4I97A

The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
207
structure length
207
Chain Sequence
ADLYYLPGSSPCRSVIMVAKAIGLELNKKLLDLSTGEHLKPEFVKINPQHTIPTLVDNGFALWESRAILVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPELYKKMEAAVEFLNTFLEGQTYAAGDSLTIADIALLATMSSFEVAGYDFSKYENVNKWYANAKKVTPGWDENWAGCQEFKKYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DELTA CLASS 1 GLUTATHIONE S-TRANSFERASE
publication title Evolution of herbivory by adaption in an ancient detoxification pathway
rcsb
source organism Scaptomyza nigrita
total genus 76
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4i97A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i97A01
2CZ2A 1Z5YE 3VLNA 2L6CA 1TXXA 1K3LA 2C8UA 3HXSA 2VCZA 2O89A 2LEGA 1O8WA 5F06A 2V1MA 2UZ8A 4HEA2 1TRVA 4EF0A 4ECCA 4XTSA 1M99A 2YOIA 2I9HA 2X64A 3CTFA 1F9MA 4DVCA 2WJUA 4V1Ag 2LS5A 3C73A 3ZZXA 3GIXA 4LMVA 2JSYA 1XVWA 4ZL7A 4G2EA 5AGYA 2GSRA 2DIZA 3TDGA 1G7EA 5CRWA 2MBTA 3D22A 4TR0A 1OKDA 1DUGA 7GSSA 1F37A 1U3AA 4F0CA 1KNGA 1MDJA 1N2AA 3P2AA 4POLA 1GNEA 3ISOA 1SJ6A 4K0NA 2WCIA 3M9JA 1X9MB 2IL3A 1H75A 2QKEA 4TRXA 4KGIA 1UN2A 1EV9A 4PUFC 1PL2A 3IR4A 4HU9A 4WR5A 3H4KA 4MLYA 1TOFA 2WRTA 19GSA 4TR1B 6GSWA 1AAZA 3GA4A 4MP4A 4F2IA 2YV9A 4DEJA 4NWYA 4PNFA 4DSSA 3HDCA 5DQYA 2LRTA 4EUYA 4HZ2A 3ERGA 4XS4B 3I69A 3DMLA 5J9BA 4GTUA 4CHSA 5ECOB 1FG4A 4IN0A 2VM2A 3ZLPA 2X8HA 3J7Yk 2H01A 2LUSA 3ZREA 4V2LA 1M2BA 3DXBA 5IPHA 3QFAC 4G0LA 2DJ3A 2VL2C 5HQPA 2AJQB 3GRXA 5DJLA 5IMCA 2C4JA 1GTIA 3QDNA 3IDVA 5AISA 1WOUA 4IJ3A 1YF0A 1S3CA 2ON5A 3IC8A 3ZFBA 4JE1A 2FUG2 3UMAA 1EGOA 3IE3A 1C72A 2LRNA 3L9SA 4XRAA 2O7KA 1TRSA 3CYNA 4Z7XA 3FR9A 3UAPA 4IELA 1TP9A 4MJEA 3TRXA 4EVMA 1OC8A 5CREA 5IO0A 2YJHA 4BVXB 2HNLA 4GRFA 2ON7A 5ID2B 3FR3A 2HYXA 4MK3A 4QQ7A 2GDRA 1SK1A 2FD3A 1FW1A 2FLSA 2C80A 4I5QA 5H5QA 3R2QA 2XHFA 4LL1B 1AUCA 1A2MA 5IOXA 1AQXA 4DSRA 1T4YA 1EV4A 2MZCA 2VLUA 5LD0A 3EE2A 1FB0A 1DSBA 1WE0A 4ZXGA 3MWHA 1TW9A 1OKTA 3EURA 2YJ7A 5D96A 4G9HA 4IGJA 1X0RA 1X5CA 2CX4A 1QXHA 1M0UA 5KEJA 1SD9A 4P3YB 2R6KA 4OFTA 3HJMA 3P8WA 2L59A 3RHBA 1O8XA 1B48A 4YQMA 2M72A 5IMZA 3GURA 3HVSA 3EU3A 3M3MA 4K1FA 4AJ6A 2B7JA 3D21A 3LWAA 3F6DA 5CRGA 3TJGA 4ZB6A 1ZZYA 4N0ZA 1FHEA 3TRQA 1E2YA 3SWLA 1XVQA 2OE3A 1GL8A 2V6KA 5HR3A 1E6BA 3L4NA 4YQUA 1YKCA 2HZEB 3F8UA 1K0CA 4FYCA 2HSMB 4BL7B 2VD1A 3HZ4A 4AF2A 2NPBA 2F8AA 1MDKA 1R5AA 3DGQA 4J56E 1TU8A 2YZHA 2WDUA 1PKZA 4USSA 3FZ4A 4RI7A 1XWCA 1GLQA 1GUMA 2HSHA 5GAND 2VLTA 2NVLA 3IBHA 4X0XA 3O76A 1EZKA 5D9VA 1NHYA 5F07A 3MNGA 2AAWA 2XPEA 4WEYA 3BCKA 1FAAA 10GSA 1GSYA 1XOBA 3LSZA 3FEUA 1SK0A 3GTUA 1ZGNA 1O73A 1RQMA 3GUSA 3LYPA 3CMIA 2DJ1A 5HR0A 1URMA 3BBYA 1THOA 3VI7A 5D73A 1QGVA 4IHUA 1IYHA 1MEKA 2DIYA 1K0BA 3I9V2 1Z9HA 3VWUA 1M7TA 1Q4JA 8GSSA 4ZIJA 5JCUA 20GSA 2PUKC 4TKYA 2OADA 1OC9A 4YAVA 2LNTA 2H1DA 2N5AA 5FWGA 4KA0A 1AQWA 5E4WA 2XC2A 1NM3A 3IPZA 1B9XC 3R3EA 3TKSA 1A24A 4ML1A 3IOSA 2ES7A 4ECJA 2P5RA 2FWHA 4MA9A 4K7NA 2QGVA 4BVYA 4DSSB 1EGRA 1A2LA 2MMNA 3GH6A 1WIKA 3DIEA 1THXA 3F3RA 1MTCA 6GSXA 1WMJA 4V2NA 2I4AA 1PMTA 2H66A 4BPYA 5A4WA 5COHA 4POMA 3UL3A 2K8VA 2XBQA 3FZ5A 2A2SA 3EINA 1ZMAA 3RAZA 2RM5A 5ECHB 2FNOA 5J5NA 4KSOA 3VWVA 1BAYA 1XW6A 2H72A 2OE1A 3M1GA 4MF5A 3L9VA 3D5JA 1EEJA 2JZSA 4XCSA 3UARA 1VF1A 1ERUA 3HD5A 1XFLA 4F03A 1PN9A 3CTGA 3KEBA 4J57E 2YN1A 6GSVA 3HCZA 3GL3A 3H93A 4ZBBA 1DE1A 1Y25A 2B5YA 4IBPA 2F8FA 1R7HA 2CVKA 5IQYA 2GQMA 3BCIA 5ENUA 4K8MA 2H1AA 2E2GA 1U3IA 4EDZA 2OA7A 1WWJA 3LXZA 3TJJA 4OCEA 1EEMA 3GMFA 3TJKA 2B1LA 1AC1A 2R2JA 3D4TA 1SKRB 2HSNB 1YDKA 2FCHA 3RDWA 1XW5A 2EIQA 3ERWA 3QOUA 2GZPA 2FWFA 3FZ9A 2HI7A 2IPAA 2R3XA 5AN1A 1ABAA 1VF2A 1Z6NA 4PQIA 3L9UA 3TCOA 3FHKA 2N5BA 1GSSA 5ECSA 4KUNA 2LV3A 3DYRA 2GSSA 2WZ9A 1PSQA 3W8JA 1GLPA 4WETA 4FO5A 5HR1A 2K18A 3LJRA 1PD21 4POKA 1Z7PA 2FWEA 5IOWA 1XCCA 4WBRD 4KDXA 1QQ2A 4K2DA 5DALA 4ZBAA 2AB6A 5HR2A 4K0GA 1PX7A 4HI7A 3HVVA 4TR4A 4IP1A 1V57A 1SL1B 5GZZB 4IJIA 5ELAA 2NDOA 2GTUA 1J9BA 2CVBA 1QUWA 4AJ7A 3QAVA 1ZOFA 11GSA 1HYUA 4LMWA 4N10A 1LJRA 1BX9A 2HRAA 1SL2B 2P5QA 5JCGA 5AIVA 1ZL9A 4OO4A 5CRDA 2PU9C 5DAKA 4YAPA 3HJPA 3US3A 2VL3A 4KNDA 2YANA 1J08A 1DBYA 4OFNA 2O85A 4IS0A 3GYKA 4G0KA 1KBNA 2H76A 5DDLA 1A0FA 1F6MC 5G1LA 1MD3A 3VURA 5C04A 1V9WA 4ILFA 1F3BA 3UVTA 3FKFA 1VRSD 2GSTA 5H5RA 3ME8A 3FW2A 1Z6MA 3KGKA 2NBSA 2CX3A 2ZUPA 4N11A 2B5XA 5G30A 1T4ZA 2VOCA 3HY2A 3A5WA 1XWAA 4GQCA 2A2RA 6GSYA 1EP8A 1AQVA 1TI1A 4RQXA 5IPGA 4G19A 1N8JA 2I81A 5IM9A 2C0EA 4MJBA 3TJFA 3EYTA 3ZIJA 1FVJA 3ZVJA 2EC4A 3RPPA 4PURA 3MSZA 3J7Yb 3GTUB 1ERVA 4PTSA 1BYEA 1G7OA 4ZL9A 3ZITA 2F9SA 1BJXA 5FHIA 2DJKA 2OBIA 2WFCA 5G31A 1UC7A 3ME7A 4HU7A 3P90A 2H8LA 3LEFA 3RBTA 2X8GA 2ZCTA 1EWXA 2IMDA 4CW9A 2DMLA 3OR5A 4EC0A 1GSUA 2M46A 2VM1A 2JZTA 3CBUA 5ABRA 6GSSA 2V2GA 2GGTA 3ERFA 5H5SA 1XW9A 2C3QA 1OC9B 1JZWA 1MDIA 3O3TA 2HE3A 2L5LA 2K6VA 4AGSA 3FRCA 3GFKA 4MPGA 3APOA 1U6TA 4K7OA 1XZOA 4MF6A 5C00A 2E2MA 3F4TA 5ECPB 2KUCA 5L71A 4BVYB 3UEMA 3KP8A 4HDEA 1NHOA 5F0GA 4HOJA 4ISDA 3MDKA 2G0FA 1OE8A 3LG6A 2OBKA 4HUAA 1WPIA 5D9XA 1SENA 2AV4A 3GN3A 2MMAA 17GSA 3M8NA 1V2AA 3ZVJD 3FY7A 1X9SB 2YCDA 4G0IA 5G2ZA 1K0NA 2B5EA 3GKMA 2CZ3A 1O6JA 3D4MA 4O32A 4FQUA 2LKUA 2H71A 13GSA 2HQTA 2L4CA 5KN0A 1MD4A 18GSA 2JADA 3DRNA 3Q74A 1GSFA 3KM6A 4OCFA 1R26A 1A8YA 4GSNA 3H8QA 4O7HA 2HT9A 2HXKA 3N9JA 2JU5A 2IN3A 2CVDA 4HS1A 1FOVA 4GSSA 3EVIA 4DSQA 1X5EA 3VFIA 2MMZA 2K9FA 5G1KA 3KTBA 1G6WA 4RQRA 2VUPA 4HQSA 3F0IA 3ZIVA 2GZYA 5EL8A 1YEPA 4JRRA 5KN2A 5B6NA 2PMTA 2IMFA 4Q5FA 1UVZA 1QMVA 3TKSE 3VWWA 1TKDB 1ZYEA 4JU5A 1NSWA 2KOKA 3F4RA 3Q18A 1VGLA 4XS6A 3O6TA 3GX8A 3DD3A 5G5FA 3UOMA 1WJKA 3IHQA 5D9TA 1CQGA 2FA8A 4ACSA 4H86A 2R37A 2YWMA 4POBA 4MZCA 2IFQA 3U6VA 4N30A 1YJ6A 2PERA 5GSTA 2DMMA 2YZUA 5DALB 4MCUA 2CT6A 3WYWA 4EKZA 4PXOA 4TN8A 1PGTA 2PN8A 2C0FA 2F3MA 3D0ZA 3IK9A 2C0DA 5BMUA 2B6MA 5CP1A 4YQVA 1XIYA 1UA5A 2Z9SA 1B9YC 1S3AA 1Z3EA 2OKAA 2PVQA 4I8BA 5A5KA 3RHCA 4TVEA 3UBKA 2RIIA 1HNAA 1TU7A 2GS3A 3D6IA 3A3TA 3LXTA 5DAKB 3KTLA 1VF3A 2VO4A 2O8VB 4KF9A 3A2VA 3APSA 1M2DA 1RW1A 4GSTA 1TDIA 1W89A 2LRCA 2LTKA 3TKPA 1SKWB 3GV1A 2HRKB 2GT6A 4NHZA 4K6XA 1IYIA 1GRXA 1GUHA 5DQSA 1JZDA 2FA4A 5J9CA 5JCWA 5JWRB 1JZRA 3UVHA 1OVNA 3ZRDA 1ST9A 2KP2A 3GH9A 4OMVA 3BOAA 4GLTA 1QFNA 3ZMKA 2LQQA 2VCXA 2E7PA 16GSA 1SJIA 5HFGA 1T7PB 1PA3A 2DJJA 1JLVA 4D73A 5GAPD 2DBCA 2RM6A 5D8IA 5EPFA 1B4PA 4ECIA 1X9WB 1SU9A 1QK8A 3DVWA 4ZB8A 2VL2A 3F9UA 5LNKe 2L6DA 3QR6A 5DCHA 2AUVA 2C3NA 4X43A 3P7XA 2LNSA 5JWQB 1R5PA 3W8SA 2P31A 2H6YA 2C0GA 3L0HA 4XS1A 3QAWA 22GSA 5J41A 3GSSA 3PGTA 2R5GA 2IWTA 3KIJA 3KXOA 2GQKA 2I1UA 3H79A 3M9KA 3ED3A 3WD6A 1M9AA 1HNBA 4MDCA 3CSHA 2GSQA 1HNCA 3HJOA 3IXRA 3IRAA 2BMXA 1K3OA 4LA1A 4WKWA 3PH9A 1HQOA 1LBKA 2LJAA 3Q19A 2L57A 1JFUA 2TRCP 2VLVA 4NMUA 4RUVA 1G0TA 3G9BA 2A4VA 2RUEA 4WF4A 5DJMA 1BQ7A 4JR4A 3F6FA 1GTAA 4V2MA 4OFMA 4MMMA 3JCML 5GSSA 2H6ZA 2L5OA 1XWKA 4TW5A 2LQOA 4GQFA 4AJ8A 2CQ9A 4GWRA 3KH7A 2VL9A 5KN3A 3UBLA 4J2FA 3LQ7A 4GCIA 3C7MA 3I6AA 1V58A 3WT1A 2KHPA 1NW2A 2ZNMA 4OD7A 1AIUA 2K8SA 2H75A 1ERWA 2H1BA 5B8AA 4KCEA 1XXUA 5CRHA 1V98A 3HVXA 14GSA 4E8EA 2QC7A 1PRXA 5FT3A 5ECMB 2B3SA 2B1KA 2YNXA 4QL7A 3EMXA 1TK0B 4MJCA 2JSZA 4TXOA 3GSTA 2OE0A 4PNGA 2X8CA 2V32A 3MAKA 2HSYA 2H0HA 2HRNA 3ZMLA 3NZNA 2IIYA 4NXIA 3KP9A 3LORA 4XHMA 2VCVA 3QD9A 2PPTA 3F4SA 2CA8A 2YWIA 1H4OA 4EDYA 1OC3A 3F3QA 4O92A 4ZILA 1T3BA 1XWGA 2J9HA 2HRKA 2N5FA 2PGTA 3LYKA 4MJAA 2YPMA 5IO2A 5KN1A 1F2EA 2VD0A 3H1NA 2LJRA 3GX0A 1CQHA 3ZL5A 4IP6A 3S9FA 2DJ2A 5CYYA 5ECNB 2D2ZA 1O7UA 2VCTA 4KX4A 4K7IA 5DBQA 1SKSB 5B7CA 3KH9A 4Q5NA 4NAXA 1F3AA 3K8NA 2FGXA 5DCGA 3ZTLA 4L0WA 3NIVA 1YF1A 2IJYA 3TKSC 3CXGA 3E0UA 3TRPA 5ECRB 2E0QA 5INYA 3IC4A 1GTBA 3LFLA 2IFQB 4HQZA 4LLRA 5B6MA 2HFDA 4YH2A 2MBSA 1ON4A 4BWSA 5J4UA 2M80A 4NPBA 4F9ZA 1YZXA 4FH8A 3EC3A 1FVKA 5CAXA 5IMFA 3DEXA 3TB2A 1YQ1A 3AY8A 3M0FA 6GSTA 1ML6A 2V6OA 4NHWA 1TK5B 2KLXA 4MZBA 5JWOB 2WGRA 2O87A 3PR8A 2TRXA 4L8EA 2CAQA 2H0IA 12GSA 1GSDA 1AXDA 5IMVA 3EMPA 5ECQB 3PPUA 2NTOA 2VAFA 4ZL8A 1ERTA 5HFKA 2CAIA 4LL4B 1PQNA 2H70A 4PUAA 4Q5QA 3HZ8A 5EY6A 3E9JB 3APQA 6GSUA 4KCAA 4WR4A 4Q5RA 3L78A 2DLXA 1JZOA 2H6XA 2H0GA 3GHAA 1K0DA 1SYXA 4OO5A 2G2QA 4KW6A 4D73B 4IW9A 2L4QA 3HKRA 2X99A 1OYJA 1U87A 1G6YA 3I43A 4KE3A 3WGXA 4JR6A 1GUKA 3C8EA 4F0BA 3QAGA 1SK2A 4KAEA 1SJZA 3Q6OA 1W4VA 1PL1A 1JHBA 2EIRA 3V1WA 5ELGA 4EXJA 2AHEA 5IMDA 2H30A 4IQ1A 3DWVA 1GWCA 5CNWA 5IMAA 1BG5A 1YEXA 1PKWA 1B4QA 3WGEA 5CO3A 4MZWA 1KTEA 3KMNA 5ECLB 2WB9A 3FR6A 3KCMA 2GVPA 1HD2A 2YWNA 1PX6A 4PQ1A 2H1GA 2CV4A 3U5RE 3TOUA 3WT2A 1OAZA 1U88A 2YV7A 5IIZA 1VF4A 2ALBA 2HZFA 4ID0A 4KDUA 1LU4A 4I97A 1TRUA 4GXZA 1T8EB 5D93A 1M9BA 3TKQA 3VI5A 2H19A 3G7IA 1BEDA 1J0FA 3W6GA 2LSTA 4I2UA 2YP6A 4GF0A 4XRDA 4O5RA 4L5OA 3VPTA 2VCQA 3HYPA 3DKSA 1RK4A 4MH3A 1GH2A 1A23A 3QMXA 4PQHA 1EP7A 1ILOA 3N5OA 4JZQA 1XBSA 3A2WA 1I5GA 3TUEA 3A2XA 1ZYQB 4RI6A 1TK8B 3ZFLA 4G10A 1TRWA 2PWJA 2IMKA 1T1VA 2FHEA 3IAM2 3CSJA 2FWGA 2TIRA 2IMEA 1B8XA 4V1Ap 3PINA 4TR1A 5F8BA 3C1RA 2IMIA 1WRYA 4QL9A 4KH7A 4FYUA 2KP1A 4NV2A 4IVFA 4JEDA 1X5DA 4XS4A 5J3RA 2MYGA 1FB6A 1OE7A 2BJXA 3KZQA 3KMOA 1XPVA 1XWBA 3IA1A 2GZZA 4PGTA 1A8LA 2LJKA 2BTOT 4WF5A 3TGZA 2FY6A 2PBJA 2C3TA 5EVOA 1YKAA 3BJ5A 3BD2A 2JACA 4HJMA 4TR3A 4TXOB 3IAS2 5ECKB 3CSIA 1FO5A 1AW9A 4BA7A 4CDOA 3FZAA 1WP0A 2DC5A 3HHVA 4FIWA 4JBBA 4MH2A 1M2AA 2I3YA 2JL4A 1ZCPA 2P0GA 4OWYA 3UJ1A 5B8BA 2QSIA 2B7KA 2REMA 2C1YA 1Y6EA 3WGDA 3TJBA 4ZBDA 1SD8A 2GQLA 2J23A 3RPNA 3VK9A 2R4VA 1Z7RA 1GNWA 2V41A 2GT5A 1YY7A 4NV5A 3VPQA 1GTUA 1GSQA 4MPFA 4WXTA 3KD0A 3IK7A 2WS2A 5HFIA 2VIMA 3NOFA 4WBJA 4EO3A 3TKRA 3QPMA 1S3DA 1K3YA 4X1UA 1K0OA 3C1SA 4BVXA 1XOAA 4E8HA 4EL1A 5ID2A 5F05A 4XIHA 9GSSA 1TTZA 5G5EA 4I2TA 4BWQA 4FYBA 2MMOA 1USBA 4ULXA 2XPDA 1O81A 1I9DA 3UIWA 1EOGA 3CRUA 5AIXA 4F82A 1A2JA 3F63A 3IV4A 1EOHA 4KSMA 3C71A 3GL5A 3LGCA 1TI3A 1TJDA 1R4WA 2RUFA 2HLSA 2HRFA 2OJLA 5LCZA 2GLRA 2F51A 3GKKA 4IKHA 1ACVA 2JZRA 3DVXA 3QFBC 3GKNA 3GNJA 3SBCA 5A4VA 2EIOA 2H73A 1JLWA 3ZYWA 3KJYA 3GKXA 5E59A 3VWXA 5ECIB 1SYRA 1O85A 1Q98A 3QCPA 4MABA 2WULA 5DVBA 3EWLA 4EE0A 2DJ0A 1K0MA 4PX1A 4KDYA 1T00A 4KB3A 3HA9A 1SL0B 2VCWA 4K9ZA 2YWOA 2XBIA 3G7YA 3FK8A 4N0VA 1GULA 2DSAA 2HZEA 3EU4A 4I6XA 4TOPA 2H74A 2HSMA 2AYTA 4BL7A 1A0RP 1DE2A 1KEBA 3E3EA 1GSEA 2RLIA 2OACA 3G7JA 4ECBA 4TXVA 4L0UA 2PVOC 4IQAA 4MF7A 5A4UA 3CRTA 1V40A 4HZ4A 1GP1A 3TOTA 1K0AA 4ML6A 4ZB9A 4HJ2A 5D9WA 4L5LA 3FYGA
