 4KB3A 2YCDA 1EOGA 1AQWA 4CDOA 5COHA 3HY2A 1M2DA 3TKQA 2B5XA 2EIRA 4X0XA 4ZB8A 5AN1A 1G7OA 2H76A 4LL4B 2OT3A 3D22A 3G7JA 3G7YA 2N5AA 3K8NA 1KTEA 1GWCA 2L59A 3TJGA 4GQFA 4V1Ag 2I3YA 1YKAA 1PKZA 2AJQB 2CAQA 3BD2A 4I6XA 2H0HA 1W4VA 4O92A 3U6VA 1F6MC 1M9AA 3GMFA 22GSA 2MBSA 4GLTA 3H4KA 1TXUA 2HLSA 1AQVA 3R3EA 4PUFC 3UARA 3A5WA 1VF2A 5HR1A 3CXGA 4L5LA 1ABAA 3ZL5A 4GTUA 1GTBA 4KAEA 3C73A 1GSQA 2RUEA 1THXA 3IAS2 1M9BA 3GTUB 3C71A 12GSA 2X4AA 3A2WA 4AJ6A 3RBTA 2DJKA 4K7IA 3LYKA 2O8VB 1XWGA 3NOFA 4Z2TA 3VPTA 1F37A 1M0UA 2LUSA 3HZ8A 2BMXA 2CX4A 1KNGA 1S3DA 4FIWA 4ZB7A 1WP0A 2LJRA 3HDCA 4MNNA 1OE8A 1FB6A 1J08A 5F8BA 1KEBA 1YF0A 2LSTA 4TN8A 1BAYA 4I8BA 3FY7A 2LNTA 2REMA 5GZZB 1O8XA 4ZL8A 2ES7A 2L6CA 19GSA 1VF3A 3D5JA 2RM5A 2DIZA 4RQXA 4ECCA 4MK3A 4EDZA 3IBHA 2DJ1A 2CT6A 2YWMA 3UBKA 4ZILA 4MZBA 3EWLA 1Q98A 3VI5A 3O6TA 4J56E 2VKZG 4LL1B 1JLVA 4MZCA 4O5QA 1MDIA 2HNLA 2HRAA 1J9BA 4ULXA 4TXOA 1V9WA 3LXZA 2QA1A 2OBKA 2B1KA 2ON7A 2CVKA 1T7PB 3VPQA 4NXIA 1H4OA 3CSJA 4ECJA 2VCZA 2O85A 4AKGA 3I43A 3P90A 4IELA 5EL8A 1TTZA 3GIXA 3ZFBA 3EC3A 4X43A 1UC7A 2WB9A 2MMAA 4XS6A 3QAGA 3P2AA 1BG5A 4HDEA 4TXOB 3ZTLA 2V2GA 3GURA 4KSMA 4G0KA 3ME7A 5ECIB 5CRGA 2MMNA 2LRNA 2VLTA 1GTIA 3M8NA 2L6DA 4DSQA 2RIIA 4I2TA 4XRAA 1A0FA 3CYNA 1K0CA 5DJMA 1B48A 3BOAA 3APQA 1H75A 2YV7A 5A5HA 3UEMA 4YKGA 4ILFA 3L0HA 2V32A 5IOXA 4IVFA 4EC0A 2WS2A 1PQNA 4HJMA 2GT5A 1F2EA 1SU9A 4JZQA 1JZWA 4V2LA 4G0IA 1ZYPA 1GSSA 3NIVA 4KDUA 3DYRA 4KNDA 2O5VA 3APOA 4E68A 1HNAA 2CV4A 4IW9A 5A5HB 2HRNA 3VWUA 3IRAA 5G1LA 3WT1A 4MMMA 2GSQA 2AUVA 2V1MA 5B7CA 3LYPA 1XWBA 2R0CA 2IMFA 1Z6NA 3GSSA 1GLPA 2E2MA 3TJBA 1XZOA 2OADA 4XHMA 4Q5NA 5DALA 3LXTA 2PMTA 4KSOA 1RK4A 3P7XA 4RUVA 1TI1A 2L57A 2H71A 6GSUA 4D73A 3FR9A 4PGTA 4AKXB 2CQ9A 1HD2A 1ZGNA 3GX8A 2CX3A 4PURA 5IMFA 2GQKA 2H75A 2I81A 1KBNA 3RPNA 5DALB 1THOA 3ISOA 5C04A 3HMJG 4E8EA 2OKAA 4D73B 5ECOB 4YQVA 1RQMA 2QKEA 2OE1A 4AI6A 2FWHA 1SD9A 2R0GA 10GSA 3ZLPA 1OVNA 4IP1A 5G30A 2AB6A 1TKDB 5D9TA 2L4CA 3KP9A 1SL1B 5A34A 3QD9A 2C0FA 1SL0B 1GULA 5G31A 2P31A 4OO5A 2AHEA 2YZHA 1O81A 4BL7A 5ECLB 4K2XA 3DRNA 2H8LA 1I9DA 2C0EA 4BA7A 1OKTA 5D8IA 5KOWA 1TOFA 1FVKA 1YKCA 5F07A 1TK0B 5A34B 5J4VA 1A0RP 4POBA 1ON4A 4LMVA 16GSA 2GDRA 4BPYA 4BL7B 2WCIA 3HXSA 3J7Yb 2BJXA 1BEDA 3ZMKA 2MBTA 4KW6A 1XPVA 1PA3A 3WGXA 3N9JA 3UAPA 5H5RA 1PL1A 2P5RA 4MPFA 2XC2A 2IWTA 4MH2A 3PINA 4AKIA 2H0IA 1UVZA 3L9SA 3O3TA 5EPFA 3VURA 4G0LA 2YOIA 5D93A 4YAPA 3F6DA 1TU8A 5CO3A 5IO2A 1FAAA 2A2PA 3CSHA 3IC4A 2GGTA 1T4YA 4Q5QA 4V2NA 4ZBDA 1X9MB 2QC7A 2PVOC 3DD3A 3BCKA 5L71A 4EE0A 3JCML 3M0FA 5J3RA 2X8HA 1FHEA 1XFLA 3QAVA 1V2AA 3VWXA 1BYEA 4O5RA 1RW1A 5C00A 2H01A 2GSTA 4MJEA 4TXVA 4F2IA 5KN2A 4EVMA 2RUFA 1HNBA 5HFKA 3SWLA 1O73A 2EFDA 1URMA 2XBIA 2A2SA 4K6XA 4J57E 2GSSA 3VI7A 4RQRA 4POKA 4ISDA 3KP8A 1DE2A 4XS1A 5HR3A 1EOHA 4XRDA 4HOJA 3S9FA 3Q19A 1TRUA 2JADA 3CTGA 4MP4A 4V2MA 3H1NA 4JBBA 2GLRA 2V6KA 3FR3A 1FOVA 1UA5A 5CNWA 3ZREA 3LG6A 1T8EB 2CZ3A 1GSEA 2NTOA 2ZNMA 3F3QA 3I6AA 4PNGA 3SBCA 5IMAA 4MJCA 1QMVA 2FUG2 4TVEA 4IP6A 1MEKA 3KCMA 1MDJA 1Z9HA 5DDLA 5G5FA 4BWQA 3E3EA 5HR0A 5INYA 4K0NA 2FA4A 3TKSA 1B8XA 4DSRA 3HVVA 4YQMA 1X5EA 4ML1A 2IL3A 1GUKA 2K6VA 3RDWA 3HD5A 4Q5RA 5IOWA 2IFQA 5G5EA 4OMVA 20GSA 1ERUA 5EY6A 3DEXA 1EGOA 2XPEA 3KTLA 3ZYWA 1FO5A 2YWIA 2FA8A 1EV9A 6GSVA 1G7EA 3Q6OA 1TI3A 3A3TA 2WFCA 3IOSA 1XXUA 5FWGA 2RLIA 4ID0A 1X5CA 4ZB6A 1A8YA 4YQUA 2PGTA 1YEPA 1ACVA 2CAIA 2JZSA 2IFQB 3FRCA 3G7IA 5B6MA 4WBRD 4ZIJA 3ZVJA 2G0FA 3KGKA 2VD0A 3KMOA 2JU5A 3FZAA 2PU9C 1ZYEA 1O6JA 2C1YA 2ON5A 3C1SA 2H74A 4PQHA 4Z2RA 2PVQA 5HFIA 5ECNB 4IBPA 1YVLA 1X9SB 3TRQA 1XCCA 3PH9A 2MMOA 1NSWA 1TRWA 1ILOA 5GSTA 4HZ4A 1T3BA 2FLSA 4KGIA 4PXOA 5JWOB 13GSA 2HSMA 1WJKA 4QL9A 3QAWA 1B9XC 2YN1A 1WOUA 3DKSA 5ECHB 4ECIA 1BQ7A 3VFIA 5DQSA 2F8AA 4IGJA 3BCIA 1YJ6A 4GQCA 3TKPA 3EYTA 3M9KA 4XS4A 3IK7A 2QSIA 2B1LA 4FYBA 3EU4A 3LWAA 2G2QA 11GSA 3E0UA 1TU7A 4WXTA 2AAWA 3W6GA 4CW9A 1GUMA 3DGQA 2VCXA 2JSYA 4POLA 3GUSA 4TR4A 1HNCA 2YP6A 2VL9A 3CMIA 5DJLA 4GDFA 1K0NA 4G2EA 1Y6EA 1GLQA 2ALBA 1BF5A 5IPGA 3CSIA 2WRTA 1ERTA 1TRVA 1JLWA 2VLUA 1E6BA 4XS4B 4W66A 4MF5A 3ED3A 3GYKA 5AIXA 3KMNA 3U5RE 4KH7A 4EUYA 2N5FA 2GQMA 4EIPA 1USBA 1V40A 2DJ0A 1DSBA 2J9HA 4PUAA 4N3ZA 3TGZA 3FR6A 1T00A 1R5PA 4G01A 3FKFA 5LD0A 2R4VA 4KCEA 4WKWA 1V58A 1MD3A 1LBKA 2LJAA 4POMA 5J9CA 2VLVA 2IMDA 5KN3A 2OA7A 1Z7PA 2ZUPA 5ECQB 1N8JA 4MF7A 1F9MA 1LJRA 1VRSD 1FVJA 2XHFA 4MA9A 1SJIA 18GSA 2DJ3A 4OCEA 1DBYA 2H1BA 5BRTA 3A2XA 1F3BA 3EMPA 5G1KA 5ECKB 3O76A 2HQTA 2ZCTA 4AJ7A 4N10A 2VM2A 1XW5A 3RAZA 2I9HA 2PPTA 3LW9A 3DMLA 1WMJA 1SENA 1NW2A 1GUHA 5EVOA 4G19A 2VAFA 4TOPA 6GSTA 1PSQA 1ZZYA 4K1FA 4K7NA 2CZ2A 1VF1A 3F4RA 3FHKA 1MTCA 1OKDA 1OC8A 4HQSA 3KXOA 3GKNA 1WE0A 1PKWA 4ZL7A 1DUGA 5JWRB 2KUCA 3IC8A 5KEJA 2YZUA 4NHZA 2D2ZA 3D21A 2IMIA 2H6YA 2GT6A 2HZFA 3PGTA 1JFUA 2P0GA 5CP1A 2QGVA 2NPBA 3RHBA 3ZVJD 5ECRB 5J4UA 1SVLA 5DCHA 4WR5A 1GSDA 4FQUA 1UN2A 4GSTA 1K0AA 5D9VA 2NDOA 1ZYQB 2OACA 4ZB9A 3G9BA 2KOKA 3QOUA 4IN0A 5B6NA 4O32A 2HFDA 1EWXA 1TK5B 3QFAC 3RHCA 4ACSA 3UJ1A 3LSZA 4EF0A 1PN9A 3EINA 3C8EA 2WULA 1JZOA 4ICYA 1XBSA 5KN1A 4K9ZA 1ZL9A 5J9BA 2M80A 3ZZXA 2H6XA 4BWSA 3EMXA 4AJ8A 5J5NA 5ECPB 1OE7A 4IQ1A 4J2FA 1R7HA 3IPZA 3V1WA 3IHGA 1FB0A 3FZ9A 3WYWA 5A4VA 1M2BA 3CRUA 3GX0A 4N0VA 3HJMA 2GVPA 4HUAA 1WWJA 3GNJA 2XPDA 1N25A 1K3YA 2HSHA 1QK8A 2FNOA 3M1GA 4GXZA 3UIWA 1G0TA 2PERA 2KHPA 2GZPA 1XW9A 2CVDA 4WR4A 3KD0A 1K0OA 3PR8A 9GSSA 3KM6A 1GP1A 2HSNA 4USSA 2GZZA 4CY8A 7GSSA 1QFNA 2LS5A 2YWNA 1HQOA 3HVSA 4L0UA 3L9UA 3NZNA 2A2RA 5CRWA 4KDYA 4MABA 5JCUA 4QMKA 1A2JA 4PQIA 1B4PA 4JEDA 2E2GA 4FH8A 3VWWA 2GTUA 2X8CA 1PX6A 5H5QA 2OJLA 3A5IA 4HZ2A 4KCAA 2HSNB 5ECSA 2KP2A 2L5LA 3TJJA 1JZDA 5ECMB 2FWGA 2E7PA 3WT2A 3QR6A 3MIXA 3HA9A 1U3IA 2IMKA 3KZQA 1A2MA 5DBQA 4N30A 3EE2A 8GSSA 4F82A 3LFLA 4OFMA 1XW6A 1JZRA 4OFTA 3W8SA 5CYYA 1GL8A 3UOMA 3IR4A 2H6ZA 2EC4A 3GHAA 3BBYA 1BG1A 4HJ2A 5F0GA 2DKIA 3ZIJA 4TR1A 5HR2A 4FYCA 2X99A 2E0QA 4XTSA 2O87A 2M46A 4ML6A 2H1DA 1SVOA 3GSTA 1OC3A 2LEGA 2R37A 5ABRA 1G6WA 3LGCA 1VGLA 4EO3A 2H1LA 3GV1A 1PRXA 2C80A 1R4WA 2OBIA 2DSAA 4IHUA 4G9HA 5GAND 5FHIA 2JACA 3TRPA 4X4JA 1FG4A 1GRXA 4PTSA 1HYUA 3ME8A 3GFKA 1PGTA 3VK9A 4DEJA 5IMVA 2MYGA 3P8WA 1A23A 4F0CA 5G2ZA 3GA4A 1TP9A 3D4TA 2YANA 3I69A 1SK1A 4P3YB 2DKHA 3GH9A 2VCWA 3ERWA 2JSZA 5D9WA 3LEFA 4L0WA 3CWGA 1QXHA 2PN8A 4G10A 4GCIA 3C1RA 3UMAA 1GSYA 3ZITA 4PX1A 3TJFA 3TDGA 2F51A 5JWQB 2WZ9A 4WBJA 5FT3A 2R5GA 1VF4A 5J47A 2VM1A 5AISA 1XIYA 3M9JA 4BVYA 4TR0A 4F0BA 1A8LA 3ERGA 4EXJA 3QCPA 4JU5A 2A4VA 4GSSA 1CQHA 3UVHA 1FOHA 2OE3A 1SJ6A 5DAKA 4NV5A 5JCGA 4K7OA 1E2YA 3QFBC 2MMZA 3HZ4A 4HI7A 3WGDA 2IMEA 4HQZA 5AGYA 5J41A 