chains in the Genus database with same CATH superfamily
1PFOA 2CZ2A 1Z5YE 3VLNA 2L6CA 1TXXA 1K3LA 2C8UA 3HXSA 2VCZA 3CHXC 2O89A 1SVMA 2LEGA 1O8WA 5F06A 2V1MA 2UZ8A 4HEA2 1TRVA 4EF0A 4ECCA 4XTSA 1M99A 2YOIA 2I9HA 2X64A 3CTFA 1F9MA 4DVCA 2WJUA 4V1Ag 2LS5A 3C73A 3ZZXA 3GIXA 4LMVA 2JSYA 1XVWA 4ZL7A 4G2EA 5AGYA 2GSRA 2DIZA 3TDGA 1G7EA 5CRWA 2MBTA 3D22A 4TR0A 4N3ZA 1DUGA 1OKDA 4BIKA 7GSSA 4Z2RA 1F37A 1U3AA 4F0CA 1KNGA 1MDJA 1N2AA 3P2AA 4POLA 3ISOA 1GNEA 1SJ6A 4K0NA 2WCIA 3M9JA 1X9MB 2IL3A 1H75A 2QKEA 4TRXA 4KGIA 1UN2A 1EV9A 4PUFC 1PL2A 3IR4A 4HU9A 4WR5A 3H4KA 4MLYA 1TOFA 2WRTA 19GSA 2WVYA 4TR1B 6GSWA 1AAZA 3GA4A 4MP4A 4F2IA 2YV9A 4DEJA 4NWYA 4PNFA 4DSSA 3HDCA 5DQYA 2LRTA 4EUYA 4HZ2A 3ERGA 4XS4B 3I69A 3DMLA 5J9BA 4GTUA 4CHSA 1ZYNA 5ECOB 1FG4A 4IN0A 2VM2A 3ZLPA 5A5HA 2X8HA 3J7Yk 2H01A 2LUSA 3ZREA 4V2LA 1M2BA 3DXBA 5IPHA 3QFAC 4G0LA 2DJ3A 2VL2C 5HQPA 2AJQB 3GRXA 5DJLA 5IMCA 2C4JA 1GTIA 3QDNA 3IDVA 5AISA 1WOUA 4IJ3A 1YF0A 1N25A 1S3CA 1ZYPA 2ON5A 3IC8A 3ZFBA 4JE1A 2FUG2 3UMAA 3FMWA 1EGOA 3IE3A 1C72A 2LRNA 3L9SA 4XRAA 2O7KA 1TRSA 3CYNA 4Z7XA 3FR9A 3UAPA 4IELA 4AKXB 2HSNA 1TP9A 5A1NB 4MJEA 3TRXA 4EVMA 1OC8A 5CREA 5IO0A 1SVOA 2YJHA 4BVXB 2HNLA 4GRFA 2ON7A 5ID2B 3FR3A 2HYXA 4MK3A 4QQ7A 2QA1A 2GDRA 1SK1A 2FD3A 1FW1A 2FLSA 2C80A 4I5QA 5H5QA 4AKIA 3R2QA 2XHFA 4LL1B 1AUCA 1A2MA 5IOXA 1AQXA 4DSRA 1T4YA 1EV4A 2MZCA 2VLUA 5LD0A 2WVXB 3EE2A 1FB0A 2R0PA 1DSBA 1WE0A 4ZXGA 3MWHA 1TW9A 1OKTA 3EURA 2YJ7A 5D96A 4G9HA 4IGJA 1X0RA 1X5CA 2CX4A 1QXHA 1M0UA 5KEJA 1SD9A 4P3YB 2R6KA 4OFTA 3HJMA 3P8WA 2L59A 3RHBA 4W66A 1O8XA 1B48A 4K2XA 4YQMA 2M72A 5IMZA 3GURA 3HVSA 3EU3A 3LW9A 3M3MA 4K1FA 4GDFA 4AJ6A 2B7JA 3D21A 3LWAA 3F6DA 5CRGA 3TJGA 2WVZA 4ZB6A 1ZZYA 4N0ZA 1FHEA 3TRQA 1E2YA 3SWLA 4AKGA 1XVQA 2OE3A 1GL8A 2X49A 2O5VA 2V6KA 5HR3A 1E6BA 3L4NA 4YQUA 1YKCA 2HZEB 3F8UA 1K0CA 4O5UA 4FYCA 2HSMB 4BL7B 2VD1A 3HZ4A 4AF2A 2NPBA 2F8AA 1MDKA 1R5AA 3DGQA 4J56E 1TU8A 2A2PA 2YZHA 2WDUA 1PKZA 5A34B 4USSA 3FZ4A 4RI7A 1XWCA 1GLQA 1GUMA 2HSHA 5GAND 2VLTA 2NVLA 3IBHA 4X0XA 3O76A 1EZKA 5D9VA 1NHYA 5F07A 3MNGA 2AAWA 2XPEA 4WEYA 3BCKA 1FAAA 10GSA 1GSYA 1XOBA 4K5RA 3LSZA 3FEUA 1SK0A 3GTUA 1ZGNA 1O73A 1RQMA 4A5PA 3GUSA 3LYPA 3CMIA 2DJ1A 5HR0A 1URMA 3BBYA 1THOA 3VI7A 5D73A 1QGVA 4IHUA 1IYHA 1MEKA 2DIYA 1K0BA 3I9V2 1Z9HA 3VWUA 1M7TA 1Q4JA 8GSSA 1BF5A 4ZIJA 5JCUA 5A1NA 20GSA 2PUKC 4PHZC 4TKYA 2OADA 1OC9A 4YAVA 2LNTA 2H1DA 3CQFA 2WW3A 2N5AA 5FWGA 4KA0A 1AQWA 5E4WA 2XC2A 1NM3A 3IPZA 1B9XC 3R3EA 3TKSA 1A24A 4ML1A 3IOSA 2ES7A 4ECJA 2P5RA 2FWHA 4MA9A 4K7NA 2QGVA 4BVYA 4DSSB 1EGRA 1A2LA 2MMNA 3GH6A 1WIKA 3DIEA 1THXA 3F3RA 1MTCA 6GSXA 1WMJA 4V2NA 2I4AA 1PMTA 2H66A 4BPYA 5A4WA 5COHA 4POMA 3UL3A 5A5HB 2K8VA 2XBQA 3FZ5A 2A2SA 3EINA 1ZMAA 3RAZA 2RM5A 5ECHB 2FNOA 5J5NA 4KSOA 3VWVA 1BAYA 1XW6A 2H72A 2OE1A 3M1GA 4MF5A 3L9VA 3D5JA 1EEJA 2JZSA 4XCSA 3UARA 1VF1A 1ERUA 3HD5A 1XFLA 4F03A 1PN9A 3CTGA 3KEBA 4J57E 2YN1A 6GSVA 3HCZA 3GL3A 3H93A 4ZBBA 1DE1A 1Y25A 2B5YA 4IBPA 2F8FA 1R7HA 2CVKA 5IQYA 2GQMA 3BCIA 5ENUA 1XG8A 4K8MA 2H1AA 2E2GA 1U3IA 4EDZA 4ICYA 2OA7A 1WWJA 3LXZA 3TJJA 4OCEA 1EEMA 3GMFA 3TJKA 2B1LA 1AC1A 2R2JA 3D4TA 1SKRB 2DKIA 2HSNB 1YDKA 2FCHA 3RDWA 1XW5A 2EIQA 3ERWA 3QOUA 2GZPA 2FWFA 3FZ9A 2HI7A 2IPAA 2R3XA 5AN1A 1ABAA 1VF2A 1Z6NA 4PQIA 3L9UA 3TCOA 3FHKA 2N5BA 1GSSA 5ECSA 4KUNA 2LV3A 3DYRA 2GSSA 2WZ9A 1PSQA 3W8JA 1GLPA 4WETA 4FO5A 5HR1A 2K18A 3LJRA 1PD21 4POKA 1Z7PA 2FWEA 5IOWA 1XCCA 2R0CA 1Y1UA 4WBRD 2DKHA 4KDXA 1QQ2A 4K2DA 2QA2A 5DALA 4ZBAA 2AB6A 5HR2A 4K0GA 1PX7A 2O36A 4HI7A 3HVVA 4TR4A 4IP1A 1V57A 1SL1B 5GZZB 4IJIA 5ELAA 2WW1A 2NDOA 2GTUA 1J9BA 2CVBA 1QUWA 4AJ7A 3QAVA 1ZOFA 11GSA 1HYUA 4LMWA 4N10A 1LJRA 1BX9A 2HRAA 1SL2B 2P5QA 5JCGA 5AIVA 1ZL9A 4OO4A 5CRDA 2PU9C 5DAKA 4YAPA 3HJPA 3US3A 2VL3A 5BRTA 4KNDA 2YANA 1J08A 1DBYA 4OFNA 2O85A 4IS0A 3GYKA 4G0KA 1KBNA 2H76A 5DDLA 1A0FA 1F6MC 5G1LA 1MD3A 3VURA 5C04A 1V9WA 4ILFA 1F3BA 3UVTA 3FKFA 1VRSD 2GSTA 5H5RA 3ME8A 5KOWA 3FW2A 1Z6MA 3KGKA 2NBSA 2CX3A 2ZUPA 4N11A 2B5XA 5G30A 1T4ZA 2VOCA 3HY2A 3A5WA 1XWAA 4GQCA 2A2RA 6GSYA 1EP8A 1AQVA 1TI1A 4RQXA 5IPGA 2A4HA 4G19A 1N8JA 2I81A 4FXYP 5IM9A 2C0EA 4MJBA 3TJFA 3EYTA 3ZIJA 1FVJA 3ZVJA 2EC4A 3RPPA 4PURA 3MSZA 3J7Yb 3GTUB 1ERVA 4PTSA 1BYEA 1G7OA 4ZL9A 3ZITA 2F9SA 1BJXA 5FHIA 2DJKA 2OBIA 2WFCA 5G31A 1UC7A 3ME7A 4HU7A 3P90A 2H8LA 3LEFA 3RBTA 2X8GA 2ZCTA 1EWXA 2IMDA 4CW9A 2DMLA 3OR5A 4EC0A 1GSUA 2M46A 4G01A 2VM1A 2JZTA 3CBUA 5ABRA 6GSSA 2V2GA 2GGTA 3ERFA 5H5SA 1XW9A 2C3QA 1OC9B 1JZWA 1MDIA 3O3TA 2HE3A 2L5LA 2K6VA 4AGSA 3FRCA 3GFKA 4MPGA 3APOA 1U6TA 4K7OA 1XZOA 4MF6A 5C00A 2E2MA 3F4TA 5ECPB 2KUCA 5L71A 4BVYB 3UEMA 2OT3A 3KP8A 4CY8A 4HDEA 1NHOA 5F0GA 4HOJA 4ISDA 3MDKA 2G0FA 1OE8A 3LG6A 2OBKA 4HUAA 1WPIA 4X4JA 5D9XA 1SENA 2AV4A 3GN3A 2MMAA 17GSA 3M8NA 1V2AA 3ZVJD 3FY7A 1X9SB 2YCDA 4G0IA 5G2ZA 1K0NA 2B5EA 3GKMA 2CZ3A 1O6JA 3D4MA 4O32A 4FQUA 2LKUA 2H71A 13GSA 2HQTA 2L4CA 5KN0A 1MD4A 18GSA 3HMJG 2JADA 3DRNA 3Q74A 1GSFA 3KM6A 4OCFA 1R26A 1A8YA 4GSNA 3H8QA 4O7HA 2HT9A 2HXKA 3N9JA 2JU5A 2IN3A 2CVDA 4HS1A 1FOVA 4GSSA 3EVIA 4DSQA 1X5EA 3VFIA 2MMZA 2K9FA 5G1KA 3KTBA 1G6WA 4RQRA 2VUPA 4HQSA 3F0IA 3ZIVA 2GZYA 5EL8A 1YEPA 3CWGA 4JRRA 5KN2A 2WZSA 5B6NA 2PMTA 2X4AA 2IMFA 4Q5FA 1UVZA 1QMVA 3TKSE 3VWWA 1TKDB 1ZYEA 4JU5A 1NSWA 2KOKA 3F4RA 3Q18A 1VGLA 4XS6A 3O6TA 3GX8A 3DD3A 5G5FA 3UOMA 1WJKA 3IHQA 5D9TA 3RFRC 1CQGA 2FA8A 4ACSA 4H86A 2R37A 2YWMA 4POBA 4MZCA 4YKFA 2IFQA 3U6VA 4N30A 1YJ6A 2PERA 5GSTA 2DMMA 2YZUA 5DALB 4MCUA 2CT6A 3WYWA 4EKZA 4PXOA 4TN8A 1PGTA 2PN8A 2C0FA 2F3MA 3D0ZA 3IK9A 2C0DA 5BMUA 2B6MA 5CP1A 4YQVA 1XIYA 1UA5A 2Z9SA 1B9YC 1S3AA 1Z3EA 2OKAA 2PVQA 4I8BA 5A5KA 3RHCA 4TVEA 3UBKA 2RIIA 1HNAA 1TU7A 2GS3A 3D6IA 3A3TA 3LXTA 5DAKB 3KTLA 1VF3A 2VO4A 2O8VB 4KF9A 4QMKA 3A2VA 3APSA 1M2DA 1RW1A 4GSTA 1TDIA 1W89A 2LRCA 2LTKA 3TKPA 1SKWB 3GV1A 2HRKB 2GT6A 4NHZA 4K6XA 1IYIA 1GRXA 1GUHA 5DQSA 1JZDA 2FA4A 5J9CA 5JCWA 5JWRB 1JZRA 3UVHA 1OVNA 2H1LA 3ZRDA 1ST9A 2KP2A 3GH9A 4OMVA 3BOAA 4GLTA 1QFNA 3ZMKA 2LQQA 2VCXA 2E7PA 16GSA 1SJIA 5HFGA 1T7PB 1PA3A 2DJJA 1JLVA 4D73A 5GAPD 4HSCX 2DBCA 2RM6A 1S4BP 1TXUA 5D8IA 5EPFA 1B4PA 4ECIA 1PN0A 1X9WB 1SU9A 1QK8A 3DVWA 4ZB8A 2VL2A 3F9UA 5LNKe 2L6DA 3QR6A 1I1IP 5DCHA 2AUVA 2C3NA 4X43A 3P7XA 2LNSA 5JWQB 1R5PA 3W8SA 2P31A 2H6YA 2C0GA 3L0HA 4XS1A 3QAWA 22GSA 5J41A 3GSSA 3PGTA 2R5GA 2IWTA 3KIJA 3KXOA 2GQKA 2I1UA 3H79A 3M9KA 3ED3A 3WD6A 4MNNA 4Z2UA 1M9AA 1HNBA 4MDCA 3CSHA 3IHGA 2GSQA 1HNCA 3HJOA 3IXRA 3IRAA 4O5QA 2BMXA 1K3OA 3EPTA 1S3RA 4LA1A 4WKWA 4YKGA 3PH9A 1HQOA 1LBKA 2LJAA 3Q19A 2L57A 1JFUA 2TRCP 2VLVA 4NMUA 4RUVA 2UV8G 1G0TA 3G9BA 4EIQA 2A4VA 2RUEA 4WF4A 5DJMA 1BQ7A 4JR4A 3F6FA 1GTAA 5J40A 4V2MA 4OFMA 4MMMA 3JCML 5GSSA 2H6ZA 2L5OA 1XWKA 4TW5A 2LQOA 4GQFA 4AJ8A 2CQ9A 4GWRA 3KH7A 2VL9A 5KN3A 3UBLA 4J2FA 3LQ7A 4GCIA 3C7MA 3I6AA 1V58A 3WT1A 2KHPA 1NW2A 2ZNMA 4OD7A 1AIUA 2K8SA 2H75A 3MYDA 1ERWA 2H1BA 5B8AA 4KCEA 1XXUA 3TU3B 5CRHA 1V98A 3HVXA 14GSA 4E8EA 2QC7A 1PRXA 5FT3A 5ECMB 2B3SA 2B1KA 2YNXA 4QL7A 4AI6A 3EMXA 1TK0B 4MJCA 2JSZA 4TXOA 3GSTA 2OE0A 4PNGA 2X8CA 2V32A 3MAKA 2HSYA 2H0HA 2HRNA 3ZMLA 3NZNA 2IIYA 4NXIA 3KP9A 3LORA 2WW2A 4XHMA 2VCVA 3QD9A 2PPTA 3F4SA 2CA8A 2YWIA 1H4OA 4EDYA 1OC3A 3F3QA 4O92A 4ZILA 1T3BA 1XWGA 2J9HA 5J47A 2HRKA 2N5FA 2PGTA 3LYKA 4MJAA 1M3JA 2YPMA 4Z2TA 5IO2A 5KN1A 1F2EA 2VD0A 3H1NA 2LJRA 3GX0A 1CQHA 3ZL5A 4IP6A 3S9FA 2DJ2A 5CYYA 5ECNB 2D2ZA 1O7UA 2VCTA 4KX4A 4K7IA 5DBQA 1SKSB 5B7CA 3KH9A 4Q5NA 4NAXA 1F3AA 3K8NA 4CY6A 2O3EA 2WW0A 2FGXA 5DCGA 3ZTLA 4L0WA 3NIVA 2VKZG 1YF1A 2IJYA 3TKSC 3CXGA 3E0UA 3TRPA 5ECRB 2E0QA 5INYA 3IC4A 1GTBA 3LFLA 2IFQB 4HQZA 4LLRA 5B6MA 2HFDA 4YH2A 2MBSA 1ON4A 4BWSA 5J4UA 2M80A 4NPBA 4F9ZA 1YZXA 4FH8A 3EC3A 5BMUB 1FVKA 5CAXA 5IMFA 5J4VA 3DEXA 3RGBC 3TB2A 1YQ1A 1M3IA 3AY8A 3M0FA 6GSTA 1ML6A 2V6OA 4NHWA 1TK5B 2EFEA 2KLXA 4MZBA 5JWOB 2WGRA 2O87A 3PR8A 2TRXA 4L8EA 2CAQA 2H0IA 12GSA 1GSDA 1AXDA 5IMVA 3EMPA 5ECQB 3PPUA 2NTOA 2VAFA 4ZL8A 1ERTA 5HFKA 2CAIA 4LL4B 1PQNA 2H70A 1YVLA 4PUAA 4Q5QA 3HZ8A 5EY6A 3E9JB 3APQA 6GSUA 4KCAA 4WR4A 4Q5RA 5J4YA 3L78A 2DLXA 1JZOA 2H6XA 2H0GA 3GHAA 1K0DA 1SYXA 4OO5A 2G2QA 4KW6A 4D73B 4IW9A 2L4QA 3HKRA 2X99A 1OYJA 1U87A 1G6YA 3I43A 4KE3A 3WGXA 4JR6A 1GUKA 3C8EA 4F0BA 3QAGA 1SK2A 4KAEA 1SJZA 3Q6OA 1W4VA 1PL1A 1JHBA 2EIRA 3V1WA 5ELGA 4EXJA 2AHEA 5IMDA 2H30A 4IQ1A 3DWVA 1GWCA 5CNWA 5IMAA 1BG5A 1YEXA 1PKWA 1B4QA 3WGEA 5CO3A 4MZWA 1KTEA 3KMNA 5ECLB 2WB9A 3FR6A 4E68A 3KCMA 2GVPA 1HD2A 2YWNA 1PX6A 3HVNA 4PQ1A 2H1GA 2CV4A 3U5RE 3TOUA 3WT2A 1OAZA 1U88A 2YV7A 5IIZA 1VF4A 2ALBA 2HZFA 4ID0A 4KDUA 1LU4A 4I97A 1TRUA 4GXZA 1T8EB 5D93A 1M9BA 3TKQA 3VI5A 2H19A 3G7IA 1BEDA 1J0FA 3W6GA 2LSTA 4I2UA 2YP6A 4GF0A 4XRDA 4O5RA 4L5OA 3VPTA 2VCQA 3HYPA 3DKSA 1RK4A 4MH3A 1GH2A 1A23A 2EFDA 3QMXA 4PQHA 1EP7A 1ILOA 3N5OA 4JZQA 1XBSA 3A2WA 1I5GA 3TUEA 3A2XA 1ZYQB 4RI6A 1TK8B 3ZFLA 4G10A 1TRWA 2PWJA 2IMKA 1T1VA 2FHEA 3IAM2 3CSJA 2FWGA 2TIRA 2IMEA 1B8XA 4V1Ap 3PINA 4TR1A 5F8BA 3C1RA 2IMIA 1WRYA 4QL9A 4KH7A 4FYUA 2KP1A 4NV2A 4IVFA 4JEDA 1X5DA 4XS4A 5J3RA 2MYGA 1FB6A 1OE7A 4PI0C 2BJXA 3KZQA 3KMOA 1XPVA 1XWBA 3IA1A 2GZZA 4PGTA 1A8LA 2LJKA 2BTOT 4WF5A 3TGZA 2FY6A 2PBJA 2C3TA 5EVOA 1YKAA 3BJ5A 5KOXA 3BD2A 2JACA 4HJMA 4TR3A 4TXOB 1SVLA 1BG1A 3IAS2 5ECKB 3CSIA 1FO5A 1AW9A 4BA7A 4CDOA 4PI2C 3FZAA 1WP0A 2DC5A 3HHVA 4FIWA 4JBBA 4MH2A 1M2AA 2I3YA 2JL4A 1ZCPA 2P0GA 4OWYA 3UJ1A 5B8BA 2QSIA 2B7KA 2REMA 2C1YA 1Y6EA 3WGDA 3TJBA 4ZBDA 1SD8A 2GQLA 2J23A 3RPNA 3VK9A 2R4VA 1Z7RA 1GNWA 2V41A 2GT5A 1YY7A 4NV5A 3VPQA 1GTUA 1GSQA 4MPFA 4WXTA 3KD0A 3IK7A 2WS2A 5HFIA 2VIMA 3NOFA 4WBJA 4EO3A 3TKRA 3QPMA 1S3DA 1K3YA 4EIPA 4X1UA 1K0OA 3C1SA 4BVXA 1XOAA 4E8HA 4EL1A 5ID2A 5F05A 4XIHA 9GSSA 1TTZA 5G5EA 4I2TA 4BWQA 4FYBA 2MMOA 1USBA 4ULXA 2XPDA 1O81A 1I9DA 3UIWA 1EOGA 3CRUA 5AIXA 4F82A 1A2JA 2WVXA 3F63A 3IV4A 1EOHA 4KSMA 3C71A 3GL5A 2EFHA 3LGCA 1TI3A 1TJDA 1R4WA 2RUFA 2HLSA 2HRFA 2OJLA 5LCZA 2GLRA 2F51A 2R0GA 3GKKA 4IKHA 1ACVA 2JZRA 4AKHA 3DVXA 3QFBC 3GKNA 1YEWC 3GNJA 3SBCA 4K5SA 5A4VA 2EIOA 2H73A 1JLWA 3ZYWA 3KJYA 3GKXA 5E59A 3VWXA 5ECIB 4ZB7A 1SYRA 1O85A 2EFCA 1Q98A 3QCPA 4MABA 2WULA 5DVBA 3EWLA 4EE0A 2DJ0A 1K0MA 4PX1A 4KDYA 1T00A 4KB3A 3HA9A 1SL0B 2VCWA 4K9ZA 3A5IA 2YWOA 2XBIA 3G7YA 3FK8A 4N0VA 1GULA 2DSAA 2HZEA 3EU4A 4I6XA 4TOPA 2H74A 2HSMA 2AYTA 4BL7A 1A0RP 3MIXA 1DE2A 1KEBA 3E3EA 1GSEA 2RLIA 2OACA 3G7JA 4ECBA 4TXVA 4L0UA 2PVOC 4IQAA 1FOHA 4MF7A 5A4UA 3CRTA 1V40A 4HZ4A 1GP1A 3TOTA 5A34A 1K0AA 4ML6A 4ZB9A 4HJ2A 5D9WA 4L5LA 3FYGA
chains in the Genus database with same CATH topology
2CZ2A 1Z5YE 3VLNA 2L6CA 1TXXA 1K3LA 2C8UA 3HXSA 2VCZA 2O89A 1SVMA 2LEGA 1O8WA 5F06A 2V1MA 2UZ8A 4HEA2 1TRVA 4EF0A 4ECCA 4XTSA 1M99A 2YOIA 2I9HA 2X64A 3CTFA 1F9MA 4DVCA 2WJUA 4V1Ag 2LS5A 3C73A 3ZZXA 3GIXA 4LMVA 2JSYA 1XVWA 4ZL7A 4G2EA 5AGYA 2GSRA 2DIZA 3TDGA 1G7EA 5CRWA 2MBTA 3D22A 4TR0A 4N3ZA 1DUGA 1OKDA 7GSSA 4Z2RA 1F37A 1U3AA 4F0CA 1KNGA 1MDJA 1N2AA 3P2AA 4POLA 1GNEA 3ISOA 1SJ6A 4K0NA 2WCIA 3M9JA 1X9MB 2IL3A 1H75A 2QKEA 4TRXA 4KGIA 1UN2A 1EV9A 4PUFC 1PL2A 3IR4A 4HU9A 4WR5A 3H4KA 4MLYA 1TOFA 2WRTA 19GSA 4TR1B 6GSWA 1AAZA 3GA4A 4MP4A 4F2IA 2YV9A 4DEJA 4NWYA 4PNFA 4DSSA 3HDCA 5DQYA 2LRTA 4EUYA 4HZ2A 3ERGA 4XS4B 3I69A 3DMLA 5J9BA 4GTUA 4CHSA 1ZYNA 5ECOB 1FG4A 4IN0A 2VM2A 3ZLPA 5A5HA 2X8HA 3J7Yk 2H01A 2LUSA 3ZREA 4V2LA 1M2BA 3DXBA 5IPHA 3QFAC 4G0LA 2DJ3A 2VL2C 5HQPA 2AJQB 3GRXA 5DJLA 5IMCA 2C4JA 1GTIA 3QDNA 3IDVA 5AISA 1WOUA 4IJ3A 1YF0A 1N25A 1S3CA 1ZYPA 2ON5A 3IC8A 3ZFBA 4JE1A 2FUG2 3UMAA 3FMWA 1EGOA 3IE3A 1C72A 2LRNA 3L9SA 4XRAA 2O7KA 1TRSA 3CYNA 4Z7XA 3FR9A 3UAPA 4IELA 4AKXB 2HSNA 1TP9A 5A1NB 4MJEA 3TRXA 4EVMA 1OC8A 5CREA 5IO0A 1SVOA 2YJHA 4BVXB 2HNLA 4GRFA 2ON7A 5ID2B 3FR3A 2HYXA 4MK3A 4QQ7A 2QA1A 2GDRA 1SK1A 2FD3A 1FW1A 2FLSA 2C80A 4I5QA 5H5QA 4AKIA 3R2QA 2XHFA 4LL1B 1AUCA 1A2MA 5IOXA 1AQXA 4DSRA 1T4YA 1EV4A 2MZCA 2VLUA 5LD0A 3EE2A 1FB0A 2R0PA 1DSBA 1WE0A 4ZXGA 3MWHA 1TW9A 1OKTA 3EURA 2YJ7A 5D96A 4G9HA 4IGJA 1X0RA 1X5CA 2CX4A 1QXHA 1M0UA 5KEJA 1SD9A 4P3YB 2R6KA 4OFTA 3HJMA 3P8WA 2L59A 3RHBA 4W66A 1O8XA 1B48A 4K2XA 4YQMA 2M72A 5IMZA 3GURA 3HVSA 3EU3A 3LW9A 3M3MA 4K1FA 4GDFA 4AJ6A 2B7JA 3D21A 3LWAA 3F6DA 5CRGA 3TJGA 4ZB6A 1ZZYA 4N0ZA 1FHEA 3TRQA 1E2YA 3SWLA 4AKGA 1XVQA 2OE3A 1GL8A 2X49A 2O5VA 2V6KA 5HR3A 1E6BA 3L4NA 4YQUA 1YKCA 2HZEB 3F8UA 1K0CA 4O5UA 4FYCA 2HSMB 4BL7B 2VD1A 3HZ4A 4AF2A 2NPBA 2F8AA 1MDKA 1R5AA 3DGQA 4J56E 1TU8A 2A2PA 2YZHA 2WDUA 1PKZA 5A34B 4USSA 3FZ4A 4RI7A 1XWCA 1GLQA 1GUMA 2HSHA 5GAND 2VLTA 2NVLA 3IBHA 4X0XA 3O76A 1EZKA 5D9VA 1NHYA 5F07A 3MNGA 2AAWA 2XPEA 4WEYA 3BCKA 1FAAA 10GSA 1GSYA 1XOBA 4K5RA 3LSZA 3FEUA 1SK0A 3GTUA 1ZGNA 1O73A 1RQMA 4A5PA 3GUSA 3LYPA 3CMIA 2DJ1A 5HR0A 1URMA 3BBYA 1THOA 3VI7A 5D73A 1QGVA 4IHUA 1IYHA 1MEKA 2DIYA 1K0BA 3I9V2 1Z9HA 3VWUA 1M7TA 1Q4JA 8GSSA 1BF5A 4ZIJA 5JCUA 5A1NA 20GSA 2PUKC 4TKYA 2OADA 1OC9A 4YAVA 2LNTA 2H1DA 2N5AA 5FWGA 4KA0A 1AQWA 5E4WA 2XC2A 1NM3A 3IPZA 1B9XC 3R3EA 3TKSA 1A24A 4ML1A 3IOSA 2ES7A 4ECJA 2P5RA 2FWHA 4MA9A 4K7NA 2QGVA 4BVYA 4DSSB 1EGRA 1A2LA 2MMNA 3GH6A 1WIKA 3DIEA 1THXA 3F3RA 1MTCA 6GSXA 1WMJA 4V2NA 2I4AA 1PMTA 2H66A 4BPYA 5A4WA 5COHA 4POMA 3UL3A 5A5HB 2K8VA 2XBQA 3FZ5A 2A2SA 3EINA 1ZMAA 3RAZA 2RM5A 5ECHB 2FNOA 5J5NA 4KSOA 3VWVA 1BAYA 1XW6A 2H72A 2OE1A 3M1GA 4MF5A 3L9VA 3D5JA 1EEJA 2JZSA 4XCSA 3UARA 1VF1A 1ERUA 3HD5A 1XFLA 4F03A 1PN9A 3CTGA 3KEBA 4J57E 2YN1A 6GSVA 3HCZA 3GL3A 3H93A 4ZBBA 1DE1A 1Y25A 2B5YA 4IBPA 2F8FA 1R7HA 2CVKA 5IQYA 2GQMA 3BCIA 5ENUA 4K8MA 2H1AA 2E2GA 1U3IA 4EDZA 4ICYA 2OA7A 1WWJA 3LXZA 3TJJA 4OCEA 1EEMA 3GMFA 3TJKA 2B1LA 1AC1A 2R2JA 3D4TA 1SKRB 2DKIA 2HSNB 1YDKA 2FCHA 3RDWA 1XW5A 2EIQA 3ERWA 3QOUA 2GZPA 2FWFA 3FZ9A 2HI7A 2IPAA 2R3XA 5AN1A 1ABAA 1VF2A 1Z6NA 4PQIA 3L9UA 3TCOA 3FHKA 2N5BA 1GSSA 5ECSA 4KUNA 2LV3A 3DYRA 2GSSA 2WZ9A 1PSQA 3W8JA 1GLPA 4WETA 4FO5A 5HR1A 2K18A 3LJRA 1PD21 4POKA 1Z7PA 2FWEA 5IOWA 1XCCA 2R0CA 1Y1UA 4WBRD 2DKHA 4KDXA 1QQ2A 4K2DA 2QA2A 5DALA 4ZBAA 2AB6A 5HR2A 4K0GA 1PX7A 4HI7A 3HVVA 4TR4A 4IP1A 1V57A 1SL1B 5GZZB 4IJIA 5ELAA 2NDOA 2GTUA 1J9BA 2CVBA 1QUWA 4AJ7A 3QAVA 1ZOFA 11GSA 1HYUA 4LMWA 4N10A 1LJRA 1BX9A 2HRAA 1SL2B 2P5QA 5JCGA 5AIVA 1ZL9A 4OO4A 5CRDA 2PU9C 5DAKA 4YAPA 3HJPA 3US3A 2VL3A 5BRTA 4KNDA 2YANA 1J08A 1DBYA 4OFNA 2O85A 4IS0A 3GYKA 4G0KA 1KBNA 2H76A 5DDLA 1A0FA 1F6MC 5G1LA 1MD3A 3VURA 5C04A 1V9WA 4ILFA 1F3BA 3UVTA 3FKFA 1VRSD 2GSTA 5H5RA 3ME8A 5KOWA 3FW2A 1Z6MA 3KGKA 2NBSA 2CX3A 2ZUPA 4N11A 2B5XA 5G30A 1T4ZA 2VOCA 3HY2A 3A5WA 1XWAA 4GQCA 2A2RA 6GSYA 1EP8A 1AQVA 1TI1A 4RQXA 5IPGA 2A4HA 4G19A 1N8JA 2I81A 5IM9A 2C0EA 4MJBA 3TJFA 3EYTA 3ZIJA 1FVJA 3ZVJA 2EC4A 3RPPA 4PURA 3MSZA 3J7Yb 3GTUB 1ERVA 4PTSA 1BYEA 1G7OA 4ZL9A 3ZITA 2F9SA 1BJXA 5FHIA 2DJKA 2OBIA 2WFCA 5G31A 1UC7A 3ME7A 4HU7A 3P90A 2H8LA 3LEFA 3RBTA 2X8GA 2ZCTA 1EWXA 2IMDA 4CW9A 2DMLA 3OR5A 4EC0A 1GSUA 2M46A 4G01A 2VM1A 2JZTA 3CBUA 5ABRA 6GSSA 2V2GA 2GGTA 3ERFA 5H5SA 1XW9A 2C3QA 1OC9B 1JZWA 1MDIA 3O3TA 2HE3A 2L5LA 2K6VA 4AGSA 3FRCA 3GFKA 4MPGA 3APOA 1U6TA 4K7OA 1XZOA 4MF6A 5C00A 2E2MA 3F4TA 5ECPB 2KUCA 5L71A 4BVYB 3UEMA 2OT3A 3KP8A 4CY8A 4HDEA 1NHOA 5F0GA 4HOJA 4ISDA 3MDKA 2G0FA 1OE8A 3LG6A 2OBKA 4HUAA 1WPIA 4X4JA 5D9XA 1SENA 2AV4A 3GN3A 2MMAA 17GSA 3M8NA 1V2AA 3ZVJD 3FY7A 1X9SB 2YCDA 4G0IA 5G2ZA 1K0NA 2B5EA 3GKMA 2CZ3A 1O6JA 3D4MA 4O32A 4FQUA 2LKUA 2H71A 13GSA 2HQTA 2L4CA 5KN0A 1MD4A 18GSA 3HMJG 2JADA 3DRNA 3Q74A 1GSFA 3KM6A 4OCFA 1R26A 1A8YA 4GSNA 3H8QA 4O7HA 2HT9A 2HXKA 3N9JA 2JU5A 2IN3A 2CVDA 4HS1A 1FOVA 4GSSA 3EVIA 4DSQA 1X5EA 3VFIA 2MMZA 2K9FA 5G1KA 3KTBA 1G6WA 4RQRA 2VUPA 4HQSA 3F0IA 3ZIVA 2GZYA 5EL8A 1YEPA 3CWGA 4JRRA 5KN2A 5B6NA 2PMTA 2X4AA 2IMFA 4Q5FA 1UVZA 1QMVA 3TKSE 3VWWA 1TKDB 1ZYEA 4JU5A 1NSWA 2KOKA 3F4RA 3Q18A 1VGLA 4XS6A 3O6TA 3GX8A 3DD3A 5G5FA 3UOMA 1WJKA 3IHQA 5D9TA 1CQGA 2FA8A 4ACSA 4H86A 2R37A 2YWMA 4POBA 4MZCA 4YKFA 2IFQA 3U6VA 4N30A 1YJ6A 2PERA 5GSTA 2DMMA 2YZUA 5DALB 4MCUA 2CT6A 3WYWA 4EKZA 4PXOA 4TN8A 1PGTA 2PN8A 2C0FA 2F3MA 3D0ZA 3IK9A 2C0DA 5BMUA 2B6MA 5CP1A 4YQVA 1XIYA 1UA5A 2Z9SA 1B9YC 1S3AA 1Z3EA 2OKAA 2PVQA 4I8BA 5A5KA 3RHCA 4TVEA 3UBKA 2RIIA 1HNAA 1TU7A 2GS3A 3D6IA 3A3TA 3LXTA 5DAKB 3KTLA 1VF3A 2VO4A 2O8VB 4KF9A 4QMKA 3A2VA 3APSA 1M2DA 1RW1A 4GSTA 1TDIA 1W89A 2LRCA 2LTKA 3TKPA 1SKWB 3GV1A 2HRKB 2GT6A 4NHZA 4K6XA 1IYIA 1GRXA 1GUHA 5DQSA 1JZDA 2FA4A 5J9CA 5JCWA 5JWRB 1JZRA 3UVHA 1OVNA 2H1LA 3ZRDA 1ST9A 2KP2A 3GH9A 4OMVA 3BOAA 4GLTA 1QFNA 3ZMKA 2LQQA 2VCXA 2E7PA 16GSA 1SJIA 5HFGA 1T7PB 1PA3A 2DJJA 1JLVA 4D73A 5GAPD 2DBCA 2RM6A 1TXUA 5D8IA 5EPFA 1B4PA 4ECIA 1PN0A 1X9WB 1SU9A 1QK8A 3DVWA 4ZB8A 2VL2A 3F9UA 5LNKe 2L6DA 3QR6A 5DCHA 2AUVA 2C3NA 4X43A 3P7XA 2LNSA 5JWQB 1R5PA 3W8SA 2P31A 2H6YA 2C0GA 3L0HA 4XS1A 3QAWA 22GSA 5J41A 3GSSA 3PGTA 2R5GA 2IWTA 3KIJA 3KXOA 2GQKA 2I1UA 3H79A 3M9KA 3ED3A 3WD6A 4MNNA 4Z2UA 1M9AA 1HNBA 4MDCA 3CSHA 3IHGA 2GSQA 1HNCA 3HJOA 3IXRA 3IRAA 4O5QA 2BMXA 1K3OA 3EPTA 4LA1A 4WKWA 4YKGA 3PH9A 1HQOA 1LBKA 2LJAA 3Q19A 2L57A 1JFUA 2TRCP 2VLVA 4NMUA 4RUVA 2UV8G 1G0TA 3G9BA 4EIQA 2A4VA 2RUEA 4WF4A 5DJMA 1BQ7A 4JR4A 3F6FA 1GTAA 5J40A 4V2MA 4OFMA 4MMMA 3JCML 5GSSA 2H6ZA 2L5OA 1XWKA 4TW5A 2LQOA 4GQFA 4AJ8A 2CQ9A 4GWRA 3KH7A 2VL9A 5KN3A 3UBLA 4J2FA 3LQ7A 4GCIA 3C7MA 3I6AA 1V58A 3WT1A 2KHPA 1NW2A 2ZNMA 4OD7A 1AIUA 2K8SA 2H75A 3MYDA 1ERWA 2H1BA 5B8AA 4KCEA 1XXUA 3TU3B 5CRHA 1V98A 3HVXA 14GSA 4E8EA 2QC7A 1PRXA 5FT3A 5ECMB 2B3SA 2B1KA 2YNXA 4QL7A 4AI6A 3EMXA 1TK0B 4MJCA 2JSZA 4TXOA 3GSTA 2OE0A 4PNGA 2X8CA 2V32A 3MAKA 2HSYA 2H0HA 2HRNA 3ZMLA 3NZNA 2IIYA 4NXIA 3KP9A 3LORA 4XHMA 2VCVA 3QD9A 2PPTA 3F4SA 2CA8A 2YWIA 1H4OA 4EDYA 1OC3A 3F3QA 4O92A 4ZILA 1T3BA 1XWGA 2J9HA 5J47A 2HRKA 2N5FA 2PGTA 3LYKA 4MJAA 2YPMA 4Z2TA 5IO2A 5KN1A 1F2EA 2VD0A 3H1NA 2LJRA 3GX0A 1CQHA 3ZL5A 4IP6A 3S9FA 2DJ2A 5CYYA 5ECNB 2D2ZA 1O7UA 2VCTA 4KX4A 4K7IA 5DBQA 1SKSB 5B7CA 3KH9A 4Q5NA 4NAXA 1F3AA 3K8NA 4CY6A 2FGXA 5DCGA 3ZTLA 4L0WA 3NIVA 2VKZG 1YF1A 2IJYA 3TKSC 3CXGA 3E0UA 3TRPA 5ECRB 2E0QA 5INYA 3IC4A 1GTBA 3LFLA 2IFQB 4HQZA 4LLRA 5B6MA 2HFDA 4YH2A 2MBSA 1ON4A 4BWSA 5J4UA 2M80A 4NPBA 4F9ZA 1YZXA 4FH8A 3EC3A 5BMUB 1FVKA 5CAXA 5IMFA 5J4VA 3DEXA 3TB2A 1YQ1A 3AY8A 3M0FA 6GSTA 1ML6A 2V6OA 4NHWA 1TK5B 2EFEA 2KLXA 4MZBA 5JWOB 2WGRA 2O87A 3PR8A 2TRXA 4L8EA 2CAQA 2H0IA 12GSA 1GSDA 1AXDA 5IMVA 3EMPA 5ECQB 3PPUA 2NTOA 2VAFA 4ZL8A 1ERTA 5HFKA 2CAIA 4LL4B 1PQNA 2H70A 1YVLA 4PUAA 4Q5QA 3HZ8A 5EY6A 3E9JB 3APQA 6GSUA 4KCAA 4WR4A 4Q5RA 5J4YA 3L78A 2DLXA 1JZOA 2H6XA 2H0GA 3GHAA 1K0DA 1SYXA 4OO5A 2G2QA 