4RI7A 4BVYB 4O5UA 2FD3A 2AYTA 4MPGA 2NBSA 1Z6MA 1V57A 1K3LA 5A4UA 4I5QA 1TDIA 2JZTA 2K9FA 2V6OA 4WETA 4GWRA 4IKHA 4L8EA 2I4AA 4K8MA 4GF0A 4YH2A 1K3OA 3DXBA 2VUPA 1IYIA 3HCZA 6GSYA 5H5SA 2H66A 1SVMA 1EGRA 2EFEA 3MAKA 2FWFA 3L78A 1SJZA 1AC1A 5A5KA 1Z3EA 5IMCA 3AY8A 2FCHA 4OWYA 1AAZA 1EV4A 1ERWA 2R3XA 4ZBAA 5KOXA 4EIQA 3F4TA 2H72A 2GSRA 1AUCA 1ZYNA 4TRXA 3F8UA 4H86A 1GNEA 1EEMA 3E9JB 2GQLA 3LQ7A 2FY6A 3EURA 5F06A 1R5AA 1O85A 3MYDA 5CAXA 2EFHA 2YPMA 3UL3A 3ZRDA 2DC5A 5ENUA 2B7JA 3IHQA 2EIQA 2VIMA 1T1VA 5ID2A 3FMWA 5D96A 2C4JA 5IMZA 2FHEA 4K2DA 3MSZA 2IN3A 1BX9A 5A1NA 1PX7A 3GTUA 4KX4A 2IIYA 4KUNA 4ZL9A 4EKZA 4QL7A 1OC9A 4N0ZA 2B5YA 2HSMB 2H1GA 2LV3A 3TKSC 2DMLA 2VL3A 2VOCA 4JRRA 3GKKA 3UBLA 5ID2B 1AQXA 6GSXA 2H1AA 1PN0A 2HI7A 2X8GA 2UZ8A 5A1NB 4MF6A 3TU3B 4LLRA 1Z7RA 4X1UA 5B8AA 1OC9B 3FK8A 4KF9A 4O7HA 2NVLA 4MZWA 1AW9A 4L5OA 3KJYA 1X5DA 2C3TA 2CA8A 3FEUA 5HQPA 2LNSA 4JE1A 4GSNA 1OYJA 3TRXA 2LRTA 2YNXA 1PMTA 3ZIVA 2DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPP A;  2VO4 A;  1W89 A;  2Z9S A;  1SD8 A;  1TXX A;  3FW2 A;  3J7Y k;  3LJR A;  1XVQ A;  3HJO A;  4V1A p;  2HYX A;  4MCU A;  3ZML A;  4AGS A;  1GTA A;  2VD1 A;  2MZC A;  1YF1 A;  2DJ2 A;  1SKW B;  17GS A;  2HSY A;  3HJP A;  5IO0 A;  1X0R A;  3Q18 A;  3F3R A;  4TR3 A;  4NHW A;  1XWK A;  3GH6 A;  4FYU A;  3ZFL A;  3WGE A;  1FW1 A;  2AV4 A;  1A24 A;  1TW9 A;  2L4Q A;  2LQQ A;  3C7M A;  5KN0 A;  1TJD A;  3H93 A;  4K0G A;  3GKX A;  3H79 A;  4LMW A;  3L4N A;  14GS A;  2RM6 A;  3EU3 A;  5IM9 A;  6GSW A;  2PBJ A;  1CQG A;  5IPH A;  3FZ5 A;  2DBC A;  3D0Z A;  4OD7 A;  3HHV A;  2VL2 A;  2JL4 A;  4HU7 A;  4HS1 A;  2R2J A;  2V41 A;  1U6T A;  2K8V A;  1T4Z A;  2P5Q A;  1NM3 A;  1XOB A;  4TKY A;  1ZCP A;  1YDK A;  4KE3 A;  1U87 A;  1SK2 A;  3HKR A;  3MNG A;  2DJJ A;  5GAP D;  1MD4 A;  5BMU A;  3F9U A;  4HU9 A;  1SKS B;  4TW5 A;  3VLN A;  3CBU A;  5E59 A;  1WRY A;  2F9S A;  2GS3 A;  4NWY A;  1B4Q A;  2O7K A;  1K0B A;  4I2U A;  1XVW A;  1AXD A;  1K0M A;  2DIY A;  5IQY A;  3W8J A;  3FZ4 A;  4E8H A;  1BJX A;  2LRC A;  2X64 A;  2JZR A;  3CTF A;  2BTO T;  4BVX A;  2WGR A;  2C0G A;  4PQ1 A;  5ELG A;  4DSS A;  1G6Y A;  2LTK A;  5E4W A;  4KDX A;  1S3C A;  3MWH A;  1SK0 A;  2HT9 A;  4NV2 A;  3TUE A;  2WDU A;  3TB2 A;  3IE3 A;  3GL5 A;  1ST9 A;  3KTB A;  5IIZ A;  4MJB A;  1ZOF A;  3TKS E;  5ELA A;  4BVX B;  1J0F A;  2VCT A;  2FGX A;  2F3M A;  4IJI A;  3M3M A;  3HVX A;  4DSS B;  1M7T A;  2CVB A;  1M2A A;  1GNW A;  3L9V A;  1SKR B;  1O7U A;  4Q5F A;  2HZE A;  4F9Z A;  6GSS A;  1XWA A;  5CRE A;  5D9X A;  2TIR A;  1A2L A;  3GN3 A;  3EVI A;  3FYG A;  1EEJ A;  4EL1 A;  4GRF A;  5A4W A;  4XIH A;  3PPU A;  3KH7 A;  5HFG A;  4RI6 A;  4WF4 A;  2H19 A;  3OR5 A;  2HRK A;  2WJU A;  5GSS A;  2B3S A;  2C3N A;  1F3A A;  3DVW A;  2HZE B;  3F4S A;  2K18 A;  4YAV A;  5LCZ A;  1R26 A;  2H70 A;  4LA1 A;  3KH9 A;  5DVB A;  2EIO A;  1DE1 A;  2B7K A;  4N11 A;  2XBQ A;  4HEA 2;  4XCS A;  1AIU A;  2F8F A;  1TK8 B;  3D6I A;  2VL2 C;  2HRK B;  4WF5 A;  3VWV A;  1U3A A;  5DCG A;  3GRX A;  1GSF A;  1GH2 A;  3F63 A;  1V98 A;  1C72 A;  4WEY A;  2HXK A;  5F05 A;  1EP8 A;  3IDV A;  5IMD A;  4NMU A;  3IK9 A;  4MLY A;  3F0I A;  2VCQ A;  3I9V 2;  2GZY A;  2B5E A;  4CHS A;  1QQ2 A;  2LQO A;  1Q4J A;  2KLX A;  1SL2 B;  2N5B A;  3IAM 2;  1PL2 A;  3Q74 A;  5JCW A;  2O89 A;  1SYR A;  4AF2 A;  2IJY A;  3TJK A;  3R2Q A;  4OCF A;  4IS0 A;  2LKU A;  1I5G A;  4JR6 A;  1GSU A;  4MJA A;  4F03 A;  2H30 A;  1O8W A;  3QPM A;  4Z7X A;  1XOA A;  1OAZ A;  2L5O A;  5CRH A;  2H0G A;  3TCO A;  1NHY A;  4JR4 A;  4TR1 B;  3APS A;  5AIV A;  4DVC A;  4EDY A;  4KA0 A;  1MDK A;  1TRS A;  4PNF A;  3KIJ A;  4NPB A;  1YEX A;  2TRX A;  1YZX A;  5B8B A;  3TOU A;  1XWC A;  2VCV A;  3QMX A;  1QUW A;  3HYP A;  2LJK A;  4MH3 A;  3DVX A;  2TRC P;  2C0D A;  1WIK A;  5D73 A;  3GKM A;  1M99 A;  2FWE A;  1EZK A;  3MDK A;  2HE3 A;  3F6F A;  3ERF A;  1U88 A;  3D4M A;  4NAX A;  2C8U A;  4IJ3 A;  3UVT A;  2M72 A;  4MDC A;  3KEB A;  2IPA A;  5DQY A;  2HRF A;  2R6K A;  2H73 A;  3A2V A;  1YY7 A;  2YJ7 A;  4ZXG A;  3BJ5 A;  3US3 A;  4OO4 A;  1ERV A;  3DIE A;  3QDN A;  3GL3 A;  1SYX A;  1IYH A;  1GTU A;  2DMM A;  3LOR A;  3TKR A;  1B9Y C;  1ML6 A;  2I1U A;  1S3A A;  5DAK B;  2K8S A;  1YQ1 A;  1NHO A;  3N5O A;  1LU4 A;  1K0D A;  2J23 A;  1Y25 A;  4I97 A;  2YV9 A;  5LNK e;  2PWJ A;  3DWV A;  3H8Q A;  1X9W B;  1PD2 1;  2KP1 A;  4OFN A;  1WPI A;  3WD6 A;  3CRT A;  2PUK C;  5CRD A;  4IQA A;  1Z5Y E;  2YJH A;  1EP7 A;  2B6M A;  3IA1 A;  2C3Q A;  1JHB A;  3TOT A;  4FO5 A;  4ECB A;  3IXR A;  4QQ7 A;  1QGV A;  2YWO A;  1ZMA A;  3IV4 A;  2OE0 A;  1N2A A;  4ZBB A;  4KB3 A;  2YCD A;  1EOG A;  1AQW A;  4CDO A;  5COH A;  3HY2 A;  1M2D A;  3TKQ A;  2B5X A;  2EIR A;  4X0X A;  4ZB8 A;  5AN1 A;  1G7O A;  2H76 A;  4LL4 B;  3D22 A;  3G7J A;  3G7Y A;  2N5A A;  3K8N A;  1KTE A;  1GWC A;  2L59 A;  3TJG A;  4GQF A;  4V1A g;  2I3Y A;  1YKA A;  1PKZ A;  2AJQ B;  2CAQ A;  3BD2 A;  4I6X A;  2H0H A;  1W4V A;  4O92 A;  3U6V A;  1F6M C;  1M9A A;  3GMF A;  22GS A;  2MBS A;  4GLT A;  3H4K A;  2HLS A;  1AQV A;  3R3E A;  4PUF C;  3UAR A;  3A5W A;  1VF2 A;  5HR1 A;  3CXG A;  4L5L A;  1ABA A;  3ZL5 A;  4GTU A;  1GTB A;  4KAE A;  3C73 A;  1GSQ A;  2RUE A;  1THX A;  3IAS 2;  1M9B A;  3GTU B;  3C71 A;  12GS A;  3A2W A;  4AJ6 A;  3RBT A;  2DJK A;  4K7I A;  3LYK A;  2O8V B;  1XWG A;  3NOF A;  3VPT A;  1F37 A;  1M0U A;  2LUS A;  3HZ8 A;  2BMX A;  2CX4 A;  1KNG A;  1S3D A;  4FIW A;  1WP0 A;  2LJR A;  3HDC A;  1OE8 A;  1FB6 A;  1J08 A;  5F8B A;  1KEB A;  1YF0 A;  2LST A;  4TN8 A;  1BAY A;  4I8B A;  3FY7 A;  2LNT A;  2REM A;  5GZZ B;  1O8X A;  4ZL8 A;  2ES7 A;  2L6C A;  19GS A;  1VF3 A;  3D5J A;  2RM5 A;  2DIZ A;  4RQX A;  4ECC A;  4MK3 A;  4EDZ A;  3IBH A;  2DJ1 A;  2CT6 A;  2YWM A;  3UBK A;  4ZIL A;  4MZB A;  3EWL A;  1Q98 A;  3VI5 A;  3O6T A;  4J56 E;  4LL1 B;  1JLV A;  4MZC A;  1MDI A;  2HNL A;  2HRA A;  1J9B A;  4ULX A;  4TXO A;  1V9W A;  3LXZ A;  2OBK A;  2B1K A;  2ON7 A;  2CVK A;  1T7P B;  3VPQ A;  4NXI A;  1H4O A;  3CSJ A;  4ECJ A;  2VCZ A;  2O85 A;  3I43 A;  3P90 A;  4IEL A;  5EL8 A;  1TTZ A;  3GIX A;  3ZFB A;  3EC3 A;  4X43 A;  1UC7 A;  2WB9 A;  2MMA A;  4XS6 A;  3QAG A;  3P2A A;  1BG5 A;  4HDE A;  4TXO B;  3ZTL A;  2V2G A;  3GUR A;  4KSM A;  4G0K A;  3ME7 A;  5ECI B;  5CRG A;  2MMN A;  2LRN A;  2VLT A;  1GTI A;  3M8N A;  2L6D A;  4DSQ A;  2RII A;  4I2T A;  4XRA A;  1A0F A;  3CYN A;  1K0C A;  5DJM A;  1B48 A;  3BOA A;  3APQ A;  1H75 A;  2YV7 A;  3UEM A;  4ILF A;  3L0H A;  2V32 A;  5IOX A;  4IVF