4KW6A 4D73B 4IW9A 2L4QA 3HKRA 2X99A 1OYJA 1U87A 1G6YA 3I43A 4KE3A 3WGXA 4JR6A 1GUKA 3C8EA 4F0BA 3QAGA 1SK2A 4KAEA 1SJZA 3Q6OA 1W4VA 1PL1A 1JHBA 2EIRA 3V1WA 5ELGA 4EXJA 2AHEA 5IMDA 2H30A 4IQ1A 3DWVA 1GWCA 5CNWA 5IMAA 1BG5A 1YEXA 1PKWA 1B4QA 3WGEA 5CO3A 4MZWA 1KTEA 3KMNA 5ECLB 2WB9A 3FR6A 4E68A 3KCMA 2GVPA 1HD2A 2YWNA 1PX6A 4PQ1A 2H1GA 2CV4A 3U5RE 3TOUA 3WT2A 1OAZA 1U88A 2YV7A 5IIZA 1VF4A 2ALBA 2HZFA 4ID0A 4KDUA 1LU4A 4I97A 1TRUA 4GXZA 1T8EB 5D93A 1M9BA 3TKQA 3VI5A 2H19A 3G7IA 1BEDA 1J0FA 3W6GA 2LSTA 4I2UA 2YP6A 4GF0A 4XRDA 4O5RA 4L5OA 3VPTA 2VCQA 3HYPA 3DKSA 1RK4A 4MH3A 1GH2A 1A23A 2EFDA 3QMXA 4PQHA 1EP7A 1ILOA 3N5OA 4JZQA 1XBSA 3A2WA 1I5GA 3TUEA 3A2XA 1ZYQB 4RI6A 1TK8B 3ZFLA 4G10A 1TRWA 2PWJA 2IMKA 1T1VA 2FHEA 3IAM2 3CSJA 2FWGA 2TIRA 2IMEA 1B8XA 4V1Ap 3PINA 4TR1A 5F8BA 3C1RA 2IMIA 1WRYA 4QL9A 4KH7A 4FYUA 2KP1A 4NV2A 4IVFA 4JEDA 1X5DA 4XS4A 5J3RA 2MYGA 1FB6A 1OE7A 2BJXA 3KZQA 3KMOA 1XPVA 1XWBA 3IA1A 2GZZA 4PGTA 1A8LA 2LJKA 2BTOT 4WF5A 3TGZA 2FY6A 2PBJA 2C3TA 5EVOA 1YKAA 3BJ5A 5KOXA 3BD2A 2JACA 4HJMA 4TR3A 4TXOB 1SVLA 1BG1A 3IAS2 5ECKB 3CSIA 1FO5A 1AW9A 4BA7A 4CDOA 3FZAA 1WP0A 2DC5A 3HHVA 4FIWA 4JBBA 4MH2A 1M2AA 2I3YA 2JL4A 1ZCPA 2P0GA 4OWYA 3UJ1A 5B8BA 2QSIA 2B7KA 2REMA 2C1YA 1Y6EA 3WGDA 3TJBA 4ZBDA 1SD8A 2GQLA 2J23A 3RPNA 3VK9A 2R4VA 1Z7RA 1GNWA 2V41A 2GT5A 1YY7A 4NV5A 3VPQA 1GTUA 1GSQA 4MPFA 4WXTA 3KD0A 3IK7A 2WS2A 5HFIA 2VIMA 3NOFA 4WBJA 4EO3A 3TKRA 3QPMA 1S3DA 1K3YA 4EIPA 4X1UA 1K0OA 3C1SA 4BVXA 1XOAA 4E8HA 4EL1A 5ID2A 5F05A 4XIHA 9GSSA 1TTZA 5G5EA 4I2TA 4BWQA 4FYBA 2MMOA 1USBA 4ULXA 2XPDA 1O81A 1I9DA 3UIWA 1EOGA 3CRUA 5AIXA 4F82A 1A2JA 3F63A 3IV4A 1EOHA 4KSMA 3C71A 3GL5A 2EFHA 3LGCA 1TI3A 1TJDA 1R4WA 2RUFA 2HLSA 2HRFA 2OJLA 5LCZA 2GLRA 2F51A 2R0GA 3GKKA 4IKHA 1ACVA 2JZRA 4AKHA 3DVXA 3QFBC 3GKNA 3GNJA 3SBCA 4K5SA 5A4VA 2EIOA 2H73A 1JLWA 3ZYWA 3KJYA 3GKXA 5E59A 3VWXA 5ECIB 4ZB7A 1SYRA 1O85A 2EFCA 1Q98A 3QCPA 4MABA 2WULA 5DVBA 3EWLA 4EE0A 2DJ0A 1K0MA 4PX1A 4KDYA 1T00A 4KB3A 3HA9A 1SL0B 2VCWA 4K9ZA 3A5IA 2YWOA 2XBIA 3G7YA 3FK8A 4N0VA 1GULA 2DSAA 2HZEA 3EU4A 4I6XA 4TOPA 2H74A 2HSMA 2AYTA 4BL7A 1A0RP 3MIXA 1DE2A 1KEBA 3E3EA 1GSEA 2RLIA 2OACA 3G7JA 4ECBA 4TXVA 4L0UA 2PVOC 4IQAA 1FOHA 4MF7A 5A4UA 3CRTA 1V40A 4HZ4A 1GP1A 3TOTA 5A34A 1K0AA 4ML6A 4ZB9A 4HJ2A 5D9WA 4L5LA 3FYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ2 A;  1Z5Y E;  3VLN A;  2L6C A;  1TXX A;  1K3L A;  2C8U A;  3HXS A;  2VCZ A;  2O89 A;  2LEG A;  1O8W A;  5F06 A;  2V1M A;  2UZ8 A;  4HEA 2;  1TRV A;  4EF0 A;  4ECC A;  4XTS A;  1M99 A;  2YOI A;  2I9H A;  2X64 A;  3CTF A;  1F9M A;  4DVC A;  2WJU A;  4V1A g;  2LS5 A;  3C73 A;  3ZZX A;  3GIX A;  4LMV A;  2JSY A;  1XVW A;  4ZL7 A;  4G2E A;  5AGY A;  2GSR A;  2DIZ A;  3TDG A;  1G7E A;  5CRW A;  2MBT A;  3D22 A;  4TR0 A;  1OKD A;  1DUG A;  7GSS A;  1F37 A;  1U3A A;  4F0C A;  1KNG A;  1MDJ A;  1N2A A;  3P2A A;  4POL A;  1GNE A;  3ISO A;  1SJ6 A;  4K0N A;  2WCI A;  3M9J A;  1X9M B;  2IL3 A;  1H75 A;  2QKE A;  4TRX A;  4KGI A;  1UN2 A;  1EV9 A;  4PUF C;  1PL2 A;  3IR4 A;  4HU9 A;  4WR5 A;  3H4K A;  4MLY A;  1TOF A;  2WRT A;  19GS A;  4TR1 B;  6GSW A;  1AAZ A;  3GA4 A;  4MP4 A;  4F2I A;  2YV9 A;  4DEJ A;  4NWY A;  4PNF A;  4DSS A;  3HDC A;  5DQY A;  2LRT A;  4EUY A;  4HZ2 A;  3ERG A;  4XS4 B;  3I69 A;  3DML A;  5J9B A;  4GTU A;  4CHS A;  5ECO B;  1FG4 A;  4IN0 A;  2VM2 A;  3ZLP A;  2X8H A;  3J7Y k;  2H01 A;  2LUS A;  3ZRE A;  4V2L A;  1M2B A;  3DXB A;  5IPH A;  3QFA C;  4G0L A;  2DJ3 A;  2VL2 C;  5HQP A;  2AJQ B;  3GRX A;  5DJL A;  5IMC A;  2C4J A;  1GTI A;  3QDN A;  3IDV A;  5AIS A;  1WOU A;  4IJ3 A;  1YF0 A;  1S3C A;  2ON5 A;  3IC8 A;  3ZFB A;  4JE1 A;  2FUG 2;  3UMA A;  1EGO A;  3IE3 A;  1C72 A;  2LRN A;  3L9S A;  4XRA A;  2O7K A;  1TRS A;  3CYN A;  4Z7X A;  3FR9 A;  3UAP A;  4IEL A;  1TP9 A;  4MJE A;  3TRX A;  4EVM A;  1OC8 A;  5CRE A;  5IO0 A;  2YJH A;  4BVX B;  2HNL A;  4GRF A;  2ON7 A;  5ID2 B;  3FR3 A;  2HYX A;  4MK3 A;  4QQ7 A;  2GDR A;  1SK1 A;  2FD3 A;  1FW1 A;  2FLS A;  2C80 A;  4I5Q A;  5H5Q A;  3R2Q A;  2XHF A;  4LL1 B;  1AUC A;  1A2M A;  5IOX A;  1AQX A;  4DSR A;  1T4Y A;  1EV4 A;  2MZC A;  2VLU A;  5LD0 A;  3EE2 A;  1FB0 A;  1DSB A;  1WE0 A;  4ZXG A;  3MWH A;  1TW9 A;  1OKT A;  3EUR A;  2YJ7 A;  5D96 A;  4G9H A;  4IGJ A;  1X0R A;  1X5C A;  2CX4 A;  1QXH A;  1M0U A;  5KEJ A;  1SD9 A;  4P3Y B;  2R6K A;  4OFT A;  3HJM A;  3P8W A;  2L59 A;  3RHB A;  1O8X A;  1B48 A;  4YQM A;  2M72 A;  5IMZ A;  3GUR A;  3HVS A;  3EU3 A;  3M3M A;  4K1F A;  4AJ6 A;  2B7J A;  3D21 A;  3LWA A;  3F6D A;  5CRG A;  3TJG A;  4ZB6 A;  1ZZY A;  4N0Z A;  1FHE A;  3TRQ A;  1E2Y A;  3SWL A;  1XVQ A;  2OE3 A;  1GL8 A;  2V6K A;  5HR3 A;  1E6B A;  3L4N A;  4YQU A;  1YKC A;  2HZE B;  3F8U A;  1K0C A;  4FYC A;  2HSM B;  4BL7 B;  2VD1 A;  3HZ4 A;  4AF2 A;  2NPB A;  2F8A A;  1MDK A;  1R5A A;  3DGQ A;  4J56 E;  1TU8 A;  2YZH A;  2WDU A;  1PKZ A;  4USS A;  3FZ4 A;  4RI7 A;  1XWC A;  1GLQ A;  1GUM A;  2HSH A;  5GAN D;  2VLT A;  2NVL A;  3IBH A;  4X0X A;  3O76 A;  1EZK A;  5D9V A;  1NHY A;  5F07 A;  3MNG A;  2AAW A;  2XPE A;  4WEY A;  3BCK A;  1FAA A;  10GS A;  1GSY A;  1XOB A;  3LSZ A;  3FEU A;  1SK0 A;  3GTU A;  1ZGN A;  1O73 A;  1RQM A;  3GUS A;  3LYP A;  3CMI A;  2DJ1 A;  5HR0 A;  1URM A;  3BBY A;  1THO A;  3VI7 A;  5D73 A;  1QGV A;  4IHU A;  1IYH A;  1MEK A;  2DIY A;  1K0B A;  3I9V 2;  1Z9H A;  3VWU A;  1M7T A;  1Q4J A;  8GSS A;  4ZIJ A;  5JCU A;  20GS A;  2PUK C;  4TKY A;  2OAD A;  1OC9 A;  4YAV A;  2LNT A;  2H1D A;  2N5A A;  5FWG A;  4KA0 A;  1AQW A;  5E4W A;  2XC2 A;  1NM3 A;  3IPZ A;  1B9X C;  3R3E A;  3TKS A;  1A24 A;  4ML1 A;  3IOS A;  2ES7 A;  4ECJ A;  2P5R A;  2FWH A;  4MA9 A;  4K7N A;  2QGV A;  4BVY A;  4DSS B;  1EGR A;  1A2L A;  2MMN A;  3GH6 A;  1WIK A;  3DIE A;  1THX A;  3F3R A;  1MTC A;  6GSX A;  1WMJ A;  4V2N A;  2I4A A;  1PMT A;  2H66 A;  4BPY A;  5A4W A;  5COH A;  4POM A;  3UL3 A;  2K8V A;  2XBQ A;  3FZ5 A;  2A2S A;  3EIN A;  1ZMA A;  3RAZ A;  2RM5 A;  5ECH B;  2FNO A;  5J5N A;  4KSO A;  3VWV A;  1BAY A;  1XW6 A;  2H72 A;  2OE1 A;  3M1G A;  4MF5 A;  3L9V A;  3D5J A;  1EEJ A;  2JZS A;  4XCS A;  3UAR A;  1VF1 A;  1ERU A;  3HD5 A;  1XFL A;  4F03 A;  1PN9 A;  3CTG A;  3KEB A;  4J57 E;  2YN1 A;  6GSV A;  3HCZ A;  3GL3 A;  3H93 A;  4ZBB A;  1DE1 A;  1Y25 A;  2B5Y A;  4IBP A;  2F8F A;  1R7H A;  2CVK A;  5IQY A;  2GQM A;  3BCI A;  5ENU A;  4K8M A;  2H1A A;  2E2G A;  1U3I A;  4EDZ A;  2OA7 A;  1WWJ A;  3LXZ A;  3TJJ A;  4OCE A;  1EEM A;  3GMF A;  3TJK A;  2B1L A;  1AC1 A;  2R2J A;  3D4T A;  1SKR B;  2HSN B;  1YDK A;  2FCH A;  3RDW A;  1XW5 A;  2EIQ A;  3ERW A;  3QOU A;  2GZP A;  2FWF A;  3FZ9 A;  2HI7 A;  2IPA A;  2R3X A;  5AN1 A;  1ABA A;  1VF2 A;  1Z6N A;  4PQI A;  3L9U A;  3TCO A;  3FHK A;  2N5B A;  1GSS A;  5ECS A;  4KUN A;  2LV3 A;  3DYR A;  2GSS A;  2WZ9 A;  1PSQ A;  3W8J A;  1GLP A;  4WET A;  4FO5 A;  5HR1 A;  2K18 A;  3LJR A;  1PD2 1;  4POK A;  1Z7P A;  2FWE A;  5IOW A;  1XCC A;  4WBR D;  4KDX A;  1QQ2 A;  4K2D A;  5DAL A;  4ZBA A;  2AB6 A;  5HR2 A;  4K0G A;  1PX7 A;  4HI7 A;  3HVV A;  4TR4 A;  4IP1 A;  1V57 A;  1SL1 B;  5GZZ B;  4IJI A;  5ELA A;  2NDO A;  2GTU A;  1J9B A;  2CVB A;  1QUW A;  4AJ7 A;  3QAV A;  1ZOF A;  11GS A;  1HYU A;  4LMW A;  4N10 A;  1LJR A;  1BX9 A;  2HRA A;  1SL2 B;  2P5Q A;  5JCG A;  5AIV A;  1ZL9 A;  4OO4 A;  5CRD A;  2PU9 C;  5DAK A;  4YAP A;  3HJP A;  3US3 A;  2VL3 A;  4KND A;  2YAN A;  1J08 A;  1DBY A;  4OFN A;  2O85 A;  4IS0 A;  3GYK A;  4G0K A;  1KBN A;  2H76 A;  5DDL A;  1A0F A;  1F6M C;  5G1L A;  1MD3 A;  3VUR A;  5C04 A;  1V9W A;  4ILF A;  1F3B A;  3UVT A;  3FKF A;  1VRS D;  2GST A;  5H5R A;  3ME8 A;  3FW2 A;  1Z6M A;  3KGK A;  2NBS A;  2CX3 A;  2ZUP A;  4N11 A;  2B5X A;  5G30 A;  1T4Z A;  2VOC A;  3HY2 A;  3A5W A;  1XWA A;  4GQC A;  2A2R A;  6GSY A;  1EP8 A;  1AQV A;  1TI1 A;  4RQX A;  5IPG A;  4G19 A;  1N8J A;  2I81 A;  5IM9 A;  2C0E A;  4MJB A;  3TJF A;  3EYT A;  3ZIJ A;  1FVJ A;  3ZVJ A;  2EC4 A;  3RPP A;  4PUR A;  3MSZ A;  3J7Y b;  3GTU B;  1ERV A;  4PTS A;  1BYE A;  1G7O A;  4ZL9 A;  3ZIT A;  2F9S A;  1BJX A;  5FHI A;  2DJK A;  2OBI A;  2WFC A;  5G31 A;  1UC7 A;  3ME7 A;  4HU7 A;  3P90 A;  2H8L A;  3LEF A;  3RBT A;  2X8G A;  2ZCT A;  1EWX A;  2IMD A;  4CW9 A;  2DML A;  3OR5 A;  4EC0 A;  1GSU A;  2M46 A;  2VM1 A;  2JZT A;  3CBU A;  5ABR A;  6GSS A;  2V2G A;  2GGT A;  3ERF A;  5H5S A;  1XW9 A;  2C3Q A;  1OC9 B;  1JZW A;  1MDI A;  3O3T A;  2HE3 A;  2L5L A;  2K6V A;  4AGS A;  3FRC A;  3GFK A;  4MPG A;  3APO A;  1U6T A;  4K7O A;  1XZO A;  4MF6 A;  5C00 A;  2E2M A;  3F4T A;  5ECP B;  2KUC A;  5L71 A;  4BVY B;  3UEM A;  3KP8 A;  4HDE A;  1NHO A;  5F0G A;  4HOJ A;  4ISD A;  3MDK A;  2G0F A;  1OE8 A;  3LG6 A;  2OBK A;  4HUA A;  1WPI A;  5D9X A;  1SEN A;  2AV4 A;  3GN3 A;  2MMA A;  17GS A;  3M8N A;  1V2A A;  3ZVJ D;  3FY7 A;  1X9S B;  2YCD A;  4G0I A;  5G2Z A;  1K0N A;  2B5E A;  3GKM A;  2CZ3 A;  1O6J A;  3D4M A;  4O32 A;  4FQU A;  2LKU A;  2H71 A;  13GS A;  2HQT A;  2L4C A;  5KN0 A;  1MD4 A;  18GS A;  2JAD A;  3DRN A;  3Q74 A;  1GSF A;  3KM6 A;  4OCF A;  1R26 A;  1A8Y A;  4GSN A;  3H8Q A;  4O7H A;  2HT9 A;  2HXK A;  3N9J A;  2JU5 A;  2IN3 A;  2CVD A;  4HS1 A;  1FOV A;  4GSS A;  3EVI A;  4DSQ A;  1X5E A;  3VFI A;  2MMZ A;  2K9F A;  5G1K A;  3KTB A;  1G6W A;  4RQR A;  2VUP A;  4HQS A;  3F0I A;  3ZIV A;  2GZY A;  5EL8 A;  1YEP A;  4JRR A;  5KN2 A;  5B6N A;  2PMT A;  2IMF A;  4Q5F A;  1UVZ A;  1QMV A;  3TKS E;  3VWW A;  1TKD B;  1ZYE A;  4JU5 A;  1NSW A;  2KOK A;  3F4R A;  3Q18 A;  1VGL A;  4XS6 A;  3O6T A;  3GX8 A;  3DD3 A;  5G5F A;  3UOM A;  1WJK A;  3IHQ A;  5D9T A;  1CQG A;  2FA8 A;  4ACS A;  4H86 A;  2R37 A;  2YWM A;  4POB A;  4MZC A;  2IFQ A;  3U6V A;  4N30 A;  1YJ6 A;  2PER A;  5GST A;  2DMM A;  2YZU A;  5DAL B;  4MCU A;  2CT6 A;  3WYW A;  4EKZ A;  4PXO A;  4TN8 A;  1PGT A;  2PN8 A;  2C0F A;  2F3M A;  3D0Z A;  3IK9 A;  2C0D A;  5BMU A;  2B6M A;  5CP1 A;  4YQV A;  1XIY A;  1UA5 A;  2Z9S A;  1B9Y C;  1S3A A;  1Z3E A;  2OKA A;  2PVQ A;  4I8B A;  5A5K A;  3RHC A;  4TVE A;  3UBK A;  2RII A;  1HNA A;  1TU7 A;  2GS3 A;  3D6I A;  3A3T A;  3LXT A;  5DAK B;  3KTL A;  1VF3 A;  2VO4 A;  2O8V B;  4KF9 A;  3A2V A;  3APS A;  1M2D A;  1RW1 A;  4GST A;  1TDI A;  1W89 A;  2LRC A;  2LTK A;  3TKP A;  1SKW B;  3GV1 A;  2HRK B;  2GT6 A;  4NHZ A;  4K6X A;  1IYI A;  1GRX A;  1GUH A;  5DQS A;  1JZD A;  2FA4 A;  5J9C A;  5JCW A;  5JWR B;  1JZR A;  3UVH A;  1OVN A;  3ZRD A;  1ST9 A;  2KP2 A;  3GH9 A;  4OMV A;  3BOA A;  4GLT A;  1QFN A;  3ZMK A;  2LQQ A;  2VCX A;  2E7P A;  16GS A;  1SJI A;  5HFG A;  1T7P B;  1PA3 A;  2DJJ A;  1JLV A;  4D73 A;  5GAP D;  2DBC A;  2RM6 A;  5D8I A;  5EPF A;  1B4P A;  4ECI A;  1X9W B;  1SU9 A;  1QK8 A;  3DVW A;  4ZB8 A;  2VL2 A;  3F9U A;  5LNK e;  2L6D A;  3QR6 A;  5DCH A;  2AUV A;  2C3N A;  4X43 A;  3P7X A;  2LNS A;  5JWQ B;  1R5P A;  3W8S A;  2P31 A;  2H6Y A;  2C0G A;  3L0H A;  4XS1 A;  3QAW A;  22GS A;  5J41 A;  3GSS A;  3PGT A;  2R5G A;  2IWT A;  3KIJ A;  3KXO A;  2GQK A;  2I1U A;  3H79 A;  3M9K A;  3ED3 A;  3WD6 A;  1M9A A;  1HNB A;  4MDC A;  3CSH A;  2GSQ A;  1HNC A;  3HJO A;  3IXR A;  3IRA A;  2BMX A;  1K3O A;  4LA1 A;  4WKW A;  3PH9 A;  1HQO A;  1LBK A;  2LJA A;  3Q19 A;  2L57 A;  1JFU A;  2TRC P;  2VLV A;  4NMU A;  4RUV A;  1G0T A;  3G9B A;  2A4V A;  2RUE A;  4WF4 A;  5DJM A;  1BQ7 A;  4JR4 A;  3F6F A;  1GTA A;  4V2M A;  4OFM A;  4MMM A;  3JCM L;  5GSS A;  2H6Z A;  2L5O A;  1XWK A;  4TW5 A;  2LQO A;  4GQF A;  4AJ8 A;  2CQ9 A;  4GWR A;  3KH7 A;  2VL9 A;  5KN3 A;  3UBL A;  4J2F A;  3LQ7 A;  4GCI A;  3C7M A;  3I6A A;  1V58 A;  3WT1 A;  2KHP A;  1NW2 A;  2ZNM A;  4OD7 A;  1AIU A;  2K8S A;  2H75 A;  1ERW A;  2H1B A;  5B8A A;  4KCE A;  1XXU A;  5CRH A;  1V98 A;  3HVX A;  14GS A;  4E8E A;  2QC7 A;  1PRX A;  5FT3 A;  5ECM B;  2B3S A;  2B1K A;  2YNX A;  4QL7 A;  3EMX A;  1TK0 B;  4MJC A;  2JSZ A;  4TXO A;  3GST A;  2OE0 A;  4PNG A;  2X8C A;  2V32 A;  3MAK A;  2HSY A;  2H0H A;  2HRN A;  3ZML A;  3NZN A;  2IIY A;  4NXI A;  3KP9 A;  3LOR A;  4XHM A;  2VCV A;  3QD9 A;  2PPT A;  3F4S A;  2CA8 A;  2YWI A;  1H4O A;  4EDY A;  1OC3 A;  3F3Q A;  4O92 A;  4ZIL A;  1T3B A;  1XWG A;  2J9H A;  2HRK A;  2N5F A;  2PGT A;  3LYK A;  4MJA A;  2YPM A;  5IO2 A;  5KN1 A;  1F2E A;  2VD0 A;  3H1N A;  2LJR A;  3GX0 A;  1CQH A;  3ZL5 A;  4IP6 A;  3S9F A;  2DJ2 A;  5CYY A;  5ECN B;  2D2Z A;  1O7U A;  2VCT A;  4KX4 A;  4K7I A;  5DBQ A;  1SKS B;  5B7C A;  3KH9 A;  4Q5N A;  4NAX A;  1F3A A;  3K8N A;  2FGX A;  5DCG A;  3ZTL A;  4L0W A;  3NIV A;  1YF1 A;  2IJY A;  3TKS C;  3CXG A;  3E0U A;  3TRP A;  5ECR B;  2E0Q A;  5INY A;  3IC4 A;  1GTB A;  3LFL A;  2IFQ B;  4HQZ A;  4LLR A;  5B6M A;  2HFD A;  4YH2 A;  2MBS A;  1ON4 A;  4BWS A;  5J4U A;  2M80 A;  4NPB A;  4F9Z A;  1YZX A;  4FH8 A;  3EC3 A;  1FVK A;  5CAX A;  5IMF A;  3DEX A;  3TB2 A;  1YQ1 A;  3AY8 A;  3M0F A;  6GST A;  1ML6 A;  2V6O A;  4NHW A;  1TK5 B;  2KLX A;  4MZB A;  5JWO B;  2WGR A;  2O87 A;  3PR8 A;  2TRX A;  4L8E A;  2CAQ A;  2H0I A;  12GS A;  1GSD A;  1AXD A;  5IMV A;  3EMP A;  5ECQ B;  3PPU A;  2NTO A;  2VAF A;  4ZL8 A;  1ERT A;  5HFK A;  2CAI A;  4LL4 B;  1PQN A;  2H70 A;  4PUA A;  4Q5Q A;  3HZ8 A;  5EY6 A;  3E9J B;  3APQ A;  6GSU A;  4KCA A;  4WR4 A;  4Q5R A;  3L78 A;  2DLX A;  1JZO A;  2H6X A;  2H0G A;  3GHA A;  1K0D A;  1SYX A;  4OO5 A;  2G2Q A;  4KW6 A;  4D73 B;  4IW9 A;  2L4Q A;  3HKR A;  2X99 A;  1OYJ A;  1U87 A;  1G6Y A;  3I43 A;  4KE3 A;  3WGX A;  4JR6 A;  1GUK A;  3C8E A;  4F0B A;  3QAG A;  1SK2 A;  4KAE A;  1SJZ A;  3Q6O A;  1W4V A;  1PL1 A;  1JHB A;  2EIR A;  3V1W A;  5ELG A;  4EXJ A;  2AHE A;  5IMD A;  2H30 A;  4IQ1 A;  3DWV A;  1GWC A;  5CNW A;  5IMA A;  1BG5 A;  1YEX A;  1PKW A;  1B4Q A;  3WGE A;  5CO3 A;  4MZW A;  1KTE A;  3KMN A;  5ECL B;  2WB9 A;  3FR6 A;  3KCM A;  2GVP A;  1HD2 A;  2YWN A;  1PX6 A;  4PQ1 A;  2H1G A;  2CV4 A;  3U5R E;  3TOU A;  3WT2 A;  1OAZ A;  1U88 A;  2YV7 A;  5IIZ A;  1VF4 A;  2ALB A;  2HZF A;  4ID0 A;  4KDU A;  1LU4 A;  4I97 A;  1TRU A;  4GXZ A;  1T8E B;  5D93 A;  1M9B A;  3TKQ A;  3VI5 A;  2H19 A;  3G7I A;  1BED A;  1J0F A;  3W6G A;  2LST A;  4I2U A;  2YP6 A;  4GF0 A;  4XRD A;  4O5R A;  4L5O A;  3VPT A;  2VCQ A;  3HYP A;  3DKS A;  1RK4 A;  4MH3 A;  1GH2 A;  1A23 A;  3QMX A;  4PQH A;  1EP7 A;  1ILO A;  3N5O A;  4JZQ A;  1XBS A;  3A2W A;  1I5G A;  3TUE A;  3A2X A;  1ZYQ B;  4RI6 A;  1TK8 B;  3ZFL A;  4G10 A;  1TRW A;  2PWJ A;  2IMK A;  1T1V A;  2FHE A;  3IAM 2;  3CSJ A;  2FWG A;  2TIR A;  2IME A;  1B8X A;  4V1A p;  3PIN A;  4TR1 A;  5F8B A;  3C1R A;  2IMI A;  1WRY A;  4QL9 A;  4KH7 A;  4FYU A;  2KP1 A;  4NV2 A;  4IVF A;  4JED A;  1X5D A;  4XS4 A;  5J3R A;  2MYG A;  1FB6 A;  1OE7 A;  2BJX A;  3KZQ A;  3KMO A;  1XPV A;  1XWB A;  3IA1 A;  2GZZ A;  4PGT A;  1A8L A;  2LJK A;  2BTO T;  4WF5 A;  3TGZ A;  2FY6 A;  2PBJ A;  2C3T A;  5EVO A;  1YKA A;  3BJ5 A;  3BD2 A;  2JAC A;  4HJM A;  4TR3 A;  4TXO B;  3IAS 2;  5ECK B;  3CSI A;  1FO5 A;  1AW9 A;  4BA7 A;  4CDO A;  3FZA A;  1WP0 A;  2DC5 A;  3HHV A;  4FIW A;  4JBB A;  4MH2 A;  1M2A A;  2I3Y A;  2JL4 A;  1ZCP A;  2P0G A;  4OWY A;  3UJ1 A;  5B8B A;  2QSI A;  2B7K A;  2REM A;  2C1Y A;  1Y6E A;  3WGD A;  3TJB A;  4ZBD A;  1SD8 A;  2GQL A;  2J23 A;  3RPN A;  3VK9 A;  2R4V A;  1Z7R A;  1GNW A;  2V41 A;  2GT5 A;  1YY7 A;  4NV5 A;  3VPQ A;  1GTU A;  1GSQ A;  4MPF A;  4WXT A;  3KD0 A;  3IK7 A;  2WS2 A;  5HFI A;  2VIM A;  3NOF A;  4WBJ A;  4EO3 A;  3TKR A;  3QPM A;  1S3D A;  1K3Y A;  4X1U A;  1K0O A;  3C1S A;  4BVX A;  1XOA A;  4E8H A;  4EL1 A;  5ID2 A;  5F05 A;  4XIH A;  9GSS A;  1TTZ A;  5G5E A;  4I2T A;  4BWQ A;  4FYB A;  2MMO A;  1USB A;  4ULX A;  2XPD A;  1O81 A;  1I9D A;  3UIW A;  1EOG A;  3CRU A;  5AIX A;  4F82 A;  1A2J A;  3F63 A;  3IV4 A;  1EOH A;  4KSM A;  3C71 A;  3GL5 A;  3LGC A;  1TI3 A;  1TJD A;  1R4W A;  2RUF A;  2HLS A;  2HRF A;  2OJL A;  5LCZ A;  2GLR A;  2F51 A;  3GKK A;  4IKH A;  1ACV A;  2JZR A;  3DVX A;  3QFB C;  3GKN A;  3GNJ A;  3SBC A;  5A4V A;  2EIO A;  2H73 A;  1JLW A;  3ZYW A;  3KJY A;  3GKX A;  5E59 A;  3VWX A;  5ECI B;  1SYR A;  1O85 A;  1Q98 A;  3QCP A;  4MAB A;  2WUL A;  5DVB A;  3EWL A;  4EE0 A;  2DJ0 A;  1K0M A;  4PX1 A;  4KDY A;  1T00 A;  4KB3 A;  3HA9 A;  1SL0 B;  2VCW A;  4K9Z A;  2YWO A;  2XBI A;  3G7Y A;  3FK8 A;  4N0V A;  1GUL A;  2DSA A;  2HZE A;  3EU4 A;  4I6X A;  4TOP A;  2H74 A;  2HSM A;  2AYT A;  4BL7 A;  1A0R P;  1DE2 A;  1KEB A;  3E3E A;  1GSE A;  2RLI A;  2OAC A;  3G7J A;  4ECB A;  4TXV A;  4L0U A;  2PVO C;  4IQA A;  4MF7 A;  5A4U A;  3CRT A;  1V40 A;  4HZ4 A;  1GP1 A;  3TOT A;  1K0A A;  4ML6 A;  4ZB9 A;  4HJ2 A;  5D9W A;  4L5L A;  3FYG A; 
#chains in the Genus database with same CATH topology
 1PFO A;  2CZ2 A;  1Z5Y E;  3VLN A;  2L6C A;  1TXX A;  1K3L A;  2C8U A;  3HXS A;  2VCZ A;  3CHX C;  2O89 A;  1SVM A;  2LEG A;  1O8W A;  5F06 A;  2V1M A;  2UZ8 A;  4HEA 2;  1TRV A;  4EF0 A;  4ECC A;  4XTS A;  1M99 A;  2YOI A;  2I9H A;  2X64 A;  3CTF A;  1F9M A;  4DVC A;  2WJU A;  4V1A g;  2LS5 A;  3C73 A;  3ZZX A;  3GIX A;  4LMV A;  2JSY A;  1XVW A;  4ZL7 A;  4G2E A;  5AGY A;  2GSR A;  2DIZ A;  3TDG A;  1G7E A;  5CRW A;  2MBT A;  3D22 A;  4TR0 A;  4N3Z A;  1DUG A;  1OKD A;  4BIK A;  7GSS A;  4Z2R A;  1F37 A;  1U3A A;  4F0C A;  1KNG A;  1MDJ A;  1N2A A;  3P2A A;  4POL A;  3ISO A;  1GNE A;  1SJ6 A;  4K0N A;  2WCI A;  3M9J A;  1X9M B;  2IL3 A;  1H75 A;  2QKE A;  4TRX A;  4KGI A;  1UN2 A;  1EV9 A;  4PUF C;  1PL2 A;  3IR4 A;  4HU9 A;  4WR5 A;  3H4K A;  4MLY A;  1TOF A;  2WRT A;  19GS A;  2WVY A;  4TR1 B;  6GSW A;  1AAZ A;  3GA4 A;  4MP4 A;  4F2I A;  2YV9 A;  4DEJ A;  4NWY A;  4PNF A;  4DSS A;  3HDC A;  5DQY A;  2LRT A;  4EUY A;  4HZ2 A;  3ERG A;  4XS4 B;  3I69 A;  3DML A;  5J9B A;  4GTU A;  4CHS A;  1ZYN A;  5ECO B;  1FG4 A;  4IN0 A;  2VM2 A;  3ZLP A;  5A5H A;  2X8H A;  3J7Y k;  2H01 A;  2LUS A;  3ZRE A;  4V2L A;  1M2B A;  3DXB A;  5IPH A;  3QFA C;  4G0L A;  2DJ3 A;  2VL2 C;  5HQP A;  2AJQ B;  3GRX A;  5DJL A;  5IMC A;  2C4J A;  1GTI A;  3QDN A;  3IDV A;  5AIS A;  1WOU A;  4IJ3 A;  1YF0 A;  1N25 A;  1S3C A;  1ZYP A;  2ON5 A;  3IC8 A;  3ZFB A;  4JE1 A;  2FUG 2;  3UMA A;  3FMW A;  1EGO A;  3IE3 A;  1C72 A;  2LRN A;  3L9S A;  4XRA A;  2O7K A;  1TRS A;  3CYN A;  4Z7X A;  3FR9 A;  3UAP A;  4IEL A;  4AKX B;  2HSN A;  1TP9 A;  5A1N B;  4MJE A;  3TRX A;  4EVM A;  1OC8 A;  5CRE A;  5IO0 A;  1SVO A;  2YJH A;  4BVX B;  2HNL A;  4GRF A;  2ON7 A;  5ID2 B;  3FR3 A;  2HYX A;  4MK3 A;  4QQ7 A;  2QA1 A;  2GDR A;  1SK1 A;  2FD3 A;  1FW1 A;  2FLS A;  2C80 A;  4I5Q A;  5H5Q A;  4AKI A;  3R2Q A;  2XHF A;  4LL1 B;  1AUC A;  1A2M A;  5IOX A;  1AQX A;  4DSR A;  1T4Y A;  1EV4 A;  2MZC A;  2VLU A;  5LD0 A;  2WVX B;  3EE2 A;  1FB0 A;  2R0P A;  1DSB A;  1WE0 A;  4ZXG A;  3MWH A;  1TW9 A;  1OKT A;  3EUR A;  2YJ7 A;  5D96 A;  4G9H A;  4IGJ A;  1X0R A;  1X5C A;  2CX4 A;  1QXH A;  1M0U A;  5KEJ A;  1SD9 A;  4P3Y B;  2R6K A;  4OFT A;  3HJM A;  3P8W A;  