A;  4EC0 A;  2WS2 A;  1PQN A;  4HJM A;  2GT5 A;  1F2E A;  1SU9 A;  4JZQ A;  1JZW A;  4V2L A;  4G0I A;  1GSS A;  3NIV A;  4KDU A;  3DYR A;  4KND A;  3APO A;  1HNA A;  2CV4 A;  4IW9 A;  2HRN A;  3VWU A;  3IRA A;  5G1L A;  3WT1 A;  4MMM A;  2GSQ A;  2AUV A;  2V1M A;  5B7C A;  3LYP A;  1XWB A;  2IMF A;  1Z6N A;  3GSS A;  1GLP A;  2E2M A;  3TJB A;  1XZO A;  2OAD A;  4XHM A;  4Q5N A;  5DAL A;  3LXT A;  2PMT A;  4KSO A;  1RK4 A;  3P7X A;  4RUV A;  1TI1 A;  2L57 A;  2H71 A;  6GSU A;  4D73 A;  3FR9 A;  4PGT A;  2CQ9 A;  1HD2 A;  1ZGN A;  3GX8 A;  2CX3 A;  4PUR A;  5IMF A;  2GQK A;  2H75 A;  2I81 A;  1KBN A;  3RPN A;  5DAL B;  1THO A;  3ISO A;  5C04 A;  4E8E A;  2OKA A;  4D73 B;  5ECO B;  4YQV A;  1RQM A;  2QKE A;  2OE1 A;  2FWH A;  1SD9 A;  10GS A;  3ZLP A;  1OVN A;  4IP1 A;  5G30 A;  2AB6 A;  1TKD B;  5D9T A;  2L4C A;  3KP9 A;  1SL1 B;  3QD9 A;  2C0F A;  1SL0 B;  1GUL A;  5G31 A;  2P31 A;  4OO5 A;  2AHE A;  2YZH A;  1O81 A;  4BL7 A;  5ECL B;  3DRN A;  2H8L A;  1I9D A;  2C0E A;  4BA7 A;  1OKT A;  5D8I A;  1TOF A;  1FVK A;  1YKC A;  5F07 A;  1TK0 B;  1A0R P;  4POB A;  1ON4 A;  4LMV A;  16GS A;  2GDR A;  4BPY A;  4BL7 B;  2WCI A;  3HXS A;  3J7Y b;  2BJX A;  1BED A;  3ZMK A;  2MBT A;  4KW6 A;  1XPV A;  1PA3 A;  3WGX A;  3N9J A;  3UAP A;  5H5R A;  1PL1 A;  2P5R A;  4MPF A;  2XC2 A;  2IWT A;  4MH2 A;  3PIN A;  2H0I A;  1UVZ A;  3L9S A;  3O3T A;  5EPF A;  3VUR A;  4G0L A;  2YOI A;  5D93 A;  4YAP A;  3F6D A;  1TU8 A;  5CO3 A;  5IO2 A;  1FAA A;  3CSH A;  3IC4 A;  2GGT A;  1T4Y A;  4Q5Q A;  4V2N A;  4ZBD A;  1X9M B;  2QC7 A;  2PVO C;  3DD3 A;  3BCK A;  5L71 A;  4EE0 A;  3JCM L;  3M0F A;  5J3R A;  2X8H A;  1FHE A;  1XFL A;  3QAV A;  1V2A A;  3VWX A;  1BYE A;  4O5R A;  1RW1 A;  5C00 A;  2H01 A;  2GST A;  4MJE A;  4TXV A;  4F2I A;  5KN2 A;  4EVM A;  2RUF A;  1HNB A;  5HFK A;  3SWL A;  1O73 A;  1URM A;  2XBI A;  2A2S A;  4K6X A;  4J57 E;  2GSS A;  3VI7 A;  4RQR A;  4POK A;  4ISD A;  3KP8 A;  1DE2 A;  4XS1 A;  5HR3 A;  1EOH A;  4XRD A;  4HOJ A;  3S9F A;  3Q19 A;  1TRU A;  2JAD A;  3CTG A;  4MP4 A;  4V2M A;  3H1N A;  4JBB A;  2GLR A;  2V6K A;  3FR3 A;  1FOV A;  1UA5 A;  5CNW A;  3ZRE A;  3LG6 A;  1T8E B;  2CZ3 A;  1GSE A;  2NTO A;  2ZNM A;  3F3Q A;  3I6A A;  4PNG A;  3SBC A;  5IMA A;  4MJC A;  1QMV A;  2FUG 2;  4TVE A;  4IP6 A;  1MEK A;  3KCM A;  1MDJ A;  1Z9H A;  5DDL A;  5G5F A;  4BWQ A;  3E3E A;  5HR0 A;  5INY A;  4K0N A;  2FA4 A;  3TKS A;  1B8X A;  4DSR A;  3HVV A;  4YQM A;  1X5E A;  4ML1 A;  2IL3 A;  1GUK A;  2K6V A;  3RDW A;  3HD5 A;  4Q5R A;  5IOW A;  2IFQ A;  5G5E A;  4OMV A;  20GS A;  1ERU A;  5EY6 A;  3DEX A;  1EGO A;  2XPE A;  3KTL A;  3ZYW A;  1FO5 A;  2YWI A;  2FA8 A;  1EV9 A;  6GSV A;  1G7E A;  3Q6O A;  1TI3 A;  3A3T A;  2WFC A;  3IOS A;  1XXU A;  5FWG A;  2RLI A;  4ID0 A;  1X5C A;  4ZB6 A;  1A8Y A;  4YQU A;  2PGT A;  1YEP A;  1ACV A;  2CAI A;  2JZS A;  2IFQ B;  3FRC A;  3G7I A;  5B6M A;  4WBR D;  4ZIJ A;  3ZVJ A;  2G0F A;  3KGK A;  2VD0 A;  3KMO A;  2JU5 A;  3FZA A;  2PU9 C;  1ZYE A;  1O6J A;  2C1Y A;  2ON5 A;  3C1S A;  2H74 A;  4PQH A;  2PVQ A;  5HFI A;  5ECN B;  4IBP A;  1X9S B;  3TRQ A;  1XCC A;  3PH9 A;  2MMO A;  1NSW A;  1TRW A;  1ILO A;  5GST A;  4HZ4 A;  1T3B A;  2FLS A;  4KGI A;  4PXO A;  5JWO B;  13GS A;  2HSM A;  1WJK A;  4QL9 A;  3QAW A;  1B9X C;  2YN1 A;  1WOU A;  3DKS A;  5ECH B;  4ECI A;  1BQ7 A;  3VFI A;  5DQS A;  2F8A A;  4IGJ A;  3BCI A;  1YJ6 A;  4GQC A;  3TKP A;  3EYT A;  3M9K A;  4XS4 A;  3IK7 A;  2QSI A;  2B1L A;  4FYB A;  3EU4 A;  3LWA A;  2G2Q A;  11GS A;  3E0U A;  1TU7 A;  4WXT A;  2AAW A;  3W6G A;  4CW9 A;  1GUM A;  3DGQ A;  2VCX A;  2JSY A;  4POL A;  3GUS A;  4TR4 A;  1HNC A;  2YP6 A;  2VL9 A;  3CMI A;  5DJL A;  1K0N A;  4G2E A;  1Y6E A;  1GLQ A;  2ALB A;  5IPG A;  3CSI A;  2WRT A;  1ERT A;  1TRV A;  1JLW A;  2VLU A;  1E6B A;  4XS4 B;  4MF5 A;  3ED3 A;  3GYK A;  5AIX A;  3KMN A;  3U5R E;  4KH7 A;  4EUY A;  2N5F A;  2GQM A;  1USB A;  1V40 A;  2DJ0 A;  1DSB A;  2J9H A;  4PUA A;  3TGZ A;  3FR6 A;  1T00 A;  1R5P A;  3FKF A;  5LD0 A;  2R4V A;  4KCE A;  4WKW A;  1V58 A;  1MD3 A;  1LBK A;  2LJA A;  4POM A;  5J9C A;  2VLV A;  2IMD A;  5KN3 A;  2OA7 A;  1Z7P A;  2ZUP A;  5ECQ B;  1N8J A;  4MF7 A;  1F9M A;  1LJR A;  1VRS D;  1FVJ A;  2XHF A;  4MA9 A;  1SJI A;  18GS A;  2DJ3 A;  4OCE A;  1DBY A;  2H1B A;  3A2X A;  1F3B A;  3EMP A;  5G1K A;  5ECK B;  3O76 A;  2HQT A;  2ZCT A;  4AJ7 A;  4N10 A;  2VM2 A;  1XW5 A;  3RAZ A;  2I9H A;  2PPT A;  3DML A;  1WMJ A;  1SEN A;  1NW2 A;  1GUH A;  5EVO A;  4G19 A;  2VAF A;  4TOP A;  6GST A;  1PSQ A;  1ZZY A;  4K1F A;  4K7N A;  2CZ2 A;  1VF1 A;  3F4R A;  3FHK A;  1MTC A;  1OKD A;  1OC8 A;  4HQS A;  3KXO A;  3GKN A;  1WE0 A;  1PKW A;  4ZL7 A;  1DUG A;  5JWR B;  2KUC A;  3IC8 A;  5KEJ A;  2YZU A;  4NHZ A;  2D2Z A;  3D21 A;  2IMI A;  2H6Y A;  2GT6 A;  2HZF A;  3PGT A;  1JFU A;  2P0G A;  5CP1 A;  2QGV A;  2NPB A;  3RHB A;  3ZVJ D;  5ECR B;  5J4U A;  5DCH A;  4WR5 A;  1GSD A;  4FQU A;  1UN2 A;  4GST A;  1K0A A;  5D9V A;  2NDO A;  1ZYQ B;  2OAC A;  4ZB9 A;  3G9B A;  2KOK A;  3QOU A;  4IN0 A;  5B6N A;  4O32 A;  2HFD A;  1EWX A;  1TK5 B;  3QFA C;  3RHC A;  4ACS A;  3UJ1 A;  3LSZ A;  4EF0 A;  1PN9 A;  3EIN A;  3C8E A;  2WUL A;  1JZO A;  1XBS A;  5KN1 A;  4K9Z A;  1ZL9 A;  5J9B A;  2M80 A;  3ZZX A;  2H6X A;  4BWS A;  3EMX A;  4AJ8 A;  5J5N A;  5ECP B;  1OE7 A;  4IQ1 A;  4J2F A;  1R7H A;  3IPZ A;  3V1W A;  1FB0 A;  3FZ9 A;  3WYW A;  5A4V A;  1M2B A;  3CRU A;  3GX0 A;  4N0V A;  3HJM A;  2GVP A;  4HUA A;  1WWJ A;  3GNJ A;  2XPD A;  1K3Y A;  2HSH A;  1QK8 A;  2FNO A;  3M1G A;  4GXZ A;  3UIW A;  1G0T A;  2PER A;  2KHP A;  2GZP A;  1XW9 A;  2CVD A;  4WR4 A;  3KD0 A;  1K0O A;  3PR8 A;  9GSS A;  3KM6 A;  1GP1 A;  2GZZ A;  4USS A;  7GSS A;  1QFN A;  2LS5 A;  2YWN A;  1HQO A;  3HVS A;  4L0U A;  3L9U A;  3NZN A;  2A2R A;  5CRW A;  4KDY A;  4MAB A;  5JCU A;  1A2J A;  4PQI A;  1B4P A;  4JED A;  2E2G A;  4FH8 A;  3VWW A;  2GTU A;  2X8C A;  1PX6 A;  5H5Q A;  2OJL A;  4HZ2 A;  4KCA A;  2HSN B;  5ECS A;  2KP2 A;  2L5L A;  3TJJ A;  1JZD A;  5ECM B;  2FWG A;  2E7P A;  3WT2 A;  3QR6 A;  3HA9 A;  1U3I A;  2IMK A;  3KZQ A;  1A2M A;  5DBQ A;  4N30 A;  3EE2 A;  8GSS A;  4F82 A;  3LFL A;  4OFM A;  1XW6 A;  1JZR A;  4OFT A;  3W8S A;  5CYY A;  1GL8 A;  3UOM A;  3IR4 A;  2H6Z A;  2EC4 A;  3GHA A;  3BBY A;  4HJ2 A;  5F0G A;  3ZIJ A;  4TR1 A;  5HR2 A;  4FYC A;  2X99 A;  2E0Q A;  4XTS A;  2O87 A;  2M46 A;  4ML6 A;  2H1D A;  3GST A;  1OC3 A;  2LEG A;  2R37 A;  5ABR A;  1G6W A;  3LGC A;  1VGL A;  4EO3 A;  3GV1 A;  1PRX A;  2C80 A;  1R4W A;  2OBI A;  2DSA A;  4IHU A;  4G9H A;  5GAN D;  5FHI A;  2JAC A;  3TRP A;  1FG4 A;  1GRX A;  4PTS A;  1HYU A;  3ME8 A;  3GFK A;  1PGT A;  3VK9 A;  4DEJ A;  5IMV A;  2MYG A;  3P8W A;  1A23 A;  4F0C A;  5G2Z A;  3GA4 A;  1TP9 A;  3D4T A;  2YAN A;  3I69 A;  1SK1 A;  4P3Y B;  3GH9 A;  2VCW A;  3ERW A;  2JSZ A;  5D9W A;  3LEF A;  4L0W A;  1QXH A;  2PN8 A;  4G10 A;  4GCI A;  3C1R A;  3UMA A;  1GSY A;  3ZIT A;  4PX1 A;  3TJF A;  3TDG A;  2F51 A;  5JWQ B;  2WZ9 A;  4WBJ A;  5FT3 A;  2R5G A;  1VF4 A;  2VM1 A;  5AIS A;  1XIY A;  3M9J A;  4BVY A;  4TR0 A;  4F0B A;  1A8L A;  3ERG A;  4EXJ A;  3QCP A;  4JU5 A;  2A4V A;  4GSS A;  1CQH A;  3UVH A;  2OE3 A;  1SJ6 A;  5DAK A;  4NV5 A;  5JCG A;  4K7O A;  1E2Y A;  3QFB C;  2MMZ A;  3HZ4 A;  4HI7 A;  3WGD A;  2IME A;  4HQZ A;  5AGY A;  5J41 A;  4RI7 A;  4BVY B;  2FD3 A;  2AYT A;  4MPG A;  2NBS A;  1Z6M A;  1V57 A;  1K3L A;  5A4U A;  4I5Q A;  1TDI A;  2JZT A;  2K9F A;  2V6O A;  4WET A;  4GWR A;  4IKH A;  4L8E A;  2I4A A;  4K8M A;  4GF0 A;  4YH2 A;  1K3O A;  3DXB A;  2VUP A;  1IYI A;  3HCZ A;  6GSY A;  5H5S A;  2H66 A;  1EGR A;  3MAK A;  2FWF A;  3L78 A;  1SJZ A;  1AC1 A;  5A5K A;  1Z3E A;  5IMC A;  3AY8 A;  2FCH A;  4OWY A;  1AAZ A;  1EV4 A;  1ERW A;  2R3X A;  4ZBA A;  3F4T A;  2H72 A;  2GSR A;  1AUC A;  4TRX A;  3F8U A;  4H86 A;  1GNE A;  1EEM A;  3E9J B;  2GQL A;  3LQ7 A;  2FY6 A;  3EUR A;  5F06 A;  1R5A A;  1O85 A;  5CAX A;  2YPM A;  3UL3 A;  3ZRD A;  2DC5 A;  5ENU A;  2B7J A;  3IHQ A;  2EIQ A;  2VIM A;  1T1V A;  5ID2 A;  5D96 A;  2C4J A;  5IMZ A;  2FHE A;  4K2D A;  3MSZ A;  2IN3 A;  1BX9 A;  1PX7 A;  3GTU A;  4KX4 A;  2IIY A;  4KUN A;  4ZL9 A;  4EKZ A;  4QL7 A;  1OC9 A;  4N0Z A;  2B5Y A;  2HSM B;  2H1G A;  2LV3 A;  3TKS C;  2DML A;  2VL3 A;  2VOC A;  4JRR A;  3GKK A;  3UBL A;  5ID2 B;  1AQX A;  6GSX A;  2H1A A;  2HI7 A;  2X8G A;  2UZ8 A;  4MF6 A;  4LLR A;  1Z7R A;  4X1U A;  5B8A A;  1OC9 B;  3FK8 A;  4KF9 A;  4O7H A;  2NVL A;  4MZW A;  1AW9 A;  4L5O A;  3KJY A;  1X5D A;  2C3T A;  2CA8 A;  3FEU A;  5HQP A;  2LNS A;  4JE1 A;  4GSN A;  1OYJ A;  3TRX A;  2LRT A;  2YNX A;  1PMT A;  3ZIV A;  2DLX A; 
#chains in the Genus database with same CATH topology
 3RPP A;  2VO4 A;  1W89 A;  2Z9S A;  1SD8 A;  1TXX A;  3FW2 A;  3J7Y k;  3LJR A;  1XVQ A;  3HJO A;  4V1A p;  2HYX A;  4MCU A;  3ZML A;  4AGS A;  1GTA A;  2VD1 A;  2MZC A;  1YF1 A;  2DJ2 A;  1SKW B;  17GS A;  2HSY A;  3HJP A;  5IO0 A;  1X0R A;  3Q18 A;  3F3R A;  4TR3 A;  4NHW A;  1XWK A;  3GH6 A;  4FYU A;  4K5S A;  3ZFL A;  3WGE A;  1FW1 A;  2AV4 A;  1A24 A;  1TW9 A;  2L4Q A;  2LQQ A;  4YKF A;  3C7M A;  5KN0 A;  1TJD A;  3H93 A;  4K0G A;  3GKX A;  3H79 A;  4LMW A;  4CY6 A;  3L4N A;  4A5P A;  14GS A;  2RM6 A;  3EU3 A;  5IM9 A;  6GSW A;  2PBJ A;  3EPT A;  5IPH A;  1CQG A;  3FZ5 A;  2DBC A;  3D0Z A;  4OD7 A;  3HHV A;  2VL2 A;  2JL4 A;  4HU7 A;  4HS1 A;  2R2J A;  2V41 A;  1U6T A;  2K8V A;  1T4Z A;  2P5Q A;  1NM3 A;  1XOB A;  4TKY A;  1ZCP A;  1YDK A;  4KE3 A;  1U87 A;  1SK2 A;  3HKR A;  3MNG A;  2DJJ A;  5GAP D;  1MD4 A;  5BMU A;  3F9U A;  4HU9 A;  1SKS B;  4TW5 A;  3VLN A;  3CBU A;  5E59 A;  1WRY A;  2F9S A;  2GS3 A;  4NWY A;  1B4Q A;  4PI0 C;  2O7K A;  1K0B A;  4I2U A;  1XVW A;  1AXD A;  1K0M A;  2DIY A;  5IQY A;  5J4Y A;  3FZ4 A;  3W8J A;  4E8H A;  1BJX A;  2LRC A;  2X64 A;  2JZR A;  3CTF A;  2BTO T;  4BVX A;  2WGR A;  2C0G A;  5BMU B;  4PQ1 A;  5ELG A;  4DSS A;  1G6Y A;  2LTK A;  5E4W A;  4KDX A;  1S3C A;  3MWH A;  1SK0 A;  2HT9 A;  4NV2 A;  3TUE A;  2WDU A;  3TB2 A;  3IE3 A;  3GL5 A;  1ST9 A;  3KTB A;  5IIZ A;  4MJB A;  1ZOF A;  3TKS E;  5ELA A;  4BVX B;  1J0F A;  2VCT A;  2FGX A;  2F3M A;  4IJI A;  3M3M A;  3HVX A;  4DSS B;  1M7T A;  2CVB A;  1M2A A;  1GNW A;  3L9V A;  1SKR B;  1O7U A;  4Q5F A;  2HZE A;  4F9Z A;  6GSS A;  1XWA A;  5CRE A;  5D9X A;  2TIR A;  1A2L A;  3GN3 A;  3EVI A;  3FYG A;  2A4H A;  1EEJ A;  4EL1 A;  4GRF A;  5A4W A;  4XIH A;  2R0P A;  3PPU A;  3KH7 A;  5HFG A;  4RI6 A;  4WF4 A;  2H19 A;  3OR5 A;  2HRK A;  2WJU A;  5GSS A;  5J40 A;  2B3S A;  2C3N A;  1F3A A;  3DVW A;  2HZE B;  3F4S A;  2K18 A;  4YAV A;  5LCZ A;  1R26 A;  2H70 A;  4LA1 A;  3KH9 A;  5DVB A;  2EIO A;  1DE1 A;  2B7K A;  4N11 A;  4Z2U A;  2XBQ A;  4HEA 2;  4FXY P;  4XCS A;  1AIU A;  2F8F A;  1TK8 B;  3D6I A;  2VL2 C;  2HRK B;  4WF5 A;  3VWV A;  1U3A A;  5DCG A;  3GRX A;  1GSF A;  1GH2 A;  3F63 A;  1V98 A;  2QA2 A;  1C72 A;  4WEY A;  2HXK A;  5F05 A;  1EP8 A;  3IDV A;  5IMD A;  4NMU A;  3IK9 A;  4MLY A;  1Y1U A;  3F0I A;  2VCQ A;  3I9V 2;  2GZY A;  2B5E A;  4CHS A;  1QQ2 A;  2LQO A;  1Q4J A;  1M3J A;  2KLX A;  1SL2 B;  2N5B A;  3IAM 2;  1PL2 A;  3Q74 A;  5JCW A;  2O89 A;  1SYR A;  4AF2 A;  2IJY A;  3TJK A;  3R2Q A;  4K5R A;  4OCF A;  4IS0 A;  2LKU A;  1I5G A;  4JR6 A;  1GSU A;  2EFC A;  4MJA A;  4F03 A;  2H30 A;  1O8W A;  3QPM A;  4Z7X A;  1XOA A;  1OAZ A;  2L5O A;  5CRH A;  2H0G A;  3TCO A;  1NHY A;  4JR4 A;  4TR1 B;  3APS A;  5AIV A;  4DVC A;  4EDY A;  4KA0 A;  1MDK A;  1TRS A;  4PNF A;  3KIJ A;  4NPB A;  1YEX A;  2TRX A;  1YZX A;  5B8B A;  3TOU A;  1XWC A;  2VCV A;  3QMX A;  1QUW A;  3HYP A;  2LJK A;  3CHX C;  4MH3 A;  3DVX A;  2TRC P;  2C0D A;  1WIK A;  5D73 A;  3GKM A;  1M99 A;  2FWE A;  1EZK A;  3MDK A;  2HE3 A;  3F6F A;  3ERF A;  1U88 A;  3D4M A;  4NAX A;  2C8U A;  4IJ3 A;  3UVT A;  2M72 A;  4MDC A;  3KEB A;  2IPA A;  5DQY A;  2HRF A;  2R6K A;  2H73 A;  3A2V A;  1YY7 A;  2YJ7 A;  4ZXG A;  3BJ5 A;  3US3 A;  4OO4 A;  1ERV A;  3DIE A;  3QDN A;  3GL3 A;  1SYX A;  1IYH A;  4BIK A;  1GTU A;  2UV8 G;  2DMM A;  3LOR A;  3TKR A;  1B9Y C;  1S3R A;  1ML6 A;  2I1U A;  2X49 A;  1S3A A;  5DAK B;  2K8S A;  1YQ1 A;  1NHO A;  3N5O A;  1LU4 A;  1K0D A;  2J23 A;  1Y25 A;  4I97 A;  2YV9 A;  5LNK e;  2PWJ A;  3DWV A;  3H8Q A;  1X9W B;  4AKH A;  1PD2 1;  2KP1 A;  4OFN A;  1WPI A;  3WD6 A;  3CRT A;  2PUK C;  5CRD A;  4IQA A;  1Z5Y E;  2YJH A;  1EP7 A;  2B6M A;  3IA1 A;  2C3Q A;  1JHB A;  3TOT A;  4FO5 A;  4ECB A;  3IXR A;  4QQ7 A;  1QGV A;  2YWO A;  1ZMA A;  3IV4 A;  2OE0 A;  1N2A A;  4ZBB A;  4KB3 A;  2YCD A;  1EOG A;  1AQW A;  4CDO A;  5COH A;  3HY2 A;  1M2D A;  3TKQ A;  2B5X A;  2EIR A;  4X0X A;  4ZB8 A;  5AN1 A;  1G7O A;  2H76 A;  4LL4 B;  2OT3 A;  3D22 A;  3G7J A;  3G7Y A;  2N5A A;  3K8N A;  1KTE A;  1GWC A;  2L59 A;  3TJG A;  4GQF A;  4V1A g;  2I3Y A;  1YKA A;  1PKZ A;  2AJQ B;  2CAQ A;  3BD2 A;  4I6X A;  2H0H A;  1W4V A;  4O92 A;  3U6V A;  1F6M C;  1M9A A;  3GMF A;  22GS A;  2MBS A;  4GLT A;  3H4K A;  1TXU A;  2HLS A;  1AQV A;  3R3E