2L59 A;  3RHB A;  4W66 A;  1O8X A;  1B48 A;  4K2X A;  4YQM A;  2M72 A;  5IMZ A;  3GUR A;  3HVS A;  3EU3 A;  3LW9 A;  3M3M A;  4K1F A;  4GDF A;  4AJ6 A;  2B7J A;  3D21 A;  3LWA A;  3F6D A;  5CRG A;  3TJG A;  2WVZ A;  4ZB6 A;  1ZZY A;  4N0Z A;  1FHE A;  3TRQ A;  1E2Y A;  3SWL A;  4AKG A;  1XVQ A;  2OE3 A;  1GL8 A;  2X49 A;  2O5V A;  2V6K A;  5HR3 A;  1E6B A;  3L4N A;  4YQU A;  1YKC A;  2HZE B;  3F8U A;  1K0C A;  4O5U A;  4FYC A;  2HSM B;  4BL7 B;  2VD1 A;  3HZ4 A;  4AF2 A;  2NPB A;  2F8A A;  1MDK A;  1R5A A;  3DGQ A;  4J56 E;  1TU8 A;  2A2P A;  2YZH A;  2WDU A;  1PKZ A;  5A34 B;  4USS A;  3FZ4 A;  4RI7 A;  1XWC A;  1GLQ A;  1GUM A;  2HSH A;  5GAN D;  2VLT A;  2NVL A;  3IBH A;  4X0X A;  3O76 A;  1EZK A;  5D9V A;  1NHY A;  5F07 A;  3MNG A;  2AAW A;  2XPE A;  4WEY A;  3BCK A;  1FAA A;  10GS A;  1GSY A;  1XOB A;  4K5R A;  3LSZ A;  3FEU A;  1SK0 A;  3GTU A;  1ZGN A;  1O73 A;  1RQM A;  4A5P A;  3GUS A;  3LYP A;  3CMI A;  2DJ1 A;  5HR0 A;  1URM A;  3BBY A;  1THO A;  3VI7 A;  5D73 A;  1QGV A;  4IHU A;  1IYH A;  1MEK A;  2DIY A;  1K0B A;  3I9V 2;  1Z9H A;  3VWU A;  1M7T A;  1Q4J A;  8GSS A;  1BF5 A;  4ZIJ A;  5JCU A;  5A1N A;  20GS A;  2PUK C;  4PHZ C;  4TKY A;  2OAD A;  1OC9 A;  4YAV A;  2LNT A;  2H1D A;  3CQF A;  2WW3 A;  2N5A A;  5FWG A;  4KA0 A;  1AQW A;  5E4W A;  2XC2 A;  1NM3 A;  3IPZ A;  1B9X C;  3R3E A;  3TKS A;  1A24 A;  4ML1 A;  3IOS A;  2ES7 A;  4ECJ A;  2P5R A;  2FWH A;  4MA9 A;  4K7N A;  2QGV A;  4BVY A;  4DSS B;  1EGR A;  1A2L A;  2MMN A;  3GH6 A;  1WIK A;  3DIE A;  1THX A;  3F3R A;  1MTC A;  6GSX A;  1WMJ A;  4V2N A;  2I4A A;  1PMT A;  2H66 A;  4BPY A;  5A4W A;  5COH A;  4POM A;  3UL3 A;  5A5H B;  2K8V A;  2XBQ A;  3FZ5 A;  2A2S A;  3EIN A;  1ZMA A;  3RAZ A;  2RM5 A;  5ECH B;  2FNO A;  5J5N A;  4KSO A;  3VWV A;  1BAY A;  1XW6 A;  2H72 A;  2OE1 A;  3M1G A;  4MF5 A;  3L9V A;  3D5J A;  1EEJ A;  2JZS A;  4XCS A;  3UAR A;  1VF1 A;  1ERU A;  3HD5 A;  1XFL A;  4F03 A;  1PN9 A;  3CTG A;  3KEB A;  4J57 E;  2YN1 A;  6GSV A;  3HCZ A;  3GL3 A;  3H93 A;  4ZBB A;  1DE1 A;  1Y25 A;  2B5Y A;  4IBP A;  2F8F A;  1R7H A;  2CVK A;  5IQY A;  2GQM A;  3BCI A;  5ENU A;  1XG8 A;  4K8M A;  2H1A A;  2E2G A;  1U3I A;  4EDZ A;  4ICY A;  2OA7 A;  1WWJ A;  3LXZ A;  3TJJ A;  4OCE A;  1EEM A;  3GMF A;  3TJK A;  2B1L A;  1AC1 A;  2R2J A;  3D4T A;  1SKR B;  2DKI A;  2HSN B;  1YDK A;  2FCH A;  3RDW A;  1XW5 A;  2EIQ A;  3ERW A;  3QOU A;  2GZP A;  2FWF A;  3FZ9 A;  2HI7 A;  2IPA A;  2R3X A;  5AN1 A;  1ABA A;  1VF2 A;  1Z6N A;  4PQI A;  3L9U A;  3TCO A;  3FHK A;  2N5B A;  1GSS A;  5ECS A;  4KUN A;  2LV3 A;  3DYR A;  2GSS A;  2WZ9 A;  1PSQ A;  3W8J A;  1GLP A;  4WET A;  4FO5 A;  5HR1 A;  2K18 A;  3LJR A;  1PD2 1;  4POK A;  1Z7P A;  2FWE A;  5IOW A;  1XCC A;  2R0C A;  1Y1U A;  4WBR D;  2DKH A;  4KDX A;  1QQ2 A;  4K2D A;  2QA2 A;  5DAL A;  4ZBA A;  2AB6 A;  5HR2 A;  4K0G A;  1PX7 A;  2O36 A;  4HI7 A;  3HVV A;  4TR4 A;  4IP1 A;  1V57 A;  1SL1 B;  5GZZ B;  4IJI A;  5ELA A;  2WW1 A;  2NDO A;  2GTU A;  1J9B A;  2CVB A;  1QUW A;  4AJ7 A;  3QAV A;  1ZOF A;  11GS A;  1HYU A;  4LMW A;  4N10 A;  1LJR A;  1BX9 A;  2HRA A;  1SL2 B;  2P5Q A;  5JCG A;  5AIV A;  1ZL9 A;  4OO4 A;  5CRD A;  2PU9 C;  5DAK A;  4YAP A;  3HJP A;  3US3 A;  2VL3 A;  5BRT A;  4KND A;  2YAN A;  1J08 A;  1DBY A;  4OFN A;  2O85 A;  4IS0 A;  3GYK A;  4G0K A;  1KBN A;  2H76 A;  5DDL A;  1A0F A;  1F6M C;  5G1L A;  1MD3 A;  3VUR A;  5C04 A;  1V9W A;  4ILF A;  1F3B A;  3UVT A;  3FKF A;  1VRS D;  2GST A;  5H5R A;  3ME8 A;  5KOW A;  3FW2 A;  1Z6M A;  3KGK A;  2NBS A;  2CX3 A;  2ZUP A;  4N11 A;  2B5X A;  5G30 A;  1T4Z A;  2VOC A;  3HY2 A;  3A5W A;  1XWA A;  4GQC A;  2A2R A;  6GSY A;  1EP8 A;  1AQV A;  1TI1 A;  4RQX A;  5IPG A;  2A4H A;  4G19 A;  1N8J A;  2I81 A;  4FXY P;  5IM9 A;  2C0E A;  4MJB A;  3TJF A;  3EYT A;  3ZIJ A;  1FVJ A;  3ZVJ A;  2EC4 A;  3RPP A;  4PUR A;  3MSZ A;  3J7Y b;  3GTU B;  1ERV A;  4PTS A;  1BYE A;  1G7O A;  4ZL9 A;  3ZIT A;  2F9S A;  1BJX A;  5FHI A;  2DJK A;  2OBI A;  2WFC A;  5G31 A;  1UC7 A;  3ME7 A;  4HU7 A;  3P90 A;  2H8L A;  3LEF A;  3RBT A;  2X8G A;  2ZCT A;  1EWX A;  2IMD A;  4CW9 A;  2DML A;  3OR5 A;  4EC0 A;  1GSU A;  2M46 A;  4G01 A;  2VM1 A;  2JZT A;  3CBU A;  5ABR A;  6GSS A;  2V2G A;  2GGT A;  3ERF A;  5H5S A;  1XW9 A;  2C3Q A;  1OC9 B;  1JZW A;  1MDI A;  3O3T A;  2HE3 A;  2L5L A;  2K6V A;  4AGS A;  3FRC A;  3GFK A;  4MPG A;  3APO A;  1U6T A;  4K7O A;  1XZO A;  4MF6 A;  5C00 A;  2E2M A;  3F4T A;  5ECP B;  2KUC A;  5L71 A;  4BVY B;  3UEM A;  2OT3 A;  3KP8 A;  4CY8 A;  4HDE A;  1NHO A;  5F0G A;  4HOJ A;  4ISD A;  3MDK A;  2G0F A;  1OE8 A;  3LG6 A;  2OBK A;  4HUA A;  1WPI A;  4X4J A;  5D9X A;  1SEN A;  2AV4 A;  3GN3 A;  2MMA A;  17GS A;  3M8N A;  1V2A A;  3ZVJ D;  3FY7 A;  1X9S B;  2YCD A;  4G0I A;  5G2Z A;  1K0N A;  2B5E A;  3GKM A;  2CZ3 A;  1O6J A;  3D4M A;  4O32 A;  4FQU A;  2LKU A;  2H71 A;  13GS A;  2HQT A;  2L4C A;  5KN0 A;  1MD4 A;  18GS A;  3HMJ G;  2JAD A;  3DRN A;  3Q74 A;  1GSF A;  3KM6 A;  4OCF A;  1R26 A;  1A8Y A;  4GSN A;  3H8Q A;  4O7H A;  2HT9 A;  2HXK A;  3N9J A;  2JU5 A;  2IN3 A;  2CVD A;  4HS1 A;  1FOV A;  4GSS A;  3EVI A;  4DSQ A;  1X5E A;  3VFI A;  2MMZ A;  2K9F A;  5G1K A;  3KTB A;  1G6W A;  4RQR A;  2VUP A;  4HQS A;  3F0I A;  3ZIV A;  2GZY A;  5EL8 A;  1YEP A;  3CWG A;  4JRR A;  5KN2 A;  2WZS A;  5B6N A;  2PMT A;  2X4A A;  2IMF A;  4Q5F A;  1UVZ A;  1QMV A;  3TKS E;  3VWW A;  1TKD B;  1ZYE A;  4JU5 A;  1NSW A;  2KOK A;  3F4R A;  3Q18 A;  1VGL A;  4XS6 A;  3O6T A;  3GX8 A;  3DD3 A;  5G5F A;  3UOM A;  1WJK A;  3IHQ A;  5D9T A;  3RFR C;  1CQG A;  2FA8 A;  4ACS A;  4H86 A;  2R37 A;  2YWM A;  4POB A;  4MZC A;  4YKF A;  2IFQ A;  3U6V A;  4N30 A;  1YJ6 A;  2PER A;  5GST A;  2DMM A;  2YZU A;  5DAL B;  4MCU A;  2CT6 A;  3WYW A;  4EKZ A;  4PXO A;  4TN8 A;  1PGT A;  2PN8 A;  2C0F A;  2F3M A;  3D0Z A;  3IK9 A;  2C0D A;  5BMU A;  2B6M A;  5CP1 A;  4YQV A;  1XIY A;  1UA5 A;  2Z9S A;  1B9Y C;  1S3A A;  1Z3E A;  2OKA A;  2PVQ A;  4I8B A;  5A5K A;  3RHC A;  4TVE A;  3UBK A;  2RII A;  1HNA A;  1TU7 A;  2GS3 A;  3D6I A;  3A3T A;  3LXT A;  5DAK B;  3KTL A;  1VF3 A;  2VO4 A;  2O8V B;  4KF9 A;  4QMK A;  3A2V A;  3APS A;  1M2D A;  1RW1 A;  4GST A;  1TDI A;  1W89 A;  2LRC A;  2LTK A;  3TKP A;  1SKW B;  3GV1 A;  2HRK B;  2GT6 A;  4NHZ A;  4K6X A;  1IYI A;  1GRX A;  1GUH A;  5DQS A;  1JZD A;  2FA4 A;  5J9C A;  5JCW A;  5JWR B;  1JZR A;  3UVH A;  1OVN A;  2H1L A;  3ZRD A;  1ST9 A;  2KP2 A;  3GH9 A;  4OMV A;  3BOA A;  4GLT A;  1QFN A;  3ZMK A;  2LQQ A;  2VCX A;  2E7P A;  16GS A;  1SJI A;  5HFG A;  1T7P B;  1PA3 A;  2DJJ A;  1JLV A;  4D73 A;  5GAP D;  4HSC X;  2DBC A;  2RM6 A;  1S4B P;  1TXU A;  5D8I A;  5EPF A;  1B4P A;  4ECI A;  1PN0 A;  1X9W B;  1SU9 A;  1QK8 A;  3DVW A;  4ZB8 A;  2VL2 A;  3F9U A;  5LNK e;  2L6D A;  3QR6 A;  1I1I P;  5DCH A;  2AUV A;  2C3N A;  4X43 A;  3P7X A;  2LNS A;  5JWQ B;  1R5P A;  3W8S A;  2P31 A;  2H6Y A;  2C0G A;  3L0H A;  4XS1 A;  3QAW A;  22GS A;  5J41 A;  3GSS A;  3PGT A;  2R5G A;  2IWT A;  3KIJ A;  3KXO A;  2GQK A;  2I1U A;  3H79 A;  3M9K A;  3ED3 A;  3WD6 A;  4MNN A;  4Z2U A;  1M9A A;  1HNB A;  4MDC A;  3CSH A;  3IHG A;  2GSQ A;  1HNC A;  3HJO A;  3IXR A;  3IRA A;  4O5Q A;  2BMX A;  1K3O A;  3EPT A;  1S3R A;  4LA1 A;  4WKW A;  4YKG A;  3PH9 A;  1HQO A;  1LBK A;  2LJA A;  3Q19 A;  2L57 A;  1JFU A;  2TRC P;  2VLV A;  4NMU A;  4RUV A;  2UV8 G;  1G0T A;  3G9B A;  4EIQ A;  2A4V A;  2RUE A;  4WF4 A;  5DJM A;  1BQ7 A;  4JR4 A;  3F6F A;  1GTA A;  5J40 A;  4V2M A;  4OFM A;  4MMM A;  3JCM L;  5GSS A;  2H6Z A;  2L5O A;  1XWK A;  4TW5 A;  2LQO A;  4GQF A;  4AJ8 A;  2CQ9 A;  4GWR A;  3KH7 A;  2VL9 A;  5KN3 A;  3UBL A;  4J2F A;  3LQ7 A;  4GCI A;  3C7M A;  3I6A A;  1V58 A;  3WT1 A;  2KHP A;  1NW2 A;  2ZNM A;  4OD7 A;  1AIU A;  2K8S A;  2H75 A;  3MYD A;  1ERW A;  2H1B A;  5B8A A;  4KCE A;  1XXU A;  3TU3 B;  5CRH A;  1V98 A;  3HVX A;  14GS A;  4E8E A;  2QC7 A;  1PRX A;  5FT3 A;  5ECM B;  2B3S A;  2B1K A;  2YNX A;  4QL7 A;  4AI6 A;  3EMX A;  1TK0 B;  4MJC A;  2JSZ A;  4TXO A;  3GST A;  2OE0 A;  4PNG A;  2X8C A;  2V32 A;  3MAK A;  2HSY A;  2H0H A;  2HRN A;  3ZML A;  3NZN A;  2IIY A;  4NXI A;  3KP9 A;  3LOR A;  2WW2 A;  4XHM A;  2VCV A;  3QD9 A;  2PPT A;  3F4S A;  2CA8 A;  2YWI A;  1H4O A;  4EDY A;  1OC3 A;  3F3Q A;  4O92 A;  4ZIL A;  1T3B A;  1XWG A;  2J9H A;  5J47 A;  2HRK A;  2N5F A;  2PGT A;  3LYK A;  4MJA A;  1M3J A;  2YPM A;  4Z2T A;  5IO2 A;  5KN1 A;  1F2E A;  2VD0 A;  3H1N A;  2LJR A;  3GX0 A;  1CQH A;  3ZL5 A;  4IP6 A;  3S9F A;  2DJ2 A;  5CYY A;  5ECN B;  2D2Z A;  1O7U A;  2VCT A;  4KX4 A;  4K7I A;  5DBQ A;  1SKS B;  5B7C A;  3KH9 A;  4Q5N A;  4NAX A;  1F3A A;  3K8N A;  4CY6 A;  2O3E A;  2WW0 A;  2FGX A;  5DCG A;  3ZTL A;  4L0W A;  3NIV A;  2VKZ G;  1YF1 A;  2IJY A;  3TKS C;  3CXG A;  3E0U A;  3TRP A;  5ECR B;  2E0Q A;  5INY A;  3IC4 A;  1GTB A;  3LFL A;  2IFQ B;  4HQZ A;  4LLR A;  5B6M A;  2HFD A;  4YH2 A;  2MBS A;  1ON4 A;  4BWS A;  5J4U A;  2M80 A;  4NPB A;  4F9Z A;  1YZX A;  4FH8 A;  3EC3 A;  5BMU B;  1FVK A;  5CAX A;  5IMF A;  5J4V A;  3DEX A;  3RGB C;  3TB2 A;  1YQ1 A;  1M3I A;  3AY8 A;  3M0F A;  6GST A;  1ML6 A;  2V6O A;  4NHW A;  1TK5 B;  2EFE A;  2KLX A;  4MZB A;  5JWO B;  2WGR A;  2O87 A;  3PR8 A;  2TRX A;  4L8E A;  2CAQ A;  2H0I A;  12GS A;  1GSD A;  1AXD A;  5IMV A;  3EMP A;  5ECQ B;  3PPU A;  2NTO A;  2VAF A;  4ZL8 A;  1ERT A;  5HFK A;  2CAI A;  4LL4 B;  1PQN A;  