A;  4PUF C;  3UAR A;  3A5W A;  1VF2 A;  1XG8 A;  5HR1 A;  3CXG A;  4L5L A;  1ABA A;  3CQF A;  3ZL5 A;  4GTU A;  1GTB A;  4KAE A;  3C73 A;  1GSQ A;  2RUE A;  1THX A;  3IAS 2;  1M9B A;  3GTU B;  3C71 A;  12GS A;  2X4A A;  3A2W A;  4AJ6 A;  3RBT A;  2DJK A;  4K7I A;  3LYK A;  2O8V B;  1XWG A;  3NOF A;  4Z2T A;  3VPT A;  1F37 A;  1M0U A;  1S4B P;  2LUS A;  3HZ8 A;  2BMX A;  2CX4 A;  1KNG A;  1S3D A;  4FIW A;  4ZB7 A;  1WP0 A;  2LJR A;  3HDC A;  4MNN A;  1OE8 A;  1FB6 A;  1J08 A;  5F8B A;  1KEB A;  1YF0 A;  2LST A;  4TN8 A;  1BAY A;  4I8B A;  3FY7 A;  2LNT A;  2REM A;  5GZZ B;  1O8X A;  3RFR C;  4ZL8 A;  2ES7 A;  2L6C A;  19GS A;  1VF3 A;  3D5J A;  2RM5 A;  1YEW C;  2DIZ A;  4RQX A;  4ECC A;  4MK3 A;  4EDZ A;  3IBH A;  2DJ1 A;  2CT6 A;  2YWM A;  3UBK A;  4ZIL A;  4MZB A;  3EWL A;  1Q98 A;  3VI5 A;  3O6T A;  4J56 E;  2VKZ G;  4LL1 B;  1JLV A;  4MZC A;  4O5Q A;  1MDI A;  2HNL A;  2WVY A;  2HRA A;  1J9B A;  4ULX A;  4TXO A;  1V9W A;  3LXZ A;  2QA1 A;  2OBK A;  4HSC X;  2B1K A;  2ON7 A;  2CVK A;  1T7P B;  3VPQ A;  4NXI A;  1H4O A;  3CSJ A;  4ECJ A;  2VCZ A;  2O85 A;  4AKG A;  3I43 A;  3P90 A;  4IEL A;  5EL8 A;  1TTZ A;  3GIX A;  3ZFB A;  3EC3 A;  4X43 A;  1UC7 A;  2WB9 A;  2MMA A;  4XS6 A;  2WW3 A;  3QAG A;  3P2A A;  1BG5 A;  4HDE A;  4TXO B;  3ZTL A;  2V2G A;  3GUR A;  4KSM A;  4G0K A;  5ECI B;  3ME7 A;  5CRG A;  2MMN A;  2LRN A;  2VLT A;  1GTI A;  3M8N A;  2L6D A;  4DSQ A;  2RII A;  4I2T A;  4XRA A;  1A0F A;  3CYN A;  1K0C A;  5DJM A;  1B48 A;  3BOA A;  3APQ A;  1H75 A;  2YV7 A;  5A5H A;  3UEM A;  4YKG A;  4ILF A;  3L0H A;  2V32 A;  5IOX A;  4IVF A;  4EC0 A;  2WS2 A;  1PQN A;  4HJM A;  2GT5 A;  1F2E A;  1SU9 A;  4JZQ A;  1JZW A;  4V2L A;  4G0I A;  1ZYP A;  1GSS A;  3NIV A;  4KDU A;  3DYR A;  4KND A;  2O5V A;  3APO A;  4E68 A;  1HNA A;  2CV4 A;  4IW9 A;  5A5H B;  2HRN A;  3VWU A;  3IRA A;  5G1L A;  3WT1 A;  4MMM A;  2GSQ A;  2AUV A;  2V1M A;  5B7C A;  3LYP A;  1XWB A;  2R0C A;  2IMF A;  1Z6N A;  3GSS A;  1GLP A;  2E2M A;  3TJB A;  1XZO A;  2OAD A;  4XHM A;  4Q5N A;  5DAL A;  3LXT A;  2PMT A;  4KSO A;  1RK4 A;  3P7X A;  4RUV A;  1TI1 A;  2L57 A;  2H71 A;  6GSU A;  4D73 A;  3FR9 A;  4PGT A;  4AKX B;  2CQ9 A;  1HD2 A;  1ZGN A;  3GX8 A;  2CX3 A;  4PUR A;  5IMF A;  2GQK A;  2H75 A;  2I81 A;  1KBN A;  3RPN A;  2WVX A;  5DAL B;  1THO A;  3ISO A;  5C04 A;  3HMJ G;  4E8E A;  2OKA A;  4D73 B;  5ECO B;  4YQV A;  1RQM A;  2QKE A;  2OE1 A;  4AI6 A;  2FWH A;  1SD9 A;  2R0G A;  10GS A;  3ZLP A;  1OVN A;  4IP1 A;  5G30 A;  2AB6 A;  1TKD B;  5D9T A;  2L4C A;  3KP9 A;  1SL1 B;  5A34 A;  3QD9 A;  2C0F A;  2WVX B;  1SL0 B;  1GUL A;  5G31 A;  2P31 A;  4OO5 A;  2AHE A;  2YZH A;  1O81 A;  4BL7 A;  5ECL B;  4K2X A;  3DRN A;  2H8L A;  1I9D A;  2C0E A;  4BA7 A;  1OKT A;  5D8I A;  5KOW A;  1TOF A;  1FVK A;  1YKC A;  5F07 A;  1TK0 B;  5A34 B;  5J4V A;  1A0R P;  4POB A;  1ON4 A;  4LMV A;  16GS A;  2GDR A;  4BPY A;  4BL7 B;  2WCI A;  3HXS A;  3J7Y b;  2BJX A;  1BED A;  3ZMK A;  2MBT A;  4KW6 A;  1XPV A;  1PA3 A;  3WGX A;  3N9J A;  3UAP A;  5H5R A;  1PL1 A;  2P5R A;  4MPF A;  2XC2 A;  2IWT A;  4MH2 A;  3PIN A;  4AKI A;  2H0I A;  1UVZ A;  3L9S A;  3O3T A;  5EPF A;  3VUR A;  4G0L A;  2YOI A;  5D93 A;  4YAP A;  3F6D A;  1TU8 A;  5CO3 A;  5IO2 A;  1I1I P;  1FAA A;  2A2P A;  3CSH A;  3IC4 A;  2GGT A;  1T4Y A;  4Q5Q A;  4V2N A;  4ZBD A;  1X9M B;  2QC7 A;  2PVO C;  3DD3 A;  3BCK A;  5L71 A;  4EE0 A;  3JCM L;  3M0F A;  2WW0 A;  5J3R A;  2X8H A;  1FHE A;  1XFL A;  3QAV A;  1V2A A;  3VWX A;  1BYE A;  4O5R A;  1RW1 A;  5C00 A;  2H01 A;  2GST A;  4MJE A;  4TXV A;  4F2I A;  5KN2 A;  4EVM A;  2RUF A;  1HNB A;  5HFK A;  3SWL A;  1O73 A;  2EFD A;  1URM A;  2XBI A;  2A2S A;  4K6X A;  4J57 E;  2GSS A;  3VI7 A;  4RQR A;  4POK A;  4ISD A;  3KP8 A;  1DE2 A;  4XS1 A;  5HR3 A;  1EOH A;  4XRD A;  4HOJ A;  3S9F A;  3Q19 A;  1TRU A;  2JAD A;  3CTG A;  4MP4 A;  4V2M A;  3H1N A;  4JBB A;  2GLR A;  2V6K A;  3FR3 A;  1FOV A;  1UA5 A;  5CNW A;  3ZRE A;  3LG6 A;  1T8E B;  2CZ3 A;  1GSE A;  2NTO A;  2ZNM A;  3F3Q A;  3I6A A;  4PNG A;  3SBC A;  5IMA A;  4MJC A;  1QMV A;  2FUG 2;  4TVE A;  4IP6 A;  1MEK A;  3KCM A;  1MDJ A;  1Z9H A;  5DDL A;  5G5F A;  4BWQ A;  3E3E A;  5HR0 A;  5INY A;  4K0N A;  2FA4 A;  3TKS A;  1B8X A;  4DSR A;  3HVV A;  4YQM A;  1X5E A;  4ML1 A;  2IL3 A;  1GUK A;  2K6V A;  3RDW A;  3HD5 A;  4Q5R A;  5IOW A;  2IFQ A;  5G5E A;  4OMV A;  20GS A;  1ERU A;  5EY6 A;  3DEX A;  1EGO A;  2XPE A;  3KTL A;  3ZYW A;  1FO5 A;  2YWI A;  2FA8 A;  1EV9 A;  6GSV A;  1G7E A;  3Q6O A;  1TI3 A;  3A3T A;  2WFC A;  3IOS A;  1XXU A;  5FWG A;  2RLI A;  4ID0 A;  1X5C A;  4ZB6 A;  1A8Y A;  4YQU A;  2PGT A;  1YEP A;  1ACV A;  2CAI A;  2JZS A;  2IFQ B;  3FRC A;  3G7I A;  5B6M A;  4WBR D;  4ZIJ A;  3ZVJ A;  2G0F A;  2WW2 A;  3KGK A;  2VD0 A;  3KMO A;  2JU5 A;  3FZA A;  2PU9 C;  1ZYE A;  1O6J A;  2C1Y A;  2ON5 A;  3C1S A;  2H74 A;  4PQH A;  4Z2R A;  2PVQ A;  5HFI A;  5ECN B;  4IBP A;  1YVL A;  1X9S B;  3TRQ A;  1XCC A;  3PH9 A;  2MMO A;  1NSW A;  1TRW A;  1ILO A;  5GST A;  4HZ4 A;  1T3B A;  2FLS A;  4KGI A;  4PXO A;  5JWO B;  13GS A;  2HSM A;  1WJK A;  4QL9 A;  3QAW A;  1B9X C;  2YN1 A;  1WOU A;  3DKS A;  5ECH B;  4ECI A;  1BQ7 A;  3VFI A;  5DQS A;  2F8A A;  4IGJ A;  3BCI A;  1YJ6 A;  4GQC A;  3TKP A;  3EYT A;  3M9K A;  4XS4 A;  3IK7 A;  3RGB C;  2QSI A;  2B1L A;  4FYB A;  3EU4 A;  3LWA A;  2G2Q A;  11GS A;  3E0U A;  1TU7 A;  4WXT A;  2AAW A;  3W6G A;  4CW9 A;  1GUM A;  3DGQ A;  2VCX A;  4PHZ C;  2JSY A;  4POL A;  3GUS A;  4TR4 A;  1HNC A;  2YP6 A;  2VL9 A;  3CMI A;  5DJL A;  4GDF A;  1K0N A;  4G2E A;  1Y6E A;  1GLQ A;  2ALB A;  1BF5 A;  5IPG A;  1PFO A;  3CSI A;  2WRT A;  1ERT A;  1TRV A;  1JLW A;  2VLU A;  1E6B A;  4XS4 B;  4W66 A;  4MF5 A;  3ED3 A;  3GYK A;  5AIX A;  3KMN A;  3U5R E;  4KH7 A;  4EUY A;  2N5F A;  2GQM A;  4EIP A;  1USB A;  1V40 A;  2DJ0 A;  1DSB A;  2J9H A;  4PUA A;  4N3Z A;  3TGZ A;  3FR6 A;  1T00 A;  1R5P A;  4G01 A;  3FKF A;  5LD0 A;  2R4V A;  4KCE A;  4WKW A;  1V58 A;  1MD3 A;  1LBK A;  2LJA A;  4POM A;  5J9C A;  2VLV A;  2IMD A;  5KN3 A;  2OA7 A;  1Z7P A;  2ZUP A;  5ECQ B;  1N8J A;  4MF7 A;  1F9M A;  1LJR A;  1VRS D;  1FVJ A;  2XHF A;  4MA9 A;  1SJI A;  18GS A;  2DJ3 A;  4OCE A;  1DBY A;  2H1B A;  5BRT A;  3A2X A;  1F3B A;  3EMP A;  5G1K A;  5ECK B;  3O76 A;  2HQT A;  2ZCT A;  4AJ7 A;  4N10 A;  2VM2 A;  1XW5 A;  3RAZ A;  2I9H A;  2PPT A;  3LW9 A;  3DML A;  1WMJ A;  1SEN A;  1NW2 A;  1GUH A;  5EVO A;  4G19 A;  2VAF A;  4TOP A;  6GST A;  1PSQ A;  1ZZY A;  4K1F A;  4K7N A;  2CZ2 A;  1VF1 A;  3F4R A;  3FHK A;  1MTC A;  1OKD A;  1OC8 A;  4HQS A;  3KXO A;  3GKN A;  1WE0 A;  1PKW A;  4ZL7 A;  1DUG A;  5JWR B;  2KUC A;  3IC8 A;  5KEJ A;  2YZU A;  4NHZ A;  2D2Z A;  3D21 A;  2IMI A;  2H6Y A;  2GT6 A;  2HZF A;  3PGT A;  1JFU A;  2P0G A;  5CP1 A;  2QGV A;  2NPB A;  3RHB A;  3ZVJ D;  5ECR B;  5J4U A;  1SVL A;  5DCH A;  4WR5 A;  1GSD A;  4FQU A;  1UN2 A;  4GST A;  4PI2 C;  1K0A A;  5D9V A;  2NDO A;  1ZYQ B;  2OAC A;  4ZB9 A;  3G9B A;  2KOK A;  3QOU A;  4IN0 A;  5B6N A;  4O32 A;  2HFD A;  1EWX A;  1TK5 B;  3QFA C;  3RHC A;  4ACS A;  3UJ1 A;  3LSZ A;  4EF0 A;  1PN9 A;  3EIN A;  3C8E A;  2WUL A;  1JZO A;  4ICY A;  1XBS A;  5KN1 A;  4K9Z A;  1ZL9 A;  5J9B A;  2M80 A;  3ZZX A;  2H6X A;  4BWS A;  3EMX A;  4AJ8 A;  5J5N A;  5ECP B;  1OE7 A;  4IQ1 A;  4J2F A;  1R7H A;  3IPZ A;  3V1W A;  3IHG A;  1FB0 A;  3FZ9 A;  3WYW A;  5A4V A;  1M2B A;  3CRU A;  3GX0 A;  4N0V A;  3HJM A;  2GVP A;  4HUA A;  1WWJ A;  3GNJ A;  2XPD A;  1N25 A;  1K3Y A;  2HSH A;  1QK8 A;  2FNO A;  3M1G A;  4GXZ A;  3UIW A;  1G0T A;  2PER A;  2KHP A;  2GZP A;  1XW9 A;  2CVD A;  4WR4 A;  3KD0 A;  1K0O A;  3PR8 A;  9GSS A;  3KM6 A;  1GP1 A;  2HSN A;  4USS A;  2GZZ A;  4CY8 A;  7GSS A;  1QFN A;  2LS5 A;  2YWN A;  1HQO A;  3HVS A;  4L0U A;  3L9U A;  3NZN A;  2A2R A;  5CRW A;  4KDY A;  4MAB A;  5JCU A;  4QMK A;  1A2J A;  4PQI A;  1B4P A;  4JED A;  2E2G A;  4FH8 A;  3VWW A;  2GTU A;  2X8C A;  1PX6 A;  5H5Q A;  2OJL A;  3A5I A;  4HZ2 A;  4KCA A;  2HSN B;  5ECS A;  2KP2 A;  2L5L A;  3TJJ A;  1JZD A;  5ECM B;  2FWG A;  2E7P A;  3WT2 A;  3QR6 A;  3MIX A;  3HA9 A;  1U3I A;  2IMK A;  3KZQ A;  1A2M A;  5DBQ A;  4N30 A;  3EE2 A;  8GSS A;  4F82 A;  3LFL A;  4OFM A;  1XW6 A;  1JZR A;  4OFT A;  3W8S A;  5CYY A;  1GL8 A;  3UOM A;  3IR4 A;  2H6Z A;  2EC4 A;  3GHA A;  3BBY A;  1BG1 A;  4HJ2 A;  5F0G A;  2DKI A;  3ZIJ A;  4TR1 A;  5HR2 A;  4FYC A;  2X99 A;  2E0Q A;  4XTS A;  2O87 A;  2M46 A;  4ML6 A;  2H1D A;  1SVO A;  3GST A;  1OC3 A;  2LEG A;  2R37 A;  5ABR A;  1G6W A;  3LGC A;  1VGL A;  4EO3 A;  2H1L A;  3GV1 A;  1PRX A;  2C80 A;  1R4W A;  2WZS A;  2OBI A;  2DSA A;  4IHU A;  4G9H A;  5GAN D;  5FHI A;  2JAC A;  3TRP A;  4X4J A;  1FG4 A;  1GRX A;  4PTS A;  1HYU A;  3ME8 A;  3GFK A;  1PGT A;  3VK9 A;  4DEJ A;  5IMV A;  1M3I A;  2MYG A;  3P8W A;  1A23 A;  4F0C A;  2O36 A;  5G2Z A;  3GA4 A;  1TP9 A;  3D4T A;  2YAN A;  3I69 A;  1SK1 A;  4P3Y B;  2DKH A;  3GH9 A;  2VCW A;  3ERW A;  2JSZ A;  3HVN A;  5D9W A;  3LEF A;  4L0W A;  3CWG A;  1QXH A;  2PN8 A;  4G10 A;  4GCI A;  3C1R A;  3UMA A;  1GSY A;  3ZIT A;  4PX1 A;  3TJF A;  3TDG A;  2F51 A;  5JWQ B;  2WZ9 A;  4WBJ A;  5FT3 A;  2R5G A;  1VF4 A;  5J47 A;  2VM1 A;  5AIS A;  1XIY A;  3M9J A;  4BVY A;  4TR0 A;  4F0B A;  1A8L A;  3ERG A;  4EXJ A;  3QCP A;  4JU5 A;  2A4V A;  4GSS A;  1CQH A;  3UVH A;  1FOH A;  2OE3 A;  1SJ6 A;  5DAK A;  4NV5 A;  5JCG A;  4K7O A;  1E2Y A;  3QFB C;  2MMZ A;  3HZ4 A;  4HI7 A;  3WGD A;  2IME A;  4HQZ A;  5AGY A;  5J41 A;  4RI7 A;  4BVY B;  4O5U A;  2FD3 A;  2AYT A;  4MPG A;  2NBS A;  1Z6M A;  1V57 A;  1K3L A;  5A4U A;  4I5Q A;  1TDI A;  2JZT A;  2K9F A;  2V6O A;  4WET A;  4GWR A;  4IKH A;  4L8E A;  2I4A A;  4K8M A;  4GF0 A;  4YH2 A;  1K3O A;  3DXB A;  2VUP A;  1IYI A;  3HCZ A;  6GSY A;  5H5S A;  2H66 A;  1SVM A;  1EGR A;  2EFE A;  3MAK A;  2FWF A;  3L78 A;  1SJZ A;  1AC1 A;  5A5K A;  1Z3E A;  5IMC A;  3AY8 A;  2FCH A;  4OWY A;  1AAZ A;  1EV4 A;  1ERW A;  2R3X A;  4ZBA A;  5KOX A;  4EIQ A;  3F4T A;  2H72 A;  2GSR A;  1AUC A;  1ZYN A;  4TRX A;  3F8U A;  4H86 A;  1GNE A;  1EEM A;  3E9J B;  2GQL A;  3LQ7 A;  2FY6 A;  3EUR A;  5F06 A;  1R5A A;  1O85 A;  3MYD A;  5CAX A;  2EFH A;  2WW1 A;  2YPM A;  3UL3 A;  3ZRD A;  2DC5 A;  5ENU A;  2B7J A;  3IHQ A;  2EIQ A;  2VIM A;  1T1V A;  5ID2 A;  3FMW A;  5D96 A;  2C4J A;  5IMZ A;  2FHE A;  4K2D A;  3MSZ A;  2IN3 A;  1BX9 A;  5A1N A;  1PX7 A;  3GTU A;  4KX4 A;  2IIY A;  4KUN A;  4ZL9 A;  4EKZ A;  4QL7 A;  1OC9 A;  4N0Z A;  2B5Y A;  2HSM B;  2WVZ A;  2H1G A;  2LV3 A;  3TKS C;  2DML A;  2VL3 A;  2VOC A;  4JRR A;  3GKK A;  3UBL A;  5ID2 B;  1AQX A;  6GSX A;  2H1A A;  1PN0 A;  2HI7 A;  2X8G A;  2UZ8 A;  5A1N B;  4MF6 A;  3TU3 B;  4LLR A;  1Z7R A;  4X1U A;  5B8A A;  1OC9 B;  3FK8 A;  4KF9 A;  4O7H A;  2NVL A;  4MZW A;  1AW9 A;  2O3E A;  4L5O A;  3KJY A;  1X5D A;  2C3T A;  2CA8 A;  3FEU A;  5HQP A;  2LNS A;  4JE1 A;  4GSN A;  1OYJ A;  3TRX A;  2LRT A;  2YNX A;  1PMT A;  3ZIV A;  2DLX A; 
#chains in the Genus database with same CATH homology
 3RPP A;  2VO4 A;  1W89 A;  2Z9S A;  1SD8 A;  1TXX A;  3FW2 A;  3J7Y k;  3LJR A;  1XVQ A;  3HJO A;  4V1A p;  2HYX A;  4MCU A;  3ZML A;  4AGS A;  1GTA A;  2VD1 A;  2MZC A;  1YF1 A;  2DJ2 A;  1SKW B;  17GS A;  2HSY A;  3HJP A;  5IO0 A;  1X0R A;  3Q18 A;  3F3R A;  4TR3 A;  4NHW A;  1XWK A;  3GH6 A;  4FYU A;  4K5S A;  3ZFL A;  3WGE A;  1FW1 A;  2AV4 A;  1A24 A;  1TW9 A;  2L4Q A;  2LQQ A;  4YKF A;  3C7M A;  5KN0 A;  1TJD A;  3H93 A;  4K0G A;  3GKX A;  3H79 A;  4LMW A;  4CY6 A;  3L4N A;  4A5P A;  14GS A;  2RM6 A;  3EU3 A;  5IM9 A;  6GSW A;  2PBJ A;  3EPT A;  5IPH A;  1CQG A;  3FZ5 A;  2DBC A;  3D0Z A;  4OD7 A;  3HHV A;  2VL2 A;  2JL4 A;  4HU7 A;  4HS1 A;  2R2J A;  2V41 A;  1U6T A;  2K8V A;  1T4Z A;  2P5Q A;  1NM3 A;  1XOB A;  4TKY A;  1ZCP A;  1YDK A;  4KE3 A;  1U87 A;  1SK2 A;  3HKR A;  3MNG A;  2DJJ A;  5GAP D;  1MD4 A;  5BMU A;  3F9U A;  4HU9 A;  1SKS B;  4TW5 A;  3VLN A;  3CBU A;  5E59 A;  1WRY A;  2F9S A;  2GS3 A;  4NWY A;  1B4Q A;  2O7K A;  1K0B A;  4I2U A;  1XVW A;  1AXD A;  1K0M A;  2DIY A;  5IQY A;  5J4Y A;  3FZ4 A;  3W8J A;  4E8H A;  1BJX A;  2LRC A;  2X64 A;  2JZR A;  3CTF A;  2BTO T;  4BVX A;  2WGR A;  2C0G A;  5BMU B;  4PQ1 A;  5ELG A;  4DSS A;  1G6Y A;  2LTK A;  5E4W A;  4KDX A;  1S3C A;  3MWH A;  1SK0 A;  2HT9 A;  4NV2 A;  3TUE A;  2WDU A;  3TB2 A;  3IE3 A;  3GL5 A;  1ST9 A;  3KTB A;  5IIZ A;  4MJB A;  1ZOF A;  3TKS E;  5ELA A;  4BVX B;  1J0F A;  2VCT A;  2FGX A;  2F3M A;  4IJI A;  3M3M A;  3HVX A;  4DSS B;  1M7T A;  2CVB A;  1M2A A;  1GNW A;  3L9V A;  1SKR B;  1O7U A;  4Q5F A;  2HZE A;  4F9Z A;  6GSS A;  1XWA A;  5CRE A;  5D9X A;  2TIR A;  1A2L A;  3GN3 A;  3EVI A;  3FYG A;  2A4H A;  1EEJ A;  4EL1 A;  4GRF A;  5A4W A;  4XIH A;  2R0P A;  3PPU A;  3KH7 A;  5HFG A;  4RI6 A;  4WF4 A;  2H19 A;  3OR5 A;  2HRK A;  2WJU A;  5GSS A;  5J40 A;  2B3S A;  2C3N A;  1F3A A;  3DVW A;  2HZE B;  3F4S A;  2K18 A;  4YAV A;  5LCZ A;  1R26 A;  2H70 A;  4LA1 A;  3KH9 A;  5DVB A;  2EIO A;  1DE1 A;  2B7K A;  4N11 A;  4Z2U A;  2XBQ A;  