2H70 A;  1YVL A;  4PUA A;  4Q5Q A;  3HZ8 A;  5EY6 A;  3E9J B;  3APQ A;  6GSU A;  4KCA A;  4WR4 A;  4Q5R A;  5J4Y A;  3L78 A;  2DLX A;  1JZO A;  2H6X A;  2H0G A;  3GHA A;  1K0D A;  1SYX A;  4OO5 A;  2G2Q A;  4KW6 A;  4D73 B;  4IW9 A;  2L4Q A;  3HKR A;  2X99 A;  1OYJ A;  1U87 A;  1G6Y A;  3I43 A;  4KE3 A;  3WGX A;  4JR6 A;  1GUK A;  3C8E A;  4F0B A;  3QAG A;  1SK2 A;  4KAE A;  1SJZ A;  3Q6O A;  1W4V A;  1PL1 A;  1JHB A;  2EIR A;  3V1W A;  5ELG A;  4EXJ A;  2AHE A;  5IMD A;  2H30 A;  4IQ1 A;  3DWV A;  1GWC A;  5CNW A;  5IMA A;  1BG5 A;  1YEX A;  1PKW A;  1B4Q A;  3WGE A;  5CO3 A;  4MZW A;  1KTE A;  3KMN A;  5ECL B;  2WB9 A;  3FR6 A;  4E68 A;  3KCM A;  2GVP A;  1HD2 A;  2YWN A;  1PX6 A;  3HVN A;  4PQ1 A;  2H1G A;  2CV4 A;  3U5R E;  3TOU A;  3WT2 A;  1OAZ A;  1U88 A;  2YV7 A;  5IIZ A;  1VF4 A;  2ALB A;  2HZF A;  4ID0 A;  4KDU A;  1LU4 A;  4I97 A;  1TRU A;  4GXZ A;  1T8E B;  5D93 A;  1M9B A;  3TKQ A;  3VI5 A;  2H19 A;  3G7I A;  1BED A;  1J0F A;  3W6G A;  2LST A;  4I2U A;  2YP6 A;  4GF0 A;  4XRD A;  4O5R A;  4L5O A;  3VPT A;  2VCQ A;  3HYP A;  3DKS A;  1RK4 A;  4MH3 A;  1GH2 A;  1A23 A;  2EFD A;  3QMX A;  4PQH A;  1EP7 A;  1ILO A;  3N5O A;  4JZQ A;  1XBS A;  3A2W A;  1I5G A;  3TUE A;  3A2X A;  1ZYQ B;  4RI6 A;  1TK8 B;  3ZFL A;  4G10 A;  1TRW A;  2PWJ A;  2IMK A;  1T1V A;  2FHE A;  3IAM 2;  3CSJ A;  2FWG A;  2TIR A;  2IME A;  1B8X A;  4V1A p;  3PIN A;  4TR1 A;  5F8B A;  3C1R A;  2IMI A;  1WRY A;  4QL9 A;  4KH7 A;  4FYU A;  2KP1 A;  4NV2 A;  4IVF A;  4JED A;  1X5D A;  4XS4 A;  5J3R A;  2MYG A;  1FB6 A;  1OE7 A;  4PI0 C;  2BJX A;  3KZQ A;  3KMO A;  1XPV A;  1XWB A;  3IA1 A;  2GZZ A;  4PGT A;  1A8L A;  2LJK A;  2BTO T;  4WF5 A;  3TGZ A;  2FY6 A;  2PBJ A;  2C3T A;  5EVO A;  1YKA A;  3BJ5 A;  5KOX A;  3BD2 A;  2JAC A;  4HJM A;  4TR3 A;  4TXO B;  1SVL A;  1BG1 A;  3IAS 2;  5ECK B;  3CSI A;  1FO5 A;  1AW9 A;  4BA7 A;  4CDO A;  4PI2 C;  3FZA A;  1WP0 A;  2DC5 A;  3HHV A;  4FIW A;  4JBB A;  4MH2 A;  1M2A A;  2I3Y A;  2JL4 A;  1ZCP A;  2P0G A;  4OWY A;  3UJ1 A;  5B8B A;  2QSI A;  2B7K A;  2REM A;  2C1Y A;  1Y6E A;  3WGD A;  3TJB A;  4ZBD A;  1SD8 A;  2GQL A;  2J23 A;  3RPN A;  3VK9 A;  2R4V A;  1Z7R A;  1GNW A;  2V41 A;  2GT5 A;  1YY7 A;  4NV5 A;  3VPQ A;  1GTU A;  1GSQ A;  4MPF A;  4WXT A;  3KD0 A;  3IK7 A;  2WS2 A;  5HFI A;  2VIM A;  3NOF A;  4WBJ A;  4EO3 A;  3TKR A;  3QPM A;  1S3D A;  1K3Y A;  4EIP A;  4X1U A;  1K0O A;  3C1S A;  4BVX A;  1XOA A;  4E8H A;  4EL1 A;  5ID2 A;  5F05 A;  4XIH A;  9GSS A;  1TTZ A;  5G5E A;  4I2T A;  4BWQ A;  4FYB A;  2MMO A;  1USB A;  4ULX A;  2XPD A;  1O81 A;  1I9D A;  3UIW A;  1EOG A;  3CRU A;  5AIX A;  4F82 A;  1A2J A;  2WVX A;  3F63 A;  3IV4 A;  1EOH A;  4KSM A;  3C71 A;  3GL5 A;  2EFH A;  3LGC A;  1TI3 A;  1TJD A;  1R4W A;  2RUF A;  2HLS A;  2HRF A;  2OJL A;  5LCZ A;  2GLR A;  2F51 A;  2R0G A;  3GKK A;  4IKH A;  1ACV A;  2JZR A;  4AKH A;  3DVX A;  3QFB C;  3GKN A;  1YEW C;  3GNJ A;  3SBC A;  4K5S A;  5A4V A;  2EIO A;  2H73 A;  1JLW A;  3ZYW A;  3KJY A;  3GKX A;  5E59 A;  3VWX A;  5ECI B;  4ZB7 A;  1SYR A;  1O85 A;  2EFC A;  1Q98 A;  3QCP A;  4MAB A;  2WUL A;  5DVB A;  3EWL A;  4EE0 A;  2DJ0 A;  1K0M A;  4PX1 A;  4KDY A;  1T00 A;  4KB3 A;  3HA9 A;  1SL0 B;  2VCW A;  4K9Z A;  3A5I A;  2YWO A;  2XBI A;  3G7Y A;  3FK8 A;  4N0V A;  1GUL A;  2DSA A;  2HZE A;  3EU4 A;  4I6X A;  4TOP A;  2H74 A;  2HSM A;  2AYT A;  4BL7 A;  1A0R P;  3MIX A;  1DE2 A;  1KEB A;  3E3E A;  1GSE A;  2RLI A;  2OAC A;  3G7J A;  4ECB A;  4TXV A;  4L0U A;  2PVO C;  4IQA A;  1FOH A;  4MF7 A;  5A4U A;  3CRT A;  1V40 A;  4HZ4 A;  1GP1 A;  3TOT A;  5A34 A;  1K0A A;  4ML6 A;  4ZB9 A;  4HJ2 A;  5D9W A;  4L5L A;  3FYG A; 
#chains in the Genus database with same CATH homology
 2CZ2 A;  1Z5Y E;  3VLN A;  2L6C A;  1TXX A;  1K3L A;  2C8U A;  3HXS A;  2VCZ A;  2O89 A;  1SVM A;  2LEG A;  1O8W A;  5F06 A;  2V1M A;  2UZ8 A;  4HEA 2;  1TRV A;  4EF0 A;  4ECC A;  4XTS A;  1M99 A;  2YOI A;  2I9H A;  2X64 A;  3CTF A;  1F9M A;  4DVC A;  2WJU A;  4V1A g;  2LS5 A;  3C73 A;  3ZZX A;  3GIX A;  4LMV A;  2JSY A;  1XVW A;  4ZL7 A;  4G2E A;  5AGY A;  2GSR A;  2DIZ A;  3TDG A;  1G7E A;  5CRW A;  2MBT A;  3D22 A;  4TR0 A;  4N3Z A;  1DUG A;  1OKD A;  7GSS A;  4Z2R A;  1F37 A;  1U3A A;  4F0C A;  1KNG A;  1MDJ A;  1N2A A;  3P2A A;  4POL A;  1GNE A;  3ISO A;  1SJ6 A;  4K0N A;  2WCI A;  3M9J A;  1X9M B;  2IL3 A;  1H75 A;  2QKE A;  4TRX A;  4KGI A;  1UN2 A;  1EV9 A;  4PUF C;  1PL2 A;  3IR4 A;  4HU9 A;  4WR5 A;  3H4K A;  4MLY A;  1TOF A;  2WRT A;  19GS A;  4TR1 B;  6GSW A;  1AAZ A;  3GA4 A;  4MP4 A;  4F2I A;  2YV9 A;  4DEJ A;  4NWY A;  4PNF A;  4DSS A;  3HDC A;  5DQY A;  2LRT A;  4EUY A;  4HZ2 A;  3ERG A;  4XS4 B;  3I69 A;  3DML A;  5J9B A;  4GTU A;  4CHS A;  1ZYN A;  5ECO B;  1FG4 A;  4IN0 A;  2VM2 A;  3ZLP A;  5A5H A;  2X8H A;  3J7Y k;  2H01 A;  2LUS A;  3ZRE A;  4V2L A;  1M2B A;  3DXB A;  5IPH A;  3QFA C;  4G0L A;  2DJ3 A;  2VL2 C;  5HQP A;  2AJQ B;  3GRX A;  5DJL A;  5IMC A;  2C4J A;  1GTI A;  3QDN A;  3IDV A;  5AIS A;  1WOU A;  4IJ3 A;  1YF0 A;  1N25 A;  1S3C A;  1ZYP A;  2ON5 A;  3IC8 A;  3ZFB A;  4JE1 A;  2FUG 2;  3UMA A;  3FMW A;  1EGO A;  3IE3 A;  1C72 A;  2LRN A;  3L9S A;  4XRA A;  2O7K A;  1TRS A;  3CYN A;  4Z7X A;  3FR9 A;  3UAP A;  4IEL A;  4AKX B;  2HSN A;  1TP9 A;  5A1N B;  4MJE A;  3TRX A;  4EVM A;  1OC8 A;  5CRE A;  5IO0 A;  1SVO A;  2YJH A;  4BVX B;  2HNL A;  4GRF A;  2ON7 A;  5ID2 B;  3FR3 A;  2HYX A;  4MK3 A;  4QQ7 A;  2QA1 A;  2GDR A;  1SK1 A;  2FD3 A;  1FW1 A;  2FLS A;  2C80 A;  4I5Q A;  5H5Q A;  4AKI A;  3R2Q A;  2XHF A;  4LL1 B;  1AUC A;  1A2M A;  5IOX A;  1AQX A;  4DSR A;  1T4Y A;  1EV4 A;  2MZC A;  2VLU A;  5LD0 A;  3EE2 A;  1FB0 A;  2R0P A;  1DSB A;  1WE0 A;  4ZXG A;  3MWH A;  1TW9 A;  1OKT A;  3EUR A;  2YJ7 A;  5D96 A;  4G9H A;  4IGJ A;  1X0R A;  1X5C A;  2CX4 A;  1QXH A;  1M0U A;  5KEJ A;  1SD9 A;  4P3Y B;  2R6K A;  4OFT A;  3HJM A;  3P8W A;  2L59 A;  3RHB A;  4W66 A;  1O8X A;  1B48 A;  4K2X A;  4YQM A;  2M72 A;  5IMZ A;  3GUR A;  3HVS A;  3EU3 A;  3LW9 A;  3M3M A;  4K1F A;  4GDF A;  4AJ6 A;  2B7J A;  3D21 A;  3LWA A;  3F6D A;  5CRG A;  3TJG A;  4ZB6 A;  1ZZY A;  4N0Z A;  1FHE A;  3TRQ A;  1E2Y A;  3SWL A;  4AKG A;  1XVQ A;  2OE3 A;  1GL8 A;  2X49 A;  2O5V A;  2V6K A;  5HR3 A;  1E6B A;  3L4N A;  4YQU A;  1YKC A;  2HZE B;  3F8U A;  1K0C A;  4O5U A;  4FYC A;  2HSM B;  4BL7 B;  2VD1 A;  3HZ4 A;  4AF2 A;  2NPB A;  2F8A A;  1MDK A;  1R5A A;  3DGQ A;  4J56 E;  1TU8 A;  2A2P A;  2YZH A;  2WDU A;  1PKZ A;  5A34 B;  4USS A;  3FZ4 A;  4RI7 A;  1XWC A;  1GLQ A;  1GUM A;  2HSH A;  5GAN D;  2VLT A;  2NVL A;  3IBH A;  4X0X A;  3O76 A;  1EZK A;  5D9V A;  1NHY A;  5F07 A;  3MNG A;  2AAW A;  2XPE A;  4WEY A;  3BCK A;  1FAA A;  10GS A;  1GSY A;  1XOB A;  4K5R A;  3LSZ A;  3FEU A;  1SK0 A;  3GTU A;  1ZGN A;  1O73 A;  1RQM A;  4A5P A;  3GUS A;  3LYP A;  3CMI A;  2DJ1 A;  5HR0 A;  1URM A;  3BBY A;  1THO A;  3VI7 A;  5D73 A;  1QGV A;  4IHU A;  1IYH A;  1MEK A;  2DIY A;  1K0B A;  3I9V 2;  1Z9H A;  3VWU A;  1M7T A;  1Q4J A;  8GSS A;  1BF5 A;  4ZIJ A;  5JCU A;  5A1N A;  20GS A;  2PUK C;  4TKY A;  2OAD A;  1OC9 A;  4YAV A;  2LNT A;  2H1D A;  2N5A A;  5FWG A;  4KA0 A;  1AQW A;  5E4W A;  2XC2 A;  1NM3 A;  3IPZ A;  1B9X C;  3R3E A;  3TKS A;  1A24 A;  4ML1 A;  3IOS A;  2ES7 A;  4ECJ A;  2P5R A;  2FWH A;  4MA9 A;  4K7N A;  2QGV A;  4BVY A;  4DSS B;  1EGR A;  1A2L A;  2MMN A;  3GH6 A;  1WIK A;  3DIE A;  1THX A;  3F3R A;  1MTC A;  6GSX A;  1WMJ A;  4V2N A;  2I4A A;  1PMT A;  2H66 A;  4BPY A;  5A4W A;  5COH A;  4POM A;  3UL3 A;  5A5H B;  2K8V A;  2XBQ A;  3FZ5 A;  2A2S A;  3EIN A;  1ZMA A;  3RAZ A;  2RM5 A;  5ECH B;  2FNO A;  5J5N A;  4KSO A;  3VWV A;  1BAY A;  1XW6 A;  2H72 A;  2OE1 A;  3M1G A;  4MF5 A;  3L9V A;  3D5J A;  1EEJ A;  2JZS A;  4XCS A;  3UAR A;  1VF1 A;  1ERU A;  3HD5 A;  1XFL A;  4F03 A;  1PN9 A;  3CTG A;  3KEB A;  4J57 E;  2YN1 A;  6GSV A;  3HCZ A;  3GL3 A;  3H93 A;  4ZBB A;  1DE1 A;  1Y25 A;  2B5Y A;  4IBP A;  2F8F A;  1R7H A;  2CVK A;  5IQY A;  2GQM A;  3BCI A;  5ENU A;  4K8M A;  2H1A A;  2E2G A;  1U3I A;  4EDZ A;  4ICY A;  2OA7 A;  1WWJ A;  3LXZ A;  3TJJ A;  4OCE A;  1EEM A;  3GMF A;  3TJK A;  2B1L A;  1AC1 A;  2R2J A;  3D4T A;  1SKR B;  2DKI A;  2HSN B;  1YDK A;  2FCH A;  3RDW A;  1XW5 A;  2EIQ A;  3ERW A;  3QOU A;  2GZP A;  2FWF A;  3FZ9 A;  2HI7 A;  2IPA A;  2R3X A;  5AN1 A;  1ABA A;  1VF2 A;  1Z6N A;  4PQI A;  3L9U A;  3TCO A;  3FHK A;  2N5B A;  1GSS A;  5ECS A;  4KUN A;  2LV3 A;  3DYR A;  2GSS A;  2WZ9 A;  1PSQ A;  3W8J A;  1GLP A;  4WET A;  4FO5 A;  5HR1 A;  2K18 A;  3LJR A;  1PD2 1;  4POK A;  1Z7P A;  2FWE A;  5IOW A;  1XCC A;  2R0C A;  1Y1U A;  4WBR D;  2DKH A;  4KDX A;  1QQ2 A;  4K2D A;  2QA2 A;  5DAL A;  4ZBA A;  2AB6 A;  5HR2 A;  4K0G A;  1PX7 A;  4HI7 A;  3HVV A;  4TR4 A;  4IP1 A;  1V57 A;  1SL1 B;  5GZZ B;  4IJI A;  5ELA A;  2NDO A;  2GTU A;  1J9B A;  2CVB A;  1QUW A;  4AJ7 A;  3QAV A;  1ZOF A;  11GS A;  1HYU A;  4LMW A;  4N10 A;  1LJR A;  1BX9 A;  2HRA A;  1SL2 B;  2P5Q A;  5JCG A;  5AIV A;  1ZL9 A;  4OO4 A;  5CRD A;  2PU9 C;  5DAK A;  4YAP A;  3HJP A;  3US3 A;  2VL3 A;  5BRT A;  4KND A;  2YAN A;  1J08 A;  1DBY A;  4OFN A;  2O85 A;  4IS0 A;  3GYK A;  4G0K A;  1KBN A;  2H76 A;  5DDL A;  1A0F A;  1F6M C;  5G1L A;  1MD3 A;  3VUR A;  5C04 A;  1V9W A;  4ILF A;  1F3B A;  3UVT A;  3FKF A;  1VRS D;  2GST A;  5H5R A;  3ME8 A;  5KOW A;  3FW2 A;  1Z6M A;  3KGK A;  2NBS A;  2CX3 