4HEA 2;  4XCS A;  1AIU A;  2F8F A;  1TK8 B;  3D6I A;  2VL2 C;  2HRK B;  4WF5 A;  3VWV A;  1U3A A;  5DCG A;  3GRX A;  1GSF A;  1GH2 A;  3F63 A;  1V98 A;  2QA2 A;  1C72 A;  4WEY A;  2HXK A;  5F05 A;  1EP8 A;  3IDV A;  5IMD A;  4NMU A;  3IK9 A;  4MLY A;  1Y1U A;  3F0I A;  2VCQ A;  3I9V 2;  2GZY A;  2B5E A;  4CHS A;  1QQ2 A;  2LQO A;  1Q4J A;  2KLX A;  1SL2 B;  2N5B A;  3IAM 2;  1PL2 A;  3Q74 A;  5JCW A;  2O89 A;  1SYR A;  4AF2 A;  2IJY A;  3TJK A;  3R2Q A;  4K5R A;  4OCF A;  4IS0 A;  2LKU A;  1I5G A;  4JR6 A;  1GSU A;  2EFC A;  4MJA A;  4F03 A;  2H30 A;  1O8W A;  3QPM A;  4Z7X A;  1XOA A;  1OAZ A;  2L5O A;  5CRH A;  2H0G A;  3TCO A;  1NHY A;  4JR4 A;  4TR1 B;  3APS A;  5AIV A;  4DVC A;  4EDY A;  4KA0 A;  1MDK A;  1TRS A;  4PNF A;  3KIJ A;  4NPB A;  1YEX A;  2TRX A;  1YZX A;  5B8B A;  3TOU A;  1XWC A;  2VCV A;  3QMX A;  1QUW A;  3HYP A;  2LJK A;  4MH3 A;  3DVX A;  2TRC P;  2C0D A;  1WIK A;  5D73 A;  3GKM A;  1M99 A;  2FWE A;  1EZK A;  3MDK A;  2HE3 A;  3F6F A;  3ERF A;  1U88 A;  3D4M A;  4NAX A;  2C8U A;  4IJ3 A;  3UVT A;  2M72 A;  4MDC A;  3KEB A;  2IPA A;  5DQY A;  2HRF A;  2R6K A;  2H73 A;  3A2V A;  1YY7 A;  2YJ7 A;  4ZXG A;  3BJ5 A;  3US3 A;  4OO4 A;  1ERV A;  3DIE A;  3QDN A;  3GL3 A;  1SYX A;  1IYH A;  1GTU A;  2UV8 G;  2DMM A;  3LOR A;  3TKR A;  1B9Y C;  1ML6 A;  2I1U A;  2X49 A;  1S3A A;  5DAK B;  2K8S A;  1YQ1 A;  1NHO A;  3N5O A;  1LU4 A;  1K0D A;  2J23 A;  1Y25 A;  4I97 A;  2YV9 A;  5LNK e;  2PWJ A;  3DWV A;  3H8Q A;  1X9W B;  4AKH A;  1PD2 1;  2KP1 A;  4OFN A;  1WPI A;  3WD6 A;  3CRT A;  2PUK C;  5CRD A;  4IQA A;  1Z5Y E;  2YJH A;  1EP7 A;  2B6M A;  3IA1 A;  2C3Q A;  1JHB A;  3TOT A;  4FO5 A;  4ECB A;  3IXR A;  4QQ7 A;  1QGV A;  2YWO A;  1ZMA A;  3IV4 A;  2OE0 A;  1N2A A;  4ZBB A;  4KB3 A;  2YCD A;  1EOG A;  1AQW A;  4CDO A;  5COH A;  3HY2 A;  1M2D A;  3TKQ A;  2B5X A;  2EIR A;  4X0X A;  4ZB8 A;  5AN1 A;  1G7O A;  2H76 A;  4LL4 B;  2OT3 A;  3D22 A;  3G7J A;  3G7Y A;  2N5A A;  3K8N A;  1KTE A;  1GWC A;  2L59 A;  3TJG A;  4GQF A;  4V1A g;  2I3Y A;  1YKA A;  1PKZ A;  2AJQ B;  2CAQ A;  3BD2 A;  4I6X A;  2H0H A;  1W4V A;  4O92 A;  3U6V A;  1F6M C;  1M9A A;  3GMF A;  22GS A;  2MBS A;  4GLT A;  3H4K A;  1TXU A;  2HLS A;  1AQV A;  3R3E A;  4PUF C;  3UAR A;  3A5W A;  1VF2 A;  5HR1 A;  3CXG A;  4L5L A;  1ABA A;  3ZL5 A;  4GTU A;  1GTB A;  4KAE A;  3C73 A;  1GSQ A;  2RUE A;  1THX A;  3IAS 2;  1M9B A;  3GTU B;  3C71 A;  12GS A;  2X4A A;  3A2W A;  4AJ6 A;  3RBT A;  2DJK A;  4K7I A;  3LYK A;  2O8V B;  1XWG A;  3NOF A;  4Z2T A;  3VPT A;  1F37 A;  1M0U A;  2LUS A;  3HZ8 A;  2BMX A;  2CX4 A;  1KNG A;  1S3D A;  4FIW A;  4ZB7 A;  1WP0 A;  2LJR A;  3HDC A;  4MNN A;  1OE8 A;  1FB6 A;  1J08 A;  5F8B A;  1KEB A;  1YF0 A;  2LST A;  4TN8 A;  1BAY A;  4I8B A;  3FY7 A;  2LNT A;  2REM A;  5GZZ B;  1O8X A;  4ZL8 A;  2ES7 A;  2L6C A;  19GS A;  1VF3 A;  3D5J A;  2RM5 A;  2DIZ A;  4RQX A;  4ECC A;  4MK3 A;  4EDZ A;  3IBH A;  2DJ1 A;  2CT6 A;  2YWM A;  3UBK A;  4ZIL A;  4MZB A;  3EWL A;  1Q98 A;  3VI5 A;  3O6T A;  4J56 E;  2VKZ G;  4LL1 B;  1JLV A;  4MZC A;  4O5Q A;  1MDI A;  2HNL A;  2HRA A;  1J9B A;  4ULX A;  4TXO A;  1V9W A;  3LXZ A;  2QA1 A;  2OBK A;  2B1K A;  2ON7 A;  2CVK A;  1T7P B;  3VPQ A;  4NXI A;  1H4O A;  3CSJ A;  4ECJ A;  2VCZ A;  2O85 A;  4AKG A;  3I43 A;  3P90 A;  4IEL A;  5EL8 A;  1TTZ A;  3GIX A;  3ZFB A;  3EC3 A;  4X43 A;  1UC7 A;  2WB9 A;  2MMA A;  4XS6 A;  3QAG A;  3P2A A;  1BG5 A;  4HDE A;  4TXO B;  3ZTL A;  2V2G A;  3GUR A;  4KSM A;  4G0K A;  3ME7 A;  5ECI B;  5CRG A;  2MMN A;  2LRN A;  2VLT A;  1GTI A;  3M8N A;  2L6D A;  4DSQ A;  2RII A;  4I2T A;  4XRA A;  1A0F A;  3CYN A;  1K0C A;  5DJM A;  1B48 A;  3BOA A;  3APQ A;  1H75 A;  2YV7 A;  5A5H A;  3UEM A;  4YKG A;  4ILF A;  3L0H A;  2V32 A;  5IOX A;  4IVF A;  4EC0 A;  2WS2 A;  1PQN A;  4HJM A;  2GT5 A;  1F2E A;  1SU9 A;  4JZQ A;  1JZW A;  4V2L A;  4G0I A;  1ZYP A;  1GSS A;  3NIV A;  4KDU A;  3DYR A;  4KND A;  2O5V A;  3APO A;  4E68 A;  1HNA A;  2CV4 A;  4IW9 A;  5A5H B;  2HRN A;  3VWU A;  3IRA A;  5G1L A;  3WT1 A;  4MMM A;  2GSQ A;  2AUV A;  2V1M A;  5B7C A;  3LYP A;  1XWB A;  2R0C A;  2IMF A;  1Z6N A;  3GSS A;  1GLP A;  2E2M A;  3TJB A;  1XZO A;  2OAD A;  4XHM A;  4Q5N A;  5DAL A;  3LXT A;  2PMT A;  4KSO A;  1RK4 A;  3P7X A;  4RUV A;  1TI1 A;  2L57 A;  2H71 A;  6GSU A;  4D73 A;  3FR9 A;  4PGT A;  4AKX B;  2CQ9 A;  1HD2 A;  1ZGN A;  3GX8 A;  2CX3 A;  4PUR A;  5IMF A;  2GQK A;  2H75 A;  2I81 A;  1KBN A;  3RPN A;  5DAL B;  1THO A;  3ISO A;  5C04 A;  3HMJ G;  4E8E A;  2OKA A;  4D73 B;  5ECO B;  4YQV A;  1RQM A;  2QKE A;  2OE1 A;  4AI6 A;  2FWH A;  1SD9 A;  2R0G A;  10GS A;  3ZLP A;  1OVN A;  4IP1 A;  5G30 A;  2AB6 A;  1TKD B;  5D9T A;  2L4C A;  3KP9 A;  1SL1 B;  5A34 A;  3QD9 A;  2C0F A;  1SL0 B;  1GUL A;  5G31 A;  2P31 A;  4OO5 A;  2AHE A;  2YZH A;  1O81 A;  4BL7 A;  5ECL B;  4K2X A;  3DRN A;  2H8L A;  1I9D A;  2C0E A;  4BA7 A;  1OKT A;  5D8I A;  5KOW A;  1TOF A;  1FVK A;  1YKC A;  5F07 A;  1TK0 B;  5A34 B;  5J4V A;  1A0R P;  4POB A;  1ON4 A;  4LMV A;  16GS A;  2GDR A;  4BPY A;  4BL7 B;  2WCI A;  3HXS A;  3J7Y b;  2BJX A;  1BED A;  3ZMK A;  2MBT A;  4KW6 A;  1XPV A;  1PA3 A;  3WGX A;  3N9J A;  3UAP A;  5H5R A;  1PL1 A;  2P5R A;  4MPF A;  2XC2 A;  2IWT A;  4MH2 A;  3PIN A;  4AKI A;  2H0I A;  1UVZ A;  3L9S A;  3O3T A;  5EPF A;  3VUR A;  4G0L A;  2YOI A;  5D93 A;  4YAP A;  3F6D A;  1TU8 A;  5CO3 A;  5IO2 A;  1FAA A;  2A2P A;  3CSH A;  3IC4 A;  2GGT A;  1T4Y A;  4Q5Q A;  4V2N A;  4ZBD A;  1X9M B;  2QC7 A;  2PVO C;  3DD3 A;  3BCK A;  5L71 A;  4EE0 A;  3JCM L;  3M0F A;  5J3R A;  2X8H A;  1FHE A;  1XFL A;  3QAV A;  1V2A A;  3VWX A;  1BYE A;  4O5R A;  1RW1 A;  5C00 A;  2H01 A;  2GST A;  4MJE A;  4TXV A;  4F2I A;  5KN2 A;  4EVM A;  2RUF A;  1HNB A;  5HFK A;  3SWL A;  1O73 A;  2EFD A;  1URM A;  2XBI A;  2A2S A;  4K6X A;  4J57 E;  2GSS A;  3VI7 A;  4RQR A;  4POK A;  4ISD A;  3KP8 A;  1DE2 A;  4XS1 A;  5HR3 A;  1EOH A;  4XRD A;  4HOJ A;  3S9F A;  3Q19 A;  1TRU A;  2JAD A;  3CTG A;  4MP4 A;  4V2M A;  3H1N A;  4JBB A;  2GLR A;  2V6K A;  3FR3 A;  1FOV A;  1UA5 A;  5CNW A;  3ZRE A;  3LG6 A;  1T8E B;  2CZ3 A;  1GSE A;  2NTO A;  2ZNM A;  3F3Q A;  3I6A A;  4PNG A;  3SBC A;  5IMA A;  4MJC A;  1QMV A;  2FUG 2;  4TVE A;  4IP6 A;  1MEK A;  3KCM A;  1MDJ A;  1Z9H A;  5DDL A;  5G5F A;  4BWQ A;  3E3E A;  5HR0 A;  5INY A;  4K0N A;  2FA4 A;  3TKS A;  1B8X A;  4DSR A;  3HVV A;  4YQM A;  1X5E A;  4ML1 A;  2IL3 A;  1GUK A;  2K6V A;  3RDW A;  3HD5 A;  4Q5R A;  5IOW A;  2IFQ A;  5G5E A;  4OMV A;  