A;  2ZUP A;  4N11 A;  2B5X A;  5G30 A;  1T4Z A;  2VOC A;  3HY2 A;  3A5W A;  1XWA A;  4GQC A;  2A2R A;  6GSY A;  1EP8 A;  1AQV A;  1TI1 A;  4RQX A;  5IPG A;  2A4H A;  4G19 A;  1N8J A;  2I81 A;  5IM9 A;  2C0E A;  4MJB A;  3TJF A;  3EYT A;  3ZIJ A;  1FVJ A;  3ZVJ A;  2EC4 A;  3RPP A;  4PUR A;  3MSZ A;  3J7Y b;  3GTU B;  1ERV A;  4PTS A;  1BYE A;  1G7O A;  4ZL9 A;  3ZIT A;  2F9S A;  1BJX A;  5FHI A;  2DJK A;  2OBI A;  2WFC A;  5G31 A;  1UC7 A;  3ME7 A;  4HU7 A;  3P90 A;  2H8L A;  3LEF A;  3RBT A;  2X8G A;  2ZCT A;  1EWX A;  2IMD A;  4CW9 A;  2DML A;  3OR5 A;  4EC0 A;  1GSU A;  2M46 A;  4G01 A;  2VM1 A;  2JZT A;  3CBU A;  5ABR A;  6GSS A;  2V2G A;  2GGT A;  3ERF A;  5H5S A;  1XW9 A;  2C3Q A;  1OC9 B;  1JZW A;  1MDI A;  3O3T A;  2HE3 A;  2L5L A;  2K6V A;  4AGS A;  3FRC A;  3GFK A;  4MPG A;  3APO A;  1U6T A;  4K7O A;  1XZO A;  4MF6 A;  5C00 A;  2E2M A;  3F4T A;  5ECP B;  2KUC A;  5L71 A;  4BVY B;  3UEM A;  2OT3 A;  3KP8 A;  4CY8 A;  4HDE A;  1NHO A;  5F0G A;  4HOJ A;  4ISD A;  3MDK A;  2G0F A;  1OE8 A;  3LG6 A;  2OBK A;  4HUA A;  1WPI A;  4X4J A;  5D9X A;  1SEN A;  2AV4 A;  3GN3 A;  2MMA A;  17GS A;  3M8N A;  1V2A A;  3ZVJ D;  3FY7 A;  1X9S B;  2YCD A;  4G0I A;  5G2Z A;  1K0N A;  2B5E A;  3GKM A;  2CZ3 A;  1O6J A;  3D4M A;  4O32 A;  4FQU A;  2LKU A;  2H71 A;  13GS A;  2HQT A;  2L4C A;  5KN0 A;  1MD4 A;  18GS A;  3HMJ G;  2JAD A;  3DRN A;  3Q74 A;  1GSF A;  3KM6 A;  4OCF A;  1R26 A;  1A8Y A;  4GSN A;  3H8Q A;  4O7H A;  2HT9 A;  2HXK A;  3N9J A;  2JU5 A;  2IN3 A;  2CVD A;  4HS1 A;  1FOV A;  4GSS A;  3EVI A;  4DSQ A;  1X5E A;  3VFI A;  2MMZ A;  2K9F A;  5G1K A;  3KTB A;  1G6W A;  4RQR A;  2VUP A;  4HQS A;  3F0I A;  3ZIV A;  2GZY A;  5EL8 A;  1YEP A;  3CWG A;  4JRR A;  5KN2 A;  5B6N A;  2PMT A;  2X4A A;  2IMF A;  4Q5F A;  1UVZ A;  1QMV A;  3TKS E;  3VWW A;  1TKD B;  1ZYE A;  4JU5 A;  1NSW A;  2KOK A;  3F4R A;  3Q18 A;  1VGL A;  4XS6 A;  3O6T A;  3GX8 A;  3DD3 A;  5G5F A;  3UOM A;  1WJK A;  3IHQ A;  5D9T A;  1CQG A;  2FA8 A;  4ACS A;  4H86 A;  2R37 A;  2YWM A;  4POB A;  4MZC A;  4YKF A;  2IFQ A;  3U6V A;  4N30 A;  1YJ6 A;  2PER A;  5GST A;  2DMM A;  2YZU A;  5DAL B;  4MCU A;  2CT6 A;  3WYW A;  4EKZ A;  4PXO A;  4TN8 A;  1PGT A;  2PN8 A;  2C0F A;  2F3M A;  3D0Z A;  3IK9 A;  2C0D A;  5BMU A;  2B6M A;  5CP1 A;  4YQV A;  1XIY A;  1UA5 A;  2Z9S A;  1B9Y C;  1S3A A;  1Z3E A;  2OKA A;  2PVQ A;  4I8B A;  5A5K A;  3RHC A;  4TVE A;  3UBK A;  2RII A;  1HNA A;  1TU7 A;  2GS3 A;  3D6I A;  3A3T A;  3LXT A;  5DAK B;  3KTL A;  1VF3 A;  2VO4 A;  2O8V B;  4KF9 A;  4QMK A;  3A2V A;  3APS A;  1M2D A;  1RW1 A;  4GST A;  1TDI A;  1W89 A;  2LRC A;  2LTK A;  3TKP A;  1SKW B;  3GV1 A;  2HRK B;  2GT6 A;  4NHZ A;  4K6X A;  1IYI A;  1GRX A;  1GUH A;  5DQS A;  1JZD A;  2FA4 A;  5J9C A;  5JCW A;  5JWR B;  1JZR A;  3UVH A;  1OVN A;  2H1L A;  3ZRD A;  1ST9 A;  2KP2 A;  3GH9 A;  4OMV A;  3BOA A;  4GLT A;  1QFN A;  3ZMK A;  2LQQ A;  2VCX A;  2E7P A;  16GS A;  1SJI A;  5HFG A;  1T7P B;  1PA3 A;  2DJJ A;  1JLV A;  4D73 A;  5GAP D;  2DBC A;  2RM6 A;  1TXU A;  5D8I A;  5EPF A;  1B4P A;  4ECI A;  1PN0 A;  1X9W B;  1SU9 A;  1QK8 A;  3DVW A;  4ZB8 A;  2VL2 A;  3F9U A;  5LNK e;  2L6D A;  3QR6 A;  5DCH A;  2AUV A;  2C3N A;  4X43 A;  3P7X A;  2LNS A;  5JWQ B;  1R5P A;  3W8S A;  2P31 A;  2H6Y A;  2C0G A;  3L0H A;  4XS1 A;  3QAW A;  22GS A;  5J41 A;  3GSS A;  3PGT A;  2R5G A;  2IWT A;  3KIJ A;  3KXO A;  2GQK A;  2I1U A;  3H79 A;  3M9K A;  3ED3 A;  3WD6 A;  4MNN A;  4Z2U A;  1M9A A;  1HNB A;  4MDC A;  3CSH A;  3IHG A;  2GSQ A;  1HNC A;  3HJO A;  3IXR A;  3IRA A;  4O5Q A;  2BMX A;  1K3O A;  3EPT A;  4LA1 A;  4WKW A;  4YKG A;  3PH9 A;  1HQO A;  1LBK A;  2LJA A;  3Q19 A;  2L57 A;  1JFU A;  2TRC P;  2VLV A;  4NMU A;  4RUV A;  2UV8 G;  1G0T A;  3G9B A;  4EIQ A;  2A4V A;  2RUE A;  4WF4 A;  5DJM A;  1BQ7 A;  4JR4 A;  3F6F A;  1GTA A;  5J40 A;  4V2M A;  4OFM A;  4MMM A;  3JCM L;  5GSS A;  2H6Z A;  2L5O A;  1XWK A;  4TW5 A;  2LQO A;  4GQF A;  4AJ8 A;  2CQ9 A;  4GWR A;  3KH7 A;  2VL9 A;  5KN3 A;  3UBL A;  4J2F A;  3LQ7 A;  4GCI A;  3C7M A;  3I6A A;  1V58 A;  3WT1 A;  2KHP A;  1NW2 A;  2ZNM A;  4OD7 A;  1AIU A;  2K8S A;  2H75 A;  3MYD A;  1ERW A;  2H1B A;  5B8A A;  4KCE A;  1XXU A;  3TU3 B;  5CRH A;  1V98 A;  3HVX A;  14GS A;  4E8E A;  2QC7 A;  1PRX A;  5FT3 A;  5ECM B;  2B3S A;  2B1K A;  2YNX A;  4QL7 A;  4AI6 A;  3EMX A;  1TK0 B;  4MJC A;  2JSZ A;  4TXO A;  3GST A;  2OE0 A;  4PNG A;  2X8C A;  2V32 A;  3MAK A;  2HSY A;  2H0H A;  2HRN A;  3ZML A;  3NZN A;  2IIY A;  4NXI A;  3KP9 A;  3LOR A;  4XHM A;  2VCV A;  3QD9 A;  2PPT A;  3F4S A;  2CA8 A;  2YWI A;  1H4O A;  4EDY A;  1OC3 A;  3F3Q A;  4O92 A;  4ZIL A;  1T3B A;  1XWG A;  2J9H A;  5J47 A;  2HRK A;  2N5F A;  2PGT A;  3LYK A;  4MJA A;  2YPM A;  4Z2T A;  5IO2 A;  5KN1 A;  1F2E A;  2VD0 A;  3H1N A;  2LJR A;  3GX0 A;  1CQH A;  3ZL5 A;  4IP6 A;  3S9F A;  2DJ2 A;  5CYY A;  5ECN B;  2D2Z A;  1O7U A;  2VCT A;  4KX4 A;  4K7I A;  5DBQ A;  1SKS B;  5B7C A;  3KH9 A;  4Q5N A;  4NAX A;  1F3A A;  3K8N A;  4CY6 A;  2FGX A;  5DCG A;  3ZTL A;  4L0W A;  3NIV A;  2VKZ G;  1YF1 A;  2IJY A;  3TKS C;  3CXG A;  3E0U A;  3TRP A;  5ECR B;  2E0Q A;  5INY A;  3IC4 A;  1GTB A;  3LFL A;  2IFQ B;  4HQZ A;  4LLR A;  5B6M A;  2HFD A;  4YH2 A;  2MBS A;  1ON4 A;  4BWS A;  5J4U A;  2M80 A;  4NPB A;  4F9Z A;  1YZX A;  4FH8 A;  3EC3 A;  5BMU B;  1FVK A;  5CAX A;  5IMF A;  5J4V A;  3DEX A;  3TB2 A;  1YQ1 A;  3AY8 A;  3M0F A;  6GST A;  1ML6 A;  2V6O A;  4NHW A;  1TK5 B;  2EFE A;  2KLX A;  4MZB A;  5JWO B;  2WGR A;  2O87 A;  3PR8 A;  2TRX A;  4L8E A;  2CAQ A;  2H0I A;  12GS A;  1GSD A;  1AXD A;  5IMV A;  3EMP A;  5ECQ B;  3PPU A;  2NTO A;  2VAF A;  4ZL8 A;  1ERT A;  5HFK A;  2CAI A;  4LL4 B;  1PQN A;  2H70 A;  1YVL A;  4PUA A;  4Q5Q A;  3HZ8 A;  5EY6 A;  3E9J B;  3APQ A;  6GSU A;  4KCA A;  4WR4 A;  4Q5R A;  5J4Y A;  3L78 A;  2DLX A;  1JZO A;  2H6X A;  2H0G A;  3GHA A;  1K0D A;  1SYX A;  4OO5 A;  2G2Q A;  4KW6 A;  4D73 B;  4IW9 A;  2L4Q A;  3HKR A;  2X99 A;  1OYJ A;  1U87 A;  1G6Y A;  3I43 A;  4KE3 A;  3WGX A;  4JR6 A;  1GUK A;  3C8E A;  4F0B A;  3QAG A;  1SK2 A;  4KAE A;  1SJZ A;  3Q6O A;  1W4V A;  1PL1 A;  1JHB A;  2EIR A;  3V1W A;  5ELG A;  4EXJ A;  2AHE A;  5IMD A;  2H30 A;  4IQ1 A;  3DWV A;  1GWC A;  5CNW A;  5IMA A;  1BG5 A;  1YEX A;  1PKW A;  1B4Q A;  3WGE A;  5CO3 A;  4MZW A;  1KTE A;  3KMN A;  5ECL B;  2WB9 A;  3FR6 A;  4E68 A;  3KCM A;  2GVP A;  1HD2 A;  2YWN A;  1PX6 A;  4PQ1 A;  2H1G A;  2CV4 A;  3U5R E;  3TOU A;  3WT2 A;  1OAZ A;  1U88 A;  2YV7 A;  5IIZ A;  1VF4 A;  2ALB A;  2HZF A;  4ID0 A;  4KDU A;  1LU4 A;  4I97 A;  1TRU A;  4GXZ A;  1T8E B;  5D93 A;  1M9B A;  3TKQ A;  3VI5 A;  2H19 A;  3G7I A;  1BED A;  1J0F A;  3W6G A;  2LST A;  4I2U A;  2YP6 A;  4GF0 A;  4XRD A;  4O5R A;  4L5O A;  3VPT A;  2VCQ A;  3HYP A;  3DKS A;  1RK4 A;  4MH3 A;  1GH2 A;  1A23 A;  2EFD A;  3QMX A;  4PQH A;  1EP7 A;  1ILO A;  3N5O A;  4JZQ A;  1XBS A;  3A2W A;  1I5G A;  3TUE A;  3A2X A;  1ZYQ B;  4RI6 A;  1TK8 B;  3ZFL A;  4G10 A;  1TRW A;  2PWJ A;  2IMK A;  1T1V A;  2FHE A;  3IAM 2;  3CSJ A;  2FWG A;  2TIR A;  2IME A;  1B8X A;  4V1A p;  3PIN A;  4TR1 A;  5F8B A;  3C1R A;  2IMI A;  1WRY A;  4QL9 A;  4KH7 A;  4FYU A;  2KP1 A;  4NV2 A;  4IVF A;  4JED A;  1X5D A;  4XS4 A;  5J3R A;  2MYG A;  1FB6 A;  1OE7 A;  2BJX A;  3KZQ A;  3KMO A;  1XPV A;  1XWB A;  3IA1 A;  2GZZ A;  4PGT A;  1A8L A;  2LJK A;  2BTO T;  4WF5 A;  3TGZ A;  2FY6 A;  2PBJ A;  2C3T A;  5EVO A;  1YKA A;  3BJ5 A;  5KOX A;  3BD2 A;  2JAC A;  4HJM A;  4TR3 A;  4TXO B;  1SVL A;  1BG1 A;  3IAS 2;  5ECK B;  3CSI A;  1FO5 A;  1AW9 A;  4BA7 A;  4CDO A;  3FZA A;  1WP0 A;  2DC5 A;  3HHV A;  4FIW A;  4JBB A;  4MH2 A;  1M2A A;  2I3Y A;  2JL4 A;  1ZCP A;  2P0G A;  4OWY A;  3UJ1 A;  5B8B A;  2QSI A;  2B7K A;  2REM A;  2C1Y A;  1Y6E A;  3WGD A;  3TJB A;  4ZBD A;  1SD8 A;  2GQL A;  2J23 A;  3RPN A;  3VK9 A;  2R4V A;  1Z7R A;  1GNW A;  2V41 A;  2GT5 A;  1YY7 A;  4NV5 A;  3VPQ A;  1GTU A;  1GSQ A;  4MPF A;  4WXT A;  3KD0 A;  3IK7 A;  2WS2 A;  5HFI A;  2VIM A;  3NOF A;  4WBJ A;  4EO3 A;  3TKR A;  3QPM A;  1S3D A;  1K3Y A;  4EIP A;  4X1U A;  1K0O A;  3C1S A;  4BVX A;  1XOA A;  4E8H A;  4EL1 A;  5ID2 A;  5F05 A;  4XIH A;  9GSS A;  1TTZ A;  5G5E A;  4I2T A;  4BWQ A;  4FYB A;  2MMO A;  1USB A;  4ULX A;  2XPD A;  1O81 A;  1I9D A;  3UIW A;  1EOG A;  3CRU A;  5AIX A;  4F82 A;  1A2J A;  3F63 A;  3IV4 A;  1EOH A;  4KSM A;  3C71 A;  3GL5 A;  2EFH A;  3LGC A;  1TI3 A;  1TJD A;  1R4W A;  2RUF A;  2HLS A;  2HRF A;  2OJL A;  5LCZ A;  2GLR A;  2F51 A;  2R0G A;  3GKK A;  4IKH A;  1ACV A;  2JZR A;  4AKH A;  3DVX A;  3QFB C;  3GKN A;  3GNJ A;  3SBC A;  4K5S A;  5A4V A;  2EIO A;  2H73 A;  1JLW A;  3ZYW A;  3KJY A;  3GKX A;  5E59 A;  3VWX A;  5ECI B;  4ZB7 A;  1SYR A;  1O85 A;  2EFC A;  1Q98 A;  3QCP A;  4MAB A;  2WUL A;  5DVB A;  3EWL A;  4EE0 A;  2DJ0 A;  1K0M A;  4PX1 A;  4KDY A;  1T00 A;  4KB3 A;  3HA9 A;  1SL0 B;  2VCW A;  4K9Z A;  3A5I A;  2YWO A;  2XBI A;  3G7Y A;  3FK8 A;  4N0V A;  1GUL A;  2DSA A;  2HZE A;  3EU4 A;  4I6X A;  4TOP A;  2H74 A;  2HSM A;  2AYT A;  4BL7 A;  1A0R P;  3MIX A;  1DE2 A;  1KEB A;  3E3E A;  1GSE A;  2RLI A;  2OAC A;  3G7J A;  4ECB A;  4TXV A;  4L0U A;  2PVO C;  4IQA A;  1FOH A;  4MF7 A;  5A4U A;  3CRT A;  1V40 A;  4HZ4 A;  1GP1 A;  3TOT A;  5A34 A;  1K0A A;  4ML6 A;  4ZB9 A;  4HJ2 A;  5D9W A;  4L5L A;  3FYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...