20GS A;  1ERU A;  5EY6 A;  3DEX A;  1EGO A;  2XPE A;  3KTL A;  3ZYW A;  1FO5 A;  2YWI A;  2FA8 A;  1EV9 A;  6GSV A;  1G7E A;  3Q6O A;  1TI3 A;  3A3T A;  2WFC A;  3IOS A;  1XXU A;  5FWG A;  2RLI A;  4ID0 A;  1X5C A;  4ZB6 A;  1A8Y A;  4YQU A;  2PGT A;  1YEP A;  1ACV A;  2CAI A;  2JZS A;  2IFQ B;  3FRC A;  3G7I A;  5B6M A;  4WBR D;  4ZIJ A;  3ZVJ A;  2G0F A;  3KGK A;  2VD0 A;  3KMO A;  2JU5 A;  3FZA A;  2PU9 C;  1ZYE A;  1O6J A;  2C1Y A;  2ON5 A;  3C1S A;  2H74 A;  4PQH A;  4Z2R A;  2PVQ A;  5HFI A;  5ECN B;  4IBP A;  1YVL A;  1X9S B;  3TRQ A;  1XCC A;  3PH9 A;  2MMO A;  1NSW A;  1TRW A;  1ILO A;  5GST A;  4HZ4 A;  1T3B A;  2FLS A;  4KGI A;  4PXO A;  5JWO B;  13GS A;  2HSM A;  1WJK A;  4QL9 A;  3QAW A;  1B9X C;  2YN1 A;  1WOU A;  3DKS A;  5ECH B;  4ECI A;  1BQ7 A;  3VFI A;  5DQS A;  2F8A A;  4IGJ A;  3BCI A;  1YJ6 A;  4GQC A;  3TKP A;  3EYT A;  3M9K A;  4XS4 A;  3IK7 A;  2QSI A;  2B1L A;  4FYB A;  3EU4 A;  3LWA A;  2G2Q A;  11GS A;  3E0U A;  1TU7 A;  4WXT A;  2AAW A;  3W6G A;  4CW9 A;  1GUM A;  3DGQ A;  2VCX A;  2JSY A;  4POL A;  3GUS A;  4TR4 A;  1HNC A;  2YP6 A;  2VL9 A;  3CMI A;  5DJL A;  4GDF A;  1K0N A;  4G2E A;  1Y6E A;  1GLQ A;  2ALB A;  1BF5 A;  5IPG A;  3CSI A;  2WRT A;  1ERT A;  1TRV A;  1JLW A;  2VLU A;  1E6B A;  4XS4 B;  4W66 A;  4MF5 A;  3ED3 A;  3GYK A;  5AIX A;  3KMN A;  3U5R E;  4KH7 A;  4EUY A;  2N5F A;  2GQM A;  4EIP A;  1USB A;  1V40 A;  2DJ0 A;  1DSB A;  2J9H A;  4PUA A;  4N3Z A;  3TGZ A;  3FR6 A;  1T00 A;  1R5P A;  4G01 A;  3FKF A;  5LD0 A;  2R4V A;  4KCE A;  4WKW A;  1V58 A;  1MD3 A;  1LBK A;  2LJA A;  4POM A;  5J9C A;  2VLV A;  2IMD A;  5KN3 A;  2OA7 A;  1Z7P A;  2ZUP A;  5ECQ B;  1N8J A;  4MF7 A;  1F9M A;  1LJR A;  1VRS D;  1FVJ A;  2XHF A;  4MA9 A;  1SJI A;  18GS A;  2DJ3 A;  4OCE A;  1DBY A;  2H1B A;  5BRT A;  3A2X A;  1F3B A;  3EMP A;  5G1K A;  5ECK B;  3O76 A;  2HQT A;  2ZCT A;  4AJ7 A;  4N10 A;  2VM2 A;  1XW5 A;  3RAZ A;  2I9H A;  2PPT A;  3LW9 A;  3DML A;  1WMJ A;  1SEN A;  1NW2 A;  1GUH A;  5EVO A;  4G19 A;  2VAF A;  4TOP A;  6GST A;  1PSQ A;  1ZZY A;  4K1F A;  4K7N A;  2CZ2 A;  1VF1 A;  3F4R A;  3FHK A;  1MTC A;  1OKD A;  1OC8 A;  4HQS A;  3KXO A;  3GKN A;  1WE0 A;  1PKW A;  4ZL7 A;  1DUG A;  5JWR B;  2KUC A;  3IC8 A;  5KEJ A;  2YZU A;  4NHZ A;  2D2Z A;  3D21 A;  2IMI A;  2H6Y A;  2GT6 A;  2HZF A;  3PGT A;  1JFU A;  2P0G A;  5CP1 A;  2QGV A;  2NPB A;  3RHB A;  3ZVJ D;  5ECR B;  5J4U A;  1SVL A;  5DCH A;  4WR5 A;  1GSD A;  4FQU A;  1UN2 A;  4GST A;  1K0A A;  5D9V A;  2NDO A;  1ZYQ B;  2OAC A;  4ZB9 A;  3G9B A;  2KOK A;  3QOU A;  4IN0 A;  5B6N A;  4O32 A;  2HFD A;  1EWX A;  1TK5 B;  3QFA C;  3RHC A;  4ACS A;  3UJ1 A;  3LSZ A;  4EF0 A;  1PN9 A;  3EIN A;  3C8E A;  2WUL A;  1JZO A;  4ICY A;  1XBS A;  5KN1 A;  4K9Z A;  1ZL9 A;  5J9B A;  2M80 A;  3ZZX A;  2H6X A;  4BWS A;  3EMX A;  4AJ8 A;  5J5N A;  5ECP B;  1OE7 A;  4IQ1 A;  4J2F A;  1R7H A;  3IPZ A;  3V1W A;  3IHG A;  1FB0 A;  3FZ9 A;  3WYW A;  5A4V A;  1M2B A;  3CRU A;  3GX0 A;  4N0V A;  3HJM A;  2GVP A;  4HUA A;  1WWJ A;  3GNJ A;  2XPD A;  1N25 A;  1K3Y A;  2HSH A;  1QK8 A;  2FNO A;  3M1G A;  4GXZ A;  3UIW A;  1G0T A;  2PER A;  2KHP A;  2GZP A;  1XW9 A;  2CVD A;  4WR4 A;  3KD0 A;  1K0O A;  3PR8 A;  9GSS A;  3KM6 A;  1GP1 A;  2HSN A;  4USS A;  2GZZ A;  4CY8 A;  7GSS A;  1QFN A;  2LS5 A;  2YWN A;  1HQO A;  3HVS A;  4L0U A;  3L9U A;  3NZN A;  2A2R A;  5CRW A;  4KDY A;  4MAB A;  5JCU A;  4QMK A;  1A2J A;  4PQI A;  1B4P A;  4JED A;  2E2G A;  4FH8 A;  3VWW A;  2GTU A;  2X8C A;  1PX6 A;  5H5Q A;  2OJL A;  3A5I A;  4HZ2 A;  4KCA A;  2HSN B;  5ECS A;  2KP2 A;  2L5L A;  3TJJ A;  1JZD A;  5ECM B;  2FWG A;  2E7P A;  3WT2 A;  3QR6 A;  3MIX A;  3HA9 A;  1U3I A;  2IMK A;  3KZQ A;  1A2M A;  5DBQ A;  4N30 A;  3EE2 A;  8GSS A;  4F82 A;  3LFL A;  4OFM A;  1XW6 A;  1JZR A;  4OFT A;  3W8S A;  5CYY A;  1GL8 A;  3UOM A;  3IR4 A;  2H6Z A;  2EC4 A;  3GHA A;  3BBY A;  1BG1 A;  4HJ2 A;  5F0G A;  2DKI A;  3ZIJ A;  4TR1 A;  5HR2 A;  4FYC A;  2X99 A;  2E0Q A;  4XTS A;  2O87 A;  2M46 A;  4ML6 A;  2H1D A;  1SVO A;  3GST A;  1OC3 A;  2LEG A;  2R37 A;  5ABR A;  1G6W A;  3LGC A;  1VGL A;  4EO3 A;  2H1L A;  3GV1 A;  1PRX A;  2C80 A;  1R4W A;  2OBI A;  2DSA A;  4IHU A;  4G9H A;  5GAN D;  5FHI A;  2JAC A;  3TRP A;  4X4J A;  1FG4 A;  1GRX A;  4PTS A;  1HYU A;  3ME8 A;  3GFK A;  1PGT A;  3VK9 A;  4DEJ A;  5IMV A;  2MYG A;  3P8W A;  1A23 A;  4F0C A;  5G2Z A;  3GA4 A;  1TP9 A;  3D4T A;  2YAN A;  3I69 A;  1SK1 A;  4P3Y B;  2DKH A;  3GH9 A;  2VCW A;  3ERW A;  2JSZ A;  5D9W A;  3LEF A;  4L0W A;  3CWG A;  1QXH A;  2PN8 A;  4G10 A;  4GCI A;  3C1R A;  3UMA A;  1GSY A;  3ZIT A;  4PX1 A;  3TJF A;  3TDG A;  2F51 A;  5JWQ B;  2WZ9 A;  4WBJ A;  5FT3 A;  2R5G A;  1VF4 A;  5J47 A;  2VM1 A;  5AIS A;  1XIY A;  3M9J A;  4BVY A;  4TR0 A;  4F0B A;  1A8L A;  3ERG A;  4EXJ A;  3QCP A;  4JU5 A;  2A4V A;  4GSS A;  1CQH A;  3UVH A;  1FOH A;  2OE3 A;  1SJ6 A;  5DAK A;  4NV5 A;  5JCG A;  4K7O A;  1E2Y A;  3QFB C;  2MMZ A;  3HZ4 A;  4HI7 A;  3WGD A;  2IME A;  4HQZ A;  5AGY A;  5J41 A;  4RI7 A;  4BVY B;  4O5U A;  2FD3 A;  2AYT A;  4MPG A;  2NBS A;  1Z6M A;  1V57 A;  1K3L A;  5A4U A;  4I5Q A;  1TDI A;  2JZT A;  2K9F A;  2V6O A;  4WET A;  4GWR A;  4IKH A;  4L8E A;  2I4A A;  4K8M A;  4GF0 A;  4YH2 A;  1K3O A;  3DXB A;  2VUP A;  1IYI A;  3HCZ A;  6GSY A;  5H5S A;  2H66 A;  1SVM A;  1EGR A;  2EFE A;  3MAK A;  2FWF A;  3L78 A;  1SJZ A;  1AC1 A;  5A5K A;  1Z3E A;  5IMC A;  3AY8 A;  2FCH A;  4OWY A;  1AAZ A;  1EV4 A;  1ERW A;  2R3X A;  4ZBA A;  5KOX A;  4EIQ A;  3F4T A;  2H72 A;  2GSR A;  1AUC A;  1ZYN A;  4TRX A;  3F8U A;  4H86 A;  1GNE A;  1EEM A;  3E9J B;  2GQL A;  3LQ7 A;  2FY6 A;  3EUR A;  5F06 A;  1R5A A;  1O85 A;  3MYD A;  5CAX A;  2EFH A;  2YPM A;  3UL3 A;  3ZRD A;  2DC5 A;  5ENU A;  2B7J A;  3IHQ A;  2EIQ A;  2VIM A;  1T1V A;  5ID2 A;  3FMW A;  5D96 A;  2C4J A;  5IMZ A;  2FHE A;  4K2D A;  3MSZ A;  2IN3 A;  1BX9 A;  5A1N A;  1PX7 A;  3GTU A;  4KX4 A;  2IIY A;  4KUN A;  4ZL9 A;  4EKZ A;  4QL7 A;  1OC9 A;  4N0Z A;  2B5Y A;  2HSM B;  2H1G A;  2LV3 A;  3TKS C;  2DML A;  2VL3 A;  2VOC A;  4JRR A;  3GKK A;  3UBL A;  5ID2 B;  1AQX A;  6GSX A;  2H1A A;  1PN0 A;  2HI7 A;  2X8G A;  2UZ8 A;  5A1N B;  4MF6 A;  3TU3 B;  4LLR A;  1Z7R A;  4X1U A;  5B8A A;  1OC9 B;  3FK8 A;  4KF9 A;  4O7H A;  2NVL A;  4MZW A;  1AW9 A;  4L5O A;  3KJY A;  1X5D A;  2C3T A;  2CA8 A;  3FEU A;  5HQP A;  2LNS A;  4JE1 A;  4GSN A;  1OYJ A;  3TRX A;  2LRT A;  2YNX A;  1PMT A;  3ZIV A;  2DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...